3OIGA

Crystal structure of enoyl-acp reductases i (fabi) from b. subtilis (complex with nad and inh)
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
260
structure length
260
Chain Sequence
MNFSLEGRNIVVMGVANKRSIAWGIARSLHEAGARLIFTYAGERLEKSVHELAGTLDRNDSIILPCDVTNDAEIETCFASIKEQVGVIHGIAHCIAFANKEELVGEYLNTNRDGFLLAHNISSYSLTAVVKAARPMMTEGGSIVTLTYLGGELVMPNYNVMGVAKASLDASVKYLAADLGKENIRVNSISAGPIRTLSAKGISDFNSILKDIEERAPLRRTTTPEEVGDTAAFLFSDMSRGITGENLHVDSGFHITARLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enoyl-[acyl-carrier-protein] reductase [NADH]
publication title Crystal Structures of Enoyl-ACP Reductases I (FabI) and III (FabL) from B. subtilis
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 93
structure length 260
sequence length 260
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2010-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3oigA00
3PVZA 3TOZA 3VTFA 3D1LA 1HDRA 4L4XA 1LC3A 2P68A 4BNVA 4I5EA 3ZWYA 1XA0A 2GLXA 3MJ4A 4BKOA 5A02A 5H82A 3C1TA 1HDCA 1QV7A 1ZO8A 2I65A 3A06A 3OP4A 4EI2A 2H6EA 2P9GA 2BGMA 3GEMA 1A27A 3IOYA 4FR5A 4RL6A 3LT0A 1BRMA 1KVSA 1RM5A 2B4TO 4PLZA 2NQTA 1F8GA 3AU9A 1Z82A 1T1RA 3OECA 3PWKA 4B4WA 3GDFA 1T2DA 3H3JA 3ORFA 5T57A 1WZEA 5TQVA 4CLXA 4BO6A 4GX1A 2R2GA 3CEAA 3JQ8B 1OC4A 4MVJE 2X9VA 3WIEA 3K6JA 4CLDA 3H8VA 2NACA 3UCXA 3HB4X 3JD1A 4YTEA 4ZQBA 3W4IA 3QVWA 3S2IA 2NVBA 3M1AA 1VL8A 3VPSA 3V5NA 1PU2A 5F1KA 3F9IA 1DB3A 2JHGA 2P4HX 4J6FA 1I2ZA 2IDZA 2EIHA 1FDWA 3UVEA 3GQVA 2DU8A 1XDWA 2BF7A 4IDAA 4PLVA 1IUKA 4XA8A 1YBVA 4B3IA 1LDYA 1XCBA 4R1NA 1J6UA 2O2SA 4GVXA 4W82A 1GZ6A 1IE3A 4CM8B 4UULA 4YT2A 4FBGA 3DBHB 4M86A 2HMWA 3UW3A 1X1EA 1VL6A 3FD8A 4CUJA 2JCVA 5L4NA 3KSDO 2IYPA 3K2BA 3ITDA 4IM7A 1PJQA 2P5YA 4NIMA 4FS3A 3WOHA 1Q7CA 4CL3A 3RKRA 2CVOA 1UJMA 3TOXA 1PGNA 5TSDA 1LTHR 2NVUB 5EESA 2ZTLA 1JAXA 3H5NA 1YBMA 1OMOA 8ADHA 3HDHA 4CMCA 5JPIA 1JW9B 4A10A 5L3ZA 3QWBA 4LK3A 4W6ZA 1E5LA 4EGFA 4IXWA 4ZRMA 1RWBA 3V2UA 2O3RA 4HUJA 5CPFA 3L6EA 3AUSA 4BV9A 2YFHA 4DMMA 1VJ0A 2Z1NA 1X13A 2PLAA 1E3JA 4E2XA 5L9AA 2C82A 3QSGA 5AVOA 1KYQA 1Q1NA 4Z9XA 2X7HA 3RU7A 5IJZA 1MV8A 1JAYA 3AFMA 2WD7B 2GYYA 2I67A 4QUKA 4MJLA 2NM0A 1EDOA 1UZNA 1IZ0A 2ZATA 3I9MA 4MVJH 2HJSA 1U7HA 1B3RA 2UUPA 4B3JA 1E1MA 1YQGA 3OQ6A 4Q3DA 3WMWA 2F00A 3OEYA 1PWXA 5JO9A 1Z6ZA 3PIIA 4YT4A 5CDGA 3MTJA 1HE3A 1K3TA 3Q6IA 2Y1FA 4Z9FA 3C24A 3FNFA 2G5CA 3PLNA 3OEWA 4CUZA 1WMBA 1NP3A 4J7CA 1YJQA 2B69A 3NTOA 1EBFA 2Q2VA 2Y1EA 4NFHA 4OMUA 4QQRA 3GZNB 5JE8A 3S2EA 4O59O 2Y67A 3O9ZA 1Y1PA 3IUSA 3WFIA 1HYEA 2AEMA 3CSDA 3PJFA 2C2YA 4Z3KA 5TJHA 4BO3A 3U4CA 4WOJA 2GERA 4MVJG 3VKVA 4FJ1A 3WLEA 1GFSA 2O7QA 4NFSA 1E1LA 1HXHA 2CNBA 2HO5A 3H2ZA 4RZIA 2BMAA 4GH5A 1IOLA 3GMDA 2HMUA 4ZA2A 3L4BC 3JD0A 5J23A 3VVBA 3ETDA 4L74A 4IMRA 5T5QA 4KWHA 1Q7GA 4JROA 3FN4A 2VHVA 3MZ0A 1T2FA 3TL2A 2IEBA 3CZRA 2VUSA 4IQ8A 3GT0A 4YAJA 4I5FA 1LSOA 3GPIA 2Y1CA 4YYZA 1H6DA 4LCJA 4N5NA 2W98A 4CLOA 4WEQA 3GR6A 4RF2A 4AJKA 1E3SA 1ZJYA 2DBRA 1M6WA 5EN4A 2WJPA 1B0AA 4R3WA 4U0JA 3TRIA 1NQ5A 1DDOA 4UAGA 3RC2A 4ALJA 1E5QA 5A06A 3TF5A 1UXGA 3DZIA 4ZQGA 5U1PA 4BNXA 1ZK1A 4L4RA 4QFCA 3RCBA 1FDTA 3H3FA 4XGKA 3IIEA 3SEFA 2JAPA 5T8KA 2H9IA 2EJVA 1GQYA 2FZWA 3OSUA 5HS6A 2DTEA 2W2KA 1E3WA 4Q3BA 1Z45A 5L7YA 1E1KA 1EMDA 5TRTA 5KVQA 4NBTA 4OGWA 4JQCA 3ZWXA 2B35A 3EVNA 3W6ZA 1W6UA 1R66A 1IL0A 1QR6A 3F5QA 4HFMA 5KWEA 1GR0A 5A4DA 3DDNA 5ER6A 3E9MA 4HNHA 1NHWA 4INAA 3WQRA 4AJLA 3SX2A 1LNQA 3GAZA 1R4NA 4IIUA 4PVCA 4R54A 3D3WB 4F6CA 4D45A 2QG4A 2RBEA 4XIYA 4I5GA 4Y6PA 5F21A 1KEPA 1P77A 2GN4A 1LBEA 4E5NA 1R12A 3BHJA 4LSMA 1EQUA 1FXSA 2WSBA 3NYWA 2CDAA 4U6QA 5GZ1A 4WKGA 3ANMA 4CLHA 2IE0A 1ZSYA 4FD3A 2G1UA 1H6BA 4CM4B 3ZWWA 3PLRA 4IY1A 2GR9A 1ISHA 2NUAA 3DC2A 4DC1A 4D3FA 1EVJA 2W2LD 4DBZA 4YB8A 2DM6A 4E5MA 5B37A 5JSFA 2GN6A 3AY3A 1ZBQA 2PY6A 3ONFA 1HYHA 3A9WA 3JYPA 5KJEA 3RD5A 1E77A 2I99A 3GPDG 1DC6A 3QY9A 1NWHA 3VZRA 4OM8A 3BIOA 3ZWNA 1R4MA 1BTOA 3FSRA 2AXQA 1OBFO 3TN7A 5ADHA 1NPTO 2DUWA 4DBVO 1U28A 1A72A 2IYOA 1E3IA 3RASA 2X0RA 2VWGA 3V2GA 2RH8A 4CODB 1AXEA 1OFGA 1E7QA 3WYCA 2YHIA 4TKLA 1BW9B 1QXSA 4CQLA 1HDYA 3DAPA 1LDBA 3WICA 2EEZA 4HBGA 3U49A 2NTNA 3ZNNA 3WGQA 4W7IA 2IZ0A 3JQEA 2JJYA 3OIGA 4R3NA 3OJ0A 3WTCA 1FK8A 4FJ2A 1QYXA 3D4PA 5TNXA 1EUZA 2RAFA 5KJ1A 1N2SA 3JSAA 1C1DA 1KEVA 3MOIA 4RDIA 3BTVA 2Y93A 5KNLA 3EMKA 4HADA 3RKUA 3K31A 1D1SA 5G4KB 4ZHSA 3WBFA 1H9AA 4N18A 5FYDA 1Y8RB 4GI2A 2ZTUA 3VPHA 1HE2A 1WNTA 4JXKA 1MC5A 1NX6A 4JN6B 3FWZA 4ND4A 1QV6A 4M87A 4BNJA 3WJAA 1VI2A 4OXNA 1V9LA 2J5KA 2PZLA 4NQZA 1YE3A 4XR4A 4E21A 1LSJA 1GQQA 3TNLA 1X7GA 1VKOA 3E5MA 1JQBA 4J7UA 1DIHA 3AI3A 4WLOA 3Q11A 3QJ5A 4WGGA 1K89A 1CDOA 4LN1A 5EIOA 3OJEA 4GKVA 3ZHYA 4GX5A 1VE9A 2HKIA 1HLDA 1P3DA 2EKQA 3VKUA 2CZCA 3E82A 4MVJM 1G0NA 1BHSA 4LMRA 3IP3A 1ZUD1 2AG5A 1EVYA 4ZICA 3GFGA 5JAQA 3RBVA 3RAJA 3O38A 1LQUA 2YDYA 4BVAA 2CDCA 4L75A 4J2OA 1U2DA 1XIVA 1EFLA 3PZBA 2I9PA 4W99A 5B4UA 3LQFA 5L7TA 1DAPA 2B37A 5THKA 4YAKA 3PHJA 4IBOA 4ZJUA 4BOYA 3WGOA 3PEFA 1GZ4A 4L9RA 5IG2A 3AOGA 4J1TA 3G0OA 2EGGA 4BIIA 4KTTE 3U5TA 3NX4A 1KERA 2AA3A 2EKPA 1DO8A 1PJCA 2VZ0A 2QRJA 1YONA 3GDOA 