1U8ZA

Crystal structures of ral-gppnhp and ral-gdp reveal two novel binding sites that are also present in ras and rap
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
168
structure length
165
Chain Sequence
SLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGYAAIRDNYFRSGEGFLCVFSITEMESFAATADFREQILRVKEDENVPFLLVGNKSDLEDKRQVSVEEAKNRADQWNVNYVETSAKTRANVDKVFFDLMREIRAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Ral-GppNHp and Ral-GDP Reveal Two Binding Sites that Are Also Present in Ras and Rap
pubmed doi rcsb
source organism Saguinus oedipus
molecule tags Signaling protein
molecule keywords Ras-related protein Ral-A
total genus 61
structure length 165
sequence length 168
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1u8zA00
2RGXA 2G83A 3THWA 1OB5A 4B3XA 4Q4AA 1T0JB 5HE9A 3K0AB 2AD1A 1Q1ZA 2WHXA 4YMSA 2QPOA 3BFVA 1JNYA 1PV4A 1ESNA 1W0JD 1NNEA 5B57C 5GVRA 2J5XA 1AA9A 2CMKA 2QL6A 4WXRA 5FPYA 2ZTSA 1OSNA 4IEIA 4HAXA 4GBMA 2ZRDA 3K09C 2EU8A 1P3JA 3X1XA 5C1BA 1FNNA 1PJRA 2GKSA 2UZIR 4KSCA 2PEYA 2WMOB 4IVRA 4KSBA 4ZCIA 3FFBA 4A6PA 4GRAA 3TW8B 3QG1A 1Q1QA 1W1WA 2QM8A 2ZRFA 2QGZA 1K8RA 1XEXB 1IM2A 1W4AA 721PA 5M04A 4O2LA 1TF7A 4FXPA 2A5FA 2IYWA 2J87A 4JLOA 3WRYC 2WWHA 3TJZA 1Z6XA 3OEHA 2O8FA 3SJCA 1ZAKA 5UKDA 1JEDA 3T1OA 3W5JA 1HV8A 3U60B 3TSZA 4JLJA 2IYXA 3DKPA 1YZLA 1TF2A 2QSZA 3QI2A 3QXCA 4L8GA 1JXMA 1NVWQ 2AKYA 4WAUA 3THYB 2BJWA 1DVRA 1XB2A 2BEJA 3T1VA 1NBME 2PX3A 3CRVA 4V0KA 3CUEF 2QZ4A 2G9NA 3RWMB 3Q5EA 1D2MA 2PMDA 4D80A 4GOJA 3ADKA 1E0KA 2B21A 421PA 3RDPA 3X1WA 1ZM7A 1XCMA 1HY3A 2E87A 5AJXA 2IBMA 4JSTA 1DEKA 5EQTA 2ZSBA 4DLVA 5K8TA 2ZR7A 4AKHA 2QP3A 2ORIA 1RW4A 1AS0A 2G88A 4HDQB 3OE7D 4A9AA 5KNBA 2G6BA 1DAHA 2AWOA 4OBEA 3ZDQA 3ND8A 5B58C 1MO5A 3CBQA 1NKSA 1IN4A 3LQRA 5FL7A 3KUCA 4NCHA 1JQJC 1ZC3A 2RCNA 1AZTA 1GKUB 1E32A 3PEVA 1R4AA 1BMFD 5AUPB 3IQXA 3B1XA 4F4IA 2J0QA 1I2DA 3W90A 1F48A 5KYKA 2JLWA 5G41A 2FE4A 4D4MA 1KOFA 3EZ7A 2RGGA 1II8A 4G5SA 4QC2A 1E0SA 3FHCB 3H86A 2VP0A 2LCFA 1UBFA 2BWJA 4W9MC 3TAHA 5LD2B 4M9QA 4X8HA 2HXYA 4EJSC 3PR1A 1Y3AA 4LUCA 2PJRA 1A2BA 2OO7A 2Q0HA 4TMTA 2DHRA 3LLMA 5HTKA 3IPXA 1AJEA 521PA 1A7JA 2ZI5A 3P26A 2O0JA 2QNRA 2CCJA 3QBVA 3CWQA 2GF0A 2CVHA 2ZRIA 3DL0A 2WWWA 3TQCA 3WBJA 1KHTA 2V1XA 4NH0A 4MA4A 4L15A 4YLGA 3NC0C 3RS0A 1FPMA 1F2TB 1XCPA 2GK6A 4GZMA 3LQQA 3OEEA 4CIDA 1NSTA 3CRMA 2XZOA 2O8BA 4ZIRA 2YYZA 5HCIA 3CF0A 1XTSA 1BKDR 3EXAA 5FUVA 1CRPA 2YC2C 1G5RA 4JLAA 1YQTA 2ZSDA 1XEWY 3QF4B 1KJYA 2NO6A 2NO0A 2UZ3A 4LYAA 3UWOA 5CYOA 3QF4A 2YOHA 2N1BA 3L0PA 1G6HA 1XX6A 2AWNA 3B7GA 2ZITA 3QKUA 3K9HA 1HT2E 1V5WA 4Z8YA 4PO8A 3MRSA 4ZPXA 4X8OA 4LJ7A 1Z83A 1W36B 1E2KA 5JWRA 2BOVA 1S0UA 4Q18A 1XNJA 3TQFA 5HR5A 3GEHA 4FWTA 2P6NA 3NBXX 3KKPA 3UANA 1CRQA 1ZRHA 5DH9A 1DS6A 5AUOB 2FU5C 1KMHB 1WXQA 5BW8A 5DHAA 3OIVA 2VTKA 3P1JA 2ZUDA 4TQ9A 5DISB 1RRFA 2FFQA 2BIFA 1Z0FA 2MSDB 4R9UC 4XWOA 3WMFA 4Q4HA 1GNPA 1GL7A 1VCMA 4US1R 2ZE5A 3X1DA 3I73A 4LJ6A 2FEMA 2ZI4A 4I1SA 3BS4A 4QGFA 3I5XA 3KQNA 4JVLA 4PZYA 2C78A 3UIEA 4US2R 2PZEA 3I8SA 2ZI9A 3G82C 5EXSA 4BRWA 2OLKA 3RC3A 4OQMA 4G01B 1K5DA 2MSCB 2IHYA 2VBCA 4PC1A 1F5NA 4LBVA 4JT2A 4DLZA 1XEXA 1P60A 2NPIA 4RKFA 3AVQA 5CDFA 5L3QA 3HR7A 1W36C 2IXEA 4UJ3A 1G19A 1ESMA 4HAZA 2WJJA 4BZXA 4D4KA 1W2HA 2ORWA 3UG7A 2ZVPX 3MWLA 4JT4A 3A37A 3K0FB 2VRWA 3ZYCA 1TQ2A 5JHHB 5GJBA 4LJ9A 4PC7A 5JRZA 3BH7A 2WWYA 2ZYUX 1ANKA 4AURA 1XP8A 3B1ZA 3NDBB 3OIYA 1DAKA 2ANBA 2DWQA 5EE1A 3CX7A 3A1WA 4AG6A 2W2TA 3GFPA 3BAFA 3SN6A 3NDPA 2Q9BA 4DT1A 1JR6A 4FI3C 1SKYB 3RVBA 4JYCA 4BECA 1TX4B 1KNQA 3WRXC 3AQ4A 4GL2A 4TYPA 3WXMA 1M8PA 1XPUA 1HTWA 2CHGA 4NCJA 4HLUA 4P4UA 1N6IA 2RGNC 2VH5R 4QGHA 1LF0A 3LO5A 1NLZA 2OBMA 4A82A 2IYTA 2GCPA 4TSFA 5JJLA 2F1JA 2O8EB 4WZ6A 2GBLC 4JLNA 3AM1A 1IQPA 4LV5B 4A36A 1ZP6A 221PA 2EVWX 2FF7A 3A4MA 5CITA 1W49A 1SVKA 3TSWA 1OYYA 2AR7A 4RJLA 3EPKA 1CKEA 4G5GA 1QG2A 4WIAA 2JJ1A 4HB4A 3LVQE 2WJVA 3LV8A 3Q72A 2GJ9A 3RAPR 2GRJA 4KYIB 2C99A 4HLUC 3B1YA 2W0SA 1NKTA 2VF7A 1RFLA 1UM8A 4PPQA 4Q4HB 5E95A 3RSOA 2WBLC 5L3VA 3PITA 4MDEA 3U3MA 4MUBA 5SZKB 4FW9A 4JL6A 1T5LA 2R2AA 1E79A 1LS6A 1XEFA 2AN9A 3DM9B 5G3ZA 4O3MA 1OFUX 3IBGA 4JVSB 4A15A 4LC1A 1O3YA 4TL7A 3WNCA 4IFBA 1HQYE 3AF3A 2CE7A 3EZ9A 3LWNA 2EW1A 4URYR 4Q4JA 5DYGA 4XOIA 1AGPA 4DCUA 4XWAA 5DNYB 2CE2X 3CM0A 2RHMA 1GSIA 3IO5A 4XTRA 2PJZA 4MUAA 1WRBA 1CJKC 1AKYA 1CU1A 2YWFA 2ZI3A 4Q21A 4AG5A 5C4MA 2Z4SA 1P2TA 1E94E 1UAAA 1YR9A 2CLCX 4PQRA 5JI3E 1OHHD 1G291 2ZVQX 4QHYA 2IXFA 1VG8A 1IY1A 4URXR 2JLRA 4NL4H 2J0VA 3MWYW 2O8DB 1E9AA 4L16A 2EFCB 1VCNA 2V55B 1OKKA 2O8BB 2ZRMA 4XTCS 4FCVA 2XNDA 4LPSA 4PX9A 4BFXA 1B0UA 4ACBA 2ODEA 2ZSAA 2IL1A 3CX6A 3D3QA 3FKQA 5JZVA 5A0FA 1Z47A 2Q21A 4HLQB 2D2FA 2C95A 1F60A 2BMEA 4K46A 3B1VA 3EAQA 4JKYA 2RGCA 1ZD1A 3MWJA 1KKMA 1G8PA 5EUQB 5DN6D 1FZQA 1TQ4A 3QKSB 5HKKD 1ODFA 2B6HA 2DBYA 2QU8A 5CLQA 3FDIA 2NO9A 4JYBA 1E0AA 4B76A 2R6FA 2ZEJA 3HU1A 5KPDA 1CJUC 2HLDD 3NTUA 4R7ZA 1FX0B 1FQJA 3OEHD 5BQ5A 4C7OA 2QMHA 1MABA 4DDVA 2FZLA 1OW3B 4I81A 4HAVA 5KPJA 1BS1A 1D5CA 4P0TA 4RZXA 5EXTA 1L4UA 4Q01A 1QG4A 5H70A 5HPYB 1AK2A 4E03A 1SZPA 