1U8ZA

Crystal structures of ral-gppnhp and ral-gdp reveal two novel binding sites that are also present in ras and rap
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
168
structure length
165
Chain Sequence
SLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGYAAIRDNYFRSGEGFLCVFSITEMESFAATADFREQILRVKEDENVPFLLVGNKSDLEDKRQVSVEEAKNRADQWNVNYVETSAKTRANVDKVFFDLMREIRAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras-related protein Ral-A
publication title Crystal Structures of Ral-GppNHp and Ral-GDP Reveal Two Binding Sites that Are Also Present in Ras and Rap
pubmed doi rcsb
source organism Saguinus oedipus
molecule tags Signaling protein
total genus 61
structure length 165
sequence length 168
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1u8zA00
3CX6A 2AD5A 2IUSA 1YJ5A 2DR3A 3FKSD 3QF7A 4MGZR 3IIMA 1IAQA 2HYIC 1KK2A 1E9FA 2OEPA 3ZJYA 1XTJA 5B64A 3THYA 2VYFA 2VHUA 2WM9B 4KCGA 1F2TB 5H70A 1DAKA 1RRPA 4LDJA 4WBSA 2CL7X 3BC1A 1G291 1M7BA 2C9OA 3B6EA 1Z0AA 5SZHB 4DSUA 2IS4A 3MWLA 2A3RA 2B7CA 4Q03A 4EFLA 4ESVA 2YC4C 2NO6A 1Z6AA 2ZI3A 1GUAA 1GKIA 3UKDA 3GQBA 2NOAA 4TT3D 3B82A 5CDFA 2JJ2A 5H1YA 4O0MA 4QKQA 4PO8A 2NO0A 1VECA 1MO4A 1G7RA 3N5CA 1NNEA 5KDLA 1ZNWA 4P4SB 4C3ZA 4C9BA 3I73A 1ZVQA 2IK8A 1ANKA 1SKYB 4OK5A 1XCMA 1SVIA 1G3QA 3A1UA 1ETUA 1E99A 1TQ4A 1KDPA 2FFHA 3ZQ6A 3ZVLA 4TL8A 5CK4A 1KAOA 2GAAA 2PCLA 4BLOA 3ZVMA 2OFOA 2QQEA 4PAOA 5JMTA 3THXB 1A2KC 3TMKA 2CLCX 4DCSA 1AZSC 1T0HB 2SHKA 3QKRB 4MA4A 3K9GA 4X8LA 5FOUA 3IHLA 3SJZA 4TTRA 2F9LA 3U60B 4EQ6B 3MWYW 3ZQJA 4OQFA 3EG5A 4C0BA 5JEEA 2NQ2C 1J99A 4NZYA 4Q9IA 4DIDA 4O3MA 4IOMA 3EPKA 1SXJA 2OG2A 3EAQA 1X1RA 3NHAA 1P72A 1QVRA 3RS2A 3VTKA 5C1BA 4KXFB 1LF0A 2RKOA 1FNMA 4E09A 4KODA 3OHMA 1XD2A 4JT4A 2NGRA 3K0CC 1Q1EA 1Q1BA 3F3YA 1E2KA 4LV6A 1NY5A 2QMOA 1KMHA 4FCWA 4GBMA 1YKSA 2ZQ5A 4Q7MB 5EXXA 5DYGA 1E9AA 4V02A 5JSZB 1T91A 4G01B 3G5UA 4UXIA 3RS5A 4BASA 5FOTA 2O8CA 1AJEA 2PCJA 2G1JA 1JB1A 5KDOA 2QEQA 4YXWA 1ZP6A 4U02A 1N6IA 1DEKA 3B5JA 3KKMA 4XOIA 1UEJA 5CIQA 3NKVA 3GLGB 2GETA 2ZU0C 1G4UR 4NHOA 5TXGA 4D82A 3LXXA 5C18A 1CR1A 2HJVA 5JHHB 3X1ZA 2OBMA 3T1VA 4Q1DA 1TEXA 1HQYE 2FOLA 1AA9A 2I1QA 5CLLA 4DDUA 1JNYA 2PT7A 2WKRA 2WPDA 3SN6A 4JLBA 3MG9A 4YDSA 4OI0A 2R2AA 2OXCA 1XNJA 2G3YA 2QGZA 4GMXA 4WOPA 5FBWB 2G9NA 2OFXA 5JWOA 2V4ZA 5JEDA 4FMCB 2I4IA 2OBLA 3TW8B 5DN6D 2A5GA 4AK9A 4M21A 2BEJA 2FU5C 1XWIA 3B1VA 1XPRA 3FHCB 3RS3A 1VYTA 3GJ3A 1G8YA 1DO0A 4XD7A 1E69A 4M1OA 2MSCB 4YMTA 5DHFA 2EW1A 1ZMXA 3TSZA 2R6DA 5CM9C 1COWD 1GSIA 3I1FA 4DLWA 1AN0A 3CWQA 4URXR 3IPXA 3NEYA 4QL3A 3RRYA 4JL8A 3UG7A 2J7PA 2P6RA 3FFBA 4XVRA 1KSGA 1E2MA 2F1JA 5F9FA 3I61A 1F3OA 1S3GA 3QPVA 4FD2A 5J4YA 2ANCA 4QFMA 4D26A 2IWHA 2QQ0A 3VNUA 1W44A 2ZYUX 3L82B 4I1SA 1PV4A 1D2MA 3LRPA 4HB4A 2W2TA 3B1WA 5SZIA 4DLXA 1JAIA 1GWNA 2YYZA 4RCZA 1S9DA 2CCGA 2IYVA 4PZLA 2GF9A 3E2IA 3QIAA 3U7GA 1P60A 3L0OA 2W0SA 4G3XA 4LJ7A 2OBNA 1FX0A 4DCNA 1W5SA 2ZRJA 1WMSA 3OFNA 2V8OA 3LQQA 1CIPA 1AK2A 3PEWA 1EX7A 4TQUS 4IW3B 4K8OA 3SJBA 3PUWA 1P9NA 1FMLA 1NJGA 2A30A 3LVQE 2J1LA 3NBZC 1ZM4A 4YMSA 1ZBDA 2G0NA 4TMVA 1IJEA 2JLYA 1Q1QA 1Z47A 4JKYA 2O0KA 3TAHA 3CZPA 2QRNA 1QDEA 5FOSA 1NBME 1W2GA 2BCGY 4TL9A 1AZTA 1LF5A 2J41A 2BBOA 3C14C 1NLZA 1VCIA 4PSVA 1SKQA 3NC0C 4DCUA 4NYMQ 2QBYA 4Q4JA 4RY2A 1KGDA 1C1YA 2PX3A 4B3GA 1SGWA 2FNAA 2ZSFA 5LBIA 2VSXA 1XXHB 2H5EA 3VHLB 2RGGA 3BB3A 1E2PA 2XX3A 1KO8A 3T1TA 3CWZA 4BZXA 3R8FA 2WWIA 1GAJA 1K6MA 3FHOA 2IYZA 4NCNA 1BMFD 4Q01A 5IDVA 3W6NA 3ND9A 2QTVB 3U61B 4FCTA 1DBSA 1TX4B 3RSLA 2VHQA 1W4AA 2JDIA 5IT5A 4MGIR 2CDNA 2ZR0A 3Q9LA 2GF0A 3QXSA 3CIOA 4G5GA 2JIZD 4F91B 1B0UA 3VFDA 2GXQA 3QF4B 1XDBA 3ZDQA 4DDVA 1WB9A 1BYUA 2JLVA 2YNMA 4D4LA 1SVKA 1ZNYA 1TL7C 1N25A 3EIHA 2UVQA 3ZZTA 4BRWA 3LBHA 1HURA 1J2JA 1TU4A 3X1XA 1OB2A 2XAUA 2RGDA 1TADA 1NN3A 2FGJA 1MR3F 5F98A 2BBWA 1X86B 4TYPA 5JCZA 3AKYA 3SI7A 3OIVA 2I3BA 3CM0A 3ICEA 5KSPA 5GVSA 3LQRA 2OAQ1 3OEHD 2WAXA 1LY1A 4D4JA 2XGJA 1OXXK 3BFKA 4R2HA 4P33A 1G5RA 3F0TA 4N0EA 1NL3A 4PR0A 1XJQA 3ZD7A 4QC2A 1H8EA 4MRSA 5CK5A 2WWFA 2J0UB 4FMBB 4RD6A 1PJRA 3W5JA 3GEEA 3HR8A 1VHLA 2VHJA 5E3HA 3I92A 4YMVA 1U98A 3KQUA 1Z6YA 2O8EB 1DAMA 4BLQA 1OKKA 2WSSA 2ZEJA 2CE2X 3RC8A 4IDHA 3AKDA 2XJ4A 3K9HA 3OEED 4QRHA 3MRSA 3UK6A 1XFAA 5B2ZA 4B3CA 2ORIA 5KYKA 4CZ2A 3KQNA 3MAAC 3QEJA 2O8BB 1PLJA 3WBKA 3LLMA 4PANA 3EPLA 5JCPA 1MT0A 3LH5A 2QY9A 4BECA 5JI2E 3ZIAA 3CPHA 5J47A 1XZQA 1KNXA 1KHTA 2ZUBA 4IOKA 3P32A 3QKSA 4IDNA 2CXXA 1HTWA 1TEVA 2WMOB 3KXKA 2O8DB 1CF4A 2QAGB 4MRNA 3NIBA 2P6NA 4CEJA 3NH9A 1LV7A 5DO9A 4RZUA 1E9EA 2ZSAA 1R10A 3GLHA 3PV0A 3PITA 4PHHA 4MKIA 1VKJA 1YU9A 3OAAA 4ARZB 5KPDA 2F55A 3WNBA 2VP5A 5HCNA 2YWGA 1VCNA 5L3QA 4WXPA 1JEDA 3AEZA 4WAUA 3UXMA 2FJUA 1E0KA 3EA0A 2J0SA 4AWXA 3CONA 5LB4A 1ZUHA 3K1JA 4QHTA 4RZ3A 4NYJQ 4HEJA 4QHSA 2DHRA 5CJPA 2WBLC 5D3MA 1Y3AA 3TVTA 2V6JA 2ZRBA 1P2TA 3QE0A 2C04A 2CBZA 2NPFA 2GEVA 1Z07A 2GTPA 3ZS9A 2X2FA 1K5DA 1EX6A 1L4YA 5FTMA 5HCIA 1MO6A 4HAXA 2YKGA 3U4QB 3CX7A 4AYTA 1KK1A 1RC8A 1G17A 5B58C 2OXRA 2VP9A 3FHTA 1G16A 1U8YA 3KJGA 2BMJA 2FV8A 3W6OA 621PA 4P4UA 4BLPA 4US2R 2ERYA 