3ANLA 3RJ9A 1D1TA 1P9LA 3I9LA 1A7KA 1LRKA 3JQGB 2OMEA 3ZWAA 4LMPA 2NU6A 2FMUA 3NV9A 3LT1A 4ALNA 3H9GA 3KO8A 3R1IA 4IIVA 4ND3A 1MLDA 9LDTA 4Y98A 1GEEA 1GEGA 4Q9NA 3PHIA 1YB5A 1PTJA 2OO5A 3GRKA 5ES3A 5HWSA 3BYZA 4JBIA 3UOGA 3GNSA 4GX2A 1B8PA 1VM6A 2YFQA 3ONEA 4BO5A 1ZW1A 5KJ6A 4KOAA 2ZTMA 3E18A 2VHWA 1RKXA 1L7EA 2J6IA 2OHXA 3OETA 2H5LA 1YBAA 2C07A 1MX3A 4P4NA 3ZCXA 2GN8A 2JCXA 3S2FA 1Q0LA 4GPD1 2B4RO 4PVDA 1WXDA 4CR6A 4RCVA 4GL4A 3ETEA 4KP7A 4EBFA 4N5LA 4AJNA 3LZ6A 4AVYA 5JDCA 2GCGA 2OFPA 3AOEA 3JQAD 3I9JA 3WBBA 1ONPA 3DBLB 4ID9A 4KUEA 4A27A 1ISIA 1DJQA 1QYCA 5IFLA 2ZK7A 4NK4A 2AW5A 1B8UA 1JN0A 2XXJA 1KOLA 1CWUA 3H9QA 3F4BA 3KEOA 4EUEA 4IZIA 1Z7EA 4TVOA 3EZYA 3C1OA 4Z0PA 4GSKA 3KXDA 3AUTA 3INTA 3VTZA 3D7LA 4D3DA 1BDBA 1EVIA 3JQ6A 1JLLA 3DBRB 3RBZA 1ONOA 4NJMB 3MCVA 2Y66A 1IB6A 1LLDA 1U2GA 2A92A 5IZ4A 2BFOA 4MOWA 3DBVO 3ASUA 4BNGA 1U4OA 3ZHXA 3FTNA 4CM9D 4JJGA 4RO0A 3K30A 2GZ2A 2NWQA 1TA4A 4UVDA 5DDIP 5BSHA 2GSDA 5K0ZA 2O48X 4MINA 1XKQA 4HXYA 2GASA 4HP8A 2OBYA 5IDQA 3GFBA 3GY0A 2PV7A 1DOHA 2D2IA 3H9JA 4WASA 1ADBA 1GL3A 5DP2A 2PR2A 2Q4BA 3GRPA 1U7TA 1PQPA 4QT0A 1KEWA 4AL4A 5AYVA 4DIBA 2D59A 3GH3A 5EQDA 1E3LA 3H9EO 4J4TA 4ALLA 1JWBB 5DBIA 1NAIA 3WWYA 2H1SA 1XG5A 4LSWA 3ULKA 3I4CA 2JL1A 2VT2A 2ZQYA 4GSLA 5C7LO 5L95A 2I3GA 3HE3A 4XKJA 1M66A 2PTGA 1U1IA 3H5RA 1UP4A 3P2OA 4UUMA 4WEOA 4XGIA 1DBVO 1IPFA 1ZK2A 1W4ZA 4Q3AA 3ZV6A 4TZTA 4OH1A 4PLCA 1I8TA 1LLUA 1PX0A 1ZSVA 3NJ4A 1T25A 5F1OA 3RIHA 1Y81A 3INRA 1A9ZA 4RDHA 4TRRA 2UAGA 3WQQA 2R6JA 4CMJA 1O0SA 3KYCB 1C0KA 3IMFA 3KHUA 4O5OA 2O23A 4DVJA 4JBHA 4F3YA 2SCUA 1NR7A 1U4SA 4ROSA 3U9LA 4NR0A 2E6UX 4DWVA 1YB1A 3LU1A 4E6PA 3PTZA 2CDBA 1N5DA 4MKXA 3C7DB 1KVUA 3ZWVA 2W2LA 1DHRA 3FWNA 1ENPA 4GLLA 5JAMA 3RC9A 1J5PA 3FR8A 1FMCA 3JCZA 2AQ8A 1HE4A 4GX0A 3I9KA 4KDEA 3RUFA 3ZV4A 4BMSA 2WE8A 2VRBA 5JC1A 1M2WA 1DFHA 2W2KB 4DQXA 3PHLA 4IDGA 4A2CA 4ND5A 4R68A 5KKAA 2BHLA 4F45A 2AE1A 2Y99A 1H94A 4UUOA 3AU8A 5C7OO 4ZGWA 1NM5A 5IZCA 4MP8A 5IXYA 2QYSA 1YKFA 2ZIZA 1BGVA 2P91A 3CH6A 5BR7A 1E7YA 1AUPA 4J2HA 4K6FA 2VTDA 2DFVA 4DLLA 2XOXA 3EY4A 3ON5A 3QV1A 4E13A 1G0OA 5I8WA 4C7JA 4WOKA 3RQSA 4GGOA 4BNTA 1O8CA 4E30A 4TZKA 1DAOA 3WYBA 1KEUA 3GHYA 1L7DA 2PZMA 1TLTA 1XLTA 2VQ3A 1BSVA 3I9OA 3JD4A 2W90A 2ZYDA 3BTUA 5JDCC 3M2TA 1EFKA 1NVTA 4AJJA 1G6KA 1DC3A 4LISA 5G0WA 3B20A 4FQ8A 3ADPA 4XYEA 1DC4A 5K6AA 5CAEA 4JP2A 2EGHA 4R1UA 3RUCA 1ADFA 2IZ1A 3GGOA 2J3KA 2PD6A 3NDJA 5EMHA 1F17A 3HHPA 2FOIA 3CTMA 4PLYA 1PZHA 3EYWA 3OJLA 5CDYA 1HZZA 2O3TA 2RHRA 4XX0A 3RVDA 3W1VA 2B83A 2EP7A 3KTDA 1DIAA 2J8ZA 3BXXA 4IJKA 3PQDA 3W8FA 4WLFA 1KBZA 4UEKA 3O4RA 1WDKA 3OHSX 3FTPA 4HX5A 3WX0A 3K73O 4L8VA 4RVUA 4TSKA 2HDHA 1T24A 1N9GA 1XU7A 1OI7A 4M8SA 3K9QO 3TZCA 4KUGA 1NAHA 4CJXA 3Q2KA 1T4DA 1MXHA 5JBIA 2PZJA 2YHIB 3GVCA 3GAFA 3LYLA 4Z9YA 3NGLA 2E48A 4EDFA 3KYDB 2YV3A 2UUOA 4HKTA 4J1SA 2XXBA 1F12A 4Z3DA 2DBQA 1GZ3A 3R6DA 4TQGA 4URFA 1JKJA 3KM0A 4BO7A 3HDQA 1UDAA 1LJ8A 3FR7A 4J90A 2BLLA 4YT8A 3N7UA 1X1TA 3UF0A 1UXIA 3PQEA 4A5OA 2UV8A 3PDJA 2DC1A 1C1DB 5T64A 3Q9NA 3ZNPA 1X7DA 2EKLA 4HWKA 4HY3A 1U5AA 2IXAA 4N54A 1OZAA 4M89A 3VAZA 3WJ7A 5G0TA 2PA3A 3DHNA 4J0FA 4G81A 5JMPA 1YQDA 3EZLA 5TF4A 5KVSA 5TS3A 5A9SA 2EJWA 4R51A 3F4LA 3M1LA 4I9UA 3NT5A 4J49A 2GDZA 1NPDA 4CLRA 3LF1A 3V1YA 1UZMA 4BO2A 4BB6A 1V8BA 4R1TA 4WLUA 1N7HA 3I1JA 4DUPA 3QP9A 2OXIA 1E1NA 3VZSA 4AJ4A 1LXCA 4CMHA 1NFQA 3WIDA 4J0EA 4YWJA 4I1IA 3QHAA 1MUUA 1S7CA 2PKRA 3K2EA 3S8MA 5HA5A 3ZWBA 2VWHA 4IDFA 4UEOA 3L6OO 4ND1A 3I6IA 2ZB3A 2DTDA 4RQUA 4XRGA 2RIRA 2DKNA 4YJGB 4MVJD 1SC6A 1ZJZA 3FPCA 4DRYA 1NFRA 2NTJA 2CFCA 1O5IA 3WMXA 4CLEA 2YY7A 2DPHA 3NGXA 4E2WA 2P4QA 4K28A 4J4BA 3PWSA 3JQAA 2CF5A 3H9UA 1NXQA 4H15A 2IEDA 3VOSA 5IN4A 3Q2IA 4B7CA 4B4OA 1DIRA 2O3JA 2X0NA 4PFJA 4BS9A 1MB4A 4ESOA 3Q3CA 1A7AA 1UP6A 4ZRNA 4RPGA 3G79A 4CMBA 1OAAA 1LRLA 1H93A 2YQ4A 4RF4A 4XYBA 4E3ZA 2CVQA 4XB1A 5G0VA 3KSZO 4BKPA 3ANNA 5JDIA 4BKQA 4NBWA 3D4OA 3EHEA 2CY0A 2OORA 4PZDA 1A71A 2V6MA 4YDRA 4KQXA 3R3SA 3DO5A 4FC7A 1U8FO 3D5TA 3K92A 3ROPA 4NI5A 5K9ZA 5HRUA 3GEGA 4GQAA 1E6EA 3G1TA 5CEFA 4OYRA 1C0PA 2DUUA 3KSUA 4PGFA 1KS9A 1MFZA 4TKMA 1W8DA 2FN7A 4I9NA 2HAEA 3M6IA 1R16A 1UDCA 4EUHA 1BXGA 4ALIA 1RM0A 4GWGA 1UH5A 4BHTA 5KJCA 4DTIA 1FF9A 2WYWA 1NBOA 1EVZA 1H6AA 3RC1A 1Y6JA 4CMGA 4EZBA 1ZCJA 1GCUA 1GV0A 1ID1A 4ZVVA 4NK5A 2YUTA 5EJ2A 2VNSA 1GYRA 1HSOA 3GVPA 4AJPA 1WZIA 2PZKA 1VSUA 2BD0A 4R4JA 5FFFA 3F5SA 1N1EA 5BT9A 1R0SA 1YOVB 2X86A 3NTQA 3WYEA 1RJWA 2WMDA 5BQFA 1FDUA 4B7XA 3WGTA 1F06A 3QQPA 2A4KA 4FCCA 4MVJI 2I5PO 2HU2A 5KVVA 2EG9A 1G1AA 3WNQA 4BV8A 3O03A 5JCJD 5JAZA 5MDHA 3HZZA 4BGEA 2AE2A 2NLOA 1EK6A 1LLQA 1PL6A 4FJ0A 1SO8A 2C54A 4MIEA 2VUTA 1KY4A 1H2HA 5AOVA 3ROKA 4RPHA 2FWMX 3BTSA 2ZB8A 2ET6A 5COAA 1IHYA 4BGIA 4FFLA 1JDJA 3RWBA 4JJFA 4DPKA 4O63O 1K6IA 3UHAA 3DAGA 4IPTA 4FPXA 4CQMB 1TT7A 3B70A 4E31A 2HMVA 3JTMA 4PZCA 1LU9A 1SB9A 2TMDA 3ADOA 2D8AA 4YJFB 2Y05A 1NVGA 1M67A 2J3IA 4YJHA 3WTBA 1ZH8A 4Z6KA 5B4TA 4LW8A 1JTVA 3KEQA 1YQXA 2I6TA 3O26A 1YWGO 4Y9DA 4BO4A 4OOFA 3K96A 5T6BA 4A26A 1LRJA 4UEJA 1I36A 5ILOA 2GD1O 2IXBA 3IUPA 1UXKA 1XELA 2H63A 3O8QB 1ZZEA 3CZMA 