3OIGA

Crystal structure of enoyl-acp reductases i (fabi) from b. subtilis (complex with nad and inh)
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
260
structure length
260
Chain Sequence
MNFSLEGRNIVVMGVANKRSIAWGIARSLHEAGARLIFTYAGERLEKSVHELAGTLDRNDSIILPCDVTNDAEIETCFASIKEQVGVIHGIAHCIAFANKEELVGEYLNTNRDGFLLAHNISSYSLTAVVKAARPMMTEGGSIVTLTYLGGELVMPNYNVMGVAKASLDASVKYLAADLGKENIRVNSISAGPIRTLSAKGISDFNSILKDIEERAPLRRTTTPEEVGDTAAFLFSDMSRGITGENLHVDSGFHITARLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Enoyl-[acyl-carrier-protein] reductase [NADH]
publication title Crystal Structures of Enoyl-ACP Reductases I (FabI) and III (FabL) from B. subtilis
pubmed doi rcsb
source organism Bacillus subtilis
total genus 93
structure length 260
sequence length 260
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2010-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3oigA00
1GFSA 3GDFA 2HKIA 4WCFB 3ZWOA 4LVCA 1ZK4A 5TRTA 5JE8A 4D41A 4IDGA 1DAPA 4J6FA 3DTTA 5EJ2A 3RAJA 4YDRA 4O0LA 1UXJA 5CDYA 3GVCA 3DONA 2FWMX 2WD7B 1JWBB 1UZLA 2D2IA 3KEQA 3PK0A 3WGGA 2G17A 2C82A 4L74A 1LSOA 4JJGA 5GMOA 3A1NA 3WR5A 3ADOA 1B3BA 3WSVA 3PGXA 3HB4X 4BNXA 4WCFA 1I24A 4AJKA 4PN3A 5CPBA 3OJLA 1ZK0A 3QA9A 1EZ4A 1GCUA 1KC3A 2NLOA 3AUUA 4CMEC 1N5DA 1QV6A 1U8FO 2WD7A 3HHPA 1OOEA 3H5RA 7MDHA 4RDHA 5G0SA 1XEAA 3RASA 1FXSA 1DRUA 3MOIA 4J43A 4ZVVA 1VJ0A 4BGEA 4B7CA 1ZFNA 4CMHA 4PZEA 3L6EA 5JC8A 4GGPA 3DBLB 3L77A 5AXAA 4E4YA 2A9FA 5L9AA 1C0PA 3Q0EA 4YQZA 3AWDA 1X15A 3FTNA 4N7RA 1T4BA 1PGNA 1HDRA 1XQ1A 4TVOA 4BMVA 2VWPA 1E1LA 1O89A 3KRTA 1JN0A 2QRLA 2RH8A 4CQMB 2I9PA 1DBVO 4XYBA 1H93A 3WLFA 4Q3EA 3EDMA 3DZIA 1I10A 4Q3BA 3DBLA 3OSUA 3WGIA 4FFRA 1Y5MA 3VPSA 3FSRA 2P9EA 3PDJA 4L75A 1PJBA 2E6UX 2B5VA 2YDYA 3Q9NA 1I3NA 4OOEA 4BL5A 3I6QA 4WKGA 1PL6A 2E82A 4W9NC 1B8UA 4ALJA 5DBFA 1XQ6A 5A3JA 5B4UA 1DC6A 2BLLA 2V6FA 3D4NA 3S8MA 2AEJA 4XIJA 4CQMA 3KYBA 3GNSA 4ALIA 4DPKA 5JY6A 2VWQA 2Z1MA 3H9JA 3JQBA 1VL0A 2E37A 1HDGO 1GQQA 3SEFA 3RVDA 2GRAA 4AJPA 2DFDA 1E3LA 3HFSA 1LLCA 4PRLA 4EEZA 2AE1A 4BOYA 1JA9A 1QV7A 2FSSA 4J1QA 4B3JA 3GEGA 4YAKA 5HS4A 2PKRA 2CDAA 1P45A 9LDBA 4W7HA 1GAEO 1LJ8A 1NXQA 3NT5A 2PH3A 3WGTA 3ASVA 3PRJA 1XWFA 3PJFA 3RCBA 2WM3A 3ZI0A 2AQ8A 4Y8VA 3VZPA 4XGKA 3VZRA 5FF9A 1BRMA 2X5JO 1N7HA 2B4QA 3P2OA 4FIZA 1ML3A 4ALKA 3A9WA 3PI7A 1VL8A 3PHIA 4D3FA 4J7UA 3WMWA 5L95A 1KYQA 2Q1TA 3HSKA 1MGOA 1R15A 4WUVA 3ETGA 1GPJA 2OFPA 1R0LA 2XF8A 1GL3A 4YCAA 4R5MA 1H5QA 4TZKA 4GX5A 1ISFA 2Q50A 3WYCA 1N8KA 1HRDA 1DIRA 2B36A 2EGHA 4ZN6A 1G0OA 4R1SA 1OC2A 1QMGA 1LRJA 4TROA 1W8DA 1HE5A 3ASUA 1H94A 4W7IA 1KEUA 2NU8A 1UP7A 1SPXA 4I5GA 3LT0A 3RROA 4IIUA 4CV2A 4TVBA 4RF4A 2FR0A 2GUGA 4HFJA 3AW9A 3D5TA 2ILTA 4JCOA 4DQXA 3BHJA 1F14A 2H6EA 4FJ0A 1T2FA 2EW2A 1EEHA 5GZ6A 3DFUA 3ZN2A 2X6TA 1ZH8A 4D0SA 3ENNA 4CM9D 3PWSA 3VTFA 4DQUA 1ZMOA 3KSDO 3IC5A 2PKQP 1YB1A 2DKNA 4DRYA 1SOVA 3PPIA 2VHZA 3ABIA 4MIEA 4J9UE 1DOHA 5JXWA 3GC6A 2PD3A 4INAA 3TOXA 3KHUA 1PJSA 3E9NA 4B3IA 5C37A 3DZKA 5TT0A 1P74A 4BNNA 1BXGB 3OECA 5AYVA 5IDXA 4BNIA 3LT4A 3C7DB 1NYTA 1BGVA 2GZ1A 3ZWVA 4Q3AA 3IMFA 2E4AA 2DPGA 3IJPA 2OO5A 2I6TA 4MP6A 3WFIA 4NBUA 4AJNA 5KIAA 3CH6A 4FGSA 4NDNE 1OAAA 1PL7A 2EIHA 4PVCA 4CMCA 4E13A 3JYLA 1BXGA 4BNYA 3DMTC 2EGGA 3DXFA 1JU9A 3OEYA 5IJZA 2AMFA 3BIOA 5CHEA 4PLGA 3JQCA 4AJ2A 4XRGA 3RFTA 2IZZA 5KJCA 1LNQA 3PHGA 2NVWA 2Y1EA 4QUKA 3G49A 1VJ1A 4KUGA 3ICCA 3DQPA 3TNLA 3SJ7A 4P4NA 1WWKA 3UGKA 3JQAB 4BO7A 3WQSB 3ZU3A 2HJRA 3VZSA 4A73A 3B70A 5DOZA 2D5CA 4MVJE 4Z0PA 5LDGA 1HZJA 2GN8A 1DO8A 1Q7GA 5KKCA 4RPHA 2BFMA 1D3AA 1NNUA 2Q2WA 1JKFA 1GYRA 5CAEA 1YE3A 3LLSA 3EAGA 4JBGA 5DULA 5FI3A 1HETA 1IZ0A 3OJ0A 3VH1A 4TRRA 3NV9A 4W99A 2O4UX 1S6YA 4CLDA 4RVUA 1WNTA 3JQAA 3JD1A 2FP4A 3E8XA 3I9LA 3M2TA 1Q0LA 1U5CA 3E9MA 3WJ7A 2QYSA 3OA0A 3PZRA 3ENKA 4F6CA 1EUZA 2EJVA 2PTGA 3JD4A 1U7HA 4BO8A 4WOKA 4MVJF 5COBA 3N7UA 4ZJUA 1Q7BA 3L4SO 4B4UA 1HDXA 3CINA 4H15A 4QEDA 3C8MA 3E03A 4OL9A 1HDOA 4ALLA 5KKAA 2GDZA 4FJ1A 5G0WA 1QYDA 1WLYA 5AOVA 4CMEA 2W2LD 3V1TC 4ZHSA 5KTKA 1KEWA 4RO0A 3FNFA 3ITKA 1O6ZA 2OZPA 4NU5A 3AK4A 4BO2A 4F3YA 4YJFB 5ICSA 3DBRB 4XDZA 2Q1SA 1AN9A 3GQVA 2EWMA 4GVLA 5HM8A 1MFZA 2Q99A 4CLXA 3DL2A 3SLKA 4DLBA 5EPOA 3PVZA 3TOZA 4FFMA 4EYEA 4RDIA 1PJTA 2CFCA 3I9OA 1ONPA 2ZYGA 3D64A 3AU9A 2HLPA 1P33A 3RC1A 1PSDA 4Y6PA 3V2GA 4YT8A 2J3HA 1M66A 1MLDA 1SNYA 2D1YA 4FS3A 3V1YA 4YJFA 3DBRA 4DMLA 1YL7A 2BI8A 4UUMA 1JKIA 3F4LA 3TN7A 3Q1LA 3EMKA 2Y67A 2OGUA 3FR7A 1JVSA 4WE3A 2OP0A 1HE4A 3GEDA 5TLSA 3VC7A 3PXXA 3ZU2A 1WAMA 3HB5X 1DC3A 4WCDA 3W8EA 2HK9A 2VZ8A 1RYEA 1GZ3A 4NFYA 4D79A 1R16A 2B69A 1A4UA 4PLFA 5A03A 5IFLA 4CM1A 3V2HA 4R3NA 3WMXA 4CUJA 2VCYA 2ZB7A 3SXPA 1PS9A 1SB8A 4GI2A 1I01A 1X0XA 2O3TA 3LQFA 4ID9A 1GR0A 4ILKA 5KWEA 1GYPA 5THQA 3ROKA 3DZBA 3ZH2A 3CMCO 3RUIA 1YJ8A 1IE3A 1MC5A 4BB5A 1ISIA 1ZK1A 1A27A 4PLWA 4RVSA 3HQ4O 2NTJA 3MOGA 4BUCA 1E3EA 3LC1O 2HRZA 5IN4A 2CNBA 3WGZA 2DFVA 3RUAA 3KBOA 4WGGA 1B26A 3QE3A 2R2GA 1HZZA 1NR7A 2VRCA 3ANMA 2X58A 3I23A 4Q3DA 5A02A 4CODB 1SEVA 2D5AA 2NVBA 3PYXA 1F12A 2A35A 3WGOA 4BNZA 4DBZA 4E21A 4C7JA 1QSGA 1I36A 1Q1NA 4R1TA 4LK3A 