1KI7A 1ZCBA 5BWMA 3QKTA 2VO1A 2H1LA 1AKEA 3TUZC 2QT1A 4TZ0A 3PUYA 3TMKA 5F9HA 3K9NA 2GXQA 5CM9C 4N0EA 2PL3A 2QE7A 3A8TA 1QRAA 2XNDD 3AF0A 1FQKA 4M4SA 5F3WB 3PV0A 3W8NA 1VHLA 3A36A 3UKDA 4LK2A 1TU3A 4ZKEA 2FH5B 5AJVB 1KI9A 3DMNA 4DXAA 2BMFA 4AYXA 3L0SA 2GZAA 5A5GA 3FTQA 4ILEA 3VTKA 3R9IA 4TZ6A 1FW6A 1VIAA 3GLHB 3SU8A 3EZFA 4DCSA 2Y8EA 2ZPTX 3GJ8A 5E4FA 4BFSA 4EQ6A 1QHSA 2C8VA 3ASZA 1W2GA 2R6CA 2FGJA 4ZKDA 3TR5A 1ZNZA 3SZRA 1MH1A 1F2UA 3EZ6A 1QVAA 3IIKA 3GJ7A 3L43A 5EP1A 1T0HB 1M7HA 4F93B 1IN5A 3M6AA 2V8OA 4MKIA 1E2PA 5AUQA 3T5DA 1M7GA 2B7BA 2GXAA 4LGMA 4OQNA 3IGFA 5F9FA 2KSQA 4Q4JB 4EPXA 2CK3A 1MO3A 5H1YA 3SJBA 5BXQC 1KZ7B 3RSLA 5BN4A 3UG6A 5FPHA 1LNZA 1R5OA 3GJ6A 3TGPA 4P32A 3FGNA 4RCZA 3KQUA 4Q02A 5GVSA 2OZEA 3OAAA 4EFNA 5JS7A 2IEYA 4L9SA 4GI7A 4PANA 3WYGA 2CLSA 2EFGA 3KXIA 4I1OA 2ZRCA 4GSYA 4PR0A 4PO9A 2NPFA 3RS4A 3NEYA 2IS6A 3ZVLA 1K6MA 4CEIA 2X2FA 1H8HD 3Q8XB 4A8JB 2FG5A 4RZ3A 1II0A 4LJ8A 5FH9A 2H16A 2PMKA 1US8B 5G3YA 3U4QB 1Z8FA 3LVRE 4CF7A 3B9QA 3UATA 2XNSA 3P27A 1HYQA 4IDPA 4HZUB 4MYCA 4V02A 4UXHA 4HDOB 4Q9HA 4AWXA 1P9RA 2QY9A 3MUFA 4NYIQ 2P5TB 3LBNA 3TE6A 2JAQA 5IDVA 2WVJA 5FTJA 5KHOC 1TU4A 2QMUA 3F3YA 1HQCA 1XXHB 2ZE7A 1G5PA 4A6XA 2XB2A 2W58A 3WP0A 1YR6A 3BIFA 2PEZA 3KQLA 1JR3A 3KZ1E 4UNSA 4XSGA 3VKHA 4JVMA 3QE0A 1OT3A 2ZROA 4I1UA 2A5YB 2EFEB 1W4BA 2A9KA 3X1YA 1GZSA 1U90A 1KI6A 4Z54A 5H68A 3KJEA 4LV6A 3EPHA 3KB2A 3MSXA 2F7SA 5A4JA 1WE2A 4Q9LA 2A3RA 1GNQA 3EWAA 2IA5A 3AGPA 1HURA 3JZAA 2OE2A 1OV4A 4URZR 3K0SA 1IN8A 2C77A 3QENA 1FFHA 1NRJB 3IKJA 4JLMA 4JKIA 4OHZA 4BQSA 1MR3F 1J70A 1FOEB 4KAXA 3W9YA 1M7BA 2QMOA 3FB4A 1U0LA 5FBRB 2PH1A 1SULA 1GOTA 5C46F 3DMDA 4S35A 3RRYA 4IDQA 1Z29A 3FMIA 2IUTA 2HDNB 5B2ZA 2ZSFA 1J8MF 5TXGA 2KBFA 1CJMA 1E99A 1N5LA 4DRZA 1ZM2A 5EXPA 3C15C 4MYUA 4E07A 1T8TA 3VNUA 2B7CA 4U02A 3LX8A 4HUQA 1BIFA 3MMPA 2GEDA 3SYNA 3CF6R 4FMCF 5FI1B 2IYSA 4BLPA 1P2SA 3LW7A 2HEIA 2VA8A 2A5DA 3GEIA 3TIFA 2JLXA 3EWSA 3SR0A 4PAOA 3GLIB 3AB3A 3PXGA 1IJFA 2R6GA 2P2LA 2XGJA 4MDFA 3EPJA 1W0KA 2A7QA 4NPHA 2BBOA 2F9LA 4D4LA 1PVOA 2AFIE 1U9IA 2GJSA 2VP9A 4MRSA 4B75A 4MYTA 1P4SA 3GFOA 4TTPA 1D6JA 3PG5A 2VIIA 3BWDD 1GDDA 5AR1A 4Q9KA 1KGDA 3E5HA 3GQBA 2GJ8A 3K09A 3UWKA 4B6FA 4BZQA 3ZQ6A 2WWGA 3OESA 1H8ED 4A8JC 5IHPA 5HCNA 3ND9A 2IYZA 4LC0A 2ZRKA 4RFSA 1RYFA 1GUAA 1NMXA 1OIWA 1Q20A 2WPDD 2XAUA 4KV9A 4TYNA 3TR0A 2GCOA 1YZNA 3ZD7A 5DHFA 2Z5FA 5LBIA 1S8FA 1COWA 1G8GA 3HWSA 2XEXA 4M9ZA 1YZQA 1D9ZA 2OCPA 5GJWC 5J47A 3REGA 2ODNA 4QG7A 2F55A 1R6BX 2CCGA 3A1TA 5P21A 4Q4LA 3Q7PA 2ZRPA 1NSFA 3EIHA 1KKLA 2V1UA 3A58B 3RYTC 2W2VA 4OQXA 1SVMA 2JLYA 1W0KD 2ZYTX 2CXXA 5DO9A 1KSJA 5JMTA 4AKIA 3VR3A 3B6EA 4PC2A 4V03A 2ZRNA 3AUYA 3ECCA 3X2SA 1N5JA 5CJ2A 3PQCA 3FKSD 4GZLA 3T61A 3CH4B 3LDAA 4PXAA 4ESVA 2AD5A 2K5UA 1UBCA 4HLDA 4MH0R 2SHKA 3R8CA 4LJYA 2CL7X 1E9SA 1MT0A 2ZYVX 3DKVA 4RD1A 3SYLA 4KLNA 3KKMA 2IWRA 4D81A 4AK9A 3DOFA 3GLGA 1G17A 5JWHA 3U61B 1XZPA 3I3SR 4POAA 4MKFA 1VG9B 3AF2A 1BMFA 4YMWA 4HAYA 4W5HA 1L7VC 2ERXA 3QXSA 2RMKA 3D6TB 2CHQA 3SQXA 3BFKA 1EFRD 1Z3IX 3HPRA 5TDHA 1R0WA 5IK2D 1DAMA 1ZC4A 1TMKA 2ZANA 1UEIA 1R10A 4G0NA 5JFGA 2I3BA 1YU9A 1KO5A 3HU2A 3EPLA 3BD9A 1YKSA 1FL9A 3SNHA 2BDTA 4Q9JA 5BYKA 1JEEA 4A0GA 1KK2A 2NIPA 2XXAA 2QN6A 1OYWA 4LHVA 1AZSC 2BKUA 1SKYE 2ZJBA 1E2LA 3TKLA 1NY5A 2Z83A 3ZD6A 2CVFA 2GCNA 3ZIAA 5FOUA 2R9VA 1EG7A 3BGWA 1C4OA 3KKQA 2C03A 3PCRB 3ZQJA 1NIPA 4BRUA 1YZGA 2WSMA 4QJ4A 5FBVB 4GDFA 5KSZA 1E9RA 1EESA 2QM7A 3NBZC 4PTLA 1NF3A 4Q03A 2C04A 1BOFA 1OKKD 4UQOA 4XVRA 4JLBA 1UEJA 1E69A 1T6NA 2IYVA 4OHWA 2WKRA 1IAQA 3E2IA 4QJ5A 4TLBA 1XXHA 4JBYA 4TMKA 3MJRA 1EXMA 1G9XA 2ZUCA 4GFDA 4OI2A 2QAGA 2ZJAA 3W6PA 1G20E 3H4MA 4JLVA 1IXSB 4KLZA 2FMXA 2J1LA 2H18A 4MKGA 4FMDF 1ZD8A 3AP1A 2R62A 4HYYA 121PA 3WP1B 1RRCA 3KFVA 3TVDA 2X19A 5D3MB 3MLEA 4IDOA 4BLRA 3T35A 1CJTC 3R7WB 5E3HA 2OCBA 4NP6A 4HLCA 4QHTA 4M1YA 1VKJA 4ZDKA 4C0LA 1J8YF 2YOGA 3B2EA 4NCIA 1W44A 2X1VA 4FMDB 4B2LA 4QBFA 4M21A 2ATVA 2CJWA 5AJZA 4DLWA 3ADCA 2N42A 3ZZTA 2OCYC 3Q7QA 1S3GA 2JATA 1KI4A 3ASYA 5KO2A 5J4VA 5FOVA 1IXZA 2ANCA 5AWFC 2WJHA 1JPJA 2DR3A 4KFUA 2N46A 2C96A 5CK4A 2AK2A 4M1TA 2FPMA 2GWHA 1MRNA 4RKEA 3HYTA 2XSZA 1OHHA 4LCBA 3DOEA 2ZYWX 4ARZA 2OFXA 1RC8A 4RSGA 5CIWA 3ZS9A 1W0JA 1N0UA 4EPRA 1NMYA 4UNRA 4JBXA 1LW7A 1U8YA 3CPEA 4JLDA 4KYUA 4ZV4A 4FD2A 3O47A 1QHYA 1MRSA 3HJNA 3OZXA 4X8MA 5EE5B 4LPKA 4ABYA 5LD2C 2XXAB 2CHVA 4G3XA 4Q7JB 1Z6GA 2D3WA 1GWNA 2FFHA 5CJPA 1NBMD 2OUKA 4BFYA 3RWOA 5JBQA 2ZJ8A 2WMNB 3B82A 1U94A 2ONKA 1Z0IA 4IDHA 4LHYA 2ZU0C 3LRPA 2Z43A 5GJCA 4IHQA 5B64A 3QIAA 3THXB 4PSAA 2Q6TA 2XZPA 2ORVA 1GRRA 1X8JA 2GTPA 2QPAA 2R6DA 4TYQA 2QA5A 2J7PD 2XTNA 2UVQA 3IO3A 4Q7LA 2XOKD 2YZ2A 1Z6AA 2OBLA 4E09A 5JSZB 1TAGA 2V6IA 3D7MA 1MOZA 1Z2CA 3BC1A 5EZ5A 3K0CA 2XSZD 1RPZA 4GOKA 5J4HA 1ZBDA 4LWZA 2H7VA 3FMPB 1E2EA 1SVWA 2G1KA 4PQFA 2HF9A 3UMRA 2ZJOA 4MQBA 4UNPA 1WDTA 2BEKA 2FSHA 1CBUA 2ECKA 2GZHA 3DPUA 2O8DA 4NU0A 2PLRA 4LHWA 3EC1A 1P5ZB 4KBGA 4LX0A 1JJVA 3ZH9B 4TYWA 2F43A 1W7AA 1TTTA 1H8HA 1E4YA 1UBGA 1XPRA 2J7KA 3ZZUA 3N2EA 5TB5A 4C3ZA 3IBYA 3AVVA 2REBA 1KSGA 3AVYA 1J2JA 4EJSB 3PJRA 