1KC1A

Crystal structure of dtdp-6-deoxy-l-lyxo-4-hexulose reductase (rmld) in complex with nadph
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
298
structure length
298
Chain Sequence
MNILLFGKTGQVGWELQRSLAPVGNLIALDVHSKEFCGDFSNPKGVAETVRKLRPDVIVNAAAHTAVDKAESEPELAQLLNATSVEAIAKAANETGAWVVHYSTDYVFPGTGDIPWQETDATSPLNVYGKTKLAGEKALQDNCPKHLIFRTSWVYAGKGNNFAKTMLRLAKERQTLSVINDQYGAPTGAELLADCTAHAIRVALNKPEVAGLYHLVAGGTTTWHDYAALVFDEARKAGITLALTELNAVPTSAYPTPASRPGNSRLNTEKFQRNFDLILPQWELGVKRMLTEMFTTTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords dTDP-glucose oxidoreductase
publication title Variation on a theme of SDR. dTDP-6-deoxy-L- lyxo-4-hexulose reductase (RmlD) shows a new Mg2+-dependent dimerization mode.
pubmed doi rcsb
source organism Salmonella typhimurium
total genus 98
structure length 298
sequence length 298
ec nomenclature ec 1.1.1.133: dTDP-4-dehydrorhamnose reductase.
pdb deposition date 2001-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04321 RmlD_sub_bind RmlD substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1kc1A01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1kc1A02
4FOOA 4AJJA 1E6EA 5A9RA 3IUSA 1T2AA 1O8CA 5G4LA 1DAPA 8ADHA 4P4NA 2GF2A 5AVOA 3V2HA 4P22A 4CLDA 3IL2A 4DGSA 4W9NA 2Y1GA 2UVDA 2NADA 3OP4A 3SJ7A 1T2EA 2WWRA 1U28A 4IJWA 4BNHA 3PDJA 3U4HA 3VKUA 1XU9A 2BI8A 2YV1A 4CMEC 1Z82A 5JMWA 1X14A 4YJDA 3HHPA 4WLNA 1YBAA 3F9IA 5JDCC 4GPD1 3SBOA 2FR8A 3C1TA 3HWRA 1UH5A 1A4UA 3OEWA 1R6DA 1C3VA 4QUKA 3NDJA 4NFSA 5ITVA 2PD3A 3CINA 2VHZA 5F5LA 3KTDA 4FGSA 1GAEO 3L9XA 1E7WA 2GNAA 4XD2A 2UUPA 1SC6A 4LRSB 1SOWA 3S1LA 2PNFA 1NQAO 2GN8A 3FPLA 3AUSA 3ZHBA 1D1TA 1PR9A 3RVDA 4XZ3A 5KVVA 3ROKA 3DZKA 5FI3A 4A73A 1T4DA 3QLJA 1GV1A 2GYYA 4K1LA 1HLDA 2NQ8A 3OJOA 1ZVMA 1I3KA 1YE3A 3UUWA 5TT0A 4DPLA 3HZZA 4E5YA 2B5VA 4I9HA 2GDZA 1ZBQA 1W6UA 3K2EA 1NX6A 4INAA 1G6KA 2VUUA 4DPMA 1C0IA 4ROSA 4UREA 3ZWBA 4URFA 3E5MA 3KBOA 4R69A 1EE2A 3PWKA 3Q6IA 5KCZA 3DTTA 3M2PA 3Q0EA 4EYEA 3FR8A 5TGDA 1LC0A 4OO3A 3SJUA 2P5YA 5L7YA 4B7UA 1SCUA 2Y1OA 3GGOA 1V35A 1Q0QA 2Z95A 3OH8A 2VYVA 4LISA 3C85A 2JHGA 1DAOA 2PGLA 2OL4A 4GQAA 1VSUA 2QQ5A 4ZJUA 2DVMA 1N9GB 3PRJA 5T6BA 1GDHA 3LDHA 3W8DA 4CLRB 1GD1O 3U4DA 2FRDA 3MJVA 4OJNA 2BD0A 4J91A 1RKXA 4FGWA 5DP2A 2GZ1A 4DXHA 3RCBA 3PHGA 1ZFNA 1ZSNA 4HP8A 4YJFB 3DMTA 4E3ZA 1EVYA 5ENVA 5I9LA 3DTYA 1XQ1A 3WYBA 2YFHA 2HRZA 2G82A 3C1OA 1ZK0A 1TLTA 3ZU5A 5FEUA 4UEOA 3WMWA 4MPDA 2XF8A 2FZWA 4YAJA 4CLXA 4IXWA 2HLPA 2C59A 3JQEA 2X5KO 4RZIA 5CDSA 4J7UA 1H2BA 1QKIA 2H5LA 2I99A 4PLGA 4UVGA 1MFZA 4EZBA 3QWAA 3P2OA 2QRKA 3DDNA 4Y9DA 1S7CA 3VZQA 2XXBA 2B5WA 3H65A 3RC2A 3PFWO 3LLVA 3CSDA 4M54A 3GPIA 4GKVA 4PCVA 4EI2A 2Y66A 2CVZA 4IXTA 1FXSA 2HK8A 1E3LA 4FFMA 5TC4A 3WSVA 4RL6A 1B7GO 4JN6B 3U4CA 4RPLA 3CH6A 5CP8A 5DCWA 4L4SA 4TSKA 1RM5A 3ZNQA 1ONPA 3MJEA 1GADO 1FMCA 4OHUA 1BGVA 2V6BA 4RVGA 4BO2A 4CR6A 1JA9A 5A1TA 5DOZA 2DLDA 3GGPA 2PH5A 5ES3A 4CMGA 3DWFA 3ITKA 1U3WA 3AI3A 3JCZA 4CMIB 4WCFC 3KLPX 3PWZA 3T4EA 1UXKA 8LDHA 4WKGA 2FR0A 5L7TA 4BO1A 2Q1UA 3ZU3A 4CMKA 4UAGA 5I7VA 1KOLA 1H93A 4R54A 1R4NB 3IP3A 3Q2IA 1ZZEA 3ZWOA 3D5QA 4XR4A 1UAGA 5HTOA 3DHEA 1DIHA 3W4JA 3WR5A 4YYZA 4N5MA 1WLYA 1YS4A 4HV4A 2WYVA 2X6TA 3JQGA 1DRUA 3ONEA 3H2ZA 3KYCB 3QP9A 4J3FA 4MJLA 5BNIA 1PS9A 4R1NA 1X7HA 4XGKA 3SC6A 4FB5A 2CF5A 3NJ4A 4XYLA 2PFGA 2FWMX 5A9SA 5EERA 4JBHA 2O4UX 3IIEA 4Z9FA 5ER9A 2Z1MA 1I30A 3RC9A 4E31A 1LI4A 2ZB7A 1AGNA 3E9QA 4OXYA 3GFBA 3VDRA 3DL2A 4RF5A 3VTFA 3FTNA 1HL3A 3ZWPA 3GVHA 4UUNA 4OKNA 3EC7A 4AJHA 1LDEA 1KVUA 1QMGA 1H0KA 1YBMA 2J3HA 5G0TA 2OGUA 4JLWA 5TQVA 5HS4A 4DLAA 4R68A 5EESA 4HFMA 2OMEA 2H1SA 3JYPA 1GYQA 2NTVA 3LSYA 4L0QA 4E5KA 1Y5RA 2VZ0A 3FCOA 3IQDB 2I3AA 4OOEA 4EEXA 4NZ9A 4WOKA 4LGVA 1HZJA 1C14A 3B6ZA 2D0IA 1I2CA 4U0JA 3A4VA 2UAGA 2SCUA 4OMUA 1UP6A 4CPDA 2G0TA 3QVOA 2O23A 4PG7A 1B15A 3ENNA 5H83A 1BW9B 2ZCUA 5T64A 3WQSB 4D0SA 4N5LA 2HMUA 2VHWA 1ZEJA 1KY4A 5C37A 3D3EA 1H6BA 4RQTA 3ZV4A 4AFNA 2ZATA 1JTVA 5A05A 4ZGWA 1ADCA 4D45A 2OFPA 5BSHA 3L4SO 2BMAA 3PZBA 2FPPA 4GLLA 3TZCA 3NKLA 4II2A 1ULSA 1JKFA 1ZIDA 1AXGA 1QLHA 4BNIA 3KYBA 4MIYA 4ALIA 2JD1A 4YACA 1AXEA 4JJIA 1XR3A 3WBBA 2P91A 4EJ6A 1B8VA 1A4IA 1BXZA 3UCXA 3JQFA 4DVJA 4XYEA 1SAYA 3QVXA 4J1TA 2UUOA 3WGZA 2NQTA 3O26A 2W90A 2IXAA 2Y68A 5T8KA 4UUPA 5DF1A 4BNKA 1HZZA 2F1KA 2VHYA 3UICA 1YH3A 1EVIA 1M75A 4NBRA 4L4RA 1I3NA 2QYTA 2V7PA 1YB5A 4G2NA 4Z9YA 4XEHA 1WNTA 1E7MA 1SB8A 2PR2A 5U4QA 1P1HA 2YFQA 4WNIA 2VTDA 2O3UA 2EEZA 4TZKA 1DEHA 1N1GA 1W4ZA 4TKMA 1CWUA 4K26A 4P8RA 2LDBA 1JAYA 5JPIA 3BMCB 3NT4A 3VPFA 3T7CA 4HXYA 3BIOA 5KJFA 3JSAA 1A7AA 2CY0A 4LSMA 4R9RA 3O03A 1DHRA 4B7CA 4CLRA 3JQ9C 5H82A 2OO5A 3G49A 4ND2A 1ZMOA 3E5RA 3UOGA 1MG5A 1Z7BA 4MIEA 5COBA 1W0CA 2RBEA 4HX5A 3I3OA 1NR1A 5CDUA 3H5AA 3OFSA 2IZ1A 2O3TA 2BFMA 3NDIA 4CM9A 1SZJG 3PIDA 4TVBA 2FZEA 5L40A 1DLIA 5F3RA 3MTGA 5F5NA 3DAFA 3F47A 1NAIA 1ZK1A 1FDWA 2WE7A 5EINA 5L95A 1E7QA 1KS9A 4WLEA 3INTA 4BNZA 2G5CA 3HNPA 3DR3A 5TS3A 1Y81A 1PJTA 4OM8A 2B4RO 4GX5A 1YGYA 2TMDA 1MC4A 4OXNA 4S1VA 1ZKMA 2X22A 1WDKA 1YBVA 2OBYA 3ITDA 4KMSA 1CDOA 2JJYA 3UH1A 2OHXA 4MKXA 4WLOA 3UHAA 1GQ2A 1U3TA 