3OIGA

Crystal structure of enoyl-acp reductases i (fabi) from b. subtilis (complex with nad and inh)
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
260
structure length
260
Chain Sequence
b'MNFSLEGRNIVVMGVANKRSIAWGIARSLHEAGARLIFTYAGERLEKSVHELAGTLDRNDSIILPCDVTNDAEIETCFASIKEQVGVIHGIAHCIAFANKEELVGEYLNTNRDGFLLAHNISSYSLTAVVKAARPMMTEGGSIVTLTYLGGELVMPNYNVMGVAKASLDASVKYLAADLGKENIRVNSISAGPIRTLSAKGISDFNSILKDIEERAPLRRTTTPEEVGDTAAFLFSDMSRGITGENLHVDSGFHITARLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enoyl-[acyl-carrier-protein] reductase [NADH]
publication title Crystal Structures of Enoyl-ACP Reductases I (FabI) and III (FabL) from B. subtilis
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 93
structure length 260
sequence length 260
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2010-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3oigA00
2YYYA 3FWZA 3TF5A 2ET6A 1HE2A 1IHXA 4KP7A 4BNJA 2O7QA 2H63A 3W4IA 3OSUA 3N74A 3NV9A 3GNTA 4TKMA 2YHIB 4ZQBA 4DYVA 3ZV4A 2RHRA 5I7EA 3O4RA 3CZMA 1GYQA 3OFSA 1KVUA 2C7VA 3ZN2A 2DFVA 2GN6A 1EVIA 4J4BA 4Z9XA 3HZZA 1MFPA 3QA9A 2GERA 4G65A 2I5PO 1GEEA 3OHSX 4E31A 3KLPX 1Z45A 1GDHA 3KHUA 5CG2A 2CNBA 3AM5A 3W4KA 1ZKMA 3CEAA 3LLSA 3PEFA 3L4BA 3EZYA 4I5DA 1JLLA 2DT5A 1B2LA 3OQ1A 4NU5A 4RF5A 4BKRA 3O8QB 1F06A 3NYWA 2UAGA 2YY7A 3MWEB 3LT2A 2GASA 1M66A 4YDRA 4ND1A 3DTTA 5ILGA 2A35A 1FDTA 2PV7A 1G6KA 7ADHA 4DQXA 3BTVA 5ENVA 4Y9DA 4WPGA 1XWFA 1DOHA 2B5VA 1E7YA 2FWMX 2OFPA 1JW9B 4WCDA 5DF1A 2DBQA 4YWJA 1IL0A 4OSOA 4PG5A 3WJAA 1C1XA 5GY7A 4PGFA 3BAZA 2UYYA 1ZEMA 2X58A 3DOCA 3KLMX 3GA0A 3C24A 1NR1A 3AOGA 3MOGA 4XQ9A 4AJJA 2GSDA 3OM9A 4CMKA 3FI9A 2PH5A 3HB5X 3MTGA 3TQHA 1EVZA 3E6AA 3ONFA 2WDZA 3QE3A 2BFPA 4IJWA 3MJVA 4RVGA 2Y68A 4BNVA 3PWKA 1VL0A 2CVOA 1KVSA 4HFJA 1E3WA 3VZPA 5HBRA 4FBGA 2XPCA 3U9LA 4DPKA 3F9IA 1Q0QA 1ZK1A 5T8KC 2UUOA 5H81A 3ZWBA 5FWNA 4NBRA 2O3JA 5B4UA 1XELA 2OORA 1LDGA 3G17A 1NNUA 3PZBA 3GOHA 4XR4A 3E1KA 4OJNA 4PLFA 3GVXA 1X13A 2DBRA 2W8ZA 4FW8A 4H16A 2FZWA 2D4AA 2GN8A 4RVFA 4PVDA 4B79A 3OQBA 4DYDA 1DAOA 1ENZA 2IYPA 3WYBA 4QEDA 3U62A 5IDYA 2DPHA 3BXXA 1CQJA 3AW9A 1LTHR 2X23A 5IZ4A 1YB4A 1JKIA 3FNFA 4TROA 3NDIA 3RC2A 4M1QA 3I9LA 3VHRA 2Q1TA 4WASA 2PZJA 1EFKA 4D0SA 4IGEA 4OAQA 2PH3A 4NK4A 4E3ZA 1KOLA 1R4NB 1W6UA 5L9AA 1G0OA 4R5MA 4IDCA 2I3AA 4PRLA 4R1UA 4H7PA 1E0DA 2Q1WA 1Y1PA 1V3TA 3B1KA 4IDEA 3L4SO 4GWGA 2VHWA 2DAPA 4HADA 4CLDA 2Q45A 1SCUA 4YAIA 1VJ0A 4U0JA 1J0XO 3M1AA 3G1TA 2I9PA 5KIAA 3EC7A 4D3DA 4Q39A 4YJGB 1YB1A 4RZHA 2HMWA 3AK4A 4WJZA 4IS2A 3GHHA 4MPDA 5TSDA 5TT0A 3WWYA 1LDMA 3LC2O 3LDHA 3SXPA 4RPGA 3DZJA 5JFOA 4IDBA 1T1RA 3ORFA 1VKOA 4OOFA 3TRIA 4W4TA 4R1NA 5IDQA 4W82A 2YDXA 4II2A 4PLGA 1UP6A 3EVTA 3UFXA 3KV3O 1GADO 2JFFA 5F5NA 3TPCA 4LMRA 4U8GA 4D44A 5BNTA 2V6FA 4YVFA 2J3HA 3DBRB 3OECA 3DOJA 4DC0A 4D42A 3I9KA 3E9NA 4Z9YA 5A9SB 3HADA 1YWGO 3JQGB 4UVIA 3RQSA 3DO5A 1T1SA 1LI4A 3BMNA 4J6FA 1I3KA 1PQPA 1Y5RA 4ZRNA 4MJLA 1SBYA 2FR0A 4RF2A 3Q1LA 1MFZA 3BTSA 5JAQA 1GTMA 3I4CA 4E2ZA 3JYPA 2WE7A 3CINA 3IMFA 4FOOA 4PLZA 3NT2A 4GX1A 1DFIA 1O95A 2IE0A 4NHEA 4PG6A 3S2EA 3FR8A 3WIEA 1DRUA 2QIOA 1Y8QA 1YGYA 3U4CA 2Y1DA 4RPJA 5F5LA 1MX3A 2JFHA 4IS3A 4Q3EA 3FNGA 4NJMB 1HRDA 3QVWA 2ZB7A 1YBVA 2HK8A 4KDEA 3E8XA 2Y1CA 4DPLA 4R3NA 3ITDA 3DFUA 1UH5A 4QECA 2JD1A 2IZZA 1VE9A 2VQ3A 2P2SA 4MP3A 3W8EA 3PI7A 1BXZA 2UDPA 3AOEC 1CRWG 4UEJA 1KS9A 5COQA 2X1HA 1DIBA 3GZNB 4C7JA 1WAMA 3L07A 1NQAO 3KO8A 3VPHA 4ALJA 3DBHA 3VVCA 3E18A 3OJOA 1ISIA 1DIGA 1K0UA 3H3JA 4B4OA 4FD3A 4O59O 1FDSA 4CMIA 1CWUA 2VT2A 2EERA 2FHSA 2BI8A 1NXQA 5C7LO 2YHUA 4YAJA 3WMWA 2UV8A 4E5MA 2BI7A 1P31A 2PZMA 1Q0LA 5G4KA 1TB4A 3QJ5A 4GLOA 5DOZA 4AJ1A 4FJ1A 1ZUD1 3IQDB 1UZMA 5AXCA 4IUYA 2B4TO 2BGKA 3P19A 3TSCA 3O26A 1UP7A 3DQPA 3C8MA 3PQFA 1I01A 4Q3BA 2ZTUA 1HDXA 1LUAA 3TN7A 3QV1A 3RFTA 3OP4A 5KJFA 1FXSA 3HNPA 3GVPA 5DP1A 4GVXA 1PGOA 1PZHA 4B7XA 3P7MA 4FFRA 1MV8A 3WX0A 2D8AA 4YBZA 1D4FA 3GN2A 3HJAA 1DIAA 4II3A 3AI2A 1JWBB 1J4AA 4BNXA 5KOIA 2B69A 3D4PA 4ZQHA 3ZU5A 4OIMA 1U4OA 1KEPA 1QV7A 3JD4A 1JQBA 1IPEA 1O5IA 3GUCA 2G1UA 4PLTA 2C82A 1A9YA 4PG4A 4RCVA 4CQMA 3PGXA 1QXSA 4BNGA 2WEKA 4JBHA 1DC5A 1DIRA 5JMWA 4KUGA 1CERA 1HTBA 1PGQA 4N5NA 3TOXA 1ZBQA 1U2DA 3DAPA 1ENOA 3PIDA 3PDJA 3MJ4A 5BT9A 5IF3A 2C07A 1UJMA 3JCZA 1X1EA 2OBYA 4QX6A 3JQ7B 1IZ9A 2VCYA 5JCJA 4XYLA 3OH8A 1M67A 3WLFA 3WTBA 3FR7A 4IMRA 3WOHA 1B0AA 1GFSA 1TLTA 3K8ZA 3STHA 1MXFA 2JJYA 3DONA 4YAEA 5KVCA 1DLIA 3GT0A 2BH9A 3KSZO 2DVMA 2WTBA 1E7SA 1C0LA 2VHYA 5THQA 1P1JA 3ETDA 3EZLA 1I3LA 1T25A 4I5EA 1XA0A 4FS3A 3PHIA 4BO9A 4EBFA 4B4WA 1GEGA 4Y98A 1ZZEA 3GAFA 4D79A 3TFOA 1SAYA 2ZIZA 1L7EA 2W4QA 3RUEA 3H8VA 4HBGA 4TWRA 1QYDA 3OBBA 2DU8A 5EL0A 4CQLA 4G2NA 5JAIA 1XR3A 1BW9A 4EUHA 1OBFO 1T2FA 4GKVA 1I0ZA 4YRBA 3W4JA 2AEJA 3OF2A 1I30A 4WLFA 1XQ6A 1G1AA 1ZEJA 4UVEA 4QO7A 3C85A 5GZ1A 4IPTA 2X5JO 3RASA 5F1KA 4XDZA 1E7WA 1TVEA 2OP1A 2RH4A 3HB4X 4FFPA 1ONNA 1U2GA 3GRPA 1LEHA 1LNQA 4BO7A 1PL6A 4ALKA 5JC8A 1DJQA 1ENPA 2C20A 5JE8A 1C1DA 1Z7BA 1DRVA 3I9MA 4J90A 2Y99A 4JJFA 4IGFA 3LQFA 4BO6A 3TZKA 2ZTLA 1Y8QB 2H5LA 3VAZA 4CPDA 1B8VA 