1KC1A

Crystal structure of dtdp-6-deoxy-l-lyxo-4-hexulose reductase (rmld) in complex with nadph
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
298
structure length
298
Chain Sequence
MNILLFGKTGQVGWELQRSLAPVGNLIALDVHSKEFCGDFSNPKGVAETVRKLRPDVIVNAAAHTAVDKAESEPELAQLLNATSVEAIAKAANETGAWVVHYSTDYVFPGTGDIPWQETDATSPLNVYGKTKLAGEKALQDNCPKHLIFRTSWVYAGKGNNFAKTMLRLAKERQTLSVINDQYGAPTGAELLADCTAHAIRVALNKPEVAGLYHLVAGGTTTWHDYAALVFDEARKAGITLALTELNAVPTSAYPTPASRPGNSRLNTEKFQRNFDLILPQWELGVKRMLTEMFTTTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Variation on a theme of SDR. dTDP-6-deoxy-L- lyxo-4-hexulose reductase (RmlD) shows a new Mg2+-dependent dimerization mode.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Oxidoreductase
molecule keywords dTDP-glucose oxidoreductase
total genus 98
structure length 298
sequence length 298
ec nomenclature ec 1.1.1.133: dTDP-4-dehydrorhamnose reductase.
pdb deposition date 2001-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04321 RmlD_sub_bind RmlD substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1kc1A01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1kc1A02
3QW2A 2ZTUA 1SB9A 3PYMA 3PK0A 2C7VA 1UR5A 3RUEA 4AJ2A 1ZH8A 2ZTVA 4PLFA 2H63A 3LK7A 3E5RA 4DL9A 3PIIA 1H9AA 4NBWA 4UUOA 2J3IA 1ZMOA 5C7OO 5K6AC 5TJ9A 4E32A 2PR2A 4MO2A 3AFNA 5DBFA 2V7PA 4ESOA 4CJXA 5IZCA 4KZPA 1BWSA 2NWQA 2Q4EA 4R4JA 5TNXA 3K73O 1CQIA 4CQLA 4Z3DA 1IOLA 1JA9A 1I36A 3PLRA 3U3XA 3BMNB 4J2HA 1RM0A 3SXPA 4AJKA 1XELA 1R4MB 1E3WB 4RVHA 5FI3A 5JE8A 3WGTA 2X0RA 4TKMA 5CEEA 3OICA 4MJLA 3QA9A 2HQ1A 3OJLA 2NADA 1ULSA 1I01A 5KNLA 3RU9A 1K89A 3EHEA 1R66A 1DB3A 4RVGA 4HP8A 1D4FA 3U4IA 5JAIA 1KBZA 3WDSA 4LN1A 1OBFO 1ZXLA 3CIFA 2OXIA 3FWZA 1WWKA 4HNGA 3S2FA 3D4NA 5F5LA 4GMGA 1E3JA 2DFDA 4Q9NA 3ZWAA 2NLOA 4N7RA 2V6BA 1VJ1A 1F8GA 3P2YA 1YL7A 4UUPA 3PHJA 4U0JA 4PCVA 2AE2A 3CINA 4XYLA 1ADFA 1R0SA 4I08A 1CIVA 5A4DA 3GMSA 4MPDA 3WLEA 4I9UA 1LEHA 1HETA 1DIHA 1SEVA 4OQZA 3MOIA 4TWRA 3DHEA 2NTNA 4D79A 3KETA 1KYQA 5JLAA 1QORA 4IUYA 5DDIP 1HDZA 1C0IA 3UCEA 5HTOA 3E82A 3GNSA 1GV0A 4R51A 5B4TA 6ADHA 4UULA 5U1PA 5AYVA 4N54A 5T8KA 1BSVA 2X0IA 1LI4A 4WK6A 1MA0A 3N74A 4GX0A 5G4KB 2EIHA 2UDPA 1QYDA 3CMMA 2ZYDA 4DREA 1K3TA 3UVEA 2PD4A 3AY3A 3WJAA 3KM0A 4LK3A 4XZ3A 4YRBA 4NHEA 3ASUA 1KVTA 3D4PA 4AJNA 5C7IO 2C59A 4PLWA 2BFPA 1NAHA 2Y1GA 3EC7A 2P4HX 4ND2A 1OI7A 2GZ3A 4TQGA 1CYDA 2CDBA 3JD3A 4AL4A 1NFQA 3COSA 4I9HA 4YVFA 3TWOA 4CM6A 4PZCA 4OQYA 1JKJA 1F14A 1LA2A 1B0AA 1U5AA 2OORA 3Q11A 1HDYA 1NPDA 1PJLA 5BQFA 5I8ZA 3VHRA 3K9QO 4E5MA 5C3MA 2XAAA 4EJ0A 2ET6A 1VI2A 3E8XA 1P77A 1HLPA 3RBVA 3PQFA 4L76A 4NQZA 3VAZA 1YBVA 1K5HA 4BUCA 3RASA 5JY1A 4B8ZA 1HE4A 2CUKA 5AXBA 2QIOA 4P4NA 2HK8A 2Q49A 1D7OA 2O3UA 4NDNE 4O59O 3RUDA 4AJLA 4BO4A 1MX3A 1NXQA 3L9XA 3BMNA 2E49A 4J4TA 4B79A 3M6IA 4F6LA 1UAGA 1GEEA 2RH8A 1T26A 1E6WA 5DP2A 3AFMA 3WGYA 3HFSA 2JCVA 1I2BA 4HUJA 4BOYA 3JQAD 3S2GA 3VOSA 2QX7A 3W1VA 5DZSA 1ZIDA 3ZWXA 2PZJA 3DZHA 5ITVA 2WWRA 1GZ4A 1Q0HA 2NU6A 4U6QA 1HXHA 2OP1A 4NZ9A 1ZK4A 3DAGA 5TQVA 3NRCA 4CV2A 3SVTA 2HK9A 2BRUA 4IIUA 1T4BA 2P5YA 3JYPA 4S3MA 1DJQA 1CJCA 4CMBA 4WCFA 4TROA 4I5EA 3R1IA 3ZU5A 2BFAA 5COAA 1VKNA 3RVDA 4N5MA 4EUEA 4XB1A 1N92A 1J4AA 1UAYA 3KVOA 4TRRA 4BNMA 1MLDA 4XEHA 1BDBA 1XU9A 3CSDA 5T5QA 1E6UA 1ZK1A 4CV1A 3AJRA 3FHLA 4CLRA 5ADHA 2Y1EA 3S2EA 4ZRMA 2NU8A 4E2ZA 3KSZO 1H94A 1ZJZA 3UFXA 3MJCA 3D4OA 2VN8A 2GLXA 4GVXA 2Z1MA 4QECA 1BXKA 4B4UA 3PJEA 4HFNA 3ROPA 4B4VA 4MVJG 2VT2A 1MUUA 4NK4A 1IB6A 2WM3A 3B70A 1GU7A 1GYPA 1U5CA 1R37A 3KRTA 2NQTA 1BG6A 3RFXA 4P22A 1NTOA 4OAQA 3K8ZA 3LLVA 4M1QA 3GRPA 4YEDA 4JROA 2PK3A 1ISFA 1NWCA 2X9GA 5IJZA 3ZI0A 2Q4BA 3OM9A 4DIBA 3VH3A 1QYXA 3WFIA 4BNGA 4CODB 2JCXA 1PJ4A 3HSKA 4BIIA 3DZKA 3C1AA 1ZFNA 1GAEO 3I5MA 3C1TA 4WASA 5TC4A 3SLGA 3VPXA 4O0LA 3HADA 2CFCA 1NVGA 4FC6A 1C0LA 4N5LA 3GZ4A 1KVUA 4DXHA 1NVMB 1E7RA 1VRWA 3GVHA 3RIHA 5F3RA 4RVFA 3F5SA 1JDJA 2ZQZA 2C2YA 2VYVD 3OHSX 2FOIA 4YAGA 1Q1NA 1XQ1A 3IKVA 4UVIA 5EPOA 4R16A 4BNUA 4K26A 2YFHA 1NAIA 4W6ZA 4CL3A 4L74A 4MVJF 3O8QA 4J43A 4MKZA 4KWHA 4CV0A 2O4CA 3VPSA 3TZ6A 4WNIA 1Z75A 2B37A 4U0KA 3ONDA 1U3UA 5ENDA 4MIYA 4IY1A 2VYND 3DAPA 1DO8A 3UXYA 1JU9A 1NVTA 1WMBA 2AEJA 3E5MA 3OA2A 1P1IA 2Q2WA 3WX0A 2GDZA 2ZTLA 1FXSA 1M6WA 4Q3NA 4IQ0A 1JQBA 4ND3A 2DLDA 3NX4A 1HZJA 1ZUD1 1BXGA 4MVJD 3A9WA 5FI5A 4P8RA 4KMSA 2Z95A 1PL7A 4OL9A 5DULA 5KVQA 3C7DB 3GGOA 3U4CA 3H2SA 1M6HA 3TDKA 5ILGA 1HE3A 4E33A 1E0DA 3C7CB 3A1NA 3QRWA 4JBHA 3DONA 3UKOA 1PQWA 4BO3A 7MDHA 1N9GA 1PIWA 2E82A 1ZCJA 5IN5A 1J5PA 4A03A 2GF2A 1N2SA 1S7CA 5KVVA 4QSMA 4HKTA 5CPBA 4L4RA 3BMQB 5KJ6A 2XXJA 3NUGA 4XGNA 3E9QA 1E7WA 1GDHA 3BIOA 3UHAA 4AJIA 2HLPA 5JAMA 1IHXA 2JFHA 4GH5A 1VLLA 3PGXA 4NFHA 3NDRA 3GZNB 4IM7A 1MB4A 3IQDB 4GX1A 1AGNA 4OM8A 3OH8A 4W82A 4WE3A 2CY0A 4CUJA 1SBYA 3GDFA 1A72A 1HTBA 1NASA 3IC5A 4BNXA 3V2HA 2YY7A 3JQBA 1GQQA 4YCAA 3HG7A 4IGFA 2ZIZA 1MFPA 2Y1OA 2EXXA 4Q3AA 1YOVA 4PG5A 4ZVVA 4Y8VA 3LC1O 5ENVA 5A1TA 4W99A 3VKVA 4UVGA 1U9JA 3K2EA 1YH3A 4GI2A 4YJGB 1UZLA 4CMAA 3GVPA 4BB5A 1KOLA 1AXGA 1HE5A 3JQ8B 4TVOA 5TF4A 4EJMA 3C7AA 3K92A 4PG4A 4BQPA 3GAZA 4YR9A 2X6TA 