2F64A

Crystal structure of nucleoside 2-deoxyribosyltransferase from trypanosoma brucei at 1.6 a resolution with 1-methylquinolin-2(1h)-one bound
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
158
structure length
158
Chain Sequence
HHHHHHMRKIYIAGPAVFNPDMGASYYNKVRELLKKENVMPLIPTDNEATEALDIRQKNIQMIKDCDAVIADLSPFRGHEPDCGTAFEVGCAAALNKMVLTFTSDRRNMREKYGSGVDKDNLRVEGFGLPFNLMLYDGVEVFDSFESAFKYFLANFPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleoside 2-deoxyribosyltransferase
publication title Using fragment cocktail crystallography to assist inhibitor design of Trypanosoma brucei nucleoside 2-deoxyribosyltransferase.
pubmed doi rcsb
source organism Trypanosoma brucei
molecule tags Transferase
total genus 44
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature ec 2.4.2.6: Nucleoside deoxyribosyltransferase.
pdb deposition date 2005-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05014 Nuc_deoxyrib_tr Nucleoside 2-deoxyribosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.450 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2f64A00
5AJTA 4PFKA 4WL0A 1KZHA 3O8NA 1S3FA 2Q4DA 5ITSA 2F64A 3OPYB 3HNOA 3EHDA 2F62A 3O8OB 5AJUA 1YDHA 1S2LA 3MAJA 4MCJA 4I4IA 4KXLA 4P5EA 2A0KA 4JELA 4HX9A 4I7EA 4U1RA 2IZ7A 1WEHA 1S2IA 1PFKA 3F5MA 4LJKA 3UQZA 2KHZA 4FYHA 1MTOA 4I36A 4P5DA 1S2GA 3BQ9A 3GH1A 3O8LA 2NX2A 3OPYA 2F67A 3O8OA 4LJLA 4OHBA 4FYIA 1F8YA 1WEKA 2Q4OA 4RH3A 4NPAA 4FYKA 1S2DA 2PFKA 2KLHA 4LJRA 3QUAA 2IZ6A 3SBXA 2F48A 4KXMA 2PMBA 4JEMA 1ZXXA 4KXNA 3PFKA 3K2QA 1F8XA 1RCUA 4JENA 3U39A 2IZ5A 3IMKA 2HIGA 1T35A 4MEJA 6PFKA 2F2TA 4OHRA 2A33A 4A3SA
chains in the Genus database with same CATH superfamily
4FX2A 4HAOA 1UFRA 2X22A 2O54A 1AU9A 1EFUA 1JKJB 4HYTA 4N8EA 3TF5A 4MIYA 1QZZA 5EKUA 4IOMA 1NN1A 2QXYA 5IVDA 1MC1A 1F3OA 1V6SA 3MRSA 4FXPA 3H86A 4X44A 1OC2A 4ETMA 4UFNA 4UJ5A 2RGEA 1QHXA 5EPOA 2VWPA 4YCNA 4OIFA 4C22A 1SXGA 3FKSD 4H31A 3K15A 4RESA 1FA9A 4WVFA 2QD5A 4MROA 3ZHVA 4MXDA 2O8CA 4TWBA 1Z5UA 1YB2A 1YL7A 1A0OA 1JV2B 5HZMA 3NOXA 1TVEA 1B7GO 1EKXA 2C7GA 4URHA 5T6MA 1QG2A 1DU4A 3LDAA 2JEYA 1QSGA 2OM2A 2Q5OA 3CRNA 4RJJA 1E58A 1JE0A 2XOKA 4EG1A 2G25A 2X1HA 3E58A 4RM3A 4N9WA 3VAZA 1KF0A 1YH3A 3C5CA 5A4KA 1D5CA 4MX8A 5DI3B 1KDTA 1Y63A 1YDEA 1A5TA 1FVFA 2B2NA 1J1IA 2AOTB 2WJPA 2ZYIA 3D7RA 3MCUA 1TQ6A 2HA3A 3E5RA 1Q14A 1ZM2A 1OLXB 1VMAA 4M1QA 3HYRA 4QBIA 4EQ6A 4WY5A 3SIXA 4WK4B 4BMNA 2XXJA 3V7YA 1PG2A 1W9MA 4LJAA 4QHTA 5LA6F 5BSHA 3KB6A 4LRTB 2Q62A 4J3JA 1E2LA 3H8VA 4G9EA 1V1RA 1CJVC 2DBQA 3R6DA 3T61A 3W9BA 3OHPA 5F78A 2PH5A 3BH0A 1W0JA 5AK0A 4OQLA 1B42A 1J09A 3SE0A 3MBKA 4KR0A 3TBHA 2A0XA 4HKTA 4LK2A 3G0GA 2FEXA 3WRYC 1DJOA 1BDHA 1WXWA 2A4MA 1YE5A 2VLIA 5HJ2A 1PK8A 1RHKA 2DFLA 4Q1AA 4BHTA 3GT3A 3AUTA 3R74A 3GXBA 1QC5B 3Q9NA 5BN4A 5A05A 3CY6A 3OZFA 3Q3JB 2F3SA 3P0HA 4KUGA 5JBNA 2A9OA 3LM8A 1W47A 1GFIA 1Q1GA 1QIGA 3PIRA 3A10A 5LQSA 5HFJA 2OD7A 1GEGA 2Y92A 4JLSA 2EEPA 4DSOA 1OV6A 3MCWA 1SVUA 2HOQA 2DH6A 2QI9C 3CWZA 4KO3S 1N8TA 3A6JA 3DVAB 3G79A 4LI3X 1J0XO 4MYHA 2E6KA 3GCXA 2FVXA 1CUFA 2C31A 3O3NB 3HWWA 4PNPA 5H3CA 3S3TA 2QP3A 1UPXA 1X1EA 1FLDA 2OC9A 2R4QA 1ORHA 3CUVA 3OA2A 1C81A 3KYJB 3GLFB 3SHQA 2XB8A 4HNQA 2YX1A 3GLUA 3VYSB 2IEDA 5H80A 5JSZA 3I9NA 1RLOA 1AQNA 4MWZA 3B1FA 1QORA 4JHXA 4K3UA 4ASUA 4X61A 1ZW6A 1P17A 5K0EA 1SG6A 1EGMB 1T8WA 2B8WA 3CNNA 2WKPA 2R8EA 2WPDA 4II2A 1CQZA 3UUWA 1FJGB 2WFLB 1NJ5A 2CXHA 2DTEA 2FPIB 1EWKA 5LZ7A 4B2IA 2D8AA 1C30B 6NULA 2HQSA 4KXFB 5M7EA 2XA1A 4EY3A 1NX9A 3FOCA 4R2WA 1J5XA 1SIOA 4AUMA 2GEBA 1TECE 4LXXA 2XDQB 3WWCA 2EFJA 3L8MA 3TQSA 5IULC 1SBNE 2VIIA 5AXBA 1YRHA 2JBAB 3QLUC 3DBLA 1EXNA 1UM9A 3VDNB 4UTZA 4DYVA 1RM4A 1OBHA 1HFJA 3DDSA 4KQKA 1D4AA 1V4VA 5IH3A 3X2EA 2QLMA 4I50B 2C3MA 2HCJB 3LYHA 3M2TA 4LWPA 4W1PA 4EDHA 2PUHA 5JXGA 5HW0A 2GTHA 1INLA 1Z4PX 1OFHA 4EUKA 4TVBA 3KEQA 1Y0BA 1YOVB 2UYQA 3RTGA 3TIFA 3DGFC 3I9V1 5FPKA 3BCHA 4TSRA 3BHJA 1M6YA 2EL9A 5IM4F 1PJ2A 3EEIA 5AD1A 5H8WA 5DGDA 5K0GA 2BDUA 4HEA6 2J87A 3DXZA 5DIFA 5AESA 3UK6A 5C1OA 2ONZA 4QICA 1H4VB 1CRPA 2BMVA 3GNQA 3WIDA 4BB0A 4KSYA 3A04A 2OY0A 5FCDA 5LIPA 4AW9A 1WUHS 5JR3A 2A78A 5KUTA 5KTSA 3QUCA 2E4AA 3JYHA 2FVYA 2P78A 5IRCD 2O2SA 1SVLA 2Y6UA 1OD6A 1XZFA 1PTJA 2V9PA 1XZEA 1DKMA 1M2VB 4ENUA 5KNCA 1QH1B 4N6NA 3RUFA 3OCUA 3JXEA 4PV7A 2Y1DA 1L5HB 4YT5A 5J59A 1V5EA 4GX1A 1RM0A 1TK9A 1OLUA 1UEIA 2OCYC 5LM3A 1RI5A 3T5TA 3S2ZA 1K0FA 1VQ1A 4RACA 2OECA 3NEJA 4P3OA 5JYEA 1JAYA 4IM7A 2KM1A 2RHMA 5F21A 3I53A 1NWCA 2OESA 3KZNA 4PZ9A 2PDAA 4MWOA 1PNOA 1ZNZA 4H60A 4HB2A 3JR7A 2EP5A 5AIAA 5FOTA 2GZSA 3H2JA 3DBIA 4OP2A 2YHSA 5BV7A 1K75A 2QE7D 3DT8A 4IHQA 3L6DA 4XCQA 4EJ2A 3HVJA 4IIDA 3TZHA 1QLJA 1T4DA 5A4FS 3U9LA 3KQKA 4I4TA 1JTFA 3Q11A 1RJ9B 1JXQA 2PS1A 1Q2XA 4HDCA 3ESYA 1DAMA 1Z5WA 4HAIA 3TOZA 4AZ0B 1S02A 5CDSA 1L4YA 4G24A 4GNKA 4OHFA 4HWOA 3MF4A 3R9XB 1LRLA 4WSOA 3B6JA 4KODA 3F6YA 4MW5A 3SBXA 2WAAA 2Z6UA 2I6FA 5IDYA 2NU6A 1Y6RA 3N8GA 2IODA 5IXJA 1TTPB 4C7OB 2BI4A 3TINA 4J2TA 1E6KA 1VLQA 4URUR 2R7MA 1UP4A 2WF6A 3BWMA 1NRWA 2J3IA 1M1YB 1TMGE 1IZYA 1ENOA 3WYCA 3T3PB 1PUJA 4P33A 4C76A 3ZU3A 2Z6QA 3VO8A 4D0GA 1V11A 