4OHUA 1C1XA 2JD0A 2QQ5A 2VOJA 5L51A 4D43A 1TT5A 5CHEA 3ZV5A 3U0BA 2ZB7A 4I8XA 1N1GA 2BKAA 3W8DA 4Q3EA 3WGZA 3MJTA 4U8GA 3H5AA 8LDHA 3EW7A 4OL9A 2G17A 4YR9A 2IODA 3G17A 4XB2A 1PS8A 5LCXA 4P22A 1ISMA 1XGKA 4OOEA 2XF8A 2B0JA 3BMOB 4RLHA 4J7XA 3QE3A 4BNUA 3TZKA 2WDZA 5B4VA 4CMIB 4WCDA 5ICMA 3JQ7A 5C5IA 1HDGO 2E37A 1C14A 3BMNA 1ZK4A 4CV1A 4DQVA 5F3RA 1D7OA 5CEJA 4BKUA 3QVXA 1Y7TA 2POQX 2LDBA 3C7AA 4BNHA 2EW2A 3R0IA 4FC6A 1PJLA 1SCUA 1VL0A 3BMQB 4R1SA 2VYVD 3QWAA 3L07A 4MPDA 1YXMA 1HE5A 4ALMA 5L45A 4DGSA 2VHXA 2WTBA 4PN3A 3JQCA 3BMCB 3DZHA 4RZHA 3NDIA 4CR7A 2GO1A 5A04A 1RM3A 5L53A 5KTKA 4L73A 3V2HA 1U9JA 1EZ4A 4XEHA 2OUIA 3GG2A 1T1SA 3IC5A 3UAGA 3QLJA 4IZHA 3T7CA 3I52A 2CSUA 2QZ9A 2PGDA 4XJTA 5HBRA 3HFSA 1AN9A 7ADHA 4AJOA 2ZQZA 2O4UX 3PGXA 5GY7A 2VRCD 2Z1MA 4ALKA 3F47A 5BNIA 1GUYA 4EEXA 1Y8QB 4TRMA 2A94A 4J16A 1TXGA 2VWQA 4NZ9A 1PJ3A 4MVJF 4NH4A 4NU6A 5DT9A 4BGVA 2D0IA 3PJDA 2AQKA 4G65A 5A9TA 4PG6A 5JS6A 1EE2A 4XCVA 2Q2QA 1PWZA 3U3XA 4NBVA 4WCFA 2YDXA 4FOOA 1IPEA 2FPGA 4XWYA 2HK9A 3BHMA 3ASVA 3GGPA 1E7RA 4YA6A 3DB2A 3UICA 1OC2A 1P74A 4NHEA 4OSOA 1ZMTA 1FDVA 1Z73A 4EJMA 4XDYA 4E33A 5JO0A 1HSZA 1LC0A 4Q3CA 4RV9A 5G0UA 4YT5A 2VUUA 1NQAO 1RYDA 2Q49A 4LVUA 4MVJA 1AGNA 4XGNA 3DOOA 3JD2A 3JYNA 3RBXA 2ZCUA 3OQ1A 2PGJA 1UAYA 4K1LA 4OJNA 4QEDA 4AJEA 4O6VA 2HJRA 1Q0QA 2VT3A 4HFJA 3EK2A 3SC6A 1EEHA 2X0IA 4R41A 4XZ3A 1MXFA 2X9GA 3FI9A 1XEAA 3GHHA 5FF9A 4M54A 3RFTA 1YL5A 5T8KC 1HRDA 4BMNA 4IDEA 1JWAB 2DQ4A 2YW9A 2JFGA 2O3UA 1P45A 1I01A 1LDMA 1LUAA 4R5MA 4RQTA 3UN1A 1P1FA 3PI7A 1PS9A 1VPDA 1DRVA 4KMSA 3SC4A 4EUFA 4ZQEA 4GMGA 5JMWA 5H83A 1WWKA 1YS4A 1ISFA 1I2CA 3CMCO 1V35A 5JW6A 6ADHA 4CM7A 5TIIA 1PEDA 5HS4A 1D4FA 1ZVMA 3FCOA 3I23A 1I3NA 1P1HA 3L9WA 1T26A 5CDUA 3DZGA 4GLOA 3V1UA 1QYDA 1I3KA 3L0DA 3G1UA 4UUNA 1WVGA 2JCYA 2Y68A 1ULUA 4CM8A 4JBGA 4PLWA 3DBHA 3R3JA 1HLPA 3DONA 5I7FA 3HN7A 3I3OA 2FZEA 3NDRA 4TMFA 2G76A 4WUVA 3LDHA 1K0UA 3FPLA 4Y6SA 5COBA 4AG3A 5GMOA 1A9YA 3KRTA 1E6UA 1BG6A 2X4GA 3C7CB 3WR5A 1NWCA 1V3TA 2I66A 2YZ7A 5TJ9A 4AJIA 2NVUA 1N92A 2OOSA 4TVBA 4BNIA 2AHRA 1CJCA 1I0ZA 1SOWA 3MOGA 4D42A 1D3AA 4DA9A 1ONNA 4XQGA 3U4IA 4J91A 4PRLA 2GZ3A 4D79A 5THQA 2Y1DA 3GUYA 4FOSA 4Q3NA 1GQ2A 2RH4A 1Q7BA 1I5RA 4YRBA 2VYND 2WWRA 3DOCA 4PLFA 3WS7A 4ZN6A 1UP7A 1UUFA 1P0CA 1ZSNA 1T2EA 2ZJ0A 4PLHA 2B36A 2F1KA 3MWDB 4MP6A 4UREA 4CMKA 3AJRA 3PHGA 2C0CA 5JCJA 3EAGA 3A1NA 3PXXA 3QRWA 2WD7A 4GVLA 3VC7A 4LCEA 2HK7A 3EUWA 4ITUA 3HDJA 3HB5X 5CP8A 3TFQA 3OIDA 1EK5A 3PWZA 4FFMA 4XYGA 2WD8A 3E5RA 4H16A 1VJ1A 1YDWA 5JAIA 5JYDA 3Q1LA 3ZWOA 1BXGB 3DXFA 3ZU4A 3VH4A 2DBZA 1TEHA 4YXFA 2C59A 5KOIA 4NU5A 3UGKA 4TWRA 4JP3A 4L76A 1NYTA 5JNLA 4NDNE 2XPCA 1IHXA 2P2SA 2RHCA 1B26A 3GZNA 4XDZA 4DQUA 3AFNA 4X54A 4P38A 4BB5A 2VWPA 3PJEA 3B6ZA 3DL2A 4BMVA 3H6KA 3A14A 9LDBA 1IYZA 5EL0A 5T67A 1UXJA 1H9BA 4JIGA 2FSSA 3DZFA 4QXMA 1PGQA 1Y9AA 3PIDA 3PGJA 5G2OA 4L4SA 1YL7A 4E12A 3IQDB 3RUEA 4R69A 4BO0A 3MJSA 3QVTA 1MFPA 3D4NA 3KOUA 2UVDA 4KQWA 2Q46A 4UVEA 1LLCA 2Y0CA 4IXTA 1SNYA 4NG5A 3ABIA 1GYPA 1O9BA 5F5NA 1WW8A 4E5YA 1ZNQO 1PGOA 2ZKLA 2LDXA 1L1FA 5IF3A 4B4UA 2B5VA 4WJZA 2Q1TA 4AJHA 4CM6A 2Q45A 2W8ZA 1IZ9A 5DCWA 1HETA 1NASA 1UR5A 1B14A 4QX6A 4DXHA 3P19A 1YH3A 2DPGA 2AMFA 3DZBA 3F3SA 3VH2A 3P7MA 3VPFA 1NQTA 4N5MA 4CLOB 2G0TA 4YJHB 3GC6A 4EJ6A 4II2A 4DMLA 2Z95A 5A9RA 1V3UA 3P5SA 1WDLA 1PJSA 4YRAA 1H5QA 3DWFA 3MJVA 2VYVA 4QO8A 4QO7A 5FI5A 2R00A 3UXYA 4JJIA 5GZ6A 3U62A 3OICA 3SJ7A 1XHLA 1C1XB 4N7RA 1FJHA 1DRUA 1E3WB 2CUKA 4OIMA 3ZHZA 3ZDFA 2GPTA 4B4VA 1LEHA 2JKVA 1R0KA 4GBJA 1WP4A 3MJCA 1HDOA 4CM5A 3WB9A 1K6XA 3ROMA 3DHEA 1YGYA 1H0KA 2NNLD 2PH3A 2J3JA 1QLHA 5IXSA 2UYYA 3ST7A 3ICPA 4BL5A 3EVTA 5CG2A 2Q4EA 2A35A 2VRCA 1R4NB 1T2AA 5COQA 3IL2A 4RLSA 1H2BA 4PRKA 2Q50A 1PJ2A 3OJOA 4G2NA 4J4HA 4U7WA 1H6CA 3EGOA 3GK3A 3VZQA 5A3JA 5IDXA 4MVJP 2Y1OA 3JQ7B 4R16A 4DIFA 4EITA 3AOEC 3TWOA 1GD1O 3BMNB 3HDYA 3MJEA 3JYQA 1C0IA 3E1KA 4CM4A 4ILKA 2DBVO 1SAYA 4FDAA 1LQTA 4BGUA 4R01A 3F6YA 5CEEA 4B3HA 2QHXA 2X0JA 4EW6A 2DT5A 4R9SA 1AE1A 2CD9A 4RPJA 2EHDA 4BQRA 2VZ9A 3AM4A 2Q3EA 3KB6A 3ONDA 1BDMA 1YRLA 2C7VA 4YEDA 5C3MA 4O0LA 3VDRA 2JD1A 5ENDA 3I4FA 3WGGA 2YYYA 2ZCVA 4GKBA 4MP3A 2YV1A 2HK8A 1UXHA 3GN1A 4U0KA 1CQIA 1E0DA 1EUCA 1R4MB 4FB5A 3CINA 4MKRA 4IMPA 3WWZA 5ER9A 3JV7A 1LSSA 1ZFNA 3KV3O 3HN2A 5I9NA 4P4GA 3GF4A 1QLJA 1GTMA 1A4UA 1YJ8A 2EXXA 1WMAA 1CEQA 4CQLB 1PR9A 1Z7BA 1CIVA 1KC1A 1HKUA 2EV9A 5FI3A 1X14A 1JA9A 1ZXLA 1FDSA 3TJRA 5MGBA 3VDQA 3X2FA 4CM1A 3BTOA 3LLSA 2JFHA 4UVIA 1A5ZA 4R5HA 3H2SA 1LX6A 1QYWA 1R37A 2BH9A 3LSYA 4YPOA 3WGIA 5TX7A 4MIYA 2PD3A 3VH3A 1EE9A 3DMYA 2O7SA 2NU9A 4FN4A 4PLPA 5G4KA 5AXCA 3GVIA 1Y8RA 3ETGA 3TSCA 3NEPX 4IDCA 3IAHA 3E9NA 3RFXA 1PQUA 4UVGA 3NAQA 1V0JA 3WXBA 5KKCA 1PJBA 1BWSA 4CMAA 4S3MA 3LLVA 4OQYA 1Q2XA 2OZPA 3BZUA 1U3WA 4FW8A 5BNTA 3ZU5A 2G82A 5DZSA 3DTYA 1J49A 2I76A 3KYBA 1E7WA 3LT2A 3OQBA 1XYGA 3ZGYA 4RORA 1PZEA 5EINA 4WNCA 1O89A 4GGPA 2PNFA 2X5KO 1DFIA 3MWEB 2JAHA 4CPDA 2X5JO 2GZ1A 5BNFA 3L4BA 1B2LA 4ND2A 2R00C 4BNLA 3IKVA 4Y6RA 1VLLA 3GEDA 1ORRA 1PSDA 1HT0A 3CE6A 2VYNA 4K6CA 4ONEA 1ZIDA 1LI4A 3GA0A 3KBOA 1ZK0A 3OH8A 