1U8ZA

Crystal structures of ral-gppnhp and ral-gdp reveal two novel binding sites that are also present in ras and rap
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
168
structure length
165
Chain Sequence
SLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGYAAIRDNYFRSGEGFLCVFSITEMESFAATADFREQILRVKEDENVPFLLVGNKSDLEDKRQVSVEEAKNRADQWNVNYVETSAKTRANVDKVFFDLMREIRAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Ral-GppNHp and Ral-GDP Reveal Two Binding Sites that Are Also Present in Ras and Rap
pubmed doi rcsb
source organism Saguinus oedipus
molecule tags Signaling protein
molecule keywords Ras-related protein Ral-A
total genus 61
structure length 165
sequence length 168
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1u8zA00
1EFTA 3U4QB 3LA6A 4RCYA 1JEDA 2XTZA 2CBZA 4LI0A 4H9GA 2AR7A 1JJ7A 5KDDA 2V1UA 2BBTA 3TW8B 1GVNB 3U44B 2H57A 5FH9A 2A5DA 1G291 2OCBA 3D7MA 3AVWA 5CIWA 1L4YA 1EFHA 1NG1A 2DWPA 1N6KA 3LBIA 3NH9A 5H70A 4CT5A 3EPJA 3EPHA 1J2JA 1Z06A 3QXSA 4E03A 2QBYB 5FUVA 3K0SA 2ERYA 2IS1A 4UKDA 2YOGA 1SKYB 2A30A 1VCOA 2YWFA 5IT5A 5SZJA 1XCPA 1HA3A 2ZJBA 5FL3A 1QHNA 4A2WA 5L3SB 1KJYA 4JT2A 3S1AA 1MOZA 2ZRMA 3L0SA 3LQRA 5HZKA 1E1RD 2H1LA 3SFZA 3BGWA 3NBZC 3LV8A 1AZSC 1RJ9B 1G8PA 3H84A 2V55B 2EQBA 1CXZA 4JJKA 4CVNA 3QG1A 3K9LA 1R2QA 1U94A 1X1RA 3CM0A 2WKPA 3IHLA 2GZDA 421PA 3OHMA 2ZSBA 2OAQ1 4AYWA 2MMGA 3QUSA 4IHQA 1J8YF 1G6HA 5CM8B 3WBJA 1AKYA 4XTRA 2VPPA 2AXPA 4IFEA 2H92A 3ZZUA 4DCTA 1H65A 2JDID 3T12A 2F7SA 4BLQA 3AVQA 1XDBA 4M9SA 2Z83A 3CF6R 2X8AA 1TUIA 3U5ZB 2PL3A 3CX8A 2HXYA 4M0LA 1KI2A 5DYIA 4DDTA 3HP1A 2JEOA 3EC1A 1G5PA 4AYXA 2ZSFA 4HAVA 2XZOA 3Q3JB 2QMHA 2C03A 5FUXA 2O8DA 3CF2A 2EWWA 3L8ZA 4HLUC 1II9A 2IUTA 2WAYA 3DPUA 2PH1A 2PX3A 4ZI2A 3Q5EA 2SHKA 3IQWA 3NBYC 3ADCA 3CNNA 4LHYA 1Z8FA 4HB0A 4M9QA 2VLIA 3CZPA 2OFXA 5BXQC 1YKSA 4D4JA 1SVSA 4V0MA 1L4UA 1ZRHA 3ZIAA 4IOLA 2A5GA 2CL6X 5KHOC 1UAAA 1Z6GA 1G19A 4FN5A 2J0QA 3ND9A 1ODFA 1G3RA 5K8UA 2WWXA 2ZRCA 4PHTA 2DFTA 4LJYA 4PQYA 1OE0A 3KQNA 1UBGA 2KSQA 5GVSA 3LX8A 1WXQA 1J7KA 4EPWA 4OHZA 2FX3A 1SXJB 5KUTA 4LZZA 521PA 3FMIA 5HE9A 2R65A 2EU8A 5LD2C 3W5IA 5CYOA 1GAJA 5DYGA 5TVKA 1X8LA 2ZE5A 3EZFA 3SQXA 1E2NA 1Z3IX 3O8DA 1IN4A 3OEED 1DARA 3MSXA 4A0GA 2J41A 1ZIPA 4UNSA 4BZQA 5FFMA 3NHBA 3TBKA 4M1WA 2W0SA 5G53C 4O2RA 4Q7KA 1AGPA 2V6IA 3VTKA 4KI0A 3QPWA 2BMDA 2W6IA 3GJ6A 3CH5A 2NO6A 4DT1B 3BD9A 5J4YA 2ZRLA 5DN6A 4Q1DA 4Z8YA 5CDFA 3FKSD 2H17A 3IKJA 1W7AA 2LKCA 2YVUA 2OT3B 4TT3D 3OAAA 3RWOA 2VSOA 1MO5A 3I4LA 4NONA 4C0JA 3FB4A 2D7DA 2BMEA 3CLVA 1U0HC 3BB3A 4Q5IA 4L16A 3I32A 3AQ4A 5GVRA 3QI2A 3GLHB 4C0KA 3UPUA 1G4AE 1UEJA 1CR4A 3T35A 1KMHB 1G41A 2VL7A 2QM7A 1Z29A 2JJ1D 2PT5A 4B6FA 3M6AA 4LHVA 4W5HA 4RCZA 1Z0KA 3THYB 2GXQA 4JYCA 4WZAE 4B74A 4YQFA 1TADA 4CW7A 1IN6A 1W0JD 4B34A 2QORA 3B82A 2IYRA 4LBZA 2OHFA 4CDGA 3SN6A 4K8OA 1ZINA 3B9QA 1Z0FA 4X8HA 1OFHA 1SGWA 2ATVA 3IBGA 2XJ4A 4QXAA 1GKYA 4QJ5A 4B47A 1IY1A 1U8AA 2HJGA 4N0EA 3RNLA 2B21A 2QUZA 1AA9A 4G5GA 4KVGA 3RWMB 4AC9A 2XXAA 2ZI4A 4QBHA 1XTJA 3SQWA 4RD6A 5FUWA 1P2UA 2QPTA 5UKDA 3AP3A 3PUYA 4XD7D 1O3YA 4AG6A 2Z4SA 3K0AB 4ZIRA 1N6PA 1X86B 2CNWD 4RKEA 2HYIC 1COWA 5JI2E 1KK1A 4TSFD 1FP6A 2JLWA 1KO7A 4Q4JB 4PSAA 3DZDA 2ZSDA 1RRPA 3Q5DA 1F48A 2C8VA 4P4SB 2REOA 5TXGA 1G17A 1RFLA 2Q3HA 2GBLC 2GTPA 2FFQA 1WRBA 4KBFA 2AHOA 1ZVQA 4XIGS 5FPTA 4GNKA 2AK2A 5CIQA 4V0NA 2G3YA 3IQXA 4XVQA 4R7ZA 4POAA 3I73A 4GMXA 4NYJR 3ZQJA 2OBMA 1KTVA 2BKUA 3OIYA 3NEYA 3QEOA 4PC3A 5FR2A 3ADDA 3IEUA 2WJIA 1DS6A 2GCOA 4GZMA 3SEAA 1AJEA 3VKWA 4EIWA 3GLFB 4AKGA 2BOVA 1Z6YA 2FPLA 2QM8A 2RGGA 4MKFA 5J4VA 1NJFA 1G7SA 4A8JC 1P9WA 2WICA 1YR9A 2A5YB 1P9RA 3VHLB 4M1MA 121PA 4Q01A 3U3KA 3QXJA 1OXUA 2FEMA 1L8QA 1BS1A 2WWIA 3LH5A 1NIJA 2IT1A 2IXFA 4MKHA 4A2PA 1CEEA 4OJKA 3ZVRA 2V7QA 2ZRAA 4D4LA 2CHQA 1T9HA 4NYIQ 3AF2A 3B6EA 4A8JA 3WNDA 3EAQA 1GUAA 4M9ZA 1YRBA 821PA 4MH0R 4C4PA 4LJ8A 2E9SA 5EUQB 5TDHA 3I62A 2REBA 3CKLA 5L3QB 1ZD9A 3P32A 3SOPA 1U90A 3LD9A 1QHXA 1E9DA 4NL4H 1S1CA 2BDTA 3H86A 1BOFA 2J0UA 2MSEB 3PV0A 2ZPTX 4Q19A 1JR3E 3UATA 1S3GA 1KNXA 4KSBA 3DM5A 2FNAA 3I5YA 2VQSA 3U60B 1ELOA 2IEZA 4II7A 1TX4B 3LX5A 1XB2A 4IXMA 5KPJA 1D2NA 4BFUA 2VP0A 3AP1A 3PG5A 4F93B 4IFBA 1KDRA 2Z43A 1P2VA 4PR0A 4PC2A 2ZE8A 1VYVA 1OYYA 1CP2A 2BBOA 4LYHA 2QQEA 4O25A 2YOFA 2WPDD 5C18A 4N3NA 4DLSA 4B3DA 1E2EA 2ZI9A 1N25A 2C98A 4HLCA 3BFVA 1FZQA 4XTCS 3UMRA 3HU1A 4FMDF 4C0BA 1NN3A 4QBGB 2DYKA 1W4BA 1XXHB 3FYHA 3CRQA 2ZJZA 3GCGA 2EWVA 2KB0A 5FTJA 3RSOA 3EZ7A 4QBFA 1SVMA 3NDBB 4OI1A 2OCYC 4Y0VA 2ZR7A 4R2HA 2CVFA 5IRCD 1KGDA 1QF9A 2ZI6A 1JR3D 4TTQA 5FOUA 3V00A 2JA1A 2O8CB 1ZNXA 2V9PA 1KMQA 2GILA 1SVLA 2JLYA 1NLFA 3KJEA 3VNVA 1ZM4A 3T61A 2AFIE 4URWR 2Z6VA 3AKCA 4TLCA 4QGHA 2VO1A 2AX4A 1H8ED 4D80A 5FOWA 2O0HA 1ZM3A 3KKQA 1NF3A 1XNJA 1G5RA 2OFWA 1PJRA 2HLDD 4HEJA 1OV4A 2GNOA 1ANKA 5JFGA 5KU1A 4MDEA 4B73A 2IYZA 1BH2A 4ZCMA 3VFDA 2B8WA 1R5OA 1W5SA 4DLXA 3EA5A 2WSSA 3OIUA 4UNRA 1PVOA 5EXTA 2ZS8A 4PO8A 2ZU6A 2WVJA 2QP4A 2WJJA 3L43A 1T5IA 2OE2A 4PAOA 4Z51A 5JMTA 5EQTA 2J7KA 3K70B 2JJ2D 4US2R 3NTUA 3ZVMA 1CRQA 4BFZA 2AFHE 4M1OA 