1KOLA 5CDSA 3A14A 3CMMA 3JYNA 3WOHA 5DOVA 3T7EA 2FPGA 1QYVA 4JBIA 5TSDA 2R00A 3FBTA 1RM0A 3CEAA 4L0QA 3ZV3A 1HXHA 1NPYA 1ULUA 4FR5A 3GG9A 5KJ6A 2W2KB 4RQUA 4QFCA 1HKUA 2C20A 4U7WA 2VUUA 2YW9A 4YT5A 5ENVA 2JL1A 4OXNA 3HFGA 1NQOA 2PR2A 2HK8A 4JX8A 1CEQA 1DLJA 2B4RO 3RKRA 1KERA 4RLHA 4Y9DA 4JBHA 4QSMA 4RVHA 4EEXA 3TZQA 4G2NA 3DHNA 4JIGA 3LZ6A 1SMKA 1E6UA 4PLHA 4CR8A 2HAEA 1TA4A 1C3VA 3UCXA 2W2KA 3A4VA 1E1NA 1VSUA 1UUFA 1GCOA 4Q3NA 4LGVA 5K9ZA 3ZWBA 3RKUA 3COSA 2G0TA 5GZ3A 4Y67A 1ZXLA 1XG5A 2AW5A 1H6AA 1NP3A 2PLAA 3JV7A 3ZHXA 3RBVA 3C1AA 1ZNQO 2BRUA 3AM3A 3H9GA 5T5QA 1PWXA 3S2EA 1NAIA 1UAGA 4CMJA 1D8AA 2LDBA 4TSKA 1ADBA 3GUCA 3GFBA 2C29D 4FCCA 4RZHA 1XGKA 4JNKA 2IZ1A 2GCGA 3FI9A 5T8KC 4ALMA 5HA5A 1K6IA 3GFGA 4WJZA 1PGJA 3A06A 4KDFA 1MXFA 2JHFA 4OJNA 1N2SA 2VNAA 3I1JA 1IPEA 3PJDA 3U49A 5K6AC 1MA0A 1T4DA 1UJMA 2QYTA 4HP8A 5TS3A 2JJYA 3TJRA 5AXDA 3WNQA 5A9RA 5A5EA 5KVVA 1KVSA 1V6AA 3P7MA 3PHHA 3Q9UA 4FBGA 2QIOA 1CWUA 2EV9A 3F47A 3FR8A 4M86A 2BELA 2PGDA 1ISHA 4E5PA 2G76A 4B7XA 5DCUA 2ZJ0A 4HV4A 5L4NA 1H2HA 4IJVA 2A94A 1T25A 4WLNA 2DC1A 3GN1A 4IQ8A 4J90A 1G0NA 2X23A 3DMTA 4NFHA 2PZJA 3C1OA 1E3IA 4E2YA 3NX4A 1EE9A 5IF3A 3UXYA 4W82A 1Y6JA 1UXGA 1UZMA 2P9CA 2QW8A 2H9IA 3R0IA 4B4OA 3BMCB 1QORA 2HJSA 1IY8A 2Q3EA 4A03A 3KSZO 5I7VA 3MCVA 1ULSA 2AXQA 3NGXA 5TNXA 1R0SA 3WBFA 4IDAA 4JGBA 4ITUA 3DAPA 5F1PA 2DTXA 3JD2A 1V3TA 1NWHA 3TZCA 3OQ1A 2IYPA 4J0FA 1LC3A 1KIFA 2IZ0A 3NDJA 3WGYA 3C7AA 2WD8A 3GOHA 1ORRA 1ENPA 2NACA 3U0BA 1MG0A 1GTMA 2YHIB 1V9LA 1E7WA 3BMCA 3FNGA 1E7QA 1IYZA 3RU9A 4R3WA 1XSEA 5B4VA 2QRKA 2WEKA 4QO7A 1ID1A 4GKBA 1G1AA 1ZZEA 3OFSA 3AJRA 1HDZA 4E0BA 3U5TA 5CDUA 2IDZA 2A92A 4XEHA 3FN4A 1LI4A 3S55A 2X0JA 3ZCXA 3RC7A 5F5LA 3STHA 1FJHA 2JAPA 2YHIA 4WK6A 5F3RA 4AJHA 3ZWMA 4GX2A 5BQFA 1FF9A 2J8ZA 3LC2O 2CMDA 3UKOA 1O0SA 1GADO 1PIWA 4KP7A 4AJJA 1DIGA 3LT2A 3JQ6A 5TJ9A 4CM3A 2CSUA 3PYMA 4UREA 5KJFA 2F1KA 4OHUA 3H6KA 3JQ9C 4E33A 4CV3A 1KVQA 1WZEA 5JDCA 1D4FA 2BMAA 2O48X 1PZHA 3G3EA 2UUOA 5DF1A 3C3XA 2FR1A 3HDYA 3NT4A 3WG9A 3RC2A 1HTBA 2FOIA 4PG6A 3WSWA 4D0RA 2P4HX 2DBZA 2P91A 1MUUA 1ZBQA 4H3VA 1LLUA 4RPLA 1EVZA 3BHMA 4I5FA 3GVHA 3O26A 4ND5A 2WYVA 3E9QA 3VAZA 1AUPA 3D1LA 1BXKA 3EGOA 3UCEA 2GD1O 4RF3A 1ZKMA 3DZFA 4GVXA 5TIIA 4YBZA 1EVIA 4PLZA 1RPNA 1UR5A 1CERA 5TJHA 2X9GA 4ZQGA 2GR9A 4GKVA 2JAHA 2UDPA 5JO0A 3H9UA 1AHHA 2BH9A 4M1QA 1UDCA 3T4XA 4U5QA 5CFZA 3GY0A 3OJEA 4GWKA 4RF2A 1PS0A 2GZ2A 2WTBA 1B16A 3ONDA 5ES3A 3DOOA 4L76A 3KEOA 3TFOA 2FR8A 3I4CA 1QR6A 1A9YA 1RJWA 2QQ5A 3EVTA 3P19A 1E3SA 1QG6A 4GMGA 4XR4A 1UH5A 4FW8A 2X7HA 1J4AA 1Z6ZA 2C7VA 4LN1A 4RVGA 1VL6A 4N18A 1YWGO 4ZQEA 3CIFA 5A1TA 3NTRA 2D4AA 3K8ZA 2O50A 2FZEA 1ARZA 4NBRA 1B14A 1P3DA 4OO3A 2ZCUA 3MTGA 1JAXA 2ZQYA 1YL6A 4DQVA 3ZW8A 4NFSA 4DLLA 1IOLA 5JAMA 5JAQA 1K2WA 3NDRA 4IS3A 4XR9A 1C1XB 3GGPA 4BV8A 1PL8A 2RH4A 2O7QA 4JXKA 3ZNOA 4BKOA 2VHYA 3RIHA 4YAJA 4RCVA 1PGPA 3DWFA 2YZ7A 3NAQA 1X7HA 5GY7A 2R6JA 1U2DA 3I6IA 4R9RA 2VHVA 3KZVA 4FOOA 5ILOA 2YQ4A 4PGFA 2OP1A 3B1FA 4TRJA 3JYPA 2Y93A 3AUTA 3RSHA 3L07A 3ZWXA 4FC7A 1YQDA 2VYVA 1KC1A 1C1XA 4M8SA 4CL3A 3TDKA 1DIAA 4CLHA 3JYQA 3NRCA 1M2WA 2FPIA 1C0KA 3GPDG 4Y6RA 3SX2A 5JBIA 3Q2IA 3OQ6A 4P38A 1XELA 3VVBA 1Q2XA 4YRDA 5FEUA 4DMMA 4LVUA 2ZB4A 4CM8B 5JNLA 4I9UA 5C5IA 4MVJD 3DMYA 1DJQA 3FWZA 3U9LA 3M1LA 4E5YA 3R3JA 2DU8A 1E7YA 3AFNA 1A7KA 1QYCA 1WDLA 3TL2A 1Z82A 1Y81A 3IUSA 1N9GB 1RKXA 1K6XA 2X0IA 3EZYA 3R3SA 3L6OO 4CM8A 3F5QA 2GZ3A 4ALNA 2V6BA 1BTOA 1XA0A 4II2A 4BNTA 3DAGA 4UUPA 4DVJA 2FY8A 2C59A 1HT0A 4DWVA 3L9XA 1NVGA 4I8XA 5G0TA 2VNSA 4WLFA 5JCJA 4CR7A 2YFHA 4IDFA 1ZSYA 1BG6A 4J0EA 1U9JA 3AY3A 1DRVA 1N9GA 1KETA 2YV1A 1XR3A 2GSDA 3NGLA 1ENYA 1AGNA 3H8VA 4I9NA 2DUWA 2JCYA 4XCVA 3DHYA 5L45A 4E31A 2AE2A 2X1HA 1A4IA 2YQ5A 3VKUA 3E48A 3NKLA 3V8BA 3AI2A 1TT5B 1ISMA 3ZWYA 5JSFA 5FYDA 2X22A 3PIDA 4UVDA 3OBBA 1YVEI 4J1SA 2NQTA 3QVTA 5A9SB 4IMPA 2WMDA 1JWAB 2JFGA 4EW6A 3IAHA 4UVGA 4XYEA 5H82A 2IODA 2EW8A 3BA1A 5BR7A 3W1VA 1JW9B 3WGQA 5CDTA 4FFLA 1TT5A 1K89A 2C5EA 4BNVA 3PJEA 2Q1WA 1NHWA 4JROA 4N5LA 1RM3A 4I08A 5EINA 4J2OA 5B37A 4E2ZA 2GN6A 4BKQA 1YH3A 5A9SA 5DP1A 4GBJA 3VHRA 1ZMTA 2W98A 3QWAA 4FPXA 5JMPA 5BT9A 3F5SA 2BI7A 1JLLA 4AFNA 5LCXA 3PFWO 3PLNA 2VHXA 3KETA 1HYGA 4EJMA 2NQ8A 1UXKA 4S1VA 5AXCA 3GN2A 2AQKA 1YQGA 1PZEA 4DL9A 3UN1A 2OMEA 4FFNA 2AHRA 1YGYA 2HMVA 4A7PA 1J0XO 1F8GA 1RM5A 4DC0A 3ITDA 3UW3A 1KVTA 5U9CA 2XOXA 4J7CA 4M55A 5ITVA 3NTOA 3NJ4A 2Y0DA 5B1YA 4WEQA 4MP8A 1PJ3A 3OMLA 4QX6A 5IDWA 3W6UA 1XDWA 1YDWA 2C07A 1QRRA 1CYDA 4LISA 3RD5A 4S3MA 1I3MA 1NX6A 4PVDA 1X7GA 3MJVA 2F00A 3UFXA 4CPDA 3CKYA 5IDQA 1HYHA 1GEGA 4CUZA 1IPFA 1S7CA 3CXRA 3HWRA 1I5RA 1NASA 3GGOA 5GZ1A 2JD2A 3KSUA 4GGOA 4XWYA 2P2SA 4NR0A 2Y1CA 4BMSA 4L4RA 4OM8A 3RUCA 4BGIA 3FHLA 2IEBA 4HFRA 4NMHA 1U28A 2DBVO 5JDIC 4R16A 3QSGA 3ZWPA 4OQYA 3ADPA 1DEHA 2X0NA 3GG2A 3JQFA 1N1GA 1M76A 3H3FA 3E5MA 2WYUA 1W6UA 2I76A 2YV3A 2O3SA 4FOSA 1H0KA 4XGIA 4DYVA 5A06A 4CQMD 4BNGA 5COAA 1U3VA 3LDHA 3EW7A 1GEEA 3JQ7B 4E5NA 4EUEA 3QWBA 4AG3A 5L40A 4E3ZA 4ROSA 4Y98A 4ZRMA 2OL4A 4O63O 1R6DA 3F3SA 5A04A 4GWGA 3ORFA 3RUFA 3MZ0A 3HN7A 3TSCA 2O2SA 