3KAKA 5CDYA 3AF0A 3MS7A 5AW4A 4DCOA 4UTNA 1KIAA 2ZUBA 3EGWA 3LY9A 3MAGA 5JTTA 4QYIA 1FU4A 4RA9B 2E89A 1Q1QA 5EHXA 4DY6A 3FNIA 2WF9A 3TQHA 4BMXA 1Q1ZA 4OCZA 3IA7A 4QUEA 4WKCA 2V1UA 1H0RA 1RMQA 2JLZA 2GEUA 3BGWA 3GT7A 3CVWA 2PUEA 5H16A 2ZXUA 4JHLA 3LS2A 4BGIA 1YKGA 1PSZA 1F38A 4QFCA 1BIFA 1M10A 4LJ7A 3IO5A 3U80A 2WTMA 4MIKA 4GDMA 3LKVA 3JSAA 1U5CA 2BR5A 5DB4A 3HEAA 1P19A 3A1DA 3NI2A 4PQFA 3A1TA 3GEGA 3MOSA 3I5YA 2B8TA 5JYBA 4AJ1A 3DCIA 1M1XB 1HC7A 1P4RA 1RYZA 4WNYA 5FWAA 1BWRA 1II0A 3B3QA 2RGUA 3IA2A 4WT7A 3CKYA 4K9PA 3WRYA 4EB3A 1EP1B 3PQEA 4KAAA 3EDRA 2Z2JA 2PUFA 1PWEA 3WLRA 4M0CA 1T2EA 3RU2A 2RJOA 4XPIA 4KI7A 1T9CA 4AT1A 3QUBA 1MC4A 1PGOA 4CTNA 2MT9A 3CIOA 4RO0A 4JR1A 1EJBA 3K0FB 2FWBA 3MS2A 1SVMA 1Y5MA 4HXFB 1DEHA 1JDBC 3O3OB 2HA6A 4TX1A 5DLEA 2JAXA 3ND6A 5BMVA 3ZU6A 5CX4A 1VPDA 2HK8A 2IL1A 3ZK8A 4B45A 5HTOA 4RGYA 4B79A 1C1DB 3EC1A 3T52A 2XJ9A 5H5JA 1YHNA 2YXEA 4PHFA 2X2EA 3EXAA 1DV2A 5SZKB 4IIXA 3IAUA 5DCWA 3WLLA 3PUKA 1X9IA 3K0HA 1T1SA 1Y33E 4B9EA 1G8FA 1QHEA 4HNTA 1MZVA 2F1HA 4JVNA 4XM1A 1OKKD 3GT0A 4EHAA 2D6FA 5FLYA 1E3WB 4BGEA 2ZR9A 4B1FA 1W76A 3JQ9A 1DRWA 2XZPA 2Y0DA 3PS9A 4R2KA 4LF9B 1WZ2A 2CCJA 1OT5A 3N86A 4PBRA 2GZ3A 5B55A 3KKNA 1OZ0A 2Y2UA 4W8GA 4FN4A 4UXHA 1Z2EA 5AUQA 4HX2A 3U09A 5HM8A 1Y8RA 4NL4H 3JZDA 3TTXA 1U7WA 2DGDA 2GRUA 2WTUA 4QAQA 4Z4GA 1QO0A 3NHLA 3EVDA 3R8CA 1ZIPA 4D3DA 5KWJA 1N5KA 4C7VA 3AVWA 1RRCA 1CS0A 3ENNA 2JLBA 3QLUA 1IK6A 3AI1A 4DDKA 4CCYA 4EHJA 5BQFA 1WL8A 5J1SB 1VB5A 4L7QA 3M6FA 4BO0A 1T5DX 4MHTA 1F6BA 1RLJA 2VH5R 5JQWA 5JJLA 1IFXA 1PGJA 3EXG2 3L6CA 4MI9A 4BE7B 3PNLA 1AS0A 1UBUS 1V6CA 3DV2A 1UOQA 4ARUA 2AMLA 3TM4A 4DF3A 5CJJA 5ELXA 1WBJB 4U2GA 4UNIA 2ONJA 2Q1WA 3OFVA 4LVOA 1HNXB 3D6AA 1M2WA 2OHOA 1LWOA 1DP4A 1RMYA 4N7JA 5EESA 2IP4A 4J29A 5FAXA 1AUQA 5E2AA 4RFVA 2IDKA 1BROA 3NR2A 5IC5A 5BT9A 1Q95A 4D79A 3EEBA 5EUCA 2DQZA 3OQPA 4L6IA 4NZYA 4C0SA 4DNPA 1VCHA 1XMSA 4DDTA 2NZXA 2QUIA 5CDFA 4ZOLA 3LBIA 3CU5A 5LLTA 2QM8A 5CVDA 3THYA 3GJQA 3JQ8B 3ZDQA 5CXQA 3DE2X 1VBKA 3SVLA 1X3LA 1J0AA 5TF4A 4OMFG 4R1MA 3BMQB 1L4GA 1MO2A 4Q9AA 3WE7A 3ZI0A 2HR1A 1M8PA 3EIUA 4PZ0A 2NYVA 3C3BA 3L8EA 3HJNA 3PNQA 2YWJA 2IZOA 2ZQZA 3GEMA 3JQ7B 4D0LB 4H3SA 1JSXA 2W2PA 221PA 2AMYA 1PX2A 2IXBA 4G0YA 3VTZA 5IJWA 2MR5A 4WBSA 2NXJA 1JHXA 5I3ZA 3NAZA 4DPLA 1KSJA 1KZGB 1A9ZA 1RTTA 4L0MA 4LX8A 4IIUA 4U9UA 3B1ZA 3LUJA 2Y4OA 2Q5QA 2PGJA 4L8GA 1TT5A 4LTNA 4E5NA 1MG5A 3QBEA 5GPBA 1VFPA 2YRFA 1MZPA 2A1IA 1JE1A 1QYXA 2JDIA 3HJRA 3NW9A 1UWKA 4GOKA 1JAIA 5FQNA 4PX3A 3RNLA 1I9GA 4Q16A 1B2LA 1XDGA 3AI7A 4ALKA 3C8ZA 2PJZA 2RHHA 5KSZA 4EM6A 3AOEC 2H5JA 1NE2A 4IJ5A 4JGBA 3W8EA 4Z9XA 3D0QA 2ZRQA 1BMQA 4DV3B 2B5WA 1IXSB 3AUAA 1T3ZA 3BDAA 4V0OA 3WLNA 4G0ZA 4DAOA 2FSHA 3MWEA 4NV0A 5IARA 3TD9A 3WO1A 2VF4X 3FF1A 3JW8A 1WNTA 1QHSA 1AM4D 2CUNA 2VDJA 4HP8A 3YASA 4DPMA 5KTNA 4L8WB 1Z39A 2G1AA 3K1YA 4R0NA 3A28A 2FQYA 1PNQA 3G3EA 4OP1A 1LU9A 2HC9A 3E4CA 4M1SA 3TLEA 4L5YA 1YB6A 4J76A 4V0NA 1DQSA 2XCRB 5EEHA 3UUEA 2PLNA 4KBGA 2Q0SA 3VOTA 4N3GA 3S7TA 3FYTA 2BL4A 3TZ6A 2OCLA 3G2KA 5EWJA 1GUFA 4POAA 1ZCJA 3HB7A 5IAGA 1O95C 5IDXA 3TUJC 3GAZA 4PO1A 1JFLA 1NW9B 2NZWA 5FOXA 1TPYA 2XHZA 3WKAA 2XMCA 5CH3A 3SE7A 3FOFC 3GFQA 3U4QA 4JXZA 4Q02A 1GSOA 1XEXA 3JAWB 4Z4HA 3NWPA 4UATA 1P7ZA 1KTIA 4BV9A 1TKCA 3AHEA 4AF7A 1T3TA 1PNVA 4W5HA 4UUQA 3RVPA 3A4YA 3C48A 2FXVA 3FY4A 3THRA 2PX0A 5FUXA 4D9IA 3P9RA 4I50F 2VAWA 2XHEA 4K2HA 2FF7A 1Z13A 2I22A 1W4BA 3ECSA 2WHEA 1N9ZA 4MYCA 5ALOA 3GN1A 2VDUE 2BBOA 2XE8A 4I4NA 3AERB 4GOJA 1IOLA 3I8XA 4WJZA 2Q5JA 2IIQA 3PFKA 4OKIA 1T9ZA 3HU5A 5DW0A 3ADBA 1NG9A 5JVDA 3UHAA 3HL4A 1UFVA 5KYYA 1P1HA 3WADA 2JZCA 3DMFA 2PQ6A 4MCAA 2YWXA 4PG6A 4NG4A 5FTNA 3JS5A 2PPVA 5CFOA 3I76A 2Y0CA 1SQ5A 4TZ6A 3CCCA 4ICIA 1ECPA 4TV8A 1H2FA 1JEYA 1TUGA 3NCTA 4XD7D 4HZIA 1SURA 2CFRA 4XIYA 1BEUB 2J9GA 3GMTA 2E2WA 3R7FA 1M66A 5PGMA 1ULHA 4BQRA 1XMOB 4LW8A 3GYBA 1WMAA 4ZQGA 4JP2A 4YCLA 3GR6A 3S40A 1PJ3A 3CUYA 2HDOA 2C5FA 3GXOA 2ORIA 1S9HA 2PKXA 1X13A 2HT1A 1FDIA 5JCZA 2WG1A 1WXDA 3R9IA 3IBGA 1DZ3A 3UF0A 3FWYA 2XUFA 5AK3A 3EPLA 1S1MA 3UWOA 1RYFA 2YVQA 1PJQA 2QTZA 1FVOA 3FUXA 4I5FA 5DHQA 5EHQA 3S2IA 3TSWA 1ZH8A 2AXEA 1GGNA 3FETA 4GRDA 2N1BA 2GERA 3CNEA 1Z18A 3NKVA 4CQLB 4AO7A 1DLJA 2J0QA 2QTBA 2AOXA 3K6JA 1PR1A 2XGGA 4X66B 3NMUF 5JCXA 2QOEA 3P5SA 1HQYE 1II8A 3EEOA 1GAEO 1B0UA 1DDOA 2MSWA 4Q3BA 4V0MA 4Y2JA 5TB5A 1CERA 5T67A 3L84A 4JELA 4ZJPA 2G70A 4NPCA 3OE5A 4U8GA 1K27A 3T3DA 1XNRB 1XD9A 4DLTA 5I5EA 1Q7TA 2A2ZA 3NETA 2RHDA 2ZUSA 4YP1A 4S1NA 3DFKA 1HSOA 5JC1A 4DEXA 3ACDA 1T36B 2ZRAA 2LCQA 2VYVD 3KEGA 2OHVA 4I8DA 4PAOA 1YOBA 4E0BA 4QAJA 4B3JA 4QOEA 1D9ZA 1WUKS 3EOBI 1KY4A 2FQ1A 3W3AA 1R7RA 3TZBA 1VBMA 1GL3A 5LB2A 1XA3A 2VVTA 5EGSA 5BN5B 1YRAA 1SBTA 4NMHA 2P6PA 3CVJA 4MVJE 2ZI4A 2PUBA 1REQB 1KAGA 3P2OA 3LNCA 3PLRA 4GMXA 3AF3A 1OYOA 5KTYA 3LECA 1QCDA 1PT9A 3UXEA 3ECAA 2C4MA 2DTDA 3NJRA 3L0CA 3P97A 3VH3A 1PQ4A 4EATA 2O06A 4QM6A 4B6RA 3RVKA 3L7BA 1T3HA 5SZJA 4H59A 2JGLA 2NGRA 3AY6A 2CV0A 3OLVA 2ZTHA 4ZCSA 3SYLA 2IPXA 1W5AA 4UU8A 2BE7A 2ENUA 4LG1A 5G4KA 3WZLA 4IDGA 3GVCA 4UZEA 5HRCA 3AUSA 4IIHA 5AVZA 4W7HA 3DMPA 3KELA 3KCQA 4XTCS 5HBRA 1O8CA 5JV5A 