1U8ZA

Crystal structures of ral-gppnhp and ral-gdp reveal two novel binding sites that are also present in ras and rap
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
168
structure length
165
Chain Sequence
SLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGYAAIRDNYFRSGEGFLCVFSITEMESFAATADFREQILRVKEDENVPFLLVGNKSDLEDKRQVSVEEAKNRADQWNVNYVETSAKTRANVDKVFFDLMREIRAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Ras-related protein Ral-A
publication title Crystal Structures of Ral-GppNHp and Ral-GDP Reveal Two Binding Sites that Are Also Present in Ras and Rap
pubmed doi rcsb
source organism Saguinus oedipus
total genus 61
structure length 165
sequence length 168
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1u8zA00
1HTWA 3C16C 5SZJA 3VKGA 3R20A 4L16A 2QMUA 1ETUA 1FL9A 3L0OA 3OE7D 4U00A 4A0HA 4ZIRA 4QJ4A 5JI3E 2QM8A 2VLIA 4BZQA 2BHRA 1VDZA 4C0QC 4PANA 4GOXA 3AVYA 4OHXA 1D2EA 1N25A 2FN4A 3ASZA 3A1SA 3KJGA 1Z08A 1U9IA 3QKSB 1MKYA 4PHHA 3OIYA 4BE7B 5GJCA 2WSSA 4D4JA 4FMCF 3RAPR 4ZDKA 2J0QA 2IW3A 3TVDA 3CNLA 1JAHA 2C2HA 2J59A 3B1WA 5HPYB 1KI3A 4L4UA 4PPGA 2FFBA 2EFEB 4EKDA 1N6OA 4IFBA 1XTSA 2HXSA 1D9XA 1KJZA 4RFVA 2BIFA 2BKUA 2DWPA 4JYBA 3EIQA 3R8CA 1EFRD 4EPTA 2RGXA 2O52A 1FTNA 5DE3A 3WNCA 3WRYC 3B6EA 1YZGA 4JS0A 1DAIA 1P73A 4RSGA 4E09A 5AUQA 1P3JA 3QXJA 4D26A 5LB2A 3DM9B 1N6RA 3D31A 1KY3A 4GPTA 2EW1A 2IYZA 1XCGB 5EP2A 3RC8A 4QBFA 4MKHA 1R7RA 1UADA 4CEIA 3JVVA 2BWJA 1KGDA 1T9HA 3L2OB 4DZZA 4YMVA 1DADA 3Q72A 4C7OB 1R0YA 2ZE6A 4HDCA 2RGGA 2QP9X 2FEMA 1E2JA 1SXJE 2BM0A 1VG8A 4NDZA 1I2MA 1OW3B 4CRWB 5JS8A 1OB2A 5DYIA 2G1KA 1G3QA 1NJFA 2CCJA 5FBLB 4A2WA 4I81A 1ZMXA 1E9BA 1HT2E 5FL7A 3LQRA 4TWZA 3UANA 3GCGA 2PMDA 3OAAA 1ONBA 4OHYA 3HR8A 3MSXA 1D8TA 1VPLA 1P62B 4LOAA 3NH9A 1AZSC 3FMFA 1W0KD 1F2UB 1VIAA 4US0R 4YC7A 5EXSA 4XVQA 1NLFA 3AB3A 2GEVA 1OH6A 3IBYA 3A6PC 2VO1A 2XB4A 1RIFA 4OQXA 4M53A 3CRRA 4LHXA 4MA4A 2YOHA 1TUIA 2GAAA 1ZRHA 1GNPA 5KSPA 1IHUA 2Q3FA 2W6JD 1L7VC 4I99A 3U44A 1GKUB 1D5CA 2FEOA 2QPAA 3LAWA 5EP4A 3KKOA 3JZMA 3MWKA 4KYIB 5J5CA 5JSZB 2YINC 2CL6X 5JHHB 5IF9A 1IN4A 1M7BA 1EXMA 2J41A 2PX0A 1XU4A 4B47A 4DCSA 2W2VA 1CF4A 3ZIAA 2G1JA 4MYTA 4Z1MD 2GWHA 2CLSA 1GITA 2FF7A 2C77A 1A7JA 4DLRA 4N0DA 5JFGA 5K8LA 3L8ZA 4LCBA 1MT0A 2DR3A 1B0UA 2P6UA 1FMJA 2HXYA 2O0KA 3LXXA 4BQSA 4P4UA 2BEKA 4BLRA 1DAGA 1OHHD 1WDTA 2F3RA 3F8TA 1WP9A 2FJUA 1ZD1A 4Q02A 3W90A 1GNQA 3ONWA 2QNRA 3SOPA 3OFND 1FMLA 1KIMA 1N3BA 3AGQA 3L0PA 4US2R 1YE8A 2R62A 3A1WA 3ADCA 2NGRA 4KFTA 1S2MA 3QOFA 3O47A 4KFUA 2QT0A 2ZI7A 1Z6GA 3P4XA 2Z5FA 2CDNA 3PG5A 4PAMA 2NMVA 5FBRB 2WAXA 1KI6B 2HF9A 1E4YA 3VR2A 4AK9A 2DFKB 2GZDA 1COWD 4OI0A 4MDEA 3DPUA 2IC5A 2VHTA 2OFXA 3Q7PA 1DAHA 2XJ9A 1Z0KA 2F1IA 4ITRC 2W6ID 2OEPA 5D3MA 1NVUQ 2BEJA 1NN3A 5C46F 1E3MA 4Z54A 2NTYC 1SXJA 4HB4A 5IRCD 3LX8A 2A5GA 4URZR 3N2EA 2HJGA 3CH5A 2F1JA 2G6BA 3BFKA 2YHSA 3OESA 3EW9A 1XJQA 4HSEA 1NY5A 4PHFA 1KO4A 4PR0A 2PEYA 4ARZA 5KSZA 3GLGA 3DDCA 1UEIA 5CJ2A 4M0LA 3PUWA 1FP6A 3H84A 3SEAA 4ZV4A 5F98A 1I4LD 1ESMA 2ZRGA 2OILA 4YMUA 3AH8A 4P4TA 4Z8YA 4RD3A 2KBFA 4ZKEA 4LJ9A 4M1TA 2V1UA 3GEHA 3CW2A 4QG7A 3V00A 3KQKA 4KAXA 4XWAA 5J4KA 1XJ0A 3DMNA 3IDQA 2C9CA 1LNZA 2HYDA 2ZRIA 1LV7A 4MRPA 1GL9B 4HEJA 4DEYA 5JI2E 1OXSC 2IYRA 1CP2A 1IJEA 1OIVA 1XTKA 3IIJA 3NHAA 2FDCA 3VR5A 4BRWA 2Q9AA 4Q00A 5JHGB 2KI5A 1MO3A 1N0VC 3LO5A 3CZQA 3IIMA 4URWR 3K09A 4YLGA 4XTRA 1W4RA 4IJMA 2GXUA 2JLYA 3SE0A 4I1UA 3GJXC 1ZNYA 1P2VA 3MCAA 5JBQA 4DLXA 5AR1A 3AVPA 2J0VA 1MH1A 2CBZA 4XSGA 3L82B 1GOTA 5HTKA 3VR1A 1QHHB 3QXCA 3NBYC 4NCKA 1V43A 2O5VA 2QMEA 3QY0A 4PC1A 2IWRA 2JJ2A 3KX2A 5F9HA 4JBXA 2QTFA 3K9HA 2AD1A 3OIVA 5JCZA 3FB4A 3OEHA 2RGNA 1M2OB 4GDFA 4N3NA 3REGA 4HUQA 4KBFA 4D6PA 3NBFA 2WWFA 4Q1DA 5C18A 2KWIA 5C1BA 4I1OA 3W6OA 5GJBA 4QBGB 3FKSD 1FUKA 5FOVA 2NOAA 1DEKA 3AUXA 3ND9A 4X8MA 4CYMA 2ZS7A 1TMKA 2F7SA 2VH5R 4CW7A 4PPFA 1KK1A 2XSZA 4GOJA 3WYAA 3CIOA 3C14C 4L9SA 3TGPA 1TTTA 4RFSB 1TQ2A 2WPDD 2EWVA 4JLOA 2AFIE 1LTQA 4TYNA 2OSBA 2X2FA 4HLQB 3SJCA 4BUJA 4B3GA 1XEXB 3NC0C 3RHFA 4LUCA 4IOKA 1R5BA 2XNDD 1GSIA 1XB2A 2ZJAA 1IN5A 4JLJA 4F91B 1KMHA 1QHXA 3IIKA 4WA7A 3UMRA 4P32A 3VNUA 2IYQA 4M8NE 4TTPA 3HU2A 1Q1QA 4DCVA 2H18A 3CPHA 1T0HB 4B2LA 2ZE5A 1AQUA 1II8A 3O8BA 4LHYA 1T5LA 3AGPA 2ZS9A 1VYUA 1E2GA 4O2RA 3RS7A 1KZGB 2RHMA 1YKSA 5CYOA 3SJBA 1EWRA 3RDPA 3U4QB 3MLEA 1YR6A 5FOXA 4M9XA 4PTLA 2QGZA 5L3SA 5CB6A 1KI9A 2WSSD 1W7AA 1NBMA 4FMDB 4EPYA 3BIFA 2G0NA 3CR8A 2OBLA 4R2HA 3BB3A 1XEFA 2ZRKA 4JLNA 3W3ZB 5EUQB 3VR6A 1N6IA 2ZRBA 1MRNA 1JALA 1TUEA 4DLUA 3THYB 2VEDA 2XNSA 2FFHA 3GJ5A 1DTSA 3WMGA 1GKIA 4LPKA 1IN8A 4ZCMA 5FPYA 2PEZA 5JMTA 2QQ0A 4C2UA 1J70A 2ZI6A 1O3YA 1N2CE 2QSYA 3NG1A 1P7CA 4C0HA 1G3MA 3GJ8A 2J0SA 4WIAA 4H9GA 4OHZA 4Q1AA 1ZM9A 3K0EA 1N6NA 4YXWA 4HLDA 1L8QA 1CJMA 4GT1A 2GNOA 2O8EB 3BH7A 1AS0A 4DLWA 3E1SA 2CLCX 1JQLB 4RZ3A 1HQYE 1KY2A 1YRBA 2Z83A 1AM4D 2C8VA 3LBIA 3U2QA 5F3WB 3RS3A 5FI1B 1XEWX 2KJQA 1RRGA 2FG5A 2GDJA 4D80A 4DUGA 5FTMA 3IEVA 2YC2C 2BDTA 2VHCA 2PT5A 1PLLA 2D2EA 2QI9C 2YOFA 3BOSA 4RKEA 3S1AB 2AHOA 2ERXA 2EU8A 2MMGA 4TN1A 3FE2A 4D2IA 