3OIGA

Crystal structure of enoyl-acp reductases i (fabi) from b. subtilis (complex with nad and inh)
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
260
structure length
260
Chain Sequence
b'MNFSLEGRNIVVMGVANKRSIAWGIARSLHEAGARLIFTYAGERLEKSVHELAGTLDRNDSIILPCDVTNDAEIETCFASIKEQVGVIHGIAHCIAFANKEELVGEYLNTNRDGFLLAHNISSYSLTAVVKAARPMMTEGGSIVTLTYLGGELVMPNYNVMGVAKASLDASVKYLAADLGKENIRVNSISAGPIRTLSAKGISDFNSILKDIEERAPLRRTTTPEEVGDTAAFLFSDMSRGITGENLHVDSGFHITARLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enoyl-[acyl-carrier-protein] reductase [NADH]
molecule tags Oxidoreductase/oxidoreductase inhibitor
source organism Bacillus subtilis
publication title Crystal Structures of Enoyl-ACP Reductases I (FabI) and III (FabL) from B. subtilis
pubmed doi rcsb
total genus 93
structure length 260
sequence length 260
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2010-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3oigA00
2YY7A 4CQMB 1QLJA 2FHSA 4NJMB 2C5EA 3GVCA 1B16A 4JBGA 3I1JA 4WJZA 1G0NA 4E32A 5DCYA 2PGJA 4ND4A 2I3GA 2CMDA 2A4KA 1I10A 3WFIA 5CG2A 2AQKA 3ZNQA 4BGUA 4ITUA 3BXXA 1EDOA 2BI7A 2DBQA 2VNSA 3GR6A 2C82A 1YE3A 3H5AA 3JYPA 4XB1A 4DLAA 5K0ZA 4AJLA 5F21A 2GN8A 5JE8A 5H81A 1DLJA 3DFZA 1PGOA 1PL7A 1P9LA 3FNEA 2P9GA 5HS4A 4J4TA 1TT5A 4HBGA 1ID1A 1ZXBA 3GPIA 1T2AA 4U0JA 3HDQA 2NQ8A 2VHVA 1YXMA 5J23A 5COQA 4AJJA 2X23A 2BI8A 4R1NA 4AJEA 3IJPA 1OFGA 2CD9A 4MOWA 4XQEA 4DC1A 1CQJA 4EITA 3OSUA 1G1AA 4YAGA 1H94A 2DUUA 4YPOA 1UR5A 3ZV3A 3U3XA 2EWMA 4J91A 3VPGA 3K5PA 3LLVA 1ADGA 2Q99A 2IZ1A 1GDHA 1DRVA 5L7YA 3WOHA 1HL3A 4D45A 2C7VA 2A94A 3PGXA 3MOIA 3OJEA 3RIHA 1F17A 4BO4A 1KETA 3GNSA 2OL4A 4GMFA 3B20A 1DIBA 4IS3A 3DOCA 4IZIA 5IXSA 5L95A 1EDZA 2FRDA 2AEMA 4K1LA 2R6JA 3VDQA 3F5SA 1KC3A 3U4HA 4BL5A 5A06A 5DOZA 4HV4A 4MIYA 2FPIA 2JHGA 1E1LA 1QR6A 4W4TA 9LDBA 1BTOA 3DAFA 4ZQGA 2I99A 3GUCA 4G81A 3S55A 3ZH2A 5B12A 1EBFA 4PLGA 1ISGA 1ML3A 1UP6A 3NYWA 4DWVA 4RVDA 4MDHA 4MVJI 1GEEA 3I9LA 5L51A 1SAYA 4AVYA 2W2LA 3KYCB 3PDJA 1A9YA 3DTYA 3U0BA 1QV6A 3HDJA 4MO2A 2BFAA 3X2FA 1NAIA 5G0WA 3VHRA 3L77A 4PG7A 1DAOA 4YWJA 3TFQA 2BFMA 3H2SA 1V35A 4XJSA 3WYBA 2YHIB 3GG2A 4NH4A 3HG7A 4DVJA 2VWQA 3RBVA 5BSFA 2B37A 5AXBA 5HBRA 3FTPA 2HAEA 5CFZA 2AQHA 3RFXA 2Q3EA 1Y9AA 3DBLB 4KZPA 3QSGA 2DU8A 4Y98A 2GZ1A 3UF0A 3OJFA 2Q4BA 5KNLA 1QV7A 3ZZNA 3MTGA 1CYDA 3MZ0A 4FGSA 5CEJA 3RUFA 4QT0A 3DWFA 3WGHA 4XIYA 5G2OA 2HMUA 1HDZA 5A4DA 2HSDA 1I2BA 3ZDFA 3ADOA 1YB4A 1DRUA 3B1FA 3CSDA 3VZSA 1QORA 3PIDA 5JDCA 4KTTE 1K2WA 3PHGA 3GEMA 3WGOA 1Y8QB 1HKUA 3SEFA 5LCXA 4B7UA 3BYZA 3F4LA 3HN7A 4A10A 2CVOA 1GCOA 1NQOA 1Y8QA 3PDUA 4KDEA 4W7IA 3CEAA 3T4EA 5DBIA 2X9GA 1U2DA 1HE3A 1JA9A 1DOHA 1SCUA 3NJ8A 4BO8A 3RJ9A 1V3VA 2BF7A 3SBOA 5HM8A 1UAGA 5U9CA 1HYGA 2FZEA 4E5NA 1AN9A 3R1IA 1WDKA 4ALMA 3RSHA 1E7RA 1SNYA 1V9LA 2P5UA 4H16A 1M6WA 1EUZA 4EYEA 1NFQA 1P1RA 3S2FA 1B14A 5LDHA 1C1XB 1U4OA 4YT2A 1OC2A 3D5QA 4M89A 4BB5A 1GQ2A 3WS7A 1E3SA 3OBBA 3DZKA 2X5OA 3UGKA 1V6AA 1KEUA 2YQ5A 4HXYA 3NT4A 4ZGWA 5C7OO 5JCXA 5K6AA 1I3LA 4FCCA 3AU9A 1B26A 2TMDA 4DPKA 4IINA 5KJFA 1PTJA 4LK3A 4R54A 3PLNA 2J3JA 2HU2A 1LDMA 5LDGA 1ZKMA 1GUZA 1I33A 4BV9A 1U3WA 2YQ4A 1LUAA 3GN1A 3QQPA 4J4BA 4TSKA 1ENZA 3ADPA 1UXIA 2EGHA 4I9NA 1GUFA 3S2IA 1I5RA 1T1RA 4IXTA 3QA9A 4YR9A 5HRUA 3AOEA 2G1UA 2NWQA 4ESOA 5TNXA 4BMVA 5JAZA 5DP1A 4LISA 3NDIA 4RCVA 4XD2A 3W6UA 2FOIA 1HZJA 2RBEA 4M1QA 3RBZA 4UREA 3I9MA 3AOEC 4N54A 4F46A 3DOOA 1UP4A 4R1SA 1LDYA 3U4CA 1W6UA 3MJEA 4E2ZA 4U7WA 3RASA 5AVOA 1DEHA 4M54A 4PZEA 2D2IA 1U28A 4PLHA 1HYHA 3I83A 2JCVA 2UDPA 4QX6A 2Y1DA 4MKRA 4DTIA 1Z75A 3W8EA 4URFA 2H5LA 5JMWA 2R00C 2VT2A 1OI7A 3B70A 1P33A 3H9EO 3QHAA 1J0XO 1CJCA 1XHLA 3NKLA 3DBLA 2E82A 2GZ3A 3QY9A 4R5MA 2PGDA 2WD8A 2Z5LA 3INTA 4NU5A 5GZ1A 3LYLA 2Q1SA 4MP6A 1EK6A 4CM5A 1P1FA 4JCOA 3DMTA 3WR5A 3F4BA 4DREA 3GZNA 4FFLA 4BB6A 1A5ZA 1O95A 4YVFA 2OP0A 5DCWA 5T57A 4BNIA 2WEKA 4J16A 4XX0A 3E8XA 1DIGA 1NVGA 5F1OA 5CDTA 2CFCA 4LMRA 4Q3CA 4P8RA 1H2HA 2BLLA 4QQRA 2EEZA 5JAIA 1IB6A 2VHWA 1DIRA 3BMNB 1YS4A 5JMPA 5JNLA 1MV8A 2FN7A 4FBGA 3EY4A 2ZB8A 4WLUA 3TN7A 2ZTLA 3DFUA 1Y6JA 2O48X 8ADHA 1Q7CA 1NNUA 1EUDA 2VZ8A 1H2BA 4H15A 1N9GB 4BNXA 2CY0A 4YJFB 5A05A 1NR7A 4W9NC 1RM0A 2YDXA 4CM1A 1QYXA 4XGKA 1K89A 1PJCA 4NU6A 1EEHA 3QVOA 3KUXA 4XQCA 2E4AA 1BW9B 4K9DA 3VPHA 1P1KA 4XYMA 1LLCA 5DZSA 3FRJA 3E9QA 1N92A 3IP3A 4CODB 4DIFA 4OXNA 5KJEA 3R0IA 4FIZA 1IE3A 4E31A 3ZNPA 4CM8B 2NTNA 3EMKA 3KSZO 4XGNA 2J5RA 1SB8A 1EBUA 4QSMA 4L9RA 2LDBA 4AICA 4BKOA 2B83A 4MVJE 2Q45A 3KZVA 5I8ZA 3U5TA 4TQGA 5JAMA 2VWPA 2ILTA 4FFOA 4E2WA 3X2EA 1R66A 1XEAA 1E3IA 4NI5A 1I3KA 4UEKA 2BFPA 2Y1CA 2PV7A 3QVXA 5GZ3A 1T1SA 1ZEJA 3ZHZA 4AJ4A 3PHHA 4NK4A 3ORFA 1RM3A 5JS6A 1PGJA 3SLGA 4BKRA 3VOSA 4OXKA 3WIEA 3E1KA 1CEQA 4IXWA 2V6MA 4JQCA 1TEHA 1ONOA 2QRKA 1IZ9A 1ISHA 3B1KA 1BXGA 3GC6A 3JQ9C 4Q3EA 1UDCA 4OJNA 4LRTB 1OZAA 4BO9A 4E13A 5JO9A 1ZMOA 3DXFA 3WFJA 1LEHA 1U8FO 1LRLA 1QYDA 2PKQP 4D0RA 3ANLA 5TRTA 4MJLA 3F5QA 1F0YA 2OGUA 4RQUA 1GV0A 1YOVA 1MXFA 1EVYA 3NX4A 3O26A 5KVQA 4JIGA 4FS3A 4RPLA 3DMTC 1KIFA 4L4RA 1ZO8A 4CM3A 1TI7A 4CLXA 3FR7A 4Q9NA 