3ZDCA 4J3FA 4FHCA 3U4AA 2GYWA 4OXRA 4IOLA 4M49A 3AHGA 4KQHA 3FWHA 4YRZA 4XARA 4TWZA 3BKWA 3KJXA 1HT0A 4IDFA 1TM2A 5FWYA 4E33A 5DCLA 3AOEA 2OR3A 2VHZA 5AVOA 5CB6A 3IRVA 2FWNA 4BO1A 3H2HA 2XCUA 1OVGA 2QL6A 1R8QA 3PENA 4DJ5X 5ALVA 4OSEA 4CM8A 1A8HA 1T5OA 4WHMA 4GE0A 3WGQA 4IS2A 4Q21A 2G4LA 3E81A 3RVOA 5TMEA 1Q7GA 4LFCB 3RJMA 1IC6A 5C8YB 1F1BA 1N6LA 2J9RA 2XWJI 2OXRA 2QY9A 1I24A 3NHAA 3P0FA 5PNTA 4RHFA 5DOVA 1Z2DA 2ZT7A 2XITA 1XVVA 3PT5A 4MK4A 1WW2A 1FBNA 1ZU4A 2B34A 5SV2A 1S2NA 2MSCB 4I6JA 3VKWA 4GKVA 2C7RA 1EUQA 1K5GA 5AJTA 2ZYWX 2GD0A 1MT0A 4N39A 4BQFA 4HTFA 1WTAA 1OGYA 1U2EA 1O95A 5DX0A 2A84A 2V7UA 3EPPA 1PRYA 2CMFA 3QPUA 3MD9A 3D0KA 5NLLA 4KPFC 5EJ4A 4OSPA 4GL2A 2YQZA 3KB1A 3O75A 4KQGA 2OQ2A 3AVOA 2NU7A 1YB4A 4UHKA 4YUAA 1H6BA 1HKUA 1RJEA 1TM1E 2W00A 4CJXA 2D7DA 1MJGM 3LOPA 1FYFA 1QYCA 4R8LA 3HXLA 5DN9A 4CFZA 4MYSA 2VRCD 1TAUA 2AC2A 2IEIA 3AYZB 3G23A 4FP9A 4QIHA 5DXJA 3Q4GA 3ZDRA 3FG9A 1GA6A 1YR9A 1EFPA 3M33A 4IXWA 2DFDA 3IAFA 1UBHS 4ALLA 2COEA 4EUFA 1CG6A 4WCVA 3EEFA 2XVAA 2MINB 3NT5A 4QFDA 2L18A 3NWJA 1HTBA 1U7DA 3F0TA 4WOCA 2JRLA 1IJKA 4MA5A 3LF1A 2GPNA 3GRUA 2FY8A 3BH7A 1P4AA 4G81A 4WZZA 4WFQA 3VOSA 4YPVA 2UVPA 1NVWQ 2DEUA 4LVUA 2IF2A 1AZLA 4AIIA 1ZXLA 2AR0A 621PA 5EIEA 4F8JA 3J7AC 1EHIA 2G1UA 3G8BA 1N2CA 5A5FA 2E5FA 2XF2A 3FB1A 4HRYA 4RKRA 3S0JA 4BMSA 1P7YA 5C81A 1DIRA 3Q3VA 4YWHA 1HDZA 1OXVA 4CIYA 3U62A 3NIGB 3T3OA 3WK6A 3F5DA 2AI1A 5GV7A 3AEKB 4RD4A 3SNHA 4DWWA 3WIUA 2QRQA 4JLPA 4BECA 1E2KA 1GU1A 1OQAA 2RSLA 3C5WP 3PXGA 3D8TA 2QAIA 2XCLA 4MR9B 1AE1A 1R66A 1XTSA 1BGVA 2ZRGA 1N2EA 3EBLA 3I64A 4NMLA 1SBZA 1JFTA 3F6RA 4RD6A 4DV6B 2BH9A 5CLQA 3H2SA 2FHSA 3M8KA 2BE9A 2OP1A 3TJMA 1JR3A 1NN5A 3FE2A 5ECYA 1KBOA 1NQXA 1L8AA 3QMPA 2DBVO 3DOHA 4R4JA 3HHEA 3OCCA 1P3Y1 5AT1A 5IASA 1G8PA 1JQLB 4REQB 4CV0A 5IK2A 1WCIB 3LQ4A 1SKUA 3DE0X 4RABA 4ONEA 1T8PA 2H2WA 3RUPA 2YUTA 2CYCA 2R00C 1YZGA 4OHPA 1J5EB 5K6RA 4ZOAA 2ZSUA 3D8NA 1S1CA 1CIJA 3V1KA 5ECDA 1VZ3A 2Q7OE 1J4AA 2PK3A 3F6SA 2B7BA 3CVYA 1KVQA 4E2ZA 1N9KA 1NQWA 3CJRA 1PZFA 2AGVA 2C3YA 3CKLA 1QCYA 2J0VA 2JAWA 1VI2A 2VK8A 3S2EA 3ZW7A 4GBMA 1NXOA 4WKNA 1N6RA 3FFAA 3LY5A 5SYAA 2LD4A 1TVMA 1QP4A 3CB4A 1SY7A 1U0JA 1GZHB 4PCLA 2HD4A 2GOYA 3BQNB 3R3VA 3A6ZA 3W06A 6Q21A 3C1UA 3GF4A 1YDGA 4Q39A 3ZVMA 1T9DA 3GLHB 4RCVA 3RWMB 2ZVJA 4AICA 3KV1A 1ZSYA 2IY8A 1KJIA 3PNSA 4LBVA 5B57C 5EJ2A 4KGZA 4HN4B 2QUKA 3BAZA 1ZI6A 1KKMA 4JASB 3GWZA 4KE7A 1C8KA 5AM4A 1NTOA 3HZZA 4FQ7A 3WFJA 4BNDB 2CJXA 3GQVA 1XDSA 1UAYA 3JASB 4YJFA 3T15A 2CT8A 4LF8B 2B6HA 2HA4A 1TUIA 3AFMA 1QB7A 1TAGA 3BK7A 1L6RA 2I78A 1NFRA 2Z3VA 3TLGA 1SOVA 4GZLA 1HT2E 4DQDA 2QLBA 1ZDMA 3MT7A 1UDXA 4KN5A 1BJRE 3HGTA 1L1RA 2EW8A 1E5XA 1H2XA 2ZGVA 3QU2A 5BSRA 2JKZA 3B20A 4YK7A 3VZQA 3EFHA 1U02A 2FPPB 1P73A 4EVRA 3ESRA 5T6BA 1LNSA 4D9GA 2IU0A 4LZPA 4TQAA 1T29A 4YJHA 5DBHX 3D5EA 4ENTA 1X7DA 4RJIA 4JOSA 4LYJA 4A2CA 1T2FA 1LF5A 3ZS8A 2VQEB 4ZMSA 1GZ5A 3FUTA 1XXHA 3H5IA 1E89A 3LZ6A 1BE8A 1RYYA 1DVRA 2PKCA 2PV0A 2PZJA 4C4TA 3T5CA 2ORVA 3U9SA 3OQNA 2H2AA 3I9LA 1H2YA 3L4SO 4GEGA 5EE9A 3WIOA 1UKBA 2HV8A 2P4UA 4EQZA 4HQRA 2H2IA 2RHGB 5DBFA 5M3BA 1L7PA 1OFGA 4LIPD 2I1VB 4M54A 3DPIA 4LNUB 3FRIA 3DR5A 1MQAA 1W0KA 3PC3A 4HMQA 1RYDA 2IZ0A 2ZSJA 4KTTE 5ADHA 1WUTA 2Q3CA 2VPXA 2ZUVA 4HDKB 1UDRA 3W7VA 1YD7A 5CB8A 3KVYA 1Y4DE 2ZJBA 4HCJA 3QKIA 1A8PA 4EAQA 2W8ZA 4F5YA 4DR5B 4YUWA 2VC2B 4X92A 1GP2A 1MGOA 2JGDA 4OYHA 5EJIA 1B41A 4Q15A 4G26A 3GEHA 2CDCA 1UBLS 1BFKA 2UAGA 3CTPA 4W5RA 3MFYA 2YH2A 3IQZA 3ZGYA 1GPYA 3KVRA 5IP5A 1FUEA 1FL9A 4D4JA 1EUDA 4CQMD 3BT7A 3HUDA 3OZIA 2XUGA 1A5BB 2QAGB 2VJMB 1NF3A 2Z83A 4UVDA 4EENA 3V4RA 1XELA 2J48A 3IV9A 3ADDA 3ZDBA 4BNXA 1A88A 1T8UA 3BSSA 4RY2A 3A6GA 1DEAA 4PZZA 5KAMA 2R751 4JI1B 4B4KA 1CR2A 2QTWB 4EYQA 2RDMA 4NFLA 4GMKA 4IXDA 1E3MA 3JD1A 3KKLA 3TW8B 4RY0A 3D7KA 3UAWA 1EXMA 1IXZA 3EZGA 2I80A 4LRQA 5T57A 2C4HA 5F5NA 1L8LA 1HOTA 3RFVA 1SC6A 3I2FA 4PHCA 1JF8A 3JV7A 4GKJB 4ZOQI 4KX3A 3GA5A 3ZU4A 4QRIA 1OWMA 4IDNA 4LOLA 1JI0A 1UIRA 4YYEA 1FXWA 2ZEJA 4ZFNA 5F7XA 1Y6GA 5F73A 3DLBA 4ZO6A 4DQ0A 3LK6A 1A3CA 2HJGA 1I3OA 2HWYA 5E0KB 4MRPA 2CMKA 4IEEA 1KK2A 2Z4TA 1ADGA 4JB8A 4ND8B 4BLSA 3RAEC 3K0AA 1SCBA 3HR4A 2XYHA 2YJ6A 3SC6A 1EIWA 3S2UA 4Q12A 1RYHA 3ZLVA 1WX1A 1R4NA 3ROPA 5CMLA 1ID1A 1KDYA 3TEFA 1ZUNA 5H4GA 1T2VA 2IYWA 4PRYA 4C2TA 4G0PA 2BAGA 5ENVA 2JBWA 2M6SA 2ZTVA 2QTCA 4CZ2A 3GJTA 3MJFA 3FMFA 4LBYA 1E1QD 1ZBDA 3GFVA 5CNMA 1W9HA 3S2FA 4WH0A 1U81A 4AWBA 1GSHA 1FP4B 1YE8A 1U4SA 1J8QA 2BMFA 3ETEA 4IGAA 3U3XA 4B7ZA 3KE8A 3S70A 1Y3BE 5K0FA 4ZVTA 1GD1O 1VG8A 4RHYA 2G07A 4Y6RA 4IXMA 1Y1LA 1F0PA 2KI5A 4YRCA 4MV4A 1NNSA 3FDXA 4NTZA 4O5OA 4ZK6A 2P9GA 2VDOB 3QP9A 4U7FA 3RNOA 4OX9Y 4ZVNA 3OTIA 4WLVA 3ZE0B 3L7CA 1F2VA 2A88A 2EGHA 4MDHA 3NBAA 1NUAA 4FOSA 1K0UA 1RP1A 3MAJA 3EIEA 4BC0A 3RG8A 5KDDA 2CNKA 5LQCA 3CPJB 3DOOA 5G1OA 2JVIA 1ZD2P 1KJZA 4X41A 4J94A 4AJ2A 5K6TA 3DDCA 4WOJA 3EE6A 3I37X 4FYJA 3UC5A 1K6XA 3UT6A 2DOKA 3DEAA 4Q9JA 3RVMA 5J2TA 1LSSA 3IEVA 4PX2A 4OP3A 3QE4A 1B6RA 5FWXB 2VPYA 4XEUA 3MGGA 4L2IA 3UWSA 5EJ7A 4E08A 5FLXA 2WWHA 2FP4A 4IG9A 2NO6A 4YQEA 1F5NA 1ZH0A 4ZOBA 4MQBA 3N2GA 1TMOA 1HRDA 1IM5A 3GCZA 