1T0IA

Ylr011wp, a saccharomyces cerevisiae na(d)ph-dependent fmn reductase
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
185
structure length
185
Chain Sequence
b'MKVGIIMGSVRAKRVCPEIAAYVKRTIENSEELIDQKLKIQVVDLQQIALPLYEDDDELIPAQIKSVDEYADSKTRSWSRIVNALDIIVFVTPQYNWGYPAALKNAIDRLYHEWHGKPALVVSYGGHGGSKCNDQLQEVLHGLKMNVIGGVAVKIPVGTIPLPEDIVPQLSVHNEEILQLLASCI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords YLR011wp
publication title Crystal Structure and Functional Characterization of Yeast YLR011wp, an Enzyme with NAD(P)H-FMN and Ferric Iron Reductase Activities
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase
total genus 57
structure length 185
sequence length 185
chains with identical sequence B
ec nomenclature ec 1.5.1.39: FMN reductase (NAD(P)H).
pdb deposition date 2004-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03358 FMN_red NADPH-dependent FMN reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1t0iA00
2QX9A 2OHIA 5B3LA 1OBVA 3OJXA 5F51A 2MTBA 3QFCA 2QX8A 2R96A 5JROA 4CETA 4FX2A 4YAUA 3W79A 3F6SA 1OBOA 1XI2A 2KLBA 1YCHA 1F4PA 4YALA 1AG9A 3EDOA 2WC1A 3NHPA 2D5IA 2V5VA 1AMOA 3NHKA 3FVWA 4LAFA 3UXHA 2FZVA 1XYVA 2FVXA 2XOEA 3F2VA 5FUQA 1GG5A 4DIKA 3FJOA 4N65A 5LBUA 1QRDA 4QOIA 2BPOA 5FX2A 3LT5A 1FLNA 4ZVMA 4QOHA 1I1OA 4YAOA 1CZLA 3HLYA 1JA0A 4HS4A 3LCMA 4PTYA 3ES9A 1XT6A 1YDGA 3R6WA 3GFRA 1CZOA 1DXOA 4M0CA 4C14A 1FUEA 2FOXA 3ESZA 4FGKA 4D02A 3OX3A 3K1YA 3TEMA 2KQUA 4OXXA 1D04A 3D7NA 1QHEA 2QX4A 1CZRA 1SQSA 5NLLA 1XYYA 5LLDA 3ZHOA 3NHLA 4S24A 1D4AA 2Z9DA 3OVMA 3OX2A 1CZKA 3L9WA 4ZVLA 3P0RA 3NFRA 3HA2A 1CZUA 5FA6A 4GR9A 2MWMA 2X2OA 2V5UA 3FX2A 4GI5A 2Q9UA 2GSWA 1RLJA 2A5LA 4U7HA 4Y9RA 1J9GA 1KBOA 1FLVA 3O73A 4U7FA 5LJIA 3KAPA 5TGZA 2HNAA 4ICIA 1AZLA 1V4BA 1J9EA 4H6PA 3KAQA 5NULA 2B3DA 1J9ZA 1H66A 4XDHA 2V9CA 1B1CA 5LJLA 4FGJA 1CZHA 4YQEA 3K20A 1X77A 3OX1A 4C0WA 3L9XA 3NHWA 1VMEA 3QE2A 2MT9A 5ULLA 4DY4A 2OHHA 4R81A 3B6KA 1FLDA 2FAXA 4ZVNA 2Z9BA 4J8PA 1T5BA 1H69A 2Z9CA 1QBGA 1AKWA 1T0IA 6NULA 4BMOB 1YKGA 2FX2A 2Q62A 2BZSA 4BMPB 2M6SA 3U7IA 4YAFA 4FGLA 3KLBA 3W77A 2RG1A 4LTNA 3FW1A 2QWXA 5EAIA 3G5MA 1WSWA 4LTMA 4QOJA 1AKTA 5BUCA 1SG0A 3JSXA 1OFVA 1ZWKA 1WSBA 4LTDA 4N9QA 5F4BA 1CZNA 3F90A 4CF6A 3QFRA 1AHNA 3F6RA 5LBTA 3GAMA 5LVAA 2FDXA 3N3AC 3UXEA 2N1MA 1BVYF 3NHRA 3B6MA 1AKUA 1AKVA 2ZKIA 1DX9A 1TIKA 1J8QA 1C7EA 3EYWA 2BMVA 3W7AA 1YRHA 3TZBA 4C76A 1FTGA 2F1OA 2ARKA 2QR2A 4NULA 4QOEA 1FLAA 2FCRA 3FNIA 1TLLA 2AMJA 2MOKA 3KEGA 2QMYA 3B6JA 3NLLA 4H2DA 1QR2A 4DILA 5EA2A 4C0XA 3NHJA 3TE7A 3SVLA 3N3BC 1E5DA 4QODA 3OJWA 2BF4A 2HPVA 3OWXA 1YCGA 5LMCA 1C7FA 1KBQA 3OWHA 3B6IA 4U7GA 2FLVA 1DXQA 4LA4A 1NNI1 1RLIA 3ESYA 2W5UA 2OHJA 3HR4A 4HEQA 4ZVKA 5A4KA 1JA1A 4NLLA 4QOFA 3NHYA 2M6RA 3GFQA 1ZWLA 4YAWA 3NHUA 4ESEA 4F8YA 4N82A 2X2PA 5EMNA 3W78A 1AKRA 1YOBA 3S2YA 3O2NA 2HNBA 1BU5A 2QX6A 3NHFA 3U7RA 1YCFA 3RPEA 2OYSA 2QMZA 3N39C 3ESXA 1FX1A 1AKQA 2XODA 2FZ5A 5B3KA 2R97A 4Y7CA 4QOGA 1FVXA 1D03A 1RTTA 2BN4A 3NHSA 1ZX1A 1RCFA 4GQIA 5F12A 4XDGA 4PTZA 4Y9UA 2Z98A 4PU0A 3GFSA
chains in the Genus database with same CATH superfamily
1RYMA 1TI7A 4KXQA 1H85A 1E6UA 3E7WA 2O19A 4N5HX 1UIRA 2EOAA 2XI4A 1LGYA 2ZYRA 1BRMA 2QMOA 3B1JA 3QBTA 4RKWA 3STTA 4WL0A 1C9YA 3EQ8A 5AJHA 1M3SA 4AG5A 5JUWA 4CDMA 3QMMA 5H9WA 1IXKA 1BCSA 4FX2A 1ZSNA 4RY9A 2R8PA 1ORVA 2GESA 3RVRA 5GZ6A 1T9CA 2EARA 5IARA 5JVDB 2PMKA 1IXYA 3QE3A 3R3YA 4MUJA 4MYRA 4MUAA 5B4TA 3WSTA 3D6VA 3UG6A 1XAIA 1ESMA 3CE9A 3E58A 4N3CA 3NUZA 5BQFA 3FMOB 3MJSA 1XCLA 2XJ4A 5FJJA 4J07A 4PG8A 3OIFA 4ALLA 3F98A 1AG9A 4GRDA 3O3OB 5ADUS 2Z6UA 3LT1A 2FR8C 1ZN8A 3EOAI 4OFZA 5A3JA 3TMAA 3U44B 4RCZA 4EQ6B 4FYIA 5IKEA 2QTAA 1EQ2A 4HAXA 3FWZA 3I4FA 2QTZA 3HG7A 2ODTX 3RAPR 5AVRA 4E5UA 4S04A 2QM8A 3F9CA 5HIMA 2OCKA 3W1VA 5ALVA 4XSVA 1WXEA 2O2DA 2V4MA 3NO4A 3ENQA 1KBZA 2UZAA 3F96A 3L8FA 5D8DA 1WUTA 2BL4A 1EK2A 4BJ1A 2IVZA 1W93A 3MBKA 1A8IA 3V4PB 4HKTA 4CM5A 4NJMB 1XRJA 2YMLA 3R3ZA 3PC8A 3QM1A 4HNSA 3F2VA 2BJWA 2Z95A 4MDFA 4F93B 4LSMA 1JB9A 4EGAA 3H2JA 5C53B 4IGKA 4YT5A 3AEUB 5HSGA 4PC6A 1SCUB 4Q3LA 3ZVKA 3PFCA 3KQWA 3OZIA 5EZYB 3CEAA 1EUDA 4R8VA 5BQPA 4JJFA 3ONDA 1Q17A 3C85A 4MUEA 3ZGVA 2CVZA 3OOWA 4BNGA 2X8LA 2XOKD 2P78A 4Q82A 2R66A 4FFVA 2GK6A 1T4BA 2OKGA 1YE8A 3QOFA 2IX9A 4G65A 