5TS3A 4R51A 4MVJD 1WXDA 3AI1A 3V8BA 3EYWA 3ZWCA 2J3KA 3CIFA 4GKBA 3GN1A 2OHXA 3MOIA 1ADFA 3GHYA 1B7GO 4XGNA 3AY3A 3ZHYA 1X15A 2CFCA 2PD6A 3TJRA 1YL7A 3FF4A 4DUPA 1P1KA 2X9GA 5IFLA 1YBMA 1YDWA 3BTOA 3VZRA 4RJTA 2O3UA 2E6UX 4DBZA 3ICPA 3AOEA 4B3IA 5GZ3A 1UAYA 4F45A 3JSAA 4XA8A 4R16A 3QWIA 1ENYA 4A10A 3NUGA 4CMIB 4DQVA 4N18A 1VL8A 3VC7A 4F6LA 3VKUA 1DB3A 3NGLA 3WGYA 1LC3A 1GAEO 3ZNOA 4DIOA 1V3UA 1KVQA 1I3NA 1PL8A 1WDKA 2EEZA 8LDHA 1R0KA 4P38A 1GPDG 4H15A 1YDEA 3T7CA 1EUDA 1U8FO 1UP4A 3RUHA 1LDYA 4PLWA 2DBVO 4L4RA 4ZHSA 5BSEA 4WLOA 3GVCA 1D3AA 3UOGA 4UEOA 4LSMA 4GGOA 1PGJA 3ZU4A 4KQXA 5ICSA 2TMDA 2C2XA 2DKNA 4ND2A 3S8MA 3WGHA 2Q99A 2NUAA 5I8WA 4JN6B 5BNFA 4ZQFA 4MIOA 5JBIA 3DHEA 2I66A 2NVUA 5HS6A 1SNYA 5FEUA 4WOKA 4ND4A 1DDOA 1PZFA 1YXMA 1HXHA 2QRJA 4ALIA 1UDAA 3RC7A 3DOOA 4JP2A 4GMGA 3WQSB 4BNYA 2G0TA 3DXFA 3E9QA 3QHAA 3WICA 1S7CA 1Z73A 2OO5A 4XWYA 3R0IA 5JS6A 4XDYA 4BS9A 2Y67A 2YUTA 4MVJA 2JD2A 4BGIA 4L8VA 5A02A 1O8CA 4P4LA 3CMMA 1TT7A 1E7QA 4IQ0A 4U5QA 4J2OA 3V2GA 3VDQA 3LZ6A 3INTA 4PLPA 5DULA 3UGKA 4YCAA 1P45A 3GNQA 4ALNA 3Q3CA 3UICA 2CF6A 1U7HA 4TRMA 4OKNA 4IQ8A 4EW6A 1N1EA 4XD2A 2UUPA 3JQFA 4PN3A 3LK7A 1JVSA 2H1SA 4DIFA 1PJ3A 2I6TA 4OXNA 5JYDA 1Z75A 1H5QA 1XU7A 3WGIA 4YJFA 5F1PA 5HWSA 4Z3KA 2F1KA 4MP6A 3O03A 1Y7TA 4J49A 5JY1A 1XDWA 5LC1A 5CDSA 2I3GA 2OBNA 3H9UA 1BW9B 3RVDA 2HUNA 3F1KA 1EE9A 2AEFA 1GCUA 4FGWA 3ZV6A 5MGBA 1PQWA 4ZGWA 5HS4A 1WVGA 1VJ1A 4GL4A 3GNSA 4OYRA 5L45A 3K92A 4EEZA 4CM8A 3WQRA 3PDUA 2BRUA 3WJ7A 5A05A 5TLSA 3RC1A 4LW8A 1FDVA 3KYCA 4RZIA 4TQGA 3ZW8A 1I8TA 4PLCA 3ZH2A 1PGPA 4NQZA 1K2WA 3TL3A 4JROA 5BSFA 3K30A 2WM3A 2X86A 3KTDA 2OZPA 2P5UA 1P1FA 2RH8A 4BKOA 5KVVA 1E3EA 4CMGA 2O3SA 1P33A 2HRBA 3X2FA 3DMTC 4KWIA 2ZYGA 4J7CA 1BXKA 2OOSA 1I2CA 2BD0A 1ZCJA 2GYYA 2VWQA 1P0FA 3ZWWA 1PWZA 4O0LA 5T57A 4J1TA 1N1GA 1ZJZA 4E21A 1EDOA 2CDAA 5IDWA 4ESOA 5A03A 1ONOA 2RHCA 4I5FA 5KKAA 1T26A 1A7AA 3A14A 4I5GA 3LVFO 5G4LA 3BHJA 3ROKA 3WSVA 4CMCA 1LDBA 1M6HA 1VSUA 3QQPA 4DRYA 4EJ6A 1R4MA 5K6AA 2Y66A 5FF9A 2HSDA 1JN0A 3BIOA 1D1TA 4CUKA 1ADCA 2FRDA 3WNQA 4L0QA 4ZJUA 4FGSA 5A3VA 3ROMA 1I24A 1KC1A 4BGVA 3EMKA 4BO8A 4UVGA 4I1IA 3ADPA 1VJTA 4Q3DA 2X9VA 3RKRA 4CUZA 2B5WA 1ID1A 1E6EA 4X54A 2OL4A 3IC5A 2H6EA 4UEKA 3SEFA 1ZO8A 1U7TA 2VWGA 4NU6A 5JNLA 1P1RA 1K6JA 5IZCC 4BGUA 1GCOA 4J1NA 2GLXA 1NAIA 1MA0A 3NT5A 1WDLA 5TNXA 1YH3A 4A7PA 5CAEA 3GK3A 4AL4A 3RUIA 4XYEA 5THKA 1NX6A 2ZB4A 1EE2A 2P91A 4GH5A 2VOEA 1R6DA 2VTDA 2W2KB 1YJQA 4OSPA 1PSDA 2AA3A 3S55A 2VZ9A 3IP1A 1I33A 3ENNA 1E3JA 4AJ4A 4XGIA 5EQFA 1N7HA 1XU9A 3TL2A 3ZV5A 3BMOB 4U6QA 4W9NA 2FPGA 4Y67A 2ZK7A 1OMOA 2BHLA 3RJ5A 2DPGA 1X14A 4YPOA 1GL3A 4YT2A 2H9IA 2EXXA 5KKCA 1WLYA 4M49A 3BMCA 3HG7A 4TKLA 3F1LA 4RVDA 2WSBA 2PKQO 3K2BA 3RD5A 4EYEA 5JDCC 3C1TA 3NT4A 1V9LA 2Q2WA 3UVEA 3H5RA 3E9MA 2A92A 5AVOA 2NQ8A 5CEFA 3VKVA 3PFFA 1WMBA 1WMAA 4UREA 1SOWA 4R9SA 3A1NA 3AUSA 5ENDA 1P1IA 3D5QA 4J7XA 2V6MA 4B3JA 2C7GA 1HZJA 3PVZA 4KZPA 4EJ0A 2AW5A 1KY4A 2CF5A 4IMPA 2NU7A 3FN4A 2JCYA 4LCJA 4P8RA 3T4XA 3HHPA 4PRKA 1ZSNA 1R15A 4R69A 1I3MA 1NM5A 4RL6A 2P5YA 4WUVA 1HDCA 3LLVA 4CMJA 5CDUA 2Q46A 4YJFB 4M89A 4BB6A 4HXYA 2IEDA 4Z3DA 2F00A 1A27A 4CLRB 3FTNA 3GF4A 1E7MA 2CUKA 5IN5A 1ZH8A 4E5PA 1H2HA 3O9ZA 4NMHA 1PJSA 3C3XA 5AXDA 1NFFA 3ZWMA 5DDIP 4WE3A 3PJFA 3GDGA 3ICCA 1CEQA 4DVJA 4FN4A 4AJ2A 3MJTA 5KJ1A 1X1TA 4CM8B 3KZVA 1QRRA 2D2IA 3DZGA 4D41A 2YFQA 1OC2A 5JY6A 1ZMTA 5C7OO 2CDCA 3ZV3A 1HKUA 3T4EA 4BOYA 1UXHA 4EITA 2BMAA 3K6JA 3VH3A 4W7IA 3KSUA 4N5LA 5DBFA 1PJQA 4YJHA 2WYWA 1H6DA 1LQUA 3WTCA 2NV6A 2Y1OA 3COSA 1X7HA 4J0FA 4CMEC 2JCVA 3D3WA 2DM6A 1PL7A 1HSOA 3ABIA 3DZFA 5JPIA 3IDSA 3ZWAA 2I76A 1KVRA 4XQCA 1GUFA 2BGMA 1Y5MA 3R3JA 5F3RA 1M6WA 3SC6A 1R16A 3DMTA 1A9ZA 2ZB3A 3AU8A 2FSSA 4E5NA 1R0LA 2FY8A 4AJLA 3GDFA 3UKOA 4PIVA 3FWNA 4B3HA 4E2YA 4BB5A 4NI5A 4AJPA 2EKLA 4M86A 3S2FA 1EQ2A 3DHYA 3H9GA 4CLOA 4YAGA 1R4MB 2EKPA 4WCFA 5JDIC 1B15A 3WFJA 2E37A 1HLPA 4ID9A 4JXKA 2AE2A 1JAYA 1ISGA 4MKXA 1G0NA 4K9DA 1U3UA 2EJWA 3VPXA 2CD9A 5L7WA 2PA3A 1VPDA 1WWKA 3GGOA 4MVJI 5G0SA 3V1UA 4FJ2A 3PZRA 1QMGA 2UVDA 3D3EA 4NPCA 1PGNA 4BO2A 1K89A 4GMFA 3PJGA 4C7KA 2ILTA 5DT9A 1QSGA 2GZ3A 3PFWO 5C3MA 2HKIA 4R5HA 1BG6A 4N7RA 3RBXA 3WGQA 5A9RA 5BNIA 3DAFA 4QTZA 4DREA 3BHIA 4GSLA 4URFA 4JIGA 4WEQA 3SJUA 1DLJA 4A73A 1U3WA 2EF1A 2JD0A 2W90A 3AM4A 1LRKA 4TRJA 2Q1UA 4ALMA 2ZJ0A 3RBVA 3IUSA 4MVJM 4EI2A 1C0KA 5A06A 1YKFA 2EW8A 1N8KA 4TRNA 2Q49A 2I99A 2YJZA 1U3TA 2Z95A 1H6AA 1KEVA 1ZW1A 1MG0A 2AQ8A 4PLYA 2DLDA 1ZSYA 3Q6IA 5B1YA 2AQIA 4EZBA 3VTZA 2C59A 2X0IA 3PHGA 3INRA 2Q50A 1OAAA 4ONEA 2QHXA 2DC1A 4XJTA 2EP7A 5C37A 5BQFA 2CDBA 3JD3A 3WSWA 1NAHA 2PGLA 2CMDA 4J9UE 1YO6A 3ZGYA 3LT4A 4PCVA 2BKAA 1LC0A 3DB2A 4UAGA 1OI7A 2PKRA 3KEOA 5DBGA 2ZB8A 5TRTA 3QWHA 4R9RA 4MDHA 4QXMA 1QYWA 3VVBA 3ROQA 1VSVA 3AY6A 3I3OA 4CQMD 5A3JA 5L40A 4CL3A 2WD7A 3WQQA 3SLGA 4M54A 1PJ4A 4UULA 4NBVA 3U0BA 4ROSA 4LSWA 1CIVA 2G5CA 5DCUA 4AFNA 5JCJD 2Q2VA 4K28A 4U0KA 4A26A 3PIIA 4JK3A 5DP2A 2GD1O 4NBWA 3QVTA 1UUFA 3EGOA 4OOEA 4H3VA 4AJNA 3PWSA 1UAGA 4L75A 4TZTA 1DC4A 4J1QA 1C1XB 4YR9A 3GG2A 4IJKA 2Q3EA 4J1SA 3IJPA 4MVJP 