1U8ZA

Crystal structures of ral-gppnhp and ral-gdp reveal two novel binding sites that are also present in ras and rap
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
168
structure length
165
Chain Sequence
SLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGYAAIRDNYFRSGEGFLCVFSITEMESFAATADFREQILRVKEDENVPFLLVGNKSDLEDKRQVSVEEAKNRADQWNVNYVETSAKTRANVDKVFFDLMREIRAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras-related protein Ral-A
publication title Crystal Structures of Ral-GppNHp and Ral-GDP Reveal Two Binding Sites that Are Also Present in Ras and Rap
pubmed doi rcsb
source organism Saguinus oedipus
molecule tags Signaling protein
total genus 61
structure length 165
sequence length 168
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1u8zA00
3GLIB 3TNFA 1XTKA 3K0AB 2FWRA 1MRSA 4ABYA 2QAGC 1T8UA 3K09A 1XBTA 3LBNA 3WMFA 5JCZA 4LBWA 2AWOA 5EXPA 4JKYA 2QA5A 1OW3B 1QG4A 1D9ZA 2GDJA 2HJVA 2QUZA 3SFVA 4JBWA 3W8NA 4ZO4A 2ASEA 2WOOA 2ZTSA 4FXPA 1GL7A 1XX6A 5LB2A 2ODNA 1HV8A 3RWMB 1GDDA 3PEVA 1R10A 5SZKB 1MV5A 5IK2D 4F4JA 2FFHA 821PA 2E87A 2P5TB 4BFTA 3O8CA 4BPBA 3A4MA 3CM0A 4LC1A 4OHXA 2AK3A 4LHYA 1XEXA 4TLAA 2ONJA 2YJTD 2AFHE 4BFSA 5BW8A 4XJXA 1HURA 2BHRA 1N6KA 4EKDA 3DKVA 4PC3A 1AIPA 1NP6A 2NZ8A 3EASA 4A2PA 3VNUA 2CDNA 4GBMA 5G41A 4CF7A 1XEWX 3JZMA 5LD2C 4FMCB 4BLSA 1YU9A 4GP7A 4FCVA 2H92A 2OFWA 1DE0A 3AKCA 3U44A 3B9PA 3SHFA 4IVRA 4LJ7A 4P4SA 4A0HA 3BERA 2BJVA 5FUVA 2IYLD 4L9SA 3WHKA 1E1RA 1V43A 5EUMA 1S2MA 3BB3A 4A6PA 3U60B 2OAP1 4AYXA 1OLOA 1DAHA 2WWXA 5AJVB 3A1VA 1WXQA 3QY0A 1Z6AA 4OBEA 4JBYA 1J70A 1NSTA 2XZLA 4WW0A 5CJ2A 4PC2A 1EGAA 2EWWA 4EJSC 1PV4A 2XB2A 3OIUA 4PQRA 1RC8A 3UMFA 4EFNA 2G0NA 2A9KA 1C9KA 3J81k 4DCUA 4GT1A 2VH5R 4AKEA 2LKDA 3K1JA 1UF9A 3KXIA 4JVSB 2A5JA 4G5SA 2X8AA 4Q7JB 1LF5A 4M1MA 2F1HA 4HSEA 4DSOA 4EPVA 2GCOA 5ANRB 4BASA 3HU2A 4TMVA 1MOZA 2LWIA 2ZI4A 3ZZTA 4C0LA 5KDOA 2RHDA 2GHIA 1GAJA 4RD2A 5DNYB 1KYIA 1PLKA 4LJ8A 4Q1DA 4BLTA 2FX3A 4EJSB 1AGRA 1KDOA 1KAGA 1MABA 4B32A 3VU9A 2NGRA 1N5LA 1ZU4A 4U5XA 5IHPA 1AKEA 4ARZA 3OIVA 3T1OA 1S96A 1GRQA 4TL8A 4AK9A 3FHTA 4LRWA 3ZDQA 2H57A 4RFVA 3CR7A 3IGFA 3IPYA 4MKGA 2VSFA 3Q7QA 3BXZA 4BUJA 1SKQA 4IDOA 1XMSA 1N6NA 1TF7A 4HAYA 1AS3A 1ZRHA 2ZYWX 3W8RA 3KQLA 2FFQA 1EFTA 5CLLA 4HAWA 3V00A 1FUUA 4B74A 1R8QA 4HB4A 2WKQA 4OL0A 721PA 4M1OA 1OH7A 4IOLA 1U94A 2NG1A 4HLDA 4LHZA 3B1XA 1BOFA 3PEUA 1UKEA 2G83A 2OE2A 2VSXA 1JXMA 4LJ4A 2ZUDA 4MQBA 5KOYA 1YHNA 1P72A 3HJNA 2ZRKA 4WOPA 4CEHA 1E2IA 2CCKA 4DLSA 4B3XA 3NBXX 1DAFA 2XJ9A 3BH7A 3QKTA 3U6BA 2ERYA 2XGJA 3AVPA 3HDTA 2QT0A 2NOAA 4A8JC 4M1SA 1IQPA 4HB2A 3B78A 4PPGA 4P4TA 3E1SA 3TSWA 1ZINA 4B47A 3BB4A 1R0ZA 3CX6A 2QGNA 2BBWA 3CX7A 3GD7A 3LW7A 5A0FA 1CXZA 3R20A 1KOFA 5CLQA 2PEYA 1Q1BA 4B2LA 4E07A 2NIPA 3VQTA 2YKGA 4TZ6A 2FPLA 3QKUA 4MA4A 4JLAA 2RAPA 1CJTC 1LF0A 1E2GA 1AKYA 2ZRJA 1SVMA 1E9SA 2ZJ2A 3AB3A 3EG5A 2NO1A 1RKBA 4NTZA 4QJ4A 3THXB 3CH5A 3EIEA 2NQ2C 1HT1E 4A8JB 4A92A 1NG1A 4IXNA 4ZCIA 2X77A 1U9IA 3CIOA 4FMBB 2XSZA 4KYUA 1KSFX 1WBBA 1OB5A 1VPLA 2AX4A 2KE5A 5CM9C 4Q1CA 4JYCA 3H86A 2BV3A 1OFHA 4IDPA 1KK3A 1G20E 1CR4A 3EPKA 1DADA 3LLUA 2IYVA 4NCJA 3ND9A 3T12A 2ZSEA 4PQFA 5CYPA 2QMUA 4V0ME 3ZJYA 1HEIA 4TMTA 2A5DA 3WNBA 1J8YF 5FPSA 2ZR9A 1NN1A 4W5WA 1CR0A 3MJRA 1CP2A 3SC3A 3CF6R 5FOXA 3CRRA 5JWHA 4CT4B 1ZNYA 2MMCA 4NYJR 5EE9A 4GSYA 2W6ID 1DAGA 2VIIA 4YDSA 2CJWB 2QTFA 1IY2A 4HUQA 1CS4C 2QG6A 4YMUA 1UFQA 2QPTA 4IW3B 2P6RA 3TQCA 1RJ9B 1W2GA 2G1JA 3L0PA 4XTCS 4DZZA 4QGAA 2IHBA 1XJ0A 1Z0JA 1YJ5A 3WBJA 1OXSC 2J7PA 1QHIA 1TU3A 1EFRD 1KKLA 5FTKA 1OH8A 3LFUA 4GPTA 1U8YA 1S1MA 4OQXA 4UJ5A 1ELOA 1BMFD 2WAYA 1RYHA 1VCNA 4QRHA 3PVSA 4M9QA 1GNPA 1Z8FA 2W2XA 1OV4A 2OM2A 4PO8A 2JATA 3SU8A 1KI1A 1Z0KA 2QQ0A 3U4QB 4OI4A 2QE7A 1R7RA 2OBNA 3ZIAD 3UG7A 3RAPR 3GLGA 2B8WA 3LH5A 2IYXA 1RFLA 2BC9A 5EXSA 3WNCA 4A0GA 2C04A 5FPHA 5JSZB 4M9XA 1UJ2A 2ZU6A 1J8MF 3C16C 3K09C 1J90A 1MO4A 2ZITA 3D31A 4B2PA 4ASUA 1R8SA 4MDFA 1UDWA 2WV9A 3T1TA 4HAVA 5KSZA 4LZZA 3RYTC 5AJWA 3KTAA 3NIBA 2OFXA 1YR7A 2O0HA 4RZXA 3SOPA 3VX3A 3IO5A 4FD2A 4GDFA 2CLCX 1KK0A 1E4YA 3ND8A 4OK3A 5AJZA 4ACBA 3VKHA 1NBMA 2VP6A 4PR0A 4OI1A 3WYAA 4D4MA 2QSYA 2QAJA 2ZROA 3AVQA 2RGGA 2EFGA 4HB0A 4B71A 1MH1A 1KDPA 2JLQA 2FSIA 3WP0A 4AYWA 1HE1C 2D7DA 4JBXA 5D3QA 1G64A 1DAIA 4KJZA 4KSCA 4XIGS 5CDFA 4KHZA 4II7A 1N5JA 4L15A 1W2HA 4N3NA 5EXTA 2FF7A 4MYCA 2W0SA 2YINC 1JAHA 2OV2A 2D2EA 2FEMA 3FB4A 3THYB 3P4XA 3NDPA 2PLRA 3EPHA 1S1CA 1QHHA 3SJAA 3HR7A 1VECA 1Q57A 1RW4A 3KFVA 3AKEA 1OFIA 4POAA 1K5DA 3NEYA 1W7AA 4BGDA 2EVWX 2ZRLA 5KUTA 1IN6A 4BLQA 1XDBA 2QPOA 3OE7D 1L4YA 1E1QD 4A4DA 3DHWC 4LWZA 3GJ5A 4DLRA 4TYNA 4WBSA 1WMSA 3H2YA 4XH9B 2MSDB 2OLJA 5JCPA 1Y63A 4QJ5A 4IKEA 2EFHB 1CIPA 5FL7D 1PUJA 2KBEA 2XNDA 3LX8A 1N6LA 3QPVA 4HLUA 4IDHA 1EXMA 3SJCA 1GZSA 2CLSA 2JEOA 2A5YB 1E2HA 2DFNA 3QKSB 2J41A 2J45A 4EAQA 2P6UA 4FWTA 4A36A 3FTQA 2AKYA 3AGPA 3ZQJA 3AGQA 3L0OA 4I1OA 2R9VA 3DVLA 3W3ZB 1MRNA 3FGNA 2ZVQX 5KNDA 5JJKA 2ZUBA 2P65A 3HYRA 3PJRA 3K0FA 2KJQA 2VP4A 5FOUA 2ZRDA 2VF8A 2BCJQ 2JJ2A 3OAAD 4LV8B 3K0AA 5G53C 3BD9A 1HA3A 2B8TA 3I32A 