3CPJB 4MUAA 1SVWA 3QKRB 1R8QA 3EIEA 4H1UA 1NVUQ 1KDOA 2CVHA 4E09A 3O8BA 1Q1QA 1E79D 1OPXA 1KK0A 1OT3A 1LNZA 3BH0A 3A1SA 4UXHA 4ABYA 1OH6A 4QM6A 2W6JD 4F38A 1UKEA 4TTPA 3F8TA 3SJZA 4LK2A 4JJZA 3VU9A 1JB1A 1S9DA 3OE7A 4B71A 2G9NA 5LDDC 4Q48A 1G3IA 2ZITA 4FMBB 1S0UA 1F2TB 3R9IA 3QE0A 3RS0A 1XBTA 2J59A 5JJIA 4K46A 3U3RA 1AKEA 4JLOA 3QF4B 4QHSA 2RAPA 3PFIA 4HAWA 2BHRA 3V4RA 3E5HA 4BFXA 2FJUA 4ZPXA 5FPKA 4OHYA 4JVSB 4US1R 4KYIB 4MYCA 3T06B 1JQLB 2ZRFA 3FKSA 1JAIA 1G16A 3SS8A 5DI9A 4IOKA 4BQSA 4QGGA 1U81A 1L2TA 2P3SA 4B2PA 2Q9CA 3W8NA 5GJBA 2Z0MA 4BRUA 1UM8A 3GJ7A 1JXOA 3QSYA 4PQRA 1ZMXA 1ESMA 3WYAA 2QTHA 1TF5A 4BFYA 2ZRKA 2FFHA 2F1RA 2IYTA 2GVZC 4FCVA 1E2LA 3ICQB 1EGAA 3JVVA 5CDFE 3LW7A 3AH8A 1N0WA 1II0A 3ONWA 4DLWA 2PLRA 5J4LA 3VAAA 1CRPA 5DI3A 3Q72A 3SYNA 5TV2A 1CR2A 3NXSA 2IYYA 1XEWX 5JBQA 4TYWA 4JS0A 3GLGE 3IO5A 4KAXA 4LHWA 2ZM5A 1LTQA 3B1VA 4IDQA 2IYLD 4LJ7A 2V6JA 4LJ9A 3W5JA 1KJWA 4RFSA 2JLXA 1OXXK 2ZSEA 4FD2A 1DBSA 3NEJA 3AF0A 2QTFA 1S4QA 4HLQB 4NPHA 3W9YA 1CF4A 2OLJA 2OCAA 2ZJ8A 3TR0A 3DVLA 3VR5A 3FE2A 3CBQA 1XEFA 4J0QA 4L9WA 4D2IA 2ZQ5A 3RS4A 4B75A 4EJSA 1E0JA 5JWHA 2W00A 3IDQA 5FI1B 3VHXA 1XTRA 3NC0C 2BIFA 3THWA 4R71A 3TQCA 3TQFA 1E2HA 3EG5A 4L9SA 1JALA 2NZJA 1VPLA 4M9XA 4B6EA 4RJLA 1Q12A 2RGAA 1W36D 1OXSC 2Z4RA 3B5JA 4FXPA 4OI4A 2VHTA 4XJXA 3BWDD 1XPRA 2ZYUX 1TAGA 4EJSB 3LQQA 4ASUD 1MR3F 2FE4A 5HKKD 3AF4A 1VCIA 1SHKA 2ANBA 5KDOA 1XEXA 5EP4A 5DH9A 3RDPA 3CWQA 1X3SA 5HTKA 3Q85A 3KB1A 3PENA 4JL6A 5KNBA 1T3SA 2ZS9A 4I4LA 4RKFA 2GWHA 3LBHA 2QT0A 3MUFA 1N5IA 1ZYUA 2MMCA 4D4MA 2JJ2A 3NKVA 1ZW6A 4JL8A 5FOSA 1II8A 3U3JA 4TQ9A 4ESHA 1RYFA 4DUGA 5BN5A 4DEYA 2F55A 4C7OA 5TY0A 2CHVA 5CYPA 1RYHA 1E2MA 2VHJA 3IIJA 4L4UA 5HCIA 5KOYA 4MRPA 4G5SA 3PVSA 3TGPA 3HJNA 1P73A 2RB4A 2Q9AA 4LWZA 5TARA 1FQJA 1M8PA 3ZZ0A 2IX3A 2PZEA 4LV8B 4CT4B 1D2EA 1HE1C 1LF0A 2I1VB 4IVPA 2FFAA 2RCNA 3FHOA 1A5TA 3BORA 2YOHA 3DDCA 2IBMA 4NU0A 1RZ3A 2XEXA 4NMMA 1MRNA 3KKOA 4AURA 1Z28A 1W0KD 4WVFA 4OL0A 1E2QA 3EIQA 4LBWA 4FWIB 5JJLA 1F3OA 3DMNA 2D74A 1SVKA 4D26A 1YQTA 1N0UA 2FPMA 3LVRE 1FFHA 4OHVA 1KI6A 1QDEA 2R6AA 3B7GA 1EX7A 2D4HA 1NBME 5AJZA 1HTWA 1P60A 4I99A 1Z6AA 2WOJA 4JKYA 4OHXA 3ADBA 1V43A 2ZYVX 5LPNA 3A37A 1UEIA 1FL9A 1QRAA 1V5WA 5BYJA 1P7CA 3RC8A 3CX6A 5IHPA 3ZVLA 5SZKB 1NN1A 3L2OB 4OQXA 3I8SA 5FPHA 3NHAA 3QPVA 1P9NA 4Q21A 4A9AA 1R4AA 4OBEA 4NYJQ 1KY3A 3LW8A 4AKHA 3CF0A 2GEDA 2IYXA 4EFMA 1YZNA 2V8OA 2GZHA 1W48A 4EAQA 2G6BA 3VKHA 1K8RA 2A9KA 4TQUS 3FTQA 5DI3B 4H1VA 1Z5ZA 4Q7JB 1IAQA 4WA7A 1NKTA 4IOMA 3SU8A 3AB3A 1PUIA 3SDZA 4URVR 4BRWA 3PEWA 1QZXA 1XCGB 5EXSA 5AWFC 1OFUX 4AKIA 3B2EA 1GG2A 3PEVA 4MRRA 3AKEA 2JLZA 4Y0AA 4Q4LA 3GJ4A 2FPKA 1EXMA 2OCPA 4DIEA 4EJSC 3QF7A 5H68A 4YXWD 2XGJA 3P27A 3VNUA 4PPGA 1Z47A 4JMPA 1WMSA 3BS4A 2ZTSA 4JBXA 4DEXA 1AM4D 1DAKA 2CXXA 1CR1A 2FWRA 4CEJA 3B1XA 2IEYA 2V1XA 4DSTA 1E2JA 1DG3A 1KI9A 2OO7A 1Z07A 2H5EA 3THXB 2QZ4A 3UWKA 4EPRA 2QMOA 1U9IC 1GOTA 1FNMA 1FOEB 3E70C 4JYBA 4A0RA 2I3BA 3QVVA 4TMTA 1I4TD 5DISB 3VR2A 3AVXA 1UADA 1DADA 5J47A 4U00A 1E6CA 2QP9X 4FIDA 3VX3A 2WJYA 4R98A 2ZAOA 4TMXA 4DCUA 5AJXA 3PR1A 2D62A 1RKBA 2O5VA 3H1TA 1U99A 2LKDA 4TMWA 3RRYA 4BASA 4DLRA 4F92B 1U9IA 2UVQA 2VF8A 2DCUA 4UNPA 3BFXA 3PIRA 2FGJA 3L8YA 4Q1FA 2GETA 2ZUDA 2X2EA 1R0YA 1W36B 2FSHA 3QY0A 3B1YA 4EPYA 2DFKB 4HZIA 4B3GA 4EUNA 5CLQA 3SYLA 3PJRA 1SULA 4GZLA 1RRGA 5B2ZA 1SKQA 4GI7A 3GLFA 4JVMA 2RHDA 4NDZA 4ARZB 3NBFA 3GP8A 2GXSA 4RD4A 4QG7A 5C4GB 2OFOA 3CRW1 1ZUNB 4PAQA 3REFA 1SXJE 5JWRA 3EC2A 2WAXA 3CUEF 4Q00A 2ONJA 1N6IA 1N6HA 1W49A 4PQFA 3GJ0A 5BWMA 1D8TA 2WSMA 2ZVQX 3H2YA 3BK7A 2LCFA 3EIHA 3GFPA 4M53A 5HE8A 4R9UC 4YONB 1DO0A 3DL0A 2ZYWX 1MH1A 2CJWA 4IVRA 1X8JA 2P6NA 1ETUA 4OI0A 1X8KA 1QHIA 1N5LA 1NRJB 2GJSA 3FDIA 5FOXA 1KNQA 4Q4JA 3NVAA 4CRWB 5EXXA 1XXHE 5EZ6B 4JLBA 3TE6A 2EFCB 3UMFA 2WWHA 1W2HA 2KI5A 3ECCA 4TYNA 1EWQA 3BH7A 4RSGA 4AYTA 3FKQA 2BWJA 4O3MA 2XX3A 3QIAA 3IHWA 1E2FA 2ZI7A 4IOJA 1RC8A 1XTSA 2ZIAA 4ZI3A 2ZUBA 4D6PA 3T1VA 4PAMA 4ZDJA 4URXR 4JLDA 1B0UA 1R0WA 5H1YA 3U3OA 3WRYC 2CK3A 2CLCX 5FOTA 5FPSA 4LV6A 4DDVA 2JLUA 1TL7C 3OF5A 4NCKA 3A1WA 1X6VA 1G20E 4GP7A 4G5RA 1KI6B 4LBYA 3N2EA 4DDUA 2O0JA 3AGPA 4G1UC 4Q9LA 1OH7A 2ZEJA 4M8NE 3Q9LA 4IDOA 2RGCA 3RLFA 5JWOA 2CJWB 5K8LA 5F9HA 4N1AA 5FBQB 4L5BA 3MJHA 2VHCA 2VH5R 3W6PA 2ZRBA 2HDNB 2YC4C 4YMWA 4YMUA 3AUYA 2OXRA 1YZUA 3OEEA 4G5QA 2RKOA 2V4ZA 5AJVB 3CB4A 2GAOA 1DOAA 3QJYA 2Q6TA 3FFBA 2WPDA 3TUIC 3X1XA 3EPLA 1IN8A 1VG1A 2NIPA 2WIAA 2YWHA 4RD1A 3BERA 3IILA 5DE3A 1GNPA 2GK6A 5AK0A 1GRQA 4KODA 3BB1A 3RVBA 3TUZC 4QJ4A 3SBDA 4I1SA 4LC0A 1HT1E 2OSBA 1XZPA 4YXWA 3U4QA 2DR3A 1T8TA 3K9HA 3DOFA 4W7SA 4Q7LA 3KFXA 3GMTA 4MYTA 1W0KA 4PC7A 3QG5A 3KXIA 2R9VA 2G0TA 1OHHA 4WXRA 5K8TA 4BFWA 2F1IA 2VRWA 4YLGA 1Y63A 1LF5A 1NIPA 3VKGA 1K6MA 4GMDA 5EE1A 4GDFA 4DDWA 4NKRA 4M1YA 2D7CA 5HR5A 5E7IA 1Z6XA 3K0CC 4IEEA 2G1KA 4RZUA 5CK5A 2YWGA 4V0ME 3TNFA 1GFIA 3G0HA 3ZYCA 1KMHA 1Q1BA 4GOJA 1E9SA 2J0VA 1NY5A 3MWYW 5L3VA 2IHYA 4A4DA 2O8CA 2JDIA 2QROA 3KJGA 3RHFA 2IC5A 2QQ0A 5EUMA 4KLZA 2PMDA 2WHXA 4W5WA 4HI0E 4XOIA 4B2LA 2R6CA 1N0VC 5JEDA 2W58A 4LJ4A 