5I9LA 1XCBA 4L9RA 2NTVA 2POQX 4E2WA 3AUAA 1K5HA 3IAHA 1I5RA 3Q2IA 1ISMA 4BGEA 2GN9A 3D4OA 4IBOA 1A4IA 1HYHA 1Z6ZA 1JWAB 4KUHA 5JW6A 1D7OA 4J91A 1E3WB 5IG2A 2O2SA 3G49A 1ONPA 4CODB 4CJXA 1ZXLA 4ZD6A 1BDMA 2J6IA 1NVGA 2O50A 1HSZA 3JQAA 3W6ZA 1QLJA 3IKTA 4PZEA 3VZSA 1LA2A 3FBGA 4BMVA 2C29D 4BMSA 4ND5A 3H2SA 4NDNE 5T8KA 1I2ZA 1MLDA 1RM0A 2PK3A 3D0OA 1BVRA 4UVDA 3RWBA 3RJ9A 5L4NA 3E82A 5DOVA 1LSJA 1L7DA 3BTUA 4XQGA 3ZW9A 4D3SA 3D3WB 1T4DA 2O2YA 2XF8A 3K5PA 3Q9UA 3EUWA 3WLEA 1Z82A 1V6AA 2FP4A 5COAA 3Q9NA 1YB5A 3H5NA 5EN4A 4Z0PA 2A4KA 1A71A 5EMHA 1BVUA 4LCEA 3QVXA 2NSDA 5AQ1A 4ALLA 4JQCA 3LT1A 4MOWA 5EINA 1D1SA 1SZJG 2IEBA 1KC3A 4RDIA 4NFHA 4NIMA 1GV1A 4J4TA 3JD2A 4Y6PA 3GZ4A 4A27A 4GQAA 1IOLA 2X7HA 2AE1A 4IM7A 5L4SA 1GZ6A 4CLOB 4WCFB 3O38A 3E5MA 1F8FA 4QT0A 4AG3A 2C54A 4W99A 5B4TA 1FK8A 4BO5A 5KCZA 4CM3A 2QZZA 1QG6A 3AU9A 3EW7A 3FRJA 3HDYA 4YQYA 1H93A 4O63O 3WG9A 1Q7CA 4HWKA 2D1YA 2O4CA 3PP8A 1ADBA 4CM4A 1Q0HA 1MC4A 4KQWA 3PPIA 2GN4A 3NJ4A 1U3VA 5H83A 5BR7A 3DL2A 3LC7O 3WGOA 4L4SA 3GRKA 4AJOA 2B36A 1N2SA 4HUJA 1IULA 3WDSA 3ITKA 4CM9D 4K1LA 1Y8RA 1U8XX 3CMCO 3E03A 1QR6A 4FCCA 4FC6A 3F5SA 2VYVD 3PHLA 4DQUA 1E3LA 4LVUA 4BNFA 1U5AA 5COBA 1NVMB 2XOXA 4ILKA 1F12A 4P4NA 2O3TA 2AG5A 4BKUA 2PD3A 1P77A 2HCTA 2RBEA 3AFMA 3Q0EA 4BKQA 4ZA2A 1LQTA 1IY8A 3SVTA 2EGGA 1RYDA 1AXEA 2JAHA 3WGZA 1LBEA 1UXKA 3BMNB 4BNUA 3RC9A 3QW2A 3ZNPA 2BLLA 1M75A 1AXGA 5JYEA 3H4VA 2J5KA 2QYSA 3BZUA 4GBJA 1I2BA 3RU7A 1H6CA 1TT5A 2JKVA 4RQUA 2QW8A 1IYZA 4R1TA 4S3MA 4CMBA 2BF7A 2RCYA 3HDHA 3D1LA 2PZKA 4IJVA 1ML3A 3V1TC 4IJUA 1YJ8A 9LDBA 4K6CA 4BNNA 2VUUA 4MIEA 4ZN6A 4QFCA 1SEVA 1VL6A 3PJEA 5KNLA 4HY3A 5TX7A 2WD7B 3B20A 2WD8A 3AUTA 1N92A 4R01A 1Z74A 5EJ2A 2V7PA 3LF1A 2NM0A 4B8ZA 2JCXA 1ULSA 3H7AA 4HX5A 4FIZA 4JLWA 4EUEA 5CFZA 1R12A 5LDHA 4HNGA 4LRSB 1LRJA 4D3FA 3L6DA 3IS3A 1F0YA 1P44A 2VNAA 2P4HX 3GPIA 3SC4A 3DBHB 1NVTA 1YBAA 1XKQA 3V2UA 4JJIA 2EJVA 4RPHA 3PRJA 1RKXA 1NWHA 3CH6A 3UCFA 4E5KA 1BXGA 4AJEA 5U9CA 1IE3A 1T2DA 4YACA 1XEAA 3F6YA 5DCYA 3FHLA 5G4KB 5U1PA 1SMKA 4E6PA 2W2LD 5I9NA 2PTGA 4LGVA 4CM9A 1QORA 3LSYA 2OGUA 3G1UA 5I7SA 2D3TA 4BHTA 1Y9EA 3QLJA 2VYVA 1M2WA 3DFZA 5G0TA 2LDBA 4R68A 1F8GA 4Z0HO 1IZ0A 1LSUA 1CJCA 4Z9FA 1N9GA 3JD0A 3NTOA 4IDAA 4XZ3A 1PJLA 1UDBA 1HDGO 5HA5A 3HWRA 1H9AA 3OA0A 5CPFA 2PKQP 1ZK4A 2AHRA 2YV3A 3HN2A 2NU8A 2ZYAA 3VOSA 5CDTA 1CDOA 3KOUA 2NU6A 2O48X 4FC7A 4UVHA 3WWZA 1B16A 4GX0A 3ASUA 2GRAA 4HKTA 4OXYA 1ZK3A 1B8UA 4S1VA 1GUYA 1JDJA 3C7AA 4YRDA 1ZFNA 4CUJA 4D46A 4YT8A 1GD1O 3QVSA 1PX0A 3WMXA 3QRWA 4AJIA 4PZDA 5DCWA 1C14A 1OC4A 1FF9A 4FSHA 4RLHA 2VUSA 1JKJA 4NR0A 3WB9A 1PEDA 3PJDA 1FMCA 5DZSA 5TJHA 2IZ1A 4CL8A 3GAZA 5J23A 3ETGA 4OH1A 4XB1A 5KJEA 5L95A 1A5ZA 4CQMB 4LK3A 4YTEA 2CSUA 5EPOA 1K6IA 1KETA 4BNIA 1CETA 1LX6A 3IIEA 5I7VA 4N54A 3QWFA 3U4IA 1OFGA 3L6OO 4I9HA 3W1VA 5IXYA 4QUKA 2V6BA 4NFYA 2ZATA 1UXJA 4ZQEA 1TXGA 1W8DA 4YT5A 3VDRA 2YHIA 4B4VA 3MEQA 4OQYA 1SEPA 5MDHA 4MO2A 1PTJA 4IQGA 1MP0A 3CSDA 5KVSA 4AJKA 1XHLA 1Y8RB 4BQPA 3QP9A 3V5NA 3GMSA 2GR9A 1TA4A 2HDHA 3L4BC 3RKUA 1OZAA 4CM1A 1SC6A 1TEHA 4I9NA 2DUWA 3TFQA 5EESA 1LJ8A 2W2LA 4U6SA 3U49A 3ZWOA 4CM7A 2GNAA 3D5TA 4K6FA 2ZYDA 3PGJA 1AN9A 1ZNQO 4CQLB 1IHYA 5TC4A 4OGWA 1HEUA 5FFFA 4LISA 2E49A 4JJGA 1Z7EA 1V8BA 4NK5A 3EAGA 3MJCA 3Q2KA 2BELA 3RFXA 3B70A 3ZZNA 5BSGA 2Y93A 2ZTMA 3SJ7A 1Q7GA 3L9WA 3GGGA 1UZNA 3AUUA 2QQ5A 2YV1A 3D7LA 5B12A 3HUDA 2OXIA 1TT5B 3ENKA 3JQ8A 3DZHA 1GQQA 3R1IA 1DSSG 4OKIA 4B8WA 1C1DB 2NTNA 2NNLD 1NBOA 2HK9A 2O3QA 4I8XA 1YVEI 4R4JA 1EEHA 5CEJA 3R6DA 4CLXA 4MVJE 5FYDA 3IKVA 2NQTA 4DLLA 4A2CA 1DJNA 3NAQA 3P5SA 3JYNA 1U9JA 3VH2A 1PU2A 4Y8VA 3QVOA 2O4UX 2I65A 1HE3A 3DZBA 4Z0TA 1PR3A 4J2HA 2J5QA 1DBVO 1LSOA 4HFMA 2VYND 3GR6A 4LRTB 2Q1SA 2WE8A 4IZIA 3I5MA 1T2EA 3K96A 5CG1A 2IZ0A 3MCVA 4QSMA 3VPGA 2EGHA 3BMQA 2CVZA 3LF2A 4QQRA 3B1JA 2OUIA 3I6QA 4OMUA 3PXXA 3JQEA 1AGNA 1XGKA 2E4AA 3ZU2A 2WJPA 5HM8A 9LDTA 3EHEA 1DHRA 4JCOA 4NH4A 3GEDA 1KYQA 4DPMA 2QRKA 3I1JA 4OL9A 3PLNA 2B83A 1DO8A 3ZI0A 3ROPA 1IPFA 1O94A 4BNKA 1P74A 5LCXA 1PQUA 2X8LA 5L51A 3M2PA 2PZLA 3D64A 3V2HA 3FD8A 1P3DA 3ULKA 1X0VA 2NACA 2NVBA 3L6EA 4KOAA 2XAAA 3K9QO 3OMLA 4P4GA 3EDMA 4W7HA 1N9GB 4WLVA 2GF2A 4L73A 1JKFA 3DTYA 1LU9A 3MJEA 1A7KA 3A4VA 2VTEA 4WLEA 4AICA 4KTVE 1E3SA 4Z6KA 2PFGA 4CLHA 3W8FA 4IDGA 1X7DA 1X0XA 1LLQA 3KYBA 4FQ8A 1GQ2A 2NTJA 4ZU3A 3C1AA 4FOSA 2NVUB 5L7TA 1LXCA 2HK7A 3OEYA 1E77A 2PNFA 3K31A 4LMPA 1YE3A 4KWHA 1GV0A 2VWPA 3HQ4O 2Z1MA 1GU7A 4IIVA 4CV3A 5JSFA 3I9JA 1KEUA 4MIYA 4BIIA 1BRMA 2R00C 1JAXA 1MUUA 1H6BA 3MWDB 5JAZA 5JCXA 2C2YA 3H5AA 4XX0A 2VRCD 3BYZA 4J7UA 1M76A 3NTQA 3DZKA 4ITUA 1HDZA 1F17A 5ICMA 2X22A 1J6UA 3FCOA 2FSVA 1EQUA 2VYNA 1GUZA 2Q2QA 3JQGA 1RM4A 1KIFA 3ZWXA 3H9EO 3LC1O 5K9ZA 5KTKA 3KSDO 1EZ4A 5U4QA 2WMDA 4XJSA 3AI3A 3FPLA 1E3IA 1BTOA 1JA9A 4A5OA 3K73O 5AYVA 3VH4A 3H2ZA 3GG9A 2AEMA 4FFMA 2AXQA 2YQ5A 2ZTVA 3WS7A 4TRRA 2AMFA 1Q7BA 3DAGA 1DIHA 1N5DA 1GZ4A 4G81A 2PY6A 3ZHBA 4IXTA 1WW8A 1FJHA 4YT4A 2P9EA 1CQIA 3KETA 1EK5A 1HETA 1RM5A 2Y0CA 1MGOA 3I9NA 4NJMA 3LYLA 3MTJA 1DFGA 2Y0DA 5T6BA 5ITVA 2HO5A 3RIHA 3RUCA 2Z1NA 1IB6A 4LVCA 2VHXA 