5JC8A 2ZB7A 1ISFA 4FPXA 4YT5A 4DPMA 2XXBA 3EK2A 2VRCA 4EW6A 1JAYA 4M49A 2GERA 3TJRA 4ZHSA 1PZHA 1E3EA 3E5RA 1X7HA 3GNQA 3D1LA 4TROA 1YH3A 3LVFO 1N7GA 4YBZA 4ZICA 3U4DA 1SB9A 2H1SA 5IJZA 4PCVA 4IDCA 2CF5A 2R00A 2OUIA 2HMSA 3OJ0A 1YL6A 2ZYDA 3P2OA 1ADCA 3GFBA 3DAPA 4E5PA 2O2SA 1G6KA 4FJ0A 4YA6A 4KUHA 3ZCXA 2HUNA 4ND3A 4BMSA 3NUGA 2NV6A 1PU2A 1SOWA 5KVCA 2BGMA 2HK7A 1U3TA 1I2ZA 1XG5A 1C1XA 2H6EA 4CMAA 5I7SA 5BSGA 4QUKA 4MVJF 1TT5B 4DLBA 5FI5A 4TRJA 1ZJYA 1M76A 3DZIA 3KYCA 3PQDA 4GLOA 3D64A 4M8SA 1DC3A 4N5NA 5JBIA 3L9XA 2OOSA 4II3A 1W73A 4PLYA 4PN3A 2OFPA 4WLEA 1VI2A 3QP9A 3FBGA 3VTFA 1FMCA 4LRSB 1Y8RB 1XELA 4EJMA 4NBTA 1Z73A 3GGPA 3I5MA 1Y1PA 2IYOA 3Q11A 1BXKA 4QO8A 4CMHA 4WEQA 3UXYA 3NEPX 4HKTA 3ONEA 4FFNA 2C20A 1ORRA 5F5NA 1GU7A 3DONA 3HE3A 4O59O 4F45A 2PKQO 5C7IO 5ENDA 3Q6IA 3QWAA 1GAEO 4XQ9A 4K28A 2GN9A 1EVZA 3QWFA 3GA0A 3O03A 4CR7A 2B4RO 4A0SA 3K96A 1NR1A 2EG9A 4OAQA 3A1NA 2AA3A 1OC4A 1LRJA 3PHLA 2PGLA 1NPDA 1IHXA 4EEZA 1NPTO 5A9TA 3TNLA 1JW9B 4IDEA 3H9UA 5MDHA 1XGKA 1Y5RA 3GZ4A 3ZWVA 2FPGA 1DB3A 1LLQA 3V2HA 1WXDA 1BVRA 3O38A 3ABIA 2I66A 4QFCA 3HWRA 3DAGA 3C7AA 1CDOA 2YZ7A 2QHXA 3R3SA 3E82A 1RJWA 2J5QA 5JDCC 1I0ZA 3E9NA 2VRBA 5DBGA 1XU9A 4UVDA 4B79A 4NPCA 3LT4A 1OBFO 4A73A 4UAGA 5LC1A 4D3DA 1UJMA 3PTZA 3ROQA 3ZWWA 2D0IA 2FR0A 2X0RA 4JJFA 3RROA 1GYRA 2SCUA 4WLNA 4KUGA 4OSOA 3ZWNA 4LMPA 5B37A 3DEYX 2JCYA 3RUCA 1MP0A 5G4LA 3JQ7A 2J3KA 1E7WA 1Q0HA 2ZQYA 3CMCO 1EZ4A 5BNTA 4YT4A 4II2A 3ONDA 4W9NA 5C5IA 2FR1A 1VJ1A 3OFSA 3TZHA 5TGDA 4CUZA 2JD0A 3JQEA 3PZBA 2O50A 2UUOA 4K6FA 1JLLA 4BMNA 5TLSA 3C85A 5TJHA 4QEDA 1GYQA 1K6JA 2AG5A 5I7EA 1F8GA 1F8FA 1MB4A 3UH1A 1X0VA 3W8DA 3TZKA 4E0BA 5L45A 1LDEA 4HFNA 3IIEA 3JQFC 3QVWA 5TJ9A 1LA2A 2EKPA 2G0TA 2UV8A 3WSWA 4CMIA 2WE8A 2FPPA 2Q1UA 4NMHA 3HB5X 5EINA 3G49A 5A04A 2Y1GA 4WE3A 4JNKA 1BDBA 4DMMA 4OOFA 1P0FA 3W6ZA 3D7LA 3OIDA 4IS2A 1EVJA 3ZHYA 3SVTA 4D3FA 1A27A 1ZSNA 1I32A 1WLYA 1DLIA 1R0SA 4EJ6A 3VKUA 1DSSG 5CDUA 5F5LA 4AJIA 4OMUA 2O3QA 3OA0A 2HRZA 4IDAA 3WGTA 5IN4A 3JQDA 2DLDA 1VSUA 2OMEA 5EERA 1Z7BA 4ND2A 1ZMTA 2DPHA 4FR5A 2PZMA 4RVFA 5IG2A 1YRLA 3IS3A 3L4BC 4P4NA 3ZU3A 4D7AA 1J5PA 1B8UA 4CLRB 1HWYA 5AXDA 1SC6A 4G2NA 1DPGA 3H2ZA 4FJ2A 4BNUA 4A26A 4GKVA 1EE9A 3E18A 4FQ8A 1XWFA 1LSOA 1HDCA 3PGJA 2YFQA 1Q0QA 1RPNA 1ONNA 3PEFA 2Y67A 2W90A 3LU1A 1WZEA 4YJHB 1M2WA 3R6DA 4ZRNA 2EP5A 3HN2A 2JD2A 4RVGA 5ICSA 4IBOA 4PG5A 4JJGA 3OQ1A 5A03A 3AK4A 1YWGO 5DULA 5U4QA 4CPDA 5IDWA 4CM4B 1VL6A 2IRWA 1MX3A 1HDYA 4RV9A 3QLJA 4R1TA 2D8AA 3AY3A 4EUHA 3UOGA 3RWBA 3WGIA 3AOGA 1XDWA 5ITWA 3L6OO 3PJFA 1NASA 4PIVA 2GR9A 1CQIA 1JQBA 3GUYA 1MC5A 3GPDG 3LDHA 5I9MA 1PJSA 4CJXA 5KKAA 1DJQA 3JCZA 2HRBA 4BNWA 3JQBC 3L4SO 3ANMA 2V6FA 3OEYA 1K6IA 2DFVA 4EBFA 1WPQA 1E3LA 4H3VA 2VT3A 3N7UA 1E7QA 5AXCA 1LC0A 1PJQA 2GDZA 1KVQA 3ENNA 4HX5A 8LDHA 4KOAA 2HO5A 1HSOA 3WMXA 4D41A 1RYDA 1E1KA 5ENVA 1F12A 3A28A 3TL3A 4BGVA 1XSEA 4FD3A 4DXHA 5A3VA 1LC3A 3B1JA 2VUTA 1FDUA 3HADA 3W4IA 2HDHA 2BH9A 3FHLA 1MFPA 1X7GA 1Z7EA 2WMDA 4WCFB 3H4VA 4J7UA 3VVCA 4YTEA 3FWNA 5L4SA 3L6DA 5FWNA 1V3TA 3PFFA 3CINA 3PHIA 1GCUA 3F3SA 2EV9A 4YT8A 4Y6RA 3NAQA 4R51A 3W4JA 3D4NA 4DBVO 4KQWA 5KJ1A 1H5QA 4KMSA 4R69A 5KCZA 4MP8A 2JJYA 3CH6A 2QX7A 1PGPA 4XYBA 3T7CA 3ICPA 1V3UA 1YBMA 1ZJZA 1WP4A 1P45A 4GKBA 4CR8A 1ULSA 4FFMA 1PJ3A 3N74A 1DC4A 3BMQA 3NTOA 4N7RA 1PSDA 3RC1A 2DFDA 3ZU5A 4BKUA 4O6VA 4Y6SA 1IYZA 4EDFA 2OHXA 1PJ4A 3RU9A 1U8XX 3FSRA 4KTVE 4BNVA 2ZKLA 4CM7A 3EW7A 3U9LA 2EGGA 1VJTA 2F1KA 3S2EA 5KVSA 3ZWCA 2NSDA 2BD0A 4EUFA 3PWSA 1IHYA 1N7HA 4DGSA 3WIDA 5DN9A 3GVHA 3K73O 1VRWA 2I67A 5CDSA 4MVJP 2O7QA 5DBFA 2X58A 1IY8A 3TDKA 3FN4A 5L53A 1PJTA 3U49A 4D3SA 1IUKA 1LDNA 3I3OA 4YQZA 1R4NB 4WKGA 5T67A 1F14A 5L7WA 2FY8A 1QSGA 5TSDA 1YOVB 2OBYA 4D42A 3AUTA 5DNAA 2DTXA 1YL7A 5U1PA 2AMFA 4BKPA 3CMMA 3AFNA 3VZPA 4ZA2A 4YQYA 3BHIA 1QLHA 2H9IA 1DBVO 3VH4A 4DIOA 3AI1A 1X0XA 2AW5A 4NIMA 2RHRA 4Y8VA 4NDNE 5L7TA 5A9RA 5ES3A 5JFOA 4IDGA 3V2UA 1C3VA 3H5NA 4CLRA 2Z95A 3JQGB 3RFTA 4RF5A 4DYDA 4I5GA 5CHEA 2PTGA 2RAFA 3UKOA 3D3WB 1X1TA 3MWDB 4HFJA 4B4OA 4EGFA 1KVTA 2VTEA 3AM4A 4NBUA 1CRWG 2X9NA 5BSHA 4ZQEA 4DUPA 1D1TA 1HLDA 1JKFA 1T2EA 4JGBA 2VUSA 4FOOA 3E6AA 1E6EA 1NAHA 3KEOA 3JQCA 5DP2A 3EYWA 3JQ8A 4R4JA 3LC2O 2VYND 4IDFA 3Q1LA 5KIAA 4GSKA 2QG4A 2BGKA 5IF3A 3R3JA 4N18A 1FDSA 4Q3DA 3SJUA 3WJAA 1PJLA 1HTBA 1DFHA 2DPGA 1LX6A 2HK9A 5KJ6A 1E3JA 3PVZA 1ZK3A 4O63O 4GH5A 3C7CB 1U2GA 5KJCA 1G0OA 4JROA 3GAZA 3AWDA 3NT2A 2GUGA 3MOGA 1E5LA 1I2CA 4K26A 3H65A 1GR0A 2GN6A 4XKJA 1P0CA 3I23A 3KEQA 4IPTA 4OQYA 1DJNA 2UUPA 4LVUA 4BO2A 3MJVA 4KWIA 1PL6A 3BHJA 1DFGA 4CMBA 2I5PO 4J1NA 1H9AA 5B4UA 2B4QA 1N1EA 1UZNA 1Q7GA 4GAEA 5G0SA 3G17A 2X5JO 2VZ0A 4JBIA 1GTMA 2NACA 4GLLA 2P9EA 3H9GA 3GY0A 4XDYA 3NDJA 4O1MA 1E6WA 1P1IA 4KP7A 1SOVA 4IJVA 3OM9A 1VKOA 1ENOA 3H6KA 4YJDA 3I4CA 4JLWA 4R1UA 2IXAA 4OXYA 2PNFA 4AL4A 4E2XA 3CZMA 5FFFA 2GD1O 2WTBA 4FFRA 4ND5A 3BMCB 4B7CA 4PGFA 4BNGA 4XR4A 1PX0A 1B7GO 4LGVA 3GEDA 4FOSA 1DRWA 2C59A 3WYCA 5L4NA 3IP1A 5JAQA 1KERA 2VWGA 3EC7A 4XRGA 2ET6A 5T64A 1U7HA 3U62A 3IKTA 3RUEA 2FMUA 5ITVA 2WD7A 3D0OA 3C7DB 3OETA 4NFHA 4WGGA 1FDVA 