3WB9A 1JDZA 1GRRA 1NBEA 4TRRA 1BH6A 2Q0HA 4BNTA 3DP7A 5F23A 2E85A 2QSYA 3ZNQA 2RGAA 3LT2A 5IN4A 4EPTA 1NKVA 1EWYA 1FU7A 3RU7A 2ZUUA 2GNOA 3P2EA 4AP9A 1RRPA 2ZBDA 3G59A 5C8YF 2J4CA 2H52A 3PQFA 4V0SA 3UMFA 2IPAB 3CTMA 4D74A 1D6NA 1P33A 3FI0A 3DCJA 1I8TA 3LVQE 1Z5OA 3KT6A 1NVFA 3TN7A 2XH8A 5AYVA 4WUTA 3VPBA 4CTOA 2R1VB 1H6DA 1DNPA 4BTEA 3ECCA 4U7WA 2Q6IA 4YJ2F 1G1AA 7YASA 5ITZB 1OWOA 1QOQB 1Z4MA 2ZR0A 3OC0A 4Y6GB 2IEGA 4PC1A 5CFMA 4ZPXA 3IUMA 3R9KA 3TCKA 1E2EA 4OU5A 1KGSA 2Q5FA 4JZKA 4NNOA 1ZR2A 1O0BA 3IT3A 4AS3A 1QIDA 1XAGA 4FLMA 4L4RA 4NJMA 3OMWA 4TS1A 1FW6A 3RAJA 2IQIA 1P31A 2OHJA 2VJBA 4Q0MA 4AY5A 1T5HX 1DAFA 4IF4A 5FJIA 3WXMA 3L43A 1EUYA 1BX3A 4RQBA 2PMFA 4MUEA 4BMZA 5IJ9A 3H9BA 1SU6A 1KQPA 2FLVA 2XVYA 2E4UA 3IBFA 5EZYA 1HNZB 3DYBA 4G84A 2ZE8A 5G0UA 3UV7A 1N2SA 1BKDR 1Q19A 1OFVA 1W30A 1L9XA 2NVWA 4FDVA 1RWXA 2XOKD 3JRXA 2GASA 2IS6A 2IHVA 2QRMA 1VPVA 4DCVA 2GJ9A 4FBMA 1JJVA 2UZ1A 3BIJA 1T24A 4EA8A 5EE0A 3I2KA 3DOIA 4F3RA 3QFRA 2O9JA 3D8UA 1PK7A 1Y8ZA 1XZQA 1LS6A 3BFKA 3I52A 2YBDA 2ZBQA 4L9RA 1F7UA 4AX8A 2NUPA 4XE5A 4K46A 1QZ3A 2XTZA 3CINA 1XAJA 2P6RA 3CUEF 3MM4A 4A3SA 4BAUA 4POOA 5JXIA 3HA3A 2BMAA 4FFNA 1YHZA 1Q7BA 3BH6A 5AH0A 1KEZA 2PN1A 4O4LF 1NM5A 4PN3A 1EB9A 3HV0A 1C1XB 2PRYA 1W5SA 2C9YA 2ZPAA 5FI1B 1YC5A 4CMJA 4BQEA 4X20B 2QWXA 1G19A 4BYMA 1W0JD 1MG0A 2CDAA 4GOOD 4JR0A 5EPEA 1E60A 1N8SA 2NP6A 2BMEA 3T8YA 5FUBA 4B31A 4A03A 2CL0X 3KTAA 2IS4A 1QS0B 2PZAA 3REQA 1C0IA 4MV7A 2ZUCA 3T9EA 2XYPA 1XNHA 2EFDB 1T3SA 2Q5EA 1NKSA 2HCBA 3WGJA 3MTDA 4UULA 2ADOA 4FKMA 4HG2A 3E4DA 2J08A 4HNAB 5BMOA 2J59A 3Q7SA 2XJ4A 3I2YX 4HXEB 3BE6A 4OKSA 2R84A 1VE5A 4JI4B 1A7JA 3P7MA 3RYCA 1WAMA 1GUAA 2P2SA 2RGNC 4X1YA 1SIUA 2UVDA 2VAVA 4HDRA 1S3SA 1ZQ1A 2WWVD 3HV2A 4IMRA 2IZ7A 3A3NA 2FR8C 2HMAA 1VHLA 2ZTUA 1NLYA 1SXJC 2VI5A 3M2PA 1M9NA 2HV9A 4NG5A 4O25A 1AXEA 4EGFA 1XMJA 3TYXA 4RY9A 1RXWA 2RK3A 2CL6X 4B48A 1MEJA 4CBVA 2F00A 5ALWA 4WLFA 1W5FA 1I2BA 4P7BA 4UCXA 3T1TA 3HZOA 1Z0SA 4GM1A 2QR3A 2GARA 4NULA 4XWTA 3QEAZ 4IAOA 1RQLA 3O1LA 4BLUA 2A5LA 1ORIA 1M0SA 4BX2A 1HLFA 1OAAA 1N8NA 1I33A 2V5AA 2YYZA 4TXJA 5LQUA 1ZRSA 1NNEA 4YUVA 4FYVA 5I9BA 1L4LA 5DVZA 3IKMB 2WSSA 5B1YA 2VCYA 2OZKA 3F4BA 5C7OO 2X42A 4MRRA 4HATA 4HQ6A 1E0KA 3BCUA 1OFUA 2FW6A 2VBIA 4DNQA 4YT8A 2C9CA 1JAZA 4QQFA 2P0EA 2ZWOA 4DZTA 4XRRA 1OREA 1RRGA 1XN4A 3CEPB 2CVHA 4NPHA 1AQJA 4D8VA 4DIBA 3CNHA 4JI2B 4RELA 3TMYA 1ZN7A 1Y89A 4DCTA 3GI1A 4YQFA 5A3QA 1OA0A 1K6EA 2QORA 2ERCA 4NYJQ 4P22A 5HG0A 2D62A 5FA8A 5I9MA 5JJ5A 9ATCA 1Y4AE 2ZAIA 3D4LA 3QV1A 2H2FA 1OLSA 3ILHA 5BRNA 5KTMA 1KEUA 3MERA 4KXNA 4D8WA 4TS4A 3UKJA 4BKQA 3AMVA 3QEOA 4R7TA 4Q4HA 1U04A 2YWEA 3DL2A 1D0VA 4H0NA 1G21E 3DB2A 1W49A 3DZCA 3EZYA 3B38A 3LSTA 2OCGA 3IV7A 4BASA 1SHTX 1VBFA 2O8VA 1OIXA 4JJ7A 3IBCA 3NBUA 5HK8A 4CLHA 1SCUB 4MRVA 3V8VA 5IANA 3EVEA 5EJGA 4LDQA 3C7KA 1NMEA 2QJOA 4O08A 4UE3S 1UBNA 3AX6A 3CLHA 3W5SA 4X45A 5CNKA 2CHFA 4UHFA 2C42A 2YN0A 5TV2A 4TSFD 3VPFA 5EUMA 5JMWA 4FFBA 1OUMA 2W0SA 5IAOA 3DV0B 1FOEB 1LBEA 1BN7A 1RWVA 3HMQA 5L40A 4IVPA 5A6SB 4D9HA 2C94A 3BC1A 1L2TA 2GPJA 3BJRA 1JFFB 3H8WA 3NQ41 3R7WB 5LIRA 3RHFA 1KZHA 2F7SA 4MUKA 4OD0A 2P9BA 4BZZA 1ANKA 1JYFA 2CJPA 1UT6A 2CL5A 3H87A 4R1LA 1TYAE 4AFNA 1VECA 1P2DA 3MJ4A 5DU2A 4WZ6A 3U56A 1BC5A 1R50A 2VSQA 2EFYA 3UH0A 5MHTA 4BFYA 3HNOA 3CF2A 1PR0A 2CUZA 3KVNA 3IEMA 1EI9A 4HB3A 4LV6A 1ENYA 4J1TC 3EQ2A 4AQYB 3ELDA 3K6KA 2CE2X 3G0HA 3A1SA 1FRQA 3V3KA 1RYBA 2QMOA 5HRUA 3LX6A 3W1EA 4W7SA 3FTEA 2PZLA 5A1TA 3SEQA 3KQQA 3NUGA 3AW9A 4WZBB 3PQDA 3A3OA 4FI3F 2QQFA 3Q3EA 3SIWA 4C4OA 4FYXA 1S2IA 3LC0A 5HGJA 1RNLA 2F43A 1PDWA 4TLBA 2XCTB 4HH4A 4P7FA 4RD0A 3CX3A 2NQ8A 3PX3A 3RREA 4B3HA 3DQZA 4ZWNA 4M8IA 1X7XA 5B58T 5E1MA 1U31A 1PS9A 3SSOA 1XCGB 2WR8A 1S8FA 2QNBA 3RHSA 1ENPA 1E9EA 2I3ZA 3TVDA 2PG3A 3E3AA 4M4SA 3A3KA 3A9RA 2ZROA 1O94C 5HPYB 1P4SA 1QLHA 5I7RA 2VJNA 4JD5A 5TQ2A 2E55A 2ENWA 4N9QA 2ZU0C 3K5PA 3L77A 5CT8A 3FH0A 1UXGA 2VL7A 5AUPB 3TRHA 1Z15A 1P1IA 3QU5A 3GLIB 1XWFA 3BA6A 3QVSA 4OK6A 3VH4A 4EB6A 2Z9CA 3H17A 3N70A 3NALA 4H7JA 4J0CA 2BEVB 3PXEA 2O8NA 4LFAB 4H4DA 4CKEB 2B5VA 5JASA 1SK8A 3DUWA 2ST1A 3NGLA 4DZRA 2VBCA 5I9NA 2W9XA 3BTUA 2X0KA 1CJMA 4IZ6A 1LK0A 1WY5A 1G5FA 3B9PA 3QE2A 5FR2A 3D8RA 1RZ3A 4A0RA 4H1WA 5LN1A 5KU1A 5CBPB 3QY0A 1X1TA 2GS9A 3IULA 3W78A 3SFZA 3ABIA 2HDHA 3PE6A 3IKTA 1IONA 1JAHA 3PYLA 5GP1A 3FUCA 3ISJA 1E6LA 3FB4A 4W82A 3T1NA 4M38A 3E5MA 3B7WA 4DA7A 1QFZA 2PWAA 4GM0A 4JK3A 3ORHA 4KZPA 3OEWA 2BKAA 3ZCPA 4QOSA 3T1QA 5L7WA 4ZYWA 2FOXA 3C4QA 4UD6A 3S8EA 3B1JA 4YRNA 3NANA 2Q9BA 2BISA 2RGNA 3DKKA 4NBVA 5CGZA 5BUCA 1XRQA 5K99A 2WD7A 3PSAA 3GNLA 4X90A 2KBFA 2XW6A 3V1UA 2EW2A 4G0NA 2PU5A 3STWA 1BW9A 1O0SA 1SXJA 3A9UA 2ID7A 5TR9A 3LT1A 3EH2A 3P0JA 1Y5IA 2JI6A 1L0BA 3JWIA 3NGMA 4L8FA 1XTJA 1OX5A 4YJ3B 3PE4A 4RS3A 3II6X 3O2SB 4HAVA 1V9LA 1Y3HA 3EVZA 3CUWA 4ZTUB 1WXFA 4KPUB 1FSSA 1P44A 4G09A 3UKDA 3VU0A 3EZLA 3O0TA 2POQX 3EXFA 2W6JA 4CLOB 5DYIA 1DJLA 3G5LA 3KDAA 2XWSA 3EDQA 4Q1DA 3WQQA 1WVGA 3RVLA 4ARVA 5K5EA 5E2IA 3MGCA 1L5KA 3K6SB 4P35A 1ORRA 2ZFUA 1VE1A 3RFCA 4LNHA 5HIAA 1ZA1A 4NKRA 5FOUA 4AWAA 2ZDHA 5IT0A 4CM6A 1R8SA 1WB6A 3GZTB 1QFJA 1F8GA 