1HLPA 4IPTA 4RZIA 2HMUA 3WQQA 4IDDA 2DT5A 3D4OA 1ZO8A 3KUXA 4MKRA 3PP8A 1PJ4A 4YRBA 2VYNA 4NBTA 2YV2A 1Y5RA 3GNTA 1LDEA 1XU9A 3JQ7A 1DC4A 3GLQA 1U7TA 4AJOA 2Y68A 2Q4BA 2BGMA 5DCWA 4E5MA 5T67A 1UP4A 2NU7A 4CL8A 2P5YA 4DIOA 2GYYA 2TMGA 1XLTA 1W73A 2PZMA 4OH1A 2Y1FA 3F9IA 1VE9A 3NDIA 4URFA 5C7LO 1FDVA 3BTUA 3JQDA 1HSZA 2HK7A 3AY7A 5JYDA 5L51A 1KVUA 2PD4A 3IQDB 4BO0A 1R37A 1OC4A 3QJ5A 3PTZA 3ZDFA 3ZU5A 1MB4A 2RAFA 1EDOA 1J5PA 4QXMA 2I3GA 5BSEA 3WXBA 2I67A 3K73O 3DBHB 1O95A 2GNAA 1O5IA 4RPGA 4TRMA 2VTEA 4UEKA 1PQUA 4RVFA 2DTDA 2J3IA 3GUYA 1PZGA 2C2XA 2VUTA 3RI3A 4IMRA 4BQRA 1Y9EA 3JSAA 5KVCA 1PZFA 2X9NA 1NR1A 1Y8RB 3H4VA 3L4BC 3H2ZA 3E6AA 1NTOA 1D1SA 2UVDA 3HZZA 4QT0A 2CZCA 4YR9A 5JYEA 2NU6A 1SEPA 3DBHA 2OUIA 3KB6A 2VWHA 4QECA 3I9NA 3AM5A 3ZWCA 4XJSA 4LCJA 1U8XX 3TZKA 2H63A 3UICA 2YHUA 2ZB3A 4XB2A 4TKLA 4FJ2A 1B0AA 4P22A 5TX7A 2C7GA 4GPD1 3VDRA 2CVZA 2X0RA 4KMSA 3ANNA 1C0LA 5I7EA 2H1SA 1Y8RA 2NSDA 2PWZA 5IAAA 4LRSB 4K1LA 4BO1A 5I9LA 3FTPA 1SAYA 3S2IA 4YWJA 1DPGA 3LLVA 4BHTA 4U0JA 2BF7A 3CPSA 1A9ZA 4YRAA 4YB8A 4HFNA 4HNHA 5I8WA 5T6BA 1XIVA 3D0OA 1X1EA 5IN5A 3GA0A 4QTZA 4BO6A 5DN9A 2UAGA 2GO1A 1I0ZA 4B8WA 3Q2KA 2RCYA 1GQYA 1E77A 4HKTA 4CMAA 4PG7A 3W6ZA 1TB4A 1BHSA 3RUDA 4EJ6A 1NHGA 1GUYA 2VHWA 3PQEA 2VRBA 4KDEA 4AJLA 1LTHR 3L0DA 3ETDA 4IJWA 4LW8A 4ZQHA 1LBEA 1ENOA 1P0CA 2ZJ1A 3GPIA 1MXHA 3I9JA 3DTYA 3IUPA 3MEQA 1RM4A 4W9NA 3MJCA 5JY1A 2Y1OA 4BNLA 1NBOA 3GRKA 3L9WA 4BNHA 3FNEA 3GVPA 3DBVO 1CETA 1PEDA 1P77A 2VOEA 3WQRA 4TKMA 1MFPA 3GDOA 3DEYX 4Z6KA 2J5KA 2ZTMA 5A5FA 5EMHA 3O8QB 2YFQA 2DM6A 2D3TA 3AOEC 1KBZA 4LSWA 4NIMA 2VWGA 1P1FA 3ZU4A 3K6JA 1LRLA 3WLEA 5KVSA 3JQAD 2FSVA 3IL2A 3GHHA 1DB3A 1PJ2A 1CQJA 1XKQA 5I8ZA 3X2FA 1AXEA 1EVJA 4K6FA 4A5OA 4NPCA 2DAPA 2PH5A 1O8CA 4N54A 3OQBA 1HDYA 2X4GA 2HU2A 2I3AA 5EL0A 3MWEB 3O8QA 4O1MA 4ESOA 1IUKA 1WZIA 3HN2A 5H83A 2BGLA 3TZHA 2DUUA 3HDHA 4ZU3A 1BWSA 4G65A 4RORA 4XYLA 1H6CA 2UV8A 3H5NA 4MJLA 1UDAA 4QQRA 1FDSA 4EBFA 3I9MA 3AOGA 3MJTA 5CPFA 1T2DA 3FNHA 1JVBA 3AY6A 4B4WA 4U8GA 1HF3A 1ONOA 4D43A 4OYRA 1EDZA 4EUFA 2EP5A 3F6YA 1E6EA 4AJ1A 3ZNPA 4JJFA 4E12A 5L7TA 4BNFA 3GMDA 2AEMA 3M2PA 1P0FA 3KVOA 4YJHB 4X54A 2Y05A 2P9GA 2GLXA 3WFJA 2W8ZA 2Y66A 3ONEA 5EN4A 5G0UA 4A26A 2DBQA 3ZWWA 1PR9A 3TFQA 3IS3A 3FRJA 4KWIA 5JDIA 3JQ8B 1LSSA 4NBWA 2PNFA 2PZLA 4CM7A 4CM4B 5BSHA 5EIOA 3WGHA 4YJHA 4G5HA 1R4MB 1P31A 4MP3A 4R69A 2HMSA 1L7DA 3RWBA 1A71A 4N5NA 4ZQBA 1A7AA 1AE1A 3WYEA 1V3UA 2A4KA 3AI3A 3I52A 4MPDA 5DBGA 1FDWA 1BMDA 1DFGA 5U4QA 3QVSA 4E6PA 4XGNA 5JAIA 2VZ0A 1I2BA 5TF4A 4KZPA 1P1KA 4HBGA 3TF5A 3JQ8A 4XQ9A 3QQPA 4PIVA 3EC7A 1P9LA 1T1RA 1LXCA 4MVJH 1C0IA 4NK4A 4CM4A 2BFAA 1LDNA 3PEFA 3HDQA 2NWQA 4I9HA 3BYZA 9LDTA 4ZRNA 5K0ZA 1D1TA 5BNTA 1R4MA 1YBAA 1FMCA 1WDMA 1MX3A 2VRCD 4MKXA 4FB5A 1E7MA 4PLTA 4A27A 3DO5A 4B4VA 4CMBA 1NVTA 3F1KA 2CF5A 3O4RA 1BVRA 1EFKA 4W4TA 3RUEA 2O3UA 3LK7A 3INTA 4YAIA 2RHRA 3O03A 4GH5A 4XB1A 3UH1A 5J23A 1EBFA 1L7EA 1JKJA 5JFOA 3JQBC 4XZ3A 3DZHA 3X2EA 5KVQA 1IB6A 4CQLB 5G4LA 2WJPA 3E18A 1LQTA 4M89A 4EI2A 1A5ZA 1YS4A 4XX0A 5LDHA 3ZNNA 2VT2A 1LU9A 1LA2A 1X7DA 1ZIDA 2WYWA 4NU6A 3DB2A 2HCTA 3DZGA 3EZLA 4ZQFA 3K9QO 4JJIA 3PJGA 4MINA 1QXSA 1VI2A 1YJQA 1DLIA 1DRWA 4WEOA 4BIIA 1OI7A 2HDHA 1O9BA 3WDSA 4Z9XA 4PLCA 5IZ4A 1LRKA 4CQLA 2JHGA 1WVGA 3QVOA 4Z0TA 3WIDA 4MOWA 1SBYA 5ILGA 1C14A 1KY4A 3H65A 3NT2A 1N1EA 3MJSA 1QYWA 5KOIA 1NFRA 2ZTLA 1EBUA 4DGSA 4GX0A 1FK8A 4H16A 4NK5A 5G0VA 2NVUB 1KEPA 1U3TA 1ZVMA 2GPTA 3B1JA 3ICPA 1Z73A 2Y99A 3I83A 4ND2A 4ZD6A 1SC6A 2ET6A 1B7GO 4R51A 4UUNA 4DIBA 4IS2A 1Q7CA 3U4IA 4OMUA 1PX0A 4J91A 1MP0A 4TMFA 2AG5A 1ZEMA 3BHIA 3M1AA 5JW6A 3LYLA 3N74A 3EVNA 3VPXA 3C24A 2BKAA 4WPGA 5A05A 1ISGA 2NVUA 3VPHA 3GAZA 2IE0A 4RF5A 4DUPA 4H7PA 1B3RA 3A28A 3OICA 4IGFA 2VTDA 4J4TA 2W4QA 3FPLA 4CUKA 1TLTA 1K0UA 2NV6A 2EXXA 3VTZA 3EHEA 5DT9A 3S1LA 3JQEA 3G17A 3T4EA 4GSLA 4UULA 4WASA 1YO6A 3H9EO 1AHIA 2ZTUA 4MKZA 3VZQA 4GX1A 4AICA 1B8PA 4LSMA 2VN8A 1K5HA 4E2XA 4J1NA 1H6BA 3DAFA 3CE6A 2PY6A 3GGGA 4Z9FA 2O3JA 5A9TA 4IY1A 3NYWA 1Z74A 5G4KB 1YOVB 4GL4A 4B79A 2LDXA 2X5KO 5EQFA 1DFHA 2EKLA 1H9AA 4FDAA 5C7OO 5CDGA 4Y6SA 2RHCA 4J4BA 5BSGA 5T57A 1BXZA 1P1HA 1ZJZA 4IJKA 3G79A 4Z0HO 1PR3A 1ADFA 3MJ4A 3HUDA 3K96A 3DOCA 4KWHA 3U4DA 1PJLA 3ZNQA 1WPQA 4DXHA 4BNWA 1NWCA 1KEVA 1HDCA 4I5DA 4J4HA 4M87A 4AJEA 5G4KA 1YOVA 3MJEA 2NUAA 2EHDA 4IM7A 3QWIA 4L4XA 4B7UA 1IHXA 2FZWA 1NFQA 4IDCA 4W6ZA 4CLEA 2VZ9A 1AXGA 2Y0CA 5BNIA 3IKVA 3NUGA 2XXBA 2RBEA 1NVMB 2ZYAA 2B83A 4RV9A 2EEZA 2Y1GA 4MVJM 4BQPA 1ISJA 4XYGA 2QZ9A 5ADHA 1TXGA 4CLRB 1DHRA 4OXYA 4U6QA 3SBOA 4IIVA 3G1UA 3K92A 4NQZA 3ROPA 1ZK3A 1K3TA 1GU7A 2Y0EA 4TRNA 4C7KA 3AUAA 4ZGWA 4HX5A 1LC0A 5G2OA 4XQGA 3H5AA 4IZIA 5AXBA 5JMWA 1JTVA 4RLSA 3VH4A 3WJAA 3UOGA 4OQZA 4UUOA 2P5UA 4KQWA 1E7SA 3CSDA 3EYWA 3ROQA 1P44A 4DC1A 1ZCJA 4XD2A 5EERA 3UHAA 5B4TA 4CLRA 2NM0A 5AQ1A 4WOJA 4IXWA 3ZV6A 2VOJA 4BO5A 4FGWA 3PHJA 5L4LA 4CLOB 4TQGA 2OBNA 4KTTE 5KJEA 3P5SA 3SC4A 4GLOA 4DPMA 1QP8A 5IG2A 2ZCVA 2DVMA 8LDHA 2ZB8A 3KTDA 1I2CA 4FSHA 3D7LA 3O38A 3G1TA 3GDGA 4XDYA 2CY0A 5JLAA 2BHLA 3RJ9A 4D46A 5I9MA 3KLMX 3HG7A 4K26A 5HRUA 1YQXA 