4V03A 1FPMA 4M22A 1CJVC 1KSGA 2A5JA 2ZU0C 3HYTA 1QBKC 4ILEA 1GSIA 3QKRA 1PZNA 2J45A 4TLDA 1YRAA 5JHGB 1E0SA 1OXVA 4O2LA 3ADKA 2WBLC 2BEKA 1A4RA 2YINC 1YVDA 4Q4HB 2QAGB 3B85A 3SR0A 5L8VA 1J90A 1Q0UA 2QPOA 3H0KA 4M4SA 4WW0A 2IK8A 4PX9A 3O47A 4MYUA 5JLJA 2FEOA 2GJAA 2GJ8A 2Q0HA 1BIFA 4V0OA 2A5FA 1Z0AA 1R6BX 3W3AA 5BN4A 1CJKC 4C0SA 1IBRA 3THXA 3K53A 4HUQA 1CJMA 2AKAB 3CNOA 4PC6A 4GSYA 4D4KA 1KI3A 4YC7A 2DHRA 5A4JA 4KHZA 1JEEA 1I2MA 3LFUA 1T3HA 4WOPA 4PHGA 4OQFA 1U8YA 4V0LA 5EZ5A 3PUWA 2WJHA 4LYJA 3EX7C 5B57C 2BVNA 2ZE6A 2P0EA 2RGEA 2RGNA 4DUGD 1E96A 3BRWD 1A7JA 3TAHA 5AUPB 4HUTA 4MKIA 3F3YA 2X77A 4D81A 1F2TA 2QENA 4YDHB 4G01B 3W3ZB 4I1UA 1KDPA 1TNDA 3L82B 5F98A 1HH4A 4UXIA 2XOKA 5EP1A 5A5GA 3U7GA 5HZHA 2AWOA 3C14C 3C4JA 3ZDQA 1Z83A 4LUCA 4ARZA 2IA5A 3ASYA 1PUJA 3GLIE 3IUYA 4Q1EA 2W2XA 2F3TA 3CR7A 2XSZA 4LYFA 1JPJA 4B43A 1SKYE 4Q4AB 2F6RA 1G64A 1T0JB 3I92A 4DC9A 2FU5C 2ZR9A 1W36C 1DG1G 2AD5A 3AVOA 5DLQC 3WNCA 3ASZA 4DB4A 1NKSA 3LXRA 1SZPA 4WZBE 1EK0A 1P4SA 2IS2A 2H18A 4S2EA 3CR8A 4KV9A 2W2TA 3UG6A 2H16A 1OIXA 4HAXA 4KFUA 2X1VA 4DZZA 5SZIA 4URZR 1DAFA 4MGYR 2XSZD 1NVVQ 1WBDA 2J5XA 3K09C 4HZUA 1KO5A 1FX0B 1NVWQ 3GEHA 3LLMA 3U2QA 3ND8A 3S1AB 3GPLA 3SE0A 2BMFA 3K9GA 4ZCLA 4AIIA 1LB1B 4PFSA 4D0GA 2YHSA 5CB8A 4B3BA 2RGXA 2XOKD 2C99A 1TQ4A 3V4FA 1VCMA 2JAQA 2P5TB 2BM1A 3K0EA 3PUXA 3L0PA 1KI1A 2JGNA 2O8DB 3FMPB 3KL4A 4DCNA 3ZS8A 2EFGA 4W5JA 4KFRA 2FSGA 2ZI3A 3D6TB 3WXMA 1E9AA 2GJ9A 3R7WA 1Q20A 1T6NA 2WMOB 4UNQA 3VR1A 2DFNA 1AS2A 1UBFA 4N0DA 2A3RA 1YZLA 5KSYA 2XB2A 4Q9HA 4TN1A 1SVIA 3AUXA 2YNMA 2FF7A 4M2LA 3KKPA 4TWZA 3ZIAD 1RIFA 4K81B 2QTVB 3K70D 4IJMA 4Q9JA 2QAGA 2P67A 3OIVA 4EQ6B 4GPTA 3AKDA 3O8RA 1NLZA 5P21A 4QKQA 3CZQA 3H4MA 2VP4A 4MDFA 2W6JA 1VG0B 3RRZA 4EFLA 1A2BA 1Y3AA 2OBLA 2HT1A 3ZLJA 1ZCAA 2QAGC 4M1SA 1VHTA 1FX0A 2ZSAA 3WNBA 1A2KC 2WM9B 4GRAA 3WBKA 4P32A 4UJ3A 1TTTA 2XXAB 1NVXQ 2VP6A 5L3RA 4JLAA 5JCZA 2ZRJA 5JHHB 3LAWA 1IN5A 2OAP1 1IONA 2ZRIA 1T0HB 1P72A 1UBCA 3RS3A 1RJ9A 4CF7A 3TSOA 4DCVA 3MCAA 4D82A 4EKDA 4LY6A 4NHOA 4PZZA 1EWRA 1XJCA 2R8RA 2YWEA 2QMUA 1YZQA 2ODWA 2HUPA 3IPXA 4QL3A 1M34E 1Q3TA 5GJWC 5FTKA 2N46A 1A1VA 2C04A 2ZRGA 3DEFA 4P4UA 1L7VC 4WIAA 5DSZA 4BGDA 4LPKA 3PEYA 2GAAA 2GESA 1VTKA 1GRRA 1XD8A 1Q21A 3TRFA 3A8TA 1G8FA 4EQ6A 3C41J 3SJCA 1M7GA 5DNYB 2K5UA 1D5CA 2WWYA 1W1WA 1H8EA 2YZ2A 3BAFA 1P2SA 4Q9KA 4ACAA 2ZJOA 4Q1AA 3ZZTA 1DELA 1KKMA 3IPYA 3QXHA 1P61B 2CL7X 4MGZR 5HCNA 5F3WB 3HU2A 2X19A 1NN0A 4Z54A 1OSNA 1N5JA 2WWWA 1OHHD 1GL7A 3AEZA 4JLJA 2VHQA 1KKLA 2G88A 3KZ1E 1R0XA 3Q8XB 4LBVA 4JT4A 1IJFA 2J3EA 2QI9C 4JZKA 2EFDB 4CEHB 2YYZA 4M1TA 1NL3A 2EVWX 2WTUA 2WKRA 4HYYA 4BEBA 3FHTA 4JKIA 1UKZA 2BBSA 3JZMA 1ZM7A 1VHLA 2NG1A 1LS6A 2RH5A 4TLEA 4D0NA 1YZTA 3FVQA 2KJQA 4UQOA 3RRNA 3ZJYA 1FMJA 5G41A 4WBSA 2OILA 3KXLA 1VG9B 1JNYA 5EE0A 4BPBA 4MYHA 5D3MA 4IEIA 4P4SA 1DO2A 2WZQA 3VU9B 3WHKA 2QNRA 1OLOA 2HCBA 1JECA 1WE2A 4IDHA 2NPFA 5JECA 5AUNB 1WQ1R 1R0ZA 1EFUA 4OKSA 4QGFA 2FV8A 3BJIC 4FMCB 4L8GA 5E7MA 2O8BB 3QF4A 2QE7A 4NYIR 1VIYA 4ZIRB 4ZKDA 4LX0A 1S9HA 2YKGA 2W2VA 1TU3A 2GDJA 2NOAA 4MRVA 1BYIA 1YR6A 3HYRA 2OG2A 1XPUA 3FPAA 4KFTA 4KCGA 3AGQA 1YHNA 2G0NA 4DLVA 2D2FA 2GEUA 3AV0B 4AK9A 1G6OA 4V02A 1NVVR 2PZGA 4LJAA 2Q9BA 2VSXA 2ZRHA 4E22A 4CEIA 1T91A 1NP6A 1Q1EA 2CCGA 2AKYA 2R2AA 3LNCA 3OEHD 4LDJA 4WZ6A 4LCBA 3CNLA 4IDNA 3RANA 4RFVA 2E87A 4DLTA 4CEIB 3CO5A 3ZH9B 2F9MA 3LBNA 4GL2A 3EA0A 1AQYA 2NO0A 1Z08A 5B30A 1HYQA 4XVRA 4V0KA 2NO1A 2GXUA 3P26A 3BH6A 4MITA 4M1KA 4OQMA 2BBWA 1F60A 1ZP6A 1HY3A 1OFTA 2VA8A 2O52A 3I5XA 4B35A 3FHCB 3R20A 2OZEA 1YZGA 3OIWA 1EESA 4YDSA 3SC3A 3U3MA 2C9CA 4KBGA 4C3ZA 4LYAA 1R10A 2I4IA 1XPOA 1OIWA 1RE0A 1XTIA 2QSZA 3FWYA 1GILA 1ZU5A 3WHLA 2V3CC 1GNQA 4HATA 4XSHA 2QAJA 1W47A 1C1YA 3NG1A 1ZNWA 3K0FB 1G4UR 2NQ2C 2ZRDA 1ZUHA 4TSFA 3W8RA 3FOZA 3WRXC 4GT1A 1P3JA 5JSZB 3WMFA 5E95A 4QHYA 2VSFA 5BQ5A 1U8ZA 1Z0DA 3N2IA 4PZLA 1QG4A 3QOFA 4DVGA 5LB2A 4AY2A 4A6PA 3KQKA 3TW4A 1MABB 2X2FA 2VP2A 3WY9A 3GJ8A 5C46F 2JLSA 3LRPA 1M7HA 2ZAMA 3T1TA 2QU8A 1TF7A 1W4CA 4PSKA 2ZANA 4XSGA 3KB2A 3M1IA 1UPTA 2J9RA 3RYTC 3QBTA 2AXNA 2PCJA 3OFNA 1W0JA 1HQYE 4IVQA 4TL9A 1M7BA 2W83A 3F5FA 4PHFA 1ZUIA 2EYUA 1JPNA 4IDPA 2P6RA 1N5KA 4A8JB 2C9OA 2D3WA 1OW3B 3NIBA 1KZ7B 2ODNA 2QY9A 2XNSA 2VP5A 1VDZA 4TMZA 3T5GA 5L3QA 3EWSA 4OJQA 2UZ3A 5FBVB 3AKYA 4RD2A 3ICEA 2EFHB 1CJUC 5FTMA 2OUKA 1G7TA 2CCJA 3GEIA 1SXJC 3WMGA 1VMAA 1XP8A 5FPYA 3OAAD 4KO8A 2J7PA 2J87A 2EYQA 3LDAA 2VF7A 4HAUA 4LPSA 3SHWA 2ZJ2A 2AD1A 5DN6D 5JI3E 3CIOA 1EFRA 1CLUA 1Z6TA 2O0KA 2W6ID 2NO9A 3B1WA 3EWAA 5TMPA 5J4KA 3WYGA 2F1HA 2IXGA 2XTNA 1YU9A 5CJPA 1R5BA 1JAHA 5CLLA 4C2UA 3KFVA 3HPQA 3K09A 1VIAA 4JBWA 5DHFA 3I3SR 1TMKA 3TMKA 1G7RA 1OYWA 2FN4A 1N6RA 4UJ5A 4NZYA 3EXAA 4BFSA 1G8HA 1E2PA 4OK3A 4A36A 4PPNA 4F4CA 4PO1A 2JLVA 3HR8A 3CRVA 1I2DA 4OHWA 3RC3A 4I1VA 5GJVC 1PLKA 1MRSA 3C7KA 5SZHB 4LRWA 4OI2A 1KYIA 2B8TA 3MD0A 1M6NA 1XMJA 1E2KA 1NNEA 1LW7A 1Q44A 4QRHA 2FMXA 1YE8A 4B33A 4B2IA 4BUJA 1QHGA 3BBPA 2W0MA 4Q1CA 5FBRB 1II8B 1DE0A 1J70A 3QQ5A 4PC1A 3THOA 3I72A 1NLYA 1P62B 1ESNA 1Q22A 1E1RA 4I1OA 1GKIA 3RS5A 2O8EB 