4F38A 4TWZA 1NVVQ 1LB1B 3W34A 3A58B 1YZQA 5CB6A 3L0PA 3HU1A 5LDDC 4U7DA 4UKDA 2RGXA 1KIMA 1R0WA 3DOFA 3PUXA 3W5IA 2VSOA 3IEUA 2IL1A 4OHXA 1OSNA 5L3SB 1U0LA 3LO5A 3THWA 1CXZA 4AYXA 3LY5A 1AIPA 1WA5A 1P73A 2Q3HA 4HLUC 3TK1A 3VR5A 4ACAA 5KNBA 2VP0A 2ZSBA 5P21A 5LD2B 4H1UA 1YR7A 4TSFD 3QPWA 4BEBA 1E1QD 4A0RA 3MLEA 5FUYA 4GZLA 4ZIRA 4LBZA 2J5XA 4TMZA 4WXRA 3PXGA 3VU9A 4DZZA 2GHIA 3EXAA 2W0MA 5J40A 1CRQA 3B7GA 3W8RA 3BB1A 4ON9A 2ZRCA 3PIRA 1PZNA 4A4DA 5JJLA 4TMXA 1R0YA 2DCUA 1SVWA 3TRFA 3EX7C 5E4FA 3H0KA 1RW4A 1Z0FA 2FEOA 2HCJB 2J59A 2PMDA 2GRJA 4B3XA 3F8TA 4QGHA 3C16C 3KXLA 3QENA 3QSYA 1XX6A 2QSYA 2QUZA 1E9RA 1F48A 2PMKA 1RJ9A 1U0HC 2ZJAA 3L2OB 3REFA 4ZCIA 2LKDA 3PJRA 5DGXA 4MUBA 5FPKA 1LNZA 1C4OA 5C46F 2BEKA 1HYQA 3AVPA 4B74A 8OHMA 3RRZA 3MFYA 5G3YA 5HPYB 4QGFA 3CNLA 1RVDA 3AVQA 3PG5A 1SZPA 4DJTA 3QG5A 1UFQA 5M04A 2XXAB 4Q1AA 1R0XA 1NN5A 4KVGA 3BFXA 5G3ZA 3QPUA 3D3QA 4FN5A 3U3MA 1G9XA 1AKEA 5CJ2A 4KSCA 4I1VA 1S2MA 1LVGA 2ZRAA 1SHZA 1P7CA 4LX0A 4Q7JB 5AJXA 5JS8A 3GLFB 3DDCA 3B85A 2WWWA 2QA5A 4KFTA 3K70D 2EVWX 2ZYWX 3ADDA 1YZGA 5E95A 3SHFA 2Q6TA 2W6IA 1YRAA 1ZCBA 3R9XA 4IEEA 2CE7A 1FP7A 3MD0A 1W4BA 1VYUA 4B73A 4ESHA 5DIFA 1D5CA 3CF0A 2BDTA 1KSFX 3A4MA 4PO9A 3FVQA 1SXJC 4P32A 1ZU4A 3JVUA 1S3SA 2ANBA 3DMDA 5FOVA 2H92A 2BM0A 2OM2A 4YMUA 2WSMA 3LX8A 2ZS7A 2P65A 4NPHA 1KI6A 2AK3A 4NBSA 1CBUA 4Q4AA 3EIEA 5GJCA 4Q21A 3TIFA 4NCJA 3WYGA 3DM5A 1ZCAA 3QUSA 1NMZA 2KI5A 3AF1A 4IVQA 4A36A 3EW9A 2RMKA 2ZTSA 5FOXA 2DWPA 4GL2A 2R65A 1ESNA 1Z0JA 2IS2A 1Z63A 2XOKA 3RWOA 2OHFA 1TQ6A 4UXJA 4CEIB 2FSFA 1T4GA 5EZ6B 2GJSA 1UDXA 2ORVA 2DFTA 1BOFA 1XZPA 3M6AA 1CULC 4KHZA 2H18A 2A9KA 4JLVA 2ZE8A 4DRZA 3GD7A 2F6RA 1N6OA 3GLIE 3KXIA 3C15C 4C0KA 2QI9C 4E03A 3AVOA 3BE4A 1P5ZB 3PVSA 3GCGA 2QPTA 1KI1A 2G1KA 2V3CC 5CLQA 4DEXA 4BLTA 4TLEA 2REBA 1QHNA 1JR3D 5FBLB 1XU4A 1ZC4A 4EQ6A 2PL3A 1P2SA 5C4GB 3T1OA 4F4JA 3A8TA 1MOZA 4NU0A 4PPQA 2FE4A 2NO9A 4I4LA 4E5UA 4W7SA 1D8TA 1E96A 2O52A 4NCHA 4WZ6A 4EIWA 3AVUA 2IXFA 1ZW6A 1CJUC 1OV4A 1UKVY 2VHCA 3OESA 4IFBA 3T5DA 1G8FA 3W90A 2CVHA 1P61B 5BW8A 4MGKR 1FQKA 1E2EA 4Q1CA 5TB5A 2CMKA 4DVGA 4EPVA 5KSYA 2R6CA 2QENA 1WRBA 4Q1EA 1YZNA 1FZQA 2J46A 2VTKA 2IA5A 3TLXA 2EFEB 3CKLA 1YR8A 1XMSA 2V7QD 3VR2A 1KSJA 3TQFA 2F43B 2FG5A 1H8HD 2WWXA 2FMXA 3KUCA 4EPTA 2OCPA 4OI2A 2OFWA 4C2UA 1IN5A 3BJIC 1ZM9A 5JBQA 3K0AA 4FMCF 5AR1A 5IK2D 4N3NA 3BH7A 2IYSA 721PA 4QHYA 3H86A 3FGNA 1OT3A 1XD9A 4XWAA 3I5YA 2OLKA 3A1WA 4PXAA 4RFSB 5H68A 2QAJA 1AQYA 3IILA 3NDBB 1DAEA 2N1BA 3W8NA 4JS0A 1GP2A 1DG3A 1X8KA 5E7IA 2VP6A 4DEYA 3AVVA 2MMCA 4JL5A 2ZJYA 1KKLA 2D74A 2JLRA 1NVWQ 1US8A 2X2EA 2EQBA 1EXMA 3K70B 2RGCA 4Z1MA 2XSZA 3M1IA 1CR2A 4PQFA 4EPXA 3EC2A 3I32A 2Q9AA 1D2NA 4HLUA 2AXPA 2ATVA 1XRJA 1Z22A 2V9PA 5E7MA 4HAUA 3K9NA 4DT1A 2WWGA 2HLDA 1G8PA 2OO7A 2BMDA 4TTPA 4LY6A 2FGKA 3IIJA 2ZIAA 1ZU5A 1MKYA 1U94A 3K0FB 3OIUA 521PA 1EGAA 4DUGA 4C7OA 4FCVA 1W4CA 2REOA 2VHTA 4IKEA 1BIFA 1UBEA 221PA 4KLZA 2AWOA 4TZ6A 1SVLA 3ZYCA 5UKDA 2QSZA 3CW2A 3QKTA 4DC9A 1NKTA 4V03A 3BD9A 3RANA 1OH5A 4LOAA 2NMVA 1GVNB 1N5IA 2ZREA 3B2EA 3WP1B 1IOZA 4LJ9A 2DBYA 3N2IA 1I2DA 3OE7A 1W5TA 1NBMA 3CF2A 1XD8A 3R20A 4R71A 4K46A 2HEIA 1W1WA 4BZQA 1G1MA 5CITA 4LJ8A 3KDSE 3NBYC 1KSHA 5AJZA 2FF7A 2ZUCA 2HLDD 4LWZA 1MRSA 2QL6A 4Q48A 1FPMA 2ODWA 5CYOA 2WMNB 4HZUB 3VR6A 4EUNA 3X1YA 5KNDA 3RAPR 1A82A 2HCBA 4Q1BA 2IBMA 1E2NA 5BYKA 2W2XA 3PUYA 1FL9A 1FMJA 1UF9A 3C41J 1QBKC 3A36A 3QBTA 1XF9A 4C0SA 3SQWA 3AUXA 3B60A 2NTYC 2P3SA 5DSZA 1LFDB 3LW7A 1QG2A 2VSFA 1NKSA 5EE3A 1D9ZA 3IBGA 5BN3A 5K8TA 1OXSC 3KTAA 3NG1A 4AKEA 3ADBA 1U0JA 2GCOA 4M1WA 4C30A 1WBDA 2RHDA 4A8JB 4B6EA 3FYHA 4DBLC 2HUPA 1YHNA 4H1VA 5AUQA 1R2QA 1UDWA 1P6XA 4TN1A 4B3BA 2AWNA 2IEZA 1CR0A 4NYIQ 1W7AA 1XXHA 1ODFA 4YMWA 2UZ3A 3LVRE 4W9MC 121PA 2BV3A 3D8BA 3VKWA 2QP3A 2QP9X 5GVRA 1N0UA 2WJVA 2W6JA 4TLBA 4YDHB 3U7EB 4B2LA 4GI7A 1TUEA 2JJ2D 3L8YA 1SKYE 3GJXC 1H65A 3Q7PA 1AGRA 1CJKC 3KKQA 2C95A 4RD3A 4ASUA 4MGYR 1Z6XA 5K8UA 1NY6A 2A5DA 2O0JA 3O8RA 1R5NA 3EASA 3AGPA 5LPNA 3BFVA 2IXEA 1CRPA 3EWAA 2YHSA 5FTNA 2IHYA 1W36D 3IEVA 2QM8A 1E2HA 3D7MA 3KJEA 2CJWB 2F9MA 3I62A 3RSOA 2CK3A 1OH8A 2VP4A 4TMTA 4IHQA 1T5LA 3BWDD 3H84A 1P4SA 2A78A 3AKCA 3B1YA 4LC1A 1BS1A 2FPMA 2WOJA 4B33A 4AC9A 2YV5A 2ZRNA 5BYJA 1Z29A 4A15A 2NG1A 1TPZA 1SXJD 1DAHA 1VDZA 4L15A 1KK0A 3UATA 1WDTA 3MSXA 3A1SA 5G40A 1R7RA 1P9RA 4P31A 4PQRA 2BIFA 1RRCA 4L5BA 1I4LD 3C7KA 3U6BA 1OYYA 2RB4A 2WOOA 2EFCB 1SVMA 2Q3FA 2ZRFA 4M9SA 2IXGA 1CLUA 3Q5EA 4N1AA 1DELA 4R9UC 4OKSA 3SEAA 4KFSA 3FMOB 1Z6TA 1DG1G 1PLLA 6Q21A 4A6XA 2BVNA 3KX2A 3AUYA 3GLGE 4Q9KA 4MYHA 3ZZUA 1OHHA 4GOJA 5JZVA 1R8SA 4YXWD 1IN7A 4TYYA 2R6AA 5HKKA 1Z2CA 2G6BA 4BFXA 2IF0A 3HPRA 4M1SA 2EYQA 3HYRA 3RYTC 4LHWA 4EDHA 3PUZA 2WJGA 2VF7A 1UKYA 3IKJA 2V54A 3KJHA 2QMHA 4ZI2A 1AS0A 4L4UA 2D2EA 2E9SA 1F2UB 4BUJA 4JBWA 3VKHA 2QT1A 2WPDD 1SQ5A 2G88A 1QVAA 3QXHA 4MRVA 2GILA 4B32A 4C0QC 3LFUA 1Q12A 1T5IA 2EFDB 1DPFA 4XVUA 1NVXQ 4LJ6A 4BEJA 1U81A 4V0NA 4IXMA 3J81k 3TW4A 1VG9B 1E9BA 1OH6A 2JLWA 2Q21A 3U7HB 5FUWA 3NBFA 4JLMA 1G3IA 4HDOB 3QEOA 4XD7D 4F92B 1N6KA 1XPUA 2D4HA 2VA8A 