3DBHA 2YQ4A 4EUHA 3JQ9C 3TPCA 2HMTA 2W8ZA 1XG5A 5COQA 3EAGA 3QLJA 2P9GA 4RORA 2W2KB 4EI2A 1BRMA 5G0WA 2YW9A 2CZCA 4Z9FA 3WR5A 2W90A 4QO7A 3Q1LA 1V3UA 2P9EA 4BGUA 2I3GA 4D7AA 3IJRA 4OKIA 4YJGA 2VWHA 2HDHA 4U5QA 4C7KA 2ZJ0A 1RM3A 5ILOA 2E6UX 3PP8A 1GCUA 4D0SA 5KVCA 2DT5A 1NQTA 3ZHZA 1FDVA 4PLYA 4I1IA 3MTGA 1B7GO 2GR9A 3P7MA 3OJEA 3GVCA 4H16A 1BMDA 3FPCA 1DRWA 3LT2A 2B69A 5B1YA 3RUCA 3KYBA 4MKXA 1U3TA 2VHXA 3RU7A 4WECA 5CPFA 2A94A 2X58A 4BO6A 1LQUA 4JN6B 2P9CA 1DDOA 4E30A 1CETA 2GN9A 4A5OA 4GMFA 3WB9A 2V6FA 1HDXA 2P2SA 2Q1WA 5A3JA 2PV7A 3IDSA 4PG8A 1CDOA 1E3EA 3SX2A 4KP7A 3DMTC 4OXNA 5CDTA 1LDNA 1J6UA 4A73A 5BNFA 4MINA 4B3JA 3NT2A 4YYZA 2X5KO 3NDIA 3ZH2A 4TVBA 3LU1A 4Z9XA 5KVSA 1UUFA 1X0VA 2FR8A 2VRCA 4K28A 1X15A 4XWYA 5A9TA 2O3RA 1KEUA 2HRBA 3FSRA 4YJFA 5HRUA 3FCOA 3O26A 4XQEA 3KUXA 3PWSA 3LQFA 1XSEA 4XDZA 2AXQA 4M49A 4CMEA 5B37A 1YKFA 1QR6A 5JCXA 4XIJA 2ILTA 4N5NA 1LRLA 4RCVA 5KJEA 4GSKA 2GPTA 4PRLA 4RZHA 3GT0A 2RH4A 4MOWA 1TA4A 2ZQYA 3DZJA 4R9SA 3RC7A 4CQMA 4MP8A 4HFJA 1SNYA 1PZGA 1NFFA 4OIMA 1R4MA 5G0UA 1GYRA 3RUHA 1NHGA 2CD9A 1QLJA 3VVCA 2NVWA 1GZ3A 3R3SA 2QRLA 3GHHA 1W4ZA 3E1KA 4PLHA 4P38A 5F1PA 4YRAA 3ROQA 2NM0A 3QJ5A 1EDZA 1DFIA 1HT0A 3ZV6A 3CKYA 3ANNA 4CR7A 1GD1O 1WDLA 2V6MA 2ZB3A 3K2BA 2X22A 3PDUA 2TMDA 3TZQA 5I7VA 2BLLA 4IS2A 5TS3A 4AICA 1A9YA 2BGLA 2EEZA 3KB6A 3QWAA 3IKTA 3DBRB 4D3FA 1WDKA 3P2OA 6LDHA 1GUFA 4N18A 2WDZA 4BNVA 1H0KA 1VE9A 1PGNA 3CE6A 3F4LA 4FQ8A 4NNJA 3AI1A 3KLPX 4YRDA 3QWBA 1FDTA 2EF1A 1T2AA 3SLKA 4E2YA 3NJ4A 2BGKA 3KSDO 3IL2A 2OBNA 4GGPA 1KIFA 1VPDA 1W6UA 3PWKA 1TT7A 1P1JA 1Y81A 2QW8A 3NKLA 5DOVA 1YBAA 4TRNA 4XKJA 2O7QA 5TX7A 3P5SA 3DZBA 1LDMA 1U4OA 1XLTA 3H6KA 1I30A 1MG0A 3H9GA 4LGVA 4J6FA 4W4TA 1SAYA 3NJ8A 3H9UA 2HMVA 4FJ0A 1XHLA 4ZU3A 1BW9B 1PJBA 5EIOA 4D41A 2EJVA 1CWUA 1LU9A 1Q2XA 4OMUA 5FFFA 3ROMA 4FGSA 1ZNQO 3L9WA 4YA6A 3VTZA 4B8WA 2YYYA 3AM4A 5JDIC 2B83A 3GLQA 2P5UA 5G4KA 4R3NA 4MIEA 5DBIA 4CMIA 1N7GA 3G0OA 3HDYA 1PJCA 1PSDA 4GL4A 3T7CA 3WLFA 4A10A 3CXRA 2GZ1A 2NVUA 3VC7A 4Z6KA 5AVOA 4NJMB 3JSAA 4FFOA 2B5WA 2PZMA 4D46A 1YWGO 5THKA 1R16A 2O50A 2ZTMA 4PLTA 1ARZA 3WNVA 4CMHA 4E5YA 2XXBA 1DPGA 5JDCC 2ZB8A 4KUEA 4RDHA 1AE1A 2VUTA 2AG5A 1MC4A 1HDRA 1LDGA 1I0ZA 4PZDA 5L95A 2I9PA 2X5JO 3T4EA 3SBOA 1ZEJA 8ADHA 2WTBA 5L51A 1EE9A 4JX8A 1FDWA 5CDUA 1DIGA 2GGSA 4RL6A 3K96A 3SC6A 3PI7A 2PD3A 2UYYA 5JYEA 2EERA 1YXMA 2O3JA 4XA8A 2CMDA 4D43A 4XX0A 4I5GA 4Q3DA 1PJSA 2BFMA 5DCYA 3NYWA 1HDCA 3BXXA 4XYGA 2NV6A 1DRVA 3PYLA 2FZWA 3OP4A 3PXXA 4ND5A 5CHEA 2NTVA 3ZV3A 5ER6A 3EMKA 3IOYA 1WMAA 2FSVA 3OEWA 4BNNA 1D1SA 2BGMA 4DMMA 2RAFA 4YAEA 1DC3A 1IPEA 4L0QA 3JQ7A 4IZIA 3HN2A 1YBMA 4B3HA 5BSEA 1U7HA 3DZGA 3KOUA 3MJSA 2VNSA 5AXCA 3ZNPA 4AJHA 4YJHB 1EK5A 1Z7EA 3FNGA 4G65A 5TSDA 2G0TA 4HFMA 4Y98A 2HRZA 2O2YA 2EHDA 1MFZA 4JJIA 4J7CA 4RPHA 1FK8A 4MP6A 4E31A 2VHZA 4H15A 1ML3A 3D3WA 3UAGA 2B35A 5JAQA 3ENKA 3F46A 2HMSA 4DLAA 2GYYA 3U4DA 1QYVA 1NX6A 4OO3A 4Y9DA 2ZKLA 3JQGB 1XWFA 4CLDA 4J7XA 3DOCA 1HSOA 1R0KA 5A06A 2X1HA 5EN4A 4CUZA 4FJ1A 4YT5A 2BD0A 5FWNA 4MVJE 1A71A 4R41A 1NQ5A 3OF2A 1ZZEA 1P1FA 1I3LA 4DIOA 1Q7BA 1Y9EA 2V65A 2E37A 2FMUA 3S8MA 1GZ6A 5C37A 4R69A 4IINA 3JQGA 1HKUA 1YJQA 4OH1A 2DM6A 4CMIB 3DWFA 1QXSA 4L75A 2CVOA 4CR8A 4PLPA 2IYPA 3O38A 1M67A 4GVLA 5T8KC 4OJNA 2CF6A 1Z74A 4WLNA 1PTJA 3RQSA 4PLGA 3WMXA 3MJ4A 2VZ9A 1ENOA 3ZGYA 1O5IA 4EEXA 1EK6A 1IY8A 4MIOA 1E7SA 2VTDA 3PTZA 3CTMA 1U3WA 4KDFA 1CQJA 3QIVA 4M55A 3WGZA 2ZATA 1DIRA 2GSDA 4MVJM 3PYXA 2OHXA 3FNHA 4TZTA 4WJZA 4CM9D 4CUKA 1KEWA 4J16A 3ZZNA 3DBHB 2WD7A 1PZEA 1V0JA 4IDDA 2VRCD 2VYNA 4DUPA 1TVEA 3EY4A 3BTUA 5K0ZA 1P3DA 3FN4A 2BFOA 4LCEA 1DIBA 3EVNA 3RBZA 1XKQA 2YZ7A 3UICA 4IPTA 4QXMA 4BKUA 1C1DA 2HJSA 1ISMA 4XQCA 3RAJA 5L45A 3I6QA 1O94A 3KTDA 3U49A 1WZEA 1M76A 1ZXBA 4WOJA 1JKFA 3I9KA 1XA0A 1VJTA 2P4QA 1ZEMA 4H7PA 5CEJA 1YQDA 4YPOA 1DOHA 2B5VA 4O1MA 3N58A 4RPGA 1I32A 2VYVA 4AJJA 1VSUA 2DTEA 1KEVA 4ALKA 3VZSA 1JVBA 1QSGA 2GCGA 3WOHA 5IAAA 3QE3A 3I4FA 4ZICA 1JWBB 1PL8A 3JD2A 5JDCA 4L4XA 4NIMA 1SPXA 4RVUA 3ROKA 1U2DA 3HUDA 3C8MA 2EG9A 2YHIB 4JNKA 3X2EA 4OXYA 2A4KA 1B8UA 2BHLA 1ZMTA 1KERA 3GEGA 4C7JA 2A9FA 2CDCA 2ZB4A 3F47A 5G4LA 1DLIA 1WW8A 2YUTA 2C20A 2DVMA 2FWMX 1ISHA 4PFJA 3WS7A 3NAQA 4UVEA 3UH1A 4BQRA 1W0CA 2FN7A 1I2CA 4PRKA 3W8DA 1X1EA 1G0NA 4I9NA 5CDSA 3AUAA 3AW9A 4NK5A 2X0NA 1MP0A 3ZWVA 4AVYA 5KTKA 1VSVA 1ISJA 4A2CA 5JC1A 4OGWA 1B8VA 2VWQA 3WYCA 2FY8A 4IDCA 4M86A 2RIRA 4WGGA 1PWZA 1XEAA 3DBLA 4LVCA 4RQUA 1ADGA 2AMFA 1EVZA 4R5MA 2BI8A 4DPLA 2PGDA 1NR1A 5KJCA 3AUUA 3ULKA 3V1YA 4AJPA 1GQYA 1N9GB 1AXEA 3LT4A 4AJ4A 4UEJA 2OP0A 1Q0QA 4B3IA 1YB1A 2D8AA 4CLRB 5JXWA 1NP3A 1C14A 3PHLA 4JBIA 3WGQA 1NNUA 1QKIA 1YO6A 4LMPA 4F46A 3NGXA 4E5NA 4TZKA 4CR6A 5BR7A 2AHRA 1KC1A 4DYDA 1PR3A 3AU8A 2VHVA 1JW9B 3EGOA 2JJYA 1G0OA 3JQ8A 2FPGA 2VWPA 2PLAA 1TT5B 2QRJA 4YQYA 1P0CA 2VWGA 2Y05A 3GHYA 4FD3A 4NFSA 2X0JA 3TNLA 3ZWPA 1DC4A 3DAFA 4HNHA 3JD4A 3VTFA 2HKIA 1LSUA 4G81A 3U9LA 1IL0A 3ZWBA 2VOEA 3HFGA 5A9RA 3V1UA 1Q7GA 4KQWA 2CF5A 5G0TA 3GA0A 4IDEA 2VRBA 4RPKA 2O48X 2PWZA 3WGHA 3WQSB 3LVFO 3WBFA 2D5AA 4HY3A 3GMDA 1YB4A 1DSSG 4MKRA 3ZNOA 5IZ4A 4FPXA 1H2HA 