4S35A 4A82A 4XD7A 1E69A 5DI9A 2XX3A 2ZI6A 2GEVA 2DHRA 3RS5A 2GEDA 4OHYA 2V8OA 3TVDA 4B33A 3EX7C 1U90A 4BFYA 4Z1MD 1T9HA 2FPMA 3ZH9B 1F48A 2IXGA 3AF2A 1D6JA 4PX9A 3WMGA 4XWOA 1SXJB 1E79A 1TUEA 5GJCA 2MSCB 1H8HA 2G77B 3BBPA 3EA0A 1S3SA 1UPTA 5EP4A 3H84A 2HLDA 5H8WA 3HPQA 4P32A 4CDGA 2BKEA 4LBZA 2O5VA 1FQKA 2IYZA 5JJIA 2YC4C 4NCHA 1KSGA 1GFIA 5AK0A 5AUQA 5HE9A 3L2OB 1W0KA 5FBLB 3B2EA 4RVCA 5F3WB 2F9LA 2YNMA 1P7CA 521PA 5FPKA 3PV0A 4M1WA 1XMIA 1MO6A 2WWGA 1OXUA 4BRWA 1VKJA 4TLCA 4DB4A 3LV8A 5L8VA 2C5LA 1ESNA 3N2IA 1CJKC 2WSSA 1W0JD 2N42A 4Q02A 3TW4A 4GI7A 5B64A 5JECA 5K8LA 2JLXA 3THWB 1NMXA 4GOKA 4KBFA 5FUWA 2OCBA 2WWHA 3Q3JB 2DY1A 3AUXA 2RGNC 4XOIA 4DUGA 1IHUA 2RB4A 3QG1A 4HEJA 4JLOA 2G88A 3LVRE 4L4UA 4XWAA 1DAKA 1VCMA 1TQ6A 4H1VA 4HDCA 4TSFD 1AZSC 3I61A 4YXWA 3MWKA 1R5OA 4GZLA 1DELA 1YZTA 4JL8A 1NY5A 2IXEA 4DLYA 5EQTA 3C5HA 2WKPA 4YMTA 4C30A 1M1YE 1U9IC 2PH1A 2V54A 3BK7A 4XWKA 3ADDA 2VPPA 5EZ5A 4TL6A 5J4KA 3K53A 4Q9LA 3ZD6A 1HT2E 2EW1A 2ODEA 2GWHA 5CIQA 1D2EA 4Q03A 3UWOA 4LC0A 1B0UA 3BGWA 1IJFA 3WRXC 3BFKA 4DSTA 3U7HB 3L0IB 1XU4A 4R2IA 5BN5A 1NLYA 3PFIA 3QUSA 1PLLA 2ERXA 3KXKA 2ZM5A 2XXAB 1P2TA 4CVNA 3VX4A 2ZUCA 3AKYA 5C46F 2VLIA 4LV5B 1UM8A 4JVLA 2DFTA 4KBGA 4RD0A 4EQ6A 1E9CA 2WJHA 5DSZA 1I4TD 1TL7C 3KZ1E 3DZDA 3G82C 2GETA 1EK0A 1JEDA 3K0CA 3MWYW 1G8HA 1JR3A 2CXXA 1XD9A 2YWFA 2CHQA 3FKSA 3I3SR 4AKGA 3PCRB 2WOJA 4EPTA 1PLJA 2OBMA 4IOKA 2FGJA 1GUAA 2OCYC 3AF1A 3R7WB 3O8RA 3PUZA 1ZD9A 2H7VA 1OH6A 4GZMA 1QDEA 5FTNA 4RJLA 1T0JB 3LQQA 1ZC3A 2PLFA 1R5BA 4DSNA 1KY3A 2BM1A 1WCV1 4JVMA 5EXXA 4H1UA 4PC7A 4TL7A 3SQWA 4RSGA 4MGYR 3B82A 3AUYA 4OK5A 3SNHA 1GM5A 1CTQA 3SYKA 3ZQ6A 2ZE6A 4AD8A 2C96A 2ATVA 2JIZD 2JDIA 1A2KC 3FHOA 5L3SA 2O8CA 1ZM3A 2CHGA 3VR3A 4EPWA 2IS1A 2UZIR 4PHTA 8OHMA 1LY1A 4RKEA 3W6PA 1J2JA 3LLMA 1KI2A 2CNWA 1E2PA 1TF5A 1ZM2A 2R2AA 5E7MA 4B3FX 3DL0A 3OF5A 3ZYCA 4G1UC 4X8MA 1OFTA 3AVUA 4MKIA 1M7HA 2WIBA 1YRAA 2DWQA 4ZDWA 3THXA 4QGGA 3NBFA 4D80A 4Q4AA 3O47A 3GLHE 4TQAA 2CMKA 2CCGA 1XJCA 2VEDA 2AD5A 1Z6YA 1XB2A 1V5WA 1KY2A 3TUZC 5BYKA 2ZRCA 3NVAA 4RZUA 2GAAA 3REFA 3I62A 1KJZA 1VG1A 5E4FA 1OIXA 4JLPA 2V6JA 4TLEA 4GRAA 3RRMA 2VTKA 2O8EA 2BM0A 2OLKA 1F2UB 3BH6A 1IY0A 2ZRIA 2CK3D 3U7EB 2ZVPX 4A9AA 2BEKA 4TYQA 2AWNA 2ZSAA 1K8RA 2W6JD 3KL4A 4HLQB 3K0SA 1CKEA 4NDZA 3QF4A 2WPDA 4W9MC 1W5TA 5J4LA 3U3OA 4QFMA 4KSBA 1U8AA 3B85A 4Q01A 4Z8XA 4DDTA 1JBKA 1B23P 3ZS8A 2P3SA 5A5GA 1GKYA 2DBYA 2FG5A 1D8TA 1IXSB 2D7CA 3LA6A 4FMCF 5J47A 4CT5A 4NU0A 2Z0MA 2IUSA 1E2DA 3KQNA 1N6RA 3IIJA 3WY9A 5HR5A 5HKKD 1ZD8A 2LKCA 2QU8A 2R6CA 4LCBA 1E0AA 3EZ7A 2QE7D 4PZLA 2ZS9A 1NI3A 3SQXA 2V3CC 2IEZA 3FKQA 2JASA 3GFTA 1ZMXA 4J0QA 4TMWA 2JAQA 4M2LA 4HLCA 5K8TA 2B7BA 1E2NA 5LBIA 4JLJA 2NTYC 4DLWA 4B75A 1G9XA 1DBSA 2V7QA 4UXJA 3RC8A 1O87A 1ZNZA 4Q9HA 4LJAA 3AVTA 1VYVA 1E4VA 5AUPB 4G5RA 2WWIA 3PEWA 1FMJA 2DYKA 3SJBA 3GP8A 3SEAA 3DEFA 3EPJA 2QTVB 1KK1A 2R6GA 1XEFA 5JSZA 1FPMA 1Q21A 1I2MA 2OHFA 4U02A 4TT3D 1R6BX 2GXQA 2PT7A 4EPRA 1KK2A 2FSHA 2Q0HA 4K46A 1G3QA 3K9GA 2HT6A 4QBGB 2BCGY 3M0EA 2GBLC 3WYGA 4EDHA 4A2WA 1TU4A 4W7SA 4EPXA 4I99A 4OKSA 5LB4A 1ZUHA 2HXYA 3K9LA 3RRNA 4C0KA 1G1MA 3B8HA 1KMQA 3B60A 6Q21A 3ASYA 1GIAA 1OYYA 1FMLA 3JVVA 1H65A 4NCIA 4JZKA 3GLGE 3B7GA 1E94E 4YDHB 5JWOA 2FV8A 2FDCA 2ECKA 3EIHA 1WB9A 3Q9LA 2WJJA 3WYFA 2D4HA 4R9UC 2QAGB 1T8TA 2WWFA 1W44A 2IS2A 5DH9A 3X1YA 1NMYA 4C0HA 2H16A 2KWIA 1DVRA 2ZYVX 4MKFA 5KHOC 3KJGA 2ZJ8A 5IT5A 1SZPA 5FUXA 1VYUA 4JJKA 3THYA 3VHXA 3WRYC 4CEJB 1EWQA 4YMVA 1RIFA 1D2MA 4NBSA 1T6NA 2YZ2A 4B76A 3EARA 4AIIA 2WWWA 2BMJA 3QXXA 1UBCA 2CCJA 4UNNA 4HAXA 1NBME 4B6FA 1KAOA 2QP4A 2GCNA 3KJEA 3RNLA 1AS2A 1G4AE 3CONA 4JKIA 3FVQA 1R0WA 5IF9A 4NONA 4ITRC 5CDFE 1E96A 3W6OA 4ZIRB 1FTSA 5LD2B 3A8TA 3AP2A 4TQ9A 3VFDA 2IEYA 2F1JA 4JL5A 1WE2A 2FSFA 3NHAA 1KI6B 3T35A 1N25A 1J99A 1ZW6A 1N6IA 4UNQA 4IXMA 1T91A 4QC2A 1NNEA 1UBEA 5FPTA 3I4LA 3V4RA 2CL0X 3K9HA 3ZVNA 3DOFA 1RZ3A 3TAUA 2Q9CA 3C41J 2GZAA 2SHKA 1E2MA 1X8KA 3GJXC 4GFDA 2WMOB 3GCGA 4DEXA 2QN6A 5FR1A 4JLBA 1X1SA 4PO1A 1Z0FA 5CB8A 5AUOB 1AQUA 2R62A 2BOVA 3DMNA 3QEOA 5TY0A 2DWOA 3TSZA 1KO5A 1XCMA 2JGNA 4B6EA 2JJ1A 5HCNA 3K70C 3KKNA 2OESA 1N0UA 1WQ1R 1NVWQ 5TXGA 2UVQA 2UZ3A 1SXJA 3FWYA 1ZP6A 2V1UA 4D25A 5FBVB 3GEIA 1H8EA 2FH5B 3QKRB 2IYWA 4MRSA 4M0LA 3F3YA 4D82A 3FMIA 1KTVA 2YYZA 2CLDX 1ZM4A 2QM7A 3CB4A 2ZE7A 3IBYA 1NIPA 4E03A 1N6PA 3VMFA 5JHGB 4FN5A 4YQFA 2YOFA 2ZEJA 2GILA 4JLNA 1XD2B 3OEEA 4B3CA 2IX3A 4MRNA 1DO2A 4Q21A 3EWAA 2A78A 2QGZA 2W2VA 1GL9B 1Z06A 1NN5A 1U2RA 4ZCMA 4CRWB 1A1VA 1RRFA 1NKSA 2DFKB 4DLVA 1XD8A 5KSOA 5FR2A 4A2QA 3BORA 1G18A 2JJ8A 1G8YA 2PJZA 4PAMA 1WP9A 4IJMA 4V0NA 2YOHA 4RFSB 2OCAA 4CW7A 4A0FA 5BYJA 3SJZA 1U81A 4PHHA 1F60A 5AR1A 1SVOA 2G3YA 3D3QA 4G0NA 4ZI3A 1VG8A 1E2KA 1NN0A 3EC1A 4KVAA 5CYOA 3QBVA 5GJBA 2IWHA 3CRMA 3QXHA 3U2QA 1SKYE 5F98A 2VYFA 1HE8B 1ZYUA 2I3BA 3I72A 4I1SA 3UMSA 2XZPA 4AC9A 4P0TA 2ODBA 5C2JB 1G19A 1QF9A 2WSMA 1WDTA 2ZJBA 1UAAA 1G17A 3DOEA 3VHLB 1YKSA 3IHLA 4OHVA 2YWEA 2W2TA 1Q1ZA 1KZGB 3NEJA 3BH0A 3BOSA 4HZIA 3K70D 3ONWA 1G6HA 4QGHA 2F3TA 5DHAA 2OT3B 2V1XA 4YC7A 5F2EA 1W36C 