3BXZA 3CO5A 2OCBA 5EZ5A 4HB3A 3E1SA 4XWKA 4FINA 1HT1E 2V1XA 3LWNA 2OE2A 1DO2A 4AKIA 2J7PD 2WWHA 1L7VC 2LKCA 5AJWA 1HE8B 2VQSA 5F9HA 2F1RA 4KJZA 2RAPA 2FFBA 2QZ4A 3QVVA 1N5KA 2ZVQX 4FI3C 4JLJA 3HPQA 4WA7A 3W6PA 1Z08A 3SBDA 1GL9B 2YZ2A 1W47A 3K53A 2ZRIA 4NE2A 5JRZA 3VX3A 1D6JA 4B35A 4UNPA 2AHOA 2Z4RA 1P2VA 2OUKA 4KV9A 4UJ5A 1G18A 3EPHA 1NN1A 4OHYA 3FWYA 2CNWA 1KZGB 4LK2A 4YONB 1J8YF 1QRAA 2W58A 2ZI6A 2EFGA 2ODEA 4BFZA 4WZBE 2TMKA 1Q22A 4I1UA 3OFND 1FP6A 4J0QA 2XJ9A 2BKUA 1XEFA 5JI3E 4AYWA 1KI9A 4CF7A 3MUFA 4Y0VA 1W36B 2IYWA 2FFAA 2BJWA 4LYJA 3I4LA 2GNOA 1VIYA 4Q5IA 4CGZA 2GAOA 4EKDA 3FDIA 3KQLA 1E3MA 4Q4HB 1OPXA 1I4DD 2ZYTX 1VIAA 3RC3A 3B1ZA 3Q8XB 4O25A 4F93B 4PSAA 2F7SA 1XXHE 1E2FA 2GJ9A 1KKMA 2C99A 5SZJA 4W5WA 4A2PA 5J5CA 4B43A 5GADl 3QNUA 3DPUA 3AV0B 3VHXA 5BXQC 1XD2B 1II8A 2QNRA 1G21E 4OJKA 4AIIA 2AXNA 5EJEA 4FW9A 3KUDA 1Z0DA 2Z4SA 1NSFA 3DKPA 1KMHB 3SU8A 1JJ7A 1UPTA 1KI3A 4HLCA 2ZJ5A 3ECCA 4A92A 4O2RA 5FTLA 1JJVA 2AKYA 2O8CB 1XTRA 2J87A 1JXOA 2QMUA 1MV5A 1GIAA 1FQJA 1XEXA 3LNCA 1G7CA 3Q72A 4JLOA 4CEHA 2V1UA 1TF2A 2C2HA 4ZCLA 1X6VA 1XMIA 2JDID 2KJQA 1RRGA 4ITRC 2C98A 1DADA 3LDAA 2JJ1A 1GM5A 4Q18A 3U7FB 4NTZA 4JZKA 1ZRHA 4NCIA 3PENA 1E9CA 2IEYA 3CR8A 2QTHA 4M22A 2EWVA 3G0HA 1PUIA 1T8UA 2GKSA 3B9QA 2HF8A 1GNRA 3KJIA 2JLUA 4TYNA 2YOGA 4ZO4A 3QJYA 2FPKA 2GBLA 3IHWA 2PLRA 2FA9A 1E2IA 3R8CA 3PQCA 4CRWB 1WXQA 5D3QA 3EIQA 1HV8A 3CPEA 5EQTA 2GEDA 4GPTA 2WIBA 3GJ7A 5AK0A 2HJGA 1VPLA 1A5TA 4IEIA 1GILA 2WZQA 3RRMA 4PAQA 2B8WA 3T61A 2IS6A 1QHSA 1EFRA 2DWOA 1WCV1 1N6LA 2AFHE 1UBFA 3DVLA 3S1AA 5KU1A 4IVRA 4L9WA 4ZV4A 3IPYA 2QPAA 4GOXA 4PZYA 3GLIA 1W0JA 4MRRA 1H8ED 1YZLA 1WBBA 2XNDA 5EP2A 4ACBA 4LBWA 2GCNA 4GP6A 5ANRB 1WP9A 1IN4A 2VP2A 4EFMA 4DB2A 3B1XA 1OKKD 2WSSD 2IT1A 1ZD8A 4LHZA 3VQTA 1G8HA 2DFNA 5L8VA 1W0KA 5DI3B 4CVNA 1HY3A 4QGGA 1OXUA 2E1RA 2P0EA 4LSGA 2NPIA 1IY2A 1HA3A 3HDTA 4XTCS 4DIEA 1IM2A 4JVMA 3TUIC 3WMFA 5KSOA 1E0SA 4KFUA 1TUIA 4ZDWA 3ZIAD 1ELOA 1J90A 1S1CA 5FI1B 5EE1A 1E0AA 4Q9HA 4E07A 3TVDA 3ZZ0A 1FX0B 1CJTC 1F60A 4FMDF 2YJTD 3SOPA 2EWWA 1Z0KA 5EE5B 2ZR9A 5AJYA 2QE7A 3REGA 3CH5A 3SFZA 1OIVA 4PPGA 4QJ5A 2PLFA 3FE2A 2IYQA 4M4SA 3OAAD 3TJZA 3ND8A 4PX9A 1OB5A 4EPYA 3NTUA 2BM1A 2BKEA 4U5XA 4V0OA 5CYPA 1OF1A 2QMEA 4BE7B 2GVZC 3LBNA 3IO5A 2O8FB 2XTZA 4R2IA 1SVSA 4TTQA 4HB0A 2G77B 4IJMA 3JZAA 4RFVA 1XP8A 2BCJQ 2F1HA 2VBCA 4POAA 3T5GA 3WRXC 2L0XA 3NEJA 3NVAA 3OZXA 4DCTA 3V4RA 3TR5A 1Q1ZA 5FPTA 421PA 1GL7A 1Q3TA 4Q4JB 2PZFA 1XJ0A 4W5JA 1DAFA 4YLGA 1T8TA 1IXZA 3T34A 4B2IA 4PC1A 4B2PA 1E2QA 2OSBA 2ZJZA 3Q85A 1E1RA 3KKOA 2GA8A 2YVUA 4M1YA 5FUXA 4URVR 4DLRA 4V0LA 3U3RA 3R7WA 4IFEA 1MO5A 2A7QA 1Q20A 2GDJA 4DKXA 3ONWA 3WXMA 5GJBA 3IGFA 1G4AE 3A4NA 4PTLA 1JQLB 4XH9B 4BQSA 3I3SR 1J7KA 4KYUA 5JWRA 4GNKA 2BMFA 2QP4A 3U44A 3CPJB 1QHHA 5FH9A 3C5CA 1TMKA 1VCOA 3RNLA 1X8JA 3E5HA 2FFQA 4RVCA 4OL0A 1DARA 3GMTA 3KL4A 1EFHA 4A0GA 5C4MA 1A1VA 1G5TA 2ZJBA 4A6PA 3KQKA 2ZI5A 5EP3A 1YZTA 4PQYA 5CIWA 5KHOC 1C9KA 4S35A 3UANA 4B3DA 4TMWA 2WTUA 1E2GA 4DCVA 1A4RA 5BN4A 2BOVA 4ZDKA 1XTKA 1SHKA 5FL3A 3I72A 4BFYA 2H1LA 1MABA 1Z8FA 3C4JA 5BN5A 1KZ7B 4EJSA 1XMJA 2C77A 1Z6GA 4HUQA 1ZYUA 3CX8A 5DLQC 5FL7A 1DVRA 1FUKA 4WW0A 4LCBA 3K0FA 4V0ME 2XB4A 1CS4C 3I8XA 1S1MA 4DLYA 4DDTA 2ZM5A 1JI0A 4M1MA 4LV5B 4KBGA 1E9SA 2CVFA 3WHLA 3MCAA 2B21A 1IHUA 1QZXA 2UZIR 2WKQA 1IY0A 1F2TA 3AVWA 1D9XA 2ZRDA 1TF5A 1E6CA 2XNSA 1NVUQ 1II0A 4OK6A 3GLFE 2OT3B 1KDRA 1FFHA 4I81A 2FH5B 1VHTA 2GVDC 5FUVA 1R6BX 2ZR7A 4IOJA 2IYXA 1EG7A 3EZFA 4US0R 2FX3A 1ZAKA 4QM6A 3CUEF 4OYHA 3PEVA 3AVYA 1EWQA 1W46A 4Q7KA 3IIKA 1OW3B 2W6ID 4LJ4A 2E87A 1W48A 4MKGA 1BKDR 2ZETA 4RSGA 5FFMA 2W00A 1CEEA 4P4SA 4BGDA 3UPUA 4JL6A 1HH4A 1BH2A 2ZRPA 3QKSB 2KBFA 3U3JA 2BWJA 3DHWC 1NLFA 2FZ4A 1KI2A 1GOTA 4B71A 2ASEA 5KNCA 1NG9A 3X1DA 5JLJA 4CEJB 4OQNA 1K8RA 2GJ8A 1Z83A 2CHQA 4C4PA 4NDZA 1M34E 4LZZA 3QXXA 4IDOA 4RD4A 1E0JA 2MMGA 4JIMA 3THXA 1E2DA 1II9A 4JSYA 4KO8A 4A8JA 2XZLA 4QNMA 3QKRA 2RH5A 5L3QB 5KOYA 2PEZA 2Z43A 2YC2C 4AKGA 2QGNA 2IYRA 1G8GA 2RGAA 4C0JA 4JMPA 3T12A 2QM7A 1JBKA 3GFOA 4FMDB 2C9CA 2ZJ2A 4KU4A 3TE6A 2JEOA 4D25A 2XOKD 5J4KA 4OQXA 2GCPA 2HDNB 1E79A 2ONJA 4D6PA 2HV8A 2H17A 2ZPTX 3CNOA 3O8BA 2FN4A 4BFVA 4M1KA 5DYIA 1LW7A 2R6GA 3NXSA 3P4XA 2YOHA 3SR0A 2IYUA 2HT1A 1YRBA 4M9QA 2RHMA 2WJHA 1Q44A 5FPYA 5JSZA 2VIIA 1ZC3A 3X1WA 4C0AC 1AS3A 3EZ2A 1VCMA 3LBIA 3RVBA 4RCYA 3NHBA 4WZAE 4B75A 1NMXA 1IQPA 2C96A 4NL4H 3LXRA 2D3WA 3BH6A 4XIGS 4PAMA 1DTSA 1GTVA 4PSKA 3THWB 2H57A 3GLGA 1DAGA 1T3LA 4KI0A 4UJ3A 4PHTA 1M7HA 1KO4A 1R8QA 1NSTA 1ZD1A 2C9YA 3BERA 4NKRA 4XSGA 1XCPA 3AF3A 2GESA 4HSEA 1CP2A 5H8WA 1FW6A 5JJIA 4HB2A 3A1TA 4QG7A 3VU9B 5F2EA 1FOEB 4TQAA 3ADCA 1GITA 2WV9A 3O8CA 1DS6A 2HF9A 1V43A 4LYHA 3PCRB 4B44A 2JGNA 2YINC 3ETLA 4QBGB 4FXPA 1WQ1R 4Z8XA 4MYCA 4A0HA 1W4RA 4URWR 3KB2A 3DM9B 2XB2A 1TQ2A 2ZJ8A 2VEDA 4LC0A 1VTKA 5G53C 1GFIA 1RJ9B 2ZRGA 5HE9A 4RKFA 3FKSA 1PVOA 1Z28A 1W49A 3W3ZB 1Q0UA 5FBRB 4BWYA 5IRCD 2GXUA 1HE1C 1L2TA 1T3HA 4IXNA 3DZDA 3T1QA 3SJAA 3AKEA 4DWJA 2PZGA 3EWSA 2GJKA 1XTSA 3HYTA 1S8FA 3WMEA 3SJCA 4F7WA 3K9LA 2WAYA 3SQXA 2QN6A 2EU8A 1ZINA 