3N5CA 4D25A 2QI9C 2QP9X 4IOLA 1NJFA 2BV3A 4JL5A 3UXMA 2VHUA 1N6PA 2VHCA 4RZ2A 2GZDA 4IVPA 2V9PA 2PBRA 1RJ9B 3P20A 3R7WA 4A0RA 3EC2A 1XZQA 1A4RA 4N0DA 1R0YA 1A5TA 2ZJ2A 4H1UA 2JLZA 1WB9A 2CL0X 3W6OA 1TQ6A 2QRZA 4PC6A 2GCOB 3UMSA 2OBNA 3FVQA 1PZNA 1TF5A 2VHJA 4D26A 2BMDA 2KJQA 3LFUA 3PVSA 4A8JA 4EUNA 1N6HA 5TVKA 5JEEA 4JS0A 5LB2A 1KYIA 3M1IA 1EFHA 2VSXA 4OKSA 2F9MA 1E2HA 1KSHA 3Q5DA 2NZJA 4XVQA 2DB3A 3DEFA 1XDBA 3O8BA 2FSFA 2ZI6A 3SEAA 3B60A 1KK0A 2VP4A 2PCJA 1JI0A 3IIMA 5J4KA 4NE2A 2AX4A 1TEXA 4KXFB 4RVCA 1FUUA 3NBYC 3HDTA 1CR4A 3OEED 3KTAA 2XJ9A 4ESHA 3QXXA 2GF9A 2C9YA 3B85A 5C2JB 4IOJA 4B33A 1HH4A 2DYKA 2V7QD 3KQKA 3V9PA 4HB2A 1DELA 4JJZA 2A78A 1DBSA 2QUZA 4KBFA 1T5IA 1M1YE 3KUDA 2D62A 4OK3A 3VKWA 1ZCAA 4LV8B 3PEYA 4MGKR 4Q48A 1GG2A 2OV2A 3C14C 4QGAA 1OXVA 2GETA 4W5JA 1KI2A 4YXWD 5AJYA 2R44A 3KB1A 2A5GA 1DAEA 1QHNA 1KI1A 4LHZA 1UDXA 4PZZA 4DUGD 2QTHA 3RRMA 3ICQB 5TY0A 1EWQA 5F98A 4DVGA 1HE8B 4JVNA 5FTNA 5K8LA 4WZAE 4HAUA 2P0EA 1VECA 3BE4A 2PCLA 4PFSA 1KK3A 1OXXK 2Z0MA 4YDSA 2WWFA 1M6NA 4HZIA 2ZJYA 5GJVC 4PHHA 5K8IA 1Z08A 4IW3B 4F4CA 2YHSA 4B2IA 2WV9A 2DFNA 3TNFA 3LXXA 4LSGA 4ZDWA 2QRNA 2JA1A 3K1JA 4DDTA 1X8LA 1GTVA 4DLTA 3IILA 2CBZA 1UADA 2J0SA 4KU4A 1JECA 3V4RA 4AKEA 4HEJA 4A0HA 3SFZA 1FNMA 1GL6A 1JAIA 821PA 1DTSA 4NDZA 3WMGA 2WKPA 4DUGA 2VLIA 2ZREA 1SVIA 2GESA 3NHBA 1J90A 1XJQA 1KAGA 4YXWA 4IXNA 3RS5A 4QM7A 1U8ZA 2C9CA 5L8VA 2ZS7A 4BFWA 3GLIE 2MSEB 2O52A 5FBWB 4P31A 2BVNA 2EWWA 1CR2A 1IY0A 3RRZA 4C4PA 1NN0A 3ZJYA 1BO6A 3BB3A 1W5TA 1YHNA 4NHOA 2QP4A 3QVUA 4UNNA 1DO2A 1UKZA 2O0HA 4YMUA 1US8A 3U4QA 2JEOA 4UKDA 4GPTA 3W3AA 2W6JD 1LTQA 3RHFA 3QPWA 3SYKA 1GRNA 4V0NA 2V4ZA 2RGAA 4OYHA 4TL6A 1VTKA 4Q5IA 3A1UA 1T3LA 2VHQA 3VR2A 4CGZA 3DZDA 5AUNB 3M4YA 4JBWA 1U98A 2OAQ1 3ETLA 1F2UB 3PUXA 1ZIOA 3L2OB 4DDUA 1VPLA 2O5VA 3MFYA 4MYHA 1Z07A 1E2JA 2J0UB 1NVXQ 4BFVA 2W00A 4PHTA 4MKHA 2QAGB 3C7KA 1OE0A 4QL3A 1PUJA 3OE7A 3QEOA 1N25A 1SVLA 3RLFA 2IHBA 3LA6A 5HE8A 4EDHA 5CYPA 3B8HA 4D0NA 1CXZA 3U44A 4BPBA 1DAGA 3N70A 1XCGB 1W4CA 2ODWA 3VHXA 4W5WA 4B34A 2IYRA 3ZLJA 1KI3A 5JLJA 4M1WA 1XJCA 4TL9A 4L5BA 4B3GA 2HF8A 1OIXA 2ZRLA 3R8FA 4N1AA 2Q3HA 1Z6TA 3AVPA 3C5HA 1CIPA 1R8SA 1N0VC 2D74A 2JIZA 1TUIA 4NMMA 2A30A 1YVDA 3S1AB 5D3QA 4QNRA 3DHWC 4PQYA 2ZM5A 2KI5A 1R0ZA 5FOSA 3U6BA 5E7MA 3K70C 1FP6A 2NOAA 3VR4A 4AKGA 2V54A 2MMGA 3FHTA 2C5LA 4EKDA 2H5EA 1X1SA 2FX3A 5EP4A 1GILA 3AP2A 3BB4A 3L0OA 3VFDA 4ACAA 4B3DA 1G41A 1HE1C 1O87A 2YINC 4NBSA 2FN4A 4TMZA 2CCKA 1NG9A 3QKSA 5SZJA 1M74A 1G21E 5DI9A 4B3CA 4F92B 4Q1FA 2VSOA 4ON9A 3Q9LA 2RGEA 2P5SA 4XD7A 1P9WA 1PLKA 2BCGY 1XWIA 2VP5A 1Z28A 1U2RA 5FTKA 4A2WA 5KDOA 2QMEA 2VP6A 1WF3A 3RRNA 4BLOA 1S9HA 1E2NA 4ZO4A 1E6CA 1KI6B 3H1TA 4HAWA 1IXRC 2EQBA 1Q3TA 1MKYA 5BN3A 2AHOA 4OHYA 1BYUA 1ZU4A 1NN5A 3QVVA 1WCV1 4QGGA 2ONJA 1Q3HA 3NIBA 1CEEA 2HLDA 4PHGA 1ZUIA 5CLLA 3IHWA 4DDWA 2BM0A 3LD9A 1W36D 1F6BA 3LW8A 4V0OA 2BMJA 4Z1MA 1OPXA 1Q21A 4M1OA 2IYQA 3TBKA 2QORA 4C0AC 2Q9CA 1Z0KA 1KDOA 1P7CA 4Z8XA 2D06A 3SBEA 4Z51A 4KI0A 1DAFA 3MGCA 1OB2A 4ZCLA 2QENA 4TSFD 1VG0B 3GEEA 3Q85A 4M9SA 1JAHA 1E2MA 2AL7A 4UNQA 3X1ZA 3EA0A 3ZGXA 3W3ZB 4XD7D 1JB1A 4XJXA 4JZKA 1DARA 2IF0A 4EFLA 2GILA 3M0EA 4OJKA 2WPDA 3I92A 3VQTA 2JJ1D 5FL3A 1NLYA 1Z22A 5EUMA 3T12A 3MG9A 1P6XA 1XTKA 3QF7A 4O0MA 4CYMA 5FR2A 4EPWA 1E4VA 2OFOA 3PIRA 1W48A 2VEDA 3TAUA 3CPJB 4PSKA 3IUYA 4IFEA 5C18A 3MJHA 4H9GA 1QBKC 2RGBA 4XSHA 2ZS8A 2YOFA 4CEIB 3QSYA 2BM1A 4P4SA 4QHSA 2WOJA 4LYFA 4PC3A 4JSYA 1QHXA 4NONA 3QBTA 3A1VA 2FSIA 2HYDA 2FPLA 4BLTA 2FFBA 3OFNA 1JPNA 3DO6A 2J9RA 4DWJA 3CRW1 2Z4RA 5LDDC 4QNMA 1U99A 3AV0B 1RYHA 3T34A 8OHMA 3GLIA 1KMQA 1XBTA 2KBEA 5KSYA 3JVUA 4BUJA 3HR8A 4GP7A 1P2VA 2FOLA 2H57A 2LKCA 1G8YA 4KO8A 2QPTA 2CK3D 2YWHA 1KDTA 3CONA 5DE3A 4EAQA 4Q4AB 1AS2A 1SHKA 3NC1C 5JECA 5L3RA 2H92A 1Z0AA 4K8OA 2DFKB 4BGDA 1FUKA 1TL7C 4IJMA 1NG1A 3AGQA 3D8BA 1AN0A 2F6RA 1E2QA 2JDIA 3QY0A 4L9WA 4HZUA 4NYIR 4A2QA 2I1VB 1P2UA 3ZZ0A 4KFRA 2OHFA 4BASA 4F91B 3GCGA 3L0IB 2QBYA 3THXA 3G5UA 2QGNA 2EFHB 4FN5A 4XH9B 3U3OA 1KDPA 3IDQA 3BH6A 1ETUA 3B78A 2FPKA 3LLUA 1T4GA 3SI7A 1G7SA 3QXJA 4TMVA 3AVOA 1GVNB 2EYUA 4TMWA 1E9EA 1Z2AA 4B3BA 2QT0A 4M2LA 4OI1A 4LJ5A 2O0KA 4KITB 3BRWD 1GKYA 3K0FA 2UKDA 3ZS8A 1G8FA 5TV2A 2GXSA 1RKBA 1E79D 2FWRA 2IUUA 3AF1A 3U7FB 4ZI3A 5JJIA 1D9XA 1W5SA 3W34A 1CF4A 1Y63A 1ZW6A 2ZRBA 4DB4A 1MABB 3FPAA 1XMJA 2J3EA 3GJ4A 1YZUA 4BE7B 2BKEA 1NN1A 3CRRA 4MGZR 4QRHA 4D0LB 2W6JA 1RVDA 4Q1AA 4TL8A 3WYFA 4LJ4A 1ZNYA 5JWOA 3S1AA 1G4UR 5HZKA 3CX8A 1OJLA 2I1QA 4X8LA 1JR3D 4QM6A 4RD2A 5EE9A 5CM8B 4DLUA 1IJEA 2F1HA 4P4TA 1DG1G 1UJ2A 1GM5A 3RNLA 2IXGA 1OIVA 4LBYA 3KJIA 1N2CE 1I2MA 1H65A 1RRPA 2JJ8A 1D8TA 2NO1A 3F8TA 4LDJA 4MITA 2P65A 1RJ9A 2IYUA 1G3RA 4Q9IA 5FBQB 4D0GA 4DSNA 4YMVA 3LY5A 2ZI7A 3RS7A 2GBLA 4FMBB 4RFSB 1FMJA 4B73A 1FTNA 3THYA 4NYMQ 3J81k 2NZ8A 3SJZA 2IX3A 3R9WA 1ELOA 4YDHB 3U5ZB 2ZUBA 2PT7A 4Q1DA 4ERNA 4EFMA 5FBLB 3EASA 1LS1A 5CB8A 1OH8A 3RC8A 5J4YA 1A2KC 3K53A 2OT3B 5JJKA 1G16A 5HZHA 5TMPA 2PZGA 1AGRA 3AP3A 3CNOA 3EW9A 3PEWA 3C8UA 4DSUA 1DPFA 3F5FA 2WJGA 1S1CA 1N6NA 3SOPA 1MO6A 2EWVA 1VMAA 