5FL7D 2FFAA 4KFRA 3T15A 3OAAD 3SDZA 2FH5B 3WP1B 4QJ3A 2JIZA 2AK3A 2YWHA 5EE0A 3UWKA 3ZD6A 1K8RA 3HPRA 4DT1A 2ZANA 1KI7A 4LGMA 3K70B 3FHTA 4DEXA 4KXFB 2BMDA 2JLVA 4TYYA 2FFQA 3W9YA 3RRNA 4M1OA 2OV2A 1Z6AA 4NCJA 2WWIA 1XXHB 1NF3A 4QBHA 4WOPA 2IK8A 2CL7X 3WY9A 5GVSA 1AK2A 1KSHA 4D4KA 5GADl 2NIPA 3FFBA 1KJWA 1NVXQ 5L8VA 3NXSA 4K46A 3QVUA 3E5HA 2QEQA 3MD0A 1GILA 1G8FA 3OEEA 4HAXA 4QHTA 3U60B 1DBSA 4BFZA 3EWSA 1GUAA 2CJWA 2P5TB 5TV2A 1J99A 1XCMA 2ZYUX 2J46A 2GILA 1IXRC 3ZIAD 1UM8A 1ZNXA 2F43B 4EJSC 4TMZA 3LDAA 4JLVA 4CZ2A 1G8YA 2X2EA 2WHXA 4JLDA 4Q1FA 4A92A 4GFDA 4Q9JA 5JWRA 1Q57A 4HDOB 1G4AE 4UXHA 4F92B 2O8CA 2ODWA 4EJSB 1KTVA 3N2IA 4PPNA 4NP6A 1HUQA 2G83A 2WM9B 4Q9IA 3LVQE 5G3ZA 2HYIC 5BQ5A 4OI1A 2LKDA 2ERYA 4OJQA 3RSOA 2GRJA 1GRRA 1U0JA 1JEDA 4XWKA 4RD0A 2R65A 3KFXA 1OH8A 5FBQB 1SVOA 1OYWA 2ZRFA 2PCLA 1AJEA 2NZ8A 3WNDA 5DNYB 3GQBA 5BN3A 2QL6A 1ZC4A 4IVPA 4QNMA 4HAUA 3K8YA 1RJ9A 2MSDB 1XTIA 2WV9A 3B78A 1F48A 4FMCB 3E70C 1EX6A 4G5OA 4JMPA 4BLTA 5AUNB 3U3OA 4N0EA 2ZPTX 1QZXA 4ZPXA 2OAQ1 3THOA 3K0SA 2CEAA 1PUIA 4DBLC 2WWGA 1CRQA 1JJVA 1A2KC 2ZI5A 1Z0IA 1G41A 2R6GA 2W58A 4EFMA 3B7GA 3R7WB 1Z6XA 2IA5A 4NYMQ 5G41A 3NBZC 4NE2A 3TMKA 1P75A 1S1MA 4GMDA 1NRJB 2WOJA 3PEVA 4LK2A 2C95A 5FUYA 1KO7A 1QHGA 5C4GB 4DSOA 2C03A 5FTLA 5DHAA 1FZQA 1WA5A 3U61B 3MWJA 1II0A 2P6RA 3K0AA 4XVRA 1RVDA 3SJAA 5CLQA 3KQHA 4GL2A 5L3RA 5DI3B 3HDTA 1DS6A 4PC2A 4CEJB 8OHMA 3LA6A 2BBTA 5KO2A 2GBLA 4B73A 5K8UA 1U8AA 3GLHA 3X1XA 1NI3A 4PO1A 2QSZA 4IKEA 1ZM7A 3CF0A 3AP2A 2WIAA 1HE8B 3IEUA 4A8JC 4ZDJA 1JPNA 2JLXA 3PITA 1XCPA 2GZHA 3DMDA 2OFOA 5B58C 4NCNA 2NO9A 1T8TA 2KE5A 4BFSA 4HZUB 4PQFA 1OIXA 1G6HA 2ZRNA 1SKQA 3Q9LA 5KTYA 2O8FB 4AKIA 5UKDA 1R5OA 2I3BA 2QAGA 4ZO4A 4A8JB 1NLYA 2JLRA 3B13B 5GVRA 2YC4C 3NEJA 3QF7A 1WB9A 4II7A 1JECA 4P4SB 4L8GA 2F3TA 4KJZA 2ORIA 4ZCLA 3MMPA 1NVVQ 4ESHA 2HV8A 3K0FA 4MRNA 2ZREA 5L3QB 1VIYA 3Q3JB 1E9FA 2UVQA 3OZXA 4BASA 1SKYB 3LH5A 4CVNA 2EFHB 1UBCA 2J0UA 3CKLA 1HH4A 1T91A 3VU9B 4QBIA 3OEHD 4DKXA 121PA 3X2SA 2QMOA 5JJIA 3TQCA 3CWQA 2ZIAA 1H8HA 4FW9A 1R6BX 5P21A 4UJ5A 2REOA 2PL3A 3QKRB 4FXPA 4BLSA 3GJ7A 4Q4HB 1E9SA 5JCPA 2OAP1 4OK5A 4BFXA 1QVRA 3D6TB 1ELOA 1GNRA 1S3GA 2J1LA 3O8DA 4MGZR 3A8TA 3CF6R 5DO9A 5H68A 2GCOB 1EFCA 3W5JA 4AG5A 2XSZD 2ZE8A 4L9WA 2XITA 3IILA 3I3SR 5DLQC 3B9PA 3A58B 2VRWA 4B32A 3CRW1 1E6CA 4PAQA 1HV8A 2FWRA 3VKHA 4DLTA 3AVOA 4TMTA 5KDLA 1DELA 4JKYA 4LHVA 1BS1A 1GAJA 2PBRA 3FHCB 3CB4A 3BFVA 1KI4A 4B6FA 1W48A 3FKSA 3HU3A 4TLAA 1MV5A 4HB0A 3FDIA 3THXB 1UBEA 4NCHA 1R10A 2J7KA 4FN5A 4JLKA 4EPRA 2IYYA 4NPHA 3N5CA 3Q5DA 3JZAA 2Q3MA 4EQ6B 2VP9A 3CRMA 3I8SA 2FZLA 4B3FX 2Q21A 1T0JB 1W47A 5BN5A 1HE1C 4QGFA 5EE9A 2XAUA 3ETLA 1KAGA 1NBMD 1KKMA 3LY5A 4Q19A 4V0NA 4R71A 3K0CC 1ZD8A 3A4MA 2ZR0A 4IW3B 2A9KA 1VKJA 4HUTA 2Z0MA 4FMBB 4LJ8A 2V6IA 1EFHA 4PAOA 3SR0A 2JGNA 4V02A 3KUCA 1RPZA 4AG6A 1XD2B 4Q66C 3AKDA 2GZAA 1UJ2A 1E1QD 3ZJYA 2GF0A 4IVRA 3WMFA 3QKSA 4LHWA 4D4MA 5TY0A 4YXWD 1G21E 1Q12A 2BCGY 2FSIA 2OZEA 3LV8A 4NYJR 2FSHA 1WRBA 2N46A 421PA 4RCYA 2ZSDA 2GF9A 1CU1A 1E2FA 2XOKA 3SFVA 3QVVA 4Q03A 2WZQA 1G3UA 4C0LA 3TIFA 1X8LA 4DUGD 1Q1EA 4Q7KA 1FP7A 2CXXA 4DIDA 4YQFA 2ZI4A 2ZJYA 2WWWA 2JLQA 3FOZA 3PUXA 4JT2A 1ZUIA 3CLVA 5KNDA 2Q9CA 4CGZA 3FMPB 3TUIC 4B43A 3MGCA 3QKUA 3EPKA 4LJ4A 1W36C 4TQ9A 2PLRA 2RGEA 1PV4A 4POAA 3PIRA 4NL4H 2IXGA 1JNYA 2JIZD 4PX9A 4Q1BA 4TQUS 1VCMA 2IBMA 2W83A 5JJKA 4OK3A 1E9EA 1G4UR 2V7QA 3QF4A 4OK6A 3AP1A 4PO9A 5JEDA 5E7IA 5FUXA 4TL9A 1G7TA 1GRNA 5DHFA 3B8HA 3T1TA 1W36B 2REXB 5KU1A 4C7OA 1IXZA 1UDWA 3A4NA 1AS3A 5TARA 3BWDD 1OB5A 1G16A 2HDNB 4TL6A 2R8RA 1Z63A 1TPZA 4I1VA 1XFAA 2RMKA 4EIWA 3HR7A 3MWLA 5EP3A 5C4MA 3GLGE 1S3SA 2XEXA 1QF9A 4PC6A 2ZRMA 2ZJ2A 2AX4A 4ZKDA 2WJHA 5DIFA 3T1OA 2F1RA 2R6FA 3RS5A 3OEED 1R8SA 3U5ZB 2Q3HA 1OH5A 5J40A 4C2TA 3OF5A 3I92A 2L0XA 1XTRA 2BJVA 3RRMA 1JEEA 4ZI2A 1XMVA 1E96A 1BOFA 4B35A 1FOEB 1P2UA 2BMFA 2WWXA 3GPLA 5CK5A 1XD9A 2D06A 3TSWA 1KZ7B 2ZEJA 1KO1A 5EXXA 2O8BB 4K8OA 4MYHA 1G7CA 5JRZA 4PO8A 1M1YE 4ZCIA 2AR7A 4YMWA 3G0HA 5FOSA 1WQ1R 1X6VA 2WWHA 2IEZA 2BBOA 4G5SA 3ZDQA 2GXAA 2PJRA 5H70A 3UG6A 3MJRA 5KPJA 4C4PA 3L0SA 3IQXA 1US8B 1IONA 5H8WA 4Q1EA 1T5IA 2D62A 2IF0A 4L5BA 5JSZA 4TT3A 1RE0A 1KI1A 4DDUA 3NWJA 3EX7C 4OHWA 1OYYA 1XMSA 4FCVA 3QI2A 4BLPA 4HB2A 2ANCA 1XPUA 2WBLC 1ZAKA 4TYPA 4V0KA 3NTUA 1HQCA 3B1VA 3WYGA 3EPHA 1W46A 5CIQA 4MRVA 2XZOA 2C5LA 1Z47A 4JVSB 1PZNA 2FGKA 5J4LA 3NBXX 1E2LA 1W0JA 1Y3AA 2WVJA 1G6OA 3MRSA 1F6BA 4IEEA 4D81A 1KYIA 3CX7A 4EPVA 5FL3A 2AXNA 4PZYA 5E7JA 1TQ6A 1A4RA 2AL7A 1AQYA 1NMYA 4D0NA 2IX3A 2IEYA 2PCJA 1AA9A 4LJ7A 1CEEA 4ASUA 1QG2A 3QIAA 1EGAA 1X8JA 1CBUA 1KI6A 1I4DD 2FU5C 4G5RA 3DL0A 4HAVA 4TZ0A 2ZI9A 1IM2A 4Q48A 1QRAA 1TQ4A 1YZKA 4NU0A 5E95A 3SC3A 3CWZA 4DIEA 1NIPA 1PVOA 3DO6A 4B76A 4B3XA 4TL8A 4AY2A 3FYHA 1M7HA 1H8EA 5GJVC 3ZYCA 1XMJA 2G9NA 2C96A 2NO1A 1ZIOA 2A2ZA 4XD7A 1E2DA 4GBMA 3PEUA 1H65A 1XDBA 4E5UA 5KSOA 3LLUA 3KXLA 3L8YA 1SXJC 2RGCA 2WKPA 3EARA 1QG4A 3T35A 2G77B 4W5JA 3FHOA 4JVLA 2YOGA 1MOZA 3TAHA 3UIEA 1OXUA 4BFWA 1E2IA 4NYIR 1ZNZA 2IYLD 4URUR 5HCIA 4Q4LA 2WKQA 3B82A 1SXJB 1ZYUA 