2QA5A 2WIBA 4DBLC 4PHHA 1F2UB 3TAUA 1GWNA 1H8HD 3IIKA 3BFKA 2CE2X 1E9CA 5CK4A 4Q47A 1KAGA 4OQNA 4L15A 2ZR0A 1H8HA 1KO8A 1JQJC 2FOLA 3BB4A 3KTAA 5C1BA 4TL7A 4EPVA 1MKYA 3O8CA 1G5TA 2V54A 1JR6A 3QKTA 4DB2A 3UWOA 3IGFA 1OB2A 4AI6A 1P2TA 1WP9A 3EZ2A 3UMSA 3KKNA 1VYUA 3GLHE 1I4LD 1KO4A 3QNUA 1G3MA 4DLYA 3SNHA 1TQDA 1AIPA 1KI8A 3R9XA 2PEZA 3LO5A 2GKSA 4DRZA 1N6NA 4GFDA 4PPFA 2NTYC 3K70C 4F4JA 4A6XA 1UBEA 3QBVA 4B76A 1E3MA 1M1YE 3PQCA 3DKVA 2GCPA 4BWYA 1NG9A 4MRNA 4B3XA 4HZUB 3KKMA 4GOXA 1E9RA 3X1YA 1ZNZA 2PMKA 1AN0A 3WP0A 4Q7MB 2FZLA 1HEIA 3TR5A 2ZJ5A 1US8B 4QBIA 3T34A 2ASEA 5HKKA 1U0LA 4UNNA 5TB5A 4ASUA 1KOFA 1TEVA 2IF2A 2ZREA 1G1MA 2E1RA 5CITA 2CHGA 2R44A 1G8GA 3JZAA 3VX4A 5BW8A 1UKYA 3KQHA 3A1VA 2GA8A 2A2ZA 1Z0IA 3B9PA 1ONBA 2J7PD 1E99A 3KX2A 4P33A 2DY1A 3ZVNA 3QENA 2ECKA 1SXJA 4ERNA 4CYMA 4DCSA 5E3HA 4NCNA 4DSOA 5B58C 4NBSA 2PLFA 3LWNA 1Z22A 2Y8EA 3SBEA 5CB6A 4TZ6A 4AKEA 4OK6A 4ACBA 1J8MF 1N6OA 4DSUA 1GIAA 3OZXA 4QM7A 4JLNA 5IK2D 4YMTA 3CRMA 2UKDA 3SZRA 4ZKEA 1FP7A 4CEJB 3B13B 3ZS9A 2GVDC 4TLBA 1WBBA 2FGKA 4XWKA 3PCRB 2KE5A 3EASA 3GQBA 4C7OB 5IDVA 1XX6A 1IXRC 5A0FA 1XFAA 2O8FB 3B8HA 1QVAA 1NMXA 2DBYA 2O8BA 3GLGB 5CM9C 1E2IA 2IUSA 4TL8A 2AL7A 3K8YA 2JCSA 3GJ5A 1UKVY 4TYQA 2C77A 1VCNA 1OKKD 4C0LA 1W2GA 3AF3A 4IW3B 2QG6A 3HPRA 2HV8A 2ATXA 1QHSA 1S1MA 1S2MA 1OJLA 2GF0A 2JIZD 3CPHA 1WB9A 3IBYA 2HF9A 4XVUA 5FI0B 1CU1A 2QRZA 3OE7D 3CW2A 5LD2B 5JCPA 1C9KA 3I1FA 2FG5A 1IY2A 3I8XA 2EW1A 4BLSA 4PTLA 1D9XA 2C95A 4FI3C 3A36A 4F7WA 1S8FA 2F9LA 3K0AA 4QGAA 4TMVA 1TQ6A 2FSFA 3VR4A 3TVDA 2DWOA 2MSCB 1KY2A 4DKXA 1OFIA 1E2GA 3AVUA 2XZPA 1CIPA 1TF2A 2XITA 1S3SA 3R8CA 4BLOA 2GK7A 1BYUA 1WF3A 4XWOA 3V9PA 1CJTC 5AJWA 2P65A 3IEVA 2AWNA 1TQ2A 3CWZA 2Q3FA 2OBNA 1CULC 3RAPR 1WA5A 4KYUA 4CIDA 5KSOA 4HSEA 1MT0A 1UDWA 1XD2B 2FSIA 3DKPA 3P4XA 1GRNA 2AN9A 3U61B 5KTYA 1G3QA 3D31A 1W44A 2GBLA 1JBKA 2HLDA 2XB4A 3DMDA 5DIFA 3L0IB 3P20A 5DGXA 4DXAA 1M74A 3X1DA 2B7CA 4GP6A 1E4YA 4TLAA 4FMDB 1O87A 3QXXA 3UK6A 1ZBDA 2R6FA 2R6GA 4HB4A 1OKKA 2QP3A 3VR6A 2EFEB 4BZXA 3RSLA 3REGA 3C5HA 4A92A 2BCGY 4LC1A 1RW4A 1NJGA 5KO2A 3QEJA 4PSVA 1YR8A 1MO6A 1XJQA 2IW3A 4MQBA 4LHXA 3U6KA 1TU4A 1E69A 2IF0A 4LV5B 4S35A 1ZAKA 1AGRA 4URYR 3TVTA 5M04A 2IYSA 4P4TA 2XJ9A 1DEKA 4FW9A 2WOOA 3QVUA 1YJ5A 1FTNA 4ZDKA 1BKDR 3B60A 3N5CA 4Q1BA 4EPXA 3GLHA 1DAGA 2HXSA 1F2UA 3QKSA 1Z2AA 1N2CE 3Q7QA 1OF1A 4JLPA 3C5CA 1E98A 5ANRB 1VYTA 2J0UB 4KVAA 1G9XA 3T5DA 1BMFA 4FMCF 2D2EA 3PITA 4E07A 3D8BA 1NMYA 3D3QA 5EJEA 3R9WA 3UIEA 5G3YA 4KU4A 4AG5A 3J81k 1XD2A 1ZNYA 2C9YA 4JSYA 2C96A 1Z63A 2QN6A 5IF9A 1P5ZB 2GXAA 1BO6A 2IUUA 4G5OA 2OLKA 4RD3A 4NH0A 5KSPA 3VR3A 1I4DD 2NO7A 4JVNA 4BLPA 2IS6A 1LS1A 2NPIA 2BEJA 3W90A 4ZO4A 5KNCA 1KK2A 1GL9B 4B44A 2GZAA 2NGRA 4ON9A 1ZM2A 3SYKA 3TH5A 3EW9A 2ZE7A 1N3BA 4OK5A 4HDQB 1E2DA 1FNNA 1GKUB 4NTZA 4QOSA 2GCNA 2FDCA 4NCIA 2ZYTX 5J40A 2ZVPX 4KFSA 2JJ8A 4I81A 4FINA 2ZRPA 1ZD1A 2QEQA 4QNRA 1G18A 4NYMR 2PJRA 4YMSA 1BMFD 5C2JB 1R7RA 3EPKA 1E0AA 4US0R 4BFVA 3GD7A 4MGKR 4U02A 2F43B 3K0FA 2IHBA 5AUQA 2DPXA 3WYFA 3LVQE 1RRCA 3MWLA 3T1OA 1XU4A 2VIIA 4TMKA 4LHZA 1JXMA 1M2OB 2ORVA 2RGBA 1KZGB 2QRNA 1U0JA 621PA 1XTKA 3CH4B 4HB2A 4R2IA 1P6XA 4EDHA 1IXSB 4BZPA 2F43A 2VP9A 2FZ4A 3ZD7A 1EFCA 2ODEA 4C0HA 1PLLA 1XD9A 2XTMA 1K5GA 4NE2A 4ZV4A 5JJKA 3IO3A 3K9NA 2Z5FA 2C2HA 1NN5A 3AVVA 1MO4A 1DAIA 2ANCA 1J99A 3T15A 3AVPA 3FMFA 4NYMQ 4IXNA 4NCHA 1KSFX 1SHZA 1UFQA 3U6BA 4M21A 3KJIA 4FCTA 2OM2A 1NBMD 4ESVA 1COWD 3RS7A 1IHUA 2CNWA 1WDTA 2N42A 4DSNA 4ZCIA 5HPYB 1IY0A 3DM9B 3GFTA 1TEXA 4XD7A 1KI7A 1KIMA 2O8FA 4D25A 3EZ6A 2F3RA 1NY6A 3UG7A 1LV7A 2G77B 2WJGA 2H8KA 2ORWA 5EE9A 4QNMA 4MA4A 1RPZA 1XWIA 2CE7A 3DHWC 4LGMA 3SHFA 1FMLA 2KBEA 3U7FB 2HYDA 2CLSA 1P75A 2ZRNA 1E9FA 3CPEA 1QG2A 2IYVA 4RY2A 4X8OA 3RRMA 4QHTA 2AK3A 4OYHA 3SJBA 3QPUA 4DT1A 1C4OA 5KDLA 3ZGXA 3X1ZA 2CL0X 1LY1A 4A1FA 1HUQA 2HJVA 1US8A 2JJ1A 5AJYA 3NBXX 3A6PC 2ODBA 3EZ9A 3KQUA 4ZDIA 3BOSA 4NP6A 1EFRD 4DWJA 1PLJA 2GJKA 3NH6A 1FW6A 4C0AC 5EP2A 4BE7B 3RS2A 3W34A 1DAMA 2TMKA 3GFOA 4MKGA 1OB5A 3P1JA 1QVRA 1KDTA 2A78A 1Z2CA 2NMVA 1XRJA 1E1QD 1AQUA 2VBCA 2IWRA 1CKEA 1QHYA 3HWSA 4ITRC 3A1UA 4Q02A 1T4GA 3BIFA 4Z1MA 5FL7A 5EP3A 1ZJ6A 2BCJQ 5K8IA 4Q18A 1G8YA 3JVUA 3NC1C 3HDTA 4X8MA 4A15A 5E7JA 5D3QA 1E9BA 5B64A 1CTQA 1U2RA 2ORIA 3OESA 4HDOB 4JSTA 5GJCA 3RABA 4B3CA 5KYKA 3KTAB 1N6LA 1XF9A 4EFNA 4W9MC 1ZC3A 1ZCBA 1KSJA 4BEJA 2ZI5A 3A1TA 3OFND 4Q03A 4CGZA 2BMJA 4WAUA 4OQLA 721PA 1W4AA 3CX7A 4A0FA 2BKEA 5JS8A 2J46A 2QPAA 4F4IA 3WP1B 1XMIA 2IS4A 1DAHA 3U7HB 4NCJA 2QBYA 2Q21A 5FOVA 1G3UA 3GLIA 4DHEA 4JL5A 4Q4HA 4RZ3A 3FMOB 2ZS7A 221PA 2XNDA 1KI4A 4TYPA 1GP2A 4PANA 3AP2A 3KUDA 1A82A 1F5NA 3A4MA 3C16C 2REXB 5L3SA 1PV4A 3LXXA 4Z1MD 3KQLA 1U98A 1FUKA 3MRSA 3TJZA 2PCLA 3MAAC 5EXPA 1AK2A 4A0HA 2DB3A 5EE3A 1SXJD 3HU3A 4KJZA 2ZETA 3FFAA 2D06A 1D6JA 4B48A 3B1ZA 2G1JA 1XCMA 2IYQA 5D3MB 1MO3A 4LJ5A 4EPTA 4KSCA 2OEPA 2R62A 3NDPA 4PO9A 2OXCA 4HAZA 1G21E 4BLRA 1E79A 1XJ0A 1AS0A 1HV8A 1XMVA 4AD8A 2BV3A 2NZ8A 3L0OA 1R5NA 2PJZA 1GZSA 3SFVA 4RD0A 1YR7A 2PT7A 1T5LA 4RFSB 4BECA 1OH8A 1ZIOA 1NI3A 4CEHA 2B6HA 3F0TA 