4OK5A 4A4DA 2HV8A 2FJUA 1L2TA 1WP9A 1XD2A 1XD8A 2BJVA 3CLVA 4A2PA 5GADl 3CIOA 3B1WA 2FA9A 3AKEA 3JVVA 1XJ0A 1XTRA 3BBPA 3FFAA 1E0JA 1ONBA 4A92A 4ZIRB 1E1RD 1EGAA 3MCAA 2HXSA 1QHHA 2CNWD 4C0QC 2W2XA 2FNAA 2RHDA 5L3SB 5AK0A 4EPYA 3AVUA 5E7IA 4M0LA 1J7KA 1E2IA 2WJIA 3FMOB 5IK2A 1G7TA 3H84A 4LYHA 2JJ2A 4AI6A 4Q7KA 1V43A 4YONB 3SS8A 2YC4C 3PUZA 3K70D 4QBIA 4F38A 5FFMA 1AIPA 3DZ8A 1P9NA 1W46A 2VYFA 4WW0A 4BWYA 1ZD9A 1N3BA 1X8KA 2A2ZA 2P67A 4EIWA 3ADBA 2QAJA 1U8AA 4HB0A 1UF9A 2D4HA 2PT5A 4B3FX 3WNDA 1NY6A 4XWKA 1U0HC 2WM9B 2XOKA 2F1IA 3QKRB 2R8RA 2ZRJA 4TMXA 4MRRA 5DGXA 4DEXA 1Z63A 4YMTA 2VSFA 1QZXA 2GXUA 2RKOA 1CULC 3PFIA 3QNUA 2XITA 1RE0A 2KE5A 3WYAA 2HJGA 1SHZA 5J40A 3WBKA 4C9BA 2OM2A 2X77A 3LNCA 3QG5A 3U7GA 1GAJA 1HUQA 4D4JA 5LB4A 6Q21A 1B23P 4IOMA 1T3HA 1II8B 3UK6A 3R9XA 5FOXA 1UPTA 4TLAA 2NG1A 4P3YA 4DCNA 3CF2A 1FP7A 5FOWA 3AKCA 3B13B 3I32A 1Q12A 3B9PA 1OLOA 3KDSE 1R5BA 2ZR9A 5IT5A 1X86B 1XMVA 2VL7A 2L0XA 2CNWA 2BBTA 2B92A 2V6JA 1TNDA 2P6RA 2JLVA 1GKIA 1FMLA 4CW7A 2OAP1 3P4YA 3VKGA 1NJGA 3U44B 1ZUNB 4DLSA 4DLYA 2RH5A 3QPVA 4LRWA 2ZE6A 1WA5A 1X3SA 1XU4A 2JJ2D 4OK6A 3CPHA 4YQFA 1M34E 1Q44A 3TSOA 1TUEA 2R65A 2O8FB 3QQ5A 1SXJC 2ZXUA 1DE0A 5DN6A 3VU9A 4UXJA 4ZDJA 5AJWA 4GNKA 4Y0VA 4B6EA 2F43B 1N6LA 2VQSA 1DG3A 4IRUB 2IS4A 5L3SA 3RANA 3I5YA 2WKQA 4G5OA 1IBRA 1EFUA 1TADA 1SGWA 4CT4B 1PUIA 4PAQA 4TQUS 5JI2E 3VMFA 1Q1BA 4DT1B 4FINA 5EE3A 4NTZA 3A1SA 5EP3A 4K81B 3SHFA 4HB3A 3GLGE 1WQ1R 4KHZA 2LWIA 1LFDB 2CL6X 1E1QA 1GL9B 1R8QA 3IQWA 2AK3A 1Z0JA 2ZAMA 3IHLA 3AF4A 1WBDA 5EE0A 4DB2A 1RRGA 3EA5A 4LBWA 3NBFA 5FUXA 5KOYA 4DLRA 3MD0A 2BHRA 2GNOA 1XEWX 4PAMA 5D3MA 2JDID 5KSPA 1SQ5A 1EX6A 4HATA 4DHEA 4EPVA 3WNBA 1G3IA 2HCBA 1XPOA 1S2MA 3I8XA 4C30A 1N0WA 4PHFA 1KAOA 3ZVRA 2O8EA 1YZKA 4C0BA 1QVRA 2OESA 3QPUA 1VHTA 1AM4D 2G0NA 5JCPA 1G5TA 2JLQA 3THWB 4OHXA 1G4AE 4JL8A 4CEJB 5FOTA 2LKDA 2ZU6A 4NYJQ 1R2QA 3I72A 1XXHE 4B2PA 4I1VA 4C0HA 1I4TD 1G1MA 5B30A 1N6RA 3BK7A 1G3MA 3K70B 4AY2A 4TYYA 3U7HB 1UDWA 3BORA 4QKQA 4BFTA 3H2YA 5FR1A 3CW2A 5DLQC 3QXHA 1NP6A 4OQFA 1T9HA 4Q1CA 4DLXA 3WMEA 2GA8A 3OIWA 4ZDIA 1YJ5A 1KMHA 5K8UA 3HP1A 1BH2A 3L82B 3MWKA 4M22A 5ELXA 4LZZA 4CEHA 2WSSD 4I4LA 3T15A 1T91A 2OG2A 4DZZA 4EPTA 4DSOA 5LPNA 2QTVB 4FWIB 3KL4A 1G7CA 3W8RA 4WOPA 2VPPA 2QROA 4PPNA 1YZTA 3VU9B 4TLDA 1Q57A 2G77B 3F0TA 3QJYA 4M8NE 2NGRA 3LBIA 2CDNA 4PSVA 4GMDA 1E9FA 3TW4A 1KO4A 4D2IA 1OFHA 4BLQA 4ASUA 3KKOA 4RD4A 2E9SA 1OXTA 2DFTA 2GEUA 1EFCA 1XTIA 3LXRA 4DIDA 3G0HA 5FPTA 1II9A 2OLJA 2REXB 5JSZA 2FDCA 4HSEA 2VHTA 1K5GA 1SXJE 1R0XA 4LYJA 1PLLA 2WAYA 1GFIA 3O8DA 1UBEA 3Q3JB 1DAIA 3C5CA 4F7WA 1EK0A 2ZIAA 5F2EA 4PPGA 4V0LA 2RGDA 1GITA 2QQEA 4M1SA 1G8HA 5E7JA 1X1RA 3HYRA 4OI4A 3SHWA 1KDRA 1SXJB 3DDCA 4B43A 4KVGA 5JCZA 3KXLA 2ODBA 4DCVA 4MGIR 3GMTA 2ZJZA 1I4LD 3JZMA 3P32A 4CT5A 4TQAA 4Z1MD 4D6PA 4KODA 5CB6A 1GRQA 5JS8A 2GJAA 2ZJ5A 1OXUA 1BYIA 4RFVA 2QG6A 3CNLA 2O8CB 1UFQA 2WJYA 5KNDA 5DSZA 3REFA 4BEBA 3PUVA 2IWHA 4J0QA 4H1VA 1Q1EA 4DIEA 3H0KA 1G64A 3NH9A 3L8YA 1UKYA 2NQ2C 4DEYA 4C0JA 2HJVA 1A1VA 2JASA 3AKDA 3CZPA 4C2UA 2AXPA 2B8WA 3U2QA 4BEJA 3UPUA 4B44A 1CJVC 1OH6A 1ZJ6A 2J45A 3EG5A 2W6IA 4A0FA 1YR7A 4XIGS 3SBDA 1JR3E 3GP8A 4JMPA 4OJQA 4RD0A 5KUTA 3LH5A 4IXMA 2GJKA 2NTYC 1QF9A 5SZIA 4MRVA 2WWIA 3EIQA 4NYJR 5HKKA 1E9CA 4Q1EA 1VYUA 1F2TA 3ICEA 4RD6A 1ZIPA 4QFMA 2DY1A 4DJTA 2OXRA 1M2OB 1W47A 3D31A 4TTQA 1EFRA 4W7SA 3W6NA 4ZCMA 4KVAA 2EYQA 2ZAOA 4C2TA 3U3KA 1YE8A 1NVVR 2OXCA 3GJ5A 1XTQA 2IYLD 3I62A 3QUSA 3I61A 1GNRA 3NXSA 4TWZA 1E96A 4AD8A 2J46A 1IY2A 4JJKA 1DO0A 1MO4A 1P62B 1IONA 1ZM4A 2D7CA 4NKRA 2WICA 1EFTA 5FUWA 4B47A 2XZLA 3K8YA 4LI0A 3OIUA 4HUQB 1CR1A 1KSFX 2IUSA 1ZM3A 4JLPA 3TK1A 2WSSA 3VNVA 4FCWA 4EQ6B 3E70C 4MRNA 3K0AA 4U5XA 2HT1A 3TRFA 3CRQA 4O25A 4ZI2A 3ZIAD 1IN6A 2PX0A 3TUIC 1LV7A 1NLFA 3EIEA 1E98A 1ZYUA 1JBKA 3EARA 3NH6A 3SJAA 2EFDB 3OF5A 1OH5A 1SXJA 1E1RA 2FSGA 2ZRAA 4BFZA 3THOA 1JJ7A 3CZQA 1DOAA 4M9XA 4RCYA 1WBBA 5FTMA 4QJ3A 5CDFE 1SKQA 3AVXA 3AKYA 4B71A 4ASUD 1Z5ZA 2DWPA 1EWRA 4IEEA 3WY9A 1EX7A 1IHUA 3PENA 2REOA 1KJZA 1LB1B 2GHIA 3AH8A 3CWZA 4HI0E 1L4YA 4B35A 2GAOA 2YVUA 4IDNA 2C2HA 3ZVMA 4WZBE 1AQYA 3CB4A 3VX4A 1QHIA 2IK8A 3K0CC 4V0MA 1G6OA 4ARZB 4R71A 2QSYA 3GD7A 4NZYA 3GJ0A 3SFVA 5BYJA 3WHLA 4TN1A 2OSBA 1Q22A 2ZETA 1XF9A 2X2EA 3ONWA 4G5RA 4BLSA 3QKRA 1OFIA 5DI3B 3U3JA 1IOZA 4IVQA 2F3TA 3OAAD 3P4XA 4IOKA 4PZLA 2E1RA 3FKSA 4KFTA 4B74A 1A82A 4CEHB 5FPKA 2JCSA 4TTRA 4LJAA 4CEJA 1XD9A 3MAAC 1TPZA 2RAPA 3C4JA 5TARA 1KIMA 2VF8A 4QBGB 2HT6A 1OH7A 4DC9A 3HU3A 4GP6A 4MRPA 4E5UA 3PUWA 4Q00A 2NMVA 2WOOA 2X8AA 5CK5A 3O8RA 3NEJA 2GEVA 1E2FA 1TQDA 2YWGA 1Z6YA 1ZINA 3KKNA 1KO7A 3SE0A 1RIFA 4WBSA 1S4QA 1SXJD 3K0EA 1I4DD 1ZVQA 4B48A 4WXPA 1F3OA 3A4NA 1GIAA 2BC9A 5FL7D 1NBMA 1QDEA 4AYTA 3IIJA 1XMSA 1S96A 4AYWA 3CNNA 1YRBA 1NL3A 1CS4C 5L3QB 2RB4A 1NIJA 2D7DA 1LY1A 2HCJB 2JLSA 2BBSA 1VDZA 2B8TA 4CVNA 5C4GB 2ERYA 2I4IA 2JIZD 4LY6A 2AXNA 2DCUA 1COWD 4UXIA 1IN7A 1NI3A 1QHHB 3V4FA 3U3RA 1OF1A 3FWYA 3GJ3A 3U6KA 2WTUA 2WZQA 2XTMA 3GFTA 3FYHA 3K9LA 2DWOA 1QHGA 3IPYA 3LAWA 2J7PA 3NG1A 4M1MA 4Q19A 4E22A 1RZ3A 1NVVQ 