3PP8A 2JCVA 1HSOA 2E48A 4RPHA 2R00C 1AHIA 1G0NA 3HUDA 4GWGA 1QV7A 4MKZA 3DBVO 3JD0A 1A9ZA 4KWIA 3SXPA 2EV9A 2OP0A 3ZNPA 3PYXA 3WMXA 4CUZA 1JKIA 3PGXA 3R3JA 2HQ1A 2EKQA 3RUEA 1KVTA 2H9IA 4YQYA 4CLHA 1N92A 2I9PA 1YL5A 4N5NA 4L75A 2ZB3A 2NU7A 3BMQB 5JO9A 2C54A 3OIDA 4AJNA 3VPXA 1E3IA 3Q3CA 3MTJA 4IUYA 3Q9NA 4R3WA 4WLFA 1WDLA 1GR0A 1U4OA 3KLMX 5FFFA 3ZHXA 3HADA 3ZWXA 1R37A 5C7IO 2I66A 4F3YA 3GN2A 4IDEA 3PLRA 3MJSA 1E1MA 3R3SA 4IDFA 1U7HA 3TZQA 3JD1A 4Q3NA 3EUWA 2ZJ1A 4MVJG 1WAMA 1MXFA 1E1KA 3HDYA 4XKJA 3FWNA 3TL2A 1Z74A 1IPFA 1X1TA 2B0JA 4IIUA 3N7UA 1YRLA 2ZQZA 1DSSG 2EP7A 4BV8A 1NR7A 2P9EA 1HT0A 1PGNA 4WUVA 3F5QA 3WJAA 3U3XA 3DXFA 4UVEA 4PVCA 3TDKA 3INRA 4RVSA 4GX2A 1M6WA 1SO8A 4D79A 1YL6A 3AM4A 3IUPA 4O1MA 3D0OA 5T5QA 1QXSA 5I8WA 5B4TA 1BMDA 3QVSA 4B79A 2V6MA 1DIRA 1P1IA 2PA3A 1V8BA 2ZYAA 2ZTUA 4CM5A 1SMKA 4IJVA 5BSFA 4RZHA 3BMNA 1UZNA 1MG0A 4B4OA 5CDYA 3QQPA 1KEUA 4ZVVA 1NTOA 3JQ7B 1BVUA 1X0VA 4E13A 5JDCA 3RUCA 2PKQP 1CJCA 4AJPA 2WDZA 2UDPA 1ISJA 1UZLA 1E7SA 2FMUA 3FBGA 3R6DA 3RBXA 2J3KA 3UF0A 1C1DB 3PGJA 4PZCA 1NHWA 4BO4A 3RFXA 5T8KC 1VL8A 5FF9A 4EUFA 1P9LA 2O2SA 1WMAA 3B20A 4XWYA 5JDIC 3PQDA 2X58A 2E6UX 4G81A 1QYWA 2EERA 2OUIA 1BW9A 1XLTA 4NFHA 4A7PA 1PSDA 2WM3A 1U8XX 4IDAA 3MJTA 4GGPA 4YT4A 1PIWA 2CF6A 2AHRA 2EW2A 2Y1EA 5JNLA 1JVSA 4YBZA 4MDHA 1U1IA 4NU6A 3AM5A 4BKPA 2X5OA 1J49A 1DO8A 1M6HA 3E48A 3VH4A 1EUDA 5ICMA 2UYYA 4BKUA 4EUEA 4DYVA 5L4LA 4IDCA 4MIOA 3DHYA 1MB4A 3IC5A 1XGKA 1IYZA 3TSCA 1Y8RB 2IE0A 1FDVA 3GHYA 3HB5X 6ADHA 2X0JA 4FC6A 1P74A 4IM7A 2O50A 4Z3KA 3DAGA 3V1TC 1IL0A 4LVCA 1YKFA 3OJFA 2CNBA 3KRTA 4YRAA 2Z5LA 3LF1A 1LXCA 1LSJA 1GL3A 4NH4A 4R4JA 1Z73A 3GH3A 3ORFA 4NPCA 3WB9A 3GQVA 1B8PA 3AOGA 5F21A 3S2IA 1XKQA 4RLHA 2O3RA 4RCVA 4BO8A 1DLJA 2PKQO 3H9EO 3L9WA 2CFCA 3O4RA 2D59A 3G79A 4BO5A 5L51A 1A9YA 2FR1A 4WNCA 2W98A 3CTMA 5G0SA 1YXMA 3VVBA 3KOUA 2HSDA 3TZ6A 4IZIA 2WYWA 3AI1A 3Q2KA 3TNLA 1H9BA 3FNEA 1A27A 1E77A 4BB5A 3SLGA 4CR8A 3ZV5A 2Q1SA 4O59O 2JKVA 3PJGA 5CAEA 1PJLA 4F6LA 2JD0A 1HE4A 1NM5A 3GF4A 4K6CA 4ZQFA 2GASA 1ZH8A 4M1QA 4Y67A 3RJ5A 3TFOA 1ARZA 2Q4EA 1EUCA 3BTOA 1V3VA 4YJGA 5EPOA 1WWKA 4JIGA 3FD8A 3ZWCA 2E82A 3DBRA 3OQ1A 2QW8A 4CMHA 1M76A 2O3JA 5ITWA 4XJTA 4F46A 3KVOA 1ZNQO 5IDXA 3UN1A 4CODB 3ZZNA 4L73A 3VC7A 2JFFA 1DFIA 1B14A 3MWEB 1LSOA 3C7DB 4LCEA 4E32A 2DBVO 1NBOA 4BGVA 3LT2A 3WGIA 1A71A 3GAZA 3EZYA 1OBFO 4NBUA 5JXWA 4ND1A 4Q3CA 4CV2A 4ZRNA 4C7JA 2X7HA 3F4LA 1DHTA 5JCJD 2W2LA 2PH3A 4KZPA 4G5HA 1T1SA 4YJHB 3WWZA 3M1LA 3VHRA 2B69A 2NWQA 3QSGA 4J1NA 3P7MA 4XDYA 5I8ZA 3S2FA 4J7CA 4BMNA 1YQGA 1DOHA 4CV3A 4B8WA 4BB6A 1X7DA 2PKRA 4WCFA 2XOXA 3AUTA 5IDYA 5L53A 2AQ8A 1RM3A 4FFPA 3GN1A 1RYDA 3OMLA 4IPTA 3R0IA 3CMMA 5F1PA 4GGOA 1T2FA 5H81A 3S2GA 2Y99A 4BO3A 2D4AA 4J9UE 4DIBA 1JWAB 3D64A 3BMQA 1BG6A 2Y1FA 5JSFA 1Y1PA 2VHVA 4RDIA 4KP7A 4Q3BA 1PL6A 4HY3A 3WLEA 3U09A 4K6FA 1XYGA 3JYQA 4FDAA 4BGIA 1PGPA 1UXJA 1KVSA 2YQ4A 4W6ZA 3DQPA 2VT3A 4I9NA 3RI3A 3RFTA 5IDWA 4PG5A 1VL6A 3EMKA 3S55A 2HDHA 1M66A 2QRJA 2VHXA 3QVWA 3GDFA 4E6PA 3PFFA 4C4OA 1GV0A 2JD2A 1IULA 4YCAA 3T4XA 1TA4A 1Z75A 1E5LA 3A28A 4DL9A 3S8MA 5DN9A 2QHXA 4JP3A 1YB4A 2YDXA 3B70A 3V1YA 1ISGA 3CZRA 1P0CA 1F06A 4W4TA 3HN7A 3QY9A 4IQGA 3JQBC 1NPDA 2NNLD 1ENPA 3LC1O 1A7KA 5A06A 1HDRA 3QWIA 1R0SA 2HCTA 1J0XO 1P1FA 1MA0A 4GSLA 1UDAA 1NYTA 5JAIA 4LCJA 3K8ZA 1JWBB 4DMLA 1GQQA 3VH3A 4DBVO 4RF4A 4CQMB 3TZHA 3UXYA 5C5IA 2W4QA 2EIHA 2R2GA 3BA1A 4QECA 2ZTMA 3EGOA 4Y98A 4DQXA 1O9BA 2WYUA 3GNSA 2BGLA 3MJCA 1VKNA 2J8ZA 4PRLA 4DTIA 5JMPA 2HUNA 1SEPA 4GX0A 4DPKA 2C07A 4BMSA 3ASVA 3S2EA 4WJZA 4KQXA 4M55A 1MV8A 2P5UA 1QG6A 2RH8A 3I9KA 3RC7A 3K6JA 4HWKA 4Y8VA 1IHYA 3OA0A 5T67A 2NU9A 3WXBA 2IEDA 2Y0EA 1F0YA 2B4QA 2D8AA 3JQ7A 1L1FA 5IN5A 3H5NA 4QSMA 4LSWA 4I8XA 3HJAA 4J16A 2QZ9A 4Y6SA 2C2XA 1C1DA 1E3EA 1QR6A 3G0OA 4NK5A 4OH1A 4E4YA 3JTMA 4D0RA 4BNGA 4D42A 4E5NA 5L9AA 4DA9A 3PDUA 4ILKA 5AQ1A 4FFNA 4YA6A 4PVDA 3FWZA 5DOVA 1BXGB 5KTKA 4CMJA 5DBIA 2HK9A 2PLAA 3WBFA 1VLLA 4BGEA 1LEHA 1GY8A 1ZCJA 4ZHSA 2VTEA 4ID9A 2JAHA 3RAJA 3EDMA 4PGFA 1JAXA 1X1EA 3D3WA 5HRUA 5U1PA 5JC8A 2VYVD 1WXDA 4BGUA 1ADBA 3BTVA 4UVIA 4CUJA 1ENYA 1XIVA 4YAIA 4U6SA 4PLWA 1K89A 4OXKA 4FFOA 4U8GA 2Q45A 3GNQA 2YZ7A 1Y8RA 2DFVA 3VDQA 3TZKA 3QIVA 1QYDA 4FR5A 3X2FA 4E0BA 4XYGA 2Y0DA 5KIAA 4RGBA 4DBZA 3WQQA 1VKOA 4ZQEA 4OAQA 3LC2O 3WTBA 2IXBA 3H9UA 2DUWA 4AJOA 3GG2A 4AJ4A 1QLJA 5L7WA 5CPBA 3B1KA 3U4IA 4M87A 4CM1A 2DFDA 1L7EA 4PIVA 3NT5A 2B35A 3DBHB 4DC0A 3BTSA 3PZRA 4B4UA 2BFPA 1MLDA 4ND5A 3WFJA 3GVXA 3JQ9A 4TRMA 1KEPA 3WTCA 4MINA 3BMOB 2NVWA 3DHNA 1GU7A 3OIGA 1PJ2A 3KUXA 3C1AA 4MO2A 4EW6A 1E6WA 4RF3A 4WOJA 2FSVA 2J3JA 5MDHA 2GPTA 1LNQA 3VKVA 4BHTA 1E7RA 4B3JA 3NEPX 1MP0A 3V2UA 4R5HA 4J90A 5JC1A 2DAPA 1YJQA 5A5FA 1Q7CA 1WPQA 1QORA 3AUAA 3ZH2A 1Y9EA 4Z3DA 4C7KA 3DO5A 2Y67A 3ANMA 3JYLA 3GOHA 1DC6A 1WDMA 2IZZA 3PPIA 4ND3A 4BNWA 1ISHA 1IZ0A 5LDGA 4CUKA 3PXXA 4CLOA 5TNXA 3CXRA 4IGEA 5U9CA 3GHHA 3WGTA 4CMCA 1XU7A 4ZD6A 5THKA 2O3SA 4L74A 5AXAA 2Y93A 4J6FA 1H6AA 4FFLA 1HTBA 1PEDA 4GWKA 4DREA 5A4DA 2IYOA 3HB4X 3TL3A 1XWFA 1GUFA 2R00A 3SVTA 2CDCA 1QSGA 2G76A 4R41A 3ANNA 4Y6PA 4PZEA 5ER6A 5ENDA 4R16A 