1YE8A 3KQHA 4C2TA 1ZNZA 1KDTA 4MDEA 3F5FA 2GZHA 1OFHA 1OH7A 1NP6A 5AUNB 4MH0R 3C8UA 4ZCMA 3KZ1E 4TYQA 3QI2A 3NBXX 3ZS8A 1XMVA 4TT3A 2Z5FA 4Z1MD 5KTYA 2XSZD 3SE0A 4DDWA 1I2MA 1UKEA 2ZS8A 3Q5DA 3TSWA 5LD2C 4R7ZA 2J45A 2X19A 1T9HA 1ZIPA 3DKVA 2GZDA 2VO1A 2AN9A 2ZI7A 2FPLA 3FMIA 4GRAA 4MKHA 3QG1A 5L3RA 2D7DA 4XSHA 1G19A 2P5SA 1KO7A 1HEIA 4Q9JA 3V4FA 3AVXA 4E22A 2R9VA 3HWSA 1UAAA 4JSTA 1HT2E 4UXHA 2ONKA 4DUGD 1TF7A 4A82A 2IUUA 2W83A 3LD9A 2IW3A 1KI6B 3P1JA 4DSTA 3BH0A 3IQWA 4Q4AB 4Q66C 2PX0A 2CHGA 1G41A 4HAVA 1IJFA 1TQDA 4LPKA 5K8IA 3BB4A 4RKEA 2AX4A 4ZI3A 2ZSEA 4Z8YA 1P3JA 3BAFA 3QQ5A 4S2EA 2GK7A 4N0DA 2J3EA 4HDQB 1M1YE 3U5ZB 2ZE5A 3OE7D 1S96A 3Q3JB 4LJAA 2REXB 3DO6A 4C0HA 5C2JB 2GWHA 1NBMD 4YC7A 5DISB 3QBVA 4TQ9A 1S0UA 3CRW1 4KYIB 4V0KA 2J0VA 2VRWA 3FPAA 2X1VA 3KFVA 1AQUA 3B9PA 3KB1A 5TARA 1JR3E 1LS1A 1RZ3A 4LYFA 1Z2AA 1SULA 4R98A 1E2JA 5BQ5A 4L8GA 1NF3A 4OHVA 4F4CA 1M6NA 1N6PA 4AD8A 1NN0A 4QJ3A 1X8LA 4NMMA 1RIFA 4XTRA 1MRNA 4MUAA 1KNQA 3BIFA 1EK0A 1Z5ZA 3AGQA 3NH6A 4Q4LA 2YWFA 1CR4A 4Q4HA 3CLVA 1N5JA 2GBLC 3GPLA 2XTMA 3T15A 1GL6A 5EUMA 2F1IA 2IHBA 4M53A 2B92A 4WIAA 3V00A 1ZNXA 4LHVA 1NIJA 1UBCA 3BS4A 3MWKA 3QF4A 4NYJR 5FR1A 1U2RA 3ZLJA 1Y63A 4B48A 3WBJA 2PT5A 3WNDA 4ERNA 4Z51A 2ZVPX 3H1TA 3OIWA 4FWTA 1E2LA 1U8ZA 2FSHA 1VG0B 2AK2A 3FTQA 5DN6A 2W6JD 2RGBA 1B23P 4DB4A 2ZI4A 1U99A 4AURA 4LBYA 3VR1A 2GJAA 1ONBA 4ASUD 4Y0AA 4A0FA 3CH4B 1WF3A 2QROA 3EA5A 5FBQB 1NVVR 2D7CA 4HAWA 1NI3A 4M0LA 2YOFA 3P4YA 2ZRKA 3FFAA 1KY3A 3P20A 2OESA 5KO2A 4KITB 1COWA 3N2EA 3QVUA 1ZM3A 2LWIA 2ZRMA 4LV8B 2R6FA 2CK3D 5K8LA 1U90A 3TAUA 4BLSA 4PZZA 2J0UA 3K0AB 4RJLA 3WY9A 1KK3A 1KDOA 4MYTA 1OXVA 4LHXA 1TNDA 4OK3A 4US1R 1IN8A 5A5GA 1V5WA 4UNSA 3TBKA 2O8EA 4JLAA 4YQFA 3GFPA 1QG4A 1IY1A 2ZAMA 5TV2A 2ODBA 2JAQA 2ERXA 2A5JA 1CKEA 1KO1A 4AY2A 1R0ZA 2QTFA 5LB2A 1G5PA 1HQCA 1SVOA 2O8BA 2V6IA 4D0LB 3RDPA 3GJ4A 2WWYA 5EE0A 4LJYA 4MITA 1US8B 3CZQA 4B34A 1GKUB 4IDQA 4DLTA 4BFWA 1UM8A 3RS7A 1XEWY 4PO1A 1YVDA 3SYKA 4DXAA 1S9HA 3PFIA 1TTTA 5ELXA 4DSOA 5IHPA 5KPJA 2JA1A 2GK6A 3MMPA 5GJWC 3TR0A 3MJRA 4BLRA 5AUOB 3K0EA 2O8DA 1OHHD 2QAGA 2K5UA 3IQXA 3EPJA 2RCNA 4DT1B 5KUTA 5TVKA 3ZH9B 2OCYC 2DB3A 5HKKD 3KKPA 4M2LA 5AWFC 4QXAA 3TH5A 1G3RA 1GRQA 1RFLA 3EZ9A 4UNQA 4ARZA 4HUTA 3IDQA 4C7OB 2QPOA 2AR7A 3O8DA 5KSZA 2ECKA 4NONA 3THOA 3THYB 4HDCA 1M74A 2WHXA 2Z83A 2DWQA 2AD1A 3AF0A 4DSNA 5DI3A 4KSBA 3AB3A 1N5LA 4JKIA 3VX4A 4KAXA 1X1SA 4JT2A 3VKGA 1N6NA 5HTKA 3L0SA 4P4TA 3EC1A 1JECA 2B8TA 5A4JA 3DOEA 3RWMB 1Z3IX 4H9GA 2IS1A 3U4QA 3GEHA 2D62A 5B57C 1RYHA 1FUUA 4MQBA 4D2IA 3PEYA 4OQLA 3E70C 1UEIA 2XITA 3U3OA 2UKDA 1L8QA 1QHIA 3GEIA 2Y8EA 1OLOA 1BMFA 1J70A 2ZANA 1AM4D 3TUZC 2A2ZA 5G41A 2W2VA 5DE3A 1BYIA 5E7JA 2Q3MA 3B78A 4JVLA 5L3SA 3K70C 4P0TA 4UNRA 1KTVA 1KJYA 4X8MA 2O8FA 2CCJA 4Z54A 3P26A 3HR7A 1U9IA 2VF8A 4IVPA 5JWHA 3HP1A 2JIZA 2B7BA 1YZKA 2Z0MA 3AF2A 3KTAB 3RS4A 3RHFA 2GCOB 4HLDA 2XEXA 4EJSC 5JHGB 4AG5A 2F3RA 4AG6A 1N6RA 2OZEA 1G3MA 3ADKA 3W3AA 3VNVA 2WVJA 5CDFE 2ODNA 1NIPA 4ZDIA 5AJVB 1CU1A 3K09C 3FMFA 2B6HA 4EFNA 4TL6A 1U8AA 4JBYA 4A2WA 1SXJB 4AI6A 1P2UA 3CRMA 1T6NA 2CNWD 5EXSA 2ZI9A 4RZ2A 4XJXA 4GZMA 1T3SA 4D0NA 4RZXA 4ABYA 2NO1A 1JR6A 4X8OA 4CIDA 4XWOA 3OEHA 4RD1A 1NG1A 2BBSA 1QHYA 1RYFA 4G5RA 1TAGA 1XBTA 2C03A 4I99A 4OI1A 4CT5A 3G82C 3AP1A 3O47A 1OIWA 1Q3HA 1UJ2A 4D81A 4G5QA 4M9ZA 2Q0HA 1SXJE 1E94E 5EXPA 4V0MA 1EESA 2OLJA 2XXAA 2PH1A 5JRJA 4HLQB 3UMFA 3AF4A 821PA 1IN6A 4A1FA 2G83A 4TYWA 2FWRA 4LI0A 3AH8A 3BRWD 3FKQA 2KB0A 3OEEA 3TGPA 1DAIA 5FTKA 1AKYA 1ESMA 3NDPA 4LBVA 4KLNA 3GLFA 5FOWA 3HJNA 3R9IA 5FPHA 3U3KA 4D80A 4ILEA 4A8JC 4TLDA 1IBRA 4TLAA 2O5VA 2DFKB 3D6TB 4QGAA 1E98A 1P75A 5KDDA 2KBEA 4I1OA 4PPNA 2Z6VA 1IXSB 1AGPA 1ZD9A 2BJVA 4NH0A 1GG2A 3VMFA 5EP1A 1Q57A 1EFTA 3C5HA 2JCSA 2GEUA 2JJ8A 1KJWA 1CJVC 3AM1A 1A7JA 3PUVA 4FIDA 1XPOA 4M8NE 2QORA 3TUJC 3K0CA 2R62A 3UG6A 4RD0A 4G0NA 1GRRA 1J8MF 2JJ1D 1GNPA 4PC7A 3ASZA 3MJHA 4GFDA 1QHXA 5FBVB 2CLDX 1A2BA 5J4VA 3KKNA 4PPFA 4W5HA 3NC1C 4B3FX 4URYR 2P67A 2I1VB 2P2LA 3BOSA 2J9RA 2RGNC 2ZS9A 4M1TA 4TL7A 4D4MA 1MO3A 2ZE7A 3LX5A 3X2SA 4CEIA 1N2CE 4KVAA 3LV8A 3AP3A 1OIXA 3SYLA 1JPNA 3QKUA 2A5YB 2IWRA 4GDFA 2NZJA 2P6UA 3JZMA 3WHKA 4NCKA 3AVTA 1IONA 3SNHA 1Z06A 3W9YA 5JFGA 1Z0IA 2ZJOA 1UADA 1EFRD 3M0EA 3VR4A 4DHEA 2JASA 4LJ5A 3CRVA 1EWRA 1OJLA 4LYAA 4OHZA 2XTNA 3EZ6A 3RLFA 3CB4A 3UMRA 2QG6A 1T0JB 5EUQB 3FMPB 4QBIA 3TQCA 4UNNA 1W0JD 4BFUA 4CT4B 2XNDD 2VLIA 3TNFA 4BZPA 1CTQA 3UWKA 2OCAA 1XEWX 1HUQA 3H4MA 1GKYA 4BRUA 4LUCA 1NLYA 2V55B 3RABA 5JECA 3WP0A 5L3VA 2QRZA 3CF6R 3NWJA 3FB4A 2IYLD 1VMAA 3GJ0A 4JJKA 4BPBA 1KI7A 4PC6A 3WRYC 1E4YA 3FOZA 4DLSA 4TSFA 1NRJB 4MDFA 1E1QA 1ZJ6A 3EZ7A 3DMNA 5DI9A 1RPZA 1W0KD 2IYYA 1X3SA 3B13B 3U2QA 2WKPA 5FR2A 4HAZA 1EFCA 5BWMA 2GXAA 1JEEA 2N42A 4BFSA 1VG1A 5J4HA 1RE0A 2BHRA 1KI4A 4HATA 1P9WA 2QBYB 4QNRA 3GFTA 3LLUA 4IRUB 2CL6X 3N70A 1GRNA 2HXYA 1R5OA 4PHFA 4OI4A 4Q1FA 4JLKA 4JLDA 2F43A 2WJIA 1L4UA 2QE7D 4HYYA 3T06B 2R8RA 5SZKB 3IO3A 3LA6A 5HE8A 2PZEA 4OJQA 1OFIA 4MYUA 1CJMA 4CDGA 2PJZA 1D2EA 3LAWA 4PFSA 4QOSA 1XTQA 2KWIA 4URUR 3ZGXA 1VYVA 3QY0A 