1SVOA 1U0JA 1P72A 5FPSA 4AC9A 4C0SA 1C1YA 3DVLA 4Y0AA 5G40A 2J59A 5KNCA 4KCGA 1Z0DA 4AIIA 3TVTA 2O8CA 2QQ0A 4M53A 4NCKA 3GLFA 1T8UA 4U00A 3A4LA 5EXXA 4XVUA 4TT3A 1ZMXA 2G3YA 2QE7D 1HEIA 1VIYA 3N2IA 2FZ4A 1KJWA 3SDZA 3WHKA 3RABA 1S3SA 4MGYR 2GVZC 1S1MA 1FX0A 4C7OB 4Q66C 4BFUA 5G53C 1E3MA 2OCAA 2V7QA 4FCTA 4KJZA 4O2RA 3W5IA 1AS3A 5DI3A 1CTQA 2G0TA 3HPQA 1G3UA 3AUXA 2OILA 3DM5A 1YR8A 4WVFA 4A1FA 3ZVNA 1XD2B 5KDLA 3RS3A 2IS2A 2H8KA 5IRCD 5DYIA 2Q3MA 2WIBA 2P6UA 2C9OA 4S2EA 3AVWA 2WWXA 5BN5A 2ATXA 4G5QA 1KO8A 1SVSA 1VCOA 4N3NA 2YJTD 3QOFA 3T1QA 1ZNXA 3VAAA 1G3QA 4Q47A 2OEPA 2RGNA 3FHOA 4D82A 2C98A 3E1SA 3B5JA 1N5KA 2WAXA 4JLKA 1KK1A 2FV8A 4FMCB 3FMFA 5ANRB 3T06B 3KXKA 3TUJC 2IYYA 3SQWA 1E1QD 2YNMA 1MV5A 4TT3D 2BBWA 3BFXA 4JIMA 3EX7C 2FGKA 4II7A 2A5JA 4V0ME 2HUPA 1C9KA 3K9GA 2GK7A 2KB0A 2ZRHA 2F1RA 1CLUA 5IF9A 3I1FA 2XB4A 3CH5A 3BH0A 2IEZA 2QAGC 2OFWA 3IEUA 1H8EA 1Z06A 4URUR 1NMZA 1E9DA 1JXOA 2CEAA 4R2IA 1R7RA 2J0UA 1P75A 2YKGA 2R6AA 1FTSA 1KI8A 2D2EA 2WIAA 3AEZA 4URVR 2JGNA 5JEDA 3R20A 5KDDA 4DBLC 2AKAB 3KQHA 5JHGB 1VYTA 1KY2A 3GPLA 1CP2A 1R5NA 1KZGB 2IS1A 4PPFA 1CR0A 1LF5A 2AFHE 2MMCA 3CR8A 3GJXC 4WA7A 3CKLA 3CO5A 3VR6A 1JQLB 4DKXA 2XJ4A 1S9DA 1ZNWA 3UMFA 3U7EB 5EZ6B 1J99A 1JALA 1E9BA 1TEVA 2PLFA 2GDJA 2CJWB 4R98A 2ZE8A 4OQLA 2P3SA 5J4LA 4ITRC 4L4UA 3A6PC 3GLGB 1LVGA 5KU1A 5KSOA 4R2HA 3LBHA 3BOSA 2QEQA 4LHXA 2GVDC 4IKEA 1ZM9A 4TLEA 621PA 4DSTA 5FI0B 4FIDA 4M1KA 4RY2A 2Q9AA 3LX5A 4HUTA 4P4SB 2ZRGA 4LBZA 1U81A 3T5GA 5CIQA 3VR1A 2XX3A 3QEJA 2QBYB 3BERA 3NVAA 1P73A 1KTVA 2Q3FA 1XMIA 4G1UC 5DIFA 4Q7MB 2CLDX 4P33A 1G18A 4RZUA 4US0R 5EJEA 4GMXA 1HA3A 5JRJA 1PLJA 1XTJA 1DADA 3C16C 1HT1E 1P61B 2ZR0A 3BJIC 3GLHA 2VP2A 2W6ID 4CDGA 2BCJQ 1N6OA 1W4RA 1GP2A 2YWEA 4CRWB 3O8CA 5H8WA 1E2GA 4KFSA 4QBHA 4F4JA 1VG1A 4HDCA 1Q0UA 2IT1A 1WMSA 4NYMR 3IEVA 1VYVA 4UJ5A 2HYIC 2YV5A 3OHMA 3KJHA 4GOXA 1YRAA 2TMKA 3RS2A 3AVTA 3FOZA 2J41A 2ZS9A 1NN3A 2IF2A 3OFND 2IC5A 3ADDA 3I4LA 2W83A 3NHAA 1VCIA 4GT1A 1U9IC 3VHLB 1UKEA 3C41J 2FFAA 1KNXA 1T3SA 3CR7A 3VR5A 4TLCA 4EJSA 1KY3A 2Z6VA 2KWIA 3PEUA 5J5CA 1ZU5A 2NO7A 3TH5A 5EP2A 5SZHB 1OFTA 2FEOA 1OXSC 3L8ZA 1XFAA 3KFXA 4URWR 4YC7A 3EZ2A 3SC3A 4OI0A 4I99A 4B32A 2H17A 1NVUQ 1N5IA 3V00A 2JLUA 2GAAA 1X6VA 2IW3A 3T1TA 2XTZA 1N6KA 1XRJA 3BB1A 3GLFE 3FE2A 2PZFA 3GLHE 3NWJA 3VX3A 4LOAA 1UKVY 4C0KA 5FTLA 1ZUHA 2F3RA 4NCNA 4QXAA 1L8QA 5KTYA 3BXZA 2QTFA 1D2EA 2DFLA 3KJGA 4RD3A 3GLFB 4QOSA 3TLXA 1D2NA 4CZ2A 4DCTA 1AQUA 2DPXA 4PO1A 2W0MA 2V3CC 4BZPA 2G1JA 1G7RA 1KO1A 4OL0A 2ZSEA 4Q1BA 2ZQ5A 4OHVA 1E2DA 3KX2A 3KTAB 5FUYA 2ASEA 3NKVA 4U7DA
chains in the Genus database with same CATH superfamily
1FFXA 3O92A 1U28A 4YCAA 2IDMA 3GBSA 4NULA 1JT2A 2YIDA 1TD9A 2MSKA 5DBOA 5JPCA 1X3LA 4QQ8A 5DYYA 2G9VA 4XM1A 1PF7E 4B3XA 9ATCA 2W70A 4RHTA 1JTVA 5H83A 1EA7A 1Q1ZA 1DI0A 2WHXA 1JKIA 2I4TA 3IP1A 1U0NA 3TI9A 3U0BA 3HJGA 3ZHTA 1ESNA 2WIGA 3UB3A 4JK3A 4IUDS 5GVRA 4CN9A 4JOSA 1ML3A 3EBLA 2E1PA 2ZTSA 1D2CA 1KMNA 3E81A 5GPBA 2QJWA 3KSMA 4O4IB 1OA1A 1NONA 2OYCA 2V58A 4FFLA 5DLPA 4Z0TA 1BZYA 1JR2A 2R1TB 1E7SA 1R6XA 4F1JA 1NW5A 2IOFK 4MROA 2GKSA 3R9KA 2C29D 3R5FA 4BJ3A 1X0XA 2NX2A 5IYZB 5LKRA 4KSCA 3A6JA 4DLBA 1SC6A 4A6PA 1SQSA 2JG3A 4BWVA 2ZRFA 4X7MA 4AN4A 4G8JA 1YS6A 5FHRA 3EEOA 7GPBA 3L4KA 4J0HA 5E9WA 1TF7A 4EY5A 4JLOA 3WRYC 2QR5A 3ENWA 5C7LO 1UUFA 1Z6XA 1FA9A 2IDKA 1C8KA 3BM5A 3OEHA 1M0SA 3QK7A 3RFCA 4AIRA 4F11A 1T0IA 1N92A 3U60B 5I45A 4D9IA 2Z08A 3DKPA 4B87A 1ZICA 1XDGA 3HLKA 3MYRA 1XZ8A 1QRTA 2QU7A 4HEQA 4C29A 4KUGA 3RAJA 4DIBA 2A9RA 3BSFA 5T3UA 3R7AA 1KAHA 2FZVA 4KH0A 1AGXA 3L0YA 1C0PA 3Q5EA 3FUUA 1ZDMA 4OKIA 4QUIA 4FM9A 2IZ7A 2WF5A 4D80A 3V97A 4L8FA 4E94A 1IBSA 4LDPA 2XNJA 5JISA 5B7QA 3F8WA 4J29A 1HY3A 4N5LA 3W8FA 2IBMA 1EUCA 2ZSBA 3GOQA 2DE0X 4QFBA 4UPDA 2JFFA 2X4GA 3GQBB 3H9CA 3T1YB 3OX1A 2Y77A 2DC1A 4HDQB 3OE7D 1PQWA 1WY7A 4KXMA 5CX1A 4DXDA 5KNBA 4CKWB 5L6LB 4EUHA 3CR3C 4MWDA 1DAHA 2GMWA 4IMPA 4OJTA 1C0EA 5K01A 1QJ4A 1Z36A 4OBEA 4PZAA 3ZDQA 2UXBB 5B58C 4DADA 1MO5A 2VJNA 2H4ZA 4P2GA 1IN4A 1FYEA 3GRVA 3K8QA 1JUDA 3CEPB 1C7EA 2W6PA 3IERA 3L4BA 4CG1A 3A6LA 5LR6A 2I6FA 4DV0B 3GEGA 1QGOA 1BMFD 3WBBA 1CNMA 2EATA 2J0QA 3I6YA 1I2DA 2JB9A 4RACA 3ESXA 3W90A 1F48A 3EWNA 4O4HA 5G41A 1N2OA 5DT2A 4Z4QA 5HK9A 4Y3UA 4DANA 4PF1A 2Z98A 3VUEA 2RGGA 1II8A 1JEJA 1E0SA 4HF7A 1E5VA 3TRDA 3ZK9A 3H86A 1UBFA 1E7RA 4N5DA 4M9QA 4KW7A 4LVOA 1VHJA 2HC9A 2H9IA 2VAVA 2QUBA 3CIFA 3PR1A 2JD2A 4I4TB 4D9MA 4Y2JA 2HLHA 2OO7A 4C04A 5C37A 2FW1A 3F98A 4N9WA 3OU2A 4TMTA 4AULA 4CMKA 3ER6A 6GPBA 2DHRA 3KSAC 1LJ8A 2GAIA 2QAIA 2HMSA 4TLMB 4F9EA 3C5EA 3TOZA 3MPUA 4N0QA 1P44A 4NZPA 2ZRIA 3DL0A 5EJAA 3TQCA 4X65B 1KHTA 4XDYA 1JB9A 3AJEA 2PWAA 1F2TB 2GK6A 2OENG 3FOCA 4GZMA 1ZGAA 1BD4A 2F1OA 3EGIA 3OZTA 4RMIA 4CIDA 5C5CA 3OM8A 1NSTA 1I7QB 3CRMA 4X1IA 5ALTA 5ETJA 2HDHA 5HQTA 3WGIA 2XZOA 2YYZA 1EE1A 3O9VA 2YZNA 1XTSA 4TS4A 4D9NA 4CF3A 1GTMA 1Z0SA 3E5NA 3TNJA 3VYTB 3WMRA 3M7IA 4WLEA 3NT2A 4JLAA 1YQTA 3B8EA 5JXGA 1H85A 1U9CA 4DPMA 3WQHA 2VP3A 3FWHA 1U0SY 3O93A 3UWOA 3QF4A 3N87A 2A59A 1BW9A 1W76A 2W9XA 1DC6A 1XX6A 4W1QA 1ONPA 