1O8CA 1IZ0A 4L4XA 2YUTA 4U6SA 2JFHA 1DXYA 4NBRA 4AJHA 1GUYA 2J6IA 2OO5A 4BO5A 4A03A 1VC2A 1A72A 3KV3O 4J49A 4Z6KA 3KTDA 2EKLA 5F1KA 1SEPA 4BGIA 4DIBA 3CE6A 1PQWA 1T25A 4X54A 3W4KA 3ZNNA 1EUCA 4W6ZA 7MDHA 3AUAA 3QRWA 5GY7A 2B36A 4BVAA 5A1TA 3EZYA 1OOEA 4HFMA 2Z1MA 2Y0DA 1LLUA 1B3RA 4WLVA 4CUJA 1VL0A 3PI7A 1CWUA 4GBJA 5CDGA 3KYDB 3GMSA 1YGYA 1Q2XA 3QWHA 1X14A 1DO8A 4AJ1A 2ZJ0A 2XF8A 1WVGA 2NUAA 4GL4A 2CSUA 2O7SA 2DBVO 2J3HA 4DQVA 4N5MA 1PWXA 2OORA 3WJ7A 3HDYA 1T24A 2X9VA 1ZH8A 3JD3A 3U4IA 3C8MA 3PP8A 4TRMA 4EUEA 2PWZA 1E92A 2BFOA 3JD2A 1HE5A 4RLHA 3SC4A 5T6BA 4MINA 3DZHA 5JY6A 3H3JA 2HCTA 5F3RA 4ZD6A 1PS9A 1DC5A 3NTQA 4HADA 4CMEA 1XA0A 2GASA 4R41A 2GN4A 4ZQHA 1JN0A 5EIOA 3GGOA 3MJTA 1E77A 2VOEA 1JDJA 4XJTA 1E3WB 4PZDA 3TZCA 2D5AA 4DL9A 5JO0A 1WMAA 5HS6A 1ISJA 1GEGA 3VAZA 3ZN2A 4OO3A 1WAMA 5C7LO 1A4UA 2C54A 4CMIB 1YJQA 2Y0EA 4TKLA 4GVLA 3A4VA 2B69A 3I9KA 1KEPA 2G17A 1NVTA 3ON5A 4RORA 4TKMA 3H9QA 3BZUA 2I76A 2P4HX 1PR3A 3LSYA 4IUYA 1BMDA 3RUAA 2PH3A 3EAGA 2IZ0A 5TS3A 4Z0PA 5JY1A 3ZWXA 5CEEA 3BAZA 5GMOA 3JQ7B 5GZ6A 3H8VA 3HFGA 4Y6PA 4E33A 4YEDA 1N9GA 1PGQA 4EEXA 4FDAA 4ZQFA 4M87A 1H6DA 2Y0CA 1CIVA 1D4FA 5CPBA 2Y99A 4ALIA 1QRRA 1ADFA 1A7KA 3GVXA 3Q0EA 4RVUA 4D44A 2PK3A 1R4NA 1RWBA 4NZ9A 1YQGA 2HMTA 3FNHA 4HNGA 4Q3NA 5TT1A 3TL2A 1JVBA 3O9ZA 4CUKA 4AFNA 5B4VA 4BO0A 4BOYA 5CEFA 2EXXA 1KVRA 4XZ3A 3VZRA 4DLLA 4EI2A 3H9JA 4B3JA 3NJ4A 5L4LA 2JHFA 3V5NA 4Z9FA 3OIGA 4RZIA 1W0CA 3FBTA 2NU7A 3EVNA 1DAPA 4CLDA 4GWKA 2AE1A 1Q7BA 5JYDA 1HXHA 4AJKA 1MA0A 4A2CA 4B8ZA 4BNNA 3OJOA 4YRBA 1L7EA 1YO6A 2VUUA 4BUCA 4L8VA 5EQFA 4PG6A 3MTJA 5BT9A 2YW9A 3I52A 2E49A 6LDHA 3IAHA 4J6FA 4CL8A 1FXSA 3AU8A 3OA2A 2IXBA 4B8WA 1O89A 3AI3A 4OIMA 1O94A 4NR0A 1MC4A 5A9SA 4B4VA 3JYNA 3GGGA 2VHYA 4BGEA 3QJ5A 3AM3A 2GSDA 2ZYGA 5IDYA 1NHWA 3LT1A 2VWHA 3GVPA 3KVOA 3P2YA 2V6GA 3CPSA 5CAEA 2B5VA 1ZK4A 4J1SA 5FEUA 2OXIA 1X15A 4JP2A 4BO6A 1VM6A 2BGLA 3PYLA 5ILGA 5A9SB 3DBRA 1NBOA 4FB5A 3ZWPA 4YAJA 2XXJA 3P7MA 4R68A 3PK0A 3K2EA 3K31A 3K2BA 3M6IA 3OJLA 4NJOA 3DQPA 4BNTA 2E37A 1HDGO 2GNAA 4O0LA 4XGIA 1LXCA 2CZCA 4F6LA 3ZHBA 2DVMA 4CLHA 1FJHA 4L75A 1GY8A 3ZGYA 1FF9A 1D8AA 2P9CA 1PQUA 3HNPA 4LCEA 4TMFA 2IYPA 3L07A 1XIVA 2YV1A 3ASUA 1BRMA 1QMGA 4EJ0A 4MKZA 3JD1A 3KETA 4J3FA 4RLSA 4L0QA 3NGLA 2EKQA 2WYWA 1R12A 2J5KA 3OF2A 4E5KA 2NVUB 3D4OA 1ARZA 4UULA 3VPXA 3JTMA 1PJBA 1NXQA 3DO5A 3JD0A 1JWAB 2XOXA 4U8GA 3ZV6A 2C2YA 3OMLA 2VNAA 4O5OA 4KWHA 3RKRA 2PH5A 3WBFA 2POQX 4BNHA 1O0SA 3TSCA 3ZU4A 2X0JA 1UZMA 3O4RA 1VLLA 5KKCA 3NDRA 3HQ4O 4R01A 4XWYA 4D43A 3DC2A 2Y1OA 3RJ5A 4BNZA 1LDBA 1MLDA 1XU7A 4OSPA 2AQ8A 2HMWA 2A35A 1S7CA 5G0VA 4E6PA 1PR9A 2BRUA 4U6QA 3A06A 3UN1A 1R0LA 2O3RA 1YB5A 4QXMA 2PA3A 1CETA 1BHSA 4Y9DA 4G65A 3K8ZA 1ZVMA 3RUHA 3ANNA 3QIVA 2JFFA 2QYSA 4B3IA 4WK6A 4QECA 1LRKA 4PLVA 1NPYA 2CVQA 4PRLA 2YDYA 3F46A 4MVJD 4J7XA 1I36A 2HQ1A 2Q50A 2ZB3A 3K9QO 4LN1A 2OZPA 4J7CA 1ZW1A 3WSVA 1LU9A 1QYCA 2NTJA 4CMGA 4YJGB 2QYTA 2Q4EA 4AJPA 1ISMA 1I8TA 2YYYA 1OMOA 2ZTVA 2W98A 2QRLA 1ONPA 4CM6A 3WLFA 4NFSA 1VPDA 1GPDG 1W4ZA 1WZIA 4WEOA 4BHTA 3IQDB 4D46A 4W82A 3TZQA 4C7JA 1YL5A 4XQGA 2GF2A 2HJSA 2Y05A 1XQ6A 3JYQA 2X1HA 3TFOA 2ZTUA 1F06A 4AJNA 4RF2A 3KM0A 1DHTA 4XB2A 3T4XA 1KS9A 3DR3A 3QVSA 4PLWA 3W8FA 1E7MA 1BW9A 5CG1A 4UVEA 1YBAA 3DBRB 2WYVA 3JQAD 5B1YA 4OL9A 2UYYA 3HFSA 4XDZA 1J49A 2X7HA 3JQBA 1E1MA 1XR3A 3AW9A 4ILKA 1YQXA 1K6XA 1HF3A 4L73A 3V8BA 2NVWA 3MWEB 1U4SA 4RPJA 2Q2WA 1IPEA 2O3SA 5T8KC 3HSKA 4FC6A 3DHNA 3RU7A 3ZWOA 3PXXA 1LLDA 4J2HA 1T4BA 3NTRA 3BMNA 5AXAA 2O23A 3DZJA 4R3NA 1L7DA 1X13A 4TVBA 4L76A 1WDMA 2I6TA 2AEJA 4A27A 4XYEA 1R16A 3VDRA 1GQQA 1NTOA 4FN4A 2QRJA 4A7PA 4DMLA 2WJPA 1BVUA 3TWOA 3MCVA 5I7VA 1P74A 3INRA 3KO8A 3O8QB 4JP3A 1HYEA 1WW8A 1J6UA 1P77A 1LTHR 2G82A 3VKVA 4ONEA 4MP3A 1LSUA 5A5EA 3WTCA 4YAIA 2FZWA 4CV2A 2NLOA 3M1LA 1UUFA 1M75A 5K6AC 5IFLA 3DZBA 1MG0A 1YQDA 2Q1TA 3QV1A 1SEVA 2UAGA 3F9IA 4B7XA 3HB4X 2EIHA 4RVSA 1ZZEA 1YONA 2YV2A 3WQQA 1HE4A 2D3TA 3RFVA 2NQTA 3GK3A 4UUMA 1B3BA 4AJOA 2P5YA 3A9WA 3V2GA 5DF1A 4HFRA 4IIUA 4B4UA 2X22A 4HWKA 2DC1A 1ZXLA 3PIIA 1RYEA 4CQLA 1PS0A 4QFDA 1BDMA 1NX6A 3BMCA 3CTMA 2PD4A 1H93A 3UW3A 5B4TA 1UXGA 5CPFA 3WXBA 4YAEA 5ER6A 5TX7A 2P68A 1E1NA 1JVSA 4CMCA 1ZSVA 4OKNA 5EQDA 3ZWBA 2YJZA 1T4DA 5BNIA 1HDRA 4ALLA 3RI3A 1C0IA 4JK3A 4WCFC 1BXZA 4BO3A 1A71A 3L6EA 4NNJA 1NYTA 1HRDA 2PZLA 1R4MA 1QYWA 4BKQA 5JPIA 4P22A 1KEWA 5FYDA 2W2LD 3ZW8A 3RUIA 3MJ4A 4WCFA 1PEDA 5C37A 1Q0LA 4RDIA 3DBHB 2XAAA 1KC1A 3PLRA 3GG9A 5CP8A 4E2YA 1HLPA 2X6TA 1QP8A 4MIOA 4DQXA 1P1HA 5A5FA 2VYVD 2IE0A 2EF1A 3FD8A 3UVEA 1TLTA 2ZCVA 1QKIA 4PZCA 5IXYA 2Y1EA 1UH5A 4ZQBA 1K5HA 2BKAA 2GRAA 3BMOB 1GZ4A 1NQTA 3PJEA 3C3XA 3OQ6A 3PWZA 1NFFA 3MJCA 2B35A 2D4AA 2Z1NA 3PFWO 3EGOA 2J8ZA 4WCDA 3FF4A 2GYYA 3B6ZA 4GSLA 1YDWA 1QYVA 5AOVA 1LNQA 4XYGA 3GN2A 4C7KA 4RF4A 4D0SA 5G4KB 3BTOA 2DAPA 3VVBA 1YBVA 1N1GA 3GDFA 4QO7A 4LSWA 4S1VA 2WE7A 3IUPA 3S8MA 1NHGA 4U0KA 5COBA 2ZATA 3M1AA 1WDLA 2ZK7A 3KSUA 2QIOA 1FDWA 2ZJ1A 2AE2A 2NM0A 4RQTA 4RPHA 4GGOA 3K6JA 4K6CA 1VJ0A 3WX0A 3E03A 3ETGA 3IMFA 3KBOA 4RL6A 4E30A 1HEUA 4R9RA 2NADA 4MIEA 2JKVA 2VN8A 2O4UX 3BTUA 