1LTQA 1G20E 3VAAA 4RFSA 5DNYB 1E9DA 2XZOA 2JLQA 4NYIR 3BORA 4KFRA 3UIEA 5IF9A 2X77A 3SC3A 5AUPB 3CNNA 4DLZA 2ZROA 2Q9BA 1KOFA 5A0FA 4DLUA 4NP6A 2KE5A 3L0IB 1I4TD 3L8ZA 2P5TB 1II8B 2JATA 3L43A 1YR9A 1PUJA 4JVNA 1OXTA 2DY1A 2ZUDA 1M7GA 1JAHA 2CEAA 3M4YA 3RRNA 3WMGA 2N46A 5F3WB 1E1RD 4JLNA 3QXCA 4JYBA 1F6BA 5FTJA 4CYMA 1NJFA 2OAP1 3IBYA 2ORWA 1G64A 1XEXB 2C8VA 1GZSA 3BBPA 4CEHB 2CLSA 3I8SA 2EFHB 3P27A 1XJCA 3IUYA 3K09A 2IC5A 3BGWA 1N0VC 4LGMA 5DH9A 2GZAA 1DOAA 2AKAB 2WICA 1MH1A 4O2LA 4B47A 1G6HA 2AFIE 2GXSA 1G7SA 3QXJA 4U00A 3R9WA 2ZRHA 3OIYA 2Q9CA 1AS2A 3B8HA 4HI0E 5EXTA 4EAQA 4QBHA 1W36C 4JLPA 2WJYA 4GMDA 4MRPA 1YZUA 3A4LA 2IUTA 5EP4A 2FZLA 1UKZA 4G1UC 4Q7LA 2RGEA 4A2QA 4QJ4A 4RD2A 3RS0A 3CRQA 5JS7A 2ZYVX 4TZ0A 4L16A 4B6FA 3VR3A 2OV2A 3ZVRA 2IYTA 1OFTA 2IF2A 3CRRA 3H2YA 1EFUA 5FL7D 1N0WA 1R4AA 1FNNA 3LW8A 4HZUA 4QM7A 4PC3A 1R5BA 3SDZA 1K5GA 3S1AB 1RRFA 4G5SA 3WYFA 2QU8A 1G6OA 2H16A 1JR3A 1GDDA 3TKLA 3GLIB 1BO6A 3DL0A 3K8YA 2VPPA 3PEUA 1WE2A 1N3BA 3JVVA 3SBEA 1KO5A 4Q02A 3GLHB 2EYUA 4OQMA 4D4KA 1NMYA 4ZKEA 1ZUIA 2AL7A 4HZIA 5DHAA 2ZAOA 5B30A 2X8AA 2HT6A 2YWHA 4JBXA 2QT0A 3UMSA 4G5OA 3D31A 5HR5A 4Q47A 3CR7A 3WYAA 1GNQA 4TMKA 1Q21A 1P62B 3GJ6A 2C5LA 5TMPA 1KJZA 3OF5A 5HZHA 4AKHA 1KYIA 2XZPA 5D3MB 4IDPA 2PBRA 4JYCA 2H7VA 1N6HA 4Q00A 4L9SA 4LHYA 1E32A 1UBGA 2O0HA 2VH5R 3GLHE 3BK7A 1G3UA 1LS6A 1PLKA 1E4VA 3AQ4A 4ZKDA 2V7QA 3Q7QA 2ZRLA 3GJ5A 3PR1A 4GSYA 4URZR 3K0SA 3A1VA 2J0QA 1H8HA 4WVFA 2ZE6A 1O3YA 1RKBA 5EE9A 3SS8A 1KY2A 2CJWA 2RGNA 2PEYA 5FI0B 2HXSA 2BC9A 3A37A 2ZITA 3GJ8A 2KSQA 2ZSDA 4Q19A 2DYKA 5IK2A 4F4IA 4B76A 3ZD6A 2J7KA 3AP2A 2VL7A 3T35A 2BMEA 2LCFA 2NZ8A 1M2OB 4HAYA 4Q9LA 1KMQA 5J4LA 1QF9A 2H8KA 2QAGC 5TY0A 2CCKA 3ZVNA 4K81B 1E79D 4IOLA 1YQTA 1OE0A 2DPXA 2G0TA 4GT1A 1G7TA 4ZIRB 3V9PA 3WNCA 4NYMR 1FTNA 4DLVA 1OYWA 1ZM2A 1JXMA 1FTSA 3UWOA 5HZKA 2DFLA 2A5FA 2IX3A 2MSEB 5GJVC 1DE0A 4XVQA 4OBEA 4EPRA 4II7A 3MWJA 2FSIA 4OHWA 4UQOA 4PHGA 3SFVA 1VG8A 2FSGA 3R7WB 3U6KA 2JLZA 3SHWA 3ICQB 3HU2A 3EARA 4JJZA 4JVSB 4EPWA 1W2HA 2HYDA 2ATXA 4MKFA 3CBQA 4GP7A 4GOKA 2R44A 5TDHA 2PJRA 4FWIB 1M8PA 1XCGB 5FPSA 2OILA 1QHGA 2CHVA 2JLSA 2WIAA 3GP8A 1XB2A 2D2FA 3ASYA 3SZRA 1S4QA 1O87A 1XTIA 3U44B 1QHHB 1F2UA 2JLXA 4A9AA 2D06A 2CL0X 3QOFA 4LPSA 1ZUNB 2YWEA 2NIPA 5CM8B 4ZDJA 1TU3A 3DZ8A 4C0LA 1YR6A 4LRWA 1IXRC 1KI8A 1ZIOA 3KFXA 4ZPXA 5CB8A 5JJKA 1JPJA 2ZXUA 1KAGA 2ZU6A 2FDCA 1F5NA 1OFUX 3HU3A 4BFTA 3A6PC 1ZM7A 4KBFA 4PC2A 3DEFA 3SYNA 3TSOA 2FEMA 2MSDB 4QBFA 2WJJA 2F3TA 2C78A 4TLCA 1MABB 2NO7A 4CW7A 1JALA 1U9IC 4M9XA 4EJSB 3I5XA 3MGCA 4HUQB 4P3YA 2BBTA 4X8HA 1JQJC 4D0GA
chains in the Genus database with same CATH superfamily
2YFQA 4IZHA 2JIOA 4KV7A 2X4DA 4BVBA 3GVPA 1ABFA 4G26A 1VE6A 3MINB 3IPRA 1X2EA 4TVBA 3THRA 3IIMA 1JBEA 2HV9A 4P82A 1IAQA 1NPYA 4IQ4A 4CEHA 3ROXA 2MOKA 2X8JB 1AX9A 1DJLA 3BHMA 3DE3X 3IERA 1E9FA 2O14A 3EDYA 2L19A 1XTJA 2X1MA 3THYA 4PLTA 2VHUA 3DF7A 4Y30A 1F2TB 5H70A 2BFNA 1I33A 3WHIA 4C6TB 3L0YA 2Z5VA 4WBSA 1M7BA 3E3OA 3TMKA 2C9OA 4EBFA 1Z0AA 5L6MB 3DAGA 1FP2A 4WK0B 3B48A 3I37X 3NBUA 2PUGA 8MHTA 1VSVA 3UUEA 5EQDA 2XI4A 2CXUA 4KQ1A 1SG6A 1EZZA 2PTHA 3D6JA 3ETEA 2NO6A 3CJTA 3GYGA 2ZI3A 3UT0A 1L9KA 2CY0A 4DM7A 5HCUA 2RARA 2C07A 2FDRA 5F2OA 3EDRA 2ZTMA 4WUVA 1IOLA 3FPFA 1BGVA 3GQBA 3TZLA 1W59A 3L02A 2QQ5A 4LX8A 4N6OA 5JATA 4OHRA 3VC2A 2BFBA 4O0MA 2AG5A 4PO8A 3DOOA 1N5RA 3N5CA 1NNEA 3M6LA 5KDLA 5KYWB 1JS1X 4C9BA 4PZPA 3CQ9A 1LVHA 3OLWA 1XZNA 1KVRA 2V0NA 1EFVB 3HDHA 1AHPA 2IK8A 1ANKA 1P19A 5T3YA 1XTUA 4YRQA 4EI7A 2H1CA 3GT7A 4YJFB 2VTDA 2XYRA 1OC4A 4X91A 1SJ9A 1PWHA 4BLOA 4QPJC 1TYDE 1E61A 1XZCA 2YJ6A 4NBTA 2E37A 1Y48E 2ID9A 4D9MA 2ZBDA 3UN1A 3F46A 4DCSA 3IVRA 4MV5A 1LLDA 4MA4A 2SHKA 4X8LA 2ZIFA 5FOUA 2G7ZA 1V11B 2C57A 4N18A 4XM1A 2DUWA 2IHUA 3OZCA 2DSTA 3CY6A 4KMOA 3ZQJA 4V3CA 1TRKA 4CLHA 4ZVKA 1KVTA 1EE1A 2I78A 3H97A 3QITA 5IH3A 5TLSA 4O3MA 3NHAA 1XZKA 2JFXA 5C1BA 1QVRA 1SUPA 3VTKA 4HH4A 1SWWA 1VLMA 4MVJM 4D92A 4ISBA 4U7TB 5K6AA 3V6MA 3V4PB 4RZHA 3RVRA 1S8NA 8ATCA 1OUMA 5IJ9A 3DMGA 3FOCA 1RPNA 2Y77A 4UCWA 4H15A 5LOVB 4RK0A 5DNEA 1KE1A 1NY5A 4DVJA 4GBMA 1YSCA 4Q7MB 1FP4B 1E9AA 3ZWWA 3RUHA 3T1NA 4AQ7A 2A67A 4G01B 1LV8A 3RS5A 1VFPA 4PG4A 4BASA 5FOTA 4DL9A 1URPA 2PCJA 2G1JA 5AW8A 2O8CA 1AJEA 4NFYA 5KDOA 4MIOA 5F35A 4XIJA 4YT8A 5I7VA 3F4KA 1QPBA 3MUNA 1BWQA 1JDZA 2OQ2A 4C76A 1XZHA 3RJMA 4DV1B 2GNPA 2QRVA 4JI5B 3NLLA 3NEAA 2K7FA 1G4UR 5TXGA 2E0IA 4MEBA 5I9TA 4MQEB 3X1ZA 5DJ5A 1RBYA 2A4MA 4Q1DA 3GWGA 1USKA 3UJNA 2DETA 1X1EA 2OB2A 4ZRMA 3AR6A 2PT7A 5ERGB 4C88A 1X0XA 3WLFA 4PICA 1FB5A 2JB9A 2PANA 3SN6A 1J0EA 5DHPA 3CSUA 5AI8A 5B53A 2R5FA 2LNDA 1GZ3A 3OIGA 1Z5WA 3MCVA 1RC1A 3OOHA 1RQ7A 2H2DA 2HFJA 2P9JA 4PNHA 2G9NA 4B7ZA 4FMCB 5A4FS 2I4IA 3WDKA 2UZ0A 5DN6D 2RHCA 3IP5A 4KG7A 5ILOA 4JI6B 4D8YA 3UM9A 3NIWA 2FU5C 2DBVO 4KN8A 5AXCA 3FHCB 4RH0A 4UARA 4RJKA 3GJ3A 4IAOA 3RS3A 5A4AA 2OHGA 3WA7A 1FDOA 4B3SB 1QONA 2VNHA 4KK3A 3RFUA 5FWNA 2BF7A 5BOSA 4XD7A 3C2QA 3DD1A 4D8WA 3VU0A 2CMHA 1RI1A 5KCZA 3RBVA 1QV9A 3BHIA 4M1OA 3WIEA 4MHSA 2PYZA 2OV8A 4GP9A 4X84A 3OCXA 3HGQA 4PZCA 4YMTA 1N77A 