5G0UA 1QP8A 3DZIA 3DC2A 3U4HA 3OICA 1PR9A 8ADHA 1YOVA 1NASA 3W6UA 3VPSA 4DMMA 3E48A 3GZNA 1PJ2A 5JO0A 4BNHA 3I4FA 6LDHA 1HYEA 4YEDA 1PS8A 3ADOA 4CV0A 2JHGA 1JTVA 1NYTA 2LDXA 3N58A 4CR7A 3KYCB 2B37A 3IJRA 3JQ8B 1X7GA 4TVBA 2BGLA 3OEWA 3U3XA 1HDYA 4XQEA 4PG8A 3QSGA 1GY8A 3EK2A 1IUKA 2FPIA 4E13A 1WNTA 1UR5A 1NPTO 3FSRA 4E30A 4BUCA 5I7FA 4FFNA 2IYOA 3RUAA 4KMSA 3M6IA 1UXGA 2VUTA 2HQ1A 3ZHXA 3NX4A 1B3BA 5JXWA 1HYGA 2VRCA 4DA9A 4BKPA 4FDAA 2EP5A 3I9OA 3U4DA 2B4RO 4PFJA 1N7GA 1ZXBA 4FPXA 4NFSA 3BMQB 2FZEA 3OIGA 4OHUA 3IL2A 1E6UA 4QO8A 3NKLA 4YQZA 1GPJA 3JYQA 3PWZA 2BFMA 4I08A 2PGJA 3S2GA 1NFQA 2EWMA 3A9WA 3GPDG 2EW2A 4JBIA 3ZHZA 3PHHA 4EUFA 2B4QA 3AFNA 3RUDA 1J49A 1EK6A 1Y6JA 4JGBA 4FFOA 1AUPA 4L76A 2CVQA 2VNSA 2R2GA 2FR1A 2PR2A 4PLHA 3CXRA 3PQDA 1GYPA 2D59A 1XYGA 1MG5A 2EG9A 1DRWA 4GVLA 3GEGA 2VT3A 4Q3AA 3I23A 2G17A 4J43A 3X2EA 3JD1A 1FDUA 2X0RA 5CEEA 2C5EA 2IXAA 3RAJA 3NEPX 5I9MA 3HE3A 4XIJA 1Q2XA 2QYTA 3ETEA 3JQAD 3JQ7A 5IZCA 2X4GA 3E5RA 3OJFA 3W8DA 4D7AA 4D43A 4DLAA 2GDZA 5A9TA 1NFRA 4RO0A 4BNZA 2FN7A 4Y6RA 4RDHA 3KRTA 1DAPA 4K26A 3FTPA 4XYGA 4FB5A 4OQZA 2J3JA 4BNTA 1YL5A 3P2YA 1GZ3A 3OQ6A 2HMTA 1VKNA 2Q4EA 1BDBA 2O23A 3F5QA 2YV2A 4Q9NA 2IRWA 4P22A 3GC6A 3GUYA 4NNJA 3DEYX 2A9FA 5TT1A 3BMCB 4WECA 5A04A 1E92A 3GEMA 3JQBC 3NTRA 2DBZA 2R00A 1RYEA 3ANLA 1KVTA 1EUCA 4MVJF 4UUMA 3GMDA 3V1YA 3F46A 3G3EA 1VI2A 2VWHA 3GVIA 4UUPA 3WYCA 4BNMA 1A4UA 1PJTA 2RIRA 4IDDA 5JDCA 5JAMA 1PS9A 2O3RA 1W73A 2G76A 1QYCA 2P9CA 4FFLA 4IDFA 4MP8A 4BO3A 4O6VA 3RSHA 5AXAA 1EVJA 2X9NA 2CY0A 4R54A 2G82A 2JAPA 1DXYA 1YQXA 4M8SA 3UHAA 1SO8A 1EBFA 4ZVVA 3VH1A 2PWZA 3FNHA 1LDNA 1RM3A 4MKRA 2DFDA 3CZRA 4XRGA 3CUKA 4GAEA 2OMEA 5AOVA 4F3YA 3CPSA 5ER9A 4ZICA 2W98A 2B35A 3JV7A 4A0SA 4TVOA 4EDFA 3LT0A 3NDRA 3QWAA 4BO0A 4Q3NA 3ZU3A 2X0JA 1NQOA 3BHMA 3QIVA 1T2CA 3B6ZA 1Y9AA 2WYUA 3DBLA 4WKGA 2OP0A 1MXHA 5EIOA 4GWKA 4XYBA 1QLHA 2D0IA 4R1SA 4NBUA 2EV9A 2NLOA 3ZDFA 3GY0A 3U09A 3WR5A 2TMGA 2X6TA 1YOVB 1NQ5A 3SBOA 1MC5A 3KXDA 1S6YA 2YFHA 5H82A 3PYLA 4RV9A 1HWYA 1P1HA 4CR6A 3CTMA 1AE1A 1H2BA 4HP8A 3KB6A 3DDNA 2J3IA 4PZCA 7MDHA 1B14A 3N7UA 1E7RA 4IZHA 4YJHB 1HE5A 1YONA 1XLTA 2QG4A 1HLDA 4JBGA 3JTMA 3R3SA 2QX7A 4XIYA 5JMPA 2A94A 3H9JA 2V65A 4G5HA 4R3WA 1UZLA 4XYMA 4CLEA 1DEHA 1EVYA 4WNIA 3TZQA 2X5KO 5FI3A 4CMEA 5CDYA 1B26A 1YS4A 1O6ZA 2NADA 2SCUA 5B4VA 1RPNA 2X0NA 1H9BA 2NVWA 2BFOA 4BNWA 3RU9A 4OXKA 1C0PA 3G0OA 4E0BA 1QV6A 4E4YA 5DNAA 5GMOA 1KEWA 2HMUA 5L7YA 3RROA 1NQTA 4GLLA 3CKYA 5CHEA 2EKQA 1K6XA 1V35A 1WZEA 1ZK2A 1LRLA 3ON5A 1ZSVA 4Y6SA 4PG7A 4JP3A 5TIIA 3PK0A 3MZ0A 3JQ6A 1R0SA 3ZNNA 2Y1FA 1HDOA 5JDIA 4TMFA 2JL1A 4CMAA 1H0KA 2YW9A 4EGFA 3FNEA 1ZJYA 3IUPA 4CV1A 5T5QA 3TDKA 4KTTE 4ZRMA 1XIVA 5L53A 1L1FA 3UAGA 3WBBA 4M55A 2P9GA 1VM6A 1JVBA 2ZCVA 4RORA 1P0CA 4B4UA 1PWXA 4UUNA 3ZCXA 3F4BA 1NHGA 2WWRA 2XXJA 1W4ZA 4I9UA 5A1TA 1VLLA 3JQFC 3KVOA 2PD4A 1I32A 2HAEA 5KJCA 3SX2A 5IN4A 4E12A 2PLAA 3NJ8A 2HJRA 1BSVA 2ZJ1A 5L3ZA 2DTXA 5T67A 1UXIA 1LSSA 4BV8A 4YAKA 4CMHA 4BV9A 4GX2A 4XR9A 5I8ZA 5K0ZA 1PJBA 2IODA 1ISHA 3EY4A 1XSEA 4GX5A 2GZ1A 1E5QA 1SOVA 2AG8A 1TI7A 4F6CA 5HTOA 3ASVA 4DLBA 1WP4A 5ITWA 1WDMA 1DFHA 3A06A 5IAAA 4RPKA 3I6IA 2ZKLA 1ISFA 4GSKA 1SB8A 3TWOA 5AXBA 3RI3A 1WZIA 2ZCUA 1VC2A 3JQBA 4GPD1 1EUZA 1EMDA 5C5IA 5L4LA 5FI5A 2X5OA 5GZ6A 3ZWYA 3OJEA 4HFNA 3AY7A 4GI2A 4XEHA 4UUOA 1HZZA 4J16A 3Q11A 4M87A 4ZQGA 3K2EA 3RUFA 3UH1A 1P9LA 4OM8A 2NWQA 4D45A 2DTDA 1VRWA 1EDZA 3UUWA 3GFBA 3GH3A 4BVAA 3WGGA 4D0RA 1HL3A 1GYRA 3F3SA 2YZ7A 3JQ9C 3L77A 4WGGA 1U1IA 4TSKA 1PJCA 1HT0A 1E1NA 3DR3A 3FPCA 1E5LA 1ORRA 2E82A 3OIFA 1LLUA 2FPPA 4W6ZA 1Y81A 3C7CB 2HMSA 3KBOA 3NRCA 3AM3A 2I67A 5F21A 3KM0A 4YRAA 4FJ0A 2Y05A 3DBLB 1LDEA 4J0EA 4MKZA 1ARZA 3JYOA 3JQDA 4L4XA 2HMVA 2AQKA 4KDFA 5G0WA 3ONEA 2IDZA 1KBZA 3PQEA 5ADHA 4RLSA 5TJ9A 5K6AC 1ULUA 2RAFA 3ANMA 1EBUA 3WGTA 1BGVA 2PGDA 2D5CA 3KYDA 3WYEA 1J5PA 4BQRA 2VRBA 3JQAB 1ZIDA 1LLCA 3UF0A 1ADGA 3GQVA 4R41A 4WEOA 4RVSA 5CPBA 4IXWA 1YQGA 2J5RA 3F47A 3GDOA 4DWVA 5BSHA 2AQHA 2YDYA 4C4OA 3IOYA 1QYVA 2GZ2A 2HU2A 2EHDA 2VN8A 3ZWPA 1FDWA 3TZHA 4O5OA 4XGKA 3PHJA 1BHSA 2GPTA 3F4LA 1R37A 4L74A 4U7WA 1DPGA 3JYLA 5B37A 5KVQA 3INGA 4WLNA 3UN1A 3OETA 3VZQA 1EFLA 4IY1A 1SB9A 1V0JA 1HDRA 4LN1A 3M2TA 5EQDA 2JHFA 3L9XA 2JFGA 2W2KA 3H9QA 3CE6A 3U5TA 4E33A 1CF2O 1B8PA 1YL6A 3WXBA 4A03A 4TZKA 2QZ9A 2Y1EA 4W9NC 2P68A 4DGSA 3PTZA 3H65A 3HN7A 4F46A 2HLPA 5EERA 1K3TA 4OO3A 3TZ6A 3I52A 2FMUA 3HFGA 3BMOA 4MINA 4N5MA 2GCGA 1BWSA 3HDQA 4RQTA 3TNLA 3TZCA 3RCBA 4CM4B 4J9VA 1DC3A 4NZ9A 4DMLA 4DIBA 5KJ6A 3IP3A 4ND3A 2BFAA 3WBFA 5KWEA 1NPYA 3HFSA 1HF3A 4DL9A 3UXYA 5CP8A 1T2AA 2J8ZA 2VHZA 4BO4A 2DQ4A 5ILOA 3OJLA 3BA1A 4EJMA 2IXBA 1NP3A 1E1MA 3M1LA 3PLRA 3KUXA 1O89A 4B7CA 4KUEA 4PVCA 1GQYA 1D8AA 5DBIA 3DHNA 5G0VA 4WNCA 3LU1A 2HJSA 5JLAA 2NU9A 4YA6A 2ZQYA 2GGSA 3AWDA 2EIHA 4O1MA 1OOEA 3S2IA 3QWBA 3OIDA 3ZNQA 2C5AA 3O8QA 2D5AA 3UCEA 5F1OA 4CV2A 2V6GA 3NDJA 2B0JA 1AHIA 3QY9A 1WPQA 4IIUA 5TQVA 2C0CA 4XKJA 2FOIA 5IDXA 5JC1A 2VZ8A 1F14A 1U4SA 4QFDA 1ISJA 3ONDA 3AJRA 4CLRA 1KY5A 1PZGA 1DC6A 5T64A 5A5FA 1ZK0A 5DN9A 4RF4A 5G2OA 3P2OA 4AJHA 4WOJA 