4DMLA 3GPIA 3RD5A 1Y8RB 3RROA 3ZU2A 3LT1A 4BNTA 1X0XA 1YL5A 4Y6RA 1ZJYA 2HCTA 3LF2A 3O8QB 1BVRA 1PWXA 1R4NA 4G2NA 1K6JA 1VM6A 3B1KA 1P45A 1B2LA 4NBTA 1WZIA 4BKQA 3GR6A 4EITA 4AJEA 2X7HA 5C7LO 3GOHA 1SB8A 4OSOA 1QYWA 4Z3KA 3GDOA 4RVSA 5TT0A 1HEUA 1DIAA 4ZA2A 1V8BA 2UVDA 4J1QA 2AE1A 4F45A 4E12A 3GUYA 5JNLA 4IDAA 4J90A 4TKLA 4RF5A 1PR9A 3KYCB 1XYGA 2JD1A 3ORFA 4PVDA 3ZV5A 3GNQA 5L4SA 2P68A 1OOEA 3ZWWA 5KJ1A 4J1NA 4R1NA 1EQUA 1AHIA 3JCZA 4CLOB 2PZKA 1A4IA 3F3SA 3I9OA 5U4QA 3WG9A 4LRTB 1HYHA 2YQ5A 2OZPA 3ETGA 3I9NA 4IIVA 1KVSA 1WXDA 5I7EA 1GL3A 3O4RA 4CM4B 5BSGA 4R1TA 2FR1A 2IEBA 2H6EA 2QQ5A 1QMGA 3QWHA 4E4YA 5AXAA 5I8WA 4ZGWA 4OKNA 1VJ0A 2Q2QA 2FP4A 4XRRA 1NYTA 1QG6A 3LC7O 1E5QA 4LISA 1DAOA 1T4DA 3TZHA 3RUFA 4CPDA 1LRJA 4BS9A 1NHWA 4TRMA 2POQX 4I5FA 4XQ9A 3SJUA 2DBZA 4FC7A 1Y7TA 3ETEA 1G1AA 3BYZA 3WXBA 2DKNA 3ZHXA 3GQVA 2RBEA 2WD8A 1HDOA 3MJEA 4J4BA 3BA1A 4JGBA 1X13A 4NBVA 4FIZA 4J1TA 1XQ6A 2IZZA 3DMYA 1HYEA 2NNLD 1GCOA 1R0LA 1NBOA 2J5RA 3ITKA 1YL6A 1R15A 2OOSA 4G5HA 5ER9A 3WGGA 9LDBA 5ICMA 1EFLA 3TF5A 3DOJA 3ST7A 4FFMA 1V9LA 3LT0A 3VH2A 1A7KA 5A9SA 5L7TA 3TFQA 2AG8A 1PJ3A 1P74A 4WLOA 3QHAA 3IJPA 4Z0TA 5T67A 3VPGA 1C1XB 3GK3A 2NSDA 1U3VA 2AEFA 4PIVA 5EL0A 3MZ0A 3S55A 4BV8A 4OHUA 3RJ9A 4GSLA 3PDJA 3IAHA 1I24A 4BO5A 1PU2A 2PA3A 2R6JA 1PGOA 3ADPA 3GY0A 4H3VA 5KKAA 2C0CA 2DFVA 3JQ6A 2UUPA 4BL5A 3DBLB 2G82A 5CG2A 3R6DA 1YQGA 1E1NA 1NPYA 2X23A 3PIDA 4ZQBA 3TJRA 4I5DA 4GPD1 1Y5RA 4NMHA 4ZJUA 4XR4A 1B26A 1I10A 1YDEA 4IXTA 4E2WA 5JW6A 4ALIA 3FRJA 2UV8A 1DC5A 4UVDA 3KEQA 2F1KA 4ITUA 4II2A 5LDGA 3QVWA 1YOVB 4EUFA 4FBGA 3K6JA 1I3KA 1M66A 3H65A 5HM8A 5KOIA 1VL6A 3L6EA 2DUUA 4FJ2A 4O6VA 3ZV4A 1F17A 3HHPA 5B12A 5DN9A 5TLSA 1X14A 2QRKA 4PN3A 4FCCA 1PGPA 4QTZA 1HWYA 4GLOA 3K31A 4PVCA 4YAIA 4WLEA 5TJHA 3WTBA 3WMWA 3ZWYA 2O3QA 1DXYA 1UDBA 3VKUA 1ZVMA 3GGGA 3Q9UA 1MXHA 1E3SA 3TL2A 2C54A 1Z7BA 4YQZA 2XOXA 1CEQA 2JFGA 2Y0EA 4LMRA 3FR7A 4WNCA 2OMEA 5GMOA 2JD0A 4YT4A 1RPNA 2WYUA 3JYLA 1QRRA 2O4UX 3B1FA 2HMWA 3H3FA 8LDHA 1ID1A 2NVUB 1PQUA 3ZW8A 1E7YA 2YJZA 3INTA 2AQHA 3CEAA 3GG9A 3D3EA 3G17A 3U09A 3HDHA 1GADO 3QVXA 1EDOA 3N7UA 3DR3A 4BO1A 4ID9A 3PQEA 3D3WB 1C0KA 4BO0A 4KDEA 3T7EA 4Z0PA 3F6YA 4OOEA 3B20A 3DB2A 1DHTA 4IMPA 4RF2A 2D1YA 2DQ4A 2VHYA 4RGBA 3KYCA 4NR0A 1H6DA 4DVJA 1Y9AA 4L9RA 1DFHA 1DC6A 4IDBA 1VL0A 2JAHA 5JFOA 3T4XA 1NR7A 1YRLA 5A5FA 1A7AA 4JBGA 5T64A 4MVJA 5TIIA 1ZKMA 4O63O 4BVAA 3IUPA 1B15A 4INAA 3V8BA 4UEKA 2X8LA 5BSHA 4E13A 2JL1A 2YDYA 1FDUA 3GGPA 4ND1A 2OL4A 3M1AA 3NTRA 1H9BA 1KEPA 3VDRA 5CP8A 1LDYA 2UUOA 1EZ4A 2Y1FA 5F1KA 3GUCA 1ISIA 1BDMA 4R54A 2BI7A 2AQKA 3BMOB 3QVSA 4NH4A 2OFPA 3V2GA 5HWSA 3IMFA 4UEOA 5ICSA 1O8CA 2Y68A 3F5QA 1HLDA 1NWHA 1F12A 1E77A 3Q0EA 4YJHA 1X1TA 2DTDA 1O0SA 2LDBA 4BNKA 5JS6A 5AQ1A 2EV9A 4FSHA 1O6ZA 2DC1A 4PG7A 5JSFA 4IS3A 4RDIA 2XF8A 1H6CA 2O3TA 4XYBA 3G3EA 1UP6A 2HK7A 3E6AA 4J4HA 3LZ6A 5C5IA 1EUDA 3DBVO 3GFGA 3GRKA 4A26A 2OGUA 1EQ2A 1BHSA 3PGJA 1MGOA 4EYEA 5DOZA 1ZW1A 5MGBA 4MVJP 3JYOA 1EUZA 1PJ2A 4ZQFA 2B0JA 2B4QA 2VCYA 3RKUA 2A35A 4U8GA 1X7DA 3HE3A 1ORRA 3RJ5A 2PTGA 3PEFA 3WSWA 1W8DA 3LF1A 1DBVO 2PGLA 3QQPA 3JQ9A 3ZU3A 3OSUA 1TB4A 1E3IA 1NM5A 1P1KA 3MWEB 5GZ1A 1WP4A 1Y5MA 3IUSA 4L73A 4TMFA 3I9MA 2ZYAA 1ZK0A 5CDYA 1EVYA 1U4SA 3G1TA 4XJTA 4BMSA 3L07A 1V3TA 4UAGA 3AM5A 2I99A 4B7UA 2YHUA 3AOEC 3B6ZA 3FD8A 2YV1A 4K9DA 2J5KA 4HX5A 2J8ZA 3FF4A 3ZDFA 1E1LA 3A4VA 3FBTA 1YQXA 1V3VA 3CH6A 3CZMA 3M2TA 3PLNA 4KOAA 2BMAA 3SEFA 5IDWA 3ZN2A 3E03A 3H7AA 3MWDB 5CAEA 3BTSA 4NPCA 1IHYA 2BELA 2D5CA 3VPHA 3GFBA 3RWBA 2GD1O 2VUSA 3QVOA 4XGIA 5I7SA 3I23A 1M2WA 3OIGA 5EQFA 1K6XA 2X4GA 1QP8A 2PNFA 1YVEI 1C1DB 3OQ1A 3ZU4A 2YHIA 2Q2VA 3V5NA 4QFDA 3WNQA 3SJ7A 2QYTA 1GY8A 1P0FA 3JQAB 1NQAO 4WLUA 2IZ0A 2HU2A 4R01A 4YJFB 5EQDA 3RC1A 1TI7A 3RBXA 3BAZA 5A05A 1WNTA 2JHGA 3D64A 1QYCA 3WIEA 1XU7A 3GVXA 1LDBA 3BMQA 3H5RA 1UZNA 3WYBA 3TRIA 3MOGA 1SCUA 4GAEA 1ONPA 2C7GA 3GEDA 3JQAA 1XGKA 4IDGA 3WYEA 1Y6JA 1EFKA 4B7XA 4WUVA 2FHSA 5KIAA 1AUPA 3DXFA 3BTVA 4YJDA 3LYLA 3NTOA 3OQBA 3AM3A 1QV6A 3RC9A 1T2FA 3H8VA 4NBUA 1I3MA 3F4BA 3PFFA 5EERA 5GY7A 3ASVA 3I4CA 1LC0A 3RC2A 1O89A 4ZQGA 2LDXA 4FDAA 4RZIA 2Q46A 5IFLA 3A28A 3OA0A 3TFOA 2C82A 2EWMA 3DL2A 3DQPA 4GQAA 4RLHA 1J49A 3Q2KA 4AFNA 3LC2O 4YWJA 1DLJA 4KTTE 4W9NA 1Q0LA 3TQHA 3TZCA 2W2LA 1IZ0A 5U9CA 5JO9A 5L7WA 1U8XX 2HUNA 1LUAA 2DBRA 1UDAA 4XDYA 3ZHYA 2VNAA 1GTMA 2J3KA 3UW3A 4QX6A 2AQ8A 2NQ8A 1O9BA 3FWNA 4HXYA 4HFRA 2V6GA 2Q45A 5FF9A 5JPIA 1ZK3A 4QUKA 2QYSA 4NBRA 4HBGA 1KVRA 2NVBA 3U62A 4J2OA 1GPJA 4JJGA 1LQTA 4WCDA 2EKLA 4R1SA 5HBRA 2PH3A 1LLDA 4BGVA 5G2OA 2Y0DA 3DHYA 1H6AA 1N7HA 2DPGA 4QT0A 1D3AA 2IZ1A 1OC4A 1X7GA 3CZRA 5HA5A 2NACA 3KO8A 3UF0A 4BKRA 1FMCA 2ZCVA 2C2XA 3KSUA 1EEHA 3RFVA 1ZSNA 3JQFA 4GGOA 4Z0HO 1R4NB 2HMUA 1PQPA 5JCJD 3ZWOA 1PGJA 4NG5A 4DYVA 3AUSA 1LLQA 4I8XA 4LVUA 4JP3A 5JBIA 2G76A 1ZSVA 2I5PO 3OQ6A 3BMCA 3K5PA 5J23A 1HE2A 2VOJA 1P33A 3ITDA 5EINA 3EUWA 1T2DA 2ZCUA 2I65A 1E7QA 1GV1A 4CM4A 4YAKA 5KKCA 5LC1A 5ES3A 3ZWMA 3PFWO 4D45A 1I5RA 1PS0A 2RCYA 2RHRA 3H9JA 3KV3O 4R9RA 3TOXA 5IXSA 1P1HA 4DIFA 4BHTA 1LTHR 1BTOA 4YAJA 5JMPA 4ND4A 3KXDA 4XRGA 2CVZA 3OIDA 1I3NA 3BMCB 