1KC1A

Crystal structure of dtdp-6-deoxy-l-lyxo-4-hexulose reductase (rmld) in complex with nadph
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
298
structure length
298
Chain Sequence
MNILLFGKTGQVGWELQRSLAPVGNLIALDVHSKEFCGDFSNPKGVAETVRKLRPDVIVNAAAHTAVDKAESEPELAQLLNATSVEAIAKAANETGAWVVHYSTDYVFPGTGDIPWQETDATSPLNVYGKTKLAGEKALQDNCPKHLIFRTSWVYAGKGNNFAKTMLRLAKERQTLSVINDQYGAPTGAELLADCTAHAIRVALNKPEVAGLYHLVAGGTTTWHDYAALVFDEARKAGITLALTELNAVPTSAYPTPASRPGNSRLNTEKFQRNFDLILPQWELGVKRMLTEMFTTTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords dTDP-glucose oxidoreductase
publication title Variation on a theme of SDR. dTDP-6-deoxy-L- lyxo-4-hexulose reductase (RmlD) shows a new Mg2+-dependent dimerization mode.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Oxidoreductase
total genus 98
structure length 298
sequence length 298
ec nomenclature ec 1.1.1.133: dTDP-4-dehydrorhamnose reductase.
pdb deposition date 2001-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04321 RmlD_sub_bind RmlD substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1kc1A01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1kc1A02
3VPGA 1VC2A 3PHHA 4OAQA 1LDNA 4IUYA 3I5MA 3UUWA 5KVQA 1UDBA 2P5YA 4R3NA 2PA3A 5I7VA 3K6JA 2IZ0A 5CEEA 5IG2A 2GN6A 2NU6A 1KVTA 1SNYA 4BNFA 1U8FO 1UP7A 1UXJA 4GMGA 4PG7A 4E5KA 4YR9A 5A9SB 2WYVA 4O59O 1JVSA 1Y8RB 3TZHA 1ZNQO 1X7HA 3R6DA 4BL5A 6ADHA 3GVIA 4DBVO 1PQPA 3O8QA 5T8KA 4CMKA 3PWKA 1ENYA 3W6ZA 3KSZO 4K9DA 1VM6A 2NQTA 2XF8A 4JJFA 2W4QA 1R4MA 4BGIA 4PVCA 1A4UA 5U1PA 3P2OA 4OXKA 2X4GA 3UICA 3HDQA 5CHEA 2G82A 1BVUA 1OI7A 4NMHA 2WE7A 2VRCD 3ST7A 5JNLA 3IUPA 1KBZA 1HLPA 2B36A 3BMNA 1HT0A 3G1UA 3RJ5A 1ORRA 5T64A 3UKOA 3M6IA 5L40A 1GADO 3WWYA 2LDBA 1E5LA 1EVYA 1PU2A 3FNFA 3JQ7B 4BGVA 3RU7A 3TZKA 3SXPA 1NWHA 4BMNA 2J5RA 1IY8A 2I66A 1A5ZA 4QO7A 2AQIA 2VCYA 4YXFA 1DO8A 1WLYA 3VPXA 2BRUA 4PG8A 4JBGA 4XR4A 1N1GA 4BO6A 5IZ4A 2Z95A 1KVRA 4NK4A 5KJ1A 3MJEA 3JQ9C 2GZ1A 3OHSX 4D43A 5LC1A 1M67A 1NVTA 2UV8A 4PVDA 4E2ZA 3WQRA 3RASA 1ZJYA 4BQPA 2CF5A 3RVDA 2FSSA 2Y68A 2HO5A 4Z0HO 3ETGA 1T4BA 1P3DA 3T7EA 4GX0A 5L7YA 1V9LA 4ZQHA 5AXAA 4K6CA 2FPIA 1AN9A 1YL6A 4IJKA 1XWFA 2DPHA 3GEGA 3HFSA 4WEQA 2DM6A 3BHMA 3H9EO 4ALKA 5L9AA 4KZPA 3KVOA 3GC6A 4DC1A 2PNFA 3QVWA 3ZW8A 3WOHA 4EI2A 4WECA 2ZJ1A 1B26A 3ZV3A 1E1KA 3TQHA 5B4TA 3M1AA 1IZ0A 2HAEA 4XRRA 1JN0A 2Z5LA 4NK5A 5DP2A 1HYEA 1TA4A 5JSFA 4GQAA 1DC4A 2IZ1A 3PTZA 4R4JA 2FR1A 2ZYGA 1T2EA 3NGXA 3LT2A 1NVMB 3BMCA 2V6GA 4E5YA 1H0KA 3GZNA 3JQBC 3MOIA 1NASA 2BGKA 3EW7A 2JL1A 3OICA 4D3SA 3JV7A 2EJWA 4L4XA 2ZTVA 2O3UA 1WMBA 4BNUA 3HHPA 2YV3A 3OQ1A 4ZJUA 3L6DA 4PG6A 3K73O 1H6BA 1NAHA 3KLPX 1ZCJA 2GD1O 4O6VA 4LCEA 1GR0A 3JD1A 4LMRA 3ZHXA 2P4QA 4BNZA 3KM0A 4RO0A 4E12A 3ZHZA 2P68A 4EJ0A 2B83A 4IDGA 9LDBA 1P45A 1QMGA 4ID9A 4GWGA 1YJQA 2HK7A 3WSVA 5KCZA 1F14A 3NYWA 4O63O 4M86A 2ZJ0A 1T24A 1LX6A 3JQAD 2DTEA 5BNFA 2VWGA 4GKBA 2JCVA 3HWRA 4EW6A 3FBGA 3MTGA 4I08A 4EITA 3EVTA 5B4UA 2HRZA 4RGBA 2GZ2A 4E5NA 3WJ7A 5ILOA 3PQDA 4NFHA 1IUKA 3AM4A 3U62A 5TC4A 4MPDA 1MV8A 3BIOA 4P8RA 2OORA 3R3SA 3WGYA 1T4DA 3BMNB 5IXSA 3F6YA 2YV2A 1WW8A 4U6QA 2CDAA 4MVJE 1V8BA 1YKFA 1YB4A 4GAEA 4LSMA 4OKNA 5G4LA 3WDSA 5CDSA 4JGBA 1GFSA 3EHEA 3HNPA 2X0RA 3QWHA 1EZ4A 2HMUA 3ROKA 3S55A 1TB4A 1XA0A 5KOIA 2FY8A 2RIRA 3LC7O 4DREA 4I5DA 2IXAA 1TVEA 3BMQA 1G6KA 1PWXA 3M2TA 2GSDA 3CINA 2Q2WA 3NT2A 3PI7A 4CQMA 4BO5A 1NQAO 3QVXA 5CDUA 3JQ9A 4RL6A 2AHRA 1U4OA 2D5AA 3QLJA 3N7UA 2Y93A 3IP3A 1YBVA 1UUFA 1Y5MA 1YB1A 5EJ2A 1V6AA 4ZRMA 2E82A 1N92A 2HQ1A 2NWQA 3INTA 1KY4A 3T7CA 5H83A 3L4BC 4PZCA 3WMWA 1H94A 5KJ6A 4NJMB 4M89A 1ZK3A 3UVEA 4MIEA 5TQVA 1AHHA 4GL4A 2HK8A 3MJTA 4KOAA 1XHLA 3ZHBA 2JD0A 4IDEA 3IKVA 2WDZA 3OFSA 3PDUA 5JDCC 4KQXA 2ZCVA 3H5NA 2P9GA 3CZMA 2HRBA 2YUTA 2YFHA 2IE0A 1O0SA 3GR6A 1V3VA 3ZNNA 3JYPA 5ITWA 1UXKA 4ZGWA 2X22A 4DTIA 1QV6A 2CSUA 3JQBA 3COSA 1BXZA 4GSLA 5DULA 4Y98A 3DBHB 3ZWAA 3AI1A 3L77A 2VHVA 4GGOA 4WNCA 2P5UA 3OECA 3X2FA 1QYDA 4OOEA 3BMCB 1GUZA 5JBIA 2VZ9A 3RFTA 2OBYA 1ISMA 2W8ZA 2Y66A 3A1NA 1P74A 3K8ZA 4MOWA 2PY6A 2VNAA 2ZIZA 3PDJA 2X9VA 4FOOA 3OA2A 2PH3A 2FOIA 3I9MA 5KTKA 2VTDA 3LDHA 4XQ9A 2CNBA 3M1LA 3H9QA 2A4KA 4DGSA 3DL2A 2ZTLA 1LDYA 8ADHA 3ZWCA 1LSOA 1ZXLA 3D7LA 5ILGA 1YOVB 2C82A 3VVBA 1PZHA 3WG9A 3AI2A 4RF4A 3K5PA 2I6TA 4E5PA 1O94A 3WWZA 4II2A 5LDHA 4AJEA 1C1DB 4AJIA 2TMGA 3ZDFA 2VQ3A 3PZRA 4BVAA 4ALNA 3GZ4A 4IDCA 3VOSA 1UZMA 4FFPA 2CUKA 3HUDA 4J49A 2JD1A 1CYDA 4FS3A 1U7TA 2FZEA 4XR9A 2IYOA 4YRBA 4NU5A 4J4HA 4AJOA 5B12A 1KVQA 1O89A 3U4DA 5HRUA 5DZSA 1KEWA 2QZZA 1UXGA 1J4AA 3WFJA 3KYDA 4FFMA 4FFRA 4EZBA 3I1JA 5K0ZA 2OMEA 2X0NA 4YJHB 1PIWA 2YQ4A 1ZUD1 4Q3CA 3ZWOA 4DIOA 4A2CA 5FI5A 1TT5A 4R9SA 1A7AA 2RHCA 1R16A 5I9MA 1EQ2A 4FFOA 2NACA 1KEVA 4CR7A 3QP9A 1Q1NA 4Z9YA 3ONEA 1E3WB 1SEVA 3ETDA 3Q0EA 4I5GA 4Z0PA 3TL2A 3WLEA 2BFOA 2B69A 3MJVA 4R1TA 3PLNA 5F3RA 1GV0A 3IKTA 5DOZA 4MO2A 3DTYA 4MVJA 4ROSA 3MCVA 3V2UA 4DIBA 5TS3A 3L4BA 4FFNA 1P1FA 4Z3DA 3QWBA 4BNTA 1IYZA 1DRWA 3MJ4A 1GQ2A 2C5AA 3PEFA 1B8VA 3EUWA 1W0CA 4FOSA 2EP5A 3FI9A 3DB2A 3INGA 1JU9A 1GQYA 4YRDA 2C29D 3HFGA 4Q39A 4HV4A 5JDCA 5JFOA 2AMFA 