4IWXA 1NNEA 4GVPA 5ALMA 4WASA 1L7AA 3EQ6A 4U2BA 2OQVA 4N3BA 2B4YA 1M6VA 3QQ5A 4L4SA 3D1JA 3GFVA 2XCLA 3IHWA 4IW3B 1UJBA 2N1BA 4O2AA 3TRIA 3ZI4A 1AUOA 4I55A 4DNQA 4PCVA 1CB0A 2DKFA 5CDFA 3KKMA 1KEEA 1DUSA 3BWEA 3BX1A 4QICA 5DRYA 4JHXA 3OHSX 1T10A 3NHAA 1S1CA 3EWNA 5KWSA 1XA0A 1NW8A 2XBLA 2ZTMA 2GSDA 1NUPA 4FD2A 5DTQA 5CFRA 3IPYA 3WSWA 3K09C 2GARA 4M0FA 5IP5A 1G7TA 1XQYA 5F5NA 3MT9A 1SHKA 4BMNA 2W71A 5BSFA 4NF2A 4UUNA 3D5TA 1OU0A 2ZZMA 1XVTA 4IS2A 3TLAA 4HK4A 3U3ZA 5DW3A 1DC4A 2ZSAA 4YA6A 2VHWA 1OQAA 2GN0A 5CFOA 1XCGB 2ZIGA 3GT3A 4MKFA 5KX5B 2ICAA 5JS6A 3PEVA 1E96A 5TS3A 1V7PC 5K05A 4QNRA 1VJGA 4XW2A 4ZOLA 5ARCA 3VVMA 1C4WA 4LE0A 4YGYA 4Z9FA 3UT0A 2OXIA 3K6JA 1J07A 1CYDA 5EP1A 3P96A 1UPAA 4J3JA 4EEKA 4GWKA 1D09A 5JEEA 2CV2A 1SPXA 4JV5B 3IJEB 1C30B 3H11A 3A06A 2IUFA 4IYRA 4CN9A 1U0NA 4RM2A 3UANA 4W5JA 4RFSB 4QU9A 1LTQA 2KBFA 4C3OB 4U7JA 5KB3A 1U8ZA 3DE2X 3B85A 1TZJA 2ATVA 4IS3A 3TEMA 3RC8A 5ESXA 4RZSA 5HUQA 5CEEA 2QXUA 3IP9A 4KYTA 1AT1A 3CYFA 1RXUA 3VC7A 3G2PA 2YDXA 4PZAA 1Y9ZA 3E3MA 3AM5A 4IJKA 1ECGA 2I2WA 4EH1A 1J42A 5ALXA 2ZQZA 3T15A 6Q21A 4QDJA 3SHWA 1IMJA 1IY0A 1D1SA 5JBIA 2YXPX 2P65A 3PNQA 3GJ8A 3JTMA 3C3YA 3QK7A 1TM4E 4HB0A 4HJXA 2JKYA 1KGSA 4Y9TA 5COAA 4KR9A 2Y76A 3FMGA 1D4ZA 4RIFA 3VSEA 2C96A 5AW3A 1QRTA 2XAAA 3UWOA 3WNQA 2XXAA 3KSZO 1PL0A 4IBOA 2G71A 1O0SA 1D4OA 4YP5A 5DO9A 1P7WA 4QBKA 4W1QA 2X0FA 1PS8A 1UDAA 2CZQA 1RPJA 2ERYA 2PIDA 4HYEA 4RZ2A 1RPNA 2HBYA 3TZQA 4CI9A 2PS9A 4Q01A 5FCDA 3H19A 1CUSA 3HUFA 4TV8B 2QSYA 4ZP1A 3CR8A 4XGRA 4ZQBA 3RS3A 4DLWA 1NX9A 4MZXA 4EY8A 3BBLA 1IB0A 1RR6A 3RBXA 1FSPA 1ECLA 4QZVA 3MHTA 5LQDA 1QMPA 1N2EA 3SMQA 4KWHA 3AB7A 4RV5A 4X1KA 2ZWPA 1NW6A 3IALA 2X0JA 2GCGA 2XE8A 3QFSA 4QQ8A 1JEYA 1D0IA 1GADO 1P2TA 1B2LA 3IELA 4U7HA 1QAQA 2C0CA 3AUUA 4IX9A 5GONF 2LKDA 4WUVA 1BHSA 1HFEL 5CXSA 3ODGA 2R86A 2GILA 2ZIXB 2P7HA 2F8SA 3HNRA 4ENPA 1E2IA 2RG7A 2I1LA 3M6UA 5FULA 4OP3A 1XTZA 2JAXA 1NL3A 4X85A 1NMSA 4HDSB 4C4ZA 2VF7A 2VRBA 5DEOA 2CMGA 1V41E 1C9NA 2Z2ZA 3FUTA 4FNAA 4E07A 1YB2A 3REQA 1MRNA 2CFTA 4PAQA 4ER7A 1QIGA 2V9CA 2LV8A 4NJEA 4OHBA 2JI6A 3HUUA 3TIIA 5LJLA 3H16A 3NQ41 4HQOA 1P0QA 3OFSA 4LZJA 5ED0A 4FNMA 1PNOA 2H52A 2HF7A 1ZOOA 5FBWB 1RWQA 2F7SA 2ZSIA 4QDTA 2OHVA 3FLEA 4XUCA 5DBHX 3IKTA 4IIXA 4XI9A 3IDOA 3KQUA 1O0CA 2YRWA 3RVBA 2P79A 5E0OA 1L5FA 1KVUA 1PWHA 2OECA 2WAYA 1N4DA 2O6HA 4Z0TA 5CB6A 1NG1A 2F17A 1FSSA 5HOEA 1AH2A 5BVGB 4C22A 2XCIA 1YKSA 2WKPA 4HYTA 4LEIA 1DMRA 2FLKA 3LLUA 2HMAA 4MW5A 3O8NA 5LYJA 3NWOA 1DKMA 4KHZA 2I3ZA 4HSGA 4BO5A 1IWPB 3ZXIA 2FP3A 1O03A 1U2ZA 2PH7A 3GPCA 3GY0A 4ETIA 1O0BA 4AECA 4LC1A 2VUTA 3SVZA 3VH3A 4BZQA 7ABPA 5CCBA 3WYFA 4XEHA 4MIYA 4JUIA 1RQ7A 4BMOB 4YCMA 5BRJA 1RRCA 4U39A 4AMZA 3M9LA 521PA 4B3TB 1JSCA 3AEQA 1I5OA 3OCZA 1IVNA 3O9MA 4HQLA 4LJYA 4PZEA 4YAFA 4DIMA 4N5NA 2YUIA 4E5VA 2NAFA 3BEOA 4PXAA 3BF8A 3R0ZA 3UTCA 5T8KC 4F7WA 1Q57A 1WL8A 2C5EA 4FDAA 5TSDA 5CMLA 3TLMA 4EFDA 4O1IA 1ZXXA 2WBLC 4C4RA 2XNDD 2BOVA 1LDYA 2HQOA 3AH8A 4NKRA 1XEWX 3CR3C 3FPSA 3WLNA 2WKQA 3GW8A 4CV2A 2A0FA 4AL4A 1QCZA 1UEXC 2IP2A 3GUUA 3M82A 2JJ1D 3KZNA 1M6YA 2BI8A 5DTMA 4OKIA 3E9ZA 1D4FA 1M1YB 1XMQB 4LTDA 4QEKA 3ZHBA 2LNDA 4ZIRA 5LP6F 3R9XA 1QGUB 1XZQA 3WHLA 2NVBA 1IUKA 4AJKA 3DAYA 1SFRA 1P7VA 4CPDA 1QXSA 3GZ4A 3G5TA 5C51B 2BDUA 4GH5A 4ZYTA 2XY4A 3F3SA 3JQ9A 2Y1WA 3ABIA 2JCSA 2GEJA 1KFEB 1II8A 1KA9H 3NBAA 5EZSA 4ES6A 1ZM4A 1OIVA 1JE0A 3K0FB 3K0EA 2KHZA 4XASA 3R5SA 3LWZA 4EYGA 1PW5A 2V7XA 1YUBA 4ILKA 1VI2A 1RJWA 4WQMA 1ONOA 4WBNF 2CYCA 4M0EA 5GAJA 4HDRA 1V1MA 1P2GA 1MX1A 2B7BA 1A98A 4PF1A 4B82A 2P68A 3QRWA 3CX7A 4C6RA 4Z4FA 3O8BA 2WSSD 1XAJA 4ZREA 4HWTA 4R5MA 4MMYB 4WZAB 1DX9A 1DBVO 3GNQA 4IX1A 4ZO6A 3PX3A 3EGDB 4GXQA 5DASA 1M10A 3CVUA 2GPSA 1LSJA 4ZYVA 1YRHA 1X8LA 1CRWG 3OQ1A 3QVJA 2HTEA 2GPBA 1FFSA 2G3YA 3C7TA 3OZXA 1A9PA 2JW5A 2Q49A 1GRQA 3Q9NA 4TGLA 2UU9B 5BMVB 4OXNA 4K87A 1JFRA 3D8TA 1Z2PX 4Q3KA 1N36B 2QW8A 5CDUA 4JJIA 1D3AA 4LUCA 4BFYA 3A4IA 5C8YB 1P2UA 5DLYA 3K30A 3D6AA 1XPJA 2P3SA 2BFDB 1T5IA 3NW9A 2ST1A 4GECA 4NP6A 3LHIA 2O2ZA 3BIFA 4OBEA 3FYDA 5AIBA 2OZVA 3H1PA 5C5IA 3DDUA 3G88A 2H4HA 3H4IA 5BR8B 2F8TA 3NU1A 1B42A 4PNHA 5G1NA 4Q03A 1OASA 4D44A 2WJGA 1H8HA 1QR2A 2UZ1A 4F60A 2VQFB 5JXWA 4QD3A 4N01A 1G2PA 2A58A 2L0XA 2VRCA 3IUSA 3PDHA 3CLSD 5EYPA 2I2FA 3A9RA 1K98A 3TL2A 