1ZVMA 4NBTA 4CR8A 4NG5A 4CM5A 3GLQA 4BL5A 4XCVA 2Y0EA 2VZ0A 4J4HA 2XXBA 4E32A 1QYXA 1PIWA 2FR8A 4INAA 3L0DA 2GUGA 1NHWA 3FBTA 3D4NA 3DWFA 3H3FA 2P4QA 4FR5A 4XB2A 1GR0A 4DTIA 5TF4A 4DC1A 2VHVA 3DBVO 4HNHA 3B1FA 3OJ0A 5CDGA 1JU9A 1C0IA 4Q3CA 2DUUA 1RJWA 5LDGA 3I83A 4J3FA 3TOZA 2Y1GA 1BMDA 1QKIA 1NR7A 1B3RA 4RGBA 3WFIA 4B7UA 1MB4A 4PLVA 1T24A 4RVUA 1U5CA 3JQ9A 3C7DB 2GO1A 2QRLA 1BXGB 2YQ4A 3NGXA 5ES3A 4AVYA 5A5EA 3VTFA 3WIDA 4RVHA 4EEXA 4YB8A 4WCFC 4DXHA 1R4NA 1NWCA 4YJDA 3C1OA 1RWBA 1SPXA 2DTEA 3MJSA 3G79A 1DHTA 3KYDB 1KERA 3GFGA 4RF3A 4WLUA 4CM6A 4NJOA 5TGDA 1C3VA 4DBVO 1A72A 1PS0A 4GGPA 2O7SA 2Q4BA 3H6KA 3RFVA 3T7EA 5HRUA 1R66A 1HE4A 2Z5LA 1NTOA 3ZWVA 3RBZA 4E5YA 3WNVA 1YQDA 1E1KA 1I36A 1UDCA 1U28A 4YJGA 1E6WA 1I10A 1NPDA 3EVNA 3JQCA 3PYXA 2R6JA 3ST7A 4XRRA 1ZMOA 1LLDA 4WK6A 1O9BA 4BNLA 5IXSA 4HFRA 3VPFA 4MVJG 4BO1A 5A4DA 6ADHA 3ANNA 1H94A 3GVHA 1CYDA 1Q1NA 1E1LA 3A28A 5ER6A 3S1LA 4YXFA 4BMNA 4E2XA 3PYMA 3ZWNA 1PZEA 4JNKA 1O0SA 3HDJA 1T4BA 3OA2A 5IJZA 5JO9A 3KEQA 4JX8A 2ZQZA 1XQ1A 2VOJA 3HSKA 1YRLA 3UCXA 3DBRA 1W0CA 1XG5A 4RPLA 2E48A 5C7IO 3DMYA 4YYZA 5A9SA 2HRZA 4IINA 1AHHA 2WYVA 3SLKA 4MVJH 1V3VA 3UW3A 4HV4A 2CZCA 3GGPA
chains in the Genus database with same CATH superfamily
4FYKA 4TWAA 4TYPA 3TF5A 3S2UA 1T9DA 1CULC 2QT9A 1HE2A 1JEAA 1J33A 2A0FA 2AV6A 2R87A 1RPZA 2Q8NA 5AQEA 3U16A 1QH1A 3N74A 3BUSA 1N2CA 2BSXA 4G5GA 3EZ6A 4EGAA 4BBPA 1Y3DE 4TKMA 2YHIB 5CX1B 4DYVA 5C3UA 3T8YA 3G5AA 4KPUB 2RHRA 5HQ3B 5I7EA 4IIGA 4CRWB 1ZOLA 4ZVQA 721PA 2WF5A 2QTLA 3AIKA 1GYQA 2DQSA 2OT3B 4MS3B 1KVUA 4WD3A 3RPEA 3WK7A 5EJ9A 1EVIA 5EE3A 1PG5A 3HZZA 3TQIA 1TFRA 3QA9A 1MD9A 2ZRNA 4Q9KA 3IUMA 5H7XA 2I5PO 2NSHA 4RZ2A 5MF6A 4MQ5A 3QKSB 5IWAB 3R6GA 5LP6B 2X41A 2XQGA 2ODTX 1EX6A 1XZEA 3G2LA 1SQ5A 3NNDA 4MV5A 3AM5A 4UASA 1QOPB 3MJFA 3VSBA 3W4KA 3THSA 2NYUA 4BP1A 1ZIOA 1JLLA 1I4WA 2FHPA 2IELA 2R7NA 3OQ1A 4L6CA 5ERGB 4YAUA 2X0KA 2IY8A 5E2BA 1T15A 5KTPA 1F5SA 4OHWA 2YY7A 3MWEB 3V4PB 2QUHA 1VIVA 1EXNA 2GEJA 3WGMA 3DTTA 7MHTA 4B81A 2A35A 2PV7A 3OCYA 3GZJA 3GL9A 1QIEA 2AI2A 2PKXA 5ENVA 4DQXA 1JFRA 3U6KA 1DO0A 3EPRA 2GAFA 3EIXA 1YFKA 1XWFA 4NENA 5DTIA 4YWJA 1KR2A 1TCUA 5DF1A 3MPOA 1UMBA 2HLHA 5J9FA 4E88A 1T5LA 5K3AA 1H2XA 5FO0A 4DV0B 1P0QA 4GC9A 1FCJA 1QJ4A 1RAHA 1TEXA 1ZEMA 2X58A 3BAZA 1US8A 3OY2A 2XDQB 4XQ9A 4ZOLF 5AKYA 4AJJA 3VU3A 3W04A 2XUQA 1QHFA 2YHBA 3D4IA 3KKEA 2DHQA 4F9EA 2HYIC 1CPYA 1QQ7A 1RQGA 1TQDA 1BKYA 2XT6A 3LQYA 4LIPD 3E6AA 4H59A 4IJWA 3B8EA 1UKZA 1DNPA 1DAKA 1ESZA 1XPJA 3H83A 3LP8A 4XUCA 3GJXC 4IDQA 4B74A 2XB6A 3W2IA 2O8NA 3A4MA 3K0HA 1E58A 3SHWA 1XCLA 2AXNA 2XPCA 3P0FA 4B3RB 4KLCA 1WD7A 1Q0QA 1AQJA 2P3SA 4COOA 2NYVA 2AFVA 1OWOA 1T1EA 2Z9CA 1NATA 5TPWA 2QRPA 4NBRA 4B0OA 2O3JA 1QCCA 3G17A 2IHJA 3EXHB 1MGPA 5LKAA 4XR4A 1ML4A 1FDOA 4JY7A 2VPQA 3GVXA 3TW8B 3NKVA 4Q1FA 5K0BA 2W8ZA 4H16A 1Z8DA 2A1UA 1E9SA 4M1WA 5I6DA 1FZTA 3RH0A 2ZIUB 4NS4A 3SXJA 2Y8EA 4RVFA 4CG3A 2Y6UA 2ODQA 4KG7A 3TCNA 4DYDA 5CFNA 4D9EA 1OT3A 3HU1A 1E2BA 3WYBA 2Q5JA 1OFTA 1OTHA 1ZRNA 3EYAA 4OREX 5IDYA 5DU2A 5FDFA 2JEOA 4RMJA 1CQJA 2XGJA 1M1UA 2YHAA 4ER5A 1M0TA 5LYJF 2ZUWA 2X23A 5IZ4A 5E1DA 3V7NA 3IV9A 3CVUA 3FNFA 4TROA 1GZDA 3VHRA 4PGMA 1WVMA 4A1FA 4F9FA 3KJNA 1QO0D 3PDWA 2GHTA 1SG6A 1LI7A 2Z2IA 1MN6A 1W6UA 2ZTHA 4YS6A 1ZISA 2ZQ5A 7AT1A 2VQFB 4PRLA 3DS8A 4ZHQA 3V4VB 4AZ3B 2HF9A 5K0CA 3AMVA 2B25A 1U2RA 4QASA 3HI4A 5IC6A 4CGZA 4IILA 4MA0A 3L4SO 2B4KA 1DTSA 2WHQA 4NS1A 4GWGA 2O2HA 1YAHA 2DAPA 4CLDA 5EZYA 2NSLA 1SCUA 2WSMA 4ZVKA 1VJ0A 3EX7C 3EGEA 1D9ZA 4JOSA 4WOBA 1BA2A 1DADA 1XMPA 2PPVA 4RYDA 1NF8A 3KSMA 3L1JA 4HAUA 5CGQB 2WSLA 3GARA 3GRRA 3N1UA 4RSGA 3WL7A 1RZRD 3R5SA 3MCZA 2XZDA 4Q39A 5EWMA 1XCJA 1UBFA 2FZGA 2G0NA 3QUSA 4FFDA 5TSDA 4MPDA 4O2BA 2O20A 3CKLA 4DIDA 5HVNA 2A86A 2ZS7A 2BMEA 2HCJB 1CUBA 1JQKA 2PSDA 4CNBA 2A1TS 5CXUA 4B2YA 4K86A 4L15A 3E3LA 1GAXA 4DMKA 3N2LA 4N39A 1LTQA 5F78A 4DDWA 3X1XA 5AUPB 4B3CA 2O8BA 2YDXA 2CCJA 4PLGA 1RC1A 1UP6A 5DTMA 3EVTA 1VHQA 2Q9BA 2WU3A 4LMRA 4EPTA 4MITA 5IT4A 4R3UC 1Q0ZA 2RK3A 4U2BA 4RYLA 2VNKA 5AW8A 5K8LA 3E4DA 5KDOA 5CIQA 1ZN9A 3KLBA 3LNTA 3EC1A 1G3IA 2J6HA 1CG6A 2OHGA 3IP9A 5FR2A 1NDQA 4QYWA 1LV7A 1U9IC 1YWGO 4ZT6A 3RQSA 3SBDA 1EK0A 3HUUA 1T1SA 1LI4A 2DOKA 1Q92A 3HKDA 4NWIA 3BMNA 2W0MA 2H4XA 4OQEA 1PT8A 5C52B 5E6RB 1PQPA 1Y5RA 3B6EA 4NCNA 5KQGA 5AVKA 4AECA 2H1LA 2WWYA 1ZJJA 4UTNA 3SG0A 3D1JA 1NP6A 1NRIA 4MJLA 2JAQA 4RF2A 5FUBA 2IKQA 2PJDA 2PKCA 3CC8A 2XSZD 4Q37A 1FP7A 3R6WA 1JYFA 1GTMA 1OR8A 5LBTA 2P9ZA 2E4ZA 4KV9A 1NX9A 3A6FA 4DUGA 1IXZA 3DFFA 3QMMA 4CKBA 1QHHB 3EDCA 1T8UA 1LVGA 4NHEA 4ZRDA 4PG6A 2EARA 4Y2VA 2QIOA 3GJ5A 3USCS 1Y8QA 3DT9A 5AUQA 3WIEA 3ZLVA 2ODWA 2B6HA 4Q3EA 1X7ZB 3FNGA 5DJ5A 5F7OA 4DLWA 1HRDA 2FPLA 2ZB7A 1W4LA 1FXWA 1NSYA 2RHDA 2ZAYA 1AV7A 2F1IA 4FWTA 4ENWA 3DFUA 3KT0A 3BE8A 1UH5A 4L4ZA 2X9LA 3IGFA 2IZZA 1H1TA 2VQ3A 3OLYA 5HKKA 1D5WA 5BW8A 1OBOA 3U56A 1ECFA 5JZMA 4UEJA 2XZPA 3MLBA 4UOQA 4KGDA 1P1BA 4C7JA 1WAMA 4E11A 1GCGA 2JEZA 5I9IA 5AUNB 1OVGA 3TAXA 4HVCA 1FJGB 3CJQA 3BKXA 3DBHA 3ESXA 4N41A 3C3WA 1Z9BA 1ISIA 1RU3A 3QLEA 2QD3A 1PJAA 3DR5A 3IH5A 1FDSA 3LY7A 2PZFA 