3I1JA 4EEZA 5I9LA 4E5KA 5A04A 5DCWA 4TSKA 1O95A 4RF3A 1KVQA 1LSSA 4DLLA 3OIFA 3GC6A 5KWEA 4CLEA 4NI5A 3WQQA 2PY6A 1TLTA 1LBEA 2IXAA 3DTTA 3Q6IA 4DTIA 1B8PA 5IZCC 3VZRA 1MV8A 4CLXA 4S1VA 1C0PA 4Q39A 3H3JA 4DRYA 3VPFA 1YE3A 2PGJA 3H5AA 3OJFA 5A02A 3ICCA 5T6BA 4DPKA 4R5HA 1JVSA 3JD0A 4WKGA 3PZRA 4ILKA 4CLOA 1P44A 5F1OA 1X7HA 3DOOA 5JDIA 2Q1UA 1UP4A 3H5NA 1IUKA 4OYRA 4BMVA 3ETDA 3L6DA 1U7TA 1Z82A 3ZHBA 3D1LA 1UJMA 2CSUA 4J1SA 3L77A 1XCBA 3FTPA 3Q9NA 4BO9A 2EP5A 1JTVA 3ABIA 3QWFA 3VDQA 4IJVA 3DTYA 4TRJA 4GWKA 1SO8A 3KZVA 4ALJA 5JYDA 2EW8A 2YV2A 2J3JA 5GZ6A 3PHHA 3W4JA 3WSVA 2PD6A 3AI3A 4IQ8A 1M75A 3HDQA 3GPDG 4CQMB 1K0UA 3BTOA 2BH9A 1GFSA 5L7YA 1UXGA 4JJFA 3ZW9A 4IXWA 4A27A 2GZ2A 2Y93A 4DWVA 1SOWA 3HB4X 3WTCA 4E21A 1KETA 1QV7A 3RCBA 2O3SA 3HJAA 1DEHA 3WICA 4DQXA 2I76A 4FFRA 5BSFA 5LDHA 2H1SA 3TZKA 5DCUA 1ISGA 2PFGA 1RM5A 3NTQA 1LLUA 2G5CA 4DQVA 2Q1TA 3TOZA 4YXFA 1ZBQA 3F9IA 5L53A 4GWGA 1PL6A 4CM8B 2GASA 2JHFA 3DO5A 4L4SA 1L7DA 2YFQA 3WGOA 1H6BA 3D7LA 2Q99A 3NGLA 3I3OA 4A0SA 1TXGA 4W9NC 1QLHA 4FOSA 3VH4A 4CV3A 2Q50A 4RJTA 3NT5A 3OBBA 3E18A 1UXJA 4KQXA 5I9NA 5IXYA 5BT9A 4IZHA 4BB6A 3FI9A 4XGKA 2VTEA 3I83A 3AY7A 4YT8A 3DBRA 4ROSA 5THQA 2QZ9A 3ZNQA 1MXFA 1C1XA 3W8FA 1YS4A 4FFPA 4ALNA 4B4WA 3LLSA 4DC0A 1U2GA 1NQOA 1OMOA 4L8VA 4CM9A 4E3ZA 3A06A 3WWZA 3S1LA 3O03A 2AA3A 1HDGO 3H2ZA 1UH5A 3RSHA 3SC4A 2VT3A 2ZJ1A 4K6CA 4Q3EA 4RQTA 4W7HA 4FFNA 5L4LA 1J0XO 2FPPA 2W2KA 2FR0A 3DDNA 1IE3A 3STHA 4LSWA 2R00A 1RYEA 3M2PA 3OMLA 1LRKA 1RM4A 3D0OA 1BXZA 3DFUA 1Y1PA 4NU5A 4EGFA 4M54A 3VZPA 3X2FA 2PKRA 4JXKA 4JK3A 4WPGA 3W6ZA 4O5OA 1OC2A 3C85A 4OOFA 1LSJA 3MEQA 1OZAA 2WJPA 4FR5A 2O2SA 4XYMA 4BNYA 2JAPA 4WLVA 5IN4A 4RO0A 1N8KA 1SEPA 2WMDA 3VZQA 1ZSYA 4Z9YA 5IG2A 3INRA 1ENYA 1U8FO 4U7WA 3MTJA 7ADHA 3C1OA 1GPDG 3ENNA 3C24A 1E1KA 3OETA 1R12A 2W4QA 3AOGA 1V6AA 1E6EA 3F1LA 5EJ2A 2BF7A 4QO8A 4J0EA 1OFGA 1Y8QB 2GN8A 2HSDA 4XQGA 2NUAA 2P91A 4IGEA 4MP3A 4BV9A 3G79A 1B16A 3B1JA 4E5PA 4OXKA 1PZFA 3JD1A 1ENPA 1VKOA 4BNZA 3DFZA 1OAAA 3JQDA 3VVBA 2DUWA 3BHJA 3UCXA 3Q3CA 1F8FA 3PQDA 2GUGA 1I2ZA 4LCJA 4XD2A 2QZZA 1U28A 4RV9A 4E6PA 3PVZA 3H9EO 4ALLA 1P1RA 3QSGA 5I9MA 2EKPA 5GZ3A 2I66A 4Q3CA 4HV4A 4JIGA 3UCFA 2Y99A 3LDHA 2VHWA 3HN7A 1VL8A 1A5ZA 2AQIA 3V1TC 5IDQA 3AK4A 2XPCA 1GYQA 2B4RO 2GERA 1RJWA 1LX6A 3PWZA 4MDHA 4XYEA 3QV1A 5TGDA 3DEYX 3JYNA 5DF1A 5T57A 4CMGA 1PJQA 1E1MA 1ZK2A 3D5QA 3HWRA 3OJ0A 1YDWA 3BMOA 1H93A 3JQFC 2C5EA 3ZWNA 4FS3A 1E92A 3QVTA 5MDHA 3H9QA 4BKOA 4DQUA 4WOKA 1IZ9A 1YB5A 1E3LA 3AOEA 1T1RA 4GKVA 4K1LA 5FYDA 3CMCO 1TEHA 4U6SA 3P19A 2H5LA 4B4OA 3ANLA 3CPSA 3KYDB 2GNAA 3W8EA 4MVJI 3QY9A 1JLLA 4KWIA 5TRTA 4GX2A 2AEMA 1TT5A 3DHNA 4PLCA 4BO8A 4DA9A 4PGFA 3UN1A 3RI3A 3L4SO 3INGA 4ZD6A 4BKPA 1RWBA 3GF4A 4IMRA 5DNAA 1UXKA 2Y0CA 4FOOA 3GN1A 3I52A 5TT1A 2Y67A 3JYQA 5KCZA 1SC6A 3JQEA 4D3DA 4JQCA 3BZUA 3W4IA 2Y1DA 3EK2A 4IJKA 1WLYA 3UOGA 3GG2A 2H9IA 3FNEA 1NFRA 3EZLA 3ZNNA 4ZHSA 2IEDA 2YDXA 2I67A 4DPMA 1IYZA 4E0BA 4FN4A 2DU8A 3RUAA 1P9LA 4UUMA 4ZQHA 2D3TA 3RFTA 1H5QA 4FB5A 5BNTA 2WEKA 2AW5A 2B4TO 1EUCA 4CMJA 2G1UA 4RF4A 1FF9A 5JC8A 1N1EA 1PS8A 3ON5A 1T2CA 4BNHA 4E2XA 5CFZA 2PKQO 4RVDA 1EBUA 1ADBA 2GRAA 3ONEA 1IPFA 4J3FA 1KY4A 2VUUA 1B14A 3I9LA 5L4NA 3FPLA 4YBZA 5G0SA 4K6FA 4D44A 1JAYA 1G6KA 4CM3A 2JKVA 2ZYGA 2DPHA 2C29D 4CM5A 4R1UA 1D1TA 4EZBA 2VQ3A 1ZO8A 2VZ8A 3FNFA 2IRWA 1Y8QA 5JMWA 3OEYA 2I3AA 3EZYA 1BGVA 3UUWA 1K6IA 5F21A 1GQ2A 4GX5A 5EESA 1U1IA 1YONA 4NU6A 4BO2A 1UP7A 2IDZA 5LCXA 4YACA 1PZHA 4WCFB 1LDEA 1Z45A 3IP1A 4EDFA 4PZEA 2EJWA 5JO0A 1PGQA 1V35A 3JTMA 4F6CA 3UGKA 1JKIA 1HZZA 2D59A 3IIEA 4CMEC 1PEDA 3U0BA 1EE2A 1HF3A 4HADA 2QHXA 4XJSA 5H83A 3WJ7A 2JCYA 4CQMD 1I33A 3WFJA 1ULUA 4KUGA 2Z1NA 3L4BA 2WE7A 5AOVA 1XDWA 3H4VA 4PG6A 4XR9A 4QEDA 2FZEA 5IDYA 1T24A 5DT9A 3I9JA 4M8SA 4CLHA 2X86A 1AHHA 2CVQA 1DAPA 2J6IA 2VZ0A 1MC5A 4J0FA 3JQ7B 2W2LD 4II3A 3PPIA 3IS3A 3QWIA 5I7FA 1ONNA 1R6DA 3ONFA 3PJGA 4GBJA 4LSMA 5HS4A 2PKQP 2PZLA 1LJ8A 3L6OO 4KUHA 1RKXA 1ADCA 2ZB7A 1N5DA 3TSCA 5L40A 3DZFA 1UDCA 2F00A 1WAMA 2GN4A 3KBOA 4Y67A 2IYOA 2YV3A 4BNLA 3MJTA 2BKAA 3IP3A 5K6AA 1WDMA 4LRSB 3DC2A 1UXIA 4PLVA 2FSSA 3OECA 1ENZA 2OO5A 2W98A 3FR8A 5H82A 3WQRA 4ONEA 5K9ZA 2I6TA 2O7SA 3GZNA 1GEGA 1KY5A 3A14A 5A9SB 3NV9A 1NPTO 2X9VA 3BHIA 1GUYA 4ALMA 1YJ8A 1PS9A 5ITWA 2Q3EA 5AXDA 5A3VA 5L9AA 4BNFA 3AWDA 3GAFA 1JN0A 3ANMA 2IE0A 4QFCA 3FBGA 4EW6A 1T2EA 3JQBC 3WGIA 4D0RA 1YGYA 3GDGA 4NFYA 4D3SA 2B36A 3HQ4O 4IJUA 1E5LA 2EGGA 3L0DA 3EVTA 4WEQA 3M1LA 4CM8A 3PHGA 3TN7A 1DHRA 4M87A 2E48A 3JQCA 4EBFA 4BNJA 3KYDA 1JAXA 5H81A 3MJVA 4M89A 3WIDA 5CDGA 1LSOA 1UZMA 3NT4A 2WD7B 2OBYA 1H2BA 2QG4A 5IF3A 1N1GA 4YDRA 3PJDA 4BNIA 3HZZA 4CM7A 5B4UA 1B3BA 4PLZA 5L3ZA 3AU9A 1KC3A 3CUKA 1EBFA 1LNQA 1S6YA 3PHIA 4P4LA 2OUIA 1VC2A 4J49A 3HDJA 4CL8A 3BHMA 3KLMX 4ZRNA 4EJ6A 4JCOA 2HAEA 4CM1A 3QP9A 4LW8A 4DGSA 1I8TA 5CEFA 4RLSA 4UUNA 3W6UA 3PRJA 4Q3BA 2A92A 1T1SA 2EW2A 4IQGA 3VH1A 4ZN6A 2O23A 4NJMA 4Y6SA 2D4AA 2WYWA 5COBA 1A9ZA 5CG1A 1CF2O 1B3RA 4GLLA 4MVJH 4XCVA 5F5NA 2D0IA 5IDXA 2IXBA 4CMKA 2RHCA 2GO1A 2CDAA 3NEPX 3DMTA 4WEOA 5JY6A 3U5TA 2DTXA 1JWAB 3NDJA 1SZJG 2Y66A 3TL3A 3S2IA 2DBQA 3R0IA 