1ZEJA 5L3ZA 1NPDA 2JCVA 2UUPA 3BTVA 3WWYA 2Y1DA 1VC2A 4NHEA 5JC1A 4WLVA 3K5PA 3QP9A 4CLOA 1B8VA 4EITA 1TVEA 4NI5A 3C85A 2YYYA 4U0KA 2DTEA 2O3QA 6LDHA 2JFHA 4R41A 5F1OA 2DPHA 4BO9A 5T8KA 5ER6A 4D45A 1QLJA 1R4NB 3GVIA 3HNPA 3R6DA 3QIVA 5I7FA 2C0CA 1QYXA 5K6AA 2HMWA 1E92A 3FBGA 3U3XA 2Q46A 4F46A 1EQUA 2EJWA 4MVJG 3HADA 4OAQA 3KLPX 3VKVA 1I33A 4CM9A 3ZWNA 1LEHA 1ONNA 1X0VA 3H7AA 2XXJA 1PQWA 1LDBA 5C7IO 1R4NA 3L6DA 3HJAA 1X1TA 5MDHA 3FPCA 1X13A 3BXXA 2E49A 4OKIA 4FD3A 3QWFA 1E1KA 4NH4A 1IL0A 1WMBA 2WE7A 3PYLA 3INRA 4IDBA 2EG9A 2QRJA 4Q39A 1E0DA 1M67A 5AVOA 4J49A 1J6UA 3GR6A 1ADCA 3KV3O 3W4KA 4RJTA 1TT7A 4WNCA 2PD6A 4CJXA 3U4CA 3UF0A 1E7RA 1I8TA 4BNMA 5DDIP 4KQXA 4XJTA 5DNAA 3IP3A 3C1TA 1YXMA 5EQDA 3DHEA 4FQ8A 4A10A 1VJTA 2CVOA 4CMIB 1PGQA 2VYVD 2Z95A 5DP2A 4R4JA 1U5AA 3WBBA 3OIDA 4XKJA 4A2CA 2V7PA 2FN7A 3FD8A 3GVXA 1HSOA 3ZHZA 1GD1O 5L4SA 3PWZA 4IQ0A 4CM5A 3OP4A 5ITWA 2DQ4A 3LF1A 1WXDA 4CMIA 1HL3A 4J2HA 2ZKLA 3B20A 3IP1A 3TZ6A 2R00C 5IXYA 3KYDB 5KNLA 1H9BA 7ADHA 5F1KA 5T64A 4HADA 4EDFA 1DIHA 2PGJA 4PFJA 3OETA 2NNLD 4BKRA 2Q4EA 1TI7A 1HWYA 3IDSA 1KVRA 3PZBA 1Z7BA 4K9DA 1WP4A 3LT1A 1ADGA 4A0SA 3FWNA 1H6DA 3OHSX 4KUEA 2XAAA 5I9NA 3OA2A 3LVFO 3KOUA 1NM5A 4R68A 5JCXA 1GZ6A 4C4OA 2BD0A 1MC4A 3KYDA 5JCJD 3ON5A 1U1IA 4IUYA 2JCXA 3JQ9A 1XHLA 1D7OA 3PLRA 4AVYA 2O3RA 3GEMA 4HNGA 4UVHA 2WWRA 4LMRA 4RPJA 1T2CA 2OOSA 2B4TO 1EUCA 2POQX 2BFOA 1XU7A 3KO8A 3RQSA 1BVUA 4BNKA 1G6KA 3WICA 1Y1PA 2EKQA 3RU7A 1V3VA 4L73A 4YJGB 3SLGA 2W2LA 5JPIA 4J3FA 4BKPA 2AG8A 1P1JA 3VDQA 1TEHA 3PFFA 3VH3A 3W8FA 4OIMA 1NQTA 2WDZA 1SOWA 3SC6A 4OKNA 4MIYA 2G5CA 4F6LA 2JFFA 2W90A 4PLVA 4DBVO 1IZ9A 4YA6A 4D3SA 2IXAA 2Q1UA 4Z3KA 3ROMA 3U4HA 1Q0QA 4BGUA 4D44A 4YJGA 4ONEA 1DAOA 2I5PO 1WW8A 4BMNA 2JD1A 3I3OA 4OOFA 3GHYA 4JK3A 3ZV4A 3AUSA 1F06A 1PJQA 4JN6B 4NNJA 4YYZA 3TWOA 3GRPA 3W8DA 5U1PA 4O6VA 3DFZA 1GV0A 2Q2QA 2C5AA 1UDBA 1I3KA 4YPOA 4B8ZA 3JYOA 3FCOA 4MDHA 3BMOB 4RVDA 1ZXBA 2BGKA 2VT3A 1T26A 3P2YA 3QLJA 4JLWA 3RUHA 3UUWA 5F21A 3ZHBA 3OH8A 1A72A 4ZICA 2O2YA 3ZV5A 1YRLA 5ENDA 3ULKA 1PJCA 1JDJA 2V6GA 1LDGA 3NJ8A 4OSPA 1QKIA 4XQEA 1CF2O 4HFMA 1BSVA 4PLPA 4R54A 4CMKA 1Z45A 4I5EA 4OXKA 4OSOA 4KTVE 3GH3A 3GF4A 3JCZA 3VPGA 5A4DA 1ZUD1 3OM9A 4D42A 3BMOA 1GQ2A 2IYOA 3F46A 1YONA 4AL4A 5HWSA 2NU9A 3M6IA 2AQIA 4BO4A 1C1DB 2YJZA 4UVEA 5IDYA 3W4IA 1VLLA 2V65A 2OXIA 2QHXA 2ZIZA 3ZZNA 5IXSA 4M49A 1CDOA 4E32A 5DBIA 5THKA 1YBVA 3JTMA 4JP3A 4CR6A 4UEJA 1T1SA 4FN4A 1ENZA 2EKPA 5TQVA 1LDMA 2Z5LA 4IDEA 4E2WA 3RBXA 2I65A 5JS6A 3PGJA 4ND4A 2JKVA 2JD0A 3CZRA 3DOJA 5IZCC 2VQ3A 1C1DA 1YB5A 3W4JA 3WTBA 1M6WA 3RC9A 3D4PA 2NTNA 3IOYA 3F1LA 2G82A 1LDYA 3IKTA 3GMSA 4EJ0A 3QVWA 3ZGYA 1E5QA 1MV8A 1EFLA 5I7SA 2WSBA 2HQ1A 4PRKA 4P4GA 3INGA 3WX0A 5FFFA 5DCYA 3GZNB 3WNVA 1O94A 5JO9A 3V5NA 4DA9A 1XCBA 1J49A 2ZTVA 1EE2A 1GUZA 4FC6A 4L4SA 5JDCC 2CD9A 1WDKA 3RFVA 4YVFA 3UAGA 3S2FA 2VYND 3QVXA 5TGDA 4LRTB 4CM6A 4K6CA 1W0CA 3QW2A 1E3JA 4UEOA 2B0JA 4BB6A 2GN4A 4HUJA 4MVJP 1BW9B 2D0IA 2PKQO 1NFFA 1SO8A 4O59O 2PK3A 4HWKA 3GZNA 2CDBA 5LC1A 2B35A 2XPCA 1E6WA 1HEUA 4QO8A 1ZJYA 4E5KA 1Y9AA 1CQIA 1R12A 3VH2A 2X9VA 1T2EA 2C54A 3Q3CA 5H81A 4WLUA 5F5NA 1N7GA 4Z3DA 6ADHA 1QLHA 4N5MA 3VOSA 4BNJA 4E30A 1HYEA 3RJ5A 1DC5A 3N58A 1BW9A 1W4ZA 4HY3A 1YB4A 1XYGA 4R1NA 1Z75A 2YDXA 1U3UA 4XQCA 5HBRA 3D5QA 5EESA 3ZW9A 3CTMA 5HS6A 1UAYA 2Z1NA 3AI1A 1VM6A 2J3JA 1EK5A 4U6SA 4YEDA 1FDUA 1DSSG 1BDMA 4AJIA 4YQYA 5L53A 4DPLA 2I66A 1PTJA 5FWNA 4YTEA 3GK3A 1YKFA 1I32A 2J5RA 1LSUA 3WWZA 1IULA 4IJUA 1PGOA 1WMAA 4PG5A 2AA3A 1E3WB 3ONFA 2DBRA 4XA8A 4ZA2A 1H2BA 3TL3A 1HLDA 2CUKA 1I30A 3B1KA 4NJOA 1M6HA 4UAGA 2O23A 2PV7A 4MIOA 4O5OA 4D3DA 1LSJA 2J6IA 2WE8A 4BO3A 2AQHA 1P1RA 1DIBA 2B37A 2VUSA 1HE3A 1GV1A 5COQA 4PZDA 4P8RA 4GAEA 2J3KA 2NTVA 4ND1A 1GUFA 4R01A 5FI5A 4WCFC 1LQUA 2AEFA 3UVEA 4PG4A 4DIFA 1DFIA 1E3WA 1PQPA 3K2EA 3PIIA 2HO5A 2GGSA 1B15A 1P1IA 1U3WA 4B3HA 3U62A 2OORA 2IEDA 4IXTA 4OGWA 3BMQB 3I5MA 2E48A 3PDUA 4MVJI 1DDOA 4JP2A 3GT0A 2PGLA 1LLQA 5KCZA 4R9SA 4XRRA 1EK6A 3RBZA 3B6ZA 4F45A 5JAZA 1Z7EA 2GASA 5BSFA 4IZHA 1PWZA 3WS7A 1T24A 3OF2A 1BDBA 4WLOA 1EVYA 2V6MA 3QRWA 4TWRA 4UVIA 4J7XA 1V35A 1B2LA 2QG4A 1T2AA 2ZATA 1OFGA 3BMQA 2DLDA 3D3EA 4GQAA 3I4FA 2B5WA 3FF4A 3AU8A 1SCUA 4NG5A 4BGVA 2EF1A 2G1UA 3BTSA 3QHAA 1ZK2A 1PU2A 3EY4A 2X86A 1M75A 2CVQA 1E1MA 2Q49A 4PLYA 4FFPA 1NPTO 1OZAA 1Q0HA 3BZUA 5CEEA 4RQTA 3ZHYA 2QX7A 3IIEA 2Q2VA 4YACA 3DZJA 5B12A 2OHXA 2CDCA 2HRBA 3JD0A 4DREA 4DYDA 3O9ZA 4GSKA 1K6JA 4HXYA 1YL5A 4R5HA 1EMDA 3SJUA 5L7WA 3SVTA 1LX6A 2HSDA 2FHSA 2NADA 4RL6A 1ZW1A 3G0OA 2GF2A 3OIFA 3LU1A 2O4CA 1DXYA 4CV1A 2PFGA 2YY7A 1F17A 4NJMB 3AM4A 5DZSA 1KS9A 2SCUA 3PHLA 3WIEA 4YAGA 1ZSVA 3HDJA 5ICMA 1Y8QB 4MO2A 4IGEA 4EZBA 4RGBA 1PS8A 5A3VA 4BV9A 1YBMA 4K28A 3KM0A 3WTCA 1U4OA 4G81A 4IQGA 3NEPX 1F0YA 2HMTA 3ST7A 1EQ2A 1GDHA 4P4LA 3RFXA 5CEFA 5L7YA 1Y7TA 4NJMA 2FPPA 5TC4A 4KUHA 3UCFA 1CIVA 3K2BA 1E5LA 3ZWAA 1Y8QA 4M54A 1OBFO 1DJNA 2ZK7A 1VKNA 3D3WB 4PCVA 3IJRA 2I99A 1NAHA 2GN9A 3K30A 5CP8A 4YT4A 4PG8A 1U2GA 2O7SA 1HE2A 1CJCA 1GY8A 4GMFA 2H5LA 3L4BA 4R1UA 3WYBA 3H3JA 4NBVA 4Q3CA 4JQCA 1VSVA 3EK2A 