1VBFA 1YS9A 2UYOA 1GSHA 2VSFA 4H4CA 1EFUA 4L8FA 5AKKA 3SHQA 2V3WA 4K6MA 4B0OA 3CX6A 4MA4A 3GLGB 3W34A 3K9QO 3EOBI 2GKOA 2YOFA 3FBWA 3N3BC 1NVUQ 3D7LA 1ZVJA 2EFJA 3OI7A 3P9IA 4MRNA 3WC4A 2QTMA 4MO9A 3B1ZA 3WDMA 4KR6A 1IL0A 1OWOA 4ML3A 5FTMA 4ZAXA 1Y1PA 4D0LB 1I01A 2LD4A 4OEHA 3WGKA 4RVGA 1M0EA 2G1KA 3U6BA 5K3EA 1C41A 3ZDAA 4P7JA 3JW8A 4REOA 1JHAA 1YUNA 3HVIA 2HWKA 4JOBA 2P2NA 5DNDA 3HDHA 4K6FA 4YXFA 3N0XA 3H7IA 2UVPA 3OWHA 4U2CA 3S7ZA 3VR1A 4ACBA 5I8PA 4KV7A 5KUTA 3HP1A 3EGOA 3FSGA 1NLFA 4B76A 4EPTA 1T35A 1CUCA 3BE5A 3DDZX 3GQBA 2Z8ZA 4XIIA 2JH9A 3BMCA 4R2KA 1NVKA 2DWOA 3AQ4A 4RK0A 4A8HA 3VA7A 3E5RA 4B83A 1CE8A 4PO8A 1U9YA 3F3YA 2V6MA 5HE8A 1HH4A 3HH8A 5JD4A 1FVOA 2H1WA 1KYTA 721PA 3UMVA 2Z1NA 1BCSB 1NVGA 1SEVA 1Z25A 3HU1A 2QP3A 4OJQA 1IPFA 1NNI1 2DRIA 4BNDA 4G37A 2XTNA 4C14A 4DFDA 4WD3A 4XIGS 5CX1A 1QIMA 4BPBA 5CK4A 4UZFA 3FOBA 4U2KA 2N3ZA 4H59A 2FEXA 5GV7A 2VZLA 3H5AA 5BP7A 4ZPJA 2VQEB 1J70A 2MYNA 2FFRA 4GPIB 4RX1A 1N0WA 4ZVKA 1IOLA 4MP8A 1SD5A 4L07A 1GLVA 1L4EA 3UPDA 3UV3A 4D8YA 2P2LA 3NWPA 1RYZA 2E49A 1A77A 2DH6A 4RK7A 2BEUA 3PA8A 1JA1A 4LDPA 3LX4A 4J7CA 1FDVA 3LXUX 3PT9A 4TVKA 3K9CA 2FPRA 3HBFA 4J94A 4AF7A 4KAXA 4KLRA 3P0FA 4DSUA 1CULC 4H0NA 4M98A 1G8HA 1F0YA 4L5BA 5HHTA 1R2QA 1SVNA 3NALA 3OTOB 5ARBA 1EESA 1F6BA 3TTYA 1DIOB 5SY6A 2Z0MA 3GL9A 1ZWLA 3CXUA 1EMDA 3VJMA 5CLIA 4GEGA 5BPHA 2RHBA 3ROMA 3OIUA 2PRJA 5FWNA 3M4XA 2HK8A 5ICGA 2CY0A 3ICWA 3VHLB 5A9SA 3KX2A 3PRHA 3SHVA 2FOLA 3L8ZA 1TW3A 2MINA 3MN1A 3V3KA 5EJ6A 4AS3A 3R9KA 2RGAA 5I7EA 3ETEA 5D6NA 1CDEA 5LC1A 4RNDB 3AF4A 2POCA 1EUDB 1G3UA 3CF4A 1K75A 3B8EA 3K35A 2PYIA 3KB2A 4R2HA 3AZOA 2EF0A 5DGDA 4KXMA 2VN8A 1W29A 1WDTA 2WMOB 1Z7EA 2ZJ7A 2ZUUA 3RFVA 3NDBB 3X0DA 1Y1RA 3V32A 1PGOA 5AM4A 1M6VB 2QQFA 2BGNA 5HWSA 4JI8B 3ESXA 5AESA 4O2AB 3NWEA 4I55B 1G16A 2G5GX 2NU6A 2IH4A 1DAFA 3FNRA 2FZ5A 4AJ2A 4XWGA 2HEGA 1NQ5A 4IJMA 5KKAA 3KPJA 4BFLA 3PUHA 1PJ2A 1KEEB 1QVZA 5J1TB 5DCWA 3DDCA 4DQXA 3LYLA 2V3CC 3Q3EA 4HR7A 4URYR 4YRLA 3THXA 2DFPA 4P35A 2OQ2A 4G8DA 3L7NA 1MG0A 2O20A 4RPJA 5F12A 5FOVA 4ZXPA 3TQIA 3P0EA 5IT0A 1WMSA 1XZNA 1GTZA 1O6FA 2R6JA 3AFHA 1KDTA 1GQ2A 1UEJA 2VDRB 2W90A 3HCNA 5BRNA 2VSXA 3ZVNA 4OB7A 4LHWA 4Y0NA 4R7ZA 2X0EA 2JIOA 1CW2B 3MJRA 1DJQA 2P5SA 3S40A 1XB2A 1OZGA 5BVHA 5JCZA 1QBKC 3WIDA 4ZOLB 3Q1KA 2ZWMA 4P9NA 3VR4A 2QX8A 1Q83A 2DKNA 1CNMA 2QW0X 4YQYA 2IXAA 2IZZA 4R7GA 1LLFA 3ZKAA 4EZBA 5B5SA 5L7TA 3H11B 4RTJA 2YJGA 3NFYA 3PNVA 4QXPA 2KLBA 4ZK6A 1VGVA 3FF4A 4OK5A 4S1TA 2LVBA 2Q5QA 3VPFA 1NLYA 1Z83A 3N8IA 4YAKA 4G09A 4CCYA 5HQTA 4N8SA 4LVUA 1SKQA 2LXNA 3S68A 3VR5A 3WNBA 3ZY3A 3FLMA 5MN6A 3ZJTA 1C4OA 4PLYA 1COZA 1BQ4A 5BQOA 5SY4A 1Q0ZA 1V9LA 4ZQGA 4BECA 5KEIA 1Z6XA 1ULZA 5BSMA 4DLNA 2MSDB 3RB8A 2O8BA 3TOVA 4RZHA 4CMIA 3LF1A 3AVQA 1CDOA 2ZRJA 3MWFA 1ZN9A 3TJZA 4I6GA 2P5YA 3KJEA 1NVVR 1P17A 2QX7A 4WI1A 1H4QA 2DFNA 5MGNA 4XFKA 4BVHA 3PL5A 3OLYA 3HCBA 1XQ6A 5G40A 4RDIA 3TBFA 1MQAA 1TT5A 1VSBA 1J2UA 2ZEJA 1HPLA 2CZGA 4KBYA 4O4LF 4RKFA 2AIRA 4HUTA 1Z0SA 3AY3A 1OYYA 1HYHA 2GPTA 3IUJA 1R15A 2R4UA 4J0DA 1ZD1A 1PLLA 1G5FA 3ROZA 1M1NA 1DG1G 1PHRA 3A3YA 2VNKA 3M1IA 4LGYA 1HTWA 5T4HA 4DDWA 1JQAA 2A14A 1XPOA 5F33A 3SMVA 5IU6A 1W1WA 3R7BA 4X1KB 3KVNA 4W1RA 4EA7A 1JEYB 3IV6A 1KI6A 3ZD8A 3DZKA 4L7VA 5D3KA 4H4DA 4NICA 3DM9B 4CM3A 3KJGA 1NUSA 2OYCA 3KZ1E 3KKNA 3BBPA 5FPHA 2B7CA 3KJHA 2CBZA 4RELA 1GKLA 3WIOA 1KK2A 4BX0A 2OHGA 3G5LA 2H0AA 1KO7A 3GJ3A 3PD0A 1D9XA 1W52X 2EXXA 2RH4A 3O92A 3DBHA 3H3JA 1E0DA 4MVYA 1MCZA 2ZU0C 5ECYA 3UT6A 2XADA 3AEYA 3VNQA 3BPSA 3REQB 4AXXA 4HS4A 1I7PA 4NJEB 4BY9E 1SIBE 1V5GA 5JIBA 2Q1XA 4R68A 4G23A 3R6LA 4XIJA 5EVCA 3T4UA 4V0LA 2PFSA 3QKRA 1ZONA 2GD2A 1Q3KA 1KNXA 4QGFA 3FHOA 3CHYA 4HUQA 4QPZA 1A4IA 3GDHA 2Q7DA 2AE2A 1DIGA 3BFXA 3ZX4A 4ASUD 2XR1A 3J81A 1BDIA 1TYEB 1VA4A 1COWA 1ABFA 1IONA 1VJ5A 1J09A 1DXOA 1PP4A 3WLJA 3SM9A 3ISJA 1K8RA 2K87A 5DN9A 2IWRA 4MCAA 2R5NA 3GD7A 4RJLA 1N25A 3B7PA 3CNNA 2PK3A 4ZAWA 2WF5A 1Y1TA 1QSGA 2PRKA 3SE7A 3BH0A 1D1PA 4JUBA 5A5GA 2I3BA 3OEEA 2IUTA 4V3CA 3S1LA 5JD3A 5LYJB 1PV4A 2PVCA 1I94B 4LOKA 5AJWA 3PF9A 4YN3A 2BFCA 3OCJA 1AKYA 2QM7A 4EF4A 2R9VA 3ASZA 4I5GA 4XPIA 4K9KA 1T8SA 1TCBA 2NT4A 1ZD8A 1P7ZA 4NK4A 2FR8A 1DT5A 4JUCA 1R0WA 4U2EA 5DNVA 2XITA 4KITB 3AEQB 3LPAA 2UUCB 4TMFA 1I3OA 1YZNA 1J0CA 2CXNA 3GPDG 3COSA 2BMJA 