4IJWA 3I6IA 1PX0A 3OFSA 3EDMA 1A27A 1BXGB 4BO7A 3E9MA 1HSZA 4R68A 3Q2IA 4NJOA 3JV7A 3V2UA 2WYVA 4JP2A 2HO5A 2WE8A 2G17A 1HYGA 4R3WA 4DBZA 3MCVA 1LXCA 3GH3A 4CQLB 2JFFA 1Z6ZA 4FFLA 1CERA 3AI2A 1RYDA 4UREA 5JCJA 3FTNA 3W4KA 4A7PA 2CNBA 4IBOA 1E3WA 1GUZA 5FEUA 1HL3A 1DFGA 1WPQA 1DJNA 1C3VA 4RPJA 4AJOA 3AUTA 1IULA 5A5EA 1Z73A 5DBGA 4W7IA 4X54A 4F3YA 3LSYA 2ZK7A 2IODA 3G49A 1CRWG 3G1UA 3RUIA 4BMNA 1T25A 3E9NA 1XIVA 3PJFA 3PZBA 5JAZA 4DC1A 4KTVE 5EMHA 4YB8A 1UXHA 2NU7A 3KEOA 1L1FA 1FJHA 4YT2A 3D5TA 3ZCXA 1F0YA 2Y1CA 2Z5LA 2R00C 3F1KA 1PJTA 3WBBA 1LLCA 3GEMA 4B7CA 5B4VA 2D2IA 1SOVA 1L7EA 1BVUA 3R3JA 4AJ1A 1D8AA 4DBVO 3GN2A 4AG3A 2X5OA 3HNPA 2J3HA 2JD2A 4UVHA 3ADOA 4XB2A 5DP1A 3RKRA 2DBVO 2DAPA 3EW7A 4ZQEA 2R2GA 3AY6A 4BNWA 2EKQA 4IDFA 4BGIA 4FGWA 4C4OA 4D42A 4GKBA 3ZWCA 4CMCA 1EMDA 4YTEA 1HRDA 3K30A 3OJOA 1A4UA 3DZIA 3HB5X 1MG5A 2SCUA 4RPLA 1AN9A 1F06A 3KHUA 3ICPA 2C5AA 2Q1SA 4J91A 1FDSA 1Y8RA 2EGHA 4WLFA 1KS9A 4JLWA 4XIYA 3E48A 2FRDA 4J9UE 1EVIA 3EYWA 1Q7CA 9LDTA 1ONOA 2J5QA 2NU9A 2UAGA 4J9VA 4DLBA 1K2WA 1E7MA 4Y6PA 5HS6A 1W73A 4WCFC 3GVIA 1EVJA 2PH5A 1XR3A 5KJFA 1BW9A 3C3XA 5A03A 3L4BC 4URFA 5BNIA 4FW8A 3U4HA 2HJRA 5G0VA 1WVGA 4BGEA 3GNTA 1LC3A 2EP7A 2FPIA 1P31A 4HWKA 4QQRA 2GN6A 4OSPA 2E4AA 2TMGA 4P4GA 2X9NA 1GR0A 2WSBA 2NTJA 1DRUA 2C07A 3WWYA 4J7UA 1SMKA 3O9ZA
chains in the Genus database with same CATH superfamily
3ONNA 2QN3A 3KDPA 1TW2A 4FWIB 2AK2A 3PK0A 2C7VA 5DSTA 3ZD6A 4HLCA 1C4WA 1C30A 1UKVY 1YI0A 4PLFA 5HQ3A 1A4XA 5JH7A 2VQFB 3GRCA 4DB2A 4L5AA 2D13A 1H9AA 4NBWA 4A0QA 3L0OA 4WNAB 1XYYA 3L0IB 5FL3A 1RWPA 1Y3FE 2PR2A 2GQ0A 4G8CA 5CIWA 5TPWA 3UK6A 3L7DA 2IV7A 2FOXA 1IONA 2VPZA 4EI7A 3T1HB 4CJXA 5FHQA 3UWKA 5TNXA 4QEKA 4K7JA 4YMLA 1KR2A 3DUWA 1P2TA 3RYHA 3ZHQA 3WIVA 1GTSA 5KTRA 4P0PB 1T10A 2JGDA 3BMNB 3U3XA 4MW2A 4BVBA 1PR4A 2FSGA 1BA3A 5KOJB 3RHZA 3OOSA 2DSNA 3SK0A 1XELA 4RVHA 3WGTA 5FI3A 4UBMA 3PNQA 1NG9A 3GPLA 3I0MA 3TK1A 1NQUA 2KI5A 2PSEA 2C92A 4QHTA 4DJ5X 2DUMA 2ZXEA 5EE5B 5F4ZA 3OJLA 4Z3OA 2NADA 2V7TA 2GS9A 1ULSA 1XVLA 2AEEA 2EP8A 5LLDA 2Y71A 3G5TA 1B0UA 1D4FA 3ER8A 1JBQA 2B8EA 1KBZA 3FIJA 4LN1A 1AZSC 5EKXA 1OBFO 3RYHB 4NCIA 3I1IA 3WRVA 3FWZA 5FUBA 4S35A 3M1IA 4AT1A 3G7UA 3JALA 2PVCA 1UWCA 3D4NA 4QM7A 4TYWA 5JATA 1OIWA 4JUFA 1FP4B 2OESA 3KR0A 2FMFA 3IHTA 3SWWA 3ICEA 2QTCA 4UU7A 2NLOA 2PBRA 3A6KA 3EIXA 2Q3HA 2V6BA 1F8GA 2IYAA 2QP4A 3P2YA 3UJDA 4L9SA 4WZBE 4PCVA 1FZQA 2QMOA 2XWSA 4I08A 1PD0A 1OGJA 1E2EA 4DUGA 1RRCA 3WLEA 5DGCA 3F7MA 3IIKA 4ZVSA 4I9UA 5F7XA 4Y2TA 2FP3A 2C3UA 1SEVA 5FAKA 4OQZA 3A6PC 4BCDA 4DLWA 1GFZA 4Q37A 2P7HA 1II0A 3TOSA 1IN4A 2B7BA 1IUNA 3D6TB 3GWGA 5DDIP 4I50F 4A36A 1SVSA 2QY6A 2QENA 4B43A 2QTFA 3UCEA 5K45A 1GV0A 3DV2A 1GLVA 3G0CA 1UJBA 5FBZA 1U8YA 5U1PA 2X1LA 4MGIR 4N54A 1FYDA 1A1SA 4WBNA 1UEIA 1TAHA 4WK6A 5G4KB 1JKJB 4BRSA 1RQRA 3QVGB 3Q8KA 5JG7A 3HI6A 1JAZA 1FXWA 1FYWA 4PCLA 1K3TA 3EG5A 3AY3A 5CTJA 3DZDA 4MYDA 4LK3A 3IAUA 3ASUA 3D4PA 1UQTA 3RREA 4AJNA 4ZI7F 3CVUA 4GXNA 4CKEA 3KVRA 4KMOA 4PLWA 1NIPA 4DIMA 2BFPA 5KC8A 4YAWA 4ZYVA 1VPWA 3X1ZA 4TQGA 2GZ3A 3JD3A 1ORWA 1OILA 4JA0A 1YK1A 1CFJA 3GCDA 4HDOB 4JNCA 1N7IA 1FJXA 3MYYA 5ALXA 4HTFB 1PT6A 2XVYA 4R6WA 2IL1A 3COSA 4I9HA 2CL7X 4WXPA 2JI4A 2JH8A 4HAXA 4C7OB 1XUOA 2Z6AA 4FM9A 1LA2A 1B0AA 1IEQA 1U5AA 2OORA 1FNSA 1HDYA 1NPDA 1RKUA 2CMHA 2ORYA 1FYEA 1SQ5A 5I8ZA 4AO7A 5ADUS 5CFOA 1JWLA 4DDUA 4RZQA 1SU7A 2VPWA 2ET6A 2RGCA 1AKTA 3RFUA 1KH3A 3ZGNA 4JELA 4X84A 5KREA 1RWQA 4MCAA 4B82A 2C84A 3RBVA 3WL8A 1KAMA 1SA0A 3ZXSA 4KQGA 5CNIA 1VP3A 3OZBA 3IQZA 2ZBUA 2WJJA 3VAZA 3WXMA 4UZFA 3BD9A 4KW7A 5EQJB 1IK4A 3RASA 2ATXA 2QGNA 2EVWX 2FFJA 2FZLA 4RCZA 2GBIA 2F59A 2XADA 1KZHA 4CF6A 3Q7RA 3P2KA 4BVJA 2Q49A 5KOYA 2JFUA 3DXXA 4MW7A 4NDNE 3NHJA 1Z5VA 1MX3A 1IY0A 3T6KA 3BMNA 2E49A 1ZM2A 3C6BA 2PX2A 1K08A 1U81A 5K20A 2OCDA 1ZN7A 1GKKA 2K2QB 1IUPA 4JP8A 5TR9A 4RCYA 2BUBA 4TYMA 4F71A 3BWDD 4D80A 1Z36A 1EFHA 3OE4A 2BONA 3B1ZA 3CBQA 1I2BA 3DYBA 4HUJA 3JQAD 4NRDA 5EWLB 3WIBA 2CFSA 4TKZA 3THRA 1Q7EA 5JD3A 3F3MA 2XSZA 1E4OA 1NT4A 1RQ2A 1T3SA 1Y6RA 3CEPB 4J0DA 4CF4A 5IC4A 5LR6A 1POXA 1AV7A 1Q0HA 2O0HA 3G7NA 2YIMA 4MLPA 3SOZA 1A5SB 4OX9B 2OP1A 3QKRB 3SYMA 1CNFA 2EFHB 1K06A 4TTTS 1U6IA 2QA5A 3NRCA 3ADDA 5E6SB 3OPNA 2G40A 1Q14A 4CV2A 3OE7D 2WFLB 1T4BA 2FPSA 2P5YA 3CNBA 1CY4A 3JYPA 1ZBDA 1DJQA 2OHGA 5HZKA 3I5XA 1CJCA 1GM5A 5JU6A 3CUVA 4RK7A 4WCFA 4JLKA 4AN4A 5EYPA 4ARSA 4DDVA 3QX8A 4NATA 3R1IA 3ZU5A 1ZMRA 3EIUA 3ZE1B 1WO8A 2H9AA 3W8NA 3FGOA 2QE7A 2J09A 3BX1A 1UAYA 3KJFA 3LY7A 4FLFA 1FQJA 3EE6A 4FQ7A 1NBMD 4XEHA 2W0SA 2FPRA 4CV1A 1ZK1A 2P30A 3AJRA 4I1VA 3KOXA 2FV8A 2YHSA 4KVZA 5KYVA 4FMCB 3UJ9A 5AIBA 2BFNA 3BL6A 3L49A 4JBNA 4BY9E 4G2TA 3AHFA 1BX0A 2ZRCA 5AJUA 1MB9A 3EVAA 5HF5A 1Z4JA 1KMNA 2G9UA 2P9FA 1DWOA 2J3DA 4MUAA 2ZUCA 1YZHA 3OE1A 3OZEA 4CDMA 4JKIA 3PFCA 1QHNA 3D8RA 4MVJG 2QN7A 3A9CA 1U7WA 4NK4A 1IB6A 2VHJA 5K4AA 2QTBA 3PVSA 3SXJA 1YMUA 4MB0A 2WDPA 4FWTA 2FUCA 3TNYA 3HV0A 2NQTA 3BJMA 4HVLA 1W9HA 4MGZR 3T5CA 4PBRA 4UOQA 4AM8A 2AZDA 4PE5B 1MGPA 4R05A 4OAQA 1BN7A 5HE8A 3IQHX 4DXAA 3LK6A 1WBJB 1KAGA 2X1MA 1I5OA 3FAKA 3GRPA 1UBCA 2CLSA 3LHKA 2PK3A 1NWCA 3ID6C 