1S0UA 1WRBA 2CE7A 4G01B 2DR3A 2ZS7A 2VF7A 4RCZA 2F7SA 1VCOA 4NCNA 5FOVA 4UNRA 4O25A 3L43A 2IF2A 2ZPTX 3RSOA 3TR0A 2J87A 3SI7A 1TEVA 2J0UB 4RCYA 4LDJA 4ZKEA 3ASZA 2EWVA 1Z63A 3AVWA 4LHWA 1OYWA 1C1YA 2OILA 5ELXA 4BE7B 1XNJA 4N0EA 4US1R 2PBRA 1G6OA 1EX7A 1P61B 1EFHA 2J46A 3RRYA 1CRPA 4UKDA 2IUTA 1VIAA 3U3RA 4IVPA 3V4FA 1SVKA 1W36B 4M1KA 4PQYA 2X2EA 3OZXA 4OQLA 1FZQA 3X1ZA 4DCNA 4M8NE 2H18A 2W0MA 3KQUA 4A15A 1GOTA 2F1RA 1CU1A 1IBRA 1VYTA 3EPLA 2JLWA 2O8BA 1NJGA 2QMHA 2AXPA 3A1SA 3RS2A 1Y3AA 2VHQA 4QM7A 3GLFA 4TYYA 3NBYC 2CVHA 1X8LA 3OFND 4OJKA 4OQMA 3MWLA 1Z2CA 2VP0A 3KB2A 4Q1FA 1E0JA 2H1LA 4HZUA 2GESA 3C14C 3KUDA 1XMVA 3GMTA 2F9MA 2RGXA 4PSAA 4DLZA 3LNCA 2OUKA 1KJWA 2WKRA 3LRPA 2FFAA 3PG5A 4N0DA 4DDVA 4JLVA 5EJEA 1U0LA 4AG5A 5KDDA 2RCNA 3QOFA 4URVR 5L3QB 1COWA 4MGIR 4WA7A 1FNNA 3QIAA 421PA 1JR3E 4WZAE 1U0HC 4O2RA 1OHHA 1Q1QA 2PCJA 4PHFA 5HPYB 4O2LA 4C7OA 1ANKA 3HPRA 4KLNA 2QT1A 2GAOA 3K8YA 4IOJA 2HCJB 3KX2A 4EFLA 2ZJOA 1QHGA 3MUFA 4DT1B 2L0XA 1W36D 1PZNA 2G0TA 1W1WA 1XZPA 3WHLA 4X8OA 3CO5A 4DC9A 4MDEA 1II8B 1XP8A 2YOGA 5JWRA 1F3OA 4PTLA 1XTIA 1JJVA 1US8A 1CEEA 3LW8A 1OXVA 5H70A 3CNLA 1RPZA 1X6VA 2QRNA 4XTRA 1ZNXA 3BC1A 3C8UA 1Z28A 1CBUA 1Z5ZA 4XSHA 4D4JA 1Q0UA 3QE0A 1XXHB 1HTWA 3EIQA 4TTQA 3IQWA 4ZDKA 2BEJA 2WJIA 5H1YA 4C0QC 3TLXA 1R4AA 2KB0A 3RABA 1VG9B 4HDOB 1F2UA 1KDRA 1G5TA 2YV5A 4JS0A 4TTRA 5JS7A 2IXFA 1G7CA 3W5IA 2CE2X 4AKHA 1FX0A 1SVLA 1TADA 4NYMQ 4PSVA 3ZZ0A 4DEYA 2R6FA 1ESMA 2KBFA 4DSUA 3PUWA 1TF2A 4Z54A 4NCKA 3TRFA 3QG5A 4M9ZA 3ADCA 1IXZA 1NY6A 2XOKD 2Z6VA 3KKQA 3W5JA 3Q72A 4FINA 3TIFA 3FMOB 1T4GA 4QBHA 1BKDR 1P9WA 3CF0A 4UJ3A 2X19A 3VR1A 4JLKA 3DO6A 1P75A 2QNRA 4F38A 5AUNB 5JRZA 4MGKR 1YZGA 1Z6GA 3G5UA 2IYYA 2GVZC 1XEXB 5BN4A 3QI2A 4F4CA 5TMPA 1E0KA 1W4BA 3MLEA 1JB1A 1NF3A 2HF8A 3IUYA 5IRCD 4M1TA 3I8SA 2HYDA 3MSXA 4RY2A 2VO1A 5DN6D 5BXQC 5KPDA 5IK2A 4PZZA 1KMHA 3LBHA 3ECCA 5TV2A 1P9RA 4JLMA 2VA8A 5G3YA 4M53A 3S1AB 3AH8A 2KSQA 3SZRA 3RC3A 4Q19A 2VP5A 3PQCA 5DI3B 1AA9A 5EE3A 2Z4RA 3LXXA 2GVDC 1E6CA 2RMKA 2W58A 2B21A 3CPJB 1OE0A 3IQXA 2ZIAA 3QXCA 4LUCA 3PITA 4D0GA 2OXCA 2KI5A 3CPEA 3KKMA 4G5OA 4AKIA 2ANBA 4LGMA 2WZQA 1Z47A 4LPSA 2J0VA 621PA 1N5IA 3GLIA 4GMDA 3PENA 2ZE8A 4YMWA 2QSZA 2YVUA 1DPFA 2CHVA 3RWOA 1DG3A 3QQ5A 2QORA 4AYTA 1S9HA 3T06B 4KI0A 3TJZA 2BDTA 2GJSA 3ZVLA 2FA9A 5HZKA 4YLGA 2QBYB 4C2TA 1T0HB 3KFXA 4U00A 1E0SA 3Q8XB 4JT2A 4OQNA 5DYGA 2PJRA 3B13B 1ZC4A 3BRWD 1E3MA 2WM9B 4G3XA 3OHMA 1Q22A 4X8HA 2GCOB 1E9RA 3UG6A 5KTYA 1WA5A 2OEPA 5JI2E 1XMJA 4BFXA 1MKYA 3CWQA 3O8DA 4URXR 1CJUC 3HR8A 3AF3A 1KJYA 4Q1AA 1P4SA 2B7CA 4PPNA 1BO6A 1NVUQ 1UADA 2QAGA 2JLVA 1A4RA 1Z2AA 2Z4SA 4ZDIA 3VU9B 4BFZA 4AURA 1E1RD 3T1QA 1Z08A 1ZCBA 4Y0AA 4ARZB 3GFOA 4MYHA 5KDLA 1ZJ6A 1L7VC 1FP7A 1ZVQA 2GA8A 3B5JA 1EFCA 2HUPA 4LSGA 1E99A 3T15A 4EUNA 3AEZA 121PA 3SFZA 4LYFA 4ACAA 4UQOA 3FOZA 4MYUA 4PC6A 3U3KA 4H9GA 2ZYTX 4PC1A 3HYTA 2FGKA 1P2UA 4DCTA 4V0OA 2QMEA 3WBKA 1AJEA 2D3WA 3U3JA 1GG2A 2JLSA 3H4MA 2NPFA 2IW3A 5JJLA 1QVAA 3SYLA 1SQ5A 3C4JA 4ZIRA 4D81A 2BIFA 1R2QA 3GLHB 2FEOA 4MUBA 4NPHA 1F6BA 3D6TB 4MYTA 2CEAA 3DMDA 3EZ2A 1E32A 1GILA 5FH9A 2Q9AA 1I4LD 1KDTA 3CUEF 3CRVA 1CJVC 4KYIB 3E2IA 2IA5A 3GJ4A 1RYFA 5EE5B 2RGEA 3QJYA 4B44A 2Q9BA 4Q66C 2QI9C 3UPUA 2HT1A 3VR6A 4PXAA 3G0HA 2BKUA 5BWMA 2IYSA 4DWJA 4CYMA 3HU1A 3I5YA 5DE3A 2ZJZA 4TYPA 3C7KA 4EJSA 1M2OB 2AK2A 4C2UA 1UEIA 2CBZA 5DO9A 5B57C 1F5NA 1IN5A 1XPRA 2FPKA 1ZUNB 1DOAA 2O0KA 3HU3A 2J3EA 4ZV4A 4Q48A 1ZBDA 2OG2A 2ZRGA 2GXAA 1P2SA 4K8OA 2DCUA 3C5CA 1NG9A 5J4VA 3R9WA 4L5BA 2J7KA 3QKRA 4LBVA 3RLFA 2ZSBA 1S8FA 4HAUA 2RH5A 5JEDA 5GADl 1E9FA 1IN4A 1HYQA 1A82A 1IJEA 4WXPA 4GOJA 3I1FA 1NVXQ 4KFUA 2Q3FA 3W90A 2F43B 1GNQA 4RD4A 2B6HA 3RS7A 1YVDA 4Q5IA 1JECA 1YQTA 2EYQA 4Q1EA 1P3JA 5EE0A 3X1DA 3A4LA 4HUTA 1QHNA 3UWKA 1M6NA 2R6AA 1OH5A 2B92A 3FMFA 3MGCA 5AWFC 3TE6A 1GWNA 4WAUA 2H8KA 1XEWY 3VR2A 4AWXA 1NL3A 3EZ9A 1OB2A 4QJ3A 2RGAA 1VTKA 2Q21A 2F1IA 2PZFA 2FN4A 1SXJE 2JLRA 2QENA 3LAWA 4C0JA 1J7KA 1NLFA 2X2FA 2FSGA 3VR4A 3ZGXA 1ZD1A 3AM1A 1UDXA 5TDHA 1VHLA 2XSZD 4MRPA 4M4SA 2ZRHA 3NG1A 1II9A 2C98A 2W6IA 5TVKA 3AVOA 4IHQA 1RRPA 4KFRA 1G7SA 3M1IA 4PHGA 3MG9A 5F9HA 1YRBA 3LY5A 3NHBA 2VP9A 4DLUA 221PA 4QXAA 3GEEA 1N0VC 2ORIA 5E95A 4A8JA 5E7IA 1XTQA 2JA1A 2RGDA 5CITA 2PX0A 4IFEA 4BEBA 1TTTA 3GLGB 4IFBA 4M9SA 1WBDA 3X1XA 2MMGA 1DAMA 1BMFA 4OHZA 3R9XA 2O8DB 2QMOA 1E9AA 4HI0E 5KSYA 1GKIA 3MRSA 2GNOA 3TH5A 4TN1A 4Q9KA 2GJAA 4PPFA 1NSFA 3SDZA 1E2EA 3ZIAA 5HE8A 5KSPA 3VKWA 2IYRA 3KTAB 2J7PD 3LDAA 1E9EA 4PSKA 4V02A 2EFEB 2CJWA 3QVUA 3T5DA 2C9YA 3D8BA 4Q4JB 2BBTA 5C4GB 1NKTA 2QRZA 4FCTA 1Q12A 1RJ9A 2VQSA 4PAQA 3LXRA 5JFGA 1VCIA 3L82B 4B2IA 4NYIQ 4TWZA 1G41A 2VP2A 1BS1A 2JCSA 4ZPXA 1LNZA 4KU4A 4C4PA 2CVFA 4WZ6A 1T3LA 4HLUC 2ZR7A 4WXRA 1QHHB 2C8VA 1T3SA 3I92A 4NYMR 4D2IA 3H1TA 2QY9A 1IAQA 2BBSA 2QTHA 3OESA 2QZ4A 4M21A 1ZUIA 1BYIA 1JQLB 4ASUD 4N1AA 2GF0A 3M4YA 4MRRA 4US0R 3TK1A 3U4QA 5E7JA 3A4NA 4FCWA 1GKUB 2IC5A 4C0BA 5B30A 4Q7MB 2V55B 5J40A 3KQKA 4QBFA 1IXRC 3TKLA 4G5GA 4OYHA 3AKDA 1KO1A 2HJGA 4BWYA 2ZAMA 3RANA 1LVGA 1NBMD 1GVNB 3PIRA 5SZJA 1D2NA 4V03A 