2C29D 2VTDA 5I9LA 1SMKA 4BNMA 5JYEA 5EMHA 3JSAA 5IZCA 1VKNA 2QZZA 1ADBA 1U3VA 5EESA 1HZZA 4UVGA 3N58A 1QG6A 3P19A 2NU8A 4MVJH 1U1IA 1O6ZA 3E48A 3RC9A 3KOUA 4MKXA 5DOVA 3WICA 5IZCC 3QW2A 4M86A 3G3EA 3ROPA 3EUWA 3OHSX 3DOJA 1EQUA 5T8KA 4UUNA 1T2FA 3OP4A 2Q2QA 2YHIA 3PYXA 2HJRA 2D59A 4Z9YA 2PZJA 4DQUA 3K30A 1EFKA 3F47A 5I8WA 3WNQA 3GNTA 4TWRA 4CM9A 5KVVA 4RJTA 3Q9UA 3AJRA 4E4YA 2E6UX 3CKYA 2EHDA 2RH8A 1IL0A 4NBWA 1T2DA 3L4BA 5TQVA 1DC6A 3EVTA 2AEFA 3GLQA 1HT0A 2BMAA 1HDOA 4J90A 4IGEA 3TF5A 1NWHA 4UVIA 4CV3A 2J3IA 4NQZA 3JYLA 4TVOA 4C4OA 3WGZA 5JCJA 2PY6A 3ZI0A 4R5HA 3RVDA 2EJWA 5T5QA 5JW6A 4B3HA 5BNFA 3CZRA 2X8LA 1ZIDA 4RZHA 5JDIA 4GX1A 2FSSA 4TRRA 4P38A 3UCXA 3DDNA 2ZYAA 4HUJA 3G1UA 1O9BA 2IEBA 4NK5A 4XIJA 1YDEA 3FNGA 4OOEA 2TMGA 3COSA 2VYVA 4E3ZA 1A4IA 3Q2KA 1UP7A 3QWIA 4CMKA 3LF2A 5HWSA 1H6AA 3WBBA 2DBRA 1U5AA 4A5OA 2C7GA 4IMPA 3BIOA 4IZHA 2Y66A 1I3NA 1JKIA 3JQ9A 1CERA 4AJ2A 5EL0A 4GX2A 2O4CA 3S2GA 3IJRA 1V8BA 3SC6A 3JQAB 4IY1A 1UXKA 4J0FA 1NQ5A 4Z9XA 3WGYA 4Y67A 2F00A 4ALJA 3LF1A 3NGXA 1E7SA 4ALKA 5G4KA 1ENYA 1VE9A 2CNBA 2WYUA 3BMOA 3LK7A 5ADHA 1YVEI 3K92A 3D5TA 4GX0A 4PLFA 1M66A 1M6HA 3WGQA 4GPD1 1E7YA 4WASA 1P3DA 3GRPA 1R15A 4FC7A 1C0KA 3WWZA 1DDOA 3H5RA 5TIIA 4I5DA 1GZ6A 3HZZA 2PD3A 3RQSA 4GWGA 5JC1A 2G76A 1W8DA 1Z45A 2V7PA 2C2XA 4RGBA 5F1PA 3KLMX 4ZU3A 3KRTA 1DHRA 3EHEA 4BO1A 2GZ2A 1ZK2A 5THQA 4NFYA 3RAJA 2VYNA 1NP3A 4U5QA 3ROKA 2YFHA 2QZ9A 4Q3AA 4ZVVA 4I08A 4PLZA 2CVZA 5DT9A 1BG6A 1PZFA 4YJFA 4GMGA 3RD5A 2GPTA 3DBVO 4UEOA 4WUVA 3D3EA 4BQPA 3TZ6A 4NHEA 2JAPA 3LLSA 2C0CA 3NRCA 1GD1O 2RIRA 5H82A 1MXHA 1H6CA 1AXEA 5L3ZA 2P2SA 2Q1WA 2P91A 4I9HA 4XYLA 3OICA 3AY7A 3WQRA 1E5QA 4N5LA 1XYGA 3FPCA 4I5EA 4BO7A 3CXRA 4CL3A 1UDBA 5HTOA 3ASVA 3DL2A 4RDHA 1Q1NA 2FWMX 4E5YA 3ZWYA 4CM9D 1MGOA 2RCYA 5TC4A 4LW8A 1KYQA 2V6BA 4P4GA 2E48A 3V1UA 1WMBA 2ZIZA 3LC1O 1JU9A 3FR8A 1KOLA 3DB2A 3ENKA 4DA9A 5ILOA 1EQ2A 2DQ4A 4GQAA 5JSFA 2DUWA 2X5KO 2QW8A 4I9UA 4E12A 3WTBA 3ULKA 1LQTA 3GZNB 4NBVA 3LZ6A 4I5FA 3GDOA 4J2OA 1EMDA 5IAAA 4PLPA 5EN4A 3VTZA 3RCBA 4D79A 2OBNA 1I01A 3OEWA 3KHUA 4E5MA 3GEGA 3OH8A 1PQPA 4J43A 2IODA 2AXQA 2YV3A 3F1LA 1PL8A 3GHHA 1U9JA 1K0UA 2XPCA 2FSVA 2NNLD 3O8QA 3GT0A 2EERA 3T7EA 3GDGA 4XCVA 1T2CA 1UAYA 1XLTA 2AHRA 3INGA 1GADO 3ST7A 1J4AA 1RM5A 2C07A 3FWZA 5BQFA 4CLEA 3H7AA 2NVBA 4CV1A 4MVJA 3ITDA 1GYPA 2BELA 1Z74A 2FP4A 3F6YA 4JX8A 3CUKA 4P4LA 1U3UA 2DTEA 1AHHA 4YRAA 2W2KB 1HETA 4J9UE 3IKVA 3IUSA 1OAAA 3GHYA 1XQ1A 3WLEA 3AFMA 2UVDA 2O2YA 1I30A 3Q3CA 4IIVA 5AYVA 3IC5A 1UDAA 3LT2A 4HY3A 3UFXA 1DFIA 4I8XA 3E9MA 4CQLB 2WWRA 4WNCA 3C1TA 3IOYA 2HLPA 3DZGA 2G5CA 5AQ1A 3AI2A 4KUEA 3UCFA 3Q2IA 1PS8A 1R37A 1QXSA 2PR2A 1C1DA 1ZNQO 2NTVA 2ZQZA 5COAA 3HHPA 5ICMA 4YJGA 1A7AA 1DIHA 4UEJA 3PPIA 3C1OA 4IJWA 1GPJA 4JN6B 2V65A 3IDSA 3ROMA 1VSVA 2VZ9A 4J4HA 4S3MA 3MJSA 1P31A 3RUDA 4ZJUA 2X86A 1TB4A 2X0IA 3UICA 1U5CA 4W99A 1IPFA 4CLOA 2D1YA 2C5AA 4KQXA 3TRIA 1P44A 4CM4A 3JQFA 3PQEA 1TVEA 1N8KA 1N5DA 2I65A 3DBHA 1I3MA 3G0OA 4B4WA 3FI9A 4IJKA 4L74A 4F3YA 2I3AA 3FPLA 3GF4A 3ICCA 1PZGA 3NV9A 1ZEMA 3WGGA 4EZBA 1GQYA 3DZFA 2B4TO 1B15A 4YRDA 2WSBA 5G0UA 1ENPA 3ZHXA 5IDXA 1R4MB 4Z0HO 1B2LA 4WOJA 3SXPA 3TOZA 3UHAA 3Q9NA 4CMEC 4YACA 4G5HA 4CV0A 3F1KA 1PZEA 3PJGA 1Z82A 4LVCA 1GZ3A 3E5MA 1B8VA 1NVMB 3VPFA 5I9NA 1P1JA 4BNLA 2DBZA 2PFGA 3UAGA 1Y7TA 1WWKA 2PKRA 2ZB4A 2VHXA 2WM3A 4Z3DA 1FDTA 2JAHA 2P4QA 1IOLA 3HJAA 1BWSA 2JFGA 3UCEA 2W8ZA 3AUSA 3PHJA 5A3JA 3WMWA 1BXGB 4ID9A 4M55A 4E21A 4MVJM 2HKIA 3JQ8B 5FI3A 2DKNA 3BHMA 1D7OA 4XA8A 3VH1A 3S1LA 1H0KA 2HK8A 2B0JA 3KYBA 2ZCUA 2NU6A 3HDHA 1YJ8A 3P5SA 4PLCA 4R3WA 3EZLA 1C14A 2A92A 3PQFA 3FTNA 4PVCA 4BS9A 3AM5A 2EJVA 1E6UA 4FW8A 4HP8A 2CDAA 2B5WA 3JV7A 5IZ4A 2I9PA 1NWCA 3M2PA 3PJDA 1I24A 4BNJA 4CMJA 1SO8A 4OM8A 2CF6A 9LDTA 1Y5MA 3JQAA 1A9ZA 2AQIA 2IZZA 1VL8A 3JQGA 1V0JA 4Z0TA 3JYOA 4J9VA 4YAKA 4RVHA 5BSEA 3AUUA 1TA4A 2EP7A 3AY6A 4XRRA 3WWYA 5IDQA 2VCYA 4IDBA 2EW8A 4OHUA 4JBHA 3KYDA 1MFZA 2JL1A 4OGWA 4L4SA 4CQMA 5BR7A 1H9BA 1TT7A 3FNFA 4BIIA 5IN5A 4YXFA 2PD6A 3WNVA 4ZN6A 1NQAO 1BSVA 3V1TC 2RH4A 3C1AA 1N2SA 3BTVA 1L1FA 1UZLA 3G79A 3VH3A 1HSZA 1LSJA 3QWBA 2CDBA 5ER9A 2RHCA 1KBZA 1R6DA 1EE2A 4UVHA 4J1TA 4BQRA 2HMVA 5DDIP 1EK5A 2LDXA 2GCGA 4BV8A 1HDXA 4DYVA 5L9AA 3EDMA 1SZJG 1KVSA 2IEDA 5C3MA 1UXHA 4R9SA 2NVUA 2H63A 2WD7B 3I6IA 1ISIA 5JLAA 3C24A 5G0TA 3KLPX 1PWZA 1JAXA 2OP1A 4WPGA 2X0NA 3GMDA 1JTVA 5MGBA 2DT5A 1T26A 2QQ5A 1AXGA 5K9ZA 1D3AA 2DM6A 3VH2A 2Q46A 5I7FA 4YYZA 4CM8A 3D3WA 4WLFA 3I9OA 3KXDA 3TOXA 3MEQA 4J0EA 4ROSA 4OH1A 3DMYA 4F6CA 1BGVA 3BMQB 4RO0A 3W1VA 1EFLA 3DTTA 1IULA 3GRKA 3VPSA 4IMRA 1TXGA 1PJ2A 4IGFA 3SX2A 4PFJA 3BA1A 2IDZA 3BTSA 1LBEA 5JXWA 2GLXA 2VHZA 5DCUA 4IQ0A 1AUPA 3NT5A 4LCJA 2YHUA 4UUPA 3ZNOA 2FR8A 3WDSA 4NJMA 2O3JA 3H3FA 4MPDA 4W7HA 1CF2O 4MVJG 3SJ7A 3M2TA 3TPCA 4XEHA 4ALNA 3DHYA 4ND1A 3LT0A 2Q2VA 1RKXA 1JWBB 1S6YA 3G1TA 2Y68A 4WOKA 3RKUA 7ADHA 5TF4A 3JD4A 3GQVA 4DPLA 2Y93A 2VQ3A 3LQFA 1ZBQA 2ZTMA 3GAFA 4CLOB 4GX5A 6ADHA 2Y1FA 2O3TA 3DHEA 4DC0A 1ZUD1 3RC7A 1GFSA 3U09A 4INAA 1YB1A 4ZRMA 3OQBA 2VRCD 5THKA 4IJUA 1E3WA 1R0KA 3PZRA 3IL2A 3JQ6A 3ZWAA 3OIFA 