4O59O 4RKRA 5ALGA 4RGQA 2VT2A 2EERA 4YFVA 5HUHA 2FHSA 4EB8A 3COPA 1ZMXA 3GXBA 1P4SA 2Z8YA 2FK7A 3BWEA 1NXPA 5DBOA 1P31A 2YH2A 4HLUA 5G4KA 2R25B 1JDNA 4QFBA 5D3MA 4DLSA 4UQLA 2X0DA 4LXIA 1ZUD1 5AKIA 1PFKA 1SCKA 1XDSA 3FUWA 1OVMA 3I32A 3IQDB 2R1VB 3KQPA 5JTTA 3GAAA 2W58A 4IUYA 5FNVA 1XL1A 5KDLA 3UK2A 5BN3A 3SHOA 2NP7A 2GBCA 1F8YA 2GEFA 4TWJA 1VIMA 1WY5A 2B4TO 3VZBA 2ZZMA 4EY3A 1C81A 2AL7A 5AM3A 1E1YA 3KXPA 3BILA 3LP5A 4HX9A 1V11A 1H2YA 4JJZA 3WK5A 3IUQA 2JFBA 4C0LA 4KN8A 3C8MA 2C88A 5K8TA 4Q3BA 5JBQA 4JLOA 3FF1A 3CRMA 1TZBA 1T8RA 1GA4A 2NXWA 2HREA 1X8LA 2Q4DA 4NP6A 3EMBA 4BVKA 2O1EA 3GVPA 2O19A 1PZHA 1W2WB 2YC4C 4DLZA 2OGSA 4URZR 2RHJA 2PMEA 2XKBA 1U2PA 1XXLA 2HA6A 2OCYC 3QE0A 1Y5LA 2BZ0A 2OKGA 5CR9A 5H1YA 4C0AC 1VOTA 2HL6A 4DV3B 5NULA 3Q5EA 2R84A 2D8AA 1KEEA 4WXPA 1OAOA 4YBZA 2QTAA 4GQIA 5HG0A 1D4FA 4BQQA 3T5PA 3HJAA 1L5YA 2A33A 3AF3A 4II3A 4B31A 2OO5C 5AI6A 2QP9X 4LHXA 2FEKA 1GFZA 4P58A 4HYYA 2FWBA 4DLUA 4EGSA 1U4OA 1IRIA 1PYOA 2ZAIA 1KEPA 6NULA 3JD4A 3IR5A 4R2JA 3IEIA 1YHZA 4OLJA 1Z5PA 4C7BA 5K01A 1JHVA 1E9EA 2G1UA 4PLTA 3D3JA 3WL8A 3W2FA 1GVNB 1MDFA 4CQMA 5TEWA 4BNGA 2WEKA 4IR7A 4JBHA 1FDIA 3HR7A 3RJMA 2NO1A 3A32A 4X65B 1SOAA 1SUIA 2QW0X 5AMXA 1E8NA 5FBRB 4HDAA 4B6QA 2C9CA 4NJEB 2CFRA 5K0JA 1YZHA 3AERB 3JQ7B 2R86A 3B85A 1QQ6A 3WLFA 4NL4H 5JZSA 4YMSA 2AEEA 1B0AA 4E4RA 3STHA 1GUAA 3HB1A 4ECAA 1EFRD 5BN4A 4YAEA 4IAOA 5KB3A 1DLIA 1F2UB 2O8EB 2WFZA 3KSZO 2WTBA 1G9TA 1HPLA 5IYZF 2VHYA 3U3OA 1EFUA 3ETDA 1HG0A 3H1TA 3L7YA 1N6HA 1E63A 3LPLA 4L7QA 2IPAB 3PHIA 4FS3A 4ZOQI 1JEOA 2VDVE 4B4WA 2RC6A 1YCFA 4D79A 2ZIZA 2OZLA 4HXEB 4FXOA 3TI7A 4MQ6A 4I1RA 2W4QA 1S1CA 2PT7A 3P20A 1XYVA 3RUEA 3TSYA 3HSYA 3JX9A 3H8VA 4XSVA 5K0SA 4RJKA 3GP3A 1QWSA 2DUJA 3DTVD 2AMYA 2BP7A 4HRAA 4IUBS 3E5HA 1EUCB 4CQLA 4G2NA 3GAMA 3V32A 4EUHA 2VZLA 1VECA 1WOYA 4KAXA 4WMLA 5BVGB 3IAUA 2B4AA 2XUFA 2QTNA 1X42A 3AFOA 4WLFA 1ZEJA 4EDHA 3S4YA 1GPLA 3RDPA 2IWRA 5CNKA 3NVDA 1YRHA 5TY0A 1C7ZA 1C9DB 2E85A 3RASA 3SEZA 4XDZA 1G7RA 5ISMA 5CCBA 1A9RA 3H2GA 1XT6A 1ONNA 1XE3A 1A2QA 1YZQA 1LNQA 1ZA1A 2YZMA 3KZMA 3QVJA 4MV9A 5BMVA 4KRXA 1CXZA 1RJ9B 1I0IA 4H3HB 3WA6A 4P82A 1NBME 1YGPA 2AN3A 1CR2A 3U3MA 1DRVA 3I9MA 3FTFA 3L06A 1NW6A 2BC9A 3BD9A 4IGFA 4IX9A 2HA3A 3GJQA 3LQFA 2W2OA 3GUVA 3OE7D 5CK5A 3TZKA 3ZZTA 1G2OA 2H5LA 3QNMA 1B8VA 2DFLA 5AJTA 5AJXA 3G1WA 1ZLYA 1LTKA 1G41A 3ANXA 3DQZA 4MVJD 1OA1A 3AKDA 3AI1A 3O83A 1GQFA 1J8MF 1OKKA 3A0RB 3EYWA 3GA7A 3CIFA 4GKBA 3ZWCA 3GN1A 5CFRA 1J00A 2PSHA 3GEPA 3KOYA 3PPXA 3WRXA 4XGNA 1RI1A 3AY3A 4Q3LA 4ZT2A 3EBLA 3G82C 4OQNA 4YJ2F 4D9NA 4ZDIA 4NE9A 4WKPA 5AM5A 5L3QA 3GO4A 2X9GA 1YBMA 3MRVA 2NUBA 2QDKA 2O3UA 4GZ3A 1Y8CA 3SS7X 3Q15C 3AOEA 3OSZA 4TS3A 4MR8B 4OHPA 5GZ3A 1B73A 1CY6A 2DSTA 3MINB 3NOVA 1N0IA 3QWIA 4I55B 3WLHA 5HZGA 1Z18A 2C3MA 5KVAA 1CJTC 2FMHA 1AS3A 3WGKA 1BHJA 2HIHA 4A10A 1P19A 2B99A 2XMRA 3LBIA 3NBAA 4H4DA 4YO7A 4YREA 5JS1A 1UQUA 5FTKA 1M7GA 2D4HA 2JGDA 5FIUA 2PUWA 2C3YA 3T99A 5IJ9A 2ZT8A 3VKUA 1DB3A 1TNDA 3WGYA 1U6KA 4EWLA 1GAEO 3QV2A 3EFBA 4Y1FA 2OENG 3ABSB 2MMGA 4GS5A 1QQ5A 1QE3A 2OOKA 2EEZA 3E2MA 4RTJA 1HFJA 1IPHA 1DCKA 1IOWA 1M1NB 5DMHA 3R9KA 4DCPA 3N8HA 4Z7NB 2P77A 2IDJA 2XGMA 4HQNA 3D54D 3HXPA 5EP2A 1UP4A 1R6XA 1Z2OX 3H1GA 2JA2A 2SCUB 4PLWA 3B3AA 4JLMA 1ZMBA 4ZHSA 4WLOA 4G63A 3QI2A 4JLJA 3UOGA 3PEEA 5AT1A 4ITVA 2LVBA 5A5DA 1S8FA 4YNBA 1AS0A 1QNLA 1U9YA 2ZJ4A 3CRRA 4RNDB 5JJBA 2ZFUA 3G0CA 2TMDA 5AJWA 1YZ3A 2HUPA 4KOEC 3VNBA 2O8VA 3AR5A 3DEIA 2Q99A 4MYDA 4ZXPA 2ZSFA 3WL4A 2GK7A 2HK6A 3BBLA 3BGOS 2QQFA 4BASA 1SUCA 3MA0A 4JVNA 1IK6A 3QFHA 4N4AA 4Q1EA 4TV8B 3ICQB 2NVUA 5HS6A 4N7MA 1ZMRA 2QY9A 2EC5A 2V8BA 3II6X 1KQNA 1UMCB 5CBPB 1T5SA 4B6GA 4HDKB 4ND4A 4BLVA 1ECCA 1Z88A 2X2FA 4NYIQ 1RSZA 2QRJA 3QXSA 5JSYA 4RC9A 4BNYA 2G0TA 1VCNA 5ABPA 3VXKA 5DH9A 2HDNB 1S7CA 3THXB 3MWDA 1Z73A 3HB7A 1A5TA 1FVXA 1G3QA 2EEPA 1P5RA 2Q28A 3NCHA 1WQ1R 3NRJA 4FONA 4MWEA 4WINA 4EYGA 2D7CA 1A9XB 3DOIA 1PR5A 3FFWA 3G8BA 4FFSA 4ER3A 4CF7A 1R0RE 2JD2A 3E0QA 4KI0A 4P3XA 1O8CA 2INGX 2V1XA 2WD9A 3D6TB 4UEQA 3ENQA 2FUG1 4UPDA 4ZEVA 1FSFA 3OPNA 4P0QB 3RLFA 2QLTA 1VFNA 3HJNA 4PLPA 1ZA2A 1XEXA 3L8YA 4RPIA 2VDJA 4LOKA 3EEFA 4PC3A 4ALNA 3VU9A 3ND5A 4RZQA 2UXDB 4JP8A 3HXLA 2CF6A 2V9CA 4DYHA 4C0SA 3B52X 4TRMA 3BK2A 3S99A 4KR7A 1FTNA 1TZJA 4OJKA 3EOBI 2LKCA 1N1EA 2CVHA 3QYAA 4KVFA 5IT9A 4DEYA 1T9HA 3CNBA 4MVYA 2ZUSA 4ND7A 3V3TA 5JJLA 2C4WA 2OESA 2XQVA 3OMXA 3B5JA 3UK0A 4I6GA 1PJ3A 5ESDA 4GF5A 8MHTA 4W5WA 4JFAA 3EF0A 2PL9A 3WJ2A 4HH0A 1OV4A 2O14A 4QWWA 2C94A 3C2QA 1A76A 1VCHA 3LYHA 3MRSA 1O9HA 4REQB 4PFKA 4ZAXA 3I9V6 3WGIA 1MAVA 5JADA 1C3JA 3G9ZA 5ELLA 3AHEA 4X3CA 1ZAYA 5JY1A 3RYCB 1XDWA 5LC1A 4B75A 1IQRA 1XPRA 2OBNA 2IOYA 3Q88A 1BW9B 1MH9A 4MJXA 3V8NA 3HBJA 1ZIYA 4MYRA 2FMTA 2Q6KA 2AEFA 1GCUA 5MGBA 2PSFA 4KO2S 5HS4A 5DSZA 1OHHD 1HDIA 4OYRA 1JHMA 1NP7A 1NJGA 1S3IA 3OZWA 4QUBA 5I45A 1E2GA 5A4JA 3K92A 4EEZA 4CM8A 3M6WA 4FGJA 3T7IA 2VQEB 2XVMA 1XRRA 4MUMA 3F5FA 3CNOA 3F8SA 4Q9HA 4M53A 3C1UA 3OPXA 4U5XA 1YZVA 3GD7A 1MABB 3AKCA 4DLPA 4RXMA 2FVXA 4QBIA 4QULA 4RZIA 3ZW8A 2NZ2A 1NDHA 3ZH2A 1PGPA 4JB0A 4NBKA 1NVUQ 4CIVA 4EI9A 