5C1BA 3GLFE 1OKKA 4DLTA 2IF0A 2GRJA 3OEHA 4C0AC 3NWJA 3AP1A 3U7FB 3UKDA 3PEYA 3F8TA 2AN9A 4XVQA 1XFAA 2ZS8A 5L3RA 2A7QA 2GK6A 4OI2A 3Q5EA 5CB6A 3OE7A 1E1QA 3GJ6A 1JXOA 4Q47A 4JVNA 4QOSA 4RZ3A 4OHWA 2WBLC 2MSEB 4AY2A 5G40A 1GRRA 4DBLC 1G3UA 2BVNA 3B1ZA 5FL7A 1XF9A 3WNDA 4B3BA 2ZRNA 5CK4A 1XXHA 3EZ6A 2C2HA 2XZOA 5BQ5A 1W49A 2XAUA 2A30A 4FW9A 3W9YA 2K5UA 4DXAA 3MFYA 5FOTA 3ZVMA 1PVOA 4QHSA 1A7JA 2ZQ5A 5D3MB 2ZETA 1XZQA 2OBLA 3PUXA 3BE4A 4A0RA 2RGCA 1IM2A 3QXJA 3EAQA 4TLDA 1JQJC 3MD0A 3M6AA 2BMFA 2GKSA 2YWHA 2GTPA 3CW2A 1KI9A 1FOEB 3OAAA 2XNDD 3AV0B 3FMPB 4LBYA 1G21E 4LI0A 4EIWA 1YR9A 1KO4A 4GNKA 3B6EA 3RSLA 1X1RA 4OJQA 3AF0A 4Z1MA 1KZ7B 1ODFA 3K9NA 5J5CA 4LJ9A 5FL3A 1CJMA 4BECA 4DHEA 1SKYB 4DDUA 3CPHA 1XJQA 1NVVQ 1FL9A 1G5PA 4GP6A 4IEEA 4LX0A 2V4ZA 2BBOA 1S9DA 1G291 4ILEA 2GXSA 3F5FA 4JMPA 4NMMA 4B34A 3VKGA 3TAHA 1AN0A 2JJ2D 5C4MA 3S1AA 3IIMA 2ZE5A 4XVUA 1XTSA 1A5TA 2WJVA 3QKSA 3SHWA 5DI3A 3EWSA 4PZYA 4XD7D 3RVBA 1AK2A 4I1UA 4E09A 3DM5A 4JYBA 1KO8A 3UMRA 3AVYA 2QP3A 3B1VA 4I1VA 4R2HA 2HDNB 2X1VA 1E2FA 3H0KA 4RD1A 3T1VA 2O8FB 4MUAA 2WICA 1BH2A 3AF4A 1E79D 1H8HD 3DKPA 3L0SA 4M22A 4DDWA 4ZKDA 1W0JA 2HLDD 1X8JA 1P2VA 3LWNA 5CJPA 3GJ3A 3CX8A 2IYUA 4PANA 4W5JA 2CL6X 2HXSA 1SHKA 2PMKA 1SGWA 4JT4A 5JLJA 2QBYA 1XPUA 1Q3TA 1AGPA 1G8PA 1W0KD 3D7MA 3HWSA 1RE0A 3NXSA 1KGDA 4X8LA 4ZCLA 5JMTA 3AVXA 4HDQB 1G5RA 2EQBA 3K0CC 1E9DA 4TSFA 2NMVA 1VG0B 3P26A 2WVJA 3CNNA 2AHOA 2QQEA 1CRQA 4AG6A 4KITB 3NC1C 3CNOA 2ZRAA 3EZFA 3IILA 4Q18A 4BZXA 4KAXA 1T5IA 3ETLA 3HP1A 1P73A 1LS6A 2Q3HA 2WSSD 3PUVA 4PO9A 2A5FA 4QHTA 1RVDA 2ZXUA 5GJVC 1IN8A 2F55A 1QZXA 4ON9A 4LYHA 5P21A 1JPNA 2NPIA 2ORVA 3GLIE 1KNQA 3TSOA 2BJWA 4DUGD 4KFTA 4E22A 4EQ6B 1N6HA 4KXFB 3I5XA 4LYAA 4Q9IA 3K70B 1S3GA 1U99A 3N5CA 3WMEA 4MITA 1OIWA 1BIFA 3CWZA 1K5GA 2G6BA 2YHSA 4Q00A 1AS0A 4L16A 1E2LA 4U7DA 2VBCA 1W47A 3FDIA 4YXWD 2WTUA 1P9NA 2D2FA 1I2DA 1A2BA 4L8GA 3THWA 3CZPA 1YR8A 2VHUA 3U7GA 1EFUA 3C15C 1YZKA 3ICQB 5FTMA 4R98A 5HZHA 4LOAA 2I1VB 5FTJA 1Z6TA 2OAQ1 4OQFA 4JSYA 3A1TA 2REBA 4F92B 3B1WA 1W4CA 3ICEA 1Q44A 1QHYA 1ZU5A 3LD9A 3NBZC 1SVIA 1FP6A 1N5KA 5GVSA 1HQYE 3VR5A 2DWPA 5FUYA 5H68A 2ZJAA 2GJ9A 1QBKC 2ZSDA 3GLHA 2NZJA 4KLZA 3N2EA 4KO8A 2P67A 4PFSA 1GSIA 4C3ZA 3QSYA 2AXNA 2W83A 3R9IA 4OK6A 3A6PC 2C99A 5L3SB 2O8CB 2RGNA 2AKAB 1O3YA 4PPQA 1EX6A 2Q6TA 3R8FA 2F3RA 2XTZA 5C18A 2WJGA 3KJIA 3N70A 5G3ZA 2JLYA 3MWJA 4Z51A 1XCGB 4UXHA 1JR3D 3FKSD 1W4RA 3SR0A 1ZAKA 4LY6A 1W48A 2XTNA 4JSTA 2XXAA 5KYKA 5FI0B 2VHTA 4C0SA 2JIZA 1JJ7A 1SHZA 2CL7X 1OSNA 2NO7A 2GK7A 2QPAA 4Q4AB 2C77A 2R8RA 5K8IA 1RRGA 2RGBA 5FBRB 3E5HA 4QNMA 3NC0C 2ANCA 2J59A 2IHYA 1YR6A 1VMAA 1CR1A 2E1RA 1Z3IX 2ZSFA 3UK6A 3VTKA 1SVSA 4FI3C 3U3MA 5AJYA 3RS0A 2Z43A 2O8EB 4V0KA 4ESVA 3TVTA 2OO7A 1NJFA 5CM8B 1GITA 5DLQC 4Q4HB 2F6RA 3R7WA 1YZQA 1DO0A 2F43A 1N2CE 3Q85A 5FBWB 1UKVY 3QF4B 2JDID 2QM8A 1HUQA 2O52A 1TQ2A 2V9PA 1TX4B 3CLVA 4ESHA 2C9CA 2A5GA 4KVGA 2E9SA 3T61A 4LJYA 4WIAA 2WWYA 4TLBA 2CNWD 4P33A 1Q3HA 4LJ6A 1G3RA 3PUYA 4MKHA 4DCVA 4E5UA 3L8ZA 3TMKA 1VIYA 5K8UA 2CK3A 3IBGA 2DPXA 4RD6A 2W6JA 3IPXA 1F2TB 3W34A 4DJTA 5F9FA 2W00A 2HF9A 3QBTA 3R8CA 2QROA 4CEIB 1AQYA 4HB3A 2D62A 5DIFA 1VDZA 4LV6A 2RHMA 4R71A 1NN3A 2ZI9A 3QEJA 5CIWA 5J4HA 4NYIR 3V9PA 5L3VA 4DLXA 2Y8EA 1TMKA 3GQBA 2IT1A 4CIDA 1N3BA 3ZVRA 2FNAA 2ZI7A 3EC2A 1TAGA 1KO7A 1OXXK 1YE8A 4D4LA 1E2JA 5HKKA 2P0EA 4QGFA 5TARA 2ZU0C 3IKJA 2Z83A 4HYYA 3IIKA 1ONBA 4D0NA 4Q7LA 2WPDD 2V6IA 1KI4A 2P6NA 2YWGA 1C4OA 4BRUA 1Z0AA 3LVQE 2O8DA 4A1FA 3AQ4A 3IEUA 2EFCB 2WMNB 1KI3A 1EWRA 3CF2A 2ZJ5A 4URWR 3BAFA 1ETUA 1DG1G 2IBMA 5B58C 3QENA 1Z0IA 3MJHA 3E70C 5JS8A 1U98A 3P1JA 1FW6A 1KSHA 3ADKA 1IY1A 1CR2A 5JZVA 3NDBB 5DGXA 2H17A 1EG7A 2QP9X 4TT3A 4QHYA 2O0JA 3DM9B 1GL6A 4WZBE 3X1WA 4Q4JA 1Z6XA 5JEEA 5FTLA 2DB3A 3GEHA 3CR8A 3P20A 5KNBA 1TPZA 1NIJA 3GJ0A 1YZNA 2V7QD 3NH9A 4Q4LA 4B3DA 4R7ZA 5KNCA 3LX5A 4TTPA 2I4IA 1Z83A 1OT3A 1LS1A 4Q9JA 4BZQA 3A58B 4BFVA 2R44A 3DZ8A 3FHCB 2FU5C 2TMKA 2C78A 4TMKA 3BFXA 2D06A 1WF3A 3FYHA 1ZM7A 3U44B 4BLPA 3BWDD 1OKKD 5FOWA 3KUCA 4P4SB 3KJHA 2J0QA 3OEHD 4P4UA 4URUR 1EESA 4YONB 4CZ2A 2PCLA 5IDVA 3VAAA 4L9WA 1UBGA 5M04A 3QF7A 3ZD7A 1R0XA 3KDSE 1KNXA 4W5HA 4UNSA 4B3GA 2P2LA 3T5GA 1KI8A 1II0A 3BIFA 2PZGA 3LO5A 3FFAA 3TUJC 1G3MA 3OIWA 1W5SA 5FBQB 2XITA 2ZANA 2IWRA 2ZI3A 4IOMA 2J9RA 2GJKA 4JJZA 3LQRA 1OF1A 1NVVR 2OSBA 2QEQA 1I4DD 2ZR0A 5EP2A 5EZ6B 2PT5A 2UKDA 1AM4D 3QPUA 4P3YA 1E9BA 4Q1BA 2J1LA 2ZJYA 4URYR 2IS4A 1U0JA 4HATA 2HEIA 1SXJC 2QL6A 1TNDA 3P4YA 1DS6A 2GEUA 5LPNA 1JPJA 3ADBA 1Z07A 1XWIA 3W3AA 2IYTA 1DTSA 4DB2A 1ZCAA 1GTVA 4NP6A 4KCGA 2Z5FA 4ZDJA 4JIMA 3SBEA 1G16A 4US2R 2EFDB 2AD1A 1Z29A 2G1KA 1E2QA 4V0LA 1MABB 1ZIPA 5BN3A 4F93B 4GL2A 4BFWA 2GBLA 4MH0R 5D3MA 4AI6A 3W6NA 4RZ2A 2NO0A 2HV8A 3GFPA 4UXIA 5HCIA 5JHHB 1KSJA 5CK5A 1IN7A 4B43A 3OIYA 1LV7A 4NE2A 3THOA 1JNYA 2GZHA 2AFIE 2NO6A 4CEJA 3P27A 3TGPA 1KIMA 1NLZA 1XRJA 2FMXA 2IK8A 4KV9A 2G9NA 2IYQA 4HAZA 4IDNA 2ORWA 3JVUA 4F4IA 5TB5A 2JLUA 4Y0VA 2YC2C 2ZRMA 1T5LA 1XXHE 3I73A 1M7GA 2P5SA 1LB1B 1TUIA 4I4LA 1GNRA 1LFDB 1D9XA 1OXTA 1JAIA 1IONA 1YZLA 1SVWA 1RRCA 