1MVLA 2ZITA 3OC0A 2OZVA 3QKUA 4LSMA 1HT2E 1DC8A 1JKFA 3D4NA 3KNZA 4M86A 4M83A 1DAPA 4UUPA 5DGTA 4X8OA 3GMSA 5ILQA 2XDYA 4PWZA 3UJCA 3CVYA 3EZLA 5AOVA 2BOVA 1S0UA 3DZHA 1O9GA 4Q18A 1Y4ZA 1Q15A 2QVYX 3OO0A 1XNJA 4NK5A 1ZJZA 4MR7B 3G7SA 3U4GA 2WZBA 1S8OA 5GQSA 4OBBA 4JI0B 4R3UC 5ECYA 4ZT6A 4F7DA 1QCZA 3TTVA 5DH9A 1HRDA 3D3KA 3BXXA 3MWDB 1DFIA 5AUOB 1KMHB 4ECEA 3RTGA 1UBNA 1YZFA 3M33A 4N4AA 2IPLA 2ZUDA 1F0NA 4AZ0B 4TQ9A 1RMTA 5DISB 4DM3A 3K31A 2X3YA 5IJWA 4WINA 2BIFA 1DMRA 2MSDB 3LY7A 3Q7SA 4CCAA 3PGMA 4XWOA 1CUZA 3GMIA 1GNPA 1GL7A 3WJ2A 4D44A 3I73A 3D0KA 4DV6B 2O5RA 1NQWA 1N4DA 2IVZA 2QLBA 4WE3A 3BS4A 4QGFA 2QN2A 4C08A 4JVLA 4PZYA 2R7MA 3JS5A 4NJEB 1R6UA 2Q45A 3A31A 5J3JA 4QRIA 3UIEA 3WLPA 3O4VA 4IZHA 4EYQA 1Y1QA 3JR3A 2NUPB 1K5DA 1NWHA 3GLQA 1F5NA 4KQKA 4JT2A 4RDXA 2R6R1 5EJ8A 4K5QA 5H7XA 1P60A 3AVQA 2XYQA 4B3RB 3A4TA 1W36C 2IXEA 3ZR4B 4UJ3A 4P0QB 1DZIA 4HAZA 1DT5A 4D4KA 7YASA 3PUIA 2YZ7A 5KQPA 3HSYA 5BNTA 3A37A 3UPTA 1Y9ZA 2TMGA 5JHHB 5GJBA 2G9UA 3OJLA 5HBGA 2IPMA 3GA5A 3AEXA 4UM9B 2P2GA 2Z09A 3OIYA 3A0UA 4JJ4A 4CIAA 5FAXA 2DWQA 1POXA 3JAKB 3CX7A 4AG6A 1XZLA 1GSAA 3BGOS 4NR0A 1QR6A 1EVYA 5M3BA 3SN6A 4QPPA 2Q9BA 4V2IA 3RVBA 2AOXA 1NBEA 1TX4B 1TC1A 2VKQA 3AQ4A 3DEHA 2WABA 2WUWE 1KQGA 5E6UA 5IM4F 2M1ZA 4ZTZB 5BUQA 1HTWA 3OCCA 3X1KA 3RUHA 3PR2B 1U6IA 4U7GA 3KQTA 1AXEA 4YYEA 4YRQA 2XCUA 4A82A 4I8DA 2IYTA 1Z68A 2GCPA 5JJLA 5JIBA 1IRXA 2F1JA 4V38A 1WBJB 1XWFA 4G5FA 3K1ZA 4JLNA 4F45A 1BE8A 1TD1A 1XELA 4RIFA 4A36A 3V7WA 1MJNA 3A4MA 3ZJTA 1W49A 4QA9A 5HJEA 3TSWA 5B1IA 5A4KA 1OYYA 1XVLA 3L1UA 4QO8A 3ZQ4A 1CKEA 1U5BA 4U7WA 5JCXA 4G0WA 1ODLA 3QY9A 2FRXA 1B26A 1NBWB 2JJ1A 2ZBGA 1PZMA 3KIPA 3LVQE 3LV8A 4WGGA 5CXSA 3ZDXB 3ZEIA 1JDBB 5AI6A 3ZHVA 5BMVB 3HCBA 3HZRA 2C99A 1Q7EA 3F5DA 3O4HA 2W0SA 2X0KA 1UM8A 5E95A 4Q4HB 2F3QA 2ZB4A 4L9AA 1EFVA 2YBEA 3EMDA 2AE1A 5E7QA 5BSMA 4WNYA 2D0DA 3TTYA 4MDEA 4DMMA 5DOVA 4FC6A 4TTAA 1LS6A 1XEFA 3DM9B 3PRYA 3T52A 2C4NA 5DHRA 5INTA 1UC5B 3NCHA 2XZDA 4NK4A 1O3YA 3N39C 2F3PA 3DPIA 3QUQA 3PTAA 1P1RA 3MTEA 5DM1A 1F06A 4RM3A 1MG0A 3RYHA 1TZKA 4XOIA 3WGNA 2HQ1A 4KC0A 4XWAA 4C6HA 1T9BA 5DNYB 3IO5A 3IS3A 2PJZA 1MQ8B 2G40A 3E18A 1WRBA 4G0QA 4LDZA 1QIJA 2XWJI 4LQCA 1UAAA 4KJXA 1Y1LA 4W6QA 1V3TA 4M0UA 4YDRA 1DKNA 3MA0A 2O4CA 4R2MA 3N7TA 3OKPA 2JLRA 4URXR 5THQA 5LP6B 2EF1A 1YQGA 1MC5A 1TRHA 3MWYW 5JXWA 2BGUA 2O8DB 2P6MA 4G97A 2EFCB 1U2GC 2V55B 1E58A 1OKKA 3G2LA 2ZWIA 1NOKA 3GX1A 2IOYA 4G1CA 2O8BB 4W9RA 3SQNA 1FQOA 4FCVA 1AKMA 3VTAA 4LPSA 3ICPA 4PX9A 4OFZA 3WSWA 2P1RA 2ZJ7A 3ZWPA 1LUAA 4BFXA 1ZN8A 3HEMA 2IL1A 2JLAA 2PL5A 3GIWA 4RTJA 5BT9A 8MHTA 3GAZA 3JV7A 1U3FA 4G5XA 1MB2A 4P5DA 2M1XA 1G2PA 4HWGA 4X93A 3RIYA 1P9LA 1SBZA 2BP7A 3VPGA 4EYSA 2V5VA 5JXJA 3B1VA 3EAQA 5A7GA 4P84A 2HWKA 5FKJA 3RFVA 3HVUA 1VL5A 1V4BA 3KWFA 3DBLB 4E4YA 1GTL1 1G0OA 2B6HA 3WIVA 5JD5A 3ZDDA 1JS1X 1VA4A 4JYBA 3OD1A 4RKRA 3IUQA 4QREA 4K88A 3D2LA 5D51S 4BMYA 3E53A 1EZ1A 5ICMA 3U9SA 5BQ5A 1FX0B 4F6RB 4C7OA 3QSGA 2Q4RA 3QVMA 3RIEA 1SZCA 2AUNA 2OHXA 3OM9A 4Q82A 3WQBA 5BWCA 5EXTA 3SZGA 3Q3GE 4LF5B 1LDMA 3GI1A 3D6JA 5H70A 1L5HA 1N5DA 1AK2A 3IAUA 1SZPA 2PGNA 4D3YA 3QKTA 3RUAA 2VO1A 1EDDA 3OOJA 4QYIA 4A0SA 2QT1A 3WGTA 2IXDA 2QRGA 4E88A 1DFGA 2P77A 3E15A 1AKRA 1NW6A 1P1JA 3A8TA 1SXHA 2QM3A 2QN9A 4M4SA 2ZCUA 1V2GA 1QO9A 3OHPA 5HDBB 4GKAA 3A36A 1TW2A 3B70A 3G2PA 1TU3A 1PS0A 3HQ4O 4KKVA 4X9XA 5CNMA 3C4VA 1CQPA 4AYXA 4DXAA 4IPTA 3CXRA 2GZAA 5E8JA 3I39X 5ER9A 2DMRA 3HCCA 3T1NA 4JP1A 2A67A 3SU8A 4N5HX 3RSFA 4UBJA 5LOVF 1M1ZA 1C3OB 4ETWA 1N2GA 3VPDA 4FXOA 2AEJA 4G6ZA 1QHSA 1LRJA 1W2GA 2R6CA 4KQEA 4L73A 4AVYA 4KQGA 3BCHA 3SZRA 1MH1A 4XDZA 4CF5A 4UMFA 2RHWA 4Y6LA 1ZK3A 1QVAA 1F0KA 2VDWA 2YDXA 3IIKA 3GNTA 1T0HB 1M7HA 4GMHA 2WNIA 3TTUA 3KV3O 4B6PA 5LZ2A 4F93B 5HRUA 4N6NA 4NEQA 2V8OA 3JPWA 1VBNA 3NVMB 3SLRA 4EA6A 3PX7A 4LSZA 4FCCA 1I3LA 1M7GA 5B53A 1KPHA 3UAYA 4Z0HO 4EI2A 1UAYA 2QL9A 4OQNA 1W29A 3GL9A 3MMSA 1X39A 1NT4A 3TNDA 2BFBA 2KW5A 2HFKA 2R11A 1KZ7B 3RSLA 4O4JB 3V7NA 5BN4A 2YW9A 5AKEA 4EELA 2B8NA 5DEIA 2IS6A 2C4WA 3JD4A 5FWAA 4RCZA 3AWIA 2RGYA 4Q02A 2JBHA 3LO8A 1ORWA 1BCSA 2NUAA 3QI7A 4J7UA 5JS7A 4ZGGA 3UKJA 2VPTA 2FVYA 2IEYA 2IY7A 3DXFA 3K5HA 4NG4A 5HM6A 5KNLA 1YIAA 2VS1A 1CY6A 4ZCPA 3KXIA 1Z73A 1P0FA 4GYWA 2XCOA 1YL6A 1XDZA 4GX1A 4GSYA 4I1OA 3H42B 4PR0A 5B1DA 2C31A 2XGSA 2ID4A 3ESYA 4FOPA 3TR6A 2QX4A 3UOAB 5K0GA 5AW6A 2FJ0A 2GR9A 2DUWA 2H07A 4GXRA 4PYQA 1JX6A 1DHTA 2R86A 4RZ3A 3OZAA 3EYWA 2AUMA 2CJFA 4MCJA 5CAEA 5FH9A 2PMKA 4RPKA 1Q14A 4HQOA 3MCWA 1KP2A 1A5AB 4Z4FA 3HVRA 3LVRE 4CF7A 4MPJA 2HCRA 3ZW8A 2NTEA 4UTZA 1OJ7A 4GIBA 3CUKA 1PDOA 1CFZA 4IDPA 1JWAB 3NKFA 4ZAWA 3UT0A 4Q9HA 1W96A 4UXHA 4EG4A 4AWXA 2HHLA 4BU1A 2P9YA 3MUFA 5DRTA 4JP8A 4UCWA 1L5NA 4R31A 1MAAA 5IDVA 4EOGA 3EPPA 4IAOA 5FTJA 4X92A 2QMUA 1BU8A 1JSXA 1R88A 3F3YA 3RARA 1G5PA 4HGYA 3UXHA 4DZTA 3WP0A 2IYNA 3CZCA 4B3JA 5ALDA 3EGOA 2F62A 3Q41A 3CUTA 1FDTA 4B4VA 3KZ1E 4XSGA 4UNSA 5NULA 3EUEA 4ZFNA 2OB2A 3RUEA 2ZROA 4JLUA 2A9KA 3EQ7A 4AJEA 2RI1A 1MOQA 3AR5A 1I1QB 1K75A 3M5PA 5E1BA 3S29A 1U90A 1KI6A 2XI4A 3DB2A 3RKSA 4RF5A 3TB4A 3URKA 1PQPA 