4GOKA 1E32A 3BE4A 2WV9A 3SJAA 4HB3A 2PEYA 1HURA 3IIMA 1R8SA 1EG7A 4YMVA 2WSSD 2ZJAA 2VTKA 3ZD6A 2VYFA 2C78A 3LY5A 4CZ2A 5F2EA 1T3LA 4HLUA 3C15C 4DIDA 1S96A 3DO6A 1DTSA 3MLEA 3QXCA 1DVRA 3E2IA 3TLXA 5AUOB 5JEEA 1RRFA 3X2SA 1NBMA 4BFTA 2GRJA 2GCOB 2BM0A 2ZJYA 5G3ZA 1XMSA 4U5XA 1OH5A 2KBFA 5FUYA 2A7QA 1TPZA 4MGIR 5DHAA 2RGDA 3MMPA 5JRJA 2IL1A 3U44A 1NSTA 1HQCA 3PUZA 1JR3A 4P0TA 2QMEA 4C30A 3N70A 2QE7D 5FR1A 5FTNA 2P6UA 5BN3A 3THYA 4TYYA 4FWTA 1E0KA 1W5TA 1IOZA 5LB4A 2HEIA 2WWFA 1ZC4A 2PZFA 4HAYA 1VECA 4URUR 3C8UA 4XWAA 4C9BA 4P3YA 5E4FA 1KK3A 3B78A 3TK1A 4DLUA 3AM1A 3TUJC 2IXEA 1RVDA 2MSDB 4A2QA 4JIMA 1KAOA 4TTRA 1XEXB 5H8WA 2JASA 1IQPA 4RZ2A 2N1BA 4Q9IA 2UZIR 3GEEA 4HLDA 1Z0JA 3AF1A 4Q4AA 5J4HA 1IJEA 2C5LA 4LOAA 2RHMA 2ZROA 3R7WB 3VQTA 3DOEA 3GJXC 3Q7PA 2IWHA 1E4VA 3TIFA 2J0SA 1QHHB 1JJVA 1MV5A 2YC2C 4PPQA 4B32A 1UDXA 2HF8A 4UXJA 4DJTA 5JSZA 2WWGA 1T8UA 1E94E 2L0XA 5J5CA 1YZKA 4JLVA 4LJ6A 1TUEA 4RZXA 2Q3MA 3MGCA 2JATA 3PEUA 3UXMA 5KPDA 3KUCA 2CK3D 3PUVA 3W6OA 4GBMA 3U7EB 3SI7A 2V7QD 3DZ8A 2IYUA 5CJ2A 1XEWY 5GADl 1ZD8A 3T1QA 4KLNA 2F1JA 1OIVA 2CLDX 3MFYA 2CEAA 1WCV1 3MG9A 2GF9A 3EARA 4JVLA 4P31A 1KO1A 4TZ0A 2RMKA 1G7CA 2BJVA 2ERXA 4X8LA 4ZDWA 2H7VA 3HR7A 1MABA 1D2MA 3GJ3A 2GHIA 4JLMA 1B23P 1W4RA 3UKDA 1IN7A 3G82C 5KNDA 2WMNB 3ETLA 2CDNA 3TSZA 1W46A 1GM5A 3M4YA 3GLFE 2OV2A 3GLGA 1UJ2A 1NSFA 3AVTA 2QGNA 4KXFB 3UANA 1ZU4A 3BXZA 4BLTA 1UF9A 1QHHA 3TSWA 2ONKA 2JLQA 1OXTA 1SVOA 4O0MA 5EE5B 4C2TA 4HUQB 5LBIA 1IXZA 1AS3A 3MWKA 5JRZA 2YJTD 3K1JA 3LLUA 1GTVA 2P5SA 1AZTA 3CONA 3K0CA 1E9EA 5ELXA 5JS7A 2HT6A 4G3XA 4G0NA 4MRSA 4U7DA 5G40A 2WKQA 4AWXA 1FUUA 3KXKA 2B92A 2B7BA 4IRUB 4A82A 8OHMA 5AR1A 1K5DA 5C4MA 2I1QA 5FBWB 1XXHA 2QL6A 2FH5B 3KDSE 1IM2A 2R6DA 1CR0A 5FBLB 3WMEA 4F91B 2ZXUA 2XZLA 2XNDD 4LSGA 5F9FA 1X1SA 4PZYA 1Q1ZA 2FA9A 2VEDA 1ZM9A 3PXGA 2DWQA 2LWIA 2QGZA 4Z8XA 4IKEA 2ZUCA 3CRRA 1KSHA 4WXPA 2BC9A 1LVGA 5JZVA 2OESA 4RVCA 1KJZA 3I61A 2YV5A 2XAUA 1GITA 4JLKA 2FFBA 3MWJA 4TQAA 4B3FX 4D0LB 3AVYA 1VKJA 3VMFA 1GDDA 3GLIB 5IK2A 1CS4C 4FCWA 2O8EA 3ZQ6A 2J1LA 4PXAA 4KITB 1EX6A 4TL6A 1XZQA 3A4LA 3NWJA 3A4NA 5KSZA 2GEVA 2G83A 5FL7D 1KHTA 1JI0A 3OEHA 4C0QC 4E5UA 1FTSA 2IYWA 2JIZA 4QC2A 1GL6A 3M0EA 4DLZA 1HT2E 3W6NA 1E1QA 1LFDB 4TT3A 3QKUA 4Q66C 3QKSB 2P2LA 4QFMA 1VG8A 6Q21A 2RGNC 3A58B 4MUBA 1XTQA 2WJVA 1D9ZA 1F6BA 2JLRA 1DPFA 1FQKA 1NMZA 1Q3HA 4XH9B 4QJ3A 3R8FA 2CMKA 3MJRA 3TKLA 3BC1A 2QSYA 2HCJB 1SQ5A 2DFLA 5FTLA 2VHUA 1Q57A 4JBYA 1CBUA 2QT1A 3X1WA 3P4YA 5BYKA 3G5UA 1HE8B 2BJWA 4HDCA 1GNRA 1DAEA 3E1SA 5DO9A 2PX0A 3THWB 2KWIA 3KJHA 2CCKA 3FGNA 2PBRA
chains in the Genus database with same CATH superfamily
5AOCA 2YWDA 1RHJA 3H6HA 4RCYA 1UP4A 1KMNA 1JEDA 2XTZA 4L2IA 4LI0A 4B6PA 5KDDA 3WX0A 4MWGA 4RAOA 1GVNB 2C2YA 3NM4A 3OQOA 1XR3A 3ZY6A 2D5LA 2ZSIA 3DE6X 1GYQA 1MPXA 3KFLA 1ZS9A 4JB3A 4JUBA 1QONA 1JG3A 4ZAVA 3IXMA 2DWPA 2DR2A 3EPJA 2QVLA 5F2OA 5EEGA 4C6RA 5LA6A 2BKXA 3M5WA 5FWYB 1RLMA 4Z5XA 2FPSA 3LY8A 3FTEA 2O2ZA 2B9VA 2ERYA 2W8BB 1U3CA 3L8DA 3AEKA 1SKYB 4P3XA 4X71A 1VIDA 3TTWA 4S04A 5IT5A 1FYEA 2EW8A 2YZ7A 1YJBA 4LWQA 3R7LA 3SAJA 2YVKA 3HGTA 3W5BA 1O5IA 3EFEA 3Q2OA 4JN6B 4U2DA 1H1DA 1KJYA 5THKA 4K9SA 2ZRMA 3O75A 3KYCA 1S4MA 1QRTA 1NHWA 4KN8A 1ZKMA 4MROA 5DN9A 1E1RD 2H1LA 3GELA 2P9QA 3IEKA 3O8LA 4FZ5A 3KS9A 4NH4A 2IKQA 5TQJA 5B2EA 1JA0A 1SUSA 2AG8A 4QOFA 1ARZA 3IL2A 3EGCA 4RELA 5IBPA 1G38A 1E5LA 2J3JA 2PD3A 3BDVA 3L5OA 3L7DA 4BVBA 1LPNA 1WZCA 4XX1A 3BIOA 1L5KA 4D9EA 3QG1A 2JI4A 3CR3C 4U3JA 1MC4A 4YRQA 1I0ZA 2GZDA 3AJRA 3OHMA 4P84A 5DNVA 4D57A 2QX9A 5SYNA 1AGYA 3HDGA 1J8YF 1G6HA 4IHQA 3BXXA 4REQB 4XTRA 5CM8B 4KDFA 2AXPA 3O6VA 1ULBA 3ZC3A 4GXNA 1T5BA 4LXUA 2NUBA 3OUZA 3Q9NA 4FUTA 5F5NA 3V4OA 3VPSA 2R60A 2IEIA 3PJGA 3C4VA 4NFYA 4WXHA 2WJZB 3TQSA 3A6JA 3ULKA 1G5PA 4KUGA 4HAVA 3NFRA 2BSQA 5IPFA 3NB0A 2ABWA 5DYWA 2O8DA 2JEZA 1M6HA 3ACDA 2VBIA 4HLUC 2Y05A 2WAYA 4C3UA 4L51A 3EIUA 2GK4A 5IULC 5M7EA 2ZKLA 3OJLA 1L5HB 1VBFA 3FYUA 1ND5A 3T3OA 3T9DA 4YWJA 1IDOA 4OEHA 4AO8A 5EJIA 1FDIA 2MU1A 1OAKA 1RM5A 2XUHA 3CZPA 5BXQC 2GYWA 3L1HA 3AR6A 4V0MA 2FUG1 3U17A 4YUVA 3GPDG 1L4UA 5BNTA 1FRFS 1PJSA 3ZIAA 5A6SA 1SHUX 2V7TA 2HI0A 2GM4A 5KHOC 1UAAA 2HKIA 1JKMA 1G19A 3K9WA 5DRTA 5LIPA 3G17A 1DRUA 4OQYA 2ZRCA 4PQYA 2DFTA 4LJYA 2QS9A 1OE0A 2XNCA 2RHTA 3KQNA 2AUMA 4EEXA 4UM9D 4JCCA 1AQNA 3THYA 2B1RA 3LX8A 1CRZA 1J7KA 1YD7A 4OHZA 4B3HA 3W5DA 3K3PA 4RHUA 4MV1A 2BFBA 2QGFA 2ZB3A 3O5AA 1P44A 4LZZA 5KUTA 5HE9A 2R65A 5IVPA 2EU8A 5LD2C 1IXKA 2WLSA 1GAJA 3BMNB 4RJJA 4TUYF 5TVKA 4JQCA 3WIUA 2F67A 5JXIA 1E2NA 1Z3IX 1NZFA 4CCWA 1SU4A 1DARA 4JR0A 2ICAA 2J41A 2ORYA 5FFMA 1SCUB 3NHBA 3OX2A 4G5HA 1ZN8A 3KRTA 4M1WA 1P2BA 3FI9A 2PPVA 1OAAA 5AKHA 3SYRA 4IBOA 3UGKA 4YRTA 5KKCA 1UFKA 1MV8A 1VYHA 3EGEA 1CFZA 1BWPA 4EA7A 4Z2YA 2CSUA 3WL5A 3HM2A 5C1OA 5FYDA 3KDPA 1CUDA 2QN2A 1WOYA 3EGXA 2IQ5A 5EOVA 3HBNA 3FKSD 1U5BB 4KLCA 3OIFA 4KXYA 5HFNA 2RSLA 5CYGA 1QHEA 2R1VB 2ZTLA 3KQYA 4J9UE 2EZ4A 4D9IA 4GM1A 4B3GA 4AF8A 3I4LA 4NONA 1IEWA 3CSSA 2XA9A 1LQTA 5HKAA 1ZVVA 4RKRA 1Y48E 3W0LB 1NJ8A 3MPOA 4IMPA 3LZ6A 3WLOA 4DIBA 1J0EA 2DQSA 