2OFOA 3RDPA 3QPWA 1CULC 2C03A 4NL4H 1LTQA 5A4JA 5JBQA 4CEHB 1E98A 4FIDA 4CGZA 1P60A 5SZIA 4QL3A 3L8YA 1KI6A 2PZEA 1TQ4A 1OIVA 4QBIA 3U6KA 5DISB 1Z22A 3CBQA 3KKPA 3A37A 4JL6A 3EA5A 1XTRA 2REXB 1K6MA 4NH0A 1XCPA 1XPOA 2JJ1D 5FOSA 2J5XA 3B9QA 5EP1A 1OJLA 5B2ZA 3TR5A 2O8FA 1DEKA 4V0MA 3ZS9A 1SXJD 2LCFA 2IS6A 1FNMA 1N0WA 1TQDA 4IDQA 3F0TA 3A1WA 3NKVA 2EYUA 3CZQA 3KB1A 1L2TA 3I8XA 1H8ED 3EXAA 1T3HA 2GZDA 1IOZA 4F91B 4FMDF 3SYNA 4DCSA 1OFUX 2ZYUX 3NH6A 4TMXA 1M34E 2FE4A 4YMSA 2XNSA 2C9OA 1KKMA 5KPJA 4RD3A 5GJWC 2Q3MA 4Q7KA 4G5QA 2VHCA 3B1YA 1M74A 5DYIA 1GP2A 1X3SA 2PL3A 3CRW1 3OEED 2H5EA 1Q1EA 4I81A 4TQUS 2A2ZA 2N46A 4LYJA 3Q5DA 1L8QA 1QRAA 3RRZA 3KXLA 2FZ4A 1G7TA 1NRJB 2VRWA 5KO2A 5JI3E 4LK2A 3GPLA 2PEZA 4Z8YA 3MCAA 3QNUA 1CLUA 2ONKA 4TMZA 3CH4B 4B48A 1G8GA 1NMZA 2ZRBA 3IDQA 4DKXA 2DFLA 1FFHA 1XTJA 1D5CA 2REOA 1MR3F 3REGA 4BZPA 4S2EA 4GMXA 4TZ0A 1XD2A 1HH4A 2ATXA 3LBIA 4K81B 3RHFA 4BLRA 3X2SA 1PUIA 4C9BA 1OPXA 4HUQB 4XSGA 1BYUA 3SBDA 3TBKA 2ZRPA 3VNVA 1QG2A 2PMDA 2R6DA 2O8BB 4KFSA 1P5ZB 2GCPA 2XB4A 3BFVA 1MT0A 4NKRA 3GLFB 4RFSA 5DHFA 3TW8B 1JALA 4M1YA 1QHSA 1UBFA 1VHTA 3DPUA 3WXMA 2FJUA 4HZUB 1FQJA 1KI7A 4RKFA 4NHOA 5FFMA 1ZIOA 2AR7A 2ZAOA 3QVVA 3SE0A 1TEXA 2RKOA 3CRQA 1PJRA 2FZLA 3IEVA 1Z0DA 2GXUA 4O3MA 5EUQB 1DAEA 3FE2A 2VL7A 3EW9A 1EFRA 4TL9A 4UNPA 3OFNA 4WVFA 3MMPA 2BWJA 5LDDC 1UKZA 4P31A 4DRZA 4LHVA 4C7OB 2FOLA 3O8BA 2WHXA 1R5NA 4D4KA 1QHXA 2GF9A 4O0MA 2OZEA 3GJ8A 2J0SA 1X86B 3AP3A 4BLOA 1W4AA 4FMDB 5FPYA 2HYIC 4EFMA 4URZR 3U61B 2WJYA 4QG7A 4JLDA 4TYWA 3UIEA 3KQHA 3IO3A 4ERNA 5EP3A 2D74A 3MAAC 1G7RA 4ZI2A 1LW7A 5AJXA 1HQCA 1US8B 2J0UA 4FWIB 1U8ZA 3PXGA 4NYJQ 3ZZUA 4EPYA 1FUKA 3P32A 3PR1A 5E3HA 1KHTA 4MRVA 1Q20A 2C95A 4DIDA 1P62B 1GRNA 4LJ5A 1JI0A 1M7BA 3GJ7A 4QNRA 2ZRFA 2BMDA 3DDCA 3IHWA 2ZI5A 4IRUB 3BJIC 4BEJA 3ZLJA 2N1BA 2R65A 1DARA 4A6XA 3SN6A 3FFBA 1G8FA 1QVRA 4LPKA 3U5ZB 5EE1A 3TUIC 2IUUA 4PAOA 2XEXA 3A1UA 4Q4HA 4BQSA 5JRJA 3QXSA 1COWD 2I1QA 1FX0B 4GOXA 3T34A 1OHHD 1ZM9A 3BB1A 3KKOA 1UKYA 3RS4A 1FTNA 3BS4A 2AL7A 2ODWA 4BFUA 4NZYA 3FPAA 1UEJA 2HCBA 5FI1B 1MO3A 3RS3A 5SZHB 3UANA 2FFBA 5J4YA 4DIEA 4XVRA 5L3QA 4QKQA 1R0YA 1F2TA 3TQFA 2NO9A 1CF4A 5UKDA 4F7WA 2ZREA 1W46A 3SS8A 4OI0A 1N6OA 2IL1A 4CEIA 1ZNWA 2BMEA 3NTUA 2XOKA 4B35A 1L4UA 4B73A 4DVGA 1AZTA 5KU1A 2EU8A 1JEEA 1KMHB 4IEIA 4DT1A 4QM6A 1SULA 1MO5A 1G4UR 4D6PA 2GJ8A 2JLZA 1HY3A 1II8A 2VHJA 4IVQA 3AVVA 2PX3A 4MGZR 3CKLA 2OXRA 2WAXA 2XTMA 2A3RA 3JZAA 2VSOA 4D0LB 1YZUA 3A36A 1M8PA 3UATA 1P6XA 4LHXA 2XJ4A 1S4QA 5DN6A 5GVRA 2WIAA 3Q7PA 3UXMA 5HTKA 1JR6A 3K0EA 3K0FB 4D26A 2OCPA 4KODA 1G3IA 3WP1B
chains in the Genus database with same CATH superfamily
1NOJA 2OZPA 3I37X 5LZ2A 5FLEX 1F0NA 3A2LA 1PKEA 5D01A 1FCJA 1XBTA 4O2BB 5F51A 5AVJA 3WMFA 2AWOA 5TIIA 1QNFA 4JKYA 2QA5A 4HQKA 1Q2UA 4MKRA 5COQA 2QPLA 2XB8A 4Z9AA 3WGTA 4KQ6A 2BLNA 1LJUA 2YX1A 2GTHA 3LI2A 1QB8A 5ALDA 4J1TA 4Y1RA 4ZO4A 4JEIA 5IC6A 5LCXA 4ZPJA 1GL7A 1YQQA 3IRVA 4RQAA 5IMBA 5E4JA 2ODNA 1HV8A 3UJCA 2CDBA 2CFSA 5JPCA 2DETA 1MV5A 1SOMA 2FW1A 4LOLA 4BO4A 5CYFA 1HNWB 3IPAA 1Z2PX 1OT5A 4RLQA 821PA 2E87A 1Y6GA 2ZBUA 5B4VA 2AYXA 4V38A 2FW0A 1IUOA 4OHXA 3F73A 4CI0B 4TKUB 3SZOA 1JZSA 4RHCA 4Y2XA 5JT1A 4KI7A 3DKVA 3FUVA 3VNUA 1VJDA 1OAAA 3BRWA 5G41A 5B37A 3W6ZA 1PEAA 6NULA 2VHYA 4FMCB 3ZDRA 1M1YA 4INZA 6ADHA 1FS5A 2AF3C 3FH0A 4FCVA 5FFFA 2H92A 5JDCC 3DPSA 3AKCA 2Y1XA 4K9OA 4R41A 3VU8A 5MFZA 1E6MA 3SHFA 4IVRA 5B6PA 4I3GA 1H9CA 4H3KB 2BJVA 1DEXA 2VNSA 2X6QA 1TVKB 3LLCA 1PW5A 4L9SA 5AW4A 4AS1A 2UXBB 1NYRA 3MINB 1AHPA 5KMGA 5KB3A 1ZITA 1BQEA 4IGAA 5CT6A 3HA2A 1VLVA 3H5AA 5AJVB 4E2YA 4J1NA 4M1ZA 4ERXA 2WJWA 3K0HA 4MWZA 1Z6AA 3BHJA 2PAFA 1NSTA 2IZZA 2WW8A 3G13A 2VI5A 3O9MA 5K0CA 4UHHA 1KRHA 2UYCA 2CF5A 5KVVA 2PSEA 2V5UA 5I45A 1MQSA 2FPIA 2R00C 2XT0A 3HN7A 5MHTA 3IV9A 3UMFA 2G0NA 3AZOA 2LUOA 1QM5A 3R40A 2YMMA 2A9VA 3AHCA 3DEZA 4DCUA 4D41A 5EJ9A 2VH5R 3G8AA 4YK7A 3EC7A 3PUJA 3PNQA 4AECA 1NT4A 1E63A 3K1JA 4D99A 3ECSA 5F3DA 1TTHA 5F64A 2FN9A 1GQOA 2A5JA 4KHPB 1NT2A 1GNLA 1R00A 4Q7JB 1SOWA 1C4KA 4M1MA 2F1HA 3QUAA 3G2LA 3IVMA 4X1IA 2A9JA 2H1IA 3O2QB 4WNAB 4MIKA 4TMVA 5KDOA 1Q7CA 3ZZTA 3RAFC 1GZDA 3DAHA 3PT5A 1WHSA 1GAJA 1OREA 1DFHA 2AG6A 3V97A 4ENRA 1PLKA 2BMVA 1DAOA 1CYDA 1UWKA 2JBAA 4RHTA 4DYVA 5DTRA 1Y7LA 5A4FS 1O77A 5E6SB 5ICFA 1YS6A 3ZBUA 2OFPA 3P0HA 3GDWA 4L6IA 3NONA 5IHPA 1AKEA 2WTEA 3E22A 4C2AA 4DMGA 1S96A 1W9MA 4LRWA 4AJIA 4I1RA 3ZDQA 2XBMA 4GEKA 1VKRA 2VSFA 2CEKA 1GCOA 5BSMA 3KALA 3Q7QA 2WU4A 1VPEA 3LGXA 1B42A 5CJJA 1O95C 1TF7A 3WGNA 1GFWA 1R27A 4ZOQI 3CLTC 2B1QA 5LP6A 1PNVA 3S99A 1AS3A 1S6YA 1ZRHA 3JYHA 2WUVA 1YBAA 4DG5A 4EHKA 2FFQA 1K7FB 4QLOA 3V00A 1FUUA 5MF6A 3T7SA 1D1SA 4FX5A 2A0XA 4OL0A 1P4GA 5KCZA 4IOLA 3TINA 2E6KA 2Q1UA 3L0BA 3R3YA 4Q12A 4CKWA 4NJEB 5JSFA 2FDXA 3PWKA 4XGQA 1THGA 2X9LA 2OE2A 1GPAA 1H0HA 3UTDA 2TMGA 4HNRA 1YHNA 4PN3A 2O7SA 3O9VA 4WOPA 4IILA 3BRSA 1EMDA 4B3XA 2MDTA 4L4XA 1JKJA 4YPFA 1DMRA 4ZO6A 3U6BA 1OC4A 2ERYA 5G0VA 2XGJA 3AVPA 5EJ8A 5IDXA 2QT0A 4GHWA 4ZOEA 3NHPA 3SIRA 3EXG2 1A04A 4M1SA 4AO8A 2H4FA 1PWXA 4WLNA 3IMEA 4PPGA 2F9FA 3L07A 