4EZBA 4HD8A 2Y0DA 2QQ5A 4Y1RA 3SDSA 1GNQA 1X1CA 2IA5A 3EWAA 2NTJA 2P9CA 4CDNA 3TBHA 3OJEA 3ZV3A 3K0SA 1DXHA 3BX1A 4PG6A 3OPQA 3LMKA 1FFHA 1NRJB 1J6UA 1S02A 1X7XA 2WYOA 3FPCA 4JKIA 4YJ3F 4BQSA 1ULSA 1IK4A 1YFKA 3BE5A 4H1WA 2E21A 4KAXA 4TTTS 1LDGA 4UDNA 1RJEA 2EZTA 5FBRB 1X19A 2Q0XA 1D1TA 2W4QA 2XCSB 3E6AA 3DMDA 3R6DA 4UTRA 1ADJA 1VSUA 3HLYA 2P69A 1IQUA 1U65A 4PS0A 4HO1X 5TXGA 3R0JA 1XZKA 2KBFA 3ABOB 3ETDA 3GDWA 4E07A 1T8TA 3VNUA 2HJRA 3FSRA 1MFZA 4O8ZA 3LX8A 4MRMB 4QUAA 1XAJA 4B4DA 1JHUA 5J1TB 2VRCA 3CF6R 4LXIA 3EEIA 2GH1A 2DQZA 4FMCF 5FI1B 2PMEA 5MFZA 1P2SA 2Q4EA 4HYTA 3EPRA 4IEFB 4WN3A 1NNUA 2VA8A 3GEIA 1E4EB 1FP4A 4TRJA 4Q16A 3SR0A 1T2DA 3EH2A 3IPAA 2P2LA 2PVSA 5IXJA 1DCTA 4D3SA 2NWQA 3G9UA 2A7QA 1SBTA 5K03A 1E6LA 4HVAA 4MUKA 5A03A 3O6VA 1DWUA 3QMPA 3QKWA 2BBOA 1QRUA 3PQDA 5J59A 3AEKA 3U39A 3WA6A 5ALQA 2GN0A 3FUXA 1HKHA 3GFOA 2IH2A 2Y4NA 4DBZA 2ZUFA 3AIIA 4WJLA 4G5YA 2H2GA 2X40A 3E5MA 5AR1A 4C4ZA 4WBNB 1QOPB 2EZUA 3LLSA 3E5HA 3OZ7A 2GJ8A 4ND3A 4BZQA 4BO2A 2Z5VA 2GRAA 2I3GA 1PSDA 3TLEA 3V1TC 2VDOB 3OESA 3VVCA 4AZSA 4CQJA 1NDQA 3AOEA 4WKBA 5A4AA 4LMRA 1EQ2A 1MNQA 3NTVA 2X0FA 1TZBA 5HCNA 3SD7A 3E9EA 1WTCA 2VBGA 4LC0A 3FB1A 2ZRKA 4RLFA 3ORFA 4U3JB 1A9TA 1A8QA 2XAUA 3GLKA 1GGKA 1L8LA 4EHJA 5ITVA 1X80B 5LDGA 5TS3A 1Z8DA 4CLOB 2LV8A 3EFEA 5M29A 2FQQA 5KYWB 3ZD7A 4MMXB 2Z5FA 5LBIA 3RGWS 3IQIX 1JZQA 1D2RA 1OVMA 3M8KA 3MCUA 2CNDA 3PLRA 1V5EA 5TQ0A 1R0SA 3LU1A 4QE3A 2GPWA 3PA6A 1L4GA 5LMZA 4WI1A 2OHHA 1D9ZA 2OCPA 5IUJC 3KYDA 2IIBA 5MHTA 1ESCA 4XB6B 1LBEA 1VI2A 2ODNA 3KQQA 5TQ2B 4ZAZA 1LWOA 3OPNA 2Q6KA 1JBEA 1PI3A 2E3JA 3HBMA 3SICE 4RUKA 1YHZA 3CLKA 5CVCA 3RYTC 2ZDHA 1AH2A 1H69A 1EVJA 1A9ZA 3VR6D 2VPYA 2ZRQA 1W0KD 2ZYTX 2GFHA 2F64A 3HJHA 4WXHA 3E3AA 3B9RA 3EQ9A 3WO0A 4RVHA 4YCSA 3WVNA 4AKIA 2PBZA 1JHMA 4PC2A 5IFKA 4EB3A 2ZRNA 5BV7A 2WRZA 3QUTA 3X2SA 2E5LB 1RMYA 4C4OA 2Y1WA 2BFNA 3O82A 3R74A 1AB5A 4AJIA 1U2PA 4GI2A 3JQQA 2K5UA 3BJMA 4HLDA 1QFYA 1YJ8A 1G21B 5DLYA 1YSCA 1KZ1A 2W2MA 3W6ZA 1MT0A 3KQSA 4TRNA 1JLRA 2PUJA 1N5RA 5DP2A 1IM5A 4LDAA 4I1YA 4YROA 2PTGA 4CG2A 2XMZA 3D6HA 5JWHA 3H6KA 1DIHA 1B74A 5LC1A 3I3SR 4GPAA 4K9PA 5M2QA 3SVTA 2DPLA 1VG9B 2D0IA 3AF2A 3ESRA 2PL1A 3F78A 3FAKA 4MWTA 1PG0A 4AW9A 1IEWA 3QXSA 4QPNA 1C1XA 4JODA 2VN8A 3BFKA 2PHZA 5IK2D 3HPRA 2GX6A 1VHDA 4IIUA 2G25A 1AK9A 4TV8A 3T7TA 1UEIA 3PKJA 5K2MA 4LMBA 4V0RA 2AR9A 3EVEA 3EF0A 2CJPA 2YNMC 4GBGA 1YKSA 2YZKA 1P5FA 1NM5A 4B6RA 5YASA 4E33A 3F96A 1QQ5A 4Y2UA 1JEEA 4KV7A 4A0GA 1H5NA 1KK2A 1QX4A 2NIPA 3NHSA 2H59A 4LOLA 4IQFA 1YBMA 4Q93A 4IR7A 1H1LA 1PUXA 4EVSA 5LMNB 3NEPX 4FMPA 4BVBA 1P19A 2PUBA 2AW3A 1MA3A 4XQGA 1SCUB 4I50A 4AX8A 2Q5LA 2FQ1A 2JGIA 4GE3A 3ZIAA 1BDIA 3C43A 3BGWA 3H75A 4F71A 1RLOA 1KVTA 2QTAA 5SICE 3DCYA 1WXEA 3EZXA 3GR6A 3ZQJA 4E13A 4PG8A 4WFKA 2FQYA 1FSFA 1YZGA 2OV6A 2WSMA 4LMAA 4U7JA 3NDRA 3VYSB 4BRUA 5KSZA 4GDFA 1YDMA 2QM7A 1NP7A 3V42A 1O7JA 4E70A 1BOFA 3TZCA 4JLBA 5E1DA 3ZNNA 3O3CA 4O02B 3LC7O 3W78A 4OHWA 5HOQA 2RH9B 4WQMA 4QJ5A 5BO5A 5JJCA 2CSXA 1ADCA 2IU4A 3PNMA 3LCVB 5AIAA 1RKQA 4PLPA 1L7QA 4RHEA 5EJ2A 3IEKA 3O2SB 2AUTA 1Y80A 2J1LA 4NV1A 1G59A 1RQ2A 3AP1A 2XLCA 3FSEA 3T9BA 4KRGA 3UEOA 4OMDA 121PA 1FTYA 1LPOA 4U2FA 1RRCA 4R84A 1XAGA 3ISVA 5D86A 4IIYA 3KFVA 4YP5A 1QPZA 4HDRB 6YASA 2E5FA 1P81A 3MIIA 3KQVA 1OBCA 1YGYA 2A86A 3GVPA 3ZI4A 3JW8A 1RC1A 3FOBA 3INTA 2WJ4A 4ZDKA 4C0LA 2BM9A 5TIIA 3DJFA 5CM2Z 3T7DA 1W44A 2X1VA 3L07A 3VPAA 5L95A 4M21A 1XNQB 2ATVA 3RUDA 1K1EA 1UFRA 3ILVA 3C3CA 5DTRA 1I80A 4PGHA 1YS7A 4QFCA 5KOHB 2OCYC 3LGAA 4NIMA 3ASYA 4WPGA 3L0BA 2I7TA 1DCMA 5FOVA 4BY9E 3K1TA 3KZVA 2O7RA 1WVIA 4HGOA 4MOWA 2AJTA 3C39A 3MTBA 3OVMA 3C1AA 2DKFA 2FPMA 2QB5A 1K4MA 3ZYZA 3CY6A 1AUQA 4CM9D 4BNFA 4KZKA 5FTWA 5KYNA 1RI1A 1TO6A 2Y1XA 3FWPA 2FEAA 2X76A 4R6WA 5CLFA 2G9RA 3N53A 5GIPE 4WL0A 7MHTA 2B5OA 5HGJA 4H27A 5FV4A 5JMWA 1U8YA 2QT9A 3O3MB 1N78A 1PYDA 2B61A 4UHJA 3HABA 4HLNA 3FTNA 5EE5B 1G60A 2H1IA 2BSXA 2H1FA 1Y0BA 1CUHA 2PUTA 4ABYA 2FN3A 5CCEA 5KHLB 2XXAB 3ERCA 4PIMA 1J1ZA 3L4BC 3I5MA 4Q7JB 5HXAA 3O74A 1JIQA 5CJPA 1XFDA 3A6DA 3JRXA 1XMOB 3EDYA 4ZANA 1DBIA 1IOWA 4BFYA 5KAMA 3P9QA 3GA7A 3VNSA 4JT8A 2HIGA 4WERA 1JN0A 4AO7A 2ONKA 5LQMA 1Z0IA 3W9BA 2ZU0C 4R1OA 4GLOA 5HP4A 2W4MA 4DLNA 1NUPA 1T43A 5B64A 3QIAA 1OR8A 4YO7A 8AT1A 1Z74A 4XVCA 1UXKA 1X8JA 2QPAA 2O2HA 3QTBA 4M46A 3TINA 1GGMA 2PLAA 3HKBA 1BS2A 1DJPA 1WW3A 2YV4A 2UVQA 2YH2A 1OC4A 3IO3A 4P1ZA 4Q7LA 3NHMA 3MYYA 2XOKD 4RVNA 2J6CA 3DBHA 3UB4A 3QYFA 2BGGA 1MOZA 2IX9A 1E3SA 3BC1A 1Z6ZA 3NC4A 2XSZD 1Z35A 4X41A 2E4UA 1RPZA 3KZNA 1JDZA 4H08A 4FE3A 2XT0A 2PS9A 4MW0A 2BKVA 3BXHA 3QHQA 2J9FA 4W5QA 1QGUA 1LLCA 1RCFA 4PQFA 2G1KA 2P4QA 2J6BA 3UMRA 2WJWA 1L5MA 3F6BX 3E9QA 3I30X 3JYNA 1E4EA 1RE1A 1IPHA 1CBUA 4FGZA 3M2PA 4R51A 3SC2B 2J6HA 4HDRA 3R77A 2PLRA 3AZQA 2YS7A 2C59A 1ONOA 5DHTA 5LU8A 4LX0A 1JJVA 1UPAA 1KC1A 2C0PA 3G0DA 2BLLA 2C2XA 2DM6A 3QWIA 1AQJA 1XPRA 1ZCZA 4JHXA 1NX9A 1FMTA 3ZZUA 3N2EA 1BRTA 4FB5A 1EXVA 3IBYA 3DVRX 2REBA 5EJ5A 1KSGA 1GQOA 3PNPA 2BFMA 3OFSA 2Y0EA 3ODPA 4DMRA 4TVBA 2GQ0A 4BYMA 1ZOPA 3KEGA 3DGFC 1ECGA 3B7WA 4JR0A 2B7LA 1K6XA 