4TSKA 4ZQEA 1JKIA 3TWOA 2O7QA 4Y67A 3DHEA 4KWIA 4DQVA 4CODB 3DZIA 2A94A 2X5OA 3GNSA 5JAIA 2O50A 4HFMA 2XXBA 3MEQA 2W2LD 4R51A 1P0CA 3JCZA 1P1HA 4H15A 5A3VA 2OUIA 4GLLA 4ZVVA 3O03A 1GEGA 7MDHA 4EEXA 3OJEA 2VYNA 3NDJA 4QTZA 4HXYA 2UAGA 4RLHA 3D3WA 3ZCXA 4CM8A 3A14A 4QFCA 3H6KA 4MIYA 2GZ3A 3T4EA 3HZZA 1AE1A 4FB5A 1P33A 4PGFA 5JY1A 3WGQA 1EUZA 4U0KA 1VSVA 4W6ZA 1T2DA 2NVUA 2GR9A 3DMTC 3IJPA 4KDFA 4QUKA 4HFNA 2Z1NA 4HNHA 3BA1A 3NTRA 3WYEA 4DC0A 3DONA 3AW9A 4FQ8A 4IZIA 5HBRA 1AGNA 1QR6A 1PGNA 3WTCA 3RUHA 3Q2KA 2BD0A 4WASA 4X54A 4OJNA 4JJIA 3KZVA 5GMOA 1PJ3A 2O23A 4DLBA 2IXBA 4YTEA 1DHRA 1MP0A 4B7CA 3WLFA 4B3JA 3HB5X 1ONNA 3FR7A 3W8EA 1MC4A 4BV9A 3AOEC 1DIHA 3D4OA 3BAZA 4DWVA 4XIJA 5MDHA 2EGGA 1P1IA 1KIFA 3KLMX 3PWSA 3H5RA 3RBXA 2DU8A 4XQEA 4BNWA 3WX0A 3PP8A 4E6PA 1N1EA 4J7UA 1PJLA 1KYQA 1Q7BA 3UCXA 2VTEA 3CSDA 1OMOA 1W4ZA 5FEUA 5ADHA 2GF2A 2YY7A 2O3QA 1YE3A 4R1NA 2OL4A 1LLDA 5IJZA 3EAGA 2Y1CA 4FPXA 5KNLA 4UEKA 3PFWO 4XYMA 1YQGA 1DLIA 1T2CA 4RJTA 2GUGA 4CJXA 2YW9A 2EF1A 2WJPA 2YJZA 4OH1A 5BSEA 3FNGA 4PLGA 4HP8A 4R54A 3GPDG 1O95A 1QYCA 3KUXA 3OA0A 1CQIA 4GVLA 5C3MA 3TZ6A 3NEPX 3ICPA 2PD6A 3BHJA 4YBZA 5A9SA 1N7HA 3NTQA 1Y8RA 4GPD1 4M55A 4CM9A 4WK6A 1C0LA 3PHIA 4L73A 2YQ5A 2Q50A 2I5PO 4LN1A 1V3TA 4GX1A 4BHTA 4FGSA 4WLOA 3L6EA 3NDRA 4CM1A 4ZQBA 5EPOA 3H3JA 3MTJA 4YDRA 3ABIA 3HG7A 3E48A 1ISIA 1FDWA 1LQTA 1D7OA 4PLTA 3TZQA 4QT0A 5KWEA 4CMBA 5IN5A 1U4SA 3CTMA 2HMSA 3ITDA 1AHIA 5I7EA 2WM3A 3LF2A 3WGZA 4CQLB 5IF3A 2Y1DA 4WCDA 5ITVA 3RWBA 4JN6B 5H81A 3S1LA 4BO0A 2ET6A 3C7CB 1GUFA 1C0IA 3I9OA 3WGTA 4CPDA 3JQ7A 4CQMD 3TL3A 3VPSA 3IP1A 3PIIA 2R2GA 3ULKA 2VZ8A 3OJ0A 4UVDA 3P19A 1E1MA 5G0SA 5ER9A 4U5QA 1ZZEA 1E7SA 2BELA 4F6LA 3AK4A 1MG0A 2Y05A 3MWDB 4A26A 2WD8A 4CM5A 3QWIA 3H4VA 3DMTA 3IS3A 4FBGA 1NFFA 4XWYA 2VNSA 4LISA 3MZ0A 3SBOA 4BNYA 3FCOA 1O8CA 5DCYA 3PXXA 3ZH2A 3WQQA 1SB8A 1LEHA 2Q4BA 4WKGA 1IE3A 5B4VA 1F06A 3E9QA 2NVUB 4ZQGA 3F4LA 4D45A 1HSZA 3GUCA 4OGWA 4YACA 2VUUA 4GX5A 3VKUA 1J6UA 1ENOA 1KETA 3AWDA 1PJCA 3GQVA 2O48X 3K9QO 4FGWA 4YT2A 1IHYA 3ROQA 2C59A 1H9AA 5TJHA 2AEMA 1NFQA 4BKPA 3VH2A 5JAZA 5KKCA 4MVJI 2O4CA 3CXRA 3ANMA 4D3DA 4BQRA 2OGUA 3AOEA 3VTFA 3F4BA 1EBFA 4CM7A 1N7GA 1GYQA 5IDWA 5I7FA 2Y1FA 5T5QA 3OMLA 1I24A 1QLJA 4MVJG 3WGGA 1AXEA 1LSSA 1LDEA 3OEWA 3W4IA 2Z1MA 3GFBA 5MGBA 2I3AA 3L4SO 4PLFA 4IZHA 4BO8A 2DTDA 1NQTA 1BDMA 3B1FA 3P7MA 4F46A 3ZZNA 2HMWA 1F8GA 5IZCC 4G81A 1GTMA 4LRTB 4XGKA 1UAGA 5JLAA 1JTVA 1E0DA 1DRUA 5EQFA 4JQCA 2BFPA 2BHLA 1E3LA 1Y6JA 4D3FA 2H1SA 5EQDA 4YAGA 4YAJA 2VT2A 4FD3A 2TMDA 5AQ1A 4UULA 3SEFA 3RBZA 3GDFA 4A27A 4RDHA 3IDSA 2EEZA 1P0FA 2HU2A 2H63A 2GASA 3GEMA 3RFVA 4FC6A 4BKOA 3TJRA 5JC1A 2OZPA 3KHUA 1JA9A 3TOZA 2DBRA 3K31A 5A05A 3VH4A 1ISFA 3QSGA 4XEHA 3U49A 1NYTA 5CPBA 1MA0A 4LK3A 1T1RA 4RVGA 4GLOA 4RVDA 5HS6A 1WDMA 4AJJA 1PJQA 3H5AA 1D4FA 1H93A 2AEJA 3SX2A 3FD8A 1GCUA 1I32A 3HN2A 5G0TA 5AXBA 4R69A 3V5NA 1F12A 4A10A 2O7SA 3SC6A 1E1LA 2BI8A 4YJGA 8LDHA 4RPHA 3UW3A 2VN8A 1X1TA 2BH9A 4PLHA 2HJSA 4Q3EA 1DJQA 4UUMA 3SLGA 5ER6A 5TSDA 4FFLA 4ZICA 2FPGA 4A0SA 5CEJA 3GMDA 3D3EA 3DOJA 4L76A 2UUOA 5KVCA 3G17A 2P91A 2Y99A 1YQDA 1QYXA 2ZQYA 1O9BA 4BNGA 1WMAA 5BSGA 4CLEA 3GRKA 4IQ8A 3HN7A 3KEOA 4MVJD 4DMLA 2DUUA 5A4DA 5L95A 1I2BA 5BSHA 3QV1A 3E6AA 4K28A 3VH1A 3TF5A 4HX5A 4JK3A 5F1KA 3EMKA 2WSBA 5BNTA 2EV9A 3AU9A 1L1FA 3V8BA 4XYBA 3E82A 1JW9B 4RVHA 3PQFA 3ANNA 3KEQA 1VRWA 5JAQA 5JMPA 3K96A 1GEEA 2GRAA 1NWCA 1R4NB 4XQGA 4ND4A 2P9CA 1PJSA 1ZMTA 2EJVA 3KTDA 4DIFA 2IEBA 5GZ6A 3ZWXA 4BO9A 3SVTA 1LC3A 1EMDA 1Q7GA 4TZTA 1LLQA 5A02A 1ZFNA 3GVCA 4YJFB 5F5NA 4GH5A 4NJMA 3OJFA 4LGVA 1ZH8A 3UFXA 4ZQFA 1NP3A 1QLHA 1HE5A 2H9IA 1BWSA 1DXYA 1HXHA 3E9NA 1UJMA 3G1TA 5THQA 3WIEA 1M6HA 1Q7CA 4DQXA 1UP6A 1X0VA 4OIMA 3OF2A 4RF3A 3PQEA 4W9NC 3KYBA 4ALMA 4DA9A 2I99A 1V35A 3JQGA 4ONEA 5JO0A 4YQZA 1HLDA 3NDIA 5LCXA 3DAPA 1RM0A 1RM3A 4E4YA 5IZCA 1VE9A 3GHHA 3E8XA 4FDAA 1GZ3A 1LU9A 1F17A 5L51A 1B0AA 1NR1A 3DQPA 1GAEO 1B16A 2D5CA 4XA8A 4YA6A 3WGOA 2PH5A 1EE9A 2DUWA 1EVZA 3DBHA 1N9GB 3GT0A 1QXSA 1XEAA 3DZGA 4IY1A 2QG4A 4ZRNA 3PHJA 4ND5A 4WLUA 5ENVA 3V2HA 3F1LA 4DVJA 3TFOA 2XPCA 3P2YA 4J7CA 2RBEA 4B4WA 1Q0QA 3ZWBA 1QSGA 3AJRA 1GY8A 1V0JA 3Q6IA 1SB9A 5LDGA 4JBIA 3O4RA 3RUDA 4R01A 5JC8A 1M76A 1DBVO 3NT5A 4BNJA 5GZ3A 3Q2IA 3V1UA 1FDSA 1HEUA 4BNVA 3ZGYA 1YOVA 4IINA 3DAFA 1DIBA 4K6FA 2ZB4A 4RVUA 4BO1A 3PWZA 4JJGA 3EY4A 1PJ4A 4KWHA 2E4AA 4O1MA 3B6ZA 4RORA 3LK7A 3HDHA 3MWEB 1NHGA 4KUHA 3RCBA 2CMDA 1JKFA 1C1DA 2WTBA 5TT1A 4Z9FA 4NBWA 2J3JA 1W73A 1P31A 4INAA 4NIMA 3ZN2A 4MP6A 4KUEA 1N5DA 4CLRB 3UXYA 4CV3A 3ZWPA 3I83A 2DT5A 1E3SA 2G1UA 3PVZA 2X6TA 4YJGB 1U7HA 4LCJA 4U0JA 5AOVA 3WYBA 2D59A 3GNTA 1PR3A 3W1VA 5U9CA 1FDUA 4ZD6A 1C1XB 1Z74A 1Q0LA 4N5LA 4R5MA 2QYSA 5KJFA 5TGDA 4XYGA 5JCJA 1FDTA 1HKUA 1VJTA 2JFGA 4BO3A 3C1TA 4YJHA 1X0XA 5C7OO 3M2PA 4ND2A 3OIGA 4CLHA 2OP1A 1Z82A 1AXGA 3F1KA 3AY6A 2X7HA 4CM9D 3QE3A 3GUYA 4GSKA 1Y5RA 3VH3A 3AUAA 1CIVA 3UN1A 4DMMA 2JCXA 3KV3O 1E3WA 1W8DA 4CUJA 1PSDA 3IUSA 4RF5A 1UZNA 2GLXA 4L75A 5A1TA 4IDAA 4OMUA 1U3WA 1MXFA 3DZBA 1BSVA 4AVYA 5CP8A 1M75A 2Q1SA 3H8VA 4QX6A 5F21A 3QWAA 2YFQA 4UUOA 3C7AA 3TSCA 4MVJP 