1Y9EA 4J1QA 4FJ1A 5H83A 1X1EA 5CDYA 4PVDA 1XKQA 1LQUA 3GFGA 4RPKA 1WNTA 4HNHA 1GL3A 5HA5A 2JD1A 4Z3KA 4H7PA 4JJIA 1RM4A 3ZWMA 3STHA 4CQMD 3GH3A 5L40A 1KY4A 1M67A 2Q49A 4TRNA 1AGNA 3D4PA 3RC2A 1SPXA 1EVIA 2A9FA 3CIFA 4PLTA 4LSMA 3VC7A 4BNFA 2PZKA 5KTKA 4Q3BA 3WQSB 4BNKA 4Q39A 4YJHA 3LC7O 2CUKA 2O3UA 4GI2A 1MUUA 4RF3A 4PG8A 1LI4A 3ZV5A 3ZV4A 1LJ8A 1KVUA 1K3TA 4IQ8A 2VOJA 3RBXA 5A02A 4FSHA 3I9JA 3L9WA 3A14A 1Y81A 3I9NA 4UUOA 1ZFNA 2NU9A 1SBYA 3VZQA 2D5CA 1KY5A 4YCAA 2CDCA 1Y8RA 4DBZA 4YDRA 4IM7A 4OKIA 2BHLA 1O5IA 1UXJA 4IQGA 4JXKA 1X7DA 2GO1A 2JCXA 1C0PA 3HUDA 1KEVA 1ZK1A 5KWEA 4WLOA 4GGPA 2W4QA 1AE1A 5KOIA 4KDFA 2GGSA 1ZK0A 1NFRA 5FF9A 3I6QA 1PIWA 3PWKA 3TQHA 4CR6A 3QVTA 1GV1A 3GVIA 1HE2A 2PLAA 2EW2A 3ZU2A 4NG5A 1NM5A 3ETDA 3PYMA 1YKFA 3OECA 1C1DB 4TZTA 5JDIC 3KB6A 3L0DA 4FGWA 5JCJD 1Z6ZA 5EJ2A 2X4GA 3KSDO 4FFPA 3QE3A 1LDGA 4I1IA 4XR9A 1PGNA 4DRYA 1E0DA 4OQZA 1LSSA 1ZSYA 1ZCJA 4WNIA 3I4FA 4RPGA 1ULUA 5EPOA 5TT0A 4PG4A 3UUWA 4R16A 3V1YA 3WYEA 2AG8A 2WDZA 3ONFA 4PRKA 3ZW9A 3ETEA 3SLKA 2W2KA 1JKJA 1MG5A 4YB8A 1C0LA 4BNYA 3WG9A 1B0AA 1U7TA 4GVXA 1FK8A 3PRJA 4TZKA 4OYRA 4IDDA 1D1SA 4AG3A 1AHIA 4WECA 3FCOA 2DTDA 1XCBA 3WB9A 1B8PA 1DIAA 2R2GA 1H6BA 4QTZA 3ITKA 3GOHA
chains in the Genus database with same CATH superfamily
2IXDA 5J5VA 3HBJA 3AP2A 3GUUA 1QLJA 4G41A 2FHSA 3UTDA 1GUBA 2RGCA 2P69A 1MEJA 2QBYB 3PX3A 3CVJA 1RLMA 3NIWA 4FIDA 3ZQUA 4BQFA 5DCYA 2X3YA 3TB6A 4ZMRA 4ZCMA 2QJRA 1P6QA 3WFIA 1IY1A 3ZNQA 1C9EA 1Q0RA 4YMSA 3B5IA 1RQGA 4AF8A 4ZAZA 1SPBS 1J0EA 4F71A 2GCEA 1Y98A 3LS2A 2Z4SA 4X7PA 4XB1A 3D2BA 4ARZA 4ZXFA 4FDUA 3HXKA 5F21A 2GN8A 4OUDB 3T3HA 1VHWA 4MS1B 1DLJA 4E1BA 3DV0A 4LYHA 1MHPA 1PGOA 3FNEA 4UASA 4Y2JA 5DM4A 3UEOA 5GGXA 3FY4A 3HB9A 3NASA 1TT5A 3A6JA 1KFKB 2N46A 2OQIA 3LAWA 2ZBQA 4DMKA 4QNNA 3HZOA 2XQFA 1XVAA 2DF8A 4U0JA 1ZL2A 1Q1QA 2NQ8A 1ESMA 3C3KA 1MO6A 1DAFA 5J23A 4KQHA 4DEYA 2WABA 2C2MA 4AJJA 1F3OA 4ZZIA 2N47A 5FWYA 4AI6A 4AJEA 2OD9A 3OSUA 5BURA 4YPOA 3HKEA 2RG7A 4DA8A 5JQGA 3VYWA 2Z43A 4BNDA 2A0WA 4BO2A 1E2BA 3AEQB 2EWMA 2QRHA 3G6WA 3UHOA 3VPGA 3K5PA 4C29A 3JRNA 3TQOA 1JHPA 1SC1A 2P67A 3LLVA 4UXJA 2IZ1A 1Z2EA 1DRVA 2R5FA 5J5CA 3CX3A 4GKKB 1HL3A 3MUEA 4HBZA 4NENB 2JI6A 4REMA 1NGSA 3ZE9A 5CU7A 4JEHA 5CFOA 3TXYA 3UJNA 3RIHA 4G86A 2FMTA 1VL1A 1B0ZA 3CVXA 1V7PC 2XTAA 2ZIGA 3QI7A 1EP2B 5E0OA 3R76A 4EKDA 1VG0B 2OL4A 4AC9A 1Y8ZA 2H5EA 3G0BA 3HU1A 4YDQA 1DIBA 5FPTA 4IS3A 1J56A 3EZ6A 4QU9A 1QGUA 4RIHA 4DN6A 1QDUA 4HQKA 2AEMA 2HIAA 3AXSA 3HVKA 3I1IA 3IO3A 2RDMA 3KQPA 4ML3A 4UMFA 2OC9A 2AI1A 3F5SA 3U4HA 2F90A 2I87A 3KJEA 1R5BA 3IB3A 1QGUB 2YNMC 5KWSA 1E1LA 1EXNA 4JBLA 9LDBA 1X8LA 3AEQA 3GUCA 1OAOC 4G81A 1J23A 3W5CA 2BFBB 2PUTA 3AHCA 1ML3A 3GLVA 4IRUB 2PH1A 1M8KA 2Y3IA 3WLTA 3DCNA 4QNRA 3O92A 3THWB 1TYBE 2VEOA 4FSXA 5L51A 3LTNC 3F4KA 2ORYA 3DP7A 3PDJA 4GRIA 4OJYA 2FEOA 4KXLA 3DV9A 1J09A 4R2WA 3VKWA 4BNDB 4NCHA 2HLHA 2HD4A 2XNKA 1OF1A 5JU6A 1WABA 5ERXA 4INJA 1D2NA 3CWZA 2PAAA 3IBFA 4GM0A 5HUJA 4AIRA 2ZIXA 5FO1A 5HFAA 2BRUC 4DVJA 3TJMA 2ECFA 2VWQA 3RBVA 3KR1A 1LI7A 5HBRA 4F3KA 1KORA 3OG9A 2OZLA 4DV5B 2FFHA 3C4QA 2AZ4A 1S1MA 3T3OA 4B3FX 2LTAA 1QCYA 3LD9A 1H05A 1V8DA 4UMVA 2Q4BA 3CF0A 5KNLA 4NXNB 1RJDA 2QPOA 5SZJA 4XX1A 3MTGA 3VYSB 5A5DA 3MILA 1W0KD 4FGSA 2MMGA 1WW3A 1NBIA 4TMYA 1S2LA 3KL2A 4RV5A 3BGDA 4OHPA 4HSEA 5G2OA 4KN5A 1D09A 3WE7A 1T0IA 5A4DA 1IHUA 1VE3A 2JFUA 3B1ZA 4OQFA 3ZDFA 1YS6A 4NZZA 3TH5A 4BVJA 3CSDA 4RD4A 4PQYA 4YMTA 1H42A 1QORA 5JDCA 2YWDA 5SYNA 1K2WA 3PHGA 3GEMA 1R9JA 4ZOLF 4C4PA 2WKSA 4S1OA 4X1OA 2CHQA 3DMPA 3F4LA 2K7FA 4A10A 4C89A 5ITZB 3F6CA 2WSSD 3L0BA 1BS2A 3LWDA 3PDUA 1V5EA 3CEAA 2OV3A 2RHOA 4KXQA 2PMKA 4P1ZA 1RZRA 2B2NA 2IE8A 4Z4IA 1SCUA 1OH8A 2OESA 1V3VA 4LQLA 1KMMA 5FTKA 4F7WA 1HYGA 1HL7A 5EIAA 1KJ8A 4M1OA 2AKYA 3BGWA 5JFTA 4Q4LA 1E20A 2E1PA 1SNYA 1L7OA 3REQB 1XVTA 2WUWE 1TLFA 1EUZA 4UBKA 2OYCA 3KKKA 2ADMA 4EYEA 4C6HA 2NSJA 1B14A 3VVLA 1MR3F 2REBA 1DWQA 1SBNE 3HJRA 3IIMA 3INNA 3WKCA 4PC7A 1OC2A 3OPYA 1C7IA 3D5QA 4C2BA 5IJ9B 5C32A 4ZQIA 4LY9A 1R8YA 1D04A 2OBLA 3UGKA 1EZZA 2YQ5A 1KI1A 2ZBPA 2PUHA 4OKSA 3ZVRA 4M7PA 1D07A 3CBQA 3DBIA 4DJJA 1KI6A 1U8ZA 2Q4RA 2XW6A 2JGRA 1R88A 2Q3LA 4MA5A 2YR0A 1B6SA 4DQDA 1ZNZA 2FSUA 3GJ6A 5FBRB 1M2HA 1JXOA 2O2IA 3HLTA 5JATA 2F3TA 4LZPA 4FWTA 1NRWA 5HM6A 2HQBA 1T5BA 2J3JA 4QTUB 1PWHA 1XMVA 5T41A 4BE7B 4O3MA 5JPCA 4CIXA 1K27A 4KR2A 1UPUA 1FY2A 3NEYA 3A2KA 2J7PA 1N77A 3ADPA 1RAFA 1AKUA 1CFZA 2IUEA 1IN6A 1UXIA 1JQLB 3KZOA 1VIAA 3PDIA 3PC3A 2FWAA 2X1LA 3P2EA 3RSQA 3SX4A 5AVZA 2JFOA 2I22A 1T1RA 4KAXA 4PQEA 1T5IA 3HBFA 4RGQA 1DXQA 3AOEA 1JAHA 1E2QA 2BMEA 1X86B 2X8WA 3TM5A 1TQ4A 4ON9A 1E8DA 2O57A 2I33A 2FOIA 3HXLA 1U63A 1F2DA 2RBEA 3MS4A 4M1QA 4PZLA 2WWVD 3RBZA 3UANA 4G0WA 3AOEC 1JLHA 1LDYA 4NHOA 2PGIA 1JECA 1WHSA 2R86A 1SG0A 3U4CA 2AD5A 4U7WA 5T4HA 3GLGB 1H2WA 2AN3A 4KFRA 1FXWF 1DEHA 3D43A 3O5AA 1RWWA 2D2IA 1U28A 4M54A 4U2KA 1FMTA 1HYHA 2GPNA 5KS2A 4LFAB 1U11A 3I83A 4Q02A 2B92A 2FSVC 2UDPA 5TXGA 4AYTA 3ONWA 4PHFA 4DTIA 3NWEA 2HJ9A 4BVBA 2JLZA 3CVWA 2JS7A 2R00C 2VT2A 1OI7A 2J3QA 2D6FA 1QUFA 2FFJA 4BECA 2Z56A 3SJZA 5E4FA 4JSYA 3EJWA 3H9EO 