4R2JA 3NYQA 3TW8A 2KS6A 3WK9A 3ZU5A 1A2QA 3FD8A 4UPVA 3H5RA 2PRSA 2QI9C 4W7IA 4WVLA 1W85A 2GZRA 3ZBQA 5AW3A 4E08A 4MIOA 1OVGA 5DGIA 1DNPA 2JHCA 1YJCA 3BWMA 4BTLA 3D02A 4GM1A 3P20A 4HR7A 3SIWA 4N0DA 1A4RA 1A4IA 1R0YA 2DFVA 3FSGD 4H1UA 1WB9A 2A1TR 3RVOA 2OCLA 3BJZA 2CF5A 2GYUA 3EISA 3A6KA 4PC6A 4RTSA 3OLZA 1TDJA 3DHEA 3LF1A 4MI6A 3GAMA 2BMDA 4KE7A 3ZHXA 4H16A 4NG5A 2PPVA 1VE3A 4W63A 5HIKA 4U2CA 4N39A 2NV6A 3KZOA 2P4UA 3PJGA 2NXJA 3PPIA 3WYNA 1KYIA 1IG0A 3SVLA 2HOQA 4UTXA 3ZWKA 5DNVA 2IP4A 4UEWA 2QN7A 3C6XA 1T2AA 2W6QA 3LG2A 3O8BA 2P75A 1P4AA 5FEUA 3Q10A 2N0SA 1HLGA 2FZGA 4EG5A 4G0VA 3MJEA 2ZKIA 3IIMA 3IRVA 4HRYA 5J4KA 3HWRA 1AY0A 3Q98A 3FF1A 2JIMA 3ZU3A 1YVEI 2XODA 3NBYC 1UWKA 4YQYA 4TVSA 1CR4A 2UV8A 3KTAA 4G4JA 4ARIA 3IBCA 1BDJA 2M32A 3QUCA 4ESHA 1I9CA 1EYZA 1Q0QA 2QGFA 1VLJA 1JQBA 5ES4B 2B0CA 4B3SB 2V7QD 3KQKA 1NM5C 3O3NB 3WLLA 3OPYI 3BHJA 3EZYA 3KHTA 4J4HA 5CFNA 1DELA 5EFOA 3GDGA 2A78A 1TAUA 3R2JA 1YFJA 3KUDA 2D62A 4OK3A 1Z5WA 1E1CB 1ZCAA 5ICEA 3ZI0A 4MQEB 3SKYA 3PEYA 4MR8A 2EDCA 4HRVA 4TXNA 4DQ0A 3LJKA 3V4PB 4F2GA 2GETA 1A1SA 3W1EA 4B5LA 5K4HA 2GPJA 4RLQA 4CKBB 1QHNA 2JBAB 2VDUE 4X66B 4PZZA 4S1PA 3RUPA 4DUGD 3A4YA 2YWBA 3LZDA 4ZO7A 3WRYA 4YR9A 1EWQA 2X5KO 1HE8B 1S3FA 5AVOA 3B38A 5TJ9A 1T9GR 4PN7A 5K0CA 4IHAA 4WZAE 2HSGA 1VCHA 3ETGA 4HAUA 2P0EA 2OV1A 1XZCA 2VHWA 4IDEA 4TTJA 2L69A 1NBHA 5F5LA 1KK3A 1ZGCA 4HZIA 4ERXA 3UWSA 3RLIA 1IM8A 3OZEA 4I5FA 1N7GA 1SCDA 1K8YB 1BROA 3KPJA 5K8IA 1TIPA 3WB0A 4MZDA 4L28A 4YCBA 4D4IA 4F4CA 2IELA 2PUVA 3UTDA 1JT9A 2DFNA 3TNFA 1QH8B 2A0WA 1BX1A 1OBHA 4K3VA 1N1EA 2PY6A 1SR8A 2JH9A 3I04A 4JY7A 4RSRA 3F6RA 2ON6A 5FUBA 3IAFA 4B3TB 1OROA 1QLWA 1UADA 5FLYA 4CTMA 2WJPA 5CDTA 1NF8A 1M2VB 3PHIA 3V4RA 1WPXA 1M8GA 4HEJA 5HF8A 1D09A 4TTVA 5FBHA 2R47A 1WSDA 4H2DA 4A0HA 1NFRA 2WV7A 4WFIA 3SFZA 1Y3DE 1GL6A 3RVMA 4UVHA 5D6OA 3LPMA 1JAIA 1DTSA 1JIXA 4KO3S 4IDFA 4NDZA 3NTXA 5H9WA 1ZN7A 1FDOA 1LK7A 4DUGA 4R2LA 3VZDA 1SVNA 4BN4A 1Z2NX 3X0DA 2P3LA 4OXNA 1KAGA 1P1BA 1W52X 5LQSA 5E9AA 4X00A 5L8VA 3VDRA 2ZS7A 1XF1A 5FBWB 3RTCA 4BO4A 1V9SA 4CL3A 3J7AC 1WPQA 2SCUA 2SKDA 4UU8A 1FIUA 3QFRA 2FRDA 4HHEA 1IY0A 4I3FA 4YNBA 1PJTA 1NN0A 3BB3A 1YHNA 2QZSA 1UP6A 2WMYA 4HNSA 2QP4A 3QVUA 1UKZA 4I8XA 1U7HA 2JEYA 1Y1SA 1JNXX 4UKDA 1YBFA 2HGZA 4OMUA 1LTQA 1B4DA 3TZQA 3SYKA 3ENKA 5K3FB 2TRSB 1P0MA 4MV3A 5ESWA 2J07A 2WSLA 2UZAA 4K6HA 4CM8A 5IANA 5CNKA 4Z9FA 2IUEA 2RONA 4ARUA 1U98A 2OAQ1 3P5SA 1F2UB 2BGKA 1F3LA 2XB9A 3PUXA 3R44A 2YJ3A 5AQ1A 4EH1A 4EJMA 1QSGA 3BMCB 3JWPA 4MYHA 2GPTA 2BFPA 4IX9A 1UBSB 1L8AA 2WQ6A 2QAGB 2AYYA 5K3AA 1SVLA 2IHBA 3ABZA 4P81A 1WABA 2H7YA 1Y8ZA 4DKJA 1K8XB 4J0EA 3BTUA 2A92A 5CYPA 1ZESA 1I2ZA 5B3JC 1FNBA 1QRDA 4D0NA 4BPBA 9ABPA 3QNWA 3N70A 1VBMA 1Z17A 3IUBA 3PXBA 4KQFA 1GT91 1IWPB 4UM5A 5E8RA 4GLJA 4B5KA 3ZLJA 2FWBA 1VLMA 1CZRA 2C5GA 1XJCA 3H7IA 1H9BA 4HQFA 2Y1EA 4QU5A 1ZIDA 1QO7A 5EIEA 2ZRLA 2VHXA 3GGPA 1F0YA 3NIFB 2VDWB 3T9DA 1Z6TA 2HQSA 5ALHA 2RB5A 1DCKA 2VQDA 3HCAA 4ZWNA 1FVFA 4CCSA 2A30A 4HEA6 5FB3A 3CJTA 1B6GA 3PA8A 4P83A 4QNRA 4P4NA 2I4OA 2Q50A 2KI5A 4TPKA 5FOSA 3U6BA 5D8DA 1FP6A 2NOAA 1YVPA 4AKGA 2V54A 3FHTA 5A5VA 1LLDA 2C5LA 4EKDA 4MO2A 3TLMA 2XE6A 2EL9A 4INJA 1X1SA 1CUJA 4N0PA 3BB4A 4QYMA 3QE3A 5FPQA 2JANA 3THOA 5KJFA 1FYWA 3L0OA 3W5CA 3H5NA 3VFDA 2RFLA 2FEWB 4ACAA 4CG3A 4CMCA 3IURA 4TMZA 1IY8A 3H2KA 1NMSA 3O8OB 3QZUA 2I6QA 1KPIA 4UD6A 4URFA 2VSYA 2NM0A 1M74A 1FRNA 2ST1A 1ABEA 3EHEA 1BWQA 4WA8A 3W2IA 1I0ZA 4B3CA 4DWOA 4F92B 3T3NA 4I36A 1M1NA 4ZV9A 1HNZB 3GAAA 2RGEA 4ZP1A 4XD7A 2ORED 1LFAA 2RHBA 4IS3A 1PLKA 4NMWA 4O2AF 3HHEA 1QTIA 3M6UA 2Y27A 3WIUA 2YHBA 2FP4B 3QLJA 4U2KA 3IDFA 4JX8A 5FTKA 3QX3A 1E3LA 5EWLA 5KDOA 4FHGA 4FUTA 4BQFA 4EG3A 1KS9A 4H7IA 3RRNA 1IZ9A 4JP3A 4P54A 3LWDA 4BNYA 3KVNA 4ZO4A 3TZKA 1GXSA 2O2IA 1HORA 1TUBB 2WA1A 4EUSA 1TQHA 2EQBA 5KQLA 2AHOA 3B2NA 2FW7A 3OFJA 1YQDA 1GA6A 2TMDA 1K98A 2CMFA 1E62A 2CNOA 2ONJA 1CEEA 3A0RB 3H83A 4N3AA 1O94C 1QDUA 7REQB 5CGQB 3SZ3A 5KINB 2IPOA 2ONZA 1IUKA 3AYXB 3WJ7A 3T7RA 2B8JA 3OZBA 1QC5A 2ET6A 2RHCA 4V0OA 3RTDA 4AF7A 3D6MA 4FGLA 1OPXA 7ADHA 3AL2A 3SX4A 1MV8A 3H6HA 3RVDA 3HTXA 2XVAA 1REQA 3GJYA 4D9CA 2BR3A 1GLVA 4F56A 1WMAA 5B5SA 3VC2A 2XUHA 4RIGA 1KP9A 5BRJA 3EE6A 3SBEA 5IVKA 1QXSA 4OLAA 3S2ZA 3IMFA 3G9QA 3NT4A 3V8BA 3EXHB 3NHZA 4ZCLA 2HA7A 4TSFD 3ZZNA 4M9SA 2AL7A 3X1ZA 2BH9A 1CUGA 1DZ3A 1HQDA 1LNSA 1T9CA 3D3NA 4IGIA 2H2WA 1JB1A 1RYYA 3HJRA 3S70A 1VLZA 1WKCA 1YOVA 4RWZA 4EFLA 2GILA 2HLNA 5DLEA 4C1NA 3WHPA 2F48A 4OJKA 3I92A 2UYOA 3S44A 2JJ1D 3CNQS 4Q15A 5EUMA 3VQTA 4EHKA 2PRYA 1M67A 1P6XA 3MG9A 3CKKA 3EIFA 3OU7A 4O0MA 4ZI7A 1E4VA 3B48A 1GUYA 3QMWA 5LUAA 3TAUA 1B76A 3AIOA 3IUYA 3IXLA 4G2TA 4IFEA 4ZQGA 2VTDA 2XDQA 2Y2UA 3HJUA 4ZOAA 4XVHA 2AC4A 5U4XA 1V8OA 4XSHA 3EZGA 3P7MA 3WTBA 3QSYA 2BM1A 4P4SA 2QS9A 4BE4A 3AFHA 1NZDA 2ZWOA 4BUZA 3SE7A 3TLBA 3I6BA 1UQUA 2HYDA 1OXKB 2FPLA 4LXXA 1VL0A 4PX3A 3DUWA 4BLTA 2MR6A 4IIXA 5FBZA 3KYCA 1B8UA 2YXEA 4BRZA 4C7JA 5IU6A 1KMQA 2KBEA 2PKEA 5ALWA 3Q11A 1MD9A 4N54A 2XMDA 3S1LA 1L4NA 2FOLA 5KIAA 1G8YA 3FYCA 5DE3A 4LCJA 2YWHA 1KDTA 4L2IB 3UM9A 4MNTA 1CY1A 3RSSA