1BVYF 3VR5A 3EEQA 5BSFA 1C1YA 1ZD3A 1ZM2A 2FPUA 2YXNA 4UPEA 4KLNA 1DG9A 2D0DA 4CU5A 2I34A 3FYUB 4N9WA 1CC1S 3H19A 5I01A 4CMGA 4OJTA 2DE0X 5AKKA 1QG4A 3X2FA 2FPPB 1EB8A 2ZYGA 3FFAA 2HPZA 4J7CA 1BXKA 2YBEA 4NATA 5DGDA 2WWGA 1SUWA 1JDVA 1WABA 2ESRA 4HEQA 4FP9A 2ZWAA 4ISCA 4HTFB 4JMPA 1R8XA 2XW6A 1PFUA 1Z5WA 1N1GA 2QGFA 4PPNA 4RAQA 1U0OC 3SE7A 3WGUA 5A0TA 2BLNA 1FYEA 2CDAA 4R9UC 2C8VA 1E2EA 1YASA 2JJ8A 3T3EA 3VM6A 1VG1A 2HSWA 3OOYA 2XD9A 1ONOA 3SM3A 4ESOA 4LXYA 2IS4A 3AUKA 4TVKA 2RHCA 4JA0A 4URHA 2FAXA 4IX1A 3V7UA 1QDUA 1P1CA 1Z5OA 4AZVA 4C4TA 1WXWA 3ROKA 4CMCA 4DRYA 3S8YA 1G8JA 1S89A 1I6KA 2HF7A 4QE3A 2WKQA 3QU4A 4B40A 4K46A 5K6AA 1A8QA 4G5OA 1NSTA 3CBQA 5FF9A 4AKSA 5DGHA 4IYRA 3ND6A 2OV3A 2YXDA 4ZJUA 1ADCA 1WEKA 2FRDA 4L0QA 3TS1A 1X7XB 2Q29A 3T5BA 5EJAA 5IX8A 2A5FA 1LKZA 2ZJAA 2IH5A 1KC1A 1R8SA 4H0CA 2Q3HA 1GSHA 2OB1A 3WIVA 2OCPA 3ADPA 1VJTA 3O2SB 4Q3DA 1G3UA 3RKRA 2HZBA 2AXPA 4EPXA 1QWOA 5F7XA 2IBTA 4TV9A 4D6YA 4D8VA 1Z33A 2Z2ZA 2KLBA 3GJ8A 2OL4A 5EE0A 3ISJA 5TEVA 3U3ZA 1LK0A 1XPUA 1NN5A 2FKAA 2P1RA 3GLRA 2FKNA 5HKBA 1H0RA 1ZO8A 1EUDB 3PRKE 1XNHA 1P1RA 4Q03A 3H8JA 1XRJA 2I1VB 1NAIA 1MA0A 3DTVB 5TNXA 5CAEA 2IC5A 3ID6C 4ZAYA 1K6EA 2ZM6B 4XLZA 4C6TA 4Q1VA 2F4VB 2F3SA 1GPWB 1ABEA 5TS2A 1EE2A 2P91A 3OQIA 4BQNA 1R6DA 2W2KB 5JXIA 1KDTA 3IEUA 4OU5A 1II8A 1FNMA 3VR2A 3EAQA 4MLDA 5KSOA 3ENNA 4FDLA 2CUNA 4IJ5A 2R68A 2ZBGA 4HBZA 5AW7A 3AETB 2FMKA 2V7EA 3ZV5A 3BMOB 4U6QA 4W9NA 5JNSA 1C9EA 2ZK7A 4GXTA 2PBZA 1OMOA 2B7LA 3M34A 1E1CA 1JI3A 2BDTA 2HNBA 3BXFA 3LP6A 3LQRA 3TNJA 3UJ8A 1RVV1 1GL3A 4YT2A 3IBTA 2AYZA 1NVKA 3H2BA 1VL1A 2PT6A 1WB4A 1EP3B 1VLMA 1GA6A 3Q7TA 4LNAA 4TKLA 4HCJA 3LPNA 2UVPB 2PKQO 3C87A 3AJ9A 5F64A 2ZULA 2CSXA 3NT4A 1V9LA 3GEEA 4HS9A 4HH3C 2RHHA 3SSNA 1D6JA 5AI4A 2FWNA 2H65A 3L8EA 1YR8A 3F71A 4WN9B 1CUAA 3QM1A 3WFZA 2NQ8A 3HCPA 2E4XA 3T5GA 3VKVA 2ZR7A 3QF4B 1U3FA 3P0IA 2W7TA 4R9SA 4R1OA 1Z4JA 3QKIA 4BNDB 4QPJC 4OFWA 1P1IA 1U7XA 1D4AA 4UHJA 3PCRB 3SFTA 4DCOA 2LUOA 2IPLA 1TA9A 3WGJA 1YHNA 1U1CA 4KZPA 4AROA 1T5DX 1CY8A 3VYVA 2CF5A 4DBLE 4GKJB 2I78A 5HW0A 2QGZA 4LCJA 4P8RA 5A5GA 3ESRA 1QMPA 3HHPA 4FYIA 4W8HA 1QQTA 2DWOA 4R69A 4M37A 1HFWA 4WDRA 4B45A 5I3CA 5IU6A 5LN1A 5KTYA 3H5LA 3PTAA 1P75A 3NPAA 2Q46A 4EW2A 4BB6A 1MOPA 4URYR 3U9SA 2HU8A 4EQ6B 2OXRA 4HXYA 2IEDA 1TM5E 4X61A 4HSEA 3IKMB 4IEEA 3DM9B 4PBRA 5K0TA 2FDRA 4MRVA 1E7MA 2CUKA 2PYZA 1DEKA 2CLIB 3ZE6A 4M8IA 4E5PA 3O95A 1I6LA 1KNQA 1CD5A 1PJSA 1V5EA 1YQEA 5CM2Z 4Y9UA 5AXDA 2CHUA 4WE3A 1CQZA 3HEBA 3JVEA 3ICCA 1CEQA 3H0EA 1KQFA 2RGNC 5E1MA 2OXCA 4OB6A 2WQ6A 3K9CA 4FNGA 4X71A 1GKUB 1RADA 2ZRQA 4R05A 3WWDA 1DQZA 5TQ0A 1S96A 4B0PA 3DZGA 2Z2JA 4IIJF 4WI1A 4D41A 4J6EA 4C9BA 3DBOB 4HQFA 2YFQA 3ACDA 1BH6A 5JY6A 1ILEA 1GPBA 3PFGA 5AM4A 3FCEA 5FA5A 3LY5A 3ZV3A 1HKUA 1QQBA 4C4PA 2XCQA 4C07A 1GTRA 1TQHA 1TX4B 1ZITA 2BMAA 4MROA 3RHFA 3LUCA 4W7IA 2BGNA 3HL4A 4HVTA 3WLNA 1PJQA 1VJGA 4KHPB 2I2XB 4NYJR 1CVRA 2IP1A 4ZV4A 4RH1A 4RMHA 1XPOA 3U3KA 2BFFA 2G28A 2Y1OA 5F7ZA 4ZZ1A 1Z4MA 3VZPA 1JEQB 1VYUA 1IUPA 1EINA 2IEGA 3GDHA 4PHTA 3SZMA 3D3WA 5F5XA 2DM6A 2AS0A 4CMEC 3NS7A 4PZYA 3Q2OA 5GOTA 5M7EA 3OKAA 3A2NA 4HGPA 3LS2A 4J03A 4K8OA 4B44A 2C1ZA 1KVRA 5EHXA 1GUFA 1B8OA 2MWMA 4NOMA 4YAFA 1AHPA 4XAQA 4Q00A 2P35A 2Z9BA 3I30X 5DRTA 1Z83A 1J7JA 4X6UA 2J46A 3R0JA 3TR0A 4D3ZA 3H8SA 4E2YA 1XNGA 3KQOA 4NI5A 4YRPA 1CDEA 4C2BA 4I4TF 3S2FA 1EQ2A 4CLOA 4MTLA 3LRPA 5HKKD 1GNSA 1Y98A 4WCFA 6Q21A 1KRWA 1B15A 4Y2QA 3WFJA 2E37A 1EGQA 4X1IB 4B47A 1B8NA 1VYVA 4DSUA 2WU8A 2BMJA 2CDRA 1FU8A 4UTRA 1DJMA 5K3OA 4K9DA 5ED0A 1W48A 5IULC 2WBLC 1J2JA 1TKRA 2FG7C 1QUEA 2CD9A 4FE3A 4B3XA 2PA3A 1J0EA 1WWKA 2XMQA 2OTCA 3EAFA 4HDSB 4LEIA 1XZ8A 3O8OA 4Q7QA 4MVJI 1WXEA 4XWGA 1A8UA 1SPBS 3OZCA 1PFYA 4LJAA 1JHZA 3LX4A 4C4XA 1QDLB 1XZGA 5HKAA 2DQZA 5LNK1 5E38A 1JIQA 1PGNA 1OWMA 4GMFA 2R6R1 1V16B 4C7KA 1ONBA 2QAGA 3BM5A 4OXIA 4ZP1A 3KOXA 3AP3A 1BAPA 3OQOA 1N57A 4UUAA 1ZQ1A 1H2AS 1YR9A 3RBXA 5FWXB 1E62A 3HRIA 5DWDA 3T7DA 2MYTA 5BNIA 1J23A 4PC1A 5LLSA 2VH2A 1SHLA 3MNFA 5EPUA 3RVOA 2JD0A 2W90A 1FVOA 4TRJA 2I55A 2Q1UA 4TYMA 1XA3A 1NI4B 1NE7A 3RBVA 4MVJM 2XYGA 1C0KA 4EI2A 2QJTA 3GLIA 1LVUA 2Q49A 5DYWA 2YJZA 3IV6A 5TVGA 3TRFA 4F2HA 1U3TA 3G2OA 3GFQA 3C3DA 2GYVA 4J0QA 3UENA 5K3EA 3UMMA 2VSOA 3FUVA 2JK0A 2RB5A 3Q6IA 4KQCA 4QAQA 5B1YA 4OHBA 3LBNA 1Z62A 2C59A 2L19A 5EP3A 1H42A 4TXJA 3U4AA 5JISA 3DEAA 5FBLB 1OAAA 1XMSA 5EUBA 4POAA 3B6JA 3ZIAA 3S1SA 4EHDA 4NONA 1W1IA 4XJTA 5C37A 1K5PA 5BQFA 4JD5A 3JD3A 3WNDA 4J9UE 5KWJA 4RPCA 4V3BA 3OKFA 2BKAA 3IT3A 4GXNA 5HMMA 3ODGA 4FLEA 1RQ2A 3IDFA 2OKCA 4UAGA 2PS9A 4H6WA 2PKRA 3KEOA 1TMGE 3B1YA 5TRTA 3VBEA 4UJ3A 1QYWA 1B1AA 1MO4A 3VVBA 3ROQA 1U0BB 2I9KA 3I3OA 3NHFA 4CQMD 3P26A 4ZAGA 4MGZR 1QS0B 1R8QA 3FGNA 2AGVA 4DKJA 3WQQA 3QMWA 4HHEA 4DR1B 2XUJA 2ZU6A 4NBVA 1FNCA 1PR0A 2EFCB 2I0FA 2RJ3A 1CIVA 2E18A 4BFTA 1ZQ9A 1F4LA 2M6SA 1SKQA 2REXB 2WLSA 1AK2A 5BVHA 3VHQA 4RQBA 4WN3A 4URUR 3PIIA 2FWPA 1SULA 3AEKA 3C97A 2GD1O 4FMCB 5DP2A 4MMZB 1MNAA 1JLSA 1UUFA 4NENB 4FYPA 4EKGA 5ITZA 5DISB 5D2CA 1G4HA 4GOND 1UMBB 1UAGA 1ZZGA 3S44A 3WADA 1HTTA 2IYAA 4X91A 3RSLA 2CNNA 3WIOA 