4H15A 1O95A 4U0KA 4BNTA 2JAPA 3BAZA 3HE3A 4LRTB 3LT1A 4YJHA 3UFXA 5JCXA 1D1SA 5A04A 4RPGA 3QHAA 2V65A 5IJZA 1B2LA 3GY0A 3W4KA 3C7AA 3OSUA 2J6IA 5EL0A 1NHGA 5THQA 2FN7A 4FJ0A 4A26A 3C8MA 5K6AC 2IODA 4WK6A 3DZGA 2VWQA 1V9LA 3EVTA 1OC2A 3G3EA 3WLFA 1X0XA 3PHHA 5ILOA 2FY8A 5JFOA 2VRCD 1K6IA 3PK0A 3Q11A 4J1SA 4QX6A 3DMYA 2Q1WA 2C82A 3RSHA 3GEDA 5IAAA 1PJ3A 4MP3A 4CM6A 2ZKLA 5L3ZA 4R3NA 4Z0TA 4B8ZA 4DMMA 1B0AA 5JW6A 3OA2A 3OJEA 1FDSA 3K31A 1DC5A 3B1FA 4YVFA 1GEEA 2VCYA 3CIFA 1CF2O 3WX0A 1K5HA 1O94A 2BRUA 2X9GA 3ZW9A 5AYVA 3PHJA 5JAMA 4DYDA 1SPXA 3NUGA 2J5RA 4CJXA 5G4KB 1RJWA 3F4BA 3IJRA 3UW3A 4BO6A 4DQVA 1DIAA 1WZEA 1PGJA 2H6EA 3EAGA 3U62A 4CV1A 3COSA 4MVJA 1HYHA 4FW8A 1I8TA 3EK2A 1B26A 2E49A 2YV2A 4FCCA 4O6VA 4BL5A 1PL8A 4DLBA 4CQMA 4OSOA 1W8DA 9LDBA 2GN9A 1IPEA 3TRIA 1ZUD1 1NPYA 1JVBA 1EBFA 4XQ9A 1ONOA 4A10A 5JY6A 3PYLA 2FHSA 3CUKA 1GYRA 3W8EA 3ANLA 3OEYA 4IS3A 3PYMA 2NACA 3HG7A 5DNAA 5A3VA 1O6ZA 1UP4A 2Y0CA 2CD9A 3KB6A 1CEQA 5CEEA 4ZN6A 4BNXA 2YQ5A 2GN6A 2HRBA 5T57A 2BFOA 2GUGA 3QJ5A 3RASA 2QIOA 3GZNB 4CM8B 4ESOA 3NTOA 1U9JA 5JDIA 1A72A 3LQFA 2DC1A 5I7EA 1O5IA 2DTDA 3GDOA 3V8BA 2G17A 1XELA 3LC7O 2WD7B 4YRDA 2W2KB 5LCXA 4Q9NA 3QE3A 4R1UA 3ZI0A 4B4WA 2Q46A 2P68A 1EEHA 1F14A 3FNHA 3OQ6A 1P77A 1T26A 2VRBA 1PQUA 1PX0A 3RKUA 3GRKA 3H3JA 1OMOA 1KETA 2VQ3A 2Q2QA 1PS8A 3PJEA 1OZAA 4PLCA 2BFAA 1N9GA 4QFDA 5DT9A 4NJMB 1NNUA 2B4TO 4NR0A 1EDZA 4AJ1A 2ZB8A 1KC3A 2EKPA 1R16A 3M1AA 3TF5A 2XXJA 1FJHA 3ROQA 4YJFA 1V6AA 3DAPA 2PTGA 1J6UA 1QYVA 1YOVB 2AE2A 3FR7A 3HDJA 3IOYA 2RAFA 4JBIA 3AY6A 1EK5A 4Q39A 3U5TA 3L07A 1GPDG 4XRGA 3FNFA 3DZJA 4BQPA 1LDMA 5CEFA 1QYXA 3WGOA 1YQXA 4NDNE 2QYSA 1P45A 2EKLA 3WGGA 4KTVE 3NAQA 3A06A 3DONA 3WSWA 4D46A 3F5SA 1IE3A 3EZLA 1AUPA 1P1RA 2DBRA 3ZHZA 3V5NA 5KNLA 2VYNA 3KSZO 2BF7A 1K2WA 4FBGA 5TF4A 2D3TA 4AJEA 3DBHA 4GVLA 4JX8A 4YAEA 3JQDA 1XSEA 2V6FA 1GCOA 1XHLA 1I24A 1H6DA 1P31A 3UAGA 1U3VA 3U9LA 3QA9A 4FJ2A 1EVZA 5DCUA 5KKAA 3BMOA 2G1UA 2IZ0A 1RM0A 3I9NA 5B37A 2Q2VA 3KHUA 4FOSA 3AW9A 4XR9A 2DQ4A 3D7LA 4ZQHA 3PWSA 1XA0A 2B37A 4FIZA 3RIHA 2Q3EA 1MUUA 2PY6A 2AEJA 2V6GA 3NX4A 4K9DA 1F12A 4HADA 2X4GA 2PV7A 3RC1A 2O48X 2VNSA 4CMIA 1GUZA 3AY3A 2OBNA 4X54A 1BSVA 1Z6ZA 4IMPA 2GN4A 3ONFA 4HUJA 1GZ6A 1KERA 3FRJA 3BHIA 4FQ8A 1R4NA 4OQZA 1EFKA 4JQCA 3FHLA 1U4SA 3KO8A 4EDFA 2NTJA 1DJQA 3WIDA 2GGSA 2RIRA 2ZYGA 5IZCC 4BNFA 4WPGA 2GERA 1H5QA 1YO6A 5TSDA 3BYZA 1N7HA 3X2EA 4AJLA 3KYCA 3OETA 4E2YA 5AOVA 1B3BA 4YRBA 1IHXA 3OIFA 4BO7A 1P33A 5JAQA 1O89A 4NMHA 1F8GA 1NVMB 4A2CA 3WG9A 3K30A 4TKLA 3VTZA 4LW8A 4PLPA 4OOFA 3VH1A 1U3UA 3OICA 3QWBA 3HSKA 5TJ9A 1YL7A 3EVNA 2YW9A 2DBZA 1XG5A 1NPTO 1G0OA 2I3GA 1DPGA 1EK6A 2A4KA 3EYWA 3JQAD 5EIOA 4NHEA 2BGMA 2HU2A 1KYQA 4UEKA 4PLYA 2C29D 4BKQA 4J4HA 5B12A 1E3SA 4I5FA 5G0UA 2B36A 1YJ8A 4PG6A 1ZO8A 1C1XB 3IS3A 3W6UA 4DQUA 2WSBA 3PTZA 2POQX 5A9TA 2I5PO 3WDSA 3HDQA 1R0KA 4RDHA 3ZU4A 1D7OA 4MP8A 2YUTA 1NASA 1YWGO 3CE6A 3JQBA 3MOIA 5GZ6A 3OF2A 5KVSA 3OQBA 5TJHA 1DXYA 2HJRA 1VL0A 1IOLA 4NNJA 2GSDA 1S6YA 3GUCA 4BIIA 3GEMA 3SC4A 3GRPA 3P5SA 4CQLB 3KYDB 1E1NA 3KSUA 1NAHA 3B1JA 2OOSA 2EHDA 1X13A 5GMOA 2Q2WA 3DEYX 4LN1A 1JW9B 4KTTE 3WQRA 3ETGA 3LK7A 4RPJA 2HO5A 4JBGA 2R6JA 3G1TA 3TOZA 4NU5A 4YT5A 1GZ4A 3H5RA 4IQ0A 4I1IA 1J5PA 2AG8A 5C7OO 4J9VA 2ZK7A 1G1AA 4MVJE 4LVUA 1ML3A 2HMTA 4UVHA 2O4CA 4RLSA 2GR9A 2RH4A 4PLZA 1PU2A 3E1KA 2EJWA 4L8VA 1BXKA 4JJGA 3KM0A 4LK3A 2VUTA 5B4VA 2XPCA 4J0FA 4EBFA 1N5DA 4KUGA 3CEAA 4I9UA 1Y9AA 4BNYA 5CG2A 2EWMA 3AFMA 4XJSA 4YDRA 3AK4A 2UV8A 2VT2A 2WE8A 3TN7A 2FPIA 1VE9A 1OAAA 2AG5A 4QFCA 5JBIA 1WMBA 1H6CA 3O9ZA 3VZPA 3ZV3A 2W2KA 2A94A 2DTXA 1C0PA 2ZTVA 4J4BA 4BVAA 2O7SA 2Y1DA 2FPGA 4TRRA 4PLVA 1LUAA 1Q7GA 2VWGA 2NLOA 2PGDA 3E8XA 1EE9A 1Q1NA 3DZIA 3OJLA 5CEJA 3E82A 4R1SA 4ZU3A 3BMCA 1LSSA 4WLUA 4D43A 1UAYA 3GVIA 4I08A 4OKIA 4NJMA 2AW5A 3PQEA 3VH2A 3NGXA 4KQWA 3QV1A 2X8LA 1Y5MA 1Q0HA 1P1KA 4J0EA 4E2XA 1PGQA 4ZRMA 1NVGA 3IKVA 3WJ7A 1UJMA 3VAZA 3JQ6A 1LRJA 1JLLA 1GUYA 4D3SA 5C3MA 1HDOA 2RCYA 1N8KA 1YOVA 5COAA 1V3UA 4NI5A 4TMFA 5HBRA 5JAZA 4AVYA 1PZFA 4JNKA 4A5OA 2FSSA 1O0SA 2GZ3A 4HFRA 5I7FA 3ZCXA 3K73O 2BHLA 4FJ1A 4W7HA 3RWBA 1KEWA 5EQDA 1KBZA 4XGIA 4HFJA 4YT8A 2C5AA 1E0DA 1H2HA 2DUUA 2EXXA 4BNUA 1JKJA 2LDXA 5I7SA 5BR7A 1U2DA 3P19A 3EW7A 2CDBA 2VN8A 3LF2A 3E9MA 1LDGA 2X0NA 5AXDA 2E4AA 1NP3A 4IY1A 3ETEA 4J2HA 3DC2A 5EQFA 4JP2A 1P44A 3CPSA 4UEJA 5IG2A 2X5JO 3DOCA 4RORA 4H16A 1T4BA 3ZGYA 3GT0A 3IKTA 5JCJA 4ALLA 3ROMA 4AJIA 2I67A 4A27A 4YTEA 2AXQA 3AWDA 1PJSA 4RF2A 1PJCA 2I65A 5JS6A 3OECA 2W2LD 1I33A 1ZK3A 3O8QB 3A9WA 1UP7A 2X9VA 4BNVA 1TXGA 3UKOA 1R4MB 3O38A 4R01A 3RU9A 1HEUA 3GGGA 5JO0A 1BDBA 3TPCA 2PZLA 3QRWA 4RVDA 4TZTA 1T1RA 5CDGA 4YB8A 4E30A 2Z1NA 3WNVA 4IJUA 4BS9A 1PZGA 1QRRA 3DZFA 2OXIA 2JCYA 1ZSVA 2HMVA 1ZXBA 4IINA 4B7XA 4HBGA 2NVUB 1ISFA 3W6ZA 1K3TA 2E37A 3PI7A 3KXDA 3ZWVA 1DDOA 4L4XA 2DPGA 3PHIA 5KVCA 5IF3A 4KUEA 4W99A 1FK8A 4TROA 3ZWNA 3D1LA 3L4BA 1P3DA 1SNYA 5JLAA 3GPDG 2C2YA 1I36A 1KEVA 5LC1A 4Z9XA 2I6TA 4GVXA 3DZBA 2Q49A 3I6QA 3I9MA 5K0ZA 3I9OA 5K6AA 4RJTA 1RWBA 3OHSX 1VJ0A 2YYYA 3FPCA 3RUIA 4YAKA 3KSDO 3WFIA 6LDHA 4W82A 1T24A 3DB2A 5ADHA 2OP1A 2QG4A 