4P4TA 2W8ZA 3ZV4A 1ZINA 2EBUA 4M1QA 4B47A 6REQB 3GXOA 5IUNC 4IQ0A 2HMSA 4XDYA 1ADBA 2BFDB 2NYVA 1QX3A 2X1LA 5DX1A 3CX7A 3GD7A 4MB2A 5FLKA 4N48A 1TAUA 4ZAWA 5DBHX 4ZAVA 4R2WA 3GB9A 4E07A 1WX1A 4B2LA 5TSDA 3FI0A 4I9FA 4IX9A 5C8YA 4JLAA 2BZ1A 2FX5A 5F23A 3ZDFA 3H7IA 2IZ1A 4G85A 1B00A 4GAEA 4R8RA 5D85A 3GH3A 4PNPA 2ZJ2A 1SVMA 3BSYA 5HEKA 3VMMA 2NO1A 3KAPA 4LECA 3WDMA 1L5OA 3S81A 4JP2A 3IV6A 2DEUA 3IDSA 1NG1A 1LQUA 1YCFA 2X77A 3NNSA 4FMBB 4WZBB 1A27A 1DOHA 1YOVB 2IEIA 4FOOA 5ARCA 5C31A 2XSZA 5KYWB 3TLYA 1OB5A 3M9LA 3OKFA 2AX4A 4K7JA 1THMA 1RZRD 1Q14A 1KAMA 5K8CA 2FJPA 2BV3A 2WHRA 1QZ3A 3R9XB 5CXSA 4EABA 1XQXA 5E4TA 1C0PA 4LZNA 3EPKA 1T3ZA 4G2TA 4WBNA 5HKOA 1SG6A 3ANXA 4K0RA 3UUGA 2JFZA 4H7JA 4QO8A 4RZIA 5CW2A 1O95D 3WRXA 2ZSEA 1A8PA 4GYWA 5CYPA 3CLTD 5BUQA 3WLJA 4MEJA 4C4YA 4W5QA 5KKAA 1AE1A 1QNLA 2WWTA 5FPSA 5LVAA 1NN1A 4NDNE 4QQFA 1YFLA 4JDUA 1XAJA 3A6JA 2GQ0A 1CP2A 4ZOBA 3R75A 2VPWA 2QXTA 3P45A 2YIVX 3CF6R 2QUHA 3O8OB 5DZSA 5EQDA 2HHJA 5ALRA 5JRDS 1ZGZA 4AN0A 3PEEA 1K2VN 1TTQB 1WS6A 3R0ZA 4BHTA 4TTVA 5FWDA 3ER6A 2OXEA 4L2IB 2QPTA 4ISCA 1D3AA 4KQKA 3THSA 4BTVA 4ZJUA 4GWGA 2G1JA 3TGLA 3V7UA 4CPDA 4EYEA 4C4XA 4EY3A 4O5OA 1Z0JA 2UYOA 3NHZA 4OFWA 1Y8QB 2H0RA 3C8ZA 3WWOA 2IDMA 2J7PA 1EFRD 2AYZA 3T5MA 1P74A 3IE1A 5CM2Z 4MS4B 1S1MA 1NURA 2JNWA 3E6AA 4G97A 4ZAZA 2EJVA 4F12A 3ELYA 3KYDA 3PVSA 2GEFA 5EERA 4M9QA 3TVYA 4X9XA 3FHLA 4BCDA 4QYIA 2XVAA 4GDMA 4IHJA 1TZCA 1P7WA 4RK0A 3PC6A 3W7VA 1VE3A 4Q9AA 1AXGA 1GUBA 4YRZA 4OI4A 3ET5A 5AKEA 3CLUC 3ZIAD 3DWFA 2AQ8A 1VMEA 5DTJA 1GTSA 1N5MA 1AVTA 2IYXA 2PYIA 1S7CA 4OQQA 5EXSA 2NO5A 2I99A 2C04A 3IB3A 2KX7A 2RGWA 1IEVA 3WS7A 4A0GA 5JD5A 5JSZB 3FSRA 4M9XA 4EJMA 4GKVA 4GWKA 4DPLA 4S3MA 3BA1A 1PG2A 1GPWB 2O05A 3D31A 3F7MA 5EWLB 2WD9A 4G0VA 1JGTA 2ZUUA 5CB0A 1R8SA 4ZT4A 3EHEA 3ZKAA 1UDWA 1GA1A 1XJWA 2CLFB 3TTXA 2B9VA 3KTAA 4M7OA 1CS0B 4UM5A 3JQ9C 4ZOLF 3IO5A 3VX3A 3TW0A 4I55A 1M0WA 2CLCX 1KK0A 2W6OA 3OTHA 1DFGA 3MW8A 4JI3B 4D4MA 3WYAA 4JI7B 1QYIA 2WSLA 3ZCXA 2CDCA 4F5ZA 1IK6A 2EFGA 2RGGA 4HB0A 3QUTA 2WYOA 2R66A 4LSWA 1U1GA 4OJNA 2XYGA 3W2GA 1PDWA 2JI4A 4AO6A 1KDPA 1U6JA 2PSFA 4AL4A 5FO1A 3PD0A 3E81A 5IEJA 2GKGA 3UWSA 3CG0A 5D3QA 3VZBA 5CDFA 3A6GA 4KHZA 1PJ4A 1UK8A 3L7AA 4L15A 4Y6PA 5EXTA 1JBEA 4ER6A 4GQIA 4MYCA 4I6EA 5B1HA 4DPMA 4NS1A 2JFPA 1IHPA 4HY3A 2C42A 2D2EA 2FEMA 1V3QE 3OX4A 1ODJA 5HHTA 3EVCA 3NDPA 2O3TA 4KMMA 2Z6AA 2JKZA 5A71A 4YUZA 4GBJA 1S1CA 5JSQA 2OCXA 4N3CA 1Z7GA 2HU7A 4PLVA 2G9ZA 3CNBA 4POAA 2EBFX 2HREA 3UOGA 4ZZ3A 4RTLA 4BGDA 1Q0QA 3LOUA 4YV7A 5DDIP 2Z09A 2WF7A 1XAHA 2I87A 3BD7A 3IC5A 1XDBA 3IA7A 5AVWA 2NV2B 1JSXA 3C3XA 3DQPA 2QRQA 4CM8B 5F7XA 4X1OA 4C5BA 1WMSA 2WG2A 3CLUD 3ECAA 4RW0A 3ZEIA 3T5BA 4QIHA 4IKEA 3CGGA 3DUFB 2EFHB 1AKNA 1PUJA 2XCTB 1MX9A 3OPQA 1DX9A 4IDHA 1YI0A 1QGAA 1SBZA 4ZP1A 1E2HA 4NQRA 2PGDA 3AILA 4F8JA 3ROFA 1T2UA 4EAQA 2P6UA 2BGNA 2YFQA 5JYCA 3O92A 1LPOA 4FWTA 2QUJA 3AGPA 3T7CA 4EYKA 2HHHB 3AGQA 3L0OA 4JUFA 2R9VA 1XTUA 4MHOA 4JFAA 2VN8A 1Z5NA 1ZZEA 3NFYA 5DLPA 5F5XA 3FGNA 1KDYA 5FV4A 3SX4A 2GM4A 1QGOA 3K0FA 4UZEA 4Y2TA 5FOUA 3UAWA 1K66A 3HJFA 2O19A 2BCJQ 3F6PA 1XZGA 2Z2XA 3OAAD 3H2SA 4PYKA 3S2SA 3K0AA 4JXXA 1U2PA 1HA3A 2B8TA 2FWAA 2J3HA 3BD9A 3I32A 3PFFA 1HM5A 4ISBA 3G9QA 2XXBA 4LVNA 1RLOA 3DBRB 2O7RA 4RPCA 4RJKA 2QUAA 2VXYA 2BN4A 4OHYA 4HGZA 4ZOLB 3CN9A 3OTWA 3V4ZA 3OX3A 4B33A 1AC5A 1NKVA 4F9GA 2X4IA 4BJ3A 1L7BA 2OD9A 4ND1A 3TNDA 4ENPA 4Z1MD 3IP6A 4B3IA 1D6JA 1Y1RA 2BUCA 5AM3A 1CZLA 1OASA 1YZVA 1E79A 1PTJC 1PYDA 1VSTA 5GJCA 5DGTA 4UATA 1ZMOA 2G77B 1CY7A 1I36A 2JH8A 3AR8A 1RKVA 4LKRA 3QFHA 5DNUA 2HLDA 3G9XA 3UK7A 3JQBC 4AB1A 3VVCA 4P32A 3D2AA 2BKEA 1CUBA 1DBRA 1SXQA 1FQKA 3GFRA 2FFRA 4MTCA 1KSGA 1KJ9A 4C6HA 1YNSA 5AUQA 4L5AA 4DDMA 3L9WA 4FHCA 3B2EA 1KYTA 5F3WB 4F3CA 4Y9RA 1U0BB 5REQA 1XMOB 4BV3A 2ZQYA 3NYIA 2Q1XA 1BOOA 1MO6A 4K87A 2OZLA 4OQZA 5K0GA 4K1LA 1LSSA 1VKJA 1KF0A 3LV8A 1WUHS 2YXBA 3AR7A 3WRYA 3Q11A 1X0XA 3IT3A 3NTLA 4QXMA 4FFPA 4XJSA 2P79A 3VC2A 2WSSA 2F2TA 3THWB 3OFJA 3W1WA 3ROZA 2VQ6A 2J9FA 1GYRA 2WWVD 4UCXA 3UHFA 3ZOZA 2BZSA 4HMOA 2OCBA 3ZZNA 2DUNA 2RONA 3AUXA 3K4HA 3KG2A 4XOIA 2RB4A 4KPFC 4U39A 4D02A 4EB6B 2JW5A 2WYUA 1A50B 2BFEA 3LVRE 4RY0A 1DAKA 1VCMA 2F4NA 1DTEA 1TQ6A 4IJQA 5TS3A 2AHRA 5TS2A 3BSWA 1SIWA 4OH1A 2M6KA 4OIMA 4ZVSA 3I61A 1JLRA 5IC5A 4O4LB 4KQMA 3R7SA 4CNQA 1T9DA 1T1JA 2XYPA 3V33A 2IZ5A 4FOLA 4WN9A 5E8JA 3GP3A 1C7RA 1JRLA 2WKPA 1ZKDA 2PH1A 2E55A 4ZTUB 1R4NB 3RROA 1S4MA 2V7EA 4KOEC 5BMVB 2RBGA 2HSJA 5BO5A 3ZD6A 2ODEA 4PXSA 10MHA 3RVOA 3SQNA 2W90A 4DMHA 1OA0A 3UWOA 4RL4A 5KYXA 1IJFA 1UBOS 2QJTA 5KWEA 5JW6A 1QS0B 3I23A 4R2IA 4DSTA 1ST2A 4YV2A 4YP6A 2PO5A 5FD8A 2JGMA 1AK9A 3U48A 3WMXA 1NI4A 2PH3A 3PFIA 1PGJA 1PLLA 5CIYA 3ZDCA 1DWOA 5FLYA 1XAIA 2ZM5A 4RK1A 1P2TA 2PQ6A 5M5BA 4GYKA 1WM1A 5HJ2A 4BP9A 1D1QA 2BFMA 2VLIA 5CURA 1UM8A 2O50A 3IP9A 3RFXA 2WU3A 1KORA 1QKJA 3B7PA 3BCUA 4EQ6A 3KYCB 4HWRA 4TRRA 5F2OA 4ALKA 1TL7C 3V9AA 3BRCA 1EWVA 2ZLBA 1KJQA 4C3VA 3ILXA 1DJPA 1N9KA 1JEDA 2GETA 4H6VA 3MWYW 1FDVA 1G8HA 2D1FA 1DKUA 1BA2A 1JR3A 2R1VA 2YWFA 3C6XA 5CFOA 5JDIC 1B93A 3NHRA 1D07A 3QWAA 