1G8MA 5K3BA 4WIAA 2O8CB 3LL7A 1OWOA 3HY4A 4C7BA 2JFQA 3DBLA 1WSAA 2E82A 2GZ3A 1U8AA 3W04A 3SF8B 3DZDA 4XFKA 2PGDA 2Z5LA 2BKLA 5GONB 4BCCA 2QUBA 3NXKA 1EK6A 3G0CA 3MUOA 2Y2VA 1NI4A 1RLJA 3M3DA 3DMTA 3VHQA 3MOSA 2FEXA 3QNMA 3AM1A 3F4BA 2HOQA 4Z99A 4DREA 4FFDA 5KQPA 4GECA 2W58A 4FFLA 3UT6A 2G9NA 4MQ5A 1CBUA 4M0KA 7MHTA 3ES9A 4JUDX 2AFHA 2OP0A 2OMKA 3I8SA 1RSZA 3MC1A 3MHPA 4YVFA 5K3CA 2LBPA 3S0JA 3EC2A 3E8XA 1XLUA 2L82A 4HDOB 2CFCA 2II6A 4HWOA 4NYMQ 1OJ7A 3OE7A 1JH8A 2FWNA 4N5HX 4DUGA 4WY2A 1UC9A 1FVOA 1YR9A 5HQ3A 1H2HA 5E6SA 4CI9A 1JEAA 3KQQA 2O7RA 2ONKA 4FBGA 2ZB8A 2ZTLA 1Q7CA 3VUEA 1QMPA 4UHBA 3FMOB 4RM3A 3U4QA 2JLAA 1OWPA 2CY0A 4H4EA 5A05A 3THYB 2FF5A 3A4IA 4PAGA 5G1NA 4I36A 5K0JA 3GGDA 3U1VA 1C2YA 2HLDA 1QFJA 1K89A 3EZ7A 4B2YA 3TO5A 1VMEA 4FNOA 2RGEA 3KUXA 3KZCA 4I4TA 4XQCA 2QW1A 4QLAA 3WB2A 3SC2A 4XYMA 5GOTA 4W5RA 4I55A 4WBXC 4XAQA 4YV2A 1E4VA 3E9QA 3BHNA 4EGCB 2YOHA 5J43A 3ECSA 4R1LA 4DIFA 2OT3B 5K8IA 2HHAA 1FQKA 4FIZA 3OIVA 3ZHRA 1RJ9A 1SUSA 1T9GS 3B7GA 1K5PA 4CM8B 2GN0A 3EMKA 1AV7A 3KSZO 4I8IA 3EISA 2ERYA 4X6UA 2IYFA 2GEJA 2ZSKA 4KWTA 4Q00A 4EA6A 3WNZA 2GHQA 2LDBA 1RPZA 2B83A 4FTWA 4LHXA 3N59A 2Q45A 3H4TA 1YCGA 2WIDA 3AVXA 4FFOA 1R66A 1XEAA 1FJXA 4HSGA 2PKCA 4A4DA 1A9XA 3BT7A 1IB0A 2FSPA 2PCJA 5EYPB 2VLBA 3K0BA 1HEYA 1ZEJA 2QSYA 4AJ4A 1O94D 2VT7A 4EG3A 4TT8A 5JT1A 1RM3A 2HA6A 3CX4A 3FROA 5EGNA 3TBFA 2V1XA 1CNEA 1UOPA 4Q1DA 3TB4A 1J0BA 4BKRA 1KO1A 4YCCA 3Q7EA 4M6WA 2QRKA 1ONOA 2PRKA 1IZ9A 1PT7A 2GCPA 4U3JA 1TKBA 3GC6A 1RACA 3VNBA 1UDCA 5EXXA 3U31A 4LRTB 1JLRA 2Y6VA 4QG7A 3HUUA 1VKJA 5MFPA 2Q3FA 2AFIA 4Y3UA 1XDSA 3WFJA 4E08A 2XUFA 1LRLA 1QYDA 4D0RA 1XQWA 1P4AA 2EFHB 5BY2A 1IZ7A 621PA 1FSSA 2WMYA 2JLUA 2OGUA 1GV0A 3K1JA 5I7WA 2PVCA 4MITA 5KVQA 3NHYA 4EG5A 5BW4A 4HB3A 2Y0PA 3WWEA 1D1PA 3GRCA 4ZU1X 2QMEA 1ZO8A 3PIRA 3MG9A 2BKEA 3ASYA 1IUPA 1EUCB 3NP9A 1CUZA 3HBAA 4FPXA 4MRRA 2XXBA 1DRKA 1JAYA 4BBZA 3STUA 4O4JF 4LUCA 3KOWA 5FP0A 4TROA 3UZUA 3EOZA 1RS0A 4DMUB 1YHYA 1SB9A 5FAXA 5BNZA 3TR5A 2CUTA 4PCVA 2CF5A 3EEFA 3EBOA 4R8MA 4M0DA 1VCMA 1YL6A 3WL4A 3UJAA 2PX3A 1EEXB 3KB8A 1ADCA 3UIEA 2GBLA 3RFUA 1GNVA 5EPUA 2ENUA 5C5DA 4MVXA 1Q15A 1KP2A 4PYMA 5EE3A 1MDFA 3WGKA 4IDNA 4ND3A 3BMXA 4FEEA 2JBWA 2NV6A 1CXZA 3N5KA 4BMSA 4QM6A 3MWJA 3M4JA 1R27A 3DOEA 4RKYA 4TXNA 3TINA 2VNKA 2XX3A 3I64A 4DLVA 4BP3A 1UFRA 3I09A 3NC1C 1IMJA 2AXPA 5AW1A 1ZICA 4LA4A 4NULA 5F73A 3TPZA 1P8AA 5ESRA 5D5PA 2R8OA 4DLBA 3FAKA 5FI5A 4BQIA 4EO7A 4TRJA 3FTFA 1V2HE 5K1ZA 2TRSB 4EKNB 2WT8A 2JK0A 5J4VA 1NUAA 1Q77A 4G5GA 2D5LA 4UU1A 2HYIC 1TPZA 1GRQA 4KN9S 3ORQA 3PQDA 4V0KA 2JF0A 3LP6A 3SHVA 3D64A 1Y3FE 1C3EA 2AMJA 4M8SA 5LP6F 2ZZMA 5FLYA 2ZUBA 2H00A 3A0UA 2HREA 1CUBA 3PXUA 1HQDA 4WLEA 1Z8DA 4G0QA 1LTKA 1TA0A 3VTFA 3FBGA 3K8OE 3DEHA 4URZR 2OVFA 3T61A 4CNQA 1MX5A 4K9LA 1XJ5A 3B7PA 3GGPA 5DK4A 1THZA 3KC2A 3O2SB 4U8HA 3VBCA 4PSCA 1JG4A 2VJQA 5KSWB 3ONEA 1X39A 3W77A 4X85A 4LXGA 1QHEA 1QIMA 2C7BA 3M70A 3ZUGA 1UBRS 5F2NA 2JFPA 1QFYA 1Z4MA 5C7IO 5ENDA 3NM5A 4MTLA 1JIXA 1B6RA 2GN9A 4V3CA 1I9GA 2QMQA 1WF3A 3TSZA 3AINA 3EXEB 4G4IA 4B48A 3BSSA 3BWEA 1JEDA 3ILYA 4LWQA 3GA0A 3O03A 2G07A 1UFQA 4CR7A 3BB4A 3OZCA 2DLCX 1NR1A 3KQUA 2XRYA 2AA3A 3EGDB 2P2ZA 2WR8A 4C5CA 2ZSUA 3AHEA 2G1PA 3AETA 3V8VA 1F6DA 1MZPA 4LI0A 3C6BA 4BDTA 3TNLA 6NULA 1C3XA 1JW9B 3OFNA 4V3BA 2VP0A 4KEAA 3H9UA 4OXXA 3IDOA 2BWJA 4ZV9A 3EIFA 4OFZA 1T8PA 3ONNA 8OHMA 3V2HA 1PBTA 2BZ1A 3L41A 3PEUA 2F1JA 1GPH1 3ECAA 4DTCA 1GGNA 2HGZA 1XMOB 1IG0A 3HWRA 3AIOA 2B34A 1ND6A 3L40A 1WEKA 3OLWA 1Q1AA 2J5QA 3EVAA 1I0ZA 3T7TA 2JH9A 2ZT8A 4UVDA 3F0TA 1K6EA 2VT6A 3LBNA 1OBFO 2QTCA 3LT4A 1U90A 5L3RA 3F6RA 3RU2A 1UJMA 3PTZA 3ROQA 4DCNA 2X0RA 3O8NA 4JJFA 1QOPB 3B60A 4HMQA 4PAOA 2A30A 5FADA 1OIWA 1E60A 4WLNA 3NS7A 2RI0A 1KHTA 3G8CA 1Y6RA 4AZVA 1ZZGA 5B37A 3VRHA 1XXHE 2JCYA 3RUCA 4C4ZA 2VXOA 5K0CA 2WIFA 4JDUA 5BMVA 2B8JA 2J0QA 4LOKA 4EPYA 4II2A 3QEKA 5JAPA 4JI0B 5ITZA 2FR1A 1VJ1A 5TQ0B 1ICEA 3O9VA 5TGDA 1TVKB 3AR3A 2Z6VA 4C7OB 1JG2A 1M0WA 1NVUQ 4Q05A 4UJ5A 4YCDA 4ACAA 2UUOA 3K2IA 4TLBA 5HQ3B 2O2HA 4QEDA 4XM0A 3ROTA 1F8GA 1F8FA 1MB4A 3W8DA 3KPWA 5L45A 4TS1A 1LVHA 3LQ1A 4I99A 3WI7A 1I14A 1C2TA 3QXXA 1LDEA 1M6VB 4P0PB 1TMOA 3ESYA 3GRFA 3K0HA 3D3QA 3UW1A 5TJ9A 2G0TA 4NU8X 4I1OA 4CMIA 1OBOA 5HPYB 1FYVA 2Q1UA 4GPBA 5EINA 4EIWA 2QAGB 4D26A 1EX6A 2RHBA 4C0JA 2Y1GA 4I1SA 1F7UA 3TX2A 1DC8A 4QQKA 1JB9A 1CS4C 3L01A 4ZVTA 4OOFA 4DMMA 1P0FA 3D7LA 4RANA 5HNKA 1CRLA 2A3RA 4IS2A 1EVJA 5BN5A 4HXGA 4G56A 1F5SA 3SVTA 1A27A 1JEYB 1ZSNA 1HQCA 4WOCA 3OQVA 2VAMA 3P9YA 3QVGB 4FN5A 4RD6A 3SDBA 1R0SA 4W5OA 1KI4A 1MO2A 1AG9A 2R6HA 2XVMA 1R4AA 2HHLA 3OD1A 2IOHA 3ZC3A 1ZQ1A 2F3QA 1C9NA 1UK8A 1YR1A 4ZT2A 2ADFA 3KOZA 5K0GA 1QPZA 4TYMA 4NZPA 1JR4A 1FW8A 5AKKA 1QF7A 1UWLA 3QMWA 3JQDA 5IN4A 1NBHA 3ESRA 1VSUA 2OMEA 1R0YA 1Z7BA 2JDIA 4H7JA 2YMMA 5EC8A 3VU0A 4FR5A 5IG2A 4I7EA 3L4BC 5CA1A 4ZAFA 1GXSB 4PU0A 1J5PA 3VYUB 4CLRB 4DANA 3EXG1 3AP1A 1SC6A 3AR6A 3ABZA 4L8YA 2QN6A 1UBUS 2QX8A 5KHAA 5F33A 2XBUA 4BAUA 4Q6WA 4RTRA 3H2ZA 3E5HA 4JC8A 4BNUA 3HBLA 2UYGA 4YALA 3QMPA 5SV2A 1QCCA 3P9PA 3BAFA 3UXEA 1XWFA 4KGXA 1YB7A 2P78A 4INPA 2YFQA 