3VZSA 1Y6JA 4BOYA 5L4NA 1DRWA 2Q99A 2Q4BA 1UXIA 3AOEA 5A02A 3GMDA 3W1VA 1OC4A 4IMRA 2JHFA 1YONA 3ZN2A 2VOJA 3IMFA 3F1LA 4JK3A 3LT0A 3CZMA 4U7WA 4PLFA 1GFSA 2VWHA 4MVJP 1C1XA 1PQWA 2HMWA 4TRJA 3ZHYA 1TT5B 5IZ4A 3IAHA 3MEQA 1DC3A 1DJNA 1UDCA 3I6IA 1CQIA 4E2ZA 3QWHA 3QVTA 2YY7A 4D3FA 2HKIA 3H9GA 4J1QA 3H8VA 3PLNA 5HM8A 3I1JA 3ON5A 3ZNNA 4E5MA 4WEQA 3D5TA 2O2YA 2ZCVA 3HDHA 3DBLB 4KUHA 2WD8A 3HFSA 2HK7A 3IJPA 3NRCA 4RQUA 4BV9A 1HDCA 4XYMA 4CQLA 4KOAA 5CFZA 3KYDA 4ZA2A 3ZV6A 5L45A 2AQHA 4WCDA 4MP6A 2ZB4A 1E3WB 4OSPA 1LSUA 1ADFA 3GK3A 5KJEA 2I76A 5EJ2A 3STHA 4Z6KA 4P4LA 3K9QO 1LBEA 1Z45A 2QZZA 2IDZA 1I3MA 4RVFA 4CMAA 1X15A 5BQFA 5IFLA 4PN3A 1BVRA 2QRLA 1NXQA 4EJMA 4I5EA 4DLLA 4PG4A 3MZ0A 4DUPA 3C7CB 2NVBA 7ADHA 1NFRA 2CDAA 3GLQA 4ITUA 3VZRA 4ND4A 2A35A 1GPJA 2YV3A 3VPSA 2CVQA 4E12A 5HA5A 3I5MA 1NFFA 3RD5A 4AG3A 4BUCA 3AU9A 3HQ4O 1ULUA 4N18A 1JU9A 5TX7A 1ZK4A 1BTOA 1A5ZA 4DIOA 4Z0PA 1Q2XA 1XQ6A 5DBFA 4EGFA 3AU8A 2D5AA 3WIEA 2O7QA 2NUAA 3GC6A 4G65A 3RBZA 2FOIA 1H9AA 1UDBA 3NTQA 4GX1A 2CSUA 2PWZA 3KEQA 3VPGA 3RJ9A 3AUUA 3WS7A 3F3SA 1LDBA 1Y7TA 4B4VA 4CL8A 5BNTA 1T2DA 5A3JA 2YHIB 3CMCO 3GVCA 3JYNA 1E7YA 1PZEA 1CETA 2EF1A 3HFGA 1VJ1A 2O3QA 4PRKA 1KVQA 4WASA 4XIYA 1LRLA 1MX3A 3BHJA 2NM0A 3G1UA 5A5EA 4BNJA 2ZJ0A 1FF9A 5CPFA 2BH9A 4L76A 3H3FA 2J5QA 4NK4A 4BNMA 4FSHA 3U0BA 3KZVA 4JGBA 1HE2A 1VSVA 4MKRA 2CZCA 1UZMA 3ASUA 3ZU2A 4R5MA 3DFUA 3A1NA 5DDIP 3DOJA 3PEFA 4AJ2A 1KC1A 5DP1A 1PWXA 1U5AA 1PS0A 3E9NA 4M89A 2AMFA 3BHMA 2OORA 1EQ2A 3FBTA 3WICA 3NTRA 4CM3A 1NFQA 3E18A 5TRTA 1ADGA 3ST7A 2ET6A 5DBGA 3LVFO 4RV9A 4JXKA 1DBVO 4XQGA 2GLXA 3NGLA 3L4BC 2GO1A 3K92A 3VOSA 5ILGA 3ZWWA 4W9NC 4U5QA 3GDGA 1VRWA 4QO7A 1Y8QB 4M86A 1GEGA 4MVJH 4XQCA 3AI2A 4Q3DA 5B4UA 4J43A 3O8QA 4U6QA 5A03A 4YT2A 2P4QA 1C0LA 3MOGA 4RVHA 1R4MA 1I32A 2J5KA 4E33A 5FWNA 1HDGO 5BNFA 1B3RA 2ZTLA 1UUFA 3JQAB 4R1TA 1ORRA 3WGYA 2GZ2A 3L77A 4IGFA 5FYDA 1LQUA 3RU7A 3AY7A 2EJVA 5IZCA 4XIJA 1R66A 3GFGA 4OQYA 2A9FA 4JJFA 2VRCA 1ZSYA 3AOEC 1YDWA 4HKTA 4K28A 1PJ4A 4GL4A 1MFPA 3D4OA 2PGJA 2FP4A 2WJPA 1CIVA 3WYCA 2BI7A 5TLSA 4UUOA 2NVUA 2C7VA 1IB6A 1U2GA 3H6KA 5BSEA 9LDTA 1LU9A 2B83A 5C7LO 4XQEA 3BMNB 3RUHA 2VZ9A 5TIIA 2J3IA 2C5EA 4N7RA 5KJCA 2AE1A 4WECA 1TEHA 3N58A 2NU6A 2Y1CA 4RO0A 1HXHA 4DC1A 4YR9A 4F6CA 4E5PA 5MGBA 1PTJA 3RUFA 3TJRA 4ZICA 4ALMA 4RPKA 4GH5A 4DRYA 1WP4A 5JE8A 3RROA 2GCGA 3ZDFA 3JD3A 4PFJA 2DPHA 4FC7A 1GQYA 4GBJA 2VOEA 1VC2A 3GVPA 1DIBA 1QYCA 1WZIA 4GKBA 1D4FA 1WVGA 3P2YA 4FPXA 4MVJD 4ALNA 1PWZA 2W8ZA 2NV6A 4NBWA 1U8FO 3H9JA 4OGWA 3RUAA 4M49A 3JQ8B 4FS3A 2CUKA 3TFQA 3ZWMA 3ADPA 1EFLA 4CQMD 4XYBA 1JQBA 5KJ6A 3OBBA 1NQ5A 2X86A 1LJ8A 1TT5A 3ADOA 1N2SA 4YPOA 1M67A 3M6IA 4II3A 3DZHA 4XCVA 1VM6A 5FI5A 3JD4A 3QW2A 2Q1TA 3EHEA 3TOXA 3GAFA 2P9GA 2ZYDA 4FD3A 2P2SA 3LT4A 4XB2A 4BMVA 3DBLA 1I2BA 1E6UA 1OOEA 1ISMA 1TT7A 3C24A 1BXGA 1HE5A 4Z0HO 4GMFA 3DMTC 3VPHA 4OIMA 2VUSA 4AL4A 4IDDA 4MVJF 1WW8A 5I9MA 1E3WA 1I01A 2DT5A 1TB4A 3L6EA 3JV7A 4EUHA 5F1KA 3PQFA 3TQHA 3GNTA 1TVEA 2WEKA 3GR6A 3V2GA 3AM3A 3INGA 2A92A 2EP5A 4D3DA 4IQ8A 1I5RA 5KVQA 3RKRA 3SEFA 3PJFA 1R12A 4A03A 4XA8A 4CM4B 3U49A 5B1YA 1MC5A 3E03A 3WGQA 2JCXA 2PZJA 2C0CA 2Q50A 2WTBA 1HYGA 1MXHA 2WMDA 3IP1A 3BXXA 3H9QA 1K6XA 3H2SA 3I52A 2D5CA 1SBYA 4IS2A 5EMHA 5IN4A 2ZQYA 4NFYA 3M2TA 3ABIA 1D3AA 4MVJI 1VJTA 2DM6A 5BT9A 1HDZA 3C3XA 3SLKA 1NQTA 3PJDA 4B3HA 4CM9D 4LMRA 3GMSA 4YJGB 4HNGA 2RHRA 3E6AA 3ZNOA 1I3LA 4J2OA 1SB9A 3GG9A 3K96A 1DB3A 4HNHA 1EUZA 5IDQA 3DBRB 2HJSA 2BGKA 3K2BA 4J7XA 2YHIA 1ZEMA 1B16A 5DCYA 5JYEA 2AA3A 5AXCA 1XCBA 2VYND 5CHEA 3H4VA 1CYDA 1PJQA 4MVJM 1I2ZA 3I4FA 1ZW1A 3H7AA 4UULA 1P0FA 1EDOA 1LRKA 4IDGA 4TVOA 3EY4A 1KIFA 1HKUA 3FN4A 3KETA 4BO9A 3HN2A 4M8SA 3A14A 1HETA 1DC4A 4YEDA 4CM7A 3I23A 2P9CA 5AXBA 2C7GA 4UVDA 1YDEA 1YQDA 3AJRA 1HRDA 2VNAA 3K5PA 1V3TA 3L6DA 1T25A 2GD1O 4J49A 4XX0A 4QO8A 2DU8A 1ZMTA 1OFGA 4D41A 3I83A 4WCFB 2NU8A 1BHSA 4NQZA 2GRAA 1UR5A 1N7GA 2QX7A 4GMGA 4TRNA 1IUKA 4YXFA 1E5QA 5CG1A 1D8AA 1DFGA 2X9NA 3DFZA 3R1IA 4KDEA 1VI2A 4QQRA 1CERA 2EG9A 1AHHA 4O63O 4BNNA 1J4AA 2X0IA 3ONDA 3D4PA 4WE3A 1GZ3A 2PZMA 2NTNA 1DFHA 4IZHA 5LDHA 4NJOA 3I9LA 1VPDA 1HSZA 3I9JA 3WWYA 1EVJA 2H63A 3OJ0A 4BKOA 4QTZA 4PG8A 3L6OO 3PVZA 1M2WA 1ZK2A 2AQKA 4R51A 4XB1A 2DTEA 4CV0A 1TI7A 2YJZA 3L0DA 4RVUA 4XDZA 3PIIA 1Y8QA 4P38A 1I10A 3LZ6A 3MCVA 5I9NA 3Q9UA 1LDYA 1Q0LA 2EGGA 3T7EA 1JDJA 1SOVA 2ZIZA 2D1YA 2DKNA 1SEVA 2OZPA 3AFNA 3MWDB 2TMGA 4AICA 3JQAA 4WGGA 1LLDA 2JFHA 2C20A 1PGOA 5GZ3A 1FDTA 1NWHA 4GSKA 3LYLA 4IIVA 5DZSA 3LU1A 2HMSA 1N1EA 4WEOA 3NV9A 1BDMA 3G17A 1ZXLA 1HLPA 3OM9A 4QEDA 3WNQA 1PL7A 4ALJA 3W4IA 4BO0A 1X7GA 4IJKA 2X23A 4F45A 4CMEA 2BKAA 1QP8A 2AEFA 2XAAA 3RBVA 1PJBA 3UGKA 1JN0A 5G4KA 4AJKA 4FFRA 4LMPA 3RFVA 1KVRA 4EITA 3NDRA 3UCEA 3JQFC 3W8FA 4PZDA 1FDUA 4HFNA 1GTMA 5HS6A 3SX2A 4S3MA 2IYPA 1I0ZA 3UVEA 4DWVA 3JYOA 2CMDA 4Q3AA 3ICCA 4PLHA 4D7AA 1HYEA 1XDWA 4PLTA 1HWYA 1LQTA 1T2CA 2P4HX 1DRVA 4OYRA 2PD6A 3JQ8A 1HDYA 1EQUA 4GI2A 3Q1LA 4L9RA 2RHCA 4ZQGA 3VVCA 3ULKA 1CQJA 1OI7A 4O0LA 3D3WB 3GZNA 2BELA 4ALKA 4CM8A 4H7PA 3F1KA 3ICPA 3WOHA 5KJ1A 2JL1A 1ENZA 1LA2A 2VZ8A 1HDXA 3FTPA 4J4TA 4YAGA 