3QWHA 1XQ6A 3WGYA 4J9VA 3BAZA 1C0LA 4FFPA 1PGPA 5IZCC 4IGFA 4BNFA 3NT2A 1PGJA 1X0XA 2BI8A 4I08A 2WE7A 1JVSA 2J3HA 2HQ1A 5CFZA 1P31A 3IDSA 3RU9A 4TROA 4IDBA 5CPBA 5KIAA 2O4CA 4YRDA 4PG5A 3JQGA 2FRDA 3SVTA 4LVCA 2XAAA 1M76A 2RCYA 3ZW8A 4W9NA 2Z5LA 1ZEMA 2QIOA 3DHYA 4YACA 1X15A 1R6DA 2O3QA 1TVEA 3NTRA 3W4KA 4RVSA 1CERA 1U3VA 5EQFA 3ZV3A 1K5HA 4QECA 1HTBA 2C20A 2HSDA 1W73A 5K6AC 1O95A 3AM5A 3WQSB 3PFFA 3AM3A 5FWNA 4XQEA 1ISJA 4KDFA 3BHIA 3ZNOA 5A03A 4FGSA 2JD2A 4CM9A 1SOVA 2PD4A 1DSSG 1GPJA 2HCTA 3DTTA 4W7HA 3AUAA 1KVQA 2D1YA 2WYUA 5AXDA 2Q1WA 2OBNA 5TGDA 1Y9EA 5I9MA 1DXYA 5DNAA 2PK3A 4FSHA 1U5CA 2YJZA 4W4TA 2QRLA 2IRWA 2E82A 5ILGA 2X58A 1NHGA 3DBLA 5TLSA 4E2YA 1P1JA 3JYLA 3OA0A 4B7UA 3GVHA 1ARZA 1LSUA 2PGLA 4JGBA 1YL6A 3LC2O 4B8WA 3B1KA 2DVMA 2ZYAA 4BO8A 5AQ1A 3I5MA 1BMDA 3D5QA 2NSDA 3GNTA 3DEYX 5A1TA 4ZQHA 3RROA 3QVOA 3DBRA 2EP5A 1ZMOA 3HFGA 4NJMA 1PJ4A 1E92A 4S1VA 1QKIA 4UVHA 4RPLA 2YQ5A 4JX8A 5G0SA 1KVTA 2O2YA 3DFUA 1GV1A 1MA0A 4HFRA 1LA2A 2ZYGA 1SPXA 2W4QA 3UKOA 5B1YA 4IINA 1PQWA 3DOJA 4OXKA 3GUCA 1NPYA 2X23A 1J4AA 2DLDA 1RM4A 1P44A 3VPXA 4WECA 2B4QA 4WLEA 1P1RA 1O6ZA 4E4YA 3FBGA 4YAGA 4MDHA 4IJWA 3V1TC 5LDGA 4U6SA 1MG5A 1DLIA 1DEHA 1QP8A 3D0OA 1F14A 5KJFA 2X6TA 4CV0A 4WLVA 4FGWA 3RC7A 3ENKA 4D41A 1PZGA 2VN8A 4E5KA 3FHLA 3PDUA 4BNWA 5JLAA 1U3TA 3VPGA 2ZJ1A 2Q99A 2AG8A 3V8BA 3VZPA 5DOVA 1P0FA 4KUHA 3WDSA 5BSEA 3QW2A 2HMSA 4DC0A 5I8ZA 4TRNA 4XIJA 3UCEA 1Z75A 3DR3A 2BRUA 3Q0EA 3UUWA 2QW8A 4FIZA 5I7EA 5JY6A 4PIVA 2ZB4A 2C7GA 4J3FA 2NTVA 3K5PA 1YO6A 3KYCA 4XRRA 3CIFA 4H3VA 4DIOA 1RPNA 2OGUA 4B79A 4OSPA 2GF2A 1ULSA 5U4QA 4NJOA 3RSHA 5TT1A 3ZWCA 4YQZA 1UDBA 1QORA 4A73A 1HZJA 4ZU3A 3JQFA 4J1NA 1KVRA 4NMHA 4W9NC 2ILTA 1ENYA 3P2YA 5JDIC 1NVMB 1DLJA 1NFFA 1I3LA 2X5OA 4CUKA 7MDHA 2X1HA 3BA1A 3CXRA 4MKZA 5AXAA 3F1KA 4CQMD 1GADO 5A3VA 3OJFA 2AQHA 5LC1A 4CMEA 2CMDA 2EF1A 2V6GA 2NQ8A 3C8MA 1ZXBA 2ZTVA 3HNPA 3OFSA 4QFDA 3E9QA 2YHUA 3ITKA 2C5EA 4XYLA 1VC2A 5CDSA 2NVWA 4WPGA 3TFOA 3LT4A 1BVRA 3KUXA 1E7MA 1XWFA 4LRTB 3U09A 4J9UE 4R9RA 3T4EA 1I2BA 4BO9A 3W6UA 4XQ9A 1IULA 3TDKA 4KZPA 3GNQA 3HQ4O 1ADGA 4XQCA 2GUGA 4PCVA 3AUUA 3LVFO 4IDDA 4I9HA 4D46A 1M75A 1NR1A 2D4AA 2HRBA 3GVXA 3AW9A 3PYXA 3DMTA 1SEPA 3RUDA 5KCZA 3E6AA 4MIOA 3ZZNA 3IP1A 4BNKA 3X2EA 3E48A 1E6WA 2V6BA 4CM3A 5DP1A 2BFMA 2PKQP 5L7WA 3I9NA 4UUPA 5JCXA 1VSVA 2HUNA 1B16A 5ICSA 1C3VA 3GGGA 3DAFA 3S1LA 3S55A 2OP0A 1D8AA 2UDPA 1R0LA 1PL8A 3ZU3A 4M1QA 2Y0DA 3W8EA 3CPSA 1LDNA 4YQYA 5HTOA 4E2ZA 4AFNA 5F5LA 3N74A 3TZ6A 1HWYA 2V65A 1OOEA 3IJPA 3U4DA 1KY5A 1WLYA 2Y0EA 1ZK3A 3ZH2A 1N9GB 3ENNA 1E7SA 3LC7O 1JKFA 1K2WA 5L4LA 4IGEA 1SZJG 1B3BA 3TZHA 3VVCA 1CRWG 3KETA 3G3EA 5GZ3A 3KYDA 1P33A 2X22A 4HNGA 4D3SA 3RUHA 1T4BA 4C7KA 3F1LA 1VRWA 2A9FA 4RPKA 4PLTA 5JY1A 3NJ8A 1QSGA 1JKIA 1V3VA 5FEUA 5DBFA 2BGKA 3L9XA 1EDZA 1PZFA 4OAQA 5U9CA 1GUZA 1ISGA 3JD3A 3RUIA 3UH1A 1YVEI 4QSMA 4CV3A 1B15A 4DYVA 4F46A 5IDWA 4CR8A 4NFYA 5I9LA 3WFJA 2FY8A 4NBUA 3WSVA 3I6QA 4DLAA 1A4IA 4I5DA 2NU8A 3S2GA 3SBOA 3HADA 4B8ZA 5ITVA 4OQZA 2Q1UA 4GMFA 4HV4A 3JQ8A 5A9SB 3IJRA 4KWIA 4CLRB 3SJUA 1T2CA 2BGLA 2D5CA 2FSVA 5CG1A 4BKRA 1GCOA 1Y5MA 4P4LA 3GZ4A 5F1PA 1DHTA 1QMGA 3JQFC 4Y8VA 5L4SA 3AI2A 3STHA 2QRKA 4IJVA 4YJGA 1DJNA 4BNNA 1HDZA 3KLMX 2B5WA 1EUDA 3HJAA 4IS3A 4WNIA 3U4HA 1KETA 3D3EA 4NPCA 2HLPA 1VKNA 2FPPA 3UFXA 2QX7A 4BQPA 5DN9A 3JQ9A 1XQ1A 3PYMA 4OO3A 4CMEC 3QVSA 3NRCA 1CETA 2BFAA 2V7PA 2VHZA 5IN5A 4GAEA 2Q1SA 3IKTA 3LK7A 3KLPX 3W4JA 1ML3A 3JQAB 5KVCA 3HG7A 1DPGA 2QYTA 2C2XA 1GU7A 5L40A 3RUAA 3L4SO 1I32A 2X9NA 1CQJA 1HYGA 3SXPA 4JCOA 4XD2A 2GRAA 3L77A 1B8VA 3E03A 4J43A 4EJ0A 3L6DA 1VJTA 3PQFA 2EWMA 1LDEA 2WEKA 1PL7A 2VNAA 3INGA 3ROQA 3OM9A 1ZEJA 3DMTC 1K6JA 3NUGA 5DF1A 2JHFA 4LRSB 5TC4A 2CVZA 1WAMA 4DPMA 4IUYA 3E8XA 3GLQA 3JQDA 2PFGA 5TT0A 2J5QA 3EDMA 1I30A 1SEVA 1HEUA 1PJTA 1PR3A 1YB4A 2NU7A 3CKYA 4AJ1A 3AI1A 4D0RA 2PH5A 3T4XA 4HFNA 3DZKA 1RYEA 4K26A 3D64A 4ZD6A 2O3SA 1U8XX 1AXGA 2E49A 3QIVA 5I7SA 5DCYA 3ICCA 2TMGA 2I3AA 4XYMA 5G4LA 1XSEA 4EEZA 4RVDA 1EQ2A 4WCFC 4XR9A 5JYEA 1E3EA 3RJ5A 4FFOA 3JQBA 1I3MA 2NADA 2VTEA 5BSFA 1NTOA 3IS3A 2P9EA 3T7EA 1YOVA 1I33A 3KZVA 3ZN2A 5B12A 5C7IO 6LDHA 2PWZA 1EBUA 4IJUA 4U5QA 3H65A 3WNVA 5A5EA 5ENVA 3B1FA 3PJGA 4IS2A 3SLGA 2J5RA 1QRRA 2FR1A 4PG7A 1UAGA 5A5FA 4D7AA 4WLNA 3VH1A 4GWKA 1ZKMA 4XJSA 1MGOA 3UCFA 2WYVA 4M55A 3C1AA 3OF2A 1QYVA 1ADCA 1DRWA 2NV6A 1U3UA 2OP1A 1DC5A 2DFDA 4E32A 4YAEA 4DL9A 3A4VA 3PZRA 4M49A 4EYEA 4WE3A 4PZEA 4IQ0A 5LDHA 3OMLA 5CDTA 1ENZA 3H7AA 4D44A 1X7HA 3JYOA 2GNAA 3C85A 2X8LA 5DULA 3QWFA 3FNEA 1SBYA 3LF2A 1DIBA 1PS0A 3GMSA 3PYLA 3B1JA 5A05A 4FFRA 2EERA 1WDMA 2PKQO 3CUKA 4RF3A 4D0SA 4BNMA 1UZLA 4JNKA 1F0YA 1JU9A 1PIWA 3PK0A 3TL3A 4A03A 2P9CA 1F8FA 4CQMA 3HUDA 1KC3A 3CMMA 1ENOA 1J0XO 3VHRA 4PG8A 4YJFA 4P8RA 1TI7A 4PG4A 4DLBA 3ZU2A 5DBGA 5ITWA 1SMKA 4Z0TA 4NNJA 5EERA 4JLWA 3TZQA 4A0SA 4AJ2A 3GOHA 4DREA 3FNGA 5AXBA 3AY6A 2YV2A 4OKIA 3AK4A 1GDHA 1MP0A 4K9DA 4CV2A 4WK6A 2OL4A 1SB8A 3O8QA 1M6HA 4C4OA 4MO2A 3AY7A 3M2PA 1V6AA 5IDYA 4YJDA 2E4AA 3JQ9C 1NQOA 3ZW9A 2O50A 4E0BA 2WM3A 3MTGA 5IAAA 2DAPA 4TRJA 2HRZA 4QTZA 1GY8A 