1T6YA 4OHYA 1ONNA 3KK0A 3PEFA 3IKLA 3N9IA 5KNBD 2VYFA 2H31A 4MARA 1A9TA 5CRIA 4YRRA 1CB7A 4OD0A 1UDRA 1QHSA 2WVGA 4RVGA 2E1RA 7AT1A 2CLKB 3SJCA 4GPEA 2YYAA 4CQJA 1FNDA 4ZOCA 5U4QA 1N6KA 1QGOA 2QU7A 3LUHA 4JWTA 1VL6A 1NUHA 1QE0A 2IRWA 1U0GA 4IDOA 4BQSA 5A4MS 1HDYA 1RFGE 2QR3A 3LK6A 4IFEA 2PMEA 4QPZA 4R2KA 2D8AA 5KNCH 3UOGA 3RWBA 1JBQA 1PI3A 4J76A 4IWXA 1P0PA 4JJZA 4ZARA 3LY8A 3NVKI 1HKHA 2XH8A 1NASA 2F1OA 2Z1DA 8GPBA 2Q9CA 3CLUD 4LOHA 3RAPR 3JWGA 3GUYA 1NJGA 1JSXA 1XQXA 2G63A 1RP7A 2I1QA 2YXEA 4PFQA 2Y27A 4LZAA 4CJXA 2H52A 4BNWA 2WG0A 3AH8A 3L4SO 4TTTS 3ZY6A 4GMHA 2H9YA 1L4YA 1WPQA 4NMWA 4Z1OA 1FFXA 2G5GX 1Q50A 2GETA 3GEBA 1W1WA 5AXCA 4MW6A 5AI0A 4C01A 5C53B 1KVQA 1YKSA 2IXEA 3ASZA 3EMBA 3I92A 5DKFA 5JWRA 4DF3A 3A11A 4D41A 3D0QA 1SUPA 2XBLA 3LQYA 2QL5A 4KGDA 4X63A 1E2PA 5A3VA 1Q20A 4B7ZA 4EY8A 1N8TA 3B1JA 4JQSA 5CJ2A 4B6GA 4RETA 4FLEA 1KKLA 1O7JA 2VDRB 1RAIA 2V7UA 2BH9A 3U4MA 1X7GA 2LP4Y 2C0PA 5FI0B 2V96A 1F5NA 4YTEA 4U2FA 4IGIA 5ALKA 5DW3A 3FWNA 2I4MA 1YIOA 3W05A 2I54A 2VYCA 4UE6A 5JADA 2HA5A 1NE2A 2FZCA 3KU4A 3H8WA 3LG2A 1FSPA 2WC1A 3FETA 3KE8A 4Y6RA 3I05A 4JB8A 2QMYA 1YR8A 3WL5A 2WSIA 3MWGA 3EEQA 4DBVO 3VR5D 1XDZA 1TIPA 1XZ8A 4KMSA 1SU8A 3ZY4A 5KCZA 2R6DA 1JLMA 4EVSA 1S4QA 1BROA 1QFXA 1USKA 2E4ZA 2QX7A 2AXNA 2Y76A 4YJKA 3N0VA 3RF7A 4EI9A 3T7CA 4HZUB 1LPSA 3E4DA 4NMMA 4O4IB 1AB6A 1AD2A 4PC2A 4W9RA 4JL5A 4B3TB 1B2RA 1QDEA 2WWGA 5KNBH 2G9QA 4YXWD 2BSQA 3N74A 1N0VC 1DC4A 2W8BB 4IVPA 1Z5UA 2XTZA 1SU7A 3D8SA 2DFDA 4FFBB 2CNLA 3RVQA 4BKUA 2AR7A 4EDFA 4R8RA 1I1OA 1PJ4A 2CLLB 2OHXA 4P2BA 3WIOA 3ZU6A 3D2CA 3FSRA 4KTVE 2XIJA 1U0FA 3IP7A 4CM7A 8AT1A 1O87A 3ZJ5A 2K4MA 4ZWNA 5HGJA 3ZWCA 5AW4A 2NSDA 1UBHS 3KUDA 3WLKX 1JBEA 4DGSA 4HLUA 3CW9A 2GBIA 1GQOA 1CY7A 1SUEA 4OHWA 3QKTA 1KOFA 3VX3A 3W9UA 1VRWA 2I67A 1MA3A 2DKFA 3R6TA 4MAAA 1ZD8A 4GM4A 4NCXA 3HUTA 3V4ZA 4RHFA 5CVCA 2I2BA 5EP1A 3TDKA 4W6QA 3CF4G 3VR2A 5JCOC 3U49A 4CVNA 4D3SA 3DE7X 3KEMA 1IUKA 2J0SA 3I3OA 2XMPA 4IIEA 3FCEA 3M4ZA 1H5NA 1JQKA 1FJGB 4ZCIA 4WKGA 5T67A 1OAKA 1HT1E 5HFNA 5BSRA 5L7WA 2HDNB 1BCRA 3GLGA 1WQ4A 4JT8A 3W6PA 5TSDA 4D42A 2SKDA 3QYPA 1YL7A 3NCHA 1BE8A 1JTEA 3AFNA 3VZPA 3I04M 3SJAA 2XUAA 3VH4A 2IS2A 4YR7A 1V2GA 1X0XA 1JKXA 3KNZA 5JS7A 1OXTA 1ZN8A 3UBMA 5KTNA 3H99A 3FYSA 2RHRA 4NDNE 2Q6LA 3NG1A 2OHVA 3GMTA 1GZSA 2EFCB 1YC5A 3SVLA 2VLIA 1ETHA 2WJ4A 1OZ0A 3I1FA 4PRYA 2ZVJA 3V2UA 4CF7A 1TYDE 1XAIA 3ANXA 2X19A 2YWJA 3DEKA 4N7MA 2Z95A 1H8EA 3I30X 1EBBA 1GHTA 1LVUA 3O1IC 4L3WA 4MWOA 1QRUA 4RHCA 2PTGA 4F9FA 3IFSA 3COZA 3N28A 3UKOA 4BRZA 2PWAA 3K0SA 3HVRA 4YRTA 1Z6GA 2XYVA 3PPVA 2YICA 4KK3A 1EFRA 1U2QA 1CRWG 4OIFA 1OH7A 2QP4A 4OQNA 3DE3X 1DBPA 3LPMA 5D87A 1CQJB 4ZQEA 2IPXA 1ATZA 3KPVA 2QENA 2FWRA 1TQ8A 3ZHVA 1P7VA 1JT9A 2P9HA 3F3MA 4PONA 4DCCA 1HLDA 2ZI5A 4R7TA 1JKFA 5CA0B 1SVMA 4E70A 1I7PA 1ZRHA 3L2OB 4ZIRA 2JLQA 4EGJA 1TEZA 4O25A 2FR8C 3JQCA 3KEOA 4HDKB 3AGQA 3JQ8A 2JGAA 4MW2A 4F06A 1M2OA 4X6YA 2YJ5A 2VYND 3HFRA 2DPYA 2GYUA 4GSKA 3PT9A 3K0EA 2BGKA 1GAQA 2JIZA 4QXPA 1JHRA 3R3JA 4Q3DA 1ZOLA 2XGOA 4GPZA 2Q6OA 2DPGA 1C4XA 2FQ1A 1LX6A 3DDOA 2HK9A 3CF4A 4JJKA 1L5HA 3X1JA 5AM3A 1XNQB 4O02B 1WSWA 3KLNA 1ZK3A 2RKBA 3C41J 4O63O 5BR8B 4BX2A 3STYA 3HY3A 4N6GA 4NESA 5ESWA 5KJCA 3P26A 1NLMA 3DDWA 2PQ2A 5K8JB 4E1AA 1NN0A 1SA0A 3QU9A 2QVXX 2ZR8A 3T0IA 3LKZA 4EHFA 1E5LA 3P4XA 1IWPB 4K26A 4J2TA 3R7FA 1GR0A 4IIHA 3H11B 2E18A 1P8JA 4EFKA 3KEQA 2XMRA 4OQYA 3W5IA 2UUPA 4QARA 2YFKA 2B98A 3MJVA 4YUXA 5JJBA 3E5NA 3K9FC 4J1NA 1OY1A 1D2GA 4FMCF 2ATCA 3MXTA 1K6MA 1N1EA 1UZNA 1TW3A 4RADA 2ODBA 2A5LA 4RD0A 3NHUA 2YJGA 5HCNA 2QOEA 1CB0A 3SBDA 3BXPA 4BV2A 4KBGA 1Q3HA 1J90A 1RLUA 2P9EA 5JEDA 5E38A 3DPIA 1Y37A 4P9NA 4BZWA 1E6WA 1OBVA 3FOAA 4DIDA 1SOVA 1DE0A 4KR3A 2DP4E 4IJVA 5DHUA 2OGZA 3OM9A 3VQTA 3WZ2A 1ENOA 4LJRA 1KZ1A 5ECDA 2ZTHA 2L42A 1P9WA 4JLWA 2PNFA 4HUQA 2PS1A 3WYFA 4WKPA 5I9BA 2GD1O 3KG2A 1V5GA 2WTBA 2O5RA 1UMDA 3IPYA 4FFRA 1CG6A 4PGFA 1EAMA 3FDJA 3Q0TA 2FRVA 4WA7A 1GGHA 4CKXA 2XMBA 2WIGA 4LF4B 2F17A 1E4EB 1BMFD 1DRWA 3WYCA 1PVVA 1V9CA 3H0KA 3LYUA 3O7MA 5K5EA 3K6KA 4YV0A 1W85A 1G66A 2AYZA 4LVNA 4J03A 1R50A 4NECA 1YRYE 1V96A 1MAHA 2EOAA 4LBVA 4U5XA 4FW9A 3OLZA 4RA6B 3DSRA 2H11A 5ITVA 2LIPA 2X8JB 3GD7A 3L8GA 3OO0A 4KZKA 1FX0A 4KB5A 2I7TA 4WGGA 3SKXA 5AVVA 3F73A 1M2FA 2VEDA 4L4XA 1TJPB 2XHZA 1NW7A 2I7DA 2JFHA 5FBZA 2V97A 1BOFA 2A0KA 2W6MA 3HY6A 4EFMA 3R77A 4B6EA 1V1MB 2IHJA 3VR3D 4RWEA 1V41E 2BEJA 5JBQA 3ZCSA 1DQNA 1PUJA 3FHOA 3IDAA 1VC2A 1Z4NA 4QPJC 2Z6AA 1A72A 2B2XA 3T3GA 2H85A 2ZBDA 2EKLA 5F1KA 4ZAVA 2CJXA 2ZZNA 4ZEVA 4DIBA 4DR4B 1T25A 3W4KA 3VZDA 4AZTA 3OQPA 1N3BA 4L95C 4W63A 2HA2A 3QQ5A 4W6ZA 2HA7A 4CGYA 3K15A 3QRWA 1NW8A 3N2LA 4BVAA 5A1TA 5AUPB 1ODIA 3EZYA 3TPFA 5HKKD 4HFMA 5EPEA 5JANA 3AR4A 4RHTA 4DS3A 1F2UB 1L8QA 3IMEA 1SCAA 4BV9A 1A8QA 2ABWA 2MYPA 4L51A 3PI7A 2XEXA 3WLQA 1MJNA 1YMUA 4JOBA 1JU3A 3P0IA 2A33A 3RSFA 1SKYE 2QX4A 2ZJ0A 4BVEA 2V74B 5THXA 4Y0VA 2O7SA 1BQEA 3WZLA 3MLEA 2DBVO 2J3HA 4J0IA 4DQVA 3QW4B 2H7YA 4Z8YA 4YRKA 2DEUA 3C8UA 1ODSA 2SBTA 3HDYA 3LA8A 4NTZA 4GU5A 1G5FA 2NUPA 1ZOPA 1JDZA 3PP8A 4BRSA 4TRMA 3WIUA 1M9NA 2PWZA 4V1CI 2JFNA 3JD2A 