4HAYA 5KTNA 3RNOA 3ZI0A 2Q4BA 3OM9A 3WP0A 2EQBA 3WLTA 4DIBA 5JR3A 4HDMB 3EPPA 1N5MA 4I36A 4CODB 2JCXA 4JZYA 3HSKA 4LXUA 4E7OA 4XUEA 4V2UA 3ELDA 4LDPA 2IP4A 3BXFA 3OLWA 3DCIA 1ZJJA 3C1TA 4WASA 4D9MA 3SLGA 2CFCA 5EIWA 5D85A 1TFRA 3REQA 3TLXA 2PU7A 2P2CA 1UPTA 1ZM4A 3GZ4A 4N5LA 5FBVB 3U26A 1TYBE 2VT7A 1YA4A 1PI3A 4GHWA 1JI3A 3RFCA 1VG8A 5EJ5A 1KPIA 1R64A 2WZDA 3LUHA 3F5SA 3OQIA 4MKFA 3U3DA 5JSKA 5IBCA 3EUFA 1RR6A 3A70A 2C2YA 1W46A 4N4AA 3QY0A 4CTJA 3HR7A 2BMEA 5J4HA 5L3VA 1Q1NA 3IKVA 3NUQA 1EZZA 1TLFA 5FPKA 5E7QA 1KDVA 4II7A 4JR1A 4QOFA 3MF4A 4S2EA 1NAIA 3C5WP 4K6KA 3VR3D 1A98A 2ADMA 4OUDB 3W06A 4B8YA 4KWHA 1LWOA 3SZ3A 3TZ6A 5TQJA 2G04A 2EYUA 4GBED 1U63A 5B2ZA 4FMCF 1Z75A 2ZDQA 4YRIA 5IPFA 4M0LA 3ESDA 2O5RA 4OHVA 5SY4A 4ZYUA 2F55A 3O4GA 5C1OA 3BXEA 4EO7A 3NOVA 1IH8A 2VYND 2X5NA 4LDRA 4MEBA 5AKLA 3UXYA 2WTEA 4Z4EA 3VZBA 1J1IA 2AEJA 3E5MA 3IVAA 2XQJA 3WB1A 2RONA 1E1RA 2ACWA 2ZTLA 1FXSA 2XDAA 1YZYA 4IQ0A 4LHVA 1G4AE 3NX4A 1RMTA 3TCKA 1FNCA 3N3BC 4L15A 2QW0X 3WI7A 1VA5A 1OU0A 4REMA 3A9WA 4QUIA 2M6KA 1F8XA 5CJPA 3TZBA 3AETA 3EQ8A 3BXGA 3TBHA 5C53B 3D6AA 1M2VB 2VA8A 3CCBA 3FZYA 3NBYC 1RXVA 3KQVA 4KSCA 1M6HA 1ULHA 4EJSA 4IFTA 1GGJA 1LH0A 3A2MA 1E9VA 3SHVA 1AK1A 1BS1A 5ILGA 1SU6A 2XWBF 3G2KA 1FFXB 4ERXA 4HNQA 2VBGA 1J06A 3NHSA 3MS2A 4P34A 2NU8B 5I6DA 3TBFA 1R8JA 4RDCA 3ZGVA 4RKWA 4BWVA 2BGNA 3GYBA 2B8JA 4ZCPA 2XMSA 3P27A 3S70A 5E3IA 1PQWA 3M8KA 2QN8A 3B7PA 3IQGX 1N9GA 3EZ2A 3NRBA 4ZFNA 1WKCA 3C8HA 1J5PA 3GGDA 1S7CA 3L46A 1T5OA 3NRJA 5BVGA 5FT9A 1M1UA 1SD1A 3LV8A 1E99A 2JKYA 4KOEC 4IZOA 3HY6A 2LR0A 5L6LB 1JIKA 2J67A 2A58A 4HGYA 2X0DA 4NEHB 1GDHA 2BFDA 3BIOA 3BM5A 2ZUBA 4RJ2A 1AS2A 1N32B 1RTKA 5JAMA 1IBCA 2V7QD 2B82A 3GBVA 3ZBUA 5MN4A 5A2GA 1VLLA 2Z08A 1OHHD 5HKLA 2C03A 2JIMA 3PT5A 4MQFA 1WHTA 1CJMA 2YN2A 1D5CA 1PZMA 1RQGA 2FW8A 3CZ9A 2J85A 3EG9B 3GZNB 3AM1A 3KPWA 1QO0D 4W82A 1IPHA 1Y4AE 3SJCA 3LIIA 3V1LA 3C16C 2NZVG 1HTBA 4PQEA 1ECFA 1HGXA 3QF7A 2X9LA 2Y0PA 3FHTA 3OEHD 2WZBA 3IPXA 4XW2A 1NXWA 1FUEA 2OB2A 3EPRA 3WBKA 5CD1A 1NQXA 2Y1OA 4Q3AA 4AZ0B 2HMAA 1YOVA 3AFGA 3LUJA 1YRAA 4N0DA 3KE8A 4W99A 3VKVA 2OO7A 1IBMB 5ESDA 1WHTB 1MB0A 1YH3A 3AILA 2XI4A 5AKYA 3GVPA 2F3TA 4BB5A 3GP3A 3MD9A 1AXGA 1HE5A 4HWGA 1TOAA 4EJMA 3C7AA 2NXNA 2ONYA 1RPZA 2A5FA 3TDMA 4D8WA 2E4YA 3U3RA 2W8ZA 3WLLA 4OI0A 3TRJA 4ZDWA 4KKVA 1COWD 1JE0A 2P9GA 1VL1A 2W2KB 2Z8YM 3QLJA 4TMTA 1MDFA 3R3YA 2V54A 1R0BA 4ZVLA 3KQMA 3UH0A 2W90A 3DNPA 1KOJA 4MGKR 1L5SA 1NLMA 4OKIA 1HRKA 1OI4A 1SPBS 2XE7A 3GRAA 4RTSA 2I4LA 4R9UC 5JRJA 1JQKA 3RWMB 4UDXX 1X80A 3OZDA 1VPTA 2PZFA 2YJ3A 4N8EA 4UDOA 3U7IA 2BYTA 4HOYA 2P5SA 1TJPB 3AV0B 3IFSA 4LC1A 5DLYA 1XMJA 2WHPB 2CXOA 3Q8WA 3S27A 3EAFA 2P0EA 3BT7A 1F8YA 1FDVA 3E15A 4PLYA 1OWPA 2GEKA 4LYGA 5EP3A 2CHEA 4I1IA 3MTGA 4EGCB 1B7GO 4GL2A 1RW4A 2QI9F 3F5FA 3G8AA 6GPBA 4TLAA 3GDWA 5I9IA 3VHQA 5LWHA 3P7MA 1H2XA 1Y82A 1Z7WA 4H16A 1BMDA 3F6RA 3YASA 1T43A 4N3NA 4UARA 1T5TA 3OAAD 1KSGA 3OQMA 5KB3A 1BE6A 4C0LA 4LK2A 2X7JA 3RUCA 2HIMA 3KYBA 4MKXA 4NCXA 5LFAA 1QRSA 1U0HC 4IO1A 2HD4A 1P2SA 2B98A 4GRDA 4WECA 3REFA 4YRPA 3K16A 5CPFA 3FOBA 1PNOA 2FZ4A 2LZ0A 5F2NA 3MG9A 1YFJA 3AL2A 2HJHA 3JATB 1CQPA 3SYTA 4CGYA 1EVQA 2H3HA 3T34A 3T9CA 3IUJA 3EIHA 4GMFA 4LOJA 4D6YA 2BR3A 4G24A 4W9MC 4JFRA 4MK4A 3RYIA 5D00A 4XUDA 1C1HA 2Q8PA 1MO6A 1T6BY 4LJSA 3LD9A 2HRCA 1O94D 2A5DA 3SX2A 4RIHA 1HH4A 3SVLA 3QH4A 1N6RA 4A73A 1N2CB 1Z5GA 4MINA 3NT2A 2V0CA 4INOA 2YJTD 2ZG6A 3ZH2A 1CUEA 5DTIA 1MORA 4V3CA 4Z9XA 4AWAA 2JA2A 5KVSA 2VYCA 3IURA 4JYCA 1YJCA 2W6MA 1WDWB 4JUIA 2VRCA 3GW8A 1X15A 3O94A 4FE4A 3FSRA 4XWYA 4PYNA 4YJFA 5A9TA 5LZ2A 1JIUA 5FOXA 2XXAA 1JDSA 2CLIB 4LGYA 3KUXA 4XQEA 3LQFA 1SCJA 5EZYF 4BFSA 2F9FA 4O2LA 3VGJA 1XSEA 4HL6A 2AXQA 4GOLD 1H3EA 1A7UA 2ILTA 3CSUA 4RCVA 2JGLA 2DP4E 3I4LA 1Y9DA 1JMVA 3IBFA 4GSKA 4X7MA 4WIAA 3DXYA 4B17A 3FWKA 2RH4A 1J2EA 2XD4A 1JSCA 4JITA 4K3VA 4JT4A 2GUWA 3RC7A 4JL6A 4MP8A 3SFVA 3W2IA 2O2IA 4P80A 1NFFA 5KNBD 1GYRA 1ZA1A 1OT5A 1SU8A 1NHGA 4R8RA 2ZAGA 1QLJA 4Z4GA 2LNDA 4ZCRA 2AOUA 1Z6XA 2NVWA 4EHFA 1BKSB 4H3SA 4EG6A 3AVYA 2QRLA 1M1NA 2L0XA 3E1KA 2O2GA 2OY0A 4L3OA 1CY2A 4RBNA 5BQ5A 3TI7A 4I6JA 1DFIA 3DDWA 3QXHA 1OYVA 4HB3A 3CVVA 1S2OA 2YOGA 4OLJA 1GD1O 1NW6A 4LV5B 4MJXA 2PBFA 4TMZA 2WM2A 2ZB3A 5FUVA 4BN0A 1TJ5A 5SZIA 4GPZA 1X8LA 1YUNA 4G67A 4DJFC 3TZQA 4YCCA 5I7VA 4LJ9A 1JEDA 1PSWA 1S2GA 2EEZA 2ZIAA 3NHLA 1DKOA 2FWBA 1KMCA 3P2OA 2C8KA 1Z6GA 2HA7A 2IK8A 3SYKA 2ZRJA 2C5LA 3LLCA 2V3CC 1ST3A 4U9HS 2W8BB 4KRYA 4F4JA 1Z08A 4E2YA 2GFQA 2BDTA 2H7YA 1QQBA 3NJ4A 4A9AA 1Q2UA 2BGKA 4JEUA 4NMWA 4WZAE 1PYOA 1X2EA 3MM4A 5HIIA 3H5IA 4PS0A 2DLCX 1VPDA 1W6UA 3I5AA 4RL4A 2O8EA 4OQ4A 3A9SA 1IY9A 1Y81A 1ZN8A 2WKSA 4OA8A 4YRCA 5DOVA 5KNDH 2XCQA 4P3XA 3VPCA 3IDZA 3OJXA 5CCDA 3NALA 3DPSA 2V6JA 1BCRB 2QTTA 3C3JA 1I30A 2CLCX 3H6KA 3P0RA 3ZI7A 5JNWA 4WSOA 1ZCZA 2OQIA 1SAYA 1XL1A 1AKRA 1RZUA 1JG7A 1SM4A 2HMVA 3H9UA 3D2BA 3NJ8A 4FJ0A 4WXRA 5CX1A 5DNVA 4HWRA 4IEIA 2E85A 3U7QB 3ZWKA 1KH2A 1R74A 2CLHB 2O8DB 5DRTA 3PRHA 1Z3IX 5FBWB 4Y2VA 4FYPA 5FFFA 3ROMA 3HVJA 2Q3MA 1ZNQO 4M76B 3RV4A 3OQVA 3TQQA 4B8WA 2YYYA 3AM4A 4M38A 3GLQA 2WFZA 1T8RA 1A8UA 1LLFA 3GROA 1AOXA 