1PS0A 1GZ6A 2O3TA 4CLDA 2YZ7A 4B8ZA 5T6BA 3OIDA 5DT9A 2ZKLA 4D41A 1IULA 4W9NA 4TRRA 3OQBA 2PTGA 2NADA 3PJFA 4NI5A 5C37A 5L4NA 1EK5A 1ZK1A 4J43A 2VYVA 2X8LA 3H7AA 1KEUA 3BTOA 3PHGA 3PJEA 2QYTA 1DFHA 3A4VA 3NAQA 4RF2A 4OYRA 4RZHA 1WAMA 2NTNA 2POQX 5CDGA 2FHSA 2RH4A 3GG9A 4Z6KA 1Z7EA 3JQGB 2AQHA 2DKNA 4J9UE 4D7AA 3NX4A 4WPGA 1PQUA 4P38A 4R68A 3MOGA 3S2EA 1LSJA 3CZRA 4TWRA 2QQ5A 3OJLA 4BOYA 1CETA 2J5QA 3LT1A 5IAAA 4L9RA 3HE3A 4MVJF 4AJPA 1ULSA 5A9TA 1EFKA 3H2ZA 4IXWA 3PJGA 2BMAA 4P22A 1B14A 4BB5A 1DPGA 4TZKA 1DIGA 1RKXA 2DPGA 2YV1A 2DC1A 4J6FA 2ZK7A 4C7KA 1PJ2A 1FDVA 3FF4A 4E2XA 1PGOA 2V65A 2AQ8A 2X5JO 2HCTA 3AY7A 1D3AA 1TEHA 2WEKA 4B7UA 2AE1A 1YBAA 1ZEJA 4K26A 1WXDA 3LC1O 4UVGA 5C7LO 2WE8A 5ENDA 4YPOA 3CH6A 2GN8A 4GVXA 5HTOA 4DPLA 1DC5A 3NGLA 5G0VA 1JAXA 1TXGA 4J91A 4DYVA 2VRBA 3BYZA 3FWNA 3Q9NA 2Y0DA 1NR7A 3ZWMA 3LLVA 2OOSA 5JCXA 1F8FA 2Y1OA 3IAHA 4IQGA 5COBA 3B1JA 5FYDA 3GDGA 1C0PA 2X58A 2XOXA 3IMFA 4Y9DA 3RFXA 5L7WA 3QJ5A 2NVWA 4YVFA 4EDFA 1BXKA 2HSDA 2O2SA 3D5QA 2Q1TA 4LSWA 1PQWA 1HDOA 4PG5A 4B4OA 1E6WA 3AY3A 3C1AA 3NT4A 3FR8A 4CM6A 4I5FA 4J1NA 4KTVE 4CR8A 5KIAA 2NUAA 1XG5A 3LT0A 2DAPA 4N5NA 5AXDA 1U2DA 4Q3BA 3C24A 3DR3A 3RC2A 4BKRA 2GNAA 2NM0A 4UEOA 5C7IO 2VWQA 3EDMA 3I9JA 3PYXA 4IJWA 1OC4A 4WUVA 1UH5A 1DB3A 2GPTA 1I3LA 1H6CA 3L9XA 4XCVA 2UYYA 2W90A 4BNIA 2Q46A 3U09A 5G0WA 2VOEA 5CDYA 3WNQA 1NVGA 5A03A 4CLOA 4CMIA 3ETEA 3JQEA 4A5OA 3LZ6A 4BIIA 2CFCA 3O38A 4NNJA 1QYVA 3R0IA 5COAA 1GV1A 3G79A 3K92A 5B1YA 2DBVO 1E1NA 1SPXA 4C7JA 5K6AC 1Z73A 4TRMA 2V6BA 3GVHA 1T1SA 2EIHA 3TNLA 3VZPA 4BNXA 2GERA 1SAYA 3CKYA 3Q1LA 2VRCA 3CUKA 1HTBA 3TFQA 1A9YA 3I4CA 3LSYA 2FPPA 4CL3A 4HNGA 3NV9A 2YHIB 2V6MA 3I3OA 4GMFA 5TF4A 4CQLA 4R41A 1U1IA 4J2OA 4I9UA 3WSWA 5AXCA 4AL4A 4NBRA 3D4NA 4R3WA 3E18A 3RSHA 3SJ7A 4LVUA 4OM8A 5IDYA 2X1HA 3SC4A 1ZW1A 3OIFA 2X9GA 4E0BA 5EESA 1XYGA 1K2WA 1NPTO 3QY9A 3L9WA 3L0DA 2Y67A 2HK9A 4D46A 3QVTA 1Y8QA 3I9LA 3MJCA 4B8WA 4EBFA 4BO4A 1YH3A 3KYCB 4RPJA 3WGIA 1JAYA 3LLSA 1HE3A 1DDOA 1MFPA 1NM5A 4IXTA 3OBBA 3O9ZA 2WD7B 3AM5A 1ZIDA 4Y6RA 3S2FA 1PWZA 3U4HA 1LC0A 1Z45A 1I10A 3HQ4O 4J0EA 2YHUA 1PZEA 1Z6ZA 2NTJA 2VUSA 3OEYA 4IGEA 4YAIA 1YVEI 3GK3A 4M8SA 4XKJA 4DBZA 4WLNA 2JHGA 3D5TA 5T67A 3WFIA 4U8GA 3Q11A 5EMHA 1DFGA 4PLZA 1LDMA 2Q2VA 3H9JA 1ZSVA 5L4LA 2UUPA 1GU7A 2I3GA 2V7PA 3DBRB 4E21A 3ORFA 4MKZA 4LW8A 2IRWA 4IJUA 3FN4A 4WLFA 5GZ1A 2NNLD 1DAOA 2PK3A 1EDOA 4GBJA 4XDZA 4J1TA 4MVJH 1E7MA 1SCUA 1PL7A 1K6IA 2NVBA 3S2IA 3C85A 3GN2A 5CEFA 3JYQA 3ROMA 3LYLA 2CY0A 1T2FA 3VKVA 2YYYA 3VAZA 3K2BA 4NJOA 2QRKA 4DQUA 3QVSA 5K9ZA 2BGLA 4EEZA 1E5QA 4Q3NA 1GQQA 4PLVA 1ZXBA 4TVOA 3WICA 4CV1A 5JW6A 1X7GA 4BMSA 1XR3A 3RUEA 3ADOA 2B0JA 1HE2A 4UREA 4II3A 1H6DA 1B7GO 3UAGA 4ALLA 3EVNA 4GI2A 4N5MA 1MXHA 1PS8A 4UUNA 3KSUA 1OAAA 5L4SA 3KETA 4R1UA 3VHRA 2W98A 2WMDA 2EW8A 2R00C 1HYGA 3ZWVA 4DLAA 1X15A 2HUNA 3I4FA 4D42A 5KKAA 4A73A 5A5FA 2DFDA 4ND3A 3E1KA 1YRLA 2I9PA 4J1QA 5J23A 2RAFA 4MP8A 2J5KA 4W4TA 4B79A 1GPJA 1EEHA 5K6AA 4QSMA 1YXMA 4CLOB 3H2SA 4CMIB 5KVSA 2EXXA 1WDLA 1WWKA 4RVFA 2JHFA 3JQAA 2IODA 5AYVA 4EYEA 4Z3KA 3DBLA 5GY7A 4NBTA 2C07A 2J3HA 3JD0A 4B7XA 4DPKA 3AU8A 3OH8A 4AJHA 2EKQA 1CF2O 4B3HA 4N54A 1XCBA 2QX7A 1A71A 5TT0A 3RIHA 1NNUA 1YO6A 3DO5A 5G4KB 3X2EA 4Y8VA 1NQ5A 2Q99A 4FIZA 1DHTA 5C5IA 1U28A 3RAJA 3P5SA 4L4SA 5AVOA 1J5PA 1ONOA 4J0FA 1WZIA 2CDCA 3NJ8A 3PHLA 5CAEA 2PFGA 4BMVA 3VZRA 2EGHA 4I1IA 3ZU4A 1W6UA 4YAEA 4HY3A 2ZB3A 4MKXA 3AUSA 3D64A 1I8TA 4HUJA 3SJUA 1GYPA 3E5MA 3L07A 3ONFA 1LRLA 4N7RA 3GPIA 2VHYA 1VLLA 3RUCA 4AICA 4FR5A 2GCGA 1Y8QB 1EVIA 3EYWA 2CVQA 4FC7A 4XYEA 5I9LA 1NX6A 4J90A 4NBVA 2AW5A 4JIGA 2AA3A 1E3IA 4J4BA 4FN4A 4BNNA 5A9RA 1DLJA 3WS7A 1BGVA 1ZEMA 4IM7A 2NSDA 2CF6A 2VOJA 1ISHA 1R4NA 1P77A 2JD2A 3AOGA 3I6IA 1M2WA 3EGOA 2I65A 2EW2A 4HBGA 3H9UA 2PD3A 4YJFA 4I5EA 2DLDA 2O3RA 3LC2O 3ON5A 4XJSA 4ZN6A 4CMAA 3I9NA 4EUHA 1I2ZA 5F1PA 4D0SA 2CDBA 4OO3A 4DXHA 5JYDA 2C54A 3JQ6A 3TOXA 1LRJA 4XYLA 3MJSA 3GNQA 2RHRA 2C2XA 4BO2A 2X23A 3GDOA 1YS4A 3E5RA 3OQ6A 3WMXA 2C2YA 1BW9B 1YB5A 3K2EA 2CZCA 2H5LA 1ULUA 2DTXA 4I8XA 1YONA 1ZO8A 1CEQA 4WJZA 3R1IA 1XSEA 4YRAA 1K5HA 3DBVO 4A03A 2D4AA 2Q3EA 3U0BA 1NAIA 3IIEA 1P44A 4NU6A 4CM4B 4FW8A 1BXGA 1MGOA 1N9GA 2PGLA 3I9KA 4YCAA 3W6UA 1H2HA 1LQUA 1GDHA 4XGNA 4CMGA 1O6ZA 3ZNQA 4S1VA 1P1RA 1PEDA 3EK2A 2R00A 1KVUA 3GVPA 1JWAB 4IIUA 4IQ0A 4RQUA 4W99A 5FFFA 3FNEA 4R9RA 1DIRA 2NV6A 4D44A 4BKUA 2JFFA 4E2YA 4KDEA 1E6EA 5CFZA 2FR0A 4TRJA 5IN4A 1HWYA 4MJLA 3V2GA 2JAHA 3JYOA 3ZU5A 2WWRA 3KSDO 4GWKA 1WNTA 3FNHA 1A9ZA 3FPLA 1GPDG 3ZV5A 4L0QA 2ZQZA 1DRVA 3S2GA 4D79A 4B4VA 1PL8A 1HDXA 4ALJA 3G0OA 1EUDA 7ADHA 4G5HA 1BHSA 2PZLA 1KY5A 1WVGA 3RKRA 4BKQA 1RYDA 1ID1A 3GOHA 3JTMA 1UR5A 1ZK4A 3JQAB 4E2WA 3W4KA 1HDZA 4G65A 3ADPA 4QEDA 1HDGO 3DBLB 5BR7A 4CLRA 3B1KA 3ENKA 1LDGA 3RC7A 2BFMA 1DEHA 3TRIA 1RPNA 3JD4A 1HF3A 4WCFB 1HRDA 1L7EA 1O5IA 3KO8A 1C1XA 4Q3AA 3QIVA 3IC5A 5U4QA 2P2SA 1PJTA 3BZUA 2V6FA 1J0XO 3CMMA 4XD2A 3ONDA 1ZVMA 3GA0A 1LBEA 4KQWA 5DBFA 5G0UA 1VJ0A 4LRSB 2D2IA 3U3XA 1Y7TA 1NPYA 1E92A 3WBBA 1P1JA 1CDOA 5IDQA 1ISJA 1B3RA 2UVDA 1HDRA 2YDYA 4PRKA 5TLSA 4Y6PA 2EKPA 2DBQA 2VHZA 2AG8A 