4YJDA 4BS9A 8ADHA 3DR3A 3ANLA 5HTOA 4DLAA 4NZ9A 3S2GA 4CMGA 1U4SA 3QV1A 3PWKA 3OIGA 2OBYA 3BMNB 3D3WA 2X5OA 1I2ZA 4LCEA 2HUNA 1JQBA 3DC2A 1JAYA 1SB9A 3TPCA 5CG1A 5IZCA 4XYMA 4BVAA 2D59A 3EUWA 3GAFA 3KYCB 3V1UA 4EUHA 4WNIA 3V2UA 2BFPA 3E5RA 1FDTA 4EGFA 4WLEA 3OJOA 1GPDG 2FRDA 3JD3A 4J9VA 3WB9A 5CG2A 3MWDB 3U09A 1VKOA 1DHTA 2GERA 1UP6A 5ER9A 3LF2A 3Q6IA 3TQHA 1UXIA 2ZQZA 1IHYA 3AFMA 3H9QA 3BMNA 2QZZA 1R0KA 4I1IA 3K31A 2P68A 3QY9A 1YDEA 2RIRA 3CZMA 3QWHA 1L1FA 4CV0A 4IINA 1OMOA 4PZCA 4BNUA 4MVJA 4TZTA 1LUAA 1UXHA 3KYCA 1X14A 1VRWA 4LMPA 2J5QA 3JQFC 3E1KA 1CRWG 4J1TA 2IRWA 4Q9NA 4D7AA 1GYQA 3I9KA 2PZKA 3C7CB 3PQDA 4YT2A 3F4BA 4XIYA 2IXBA 1GZ4A 2FMUA 3CUKA 1SZJG 1MG5A 5MGBA 1NQAO 1R66A 3LC7O 3MTJA 4YAEA 2C2YA 2P4QA 3GZ4A 4J16A 1RYDA 3E82A 3VPFA 2ZYDA 3BAZA 4AJ4A 4RPKA 4BKUA 2D8AA 1F8FA 3HE3A 1ZSNA 4DTIA 2EP7A 3ETEA 4L8VA 2YUTA 2CF6A 1V8BA 2EERA 4YXFA 2UYYA 4ND3A 1EUDA 5BNFA 3TRIA 3VVCA 1NQ5A 3NTQA 1I3LA 1KY5A 1LLDA 3JQGB 3PQFA 3AOEA 4II3A 3T7CA 4WECA 3GNQA 1V0JA 3R1IA 5TT1A 3BTOA 4GLLA 5CEJA 2Q45A 5C3MA 4IBOA 5KJ1A 1N92A 1VPDA 3LSYA 4Z9YA 3DDNA 2PA3A 3H2SA 2TMDA 3OEWA 4L9RA 3KXDA 3OJFA 2X8LA 4FFOA 3JQGA 1RWBA 4KOAA 4QFDA 3Q11A 1UZNA
chains in the Genus database with same CATH superfamily
1GFSA 3GDFA 3IRUA 3MG9A 4O4IB 1Y1KE 5JE8A 3KPJA 4D41A 1DKMA 5DV9A 1GHTA 1V6CA 4J6FA 4Z3OA 1XI2A 5JD5A 1WBBA 2OCAA 2ZM5A 1P4RA 3DKPA 1XU4A 3BWYA 3FGNA 3SDSA 4I66A 3UO8B 3PK0A 2FWMX 2WD7B 3WGGA 1ZLXA 2D2IA 2QL7A 3C74A 2B1QA 4IXDA 4KN5A 4P84A 5EKXA 2AR7A 5EKTA 5J2UB 4IIYA 1LSOA 4HGZA 2CVHA 5GMOA 3UG6A 2V5AA 4ECAA 1N5LA 2I9KA 3A1NA 3WR5A 2V7QA 2FUG1 1W4LA 4KDRA 4QUIA 1AGYA 4BNXA 1P2DA 3M5CA 2GYVA 4J2TA 4O4IA 4C6TB 1W36D 2VKQA 2C58A 3WMRA 1DT5A 2NLOA 2V6IA 4JR0A 4LDAA 3ER9A 4P3OA 5EIBC 3IOCA 1NBME 1U8FO 3LVBA 4ZZ2A 4R8RA 2WD7A 1NC3A 3H5RA 5J2UA 7MDHA 3IJEB 1KR2A 1GAXA 1XEAA 2E1PA 3GGSA 4J43A 3TTTA 1YSCA 4BGEA 2J6HA 2D8MA 2WAMA 1PNOA 4GGPA 2D74A 4H4CA 4JLOA 4C6TA 5ELXA 3L0PA 1TYDE 4KGXA 4KN9S 4MUFA 1XWWA 1YZTA 3TKYA 2RGUA 3I5AA 3TRFA 2RE8A 1BDJA 4TT3A 5TVGA 3W2TA 3ZYCA 4BP1A 4KR6A 1DBQA 1SCNE 3RSFA 4AKIA 1T4BA 2WTXA 5DTQA 1T2UA 2I2XB 4BMVA 3BCSA 2VWPA 3SMVA 2XSZD 2P90A 5JARA 4MULA 3KRTA 2ZYWX 1O0CA 2RH8A 1QU3A 1TYZA 2AFHE 2RC6A 4OLAA 1H93A 1A88A 4NOKA 3WLFA 2W70A 3PKZA 4BQFA 5JCOA 3E2PA 1RJ9B 1ZMXA 3H86A 3S68A 3MMPA 1VCOA 1QIDA 4NBKA 2JEYA 3A4LA 3MMXA 5LLTA 3NOOA 3SHFA 3OD1A 4Q1VA 2E6UX 2B5VA 2VIIA 3Q9NA 2M6SA 1CY4A 4FILA 3SYKA 3CH5A 2VA9A 4ALJA 5E4FA 1YHZA 1U0EA 2ZAGA 3KAPA 1XQ6A 3PQ5A 5A3JA 5JS8A 1CUUA 1DC6A 3MRSA 4I1OA 2HWWA 1AMOA 4BE7B 4JXZA 1Q3HA 3HCRA 3GNSA 4PC6A 3P9QA 4B2YA 5CHYA 4R8VA 1L3BA 5K8UA 1RJ9A 2IE8A 3I6BA 3L40A 3E2IA 3WWCA 3PB3A 1JBQA 3S27A 3UXEA 3VOAA 2GRAA 4AJPA 3WIVA 2VAWA 3FX2A 5KQPA 1LLCA 1EGAA 4PRLA 3KLOA 4UNNA 4XDGA 5NLLA 3UV7A 1K92A 1KI2A 4EEZA 3IO3A 4B6EA 1YC5A 3CX7A 3RABA 2XITA 1Z63A 3JWHA 4Q9LA 3W90A 4YAKA 3P9IA 1QIFA 5CFOA 4L27A 2JRLA 2HTEA 3BSFA 1GAEO 4W7HA 1FNBA 3HBAA 2KSQA 2ZW9A 4OK6A 3R3ZA 1DTSA 3CNEA 3NT5A 4P33A 3TH5A 5E3IA 3KOWA 4I1PA 4RA9B 3PRJA 4EGAA 3BGVA 2QUHA 3PUXA 4XAQA 5K45A 3OE1A 3N8DA 1ECPA 2AQ8A 4Y8VA 1QHXA 1G38A 2CNLA 4XGKA 4LBWA 4JA0A 3P2OA 2BMEA 2C4WA 1ECCA 1ML3A 3I04M 4PPGA 4YP7A 1KYVA 1OU4A 3CX4A 2I6SA 5JG7A 1GSHA 2VXYA 1BAPA 4ZO6A 5DYIA 4Q7QA 4HEHA 1YCHA 2TMYA 1M2EA 3TNDA 1I6KA 1KYQA 3E8MA 1PR6A 3GRUA 4B6JA 4F1WA 4FZ3A 5GM1A 4MGEA 1FIUA 3O91A 3WDLA 4HH1A 2PXCA 4CKEB 2CXQA 1K7XB 3K72B 3CUTA 2XF8A 3E8SA 2CB9A 4RA9A 3PC8A 3VDMA 3GRVA 1KKMA 3VX3A 4GX5A 1ISFA 4X00A 3OLQA 3WYCA 3X1DA 1J2RA 4MH0R 2QTBA 3ZS9A 4BX8A 4RD3A 1ORIA 3BWDD 3FOEC 1GGVA 1RYZA 3H5LA 3GLHB 4JWTA 4TROA 4CKYA 1O97D 1W8DA 3ASUA 4FKMA 2TRSB 3JZAA 4W7IA 3W06A 3W5JA 3TL6A 3WBKA 1VG1A 4IIUA 1T34A 3E9ZA 4IH1A 2Y76A 4CKEA 1M5UA 2Y1KA 5BYKA 2GUGA 3LRXA 1J8QA 3ROZA 5EWMB 2FE4A 1U65A 1XJWA 4EBBA 2J0UB 1KPHA 1N0WA 3M8KA 3H18A 4FJ0A 1T29A 2AZ4A 1OXKB 1X8KA 2AOWA 2I33A 3DFUA 4IHKA 4KITB 1RZRA 1E58A 4I0WB 3RVRA 1LF0A 3ENNA 1JMVA 3GLHA 1CUBA 4HXFB 4OCZA 2R8OA 3S99A 3TO5A 2YINC 4ABYA 1CUIA 3ICVA 4CM9D 1SUEA 4QTUB 3PWSA 3V4FA 4C3ZA 5KDLA 1NSFA 2NTEA 3IC5A 2QV0A 4M9SA 4OAOA 3ABIA 9GPBA 1MPTA 4COKA 3C70A 1DOHA 1PJ8A 2OCIA 3D7NA 3GC6A 2D6FA 1L8OA 3K2IA 2ZVQX 5EWMA 3E9NA 2UZIR 3DS8A 3TDNA 3NU1A 5C37A 3I42A 2J0UA 2QG6A 3KAJA 1BXGB 5B30A 1L8QA 2CVFA 4UDYX 1TQDA 3LT4A 4MWCA 1Y8AA 1U0FA 3DVLA 3OTIA 2JZNA 3P9CA 3KD3A 4HAUA 1D4AA 4H1UA 5IKOA 3VPCA 4JX9A 3AV0B 5AMXA 1MT3A 3D3QA 1IQRA 1CY6A 3IJPA 1D2NA 2OO5A 4L0CA 4P0PB 3O9MA 1YRBA 3Q7QA 3EMDA 2IHYA 1QTIA 4NBUA 3GFFA 3WMFA 2R11A 3CH6A 3ZY5A 4G24A 1AKUA 3G2MA 5D6OA 3TD9A 4KX5A 3KE8A 4ZALA 2A59A 2CV2A 4DR7B 1CD5A 5EHZA 1KBOA 4WKOA 1IRXA 1C30B 2BSXA 1XF1A 1BXGA 2CXNA 2I4RA 1TO6A 3M6WA 4AM8A 4BNYA 4KE9A 3DXFA 1JU9A 4H1TA 3IEXA 2CKMA 4RK4A 5DYTA 2AMFA 2CWWA 2YW2A 3NBYC 4O25A 4XRGA 2IZZA 4FIDA 4YRCA 2CBZA 3QXGA 4DG8A 2X0KA 3RIEA 2DUMA 2Y1EA 1RHJA 3IP8A 1H4QA 3G49A 4KUGA 1OWMA 3GEEA 3LLCA 4DCGA 2G04A 3ICCA 4LSGA 3TNLA 3LQ2A 2GBPA 1JEJA 4UZFA 3VJLA 1YJXA 1IVYA 3HCNA 1C30A 2VSFA 4LX8A 521PA 4A73A 4MVJE 2QVGA 2C57A 1Q7GA 2VDJA 3EH2A 3L1IA 4R8KA 4RPHA 5KKCA 3LE8A 1FFCA 1ZCZA 