1BDHA 4YK7A 4IJKA 4WKCA 1US8B 2Q3EA 2ZRJA 4J1SA 4MRRA 3K8OE 3IEMA 5JRJA 2ZXUA 1V39A 1VJDA 1ZW6A 2XGOA 1GNVA 3IAHA 4AD8A 1FYXA 3BH6A 4BGEA 3P9PA 4JQZA 1ZRSA 2QU8A 2ZE6A 4HUTA 4DTCA 1IXKA 1QZZA 5ALZA 1Q0SA 4GRIA 1FFWA 4J91A 3RS0A 2O2SA 3QFCA 3ZHUA 4CODB 5E9QA 1GG8A 1ZXLA 1RLUA 1HSZA 2JZCA 3JQAA 4NCBA 2XTZA 2C5FA 2F62A 3IKTA 3VZSA 1GPAA 2C29D 4BMVA 4KO8A 1NNSA 2FFRA 4ND5A 4OQPA 5H3HA 4YRLA 2FSHA 1T36B 2ATXA 2CJXA 3CF6R 1M8PA 2A1UB 1E99A 4D26A 1I2ZA 3GBSA 3RWBA 1RD4A 5CDFE 3JASB 4UVDA 3SX0A 3RJ9A 4Y0NA 1G21A 3ZW9A 2G9RA 4LZPA 1T4DA 2CV2A 1U99A 3EUWA 1CQJB 1KAMA 2VH1A 1T6XA 3THOA 2H92A 4ZI7F 1DS6A 1L5FA 4Z0PA 5A9SB 5DTJA 2GKOA 5EMHA 3PXDA 4GZLA 4LCEA 4DMRA 16PKA 1F9EA 4ALLA 4X3OA 4BAZA 1ZDMA 1RFLA 2IEBA 3NVAA 4JKIA 1KC3A 2HU7A 4RGVA 4XIGS 3T7AA 1TCBA 1RNLA 4J4TA 3VPBA 4F5YA 4WNAA 1OKKD 3GZ4A 1CP3A 3PNLA 2RONA 5JZOA 3GFOA 1BDJA 2AE1A 1WE2A 2PKWA 5L4SA 1QRAA 3LY9A 3HH8A 1NMSA 4N7BA 1OFUA 1J25A 2FWRA 3HDTA 3NCTA 2XYRA 1F8FA 3KSRA 4AG3A 1AKWA 5C35A 3EGDA 2WTMA 5B4TA 1FK8A 3A1EA 3UAZA 4BO5A 3QU9A 4WGFA 5B6PA 3L18A 2ARKA 3ML1A 4KR2A 1QG6A 1JEYB 2DXIA 2P6OA 1I5OA 4LA4A 1K8XB 3WG9A 4EX7A 4CXMA 3P9CA 2W22A 3QUTA 4F5EA 4K9SA 5EWMB 4QM7A 4ZODA 2DCUA 2MOKA 2CHEA 3FSGD 2HGZA 3K0KA 5CLHA 4KXYA 5BR7A 3CCCA 1R7RA 4DJAA 2Q6VA 3AGPA 5ALIA 3LC7O 3W2HA 1EWRA 4TZ0A 3K05A 5EIEA 1ZH0A 2WLTA 2JZNA 4AJOA 1IBLB 4D82A 1IULA 3ECCA 3S40A 2VXCA 3ITKA 1L4HA 4P35A 4K1LA 1EDBA 3VSAA 2B8NA 3L0YA 1RYHA 4RY0A 4AS1A 3KPVA 2GH1A 3CMCO 1S8AA 1RQLA 4ER7A 3OHPA 3QEBZ 3EGXA 3F5SA 2VYVD 3MWJA 3MJDA 1UBLS 4KE8A 4BNFA 1L7RA 2CXTA 3A6LA 4TYNA 4ILKA 5KYUA 1Z4LA 4P6VF 2FFBA 2PX5A 4P7FA 3RHSA 2DF8A 2VNHA 3L6RA 4HLNA 4Q66C 1UK6A 4Z1MA 3UAXA 4XWKA 1XVUA 2ZSUA 2FV8A 1AQNA 1TW3A 1TF5A 1XMOB 5EXPA 2HRCA 4YQEA 3MQFA 1DEAA 1T0PA 1EX1A 2AFIA 1GG9A 2JAHA 3DQQA 3V7FA 3WKCA 4G1UC 1K27A 1XTPA 3HKDB 3WGZA 3BMNB 4V1CI 3DA8A 4RHTA 5CT8A 4ZPJA 3NHMA 3SCZA 3OX4A 13PKA 2HA4A 3HVIA 3EPHA 3AEUB 1JSLA 1QUFA 2BLLA 2WT8A 4DSZA 3H5WA 2ZBQA 5SY9A 2OXTA 1OLSB 2WAAA 1CZUA 3E53A 1GSIA 2E7ZA 3BZUA 5DXAA 1I2BA 2V58A 3RU7A 1FE8A 3WHIA 1ZHFA 1RPAA 1Z0JA 2QW8A 3G0IA 4XDHA 1OLXA 3C6XA 3TXYA 5LLTA 2BF7A 2J0UA 2F3TA 3HDHA 4CKBB 2OQRA 1XWWA 4IJVA 1PSZA 1HQKA 1ML3A 4N5IX 3PUKA 3V1TC 1JWLA 4I1PA 2IP4A 2LWIA 2BL4A 4K6CA 1GAJA 1COWA 4MIEA 1QO7A 1Z15A 2PUAA 3N70A 3Q87B 2Y9PB 1E5XA 1C30A 3EXHC 4HY3A 5HF5A 1KR5A 5KNLA 2WD7B 2ZPUA 3B20A 3AUTA 4XUEA 2JLQA 1T9GR 5EGNA 2E55A 1IOVA 1CUJA 3LF1A 4G1EB 4LE0A 2VAXA 4WZ6A 1Z28A 4ACAA 4AY5A 4BX3A 3GRZA 3H7AA 2YMLA 3G9UA 4FIZA 4JLWA 4KSYA 2ORIA 4KXMA 1V5FA 1Y6QA 3EGIA 3PE6A 1VMAA 4G1VA 4R83A 1AQUA 2IBSA 2OQVA 2VL7A 2JJ2A 3HR8A 4A2QA 3L6DA 4G2TA 1G291 1M2OB 5G41A 3QTTA 1KO5A 4FMCF 2F8SA 4FINA 1BS9A 1CUZA 2V6IA 4MYUA 1T0JB 3DBHB 2P4EA 3E3OA 4KDRA 1NVTA 4YRJA 1XKQA 2GMWA 1GHTA 3NBQA 1U0GA 3ZXXA 2P2ZA 1V7ZA 4RPHA 4NYMR 4Z2YA 3K9LA 2H18A 3R7AA 5A6SA 2X2OA 3PQ5A 4M0EA 4JKYA 3D1VA 1JGTA 5K05A 4AJEA 2PU5A 1IU9A 1T2DA 5U9CA 2EJCA 5DCYA 5G4KB 3FHLA 1KKLA 2C9ZA 1N5LA 3BEDA 3CPJB 2XBLA 3CV3A 3FA2A 4R1MA 5D3MB 3UAVA 2DERA 5I9NA 4LGVA 5ILQA 3ZQ4A 4CM9A 4DWWA 4BEWA 3K09C 5DHUA 1WW2A 5CVJA 3WLPA 4OQQA 4YH1A 3O4JA 4BHTA 5FNVB 3MIIA 4F4UA 1Y9EA 1X6VA 5BN3B 4OK3A 2HXYA 2VQSA 5A4AA 4YO8A 1SXQA 4OI0A 2ZJYA 3G0HA 2ZBPA 3OPYA 4Z0HO 1OH8A 1NT4A 2BFCA 3WDKA 4W8OA 5KO2A 1CVIA 4JUCA 4MWOA 1P0PA 1V11B 4Z9FA 1ZNYA 4HSGA 4F4IA 5CT9A 5D7NA 6REQA 3IMGA 1DAFA 1SZDA 1YK0A 1BQEA 4XZ3A 2XWBF 1HDGO 4D5GA 5LU8A 4DR3B 2VAWA 2QORA 1MQ8B 3O7WA 4BUZA 1M9NA 3QF7A 2QV7A 4LVOA 5ALPA 3VFDA 4KR9A 4DBLC 5AJVB 4MUYA 2PUBA 2ZYAA 5CDTA 3BQ9A 4QODA 1CDOA 2P79A 3KOUA 1JMKC 4FC7A 2XCRB 1W93A 2WSIA 3A6DA 1USVA 3CHYA 3P2MA 4JC8A 3VR5D 3WWZA 2GRAA 2YQZA 1UOEA 4RW0A 3USZA 4PNZA 4LZJA 1ZK3A 4JQYA 5HOQA 1NW8A 4S1VA 3GI1A 4YRDA 1G5QA 4V0ME 2MIIA 3T4PA 4YT8A 4JJAA 1PSWA 1PX0A 3WMGA 4QYIB 3ICWA 1ULHA 4MDEA 1HEYA 4NAHA 3MMSA 3TOVA 4D9MA 5IT5A 1B00A 1C14A 2RC5A 4C7MA 4RLHA 2WFLA 3UAOA 3HXMA 5K3BA 2GZSA 1PEDA 5DZSA 1UKAA 3WB9A 2DFKB 1JJFA 3N75A 3BWYA 5IBQA 4ZHQF 3NIDB 2PX4A 4KFRA 1K4KA 3NBKA 5L95A 3L8FA 4CQMB 4HAVA 4I3FA 2CSUA 2C5GA 5EPOA 1KHTA 4B2LA 3HJFA 5AJHA 1ZICA 2JDIA 1S7GA 2QUZA 4TKZA 1MX9A 4N54A 5DM4A 5EZYF 4YMTA 5JZ9A 5KYXA 3I92A 3QWFA 1OFGA 4I3GA 1IXSB 2I8LA 3L6OO 4I9HA 4QUGA 2V6BA 4QDOA 4W1SA 3DSRA 3KAJA 1LPMA 4RABA 2BMVA 4LXXA 1RWOA 3CRW1 5C46F 1KI2A 2PQMA 2XHZA 4DHEA 1TXGA 3G2NA 4O2BF 5BN4B 2RFLA 3PHBE 3RE1A 1OWLA 1SEPA 2HXSA 3A26A 3AEZA 2XUGA 3BPSA 4YN3A 1PTJA 3EIHA 5CT4A 5MDHA 4FYVA 3R09A 4HEJA 2R9VA 2BM9A 4EJ2A 1U0FA 1SURA 1XHLA 3KAKA 5AKHA 5IXJA 2FX5A 3A04A 3QP9A 5LJLA 1TA4A 3HJCA 3CUVA 4W63A 4H1TA 5GV7A 1QYRA 2OZLB 1RHUA 2V55B 3EZ9A 2PLWA 3L4BC 3RKUA 4P5PA 4B84A 4CM1A 1HRKA 2DUWA 4OBWA 3PXEA 5JVDA 4J0KA 1UQTA 3RQIA 4JSYA 4YCSA 3DLIA 2TSYB 3U49A 4K2HA 2JFZA 1AK9A 2IIPA 4CM7A 2H1HA 3PGJA 1ZNQO 1VPWA 5D51S 4CQLB 1IHYA 1P3Y1 3B3GA 1L4YA 2XT9A 5A71A 4RY8A 2H16A 1MAHA 4OGWA 2GJKA 2YYSA 3S28A 3TLZA 4TL7A 2H48A 4NK5A 3MJCA 1ANKA 4D3YA 2QPTA 4TWBA 3ZZNA 3RODA 4JB8A 4DAOA 3VR2D 1LPAB 2ZTMA 3SJ7A 4F21A 1NMYA 2VLBA 4Y7CA 3E8SA 1D4OA 1Q22A 1Z26A 3I04A 2QQ5A 2AK3A 1M0EA 2FRXA 1TM3E 3D7LA