1X14A 3C3EA 1CW2B 4EENA 4NVRA 2HXGA 2X8WA 2LZ0A 4H31A 1NX9A 3EB9A 3I2JA 1SCJA 1LDYA 2YTZA 1JEJA 3AF1A 3KU1A 1QAQA 1VHWA 3IODA 3NETA 4GXRA 3CISA 3U0VA 5HOQA 3ODGA 2GZRA 2PXXA 3CUSA 2QRKA 4GZMA 4YT8A 2C58A 2JGDA 4NBKA 4RJLA 5FTNA 1M2KA 3VKFA 3LQQA 1I10A 3NORA 5EWJA 3X43A 4EA7A 2Q7DA 1NU8A 4AZ0B 5K0ZA 2JFHA 3T7DA 3JWHA 4XM2A 4RH0A 2IY9A 3O6VA 4FHZA 1W8IA 2CLMB 4HNQA 4DCCA 2UDPA 1ZICA 4MGYR 3SHQA 3U4HA 2HIAA 3TECE 2DULA 2DCMA 2O48X 2XCLA 3GHYA 3KHSA 4OK5A 4ML3A 5DCLA 5EKXA 3TB4A 5K05A 3PYLA 3ZQ6A 4ZVLA 3LDFA 5ESDA 2Z8XA 1P18A 2FRXA 3LECA 1A2KC 4CMIA 3FHOA 2Y1FA 1RYMA 4KP7A 4TSKA 3LKVA 1T9GS 2FPGB 3FYUB 2HWUA 2CHGA 2HPHA 1SZDA 2VR1A 3IMFA 4BPRA 3JW8A 1YDGA 3I2FA 4FFOA 2ZJ7A 4KQWA 4OXXA 4MW0A 4RKEA 1JQDA 3W6PA 4C78A 1KI2A 2ZW9A 3N6XA 4L4ZA 1TF5A 1ZM2A 1RWKA 3DYIA 1YAJA 3H5VA 3I53A 5CDSA 3GUZA 4X8MA 1SC4A 2Q7OE 1RQNA 2DTDA 3E9NA 3EF1A 1J0CA 1RD4A 3A1FA 1M7HA 2I2FA 3LDGA 5TPWA 3GR6A 1JWLA 5JBNA 2XMCA 3FPGA 3KDAA 3NBFA 4QGGA 4MVXA 1H5QA 3OKPA 4Y7DA 1U4NA 1W85B 2N1MA 3GLHE 3O47A 4G84A 4WASA 2CMKA 2CCGA 5ALFA 1NF8A 4V39A 3KXDA 4N65A 1AB5A 5KJCA 3MT8A 3TUZC 5BYKA 4K2HA 3WL4A 3I28A 1OLXA 3DT8A 1ZG3A 2JAPA 1PQWA 3FXAA 3GV0A 1OGIA 2ADOA 4OM7A 3TOZA 1A7UA 2P6PA 2JGFA 4M7WA 3RRMA 4GRAA 4QDTA 1ODLA 2X9VA 3IBFA 3R5JA 3WO0A 3WVNA 1HOXA 3S29A 1Z7EA 2BEVB 4YUAA 2O1XA 4IG9A 4A9AA 3SZUA 3U7EB 3P9QA 5KEIA 3JU3A 2RAFA 2AWNA 1NTOA 2ZSAA 2W6JD 3UYKA 1CKEA 3NI2A 3QY9A 1BA3A 2JIPA 2IH4A 1MG0A 2PU7A 3V2UA 4R2KA 4NZPA 5DBGA 5HQ3B 4WCVA 4WEQA 1JWBB 2R8XA 4QFMA 5GPBA 2ASVA 4Q01A 2AUNA 1Y9AA 4DDTA 2QV0A 1B23P 2XXJA 3B1KA 3FX2A 4OB8A 3C48A 1ODKA 1D8TA 3OCVA 2AI3A 3NBUA 4G8CA 3KR9A 2J6BA 3ORYA 2V8BA 5LUBA 4C43A 4R68A 3QXGA 3WLSA 3TLBA 2IUSA 1N6RA 5BN4B 5CCBA 2C2KA 3K16A 5HOEA 3T5TA 4CODB 5EVCA 2AN1A 4Q4DA 4B84A 4BKUA 3QP9A 1PR2A 1QPGA 3EZ7A 3M1AA 2QE7D 4AJOA 3G6KA 3SQXA 5JS6A 2FQWA 2IDJA 3KOXA 2AXQA 4GMHA 5FHRA 2QMQA 1DJNA 1Q0SA 4LJKA 4I14A 2L2QA 1REQB 2AZDA 2PHZA 2YZKA 4M2LA 3VKUA 4GKKB 2FQYA 3I3OA 4BVLA 4HLCA 1CF9A 1XR3A 2OZKA 5K8TA 3NAMA 1E2NA 1LH0A 3FR7A 1MLDA 2NXWA 2GBGA 3H11A 3KC2A 4ZTBA 4EEKA 4D7AA 1TVCA 3RC8A 1VJCA 2FWIA 3HK2A 5AW8A 3AVTA 4Q9HA 3K71B 4PSUA 1WVGA 2I7DA 3W1VA 3IVGA 4UUAA 1KU6A 1Y5MA 4LHSA 3OPVA 2XF2A 5AUPB 4LF6B 4LYGA 5A6SB 2BGJA 1UJ4A 3K92A 4H3VA 3P2OA 1ITZA 1Y3IA 3DEFA 4INOA 3SEAA 4YMGA 1YXMA 3NTXA 1HYHA 4Z6KA 3JYPA 4G63A 3BVPA 4TXNA 1R6BX 2GXQA 1DJOA 4RAOA 4IQGA 1FK8A 2FSHA 4IV5A 2Q0HA 3Q3IA 3AOGA 3NATA 2EJWA 4QBGB 2F8SA 2GBLC 1S8AA 1T43A 2FP4B 3AUFA 3WYGA 1BWSA 4EDHA 5BV0A 4G9BA 1TU4A 1RXIA 2WHEA 4L08A 4W7SA 3V8NA 4H1WA 1KWKA 4I99A 1PEDA 3DOCA 4L3VA 5I5GA 3ANMA 3RRNA 3I8OA 4LZOA 2NQTA 4ALIA 2I2XB 1KMQA 3O82A 5IJ0B 5KNCD 5G4KB 4BN4A 6Q21A 4AJNA 1X80A 3PLNA 1KRXA 2O1WA 1GIAA 5LKRA 3PXDA 4C05A 1HDOA 1SG9A 4UCFA 2ZTUA 2ZTVA 1AKTA 4JGBA 4EYOA 2UXCB 2PE5A 1F2DA 1E94E 4FM9A 4ARUA 3WK8A 2GRAA 2VDPB 2L69A 4EUSA 1AGYA 2FDCA 2DQKA 4MOWA 1WB9A 2F48A 2C4WA 3FCEA 2RD2A 4K0KB 3RVLA 3IUNA 1T8TA 2J9GA 2HRBA 3B53X 3X1YA 5BQFA 4R51A 2VOJA 5BSGA 4ZYYA 1C7QA 2ZYVX 3DJFA 4DBVO 5AW7A 8LDHA 1KVRA 3F47A 1ZOLA 3AERA 4M3NA 2J5BA 3VHXA 1GARA 3FNQA 1NFFA 1VB3A 1WDMA 2VUSA 4MIEA 1BFKA 4BS9A 1CNEA 2RI0A 1D2MA 1O9BA 2WTXA 4E15A 5BWOA 2FCAA 1IHOA 4MYDA 2BMJA 5AIBA 3R5HA 3LCVB 1S3FA 4YCMA 3PGXA 2BFWA 4IGIA 3A1CA 3QLUC 4HAXA 1LEHA 1WD7A 2ZUWA 3GG2A 3QHAA 1KAOA 1GZ7A 1M1ZA 5SY6A 3V1TC 1GGHA 5ESWA 2RCYA 2GCNA 1KE2A 5AW3A 4UDNA 3T1NA 1VDMA 4H60A 2EEZA 2L18A 5CLGA 2B69A 2NQ8A 5GV7A 4X54A 4D9FA 1V1MB 3W5BA 2EZ4A 4I0WB 2CBXA 1M5TA 4NONA 5AK3A 5DGIA 3W3AD 4RTKA 1E96A 1X13A 4LF9B 2GYUA 4BMOB 4LRQA 3W6OA 1MGPA 4OLJA 3A8TA 1ZMRA 1E7QA 4TQ9A 2IEYA 3VSDA 3QE9Y 5BXYA 1YBMA 2BAGA 1EVQA 3MNFA 3QEMA 3EAGA 5ECWA 3NHAA 1KI6B 2JFUA 3DV0A 4O1IA 3OA0A 3WWZA 3KSZO 4P34A 1DDGA 3ETHA 2ZPUA 4CR7A 2W4MA 2W98A 3KWMA 1NNEA 1EAYA 3IAS6 5FPTA 1YR3A 3CUYA 3I4LA 1PS9A 3W4KA 3V4RA 1VSVA 3ES9A 3TIXB 1R9JA 2HMUA 2YVLA 3PNLA 2Q9CA 3C41J 3GJXC 1LX6A 3IQEA 1X8KA 1J24A 3KM0A 3ZKWA 3J7AC 4DEXA 3D8SA 1EUYA 5K3SA 1N2CB 4XCXA 5CB8A 3CY6A 4IKPA 4CM1A 1K92A 2DSTA 2WEKA 3HKBB 3MWGA 4N3BA 2O2SA 5TY0A 1H69A 3A27A 5I4IA 3FB1A 3B9RA 2QZSA 2SKCA 3C87A 4CLOB 2LNDA 1P1RA 3EXHA 3FD8A 4B6EA 1W88B 7GPBA 4EK9A 1GAWA 1I1NA 2A5LA 3D4NA 4I7EA 3QI7A 1BE8A 1QV9A 1UL1X 3P2YA 1MG5A 3C2QA 4FBMA 3GA0A 1VE9A 5FB3A 4QZVA 1CQPA 2R6R1 1PVVA 2DTEA 2V1UA 1RAHA 2VFAA 1E89A 1J9ZA 2R7MA 3GEIA 5CNKA 3SQDA 4F85A 5JNTA 2Z2KA 3QKRB 3UMCA 4OLFA 1QSGA 4U3JB 1TUBA 1V4NA 4M0PA 4CM5A 4D9MA 4R6XA 1A5BB 3P94A 3ONNA 4WQMA 1YVPA 1WABA 5JE8A 1RXSA 2YYZA 2PGIA 4BP3A 5KTTA 3COWA 3HY3A 4Y9UA 2QM7A 1F4PA 1EM6A 2ZE7A 3W8FA 3RCBA 4BX0A 4AAYA 3IBYA 1NIPA 1MOQA 3HB7A 4IO0A 2I2WA 1XVIA 1NM5A 4JDPA 3UWDA 1DO2A 1XLTA 3UICA 3ROKA 3ZU3A 1SUAA 1N3YA 2QRVA 1Z06A 2ATEA 2V0CA 1U2RA 2QIOA 2W2VA 3FZYA 4UUNA 4ZVMA 4BMNA 4BV8A 2C8JA 3LC0A 4F6LA 4LXXA 5M2QA 1XD8A 3EQ7A 2Z4TA 1G18A 2GLTA 3GQVA 4RV4A 3R5SA 4Y2GA 4DBLE 2OQIA 2BYTA 3GFFA 4PAMA 1HT0A 2DXIA 2QN1A 5SYAA 1PEYA 3M3PA 1EFVA 3CS3A 4R69A 1LPAB 5NULA 3GZJA 5AOAA 1UJNA 3C45A 4PZEA 4RM3A 5ECDA 1DINA 3UMVA 1EKXA 1SVOA 3T7JA 2G3YA 2Q6KA 4ZI3A 1E2KA 3EC1A 2Y2UA 