2A1UA 4G0XA 5AJWA 1XTQA 2X9LA 4RAOA 2DQYA 3AB3A 3DZHA 5JY6A 1W5AA 2HBQA 5DYGA 4O8ZA 4RPIA 2BFFB 2VH1A 3HP4A 1XA0A 1GGFA 1MO5A 3D3NA 3UT5B 5B6PA 2NP6A 1G41A 4LOAA 1QIEA 2GN4A 2QUAA 3T5BA 3ZIAD 5H68A 5LFAA 2BT4A 4S24A 1JN0A 3TGLA 3IAFA 1ZYUA 5EWMB 3ICOA 4YRMA 3GGOA 2QLTA 3SIXA 1JDJA 3HABA 4ATNA 2P9JA 2D5AA 1QRAA 2WNSA 3SU8A 4DL9A 2BGJA 3B9QA 1ZIYA 5J1SB 3WLRA 3QOFA 1E2EA 5AHOA 2QLNA 3MMZA 1N6OA 3CX6A 2Q7OE 1XQ9A 3KJGA 3F49S 2QXTA 2C54A 4CMIB 1YJQA 2Y0EA 4RMJA 1MC1A 1G42A 5K09A 3A4VA 1TPYA 5CW2A 4LJKA 4QAJA 1I51A 3H75A 2G17A 3ZXIA 2PUCA 5K3SA 1VBMA 3FLAA 3B5JA 3RNOA 4XPZA 4CKBB 3MPOA 4LJ6A 2I76A 4ESHA 2YV5A 1IH8A 3MF4A 4LNHA 3L0SA 3QPAA 5HMMA 1CEXA 1XCLA 4YCJA 5LD2B 4MDFA 2PEYA 1DS6A 2YWFA 3QLVC 3MWFA 4IV0A 5CYPA 4Z0PA 2QVGA 1KI7A 5IH7A 1UBOS 4LNAA 4ARSA 2ZBGA 4DBLC 4DSTA 2WTUA 2FV8A 4LC9A 1QTNA 3LP8A 5GZ6A 4LHZA 3U39A 4E33A 4PTLA 3FBWA 1CZLA 2IYRA 2HBRA 1PGQA 3GLTA 3RSZA 4DDMA 2W2MA 5C1DA 4AYWA 1XA4A 1A2KC 2RHGB 4FYYA 3G13A 5SZHB 5C81A 4TKVB 4NX2A 1DT5A 3BJZA 3KPYA 2Y99A 3L1HA 3T1VA 4ASUA 1COWD 5AR1A 4M7WA 5EA2A 1ADFA 1R5JA 4RVUA 4D44A 3ZHOA 4KKXB 1WXEA 3HCAA 3M6FA 1LK5A 1E32A 1ATIA 5J2TF 5TT1A 3RWMB 5ESDA 3TECE 1IK6A 1TM3E 1KPHA 1JVBA 1YZFA 5E9QA 4Z3OA 3M6AA 2D7JA 4EFNA 5LZ7A 1Q3KA 3THOA 4AFNA 4L15A 1DV2A 4LJYA 3D6MA 3VSDA 3DJFA 3CE9A 3R0XA 5IJWA 3BD8A 3KUUA 5AKHA 3IPAA 1JJ7A 3H9JA 5TVKA 4B3JA 5D3MB 3V5NA 4JLSA 3J81k 1W88A 3HA5A 4ESEA 2HDWA 1Z6YA 3E27A 1W0CA 5BV8A 2ZYSA 5JISA 3FBTA 1JYSA 2ON6A 3USZA 2VP3A 4CLDA 2IKSA 3IUNA 4GWKA 1UFOA 2J9YB 5CM9C 2AE1A 2GVZC 3UPTA 1HXHA 4AJKA 1GPAA 3TNFA 1O97C 5ALLA 1A2BA 2GYWA 3N0TA 4B8ZA 3A1WA 1WKCA 2XDYA 2BR5A 4EQ6A 2CYCA 1KJNA 4YRBA 1L7EA 2VUUA 2VDWA 3REQA 5BQ3A 4QVIA 4L8VA 5BYAA 4PG6A 1QAOA 2WF7A 4JQZA 2PSHA 1RKUA 4OUDA 5F98A 5I7RA 5TMPA 4EG8A 1X1BA 4BE9A 2REXB 3VO9A 4Q82A 4OIMA 4Y2HA 1MC4A 1N2EA 2GMWA 2O0LA 2ZI7A 1I13A 2WICA 3GFTA 4B4VA 2EBFX 4B6SA 5K3OA 2PL5A 5IK2A 1ZUWA 3GGGA 1NI3A 1X2EA 2VHYA 4CU5A 3LKDA 4BGEA 3MJDA 3WL3A 3I5XA 2YCLA 3EEYA 1GG9A 1JDBC 4J0CA 3K09A 2ATVA 2ZYGA 4UHDA 5ALUA 4BLTA 3LT1A 2CD7A 3BK7A 3ISJA 4H9GA 5JPDA 3CPSA 4EVQA 1QVWA 3C70A 4KRGA 1DCKA 1ZK4A 3AZPA 1FQOA 4A36A 2HMYB 2OXIA 2AW3A 1X15A 1SQGA 1Y3IA 2CHFA 4BO6A 4Y2GA 4EKEA 1VM6A 5DMHA 2BGLA 1WUKS 5ILGA 1P9NA 4V0QA 3DBRA 1LV7A 1NBOA 2BC9A 3FGPA 3WWOA 4A6PA 4FB5A 3ZWPA 3IAAA 3PA6A 2XXJA 2VFAA 1CDEA 3PK0A 3K31A 1E6MA 4O2AB 4R68A 4E3ZA 3OTOB 1ZINA 3DQPA 4GXNA 2E37A 1HDGO 2G83A 3SHWA 2GNAA 3FVQA 4KH1A 4XGIA 2CZCA 2PMDA 4H0FA 4LS3A 3IMGA 4NPHA 4F86A 3RNLA 5GIOE 2PFKA 1FJHA 1EA7A 1M34B 4V0OA 5E7JA 4RHYA 3ZGYA 4CEJA 2CL7X 1J8MF 3HNPA 4LCEA 3BSYA 3AYZB 4M1SA 3L07A 1XIVA 2YV1A 2IXTA 4HH3C 4KJXA 2A86A 1QMGA 3IPLA 4F56A 2QT9A 5KYWA 3JAMA 1L5MA 3PS9A 1H3NA 1COZA 4J3FA 2LR0A 3V7YA 2NZVG 3BF7A 4NJEB 3NGLA 1KSGA 2CMGA 2QG9A 2J5KA 4EYQA 3FSEA 1C7FA 2VF7A 2ZRLA 1S89A 3THRA 4HLNA 1E9SA 1ARZA 5DO9A 4ABTA 1G5IA 3PTLA 4M9QA 4R05A 1KU6A 3VPXA 2WFLA 3M9WA 1JG1A 1JWAB 1UKEA 2XOXA 1R0ZA 2BEUA 3S99A 4BFXA 1OXBB 2MSNA 3KXIA 821PA 1VHLA 3FSGA 1R1DA 2A59A 5FT9A 4INOA 1KE1A 2COEA 1ZVQA 1GVNB 2V55B 4ANFA 2VJCA 4BNHA 4DCOA 3KLBA 5J40A 1SBQA 2GWHA 4P93A 3DCIA 3GCZA 3P0RA 4HVCA 3O4RA 3R0QA 4ZYUA 2C7OA 1VLLA 3V6LA 3RIGA 1XA3A 1THTA 1Z0IA 3HQ4O 3I42A 1TYZA 1XL0A 2FA9A 1JLLB 2Y1OA 5DNEA 4BNZA 3FMVA 4G1EB 1CZUA 4PY2A 2O14A 4UATA 2CK3D 4NF2A 5CX1A 2R84A 2HMWA 2JEZA 4O2RA 1X2BA 4Z4HA 1YACA 1OKKD 5BV0A 2IUFA 4E6PA 4JFAA 1EFPB 2C8LA 4U6QA 2G0NA 3UN1A 4BFTA 3NGMA 4EAAA 3T9CA 4I9GA 3C5HA 2P2YA 4BASA 3CT6A 1PLLA 3CH5A 1KSHA 3CZPA 3DE5X 5AW8A 3RUHA 3ANNA 1SXIA 5DM2A 5AW0A 1MRSA 1USVA 4G0ZA 4WK6A 1IONA 1YUNA 4LY6A 1K8QA 1ZONA 3HP1A 4PRLA 4QDUA 3PQ7A 1F4VA 5D84A 3RSSA 1I36A 3NBMA 1U8UA 3O8DA 2GKOA 4K5QA 5KWVA 2JGEA 521PA 1YCDA 1XKXA 4RYLA 5IAJA 5JSHA 2COKA 4KPUA 1C7JA 2J4FA 1KP3A 4F2HA 4M2LA 4FYMA 2YXLA 1X77A 3UMGA 2QYTA 2Q4EA 3M8KA 2YYYA 2H5IA 3KTAB 2W98A 3IXLA 1ONPA 1XPJA 1YDHA 2Q62A 1KRWA 1OXUA 1QPBA 2Q9BA 2HRRA 3NHWA 1O4WA 5DTMA 2EX1A 4ZOQI 5AESA 3ER6A 1V9SA 2DJ5A 4WEOA 3HCRA 4IHAA 3TI9A 1SK9A 1E1CA 4DRXA 4ZHQF 4RK7A 4P54A 2VP5A 3OT1A 1N32B 1MD9A 1GPBA 2PVPA 4RKWA 3OM1A 4RZ3A 4AJNA 1Z4JA 1WXHA 2AK2A 4Q4DA 3SC2B 1UM8A 3X2SA 4EABA 4F4FA 5CG1A 3VO8A 3Q7SA 1EHCA 4RD1A 1UK9A 1YBAA 3PC2A 1TM2A 2CUNA 1MNQA 3T5TA 4XDZA 4X84A 1J49A 5BUQA 1FYWA 1O0CA 4DQLA 1D7AA 2Q3DA 2W6QA 2POCA 3AW9A 1YR6A 4H7KA 1QFZA 5CT8A 3VISA 1MOPA 1HF3A 1XMJA 3EVDA 1SUFA 2I8CA 3MWEB 421PA 2Q2WA 4K2AA 1L4BA 3CRVA 1B74A 5IKXA 4H17A 4L27A 1J2EA 5T8KC 1A97A 3RU7A 1WEHA 1QJCA 2PUJA 4C0AC 4C05A 3B1XA 4N5IX 2Z9BA 4C87A 4KPGA 1X13A 1XZMA 2QTTA 4RZUA 2AEJA 3B89A 1R74A 3UJ6A 3SAJA 1JR2A 1P74A 3G9XA 4RACA 2GF0A 1WW8A 1P77A 2O8NA 1U0EA 3GNLA 3I04A 2XD4A 3LYAA 4MP3A 1QOZA 2VS1A 2ZIAA 3KFLA 1KMCA 1O77A 4CV2A 5AFSA 1YTUA 2NLOA 2I4IA 3M1LA 4Z49A 3D8RA 1KK3A 2WBLC 1VKHA 5CDFE 1YQDA 1LS1A 1PVDA 2QD1A 3KR0A 3QV1A 1SEVA 3MS2A 4W5HA 3F9IA 4B7XA 3BCUA 1W76A 1UIMA 1NM5C 1ZZEA 3LI2A 4UKDA 3GLGE 6REQA 3WQQA 4YFYA 1X19A 3IDQA 3TOVA 4M53A 2A6PA 3M34A 4UFNA 4LRUA 2ZUFA 4UUMA 2IYZA 3BXZA 3EAFA 4M98A 4YPFA 2P5YA 1QK3A 1W36C 2YZNA 4M0FA 4IIUA 2G08A 1XB2A 1NN1A 2UVPA 3KKLA