3T9EA 1C9EA 2P2CA 5IM4A 1L8OA 1LRLA 4N9WA 2V7WA 5BSRA 3TCXB 1GG9A 3CSUA 4KSCA 2O2GA 4BB6A 2EP5A 5LLDA 4ZVTA 1BEUB 3C6BA 3FZEA 4B09A 2Q5HA 4RLQA 4H6WA 4PC7A 5JD6A 4MRMA 5TY0A 3FLBA 5GADl 3WTCA 3DO6A 4XLZA 2J3KA 2J9XB 1N8NA 4QDXA 4KO2S 2IS1A 3B1WA 4HEJA 2QNBA 4AUMA 1DV2A 3LI2A 1Y33E 2GVDC 1MQ9A 4F9FA 1AHHA 3I9V1 4ZIRB 2PL5A 3K9HA 2AB0A 3E15A 3R9XB 4D97A 2PNFA 3TDKA 3PPWA 2C4TA 1MO4A 2AL7A 1KVQA 3NFRA 2EX0A 4XM0A 3FJ1A 4CG0A 1EX1A 1EQUA 2OXCA 3PC2A 1SG6A 5FA6A 4TWAA 4Q0MA 1TO2E 3UW1A 2VIIA 1KPIA 1G42A 3ORSA 1TZKA 4L28A 3NHMA 2WWGA 5DTRA 3G2QA 2OE2A 1II8B 2Z2XA 3IEKA 3VVLA 5DNAA 4DUGD 1YZGA 1JQ5A 2DUJA 2GNOA 3PV0A 4HWGA 3ACBA 2HF9A 4G1VA 1XBTA 2ZWVA 1KH1A 5K4AA 3RHSA 1KBOA 3FCOA 4CM9A 4G0VA 3BTSA 2FWIA 3PBKA 2Q8QA 4X84A 3UMJA 4HDRB 1GGVA 2CLCX 1V1MB 2EDAA 2EFGA 2C4VA 1Y6ZA 1PKXA 1D9ZA 4JHLA 4QBFA 4S1NA 2BFMA 3SHOA 3BXEA 3Q6MA 4DMLA 1SCAA 2W0MA 3N0WA 4BYMA 2HK9A 3JQEA 1EXWA 3BZWA 3M6WA 4KPEC 2I6FA 4CIAA 1EUCA 1B1CA 1G3IA 4RTLA 4HX9A 2WTXA 1LLCA 2VAXA 1O9HA 1E63A 2A33A 2HI0A 2OBLA 3KVVA 4K9PA 1JR4A 5CJJA 1PU2A 5A05A 3WZMA 1YJ5A 3IQHX 3OZUA 4DN6A 2EC5A 1RJEA 4PYRA 4E11A 3JZIA 4C0WA 1Q1GA 4GOXA 4EHFA 1TFUA 2DY1A 2ZJ5A 1RAAA 4CV1A 2L18A 5J63A 1TF7A 2J3LA 3VXKA 1UXJA 4MNTA 3AJRA 4F91B 4CM8A 3UWPA 2QL7A 4YO7A 1DJNA 3T3GA 9LDBA 2PUBA 4MQBA 2CLEB 1L4LA 4Q3EA 4YCSA 5JAIA 4E5KA 2JIDA 1ETUA 2HO5A 4E7PA 1IEWA 5D3MA 4GQBA 4ALMA 4IO0A 1CS4C 3BCSA 2P4SA 3ENKA 4JJ4A 2FG7C 1K6MA 3N2LA 4UTVA 3PWKA 1ULHA 3GI1A 2I2CA 5K20A 3CIOA 1HEIA 1MB2A 3ZYZA 1ZVKA 1OXBB 4NE7A 2IYRA 3N2YA 5HBRA 2C5AA 2QDXA 3ZHZA 2UZ1B 2C8VA 4HXGA 1JIQA 5EYPB 4XWKA 3DLBA 4L76A 4OXYA 2P7IA 3VZCA 3B53X 4NQRA 2J9RA 3M4ZA 1MTZA 2NADA 2FK8A 5F64A 5JEDA 4OQYA 4L8WB 5JE8A 4Z5XA 4DHEA 1EUQA 1MAAA 1GCOA 1ORRA 1P1IA 1U2GC 2C2WA 2D2IA 2FQXA 3O1HB 1NR5A 2TMKA 3EDMA 4DSZA 2XUJA 1ZC3A 4FOTA 3WB1A 5BMOA 3GFPA 4M37A 3V8RA 4BMXA 2YICA 3DG9A 4M8KA 1TEXA 5B7NA 1K8ZB 1N3IA 1RD4A 2IYYA 3GLKA 3DO8A 1U28A 3PT5A 1L7EA 2L69A 1W9HA 3BREA 3DM5A 4WKGA 3UAOA 1ILEA 3MWKA 1OH5A 1D0SA 2OGWA 1NW4A 2QENA 1WXIA 4RHCA 1L7OA 2V4ZA 5F4BA 3RKSA 4N76A 2UVPB 3GF4A 2B30A 3LVQE 1EP2B 3TUZC 2OPBA 4X92A 1KWKA 1G1AA 3GQBB 1R16A 1TMKA 2HHCA 4G8BA 3BMCB 5DNUA 1O95D 4BMVA 4CHGA 1GP2A 3KVRA 2HIGA 1CE8B 3N86A 2J48A 1I3MA 4G0QA 4DQVA 4FYWA 1N2OA 2FA9A 3ZGYA 4PY2A 3UMYA 3BFKA 4ZCTA 4PYMA 2HSGA 3DKKA 3LCJA 4BNDB 2BZGA 4TSRA 3ET4A 4L0QA 3TNYA 5EHGA 1QK3A 3AP2A 4BNWA 1I4EB 5CX1B 4KG7A 2FF5A 2VT2A 3D4PA 3RAEC 4F71A 2E3JA 3KKLA 3AR4A 4IXNA 2F59A 1VCIA 4MJLA 1QQ7A 5J43A 3AG5A 2K2QB 5BUSA 5KBYA 4F46A 3QPVA 1UBHS 1A7AA 1U9IC 4GZ6A 2QI9F 1XG5A 3SAJA 4PZZA 1YJAA 4O3FA 4CF5A 2NW6A 3O7WA 3QV2A 4DJ5X 3E81A 4RTOA 1ZMOA 2BEUB 4HNRA 4KKXB 1PZFA 1NAHA 1MX9A 1F9AA 2PXAA 3GUHA 4G8JA 5CYFA 4YRTA 4ZWNA 4D3YA 2C2XA 5B36A 5JPCA 4MVJD 1PE0A 1MH1A 2C3OA 4R40A 1U11A 2G1PA 2Q9AA 3HRIA 3JQRA 2TRSB 3K5WA 3NX4A 1K6EA 2BMDA 5ALQA 1IBLB 5DYYA 3K96A 1QZZA 1G8GA 2Y1GA 3FSEA 4ZVQA 3T3OA 2O7RA 1Q95A 1ABEA 3DE6X 3W05A 1TVCA 1Z4IA 1PUXA 2ECQA 4M22A 3O1IC 4UU8A 3TIVA 3VNUA 3KQVA 5F7JA 3GK3A 1N6NA 3MGAA 1GRNA 2ERCA 2IITA 3RBVA 3G7SA 2O8NA 4A82A 1ARZA 4F04A 1SUWA 1HT3A 2AF4C 3DCIA 4J6FA 1TLLA 5A9SB 1NJ5A 3H1FA 4HQ6A 2RHRA 3AVPA 2MINB 3QPWA 3DZDA 3DVSX 3S28A 3JRNA 5IMSA 2VSQA 1YE5A 3OOJA 4C29A 1TVEA 5JAOA 3QNMA 3H9UA 5CEJA 3BIJA 4EG8A 4E15A 3PXXA 2XRMA 2ZAGA 1KI1A 1L4KA 3WAGA 1JH9A 4RJTA 1AB5A 1RXEA 2PLWA 2VTKA 3CJTA 5CUQA 5EP2A 4DLBA 3GGGA 1Q5PA 3D8BA 1LLQA 1WVMA 2XMBA 2AN4A 3DVRX 5DE3A 1CUAA 1KAHA 2GK3A 3LXMA 1X6VA 1SVIA 3DVQX 3F6YA 3H9BA 4JUDX 4ZGGA 3LXXA 1VPVA 4HLUA 2PPLA 5KVAA 4MHOA 5EJAA 1IOVA 3SX4A 4TTRA 3SVLA 1DARA 2NU6B 1M2NA 2IYVA 1BX3A 1XALA 1H3FA 2OUIA 5JNWA 4PYNA 2ESRA 3TKLA 3H75A 3MLBA 1IN6A 3EVEA 3HABA 1BFUA 3LUHA 3ZTYA 3BXGA 4LK3A 3ZWMA 3R5HA 4EECA 1QH1A 1BWSA 3OJWA 3THXB 2RD2A 1DC3A 3CBQA 1Q1BA 3AX6A 1YB5A 2PEYA 3E5MA 2PBLA 3HJUA 5BWMA 1EXDA 3ORQA 5E95A 1QHYA 4JBGA 3VUFA 5DCYA 1DJMA 5MFZA 3DMFA 4OM7A 5IZ4A 2C1EA 4YR9A 3GROA 3RABA 3B5JA 3CUEF 1X1TA 4AKTA 2QMHA 3CISA 3WLAA 4EMUA 1Z3CA 1Y5MA 5BVHB 4Y2PA 2OV1A 4R1NA 3W7BA 2FSPA 1IUPA 4CMEC 2YV4A 3RYCA 2FN4A 2DC1A 2E0IA 1PDOA 1PNTA 3L6UA 3LW7A 4DLTA 5K99A 1GKUB 1K97A 3EF3A 4Q4HA 3QVSA 4D43A 5JYEA 3L46A 4I9FA 2CLMB 2DU8A 3LA8A 1II0A 3LUCA 4II3A 4M8SA 4PICA 3X2FA 5KYWA 3EB9A 2VPIA 2WRZA 1NFFA 