1LS1A 2A30A 4YDHB 3GLIB 1TF2A 3T5GA 2VSOA 1ZM4A 3QKTA 3LQQA 1NBME 4XJXA 821PA 2ZJZA 4E03A 3BJIC 1EESA 2HF8A 3B9QA 4GZMA 4IEIA 4XOIA 3U6BA 3MWYW 3TLXA 1WMSA 2QT1A 4B48A 1X3SA 1MABB 3U7HB 1MO6A 1IY2A 4KHZA 4F4CA 3ZQJA 4C0KA 3K53A 1NN5A 3QENA 1ZIPA 5J4YA 1WCV1 3CPEA 3G5UA 3MFYA 1TF5A 4AD8A 3EPLA 2V3CC 3AF1A 1P72A 1E32A 4RVCA 3RRZA 3HYTA 1ANKA 4M1YA 2X77A 1TU4A 1AKYA 4HLCA 2VL7A 3P27A 4QFMA 1OFTA 1ZNWA 3Q8XB 4R9UC 4AYTA 2FMXA 2QBYB 1OPXA 3BFXA 1H8HD 1VYTA 1W4AA 2A5DA 2WTUA 4DHEA 1E9RA 5D3QA 1Z6YA 2QROA 4GNKA 5DI9A 3RYTC 3H2YA 1RYHA 2ZJBA 3TK1A 4U7DA 3GLFB 2H16A 1XP8A 2Q6TA 5FUWA 3DKPA 5HKKA 3QBTA 3EZ6A 3SBEA 3SFZA 4DSNA 4MGIR 1QHHA 1I2DA 1JJ7A 2H5EA 4LC1A 3CRQA 2H1LA 4UNQA 5LBIA 4QC2A 1XPRA 1SVKA 4PHGA 1D2MA 3CRVA 4KYUA 4UJ3A 1SVLA 4AYWA 1NMXA 1GIAA 1UEJA 2F6RA 2FGJA 1BYIA 2NO0A 2ZRHA 2FSFA 4TLCA 1YU9A 3RS4A 4CEHB 1U2RA 2GKSA 4O25A 2J7PA 4W5HA 2V6JA 2AKAB 5BXQC 2ONKA 2ZJ8A 4RD6A 4EDHA 3DOEA 5AJVB 3UPUA 2JEOA 3DHWC 4Q21A 1A2BA 5EE1A 4TQAA 1TAGA 2QE7A 3C5HA 2IS6A 2OCBA 1J2JA 1W2GA 4HLUA 1VYVA 3QJYA 3CUEF 3KJHA 3NHBA 2ZUDA 4MKGA 1Q3TA 3VKWA 2QORA 1GZSA 3M6AA 4HUQB 4IRUB 2YZ2A 4C30A 3BB1A 2EWWA 4NHOA 2C9OA 4U02A 4RFSA 1UBFA 1F2TB 2ZYTX 3I32A 1U98A 4CT4B 4V03A 1XEXA 4G5QA 1CJUC 521PA 2C04A 3UWOA 4AKHA 2NG1A 3SN6A 2E9SA 3W8RA 4MITA 1OXXK 4HAYA 3P1JA 5CITA 1F5NA 3LWNA 2PZGA 3ZZTA 2CE7A 1CLUA 1E2KA 4Q7LA 3SQXA 4H1UA 1Z07A 2F9MA 1OFUX 2K5UA 2QA5A 3K9GA 4RZUA 4HI0E 4QJ5A 2ZJOA 5SZHB 2IF2A 4HB3A 3JVUA 1KKLA 1FNNA 3GFTA 3I8XA 1QHSA 4C0JA 2GETA 1KHTA 3PV0A 2VF8A 2E87A 3U4QA 1LF0A 1SVSA 1VG1A 2VHJA 4IXNA 1G291 3MG9A 2OBNA 1DE0A 1E69A 3IO5A 2CHGA 2EVWX 2IYTA 3QQ5A 4BRUA 5KOYA 3B85A 1E0KA 1F60A 1G5PA 1P6XA 1ZBDA 2HT6A 5LD2C 2VSXA 4YONB 4BWYA 2XOKD 2B8WA 5JWHA 1F3OA 4V0LA 4O3MA 1G8HA 1UKZA 3RC3A 1BIFA 3UMSA 2JLUA 2ZUBA 3THYA 4W9MC 4M1KA 1G9XA 4B71A 2ZQ5A 4OQFA 5L3SB 1E1QA 2BJWA 4MUAA 5LD2B 1UPTA 3DZ8A 3P32A 4X8LA 2MSCB 4WXRA 2ZU6A 1RKBA 4BFUA 1OT3A 2DPXA 2J3EA 2JJ1A 1IY0A 4Q5IA 4BFYA 2OUKA 2CE2X 4BPBA 1UKVY 3BH0A 2Z6VA 2A7QA 3KXKA 3SQWA 3CO5A 1DG1G 3REFA 2I1QA 2ZS8A 4PC7A 1NN0A 5B2ZA 2O8EA 4FIDA 3TH5A 1S8FA 2YKGA 1HA3A 2V7QD 4IOJA 5AJZA 3I61A 4EPXA 3SHWA 4PQRA 4A6XA 1XZQA 4AKGA 4UXIA 4IDNA 2VP6A 2B7CA 5DGXA 2ZR7A 4AURA 2CCKA 4BFVA 2ZVPX 5BWMA 4JJKA 1RFLA 3EPJA 3S1AA 4B3CA 4XTCS 3EZFA 1CIPA 3TQFA 3AQ4A 1Z2CA 2VHUA 5G3YA 2XTNA 2BC9A 4KCGA 3EIEA 1P4SA 4JZKA 1GVNB 1OV4A 4JLBA 4PZLA 5KNCA 5FR1A 3BERA 4BLQA 4LJ5A 4KVGA 1LW7A 4C9BA 3A36A 3ND8A 4EFNA 5EE3A 3QNUA 3B5JA 3GEIA 1P9NA 3GLHE 1IQPA 4Q9HA 5F9FA 1XTQA 4B2IA 4M9ZA 1VCOA 1U81A 2IHBA 1PUJA 1XXHA 1TEVA 4GP7A 1WBBA 3J81k 4MKIA 1E2MA 2UZIR 3EA5A 2BBWA 4Q7JB 1ZCAA 4Q4AB 3DEFA 3TW8B 4US1R 4RZXA 5HR5A 2ODBA 1G20E 1K5DA 1BO6A 2XGJA 2WJYA 3EIHA 3AF3A 2HUPA 4KBGA 3QPVA 1E0SA 1CJVC 4QNRA 1E2HA 2R44A 2ZROA 1E2QA 4TT3D 4LYAA 4DRZA 1ZD9A 3DZDA 4E07A 2BV3A 3IBGA 4B34A 4KLZA 5ANRB 3ECCA 4P3YA 4Q4JB 4D0LB 2FSGA 4PXAA 4C0AC 2F43A 2QRNA 1YZTA 3THWB 2IL1A 1U94A 3T34A 1NSTA 1QDEA 1G7SA 2VTKA 1E1RA 1U0LA 1Q1BA 4B75A 2RH5A 2ZAMA 4FINA 4WBSA 4HYYA 4QHYA 1WE2A 4LX0A 2HEIA 1W0JD 4MDFA 1XX6A 1YVDA 2D7DA 4EJSA 2FZ4A 2G88A 2ZYVX 3P20A 4ZI3A 4A2QA 4M1MA 4ABYA 2CL0X 3I62A 3BXZA 3T61A 4Q47A 5FPTA 1FUUA 3W8NA 1DAEA 1OSNA 4ASUD 1JR3A 2EFCB 2ZRDA 1OKKA 4PFSA 3VTKA 1U8YA 3X1YA 3K1JA 3M1IA 5AUPB 2HT1A 3B60A 4JVNA 1M74A 3FVQA 4JL6A 5CIWA 3SZRA 4JL8A 1E98A 4PC3A 1H8ED 3RNLA 1SVMA 4HZIA 2A78A 1G18A 4XD7D 3TE6A 2GJSA 1E94E 4FI3C 5JLJA 3R7WA 2ZM5A 3GJ0A 5DYGA 1FPMA 1M6NA 3X1ZA 4RJLA 2IHYA 2X8AA 4OI4A 4TYQA 2QQEA 1OF1A 1G19A 4PZZA 3TSZA 1NLZA 3KQNA 1D2NA 2VIIA 1AGPA 5KDDA 4EUNA 1E2EA 1TQDA 2QRZA 1TNDA 3ZZUA 5FOWA 3DM5A 3CH4B 4LJ6A 5DI3A 4EPWA 1G8PA 1FQKA 4X8OA 1DOAA 2QUZA 4CEJA 5F2EA 4TYWA 2JA1A 4JBYA 3BORA 3BE4A 4DXAA 5KDOA 5BW8A 2A5JA 2FOLA 2QY9A 4ILEA 5JS7A 2OESA 2GBLC 3KTAB 3VX4A 3MAAC 3WBJA 3QXHA 4LI0A 2Z4SA 1KO5A 1ZUNB 3TJZA 4AYXA 2NO7A 3PEYA 4ON9A 3EC2A 1Z06A 2CLDX 5KNBA 4IVQA 5A0FA 2G0TA 2V54A 4QGHA 1KAOA 3HJNA 1C9KA 4GMXA 1UBGA 2ZSAA 4HZUA 4CIDA 3D7MA 2O8FA 3FMIA 1HEIA 3I4LA 3X1DA 3EZ9A 4LV5B 4A8JA 3LNCA 3PVSA 2D4HA 621PA 1FX0B 3VAAA 1CR0A 1N5JA 1C4OA 3KJEA 1E2PA 1XPOA 1ZJ6A 1Q3HA 4P4SA 1AN0A 4URXR 1KSJA 3FPAA 1G7RA 4PSKA 3T5DA 4WVFA 1G1MA 1II9A 1G8GA 4MRSA 4LDJA 5HKKD 4UNNA 1D9ZA 2PT7A 5L3QA 3AF2A 3AF4A 5AK0A 2O8DB 1U99A 2DY1A 2GEDA 2VP2A 3AUYA 2FV8A 3V9PA 1NSFA 1L4YA 3VU9A 5DN6A 4EFLA 3ICEA 1IY1A 2QU8A 4PQYA 3VHXA 3MUFA 1NNEA 4TLDA 1GL7A 2J7PD 2OXRA 2IWHA 4RD2A 4B2PA 2ZU0C 2Z4RA 1LF5A 3R8FA 1RRFA 4LRWA 4W5WA 4LYFA 3QEOA 2XXAB 3BK7A 3RSLA 2IYUA 4O2LA 4WAUA 1LY1A 2QE7D 3TUJC 3QKRA 4Q01A 3OHMA 4Q4HA 4UNRA 4MH0R 1YJ5A 2DWQA 2ZE7A 3GJ6A 4OYHA 1Z0DA 1XJCA 5KHOC 3WBKA 2GCOA 2EFDB 2B6HA 3LBNA 4NKRA 5CM9C 1KSFX 5HZHA 1DO2A 2ANBA 4M2LA 2GJKA 3G82C 4M1SA 1KDOA 3T12A 2GJ8A 3VR3A 4M4SA 4A1FA 2BCJQ 2LKCA 4JYCA 4AC9A 1E79A 3BH6A 4OHVA 4QHSA 2R6DA 2GAOA 1BMFA 2EYUA 1Z83A 1E0JA 5JJLA 3THXA 3HPQA 2ZRJA 2OFWA 3CF2A 3FFAA 2F55A 2ZRCA 3C8UA 1I4TD 1WBDA 3W5IA 4KVAA 3ADKA 2QGNA 3SYLA 1FW6A 4EQ6A 2ATVA 4KI0A 1G3RA 3L43A 4LV8B 4PSAA 1T3LA 1HURA 2O0JA 1IJFA 1R4AA 3QXXA 1X1RA 4OI2A 5CDFA 