1WXHA 1ZMXA 2EW1A 4NOJA 3Q7EA 2DY0A 2QIOA 2HU7A 1YQXA 1CCWA 3H75A 4UCXA 4DLWA 2O54A 5FNVF 2DBRA 2QM0A 4YO7A 1E7QA 1HL3A 4JKOA 3RFFA 2CXHA 4GOND 4F9EA 4XM0A 3RRYA 3DDOA 2HLPA 3TQSA 3KSBC 1KEWA 3OJWA 1LK5A 2FKNA 3ZI0A 2EJWA 3UUFA 4QYIB 4R1NA 5FLEX 1Z39A 3ISJA 4G2TA 4W63A 4OB7A 4BX9A 3GUYA 1FMFA 1THMA 3JPWA 3H3FA 5FYQA 4U0JA 3RK0A 3RPEA 5KYNA 3L77A 1LQTA 4P92A 2MDTA 2Q3LA 3TW6A 1W44A 3BF8A 2WKSA 3L82B 1D2MA 2B4TO 2PIAA 3B1WA 3B38A 3KEGA 2ZWPA 1GWNA 2VK8A 3EB9A 4UAGA 4RCZA 1JEJA 4X95A 5TMDA 2O3RA 4BY9E 3QIAA 1PCXA 4WNAB 4TWIA 1FYEA 4B3JA 3LTEA 4G3XA 4J43A 2CZCA 1FX0A 2JIQA 3O7WA 3HY3A 2ZRJA 1UJ5A 1QK4A 1WMSA 2V8OA 2VA9A 4IG4A 1Y98A 1J33A 3I0NA 3LFHA 4UTOA 2P4HX 3B5IA 3MJCA 2UDPA 3MMSA 3SJBA 3DT8A 3FXAA 4FCCA 1TCAA 4MPPA 3LVQE 4YLEA 5KYXB 4P86A 5L7YA 3HDQA 4OGFA 4EDFA 3GROA 1ZBDA 3DAFA 5FOXA 1IJEA 2I7XA 4HADA 5FRDA 1B0PA 2OAEA 5ECYA 3O8OA 5K7SA 2P7HA 3OSUA 3K8ZA 2IEAA 3I53A 3N2LA 3A6HA 3OQPA 4EI9A 5LIRA 1EP2B 4NOLA 5DM2A 3CHYA 1BHJA 1VB3A 1EGQA 3R0VA 4QQRA 1LF5A 3UNXA 1PJQA 3HUDA 2JBAA 1O4VA 3SF0A 2XCQA 3EPHA 3HFJA 4UAUA 5DM0A 1O6CA 2IE0A 5E6SB 4ALKA 3FCUB 3HRIA 2AMYA 2V9CA 1C8BA 5AI0A 1G20A 2FSUA 2IEIA 2YVAA 3L1JA 1Q0TA 2CSUA 2FNAA 2WU0A 4B3GA 1EUCB 2H5EA 3HV0A 1DG9A 1ZR4A 3BB3A 3BMQA 3GCWA 3SSMA 5AVRA 4K9QA 3LVFO 4B4VA 4IDDA 1L1FA 1L6IA 5DNCA 4AT1A 3G9QA 5IM5A 4ZOLF 1QCCA 2BH2A 1A2OA 4OQZA 2J4CA 4NESA 2IYZA 4E5KA 3DTTA 1OLUA 2CLOB 1BMFD 4Q01A 5C31A 1YR3A 1EQ2A 2HPVA 2W7TA 3ND9A 3NHPA 4RGQA 3RSCA 3U61B 4CT0A 4DA4A 1UWKA 3NHLA 2W6MA 4EA7A 3A1FA 3QVLA 1JPVA 3HNPA 1YL7A 2JDIA 4HQRA 4QICA 1W88B 4PHCA 4KNYA 2H4XA 3BTSA 5TC4A 3O2SB 4JHXA 4RJ2A 3O82A 3MWEA 4TWRA 1ENYA 3JQFA 3QVTA 1V35A 3F7TA 4O4JF 2Z1NA 3ESRA 5ALLA 1K88A 3VFDA 2GXQA 4HCJA 1LK0A 3W3AD 3ZDQA 4F11A 2P41A 1QOPB 3WADA 2DLCX 2COEA 4ZALA 3HZOA 4F5ZA 1SVKA 3BXGA 3B6JA 5LXTB 1D04A 3JALA 1N25A 2VPYA 2B61A 2AFIA 5DM1A 3T7IA 3X1XA 3ROKA 2D5BA 2XAUA 3ONDA 2FGJA 2QUAA 1U8EA 2H0QA 1ENOA 2VCEA 1L4KA 1UUFA 2BBWA 2XB9A 1X86B 3PR2B 1RJWA 2HQRA 1AOXA 3MB8A 4IR7A 3C8ZA 4IRMA 4REQA 2J3MA 2NYAA 3AR5A 3SD7A 3CM0A 2NZWA 3TVYA 2QXYA 5IU6A 5KSPA 4RGBA 4Y6QA 5GVSA 2V8BA 3DE1X 2OAQ1 3EG9B 3LQRA 3OEHD 5D8DA 4CTKA 1DJQA 5A6SA 1LY1A 4P84A 2VJPA 3F3SA 4QDUA 1OXXK 1GNTA 1PL0A 3BFKA 3SC2B 4JDPA 1VHJA 2IHZA 5B12A 3H5OA 5IWAB 1GPDG 2OBBA 2Q27A 4KMMA 3I34X 3V8RA 2RD2A 1ZY2A 3WRWA 4MRSA 2WWFA 1XI2A 2W2NA 2YQ4A 1PJRA 1RLIA 2MSWA 2YICA 1VC2A 1VE1A 2EGGA 3I5UA 3IBFA 4RSRA 1DFIA 2G67A 4WX2B 1IVSA 3K72B 3KQUA 4GXTA 1U98A 1IHDA 1F4LA 3KBBA 2Y66A 4BLQA 3ORRA 4ZARA 2ZEJA 5KWEA 3NASA 3EXFB 2DWUA 1KDVA 1SG0A 4IDHA 5H80A 3K9HA 1H4QA 4RK7A 4RMIA 4XX0A 5ALQA 4DKJA 4IPTA 1SOAA 4B3CA 4RLQA 3EODA 2FRVA 3T5MA 1M2VA 3QEJA 4DC0A 1PLJA 3P8ZA 2ZBVA 4X97A 1HYHA 2R3SA 4KN6A 3VU3A 4HVTA 1D2HA 3NI2A 3EPLA 5JCPA 2FWJA 4LDZA 1B0ZA 3CMMA 1Z2OX 1N8TA 3LNTA 4JI1B 1LDYA 2HJWA 4JH0A 3ZIAA 4KE6A 4R9SA 4IOKA 3T3EA 4DEVA 2W98A 2RFLA 3K31A 4M7OA 2WMOB 4XA8A 1A69A 1GQSA 1K08A 3PGA1 5REQA 3NIBA 1YT5A 1XCLA 3QVGB 2P6NA 3EEBA 4OGWA 1VXOA 3QWFA 4Y2HA 4CEJA 5DO9A 4D43A 2HA2A 5KKAA 2C5HA 2Q29A 4C3OB 1RZRA 4KGDA 4GD3Q 1XGKA 1A72A 1WD5A 3ZDXB 1H1LA 5KPDA 4MKIA 3V9AA 4MV6A 3PNSA 2DC1A 3E35A 1GG8A 5BSUA 1VCNA 1PG2A 2QQFA 4F1KA 2FJUA 3GLKA 3LU1A 1XNHA 3N0RA 3GJQA 4IFTA 4AWXA 3CONA 4N7RA 4YRBA 3L8HA 4MXDA 3K1JA 4QHTA 1WDMA 4NYJQ 4JI7B 5CJPA 3TBHA 1N57A 2XF2A 5KTOA 2V6JA 2ZRBA 4C3VA 1ZGGA 4XIFA 5CLJA 1Z07A 2AOXA 3DVAA 1EX6A 4X1KB 3B2QA 3UGKA 1MO6A 2E4VA 5KKNB 2V6BA 2YKGA 5AW5A 1KK1A 1RC8A 5TJHA 1IMJA 3RYIA 3WWEA 4TMYA 5HM6A 1TE2A 3FHTA 1G16A 1U8YA 621PA 3Q3EA 1AUXA 4US2R 4GXRA 3OKPA 3VR4D 1HE3A 2LTAA 2A0KA 3A9TA 3PHCA 2OFFA 2O4UX 4EEZA 3JQGA 4XASA 4QJIA 4Q93A 1Y0BA 5KYYB 2PWBA 4U6QA 4U7DA 1M0EA 3DOFA 3PUXA 4YQZA 4UAJA 3IEUA 4WBNA 1YNOA 4QTYA 3FNEA 3LO5A 3HG7A 3QX8A 5DW3A 3RYHA 3TI9A 3WQBA 2Q1TA 4Q0MA 4BO4A 1J1UA 4P2BA 2D7JA 2C20A 2C2KA 1AIPA 2EL7A 2IPNA 4HLUC 1GA6A 3GG2A 2JJMA 1NUAA 1DC5A 4KLAA 4Y3UA 1RQRA 5G4KA 3H19A 2JZNA 3QPWA 1STOA 3UTDA 1QKIA 3CG4A 4E5PA 5ETJA 3JR3A 4FU0A 3FPJA 1PBTA 4KDEA 1MOPA 4UVIA 4ZIRA 2F2TA 2J5XA 4LK3A 4M1QA 3LYAA 2XBUA 4QYSA 3B7GA 2XRFA 5IKOA 3RHSA 3P45A 1L4EA 3PIRA 3DR3A 5BQXA 3FMGA 4EG7A 3ZTYA 3S44A 3KLNA 5GP1A 3L7LA 2UAGA 3K1YA 2EEPA 3NRCA 4KE9A 2P2DA 3EX7C 1KOGA 5SICE 5E4FA 2ZK7A 3GEGA 3K8QA 3JQAA 3H0KA 2YJ3A 5CEJA 1FFYA 1FNBA 3SOZA 1Z0FA 1GV0A 1YS2X 2BGUA 2HK9A 2J59A 3LKBA 4YIHA 4GUAA 4QGHA 3R3ZA 1XX6A 4JGIA 3ZNOA 4QVIA 4CF4A 1E9RA 1F48A 1ZXLA 1H4VB 1PVDA 2A5LA 2PMKA 3G7NA 1K2WA 3QXGA 1UL1X 3GGSA 3REFA 3W2TA 5CFRA 4KPUA 2QX9A 4MQLA 3SMVA 3PJRA 5HXAA 1JVSA 2IOFA 2WUGA 5B3JC 5EZSA 3ZYZA 1MD9A 1HYQA 3GRAA 4GPBA 4KXYA 1PNTA 2LIPA 2BP7A 4IINA 4ZD6A 4LF8B 5G3YA 4FZ5A 2J6HA 3KUUA 4IIGA 2EG5A 2Y68A 3CNLA 1B6GA 1MIOB 1H05A 1O96A 4QUBA 5DTEA 1KR5A 3BFXA 1YOBA 4HQNA 4J2HA 3NETA 4S1WA 3LZ6A 3RTBA 3QPUA 3D3QA 1PFVA 4CKWA 4BS9A 3QLUC 1L5NA 4G8CA 1ZMBA 4FN5A 3D64A 1G9XA 3IELA 4XZ3A 1AKEA 2ERCA 3RF6A 2WF6A 2IHNA 2RBGA 2UZ1A 2VK2A 4CMGA 1S2MA 1LVGA 3SDBA 4TVSA 5DM70 1ID1A 3E4DA 2JFWA 4DLBA 3KLBA 3DDCA 5K09A 3B85A 4FOTA 5AK4A 5JPDA 1EK5A 2QA5A 2EVWX 4CJXA 4DBLE 3ADDA 1YZGA 