2V0NA 1OPRA 2VC2B 2X0KA 3E4CA 2GBLA 5CDSA 1Z4KA 2BWJA 5B64A 3P27A 5K6AA 4M1YA 4DA6A 3AV3A 4EI7A 3EQZA 5I45A 2VUHB 4CCYB 4QJIA 2XB8A 3MQ4A 3I72A 1UH5A 1GTL1 2EFCB 3Q8MA 2FSIA 4G5YA 2LUOA 3OU2A 3CUKA 1Z36A 3NWBA 2QQGA 2JGNA 5CBKA 4FDTA 2WILA 3FXAA 2O8BB 2AH5A 5HQ3A 4CMIB 1X7HA 4DR1B 3DF9A 4HFNA 4BQRA 4DJEC 4C43A 1JDZA 2YQZA 3FWNA 1Z62A 3W0LB 3ZNPA 2PZ8A 3RIXA 2A9PA 2EFDB 1C7JA 2PX6A 1KYZA 1GUAA 1YJBA 3A10A 1EWVA 1A2OA 1N0VC 4CG1A 1UPUA 4LYAA 3O5AA 4B74A 1US8A 1DJLA 4CLOA 1JEQA 1TT5B 3KLNA 4GBJA 3K9LA 3SXJA 1A04A 1X0XA 2R7LA 1LF0A 2BI7A 1PJSA 3ABQB 2NXJA 1OSNA 3HLTA 5IJWA 3CQ9A 3V1TC 1KK3A 1QQ5A 1M1NB 1S2DA 2JLQA 2VHUA 3IV7A 3K4PA 4J1SA 4JLDA 3QZUA 4MWTA 5AKLA 1P7PA 1UXKA 7MHTA 1FDIA 1HM5A 1SXJD 1K1EA 5I7AA 4MVJG 5I7VA 1KI6B 3ZLVA 1HE3A 3GJXC 3Q98A 1PFKA 3U3RA 2NUPA 4QXMA 3V7NA 3VM6A 4CKEA 4B6EA 1GFZA 2C4UA 5CFNA 5DBFA 5MFPA 4B79A 5CLJA 5FT9A 1GKYA 1KHHA 2P27A 5HX7A 3PJDA 2ZDGA 2AZXA 2VQSA 2WF8A 5FOWA 1JBQA 3A28A 4CQJA 4A03A 2P9GA 1V48A 2HQRA 3DBHB 3GLFE 1FRFS 3NM5A 1V3TA 1RTTA 1HSZA 3HTXA 3BMQA 4ZGBA 1GV1A 4DJJA 3EXG2 5B55A 3LTEA 3E70C 4GQIA 4JQOA 3QKRB 3UMRA 4DG5A 1O6GA 1U3FA 2YS7A 4NZOA 1DBQA 3OIDA 4C7OA 5BOVA 2FW6A 4HUQB 3EWAA 4FLMA 2QTWB 4G81A 2GLTA 2B92A 3AWDA 3FPGA 3IP7A 3IT1A 4PSAA 4S1VA 1WSBA 2JBAA 4X3OA 3RYIA 3EBPA 2QIOA 2QLBA 3BOSA 4AN4A 4FSXA 5AIAA 1L7NA 4JODA 3M4YA 2IPAB 1DBPA 4O2BA 3C3JA 1X1CA 3QVOA 3Q7EA 2C3PA 4CL8A 5LOVA 4QWMA 2QSUA 1ONPA 3L02A 3GOQA 4LCBA 2Z8YM 3ITEA 4H0FA 2OVBA 3DT9A 4K9RA 4XAQA 5FHQA 2HSWA 4BJ3A 4O0MA 4ZU6X 2FFQA 2HXGA 3PPXA 2QZZA 3BXOA 3UB2A 3OUZA 2BFCB 1VKZA 1GQRA 3TIXB 2XYRA 4XPIB 5EZ5A 1DWOA 3TBKA 2RB5A 5IAGA 3P5SA 3TLJA 4TOIA 1CXZA 3BB3A 1C7ZA 2PGIA 4UJ3A 3AY0A 1CEYA 2W6OA 4GWGA 1YIAA 1SBNE 1NW3A 1P0PA 2PD3A 2GYUA 2W37A 4B35A 2D8AA 4ZZ3A 3C8MA 3EDRA 4K88A 1ZU4A 5BWCA 2V5VA 3S2EA 1AMOA 4NENA 3PRJA 4YP9A 1P1CA 3Q7SA 3D7RA 1J49A 2QYOA 2O52A 3FKJA 4XQEA 1H2XA 1FP6A 1TTQB 2YV2A 4MRMB 4H9GA 1V9SA 1LTHR 4YUVA 1B8NA 1LFAA 1VYVA 4KZKA 5IXJA 2WG0A 2C7QA 1ZXLA 3PNPA 2VJAA 3ZPXA 4TZ6A 1UJ4A 4WY2A 4ZI5A 5DHRA 1TCUA 4JBYA 1XDZA 2BY4A 1KKMA 3RSSA 2GEBA 3U7QA 1EWTA 3IAAA 5DYTA 1JKJA 2H54A 5AVYA 1OIXA 1NYLA 4CHTA 5ELXA 2GWHA 3KVOA 1U5CA 1K6IA 3D3WA 3FD8A 4G84A 4DDMA 4F84A 5AH0A 2Q6VA 4B6PA 4F6RA 2RK6A 1ZLXA 3DLIA 2D0IA 5HE9A 1OB5A 2R7KA 1BJKA 5JASA 2JH3A 1W5BA 4JWKA 5E7QA 1YDHA 3HKBA 1W2HA 4M7WA 3TLCA 4CKBA 5JZBA 3BRWD 5ENDA 3SQDA 4DLPA 5K03A 3HJGA 3C5WP 2JJ8A 3Q72A 4R41A 5AI5A 1QYVA 5K0CA 5C32A 5MHTA 1J06A 2DR0A 3K05A 3HSKA 2X22A 2VH1A 5HKAA 3FFXA 2B35A 4KE7A 5KKNB 4LC9A 1JIVA 3RR2A 4OO3A 5DIFA 1EJBA 1DS6A 3AILA 2UDPA 1WDMA 1EUCB 3CKMA 3Q10A 4GYJA 3HZOA 2QLMA 4MUGA 4W8GA 3ADPA 3R7LA 3HRKA 2V59A 5IZCC 1MO6A 2BUCA 4CMHA 4GU5A 1C0LA 4I9GA 3QELA 1FB5A 1R6XA 1LQUA 2QRVA 2XUOA 3O0DA 4BFZA 5KTMA 4XTRA 2P62A 3DMTA 3HJAA 4X7PA 2WHRA 3FPHA 3WLLA 2QPLA 1QRRA 3JYPA 1S4MA 2OZEA 4ARSA 1FFEA 1PW7A 4CM8B 1J23A 3RREA 4A8JA 1D7OA 3KETA 1J2TA 1ESDA 4IV8A 4MTCA 4D99A 1M2FA 5D3MB 5GM2A 1KEKA 4Z53A 3SS9X 5AJVB 5IN4A 3HEAA 4UHJA 2O2YA 3LWNA 3OZWA 3H17A 2QU7A 3JRXA 4LK2A 1R6DA 2E18A 5KWIA 1FE8A 2BF7A 2OL4A 3I2JA 3V8VA 2BP7A 5KPJA 2QQ0A 2CE2X 4DR7B 2QZ4A 3U7FB 2I6TA 5HTKA 1YQUA 3EZ2A 4LVOA 3U3MA 4PIVA 4AN0A 2IP1A 5AHOA 4ND1A 1V95A 2ZI5A 3DOEA 2IZ0A 1E1RA 5U4QA 2NZXA 4BTVA 4KJZA 3PC3A 3USZA 2QGNA 3LQ4A 1E5XA 4WECA 2PKEA 2VF8A 3ZHOA 3G8AA 1FP7A 2W6JA 3QLTA 3E6AA 2BH9A 2DWCA 2D3WA 2H7CA 4C30A 3WQHA 1UK6A 2F9LA 4DZTA 4TKVA 5CPBA 3A36A 4RSRA 1Y6JA 1IWOA 2BD0A 1ST2A 2AFRA 2DKOA 1W47A 4E5MA 5AW6A 1D5WA 1EPUA 1EWKA 5K0ZA 2B83A 2Y9MB 2RJ3A 4XQ9A 4XWWA 1THMA 3BFVA 2DWPA 2D1YA 3A4YA 3IAFA 4NEHB 4GSKA 3LQQA 3ZE8A 3ER8A 2P9HA 1GCIA 2H1VA 3BL6A 3BSSA 2GM3A 3OLQA 4MWEA 4P58A 5HOQA 3IHKA 1PVOA 3T9BA 4WEOA 1QMGA 2QN2A 2DLCX 3EAGA 5JR3A 5JECA 1JIKA 1AGRA 2HM7A 2ZVDA 3DE0X 4PGGA 3R0QA 4U8HA 1Q7EA 4CU5A 4DB2A 4YRRA 4OK6A 4RPKA 5JC1A 5EXSA 4IJUA 3C70A 4DCSA 1KFCB 4G97A 2L2QA 4C0HA 4K2AA 2OHOA 4TRRA 3OT1A 3PQ2A 2CFSA 3STVA 3THRA 3ZW9A 1I6WA 2NSLA 4RTMA 1WUHS 4OJNA 1ZNZA 4Q66C 1EZ1A 5AXBA 1TD1A 5AVXA 1XRMA 5GTDA 4HH3C 4DUYB 2Y0EA 3CV3A 4DRZA 5FJIA 4WGGA 1Y3CE 1SUCA 1F1JA 5MGBA 4XDHA 4XM2A 3HB0A 5AKYA 4AG6A 3T7AA 4DMMA 1RXIA 2FSSA 2VYQA 2YIDA 1UKYA 3L6EA 4DEVA 1SK8A 2ENUA 4WCFA 5J2TF 1AO0A 4DG9A 1Z29A 1QX4A 2Y1LA 4N3GA 5AKHA 2AFIE 3CMCO 