3SHFA 2EYQA 2W00A 1S96A 1E4VA 4LZZA 1R8QA 2VF7A 4Z8XA 1B23P 3RWOA 4MGKR 4QGGA 1R0XA 4DLVA 3CX8A 3LBHA 4TLBA 4FWIB 3A1TA 4LYJA 3GJ4A 2ZR9A 4F38A 2ZAOA 1QHYA 5CM8B 4B6EA 1T3HA 2ORVA 1XD2A 2HCBA 2QAJA 4GI7A 1NG9A 3F0TA 3PENA 1Q21A 2OXCA 4CF7A 1GL6A 4DCUA 3PEWA 2JJ1D 1S0UA 2RB4A 4JBWA 1ESNA 2EQBA 3KKNA 5HE9A 1U9IC 5AJWA 2WICA 4Z51A 4JVMA 5AUOB 1CULC 1WF3A 4URYR 3KQLA 4ZIRB 4IHQA 3CNNA 4TMXA 1SULA 4MQBA 2ONJA 2JLZA 5IDVA 3I5YA 2QN6A 1KK3A 4TMVA 2VYFA 1UF9A 3F5FA 1LB1B 1QBKC 2IS2A 1W2HA 1VTKA 4M9SA 3KDSE 3B1YA 2WWYA 3KKMA 3NDPA 5FUVA 3ZS8A 2UKDA 3E2IA 5FPSA 1RZ3A 3LLMA 2CNWA 1EK0A 2WOOA 2FE4A 1N5LA 1JI0A 1IOZA 4FCWA 4FCTA 4BLOA 4LY6A 1Q22A 5A4JA 1BH2A 3RWMB 3WHLA 2LCFA 1G5TA 6Q21A 2KB0A 5K8TA 1KOFA 5BYJA 2WJIA 3BBPA 2NPFA 4H1VA 2P67A 1UAAA 3I73A 2GJAA 5TDHA 2OCPA 3K70D 1XNJA 1RRCA 3U7EB 4IDQA 1V5WA 2D7CA 4XSHA 4M21A 5FTKA 4JT4A 5FBWB 2WMOB 1M8PA 3FWYA 4G3XA 3PUZA 3RLFA 1J8YF 4PSVA 2R6CA 3C5CA 4HATA 4KFSA 2GJ9A 1FNMA 1Z0AA 4CEIB 4AIIA 1U8ZA 3QF4B 1OFIA 1SVWA 2VBCA 1NKTA 4MUBA 2CCGA 3AVVA 3C15C 1KJYA 1N6PA 1PLKA 3M4YA 3CNOA 3U6KA 4V0OA 4OL0A 2XB2A 1F2UA 5EXPA 3GLIE 3QE0A 2ZSEA 3KB2A 1NKSA 4QOSA 5AWFC 2XJ4A 2O8BA 3AKYA 3ZVNA 1QVAA 4B33A 2B8TA 3FTQA 3K9LA 4GRAA 2ZXUA 5IHPA 3AVUA 1E1RD 1G3IA 1VECA 5KYKA 2Z43A 2CHQA 2WSMA 1P2SA 3Q7QA 3AKEA 2BMEA 5FTNA 1NY6A 1Z22A 1US8A 2IUTA 3TAUA 1NMZA 2JATA 3TUZC 1ODFA 1K6MA 2HLDA 3RS2A 4IDHA 4OQLA 3U3RA 2H8KA 2W2XA 3LD9A 2JDIA 2NQ2C 2IYXA 3QXSA 2KBEA 2C98A 1YRAA 4R7ZA 1GP2A 3W6NA 3CPJB 1JR3D 2P0EA 3QPUA 1SGWA 1OKKD 3GLFE 2DCUA 4FWTA 3U44B 3D8BA 2QM7A 4B74A 1P9RA 4A15A 1Z8FA 3X1WA 2E1RA 3ZVLA 3GMTA 2GVDC 2N1BA 1LS6A 4BZPA 1A82A 3SYNA 1JPJA 1OJLA 4RKFA 3BD9A 3WMEA 1RW4A 4TTRA 3UK6A 4DCTA 5IK2A 5CB8A 4ZDIA 1W49A 1C1YA 4HAWA 1SHKA 4TZ6A 1R5NA 3EC1A 3NH6A 3U3JA 2X19A 3U3MA 3CZPA 4BFTA 1R0WA 1KNQA 4LHZA 1Z6TA 1J90A 3QPWA 2WAYA 1DAKA 4XIGS 4DB2A 3EAQA 4UNSA 2GCNA 3AVTA 3A4LA 1DAFA 1E99A 3PJRA 1BYUA 1XF9A 3ZLJA 3ICQB 3ZQ6A 4TSFA 5GJWC 2DWOA 4LBWA 4KLNA 2QZ4A 4RD1A 2BVNA 1VCIA 2YNMA 4G1UC 4KU4A 3KFVA 3WP0A 4JSYA 3LXRA 2ZYWX 5EJEA 3IUYA 1Z3IX 4Q9LA 1XBTA 1XD8A 4QRHA 1O87A 3MJHA 2OE2A 2C78A 1W5SA 4F7WA 1MO4A 4QKQA 4NONA 4DCNA 2GXSA 2P65A 1Y63A 1IAQA 2ZUCA 3DVLA 1Z5ZA 4S2EA 4MYUA 4YMSA 4A4DA 5D3MB 3IGFA 2QP4A 1CR2A 1XMIA 3B1XA 2UZ3A 1P60A 1TU3A 2FA9A 2QG6A 3LW7A 4LSGA 5AJXA 4IFEA 2NZJA 3BRWD 1QHIA 2WKRA 2W0SA 4G0NA 5E4FA 4LBYA 3HYRA 5FTJA 3GLIA 1L4UA 2A3RA 2GHIA 1J8MF 2RCNA 4NH0A 2OO7A 4PHTA 4A2PA 3AEZA 1NN1A 4QL3A 3GLGB 1X1SA 1NG1A 4ARZB 2WJGA 4GZLA 4GSYA 1DVRA 1OFHA 3LW8A 3EWAA 3AVWA 3AF0A 1VCNA 3SI7A 3BGWA 1MABA 2IS1A 5HCNA 3SBDA 3SYKA 1YQTA 4DJTA 3PUYA 5KPDA 1FFHA 1IXSB 2QTHA 3UG7A 2ASEA 4JLMA 1NIJA 4AKEA 5DN6D 4RD4A 1MO5A 3EG5A 3GJ3A 1SVIA 4W7SA 3A37A 3K09C 4ERNA 3WNBA 2FNAA 5AJYA 2QBYA 3HWSA 1Z0FA 2J45A 1PLJA 2XZLA 4Q9KA 4LC0A 5L3VA 4URVR 2I1VB 4A9AA 4D25A 1NJGA 1T8UA 3GLFA 3C7KA 3IO3A 5CLLA 4NYJQ 1W44A 1YZNA 2B92A 4DSUA 2GESA 4JKIA 3TBKA 1GFIA 2GK7A 1JAIA 2VHQA 1Q1ZA 4XVUA 2RGDA 1A1VA 4I4LA 3PCRB 3RS0A 4P0TA 5EXTA 3DKVA 2NPIA 3RANA 3HP1A 3C4JA 3IPYA 2ZJ5A 4CEHA 3NIBA 3CM0A 3SNHA 1L2TA 2RGNC 4P31A 1E79D 4OQMA 1CTQA 2I4IA 4WZ6A 4M9QA 3WHKA 2B21A 3N70A 1BMFD 2ZITA 4KV9A 2ODNA 1GWNA 3A1UA 4R98A 5FI0B 3TNFA 2J87A 3EA0A 1N5KA 2V8OA 1ZP6A 4BEJA 3VX3A 4WZBE 1M34E 2PZFA 1ZVQA 4NYMR 4OKSA 4LPSA 3ZD7A 3W34A 4HLUC 4OQNA 4GOKA 4NZYA 3VR4A 5B30A 1VG0B 5FFMA 2OHFA 1EG7A 4A6PA 2OM2A 4TMWA 1AIPA 1P61B 1XXHE 1KNXA 2TMKA 1IN7A 3I72A 4J0QA 2XTZA 1F2TA 2N42A 2DYKA 2D2FA 4U5XA 5M04A 2IS4A 3VHLB 4B44A 4IDPA 4A0GA 5BN4A 2ZSBA 4ESVA 1OXTA 4BECA 5FBVB 3T1VA 2CK3A 1RC8A 1Z0JA 4F4IA 2H57A 2IT1A 5ELXA 2DB3A 3AP3A 4Q18A 4R2IA 3CBQA 2RKOA 2AFHE 4LWZA 2VPPA 1SQ5A 1X86B 3ZGXA 1ZM3A 3TSOA 2GA8A 5J4HA 3IQWA 2W2TA 3EZ7A 5CK4A 5JWOA 3BB4A 5JRJA 1G17A 5JZVA 4HAZA 1M7GA 5FPKA 2EFGA 2ORWA 3V4RA 2ZRLA 1CR1A 1JBKA 1KMHB 1GRQA 2AD5A 2WJJA 4N1AA 5HE8A 1ZM2A 1OLOA 2YYZA 1XZPA 2IYSA 4DDTA 3IPXA 4AWXA 1II8B 1YZQA 2ECKA 3I5XA 3KQUA 5FOUA 1ZINA 3EZ2A 4WW0A 4DLZA 1AKEA 3QUSA 4QM6A 4M22A 3SU8A 5DH9A 1CJTC 5K8IA 3U7GA 1JR6A 2VP5A 3FMOB 1DPFA 2HCJB 2AKYA 4MKFA 4TL7A 1S1CA 3LRPA 1NVVR 2QMHA 1P2TA 2P2LA 2CNWD 1S9HA 1HY3A 2JCSA 3NC1C 4LYHA 4Y0AA 3UKDA 4ACBA 3TR5A 1JR3E 2ATXA 1LVGA 5KUTA 1N6KA 3AVXA 5CYPA 1SHZA 2NO6A 2DHRA 4RCZA 4LBVA 3NDBB 3TW4A 2VP4A 2WJVA 3OE7A 1VG9B 2IUUA 3RRYA 1KDTA 4UKDA 3P4YA 1ZU5A 1NP6A 3C41J 3FGNA 3B1ZA 4IOMA 2W0MA 4FD2A 5EZ5A 4DLSA 1OE0A 1W36D 1AS2A 3U3KA 3EASA 5TB5A 3ZZ0A 2OT3B 5LPNA 2H17A 3QG1A 5G53C 3LX5A 3A1VA 4IDOA 4Y0VA 2JJ8A 3K9NA 2ZTSA 1ZUHA 3BS4A 3U7FB 3H86A 5JEEA 2AN9A 1G64A 2BMJA 3Q5EA 5J4VA 2VP0A 2F1HA 5DISB 1DG3A 1VHTA 2PX3A 3VFDA 2O0HA 3W3AA 1JB1A 1SZPA 2GEUA 2ZRPA 4F93B 2GXQA 3ADDA 1TX4B 4MRRA 1EFRA 1KI2A 2JASA 1Q20A 2H7VA 2OCAA 4BZXA 3B2EA 3K70C 4RZ2A 4PPQA 1TL7C 1TEXA 2QPTA 3H4MA 3ZVMA 4NBSA 1NVWQ 5TMPA 1OXVA 2YWGA 4Q4AA 1E9DA 4C3ZA 4DT1B 1CRPA 1ZCBA 4JSTA 2IUSA 3SS8A 1CXZA 4JLPA 4LBZA 2D3WA 4A0FA 4DDWA 3WXMA 3CR7A 4A36A 3NEYA 1A5TA 1GKYA 4DWJA 3AVQA 1X8KA 3CX6A 2FPMA 2HLDD 4WZAE 4D4LA 1YR8A 1S9DA 2A5FA 5EZ6B 2JDID 4NYIQ 5FR2A 1EFUA 1PJRA 3TVTA 