2PGNA 3ESRA 4LXQA 3AQ4A 4YCBA 3CJTA 4UUQA 3UPUA 1QYCA 4H59A 1UEJA 2PNJA 4XFKA 3B38A 1N1DA 3T35A 4EYEA 1NMEA 4GE3A 3NXKA 3E22B 5JG7A 5BWCA 2QM7A 2JJ1D 5JCOA 3UBMA 1DBQA 1S7GA 1FYWA 4RCZA 3LKVA 5BSEA 1E1MA 4JYCA 1A98A 3RC7A 4CW7A 3HHPA 1JQAA 1W0JD 2HRBA 2R25B 3OPYI 4B34A 2QORA 3B82A 2WHEA 3VU8A 3A7DA 3GA5A 1P1BA 2OHFA 4CDGA 4I50A 3RFUA 1WZNA 3ZW7A 4JUCA 4K8OA 4JH0A 5DM0A 2APJA 1NNLA 2ATVA 2Y2VA 2OYRA 4QXAA 1GKYA 4B47A 2XKBA 2G0AA 1HLDA 1ZN2A 2M9MA 1UINA 1U8AA 5AXBA 4TV9A 5J1SB 1W29A 3AINA 4QYIB 1NFRA 4KN9S 3DDWA 1I10A 2F4NA 2QD5A 3JWGA 2ZAYA 1EX9A 5A04A 2XXAA 4DC0A 4QBHA 3ETJA 4E7OA 4C4ZA 4PLCA 1P2UA 2PFSA 1RP1A 3PUYA 3JYQA 3RSQA 1O3YA 1EVEA 4AG6A 2Z4SA 4ZIRA 3PZRA 4RKEA 1O9GA 2V9ZA 4UHBA 3P0FA 3JARA 1COWA 2N0SA 3RB8A 1GUYA 2K7ZA 2AT1A 1BW9B 1IQ0A 4WLEA 4Z7NB 5DNCA 5K0CA 1UZUA 5EUBA 4ER5A 4V3CA 4KXMA 4N7BA 2ACKA 2JLWA 1P17A 3W5SA 3NMUF 3NATA 4I4TA 2C8VA 5KVQA 4KO2S 2REOA 1D1SA 2I7CA 2J9FB 2Q99A 4V1CA 1RFLA 2Q3HA 4O2AA 2FFQA 1TVCA 4KBFA 4DKJA 2AHOA 4L2IB 3E35A 3G6WA 4MQ4A 4XIGS 4GNKA 1YA4A 3SJUA 4LOKA 2G3YA 3LIPA 3E7FA 3L7KA 5AM2A 1P5JA 5BMOA 1KOGA 4KQ2A 1KTVA 1B15A 3NEYA 3I09A 5KHLB 5LXTF 2PWPA 3Q7EA 3I6ZA 2WJIA 4JUAA 4RE6A 2C9DA 2ZB4A 5E3IA 1YDMA 4KR3A 3CUUA 1AJEA 2PBRA 4YREA 1ZGAA 3VKWA 2VS1A 1ZIXA 4EG6A 5ILQA 5DJ5A 3CLUD 1QR2A 3IURA 4ZTBA 3ROGA 2RGGA 3QHAA 4PGMA 1MFZA 5LLTA 2ZJ0A 1YR9A 3G1TA 4F04A 4GWGA 1CUHA 3ZV6A 121PA 4UUBA 3U3KA 4EKNB 1OXUA 2FDRA 1L8QA 2WWIA 5AP9A 4DQDA 1W6UA 1MTOA 4QJBA 2W42A 3IDOA 3HVRA 5C31A 1U04A 1FUYB 2WIKA 3GU3A 1ZK3A 2OWDA 3L6UA 4HSGA 4PWZA 4YECA 1DIOB 1BCSA 2A57A 5ALUA 4FDUA 4ZJUA 3RC9A 4NYIQ 3JVIA 2A9JA 1XYVA 1LCIA 1YFKA 1OZFA 3B6EA 3IDZA 4M9ZA 3RS9A 4A8JA 4EAAA 4MH0R 1JTEA 1KHHA 2QVGA 4DCPA 2WEKA 2JHCA 2XDWA 4L28A 1CY8A 3VO1A 4H35A 4UM9B 1K06A 1NJ6A 4ZA2A 1U90A 4BNXA 3LD9A 1E9DA 1TK2A 4KAAA 2OUIA 2P2GA 4E33A 1UT6A 3PV0A 2ZPTX 1H6CA 2DGDA 3UATA 3SHVA 4HTFA 1V1MA 2FZEA 4LTDA 5E1MA 1GGMA 4FM9A 2BFFA 3U60B 1K27A 5AKGA 1VHWA 4XSVA 3LX5A 3FHJA 3KKEA 1VKHA 2ZBVA 3PD1A 4IXMA 4D8XA 1SKAA 5U1PA 4DUPA 5KVCA 3MOIA 2H2WA 2VP3A 4ZVVA 3RK0A 3U6KA 4PR0A 4AJ1A 4PC2A 2ZE8A 2QQEA 2NSDA 3AILA 4UAGA 4UFNA 5T3YA 4AY5A 4BQQA 1B8VA 4PLHA 4N3NA 4IGAA 4IKOA 4MYRA 4DLSA 5FBZA 3H7AA 3OKPA 4C6TA 4ZEOA 4AW9A 1N25A 2NTEA 4HLCA 3AFHA 5FORA 5BQPA 2OFFA 3WGQA 4JJ6A 2E3JA 3A0UA 1TIBA 2GLTA 2I3ZA 4RKYA 3EDCA 4FMDF 1NN3A 4NQZA 2DYKA 1J42A 1ORDA 1W4BA 1YJAA 3CH7A 3RIEA 1XXHB 3ZBPA 3LLCA 2ZJZA 3RSOA 1A7UA 4R01A 1T5TA 2V7WA 3DVQX 4CLRA 2X0IA 2H52A 2O2DA 3NDBB 2A4KA 2BMWA 3DB1A 5FFFA 4RMJA 1AF7A 4W5QA 2A67A 2ZR7A 3KALA 4J75A 2CVFA 3TD2A 1QF9A 2O8VA 2WM3A 1JR3D 4M37A 3VPBA 2FQYA 3EG9B 5LZ5A 1ZNXA 5JNLA 5E2AA 2IELA 4YJHA 1KMQA 1SVLA 1NLFA 2F62A 3KJEA 5DK6A 1NXTA 2QTLA 2EQ5A 1NXOA 4URWR 4R8LA 4OFZA 2P7HA 2L42A 1EVYA 2XRYA 4ZCRA 2O0HA 2CXSA 5JAUA 5KB3A 2Q4DA 4CUKA 1R0BA 4HEJA 2E7ZA 4GI5A 1G20B 1OV4A 2C5BA 4MWZA 4DSZA 2C4MA 3KTDA 1ANKA 5ALWA 4BYGA 3G9UA 1U1IA 1ZFNA 4U2BA 4WY2A 4B73A 4XEUA 4ZCMA 3BA6A 1XELA 2YHIA 4A6DA 1RKVA 4DLXA 3SDBA 4UNRA 1K2WA 4CMEC 4ZICA 2I4TA 1PYDA 2QP4A 1BVRA 2B2XA 3OPYB 1C7IA 1NA5A 5FI3A 5CD1A 4ZYVA 4PX2A 1RZVA 2INGX 2JZNA 1DJLA 4MWCA 4US2R 1BS9A 1Z45A 4H31A 4DS3A 2AFHE 2P9GA 4M1OA 3WG9A 3CPJB 3ST7A 4PYRA 3RREA 1VPWA 2X3FA 5SY6A 5B7QA 3EIWA 2OQVA 2PMCA 3DDUA 1R3DA 2ECPA 5B1YA 3ZWXA 2DBZA 4KMOA 3DP7A 5DGHA 4Z9BA 1Z74A 3HV0A 2RHOA 2B2NA 3JAKA 4E09A 2VC2B 2AG1A 1KK0A 1OT3A 5JOQA 1THMA 1WMBA 4NOMA 3A25A 3A1SA 5EWMA 3WA7A 4HQFA 3C7TA 1JKJB 1KYWA 7AT1A 3RW9A 3EXIA 3F8TA 1LDGA 3OZUA 3QFTA 2XQFA 2YY5A 3V32A 3OE7A 3CVYA 4JENA 4L6AA 2AN3A 2G9NA 3WLJA 5LDDC 1Y9AA 2ZITA 4HHEA 3KT0A 4G1VA 4YMUA 2GNAA 2XE7A 4FGWA 2A35A 5JJIA 3DLBA 4Y2SA 5BYBA 4K46A 4QEZA 5EWMB 3DV2A 3THRA 5DCLA 1L1EA 2RAPA 4NFHA 4HAWA 2UZ0A 2IHVA 5DBGA 3V4RA 2XIQA 4PNPA 3R2JA 4JVSB 4K9NA 4MYCA 5HMMA 2D1TA 4U2GA 5C8DA 1EP3B 1IHXA 3TSAA 1LKZA 1W19A 2Z98A 5D00A 2WF7A 3FDZB 3AETB 3GCZA 4MV5A 4BQSA 5GGYA 3ER9A 2XUJA 2X5OA 3C3JA 5GJBA 2OV1A 2ACVA 1N7JA 3AFNA 4BRUA 1TAQA 3RHZA 4YJFA 1LPSA 4J8PA 3GJ7A 2I3DA 3JZFA 4ISCA 4PQRA 2HV9A 3L8FA 2CMFA 3IUQA 5CHYA 1NWCA 1TF5A 4KR9A 3PHLA 4FHCA 4F1JA 2Q5HA 2P27A 5AKKA 2E4ZA 5CDFE 2I3AA 4DLWA 5J4LA 1N0WA 1II0A 1YDFA 1E64A 2PLRA 2X1HA 4Z99A 5TT1A 2VQFB 5DI3A 1LA2A 4KXXA 5IDQA 3QUAA 1CR2A 2XW6A 4TVBA 2IYYA 5CH8A 4OSEA 5I45A 2DECA 1FNSA 1DWQA 3IO5A 2ZM5A 3M6XA 1X7WA 4BEWA 4U0KA 5EJ4A 2VYCA 1LPPA 4K87A 4QA9A 2J9GA 5IT4A 1GEEA 2ZSEA 3VSCA 5K45A 2OPBA 1DBSA 4HLQB 1TKAA 4AXBA 2OLJA 4R5MA 4CF3A 3DVLA 2XB9A 3LUPA 1GQFA 3N59A 4PRLA 5DRYA 3CBQA 4C6TB 5DBHX 4HVLA 4RZQA 3DS8A 4L4XA 3L7IA 2ZM6B 2ZQ5A 1QCCA 2GAJA 2AZMA 2UV8A 4EJSA 1KVSA 2EP8A 2J85A 1JDTA 3NC0C 5CVCA 4J29A 4KDCA 4NECA 4RV4A 3GRPA 3I37X 3T4EA 2SCUA 1T34A 4KN6A 1YL7A 4TXJA 4HVCA 1VPLA 2ZT8A 3PHGA 1TRHA 2FEWB 1W96A 2LDXA 3CEHA 1QRSA 2UUAB 4FXPA 4I66A 2HFKA 2I6XA 3E3LA 1TAGA 4EJSB 3MXTA 3B3FA 3V34A 3PUKA 3AF4A 5F23A 5DMHA 4CQLB 4TTVA 1SHKA 1J8FA 2ADFA 4EYSA 4FDLA 3OBBA 4UTXA 3CWQA 3WKAA 2PV7A 1X3SA 3IERA 3HYNA 1Q0HA 3KB1A 1NPDA 5K51A 1I51A 1T3SA 1U0SY 3CUSA 3IP9A 4RKFA 2PN1A 5BW5A 4LN1A 4BUZA 1UWVA 3BIXA 4OQ4A 