2QGNA 1NNUA 1RXEA 2Q2WA 3FPFA 4M1OA 2YNMA 2PXHA 1RXVA 1C50A 1WUTA 3LLSA 3VHXB 2CHGA 4POAA 1SD2A 1CW2B 4K6KA 1Z5PA 4UATA 2ZS8A 2ZRAA 4GOXA 2E4ZA 3QYPA 3RKSA 3JPWA 2QVBA 4CCSA 1WNTA 1YCFA 1Z56C 2MYUA 1J06A 1KA9H 2IY8A 3E8XA 4OMFG 4EVQA 1ZBDA 4QQKA 3DMFA 4P6VF 5B58T 2W6OA 3WJ7A 3AIKA 5JH7F 4M98A 1QWOA 3ENKA 4A1OA 3Q88A 1EUZA 2OILA 5KBYA 1P1CA 4D0GA 2DETA 3R74A 2OA0A 3X1JA 1CS0B 4WWHA 1JJFA 4PGGA 4BO8A 4WOKA 3VHXA 1X3LA 1PRYA 2OWEA 2ZUBA 2W2OA 3NUZA 4M2LA 4MVJF 3UJ8A 1JVNA 1K6EA 4HAZA 5EPUA 2AMLA 4CNBA 3KJGA 1Q7BA 2HA3A 4H15A 4I4CA 3VBEA 3CVWA 1PHPA 4OHPA 3PSAA 1CDEA 1E4OA 5KKAA 4KBFA 3LNTA 2QLBA 4FJ1A 3PGVA 1WLYA 2I4IA 3V1TC 4MCHA 1AN0A 4RO0A 1UBKS 4MB0A 3ZCVA 2I6FA 1ID8A 1Y3HA 3FNFA 4B3MB 2DCUA 4ZHQF 3A25A 4F3YA 1R8JA 1CS0A 3ZV7A 3OCZA 1VMAA 1JJVA 4KDCA 1IXZA 3EC2A 2WU3A 1RAIA 2EWMA 1GGMA 1C4KA 3MRVA 4GVLA 1USUA 3IOMA 4PR0A 4N8SA 3L0SA 3I2KA 2GK3A 4DLBA 4JYZA 5JSUA 3PVZA 3LZDA 4JH0A 4LJ5A 2R87A 5JZMA 3G5MA 4KN6A 3I73A 4AKHA 3OE5A 2IU4A 3DGFC 3JW8A 2ZYGA 3M4XA 2DWCA 9MHTA 4H0CA 2HLPA 1GU0A 3ABRB 4IIXA 1VG8A 2ZR7A 2ZT8A 3CJTA 3HU5A 4B75A 4YT8A 4KVAA 5DYGA 1MLDA 1EBBA 2FMIA 2R6CA 4WY5A 3Q8MA 3E70C 1BO6A 1K8ZB 3KL4A 3N8IA 4QE3A 1XVAA 5FH9A 2GESA 4UUMA 3IMGA 3VMMA 2P8JA 1R0RE 4OA5A 2GN0A 3OZEA 3UJ9A 3FOBA 2PUJA 3VU8A 3ZH9B 2OGUA 1XALA 2GTPA 4RD4A 3PXXA 3M89A 4A92A 1SVIA 1C4OA 2FUG6 4NZPA 1J23A 5B7QA 4PNEA 4EY4A 5AI8A 3V34A 5JAOA 1QO7A 2QOEA 2GN1A 1GZ3A 2FR8C 1ZY2A 2K5UA 2Y2UA 4MW7A 5HJEA 1H66A 1FTQA 1RZVA 3A6EA 3QE2A 4B3BA 4DMKA 2HGSA 5EKUA 2H4ZA 1K06A 1WV0A 3G2PA 3K1AB 4FCVA 4GSYA 3QE0A 4ID9A 4MRAA 4JB0A 4XLLA 1GYPA 4S0ZA 3ED5A 4BB5A 3HXLA 3K9BA 4G01B 1KL7A 3GELA 3JRNA 1S3IA 2H4HA 2H3EA 1BHO1 4YMVA 4PLWA 2FPGB 1JFFB 1O77A 3FA2A 4PYKA 4BUCA 5IN4A 2HRZA 4P32A 2Z9DA 3WGZA 1RMTA 3D4BA 3V8PA 1SFRA 2DFVA 3RUAA 1B41A 3R24A 1LZKA 3LAWA 5A5GA 4Q4HB 5HF5A 1NR7A 3L5OA 2VRCA 1AS3A 3ANMA 3CNLA 2A5GA 1V9SA 2W6CX 2J33A 3EMVA 3BAFA 3N75A 1SEVA 2C9OA 3KZNA 4LRYA 4CODB 3FOZA 1DKNA 4LSZA 5EC8A 3K1AA 5IVHA 1F12A 5FTMA 3TMKA 1IUNA 4E21A 4C7JA 4KWTA 1Q1NA 5F52A 3V4RA 5CDSA 3A14A 5DH9A 1HNNA 1YRAA 3U40A 5CTAA 2BKXA 1ORWA 4IGIA 3WDKA 2FPGA 1JFFA 1QYVA 5K03A 4WKCA 5DTRA 2VTKA 5TSDA 3T3OA 4JUIA 4UHDA 5EHGA 3HXMA 3HO6A 3PENA 5DEIA 2CL7X 1ZH0A 4Q4HA 2RSLA 4EY7A 5FOQA 3CJRA 3NH6A 4M7OA 5CVTA 4RQUA 4QT4A 1HKUA 2ZIXB 2G8LA 3DSRA 1CEXA 5ENVA 2V74B 1LGYA 2VPQA 3HFGA 3PUKA 5J4KA 1Y6ZA 2PR2A 1JIIA 2C5FA 4BLWA 2JIOA 2B4RO 4QDKA 3PNBA 1TO2E 3GJ7A 2CMFA 4KO3S 3SKYA 2FMTA 4KRGA 4NULA 2AKYA 4G2NA 4S24A 5A3QA 1KQGA 1QUFA 4E46A 5JADA 2DHQA 1XHFA 2FW8A 2I1LA 3FDZB 5FV7A 2OFWA 1DGQA 2HAEA 2JLSA 4HWRA 3KQHA 1TA4A 2PXAA 1C3VA 4YGYA 4NRDA 2R751 1WG8A 3ML1A 4EPRA 5HNKA 2ZIXA 1W5AA 2IX9A 2YS7A 5EHNA 4C2BA 5AJYA 4ZODA 4YDHB 3D6MA 4H1HA 1JYFA 2P6PA 2QN1A 3FYTA 2RMKA 4Y67A 3D3JA 3B1ZA 1BDIA 1XZMA 1VA4A 1WDTA 2HRCA 1XVTA 2JHCA 1NP3A 4NE7A 5DBHX 4DLXA 4YMUA 3RBVA 4CIDA 1F1BA 1E9SA 2BRUA 3HCPA 1DX6A 3S2EA 4OB7A 1NAIA 2BBTA 1Q57A 3TG8A 1ZKDA 3WQHA 3FDZA 1F20A 4WK2B 3A31A 1SC3A 2XB9A 1K4KA 2XYHA 1JH8A 1GKIA 4K6HA 1XMXA 4RZHA 1XGKA 5AKKA 4D4GA 3KR1A 3HUFA 2WFLB 4Y2YA 1PGJA 4R6XA 3HB0A 1V1JA 3BCUA 2JCGA 3CLVA 4LHEA 4OJNA 5CX4A 3HJFA 1L4NA 2WG0A 3I1JA 4PO8A 1L9KA 1NVEA 4H7FA 2AUMA 4KV9A 4X62B 4IHQA 3DEHA 5C53B 1L7AA 1WOYA 1MA0A 1UJMA 3TJRA 5A9RA 1GJRA 1SXJD 1SD1A 3QUTA 1KVSA 2IV7A 3PHHA 3EUEA 5C5IA 2VAVA 2QIOA 3FR8A 2EV9A 3F47A 4G0PA 1MORA 3RO7A 9ABPA 1EYZA 1JJ7A 2G76A 1V7QA 1B76A 1NKSA 4GMDA 2IEZA 3H1FA 3KXLA 1G8SA 4OG2A 2XB6A 2WFLA 4PR3A 3OOJA 1H2HA 4QUHA 1W46A 1PF7E 4IJVA 3WV4A 3L79A 4IQ8A 4WQMA 1CDDA 3D54D 3KHSA 4W1PA 2I7VA 3DV0B 5KWJA 4B35A 5LWQA 1J1ZA 3EGXB 1VPWA 1TIBA 4JY7A 3E3AA 4GUDA 2ADMA 4QFBA 4Y3UA 3TUJC 4PZ9A 2BKUA 2GQ0A 4NWIA 3UK6A 4E2YA 3NX4A 1KQFA 1CHDA 3UXYA 1P7VA 1Y6JA 1UXGA 2BSQA 3TLGB 4OBEA 4M9ZA 4B4OA 3SHTA 1QORA 3EXHB 3O2JA 5I9SA 1OGYA 3QU4A 1QGAA 1MQ8B 4A03A 3BXZA 4ZV7A 4UCQA 2PCLA 3AONB 3NGXA 4IH4A 4QELA 1EFCA 4IDAA 4TN1A 4WFJA 1JE0A 5AW7A 2DTXA 3DV0A 3GGJA 3VZDA 5AJHA 3EGXA 3OQ1A 3V46A 3W9YA 2CLHB 1LC3A 1KIFA 1CY7A 2JFZA 2IZ0A 3IHWA 5KS2A 2P6NA 2WD8A 2G67A 1B42A 1O5OA 1ENPA 2JHAA 1L4EA 1MG0A 4PIMA 3U0BA 3TLGA 1P18A 2YHIB 3UAOA 1J9ZA 2BWJA 5KNBH 3BQMB 3EXHA 2GEBA 3USCS 1F8XA 4W1QA 1GLVA 2WEKA 1ID1A 4XGRA 4IV0A 3SEAA 2IUEA 2J30A 3HSYA 2BF4A 1TTHA 3ND6A 3OFSA 4IZOA 4P35A 2VHEA 2NXCA 5EUBA 3VPAA 3B48A 1I3OA 3DTVB 3GH1A 4XEHA 3FN4A 3L3BA 2JLBA 3LUJA 2C1ZA 1UPFA 3QTLA 4K9MA 1LW6E 3T52A 3ZJYA 4GYJA 2HBYA 3STHA 2FZCA 3EQ6A 5JXGA 2JAPA 1Z26A 2JBWA 2ORWA 2YHIA 1H8EA 5F3RA 2OCPA 3T5MA 4B6SA 4E88A 3PXGA 1IG3A 3NC1C 1DEXA 4M8NE 1YNSA 1AB5A 2A5FA 4QG7A 1N75A 2BMDA 3EHDA 2C4TA 1HOTA 1A0OA 1KZ1A 3H1AA 4NX2A 1AURA 3L82B 4G97A 1DIGA 2IA5A 3FFXA 5CYOA 2C77A 1Y3CE 3JQ6A 3DULA 3TLCA 1YJ5A 2YWJA 2AF4C 4UREA 3ZZ0A 1QP0A 3DTVA 3HJNA 2G0NA 5I5EA 2ZT5A 4OHUA 5H80A 3RV4A 3H6KA 5TF0A 3GEIA 1U28C 1V4NA 4E33A 5K05A 5K8IA 3LUHA 1KVQA 4ZOQI 2ZRHA 2BMAA 3VR6D 5MN5A 3TXYA 3NALA 5DF1A 1K7YA 3C3XA 3EN0A 2YC4C 5BMVB 4CU2A 1O6CA 3WG9A 2PWBA 4D0RA 2Q1YA 2F1HA 4PG6A 1AS0A 2ZJYA 5K4HA 2P4HX 1QE3A 3ZZMA 1NW5A 1ZH4A 1MUUA 4G85A 4CIXA 3KT8A 4C4YA 4DLZA 