4TL8A 1NBHA 4YCDA 1P1FA 2VRWA 3M6IA 2GPWA 3EHEA 3MXTA 4OGGA 2D2IA 4PIMA 1WUIS 4OB8A 3B12A 3UV6A 3HK2A 3AUKA 3AL2A 5KWEA 3JZMA 3HBFA 4ENPA 2KX7A 3THOA 2QW1A 2YWGA 3FYSA 4ZEWA 2PYDA 2QJWA 3RO7A 3ZXXA 5B7NA 1XU9A 3FFBA 1KMMA 4RL6A 2I65A 1LNZA 4JL6A 5J23A 3P8ZA 1LVHA 1YQWA 2Q6TA 1WKBA 3HBMA 1AKEA 2C9ZA 2H5IA 2BWJA 2M98A 2MSEB 2VHYA 2VBGA 5LC1A 1HE2A 1SUEA 2ZW9A 2HU5A 3EVGA 1OXUA 3K0KA 1KVRA 2QGZA 1DL5A 4WY8A 4NI5A 3TJZA 3TOSA 5IT9A 2TS1A 1Q0HA 3W79A 3PJFA 2V9ZA 2NMVA 2HSZA 3RVDA 3FWPA 4GG1A 3DMTC 1M1UA 1H42A 4F72A 4BLVA 5DNCA 4QDUA 1ZUD1 3JR3A 4I9HA 1PYGA 2NSYA 3CS3A 2V6GA 3MAAC 2CEAA 2WG0A 1SBYA 1PZNA 3VNQA 3JQCA 3LHKA 1T0IA 2BFEB 2ID4A 5ICFA 3BBPA 1J70A 2J3JA 4RFSA 4N5MA 4LS3A 2IVZA 4ZVOA 3TSAA 1DG3A 2HLNA 4EY5A 1F0YA 2ZQ5A 3Q12A 5HOEA 3ND7A 1XQ6A 1VGVA 3HI6A 2J67A 3IPXA 3NDIA 4DLZA 4TWJA 2RI1A 1X6VA 2I4MA 1KU0A 1NBMA 2PYIA 1GLVA 2CK3A 3IR6A 3OFKA 4J2OA 1FRFS 2WT8A 4N7BA 3TRKA 3AY3A 3L7YA 4NLLA 1Z74A 4E5YA 3M1AA 3LDFA 3PDIB 2NZJA 4G56A 3ES9A 3NHRA 1PBTA 4IY1A 4AMZA 3BD7A 2ORYA 3W5CA 4G0WA 3MUEA 1DARA 3OU7A 3BPSA 5LB4A 2IZ5A 2L42A 3CONA 3OC6A 1K4YA 2PFGA 3FBGA 3AM5A 1NYRA 4G1EB 5BSKA 3SQMA 2L0XA 2I8AA 3CURA 2RGDA 1I10A 1SC4A 1ZCAA 1Y37A 4QUDA 3EODA 3MJRA 1QP0A 4CLRB 1FYEA 1P3JA 3K0EA 4RHXA 4UTRA 1F8UA 5KYXB 2PUWA 5CVEA 4CYMA 3KD3A 5BV1A 1A9SA 1Q15A 2W2TA 3ED5A 4IEIA 3A9WA 3SU8A 3C1AA 3WHKA 3TO5A 3KQUA 4NDZA 1TTHA 1LVUA 3PUVA 4Y2GA 1LV8A 4O1IA 1O94A 2C7VA 3QELB 5REQB 2QV0A 2O1XA 2IV7A 2WM3A 3UAXA 3B36A 1FDUA 4XOIA 3P2KA 3WWOA 2HPHA 3ZY4A 2YHIB 4OH7A 3PRJA 3L92A 5D6NA 1J2TA 1V48A 3GY0A 4A8TA 2X2FA 7ABPA 1SXIA 4KVGA 2VA8A 2ZI5A 1KNXA 1RW4A 1IVNA 1EP3B 2HWUA 4X24A 4I4LA 3OJFA 2CLCX 2IPOA 4D0SA 2O05A 4KN8A 3L1IA 1UPTA 4UAJA 1Y34E 4C3UA 1TA0A 1T1IA 2QN7A 2BI8A 3UHPA 3DEHA 4MRSA 4RMNA 4HX5A 2ZANA 1NI4B 1Y6JA 4C2UA 2GM4A 3MRTA 3IPRA 5FNZA 2ECKA 3EA0A 4N5DA 1MVOA 4W8HA 2Q9AA 4CODB 1IY9A 3PHLA 4M8SA 4DIUA 5KNCD 3QMVA 3RWBA 4RANA 2J41A 5F35A 1JYSA 2UUBB 2XUPA 3QVGB 2JJQA 2DUUA 4PAGA 4R40A 4HT3B 3KR1A 4LBZA 1RM3A 4BQOA 4BBAA 1N3IA 4OREX 2RHWA 2GTPA 4R7ZA 5E1OA 1U0EA 4R68A 4RQUA 3RSLA 1XSEA 4IYJA 1LFAA 2XKKA 3TW6A 1FF9A 1ZYUA 3HZHA 2B8NA 1C2YA 1GG8A 1UPBA 3ZV5A 3P9ZA 1GAXA 3FWKA 1Y4ZA 3COPA 1P2SA 3IAXA 4TL7A 3ZKWB 4FN5A 3K35A 3OZXA 1GPUA 3PI6A 4ZCLA 1HYHA 3RRXA 2UYOA 2GFIA 4PZEA 3FHLA 5DZSA 2ODBA 4TQGA 3HXQA 1NVMB 3OQIA 1V4BA 1AOXA 2IDMA 2B8JA 3RUDA 3X3HA 2BSAA 4BO2A 3WO0A 1BCRA 3H8JA 1YZLA 3A06A 3H2BA 1X74A 1J9ZA 4PHTA 2JIOA 1EA7A 1NSTA 3I0ZA 1NYQA 5F2KA 2ZKIA 2WMDA 2VJDA 2W4QA 1UWVA 3PDHA 4BFUA 1H93A 3ZG6A 1MJ5A 3H04A 3MWDB 2WUFA 1NW6A 1XHEA 4BRWA 4ZZIA 4ZCIA 1UFQA 1UMBA 4HAZA 1G59A 4A92A 5DASA 2QVYX 2WUDA 5JG7A 4BVBA 1FX1A 1NI5A 4FQ8A 4EBBA 4J0FA 2BHLA 1W581 2RB5A 2NUAA 3E5NA 2IC5A 1Q0SA 3IYLW 1RDFA 1RZRA 1YULA 4PAQA 4M0KA 3GT4A 5IMSA 2HFKA 5ALGA 3JQBC 5BSWA 2AQ8A 1ZEMA 5GQSA 5C1DA 4RIFA 3RV4A 4C7KA 3LCRA 3STVA 3VJRA 2GK6A 4KFSA 3Q7RA 4IWXA 1Z17A 4YDRA 2C2BA 2YJZA 2J4FA 2BKXA 2ODWA 3WNBA 2WWXA 3HDJA 1PFVA 1IEWA 4X8OA 4OVKA 3B1KA 3C15C 3QWIA 3SP1A 1RTKA 1UK6A 3HUEA 3FOEC 2XXBA 4GI3A 9LDTA 3DAFA 3INYA 2CJWB 2H9YA 1AHNA 1K4MA 4M1WA 4IGKA 3PQCA 4DLSA 4GKBA 1RKBA 1U7TA 3F7TA 4KXUA 1J97A 1M7HA 4CDGA 1ZVKA 3D2BA 3OJEA 4LQCA 2CN1A 1BXRB 1XDBA 2PGOA 4UNPA 4UVIA 5COBA 3DMTA 4BWFB 4JA2A 2QIOA 1U0BB 5TRTA 2C04A 3W2EA 3WIVA 5JQGB 2HWXA 3BXPA 5L51A 1T5IA 2IXDA 3F71A 2APJA 1UANA 4W9MC 4JQOA 2PL9A 4WZAA 2CLOB 2DKNA 2PA3A 1NUPA 3UPTA 2C1EA 2XUOA 3A1CA 4IFBA 4CMBA 2CYAA 1KRHA 4LRSB 2V7GA 4EG4A 1WXIA 2QN3A 3BL8A 1BE0A 2V0CA 2ZKLA 4IJKA 5I48A 2FEAA 3ICEA 1FFYA 5LZ9A 5YASA 3Q2OA 4EG6A 2P27A 4JB0A 2BYTA 4BP1A 1E3DA 4A2PA 1RABA 3VI3B 5FNVA 2PMEA 2JFUA 4JU8A 2MOKA 4GLOA 4U2BA 3EPJA 5C80A 2IXEA 2DY0A 2YJGA 4UJ3A 3Q7PA 3U7QA 2V7EA 3FPJA 4GVPA 3CC8A 1NMYA 2D0PB 3N2ZB 5BT8A 1Q74A 1R4MA 4RTKA 4ZODA 3ZCUA 1EG2A 4IR7A 2PCLA 4KQIA 4NONA 1NMQA 4ZVUA 4MS1B 3STYA 2NZYA 3QYJA 1TM5E 1HYQA 1EQUA 3RSFA 1H05A 1ECFA 5IC4A 4FMPA 1GRNA 3MCVA 4EEKA 4KSCA 2V3VA 4CQMB 2R6ZA 2WWIA 3OLXA 1SNYA 3H11B 5DM1A 4PVDA 1MO3A 3EA5A 4WFJA 4AG6A 1MAAA 3CX4A 2ZM5A 1Z68A 4YJ3F 2RG1A 4IIYA 5DSZA 5TT1A 1M5UA 5GONF 3UBTA 1U9IC 4P53A 3UIEA 4NPAA 4L08A 3NRBA 3H2ZA 2PX5A 2AZTA 3TLBA 3ESBA 3SC4A 1J24A 3ER6A 3PGMA 1D0SA 1M1NA 1T91A 4UBKA 5EWLB 3AEUB 3PA8A 3AGPA 2DFKB 2QPAA 2P35A 1EQAA 3L2OB 3ZBPA 4OHCA 4ARZA 4GYKA 3OAAD 3DKPA 1YZKA 4QXAA 5HDQA 4A7PA 1E7MA 2GX6A 1PFWA 1PR9A 3BB4A 3KE9A 1YVUA 3N6XA 4AJHA 4AY2A 5J5AA 4BTLA 1BVHA 1U7UA 1QIFA 2QVXX 1N5DA 3E18A 4WA7A 1EVYA 5F7JA 5EUBA 2Z57A 2YINC 2OT3B 5TF0A 1I3CA 2PKEA 1MLDA 1ZOPA 2Y68A 1H4SA 3SQXA 3U3MA 1MOPA 2C3PA 5LDGA 1V8ZA 4GDFA 3OOJA 4RTOA 1G2OA 1ISMA 1YI8A 3PCTA 1AC5A 5EYPB 2RGCA 4FYWA 3ZH2A 1S2MA 1PKEA 1MFPA 2QU7A 2OFXA 5LBUA 1Y6FA 3VSDA 1QRTA 1VSTA 2YUIA 3WNCA 2PT9A 1WZNA 1GU0A 4B7UA 3ROZA 2R11A 4MSUA 4G0UA 4WAUA 1FS5A 3O9VA 1E0DA 1FDVA 4IO1A 2ZI9A 3H7IA 1N2JA 2YJTD 4P4SB 4HN2A 4TQ9A 3UPUA 5KYTA 4LZOA 4L3OA 4U2CA 2DY1A 4MGIR 2PXAA 2DJIA 4L0QA 4RPLA 1E2GA 3SQLA 3WLOA 3PGKA 4E13A 2ZJ5A 2NN3C 5JANA 2BZGA 2IYZA 2Y1WA 3Q9LA 4YS6A 4B4DA 1IYZA 2C5AA 3RQSA 3Q3HA 1QTNA 3IURA 2GYVA 3IJPA 1OYVA 3IOCA 4US2R 2YXBA 1ADJA 2IX3A 3U4HA 