1IZ0A 3CX3A 4KP7A 5A5FA 3GPCA 1E7RA 1N5IA 1ZYUA 2MMCA 3FOAA 2HC9A 3BHMA 1DBIA 1JFFB 1TZMA 1ECGA 2XYRA 3NKVA 3JD4A 1BX3A 4Y9TA 4KQ6A 3EZYA 3IVCA 4B81A 1TIKA 3U3JA 1CY2A 5B1SA 3P9IA 4ESHA 1MG5A 2WU1A 5ERXA 2F55A 1IE3A 3HB1A 2NN3C 1BCRA 1F2DA 4AZWA 5LMUB 2XWSA 1K1EA 2VHJA 3IIJA 4L4UA 2Q9UA 3AEQB 3IUEA 4Y2QA 5HCIA 1FXUA 2FMFA 4OHOA 5B4VA 4IDFA 4B6JA 1O6CA 5DOVA 1OFGA 1P73A 3H87A 2KM1A 2RB4A 4KQEA 4LJKA 5TARA 3OQPA 3P2IA 2WY2D 1R64A 3Q6IA 3CG0A 3MD9A 1J8DA 4QPPA 3UW1A 1E8MA 1SN7A 1LF0A 1Z0UA 4FD3A 4R4JA 1GPDG 3SS9X 3W2GA 3NTXA 2TMGA 1IOVA 2WKWA 3M1YA 2COEA 16PKA 4LVUA 1GY8A 5EC8A 3UB4A 4MVJD 1MRNA 3QLJA 1QCZA 3RR2A 3GH3A 1GUDA 3CKYA 5IAKA 1SBCA 3W1EA 3AZQA 4DR6B 4FWIB 5CDYA 3RU7A 2ZUFA 1F3OA 3DMNA 1CFJA 3OLXA 2FPMA 4M8KA 3I0ZA 1KI6A 4B6RA 2R6AA 3NLLA 1EX7A 2BMAA 4E2FA 4UBNA 3TXYA 4I99A 4JDPA 2WOJA 2YWXA 4NRDA 4JKYA 3QHPA 1DMRA 4DTCA 1X1QA 2O2SA 1EIZA 2V7VA 4IG4A 2DZDA 5IP5A 3PNPA 2XT9A 3EXFA 4K9QA 4Q6WA 1QRAA 1V5WA 1LDBA 1P7CA 3DHEA 1I3CA 2QPLA 3G2HA 3HCPA 3KSZO 4IXDA 6REQB 1I1OA 1E2BA 2CFRA 5SY4A 2ORED 3L92A 1CWUA 3ZVLA 3I8SA 4HDNB 1O77A 1VMKA 4AS3A 9ABPA 1P9NA 4R5HA 4D46A 4PQEA 3F7OA 2B94A 3UXEA 2J07A 1ESCA 5FHQA 1TJYA 5JW6A 4NYJQ 3L4SO 4EHAA 4UHDA 2UZ1B 1W48A 2ZVDA 2G6BA 4O33A 4WBNB 1K8RA 4TQUS 1SZCA 1R1DA 3LT1A 4LTNA 1PS0A 1FFWA 3WLKX 3GGCA 5JFOA 2IIQA 2JGFA 1TYBE 3JQRA 5JSFA 4BXOA 1P39A 4LQDA 1X14A 2FXIA 4FZ3A 5EXSA 5C51B 1TTHA 1Q77A 1HF3A 3BWBA 3AKEA 4MR9A 3GJ4A 3QFFA 3QVMA 1SBZA 1AKTA 4KH0A 2FPKA 1C30A 4NPCA 4DIEA 3PXAA 3R0ZA 3A4TA 1RAEA 1SOVA 2G28A 2O23A 4JP1A 1Z8HA 3L1JA 1D0SA 2Q41A 2SECE 4Q4DA 1EZZA 1WAMA 3WYEA 4Q37A 3WYDA 4ZI7B 4EZIA 2CXXA 4CEJA 1NLUA 3E4CA 4DSTA 1TGVA 5FB3A 3BGOS 2EATA 2OGUA 4BDTA 4F3YA 5EIEA 4GSKA 2QZ4A 5LZ2A 5BUSA 3BWVA 3PHBE 4JYBA 4A0RA 1PEAA 2G5PA 3VR2A 3BRCA 4F3NA 4TKLA 4KIJA 3VX3A 3VVCA 1PUXA 2J31A 2WJYA 3AYXB 1M6YA 3LGSA 1CV2A 3NYIA 3VOBA 4RTNA 4TMXA 3NTLA 1Z4PX 2R8OA 1N7GA 4MMXB 1RWBA 5SICE 4DCUA 2D7JA 4O59O 4TMWA 5TS3A 4D9MA 4EARA 1QDUA 1DFGA 1U9IA 1CDDA 2G72A 3B48A 1WUYA 2IPAB 2Q45A 3H9EO 3BFXA 4TM7A 4BO0A 2FGJA 1FRNA 3F1KA 1CY4A 2G1UA 4MV9A 3OTIA 3F3SA 4PZPA 4Q9DA 5ENZA 1T8RA 4TTTS 4MW5A 4A3SA 4Z49A 1ZEMA 3RUCA 3IV9A 4OB8A 1E1NA 1UEXC 3OOHA 3VKFA 1L5RA 1UC5B 1GPH1 1X7DA 2PLAA 5CLQA 4EUNA 5JXGA 2C88A 1P2DA 3D8UA 5G2OA 4X00A 3REQB 4GI7A 4JVMA 1WPGA 2YW2A 2V58A 3NBFA 3ODPA 4QUBA 2QSUA 2OY0A 3AIIA 3GP8A 2Z9CA 4RD4A 3FPSA 1L5LA 3MB8A 3HDQA 1O96B 1GPUA 1SXJE 2CMGA 1XDWA 4Q00A 1P4JA 4PIMA 3TFOA 3IP8A 3WVNA 3GJ0A 2B20A 2PH3A 2ZVQX 2OXFA 3EBPA 5DX8A 4JD5A 3VH1A 4PN7A 3TPCA 4YT2A 5HZMA 3OOYA 5MF6A 5CYFA 5JJCA 2EJTA 1GYPA 3RYCA 1DO0A 4MKXA 3DBHA 2PRKA 2XA1A 2CJWA 4IVRA 4Q34A 2P6NA 1YB1A 5GZ1A 1MB9A 4OI0A 5T4EA 3FDIA 5FOXA 2A6PA 4DIFA 3VR4D 2DT8A 1XSEA 1JV2B 5LFAA 3MIIA 3OA0A 4CRWB 4HKTA 3HP4A 4JLBA 3HLKA 3RTAA 3TE6A 2EFCB 4TUYA 4NC9A 1MZVA 2WWHA 4D6XA 3I5MA 4WK6A 3SKYA 1NATA 3RSGA 1NZJA 1W2HA 4G25A 3ZBQA 1M3SA 4JI8B 4RSGA 2P3QA 1OAOC 1LPAB 1ZJ4A 1RI1A 4FFSA 3TLJA 5A6VA 2Q2OA 1REQB 2P2YA 2V0NA 3TLGA 1L4FA 3MIZA 2OV8A 3ZDRA 3AEYA 3G23A 1KWKA 1B0UA 4NU6A 3U3OA 3NIFB 4UPVA 4D97A 3S5UA 3IVAA 5IC6A 1TU0A 1C3XA 4OGFA 1TL7C 3PE3A 1OAOA 5G4KA 3IE2A 5AW7A 3ZJ5A 4BO5A 3N2EA 2O0JA 3AGPA 4Q9LA 4HGQA 3TZQA 4M8NE 3IR7A 1P1JA 3PQDA 1GTMA 3LOUA 3OH8A 3MZ0A 2NZYA 3KDAA 4W4TA 4YB8A 5K8LA 2FQ1A 1R3UA 3F6EX 5CCDA 2J3DA 2VHCA 4PSCA 7ABPA 3VXKA 4DMCA 4YJFB 5LUBA 1ZK2A 4NI5A 1GYRA 4JP8A 4F21A 1Y1KE 5BV2P 2P30A 4G4JA 4J0DA 4EHIA 5C37A 2C5FA 3ZXYA 3P9NA 1YZUA 3N2GA 4G5QA 3VKVA 3FVWA 4HDKA 1AHHA 2YXDA 1UPAA 2JHPA 1IULA 3CLHA 2HK8A 2GAOA 1DOAA 2FUNB 5JSQA 3MERA 5TF0A 1MEJA 5TMDA 1JX6A 1M0SA 2WPDA 3T7RA 1VG1A 3ITKA 3GCXA 1HG0A 3UV6A 3IILA 3VOAA 2LCIA 2GK6A 5CXXA 3Q1LA 1TEZA 3RS8A 3RVBA 3SBDA 1OTXA 4I1SA 4LC0A 4S0ZA 1OD6A 1RHUA 1TMOA 2OSBA 1FFBA 1XZPA 4YXWA 3JQEA 3U4QA 1DV2A 3O4HA 4Q05A 2XNKA 1CZHA 1SEVA 3DOFA 3NHFA 3E7WA 1J25A 4E13A 4GX0A 3PDWA 4RSHA 4MYTA 1YFZA 3T95A 2DPMA 1WZ2A 3CZRA 3PI7A 1GO2A 1JQKA 4C20A 1M67A 1FTQA 3KT8A 1EFLA 5K8TA 1T1GA 4XJSA 4P0QB 1O08A 3QPCA 3NOXA 4LOHA 1Y63A 1EEHA 1NIPA 3MJDA 4AJKA 4GMDA 1GNLA 5EE1A 1J8QA 3G9QA 3HKBA 5BW6B 3W79A 2ODTX 3QVGA 4FCCA 1U0FA 4ML3A 4NKRA 2AA3A 4OGKA 3RFCA 3D4LA 4BNIA 3HKCA 1Z6XA 1L5FA 2DQKA 2G1KA 2Y0DA 4WKCA 4WRRA 4ZZ2A 3MYRA 4H3KB 3TNFA 3QVKA 1SOMA 2WQZA 3OT5A 1V7PC 2VDWB 2J0VA 2OV6A 2ZB7A 3FFTA 2I99A 4NR0A 2O7SA 3IAS6 4ZO6A 1XMPA 4A4DA 1KYZA 3H1EA 1KEVA 4MKRA 3MVEA 3L46A 1Y8QB 5C5EA 3FOFC 2FMHA 3RAEC 1MJGA 1OX4A 3NEAA 3WGUA 5JEDA 1V48A 2X0JA 4M22A 3DL7A 3U4DA 3OX1A 2WSIA 4BVAA 2ZU0C 3L0DA 4ILEA 4BVKA 4MP3A 1GSIA 1KA9H 3PCXA 3LF2A 3QKRA 5BRJA 3LHFA 2FSPA 5JHGB 1OXVA 3F96A 1J2TA 5T7BA 2WFAA 4PQGA 5T8KC 3DCJA 2C7QA 1CUFA 3ANMA 3QVWA 1C9NA 1A4RA 1HNNA 3CSDA 1YVDA 2BE9A 3OT1A 3SC6A 5BN1A 2GRAA 1OASA 4N0MA 1OPRA 3FSGD 1Q0UA 3H0KA 1YQ9A 4EW1A 4Q9NA 1XRPA 2BGUA 1FS5A 2CXHA 1YL5A 2P9TA 2PKQO 3W9UA 4ZI7A 5BR1A 1SD2A 3ORSA 4NJEB 1NZDA 3DCYA 2FG6C 1H3FA 3WIDA 4KNYA 1G2QA 2Q0HA 4LHSA 1BIFA 1XQ6A 2A5FA 5K3CA 1L8LA 1R6BX 1Z0AA 2ZDHA 3AJAA 1CJKC 3FR7A 4WOKA 4HUQA 2DUJA 3EIFA 4PLZA 1CJMA 3UAXA 3V2UA 1MX5A 3BMOA 4IV0A 