5G0UA 3FGZA 3BG5A 1M8JA 1YRAA 3ZNPA 1J6UA 4OM7A 5ECDA 4YMLA 3KQMA 3MD0A 1VYUA 3CNEA 4B73A 1I3OA 4JI2B 5DIFA 2HRRA 2QAIA 2AVNA 2QN9A 3DWIA 5IZCC 1HL7A 5EJ7A 3Q7SA 1HNZB 2PIDA 4P32A 2ZB8A 1B26A 1ZU4A 2ZKIA 1S3SA 2ANBA 3VPHA 3FUWA 2GYYA 1JXQA 3C48A 5FOVA 5DCLA 2WPNA 2AQKA 2BM0A 3UUGA 4IZIA 1U7WA 1XZFA 4NPHA 4P36A 1WVMA 4Q37A 1WJGA 2JH8A 3RC9A 4W6ZA 5GJCA 3TLCA 4Q21A 2ZB4A 1SUIA 2LW7A 4WOJA 4WERA 3O3CA 1GU7A 3DM5A 3F6PA 4X6XA 3KE9A 2X2PA 4MKXA 3QUSA 3AHJA 1EXNA 4IVQA 1ZPDA 4PFKA 5C2JB 4Z9BA 3KE8A 3PUKA 4QNNA 4AZWA 4Z9YA 1C81A 4GL2A 1OTYA 2AI1A 3ED1A 3NU1A 2CJPA 2JFFA 2B7LA 4JP8A 3RWOA 1WV1A 2OHFA 2W2KA 5HP4A 3VVLA 4JVOA 3RIHA 1UDXA 4GG1A 3UJ9A 1XZPA 2B82A 1CULC 4KHZA 4PGAA 1NVTA 4UTRA 1LCIA 3Q7TA 3PNPA 5JQGA 3GH1A 2J0EA 2VUHB 1F6DA 2F6RA 3ZX5A 4BAUA 4E3WA 1D2RA 5ALDA 3E3NA 5CFPA 2ZM6B 4YJFA 2GARA 3AVOA 3BILA 1KIAA 3UAVA 4UE3S 3IMCA 1RWQA 3GEPA 2V3CC 2G1KA 5CT4A 5CLQA 2C2BA 1PQ4A 1YJ8A 2X0DA 3WLKX 4LRQA 3IAS1 3M5DA 3ACDA 2PQMA 1BA3A 5EINA 1ZC4A 2FZEA 1QO0A 3FIJA 4HNTA 4JOQA 4UDOA 3IHKA 1FS6A 1A7AA 4ENPA 2CNBA 1COZA 2Y0DA 3G8AA 2WJ6A 4LTMA 3VZRA 4V0RA 4Y2QA 1W29A 1MOZA 3MNFA 5GQSA 2RCYA 3GAZA 3STWA 2Z6QA 3BFPA 4JUDX 2FE4A 4YMIA 4HF7A 2VDRB 3EUAA 1QRRA 3S2ZA 1YRWA 2XYHA 3GYBA 4I4LA 5CX1A 2B37A 3SICE 1SO8A 1E96A 1Y1QA 2P11A 1YDEA 4NCHA 3E81A 4WZ6A 4ZVQA 1E3QA 4RQBA 3RSQA 3TMYA 4FM9A 1KRXA 1XALA 3LE8A 1ZW6A 4N3CA 4HFRA 3TGLA 2FPXA 2I6GA 2KLHA 4ZK6A 2I3AA 1EJ2A 2I22A 3X2FA 3V55A 2GCEA 1RXWA 1FP4A 1TTQB 4CI9A 2SCUA 5A4KA 2XAAA 2CWDA 1IU9A 5TB5A 2CMKA 3KSZO 4UM9D 1LRJA 3H1EA 2QENA 4DLNA 3JZFA 1PJ3A 4Q1EA 2PE5A 1MAAA 3LYUA 1KYVA 1GZHB 4MUEA 3RBXA 2B4AA 2IPMA 5LQCA 3TJRA 1TM4E 2JEZA 2EF1A 4RKWA 1H8HD 2WWXA 2FMXA 3BRSA 4GVXA 3BPSA 3KUCA 1AGXA 4MQEA 3JZDA 3L5KA 4YHHB 1IN5A 1U4SA 1ZM9A 1P2FA 2PUHA 1CRWG 1P3Y1 2AG0A 2Z1MA 3E9DA 4O4LF 3DJFA 3OMWA 3ZW9A 5IK2D 2W2LD 1MTZA 4MQ5A 2CUKA 3BH7A 5C7OO 4XB1A 3R76A 2GK3A 3MGGA 4XWAA 3I5YA 2OLKA 1P1KA 3A1WA 4RFSB 2XUIA 4PWYA 5D7BA 3SKVA 1P39A 2QAJA 3A2MA 3IILA 5EL0A 5AO9A 1ENZA 1KY5A 2N1BA 4JB0A 4E14A 5C5CA 4ZQHA 4KVFA 2GB4A 4DEYA 5JANA 5LQJA 1SELA 3VPBA 3ELYA 2NP7A 5F64A 4RDCA 1FNCA 3CEPB 1Z74A 4W9NC 2JLRA 2VNSA 3FPKA 1NVWQ 4G07A 4NH4A 2OXIA 4QTUB 1XXLA 3UMBA 3A7EA 1G6Q1 4MUJA 1OBFO 3K70B 4FZVA 4KQXA 2XSZA 3FYUA 1KJJA 2DFDA 4EI8A 3A06A 5EFOA 1Y9AA 3IA2A 4XGQA 1D2NA 1R9GA 1VL5A 2AXPA 1J0XO 2ATVA 2B4QA 5E7MA 3LS2A 3BMOB 4HAUA 3GUUA 3GBVA 3MTBA 4KJXA 4B4UA 2PXHA 3BQ9A 3FLBA 2HLDA 2OO7A 4JEMA 2BMDA 5BXYA 1V4VA 2ZSUA 3D81A 2WNIA 2Z8ZA 3AY0A 2CNDA 5BMVF 2VDMB 3ZE0B 1ML4A 1EGAA 1DKPA 4C7OA 1EPUA 3D7RA 4QYIA 3DEKA 2CVOA 4QUHA 1ZZGA 1OWMA 2VHTA 4IKEA 1UBEA 1BWPA 4LQ4A 1BCRB 3AJEA 3BJMA 5LU8A 3DBLA 1LZLA 3VPXA 4D45A 1JIJA 1H9AA 3F6SA 3L3BA 3WOVA 4PZAA 2ODAA 4LOAA 1EE2A 2ZREA 3ZQUA 1J8VA 1LZKA 2PKCA 3DUWA 5B1IA 2EBWA 3BZWA 1S2IA 2JRCA 4AF7A 1OX4B 1NBMA 2QW0X 3K7EA 3OWXA 1VHQA 2PR7A 2QV7A 4ND2A 4PZEA 4Y2VA 3N28A 4J94A 2C4TA 3VI4B 2EP5A 3QU4A 1KSHA 5AJZA 1KJQA 4UU1A 1ESEA 1PJZA 2ZUCA 3LMKA 4GGOA 1M1YB 1UT5A 5DEOA 3T9EA 4DJDC 4EUNA 2C7GA 3RAPR 1U0TA 1A82A 4OBXA 3RLIA 5E0KB 1X87A 1E2NA 2AOWA 1AUQA 3LGXA 1W30A 4NJEA 4D3YA 1KIFA 2YFKA 5EQJB 4F9FA 1FL9A 4FHGA 2ZAIA 3RTDA 4YCNA 4LF6B 4U7GA 3ZKWB 4WY8A 2X13A 3FDZB 4JGGA 2FPIB 3AZQA 4FP9A 3CCBA 3JARB 1EINA 1WSAA 5IG2A 1MJHA 3LBFA 3BMCB 1P17A 1E7WA 2QVLA 5BN3A 1U0JA 4WWHA 3ZE6A 1R15A 4M1WA 4C30A 2RHDA 2QK4A 3A1DA 4RJTA 2ID4A 3KT0A 1Y80A 3A9UA 4QREA 4WUTA 5C3UA 2NAPA 1UDWA 4AUNA 3HN2A 5LMZA 1VLJA 2GEJA 1CR0A 4NYIQ 1EUCA 4RAQA 3CKYA 4R9NA 4YMWA 2UZ3A 3LVRE 4W9MC 2Z6AA 4GOOD 2AMFA 2QP3A 1JWAB 3PC6A 3I6BA 4YDHB 3U7EB 4NJMB 1ITZA 4KAAA 4XCVA 1QU3A 1WKCA 2AI3A 2Z5LA 3D6MA 4KQEA 4RD3A 2C95A 3UQYS 3AETB 4FHCA 1F51E 1GHTA 4MGYR 4L22A 5EKDA 5K8UA 5SY9A 5IAGA 4N3AA 3L7DA 4TV9B 3RW9A 3EASA 3Q41A 2QL5A 4BOYA 4IDBA 4IQFA 1JFFB 1WU8A 1SUFA 5DTQA 2VPZA 3EXG2 2GDZA 1W36D 3H2SA 1MFZA 1W8IA 1QYCA 5DX8A 3IBSA 3IXMA 5HDQA 2PVSA 2WILA 1SC4A 3I62A 2CK3A 1Y34E 4TMTA 3BWDD 3H84A 3R7BA 1P4SA 3BSYA 2P4UA 4KXXA 4LC1A 2WZBA 3MTIA 2FPMA 2WOJA 3NVMB 4B33A 4KH1A 2GSWA 1TZBA 4AC9A 5KQGA 2YV5A 1F8GA 4PINA 3T4UA 1NQAO 2J3JA 2IUEA 3EE6A 4ZI7A 5IASA 1Z29A 3WGTA 4J0CA 2HMAA 4KXMA 1UK7A 2GPAA 4B81A 1VDZA 2IYOA 1KK0A 3PX2A 4L15A 5HEKA 3MSXA 2Q7XA 3A1SA 3WGZA 4DYDA 5DP2A 4CLRA 3E18A 1JG6A 4P31A 5BR7A 4N49A 1RRCA 2L18A 1ZMRA 3JPYA 3P71T 1IBSA 4I3FA 5GAJA 5JJ5A 4Q4CA 2HW8A 1OYYA 2OBXA 2WOOA 1FF9A 3AFIA 2EFCB 2Q3FA 2ZRFA 4M9SA 4N1AA 1Y7IA 1DELA 1F9AA 1PS9A 3EG9A 3KZNA 4NENB 4WSOA 3SEAA 3VZPA 4BMYA 3FMOB 4C87A 4NICA 1IAVA 4P38A 4R2KA 4CV3A 4D4GA 4M46A 2B35A 5KQRA 1O03A 4A6XA 1ZJWA 1BXGB 1NDHA 3KVOA 3VKUA 3FUUA 1O6FA 4WY5A 3CVOA 2VJBA 4X1IB 5EOVA 4YREA 1IZ8A 5JO0A 5HQJA 3HSKA 1UMDB 2W43A 3WGUA 1Z2CA 3F98A 1W4LA 3AZPA 5A06A 2HPAA 4MW6A 1P5HA 3P7MA 1V1MA 3HYRA 2JCGA 4JJEA 4LHWA 3RYTC 4MO2A 1L4LA 1NUHA 3EGDB 4EDHA 1ZFNA 3I64A 3WB1A 4EVRA 1QLWA 3IKJA 1U5AA 2V54A 1WS6A 2H31A 3KJHA 4UPDA 1KL7A 4ZI2A 4NCBA 3NVDA 4L4UA 3VJRA 3ZWBA 2OCLA 1F2UB 5LQRA 1MO2A 1U7OA 3DO8A 3U4IA 4G37A 4UUAA 5DLYA 1WXEA 3EOBI 3TTWA 4ZGBA 1Z8NA 3G0GA 5LZ5A 4H16A 4BGEA 4DRYA 2LD4A 4OREX 