3VH2A 4OY3A 4HF7A 4EX6A 1P8AA 5JCPA 3KQNA 1Y4UA 4L4SA 2CE7A 2J8ZA 4I3FA 2VXBA 1SUIA 5D01A 2JD0A 1HDCA 3TMKA 2AUTA 2ZE6A 4D43A 1QVZA 2P4QA 2ZITA 1TMKA 4UUNA 4KTVE 5JATA 4DW8A 5L4LA 4PYNA 2XLBA 3WYDA 1KQGA 2ZTSA 2D1RA 3G0CA 3MUOA 3IBYA 3OOSA 3BQMB 4M99A 4AJEA 4CMEA 1WB9A 4FGZA 2C61A 2PMKA 1RACA 3AH8A 3EWNA 3K9GA 2HEIA 3PUJA 4GQBA 4RDHA 2QM0A 4WESB 3WLTA 3H1GA 1N4DA 4TYQA 1B6SA 3P9SA 5IWAB 3AP3A 3FMOB 3QXCA 4H7IA 4UHDA 4DC1A 1PYOA 2FW7A 5CDFE 2PSEA 4HJRA 5KNCH 1JKJA 3OO0A 2YIDA 1T10A 1KYQA 5DHSA 1MO6A 1Z75A 1I13A 4UDYX 3ZWKA 1P9LA 1T0HB 3CF4G 3JQBA 2GVZC 1U9CA 1C3XA 4CLXA 2C2MA 2DUWA 3V2IA 2I67A 2IYQA 2RGXA 4C6TB 5LDHA 4QGBA 2PUVA 4XM2A 3PVZA 3BA1A 1PT6A 4BUZA 5AJXA 1XK6A 2H00A 3HCNA 5A3JA 1K88A 2O2CA 4D4GA 2VJPA 5DRYA 1SU8A 4E31A 2HTEA 1RQ2A 1SU7A 3EIHA 1R0ZA 4KK3A 1U65A 3A25A 4LE0A 4KNWA 1KZ6A 1VL5A 5TPWA 1DBWA 1FNBA 5LD2B 3AHIA 2R8BA 3KUDA 4HGYA 2E82A 4UE2A 3OOWA 4G5RA 4YMIA 3N0RA 4GRAA 1NVVR 1Q0UA 3OSUA 3GRVA 3EOAI 3UJCA 4WBNB 1VHDA 3LMKA 5DI3A 1P77A 4QTUB 1GR1A 1IAQA 1YS7A 3QUQA 2H92A 2J7PD 2QVCA 3WISA 1XG5A 1I4LD 3KJHA 1R0LA 3PD0A 2YFYA 3TJRA 5KTOA 3G2OA 4G8CA 2YFHA 3N2LA 1VL2A 1HSZA 3FZEA 1XTUA 5SYNA 1PV4A 5A0FA 4YRAA 4GX2A 2ZWIA 1E8MA 1K89A 3QF7A 5K3SA 5ARBA 3D6FA 1X8KA 4B0OA 2GK4A 3NNSA 3M3HA 2Z09A 4MKXA 4DOMA 3FIUA 4X1KB 3TB6A 1PZMA 1ONOA 1KU6A 5BYAA 5I9LA 3N0XA 5H02A 1LSUA 5B6JA 4Y0AA 3IPCA 4RZHA 4Z1OA 4I3HA 2CY0A 3LXXA 4CMCA 2PO7A 2GFHA 3S81A 1QGED 3ZX5A 3CKMA 3DE6X 4JOBA 2JVKA 1IU9A 1K1EA 3R0QA 3T3NA 2RI0A 2B36A 3PFCA 3MWLA 1GPNA 1RADA 3KEMA 1QV7A 2W2LA 5FV7A 4G1CA 4C0XA 1AGYA 2QN1A 3NHWA 5KTKA 4YRBA 2QR2A 3L82B 1D4FA 4IFEA 2VXCA 3L0YA 3G13A 2RAUA 3UA4A 3DMDA 1SVOA 3DA8A 3W3AH 1U7ZA 1E2QA 2AJCA 2HGSA 4K6OA 1PT5A 1ID8A 1G8HA 1QX4A 3HPRA 4UXIA 1ZEJA 1UPCA 3QYPA 4JLOA 3T3GA 4UHEA 3VR2A 3CZMA 1P1CA 2EV9A 3DVAA 2WWTA 2OCKA 1L4UA 3BIFA 4K8OA 3GJSA 4MKFA 2WICA 4PWYA 4QC2A 2QF7A 4CCAA 4F38A 2O59A 3KPUA 2IUFA 4JIGA 5B1IA 3F9CA 1ZUHA 3O4JA 4J90A 2HMUA 3GGDA 4YREA 3T5PA 3GLFA 3WNVA 1U9IA 1I0ZA 1UZLA 2XR1A 3HSKA 1RPAA 2UZAA 4G67A 1WDTA 4RNDB 3SSAA 1C7IA 1E63A 1OXBB 1IN5A 2GYYA 3F5FA 4A8JB 4BVGA 4QECA 4I08A 3O8OB 3D9QX 3HB4X 1C7JA 4BWYA 3EDCA 2I2WA 2IHZA 1FTNA 1EAMA 2JHAA 2A9JA 1MX1A 1I3KA 1N5OX 1YBMA 2FDXA 3E9RA 3ILVA 4OI2A 2OAGA 4UEJA 1Y42X 3GVHA 2XOEA 2WFLA 1T9BA 5DE3A 4BWGA 1Y1KE 2GWRA 4DUGA 1PGNA 2FPIA 4KNYA 1R9GA 1C30A 1EFLA 4G8JA 5LMUB 1YFJA 3EN0A 3A2MA 1D2HA 1EVQA 2W98A 1GZ7A 3GZNB 3Q85A 5FL3A 4HN9A 3UMSA 5JW6A 4CQNA 3EDYA 1OCEA 2IKSA 3PHCA 3MCZA 4RTNA 3BEDA 3DQPA 5G3YA 2JBAA 4RZSA 3K9FC 1QOPB 2Q1XA 1SA0A 2WIDA 4M87A 2IITA 3E9YA 5I7SA 5KMGA 1SEPA 2C8JA 3W7BA 2ANBA 2AI3A 4GRIA 1VMEA 3IBTA 2PA0A 3L02A 4M7OA 1NIPA 2ES4A 4I50A 3HSYA 4N18A 1VCIA 1CY8A 2NTJA 4X97A 1C9EA 1N3YA 3DD5A 2D0IA 1THGA 3C74A 3IESA 3N9IA 4YAWA 4CF7A 4S0XA 2NSHA 1YOVA 4CT4B 1N78A 1QYVA 4AI6A 1QQ6A 2JHPA 1SBIA 5EOVA 2DR2A 1F2DA 3DBLB 2XNDA 3CN9A 3FROA 1UM9B 2CBGA 2IHYA 1NKTA 3QUSA 4WN9A 1FXSA 1HR0B 3P9QA 5DGHA 1U2QA 1KO4A 3MG9A 3Q98A 4MWEA 2O14A 1KYTA 2JJYA 3MWKA 3L07A 3ZDZB 4MPJA 1SWWA 2XB4A 5H4HA 3TNDA 1T8RA 1Y9ZA 1ZD9A 1Z22A 1WVMA 2B1RA 2QDKA 4R1NA 1VPTA 3QFCA 2JLYA 4MDEA 4PSCA 5KHAA 3B8EA 1M2VA 2XWBF 5CT4A 3AKDA 2P2YA 4UMEA 4OQEA 1I5OA 3AR3A 4V0ME 4G0XA 4R1QA 1U1FA 1L5HA 3TH5A 1U7XA 4H6PA 1LQTA 3EAFA 1NBIA 1XPRA 1HDOA 4GPD1 1KVUA 2ANCA 4IXTA 4QEZA 2OHXA 4YN3A 3V7UA 1Q5PA 1XQWA 4NOLA 4YYZA 1IBKB 2A58A 4HXGA 4F4DA 4KWHA 2IYYA 1TQHA 1KI9A 4HQ0A 1QDEA 1EAYA 1WG8A 4IJ6A 2EXXA 2CNWA 3WGTA 1NP6A 5FPHA 1NJ8A 4V2UA 4EFLA 3CRMA 3LA8A 4CIAA 3AUYA 4BUJA 4LDPA 1FJHA 2R6CA 2ZRPA 2JA1A 2FMXA 5ESXA 3WLJA 2W0MA 1RJ9A 4TKLA 5D7BA 5A4DA 5AVXA 3CMCO 3DBRB 4N65A 4RA6A 1TDJA 2REBA 1RKXA 1K8YB 1LDNA 2H4FA 2FMTA 2JIQA 3T0GA 2HADA 4TTPA 3BB3A 4E3WA 5TE9A 3GDGA 1FTYA 1Q12A 1K7SN 2IYVA 4A8PA 3ILXA 3KQTA 4P82A 1XVAA 1GZVA 1YVDA 4I4TB 4JMLA 3G5TA 4GLJA 4C7OA 4DHEA 2A7QA 1KHHA 3BHIA 2H17A 4X91A 1H5NA 4LDRA 2VDPB 1T25A 3WWYA 1N32B 3EW7A 4U2DA 1KZ1A 2BMDA 1SUPA 3OPYI 4J0IA 3SJCA 2H1SA 5HEKA 3F9RA 2K4MA 3B5EA 4D6XA 2F1IA 1JXOA 4NJOA 3PC2A 4TMVA 5DMXA 4CT0A 2XQFA 3T4UA 1JH8A 2NU6B 4GEKA 4UOEA 2XGJA 5GZ3A 5CVTA 2V7BA 1UJ4A 4QGSA 3TI7A 3EISA 4RF2A 2G9QA 2AQKA 1W7AA 5IBRA 2W8BA 4RFLA 4QBHA 3U7RA 3H42B 4BJHB 1LBQA 4QXPA 1U8YA 4UUAA 3MHPA 5JXWA 3EFEA 5EIWA 3VYVA 1H65A 3N0WA 5B12A 3K09C 1K7EB 3HLKA 2AEFA 5EQTA 2P9CA 3OQHA 4L72A 4IUDS 3PEVA 3EJ6A 4IBOA 1K3UB 5F2NA 2W2KB 2VJOA 3NVMB 2YW9A 3ODGA 4AD8A 5T4FA 1FQWA 4G0VA 2WKQA 1P1BA 1N33B 3VV3A 3AOGA 3TBKA 3DWIA 1ZM4A 2RCYA 2VHWA 2XMSA 4AF6A 1A9XA 1Z6ZA 5DH9A 2ZI6A 5IYZA 1ZVJA 1D8TA 1MTOA 1DIAA 2YZ2A 1GPMA 2DT5A 3D7SA 4O1MA 5TARA 4R2JA 2Q8PA 4DJJA 2VZLA 4BKOA 1C8BA 2EIXA 4CCWA 4E21A 3PRYA 3A31A 3MRXA 3NPMA 1KP3A 2VUSA 3PLNA 1K4KA 4Q37A 2E1RA 5B1SA 3IEPA 3FCOA 3S28A 2AG5A 1SK9A 2DPXA 3U4GA 3TAUA 1E79D 2RG7A 1MABB 3K0FA 4PINA 3OEED 4TMYA 5KKAA 1YQQA 3WGZA 4KNVA 1FNCA 3ETLA 4BNLA 4FC6A 3L1UA 3ZZNA 4RVOA 3FFWA 3PNPA 1C1DA 3AKYA 3U2QA 3BFJA 2HGZA 1H0SA 1V39A 1KSGA 2KS6A 4P4TA 1DPGA 2OXTA 1JEEA 2BTQA 5I45A 2P41A 2R7NA 3GPCA 1S3IA 2OENG 3BF7A 4HQNA 2WHXA 4R1TA 3VSBA 1XHFA 1Y9AA 1B26A 1V2HE 4QE3A 5HKKD 4DY4A 1DXOA 