1KMQA 2V55B 1HT1E 3R9WA 3OIUA 1IBRA 3QG5A 1CJKC 4Q4JA 1OIWA 3GFOA 1P9WA 4ZDWA 1ZU4A 5SZIA 1YR9A 3R9XA 3PUVA 1N6LA 3THWA 1EWQA 4NTZA 4V0ME 2PMKA 1KK0A 4LV6A 4E22A 5E7MA 4QGAA 1SKYE 2RGAA 3BC1A 3TR0A 1XEWY 2C99A 1W0KA 2CJWB 1KDPA 1JQJC 4KODA 2HJVA 3UATA 5IK2D 1LFDB 2P6NA 2GVZC 5H1YA 2QTVB 3ZH9B 1W4CA 2YV5A 3CONA 1CS4C 2G3YA 4YMTA 4EAQA 2FPKA 4XH9B 1MR3F 1W5TA 2MMCA 4XWOA 1IN6A 2W6JA 3L0IB 1W4BA 2ZSFA 1YHNA 1ZW6A 2AWOA 4I1SA 2B7BA 2RAPA 1YZLA 2O8CB 3KL4A 5SZKB 1TF7A 3IHLA 4BGDA 1WXQA 5HZKA 3ZVRA 2AK2A 4G5GA 2OCYC 5BYKA 4TSFD 2X1VA 4Q7MB 1HYQA 2JAQA 3LFUA 4DC9A 3ADBA 5E3HA 2D74A 5EP1A 2IXFA 5LDDC 5FPHA 1UKEA 2ZVQX 1U0HC 3IKJA 4Z1MA 3GP8A 1TADA 1Z2AA 3PR1A 2WMNB 4F4JA 3O8CA 1D6JA 1T6NA 4L15A 2J5XA 2DFTA 1RJ9B 4TMKA 1UKYA 4MYCA 1T3SA 4NMMA 1UDXA 2ZETA 5C2JB 2CVFA 1OHHA 3KKQA 3RVBA 5TVKA 3TKLA 4M1WA 1EX7A 221PA 4IOLA 3NKVA 4G01B 1CR4A 3KB1A 3WYFA 4KITB 1YR7A 3OFNA 3KKPA 1OH7A 1SXJD 4ACAA 3F3YA 1RYFA 1KI8A 5B64A 2DBYA 2CVHA 3EXAA 1JXMA 4IXMA 5CDFE 3KTAA 3Q85A 3K0AB 3SJZA 3DOFA 1GG2A 2R9VA 1DO0A 1QHNA 4DB4A 1COWA 3RABA 1GTVA 2VSFA 4D0GA 2QPOA 4BEBA 3AM1A 4FMDF 2C9YA 2W6IA 3W6PA 3O8RA 4C0SA 3GLHB 1FTSA 4RY2A 1K5GA 2P3SA 2FPLA 2CMKA 1XRJA 3AV0B 2QAGC 3P26A 4WXPA 3TRFA 1FX0A 2ODEA 2WIBA 1YZUA 2VQSA 2MSEB 4NCIA 1DAMA 1G5RA 4CT5A 1E0AA 1T4GA 2AWNA 1R0ZA 2YVUA 5CJPA 4LJYA 3QEJA 2RHDA 2Y8EA 4V0MA 1GM5A 2BM1A 2J9RA 1R2QA 1Q0UA 2Q9BA 2QAGB 1EFTA 3FKQA 2O8DA 1FQJA 4DDVA 3KJIA 2FX3A 1P5ZB 2BKEA 2PZEA 5EUMA 1NL3A 1VMAA 1Q44A 2CHVA 3K0FB 1UFQA 3I1FA 2KSQA 1KDRA 2VA8A 4UNPA 2PH1A 2QENA 1ZC3A 3T1QA 2XTMA 2F9LA 4TLEA 4A0RA 2XXAA 2J0UB 2JJ2D 3PXGA 2OG2A 3H1TA 1W1WA 4TTQA 2LWIA 2Q0HA 3KUDA 5FOTA 3PFIA 4P33A 1DARA 3R9IA 2P5SA 2ZI3A 1GDDA 5JECA 3ASYA 3UXMA 4A82A 2BBSA 5IT5A 5KSYA 4UQOA 3V4FA 1KK2A 1N0UA 5DSZA 2V1XA 2AXPA 2CK3D 2YJTD 2IYWA 1S4QA 2H92A 2IXEA 5TXGA 1CKEA 3VQTA 5EE5B 1XWIA 3VNVA 2XX3A 4Q1CA 2RGBA 4OBEA 4C0BA 2DFNA 2JLWA 5A5GA 2REBA 1J7KA 1Z29A 2OBMA 2YWFA 1U90A 3VMFA 2GCPA 3OIWA 4X8HA 1N5IA 1Z28A 2ZRAA 3KXIA 5LB4A 2YWEA 4KO8A 2A5YB 2PLFA 3UMFA 4LJAA 3H0KA 2GTPA 2PJZA 3M0EA 4JL5A 4K81B 5J47A 2OLJA 3QBVA 3GD7A 3WRXC 3KZ1E 2JLSA 3ZS9A 2V4ZA 4JIMA 4YDSA 1RRPA 3LVRE 1XTJA 2IYVA 3HU1A 5EQTA 3BAFA 1N6HA 4QXAA 4AI6A 4B3DA 3NVAA 1E9AA 3AKCA 3GFPA 4KSBA 5FH9A 1KO8A 1AGRA 1JXOA 1E2NA 2GK6A 3IHWA 1AZTA 3PQCA 4O0MA 3T06B 1VHLA 2QP3A 721PA 1KSGA 4JJZA 2SHKA 3QSYA 2WPDA 4GP6A 3K0CA 3D3QA 4JLAA 4CDGA 1BKDR 4S35A 2BOVA 2R6AA 1E9CA 4OJKA 4DSTA 1MRSA 1N0WA 2OLKA 2XNDA 4MGYR 4D82A 2XZPA 4KSCA 2DFLA 2R2AA 4QM7A 3GEEA 4HDQB 5G40A 5B57C 2V9PA 4DLYA 4B3BA 4DVGA 4UXJA
chains in the Genus database with same CATH superfamily
1DC8A 2QW0X 2B9EA 2PZMA 4X1YB 1Q7RA 1XOIA 4EZEA 1FS4A 4U00A 1ZWKA 2PUWA 4NC9A 4CNQA 3G2OA 4K40A 2BHRA 2DKNA 2JS7A 1QLJA 2WPNA 2II6A 3KQPA 4PANA 3AVYA 4IR7A 3ZR4B 2J48A 4NARA 3ASZA 5BWBA 1Z08A 1U9IA 4L0MA 4E2XA 4N12A 1ND6A 4EKYA 4H4CA 5AKEA 2WSSA 3JQ8A 3AOGA 3C6XA 4FMCF 2BMWA 3WRWA 3V8MA 4IXDA 4BL5A 2XQFA 4D4JA 4CLOB 3I01A 4PFQA 5A7GA 2IXDA 3CNLA 2GFQA 3DKIA 2J59A 1P7VA 2ZJ6A 3B1WA 4KQ6A 1KI3A 3UPTA 3W77A 3BMQB 1Y1KE 3NHLA 1CUHA 3CT6A 2IU3A 1H0HA 2EOAA 4FZ3A 3JQAA 4RFVA 5JXJA 1RYYA 2DWPA 4JYBA 4Z4QA 1XZGA 3DNMA 4UMDA 1RWMA 4YCJA 3KZCA 5TE9A 3R8CA 2A84A 2BLNA 1N5OX 4E6EA 2RGXA 4NPAA 3SQOA 1FTNA 4LYYA 4EHAA 1X14A 5AW7A 5CCBA 5BWOA 5A7FA 4GMGA 5K5EA 1ACLA 3EVGA 5TGTA 1DAIA 1A27A 3FR8A 4R1OA 3WDKA 1CEXA 4JSRA 5ITVA 3QXJA 4UU8A 1C3EA 2XDYA 4XDGA 4HS9A 1N6RA 5DASA 5EWMB 1ZKDA 1GZ3A 1GA1A 2WWRA 4V1CA 2PRKA 4MKHA 1GPJA 5EIOA 2JAHA 4RH3A 1VPTA 3EVNA 3JVVA 4CEIA 2BWJA 1KGDA 1JEOA 5AW9A 1T9HA 3L2OB 4AZWA 1A4UA 3GWGA 3QPAA 4C7OB 2Z1MA 2WFMA 3LQ1A 2ZE6A 5D3KA 3EY9A 1MQAA 1JLSA 7MDHA 2QP9X 3E7WA 1A7KA 3MRVA 4XQ9A 1VG8A 4QDJA 3FNBA 1I2MA 2R00C 4CRWB 5A1JA 1OB2A 1P74A 5DHTA 5DYIA 4F3CA 2G1KA 1H3EA 1NJFA 3ZTYA 4A2WA 4HRYA 5I4KA 2Y1GA 3O8QB 2R8ZA 5FL7A 4TWZA 4UM7A 1QJ4A 4K28A 4LXIA 1ONBA 1XCBA 4HGRA 5AW3A 3HR8A 1P0CA 3MSXA 2QF7A 3OM8A 1LD3A 1UT8A 1VPLA 1Z7YA 1P62B 3UC5A 4LOAA 2HH9A 3NH9A 2HMAA 4WN3A 1NVDA 1AZSC 2DHCA 2R1VA 3FMFA 1F2UB 1VIAA 4GPEA 3W6ZA 1C1DB 1ZD2P 5KTTA 4WXHA 1EK1A 1TT5A 3AB3A 4BC0A 2GEVA 4GLBA 2PAFA 2UZ1B 4FOOA 4EYGA 2VO1A 4J6FA 5ARDA 3FUVA 1RIFA 2JFOA 4M53A 2VQ3A 1U0BB 1Q92A 2ODAA 1LQTA 1YCGA 3R4CA 1TUIA 3ZBQA 3MGGA 4OSPA 3U19A 1PG2A 3A6ZA 1MMFB 2EL9A 3TTYA 2WU0A 4GGPA 3W1VA 2WB2A 3RAJA 2VNKA 2FEOA 1R5JA 4C6HA 4J0JA 2ARKA 1RMQA 1LWNA 3RU9A 3TQTA 3VU8A 5E6RB 1PJ2A 5TRTA 1JEQB 2G25A 3IAUA 4AJOA 1E64A 1ZCJA 2PDAA 2MIIA 5JHHB 3D2BA 1NFQA 1EXMA 3NETA 3OCVA 4EW3A 2QLBA 4ZO7A 4HNUA 5B4TA 4C06A 1XU7A 3CCFA 2BJHA 1JJBA 5CU7A 2QN1A 4FNOA 5EEGA 1KQFA 1G21B 2CLSA 3EGDB 3ED5A 1IHOA 1L4LA 4RLFA 2J33A 3CLRC 1UZNA 1I13A 2HNBA 3MT9A 3D0KA 4CTOA 4J0IA 2C42A 1U1IA 2H5LA 3RVKA 1A8UA 4ZO8A 2HXYA 4RANA 4BQSA 4C3VA 1RXVA 4YO7A 4KNYA 2JIQA 4P4UA 1P1FA 1HKUA 2BEKA 2WRZA 5CD9A 3AESA 1SJ9A 1VL2A 3AEKA 4BNLA 3F8TA 1WP9A 1D1TA 1ZD1A 3W90A 8ABPA 4U7JA 1FMLA 2RSLA 3ZE8A 4Q24A 2RDMA 3PWSA 1ITZA 2CLOB 4KFTA 4OP1A 5P8WA 1ZI9A 4PAMA 1XRSB 1Z6GA 2Z5FA 3P4XA 3FZEA 2VDRB 3TI9A 4S1OA 4IIFA 1AF7A 1KI6B 3AC0A 