1K6JA 1XU7A 3FTPA 3NJ4A 4OL9A 4B3IA 1E7WA 2EWMA 4PLYA 3T4XA 4QQRA 2OO5A 4MDHA 1H2BA 4AJLA 1PL6A 3IQDB 1IB6A 3VVCA 3RU9A 1UDCA 2PKRA 2BGMA 1PJBA 1SOWA 3H65A 2Q49A 1EUCA 3DOCA 1FXSA 2F00A 2Y1EA 1J49A 1HDYA 1LJ8A 4L4RA 3C7DB 1X7DA 1R12A 1G1AA 2H6EA 4P4NA 1WDKA 3PPIA 3JQCA 3E9MA 5B37A 4WOJA 2JJYA 4K1LA 1VJ1A 4NR0A 4ZU3A 3KXDA 1Z7BA 3ZW9A 4CMCA 1BDBA 1K3TA 3ZNOA 3RJ9A 1PR9A 3DZKA 4CUKA 3RKUA 1R66A 2W2LA 1GD1O 1MC5A 1PZFA 2B4QA 3QA9A 4L74A 1JQBA 3RUFA 4JP2A 4JBHA 2VYND 1P9LA 3VC7A 5BQFA 1PGPA 2NU7A 1I30A 3G3EA 4WEOA 3STHA 3DZHA 5CG2A 1EFLA 2Q1UA 5CPFA 4AJ1A 3GFGA 4JCOA 4EUEA 4YWJA 3WB9A 1KOLA 1LLCA 2WYUA 2W2KB 4KMSA 4NDNE 3ZWWA 3ZU3A 1DC6A 1UDAA 1XQ1A 4DYDA 1DJNA 1Q0HA 1VSUA 5HM8A 3RROA 2I76A 3WXBA 1ADFA 1BXGB 3DFZA 5TIIA 1IPFA 4YT4A 5COQA 3ZI0A 3ZWYA 3KBOA 2PKQO 1NXQA 2O4UX 4CR6A 1NFRA 2X9NA 4MINA 4RVSA 4XQCA 1B8PA 2VHXA 3ICCA 1KS9A 4TROA 4OSOA 1HZZA 1LNQA 1SEPA 4HFJA 4EJMA 1QYWA 3JQFC 2J6IA 5DBGA 4IS3A 1F0YA 1BRMA 1D8AA 2ZTMA 4AJKA 1XKQA 4PLCA 2PWZA 3DZJA 4BNHA 2R6JA 1UAYA 3GAZA 1OZAA 4TVBA 4BS9A 4EUFA 1IZ9A 3A9WA 5F1OA 1ENZA 5L7TA 1ML3A 3QRWA 2PZMA 5I7SA 4URFA 4F6CA 3RUIA 4PG4A 3ZV4A 1A4IA 1I3KA 1LDBA 1JDJA 1EVJA 2GDZA 4OHUA 1HETA 1ZJZA 1ARZA 1QORA 3DOOA 4TKMA 5TRTA 2VT3A 3OETA 2QRLA 1YDEA 3V1YA 3HSKA 3W8DA 5L45A 4PN3A 1QV7A 3KB6A 3VZSA 5BT9A 1Y1PA 3GGGA 3R3JA 4YJDA 3C3XA 3RC1A 1B15A 3GRPA 2ILTA 2PR2A 2QW8A 2BFAA 3HJAA 1GCOA 2D3TA 3QQPA 5I8WA 1VL8A 4KP7A 3AUUA 2VWPA 4ZHSA 3WYCA 4IDDA 3B20A 3O8QB 4XX0A 2G5CA 3UHAA 1FMCA 2HMTA 2UDPA 4HWKA 3GGPA 4OSPA 3LQFA 1IHXA 2JFHA 3OP4A 3QW2A 4BGEA 1R4MB 3F47A 3UGKA 4E31A 3F9IA 4FJ0A 2BI7A 4JLWA 4CV0A 3OSUA 4HFRA 5DF1A 1XELA 4TKLA 3ZV6A 3GAFA 2VUTA 3VPHA 2PGJA 2X0JA 4TMFA 4AG3A 1ZK0A 1E6UA 4R1SA 4H3VA 1B3BA 4NPCA 5JYEA 1YJ8A 3JYNA 3A06A 3WQSB 3DEYX 1YDWA 3A28A 3VDRA 2XAAA 4OXNA 4NFSA 5DCWA 4OQYA 4WGGA 2ZYAA 2J3IA 1YL5A 1GYRA 4IJVA 1YQXA 3AFNA 1HDCA 1XIVA 2YHIA 1BVRA 1E7YA 3FRJA 9LDTA 3QVOA 5TNXA 2E6UX 1T25A 1X13A 3RBVA 4F45A 2QIOA 4YAKA 1B8UA 3N58A 4E5MA 3WJAA 5DP1A 1IPEA 1SC6A 5DBIA 1U2GA 3IOYA 5IFLA 3N74A 5CG1A 3G49A 3BTUA 4UVEA 3GGOA 4OQZA 1C3VA 2BKAA 1ADCA 1MG5A 4Z9XA 1KC3A 2A9FA 1OFGA 2F1KA 1LTHR 3KYCA 1ENPA 2SCUA 1IL0A 4RQTA 1XLTA 2FN7A 1D1TA 1JLLA 4ILKA 5EERA 1HL3A 1YGYA 2WD7A 5A5EA 2C5EA 4M87A 2Y1GA 3FHLA 1LI4A 4BNLA 2DBZA 1SMKA 2B4RO 4IMPA 1ZKMA 4I9HA 2E37A 1VKOA 4IPTA 2Y0CA 4NG5A 4FJ2A 1RJWA 2E49A 4JXKA 2VWHA 2AEFA 4BB6A 1MFZA 1QG6A 1ZSNA 2FSVA 4WLEA 2PZKA 4YEDA 4RCVA 5BNIA 1I36A 3JQFA 3PYLA 2D0IA 2D1YA 5HS4A 3DXFA 2AXQA 1I3MA 2J3KA 1UXHA 3DBRA 4FJ1A 4H7PA 1Y9AA 2FWMX 1XGKA 1DFIA 1OBFO 1LRKA 5DCUA 1E77A 2PV7A 4JX8A 3VDQA 1ONPA 4IMRA 3ZNPA 3U4CA 4CLXA 3ROPA 2BF7A 3UCFA 1R6DA 4Z0TA 2G17A 3CMCO 1G0NA 3DFUA 1DC3A 1ZSYA 3OJOA 2VZ0A 2A92A 5H82A 3W4JA 3JSAA 4IGFA 3CE6A 3GMSA 5HA5A 5CDTA 1JWBB 4PRLA 3PYMA 2HJRA 2P4HX 3GZNB 1B2LA 1JVBA 3EZLA 4OKIA 4XB1A 3LT4A 4ZA2A 4W82A 3H9GA 1E7QA 1ZBQA 4U7WA 5L53A 4ALIA 1CQJA 4QO8A 2AQKA 3FSRA 1A27A 4HADA 2AE2A 1Z75A 4DPMA 4WOKA 4BUCA 3EZYA 3AI3A 5FWNA 3BXXA 4E32A 2G76A 4J16A 4D0RA 1X1EA 1NQOA 3HDJA 3PFFA 4JROA 3VTZA 5EL0A 3PJDA 1MX3A 5TX7A 2ZYDA 1Y81A 3DTTA 3O26A 2A35A 2C7VA 3CPSA 4M1QA 3RUAA 3GY0A 3PLRA 3U9LA 1ADGA 5THKA 3GH3A 1I33A 3ANLA 2OBNA 5IXYA 2G0TA 3CIFA 2GN4A 3WR5A 3ZHYA 3ZU2A 1KVSA 5DOVA 4CMEC 2HMVA 4AJ2A 3ENNA 4CM3A 3VPFA 3H3FA 1E3EA 3JQDA 5JY6A 1LA2A 2JKVA 1D1SA 4AJNA 4UVIA 1DSSG 2C20A 3NKLA 3WNVA 2D8AA 3LVFO 4O5OA 5I8ZA 4W7HA 5JS6A 1K89A 2O2YA 4FCCA 1NPDA 2B35A 5G4KA 4IDFA 3FTNA 4U6SA 3PGXA 1KEPA 1R37A 4BV8A 4YT5A 4XGIA 4R5HA 2E48A 3GHYA 3TN7A 3UCEA 3BHIA 2B5VA 5JAMA 1G0OA 4ITUA 4RV9A 4M49A 3I23A 4TRNA 1U8XX 3WBFA 4B4UA 4CMJA 5A3JA 2EHDA 2OP0A 4GKVA 1UP4A 4CL8A 3GVXA 2YDXA 3BMQB 5A06A 3C1OA 4WCFC 1YL7A 2Q45A 1VPDA 4DUPA 5DNAA 4RPKA 3HADA 4CQMB 5KJCA 1XDWA 2B5WA 3JYLA 4Y6SA 2FZWA 4L8VA 1X14A 4Q9NA 3D1LA 2WYWA 3FWZA 1GUYA 1NTOA 2X0IA 4UVHA 1ZMOA 5ICSA 1LUAA 1LSUA 1SO8A 1S7CA 3K30A 3RQSA 4J9VA 3BTVA 3KRTA 5EINA 4H16A 4QECA 1C14A 1FJHA 1R15A 3NUGA 5ES3A 2X5KO 1KERA 3C8MA 4G2NA 1EE2A 1N2SA 2DVMA 4WNIA 1DAPA 5JO9A 2OFPA 3PZBA 5HWSA 3TPCA 3WIDA 1CRWG 4QFDA 2PGDA 3AUTA 5F5LA 4MIOA 2XXJA 2GGSA 3GLQA 4C4OA 4E3ZA 6LDHA 4J2HA 1TT7A 1M66A 3GN1A 5DN9A 1OC2A 5BSFA 4PFJA 1Y9EA 3V1TC 5JE8A 1K0UA 2EERA 4AJ4A 1QRRA 4MKRA 2AG5A 4NFYA 3UF0A 2FMUA 2P9EA 2VHWA 3NRCA 5KVVA 1BW9A 4IBOA 1BTOA 1PGQA 1VL6A 2HKIA 3JD3A 4NH4A 1OOEA 1NBOA 1S6YA 5JPIA 5T57A 1LLUA 5FF9A 5TJ9A 1P1KA 2IDZA 1EQUA 3L6OO 2B4TO 3DWFA 1MLDA 4UAGA 3GEDA 4XDYA 4XIYA 4W7IA 2X86A 2C7GA 2Q4EA 4TQGA 2ZCUA 2C0CA 1KC1A 5G2OA 4CM4A 3UOGA 1NHWA 1JKJA 3JQ8A 2IZZA 4I9NA 1I3NA 4ESOA 2QRJA 3KOUA 2ZB8A 1BMDA 1VI2A 2LDXA 4GX2A 4N18A 3TZCA 4DLLA 4BGUA 3AM3A 1I5RA 2I67A 1CWUA 1M6WA 4O0LA 2FRDA 2HDHA 2NU9A 2ZATA 4F3YA 2CD9A 3HDYA 2Y0EA 1GZ4A 4CUZA 2HLPA 3ITKA 1T26A 2PLAA 4ND1A 4UEJA 5KJEA 2NQ8A 4J3FA 1BG6A 2PZJA 4IDBA 1DIAA 4CMEA 4DRYA 2JCYA 4NZ9A 4XB2A 1WP4A 3F5QA 3CEAA 3BMOA 1MB4A 3S8MA 2BLLA 1C0KA 4BO7A 1QKIA 3GF4A 5DDIP 3SLKA 5FI3A 1IOLA 4RDIA 1U3TA 4MVJM 1U5CA 1HE4A 3GG2A 4P4GA 3VZQA 1PGJA 3F5SA 4XRGA 4DL9A 1UZLA 1UXIA 4J4TA 1YWGO 4RPGA 4S3MA 5JDIC 4PZEA 3PRJA 2RH8A 3KYDB 3INRA 4PIVA 