1HE3A 3BZUA 4N54A 4NBTA 1DIGA 3PHLA 1CRWG 2WD7A 3ZWAA 4IBOA 1ZJZA 4D44A 1LLQA 1PQPA 1Z7EA 4QXMA 5G0VA 4CL3A 1U5CA 1H94A 2Y05A 5ICSA 3GEGA 1YVEI 1ENOA 3N74A 1E3JA 4EJ0A 2IRWA 1GYPA 5IXYA 4NBVA 5EN4A 1PZHA 5DULA 3D4NA 3GZ4A 4ONEA 3BTUA 5TT1A 4Q3EA 3CKYA 4O5OA 3RQSA 1F8FA 5G2OA 1LDNA 2AQIA 4FN4A 2AEMA 2NSDA 1RPNA 2HAEA 4DIFA 4A0SA 1B8UA 3FI9A 3ENKA 4P4GA 1AN9A 1RYEA 3QWFA 4H3VA 5K9ZA 1LTHR 4CM4A 1NWCA 4I5GA 4OL9A 3LLSA 3FF4A 2F00A 4Y6RA 4CR7A 1NQOA 1YB1A 2PD4A 3MJ4A 4XRRA 2VWPA 3ZWYA 1P1JA 4BQRA 4MOWA 1IY8A 2DBQA 2ILTA 2YHUA 1EZ4A 5KKCA 2EW8A 4CLEA 2PK3A 5JYDA 4TWRA 1XEAA 3F46A 2D2IA 3FSRA 2X1HA 2EGHA 1PR3A 1KY5A 1E1LA 3KEOA 2JFGA 4JROA 4KWHA 5G0WA 3RUDA 5BSGA 3JD2A 1ONNA 3ETDA 4GLOA 5L4SA 1F17A 1EBUA 4B3IA 5IXSA 1ISIA 4CLOB 1C0KA 4KDFA 1EMDA 4R9SA 1LC3A 4XGNA 4NG5A 1GCUA 5GY7A 3TWOA 1Q7BA 3JQCA 4IDBA 3WGHA 5KWEA 4BKRA 5GZ1A 1K6JA 1K0UA 1W73A 3NJ8A 5J23A 4YQZA 1BWSA 5JY1A 1LLUA 1RM4A 3IDSA 3JQGB 3ZW8A 4E2WA 5HWSA 3V1UA 2PZKA 1MGOA 1QV6A 3GA0A 7MDHA 1BRMA 3NT2A 5COQA 4ZQBA 3GUYA 1UXHA 3UCFA 4EEZA 1LLCA 4GAEA 5CDTA 4E21A 2IEBA 1HF3A 1ZJYA 4I5DA 1NVTA 1UXGA 4BNLA 5A9SB 5KOIA 3I4CA 2CVOA 2X0RA 1ID1A 1R0LA 4UUMA 1R15A 4NIMA 4WLVA 1E92A 1L7DA 1LX6A 4YWJA 1V0JA 4TQGA 4QT0A 5F1OA 1AE1A 1U7TA 3WYEA 3DOOA 3FNGA 3ROPA 4CMBA 3NYWA 3F6YA 4JCOA 3KV3O 2BLLA 4W7IA 2YDYA 1IZ9A
chains in the Genus database with same CATH superfamily
1GTSA 4GRAA 2GHQA 4AJJA 1KO7A 5A9RA 3C4QA 5CLFA 2CW5A 2HW8A 3NOOA 3RUPA 4K05A 1KU0A 4GZMA 4B46A 1WA5A 2GF2A 4M88A 2AR0A 5AVOA 2W70A 4BZWA 3O21A 3R9IA 4JQSA 1AGPA 5HF5A 3QUTA 1VA4A 1N2JA 3D6TB 2Y1GA 1P4SA 4ZC8A 4QGSA 1RXIA 5EJFA 3WZMA 2J9XB 2NADA 1RFLA 1SXJE 4LHZA 3IP9A 3C5HA 2WWRA 2O5EA 1G18A 1RAAA 1ZZGA 2QTRA 1JQAA 3EGXB 3JAWB 3PCTA 3W0LB 2FW7A 1E2BA 1E5TA 4LXTA 2QD3A 2GQ0A 3H13A 4RH0A 2C3PA 3EB9A 2GFIA 2SCUB 1KAEA 4NENB 3AKYA 5F1YA 4AZ3B 3PT9A 5ICCA 1J56A 1YBAA 2O1XA 2ENUA 2EX4A 2VPZA 3S2ZA 3F9IA 4TLLB 2YVLA 4WK0B 4X5OA 4XOUA 3SBOA 4D9IA 4UMDA 2UU9B 2E4VA 2P8JA 4QELA 3U37A 2O1SA 4X24A 1A4UA 4J75A 1F2TB 2G40A 3EEOA 5DKFA 5J43A 1FLDA 1EHYA 1XUOA 2PD3A 3ZKWA 3MWDA 1S02A 4R2JA 3UTCA 1LI5A 2VHZA 3BB4A 4D9NA 4EZEA 5EZ6B 1QDEA 1FSZA 5KSZA 4INZA 1MB9A 4C0QC 3HO1A 3NO4A 2AV6A 2BV3A 2OD7A 1AMNA 2UUPA 3VV3A 4ZVUA 1XLTC 2FW6A 3S1LA 1NQAO 2GN8A 3KAJA 3AUSA 3A3PA 3HBNA 3V1NA 3ZHBA 2PKEA 2PX6A 1XXHA 1IONA 3T3NA 1EGVB 5B57C 3UANA 5ALKA 4OAPA 1QVRA 1X7WA 1GV1A 2ZT8A 2ID9A 1OLOA 2JCSA 3C3PA 3BGVA 3TSOA 1S0UA 5T7BA 1WW3A 3NCHA 2C3YA 3OJOA 4D9MA 1ZVMA 1VJGA 3BXEA 5IF9A 1JJFA 3PKIA 3K8OE 1Z2DA 4LK2A 5TT0A 3TQIA 1QRUA 3CGGA 5LD2C 3OLCX 2C0PA 4DPLA 3EW9A 4PTLA 4DA0A 4EX7A 1SBHA 5IH7A 4C07A 2W6ID 4ZI2A 4HLNA 2QI9C 5KMGA 1QX4A 4LBZA 3TTUA 1EG2A 1JG3A 4G9BA 4P5EA 5DEOA 4GG1A 2GJ8A 1C0IA 1QHYA 3N87A 1YR9A 4HLDA 4ROSA 2C2HA 1TFRA 4UREA 4URFA 3KBOA 4HWPA 4V0QA 1BE8A 3LQ1A 4R69A 4EO4A 1MX9A 4HQ6A 2P1ZA 3N5CA 4HAYA 3GLIB 5E38A 3PXBA 4QPDA 5CDFA 2V03A 2VJMB 3GGOA 1Q0QA 3MWJA 4RS3A 2G04A 3C85A 2PZGA 3NB0A 1DAOA 3M1IA 2XYRA 2RI1A 5DGDA 1CJVC 1T5OA 4ZJUA 2W8BA 1N9GB 3C41J 2QY6A 3ETJA 2QB5A 3PRJA 4M2LA 4UHDA 1TOAA 5TS2A 3LDHA 1TF2A 4LRXA 1UEIA 4M9UA 1YB2A 5G1OA 1U8UA 3U4DA 3MJVA 1OH5A 2Y1WA 3C6ZA 1TQ8A 4ZCPA 1IOZA 1N6IA 3IR6A 3HJCA 4WKOA 3TVTA 4IQFA 5LQKA 3ZJVA 4N76A 2JAQA 1ZSNA 4K03A 3ZBTA 3DMTA 4EG5A 3M83A 1EVYA 2DUMA 3OKAA 5EJ8A 4PS0A 3EXFB 4OREX 1OYWA 1ZCFA 3WLSA 3S0JA 3HM9A 3CRZA 4GO1A 3ZU5A 4BASA 1CQXA 5J9FA 3SFZA 4LF9B 1R64A 3R4VA 4DLNA 4OP2A 1L5VA 4MPDA 3WGJA 1W4RA 2AG6A 3IODA 5EIBC 4CLXA 2HLPA 3ECSA 5HJ5A 3SF8A 1PG5A 4RZIA 2JLXA 2W5UA 3OEEA 1SBZA 1XTPA 3KPYA 3TSZA 1FFHA 3DW3X 5ALHA 4PLGA 3WC4A 1RAGA 1GT6A 1TF7A 4EZBA 5TVGA 4OI4A 1VBNA 4UHEA 3U3ZA 4CIAA 1PKEA 4JYPA 1Q0PA 2INGX 5FJJA 2CLMB 4YAFA 1CNFA 3CSDA 3W06A 5D86A 4GKVA 1BJTA 1Q1GA 4DIUA 4EI2A 4OYHA 2RKOA 2VR1A 4KRYA 2ZI7A 4FFMA 3V4VB 3NATA 3EIEA 1URPA 1ADYA 4OIFA 4MHSA 5FHRA 5DCWA 1ZD4A 2GXSA 4V02A 4L4SA 4AYXA 1RM5A 4CKWA 1ONPA 3MJEA 1UC4B 4MYTA 2WJWA 4OHUA 2LCIA 4I19A 2V6BA 1WY7A 5IEJA 1XOIA 1E9DA 2AOVA 2WKRA 1R0CA 4KLAA 5DK6A 2HLDA 1JA9A 2DLDA 4X1OA 1UBOS 2GESA 3R7BA 2PH5A 3LL4A 3GP3A 1C30B 3JWGA 3OM1A 1NYRA 1WMDA 2LR0A 3OURA 4K86A 1N9KA 3T1OA 4B47A 1O77A 2BKEA 5EJEA 1UMCB 2YWRA 3AI3A 1JLRA 3GMTA 4EHDA 4ABTA 4BJ6A 2HF2A 4LY0A 4EFLA 5ERXA 3LKZA 4WKGA 5L7TA 3RS5A 3RR2A 3ZCSA 3UO8B 4HI0E 3ZU3A 4AWBA 4KN5A 4GE0A 1QF6A 1P9RA 1R4NB 2V7XA 2YR0A 1ZZEA 1IRIA 1EIZA 2OV2A 4MB0A 5J4HA 1RU3A 1HR0B 5FKJA 4YYZA 2PL9A 4DDHA 4K0RA 2QMQA 1U6JA 2EU8A 3QXGA 1UJ6A 2WYVA 4HV4A 2AX4A 1W36D 2EFGA 3RTBA 1O95D 3KYCB 3QP9A 1QIMA 4JC8A 3TW0A 2IGTA 4L08A 5LXTB 1IM2A 1LBQA 3HCOA 4IIEA 3CRNA 4NECA 4DRXA 1R6TA 5I3CA 2X9QA 1PS9A 4K6KA 4R1NA 2BP7A 4K6OA 4OQ4A 2CF5A 3AG6A 3IUMA 3KR9A 3NJ4A 1E0KA 5CFLA 1KI6B 4PZLA 2O4UX 3A36A 4HUQB 2Z1MA 1I30A 1YZNA 2D0PB 4H2DA 3RC9A 1LI4A 2ZB7A 1C7EA 1QZUA 3E9QA 4FMBB 1D6JA 1NJ6A 4OXYA 2J9ZB 2R87A 3COWA 1WUIS 1XTSA 1Y3AA 3D43A 4B48A 1T0HB 2RGEA 4EKNB 3EVEA 5BPFA 1CJSA 4KZKA 4B6OA 1QVZA 1GZHB 2IY9A 2V58A 4WN3A 3SBXA 1WEHA 2HNAA 3IIKA 1II9A 2J1LA 3EGEA 1PW5A 2WWFA 1H0KA 1H5UA 1YBMA 2J3HA 5GIPE 4O33A 2NVOA 3NALA 4W5TA 5KDDA 4R68A 3FTEA 4REQA 2X13A 3KQOA 2DULA 