3QA3E 1Y7TA 5CAEA 2PRYA 4KDEA 1QKJA 1KI3A 4D41A 2DHRA 4M0FA 3I9NA 2VNAA 3PIDA 5FNVF 3EDYA 3LFUA 5HS6A 2RAUA 1VQ1A 4OQFA 5KQLA 3CEPB 3F7TA 1D8AA 3N7AA 2X0KA 5B57C 2BVNA 2AQHA 5JYBA 3ZJUA 2RGNA 3OZAA 1XL1A 2G06A 5LYJF 4M8LA 1A7JA 4EG0A 5L4SA 1F2TA 3KLOA 4AIRA 2QXUA 3X3HA 4YDHB 4L57A 3JASB 2AN1A 2I8AA 2D1YA 2C4VA 3I53A 1RS0A 1U7ZA 5EIOA 4RX1A 5JJBA 2PU5A 4RM2A 1TNDA 1E59A 1IU9A 4U7PB 4UXIA 1Y42X 5J23A 2AWOA 3C14C 4RK0A 2QRGA 5DXJA 1TT5B 1ZX1A 3I6MA 4J1TC 3C6KA 4NJMA 5F12A 1CS0A 1W581 1H2ZA 2WHQA 2HIMA 3S6JA 2BFEB 3ASYA 4QQRA 4X63A 3V33A 3KM0A 1KOJA 2GPYA 1SKBA 3DSRA 4PTZA 4Q1EA 2AR9A 2F3TA 1CVLA 2W2XA 3B6MA 2YJ4A 3CR7A 4TSRA 5H7XA 5HRUA 2R11A 4MV0A 1M72A 1Y37A 2GK3A 1EUQA 4L6IA 3JYOA 4KGVA 5DHRA 1PAUA 3RYFB 3P7MA 4OX9B 3LYAA 2XD4A 2YZKA 2A0FA 2PIDA 4KXQA 4KR2A 1FP2A 5ERYA 3ASZA 2VXOA 3LXRA 1UKCA 3BM5A 1TAHA 4JOSA 4MINA 1Z17A 4DJFC 1J5EB 4YACA 1DFHA 2GDZA 1U0RA 2CNLA 3JQ8B 1LDYA 4PE5B 2UYQA 1P77A 3CR8A 4S2EA 3ROQA 5THQA 1AHNA 2NU9A 3OU6A 4X0EA 3W4IA 3B7PA 2OV3A 4DNQA 1XIVA 3NTQA 2PUFA 1NVVQ 4JR1A 1ITZA 2IH2A 4ZYTA 3ETNA 1KO5A 1NDHA 1FX0B 2WD8A 4WA8A 5CX1B 5IVDA 2GZ1A 4C03A 1N2BA 4RIEA 4YPFA 3S1AB 5FNVA 4HAOA 1RZUA 4PFSA 5CB8A 2YHSA 1JEQA 2Y76A 4YRAA 1Y5NA 4WN9A 3HR4A 3ORRA 4OYRA 1BTOA 3V4FA 3D43A 4A0QA 3L3BA 4DAEA 4M7WA 2XCIA 4YMHA 4NXNB 3H4TA 3K0EA 4P35A 1JF8A 1I7PA 3G5MA 2JL1A 3BSSA 2JGNA 1WEHA 1GGJA 3E9NA 4RABA 2CL5A 5ICFA 3K6SA 3RJ5A 1DDGA 4ID3A 5CHEA 3MCVA 2A88A 1VSQA 1RWWA 1UJ6A 3N6RA 5EJMA 3TQQA 3WXMA 3WAGA 3PGJA 1DC4A 1T6NA 1WUTA 3AEQA 2WMOB 4UNQA 3RG2A 3UMCA 1PWZA 3I9V1 3BF7A 2HA2A 3H65A 5ECGC 4CFZA 1S2GA 4N0DA 3SXUB 1T8WA 4GI1A 5LQCA 4S05A 4G0QA 3H9BA 4BLUA 4DMGA 4MDEA 2CUKA 3GDFA 2GUGA 3AUXA 2FF7A 1JIJA 4TWZA 2XDQA 1PT7A 2QTVB 4Q9JA 3BRQA 1JYEA 2ZTVA 2BZ0A 1J23A 2P67A 1LRKA 3IX7A 1QGUA 1W6RA 3KOUA 3OIVA 3U49A 4NZPA 1NLZA 3O8RA 5P21A 1XQVA 2ISCA 2Y1WA 2VHYA 5JROA 2VP4A 3IQHX 4M7PA 1MH9A 3HJFA 1VG0B 3G0DA 3LDGA 4LJLA 3UT0A 4EFLA 1PCXA 3S29A 1Y3AA 5BV7A 2O0MA 2D00A 2RHGB 3KYDA 2HT1A 2VT2A 3QUTA 2QLJA 1MQ8B 2ZSAA 1YTLA 5JAZA 5KOJB 3H05A 2GM5A 5G0WA 3QJGA 3QPDA 3WNBA 1W30A 1TTTA 1LBSA 1NR1A 4J0HA 2Y1GA 2O1SA 1TZKA 1G1AA 3LAWA 1IN5A 3M6MD 1Q7CA 2VPTA 2I5PO 5C8YB 3BHIA 1ZJ5A 3MELA 4RHYA 1NBAA 2ZRIA 3EVBA 3RS3A 4JITA 2RBEA 1MJ5A 2TMYA 3MCAA 1T9GS 4D82A 3ND5A 2IY7A 3DLHA 4LY6A 2FMUA 3WK7A 2R8RA 4FWBA 4LSMA 3BTSA 1KZ9A 2G9ZA 3FHTA 2X7JA 2ODWA 4LDZA 5GJWC 1M34E 1Q3TA 1A7AA 2HHLA 4OXIA 4YCSA 4V0QA 1TO6A 1DJPA 2C04A 4G1FA 4WIAA 1L7VC 3NWOA 4LPKA 2IE0A 1AHIA 1F8FA 2GESA 3Q8WA 1Z6QA 3A8TA 1G8FA 4EQ6A 3ITEA 1M7GA 3CY6A 2WZDA 4JGGA 1J0XO 1I1QB 2HHJA 2JGAA 1E2UA 1EHCA 4W6ZA 1X7GA 3NUQA 1W1WA 1H8EA 4K6CA 2J3IA 3EXG2 3QEMA 4Q9KA 1SH7A 4R41A 5DT9A 4Z7JA 2ZJOA 3LOQA 4OD0A 1CS0B 2A86A 4PZUA 4PYJA 4O29A 2C54A 1PGNA 3ZI7A 3I45A 1NN0A 4UTPA 4G0XA 1N5JA 2EERA 1GL7A 1V9CA 1B8PA 2G88A 3D7SA 1N5MA 1XLUA 2JD2A 3KZ1E 1RAFA 4OO3A 5AKLA 3ICVA 3STTA 4KXVA 1EA5A 2P9HA 3D4BA 1M2VA 4L5JA 5TGTA 3SYTA 2HU2A 4OMUA 4AWAA 4F9TA 5CDGA 3UXYA 2AC2A 1O03A 1CVIA 2EFDB 3EUAA 1KOLA 1I24A 3ANLA 4OJMX 4B4OA 4F4FA 4CEHB 1ZMBA 3OECA 1EX1A 1DUSA 2WKRA 3DFIA 1BXRA 4JKIA 4KAJA 4UQPA 4TPKA 1YNSA 5JYDA 2J4DA 1N32B 5EWLA 1Q2XA 3OHPA 2BBSA 1F17A 3GEGA 2NG1A 1LS6A 4NZOA 4G56A 4RULA 1UL1X 2UXBB 1CETA 3INGA 2IPMA 1C80A 4E12A 2GCEA 2BH2A 5G41A 2OILA 3Q2IA 3Q7RA 3KXLA 2HWYA 2J32A 1SBHA 3G7NA 3OEYA 3R7BA 4HQ6A 4IEIA 2B1JA 3RT7A 3H11B 2ATIA 3GXOA 4BB6A 1Q92A 3IHTA 1NV9A 2CXTA 1PJZA 4K6MA 2HO4A 3O9ZA 1ADFA 1JG7A 1OLOA 4KL8S 2H9IA 4CLDA 1JWAB 3NZEA 2O0LA 1BE0A 1R0ZA 3FNEA 4JELA 2OYCA 2FV8A 3BJIC 4L8GA 5E7MA 1NW5A 3ZHVA 3C4QA 2CFIA 3RRBA 3S2FA 3URMA 1JYSA 2C42A 3QF4A 3NORA 1VIYA 3MK31 4X62B 2YKGA 3N75A 2OGWA 4NEQA 4PFQA 3WK6A 3SP1A 1QO0D 3LHDA 1L5YA 3KB8A 2P5YA 4J3NA 1CP3A 3H3XA 4KFTA 3AGQA 4XGQA 1SQSA 1Y5LA 2GEUA 1OU0A 4QWWA 4K0RA 1YHZA 4M0PA 3ORHA 1XVAA 3PSAA 4E31A 3FSRA 3IKMB 4V02A 2PZGA 4EKGA 1SWVA 4E22A 1E61A 4EA9A 3C8ZA 5DW3A 1EWVA 1Q1EA 2CCGA 3RIGA 1RU3A 3LNCA 1QHFA 1CUWA 1EM8A 3L8EA 2E48A 4QAQA 4JI3B 2AZDA 1EGVB 2RC5A 4QBKA 4RESA 5A3SA 1F5SA 4YFVA 2BR4A 4LE0A 4QVGA 3PPVA 5AW8A 3S8MA 4UDYX 1Z62A 1YC2A 3PQ4A 1YRWA 4CIXA 3KEQA 4X97A 1U7XA 2Y1XA 4B9EA 2QVYX 4CEIB 4IUYA 4CM9A 1XKQA 2UXDB 2AW3A 5LXTA 4IM7A 1MIOB 3EA0A 4FS3A 1IZYA 3ZOKA 1TVKA 4GL2A 4XVRA 2O5EA 3F7NA 3DWGA 1QO7A 5EPOA 2GXUA 4U7TB 4YS6A 4EEZA 4FGKA 4RLSA 3IXLA 3EQ6A 4NCBA 1SR8A 3N2KA 3NWPA 1DGQA 1OWPA 5KYUB 3A06A 3MINA 1VSVA 1TCUA 3EK2A 5CLFA 2WHYA 2O52A 1TYAE 3RV4A 3JQCA 1I36A 1G5QA 3GOQA 3QMPA 1JU4A 4EF4A 2OZEA 3H2GA 1EESA 3LQFA 1SIOA 1GZ5A 3U3MA 1EVKA 2O57A 2JFPA 3VM6A 5I9BA 3HVJA 1LZKA 3DZCA 3HJGA 3DE3X 2DH6A 1OIWA 2XDAA 5ESWA 1RE0A 1XTIA 1NXQA 3FWYA 2UUCB 1GILA 3IMFA 2D2VA 4OJYA 2V3CC 1GGHA 4LZAA 2QF7A 3BXPA 1C1YA 2XWBF 3DGEC 1FFXA 4FILA 4BVEA 1G4UR 1NT2A 2ZRDA 1UFOA 2Z1DA 4U2EA 3FOZA 4DC1A 2JGMA 4GT1A 3R7NA 3WRXC 1K8YB 3WMFA 4HP8A 4QNNA 4NSNA 1DKMA 1SUBA 2JBHA 1OTYA 4FONA 5BQ5A 5KAPA 3B1KA 2O1WA 4WJKB 3OLQA 5J9FA 3DFFA 5TR9A 1P8JA 3LUJA 1R9JA 1QG4A 3Q0IA 3H9QA 4H6PA 4GZ5A 1PJCA 4NZNA 4PG6A 1AD2A 1ZCJA 1OZHA 5LB2A 2QUKA 1JJFA 3ETCA 3FNHA 2LW7A 3QBDA