3EC7A 2QZZA 5H81A 4RVFA 3NKLA 1TT5B 2CF6A 5EPOA 2C29D 4BNZA 1O94A 2BI7A 1HF3A 3G49A 4DPLA 3GN2A 3LC1O 5JFOA 2VHYA 2VZ8A 4KTVE 2JFFA 1MG0A 3DFZA 2FP4A 4OKNA 3BMOA 3ZI0A 2HMTA 3WSWA 1WPQA 1W0CA 3D3WA 3FNHA 4G5HA 1X0VA 2EW8A 3C3XA 4NBRA 4YVFA 2C5AA 1CF2O 4RJTA 3FF4A 3N58A 4CMIA 1P1IA 5DOZA 5JC8A 2FPIA 2BFPA 2D3TA 1Y5RA 2D5AA 3WGHA 5JXWA 5DCUA 1GYQA 4AICA 3GG9A 3COSA 3GDGA 3WG9A 4YAIA 1CYDA 3QWIA 4BNYA 2P5UA 2FHSA 3DZJA 1GAEO 3PPIA 1N7GA 1P1KA 3OBBA 4RVGA 3PFWO 3BMQA 1GUFA 2Y1GA 3F46A 3OIFA 4RF5A 4RVHA 3HSKA 2DTXA 1XU9A 4FFNA 1BXKA 1HDXA 1S6YA 4O1MA 3MEQA 4DYDA 4JK3A 1TB4A 2V6FA 3BMCA 4Y67A 1BXZA 1B7GO 3DQPA 2FR0A 2AEJA 1MC4A 3K8ZA 1KIFA 1I10A 4RGBA 2VOEA 3QA9A 3ZWPA 1HL3A 3JQBC 3PRJA 3Q9UA 1DIGA 3WLFA 2GN9A 4OXYA 4Q39A 3NT4A 1BVUA 1Z74A 2IZZA 3SLKA 2GGSA 3KVOA 3I83A 4PLGA 1BW9A 3HWRA 4E5PA 3ZWMA 3ZNQA 3AWDA 4YBZA 1IY8A 4A7PA 1Y8QA 4II3A 4H7PA 3TPCA 4J1QA 4IQGA 3ZHBA 4CL8A 4F6LA 3A28A 2FR8A 3FRJA 3RI3A 1AHHA 1N8KA 3TQHA 2BELA 3PHHA 3FBTA 2AQIA 4BO1A 4ZQFA 4LGVA 4L0QA 1YDEA 1LDGA 4YCAA 2Q2WA 3H4VA 4WCFB 1GPDG 2VCYA 1R15A 1I24A 1Q0HA 1QG6A 5BSGA 1DFGA 3RFVA 3OA2A 3PP8A 2AEFA 4Z0HO 4BUCA 5I7VA 1NNUA 1XR3A 5C37A 1JVBA 1AHIA 5HM8A
chains in the Genus database with same CATH superfamily
3TOZA 3D1LA 1HDRA 1J90A 2TMYA 3BWEA 4QHSA 1Z7YA 2C5HA 2ZIXB 1LC3A 1QZ3A 5TMEA 1DEOA 4O08A 5JJLA 4BNVA 2WSIA 4LF6B 2O8CB 2FG7C 1A4XA 2GLXA 4KFTA 3WKDA 4BKOA 5EJGA 4EI8A 2OCIA 1JDZA 3LE8A 2HK6A 4ME6A 3UOAB 2P0EA 3OP4A 4H6PA 2RHGB 4FGZA 4FZVA 2HA4A 3FRHA 3R7AA 3RSGA 1TD9A 3UHPA 4FR5A 3V34A 3MN1A 1BRMA 2W6NA 2B4TO 3H2JA 1LX7A 3ZDRA 3FCXA 6PFKA 4PFSA 1V26A 2JKZA 1E89A 1Z82A 2XECA 2JASA 3PS9A 4UDXX 3CX7A 3PWKA 1LVUA 4WY8A 4CFYA 5BN3B 3ZTYA 3GDFA 4YXWD 3L8EA 5EFZA 1OLSB 4EHIA 3EWIA 4JASB 3JQ8B 3H1BA 3KD3A 5DTRA 3F49S 1G7CA 2ACKA 2WF5A 2J48A 4ZQBA 4UDNA 4JYZA 3S2IA 1Z5ZA 3D6FA 1FMJA 1WUKS 3LHIA 2QTZA 3QPBA 4TKVB 2Z57A 3VPSA 4BC1A 3H05A 3F2VA 2VDLB 2QQFA 5AHKA 2O2EA 4DCNA 3UG6A 1N2JA 2JHGA 4Z4QA 3QVGA 1UJBA 4YLGA 1Q77A 4KX3A 2XUJA 3K16A 1FDWA 3PXUA 1EG2A 4A3SA 1V2GA 1XDWA 1BDHA 1IWPB 3H8SA 1XNHA 3D0KA 4HGQA 1ZL2A 2HY7A 2A1TS 2QD2A 2IPXA 2WJJA 1XCBA 3EG9A 1JEDA 1J6UA 4GVXA 4FFBB 4R1NA 5CJPA 4ZVOA 3UMRA 4E4RA 1GZ6A 1IE3A 3Q1KA 5D85A 2W93A 3D31A 1EH5A 2AR0A 4M86A 4CM8B 1IB0A 1CRLA 2IY8A 5L4NA 1MEEA 2IYPA 2BGRA 3R8XA 4ZCLA 1TDJA 1T0UA 3K2BA 4RK4A 4COKA 3P2KA 1ECLA 4HRYA 5FL3A 4QTXA 4CL3A 3PENA 4FK8A 4BQFA 3TOXA 1D0VA 1PGNA 2J9YB 1TNDA 2NZVG 2GPYA 2ZTLA 1JAXA 4OVKA 3EX7C 1TCUA 1YBMA 2CEAA 1OMOA 3DOEA 1TO6A 2HA3A 1F4PA 3D6VA 3ONNA 1KI3A 1OLUA 4HWGA 4PHFA 4A10A 5LQKA 5CLIA 3QWBA 1JG6A 3F7MA 3RT9A 1XE3A 5HBGA 3FJOA 2YX1A 4HPXB 3SY8A 1Z22A 1WTAA 5JUWA 4W6ZA 3D7NA 4AS1A 2NZXA 4ZZ3A 4DTCA 5LYJF 4PO3X 3V2UA 1D07A 2O3RA 5CPFA 1KAEA 1X86B 2RBKA 4O25A 4GT1A 4ANFA 1R6AA 2EVWX 1I4LD 2GBPA 2MIIA 4BPRA 4BV9A 1VJ0A 4PS1A 4Q4LA 3GA7A 4F91B 1KBQA 1YQWA 2HW8A 4ZYWA 2O54A 4KQFA 1SXJC 3B2NA 3WMGA 1A0OA 1E18A 2QA5A 3KKNA 1Y3IA 4DYHA 3LIPA 4ZREA 1AUOA 1L8AA 1Y34E 2X7HA 3RUPA 3TECE 1MV8A 4IRMA 3D1JA 1GFZA 3RK4A 2GYYA 2I67A 4QUKA 2OENG 5E6RB 2XITA 2NM0A 4ZZ1A 2O8FA 1UZNA 1IZ0A 4FT2A 5JZBA 4UNNA 1T8UA 4DCPA 4Y9SA 4JYMA 1L5QA 3QE0A 1CRPA 1DRKA 5CB4A 2VDWB 1JYEA 2IBMA 3MWKA 1B3RA 4OL0A 5GAJA 1RXCA 1QVAA 4BCDA 4B3JA 1JB9A 4S1WA 1HH4A 1E1MA 1YQGA 1ZITA 2IUFA 4NS4A 1JMVA 1B6GA 5AP9A 5A4JA 1D6SA 2XWSA 3OEYA 2RFLA 4QNMA 1C4XA 3UWPA 3WO1A 3PX7A 2ZTHA 5FLYA 1W1WA 1GAXA 2HXGA 4GDFA 4OUDA 4TLAA 1ZCAA 1ZJ4A 2BCJQ 2YNMD 1XCPA 3PLNA 5AK3A 3Q4GA 2Y0BA 4N5IX 1FFGA 4QT4A 3COJA 4J7CA 2FMKA 1L5KA 3BIFA 2XVMA 4NNPA 3NTOA 3HB7A 2YN2A 1YVPA 4OMUA 4CCYB 3N2GB 3P0FA 3O9ZA 5HM6A 4M6WB 4UW9A 3U3KA 1WCYA 2WV7A 3LA6A 4ZCQA 3JATB 4PWYA 2L82A 4Q7JB 2DG2A 2JI6A 1QQ6A 3RTEA 5TJHA 3QBJA 4BO3A 4NTZA 3LUBA 3DZCA 4HYEA 1SPBS 1MW9X 1UWLA 4WOJA 3O75A 3LUHA 4A16A 4PZAA 2GERA 2I2BA 3IAS1 3QHQA 3ECSA 4R2XA 4Y0AA 2UUCB 1GFSA 4MHSA 1VCIA 4HZGA 2HO5A 4RZIA 1OBCA 3ZY6A 5KTPA 1VE5A 3C5EA 3C8UA 1MPTA 1U0LA 4B71A 2GUWA 3ORQA 2R7MA 4MGKR 2LRHA 5EJ6A 1HQKA 5KOJA 2CSXA 1Z0UA 2POCA 3QPUA 4PN7A 1H2ZA 2XQJA 1XTRA 1DAIA 1JFFB 1JKMA 1SZCA 1UMDB 1BH2A 3JD0A 3SEQA 2AC4A 4DSAA 5J23A 3V4RA 4IMRA 5T5QA 5CLJA 1NXVA 4JROA 1ULZA 1SR8A 2NXJA 3FN4A 2VHVA 2AZ4A 2GBLC 2VT7A 4H4CA 4AAYA 1T2FA 5KX5A 2IEBA 2H31A 3CZRA 3OZRA 1HR0B 2WIFA 3K6RA 4MVWA 2LXNA 5L6LB 4YAJA 5EZ5A 3DKKA 3OIYA 3ZGXA 2IZ7A 3LG2A 4G9BA 4JYPA 4F1KA 4FFVA 4LCJA 4XM1A 4KSBA 1MN6A 1G5QA 1IJEA 2PPLA 1QVVA 1E64A 2W98A 3GR6A 3IAS6 3VVLA 2DBRA 3KSBC 5EN4A 1A1SA 4Y6LA 3GA5A 3OQIA 4DHEA 2XUQA 3HY3A 1M3SA 1NVAA 1BS1A 1ZY2A 2Q6TA 2W2TA 1E5QA 5A06A 4TSFA 3LKBA 3TF5A 4IL5A 2ZYIA 3BXEA 1JSXA 5D5HA 4ZKDA 4M7PA 2A30A 1GTVA 2WF7A 4J3NA 1FB5A 4OJKA 5BOVA 4HQFA 2V9CA 3HKDB 3ISJA 1OREA 5B3JA 5IHXA 3K5HA 4NBTA 4JQCA 3CLHA 5DK4A 4QGHA 1XCGB 1YA6A 3NW9A 4TMXA 1R66A 3VYUB 1FDIA 4HFMA 4N8EA 3E27A 5C5CA 1W49A 2H65A 2B78A 4WRRA 1HURA 5A4DA 5FL7D 3WGVA 4WW0A 4D92A 2Q0SA 3E9MA 1P4GA 1NHWA 1Z6QA 4ZAFA 5JH7B 5CLLA 4GE0A 2BR5A 3DYIA 1LNQA 3P2EA 1R4NA 4QDZA 1X7YA 4R54A 3QJYA 2X3YA 3N8HA 4N6NA 1BKSB 1XEFA 2C57A 1MABB 1R8QA 4UTNA 4QYMA 3H1TA 2RBEA 2VK2A 1GU0A 2DHQA 