4RTQA 3PVCA 4IG4A 3EQ6A 2OYCA 4NXMB 2AXEA 1KK2A 3T7CA 2XQGA 4A10A 3WLFA 4M46A 2N9UA 2P78A 3CXRA 1T5IA 2ORIA 2FSVC 4GM1A 4U7TB 5EHIA 4Q15A 4Z6KA 4N0PA 1Z2DA 3BQ9A 3TVDA 2HSWA 4CIDA 3QEBZ 5HIAA 1YWGO 2ODBA 4DSOA 3U1BA 4PLTA 5LZ9A 1LBHA 3IOEA 3EXHA 1BZYA 3WNVA 4CMHA 5JBQA 3W5UA 1MX9A 4YXWD 4LNUA 3V9AA 3WNCA 1EESA 3AYXB 4E88A 1AE1A 2J1LA 1MC4A 4FNMA 4EQ6B 2IPMA 1LDGA 1I0ZA 3SR4A 5L95A 2I9PA 2O6LA 3T4EA 2HB6A 1Q92A 5J40A 3A10A 1RRFA 2VDRB 1EE9A 1SUBA 3P26A 3WV4A 3KC2A 1DDIA 1FDWA 2GGSA 4RL6A 2BF4A 1EWYA 3SC6A 1WZ2A 4FT4A 3GUUA 2UYYA 1NBEA 3R7DA 4D43A 1LFAA 5FBQB 1MJGA 5JSZB 3K3PA 4COOA 2ZW9A 1P19A 5DCYA 1HDCA 1KYYA 4LOIA 5EE3A 5CA1A 1OAOA 2XTAA 3BGVA 4KFSA 4MLZA 3O84A 3OZTA 3CX4A 4G01B 2OCXA 2FZWA 3S28A 4I4TA 1MEOA 3M9WA 1DDGA 3OP4A 4ND5A 1N6IA 4R7TA 1XQ9A 3UW1A 1AXRA 1T13A 4TV9B 5ER6A 2EL7A 3PPVA 5BUCA 2XBUA 1S8OA 4L0MA 2FSVA 5JVDB 4FHZA 1N6KA 1GL7A 4BNNA 1A7JA 2O8BB 2RAFA 4OXQA 1DC3A 5IAEA 1IPEA 4L0QA 3LXRA 1MO3A 2GMWA 1UC5B 3A1CA 2ODEA 4IZIA 5EZ5A 4U9IS 5G41A 3DZGA 4YGXB 2WF8A 4B3HA 2O1XA 3QX3A 2YZKA 3MJSA 4PC7A 1JSLA 3I39X 4YJHB 1RLTA 1WZUA 3E3AA 1QE0A 2FYTA 3FNGA 3NCTA 1G8GA 4YJ2F 5E6SA 4RKYA 5IKEA 2G0TA 5JRZA 1IBSA 1VI5A 2Z09A 10MHA 2EFDB 1D4AA 5DTQA 2EHDA 5CNKA 4J7CA 4RPHA 4TV9A 1FK8A 1IN1A 4MP6A 4E31A 2CE7A 5DWQA 5IAGA 4DRXB 5AI8A 4YPVA 2AC2A 3DAOA 3AKZA 1L5OA 1REQA 1TJNA 2CBGA 2GO7A 5C34B 2HMSA 4ZV4A 2Q5CA 3PPXA 3TIFA 1Z16A 2EQAA 5LP6F 1YJAA 3MPUA 3TX2A 3BWVA 3KIPA 4NCNA 4Y9DA 4JWKA 4UXIA 5CB8A 3LW7A 3W1WA 4WFQA 4DR2B 4JJZA 1P17A 2YXPX 2ZPTX 3OTOB 4CLDA 1AG9A 2ZJBA 1P29A 3EWSA 3DOCA 3I92A 4JJ4A 1R18A 4DNXA 1HSOA 2CD7A 3VYUB 4ESHA 2NUPB 4EW1A 1BKDR 2X1HA 2VPYA 4B3FX 4CUZA 1FLVA 2WV9A 3KTAB 1NF9A 1A71A 5EFOA 2A30A 2XEXA 1NQ5A 3CRNA 4R41A 4CG0A 4PNZA 5JTTA 1XL0A 1KNXA 3DV9A 1P1FA 1O5TA 1OH6A 4NVRA 4NL4H 5E2BA 2E37A 5HHTA 2ROQA 4FUQA 3Q9LA 1C4XA 4A1OA 5DE3A 1P7WA 1XAGA 4JQSA 5AVRA 1DU4A 2G6BA 4X8MA 4YC7A 1QXSA 2PRSA 3B6JA 3CO0S 3NHMA 4N3AA 4MQ4A 5FD8A 4BQOA 3FUCA 4EP1A 3U7RA 3CS3A 4PLPA 4B73A 1JQDA 1RRPA 4P0TA 2IIBA 3OMWA 4UZEA 2CF6A 1Z74A 4WLNA 3TLGB 3VYSB 3CW8X 5CVEA 4EPVA 1UAAA 4PLGA 4RFSB 2JDIA 3R4VA 4Y3UA 2BBTA 2I3BA 3UJBA 1ZVQA 9ATCA 4RS4A 5EA2A 1SXPA 2VTDA 3CTMA 1CQJA 3IQEA 2I3DA 4JMLA 4UHJA 1Z0JA 3OI7A 4KVFA 3PL1A 3V6MA 2OYRA 3IXLA 4E70A 1ETHA 5KTYA 3KX2A 2EBHX 4CM9D 1DEKA 2FVYA 1KHTA 5FP0A 3P52A 1QTRA 1VSTA 2HDNB 5BWNA 4RYDA 2WD7A 5I3ZA 1PZEA 3JAKB 2RI0A 3LNCA 4LRXA 3MRXA 2Y8EA 5AI9A 4DUPA 2G1AA 2V0NA 3HCAA 2BHNA 5ALPA 3PEYA 3QEKA 3BTUA 5KI6A 4FNOA 5EE9A 3GJZA 4DTCA 1F2VA 2Z5FA 4MR8A 2J4DA 4IDUB 4I6GA 4K6MA 3UK7A 4XD7A 1ILWA 3EEBA 4AZTA 4KODA 1QIDA 3M0EA 2YIJA 4BKUA 3O31A 5IWCA 1W36D 3I6QA 4X85A 1Y1QA 1M76A 1ZXBA 3GA5A 1WPRA 3U49A 3EAQA 5CEJA 4R1QA 4YPOA 3UMYA 3RVBA 4RW0A 1MC1A 4ENQA 2QP3A 3PUKA 4YV7A 2VK2A 2OV2A 4ZZ1A 3NETA 2DTEA 3T99A 5C2JB 2RDMA 3K32A 1XLWA 4PX9A 1KDOA 4V0RA 4ZICA 3B6KA 5I9BA 4EZIA 4IJSA 3KLNA 2DF8A 3DEZA 3RJMA 4U2CA 3VO8A 5BN5A 5I7RA 4N3GA 4MI6A 4EABA 2I0FA 2FDCA 2F62A 4RVUA 1ABFA 1E9CA 1JZQA 1U2DA 1QB7A 2XIQA 3HUDA 5DGTA 1GG2A 1JB9A 3VSCA 4EY6A 2A4KA 1B8UA 2BHLA 2OCKA 5E1BA 4ZK2A 4DDWA 3GEGA 2A9FA 1XJQA 2A1UA 1O95C 2WHRA 3F47A 5EZ6B 4E2FA 4A15A 3OX3A 2I2WA 3TIIA 2Q28A 5KOJA 1J9EA 2EJUA 2YUTA 2C20A 4J03A 1Z62A 1WJGA 1TM3E 1ISHA 2FWMX 3OT5A 3WS7A 1QE3A 1WG8A 2XMCA 3LAWA 5EJIA 3DE0X 3TX6A 1PCXA 1EGAA 4P0QB 3Q1KA 3WB2A 4I4LA 2IHUA 1RSZA 4O4LA 3SZUA 3W8DA 4TTVA 1X1EA 2QSYA 1XMQB 4CIYA 1GLNA 4GRAA 4Y6LA 4JV5B 4GEKA 4NK5A 4AUMA 5JWHA 1UKCA 1VJRA 5ALNA 4B2YA 3EWIA 3I2IA 5EXPA 5I4BA 1MIOA 4OJTA 3SY8A 5ANRB 2PSHA 5DHQA 4A92A 1T5BA 3DVLA 3PCXA 4NH0A 2FY8A 3QPAA 5DTEA 2BKLA 1H9CA 4YHHB 5B3AA 3CEHA 1ZU4A 4Q4HB 1XEAA 4RQUA 3P97A 2AMFA 4R5MA 2BI8A 4PFQA 3K1YA 4TT8A 1B0PA 1IRXA 3ULKA 2F1OA 1CSEE 1EQAA 3EIQA 1GQYA 3RLFA 4AJPA 5JCOA 2YINC 3WMEA 3UIEA 3V3KA 4MW5A 2B2CA 4UEJA 3EA5A 4R0MA 3H97A 4ZT5A 4Q1DA 2VF7A 5HJ5A 2VHQA 5F2EA 1M74A 1W1IA 4Q66C 2D8AA 3CGWA 1M2HA 4RMHA 4ML3A 2GKOA 1UMCA 1NNUA 4U7GA 1YO6A 4K9PA 1JHQA 4LMPA 1BH2A 2GF0A 2ODNA 1Z39A 1GPUA 3NNNA 5KTTA 4KWCA 5FPPA 3LUAA 1R8XA 1MOPA 5H9VA 3RHTA 1KC1A 4DYDA 4BXOA 4AJ9A 4IGAA 1F3OA 4U02A 1KYXA 4ZMRA 4D4HA 1YI8A 4X6YA 2VHVA 4J07A 3TLBA 2DECA 4ED9A 1G0OA 4ENUA 4M6WB 2FPGA 4ARAA 1OHHA 3V1MA 1SD5A 4HQLA 4HYQA 4ES6A 2PLFA 2VWGA 3OE7A 4FD3A 2XB6A 1N2HA 3SM3A 4BVFA 4AQYB 2AC4A 3RVMA 2HL6A 2QI9C 1L5QA 4G0OA 4RSHA 5DV9A 2MINA 1S9HA 3TAHA 3OQIB 4RNDB 4A1FA 5A9RA 4MWOA 3H5TA 3GA0A 1Y4SA 4AROA 4ZEXA 2VRBA 1TF5A 3K9CA 2A5LA 1F6BA 3TVYA 1AHPA 5CYOA 3WGHA 3WQSB 3LVFO 4M88A 1FEZA 2QN1A 4MKRA 1YB4A 3ZNOA 1ZIOA 3IOMA 4IHJA 1H2HA 4DMLA 2K2WA 3WGVA 2IYVA 2JVKA 4QNNA 1AO0A 2GETA 3OX1A 3KPYA 1AK2A 1FU4A 2ZYWX 3LT1A 3ZU2A 4LBVA 1XZAA 3TEJA 1GCIA 3PQ8A 3UT0A 2OXFA 3LF2A 1GAJA 1OXBB 3DTVB 3MT7A 2SCUB 5GJCA 1PWXA 2QZ4A 4OYHA 3U56A 3B1KA 1P45A 4X65B 4I2NA 4RHXA 4BRUA 4NZZA 5JNUA 4WHMA 1WZIA 2Q4TA 4OHCA 5HTKA 4AJEA 5B3JC 1SUDA 2IUFA 1E6CA 2JGKA 4M53A 2OG2A 4OJQA 3C41J 2Q6IA 1TUBB 2YNMC 3A4MA 3RM3A 2RG7A 2O7VA 2Z8YA 3GFQA 1Q1BA 1W49A 1DC7A 3HWX1 4TXNA 4DE5A 1G41A 3F90A 4Q1AA 5I4CA 1HLGA 4DABA 4E12A 2X4DA 3GUYA 1S1CA 3MMPA 2OVFA 4MUGA 4WADA 2D4HA 5MF6A 