2Q2QA 3ZWNA 2JAPA 5EN4A 3U4IA 1H6AA 1ZK2A 1I0ZA 1E7RA 3DDNA 4WCFA 3AFMA 5JCJD 4QXMA 4AFNA 3DC2A 4A7PA 1TT5B 1XQ6A 2PD4A 3DAGA 2QZ9A 4NQZA 4RZIA 4OOFA 5IDXA 3U5TA 2PKQP 1L7DA 1AUPA 3JD2A 1EDZA 1HSOA 1SZJG 3F3SA 3PK0A 4YQYA 2NLOA 4E13A 1E3JA 2IEDA 4XZ3A 3W8FA 3B70A 3DHYA 1I01A 4Q3DA 3ASUA 1ADBA 1H5QA 5JMWA 4MP3A 1TI7A 5T8KC 2GYYA 2DQ4A 1PS9A 2GO1A 3D0OA 1QP8A 3I6QA 1WPQA 1EBUA 4UUPA 4JNKA 4YB8A 1T2AA 2O3SA 3E03A 1R0LA 1VL0A 3WGHA 4EJ6A 2FP4A 4KTTE 3RI3A 4NHEA 5ICMA 1RM4A 3UH1A 3LF1A 2J8ZA 4J7XA 2VYVD 1HZJA 2Q1WA 1HYHA 1V3UA 4LMPA 4E30A 1RWBA 1U3UA 1YBMA 1SOVA 3PIDA 4IS2A 3D3WB 1PZGA 4CM8B 1PTJA 1PX0A 3EC7A 4JP3A 2NTVA 2NU8A 1RYEA 4XJTA 4YT8A 1H9BA 1MUUA 1U9JA 1EK6A 4RPLA 5L3ZA 4J1SA 2ZTUA 4EGFA 4OXYA 4RLSA 1A72A 2DFVA 3IL2A 4IIVA 3I52A 3DZFA 2W2KA 3HB4X 4PCVA 1U5AA 4PLWA 4PLPA 1A7KA 1FK8A 3DMYA 4BNKA 5I9NA 1FF9A 1N8KA 1R0SA 1U3VA 3JQ8B 2RCYA 1R0KA 1CERA 1Q2XA 4GGPA 3WTBA 2EKLA 1CJCA 1TLTA 2EP7A 4KUGA 3D4PA 5A04A 4CMHA 5JXWA 4M54A 3FBTA 3ASVA 3FPCA 1RM5A 3Q9UA 4E33A 3PGJA 3QWFA 1ISGA 2QHXA 3LU1A 2B37A 1DOHA 4LVCA 1LXCA 1XU9A 4WLVA 1GL3A 3RD5A 3DHNA 4PZDA 3IJRA 1SBYA 3BTSA 3F46A 2ZB7A 1K6XA 4WE3A 2EG9A 4HKTA 4BNMA 2CVOA 2GN9A 1WZEA 4P4LA 2O3JA 4CV2A 1I2CA 2CVZA 4R16A 5EIOA 3QHAA 2FR8A 4FSHA 3Q3CA 3OM9A 3BMOB 4NBUA 5JDIA 3RC9A 2OHXA 2OXIA 3TDKA 4YYZA 2IYPA 1VKNA 3NTOA
chains in the Genus database with same CATH superfamily
4RZ2A 1W1UA 2O8CB 3VPGA 3OJCA 4I4TB 4RFSB 4LF8B 4MRMA 4R2WA 5CCBA 1MOQA 3HRHA 1ZUWA 1H5NA 5IEBA 2ADOA 4GFDA 2H51A 4MUJA 4FKBA 2KLBA 4ZYVA 5CBPA 1KKUA 3IAXA 3P27A 1EGHA 3ROTA 4AG5A 4R3NA 3GLVA 3EF0A 1AK2A 2J33A 3B1XA 2NYVA 3A6DA 3EPLA 4EG0A 1U11A 1W85B 2R6AA 1CQIB 1JL3A 1L5OA 1UXJA 1SG9A 2ZGVA 1NMYA 2WYVA 1G3IA 3DCIA 1XU4A 3TZHA 4RD1A 4YPVA 2B6HA 1X7HA 3R6DA 4G1EB 1CZNA 3VR3A 2X8AA 4G9EA 4MYSA 4JA2A 4ZI2A 1Z35A 4CCAA 2FW7A 2H2HA 3KSZO 4G67A 2LKCA 2NQTA 4O2LA 2PUJA 2W4QA 4BGIA 1G7SA 4RCZA 1A4UA 3P2OA 1F2DA 2VNIA 2X4GA 2C2HA 3FOBA 2O0KA 1NP6A 4KHZA 3KQSA 1OWOA 1NF3A 4BC1A 1OI7A 4NBSA 2ZQ5A 3V8QA 1ONSA 2VRCD 5JNLA 4EPRA 1XCJA 1GCGA 1I1NA 1G5PA 1KBZA 1U80A 3BMNA 1XRMA 1D2GA 1KI8A 3LQRA 4IYRA 5GADl 5FPPA 1L4GA 2AG0A 3M6IA 3QVVA 5AKIA 3C6YA 3FFWA 3P9ZA 4NENB 4X7PA 4AN4A 4BQEA 2HCJB 1UMKA 3X1DA 4GOKA 1NXSA 3JQ7B 4M0MA 4YS6A 2ZSEA 4TWAA 2Y1XA 4BGVA 3EUEA 3SXPA 4BE9A 1O6GA 2E87A 2MYTA 2XMSA 3UT5B 1OI4A 2HUPA 3LA8A 4ZEWA 4CKEA 2DE0X 5CIYA 5IX8A 3UFBA 5LNK1 3C3JA 1KJQA 1K7YA 2I66A 3L1KA 3TG2A 3QENA 1UFRA 2VCYA 4YXFA 2V5VA 3ZWDA 2O8BA 4X7BA 1EFTA 1WLYA 2HQSA 2IYAA 4UNSA 3T41A 4C3UA 4HEHA 4PG8A 4FEEA 4ZAGA 1QJ4A 1NOIA 2MR6A 3NBYC 3F49S 4RIEA 3R3ZA 4CFYA 5JV5A 1N1GA 4D9CA 5IUNC 1KVRA 1ZN2A 3C3MA 3LLCA 5T7BA 5JU6A 2OHOA 3MYRA 1WUYA 2GXSA 5KJ1A 5LMZA 1FY2A 4HGRA 1GZDA 4D43A 3ZWQA 2IYSA 2Q62A 4RY9A 4F38A 3THWA 3SBDA 3G5UA 1X1RA 4PVDA 3AF0A 3EX7C 1EVLA 1F1JA 1TAHA 2XQJA 3VSDA 1G8YA 1NJ5A 3IP9A 2ATCA 4YJ2F 1ZJYA 3RASA 1W47A 3WQRA 4KHPB 2Y68A 4L5AA 1T4BA 2N1MA 4DEVA 4OBXA 3FJOA 4RZUA 1H0RA 3B5EA 2WB4A 4PX2A 2I4MA 5AKYA 4GX0A 3C39A 5L7YA 1S3SA 1GNPA 3LY7A 5JXJA 1U0SY 2HWYA 4NONA 4AWAA 1AN9A 1MRNA 3IQZA 4YXWD 2W6ID 4FSDA 3GEGA 1E98A 2JJ1A 2GJSA 3BHMA 1MCZA 1JHMA 3H9EO 3PUXA 2PBLA 1K1EA 1P62B 3D0QA 2LTAA 2QVLA 3GC6A 2OAGA 3NOOA 2E85A 2AD1A 5TPZD 3WNDA 3TLBA 4DMHA 1JAZA 3QVWA 2NXNA 2ZBPA 1K97A 3MMNA 3P4YA 2XLBA 4LDAA 1MHTA 1OGIA 3IKLA 2B7LA 2ZYRA 5EJAA 4MGIR 4FYKA 4P36A 2I8LA 1ORVA 1E1KA 1G8JA 4Q18A 1H42A 5FFNA 1LPBB 4Z7QB 1BHO1 2Z5LA 5IWAB 5DP2A 1IQRA 5GONF 2XYVA 1W48A 4GQAA 4TL9A 4G4SP 3W90A 2FX5A 5D3KA 3U5ZB 1CP2A 5F12A 2ZYGA 1T2EA 4ZI5A 3BMCA 4B09A 3UBTA 4NCJA 2E4XA 3BFJA 4AKTA 5BYAA 3OPMA 3TSYA 2V6IA 3JQBC 1RZRA 1Z5PA 3QMPA 3BFVA 5CW1A 1KAHA 2ETXA 2JL1A 3K70C 2XUOA 3NEYA 5E9AA 4XUEA 2EJWA 4GW3A 2ZTVA 4RABA 1VFPA 3RO7A 3K7EA 3Q7QA 1O8BA 3SK0A 2D1QA 3ZVKA 2OO3A 4W9MC 1MJFA 3AVPA 4PG6A 1Q3HA 2BAGA 3K73O 1NAHA 1XQXA 4EB6A 2GD1O 2GVNA 3S0JA 4DUYB 3R76A 1OA1A 3TX6A 5D87A 4AZTA 3JD1A 3ND6A 4OFWA 1A8QA 1CF9A 5FLXA 1FW8A 2QTZA 2XT0A 3FLMA 4M0EA 3VQTA 3ZXXA 2I6SA 4BLPA 4BNZA 1Q17A 4AQ7A 2NU6B 1O77A 2Q6OA 4RO0A 1FUUA 4U2GA 1J5EB 3MMZA 1LTKA 2DPLA 2B20A 3EBOA 4IDGA 1P45A 1QMGA 2AVDA 3BM5A 3OY2A 4ID9A 2YNMD 3DUWA 2W71A 5KCZA 3GRYA 1K8YB 3B3GA 1R8QA 3OG9A 3TTWA 5J4HA 2ZWVA 1ECBA 4C08A 5KYTA 1NRIA 2QXTA 2IA5A 1NUUA 1Z63A 1PR2A 3LO5A 4MLCA 3FSGA 3QMMA 2G88A 1G21E 2FCAA 1L4LA 4OQNA 1APBA 4EW6A 3FBGA 4YNBA 4EITA 4HLUA 4WFKA 5B4UA 1E2KA 1OX5A 3SWWA 2HRZA 3OQOA 1H2FA 3U7EB 3O2SB 3ZLTA 2VXBA 4B7ZA 2F3TA 2HEIA 5ALHA 3S27A 3WBJA 5JH7B 3PQDA 1XMIA 4NFHA 3GJ6A 2VPZA 3N2NA 1P17A 1MV8A 3EH2A 3DTVB 3R3SA 5IXSA 1T4DA 2NZYA 3AY0A 1WW8A 3QVGA 4WXEA 4GAEA 1YB4A 5G4LA 5CDSA 2QYOA 1U90A 4DJDC 3QQ5A 4F3TA 2QE7D 4JGBA 5A71A 5FPQA 1TQ6A 1EZ4A 2P8JA 4DLUA 1FMLA 3GP5A 1XA0A 1XX6A 4JLNA 1ESNA 3LC7O 4MYTA 3VYVA 1IJBA 1PUIA 2IXAA 2HH9A 3EJ6A 4I5DA 4M9ZA 5AVJA 4TUYF 2B1IA 4YP1A 1ECFA 1PWXA 1XP8A 4KAFA 3OLCX 3S40A 5FOQA 5G40A 1L4BA 5CIQA 4DT1A 3DL4A 5CDUA 4CU5A 1JSXA 4IJQA 1CR2A 2AHRA 4ENQA 5CCEA 2P0AA 2C3PA 1PWHA 3PQCA 4R2KA 2ZUDA 4KE9A 5D51S 1WCIB 3O95A 4S1PA 4BWFB 3K15A 1ZUNB 2Y93A 3TM4A 2XB2A 3W9YA 1YBVA 3A32A 1X86B 2CBXA 4ZCMA 5HKKA 4TTSA 3T15A 