3FUXA 1AKQA 3IV7A 1KA9H 2I4LA 5I9SA 5IEJA 4NE7A 4EFKA 1CIJA 1CZRA 4DSAA 3HP4A 5CXSA 1DPFA 3M81A 1JFTA 1DBVO 1NVXQ 3PEEA 3U4GA 2P91A 1RI2A 2Q6LA 3B53X 4HDKA 2BRUC 2ZIZA 3RVDA 2CLKB 2PX4A 2AR0A 2AJBA 4HXYA 4MYDA 3EDOA 3HFGA 4MYRA 4XD7D 5AM1A 5IVHA 1N6KA 3WKBA 4MMYB 3ELBA 1CQIB 2E85A 2OCBA 5EZ5A 1SC9A 3F67A 1ECCA 2Q4TA 1H5NA 1H6AA 2EP7A 4A03A 3N0TA 4Z1OA 1GY8A 4TLMB 4MW9A 2QV0A 1GG9A 2UV8A 2V1XA 2XV1A 4NABA 2OE2A 4R1MA 2MCFA 3WQRA 3LCRA 1L7VC 4ZQBA 3DLCA 2G1AA 5AJWA 3U26A 4RNDB 4IIVA 1G38A 4Y6GB 3IOEA 3MK31 1QS0A 4KWHA 1C0EA 4QXRA 5T4BA 1BDHA 3W5CA 3E58A 3L4SO 3KQPA 4JP5A 2H9IA 3U3ZA 4FI3C 4I8DA 1V5FA 5CFLA 3GXOA 3K6KA 3HPQA 4ZO9A 5HILA 4Z4CA 4K86A 4KQKA 1JG3A 4GPIB 4X1KA 1MB0A 4W1RA 3VX3A 3JD0A 3PD7A 3ESQA 5F1KA 1OX6A 1QNLA 4J90A 2FHPA 2CZGA 1P2VA 3I76A 1DIGA 4KV9A 3NPMA 1Q95A 3QE4A 4J0KA 5D84A 3CZCA 3ZK7A 4UBOA 2HRCA 4EGFA 2JI7A 9GPBA 1C7EA 2X14A 2AOTB 3RTCA 4CDNA 2ZI6A 4TSRA 3N6XA 1K9VF 4F56A 2X8WA 1XWFA 5KX5A 3RVSA 5JUWA 3ESCA 4I1UA 2OK7A 3COSA 1QYIA 2EXXA 2EX0A 4GOMD 1RWBA 2BYTA 1YDFA 1M2NA 4CF7A 2EZ4A 1I24A 4Y0VA 3UA4A 2E48A 4HMPA 3PQ6A 3VC1A 2EKDA 4J0DA 1XLWA 1QZUA 3CFYA 3FJOA 1TZ2A 3I4LA 1D03A 4I14A 2WU1A 2DP4E 4Q5IA 5ALYA 2BFEB 1Y7HA 4I9HA 4CGZA 1GYQA 2GAOA 2HPHA 5DT2A 1C9DB 5I7WA 4WECA 4IL5A 1VIAA 3HN6A 4GEKA 3FZEA 1X7XB 4MI3A 3CLRC 2GJ9A 2WYVA 1ES9A 1ADYA 4W5WA 4YH1A 2YWDA 1MB2A 1U7UA 2EJCA 3NM4A 2NU6B 2X5KO 4B8WA 3ZI4A 4DANA 3DPUA 3AV0B 3H8JA 5EKSA 3VHXA 3ZE2B 1P7VA 3TGWA 3TTXA 5JDIC 4GBED 2ZCJA 1XD2B 4LSWA 2C00A 2FAXA 3DLTA 4Q3EA 4OXRA 3SZOA 3R0IA 2AXNA 4MWDA 3FNRA 2NUPA 2Z4SA 1NSFA 1LJLA 4GWKA 4J29A 1K1EA 2JVIA 1JJ7A 3ONFA 4XDHA 2Z2KA 3PHHA 1I51A 3AEYA 2RH4A 3ECCA 4O6VA 2IH2A 4RBNA 3VPCA 1E4EA 3RUDA 3LXMA 4A23A 7YASA 2YIVX 3OJ0A 3R5HA 9ABPA 3LNCA 2X3FA 1G7CA 2NTVA 4ZVUA 2P2NA 4KQHA 2HSJA 3SLKA 2C2HA 1CHNA 2F3PA 1NOJA 2JDID 5C0OE 1W94A 4ITRC 5HFNA 3HCBA 3C6KA 1GPMA 4BV2A 1PQWA 2Y9MB 2MSNA 5AT1A 2ACEA 2RHJA 3NWPA 4OPMA 2EJBA 3FVTA 3NT2A 1ZK3A 1SZDA 3AKZA 4M22A 4U6NA 3PFCA 2EWVA 4X1YA 2ZDHA 5EXDA 5HJ2A 2RSLA 3HWX1 5HK8A 1T8UA 1Z0UA 3GB9A 3O3OB 2JH3A 1DOZA 3UHJA 4MWBA 4EMUA 2XOXA 2HF8A 3V1TC 2OY0A 3KJIA 3EJ6A 1CUJA 2Y93A 1YQWA 1N0HA 3X43A 4EKGA 3IUQA 1H4TA 1C7QA 2ZWVA 5G02A 3U37A 3HDGA 4DCGA 2R751 4PG8A 1E2IA 3QFTA 5LLSA 2RI1A 2RHHA 1R00A 4CETA 3UGTA 5EQTA 1BOOA 4GPTA 3PHJA 2WIBA 3GJ7A 5AK0A 2YV3A 1KQGA 2FE1A 1QYXA 1DQSA 1VPLA 2IDZA 3SBXA 4NZNA 4GZ3A 4B0OA 1ORHA 4G41A 1IG0A 4YK7A 2HBZA 4I55B 4BNGA 2BKAA 4IQ8A 2HMYB 1DSSG 1WCV1 5B6PA 3WO1A 1UBFA 2HY7A 3WGHA 4IVRA 2QR3A 3TEMA 1L7EA 1F4VA 4L9WA 2MTBA 2Z98A 5J5VA 5KOJB 3CLSD 2A9VA 2GPTA 2YXBA 5U4QA 4LFCB 3DA8A 1H6DA 5C7LO 6LDHA 3OLYA 4XDGA 5JYDA 1YZLA 1WBBA 1EVKA 4EG8A 4HXEB 4B0PA 5IBCA 2JBWA 1FFAA 4LBWA 3HCOA 1WP9A 1D6SA 3EBLA 3C3JA 1TUBA 1FYWA 2DHCA 3MQ4A 4KDCA 4BEVA 5ED4A 3L4JA 1CY8A 1GDTA 1MX5A 5A0VA 1HK7A 2YFYA 1BFUA 4KQGA 3T3OA 5CVUA 4DUZB 3C24A 2YS7A 2D0PB 4E31A 4AN1A 3I1YA 1LSJA 4LE1A 2C97A 1EWTA 2PR2A 3QUCA 3KG2A 4AJOA 2WHRA 3A26A 4F9TA 3L8GA 5DI3B 1HY3A 1O54A 2O0LA 2NU9B 3I2YX 3RKUA 1ECJA 2C61A 5I9IA 4OFWA 2NPIA 2OVFA 1EP1B 4KQWA 3ROGA 5EJ8A 3U09A 1P0MA 4H59A 3PA6A 4EA6A 1BE6A 3LCUA 3ZIAD 4C20A 5I8WA 1W9HA 1XRSB 1J90A 4ZODA 3A4IA 3LQYA 4G8BA 1UC4B 2I8CA 4NE9A 1E0AA 3E22B 3GDOA 3HVHA 4MKRA 5CX4A 5HS6A 3TVDA 4BQNA 1F60A 4E07A 2IUYA 3DV9A 2VYQA 3RNOA 3SOPA 4B3RB 2D00A 1E7SA 3OC6A 1IK6A 1YHYA 3ZE9A 2W8BB 1RZRD 3CH5A 3SFZA 1ZMTA 3HBLA 4PPGA 4YJHA 3EDMA 4E5YA 5JCOC 3OG9A 4ISCA 4M4SA 3VYSB 1BN6A 1QGYA 2O48X 2IPXA 3DFUA 1OY1A 3CUTA 3V7YA 1Y1SA 1U28A 3F9IA 5TQVA 2FR8C 3TRIA 3C43A 4L28A 3C8MA 4BE7B 2QMEA 2GVZC 1ZGCA 3FZQA 4IGFA 2P77A 4AJ9A 3A6LA 1M2OA 4R3WA 1SVSA 4TTQA 4HB0A 4RHEA 4IJMA 4KLRA 3H13A 4RFVA 3W8DA 2BCJQ 2VBCA 4IHJF 4FYYA 3AG5A 2L0XA 1DKRA 3V4RA 4XRRA 1Q1ZA 1OILA 3TR5A 1TK2A 2DPYA 3QVWA 2YWXA 3RFXA 3RBZA 1XJ0A 1AKWA 4BQEA 2C3YA 3BICA 1W75A 3E23A 5AICA 1M8FA 4YLGA 1R8JA 2MR6A 4GC9A 3OKCA 4B2IA 2HZBA 1A76A 5ITSA 4QE3A 3HA5A 3BUSA 3Q85A 3KQTA 2GA8A 3C0KA 4G0OA 4IF6A 5EIOA 2YVUA 4BFCA 4EY5A 2I2WA 4L74A 5CXQA 1EB9A 3QPCA 1WSBA 1M5UA 3E3LA 3ILYA 3CLHA 2WLSA 1SU4A 3DOUA 3E84A 3ONWA 4Y98A 2XMSA 4WACA 1G4AE 1Y5LA 4JT9A 1YASA 4FSHA 2YN0A 3VO2A 3A6EA 1PQUA 1KU0A 1J7KA 4N47A 1EAYA 1T9BA 2C4UA 3QIVA 3ENZA 3HYLA 4IQ0A 3CPJB 3ETNA 4KQMA 1KJNA 1QHHA 1XDUA 3LBYA 4E4RA 5AXBA 3FF1A 5LLDA 1X8JA 1QFZA 3L18A 1ZUNA 3LPDA 4GLFA 4LCJA 5LMCA 1A1VA 2BGRA 1CUWA 4MGHA 5TQ0A 1WCIA 4MR9A 3KQKA 3UGQA 4LZPA 3V5NA 2HNAA 5KJ1A 2P8JA 2YWCA 3BWYA 3CLTD 5EP3A 1YZTA 2DUJA 4S35A 4QXQA 5KC9A 5KHOC 1HM5A 2BELA 1DZ3A 4XIIA 1V8FA 2A35A 2V65A 1TGVA 3L0BA 3W7AA 4CR7A 1SHKA 3I72A 4A3SA 2I65A 1Z8FA 1F38A 3H18A 1SC6A 2QD3A 2W9XA 3C4JA 3JQAD 4HGYA 1NA5A 4Y9TA 2C1EA 1NVDA 4LSZA 4N01A 4EJSA 3TNJA 1V9LA 4EHNA 2Y2VA 3LT0A 2NZVG 1R6DA 2QLFA 2QZJA 1I9GA 3AEUA 3NT4A 1CQWA 1CZKA 1YA8A 1T9GR 4UMFA 5EJ9A 4V0ME 4WHMA 2XB4A 4X62B 1CS4C 5EYPA 1S1MA 1YR2A 4FFMA 1DC3A 3HADA 3IQFA 1GJRA 3JQ8B 3HJGA 4M1MA 4XUDA 5DNDA 2CVFA 5C8VA 2F64A 4ZZIA 3A28A 5EEGA 1E89A 1IHUA 1N9GB 2BSAA 3GFQA 3A70A 4WJLA 5AVOA 3AVWA 3GUCA 3IXQA 3JATB 4NMLA 3UJDA 1E6CA 1RTTA 1MLDA 2GPWA