2FZKA 3N75A 4W8OA 1E4YA 4MVJP 1WMDA 3EXG2 4L75A 1A97A 3IAEA 3AIKA 4MR7A 3CYFA 1IB6A 1VBKA 1V37A 3R0ZA 2RJOA 3DPUA 4ZMSA 1HBJA 1WXXA 2VHTA 5EJ5A 5D3MA 3NRJA 2W6ID 3DHEA 4JQYA 1STOA 5FEUA 2C4WA 3ECSA 3IAS6 1YE3A 1J2YA 5AK6A 5ED0A 5C46F 1E3MA 1M0SA 1RTKA 3VSDA 3PWZA 2FFRA 2A5GA 1EFVB 1JPUA 1ECGA 1QONA 3JARB 4UHDA 3WQSB 3G9UA 1R0LA 5IVDA 3D3KA 1XVLA 3TLAA 3IP8A 1UJ6A 1VBMA 3A3NA 1BCRA 4KYTA 4W82A 1V9CA 3ORYA 4HSEA 3AR4A 1KO4A 4IY1A 2LRHA 2DGDA 1FDIA 1ZMOA 2JJQA 1EK2A 3DMYA 2VNHA 2VZ9A 5FORA 3ROQA 3DWIA 3PUWA 3H84A 1BGVA 1E7RA 3LGSA 2P1RA 2CB0A 1KAQA 1ESMA 4X71A 3SXPA 1DHRA 4AMZA 4DBVO 2O2IA 4P4TA 5IASA 2ZUWA 3D1LA 4RD3A 3WBBA 3IVMA 3FCEA 4KQEA 3JZIA 3OU6A 3VNQA 2ZIWB 2OCGA 2CZCA 3CW2A 1E92A 1WCXA 4PONA 1L5LA 4AN4A 4PNPA 1GYQA 1BXRB 4XWAA 3VZPA 4AWBA 5K0JA 5HM8A 3DMNA 4GD3Q 1LNZA 3ESZA 5JC1A 1LV7A 3PX7A 2CUKA 3AILA 3DT9A 1GZ5A 2XUJA 4D3XA 4LVCA 3F47A 3DO5A 4TUYA 1CP2A 3NHMA 2XVZA 5ALUA 1XTKA 3BEOA 5JD4A 4MVJE 3VR5A 1HGXA 3HV0A 4BRWA 2XUGA 3S27A 2KI5A 2LIVA 3LO5A 2WT4A 4YLGA 4XTRA 1FYXA 4H35A 4IJMA 4TKLA 1OOEA 4P3OA 3DL7A 4J94A 3KB8A 3ZTWA 4B3RB 5CLHA 1N1EA 3N2ZB 5BUSA 1ZNYA 1VJ1A 4IGEA 2EARA 3R7SA 1GGEA 1P7WA 4AIRA 3AVPA 1G60A 1OI3A 3T3PB 1UM9B 2J0VA 3D6UA 1MH1A 1R6UA 1GOTA 1MC4A 2QE6A 3ZWQA 4NCKA 5JATA 1QRSA 2ZBRA 1KQOA 3QY0A 3DZIA 1MJNA 2JHAA 2JJ2A 4TS4A 3CZ9A 1M5RA 2V3VA 5KB3A 4MUEA 2AD1A 2I2CA 2GPBA 3H17A 4AO8A 4WACA 5JCZA 5A3JA 3U4CA 4PLGA 5K6TA 2RGNA 4QPJC 4GDFA 5E2AA 4CIYA 4HUQA 1HNZB 5C8YA 2QIOA 1C8LA 3OMWA 3TLGB 4D6PA 5BP7A 3NBFA 2G9ZA 4Q1DA 5C53B 3TNLA 1KP2A 2IX9A 1CIVA 2P9EA 1EDBA 3NAGA 5GJBA 4IICA 5AI0A 3FKSD 1O7JA 3QUQA 5CW2A 5IAKA 4BE4A 1IE3A 1NNLA 2WTBA 4CYMA 2EAUA 1YKFA 2XMSA 3S6JA 3P2EA 2O7RA 2P30A 1N3YA 4NAHA 3URKA 1CD5A 1TMKA 3ZXSA 4AUEA 4UUAA 2VK4A 4BP1A 4F06A 1KWGA 4CW7A 3GNSA 4TGLA 5FKJA 3LMKA 1D7AA 4N40A 4TVBA 1J2RA 2PL5A 2OMEA 1EYZA 3OQJA 4NIMA 3UJDA 3ZWXA 3MMSA 3OWXA 4RFSB 2JCGA 2WPDD 5LWHA 1TTTA 3GAZA 4HLQB 2ASVA 4B3GA 4BUJA 4JA2A 3WYBA 1Z73A 2O7VA 2GJ4A 1N2HA 3KVOA 3FYTA 4IOKA 4LUCA 4P83A 4XEHA 4R3UC 2JIPA 3S5JA 1T8WA 1XB2A 2DEUA 1KZ4A 3PQ6A 3VNUA 1BHJA 4CV1A 5C80A 4YBRA 3KEGA 2PD6A 2QKYA 3PHHA 5DHQA 2XGGA 2V4UA 4KWTA 4PFKA 4EF6A 1KQPA 3IKVA 4K9RA 3O8BA 3GNLA 4LHYA 5IYZF 1ODIA 3G02A 1Z4OA 4ZVNA 3FDJA 1VXRA 1VYUA 2H4XA 3RO7A 2VK1A 2YWXA 3WHIA 2RHMA 6YASA 4YAIA 5KEIA 2MYNA 1UZAA 2JF0A 4KXXA 3RDPA 1AKWA 3ROPA 3F4KA 3U4QB 2JHFA 2PKCA 4IIXA 4HDSA 1A8PA 4PLVA 2K2QB 4RQAA 3L6DA 5L3SA 1W7AA 1VJRA 3HGMA 1V35A 4EPYA 3EDQA 3UB2A 3WGQA 3UV6A 2PGLA 5U4XA 1CF2O 1THMA 1HE3A 3H19A 5EUQB 2RBEA 1JQEA 3KD3A 4MLPA 3OOSA 1SPBS 1V39A 2GM5A 4DLUA 1E1MA 2UUPA 4DQXA 1EVZA 2VEDA 3OSUA 3FVVA 4DJDC 4MVWA 1E3TA 4ZALA 1Z0SA 4C5AA 4ZMRA 3AR5A 4WE3A 1XU9A 2VAWA 4C2UA 2QRKA 3CCCA 4I4NA 1N2CE 2CJFA 2QSYA 5U4QA 3T4UA 4MR9A 1G3MA 4OEHA 3NAZA 3GJ8A 1T36B 1I3MA 4UARA 5KNDD 1YF3A 2RGRA 4Q1AA 5ERXA 1ZM9A 3K0EA 4JXJA 2HFKA 2VDNB 2B0JA 4EL0A 1TVKA 3MXTA 2FWIA 1CY4A 1L8QA 4GZ6A 2CXUA 2R3SA 3INYA 1M1XB 3GRVA 3MNFA 4EGCB 3BH7A 4MYDA 4GWKA 4D8UA 4DLWA 3T5AA 1SKAA 4LOKA 1PNQA 1PSDA 2CLCX 2PS0A 2XZTA 4IP0A 5AM5A 1NM5C 2J30A 3HCOA 1HQYE 4K1LA 3NUZA 1Y7LA 3SZUA 1YBMA 4OYRA 1LJUA 2Q3CA 3OD5A 4RPKA 1N1DA 3CEAA 3ILVA 5HHTA 2W6CX 4MARA 1DPGA 3VHQA 1PR1A 1RRGA 2FG5A 3TZEA 5EFZA 5JAHA 4NF2A 4TXHA 5D86A 1GV0A 1I2BA 1XMXA 3K0BA 3U4GA 1IHPA 2GF2A 3R6DA 1EA5A 1VE7A 2AHOA 3C98A 2H2DA 3I5UA 3KQWA 4ZEVA 4X00A 3FE2A 1DZIA 1NQUA 1PT8A 4I5IA 4PZEA 3IUSA 3WIDA 1FFSA 4YCSA 2FH5B 1A8IA 1J24A 2ZBFA 1T5BA 2AK3A 3PF9A 2ERCA 5E6SA 3V32A 4ZEMA 2E6UX 3W7AA 3ZCSA 2D1RA 2E1PA 1FLDA 5T8KC 1XDZA 1RS0A 2FWBA 2ZANA 1KI7A 3FHTA 4RELA 2ZJ3A 4KXFB 2JLVA 4XYBA 1THZA 4Y2PA 4AKSA 4UHCA 2OV2A 3HE3A 3JAWB 3FTDA 4KZPA 3JPYA 1BJRE 5ALIA 4EI2A 4HDKB 3EVCA 4TKVB 4ESOA 1XIVA 5MN6A 5ALPA 3TG2A 2G4CA 3H5IA 2PV0A 1A5SB 4ZEXA 1XDDA 3NRBA 1ZONA 2QRMA 4ALNA 4HXFB 1KSHA 2XR1A 3FFBA 3HVJA 1EJBA 3GP5A 4GKBA 2VSYA 4K46A 3LUAA 3QVUA 4U0KA 3MD0A 3MWFA 2JK0A 4KAFA 3DG9A 2Q5JA 1G0OA 3QUCA 1LQUA 3FYUB 4QHTA 4UTRA 5AVUA 3IE1A 5HP4A 2HR1A 4FLMA 5LFAA 3EWSA 1I0ZA 3DDNA 3NHRA 4R84A 3R23A 5KMGB 4TTAA 2C9DA 4TUYF 3E03A 3SC4A 1A9SA 5CCEA 2RHBA 5TV2A 3ZWAA 4YRSA 4ITVA 2ZYUX 2WLSA 2GILA 4M55A 4EFDA 4HEHA 5I47A 4RAQA 3ZIAD 1P4HA 4PG7A 9GPBA 1WZCA 1D1PA 3F1KA 5EIBD 1YS2X 5AQEA 3ELUA 5DBGA 4TMZA 3ZHSA 3R0VA 3RVNA 3FHJA 2PUGA 3HG7A 4U9HS 3ZLUA 2A9QA 1P4AA 3U7IA 2K7ZA 3WLOA 1HYEA 1RJGA 4W1PA 4AZ0B 3QA9A 1Q57A 4Q16A 3ROEA 4UXHA 4F92B 4Z86A 1NBOA 1ODKA 4O5OA 2WE8A 1Z6QA 2WU4A 3MS4A 3MJ4A 3I4CA 3LVQE 5G3ZA 4TWJA 2FW9A 4ZC8A 4OI1A 1W2WB 5B1DA 1JEDA 1GPLA 1AHPA 3WA7A 1PNRA 2R65A 3KFXA 1OH8A 4QQFA 1ZD4A 1OYWA 2ZRFA 1K9VF 4PCLA 3FH0A 2MINB 5BO5A 1WHTA 2H1HA 4Z4HA 1ZC4A 3Q1LA 4KMOA 3OURA 4QNMA 1RJ9A 3B78A 1P33A 2Y1DA 2G1UA 1F48A 5A0FA 3TTSA 5AI6A 1GNLA 4MS1B 3PTAA 1M2FA 2XA1A 4M89A 5C8VA 1N5MA 1EB9A 2OAQ1 3K0SA 2CEAA 2DTEA 2V45A 5JUWA 3UNXA 1JJVA 4C01A 5FI5A 1Z0IA 4AM8A 1G41A 3E7PA 4L73A 2R6GA 5LP6B 4G4JA 4EFMA 3B7GA 4PYRA 1MAVA 1ABEA 3TLEA 5IT9A 5G41A 4UUNA 2OVBA 3A25A 4XFJA 2E6KA 3E23A 4LMAA 4X54A 5C4GB 4N3CA 1M8GA 4X90A 5AHXA 1BC5A 2C03A 1RT9A 1TO6A 2QPLA 4AMGA 