1QB8A 1VA5A 5JSFA 1WSDA 2JCXA 5HIJA 4TT3A 1Z4LA 3FLBA 2SKEA 4BLPA 1E3WA 2HNBA 5FH9A 2FUEA 1VSBA 2EJCA 3O1JC 4MI1A 2Y27A 4DTCA 1K8ZB 3I12A 3IODA 3A2KA 3ZW8A 1KI4A 4JYAB 1VHWA 3PC7A 2V1XA 2V97A 4OLHA 3H1TA 1MC8A 2ID9A 3HCDA 3H0EA 1UMKA 3MXOA 4PLHA 1KARA 1R6UA 1B8OA 1WUJS 2Y1EA 2I66A 2HJSA 1MA3A 1P9OA 3OZEA 4RZ2A 5J40A 5FI0B 4G0MA 4GW3A 4M9RA 1TJNA 1KJYA 2BLNA 2OZLA 1QFSA 5JZMA 3I5AA 3K8ZA 5D84A 1YK0A 4G9BA 4GL4A 2LXNA 3GIWA 1KJWA 3GIDA 1T0BA 2Q3FA 2LDBA 3OZ7A 3VMFA 1Y9EA 1V35A 4YC7A 2V6IA 4PM4A 3PQ5A 5DTMA 2WTEA 4UQPA 2FEOA 1Y8RB 1CY7A 2BFBA 1I5RA 3DTYA 3PPYA 2WG2A 1T8TA 4PW0A 3NOOA 4RJ2A 4UBOA 1I14A 1RPNA 3E7WA 4BN0A 1JR3E 4AQ7A 3E3OA 1ZGAA 5BSTA 3ZJVA 3WNZA 3SF0A 5KO2A 2P6NA 3V8EA 1P62B 2RMKA 4QATA 1UBMS 2ZULA 4Q7JB 1IY8A 2W6CX 2A7XA 1H4QA 3KCNA 3VR6D 2GN4A 3N7UA 3N87A 4QOJA 4TS9A 3RJTA 2J6IA 5F9MA 4F4HA 3ZD8A 1X7YB 4ESHA 5HYVA 2EX1A 2O2DA 1J2RA 4BPRA 2FGJA 2D5CA 3K70D 1P7WA 3L6RA 1XL0A 4A9AA 4EEXA 2WM2A 3JQ8A 1RD4A 3Q87B 4LV5B 4R1UA 3FWNA 3IDOA 4MOWA 4UU0A 5DLYA 4AQDA 3ZDEA 4JWKA 4E6PA 2R62A 4XXHA 1I7QB 4NU0A 1AT1A 1SHKA 4UMFA 5TJ9A 2FUKA 4HX9A 3UNXA 2XEDA 5JS2A 4PYLA 1G8GA 3C7TA 1L7DA 3I28A 1KR2A 4PXAA 1L8XA 3CXUA 2BF7A 1OPXA 3DO5A 1PJRA 4DC9A 4D5GA 1YRLA 4W5QA 3THYB 3MFQA 4L9SA 3ZGLA 3R3UA 4ZKEA 1S7CA 2QX8A 3OZVA 3PV0A 5LQDA 3A9CA 1PUIA 2G0AA 2ZS7A 3O74A 4G37A 4G8DA 4NBNA 5BR7A 3NC0C 4OA5A 5KWIA 1S2GA 4RULA 3SYTA 1DWOA 4BX0A 1LI4A 2JFNA 2QPLA 5E6RA 5I7OA 2FN4A 5TMPA 5GZ6A 1R18A 3LQYA 3V8NA 1YACA 2C2HA 1OZGA 3HDHA 4KVAA 5EJ9A 1IXRC 5TQVA 3ZJYA 1DRUA 1KH2A 2ZRFA 3R23A 5AJVB 3SYMA 2OORC 3SX4A 1DIGA 1QGDA 1DKRA 3S1AB 4FMDB 2Y71A 3IKLA 4R71A 1D6SA 3KJEA 2PZFA 3Q8XB 2WI8A 1U2PA 4AKGA 3EIXA 1LZKA 3QPVA 4PRKA 1WXEA 3OG9A 4LECA 1I3NA 4RJLA 3A6FA 3FW1A 1N2GA 1SCIA 4PS0A 4XB6B 3ZHXA 3FOBA 5JRDS 3LSYA 3H84A 2VFAA 3I8OA 2RJ3A 3I9KA 1GG9A 2I6UA 3IVXA 1SHZA 1B8VA 4W9RA 3K6RA 1V3QE 1T1RA 3PPIA 2QM7A 4LDAA 4JOCA 1L9KA 4NU5A 2Y0PA 1H94A 4QDJA 2ZPTX 4M98A 4MGZR 5JHHB 2BR3A 2IH4A 4I9UA 3KZ1E 2G83A 1SN7A 3C0KA 1O58A 1JPUA 5DN6A 3NM6B 1XXHE 1VMKA 3H9CA 4BBZA 3G1UA 4FNGA 2FSIA 4GNRA 4P3KA 3PNYA 4XYLA 4ZZ3A 3GGJA 2VCEA 3WDSA 2OBMA 2Q6KA 4X5OA 2HF7A 4FEGA 4WERA 3SXJA 4M9SA 5M34A 4I81A 1KFBB 3SLGA 2JIRA 2VQ3A 1SU4A 4P58A 121PA 3EG5A 4ESVA 1D2AA 1YB7A 3K09A 1J20A 2JI4A 4AO8A 1W36D 2YR0A 2D1YA 3P0IA 1UJCA 4BDSA 5B6PA 1EFDN 2ZBFA 3C4VA 5D3QA 1I4EB 1MRSA 1QOZA 3FUWA 2HJWA 2HF2A 2X14A 3ND9A 3UH1A 3VPHA 5CFNA 3JAWA 3OESA 1ZKDA 3V5NA 2WSYB 5EWJB 1ZCBA 4PYKA 1ZK0A 5BR4A 3O3MB 1XA0A 1LDEA 2CXNA 1VMIA 1R0CA 3NH6A 4UEQA 3AVTA 1SKBA 1TQDA 2A33A 2JEZA 2VP5A 1TCBA 3P45A 3HCAA 1KAOA 3NGXA 4OXYA 4HYEA 4II7A 4L8YA 4MEBA 3U4QB 4E11A 1VTKA 1XEXB 2XCQA 4IX9A 4WOKA 4H7HA 4TLMB 2QSJA 2ZYSA 2ZRHA 4KH1A 1ESEA 1DKLA 4KN9S 2Z2KA 3OTGA 3VOBA 4TKZA 1K9VF 3DBOB 4W1SA 1UPFA 1WV1A 2JCYA 1XDDA 1F48A 3U4CA 1IN4A 4FHFA 2B3TA 2ONKA 1YKFA 3KQVA 3PEWA 3CEAA 5FPPA 1LTKA 2A0FA 2ODAA 2W2MA 1E9BA 3GJRA 4GLLA 3WYGA 4DCCA 3R40A 1C7QA 5IBQA 4CPDA 4DXHA 1K2VN 2GPBA 3AESB 5COAA 2GA8A 2H4HA 5A0VA 2HF9A 4NBUA 2D8MA 4D9CA 4MO2A 4TYPA 3HCPA 4TZ0A 3KYBA 4O4JA 3FSGD 1RYMA 1XEFA 4RE5A 1YDMA 3NEYA 3N8IA 4ZEMA 3ZIAA 4HQLA 4NATA 1L7NA 1T5TA 1YZQA 1QRAA 3GPDG 2C96A 3KT8A 3NLLA 4HNUA 2F1KA 5BNTA 5JZOA 2GAFA 3IEKA 1H2WA 1NASA 2DVMA 4TV8B 1IHOA 3SS7X 1WD5A 2JGIA 5IABA 5EERA 5AVRA 1U6JA 4PQRA 2CLLB 2WFMA 1PYDA 2G40A 2QZ9A 1DHTA 2P4HX 5AOBA 1PW5A 4XD2A 4CQLA 4DJTA 3MNFA 2I6SA 5F5XA 3HWX1 1EWVA 1FTWA 1TCCA 2A0WA 3KIPA 1GPKA 3EUAA 4UZSA 4U8HA 4G97A 1NUQA 3IJ5A 4BYGA 5AOVA 1R16A 1KRWA 4IQFA 3WWZA 4XEHA 1XO1A 4XIFA 3TOCA 2XQGA 1ESMA 3OA0A 4I4TF 5F1OA 1SUFA 4H6WA 2NO9A 5C8ZA 4G5XA 4XIGS 3V8PA 3IAM1 4EPRA 1H2HA 4DMKA 2ZT8A 4OX9B 4NYIQ 2QLFA 3SLRA 5MGBA 2NW6A 3KJQA 2VHEA 4LXHA 1II8B 1T36A 2VSYA 1JHZA 3D4BA 4XCXA 3IEXA 4IHJA 4XLLA 1VJDA 3VSEA 4G9GA 3IH5A 4HRVA 4P3PA 3I34X 2Z2XA 5ANRB 3FVVA 3ZPXA 4PPFA 1CV2A 2GZ1A 2O2EA 4MHSA 2R7KA 5AXAA 5CXUA 4RS4A 2FX5A 4J3NA 3T7EA 2MHCA 2XVXA 2FSUA 1TKBA 2WSIA 3VVLA 3UMYA 3PB3A 1NUHA 2QUAA 3FUUA 3CW9A 4QDZA 5LBIA 3VKVA 1JH9A 5HMLA 3RLFA 2V0NA 5KNDA 2DP4E 1EFKA 1N1EA 2JCGA 2ZOSA 5EXSA 2VYNA 3KQSA 4B3IA 4B4OA 4R9SA 5DXAA 2VBFA 1EDBA 5L3QB 4RGBA 4IS3A 3HYCA 1ULAA 1W4CA 4WEQA 4WJKB 3D3EA 5JADA 3UBMA 1WE2A 3M34A 4R2HA 4YFVA 1G8KA 2WMYA 2AN1A 1XZAA 4G4JA 4LC9A 2BMJA 3ROMA 4ZV7A 2VZ9A 2D59A 3D6UA 5M5BA 5DISB 3SN6A 1U63A 1XQVA 1U4OA 5LQMA 3GROA 3VDMA 1USUA 4ZYTA 4DANA 5A5GA 1K8XB 2ZYAA 2AKEA 5AVJA 2KQUA 5ULLA 3U7IA 1RP7A 2NV6A 2JIBA 3MMZA 4P38A 4L27A 3GCDA 1ISHA 4PFQA 2OORA 3AILA 4M1TA 5G4KB 2G5TA 1JDNA 4QO8A 1N0HA 1P2GA 4TGLA 1XCPA 4Y1FA 5AKEA 3UUFA 5CB4B 4LXYA 2QENA 3DLCA 4C6HA 2DKFA 1NXXA 2FPMA 4NEQA 4JKIA 5KKCA 5F4BA 5K09A 3I6QA 3M82A 1L5LA 1O03A 3CZ9A 1EZ4A 1PS8A 1C9YA 4FFRA 1HQDA 3P32A 3NHKA 4JJIA 4MUFA 1HL3A 4MCHA 4U7TB 2A92A 3L5KA 2D2XA 1BMFA 4RKYA 4J03A 2FSGA 3EZNA 3WMGA 4BO9A 4FZJA 3NFRA 5BV0A 3QTLA 3VR5A 3T7JA 3VOAA 1GT6A 5TEVA 3KQWA 4O3MA 1I0LA 1CR1A 2AZMA 5BMVF 5KCMA 1CUSA 2IPLA 3NIWA 3ORQA 4PGAA 3QBJA 4AX4A 1LK5A 4XFDA 2QI9F 1GPDG 1VPLA 4UBLA 3SF8A 3ITEA 1HEIA 3IAHA 2WT4A 3BXEA 1DELA 1M1ZA 1V45E 3T7KA 5JSHA 3DHYA 4X9XA 4D4MA 2CMHA 2PQ2A 3QVMA 