4RVOA 4J07A 2VSOA 5GQSA 4E5KA 1Y5RA 3P9RA 4FEEA 2EKDA 2B21A 2WWIA 5ELXA 1QE3A 3DEAA 3AGPA 4OOEA 4F11A 2AMYA 4MI3A 2EQ5A 2G3YA 2LIVA 3UB3A 3QOXA 4ZVKA 5HUQA 1KJWA 5ALRA 4IHJA 3M3HA 2ZRCA 3MA0A 1U8YA 1FDOA 2Q6LA 3TGWA 2GAOA 4DTCA 4W8OA 1WSWA 4CE6A 1PR4A 2DFNA 1JJVA 1Z0AA 1NN5A 2Y0PA 3HYRA 3HYSA 3GBPA 4RQBA 1JXQA 2O23A 3T3IA 5AVQA 2P9JA 4PG7A 1DOAA 5MFPA 4J16C 4ZYLA 4N5LA 2VT7A 5A3QA 5JAHA 2G06A 3EF1A 4G67A 1GPMA 2J9GA 3K0CC 5FXMA 5IJ0A 4ARZB 2YVAA 1WXIA 5IVIA 1KZ6A 4RQTA 1WUYA 2QZPA 3IQHX 4AFNA 1Q5PA 3KK0A 3BJIC 4S1NA 2AIRA 5DW3A 2NTYC 2NP7A 3VR4A 3NKLA 4II2A 1ULSA 2B7LA 3CTPA 1L8AA 4MIYA 4R2XA 4ALIA 5B1EA 1UFVA 4YACA 1AXEA 1YRQA 4B40A 2VDRB 3LVBA 4KG7A 4OF4A 1L8XA 4FHDA 1QHHA 2J5XA 2RG7A 4EJ6A 4CDNA 4KAAA 3N2KB 3C97A 3C8DA 1BXZA 1RLIA 1YQ9A 3UCXA 1EDDA 2WSSA 4BATA 4KQ9A 1ZGGA 2I2DA 3M82A 1SAYA 4IV0A 3THXB 4J1TA 3G7NA 3QG5A 2UUOA 1ZIYA 4PSDA 2P30A 1UANA 1U1FA 4Y2SA 3OZDA 1OA0A 2REOA 2W90A 2WUGA 4YK7A 2Y68A 1UKEA 1RNLA 5DF1A 5GWXA 1T2UA 5DT2A 2X0FA 2F1KA 4BNKA 3UMYA 2EARA 1XJWA 2C78A 3FGNA 1IFXA 3P0FA 4NBRA 2AFRA 5EKUA 4BO2A 4F56A 1LPSA 1YRAA 4YRIA 2V4MA 3WKBA 5HZHA 2VDQB 1GGKA 1W44A 1WQ1R 2QYTA 2V7PA 4YHBA 4KVGA 4AY4A 3WK9A 4Q16A 2VYCA 2ZEJA 4Z9YA 4KR7A 2PR2A 1FRVA 4GBMA 4KNWA 1Z0SA 3O9MA 4X1YA 4AF8A 2DB3A 3M6FA 2DHCA 1Y6FA 2Q5HA 3AJ8A 1WHTB 3MT8A 3JZFA 4CXMA 2LDBA 1SU6A 3VPFA 5HR5A 3I8SA 4HEHA 1KRWA 1EFRA 3FCUB 4N03A 4R9RA 1M6NA 2F4VB 2ZTHA 3GW8A 4N7MA 3R0ZA 2VPPA 3NEAA 1G4AE 4UZEA 1E6MA 2AKYA 3G49A 3K5IA 3KFLA 5KHAA 3I0NA 4DR6B 3GIWA 2GS9A 2IOFA 4ND2A 1L5LA 3UOGA 3WL5A 1RZRD 1JLLB 5C18A 2BFCA 5EP2A 2ZJ7A 2SBTA 1Z7BA 3RVPA 1MPTA 4Y7CA 4GEKA 2QXTA 1TZMA 2NZVG 2YIJA 3M81A 5AM2A 3OSZA 1W5EA 2NO6A 2B99A 2O07A 1TYDE 4L15A 4JVLA 3L8EA 3OFSA 4EM6A 1NC1A 2DERA 2ZWVA 3B1YA 3V8MA 2WHQA 4CM9A 4M0LA 1JAIA 2YWDA 3RRMA 3PIDA 5JFGA 5ALXA 3PNOA 4MV8A 3TIFA 1F2UA 2CBZA 2O1WA 1DLIA 5I4CA 3MTGA 1W6RA 4FSDA 2Q4DA 5DHAA 4XIFA 5EINA 4TLCA 3ZD7A 1KS9A 3BD8A 1KHTA 2EFEB 4PNPA 3INTA 4PTZA 1PK9A 3OEHD 4TTVA 1U8ZA 3FWKA 4BNZA 4JI1B 2G5CA 1KO8A 2F3SA 3DR3A 2V96A 1E2PA 3EZFA 4HAIA 1Y81A 1TUEA 5LR6A 1PJTA 2C00A 4GUAA 4K46A 2O8EA 1YJAA 2B4RO 5AKHA 3TSAA 2D7JA 4KQGA 2NSJA 1TX4B 4U2EA 1YBVA 2QENA 1SOUA 1Z2PX 1PNVA 1VPEA 5KYYB 4C0SA 3UH1A 1U0HC 4WLOA 4OQLA 1GQ2A 4J0GA 5CXXA 2ZIWB 1UBLS 2WYIA 4EAQA 4OHBA 2QW0X 2E48A 2C04A 3QLVA 1AHIA 1S2LA 1G0NA 3T0FA 1DDIA 4OG2A 3FMOB 5C1IA 5AVKA 1A9ZA 4UHJA 3RWOA 3OZRA 5AH0A 2OP0A 2JJ2D 3LHFA 4RJKA 4ZPJA 3RVBA 4CTKA 2C8JA 4X66B 1X8JA 2O0JA 1BYUA 5CDHA 1O97C 3H1PA 1GUAA 1ACLA 3P94A 4KLCA 2PKYX 3IQEA 4XWGA 1G6HA 1WU7A 3ETLA 4L75A 2ZB3A 2NU7A 3WDMA 4FHEA 2C54A 2PZ8A 3OIDA 5I7EA 1E3IA 3Q3CA 5E7IA 1SU7A 3MTJA 3QBEA 1R0ZA 3GJ0A 4NEHB 5ALNA 4R3WA 3RK1A 2OZEA 1WDLA 1FMFA 1U4OA 3P2IA 3I12A 4TMKA 2AEEA 5FFFA 4ZVMA 4EA9A 5IANA 1EVQA 3GJ8A 5C8XA 3PDIB 4W5HA 3A70A 4YMSA 5EVJA 4CL0A 3BXPA 5C7IO 1R1DA 2BZ0A 3HEBA 3ZCVA 3PLRA 4EABA 4EFMA 3KZOA 2WWHA 3R3SA 1Q91A 2X42A 4IDFA 4O3FA 2RB4A 3JAMA 3A1WA 2XT9A 4Q3NA 5BXQC 1YT5A 3BL6A 1IK6A 1ZRMA 4S24A 2YXPX 1TK3A 1MXFA 2J07A 1LH0A 3GLHE 3HVUA 3IHKA 3L43A 4GYJA 4XKJA 3DE4X 3U7JA 1BIFA 3TQSA 1ONSA 2B0JA 4FEYA 1Q17A 4E15A 4TXLA 2BTQA 2EP7A 4MW0A 4BCCA 1NR7A 2P9EA 1HT0A 2JDID 2XUZA 5HTKA 3WL4A 1CUVA 4YREA 4CKZA 4ND6A 1OX6A 3F5QA 4P3XA 3WJAA 3R6LA 3LLCA 1SXHA 3PUXA 1O94C 2BRUC 4PVCA 4UVEA 3TDKA 3ROZA 1XI2A 3IEPA 5IVPA 2AB0A 4RVSA 2ECQA 4LDZA 1SO8A 4MYHA 3UJ3X 5CIYA 4L4YA 1QK3A 3AM4A 3DP9A 5T5QA 3T3MB 2OILA 5I8WA 3G85A 4WMLA 2RGNC 2V6JA 2JHCA 2H57A 1Y5IA 2X2OA 3C6KA 3I5AA 5AVRA 2UXBB 2GTPA 2PA3A 2QN1A 1CZHA 2ZYAA 3MMNA 3VNQA 3Q88A 2LNDA 5BWLA 1SMKA 3KFXA 1JI3A 4FS8A 1EAMA 4P08A 3JR7A 4KE9A 4GOMD 1C7QA 4UQLA 5MF6A 4G0UA 1YU9A 3WQHA 2QRVB 3CX3A 1YE5A 1L5NA 3SR0A 4NS4A 3PFHA 3TX2A 1CJCA 1DBSA 2I4NA 1CQIB 1ISJA 1OLSA 5IM5A 4AJPA 2FMUA 3V42A 5HM6A 5JFTA 2J3KA 1C1DB 3P2JA 4K9OA 1LLFA 1BA3A 2VHCA 4JJEA 1P19A 1XTQA 3KJEA 4PZCA 4U8HA 1KR5A 4ZYTA 3MHPA 5DHRA 4MW1A 1P9LA 3IHWA 5E9QA 4R2IA 1RXUA 5JDIC 4A8JC 1VKZA 4ZHQB 4G81A 1BMTA 2ZJ5A 2OUIA 1XLTA 4NFHA 3WGMA 4A7PA 3T9EA 1YF3A 1QC5A 2Q9UA 3IE2A 3N75A 4IDAA 3MQ2A 4DEXA 3GLFE 2RSLA 4WK4B 1SVLA 2H5IA 3D0QA 2AHRA 2DWUA 1L5HA 4F7DA 4IJMA 4QUHA 2BTEA 2IEIA 1JVSA 4YBZA 2VSXA 4MDHA 4A6DA 1TAUA 3T7KA 1G8GA 1Y1RA 3SVLA 4C22A 4V2IA 5A5GA 1ZLYA 2X5OA 4DABA 1M6HA 1I4WA 3E48A 1EUDA 2JJ8A 1FX0A 1YAJA 1WEKA 1FRZA 4RXTA 5L4LA 2ONZA 4OA8A 4RKWA 3VTAA 3VKGA 3FNBA 1JIQA 3B51X 4S0XA 2VZLA 4M0DA 1YRWA 4GI5A 1M8KA 2X1MA 1XGKA 3TSCA 2OLKA 4ZJZA 1NONA 4NCIA 3T41A 1JFFB 1SCKA 3M6UA 3MSXA 3ESXA 3ROTA 4H31A 2QJTA 4FC6A 4Q7MB 1P74A 1WPRA 1SVSA 3LY5A 4JITA 2EW1A 1U3FA 2Q3LA 4L27A 3UQZA 1IL0A 3V8EA 1M0TA 4LVCA 1SH7A 2E9SA 2QX8A 2BEUA 3QLEA 3BOSA 1ZNYA 3KRTA 4YRFA 2Z5LA 2QT0A 3GARA 4O8CA 2BKVA 2B7CA 3NUQA 1U98A 2FZLA 1GL3A 2DFPA 4NH4A 4RTPA 1TC1A 3PUHA 4KBFA 4Q01A 1G1MA 3T7SA 3WB9A 5BWCA 3D7SA 5F21A 4FWTA 3DLAA 1XKQA 3T9BA 1D6NA 1QF9A 1Q16A 1PT5A 3FVVA 3R09A 4PC7A 4UHCA 4UCWA 2FDCA 1X1RA 3WAKA 2CFCA 3O4RA 1PI3A 4Y1GA 5AW6A 4IJ5A 2R8ZA 1OLXB 5FOUA 1T4CA 2XBLA 3VRHA 2AFHE 1L9XA 3GLIE 4LBWA 1ICIA 4KXVA 4H0CA 2HSDA 5DTEA 4DT1B 3AI1A 5DLQC 3TNLA 2Q21A 3SG0A 1E77A 4FT2A 4PYJA 