1S8NA 2HRDA 1Q0SA 2Y1XA 1WA5A 3U61B 1BWPA 2XZDA 3MWJA 1II0A 3L8CA 1Y7IA 5G0SA 4D4GA 4F5WA 2P6RA 3LE8A 3V55A 1DC6A 3QITA 1LBIA 2O5EA 3E61A 1V8DA 2UV8A 5DBFA 1E9VA 1G4HA 2ZSHA 3PGVA 4QDXA 3IUJA 1U2GC 2BBTA 2ROQA 3KXPA 8OHMA 1SBCA 2CL5A 1VI5A 2QT9A 3GFVA 4WERA 5KO2A 2QHXA 1NI3A 2VYVA 4JEIA 4YP6A 4PO1A 3EZXA 3T7TA 4BO1A 1Y4ZA 1TAQA 4WCDA 3IIEA 3D6AA 4OFWA 2PANA 2BAGA 2AG0A 1M67A 1HE8B 5BOSB 3Q3CA 4A8JC 1E8NA 1JPNA 2HY7A 3IR5A 3PITA 4Y2RA 1D03A 3FGPA 3IV6A 2ZUFA 2XT6A 3PEEA 1IWPB 1G20B 2PYZA 3F6RA 4OOEA 3UAYA 4C5CA 5B58C 4R1MA 1QU3A 4Y2VA 4M0DA 4ER0A 1GJRA 3BF7A 3CMMA 4PG5A 1SKQA 5KTYA 2NAPA 4WJLA 1PDVA 3ZOKA 1PNTA 1H5UA 2WD7A 1W96A 4ZO4A 1W59A 4AECA 4YLYA 2C5SA 2RH8A 3AHEA 1WB9A 5LZ5A 4II7A 1YS6A 5CDSA 4WADA 1W88B 4P4SB 1QS0A 2XLCA 3HJCA 4KJZA 1AB6A 4ZAGA 3CH7A 3D4IA 4ZCLA 3IJRA 4ZAZA 3EMKA 5LBUA 4G4GA 2R96A 4BEWA 2BGGA 13PKA 4FWBA 1TUGA 1NXPA 2HMTA 4ZC1A 3G2LA 5AK3A 4GMFA 3D6HA 1Z12A 3ZV6A 4CVNA 3CN7A 4LVOA 1P4JA 1M6VA 1FSSA 3K3PA 1T91A 4GR5A 4HFNA 1YD7A 1KR2A 2NV0A 121PA 5AVOA 4ETIA 2JHPA 2V59A 1PQPA 1G8MA 2AQ8A 3C8HA 4G37A 1X92A 3HO1A 1CSEE 4RENA 3QGMA 5BPHA 3GLTA 3VC3A 4G89A 3PNLA 2RHWA 3TIXB 3VJRA 1ZH8A 4DYDA 4FT2A 1HZJA 2JFYA 4KI7A 3ID6C 2BLLA 1ATIA 4RK7A 4BLSA 1V4NA 4K0KB 3GAFA 4Q4HB 2JBAB 3KV3O 4YAGA 1QVRA 3PNMA 4NR0A 3BHIA 4BVFA 1AV7A 4RF3A 2LCIA 3QWBA 1S3GA 2PBZA 3A6JA 4MGZR 5H68A 3WLRA 3UOWA 1V8BA 2GCOB 9ABPA 1T5OA 2XSZD 2ZE8A 2XITA 5DLQC 1TM7E 2H4WA 3I3SR 4BUZA 4RY8A 4YV0A 3H5TA 3A58B 4L74A 4DV7B 3QEBZ 2ZUVA 1P91A 4PAQA 4U7FA 2IYFA 3H7IA 2BY4A 3VKHA 2C9BA 4HZGA 4M54A 4DLTA 3HCWA 4GZ5A 2A94A 4ND6A 2JZNA 3SBOA 1C3JA 4R01A 5IM4A 4S04A 4LY0A 1F8FA 1TA0A 3UMGA 4LDRA 4DPLA 1GAJA 3FHCB 2ZJ7A 3KELA 3P2IA 5KQSA 2Y66A 1MO2A 1PJCA 3NX4A 3ZK8A 4HB0A 1AC5A 5FO1A 1KH1A 1ZK0A 3I6MA 5KTOA 4FN5A 4JLKA 4YHBA 4AS1A 3IQDB 2I0FA 2FOXA 2IYYA 5G0UA 4EKGA 3STYA 3Q5DA 4E0BA 5LQAA 3Q6NA 1X2EA 2Q3MA 3I8SA 2H2WA 3GRRA 1OBFO 1T0JB 2AOVA 2ORYA 4Y8VA 3UPDA 5JNRA 2EFJA 3COVA 5BN5A 1NUPA 4CUKA 2AOTB 1LDYA 2V0CA 2ZPAA 3NWPA 1GTL1 3FPCA 1NBMD 2ZRQA 1KKMA 2YV2A 1V7PC 3AY7A 4JX8A 4W1RA 3IE2A 3E5NA 1SC6A 5B6PA 5K2OA 4FYWA 1E5TA 2PM8A 1U7TA 2ZR0A 3GN1A 1NW6A 4IW3B 2NNLD 2FQ1A 1MX9A 3L5OA 4FMBB 1NMQA 3QWIA 2PX5A 2SCUB 3J80A 4PLTA 4Y1RA 3BQNB 4J90A 1ZGGA 2JGNA 4OU4A 1DIGA 2VDMB 3N3BC 4I6JA 4M9UA 4X1YA 4YCDA 5BN4A 1RPZA 2ZULA 4FN4A 2F3QA 2WW8A 3NVDA 4BO7A 3FJ1A 4GX1A 1WR8A 1ZXXA 5GM2A 1AGNA 1SZCA 4WZZA 1Z13A 4LHWA 2AYXA 3QHQA 4YXWD 1EZ4A 1GUZA 5JNTA 3LV8A 1WQ4A 2MWMA 2Q5CA 4UMEA 5DXAA 3Q1KA 4BKOA 3UZUA 4CLOA 2HPHA 421PA 4RCYA 4EI9A 2HHAA 3HCCA 2V7PA 1CU1A 1Z7GA 2H9YA 3I0MA 3QU9A 3JPWA 4CLHA 3SWWA 5HF6A 3BMQA 1N34B 3BD6A 2OD9A 3F5MA 3JWIA 1G3UA 4NE7A 4PG6A 3J81A 3F49S 2GLXA 2VTBB 4DUGD 1Q1EA 4JGIA 1JQ3A 4L5IA 2BONA 4AY5A 2WQ7A 2X0IA 2VK2A 3RFCA 5JFTA 2G67A 2QJWA 2PUEA 2CJPA 1N57A 3CLVA 5K0ZA 4CGZA 2V3WA 3OY7A 4M0MA 2PUCA 4CBVA 4B43A 1QKIA 2WUEA 3LPAA 4LJ4A 1GTZA 4TQ9A 2PLRA 1PV4A 1M2NA 4FI3F 3JQRA 4WSOA 1KYTA 4YJDA 4BJ5A 4YP5A 2NYVA 4AYXA 3WB1A 5TVGA 3OOYA 3Q8WA 1JNYA 1EM6A 4JDPA 3D1VA 4Q1BA 5EWMA 4ZYXA 2HBQA 5JCXA 1C41A 5JJKA 3R0XA 1E0DA 3RAGA 1G4UR 2Q07A 2RAUA 1NBHA 3I1IA 3MT7A 3QX8A 2WILA 5FNVF 5JDCC 5SYAA 2OBFA 2GZ3A 1RAFA 1UQRA 1G7TA 3C4VA 4RMJA 3NYIA 4C7OA 1E61A 5KNCH 3L7LA 1JWLA 5FTWA 4B6QA 3K8QA 5D5HA 2BFDA 1D2HA 5TARA 3BWDD 1U1GA 3RT7A 1G16A 1D5WA 2OKGA 3PGA1 4N18A 2P4UA 4TL6A 3L7JA 2RMKA 2JGEA 5EOVA 3V8VA 4DQDA 2LDXA 3FNHA 2LVBA 3HR7A 4K6GA 3O8QA 1P31A 1S3SA 2Q5HA 2ZJ2A 3VNAA 2AX4A 2WYIA 1YVPA 3KHSA 4E13A 3M7IA 3FRJA 2F1RA 3RS5A 2VYNA 2HZBA 1OH5A 4D98A 4RXTA 4QICA 3TGLA 2IPAB 4AT1A 1QVZA 2O3QA 1C7QA 1SD5A 2YZNA 2BJVA 2ZIZA 4IJKA 3S0JA 4HOYA 3VPCA 3VPHA 1PR3A 3RSFA 3R7AA 4Z3KA 1E96A 2RC6A 2WYHA 2BMFA 1C1DA 1Y48E 4PR3A 3R3SA 3NR2A 1XD9A 2X4IA 1QFZA 3NM5A 4MI6A 3TB6A 3GUZA 3TRHA 3WLKX 4R0MA 4G5HA 1G7CA 3E22B 4HWPA 2RG1A 2M6RA 1JFTA 2E4AA 1E2UA 3LU1A 2H1IA 4K6HA 5DOVA 3WDSA 4RIIA 3IPLA 3TKAA 4XWYA 4HSGA 5CDUA 1X6VA 3F7NA 2WWHA 3UW3A 3UJBA 3BKXA 2GXAA 3UG6A 2OORA 4Y30A 1GSHA 2EDAA 2UYQA 2VHWA 3FFXA 3F98A 2HK6A 3IQXA 4RZQA 5EHQA 3ZGNA 4Q1EA 5J3JA 1L5SA 2D62A 3PXGA 4KDEA 4M36A 1BU5A 5E6RA 1RE0A 1JEQA 3K9WA 3SS7X 4BY9E 5IMBA 5KQGA 4OHWA 3C3DA 3V1LA 4E7OA 3DDHA 3JALB 4L0DA 3VXKA 2XUAA 2WVGA 3EWIA 3DQQA 1SC4A 1NJ6A 1G21A 3HI4A 4JLWA 3EGDA 4P54A 1K9SA 2QQFA 3WYGA 1WUIS 3INNA 1EBUA 1U2DA 1F0KA 2FRDA 4WDQA 1GUBA 1Z47A 4IBOA 4DZTA 3DDUA 1Z5PA 2FGKA 4KDFA 4QG3A 5LIPA 1W0JA 4CIBA 1ZK1A 5AJUA 1G6OA 5HQTA 4UQPA 1JWBB 3W8FA 1FYVA 3OQOA 1J25A 1KYIA 1YR1A 1WPRA 1BDMA 3CX7A 4LISA 4RQTA 1NU8A 1QO0D 4XYMA 1RHKA 5C8DA 5FL3A 5ECWA 1HWYA 4E5DA 2AXNA 3O4FA 3QBDA 2W4MA 1TM3E 1DNPA 3UHFA 1G38A 1GTMA 1XRRA 4N41A 1AQYA 1DXHA 4D0NA 1QE0A 4GPD1 3SHQA 3ZWKA 1CEEA 4P6VF 4QT4A 1B8NA 1EFDN 1VLJA 1KI6A 3IHTA 1KEUA 1R0KA 1J2TA 3D7KA 5IM4F 3DL0A 4KQJA 5K4AA 3VOTA 4WOBA 5LDGA 2JFWA 1QRAA 3EG9B 3QP9A 3I52A 2OO5C 4NAUA 3GELA 4DZRA 3LZDA 3PE6A 1SIBE 1U3GA 3U0BA 3UY4A 2BFBB 3GUUA 1FMFA 2V5UA 3FF1A 1R37A 5EWJB 4TL8A 1D0VA 4OGLA 2PO5A 4S1NA 2BRUC 2G9NA 4RTNA 4H27A 2CXOA 2H06A 2J31A 2NO1A 5MFPA 4PICA 3OJ0A 3PEUA 5DYNA 4UEWA 