4HC4A 3UQZA 4ILKA 4A4DA 1WB5A 2G82A 3AHHA 2HT6A 2JGKA 2QAGC 1KJ9A 5F1PA 3W5HA 7REQB 3QX3A 2JFBA 2MYNA 4XYGA 3U17A 1KXZA 2BCGY 4A2WA 4TXMA 2FZ4A 3L5OA 5KHOC 3KAQA 2RH8A 4FCCA 4IOJA 5AR1A 1K6MA 2BFMA 2QW0X 2VDQB 2A1TR 2ZJ8A 1CWUA 4ZQCB 4BJ1A 5BN1A 5C1BA 5HS4A 1WXGA 4FYIA 4TTQA 3DUFB 1FJ2A 3URKA 2MINA 2NO7A 4TL9A 3USES 3T9CA 1KA9H 2NU7B 2J3HA 4ZXPA 4MP3A 2GN0A 3QOWA 4MAFA 4ZCMA 4X85A 3LLUA 5B30A 4KBFA 2WWRA 2P79A 3RBXA 1TC2A 4PQGA 3ZHYA 1USKA 1QP7A 5EXEA 1BGXT 3BE4A 3LKDA 1EFPB 2C4TA 4I9NA 1MO5A 3EGEA 1MVLA 5AW1A 2J9ZB 4Y9SA 3LFHA 5CJPA 3QFFA 3GFPA 4DJEC 1F60A 1W44A 2LCIA 2FFRA 4UC0A 1R6BX 1B3BA 4UBIA 4MQMA 3RARA 1U3TA 1E1RD 3C97A 3USCS 3I9V6 4R1OA 4BX8A 2DHEA 4HWTA 4NYMR 5JJKA 1JLHA 2I62A 4MUNA 4Y9TA 3AEKA 4RTJA 1UMCA 4RVCA 3VU3A 3O7MA 2OO5C 1CEQA 1RKQA 3A6DA 4O8CA 3WTBA 1OB5A 4IDDA 4RHTA 2XKJE 4Q82A 3OCXA 2YMLA 3WSTA 2P77A 3C8UA 1ZISA 1N2CB 3MK31 1CNFA 1CR6A 2JATA 2YASA 1VYHA 2XYGA 1NBWB 1LBHA 2O2XA 1C9DB 2C5SA 1K68A 3HVUA 2HX1A 2I5PO 3G1WA 3JAKA 2P6OA 4M89A 3V42A 3VYRB 2X1VA 1LLDA 2CC2A 3D4PA 5GGYA 5LJLA 3CZRA 3MT9A 5MF6A 1KKLA 3ASZA 2BVNA 3WGGA 4UDNA 4EI9A 1WCIA 1JU3A 1KFEB 4H0CA 3C6ZA 4KO1S 4NFYA 2GZAA 4GWGA 2QGNA 3JYPA 4N8DA 1JDJA 1Q1AA 2FW1A 1ATZA 1H1LA 3G2MA 4H7EA 4L9WA 4NBLA 3VUFA 3VZSA 1VPWA 1DT3A 1E1YA 1FY2A 2C29D 2PWPA 4BNYA 3V8QA 4MPPA 4HO1X 1ZNYA 1U0FA 3SMQA 3OJ0A 2X8AA 3PFIA 4FMDF 4JL5A 5ED4A 3O8NA 4K26A 1POXA 3SR0A 1JA1A 1U3FA 3EVAA 1EWTA 2OHHA 4EHBA 1VGRA 2AXNA 2NPOA 5ALFA 2GRAA 4F9EA 1LH0A 4Z4FA 2F64A 2OYCA 2EWMA 1APBA 2O0MA 2XT6A 2OA0A 2Q3MA 4ZU1X 1MN6A 1IXKA 4PZAA 2JI7A 2YRXA 4DA4A 2WD8A 1EBUA 2C7OA 1ML4A 1HZZC 4ILEA 4KR2A 3GLHA 2IHBA 3H9QA 4E2YA 1V7PC 2QROA 4JYPA 3C87A 3M5CA 1JHRA 1RYEA 2FSVC 3FLMA 1NXVA 4IQ4A 3UB3A 1M75A 4HNHA 5JFOA 1DQZA 3ELUA 4QRDA 2FHPA 3MEQA 1PR5A 2OGZA 4I7EA 1RSZA 4MW2A 1U0LA 5GM2A 1NBAA 3ZEAA 4B7CA 4C4PA 4D9JA 3UJHA 2X15A 3LUAA 4O8ZA 3FKSA 2OHFA 4TVOA 3HE3A 4K0RA 4BNDA 4ZHSA 2W2XA 4YASA 3JASA 2NNWB 3KNZA 1EUCB 3BZWA 1NHWA 2FKNA 3DHEA 2ZDGA 3LXRA 3TLYA 3LHDA 4QDXA 4RXMA 3LXUX 2DWOA 3JD3A 1W2GA 3ICVA 2X8BA 4CNQA 2C07A 1NVKA 3PEFA 1DO2A 4FYYA 3ZWBA 3UJDA 4ON9A 3PXBA 1UBRS 4YJFB 5IZ4A 3H13A 5HUHA 2FPPA 5ERXA 2IOYA 4O29A 5EVCA 2Y05A 1KO7A 3JZFA 3TLGB 3RYFA 4CTJA 2AMFA 2P0AA 4BO3A 1ONNA 2ISQA 4PGMA 2QKYA 1K5DA 4FOPA 2BFWA 3PC6A 3C6YA 4J16C 4BEJA 5E6UA 5DM0A 1EWRA 5T4HA 2IUYA 4AN0A 5FTJA 2F90A 2KYRA 3A4MA 4ROTA 3HDTA 4DIOA 4JAVC 5LNK1 3DSRA 3NZEA 3BULA 3U7GA 1RKUA 1X7ZB 3CGGA 2ZSHA 3CF4A 5DNDA 2O8EB 4BS9A 2PBRA 1G42A 2I4IA 2LBPA 3DYVA 4PQYA 5E6SA 1W5TA 3GFTA 1V8PA 3WGMA 2Z6VA 1JS1X 1AS2A 3KOZA 1XXHB 1L5ZA 4XQCA 2GR9A 1OMOA 3RSCA 3WGOA 4Q7KA 4YNBA 5H59A 3NCHA 3UJ6A 3R75A 2GJSA 5JVDF 4NHEA 4AG3A 5CLJA 2C82A 4HPJB 5FA6A 4D8TA 4KMOA 3V2GA 4QGFA 3M70A 1HYGA 1X42A 2RC5A 1G64A 1T2DA 1YR8A 5JFTA 1GDTA 3M4YA 1DHRA 4TV8F 3A7EA 4HAWA 2HIGA 2WYHA 1Z7GA 1XDZA 1RWNA 2OVBA 3KKEA 2QAGA 2FOIA 2VJMA 3D3NA 1VLHA 1V1MB 1XEWY 2OAEA 1YZFA 1UJ6A 2JGDB 2NACA 2QLLA 2UDPA 3OCJA 4GSLA 4INOA 5FWDA 6PFKA 2WU0A 3F8SA 2Z1MA 3PD7A 2CL7X 2XZDA 1M3SA 3F67A 3KK0A 4XYEA 5EMJA 2DQSA 3GHHA 4Y2XA 2FPLA 3CX8A 1IBRA 2A9VA 1GN9A 2JFOA 3HU2A 2FLKA 3TW8A 5A62A 4ZYZA 5KOHA 2RAPA 3CUTA 1NUSA 4MW9A 3X1ZA 2GF2A 2AWOA 4PSKA 1IHPA 3PC4A 4E1BA 1AGXA 4KYTA 4CQJA 2H08A 3EGCA 3QW4B 1GAWA 2B99A 1ZPDA 4RVFA 1AO3A 4F3NA 5IHPA 5IJXA 2F8TA 2YL2A 3E7XA 3RS8A 1RBMA 2JKVA 3WIEA 1VSQA 2EDCA 3LUHA 2EVWX 3GPIA 5HE9A 2X0EA 1ISFA 1V3UA 1P1RA 2DPMA 1PU2A 5T7BA 3AF1A 3U61B 1A1VA 4DIDA 4C1BA 3UWMA 1CUXA 2C3UA 1YV9A 3ZJ5A 4Z86A 4MJ3A 1GFSA 1W48A 1Q84A 1I51A 4R81A 4COKA 1B74A 4M22A 5B2ZA 4PONA 1GZDA 2N9UA 2LCFA 2YWBA 3K0AB 3QFSA 1SXJE 5HXAA 1HURA 3FPHA 3L1JA 5IDVA 4S05A 2IH5A 5FOQA 4JQSA 4X65B 2A9PA 2XF8A 4GAEA 4YRRA 1HE8B 1P2VA 1ZUNB 3R09A 5BW8A 4QXOA 3WA7A 4JEUA 3WAGA 2VDRB 5JDIC 3C70A 1I32A 3EOZA 1RI3A 1SOUA 3LW7A 1TYDE 4YXWD 2VHXA 1FEZA 1PEKE 4LRWA 1AQLA 1NW5A 1BHSA 3NNDA 4ND2A 3ZXSA 1YCHA 2DBZA 2G4CA 1LX6A 3B13B 5HQJA 1DLIA 3I01A 3QU9A 4Z6KA 3WGNA 4ZYXA 4JP5A 1WCXA 3QJ5A 1Z45A 4KB5A 3QPCA 4QUIA 3OM0A 4M0UA 2ZT5A 2I6TA 1LDGA 1TFRA 2WE7A 1KS9A 4G41A 1Z7YA 1QCCA 2CWDA 4MUAA 4RK1A 5GIOE 3G9XA 1PLLA 3LLSA 3NYWA 3O9MA 5FWXA 3SYNA 1Q17A 2Q28A 2VWGA 3LPLA 5CT9A 3ACCA 2WF5A 1ZIYA 3NXSA 2O4UX 4K9DA 4P4GA 3U26A 3ZQ6A 4C2AA 2JFQA 4CEIB 2QE7A 2VTDA 4J43A 3WGUA 3DBVO 1NYLA 3EA4A 1U80A 1GZSA 3WXBA 2AHRA 2PZKA 1R5OA 1NV9A 4K9QA 4JEMA 5J2TB 3TR0A 3VJMA 4GBGA 1ZSNA 4LYAA 2PRJA 1UP6A 1GVHA 4ME6A 5LZ2A 4KIFA 1HZZA 1T0UA 2C8KA 4L2IB 1NMZA 2UZ3A 4WXRA 1JGTA 5I8WA 2P2ZA 2FSVA 1GY8A 4JENA 4CF5A 3HXTA 3N2GB 3CF0A 2C8VA 4AG5A 4WKPA 2QQ5A 3W1WA 1YASA 3ZCXA 3UN1A 2XWPA 3LI2A 4DRZA 2D74A 4DIMA 4EKGA 3WOHA 3OKPA 1ZMTA 4G0OA 4QZVA 2QMEA 3K2BA 4US0R 4U7DA 1SQ0A 2CFIA 1AKTA 2VF8A 2Q8QA 3RB8A 1IQ0A 3E8SA 3H2YA 1F8FA 4M55A 3UT0A 4E5VA 1E18A 3KKPA 3U4DA 5BQPA 1SPBS 1JLKA 1WLSA 1CEXA 1JSLA 2HNKA 2P8JA 2LIVA 1VP3A 3IIIA 3SD7A 3UGTA 3UGQA 5BPFA 1NF9A 1QYDA 3P26A 1YUBA 1AD2A 1QNFA 3SY8A 1JQDA 1P72A 1XWWA 4BN5A 2BUAA 2WFAA 1MV5A 4GBJA 5CA1B 4FFDA 1VDZA 1P74A 3ICWA 4GS5A 1JMYA 3L0IB 4ZJYA 3L7LA 1EBFA 1W35A 2I3DA 3ZQKA 1QE3A 3PYXA 4OSOA 4UKDA 3WC4A 4CFYA 4NJMB 4AK9A