3OCVA 1N92A 4NE2A 3E9CA 3T5TA 2QP3A 1V4NA 3L4BC 4PZ0A 4NCKA 1RJ9A 4MAFA 1TA0A 1H94A 4HEQA 1CDZA 3L04A 4I14A 4ZK6A 1OWLA 8GPBA 1XAGA 1GL7A 2ZITA 4MIEA 2VATA 1YA8A 3L7AA 3BH6A 1IY2A 2FKNA 1AHHA 3EQ6A 2BZGA 4EWLA 3W3AA 4A6PA 1KJYA 2OOKA 5J2TA 4KOAA 5AD1A 3KELA 4B3SB 1G63A 5E4TA 2XCTB 2ZI4A 1XRLA 4D3XA 3QITA 3V1KA 3W5DA 1KIAA 1PBTA 2WDZA 3OFSA 3PDUA 3K9FC 1ZYUA 2C4MA 3CGWA 4NYIR 1VXOA 1XRQA 4OH7A 4CN8A 3TX2A 1V5GA 1YBHA 2B0CA 2F1RA 3CZMA 4IMJB 4ZMSA 4OMCA 2FQ1A 4DJAA 3R75A 4KYIB 1PV2A 1O0SA 4XUCA 4Q37A 2A59A 1XL1A 3GB9A 5FA8A 1IEWA 2XOKD 5HQJA 2CHGA 1JZTA 3GT7A 3D6UA 4A8TA 4FHFA 1RPTA 5FTMA 1QV6A 2M1XA 3SE0A 4DTIA 5GZ1A 3OCXA 1IONA 3COSA 1YUBA 5DULA 3M4JA 3V80A 3AI1A 4GGOA 1N6OA 1JLMA 3ZHOA 2P5UA 5KDOA 4J8PA 1QYDA 5TARA 2H92A 2Q7OE 5KPJA 4DCMA 3VJRA 1GUZA 3DF9A 3U3DA 4FVTA 3JZDA 1C3XA 1P5ZB 2MOKA 5ARCA 5C5DA 1N9ZA 3LUJA 3A1NA 3R5JA 5EUBA 2PY6A 2VNAA 3SJCA 1T29A 2GXUA 2PAAA 3HKDA 3PDJA 1C8BA 4X71A 3E9ZA 1VG0B 4PCAA 4R8LA 2AZXA 4CF7A 3VHLB 2VTDA 1GO2A 2G77B 3OY7A 3JXEA 4UBJA 4UM5A 5D3MB 2ZTLA 4D25A 1LSOA 1IN1A 3A1FA 2CFOA 1FSZA 5BVGA 5B7NA 4LYAA 1J90A 3SICE 4F71A 2OQRA 1N34B 1Y6FA 1AKVA 1JT2A 1KOJA 2AR0A 1K68A 2I6TA 2LUOA 5CUQA 1QG0A 1QB7A 1O94A 2YZMA 4ZVLA 1W36B 1Z0FA 1I7PA 4G84A 4WKCA 5EZ5A 3H2KA 2B78A 3AG5A 4MWSA 3HRIA 4R2MA 1SBHA 5E9JA 1B6SA 1P4SA 3RUPA 4ALNA 3LI2A 4BVAA 3RFUA 1DTWB 4EX7A 1UZMA 1QCCA 2WIJA 2RSLA 4G37A 4FFPA 1JG4A 4ZFNA 2AC4A 2WKRA 4IXMA 2WV9A 1CYDA 4MUEA 3HCOA 1ZJJA 4DS3A 3BCUA 2J0UA 4RYDA 2ZROA 2IYOA 1J06A 1P8AA 2R97A 3HGQA 3JR3A 4PAQA 5FNVB 1TM2A 4AJOA 2Z98A 4CTKA 1KVQA 4ZEXA 2PKEA 3OZGA 4EENA 3KC2A 2XUDA 5AI6A 2I8AA 1HYQA 3RYHB 1VECA 3Q9LA 2I2AA 2QZZA 3WFJA 5AJXA 3KYDA 5BOSB 4HEA1 1TFRA 3KOZA 4DWJA 4DB4A 3M81A 2OQVA 2Q7DA 2Q7XA 2PL3A 4EZBA 3I1JA 1G2OA 4O4JA 4YJHB 3BN3A 3R7NA 3PEWA 1PIWA 2YQ4A 3B7WA 2GI4A 1G21A 4MQMA 1OFUX 3M34A 3HUTA 3TLKA 1T9DA 4F60A 1JS1X 4ZYYA 5F77A 2BFDA 4R9SA 5HE8A 4ZJYA 4J2TA 3G0CA 1OZ0A 3KCNA 4F9EA 1H22A 4FFOA 4Q1EA 2AFRA 4CR7A 3JAKB 1RWWA 3LPLA 1PT8A 1Q1NA 3QG5A 4DJJA 1TAUA 1J21A 1STOA 3Q0EA 3EZXA 4PGHA 4TT3D 2BFOA 3D8BA 3MJVA 1WXIA 3PLNA 5F3RA 3AVWA 1QKJA 2BFCA 3T5MA 5HQ3A 4EAAA 4QQ8A 3KPUA 4K46A 1E2MA 3OT1A 2ZTSA 1B43A 3PEEA 2VK2A 3R0VA 4YMSA 3V2UA 4DIBA 3D6MA 5TS3A 2C92A 1ZKDA 4B6OA 1TJ5A 2G8NA 2QR2A 4DLKA 3P0EA 1YMVA 4GYYA 1FIUA 2GEBA 3AF2A 4FFNA 4Z3DA 3A9SA 5IH3A 4XDGA 1DRWA 1JP7A 3MJ4A 4XWWA 2C5AA 3DO6A 3HVJA 1U0JA 4EY7A 4S1TA 3V4OA 3PEFA 2K5UA 1U7UA 3E1GA 4QKQA 2C42A 5E7MA 3EUWA 4V02A 4HNQA 1I4TD 3ZJ4A 4D8TA 3O7MA 2FFBA 1FZQA 4JHXA 2EP5A 3FI9A 3W6PA 2Y76A 2DB3A 5F51A 5K0BA 3ROGA 3DF7A 1GQYA 2XB6A 2C29D 4AWXA 4TSKA 5EIEA 1S96A 1NLMA 1UFOA 3PC4A 2GZAA 5CT5A 4ZOAA 4NARA 3DHEA 1FNSA 4DQVA 3K53A 1LK5A 5JAIA 2O2EA 1A9OA 3N59A 3MEQA 5JPDA 4R51A 1N0HA 2YKGA 3QU4A 1P1HA 4DNQA 2C57A 1E94E 1RXUA 1NLFA 4ZVVA 3KJQA 3UAXA 3IB6A 4UFPA 4FNGA 7MDHA 5HJ5A 2XZTA 2VYNA 4QTZA 4RK6A 1H0HA 2KLHA 2KX7A 2UAGA 3D3WA 4MB6A 4QULA 4RLHA 3SIXA 3ZCXA 4CM8A 4P2BA 4TSFA 3OKCA 5H80A 3O4GA 4G36A 4JNGA 1GLNA 3OM8A 1GTG1 4FB5A 1CEEA 1EUZA 4W6ZA 2NAPA 1WTAA 2MSLA 2NVUA 4BDSA 5JG7A 1SHJA 3IJPA 3T7TA 5LVAA 4LDRA 1KY3A 1YS1X 3U19A 2O52A 2R1TA 3MAJA 4JLDA 4MVYA 1E8MA 2ANBA 4XPIB 2WHQA 1OV6A 5HDQA 1W4CA 3BA1A 2OCPA 3H6HA 3WYEA 2VBFA 3U7IA 3DONA 3AW9A 1IATA 4D5EA 4EJSA 5F7XA 5A2QA 2VF8A 4FT2A 4BUZA 3OQNA 2JARA 4EGSA 1CSEE 4YMIA 5K0FA 1XLVA 1J2RA 2F43B 1MH1A 5EIBD 1R0XA 3UWSA 3GD7A 2VL7A 4PYOA 4YGXB 4XGQA 3PFKA 5GMOA 3U7JA 2O23A 2QYHA 4ROTA 4R3UC 3X1YA 1UBGA 2IXBA 4YTEA 3ZZ1A 3EZ9A 3K2QA 1AO3A 1XRJA 4G1FA 1XPUA 2ODPA 3L8GA 5JS2A 3OO0A 1N2EA 4BV9A 3LG2A 1QTQA 1YZ3A 5EZYB 1QIKA 4QBHA 2HHJA 3BAZA 2HSWA 4DWVA 4BY9E 1R0YA 1EFPB 1P1IA 2I7TA 3D9QX 4FGKA 5DPMA 1KGSA 2CLSA 3QBTA 2VJOA 2JFNA 4JT4A 5JJKA 5JSUA 2DU8A 3LX6A 4Z4CA 4XQEA 2WIGA 3LJKA 3ACCA 4ZHQB 4E6PA 2HB6A 2RC5A 3NC1C 1FNDA 4J7UA 2XYGA 3WO0A 1GM5A 4G4JA 3WIVA 1NI5A 1B1CA 4FINA 2W37A 1J23A 3ICWA 5LNK6 3GUZA 3ZUPA 3I04M 2CDRA 3ZXUB 3HJUA 4UTXA 5AVWA 2OL4A 1CLEA 1LLDA 2XUPA 3GGJA 1YIOA 4DBLE 4Z1OA 3ADKA 5CIWA 3QKSA 5KNLA 1CEXA 3LMKA 3N6VA 3FPAA 1DLIA 1U3CA 1K3FA 2F48A 2FMHA 1E4EB 2WG0A 3B13B 3LHSA 3Q7PA 2C9DA 2YIJA 4TM7A 4UFNA 1XZKA 3R8CA 4BX0A 4U4AA 4A2QA 1HT2E 1DT3A 1Q2UA 1G5TA 2YW9A 3BCHA 4X1IA 3VHQA 4HGYA 4OH1A 1V37A 2OD9A 1Q11A 2IYYA 2RHMA 1Q0ZA 1QZXA 2REOA 1VYUA 4NJEA 5ALSA 3K0AA 3T5CA 4JI7B 3LWZA 1A77A 1X8LA 2JFZA 1QYCA 1IMOA 3KUXA 3O2NA 4KNWA 4DJFC 1MTOA 3TECE 1NKSA 4KLCA 2Z8YA 4IIBA 5C3MA 1R8JA 4KJZA 2VP3A 1JSCA 4K9NA 1DJLA 1N7HA 2PA0A 1Y8RA 3L8ZA 2I7VA 4M55A 1JEOA 4S1WA 3WMGA 4EM6A 3M8KA 3K9BA 3L8MA 4WK6A 3EY9A 2CMGA 2F1JA 3CRZA 3N0WA 4L73A 2CNDA 2YQ5A 4V0QA 4IG4A 1DEKA 1SKBA 2I5PO 1V3TA 4LN1A 3RSOA 3THYA 2FSHA 1U0GA 2RAPA 4FGSA 3P5BA 1BJRE 1GN8A 4OPMA 4DLRA 3BERA 1NW9B 3H3JA 1SIWA 4I9FA 5CXQA 3R3UA 4MVXA 4D98A 3E48A 1ISIA 3PGLA 3HFJA 1D1PA 3ESDA 3R6GA 2WW8A 1PV4A 1ZM3A 5ITZB 4CYMA 5B3LA 2ZRKA 2QX4A 4RH1A 3G2MA 4D8VA 2HMSA 5DHSA 3HI4A 3LF2A 3AP1A 4CQLB 2XUKA 3ISVA 3STWA 4OQFA 3T38A 1SUEA 5IT5A 3NYQA 1KORA 2ET6A 1KJNA 2I80A 4AZSA 2Z3WA 4FZ5A 4LE2A 3L1HA 2BP7A 2CHEA 1JMVA 2D7DA 2FMTA 1HLGA 3VNRA 1GTL1 3PIIA 4UJ5A 3P9QA 1AGRA 4UVDA 