5ESDA 1GSOA 1O54A 5G53C 3HCOA 5BT9A 4G89A 5F1PA 3ZJ5A 1X77A 3EZ7A 4G0NA 4M49A 4YK7A 3L9XA 4WFQA 4AXBA 2WWFA 2CXUA 3H8SA 4QQFA 2IPNA 2BW0A 1W4CA 3NHWA 4ZC8A 2VRWA 2WWXA 4Y2QA 2WHPA 3OURA 3ANLA 4KQEA 4ZO7A 3VR6A 4UBNA 1OI4A 1BFKA 3A3OA 4G2NA 5DTEA 1O7JA 4NFSA 2ZYSA 3VBEA 2JJ2D 4B3GA 4LXTA 1M2OA 2DLDA 4MWOA 4Z1OA 4OHZA 5A5DA 5EOVA 2R7NA 4UNPA 3GRCA 5K8TA 5IFLA 4PZ0A 3WMFA 4EY3A 4UM8B 1P6QA 1I4TD 3FVRA 1J8DA 1H1LA 3K2BA 1XZIA 2TMDA 4YJKA 3T4XA 4EHAA 5E7JA 3RW9A 1YKGA 3ET5A 2Q62A 4I3GA 4XVHA 3U4DA 3W2TA 3ZCSA 1J8YF 1GEGA 4KO3S 3UPUA 1WZUA 3IMFA 1HYEA 3OEHD 2DPHA 3JWPA 2G07A 4FGLA 4GYYA 4J2TA 3JSAA 4OK3A 3ZYCA 1TCVA 5A2QA 3DYIA 3R4VA 1U3CA 3ZHUA 2WT9A 1GGNA 3I73A 4H1HA 1WP9A 3U37A 4AQYB 2AYXA 4JJZA 1GPMA 1NXOA 1UC9A 1NW5A 4WRRA 3JAMA 1WVIA 1DWQA 1NJ2A 3BMOA 3WJAA 1REQA 4KAFA 1L0BA 2R8ZA 4MXDA 2ZS8A 1R9GA 5LKAA 1KKUA 1UQUA 1W19A 2Z6AA 1QH1B 3RH0A 1S2MA 1N8TA 1R5BA 2XYHA 3AU8A 1QG0A 3D02A 3EVTA 4H3KB 4MQ5A 1GLGA 5T57A 5T67A 3TRJA 3ZJ4A 4RBNA 3BWVA 4CT5A 1KR2A 3DOIA 5JY1A 4UNNA 3ZWWA 2VT7A 4KQGA 4JI7B 1SJ9A 5FH9A 3OMWA 3FE2A 1GGMA 1ZS9A 1M2HA 2YV1A 3M49A 1H2ZA 1EFRA 1P2BA 3EZYA 4A15A 2PCLA 2VRCD 3QFRA 3V80A 2H4FA 5JVDF 3WA7A 1XWFA 4R2JA 3RFUA 3DL2A 1XYGA 1K2WA 1GL6A 2VH5R 2PDAA 3A9CA 3BL5A 3PFNA 4YONB 3ITDA 4J0EA 3UAWA 4QUKA 4Q4HB 4RQUA 5KYWB 3QFHA 2CFOA 2HDHA 3LLSA 5P8WA 4OGFA 3NC4A 4YRMA 1XQWA 2AK3A 1MB0A 4ZCRA 2HQBA 1RC0A 3KS9A 4DQDA 1NFQA 1BYUA 1GUBA 1G8FA 2CCKA 3DDHA 1XVVA 3WL4A 4CXMA 4Q9AA 5J4HA 3BAFA 4M55A 1PZHA 4RTSA 4DNFA 2WIDA 4IGEA 4JP1A 4CTOA 2DWUA 2Z04A 5D84A 1I7SB 4IIEA 1RPZA 1RFLA 1FXWF 3I53A 3W7AA 5JQWA 1UAAA 1KPGA 1LW7A 3CH6A 3QX9A 3L3BA 4MLZA 3T1OA 4L51A 1Z5ZA 3RRMA 3ZCQA 5HQ3B 4W7HA 2VYND 3KSRA 2VJCA 3FPLA 2F9MA 1DUVG 1NJGA 2Q1WA 2REQA 3PIRA 4ZDWA 2QAIA 5T41A 4NXMB 1VMDA 1I3CA 3Q2OA 4UPEA 5FOQA 4JOSA 3DOHA 2F1OA 3ORRA 1BVUA 2WNIA 3IEMA 1FDWA 3EMBA 4JJ7A 5EZYF 5J5AA 4TLLB 5I3CA 1US8B 2EAUA 5JAQA 1JEQB 2QZ9A 4B8YA 4CLOB 3T1YB 1VE6A 1JLRA 1WXWA 4GYWA 4G0XA 4QLAA 1QYCA 4LC0A 2QLFA 5KNBA 4L57A 1K5GA 3LT2A 3KEGA 4GIBA 3IB6A 4Q21A 1EP1B 3TO5A 4JN6B 4NU6A 3QLVC 1YVRA 3JQAA 5AUQA 4NSNA 1WS6A 2ENWA 1OA0A 2ETVA 1NSFA 4Q6WA 1IEVA 1WPXA 1Y7IA 3QEBZ 3FMVA 2ZUTA 4JBNA 1VG9B 8AT1A 2NUPB 3NHJA 1MJHA 4CKEB 2PKWA 1U2GA 2X3UA 2GR9A 1YDEA 2N0SA 3GGPA 3KB8A 4H16A 2WUGA 2WTBA 4HQNA 4HXEB 4RL6A 5LFAA 2X1LA 2HRZA 3HHPA 1NWCA 1XDWA 2AS0A 2H00A 1X42A 4MV1A 1J0EA 2PO5A 3RIYA 8LDHA 2O7VA 1JSZA 4QQNA 4C87A 1B7GO 1U0TA 1K3FA 1PWEA 5AHKA 3ZWAA 4KFCA 1E8NA 1V7QA 2YYSA 2LW7A 3ONWA 3TGLA 2YHAA 4B3CA 2NWQA 1O4WA 1WY7A 4DMGA 5KX5F 3BMQB 2YJZA 3DKRA 5B1SA 4BP1A 2A9OA 3H9QA 5KYNA 1U8UA 3IRUA 1AQUA 2XVZA 3DJYA 2XKKA 1G59A 1YFJA 1OHHD 3R8XA 4FFNA 4C7OB 5ICEA 3MJHA 5JI2E 3EQ2A 2YNMD 1RLOA 1CJCA 5BQ5A 3RYIB 1KI2A 2JBAB 2J5RA 1Y4SA 4ALKA 3DULA 1W1UA 4O2BB 4UC0A 4BNIA 2BHNA 1R10A 1XDGA 3BYZA 5LOVB 2IS4A 1MC4A 4A8TA 2ZYGA 1W5TA 1R12A 2X77A 4JLNA 5ADWA 1DZIA 3CWQA 3V4LA 2J46A 4Y2UA 3D2AA 2PD6A 4I4LA 3KYCA 3RFFA 2CHGA 3E3AA 1ODTC 1WRBA 2WUWE 1V26A 4LF5B 4G0PA 2VCYA 4Q7KA 1WZNA 5DM4A 1T1EA 5ILOA 2W8BA 3OZVA 4AY3A 1INLA 3UEOA 1V8DA 5B1DA 4EPYA 1NBAA 3VYRB 1JLSA 2HY7A 1FK8A 4UE2A 1RQRA 3DEYX 3TD6A 3U39A 3TKYA 3VRHA 4F2HA 5T4BA 2CBGA 3KJQA 2AJLI 1GNLA 1ETHA 3L1UA 3DWFA 4AVYA 1UKZA 2Z1DA 4NENB 4WN3A 5LCXA 2C2HA 3FYCA 4IZOA 4J76A 5A0FA 1G55A 4HGPA 4TZ0A 3MERA 4TV8F 2O3UA 1AV6A 4D9BA 1WLYA 3GH3A 3GFQA 3RSQA 1YBHA 1ZI8A 1K8QA 2Q3MA 3RYTC 2OFWA 2Q0XA 4C0LA 4F2GA 5KKCA 2EJTA 4IF4A 1TW2A 3I2HA 3DPUA 1BKSB 4Q3AA 4HO1X 4RU1A 4D2IA 2GZ2A 4R31A 2QTVA 3WLRA 5EJ7A 1DDIA 2LE0A 2Y4OA 4IHJA 1N9KA 4NNPA 3USCS 3ZZMA 2HPHA 2WM3A 1IY1A 7YASA 2PT7A 1HX7A 1I8TA 1GAEO 4KIUA 3U7QB 3FZGA 1JKJB 1NY5A 4HPWA 4Q12A 2HJWA 1LI7A 2ZRMA 1T4DA 2W2XA 1ACMA 3D3WB 4F6RB 2XT9A 1U0FA 4DUZB 2LDBA 4I1OA 4KTTE 1U7DA 4BU1A 1CVLA 1V6SA 4C6TA 4DPLA 3HKBB 1JPUA 4CKBB 2RHDA 2VA8A 2QP9X 1AKQA 4J3FA 4CLXA 1HGXA 1SD1A 4YV0A 1XOIA 5L4NA 1ESCA 3KU4A 3EAQA 3PEEA 4IDCA 2ZYDA 2F55A 1VE7A 2R97A 4JZKA 2WMDA 1VYUA 3W9BA 4MIOA 2Z3ZA 3BK7A 4AMVA 3OCWA 3FETA 4KQJA 2CMDA 4HI0E 1IHOA 2P6MA 3NGXA 4KQWA 3I6MA 1WCWA 7ADHA 1K86A 4FGUA 3GA5A 3QELB 5A06A 2QRVB 1MAUA 2ZW9A 3O4VA 3ANSA 1E1QA 4FJ0A 1ENZA 1KC3A 4AJ1A 1R1DA 2C31A 5M7EA 4PVCA 1RVDA 1V5FA 1ZYUA 5T4FA 4CEJA 3WOVA 5B7QA 3LA6A 2R11A 1LLUA 3N58A 4C1BA 4GOLD 3TAXA 