3ELUA 4W5QA 1W7AA 1I6LA 4X45A 3RSOA 1SQGA 5HUQA 5HK8A 5IWCA 3FG9A 3O26A 2GD2A 4L3WA 4ND5A 4D0NA 4QYSA 2ZIWB 2AN1A 3EGOA 2KPOA 1TKRA 1X77A 4RXUA 4ZVRA 4LTMA 1VA5A 2XIQA 3AYZB 3DZFA 4GVXA 3TNFA 3NHAA 5TIIA 3VAZA 3NKFA 1P61B 3AIIA 4JLMA 1RPNA 5AKHA 5HOQA 3T3EA 1UR5A 5BMVA 1CERA 2F64A 4I2NA 4ZQGA 4XUEA 5JO0A 1K7CA 4M1QA 1S01A 2HTFA 4U5QA 4DDKA 4IOLA 3REFA 3WLOA 5CFZA 2J7PD 2M1ZA 4GWKA 3D2AA 2GZ2A 3DOHA 1KTIA 3GXOA 3ONDA 4KFRA 3DOOA 1ZGZA 2WD9A 1RABA 5EZQA 4HAOA 1JHYA 3OQOA 2EFDB 3EVTA 4O3FA 4XR4A 3P19A 4HYQA 1QG6A 1TZCA 1UH5A 4FW8A 4K81B 1BE0A 1K3FA 2C7VA 2R7AA 3HNOA 3IUBA 4JOSA 4QHYA 5A71A 1B0ZA 4GR4A 1H3FA 4QJ3A 1M8PA 4N18A 4AYTA 4C05A 3JRWA 1EX1A 5BYBA 3DDHA 4QGGA 4RTRA 4DKXA 2FZEA 1RWWA 2R8BA 2RBKA 3H6GA 4YP0A 1YS6A 1OY1A 1Z4JA 3TE6A 3ZJ5A 1W35A 2D1RA 1N78A 1U6KA 1SIOA 2ZCUA 3WADA 2ZQYA 2ZCJA 4DLLA 5JAQA 2GCPA 3U3ZA 5CIWA 4RK0A 5AFSA 1QK4A 1ZN7A 1CUSA 4Z9BA 3GJQA 1EGQA 3M83A 3NNSA 1TU3A 3PR1A 3QBVA 2RH4A 2O7QA 4H31A 4P86A 2HJGA 3SZMA 3ZNOA 1CZRA 4YAJA 4BKOA 3EXAA 4RCVA 4BJ3A 3NAQA 1CJUC 4TQAA 1WETA 1U11A 5GY7A 3RS0A 1U2DA 2PJZA 3CZAA 3KZVA 3MVEA 3MTBA 3NOQA 5IT0A 5F3WB 2CXUA 1VZ3A 3GLSA 3B1FA 3LY7A 3WLMA 2Y93A 2Q9UA 1R6BX 1ZL0A 1YQDA 1TM3E 2B1IA 1KC1A 4CL2A 4M8SA 4IYRA 2HPZA 4PIPA 4XGQA 3AF0A 3TDKA 3G0HA 2HH9A 4CLHA 1JR3A 2H4FA 2I2DA 3JYQA 5J2TF 5EIEA 1CF4A 1E0AA 2QDKA 4A36A 1C0KA 2N1MA 1NU8A 1CSEE 1VJCA 2WLTA 3LUAA 4M88A 4NYMR 3CLRD 4BQEA 4GVPA 4QBGB 1GT91 3GA7A 4G25A 3PEVA 4F91B 5FEUA 1YFLA 3SF0A 1VPLA 3RVKA 3WYFA 4CM8B 1UJ2A 3CVJA 4WBNF 3IBSA 1TK3A 3O8NA 4GXQA 1TYEB 4H6XA 1HQCA 4G41A 3ONWA 5ED0A 1L7NA 3SLRA 4LDQA 3TSYA 4AXXA 3C6XA 4RULA 3U9LA 3SZ3A 1SG6A 1JDSA 4X8OA 3CCCA 1CUZA 4E5YA 2QD5A 2P4EA 4IDQA 4M60A 2G4LA 3CF6R 1VJGA 1Z5NA 2XB2A 3P9NA 3HVUA 1A7KA 5BXQC 4BFSA 4ZVPA 3IH5A 3TL2A 1VE5A 3LFHA 3IUSA 5J4HA 2F4NA 1GTL1 1K4MA 4MEBA 3E53A 1P9OA 4UXHA 5FBRB 4REQB 1WXIA 1P1BA 1K88A 3QFTA 1IEVA 1C3LA 4CM8A 4RJJA 3EZNA 5A3RA 2V6BA 3R23A 1VJDA 2NYUA 1QIEA 4II2A 1O94C 2XXAB 3KWFA 2AOXA 1N3YA 2GJ8A 1DC8A 2FY8A 4HHEA 3EY9A 3A9TA 1XMOB 3F9CA 2QKYA 2V8OA 3L9XA 1NVGA 1QCZA 3QELB 3QEMB 4I8XA 4JD5A 3HJHA 2JFPA 1M8JA 4YECA 3G82C 4JB2A 5JCJA 1S0UA 2P6OA 1ZSYA 4W9MC 1E63A 2QD2A 5AW3A 3OIUA 2HSEA 3KS9A 4WXYB 1E79A 3OEEA 4WKNA 3BDIA 1KETA 4XM1A 2NMVA 4REQA 1FMLA 3NGLA 2OYRA 4BFYA 3TYXA 5DM0A 4XCVA 2ZE5A 5CH5A 3LYHA 1Y6GA 4E31A 4LFAB 2C2MA 2XXAA 3IMEA 4CTOA 1KDPA 2HR1A 3V8BA 3PUIA 3VGPA 3ZWYA 3PPWA 3QELA 5FYDA 3PIDA 3QEMA 3SZLA 4ILEA 3P0EA 1R7RA 3TW8B 1CIJA 3HV0A 2ZVDA 4FI3F 4J1SA 5ADWA 5HQ3B 1VGQA 5FPQA 5BR8B 3AKZA 3AF5A 2PUWA 1LS1A 2ZRGA 1SZCA 1CZOA 1V8DA 2F8MA 4G4SP 4HNRA 2AJBA 5AKYA 1TKBA 5AVZA 4DV0B 1FZTA 4B82A 4ESEA 2GBLC 2X8BA 2FX2A 3IAHA 3A9VA 4XYEA 3HCFA 5LU8A 1PHRA 3EGIA 4NNOA 3HVJA 3T4UA 2ETVA 3AM1A 1J5XA 4WMLA 4WV3A 1JW9B 2IYUA 5CDTA 2A58A 5DTJA 1QHSA 4GYWA 5KQMA 2EJTA 3MGCA 3PJEA 1O08A 1DPFA 4M9QA 2FPXA 4FI3C 2O1XA 2XWPA 3TW8A 5HQ3A 1LJUA 1FVHA 2C84A 2GN6A 1KJYA 4GBJA 5JMPA 1N6LA 1R18A 2IUYA 3QYAA 1S1CA 2DHEA 2QUKA 2BI7A 1Z37A 3AKYA 4TLLB 2ACWA 3T9CA 3P0RA 2VHXA 3KETA 3KEFA 4P2GA 2G72A 1HYGA 4REMA 2NQ8A 2JIBA 5AXCA 4BVGA 4D0LB 1WU8A 3GN2A 4I1UA 1M1UA 1BYUA 1YQGA 2IQIA 2PMKA 2W71A 3OT1B 1CTQA 3OVMA 3QNUA 4TL9A 3CNBA 3ZDAA 1U1CA 3UFXB 1VLMA 1E3QA 2AHRA 4KO2S 3GO4A 1EPUA 1W1WA 3CLTC 2GVZC 4F8YA 5K4AA 1ODJA 1IOWA 5U9CA 1XP5A 3I30X 1JFTA 4M55A 4BQSA 5ITVA 3NTOA 1Q74A 2P4UA 5AKIA 4TTPA 4QKQA 4HB4A 3L8YA 4QX6A 1UK7A 3KUUA 1QHFA 1D0IA 1XDWA 2C07A 1QRRA 1CYDA 1UBJS 2WZBA 2YASA 1NMEA 3ET4A 3NHMA 4XARA 1M1NB 1WD5A 3BMXA 3OT1A 3RHTA 1RQXA 1T8SA 1XZHA 4CL0A 5JFGA 1X7GA 3QLVC 1BN6A 1J0BA 3DB1A 3UFXA 4CPDA 5T7BA 1ZI9A 2JHPA 1GEGA 4CUZA 2XCIA 4GE0A 1EUQA 1G20B 4I4TB 1I5RA 1NASA 2Q4DA 4AUMA 1IHOA 3GRAA 1XAIA 3OZVA 4NL4H 3ICEA 1DCKA 3MT9A 1OIWA 2RHHA 2BFEB 4GGOA 4L85A 5FA6A 3WRXA 1WY5A 4JUDX 4NR0A 4QU8A 3FTEA 2C98A 1H0SA 1NY5A 4G6ZA 4L4RA 5KHAA 3FHLA 1F5SA 1GU1A 5DNWA 1M1NA 4GP7A 3PVCA 1T4GA 4LJYA 4ZAWA 1Q77A 1RWNA 2IVZA 4I3FA 5JNRA 1XZBA 4G67A 1M74A 1OZHA 3M6LA 4JC4A 4XDHA 5ERXA 2ZUSA 3JQFA 4NCKA 4UKDA 4HVTA 4BGDA 1G20A 2WYUA 4I4TA 2I76A 2VNHA 2YV3A 4DYVA 2P6MA 3I5XA 1Y1QA 1RHRA 4RFVA 1W94A 2FEOA 1NUUA 3LDHA 3LSTA 3O4FA 2BFEA 4QXRA 4ZT7A 4AG3A 4E5NA 1T8RA 4H18A 1JX6A 4E3ZA 1EA5A 5AKXA 3GPCA 4ROSA 3R5JA 3K0AB 5D7NA 4E08A 4O63O 3F3SA 3FE2A 5A04A 4FMDB 3K70C 3ORFA 5AW1A 3RUFA 1KJQA 2L82A 1GSOA 2IW3A 3TCXB 4HGQA 1HLPA 5D3KA 2HMUA 1T3GA 3PNQA 3PF8A 4KR9A 1E2GA 3D4OA 1AGRA 2C92A 1AQNA 4MKRA 2FJPA 5HKBA 1PJ4A 2Q07A 4IRXA 1FMFA 1H5UA 3ZDBA 1Y5RA 4FDTA 4JEMA 3GNTA 1JG2A 1XU9A 3UZUA 2IXTA 2YCBA 3F3KA 3FB4A 3GLQA 5DTEA 2Q4BA 2GZAA 3NORA 3K0AA 2WWHA 4FGZA 4BFUA 1XPRA 2XMZA 1T6ZA 2FEKA 1KQ3A 2TMGA 4ZOAA 4JLNA 4RLFA 4DM7A 4GYYA 2F7SA 1WUKS 3QKIA 2AX3A 3R41A 2I6XA 1DNPA 3OCXA 5C7LO 2YFKA 2X0DA 2CFRA 1HSZA 3RT7A 3P9ZA 3KKOA 5JJ5A 4UTOA 2PD4A 4DIDA 2FB9A 2EQAA 3IV6A 1R37A 4AU1A 3ZDFA 2VL7A 2JGDB 2WBLC 4XVUA 5LP6B 5LA6F 1KAMA 4ZIRB 3TIGA 1IB0A 3VRHA 1TD1A 1RBZA 3WXBA 2FV8A 2I67A 3P4UA 3ZDEA 3T6KA 3BJRA 3IBTA 3ZPXA 3SBDA 4LY6A 2GNAA 1FNNA 2VTEA 3DMGA 1FRFS 4HRYA 5BPHA 2WWFA 4LX0A 2YWBA 4K0RA 2RGNA 4UMEA 4N9WA 