4TV9A 3T99A 4MYHA 4E94A 4Y6PA 2Q6KA 1KEPA 2AFRA 4E5NA 1R12A 1ZRSA 4EF6A 3G9XA 4Q24A 2R2AA 1OQAA 2WSBA 3NYWA 2CDAA 4U6QA 3LDAA 3OLZA 1B6RA 3FYHA 3SBEA 5AM3A 2REQB 2BMDA 2IWRA 2J5XA 2O2JA 4EABA 3K9HA 1RWQA 2XVZA 1WCWA 4HB2A 5INTA 3VR4A 4QUAA 3AL3A 3OE1A 4BWFB 4RX1A 3OT1A 1IQRA 1ISHA 2FX5A 1GA4A 2GR9A 1IZZA 2O2IA 4C7OB 5KWJA 5AM0A 2DM6A 3FPSA 2A0YA 2EGUA 2ZSDA 3NHUA 4OBXA 5EVCA 1FDRA 5CVVA 5GJBA 3NWOA 5KDDA 2EG5A 2JIZD 3Q8WA 1QS0B 3A9WA 5KJEA 5BXYA 1EX6A 4GPEA 4PZUA 4URZR 2XUIA 3QFRA 4DIKA 1QHXA 1WDWB 3I01A 3VZRA 3BIOA 3ZWNA 1BTOA 2JZCA 1IJBA 2OC4A 4NYIQ 3B3AA 3F6CA 1TVKB 2VPQA 3K9NA 3T1QA 5ADHA 5LKRA 2HWXA 3MC1A 4Y1RB 4DBVO 3JZMA 2QW1A 3R9WA 1NJGA 1NXPA 1YZNA 1JU3A 3RASA 5E95A 4LY0A 2FLKA 2YXNA 4JHLA 1IK4A 1C3LA 4K2HA 4MQUA 4ENUA 3W5AA 1KFEB 1OXSC 1J8YF 1OFGA 4ZYTA 1KY3A 3WYCA 3ZDCA 1AC5A 2RGNC 2ZBQA 1LDBA 3VJMA 2EWVA 1K6EA 2J3DA 3U49A 2E5FA 4GRAA 3WK8A 5K03A 3Q7EA 2K7ZA 1GZUA 3B9QA 3OPYB 4BZZA 5HR5A 1JAHA 4ER3A 2VQDA 3A05A 4V0NA 1KJ9A 2R6AA 2Q3JA 3U7EB 5EHGA 3AERB 2HF7A 4JBLA 3V8VA 5LFAA 2YMPA 1X7XB 5KJ1A 3V4FA 3L1JA 1Z07A 1PK9A 2HA5A 3VAYA 3V2IA 4DJ5X 2HX1A 4ZGBA 3W6PA 3W3ZB 3CU5A 4ASUD 1WBJB 1YHZA 3SJZA 3UWOA 3MB8A 5G4KB 5JXGA 2HV8A 3I28A 3NHSA 5EIHA 5FYDA 1GKKA 3VPHA 1MW8X 4BUJA 2WHPA 4JXKA 1NX6A 4JN6B 3M7IA 1E94E 1QO0D 1J97A 4MI6A 5B1SA 1QU2A 3Q40A 3U17A 4LBYA 1X70A 1YDMA 2BM9A 2L18A 2J7KA 2J3MA 2WG2A 4R2LA 3ZKWB 4MRSA 4F5DA 1F2UA 2OXTA 2J5KA 1YT5A 2B4AA 4XR4A 5FB3A 1R0XA 4G09A 3S44A 4YUYA 1TKRA 3TNLA 3ELWA 3EIHA 3E5MA 2P40A 4MRRA 1VFPA 1DIHA 4J7UA 3LX6A 1CUGA 3Q11A 4WLOA 4KDRA 2DJ5A 1K89A 3P9NA 3DWEX 3TTTA 4POAA 4LC0A 3OJEA 1E2MA 5C8ZA 4OEHA 4DSOA 2XE8A 4GKVA 2NZYA 1FXUA 2PZGA 4TS4A 3ZI7A 5JJ5A 1T3ZA 1ODIA 3QJGA 1P3DA 3P0RA 4WOPA 1O97C 1E2UA 1ST2A 4A2WA 5A3RA 1DCFA 3IP3A 4OQMA 3THWA 1YCFA 1QF6A 3IILA 2N42A 3TPZA 4ZAVA 4ZICA 4A23A 2WWIA 3RAJA 3O38A 2DRIA 4LMAA 4L75A 2IYUA 3R9IA 3Q6NA 3O3CA 3N70A 3T1HB 2DFNA 4XEUA 5B4UA 1JGTA 1RBZA 1MV5A 3LQFA 1D2MA 1U11A 3HJBA 3O0TA 5L7TA 9MHTA 1SVIA 2Q5IA 3DV2A 3PHJA 4CYMA 1EBBA 4IBOA 4YAKA 3P26A 5JQGF 5IT0A 1N2HA 4BOYA 2WM8A 3FHOA 3M4YA 4L9RA 1VPLA 2ZJ4A 2VHTA 2EGGA 4BIIA 3NX4A 3MQ2A 1ZXXA 2OGZA 2ZSIA 5LM3A 3B13B 3T34A 4PZLA 4ZT6A 3V7NA 2QRJA 4LZPA 4Z49A 1N4AA 4AF8A 3GLTA 3NAMA 3PCXA 1XRLA 1A04A 3RJ9A 4ENRA 1D1TA 2P4SA 3DGEC 4GRIA 1P9LA 3NI2A 4L0CA 4DA6A 2E6KA 4UPDA 1LRKA 2ORIA 5I4IA 1SG9A 2EFDB 4LMPA 4MCAA 4K1XA 2FETA 2WUWE 3PX3A 3ZV7A 1OD6A 1X6VA 4HLCA 3FZEA 3PNOA 1U3CA 5EI5A 4AMUA 4EENA 1ZWKA 1BVYF 1DCKA 1Q2UA 1RIFA 1Y4DE 2FPSA 3UJDA 3ZBQA 1DAGA 2VSXA 4Q3LA 9LDTA 2V7UA 4Q18A 4Y98A 3WGNA 1GEGA 4C05A 1GGJA 1JE1A 4WWHA 1ZRHA 4LHYA 3WA6A 1YB5A 2DH6A 3H0KA 1FFCA 3NB0A 2ZJ8A 2B7CA 2Q21A 4DDVA 3QKSB 4P7GA 1NC1A 3UOGA 4BP9A 1VM6A 4XOUA 2YFQA 4JBXA 4BO5A 1E32A 1TECE 2R85A 3ORHA 2Z30A 4O4JF 3AFIA 1NV8A 4JDUA 3E18A 1CNFA 5F52A 1NKSA 2Q8PA 3ER9A 2C61A 2KM1A 2GEUA 2HU8A 2WUVA 2C07A 2BUAA 3QU7A 1F6BA 1BN7A 2P2YA 2GN8A 3CF0A 3RJTA 1D4AA 1Q0LA 5EEHA 2WIDA 1TAHA 3CUEF 1MDFA 2QRHA 4CR6A 4RCVA 4RE6A 2P2GA 1PWYE 3AF6A 1UMBB 1UPFA 1V16B 1VRVA 3I9JA 5LBUA 3WRVA 4GLFA 5ILQA 3GRRA 2XUFA 4OP3A 1ISIA 1SBTA 2QEQA 4J3JA 2PX8A 2OM2A 3L8CA 3ZD6A 5HUJA 5IFLA 1Z0AA 4NK4A 5IUNC 2YUIA 4I6JA 5EIXA 1JN0A 2RE8A 1NYLA 2XTMA 1CWUA 4OGKA 1V8DA 3LCJA 2JRCA 1GSOA 3KEOA 4P2GA 3UJ6A 3SWWA 3V42A 1V8FA 4TVOA 1KYWA 1D2GA 1USIA 3LPNA 1P2TA 1MAAA 1T5OA 3WGLA 4C7BA 5T6MA 2W58A 3AUTA 3VTZA 3CPJB 3D7LA 5K6TA 3R7FA 4NYMR 2QAJA 4NXNB 3LY8A 4ZMSA 2DX7A 3GCZA 2AZXA 2Y66A 2P1ZA 2CXUA 1LLDA 1HK7A 2A92A 2FPRA 2NXCA 2V0NA 1DKMA 3K09A 3QM1A 1Y7IA 3ASUA 2XH8A 1U4OA 3T5DA 3VMFA 4BNGA 4L6IA 3FTNA 2FPMA 4M0DA 4CM9D 4JJGA 1I7SB 4RO0A 3PFCA 3K30A 2XUZA 3MWYW 4JR0A 5D5QA 4X5OA 3T4UA 4OHPA 1R5JA 1L7PA 2WG1A 2AI1A 1NVVQ 1VSBA 2VAXA 3S28A 5E7MA 3WLNA 2CNWD 3CWQA 4AKTA 3RRJA 4NE7A 2GASA 4HP8A 1KGDA 2HPVA 1YS7A 2PV7A 3IKMB 1GRNA 4IQFA 4BJ6A 3MMPA 3J80A 1ADBA 3L49A 3NORA 4A9AA 1YRYE 2NO0A 4CIWA 3GRPA 3SI7A 4MNTA 4YP5A 1C8BA 3TSYA 4I6GA 2OLKA 1RXWA 1CD5A 1L1EA 2WSMA 2YIJA 2YZMA 4JHXA 5CVTA 1QUEA 2JDIA 2FSVC 2C77A 1NYRA 1S9DA 2ASEA 1NAIA 1U0RA 2WZCA 1IPHA 1XRPA 2ATIA 2H1SA 1XG5A 2XUAA 4JJ8A 3SE0A 1ZLXA 4Y30A 2JL1A 2G09A 3HRIA 1G1MA 4Q9KA 2P30A 2VQ6A 2I3GA 3MMZA 2GKOA 4PSAA 5C1IA 5KDOA 3R74A 2R7AA 3HE3A 3OTWA 1RLUA 2VPTA 7AT1A 5AK6A 1ECBA 1QBGA 1Z8HA 2XHEA 4K6GA 1U1IA 4NONA 4ENTA 4UUMA 4WEOA 4G5FA 1U2DC 3AYZB 1W4ZA 3AV3A 4TZTA 4EGCB 4PLCA 1PX0A 3NJ4A 1DOAA 1O6FA 3JALA 3L0BA 5FD8A 4C4YA 1Y81A 3HUTA 3INRA 4FZ3A 4RDHA 3GLGB 2EOAA 4TRRA 3FETA 3AR9A 4XDGA 1TCAA 4O3MA 3M89A 2R8EA 4JWTA 1C0KA 2RG7A 4DSNA 3IMFA 5HZKA 5JR3A 1EB9A 2NT4A 2VUIB 4UJ3A 4JBHA 3RU2A 3T3DA 3YASA 4EKEA 4JV5B 1NR7A 1G8SA 1QZZA 2FWJA 1M1YB 2E6UX 3E5NA 1YB1A 3KTAB 5FQOA 3OX3A 3AHEA 5LB2A 3ELBA 2CDBA 3H4MA 3O4VA 5IHPA 4DA0A 1VRCA 4GKKB 3P0HA 4IW3B 3HY6A 3K0EA 1ENPA 2QTHA 3DEJA 4FYJA 4GLLA 1J5PA 3TNFA 3ZY5A 1JT2A 3FR8A 1O0BA 3EGDA 3JTEA 3MCAA 3X1YA 1T29A 3ZV4A 3F3KA 3QLTA 4RZSA 3N87A 1EPUA 5DM70 3B1VA 1IXZA 4BMSA 4XVQA 5JC1A 2W2KB 3BL5A 2AN5A 1RYHA 1Q15A 1N4DA 4IDGA 3W2GA 5C80A 1J23A 4F9EA 1NY5A 2I6XA 4G23A 3QFCA 3NIGB 4OB7A 4F45A 4AQ7A 1JZQA 