2CMFA 4TSFA 3ZGLA 4A8JB 5A7FA 1C5KA 3T3DA 3MMXA 3EA4A 4K03A 3WDLA 1PFVA 2RGBA 3RU3A 4B3MB 2NSYA 3E35A 1ICEA 3REGA 4D9FA 2ON6A 2Y6VA 3MTGA 3ZY6A 4W5TA 3A25A 4PVDA 1BG6A 1CT9A 5EIAA 3TLEA 3AEXA 4IDEA 5TIIA 1SG9A 3DCYA 1JAIA 1I51A 2YCLA 3A1EA 4TTIA 1VLLA 3K72B 2YY5A 5CJPA 5AKJA 2BP7B 3DEHA 1MX3A 4EG5A 3HN2A 4TWJA 3SR3A 2WEKA 1U0SY 3CF4G 3NHZA 5HEKA 4JI1B 4L6IA 2WSLA 2Q6IA 3NBQA 4PIPA 3QWIA 2IU3A 2ZJ1A 4Z6KA 2L42A 1Y7TA 3GVHA 2PKCA 3QUBA 1COWD 2V7UA 3EOZA 4F9EA 3DFIA 1CUIA 4DSAA 4MKHA 1Y8AA 4J1NA 2AJCA 2F3SA 4MPJA 3FOZA 3DEAA 4O25A 2DT5A 4TQAA 4TKVB 3EVAA 1MC5A 1DOZA 2H29A 2YHIA 3MFQA 5L40A 4NJOA 1K3TA 1WQ3A 4BNKA 2FZVA 2G8NA 4B5KA 4OXQA 4KIJA 2GYYA 1HQDA 4GBGA 1IBKB 3BL8A 1P5JA 4U0KA 1ZZGA 2WDPA 2QN9A 121PA 2I7TA 3HB5X 4NYJQ 4B34A 1LPPA 4ENQA 3I62A 1HDCA 3Q3IA 4B6RA 1OTXA 2ZLBA 2WIJA 1DE0A 3UHAA 1APBA 5G4LA 5L7YA 2NP7A 3FHJA 1KI3A 1ODLA 1O87A 3AI1A 5HXAA 1GL3A 2VRNA 5AKXA 1MC8A 3BD9A 1RC8A 3AI3A 1QFSA 4NQZA 3U4CA 1MP0A 2D1TA 1J2YA 1RZVA 3IRVA 3RUAA 3IYLW 3ZDYB 1FFWA 5C7IO 2D7JA 3K15A 2RARA 4QU8A 1P0MA 3OJCA 4F5EA 2VVTA 1VL0A 2IQIA 3OT1B 3FNHA 2FH5B 3A58B 1RSZA 4ZVOA 4DY6A 4MZDA 4PHFA 3ETDA 2X9VA 1NVBA 3U19A 1KVTA 4MVJH 5EWJA 1GA1A 2G7MC 2YXBA 2ZUWA 5DWQA 3T5MA 4JJ8A 3T5TA 4H3SA 5KYKA 3HUDA 5C8ZA 1J2JA 5H4GA 4DR2B 1NHWA 2G28A 4P33A 5CP8A 5BMVF 2WZCA 2ZWOA 4E3WA 4QUGA 1R64A 4KE6A 2BMWA 3OKAA 4R9VA 4WCFB 2Y3IA 5C9ZA 4R9NA 1BOFA 2C04A 3AK4A 1PFQA 1PYOA 4C1NA 2W42A 1A76A 1NC3A 5EIBC 5C8YF 3QF4A 1U8CB 2AUMA 2MYUA 1YDGA 2OB1A 4GC5A 3RUHA 3LQ1A 1DTWA 3R6WA 1L7QA 1CZOA 2I0FA 2O2HA 4M1WA 1BXRA 3UY4A 2ZJ6A 3AONB 3I6QA 5A3VA 1RRPA 3NAQA 3VKUA 2CMHA 4Z9XA 2AUTA 2WHPB 5DSTA 2AEJA 1T2EA 2R6R1 4BGEA 1XVUA 2XA9A 3BD8A 5AW5A 4URVR 4FFDA 3MS7A 5KNCH 4D0SA 4RIEA 1M5UA 2Q9CA 1F1BA 2I8AA 2Q99A 2VCHA 3EDQA 5FPQA 3G0HA 1M2OB 5JFOA 2RHMA 4R51A 4A26A 4FYYA 4DCGA 4ME6A 4J2HA 3GCDA 2EZ4A 2VDJA 1AGNA 2PKYX 1GU1A 1E79A 2QROA 5JJBA 3PCXA 1Z73A 3BN3A 1G3QA 1H1LB 1YAHA 3EMVA 4OQXA 3MTAA 4I8IA 5KCZA 4YRSA 4B40A 3C1AA 5FNVA 3RCBA 4DQLA 1NNUA 2VDLB 1E9EA 1CJSA 3L1HA 2I6QA 3O1JC 1BHJA 1OWLA 3DVAA 1KMIY 2HDOA 4C5AA 4I9NA 4O29A 1PT9A 2XTJA 5CFPA 4AW9A 4ENSA 5CHYA 3AR8A 4BNHA 5JADA 1PVDA 3DB2A 3GBVA 3MUEA 3QLJA 2OLKA 5KHOC 1QO9A 2PRSA 4ER6A 5ITSA 2ILVA 3BMOB 3GRUA 1REQB 3FMIA 4YO8A 5ECDA 4E30A 5BV0A 5K0BA 4UBLA 3EQ7A 3ZHTA 4XJXA 4YDHB 1L9XA 4ITRC 5AOBA 8OHMA 1EZ4A 3OVMA 3D4LA 3ACDA 2JBWA 2CK3D 2HCRA 3EAFA 4P84A 2Z3VA 1VLQA 1G5TA 2XF2A 1E2BA 3I2GA 1Y5IA 3HM2A 4P3YA 2VHQA 1XA4A 4IV5A 1N2GA 2GRUA 2I67A 3IAHA 2I6UA 3OA2A 3OZBA 3PHJA 5CTAA 3QNWA 1HFWA 4Y1FA 3H87A 5KI6A 3WQRA 4BLQA 3BE6A 2X7XA 3JALA 2XH8A 2CW5A 4UEWA 3WWEA 1XD9A 4CBVA 2DQYA 1Y1QA 4J4TA 1RADA 2BM8A 1MUUA 1N1GA 2H0RA 2V5UA 2WJ4A 1E69A 2X2OA 3BRQA 3DV2A 3QU2A 3T3HA 4K3VA 1ZUNA 3WGMA 4E4TA 4E2YA 5ETJA 3ZHQA 1CJMA 4F4UA 3E61A 4QEDA 3UK2A 2XDAA 5TE9A 3ED1A 3PXDA 3U1TA 3O26A 4OATA 3IJRA 3O1LA 5AKZA 3LQFA 3KAPA 5H8WA 1RQNA 3E2IA 2O2IA 1S3FA 1N77A 1A5AB 3D2CA 3QUSA 2SNIE 2HHJA 2X40A 2ZE5A 1SZCA 4NVRA 4AJ9A 5JH7A 1KMMA 1H2BA 2OWEA 3G9ZA 4BMDA 1OPXA 5HZMA 4HFMA 3VNBA 1U1IA 3PXAA 4UMDA 5KC9A 5H70A 3ZY2A 2OG1A 1H5UA 1G6HA 2REQB 3L8EA 4KQIA 1K5PA 5DLDA 2MCFA 3LDUA 1SOVA 4YXWD 2JK0A 4F2PA 2Q6TA 3O2SB 1JT2A 3HY3A 3WQBA 1QHNA 1E0JA 3VUEA 1WOYA 4P7BA 1IBCA 4PR0A 5DX8A 4DY4A 2FSVC 1ZD9A 1CUYA 1JHZA 3LO8A 4ZTZB 4R81A 1VIMA 1VP9A 4WVFA 1BW9B 2AFVA 4B85A 1ZGBA 1T5DX 2GRAA 1B6RA 4M86A 4QRHA 1H69A 1NRIA 4BRSA 1IB6A 1GQQA 1RBQA 1NXSA 3KWLA 4R9UC 2XRFA 4U2DA 1YASA 3QI2A 1IHDA 4O2AF 5A4AA 4CTMA 4I55F 3LUAA 1OLXA 2BZSA 2IHUA 3JQAB 1F38A 3QPCA 4L4YA 3JWGA 4OI4A 1LPAB 1XNGA 2N46A 2OILA 4FCTA 1SU8A 2YRFA 2YOGA 3I37X 4ZMRA 5JRZA 1CUGA 5B3JC 3W5HA 2NIPA 1IG3A 1H94A 3GFGA 1FS6A 2BAGA 4BJ5A 3CEHA 1UZUA 1ML4A 3UJ7A 4X1OA 2HWYA 1JDNA 5DEIA 2CN1A 1F12A 3IUBA 4QC2A 4D98A 1AKTA 2WYHA 3G1UA 1QTNA 2FEWB 3E8SA 1GTRA 4RV9A 3ADBA 1OREA 3THWB 2QPAA 2A1UA 1RHRA 2QT0A 1XRQA 5D7NA 5E38A 5E6UA 1JT9A 2PUTA 3C7DB 4HRAA 4C5CA 1CETA 4AJIA 2YHSA 5I48A 3DUFA 4ZOLF 3QU5A 3PJEA 3CTPA 4EA6A 2DPYA 2HLDA 3B82A 2RI6A 3IX7A 3PVZA 4G1CA 5DMXA 4GZ5A 4ENRA 3F90A 1PFYA 5EQFA 4V39A 1ZW6A 2EQAA 1CQJA 2GHRA 2WHQA 2KX7A 3AR6A 1LZKA 2DOKA 4RK4A 3SYRA 4DCOA 3DMGA 3M5CA 5BQ3A 5SZIA 5CX4A 2Y99A 3BB4A 2GF9A 1QV9A 2YWRA 4TWRA 3F6RA 3TVTA 4C5BA 1Z88A 2XWSA 1XKLA 2HRCA 