2O8EB 1GCAA 3GYBA 4EL0A 5F7OA 4ON9A 3MQ4A 2ZUTA 1RZ3A 2VUTA 3C3CA 5FHQA 3WHIA 2YYAA 3N8KA 5AVRA 4MI9A 5AVQA 3KQUA 3VR4D 3WLPA 1EQAA 1G3IA 2JGDA 4XB6B 5LP6A 5KVCA 4Y2RA 3O1LA 4RH0A 4ZIRA 2UUBB 1Y8RB 1BFKA 2R5WA 3IEUA 2D0DA 1CJKC 1UOEA 5B1IA 1D1SA 3B5JA 1QGOA 1V26A 4PXYA 2COUA 5CJPA 5AVKA 5JYEA 1WPRA 3J81k 3KB6A 3EIEA 3V7YA 4NKRA 2QJTA 3AM5A 3UH0A 1SC9A 3BORA 1O3YA 4XJSA 3TZKA 4MV6A 1VL5A 1V2HE 1ZM7A 2IW1A 2YHUA 5FTLA 5IPFA 3NM4A 4CQNA 2P7IA 2O8EA 3SICE 1XD9A 1QG2A 5EA2A 821PA 4TKLA 4KPEC 3EWAA 3TB4A 4Q02A 4MUJA 4X95A 4HAYA 2CVZA 1I2AA 5FULA 4X65B 1C0LA 1QF9A 5I7EA 5AVTA 1T1GA 2CXOA 1L8AA 1Y8RA 2J9XB 2DG2A 2PCJA 2PWZA 2WA1A 2Z1DA 3H16A 3KUDA 4K1LA 4D99A 3THXB 1LJLA 3PCRB 4QBKA 1SAYA 3S2IA 3VJRA 4CGYA 1Q44A 1XZFA 4M9CA 4YRAA 3F5FA 3AEYA 1UZAA 5GQSA 5I8WA 5T6BA 2QRGA 5EXPA 5IXJA 1GNTA 1K8QA 4EJFA 1JHPA 1RLUA 5IN5A 1VLVA 3EOBI 2YOFA 4FE7A 4ER5A 5LU9A 3THOA 5MHTA 2I3ZA 4V3CA 3OU7A 4CCAA 4J0JA 2WAAA 3B3GA 3IE0A 3Q2KA 3LL7A 2G28A 4AURA 4JP1A 1T6XA 4HKTA 3THXA 4PG7A 5DLDA 3RARA 3RUDA 3SQLA 1GUYA 4KN8A 1Y6RA 1NRWA 1PBTA 1VCMA 2F62A 2VRBA 4KDEA 5DHSA 3I8OA 3L0DA 4ZVLA 4HNUA 1YRQA 1IMOA 2XKBA 3ETDA 4IJWA 3HYCA 3QOYA 1RP1A 4ZQHA 1UAAA 3E5HA 5DM60 3G8DA 1RM4A 1YKSA 2NT4A 2WINI 3GARA 4F92B 2PN1A 3COVA 3IR5A 4QUEA 4GBED 2CNKA 4FMPA 1NBOA 3LM8A 1FP6A 1Y4DE 1Z6TA 1Z47A 2WHQA 3L9WA 5KCMA 3SQOA 1ZRHA 4X64B 4BNHA 4YUWA 1JEAA 3GVPA 3K0HA 4J16C 1PEDA 1P77A 2WV7A 3TEMA 4AAYA 3PCTA 1OBOA 4EWLA 2JW5A 2M9MA 2OD2A 3QNMA 2R1VB 1VHJA 5CVCA 1RXYA 1Q1AA 4PYOA 1FS5A 4EB8A 2CV0A 4Z6KA 2J5KA 2Z9CA 4JHXA 4CWAA 3STWA 1LPNA 1MDBA 1MO2A 1YB7A 2Q6OA 4J3NA 1G5QA 4JBXA 2X19A 3VYTB 5I45A 1NXPA 1JF8A 4PC1A 2WUGA 1AHPA 2WYHA 1FL9A 1P1FA 3LQYA 3P9YA 1ACMA 1QVRA 2XNDA 2QVYX 4Y2GA 3OHPA 3I2JA 4UTPA 3GGCA 1DB3A 2R47A 3DE2X 4PQYA 1CK4A 2R1VA 4M1MA 3UJAA 1XKQA 1W29A 4A5OA 1EVJA 1FNSA 2YMQA 5DM4A 2FWNA 1WW2A 4AIIA 1ACLA 1R3UA 1O8CA 4X60A 3OQBA 3A1WA 5TXGA 3R7NA 3ZLJA 1L1RA 3ZTTA 2QXUA 2EZ4A 2P75A 2NUPB 1M0WA 3USZA 3FI0A 1WZIA 3HN2A 4YX9A 2DUUA 4CZ2A 1BWSA 3AHDA 1RAHA 4ZAYA 1CIPA 4JQSA 4MJLA 3BG5A 1CUVA 1HORA 2FZKA 1E5VA 1TPYA 3O94A 4IQFA 4CDMA 4DARA 2BJVA 3C39A 2VHQA 1E9RA 2R6GA 2Z3WA 3KVVA 1I4LD 3OEHA 1YI0A 3IULA 1XVIA 1G16A 4IIEA 5F73A 5M3BA 4CDRA 3KFVA 1T2DA 5JS7A 1P5FA 1K2VN 3QA3E 1VBNA 5G40A 3EEFA 5PNTA 3WKDA 4DQDA 2NUPA 5ECGC 3IR7A 3A2LA 1I6MA 3O0DA 4B4WA 2J6CA 3LUDA 4FEYA 4U8GA 3JWGA 3IQWA 4PO3X 5B3LA 1JQJC 1AKTA 2B20A 2OE2A 3IHKA 4J03A 1WEKA 5E1DA 4OYRA 3BH0A 2W2TA 1V5EA 4ZKDA 1BE1A 1E5DA 3NWOA 4G9GA 3ZIAD 2IZ7A 1G5RA 1CDZA 2EP5A 2V4ZA 3NQ41 3S40A 3RW9A 4TWJA 4CHGA 5C8ZA 1XKXA 1S2NA 3O3CA 4E12A 5L7TA 4EB0A 3K53A 1YBFA 4AO8A 5DX1A 1MN6A 4ZYZA 5FPSA 4YJHB 4X54A 2J0EA 3TCNA 2WRZA 2Y05A 3IA2A 1KO7A 2G80A 2NSJA 2P9GA 2VG8A 2YV4A 4Z8YA 3BVPA 3WFJA 3N28A 4MYSA 5EN4A 3SCZA 4A26A 2WDPA 2GJ9A 3ESCA 4L6IA 1QQ5A 1FB5A 3S44A 3E5NA 1ESMA 1TA9A 3DW3X 5DGIA 2J31A 3QI7A 4KYUA 1A69A 2P11A 3U60B 4UBLA 5BN4B 4DXDA 4ETWA 1KWGA 1USGA 2ZIVB 1WPXA 2FG7C 2PNFA 1B6SA 3S28A 1MABB 2PHZA 2INGX 2PYDA 5KNCD 2O8NA 5EIOA 3AL0C 4YJHA 1C2TA 2XWSA 3X1KA 4OJQA 5FPPA 4MP3A 1TKCA 1L7DA 3RWBA 3QFFA 2CHVA 5HKKA 4WK4B 1ZCBA 1NBMD 1TMGE 2HXSA 3M6VA 5LWHA 3I52A 3PDWA 4G5FA 4EO9A 1VMKA 4JXJA 1A2OA 1BMDA 4X0EA 7ABPA 5JAIA 4HX9A 3DUFB 3KB8A 3MHPA 3OQHA 5TF4A 4HBGA 2D1SA 5EG5A 1D0SA 4PIVA 2ZJBA 4ZVNA 3EC7A 2VDNB 1WSDA 1T1RA 2HQRA 1SUPA 2R5FA 1C0IA 2Q5CA 1NULA 3PEFA 3NW9A 1MABA 3HDQA 4NK4A 2B8EA 5HVNA 3Q4GA 4BQOA 3PUYA 4ZOCA 5FTWA 3ZGZA 3LGAA 4MKXA 2XYGA 3OZFA 1NNLA 5DKFA 1TJPB 3MBIA 1TCVA 1C7JA 5KWSA 1XROA 1PYOA 3O4RA 1G7TA 4UNQA 4M3NA 5G1NA 4K40A 3F96A 3T3PB 4OX9Y 4G5XA 4Y2UA 4PZUA 4YAIA 3DUFA 3VSBA 4HZUB 3OZSA 2QIPA 5DWVA 3DZHA 3X2EA 1GZHB 5KVQA 1I7QB 2NP7A 3WZ2A 1MIOB 1L7BA 3I01A 3OZCA 2B92A 4B0OA 2WJPA 3E18A 1LQTA 2Z2YA 3FNIA 1A5ZA 2SKDA 3EGDB 3Q3VA 1SRQA 4EK9A 3ECCA 3ZNNA 3SQMA 4EVRA 1X7DA 2WYWA 3G0BA 1GKKA 1E18A 3A37A 1KY3A 2D5IA 3DZGA 4FOPA 1G20E 5IBRA 3ODPA 3FKSA 1NUTA 1A50B 3VC1A 3B6EA 3MIIA 4YMGA 1U31A 4EMBA 1VI2A 4BWVA 3J80A 1KRXA 4ZJZA 4FMCB 3PNSA 2OQVA 4Q3LA 1C4XA 3C3EA 4HZUA 2HWKA 2FF5A 1RQ7A 5BPFA 1U99A 5IULC 4O2AB 1MIOA 1LRKA 1PR1A 4GG1A 2JHGA 5JCPA 4BEBA 4E51A 3KP1A 1Z25A 3EGDA 1F3LA 2DHDA 2H1WA 4Z0TA 4B6RA 3UAXA 4FVTA 4GOKA 4W9RA 5DK6A 4TQUS 3SSAA 4OHYA 1FYWA 2GHQA 4H08A 4LXTA 4NK5A 4JSRA 3MYRA 3UAVA 1FW8A 1IEQA 1GPNA 4EY3A 5LQDA 3HPRA 4ZWNA 3SF8B 3E05A 5EVCA 4BLSA 2ZUUA 5IHPA 3LTNC 1GT6A 1B7GO 4R51A 3MUOA 4O2AA 4IS2A 3D0QA 1SKAA 4MUMA 4TWBA 4Z99A 1Q7CA 1R5OA 5HDQA 2DWUA 3H17A 4KQ9A 2G4CA 3DNFA 4J91A 5J9FA 4HX2A 3NIWA 5J5AA 2H2HA 3PKIA 4RSMA 3UUFA 3N74A 4PS1A 5HZGA 4LK2A 2IUFA 1BS9A 3RS4A 1E2NA 1QVZA 3E2MA 3OESA 3P2KA 1NVDA 3GAZA 1IXRC 4LJ9A 4DUPA 2ONYA 5L4NA 1DOAA 4JZKA 3C45A 4J4TA 2BBSA 1OW3B 3UWPA 2VPYA 2ACVA 3DEIA 1LVHA 3QUSA 3SF8A 4CF6A 4CUKA 5AESA 4XSGA 1TW3A 1EXWA 2GXSA 2NV6A 2ZBPA 4LJAA 4BMYA 4XCQA 1KMHB 2EXXA 5FBVB 5JLJA 1PNVA 2J9GA 2XYQA 2IV2X 5DHUA 2VTVA 3S1LA 1TK9A 2JC3A 1EHCA 5DLYA 3CVUA 5TR9A 2HD4A 3CS3A 3VZQA 4GX1A 1R64A 4LHYA 3CX8A 4X1OA 4DUZB 2P5SA 2PKYX 3LTEA 4AICA 3MYYA 4M1WA 2YYSA 1DV2A 3SVLA 2HJVA 1GPAA 2VN8A 1MRNA 3FCXA