4TKLA 2DT8A 3TDNA 2WUDA 3QVVA 4K9SA 4AULA 4G4SO 1PR9A 1UF9A 1ACJA 1XYGA 3FHOA 3KYCB 1QFXA 2D00A 1KDTA 2VJMA 3OCYA 1FFWA 1N6LA 3GNQA 3GO4A 3ZV5A 5L4SA 2P68A 3U3MA 1OOEA 5KJ1A 5F7ZA 5TQ2A 1EKXA 4CLOB 1HTTA 1A4IA 2PZKA 3ZK9A 3CLRC 4LRTB 1C8KA 3ETGA 4IIVA 4V24A 2J9YB 1D2GA 2H1CA 3IDFA 1U80A 2ZJ8A 4QBTA 5CRIA 3QKRA 3O4RA 3PDWA 4UOEA 5A4FS 1TZKA 4EB8A 4R1TA 4YJKA 3CLTD 4NCAA 4CU5A 2FR1A 2OV8A 1KO1A 3D6UA 3P0FA 4LNHA 1ZGHA 2H6EA 1K86A 5E4FA 2Q9BA 3HKDA 4B3TB 5B1EA 2HSEA 4B33A 3TSOA 4F2GA 4OGGA 1E5QA 2DUNA 3W78A 3TZHA 3WAKA 2ZAIA 3WLHA 4LYFA 2MSCB 3RR2A 1ICIA 1GITA 1LTKA 4BS9A 3RBAA 1ZINA 2YMLA 4P7FA 5JSZA 2VNKA 4XQ9A 3N2KA 1NTRA 4FC7A 5FXMA 3AZPA 3A9VA 3PPWA 3RVLA 3ETEA 1G7TA 3OPYB 1G1AA 3N8DA 3QJGA 3BYZA 2W9XA 3RK4A 2DKNA 3TW8A 2WSYB 3THYB 1D1PA 3LVBA 1RYBA 2GAIA 1FXUA 1HDOA 3FUVA 3MAGA 4RAQA 2AXPA 1JNXX 4GOJA 1M34A 2XXAB 3NVKI 2VDVE 1EWVA 1M8KA 4EW2A 4BQFA 1ADJA 2GK3A 1G3UA 3GOQA 2IZZA 1L8QA 5A3SA 4LYYA 1CKEA 3NIWA 5B55A 1EPUA 1JIIA 5ICMA 1R15A 2OOSA 1N5JA 3I73A 5IM4A 1XEFA 2D5LA 5C3UA 1T3TA 1YI1A 5CB4F 1BMFD 4MS4A 1KSHA 3SEAA 1V9LA 3URMA 4D4KA 3K0CA 4F4FA 1A7KA 1OT3A 1W29A 2X77A 2MINB 2AG8A 4WLOA 3RRBA 1H3FA 3HP4A 3EQ2A 3QHAA 1IB0A 3IJPA 4PNPA 5IEBA 5FOQA 3EPJA 4Z0TA 3VPGA 3ABSB 3S55A 3GK3A 2NSDA 1U3VA 1ZG3A 2AEFA 5K8VA 5K9ZA 4BV8A 4MUIA 4QFBA 4IOMA 1PU2A 3OUZA 2R6JA 1I2AA 2QAIA 3L06A 4MRVA 1WVMA 4B3SB 3IP8A 1W48A 3WQHA 1ZS9A 1T1JA 4DJTA 5BT8A 2V59A 3MJRA 5C4MA 2CE2X 1U6JA 2UUPA 3G9QA 2MTBA 3SFTA 2XCIA 4BL5A 4DQKA 5CG2A 1BRTA 2QWXA 2QRHA 2Z3WA 1UMKA 4AY2A 3BB1A 3B8EA 4ZQBA 3FFBA 1XJ5A 4I5DA 4NMHA 1SOMA 4Y1GA 1LPMA 1O58A 4M0FA 4Y0VA 3ORHA 1U3DA 5BOSA 4M7WA 4E2WA 4MV1A 1O87A 2SKEA 3FRJA 4IILA 4OHXA 3T0FA 3EVBA 3Q7EA 2CJWB 2F1KA 3WKCA 2H0AA 3NP9A 2C4VA 2G9QA 4YRJA 2GT1A 1X80B 3QVWA 4PHCA 3QG5A 1N2IA 5DYGA 4ZCSA 1WE2A 2PDAA 2CLLB 3K6KA 3DPUA 4ZGBA 4KNWA 2Y77A 1VL6A 3DULA 2DUUA 1LI7A 3D8BA 3FOWA 4FJ2A 3X1KA 4DG5A 1NKSA 5IF9A 5HM6A 2EYQA 4TMVA 4NBNA 5DN9A 5TGTA 3TNFA 4KLRA 1NGSA 3C5VA 4KQ1A 2WJGA 2ID7A 4DAOA 4HZUA 2ETXA 4RD0A 3NEAA 1HWYA 5EP1A 4GLOA 1JXQA 3W1EA 4EAQA 4G1VA 1WCXA 3BXOA 1WB9A 4TMXA 4WLEA 1JFTA 1OZHA 3HFJA 1JR3E 3FYUA 4HQRA 3WMWA 3WTBA 1L8XA 3ZDEA 4ZOAA 4W5RA 1DXYA 2E5FA 3CA8A 1NJ5A 3ZY5A 1ZVMA 4LMAA 4NQRA 2OHIA 3X1WA 5GONA 3IP7A 2J9FA 1RI4A 3IVGA 1XJWA 3WP1B 5LA6B 2B9EA 3FLMA 2XOXA 2JFGA 4RIEA 5AIAA 3WHKA 2PV0A 2H06A 3R5KA 3MS4A 2AFVA 3I8XA 5F51A 4ZVNA 2QLLA 4YT4A 3FCAA 1QJ4A 1ZHOA 3CX3A 2O4UX 1CZHA 1E58A 1U11A 3OFKA 2V8BA 3HXPA 2HMWA 2JGDB 2Z04A 1A97A 5EXEA 3T95A 4UFNA 1ID1A 8LDHA 1PQUA 5FWYA 3TW8B 4OREX 3INTA 2AQHA 3LBHA 3TTTA 3GG9A 2I91A 3U09A 3HDHA 4GO1A 5CH3A 2I71A 4YHBA 4ID9A 2BBWA 3JZAA 2ZI5A 1SUAA 1ZUNB 5K3FA 2YWHA 4WKPA 4FDUA 1QQ5A 1ESCA 3B20A 3KR2A 1CRQA 3IR7A 3DE6X 1J9GA 3STWA 3EPLA 2RC5A 2A9PA 4CEIA 2A7XA 4GNRA 3AHHA 4Z0NA 1GU0A 4GMXA 4IDBA 1G8FA 3WK6A 1NQWA 1YRLA 3CM0A 1A7AA 5GWXA 3UHPA 2W43A 3EIWA 3IE2A 4JBGA 4MVJA 1F1JA 3BH6A 1CQIB 3I1YA 4O63O 3UC9A 1UK7A 1MOQA 1E62A 1WHSA 3OU7A 3QLEA 4BVAA 3IUPA 1B15A 2O5EA 4C1BA 5LYJF 3B3FA 1SBCA 3KVNA 4JUDX 4DANA 3GLIA 2O2EA 1JR3D 3LIPA 2PL1A 5ALFA 3VV2A 1FDUA 4TKUA 3GGPA 2C2ZA 2PUEA 4H7EA 1KARA 1S8FA 1KAOA 4NONA 2JFNA 3OKCA 1G60A 4ZDIA 5BSUA 1LDYA 3HB7A 1EJBA 2ZRNA 5F1KA 4Q03A 2JRCA 3HL4A 5AO9A 4FI3F 3UMRA 3VR5D 3TL6A 3HXTA 2COEA 3BMOB 3QVSA 4N82A 2OFPA 3DKIA 3EZ6A 3IMFA 2ZRMA 4UEOA 4V0QA 3F5QA 4I3GA 1FFSA 4JODA 2IVZA 3I12A 5EHZA 1F12A 1E77A 2OOKA 3HUTA 4ND6A 1P91A 4RETA 2DTDA 1O0SA 3DEAA 5AQ1A 4HZIA 5FUYA 2QMQA 1JTFA 2WZQA 3GP5A 3K0FA 1S9DA 1TGVA 2RH5A 1IWPB 5DEOA 1TKAA 3ZDQA 4RDIA 2XF8A 1H6CA 2O3TA 4K0KB 3G3EA 3ZPXA 5D5HA 2JJMA 2DUJA 2COUA 3MXOA 2HK7A 4R3UC 3OF3A 1O94C 2B20A 5C5IA 3DZ8A 4NESA 3RVQA 1X7XB 1U31A 3G9TA 3VU1A 3F6PA 3HHEA 3P1JA 5IVHA 2HF7A 5EQTA 1EQ2A 1BHSA 4O8CA 1AQLA 4FLEA 4P32A 1GQRA 5C35A 4IFBA 5MGBA 3TXAA 5JADA 3E61A 3DS8A 3UV6A 2FX2A 1VCMA 2JLUA 1HQCA 4HDSB 5GINE 2A35A 5PNTA 4EFKA 2ZSUA 5GOTA 3MCTA 1SXJA 3N75A 2FN9A 2LE0A 1W2WB 1W8DA 3R76A 3SHFA 3LF1A 1BEEA 1DBVO 4XARA 1QIIA 1R1DA 4DLKA 2O0LA 4QPDA 3IE1A 3JQ9A 3ZU3A 3HBJA 3S99A 2HQRA 1NM5A 1P1KA 1RRKA 3IEUA 3ESCA 1Y5MA 3PXEA 4L73A 1G17A 1VKJA 1ZISA 4L85A 4U8HA 4IH4A 3LGAA 1EVYA 4CDNA 1GAQA 2SKDA 4RANA 2J9XB 2IX3A 1Z5PA 3H83A 5G1NA 1POWA 3C7TA 3AM5A 3T9DA 1QE5A 3QJYA 4B7UA 3AOEC 5LQUA 1YD7A 1QAMA 4MS3B 2PEZA 1IAQA 4K9DA 1PRYA 4CKWA 4HX5A 5FWAA 1TTQB 4MEJA 3L0BA 3FBTA 1V3VA 2XE8A 1CV2A 2BMAA 1U8TA 4PXYA 1BCSB 3LCJA 5THXA 3UAOA 4QXRA 2VK8A 3BK2A 3E03A 5IDWA 3WY9A 3O83A 1H8ED 1AQUA 4MLCA 5DT2A 4NPCA 2XCRB 2HFJA 1IHYA 2BELA 4OP1A 3RRNA 2F1IA 3S6JA 2R8BA 3DBOB 3E58A 3RWBA 5JYCA 2Z0MA 2VUSA 1XN4A 3QVOA 1O2DA 1OR8A 1XTZA 5I7SA 1N9ZA 1T5DX 2CDRA 2IYQA 4EECA 1I7DA 3VNAA 3R5SA 2QBYB 1RXSA 1XZHA 3N2IA 4MWEA 3BRWD 4OQNA 1J0CA 4W6QA 1QP8A 3EXHC 4ZANA 5MN6A 4XOIA 2PNFA 3WYDA 5M34A 1RHRA 3R0VA 3R0XA 1MT3A 3UAZA 3LA8A 4F38A 1DRKA 5BPHA 1GNTA 3L0SA 3SJ7A 4LRWA 4WN9A 2FPXA 5KSOA 1P0FA 2W11A 3L93A 1NQAO 1MIHA 4UHDA 3ZGZA 1NMXA 4M0EA 5ALQA 2E55A 5AJXA 2BCGY 5AOAA 2OV1A 4HATA 5CBKA 2W2NA 4PXAA 4EY7A 1CZOA 4B3XA 1JLSA 2IBMA 3WQBA 3L1UA 1U4NA 1OE0A 3ITEA 1WNTA 2L42A 1NXVA 4ZP1A 4JR2A 3F71A 5G3ZA