3ICOA 3UT0A 2RGAA 4UPEA 2Q1SA 4OX9B 2J0UA 5CAEA 3BF7A 4W5RA 3GF4A 4M8LA 3HACA 3WYAA 1WU8A 5EQJB 1WUHS 2EZ9A 3TZEA 2GASA 1ZH8A 1MF7A 4Y67A 3TFOA 4O2BF 3D8SA 5CDFE 1EUCA 3JQPA 1SJ9A 2HBQA 3BTOA 4RTJA 1V3VA 3MB5A 4TSFD 4M1ZA 3BGSA 4JIGA 4MRPA 2Z9BA 3TTTA 1V1RB 5B6IA 4AMUA 3FWYA 3WLOA 3PVSA 2FSPA 4D8WA 4DNFA 3ABOB 1CUGA 2GETA 3KVOA 5IDXA 1QH8B 1NF3A 4MR7B 4R1QA 3SQDA 3UN1A 1FX1A 1RLOA 2M6KA 3ZZNA 3UENA 2H5JA 3ZHUA 2YBEA 1DFIA 3AXSA 2WU1A 3D6MA 3ESYA 3MWEB 1T8RA 2VQDA 3QSYA 2QN6A 4MARA 1TYCA 3ONVA 3UWMA 1PBTA 2E85A 1A71A 2H31A 3L4JA 1R50A 4S05A 3E70C 2BY4A 4G0NA 5KYVA 4Q3CA 5JXWA 3CVOA 2QGFA 4LHYA 4CV2A 4I55B 2FXVA 4XARA 5JCJD 1GPBA 1EJBA 3VSAA 3L7CA 1HOXA 1JR2A 3PEVA 3WKAA 3KOWA 4KZPA 5AW3A 3KT3A 3HCWA 2PGNA 2B69A 4UZFA 4CIXA 1IBLB 5JJBA 3BB1A 5I8ZA 3S2FA 3AESA 3NDBB 4J7CA 1KAGA 2XMRA 1YQGA 1Q1ZA 1VHTA 1N25A 2UZ1A 2NT3A 4HWTA 5FUYA 4B8WA 2PQMA 1DXOA 3DEHA 1AMOA 3U6BA 2ZJ4A 1V5IA 4BP9A 3OJCA 1RM3A 1E66A 1COWA 3HKEB 4D9JA 1SQ5A 2H3EA 4F8JA 3K9BA 3R0IA 3ANYB 4N7JA 5F1PA 3EPJA 3DEKA 4F06A 1T2FA 5H81A 1SVNA 2D4AA 2BCGY 4DIBA 3HKCB 3CH4B 3ODGA 4JL5A 4NL4H 3D64A 2H59A 3NM4A 4F3CA 3RU3A 2ZIUB 5LQJA 5ADUS 4KP7A 1CB7A 5KSOA 1DAIA 1FTQA 4RIEA 4EF6A 2ZW9A 1X38A 3I2JA 3LH5A 4KPUA 3TLXA 1XYGA 2FUG6 2V7QD 4FDAA 1E1RA 1PGPA 1WPXA 3ANSA 3ZE8A 4YHHB 3DQPA 1VE7A 1MENA 3QVLA 3RFTA 4CKEB 2OHVA 3OPYA 3A6JA 2IIVA 2QRJA 2QTNA 2EFDB 5J2UF 3PFFA 2ISCA 3GBVA 1GV0A 5DM0A 4YCAA 3T4XA 5HW0A 4MW9A 2MYUA 4KXYA 4XD7D 3GCWA 3K70B 3BWMA 1LBSA 3B2EA 4JP3A 1NXVA 3TNDA 1YZTA 1P0CA 2JFUA 2E89A 4Q1CA 4IQGA 2NNLD 4ZVOA 3SYTA 3ZJUA 1A7KA 4BLQA 5C51B 3I9V1 3BWDD 3F78A 4FYHA 3RM3A 2HB6A 3IAUA 3RGGA 3NBFA 4PR0A 4DY4A 2XNJA 3CNEA 1TQ4A 2ID7A 3H2YA 2JIDA 4GSLA 5EP3A 1NYTA 3DH0A 3WLQA 2R4UA 4LCJA 1UT5A 2PQ6A 3LY8A 1ICEA 5JAIA 3QKUA 5TY0A 3AP3A 3FZYA 1NV8A 3DL7A 1DAMA 3UXYA 2P9TA 5C5IA 2EIHA 2W6JA 4YO8A 3EGOA 5DYTA 4U02A 4L0CA 2WYUA 4PRLA 3AR8A 4DTIA 4PF1A 3CEMA 3CJTA 3OPXA 5CH8A 1PUIA 2HUNA 2H2HA 5TPWB 1FFXB 4YJ2F 3PR1A 3D1JA 3ELYA 5H7XA 2OCYC 2O2GA 2P5UA 2RH8A 5LZ8A 3DM5A 3K6JA 4MLCA 1E9FA 3QFCA 3N39C 3L84A 4JDPA 1KEKA 1F7VA 4ZALA 4HH4A 1E9AA 5T67A 2NU9A 2ORYA 4MX8A 2NQ2C 3UJPA 2IEDA 2Y0EA 1KJQA 3ZCTA 2B4QA 1U90A 3E7XA 3DYBA 1K7XB 3H5NA 1P17A 2J4FA 4QSMA 3TQQA 3RODA 3OD1A 1EX6A 3Q4GA 4J16A 2QZ9A 1T4MA 3AVQA 2IS6A 5D5PA 3MERA 2KJQA 1HDIA 2D1QA 2FLKA 3K0CA 1FQJA 4E4YA 2VPIA 4CKCB 4BNGA 3HV2A 4HRYA 2ZE7A 3UK2A 1CULC 4TS3A 2BCEA 5KUTA 2BSAA 3L7IA 4WESA 3E4CA 3EEYA 4LZAA 5L3RA 3ZY2A 4AN4A 3LPMA 4DV7B 1KSGA 4N3AA 5BWMA 5KTKA 2CXXA 3O94A 4EECA 4DDKA 4TZ0A 4X64B 1WB5A 4BGEA 2C5HA 1LEHA 3E05A 2J6HA 1K66A 4ID9A 1XZLA 1E4EA 4FLMA 3HYNA 4KFCA 2Q28A 3EDMA 3MTEA 4IL5A 5U1PA 2VYVD 1V11B 4QOSA 3SMVA 5BMVB 2XXAA 4UVIA 1BH6A 2YY5A 3LP8A 4QARA 5IYZF 4YUYA 2BFBB 4YAIA 2P9FA 4OQXA 1K89A 4OXKA 3E7PA 3UFBA 3KOZA 3QLUC 5IEBA 3JWJA 4Y2YA 2Y6VA 5AHWA 1TKAA 4HDCA 4I50F 4F38A 1NF2A 2RAVA 3VDQA 4B33A 3L1KA 3VNBA 1QYDA 2EIXA 3HFJA 1XD9A 4FR5A 4LV8B 4XYGA 1Y80A 2OV6A 5LA6A 2A1TR 3C6MA 4DBZA 3KKPA 3OJWA 3ZXXA 2C3OA 1VKOA 3HJUA 5H3CA 4OAQA 5BRJA 3WTBA 2R66A 3WK7A 2DUWA 4G5GA 4AJOA 3UBTA 4CG2A 2JVIA 1NT2A 4AJ4A 4C7XA 2GEBA 4IF6A 4M87A 4LC1A 2Q5QA 4NZZA 5EI5A 5B1IA 2OZKA 3D2CA 1UFRA 3DBHB 3OQNA 3QEBZ 1CZNA 2Y3IA 3PZRA 5JH7F 1VPLA 2BFPA 2QS9A 4J76A 4ND5A 5CT6A 3S2YA 1KNQA 2COEA 3WFJA 4IW3B 3TDNA 4IGIA 2FH5B 2Q3DA 3OZCA 1SD2A 2VBFA 1MB3A 3BMOB 3GEBA 3OIGA 4KIFA 5LP6B 4OHYA 1FSGA 2CFRA 1YZGA 2IXEA 2OY0A 4LDQA 2VTKA 4PYQA 4L4ZA 4JI7B 1SC1A 4EW6A 1E6WA 3Q1KA 4B34A 5B2EA 3NRBA 3K9NA 1LNQA 5EYPB 3VKVA 2VXBA 4BX2A 2CLKB 3EC1A 1XKLA 1P9WA 3B2QA 2BMEA 1AURA 1Y7PA 3QW4B 2JAXA 1TADA 4R5HA 5LYYA 2HK6A 1YA4A 2DAPA 2Y8EA 3JALA 4ISBA 2RAPA 3B8HA 3EDYA 4X6XA 5HG0A 5BSMA 5AKGA 1H42A 2FJUA 2QJOA 3IQIX 1R9NA 3ANMA 2TS1A 3JYLA 4B76A 1DC6A 1WDMA 3G2PA 3OMWA 4ND3A 1ZWKA 2J67A 5LDGA 3COPA 3L06A 2R6ZA 4HDMB 1NVUQ 5CJJA 3I30X 3FOWA 4R8KA 4CLOA 4G24A 3SQXA 4IOJA 3UAWA 1MHPA 2XTNA 2ZJ2A 1NMZA 3GHHA 4FYJA 1QQTA 5CD9A 4CMCA 1XU7A 3IQXA 1M8PA 1NUHA 4L74A 4V0MA 4FVTA 4EYKA 1HLGA 4LJ9A 2W2NA 3KYJB 1JT2A 2ZSDA 1HTBA 1UOOA 1Z2CA 4ABYA 3HCDA 2IYOA 3EY9A 4PS1A 2CFIA 4Y18A 5CX1B 1FJ2A 1RYBA 3TL3A 4D3XA 1V6SA 1JE0A 4BBZA 4EP1A 1U7XA 3HY4A 5CIWA 1GZUA 3SVTA 3M4YA 2G76A 3H5WA 1E2FA 4R41A 2HREA 5LMNB 4C1NA 1IBMB 4PZEA 5ENDA 4C04A 3IMKA 4H15A 1O95A 1SBCA 3E84A 4U0KA 3P71T 3IP6A 1PX2A 2JAPA 4NYJQ 4ZIRA 3LKBA 3ZDDA 2LKCA 4LRTB 4XAQA 5HFNA 2KQUA 1H2RS 3LCJA 4G5OA 4RPGA 4C6SA 3P9XA 1B2LA 3RS9A 1CB0A 3W4KA 1UINA 3JQRA 4FKMA 4HLUC 5EL0A 1IHOA 2HIMA 1BMQA 1U31A 2Q6TA 1E4YA 4PQYA 1O6GA 1L7QA 4EJFA 5CA0F 5JEDA 4MUBA 1SUPA 3BRQA 2WW8A 1GTL1 3JS5A 4G0MA 3G02A 5D3MA 3RBAA 3SX4A 4WK6A 5F3DA 4NBKA 4AG5A 1O0CA 2EKZA 4LWZA 2QN9A 1OC2A 1YVRA 3BCUA 3G3EA 1CUFA 3H86A 2C7BA 4QOHA 4X91A 4Y2HA 5K4GA 3IEVA 3T5AA 2VRCD 1VP3A 4QYTA 1KQOA 1YIDA 4MTLA 3TCKA 4Z1MA 1PK8A 4Q4HB 2C82A 2W43A 3CLVA 2C2WA 4XPIA 1FYFA 3RSHA 3DEIA 3IP5A 2OENG 3TZLA 1J99A 3ZQ4A 4P7BA 2A1IA 3GB9A 2J0EA 3SYRA 3QFRA 4TTRA 4RKRA 4OBWA 2W22A 5JW6A 1WXXA 4D8YA 2NSHA 3BE8A 1DC5A 3B1FA 1HM5A 4WKNA 3SF0A 2FG5A 4KO4S 4LOJA 5DIZA 5AT1A 1DJLA 1GGMA 3CX7A 1K5HA 1O94A 2BRUA 5HILA 1ZNWA 