4X3OA 4IFBA 4UUOA 3U0VA 1DU4A 2QTMA 2QLNA 3L18A 4ZCPA 2MSLA 3AI7A 4UBLA 5FYQA 5IZCA 1W581 2H2WA 2JJ2D 5HKKD 3GGCA 4RMGA 4AURA 2JLYA 2ZIZA 2P91A 3AVUA 3EA5A 2ZB2A 4N9WA 1E7YA 3N28A 3IP7A 4BX3A 4JJEA 4ENWA 5JHHB 1WO8A 5LZ9A 1T9GS 3U37A 4E13A 4C7JA 5JXIA 4H18A 3EFOB 4TZKA 2M6SA 4V0SA 3KX2A 4O4HF 3OCZA 1KEUA 3PEEA 5LA6B 2PZMA 1E6LA 2VQ3A 3M1YA 1BSVA 3G2KA 3I9OA 2W90A 4IKPA 3BTUA 4QLAA 5LQAA 2VH2A 4LTDA 4RTPA 5FDFA 2WU0A 4B44A 2HQOA 4C0XA 4RTRA 4KBGA 4KN8A 1EFKA 4MVCA 5DYTA 2JFBA 1RXUA 3QKRB 3B20A 4FQ8A 4Q4CA 3I2HA 4K7JA 4XYEA 5K2OA 5CAEA 1JQJC 2ST1A 3L0CA 4B40A 3S0JA 2PD6A 2VT6A 2VJPA 4HSEA 5EMHA 1KMCA 4OGGA 4E6EA 4DLKA 4HEA1 3LXUX 1F17A 2WJHA 1V7ZA 4DXDA 2D0PB 3LTEA 4PLYA 4UBNA 1SKAA 5ESWA 4H0NA 1ID8A 4KAXA 5J5CA 1NVFA 1VI6A 4IWYA 3I8XA 2WAAA 3EY9A 3E9EA 5DXJA 5K0CA 2O3TA 3RVDA 2QTTA 1FYDA 4QJIA 4PM4A 1GG9A 1BS9A 2B83A 2EP7A 4Z2YA 1DIAA 1E66A 3BXXA 3GJ8A 1NSTA 2ZUDA 4WLFA 4PAGA 3CLUD 3WX0A 3OHSX 4M38A 1LFAA 1U2GC 1WV0A 4HVLA 3JAKB 3SN6A 4L8VA 1W85A 4TSKA 1W5TA 1CJSA 5AJXA 4TVSA 5LXTA 4H7FA 1ACLA 1OI7A 1OWLA 5DNEA 3L6UA 2V96A 5IANA 2OPHA 1TZCA 2PV0A 2WAXA 3T3IA 1Q95A 4A8TA 5EGNA 4CJXA 3UBTA 2YBEA 3FW1A 3Q2KA 2WYHA 1JQDA 1K98A 4KGDA 2PZJA 4LEIA 5JCOC 3HL0A 3K70C 1P72A 2PSJA 5F9HA 3RYIA 4EDFA 3MTIA 2UUOA 4HKTA 5EAIA 5C1OA 4J1SA 5EP3A 4L5YA 1F12A 3L8DA 3H5IA 1SD1A 3JR7A 3KB8A 5K8VA 3GEHA 3P9RA 1HNXB 3UKJA 3R6DA 3PBKA 4U7HA 1JKJA 5GONF 4Z4GA 1ZL0A 1UDAA 4R8KA 1O57A 1YR1A 4J90A 3N7UA 4NE9A 4P36A 5EHZA 1DTWB 3NDBB 5I47A 5DN6D 1YJCA 1WQ1R 1GAQA 1SJ9A 1C1DB 1WB6A 1C9MA 2EQAA 4N5DA 4O0MA 4WV3A 3BC1A 5T64A 1EX1A 4Y18A 2OHIA 1CUWA 2ENWA 4I99A 4KB5A 4BXOA 1PZNA 4IYRA 1S3FA 1GNTA 3ND9A 3H0EA 4V0RA 4GC5A 3G59A 1T9AA 2IYLD 2PSFA 2WKSA 5G3YA 3A1DA 5BWCA 1NG9A 3R9XA 4NX2A 2VHJA 3LRXA 5AMXA 1H5NA 1XQXA 3D8SA 4WIAA 3G0BA 5LMNB 1TGVA 1AQIA 5ALGA 3C6QA 3AESB 4CT0A 1XXHE 1PF7E 3I4LA 3ILVA 1JJ7A 1VBKA 3FZGA 2GDZA 1NPDA 3M1LA 4I9UA 4N01A 4NV1A 3F6RA 3SBXA 3MBIA 1UZMA 1NUHA 4R1TA 4WLUA 3RSCA 3DYBA 5A7FA 3I1JA 1L6RA 3QP9A 3VZSA 4PYOA 2XOKA 3WZ2A 1FE8A 4CMHA 5AM1A 4D57A 2NO9A 1K7XB 3QHAA 4F8YA 1OI2A 1FJGB 3I9FA 1KPGA 2O2HA 3IHKA 1L5ZA 3RVPA 1LPNA 4IDFA 5DM60 1JR3A 3QPVA 5J47A 4ARVA 2PWBA 3LP5A 3K9BA 3L6OO 3PNQA 1WXXA 3AFGA 3I6IA 3LUJA 3JVDA 3T9BA 2XKKA 4RQUA 1P75A 3OOJA 4PO9A 4NBSA 4OUKX 4TS9A 4YJGB 5AKXA 4MVJD 5KQGA 4GI3A 1ZJZA 2ZAIA 4DRYA 4FYPA 5J2UF 4MV7A 4FEEA 4DJTA 2R25B 4EPYA 4H08A 3OCUA 5TGZA 4GQBA 1KR2A 2YY7A 3CUUA 3FCCA 1HLGA 1P5FA 1T6XA 1JTFA 4E2WA 3BHNA 1XEXA 1NM5C 3BULA 1DX4A 2QPAA 3A0RB 1ATIA 2BEJA 3MGBA 4JT8A 4H15A 1A96A 2JPDA 2QPLA 5KOYA 4K8OA 5IAJA 1SVSA 5YASA 4B82A 1DIRA 4M2LA 1KK3A 1VLQA 2VZLA 4X1IA 1MB4A 1RAFA 3Q3CA 1P4SA 1PSWA 3W9UA 4AT1A 1OWNA 3I42A 5T41A 5ECGC 4WDQA 1RAEA 3DTVB 4QYWA 1MO6A 4XYBA 2RK6A 2PH7A 3JZAA 1CUAA 2CVQA 2I7CA 1N5JA 3N8IA 3DOUA 4XB1A 3W5BA 3TR6A 1JJFA 3EOAI 3ANNA 4RSGA 5JDIA 2J59A 4BKQA 1VXOA 4QOJA 4MI9A 2CY0A 2OORA 1II8A 3GP3A 3AF4A 4HTFA 4MWDA 3JZDA 2A9JA 1A5AB 2V6MA 4PZDA 1Z4MA 4UATA 2FI1A 5AJTA 5C4GB 1YB2A 2Z3VA 4I4CA 3G82C 5K9ZA 5HRUA 3Q7IA 2JA1A 1M0WA 3GLIB 3M6VA 1N6IA 3LOPA 5FCDA 2GHQA 3MGKA 4KKVA 5FLKA 1OWPA 5GTDA 5ALEA 3VSDA 4TKMA 4TXLA 2WF8A 4AG6A 5AD1A 1W8DA 4ZIRA 1XV5A 1G8JA 1PG5A 4A6PA 4V38A 4EY6A 2NU7B 1BDIA 4O4LF 1C7RA 1O54A 4Y3UA 1TC1A 3W34A 3M6IA 4EFKA 1S8OA 1UDCA 1P6UA 3L0OA 4EUHA 1BXGA 1ONBA 1NUAA 4GWGA 4QU9A 3SM3A 2W6JA 3NHFA 1HQCA 1JXQA 1V5WA 3VR5H 5E6UB 1JPJA 1QB7A 1EFPB 3Q3GE 4MPJA 5KJCA 3ICEA 2QZSA 3VAAA 1FF9A 1MNAA 4DTIA 1EVZA 1H6AA 1PLKA 1Y6JA 4EZBA 2I6SA 1ZCJA 1GV0A 1ID1A 4MR7A 4NK5A 4ZVVA 5EJ2A 1HSOA 3KCNA 3DLBA 4AJPA 4RD1A 1WZIA 2AOTB 4R4JA 5FFFA 5CK4A 3TSWA 1N1EA 3TMYA 1WM1A 5C3UA 3OE7D 3U31A 3RV3A 2QWXA 3TB6A 4D9FA 2QRQA 2DKFA 5BV2P 5A4IS 4E03A 3NEAA 4B6GA 3QQPA 3IEMA 1LKZA 1Z6XA 4LYDA 4QBGB 4HUTA 5FPPA 1ORIA 3L4EA 3AUXA 2OV2A 4WBXC 1JG4A 4RHEA 1D09A 2ZRQA 4V02A 4S04A 1MRSA 3HJHA 5FRDA 3AP1A 3HV2A 2DECA 4Q7EA 5JCJD 3TLJA 3ZWDA 3PUWA 2VS1A 3IOMA 5BUCA 2FW7A 4EY3A 2JEYA 1X3SA 2NO1A 4BGEA 4QASA 2AE2A 1NN0A 1J20A 5EJFA 1G4HA 2BFCA 3BWVA 1SO8A 3EIOA 5ALTA 4FHCA 3A2MA 2C1XA 2XTJA 1FVFA 1XMIA 3GJ0A 5AO9A 4YRNA 3ROKA 1PT7A 4MKFA 5TS2A 5COAA 3EPLA 1IHYA 4TM7A 4AN0A 2PE5A 4RTOA 4BGIA 3OMXA 1CP3A 3PEWA 3NIDB 4PPFA 1WZUA 3DA8A 3FKSA 4BMXA 2YRWA 2VUHB 1WUHS 1N2CA 4HDSA 4OV6B 1SQFA 3FNRA 1K88A 2X7JA 3B8EA 4IPTA 1CF4A 1NZDA 1Z08A 1KI2A 3BIJA 3SXUB 1L8OA 2J4FA 1XJCA 3GRFA 1C9NA 4PZCA 4EUNA 1G5RA 3U26A 1TM5E 1T6ZA 2D8AA 2A7QA 2WB2A 1C7FA 2Z2ZA 4NCHA 4ND8B 3V4PB 2ZRAA 3IE2A 3VYRB 4X66B 2YZGA 3GFOA 3J7TA 2PMFA 4OOFA 3CKKA 3K96A 4RCZA 4Y9DA 3BDVA 1L4LA 4ZPXA 4YP7A 4A26A 3CPHA 5C18A 4DV4B 1Q20A 3QVLA 4O2BB 2ZJYA 1JQ3A 2PEYA 1UXKA 3F0TA 3OOWA 1DKUA 3O8QB 5F7ZA 3IAEA 3QUQA 1IFXA 1ZZEA 3CZMA 4OHUA 3PLAE 3OPVA 1ZOOA 4S0XA 4FW9A 3U6BA 2VOJA 4KXWA 3T9AA 4D43A 2M6KA 1ESNA 2QN8A 5IWCA 2ZB7A 4GP7A 1EFRD 1N3BA 3D1VA 1Y7HA 3WGZA 1H05A 2RKWA 5BR4A 1FUKA 4JLKA 4KYUA 4US2R 2PXXA 1XZIA 4XM0A 3I92A 2JI8A 2X5XA 3B9RA 3IVGA 4HPWA 3CISA 2ZUCA 5EIWA 1FTYA 4F3RA 1EFCA 4P22A 1I2AA 1JT9A 2FP4B 3ACDA 3DUFA 4MV5A 2MCFA 3EQ9A 2QG6A 3T7AA 4RMIA 4CBVA 1KSFX 2IHYA 3P20A 4RQAA 