1U7UA 1EFVA 4JJAA 2JD1A 3VYTB 3JARA 3KXLA 5DBIA 3AY6A 3PC6A 1OYOA 2AC7A 3CGGA 3IQFA 2BTEA 1LCIA 2RHJA 4DG8A 1GAEO 3VPAA 2QUAA 1QP8A 3QJGA 2CW5A 2WQZA 5EVJA 4W5JA 3FHOA 4JVLA 2H9AA 4E5KA 4YT4A 1DTWB 1OXUA 1E2IA 1GCGA 2G8LA 1J8VA 4HWKA 2H00A 4M1EA 3W06A 4CM3A 5CRIA 5BQOA 4P1ZA 3QFHA 4DMKA 2WKQA 4F1WA 4PZAA 4MWEA 1ZYUA 1LS1A 2A30A 2ZZKA 3OPMA 1TF2A 4YDHB 4U6NA 3HM2A 1T34A 3HCNA 2NSLA 2VC2B 4HVLA 2ZJZA 5IVPA 4QT0A 4QUHA 3BJIC 4E7PA 3BE8A 1FDTA 1BXRA 1JUDA 3B9QA 3EDYA 5HGJA 1U7OA 3MWYW 3H5OA 3TLXA 1WMSA 1VBNA 3HP7A 4LRSB 1DCTA 2QT1A 4KLAA 3WJ1A 4TV8B 1MABB 3JVIA 4PZ9A 5ALJA 4RTOA 5KYYB 3IP5A 5JYEA 3OFVA 1SEVA 3WQHA 3ADOA 3QBEA 4AJKA 4FYMA 4ZP1A 2FRVA 4A26A 2VAXA 3NORA 5J4YA 1S8OA 2CXQA 3G5UA 4I7EA 4AD8A 4ARAA 2PIDA 4DM7A 2V3CC 3AF1A 1P72A 4L8WB 4F4DA 1RCFA 3HYTA 5JZSA 4M1YA 1KZYC 2X77A 4J1NA 2Y6VA 1TU4A 3AO0B 5F76A 1JH8A 3P27A 1C3XA 2XUHA 1U3DA 4E5PA 2FMXA 1W4AA 2K2WA 2C5HA 3SM9A 3TL3A 4DHEA 1E9RA 1Z6YA 2QROA 3E53A 4ZO9A 3EN0A 3IEIA 2H16A 1F2DA 1I14A 1XP8A 3Q0IA 5FUWA 1UM9A 3DKPA 1PYGA 2X4DA 1HYHA 4JMLA 5ALRA 2RK4A 1KFBB 4DSNA 5DM70 2H5EA 2X8JB 3IOMA 3CRQA 2H1LA 3DKKA 3RFVA 4M88A 4P7KA 2AOWA 2SKDA 4BZWA 3CRVA 1T8SA 4KYUA 5GTDA 1NMXA 1GIAA 1UEJA 2F6RA 2NO0A 1BYIA 4TLCA 5NULA 2FSFA 4C78A 1YU9A 3RS4A 2BH2A 4G85A 1LPOA 1M9NA 2O3TA 3L93A 2ZKLA 4Q37A 3R6GA 3HCBA 4BFSA 3I9V6 3DHWC 2NPOA 4XUGB 4TQAA 2BKLA 2IS6A 4MUMA 5J2TB 1KYYA 2OCBA 1TTQB 5IZCA 1W2GA 1I1HA 3TD9A 4D9CA 3KJHA 3GBSA 1ZVVA 1E6WA 1NUSA 1SRQA 5AK5A 1UT5A 3ZNQA 2YIVX 2QN8A 4XGKA 1Y4DE 2B6NA 2ISQA 4N6OA 2E4WA 3CU5A 5K8JB 1P9LA 2FOIA 3L1VA 3V3KA 2PNJA 4FFLA 4RFSA 5DV9A 3U81A 2CDRA 3ZN2A 2AE2A 5HDQA 3ZIDA 2ZBVA 2CLMB 4V03A 5FHQA 5BN4B 1I7QB 4P36A 2ZBEA 3I1JA 4AKHA 3K73O 3BQ9A 2XADA 3BPSA 3IAXA 3SN6A 3A4IA 4NU6A 1EEXB 4R16A 2AW5A 1DRJA 1MJFA 2C57A 1F5NA 1Z9BA 4NH4A 4GVLA 3SF0A 2UUAB 4FYJA 1K0UA 2O4CA 4LMPA 4Q7LA 1Z07A 2Z5VA 3B3GA 3LVFO 1XZCA 2VDKB 2QYTA 2X1MA 3PZRA 1R6DA 3HB7A 4QPNA 4ZVPA 3RC9A 1ORRA 2JFNA 4CTMA 3KRTA 2O3SA 1LPSA 1UAYA 2FEKA 2P69A 2VXCA 3K9GA 1K98A 3BZUA 4QJ5A 5SZHB 1O03A 4R8LA 5J63A 2ZB8A 2H0AA 5I4IA 1KKLA 2AMVA 2FUNB 1L5YA 3VYWA 1UODA 3R5SA 4M0EA 3U4QA 1GPMA 4LQLA 1SVSA 2JAPA 4D45A 1PDOA 3EGEA 1YRQA 1WZIA 3GFFA 5JAPA 2OBNA 2QV0A 2VCHA 1UPAA 3IO5A 4X65B 5GM1A 2HJHA 3A6DA 3EA4A 5KOYA 1PJ3A 1F60A 1VHQA 1G5PA 5ECGC 2PUVA 5LD2C 1K06A 1N2GA 4XLTA 5HDBB 5JD6A 2NV6A 1ZOIA 2XOKD 5JWHA 2PZKA 3G0GA 4RE5A 4OJMX 2LXNA 3A9CA 4V0LA 5E0OA 3RSHA 5BQFA 1UKZA 1BIFA 1QOPB 4RHCA 2F8LA 2ZUBA 4QQNA 4WDRA 4W9MC 5L3ZA 3GY0A 4JXKA 3UJHA 3WAGA 2E4XA 1RZRA 3NBAA 3DZBA 3PFWO 1YB6A 4OQFA 2BJWA 3KOMA 1CUZA 1RC0A 4WKPA 1I30A 2VDLB 3CQ9A 4WXRA 1T36A 1PRYA 3IEMA 1NOIA 3OLZA 2WG1A 4Q5IA 5LA6F 4PO3X 4AP9A 4XYGA 4AN1A 4ZU6X 3BH0A 2Z6VA 2A7QA 3EMBA 4OB7A 1DG1G 4ZZ2A 3DAHA 3ODPA 3GCWA 2ZS8A 4PC7A 1IHXA 3QNWA 5ITWA 1Z6PA 2FDRA 1HA3A 4BIMA 2XQIA 1QH8B 2I8AA 4RQUA 4X93A 5AJZA 4YRBA 4D3DA 2VAMA 3S81A 3I61A 4LCJA 1UC5B 3KQQA 4NBRA 4Z3OA 1L5RA 2VHEA 3M2TA 3HJHA 2HHHB 4IDNA 4UAJA 4RVDA 5IU6A 4UUMA 5KI6A 4JCCA 2ZVPX 5BWMA 4HBGA 3C6KA 2HSZA 1B74A 4MDHA 4NESA 3EZFA 2R5NA 1ODSA 4QXMA 1Z2CA 4DCMA 3CY6A 3QQPA 2BC9A 1I1QB 4IUBS 2EX0A 2W70A 5AVVA 5BYBA 4BRSA 1LPBB 4BGVA 4IZIA 3PLNA 3HY3A 2MHCA 4RV9A 3KPVA 5JSKA 1MJGM 1ZIDA 3DDZX 3PIIA 4EFNA 1DWPA 4J07A 1P4RA 3EQ7A 1K75A 2JEYA 2C1XA 1EDOA 3O9MA 4B2IA 4I1IA 5I7EA 4LZNA 5CAEB 3JAWA 5TMEA 1PUJA 3R3ZA 3SIPA 1R6XA 3FJYA 4HDKA 3DBLB 1OROA 4N54A 4NK5A 4OD0A 1C30B 1E2MA 2VF4X 4BJ1A 1WBBA 1OWLA 1ZN8A 2BBWA 3Q4GA 1QM5A 1UOEA 2QJFA 3E48A 1XA3A 1J8FA 4KXWA 5FI3A 2WJ4A 2QLMA 4YP9A 1EXWA 2P1ZA 2Q62A 3K8OE 2BMVA 1AQNA 2MU1A 4INZA 2NUTA 1I33A 5LYYA 2FLVA 4HWRA 2HPAA 2VT3A 4KBGA 4JC4A 1Z16A 3A2MA 2YZGA 3FYUA 4C20A 1Z4QA 3N8GA 3GK3A 4TT3D 3RIMA 1E2QA 2F4VB 4LYAA 3K1ZA 3SZOA 5KMGA 3DNFA 3EEBA 5IULC 2BV3A 1TA9A 3IBGA 5ALOA 5ANRB 3PJFA 5F7ZA 4B34A 1YFLA 3O3CA 4Q4JB 3TIVA 3V5NA 2FSGA 4P8RA 3W2IA 4D0LB 3T3OA 1GQFA 5F77A 3GEBA 4C0AC 3KUUA 1YZTA 3EHEA 5E2BA 1FDUA 4QJIA 4MUNA 1U94A 1RABA 1VI2A 1U0LA 4GYWA 1OQAA 2FEWB 4EUFA 4R0VA 4WY8A 3EIXA 3RREA 4HYYA 3LSYA 1QHEA 3EAGA 4QHYA 4CL0A 3AUTA 2GFIA 4YNBA 2HEIA 1ZHHA 2PS3A 4AJ1A 3KOYA 1XX6A 5KBYA 4MDFA 2D7DA 1U7HA 2PU5A 3NHSA 1GZ4A 3E5RA 1Z5NA 2G88A 1JLLB 1AG9A 4JX9A 4QRDA 2CL0X 3AHCA 2X0NA 1Z26A 4ABYA 5GIOE 4OB6A 4FEGA 4O4LA 3FYSA 2X9VA 5FPTA 2UVPB 3QI7A 2JH3A 3BIOA 5KOHB 3G5MA 3OZVA 3G6WA 2HMUA 5JCOA 2NWQA 2ZRDA 2EFCB 4YI3A 3HR4A 4ZQHA 4Z4CA 2VBGA 1M1UA 1ZOOA 3VTKA 3X1YA 5ADVA 5CA0F 4TWBA 4I2VA 2V6GA 1NJ2A 3INRA 2H54A 5JTTA 4D43A 4JL6A 4M98A 5CIWA 3L4BA 4MS1A 3WMRA 3LKDA 4A5SA 3NBUA 2J3QA 2R8PA 3RNLA 1F8UA 2A78A 3LUCA 2O06A 4IJUA 3V1TC 1OU4A 1WB6A 2BHNA 1E94E 2GJSA 2JI4A 2ZJ1A 4FI3C 4W5OA 1I3LA 2GEJA 3MC1A 1A9PA 4MV8A 2I8LA 2JJMA 2OAEA 1URPA 2X8AA 2QQEA 4OI4A 1OF1A 3TEJA 4YJ3B 1DXOA 4DTIA 4EO4A 2QWXA 2BDEA 3TSZA 5ICSA 2QXYA 1M0TA 2G70A 2VIIA 3ZY5A 1NDQA 3T9BA 2REQA 3IQGX 4YECA 3WL4A 4EUNA 3MJDA 1DG9A 3TMYA 3ZZUA 3U1BA 2CKMA 3IAM6 4KQIA 1JPVA 4GEGA 4LYEA 4JC8A 5C5EA 2P9TA 2PRJA 4HX2A 1DOAA 5DW0A 4CEJA 5F2EA 4TYWA 1WL8A 2LE0A 4X94A 4DXAA 5BW8A 2Z8YA 1JBEA 1EU1A 5IARA 1YAHA