3GT4A 4JX9A 5K4HA 3TGLA 2A1UB 3L8FA 1PHPA 3N2ZB 4DYDA 1JRLA 4RCYA 1NT4A 2YJ4A 1CUYA 4TYPA 1TTPB 3KZMA 1RJWA 1ZN9A 3F4BA 3HCAA 3IJRA 1A8QA 3TD6A 1R5JA 2RGNA 2IHUA 3COSA 1S89A 1QO0D 4BAZA 1P9NA 3Q7IA 1NI4B 3OTGA 4D99A 4FCCA 3KCQA 3OTIA 2R44A 5AP9A 5LU9A 2JH8A 3FOBA 4OSOA 4YH1A 4C78A 9LDBA 4D81A 2R86A 3FFBA 2O8CB 1NPYA 2AI1A 1EBFA 5JY6A 1ONOA 5B2FA 2GBIA 4RSHA 4BFSA 2IXDA 3I01M 2G08A 5CIQA 4ZT5A 4EMBA 4JJ4A 1S9HA 4K88A 3HP1A 1H2YA 3TQRA 3BQ9A 1IIBA 2C61A 4OP1A 1TM7E 5AD1A 2IBTA 4D0NA 1WCWA 2EZ8A 4DZZA 2Q5JA 2V0NA 2BFOA 5E1DA 2FZVA 2C92A 4ESOA 3S6JA 3NTOA 1J00A 1BVHA 1Y6ZA 5JDIA 2GLUA 4A8JA 5AJVB 1T9KA 3ISTA 2AOXA 2DC1A 2IUTA 1HT2E 1N6OA 2M9MA 2OHOA 1J97A 2DTDA 3ESZA 3TMKA 2W2VA 3ZVKA 1IIRA 1BNCA 4L1KA 1K7EB 5LB2A 1CE8A 5FOWA 4JOSA 2W6PA 1P62B 2WAYA 4CN8A 4G4SP 3GLKA 4L3OA 3OQ6A 1E5XA 3CWZA 3A58B 1P77A 2VRBA 3CEJA 2ISSD 2D2EA 2FW8A 3EVBA 5C0OE 1PK7A 2ZRGA 1PX0A 1S9DA 3QVVA 2G67A 4TOIA 1PFQA 2CUNA 2CZGA 1W47A 2VQ3A 2W11A 2YNMC 4WCVA 1O1YA 3T5TA 4DFDA 3DG9A 3N3AC 2GBGA 2BFAA 2CXUA 1KMHA 3VO1A 4JD5A 4DRYA 2FU5C 3VYTB 1JWLA 4LPSA 1EDZA 4GL2A 4YDSA 1KC3A 1GKUB 2JCBA 3QU7A 2ECOA 2CL5A 4KGXA 4ZT2A 3T5CA 4LE1A 4QU9A 4CDMA 4R71A 5AJUA 5LWHA 1R16A 3TF5A 1CY2A 4GVPA 2H4JA 3X44A 3VU9B 2K5UA 1R8QA 2WINI 1E20A 4OUKX 2PTGA 2FE4A 2Y1XA 4FD2A 2SECE 2J6CA 4HEJA 3HDJA 4JBIA 2RAFA 4IIJA 3AY6A 1EK5A 4E11A 4LFBB 4DR2B 1Y42X 1GPDG 3ESDA 2AXEA 3N2YA 1RQRA 4KKXB 1Z5ZA 5DHUA 3CS3A 1BMFA 1X7ZA 4XXHA 1M2OB 4BB9A 5JBNA 3FCYA 5J63A 2JRCA 2R1TB 1GL6A 3TLJA 1T29A 4LTNA 4IAOA 3K6SB 1E32A 1I4LD 2EKLA 4UDYX 3AYXB 2G1AA 3H4TA 3NAQA 4Q1FA 3A06A 3WSWA 4D46A 2B1RA 3D6AA 5DB4A 2JPDA 3G89A 4EVRA 1G8KA 5KU7A 4V3BA 3V5NA 5IK2D 1GKIA 1X1CA 4AAYA 1T0PA 1Y4UA 3CPHA 3KZCA 2JLUA 4K6HA 2D3TA 1U0LA 3LO5A 3OEHA 3EEQA 3PENA 5LYJB 4DMUB 4GVLA 2P9QA 4JSRA 3C8ZA 5KC8A 1FPQA 1MQ9A 2A33A 4DMRA 3O74A 4Z7QB 4FNOA 1P31A 3EQ2A 2YVQA 2K87A 4UMEA 5IJWA 3EOBI 2F59A 4N6GA 5DCUA 5FUBA 1KQFA 4JXXA 1USUA 1NBWB 2PUGA 2RONA 4NYIR 1MQ8B 2BKUA 3DHVA 1AGRA 2OORC 4L2IA 4JNCA 3TXYA 3KHUA 2O14A 5DXJA 3D7LA 1J0CA 1Z4LA 3DXXA 3UPTA 5HP4A 1F51E 4YGXB 1U11A 2R7AA 3KWJA 4JT2A 3T5PA 2PY6A 4E5SA 5JR3A 1OE0A 4K9DA 2O2HA 1DAEA 2JJ2A 3DCNA 3B6MA 4HTFB 5F23A 1E9SA 1YACA 4HSGA 2RD2A 1GQSA 1J1UA 1GUZA 5TDHA 4X54A 3V8PA 3RIEA 1Z6ZA 2V7UA 4IMPA 1O58A 2GN4A 1IQ0A 3QXSA 1YQEA 2EJBA 3W6OA 7REQB 1GRRA 4OFXA 4UM9D 1PL0A 4I1OA 4M8KA 4GQIA 3TBFA 2XUJA 3BIXA 1U4SA 2QTFA 2I2WA 4C3OB 4H18A 1MO5A 2VXCA 3MAAC 1EFTA 1EFPA 1H0HA 2F64A 2CNDA 2RIRA 1GZ5A 4IFIA 4O4IB 2ZYGA 4AO8A 4FK8A 4I3FA 3B7GA 3KJQA 3DWIA 4WINA 4ZKEA 4DAEA 1S1CA 1YO6A 4I99A 3VNUA 1N7HA 2ZIVB 4AJLA 5BWNA 1TTQB 2C96A 3LX4A 5CR9A 3L8GA 3OIFA 2ZR0A 3LRXA 4PC6A 3RVSA 1UM8A 1EUYA 1JR3E 1P33A 3HR8A 1XKTA 4LSGA 3KT8A 5AI9A 2AFIE 1NJ5A 1X8KA 3TW8B 3TLGB 3T12A 1FSPA 2IX9A 1NVMB 2EYUA 3WG9A 2AZMA 3DLIA 5ARDA 2QUHA 3VTZA 3VH1A 4AUKA 3O91A 2I4IA 5CNKA 4MVCA 1O5OA 3A25A 1E63A 5DHPA 1WCIA 3OICA 4Q4AB 3HSKA 4URVR 1MAWA 3H5IA 1VIAA 5D3QA 1G3QA 1YL7A 3A4NA 5BN5B 4JAVC 3Q3GE 2YW9A 2DBZA 2HRDA 2Q4OA 1NF8A 3P27A 4OLAA 2OECA 4W5NA 1G0OA 2I3GA 4PWYA 1JIIA 3P8ZA 5EIOA 2UXCB 2BGMA 3GCGA 3MINA 1JALA 1T91A 2CCGA 2Y2VA 2C29D 4UNIA 4BKQA 4EA8A 2NP6A 4J4HA 3P4YA 3E9EA 5AI8A 5G0UA 2ZBDA 1YJ8A 4QDJA 4WZAB 3LDGA 4L0DA 1TM4E 1CR2A 3PKZA 4JLBA 3G8DA 1YS1X 2QAGC 1ISSA 4DQUA 3NTLA 3G5UA 5FOTA 5A9TA 3WDSA 4B6QA 2QTGA 3HDQA 2JA2A 1LTQA 1KDZA 5BUSA 5A3SA 5AW9A 2GAAA 3K8YA 3B7PA 3CKKA 5AW0A 2QMYA 4LC9A 5ALSA 3B89A 1GG5A 2CFSA 3RSSA 2VL7A 3QUAA 4F3KA 1M2FA 3OF2A 1ORIA 3OTHA 3OQBA 1W52X 1KI8A 3LP5A 2DG2A 5LXTF 1WZUA 1EZZA 2C4UA 3R41A 2FPOA 2K6GA 1KEEB 1RI5A 1XTVA 2WIFA 5FWYA 2OBXA 3RRZA 1E1NA 1HQCA 3GBSA 2YZ2A 2WUDA 3TE7A 1ULTA 2JEZA 1WOMA 1H2FA 3B1JA 4LJ5A 5D2CA 3UH0A 1KO1A 3UMJA 5GMOA 3GLSA 2Q2WA 1H8ED 3CF4G 1RRPA 3EC2A 1KI3A 2CK3D 3LK7A 3B85A 4JP1A 4LYYA 5FV7A 4O2RA 1D2GA 2HO5A 2R6JA 4JBGA 5CVJA 4WV3A 3TOZA 1Q6YA 3CUWA 4N48A 1KDOA 1J5PA 1X80A 4J9VA 5ALYA 1G1AA 4BLTA 1W2WB 1ML3A 4OHKA 3ZEIA 3VKWA 3HBJA 4UVHA 4IDHA 4MQEA 1ZM9A 4A9AA 1MC1A 2IBSA 2QE7A 1M8JA 5FA8A 1PU2A 2VQEB 2G28A 2GYWA 3ILHA 3KUDA 5LQNA 2OFOA 3CG0A 2VUTA 3LBAA 5J40A 4EKEA 5B4VA 3PGVA 1A9XB 4HWOA 5DNUA 4DHWA 4YDQA 4ICIA 2EGUA 1QOQB 1UXOA 1ZOOA 1ZDMA 3D3NA 2OSVA 4MQUA 2BFNA 3F6SA 3LRTA 1SR8A 5CG2A 3BJEA 1UJ2A 2EWMA 5LL6P 4XJSA 5CA1B 1FRFS 1TKBA 4MWOA 3IEUA 1H23A 3PDWA 4JIMA 3TN7A 1U0FA 3AF5A 2FPIA 4Z51A 5KYXA 1VE9A 3B5EA 1EXMA 1P7CA 4P7KA 3FPGA 4C4ZA 4C7OB 2JFVA 2NZWA 2PKXA 4YLGA 3S27A 2QNBA 5A7FA 1C0PA 5JQGF 3DTVD 2Y1DA 2IYLD 4KFRA 2GD2A 2CUZA 4CVNA 1CVIA 2OSBA 1BD4A 2HLNA 4R0MA 3EPLA 1TF5A 1EE9A 5JVDA 4R3UC 4F8EA 1IY1A 2COKA 3KKNA 1UJ4A 2OG2A 1NVVQ 2QAJA 4QOIA 2PS1A 4C30A 3BMCA 2EJUA 3RYIB 4P2BA 3WADA 3UJ6A 3AKDA 3TVYA 3ZXUB 4UOZA 3HN6A 2ZSEA 1Y3HA 2V98A 4NJMA 3RPEA 3EXAA 3WMRA 5SY9A 3VH2A 3QLUA 4JLSA 3V00A 1Y5MA 1QVAA 2FMXA 3B9BA 2JHPA 3H0CA 1T2VA 3TBKA 1U0RA 1W581 1CS0A 1F1JA 2XUAA 4XVQA 5EZYB 1WKCA 4D3SA 1UFQA 4OHMA 3Q8KA 1GFZA 4YMHA 4D56A 1HNXB 1JZTA 2ZSJA 5COAA 1NW9B 3QNUA 3OE1A 5HBRA 5JAZA 2R96A 4WK2B 1PZFA 4O4HA 3G2OA 5AKEA 5T4EA 3H1EA 4A5OA 1O0SA 4D0GA 3O4HA 4KB5A 2UYHA 3AH8A 2ZJAA 4TTTS 5AK3A 5LLDA 1U2RA