1FLDA 4NH0A 4IIDA 1YMVA 4I1YA 5ALUA 5B4VA 1PFUA 2XSZA 4JU9A 4TLEA 4XWTA 2E4WA 2VYFA 3T38A 2YXLA 3F3MA 1H22A 1ZK4A 4CV1A 2V4UA 4RJ2A 4Q9AA 4R31A 3SICE 3E7DA 2LUOA 5P8WA 3C6KA 4L57A 4LWZA 4WZAB 1J8MF 1NW7A 2EW2A 2DR2A 5BQXA 2JFUA 4JT9A 1GR1A 2NXNA 2JHAA 1QUFA 2CJWB 1F2TA 4B3RB 2VYVD 3QG5A 3L07A 3RYTC 5K0NA 2YY6A 3BWXA 3ENQA 4PCUA 5A3QA 3BBPA 4B2YA 3TW8A 2YVUA 2FCAA 3E1GA 5DPMA 4A4DA 3DCJA 1FFBA 3GFTA 2CB9A 3JQCA 1SBZA 3BRWD 3ECAA 5A3SA 3RRBA 4B6OA 1VYVA 4H35A 3FUXA 5CR9A 2GO1A 3ILSA 1NJFA 3JS5A 3QBDA 4CKZA 1BCRB 1MRZA 1O94D 1RM3A 4F2HA 5L53A 1E4OA 1U04A 5KTKA 4L73A 2IIVA 1U9JA 3I37X 5B64A 2OUIA 1QZXA 1R3UA 2BCGY 2IJGX 1T1SA 4X1KB 5CLGA 4OHWA 3T7SA 4DBLE 4W5OA 2WLTA 3QLJA 4PXAA 1W4BA 3OU2A 1T3GA 1OXVA 1BQ4A 3CFYA 1C9YA 2A5GA 3Q8KA 1AN9A 4MS1A 3NCHA 2ZQZA 1ZONA 2H4HA 3GJ4A 1FLAA 2YXPX 3NETA 4ALKA 1Z5PA 1EIZA 3RW9A 2D06A 3ZHOA 1GUYA 3GU3A 4QUJA 1Y8QB 1O8BA 1UK8A 4TRMA 1RXVA 1MJHA 1TXGA 1DI0A 2AOWA 1KO7A 1XTQA 4AKGA 3AT1A 4AY3A 1ADJA 2B2NA 4RMHA 1Y80A 4NU6A 4R8SA 4G65A 3A3PA 1EVQA 2D0OB 2NSHA 1JX6A 5CB6A 1EE2A 3E9DA 2Q2QA 2Z8ZA 4F9GA 4HAIA 4WCFA 1PFWA 1Y89A 3CNLA 3DPSA 4FOOA 4GSYA 2ZWIA 1VE7A 3BHMA 1ZKDA 3GGPA 4JNCA 3MRSA 2RSLA 3K1AB 4ZEXA 1GZ5A 1CRQA 4XVUA 4RDXA 3GEBA 4TUYB 3OLQA 4KRXA 3WK7A 4IOMA 1EU1A 3A04A 1FDVA 1Z73A 1PYOA 2E89A 4EJMA 5JV5A 3THXB 3AF5A 4IX1A 4KFCA 1TQ6A 2VA9A 2XMSA 5IBQA 4Q3CA 2Q2OA 4RV9A 5MFPA 2VUUA 3KD2A 2Q49A 1RYDA 1H0HA 4F4FA 2ZIXA 4KQ6A 1U6IA 2CDNA 2WYOA 3HCPA 1VYUA 2ZI6A 5CW2A 3DOOA 1C9JA 2O8CA 3WL4A 4YP0A 1J7JA 3OQ1A 4AS2A 1XX6A 2G9QA 2WT9A 2EJBA 3VR0A 1SZDA 5B3LA 3RB8A 3PPWA 4K9NA 5GGYA 5FTMA 4HVCA 2P3LA 3HM9A 2VT3A 1GPWB 2BIFA 3EEQA 4C6HA 3T7JA 5DHFA 5IUJC 2IL1A 1XEAA 2RJ3A 4DR7B 1P17A 1OGIA 2GM5A 4P54A 5A1JA 3RFTA 5FWXB 4OX9B 4PSKA 4IZOA 2HFKA 2GTIA 3A1WA 1OLSA 1GA1A 4BMNA 4E3WA 5HOQA 1BD4A 3EQZA 3H16A 1KR5A 3VUFA 1P45A 1ZMBA 3P0EA 4R5MA 3QW4B 3TG8A 1P1FA 4KMSA 1VPDA 3PXEA 3TAUA 2CN1A 3HJRA 1TCCA 3EAFA 3A3KA 1WWKA 4BX9A 4TKVA 4YRQA 4FEAA 2RHWA 1V35A 1TFRA 4QXAA 1V47A 2I55A 4JT4A 4CM7A 1Q50A 2J6CA 1CUFA 1DNPA 4ILEA 5TIIA 6ADHA 3IYLW 3L82B 2ZM6B 1BE8A 1D4FA 5L3RA 3HEAA 1Z12A 3W05A 3O8RA 3FVQA 1JEQA 1XDDA 2ZI5A 4D9KA 5HK8A 1T9DA 1M8GA 2I3DA 5CDUA 2C2MA 10MHA 4TTQA 2GFQA 4NCKA 4XOIA 1QYDA 3X0DA 3P9SA 3L0DA 2EJTA 2PAFA 1T2NA 4UUNA 5FADA 1RXYA 1H42A 1SKUA 1W0JD 2OYSA 3BWYA 3D9QX 1FP2A 2BWJA 4XXHA 4B87A 4CM8A 5JPCA 2B99A 5I7FA 1C9EA 1YQ9A 8MHTA 3B36A 3IFSA 3C15C 3O1IC 2QTBA 3HKEB 3LDHA 3KPYA 1E20A 1VJCA 4AG3A 1CR6A 3KRTA 1GUAA 3TGPA 3EIXA 1KNXA 2B3TA 1FNDA 1GQRA 3B38A 3BQ9A 2QD1A 1V3TA 3C2QA 3U4GA 5AVVA 2XDQB 5KTOA 4EG8A 1QQTA 1N92A 2LIPA 3QX8A 2AHRA 2CNLA 4MWGA 4DA9A 5JMOA 4P80A 4D42A 3LQQA 2AVNA 2HBQA 1Z35A 2E5WA 1L9XA 3RHSA 1R6TA 4MB6A 5D86A 4QWWA 1IEQA 2QVZX 2Z8YM 5THQA 2Y1DA 3H17A 4AKSA 1NMSA 5B6IA 3U3ZA 4EGSA 3DE2X 2RH4A 3ERCA 4FDMA 3C16C 3OI7A 4H1VA 2CE7A 1TF2A 3DOCA 4MARA 2I3ZA 3WS7A 4ZN6A 1E2LA 2VTBA 1UUFA 2BE9A 4HBZA 5KC9A 2RK3A 3W78A 3G0HA 2ZT8A 4PLHA 1NR5A 3VPCA 2F1KA 3MWDB 4EX7A 1UJ2A 1KDRA 1NF3A 2HU7A 3BEDA 3EAGA 1PJZA 4D9JA 4NCAA 1FNCA 2PX6A 5E6RA 3U3OA 4GVLA 4ZOQI 5GIPE 3DEZA 4LDAA 4N82A 4ZI7F 3L7JA 2HK7A 5LWHA 2HC9A 4LJLA 1QAQA 2VDWA 5J58A 2PWAA 3K20A 4I7EA 1QK4A 1C30B 1D1QA 1Z4IA 2G80A 3PWZA 3WIVA 4DMCA 2CYCA 1S7GA 4H16A 4LOAA 4L4ZA 1YSCA 2VYCA 3MPOA 3MF4A 3ESQA 3Q1LA 1RRGA 5JYDA 1HOTA 4EMSA 1VMDA 2H1HA 1JRLA 5C8YF 3ZU4A 1DJMA 4JKOA 1ZI8A 1TEHA 3H4TA 2QJRA 4KIGA 1VLJA 1DUSA 2C59A 2IIQA 4TWRA 4X61A 4UBIA 4DCTA 3I1IA 2DF8A 4EHAA 1BFKA 1O95D 3OOHA 4DJDC 1NYTA 5DHSA 3I53A 2HIGA 2RHCA 4IV8A 1HYQA 1KYXA 2PH1A 4XDZA 4CCYA 3N2GA 4DQUA 4OJYA 3O2NA 4DMKA 4P38A 1V9CA 4BB5A 3DL2A 5MN4A 1X39A 3ZX5A 5KEIA 3JATA 3O7WA 3NR2A 4QQKA 2FZ4A 3AC0A 4TLLB 3ZY4A 3KZCA 2PCJA 3B9BA 1Y9AA 3PGJA 4LPSA 2IV7A 5AKJA 5HFNA 1YL7A 3RUEA 4KRYA 2ZBGA 5IJAA 5I6DA 2WT4A 3HR7A 4ND7A 1MFPA 5SZJA 2I1QA 2GARA 2AFHB 3D4NA 2H16A 3GBSA 5E4FA 4C4XA 5C81A 5KTRA 4Z7QB 4EBFA 1COWA 3FYCA 4BZWA 4KQJA 4HX9A 1UMDA 3DHWC 3LGXA 5F5NA 1SELA 4AMVA 5AIAA 3M6LA 2IHZA 3NHJA 4GMXA 4JUAA 2PUEA 3L1HA 1ZUWA 1L1FA 4BMOB 4EIWA 4OAOA 3PUKA 2B5VA 3VU8A 4AJHA 5D1HA 1F0NA 3FMIA 3PC4A 4JU8A 4D8VA 5IKMA 3T9CA 1IZ9A 4HAUA 1KFKB 3RAFC 3KJQA 4QX6A 5K0LA 5LZ7A 3VV3A 3ZGNA 3N2IA 2XMRA 3P19A 1KH2A 4NJEB 2C92A 1GCAA 1OFVA 1TJ4A 1A5TA 2AMFA 3DMNA 4GI7A 4EAAA 2IUYA 1CE8A 3SKXA 3BIWA 1NQTA 3RS7A 3HYSA 5HJ7A 4DLVA 1G59A 4J0JA 2G0TA 4YJHB 4X64B 3P71T 1RAIA 4LG1A 4YALA 1CB7A 3GC6A 4EJ6A 2F3TA 5IS2A 2G1PA 1MJGM 5AVZA 3M6WA 4RL4A 2QDXA 2YVKA 5I4KA 1PJSA 2B1JA 4K9PA 3TTVA 4D9MA 1H5QA 4QO8A 3S8EA 4K05A 5HF9A 2EFJA 3N8DA 4ARIA 3LHSA 4RY8A 1Q91A 4UFOA 3JVUA 1T1GA 4JJIA 5GZ6A 5FX2A 4CW7A 4CTMA 1XHLA 4N7RA 2GS9A 4RFVA 3KKLA 2IA5A 4LQ4A 4PGMA 2GXQA 3OFND 5E7IA 1P2GA 1M73E 1E3WB 2CUKA 3NOQA 3MCUA 4JXJA 2E4VA 3ZHZA 5HEKA 3GLGE 1FA9A 1QO7A 1MX9A 5K05A 4TYPA 1LEHA 2JKVA 5BPFA 1R0KA 5KZMB 1WP4A 2I4RA 3UMFA 4CM5A 3B6MA 3WK4A 1YGYA 4RD6A 1E58A 2GHIA 5JH7A 4N3CA 4GD3Q 1NTRA 2J3JA 3QEKA 3EFHA 5AW6A 5EP2A 4GKJB 1M1YE 5T3YA 3O93A 1J9ZA 3M3DA 5GP1A 4CI9A 4XAQA 1MABA 3PG5A 2YWJA 5J2TF 2A35A 3ZPXA 3EOZA 3HYNA 5COQA 4B3FX 1WCIB 3W04A 4RLSA