3L7BA 4WLVA 4RYLA 5CYOA 5GJBA 3QXHA 3R6LA 4G23A 3H75A 1ESDA 2Z2YA 1HE8B 5F21A 1LLUA 3ZE8A 1YGPA 2I3BA 3I72A 1KA9H 4HTAA 5DSXA 4AC9A 2ODBA 3IYLW 3NWEA 5C2JB 3CVVA 1GADO 1WDTA 3ACCA 1UAAA 1SCUA 1CDDA 5TC4A 3VNAA 4YY3B 4G4SO 2AOUA 2N47A 2YWEA 4OHVA 4UM8B 4XI9A 3A2NA 5EVJA 3NEJA 3SYMA 2G8LA 3BOSA 4LW8A 4RKQA 4HWOA 2CUTA 5LXTF 3ONWA 3ZE1B 5DHAA 5K6AC 2V1XA 2YS7A 4OF4A 3EVGA 1S0UA 3KV1A 2EFJA 4WLEA 2DQZA 4P0QB 2QN9A 4MVJF 4N8SA 5DYYA 5EMNA 5SYNA 2DHCA 2DR3A 2VF7A 4KPYA 4JASB 3LC1O 3LPDA 1DBIA 4RCZA 4D3ZA 1VCOA 4C7XA 4DANA 2YCBA 1L5QA 5BNIA 4PS1A 2IF2A 2OBXA 2ZPTX 4XM0A 1XI2A 4F1WA 2J0UB 2EWVA 1P91A 5IWAB 1OI4A 4YGYA 3CUTA 4EM6A 2E37A 2EW2A 4LN1A 4OYLA 3V8MA 4CM3A 2FWJA 3ODPA 4N0EA 2DG2A 1EX7A 1DUIA 3CLSC 3X3HA 1CRPA 1A8UA 2JD2A 5IPFA 1TMYA 3ESZA 1J97A 1PR0A 3WOVA 2PGXA 1W36B 2W8BA 1FDOA 1Z4MA 2X2EA 1FMFA 4E5SA 3OSUA 1UFVA 2R4QA 4M8NE 2W0MA 1F5SA 5IJAA 4E21A 2F1RA 3IAS1 5HZGA 5JZOA 2O8BA 3M6IA 4U7TB 5C34B 4TTIA 3A9SA 1DIGA 3PPWA 1XHFA 2AXPA 2P11A 2R6JA 4HH4A 4KQHA 4LX8A 5FO0A 5JCJA 3NBYC 2CVHA 3A11A 4B1FA 5KKCA 4NOLA 2FVXA 3G88A 4HNAB 4Q1FA 5JVDA 4PX2A 3C14C 1NXOA 2I33A 3KFLA 1XMVA 3VUEA 4IJ5A 1BU8A 3FCXA 4PSAA 3JQGB 4JJIA 4YCBA 4RA9A 1MA3A 4LMPA 3ZWQA 3LPNA 1YS7A 3RK4A 3ZK8A 4CHTA 1F7VA 2IVFA 1KJWA 2OUKA 4J0HA 1VMIA 4DDVA 4JLVA 1U0LA 4AG5A 1T5DX 4IV8A 5ERYA 4FBLA 4QULA 3G89A 3E1KA 3ZCSA 4MGIR 4DRXA 2XI4A 2V7XA 2NAPA 4WA7A 3J81A 4WZAE 1BSVA 1Q1QA 5FUMA 5IWCA 1S2GA 3ZHQA 3MWFA 4DVJA 2YWJA 4YI5A 3I5MA 3OLZA 3HPRA 3I2YX 3ITKA 3LHSA 3P9KA 2HNKA 4GPAA 4QFBA 4QXOA 3DMGA 1E5TA 2V59A 3A32A 3L1UA 2HCJB 3MTJA 5L51A 1PGQA 1SZCA 2ADMA 1QHGA 1VLJA 3MUFA 3WWYA 4CFYA 5L4LA 4TN5A 4CKBB 3U81A 2G0TA 1NNSA 3QYAA 4R9NA 4DC9A 1TO2E 2PK3A 2C8LA 4N03A 2YOGA 3U9SA 5IKEA 4PTLA 1XTIA 1JJVA 1JIIA 1NXVA 1US8A 3Q8KA 1HI9A 1OXVA 3A70A 3ND5A 1R4MB 3CNLA 1B8VA 3EVZA 5DPMA 3ZH2A 4PZPA 4UZSA 1X6VA 4Z0TA 4DJDC 1IAVA 3MCUA 2IYAA 2FZWA 3BC1A 2C61A 3OX1A 1J5XA 1O96B 1TECE 4XTRA 1RR6A 3RO7A 2HK7A 1EK1A 1KS9A 1I3LA 3OE4A 1JV2B 3NW9A 4U7GA 4C14A 2J3KA 5COAA 4TLLB 1Q0UA 2X3FA 3QE0A 3ROXA 5IVHA 1B7GO 3CLSD 4B46A 2X1MA 3FSGD 4QUHA 4C0QC 1KEKA 1R4AA 2KB0A 3RABA 1VG9B 3WKAA 3D02A 2IJGX 1F2UA 2YV5A 3VXKA 2ARKA 4D8XA 1USKA 1WSDA 2JBHA 3W5IA 4JYZA 3PPVA 4Y18A 1FX0A 1SVLA 1RFGE 2GSDA 4PSVA 3CSSA 4TWBA 3VJKA 4DEYA 5CG1A 1KVQA 4Y2SA 4DSUA 4V0QA 1NU6A 2PL1A 3TRFA 2X9QA 2XOKD 1LLQA 3G23A 3W5JA 3IQIX 3R0XA 4F6RB 5LUAA 2FOXA 3Q0TA 4EFKA 1P9WA 3CF0A 4EHLA 3QFSA 4D4GA 2A14A 2X19A 2P4EA 4JLKA 4MKZA 3OT1A 2NTNA 3VR1A 4W8GA 4B3HA 1I9GA 5JRZA 4BNWA 1PJSA 3ESYA 2ID4A 2IYYA 4B82A 1I7NA 4W7HA 3QI2A 4XUGB 2ET6A 1YQEA 5EKSA 3B6IA 4REQA 1RQPA 5CVVA 1JB1A 3IUYA 3H42B 5IRCD 4YRLA 1KQOA 4M1TA 3I8SA 4MAMA 1J06A 1TJ5A 5DN6D 5KPDA 1T2VA 4P7JA 2JZCA 4PZZA 4HN4B 5G1PA 4QQ8A 3UZUA 2OGTA 1NNI1 4FKZA 4I36A 5G3YA 4PCAA 2JI8A 1ZK2A 4ZU6X 4ETIA 3QQPA 1L5MA 2DFPA 4DA7A 4Q19A 3GIDA 1WKCA 3BK1A 1VKZA 3BXOA 3EEYA 3LXXA 4FHGA 2J3JA 1B6RA 4OBBA 1LBIA 2B21A 4UTXA 1OE0A 2B3DA 1G5IA 2Y1GA 3TSYA 1TUGA 1JX6A 4MRMA 3PITA 4D0GA 1UXJA 2OXCA 4JI0B 1J09A 3HXKA 4GGMX 2QTVA 1XCLA 2VVTA 2YRFA 1KEEB 2HLPA 3NEPX 3HKDA 4HKTA 4DMRA 1WZUA 1Z2OX 2J0VA 1LJLA 4QDZA 1FBNA 1GPBA 1FRFS 1N5IA 5BRJA 621PA 1DSSG 1I6LA 1U1IA 2ZE8A 4C7MA 4YMWA 4GX1A 3K72B 1P0FA 2QSZA 5A1JA 2R751 2CHVA 1QG0A 2YZMA 3RWOA 2QORA 2QTBA 4MKXA 1IDN1 1UBUS 5AW9A 1TIBA 3EH2A 2VG8A 5T4HA 4EMSA 1JKMA 3ZVLA 3F4BA 4CM4A 3RT7A 2VJKA 5HZKA 2C3OA 4REMA 1T0HB 2HTFA 2RAVA 1E0SA 4U00A 3UBMA 4OQNA 5DYGA 1FLAA 4L74A 2WM9B 7REQA 1I24A 3DAYA 4L3WA 4OGFA 3VGPA 2WYIA 2GCOB 4WERA 3MGAA 1GAQA 1DIHA 3FPEA 4ZK2A 5JI2E 1VL0A 1FVFA 4ENSA 3N2GA 4OGLA 1SOVA 5BMOA 4URXR 1V6AA 4TUYF 2D1QA 2WLTA 3D3WB 3HR8A 4HNGA 4Q1AA 1P4SA 1MXFA 5FAXA 1X15A 3NHFA 1BO6A 1NVUQ 2JLVA 1GTMA 1EBFA 1A4RA 1NE7A 1SBCA 1VL2A 4M89A 4CIYA 3HTXA 1O5OA 3NIFB 4HV4A 4O1MA 1ZCBA 1NXSA 2GN8A 1X1AA 4MYHA 4Y0AA 1GTJ1 2BRUC 4ARZB 1ZGBA 1Y6FA 1L7VC 1FP7A 1NRWA 5D1HA 1U3GA 3RYHA 1Z17A 3B5JA 5CGQB 2HUPA 3DLTA 4QDXA 2CXNA 4WL0A 3BL5A 2DQ4A 3TB6A 2RHTA 5F7ZA 4C29A 5B12A 4UQOA 3OWXA 3EIUA 4JNCA 3NDIA 5E6RB 2P4QA 1VOTA 4GE0A 5E9WA 4M8KA 4NIMA 2RFLA 4DCTA 3WBKA 1EGHA 1HTBA 4HDNA 3EBPA 3U3JA 1GG2A 1WSAA 1TZKA 1TFUA 3H4MA 4HPJB 1XA0A 1V3TA 1IE3A 1LK7A 3ETJA 1FP4B 1GU1A 3AHDA 1QTNA 1ZIDA 4MVJI 5J2TF 5KQGA 3SYLA 4ZIRA 1KJIA 3BQNB 4DADA 3IPRA 5EJ7A 3MQ2A 5AVVA 1QTQA 3N8IA 1R2QA 2PH5A 4N5MA 2FQ1A 2FEOA 1K6IA 4LDZA 4LISA 1V8DA 4D44A 2HA5A 3FUWA 5BV8A 4JOCA 5JSKA 1F6BA 1RCUA 3D6TB 4B4WA 1L4GA 4EITA 3JVDA 4LWOA 3RM3A 1XMXA 1LLFA 5AHRA 1YCDA 2Q9AA 1I4LD 1KDTA 3AHIA 4NENB 1CJVC 4F3YA 4W82A 4KYIB 5B6IA 4BXOB 3E2IA 4RJIA 1RYFA 4BNVA 4OL9A 1BGVA 2RGEA 4ND8A 4S1TA 3WGGA 1QFZA 1S2NA 2AMVA 3ND7A 1T0PA 3PB3A 4JU8A 4NI5A 2QI9C 4Q66C 2JKVA 3OCXA 2HT1A 4BMCA 4PLGA 2DM6A 1JHUA 2Y1OA 5CXUA 1BXRA 2J8ZA 1EB9A 4N18A 3C7KA 1L5HB 4WY8A 1EK5A 5IJWA 2CBZA 3BAZA 2R00A 1RI1A 1N9GB 3L8CA 5CTJA 1XPRA 4ONEA 2FPKA 5U4XA 3K2EA 1EAMA 1H6AA 2CJFA 3H0CA 4OMFG 5HQJA 5I8PA 3KP1A 2O0KA 1ZJ4A 2OV6A 3HU3A 3QBDA 2W2NA 3QSGA 2EERA 2EDAA 2OXFA 1LCIA 2OG2A 1PAUA 1RPNA 1COZA 2DKFA 2MSNA 2RC6A 3C6MA 2DCUA 3ISJA 3L1HA 4TUYB