4MRNA 1E1MA 1OA0A 4EYGA 3SFZA 5G0SA 3HPQA 1UQTA 3E15A 2QQEA 1V48A 5ER9A 4EHDA 1SXIA 2BELA 4Q7EA 3LXUX 1YR9A 3PFNA 4XWTA 4NMMA 3FZQA 2P6NA 1SKQA 4JMPA 4MQEB 4EYKA 3O8DA 3VSBA 1T3TA 3PFIA 2JI8A 2DSNA 2GF0A 3GXBA 1SC3A 3KDAA 1WO8A 1G38A 1SB8A 4WKGA 1IE3A 2VAMA 4BTVA 1N57A 1XAHA 4I50B 1JIKA 2FZLA 1RYFA 1UPFA 1ZJ6A 3MUNA 4ZQGA 3F4LA 1Z0SA 1HSZA 1U04A 2ZVJA 1NW4A 3REQA 4YUZA 1U9ZA 3QPVA 1TK3A 4QHTA 2BSXA 1ZWKA 3H0KA 5F9HA 4MR8A 4C05A 4ZOLF 1RAGA 2V7XA 1GG9A 3VKUA 4B1FA 1J6UA 4N0PA 4N6GA 3SS8A 3AHIA 2BFFB 2FHPA 4FGWA 2FFRA 3ZIUA 4W8OA 5KHLB 5DCLA 4AUKA 3RG8A 3V2IA 4ZPXA 5KKCA 1B6TA 4MVJI 2RK4A 1NDUA 3GJ5A 4D8XA 3Q9SA 5LLDA 2NN3C 3AOEA 1E5TA 4BQRA 1O7JA 5AK3A 2AN1A 4I7EA 4GXRA 2MSWA 4F7DA 1KI6B 4EMTA 1N7GA 2H7YA 1EWYA 2FUEA 1YJXA 2Y1FA 3C6BA 4V3CA 5T5QA 1I24A 4H2DA 4AN0A 2H1HA 1QLJA 2PAFA 3KXPA 3WGGA 1LDEA 4Y6LA 4CCWA 1D4AA 4K6KA 4OVKA 2CMFA 2NYAA 2GPSA 4F3CA 2BYTA 5CLHA 1OVGA 4L2IA 5AKGA 4OX9Y 3P7MA 1E20A 2GZRA 1EXMA 3QELA 3ZZNA 3EEYA 5D6OA 1P73A 1U65A 1YNOA 4G81A 1YC5A 1NA5A 2OGTA 1VB5A 5JLAA 3V7YA 3OE4A 2HGSA 1DRUA 1C2TA 5AW2A 4QPZA 2QMZA 3VR6D 3W5BA 3RRMA 5E6SA 4AJ9A 1E3LA 4MUIA 4D3FA 2BEWB 5EQDA 4DR2B 2QTNA 1YR2A 1VPVA 4YAGA 1QQBA 4V0SA 3WRWA 2ZLBA 1FFGA 3LSTA 3OM0A 2TMDA 1Z37A 3PGKA 4FD3A 4AYWA 3K09A 3SE7A 3SEFA 2O8DB 1YOBA 1FVFA 1QHNA 4NL4H 1XZFA 1Y3BE 2VDPB 3IDSA 4Y2JA 3RTBA 2L69A 4A27A 4TTTS 4NWIA 4POAA 1X7YA 2W6NA 4ZXFA 3RFVA 4BKOA 4DHEA 2HJVA 3RK0A 1O3YA 4QODA 4TSRA 4F7WA 1GA6A 3TJRA 3G5AA 1LBHA 2FQWA 3FCXA 3KHUA 5HCUA 2DBRA 6ABPA 2XUGA 1KZ6A 4YI3A 1QAOA 4URYR 2NSYA 4ML3A 5FA5A 2O5RA 1WQ1R 1D04A 3SSMA 1BKDR 3T1OA 5EJFA 3A6PC 5DHUA 4RVGA 4GLOA 4RVDA 4RA6B 2H48A 1ABBA 4AJJA 3P9SA 1PJQA 2XUHA 3H5AA 4BFSA 3SX2A 5G0TA 5AXBA 1GG2A 1I2MA 2C4NA 2GBCA 3R0ZA 4MHTA 3CWCA 1ICIA 3STXA 3Q85A 1NU6A 4F4IA 2BI8A 3CUUA 1C9YA 1WXXA 4KVZA 4RPHA 2AWNA 3KSMA 3JVEA 1N2CE 1P1CA 1BCSB 3QBDA 3KWLA 4JLVA 4O2BB 2I7DA 2PZ8A 3STTA 1FNMA 3BZWA 4PLHA 4Q3EA 1GVNB 1FRVA 4UUMA 5EIAA 3P9RA 4GO1A 5TSDA 4FFLA 4NCBA 1G9SA 4MDEA 4AX8A 3GMDA 4DF3A 3PNLA 4K9MA 5L3QA 1SQSA 4G0VA 2O05A 3ZBQA 3SF0A 3VYTB 3G17A 4BJ6A 2P91A 4TLMB 3KXKA 2Y99A 3R0JA 5JD4A 2Z9DA 1CUEA 5C1IA 1DJPA 2IU4A 1S0UA 1BGWA 1IWPB 1MB9A 5EMKA 2JLSA 1XZBA 4IGKA 5AOAA 3FFXA 5HYVA 3ZJTA 3BQ9A 3HY3A 4IQ8A 4B6RA 1L7XA 2BR3A 4MVJD 4PAWA 1WEKA 5A4DA 5L95A 5JMOA 5BSHA 5DM60 3RVQA 3QBEA 4D81A 5F1KA 4TWJA 2WUGA 3FGPA 3EMKA 4TV9F 4ZQCB 2C8LA 2I62A 2JGNA 3VO2A 4ZCIA 5K05A 5ICEA 3PNVA 3PC8C 4R7ZA 3H87A 4F1WA 4IVQA 4G8DA 3E82A 1FU8A 2YS6A 3LWBA 3PQFA 3IBFA 4JYBA 4S2UA 3EGIA 1IWOA 4M0UA 2IEAA 4U7GA 1NWCA 1R4NB 2I6XA 3L7MA 4DG9A 2P2CA 3DNFA 4KDCA 3ZY5A 1QK5A 2YS7A 3RYFA 5KOYA 2BMVA 1CHNA 1TZMA 3R20A 1LC3A 4M6WB 4BO9A 1Q7GA 3C5VA 2RI6A 3KDPA 4A92A 3SVTA 1LLQA 2QRUA 4M53A 4UM8B 5F5NA 3SN6A 1T6BY 5DEIA 2OCKA 5DGHA 3OJFA 4JKOA 3OIWA 1V5WA 3Q0IA 4L9SA 4ZQFA 4BO7A 3TBFA 1NP3A 3HXQA 1O1YA 5KNBA 2H9IA 1SBCA 2WQ6A 1NZFA 1BO6A 1WSDA 4C5BA 3A6JA 4DQXA 3KDSE 3WDMA 5JNSA 1GGMA 4OIMA 1OBHA 1AKWA 3BPSA 3FLBA 3PQEA 4HDNA 5HJ2A 3VKFA 2GPJA 1UXOA 5FR1A 2P41A 1F9AA 1PJ8A 2MHCA 2RK6A 3BWEA 3NATA 2B30A 5BSTA 2Q4RA 4DR5B 4ONEA 2BI4A 2R86A 3G6KA 5JO0A 5EPUA 2V59A 1H1LA 2QLFA 3NDIA 2QJTA 2CGEA 5HTKA 3B3JA 2C84A 3LYAA 1M7BA 2CHQA 2AI3A 4O4HB 2PBZA 3GELA 1VE9A 3VGPA 1GZ3A 5AVSA 1F17A 1QJCA 3GRRA 4RJLA 3W77A 4EYOA 5L51A 3DLPX 3DQPA 4B6JA 1PYOA 1TW3A 1Q0TA 3VPCA 1GQRA 2GEFA 2YY5A 3WGOA 2DUWA 1OVMA 4H17A 4BMCA 5IF9A 1B93A 1XCGB 1QHHB 1XJ5A 3DBHA 3SMQA 5I7HA 3D8TA 1QXSA 1XEAA 3HKEB 5CVVA 2Z43A 4MKFA 4LHZA 5TF0A 4OFZA 4DVJA 3I0NA 1VHDA 2XX3A 3F1LA 3ISTA 4MUBA 2OPHA 1DX6A 1ECJA 4BYMA 3P2YA 1W93A 1QGAA 1BRTA 4LFBB 8MHTA 1GL9B 5IBPA 4B4WA 1S3FA 4EYQA 3ZWBA 1GGNA 3IHKA 5BRAA 1GPH1 1VJ5A 3O3NB 4I46A 2JJ2A 3FMFA 1GY8A 2Q07A 1SB9A 4ZIRA 2HJGA 3O4RA 4FYVA 1IZ8A 3RUDA 4R01A 1G4HA 3LUFA 1GPUA 1I1HA 5THXA 3VM6A 5JC8A 1MD9A 4BNJA 1Z15A 1XF1A 5BUCA 5GZ3A 5C3UA 2ZAIA 1KQ3A 4JT2A 4KYUA 1FDSA 4GBMA 1Q14A 4P92A 4Q19A 3V1UA 3T06B 4ERNA 1NW5A 1RZVA 2JAXA 2W2VA 3HCCA 2ZBEA 3ZGYA 3GGCA 4YCBA 3DAFA 1DIBA 4KIGA 2NYUA 4QYTA 4RVUA 4BO1A 2VHJA 4KWHA 1PJ4A 4JJ6A 5AI8A 5H59A 4E3WA 3LK7A 5A3SA 3ZCSA 1A8SA 3DVLA 4W5OA 1R6VA 2CMDA 1CY0A 3LOUA 4AULA 2XRZA 4RTJA 4KODA 4NBWA 4PZ9A 4QEKA 2OHHA 5LQMA 4DLZA 4R9UC 4ZV4A 2XCOA 4N7MA 3SJZA 2OFWA 4G1MB 3G9XA 3AX6A 3CJQA 1LVGA 3D7KA 3TB6A 3ZWPA 1KYVA 2EBUA 2AI1A 2R87A 4CCSA 5CW2A 2D59A 2QW1A 3ZD7A 2QLBA 3W1VA 5U9CA 1X19A 2OK7A 1QH1B 5EKUA 1Z74A 3P0JA 5DNCA 3L7IA 4LHYA 1NXTA 2J87A 3NS7A 5FJIA 2VBGA 4DNXA 5KJFA 3D43A 1VMKA 4UTOA 1R9JA 5TGDA 3X1MA 3MHTA 1MHPA 1GQFA 3QEKA 2JS7A 1R9NA 2JFGA 4BO3A 3L1IA 5LIPA 3Q8LA 1X0XA 2SICE 3NTVA 3QUQA 3I5UA 4MTCA 1OIVA 4KFTA 4ND2A 1K86A 2OP1A 2EL9A 4PXAA 1N5OX 1TGYA 4N47A 4CM9D 2HBZA 2XEDA 1N2CA 5D7BA 4OXQA 1TO2E 3BJIC 3QE3A 1A2KC 3VH3A 4DIUA 2R68A 1W59A 4U7HA 4K1XA 1HK7A 5E4FA 3UN1A 2YOHA 3LBHA 4PQFA 4DMMA 3KV3O 4I6JA 4RJIA 3VKGA 1L3IA 1W8DA 2UYQA 3EIEA 1PSDA 1CS0A 5AVTA 4RF5A 4FFBB 2HU7A 1K9SA 5EE1A 1CUGA 1Y0BA 2NSJA 1Z25A 1AM4D 2CUNA 2D13A 1MXFA 1ZH4A 1NG1A 3DT8A 5EJMA 1BSVA 2QU8A 4AVYA 4IF4A 2Q1SA 2A30A 4QX6A 2PGAA 5E0OA 3D3NA 3FG9A 1W30A 1KF0A 2P77A 5SYAA 1VBNA 4JSTA 4CF4A 3KKMA 4ZCRA 2PO7A 2O3TA 2G9NA 4IIJB 1DJMA 2YZ7A 3VR1A 2V7QA 5T6BA 5DT9A 2PX0A 5TGTA 4KK3A 2ZKLA 5HEKA 3RFCA 4D41A 4W9NA 3WP1B 2IS6A 5AT1A 1QS0A 2Z6QA 4NI5A 5EHGA 1SBQA 3PUJA 1EK5A 1EVKA 4C0BA 2HBYA 1ZK1A 3T9FA 2VYVA 4GMXA 1PR6A 2IOHA 3MIZA 5H3CA 4TKZA 4YK7A 3KU1A 2VLBA 1Z8HA 3BX1A 4DZRA 3A4VA 3N0RA 3RRXA 4CN9A 3RAEC 1WAMA 3GA5A 2NTNA 4MV1A 4WY5A 2ZCJA 3N6RA 4Z6KA 2A33A 3WKDA 4C4AA 1QTNA 4YJ3F 5EKTA 2AQHA 4D7AA 2ODBA 3JS5A 3PXDA 2ISCA 3DDHA 1LSJA 1UDXA 3UHJA 3NC4A 4TWRA 2NQ2C 2ZUUA 3WMRA 2DXIA 1TM3E 5F7ZA 3HUEA 1I4EB 2TSYB 3SCZA 2J5QA 1THGA 3LT1A 3RQIA 1USVA 4BOYA 5IAAA 4MVJF 3AGQA 4EO9A 2A0KA 3ZGOA 1EFKA 4IVRA 4MIKA 4I6EA 1AUXA 3SDSA 3CUEF 2BMAA 2XUQA 1B14A 3HGMA 2H1WA 2IHZA 4CKYA 3MGBA 1PYGA 1SM4A 1KI1A 1T8PA 2XQIA 4AMZA 4X5OA 3NOVA 4IF6A 4MCAA 4EEKA 4EVRA 2WTUA 1T2UA 3IV6A 4UDOA 2BCJQ 3VU8A 1I4LD 2I4RA 1TK2A 2JHCA 4GOOD 4JQZA 3ZDQA 4ENSA 4E2XA 1PGOA 1VCMA 2AQ8A 2J1LA 2Q5IA 1G7CA 1XL0A 2HCTA 2QTLA 2X5JO 4QA9A 2PSFA 4TPKA 1NW3A 1V2HE 2Q6IA 1YBAA 5KDDA 4GL2A 2DWPA 2I1LA 3IVRA 1OXMA 1Z5UA 2D62A 3LC1O 2WE8A 5C7LO 1N3BA 3CH6A 1QV9A 1QTIA 2RKOA 3WGMA 1E6CA 4MJXA 2W6JA 1Y89A 3TNFA 5G0VA 3O8RA 5JR3A 4AKIA 1IOWA 1SJ9A 4YH1A 3AQIA 1E2GA 2FJ0A 3A36A 4DYVA 2KSQA 4LG1A 1FVOA 3ZWMA 3E4DA 3LLVA 3TNDA 4KQKA 2J0QA 1GRQA 1R74A 3VUEA 2Y1OA 3OZVA 4IQGA 1EM8A 1K06A 5COBA 3T3DA 2HIHA 2FRXA 3ZBTA 1E2BA 5J3JA 1ECPA 1C0PA 1KSFX 1KYWA 2A9QA 2X58A 3IMFA 4UU1A 2XITA 2WF8A 5HP4A 1NP7A 4FFVA 4QWMA 5KYNA 1C3OB 1XTZA 4XPZA 4CTMA 1OIXA 5KYYA 4EDFA 4OQEA 5BY2A 5AK5A 3ZJ5A 4JB3A 4Y0NA 3I6MA 2O2SA 3PKJA 4DV6B 4U7DA 2Q1TA 4WXPA 5ICFA 4B4OA 1E6WA 3QY0A 2DJIA 2QQGA 3GBPA 3C1AA 3DVSX 4CM6A 1JJVA 3IFSA 4J1NA 4KTVE 4Q34A 5KIAA 1GT91 1ODIA 4TUYA 3L7OA 1JFTA 2DLCX 2WABA 4ZVMA 1U2DA 2DJ5A 1UBKS 2ZWPA 1Q20A 2QN6A 2GNAA 3DR3A 2NM0A 2IVFA 4UEOA 4E2FA 4AKHA 3WJ1A 4Y1GA 2JIZD 3I9JA 4X45A 3N2KA 1KQNA 3N2GB 3RRYA 1MJNA 5AK6A 1QO9A 1RC1A 2OLJA 1BD3A 2VQSA 1G6Q1 4M76B 4EKYA 2O8EB 5IJAA 3RADC 3L9XA 2RBKA 2BMDA 3D6FA 5BQOA 3W5CA 2WWYA 1CV2A 3TQRA 1FA9A 1XTKA 2AFHB 3VUFA 4UPEA 1XYYA 5CA0B 1PJRA 4CMIA 4A5OA 5ALJA 4ANFA 4P4SB 1IN6A 4BIIA 5COAA 1S2LA 2PBRA 2Y2VA 3P0RA 2H4HA 5B1YA 1FFSA 1TPZA 3V4SA 1E1NA 1SPXA 2LWIA 1WUJS 2QTVA 4TKUB 4KN6A 2QS9A 3VR0A 5K6AC 1JQ3A 4JYAB 5CFOA 1SKYE 4D4HA 3HXKA 3TD2A 2V6BA 2F2TA 1Y1TA 4TTVA 1BQEA 3AYXB 4WUTA 3RIGA 3DTVD 2FF7A 2VRCA 4DUGD 4ZKDA 2UXCB 3KEGA 3GUHA 1G16A 1HTBA 2ARKA 4URHA 4Y9RA 4A2WA 4JGGA 2UZ1A 3LP5A 5BW5A 5JNWA 4PINA 4CL3A 1AUVA 4HNGA 1LNZA 2FN8A 1PQYA 3B7GA 4I4TF 1UMBA 5AI0A 3V4PB 4R41A 2Q21A 2UUCB 4I9UA 4CG2A 1YZHA 2HT6A 2WVGA 2C2GA 4QSHA 4EHLA 1OLSA 1R18A 3E18A 3M6AA 1FE8A 4R3WA 3RSHA 4A8PA 5JYCA 2WHYA 4KVGA 1ZW1A 4YY3B 2ECKA 3LAWA 4KR9A 3A4IA 5HUJA 1QDLB 2G1JA 3K0CC 3Q3HA 3QY9A 2JLZA 1CUBA 2FXVA 2H8GA 3CEJA 3L0DA 3N0TA 2Y67A 1EZZA 4GYKA 4A8JA 3QVTA 3I9LA 3MJCA 2WAOA 2XTJA 4WOCA 3EIUA 3MWDA 3TMAA 3UUGA 4DB2A 1HE3A 1MFPA 2RI0A 3MVEA 2CDNA 5HBGA 3UMFA 3NDBB 4F72A 3HCEA 4LVOA 2J3LA 2Z2XA 1AKUA 4QYXA 3MTQA 1Z45A 1RVDA 4Y1FA 5HGJA 3WLQA 2BISA 2KMLA 4WVLA 1E9VA 3PENA 1U1FA 4V2IA 5T3YA 4CIYA 4RC9A 3UMMA 2CNOA 5E3HA 4K0RA 4D96A 2QSJA 3U7GA 4V2UA 1VA4A 4YAIA 1EGMB 3JRNA 3KFLA 4XKJA 3SY8A 2ZW9A 3LCUA 2H3EA 1XZIA 1ECGA 1RWXA 3PE3A 4KR3A 2O59A 1E9AA 1BNCA 4I5IA 1UBSB 2QX9A 2VP9A 4MRSA 4QNRA 4HTFB 3RJMA 3ME5A 3QXGA 5FX2A 1LDMA 1EAMA 1BKYA 5L4LA 4YXWA 3M6XA 2CKDA 3MD0A 1YKSA 3PCXA 2QLNA 1KFJB 3KQOA 3QPUA 4BE7B 1AZWA 2YL2A 3ORFA 2D1RA 4PSUA 5ALXA 3RT1A 1HR0B 3DPIA 1ZC4A 3RBAA 5TPZA 2ZRFA 2A1UB 2J9FA 4F12A 4GBJA 1TFUA 1DBIA 2YN0A 1FFAA 1QUFA 1PL7A 2NVBA 2FXIA 4DMRA 4ZT2A 3TUJC 3GN2A 1RU3A 3NM4A 2RJNA 1KGDA 4EY6A 3JYQA 5CEFA 1OH5A 1REQB 5HZKA 3QKRA 4Q12A 4Y2PA 1I6LA 1W49A 5J5VA 1COZA 2XHZA 3EA5A 2CY0A 3O93A 4QD3A 1QRUA 2XKBA 1THTA 3IMCA 4NJOA 4PTZA 2QRKA 1R6UA 3HDVA 3WLLA 1WUHS 4DRXA 2RC6A 3L06A 1BEZA 3LX4A 4QIHA 4U9IS 4WX2B 5K9ZA 3EXHA 2IWHA 4MA0A 3UPTA 2V3CC 1R3UA 3ROEA 4GPAA 4KRXA 1Y8CA 1PLLA 2D2FA 3K0KA 5KPDA 2GZMA 3PGMA 1AS3A 3PTAA 1VI5A 5AUQA 1H6DA 4KQCA 4ALLA 3QYPA 4MWGA 2JLXA 1GJRA 2ODNA 4N5MA 4EYSA 3S6JA 1WMSA 1Z0KA 5HZHA 3SZGA 2I7XA 3OFKA 4MUHA 5KC9A 4TVKA 2XBLA 2IPMA 2ZE7A 3OSZA 5H9VA 2OB2A 2WMDA 4DXDA 2EW8A 2R00C 4JOSA 1NVBA 1HYGA 4DLAA 1B23P 2V9PA 3ZQJA 2AGVA 4LC9A 1XZGA 3NNDA 1W36D 1YRLA 2ZUSA 5B57C 2APJA 3L7LA 4XX1A 4WGFA 3CH5A 3MJFA 2DT8A 5ADVA 4LV5B 1UM9A 3CBQA 2W48A 4G5GA 2O8VA 2BIFA 1CQXA 3LBIA 2OGWA 2YNMA 4QSMA 1RIIA 3AJDA 4BPRA 4ESEA 4COKA 4Z1MD 2X19A 3Q3EA 1E79D 1SCIA 1D9ZA 2JHFA 3OJXA 4B3CA 4EYEA 4HSEA 3R7WA 4KXWA 3N8DA 4QDUA 4XJXA 4X60A 2PYZA 3J7AC 3FDIA 2C07A 1DUSA 1DC8A 2XMGA 4NBTA 1OX4A 5A0FA 4B7XA 4B3HA 4EF6A 1I0IA 4N54A 5I6DA 1O96A 1TUBA 1OPXA 2QX7A 4MJ7A 4UTRA 3B3FA 1J8FA 2AF3C 5G4KB 4ARCA 1G8AA 2ZWMA 1JR2A 5H70A 5FL7D 1Y9DA 1GG8A 3W2HA 4EFDA 1KYXA 3RB8A 3U13A 3P5SA 5BQPA 2PL1A 1GA1A 1J5PA 1E5VA 1R27A 2XDQB 1YZLA 2YJ3A 3OQPA 4RAOA 3PHLA 2I2WA 1ZITA 4BZXA 4GDMA 4BMVA 3OWXA 4EG8A 1O4WA 1RFGE 2B92A 2F3SA 3VZRA 2BHSA 2JGDA 1ST2A 3EEOA 2C31A 2QE7A 4H1UA 5DEOA 2ZSDA 1W6UA 2ID7A 1SU7A 4GOXA 1RXEA 4DAEA 3L1JA 5A4IS 3O4HA 4OK6A 2XEXA 2WYHA 1L4NA 3K94A 4PV7A 4X0EA 3MMSA 1KFCB 4X91A 5FLEX 2VSFA 3HU1A 3CM0A