1GU0A 3KBBA 5AI9A 4M46A 2PA3A 4JDUA 2JZCA 4YLGA 1E60A 4KOAA 1ADFA 2PXCA 1MG5A 2OVFA 1RRMA 5DXFA 3L82B 1GOTA 5ICMA 3KYCB 4FT4A 2N1MA 4YCBA 4NPCA 5JZ9A 3D6NB 1PF7E 3TSYA 4DZRA 2XUPA 1ZI9A 5LUAA 5THQA 2YRXA 2W8BB 3HYSA 2NYRA 4O4IF 3T8YA 2JK1A 1ZHFA 2HAEA 1DFIA 2XWPA 3U9TA 5IFKA 1X1DA 2ZRPA 1B00A 4ZODA 5FHRA 3T9AA 3UAVA 4RZXA 2DBYA 1YONA 3AINA 3GJ4A 3SBEA 3BKXA 5F5XA 4LI0A 3NH9A 1FQJA 4LV8B 3U62A 5CB8A 3NUGA 4QVKA 1KGDA 3RC3A 1YGPA 1NU8A 2QRNA 3JWJA 4ZCLA 4MPPA 2HQ1A 1YQTA 3NYWA 1JG6A 1RU3A 4FYXA 4YRAA 1IU9A 1AZWA 4NBLA 4Z9BA 3G2MA 1ZA2A 4WOBA 3K9NA 4IIHA 1XZFA 2WJYA 1CJVC 1KAGA 4DLVA 3N75A 3HXMA 5LN1A 1R88A 1S8NA 2JCYA 2V7GA 4MGEA 1KEVA 4NULA 1V5WA 1R0SA 3CLRC 1T2FA 3EC2A 3TRDA 1T15A 2QTVB 4E70A 3QH4A 3TR5A 4A10A 4IHJB 3FY4A 1G19A 1NOIA 2AG6A 2FJ0A 1QVWA 3OCUA 2I3AA 3TZ6A 4G41A 1SHUX 3JQFA 4ER3A 3VJRA 1MB3A 3C1TA 1X7YA 2BFNA 3B6JA 1YZKA 2I8LA 5AXDA 3I9OA 4UTPA 4YV7A 3QVXA 4UVHA 4H2DA 1QGZA 4A91A 4Y1EA 3WDSA 2RE8A 2COKA 1EVZA 2A84A 4HX5A 3KXLA 4TVBA 5JZMA 3ZQKA 4HP8A 4YWJA 4C0XA 5CITA 3MJDA 4G07A 4C6TB 3L8DA 4MRAA 2HA3A 4FDLA 4UOQA 4KO4S 3ZU4A 5LWQA 1TO6A 1RHMA 3C7AA 1XNQB 4CIBA 3EODA 2CJWA 4GRIA 2P91A 4GS5A 3GN2A 4ZJYA 4G25A 3FUCA 3KR0A 2Q5JA 3OZRA 3KKPA 4L2IA 5FV7A 3S7TA 1AQJA 3TUJC 2AXPA 2VOEA 2VG8A 3HPRA 4HG2A 4QGAA 2QTBA 2VPPA 3ADOA 2C5HA 3D6FA 1QWOA 3BSFA 2AEEA 2O1SA 1GZ3A 2FW8A 4E03A 4OB6A 5GINE 2NO7A 3WQQA 4ZRDA 4Q9LA 1C8BA 2V7BA 1EVIA 4K1XA 4N5IX 4QX6A 4UDNA 4E51A 5IC4A 5K3OA 1K7EB 4F5YA 3UMMA 3N8GA 4NK5A 1PZGA 1ZEMA 3TW0A 8ATCA 3OBBA 5LYJF 4W4TA 3LK7A 1W1IA 4RW0A 1EFTA 4D8UA 1KOFA 1JTEA 1MGPA 3WBKA 1KO5A 4W1SA 1E6LA 3GD5A 1NQWA 1AC5A 3KE9A 4EG6A 4RE6A 2XTZA 1WKBA 3LUKA 3T7DA 3OLWA 3B2EA 2G82A 3ROPA 4HY3A 2CUTA 5TQJA 1X87A 1TQ4A 1VSUA 4K6OA 1Z7GA 1ITZA 4M0PA 4NHOA 1H65A 2O2SA 2PWYA 3HUEA 4NBVA 1S7CA 2IH2A 1VYTA 1UP4A 2ZUVA 4JVLA 3RSGA 3CC8A 2UUOA 3LPNA 4G1MB 2A0KA 2CVQA 4KXVA 4F1KA 5KO2A 1W73A 1JQLB 4UASA 1I2DA 2WVGA 4ARIA 2ZZNA 3A2LA 4RKYA 2II6A 2YW9A 4YHHB 3PGA1 1EE9A 3PA6A 3PRYA 4G4GA 4DEYA 4IOLA 3E9CA 4COOA 4UTNA 5J4YA 2ZTUA 1GYPA 1G8MA 4G5GA 2H1SA 3ANMA 5I9IA 4LFBB 3T5CA 2XMGA 4UXHA 4WFKA 1SU7A 1R6UA 3KYJB 3PVSA 4N6NA 3C3PA 3GAAA 1SIWA 3ISVA 3W5VA 5I7FA 2QLTA 3MOSA 3E7FA 3GX1A 5JRJA 2VBCA 3LZDA 3LHDA 3M8KA 1D2HA 3NHYA 2M6RA 3K0HA 1M0SA 4JCOA 2CSUA 3RE1A 1XQ9A 2WIKA 4L0DA 4ZN6A 3LU1A 1ISRA 5BN1A 1Y9DA 1I14A 4XVQA 2YHIB 4O4JA 1MVNA 4ZDIA 3RUDA 5CVVA 4ZQEA 5FQOA 4YT4A 5C5CA 3BE8A 1J00A 4L02A 5HIIA 1F7UA 3HDTA 5T5QA 3NORA 4WXYB 2RHCA 2L19A 4MMZB 4PYIA 1HRKA 1S8FA 2XBUA 1JHDA 1O2DA 1Q74A 1U8TA 1CRPA 1Z6PA 1QORA 1N6PA 4FEGA 4DCPA 3PEWA 2IYZA 5AVSA 1FNDA 4G36A 3OZEA 1XA3A 1YOBA 2Q41A 1D6MA 3S2YA 1JJFA 3TTVA 1SBYA 2COUA 2REOA 2HUNA 4TYPA 1TAHA 1FBTA 4XPZA 2F1IA 1HF3A 3FFBA 4MK4A 4RKEA 6AT1A 4GXRA 4Q7QA 1JR2A 2DPMA 2BEJA 4ZI7A 4YCNA 5AKEA 4HQFA 2OESA 3PQ7A 1NBME 1E4EA 1V2GA 1SUPA 2J7PD 4A2PA 4CIWA 3B9BA 5EWJB 2F00A 3DTTA 3GT0A 1I4WA 4E5PA 4QFDA 5HBGA 3NHSA 3FIJA 3O3CA 2ZBDA 5IJXA 5B30A 5GVSA 3B38A 4U2GA 2JNWA 3IDZA 3W4IA 1Q1AA 2YV5A 3HZHA 1JHXA 5KDLA 5DGTA 4C2UA 5AJYA 4YQZA 5BNZA 3Q1LA 1ISFA 1P73A 4H7KA 3QF4B 1RWOA 4DIDA 4JYMA 4PTZA 1DTWB 1R7RA 2I2XB 5DM0A 2QX9A 1BXRB 4GOND 2B2NA 3PXBA 3NJ8A 4FDMA 3WWZA 1OBFO 1K3UB 5B3LA 1T4MA 1Q0PA 2EJWA 1MFZA 2NO6A 4DA7A 5TX7A 3AVYA 2F3UA 1YF3A 2IODA 1G2OA 5LL6P 2AG0A 2O2EA 3RVJA 2R96A 3EIFA 4Q9HA 2WAAA 4KDRA 4M1QA 2NTEA 1VIYA 4RY2A 1MAVA 4OL0A 3V4FA 5KTRA 2VF4X 3KEOA 4IDPA 3IIKA 4KQ1A 2XUFA 5JCPA 1GUYA 3E23A 1B43A 3UG7A 1OBOA 1XI2A 1ZK1A 2PBFA 3X2SA 3KQNA 2VPQA 2CHUA 1YCHA 4GQAA 4CNQA 2HIAA 1Q1NA 3L40A 5I8ZA 1UT6A 1EK1A 3RFTA 5FNVB 2HV8A 1H42A 4D9NA 1OAAA 1I2CA 3OEYA 4XR9A 5F2EA 3DH0A 3B1YA 3DVAB 3P0JA 3KL2A 1XPUA 4YRNA 4RD4A 3NVKI 3IEPA 4FGSA 1EFVA 3IJ5A 3PC7A 4G4SP 3ZHXA 1Z8NA 3L7MA 4E2XA 1X7ZA 1L5RA 2HRRA 2BKLA 3ECSA 3PNOA 3GLIE 2JJQA 3LP8A 4MEAA 3ZGOA 3ANYB 1NA5A 3H5IA 1SZPA 5M34A 1PR1A 1EM8A 2YX1A 1FMFA 1NYTA 2JIBA 3TDMA 4BVGA 4UEQA 1CNFA 4LJ4A 3U56A 1SBIA 4LAFA 1T0UA 1NYQA 3DZ8A 3T7RA 4BCDA 3V8NA 4EGSA 3BICA 2EZUA 2XXJA 4S1PA 2CXTA 3AM3A 4MKRA 1MV5A 1T9ZA 1W30A 5BRAA 4B7XA 1ISJA 1JSLA 2FE4A 4KNWA 1BO6A 3LBAA 3OX4A 4B3IA 4RVCA 1KEPA 4MQEA 3G9XA 1FYEA 4OPMA 2DULA 5HCNA 2UZ0A 3OE4A 3KWFA 4QA9A 1I1HA 3ORFA 5HJ5A 3WYNA 1UWCA 3OAAA 4Q24A 1L6IA 1WZCA 4V0KA 3QX3A 2XQGA 4P31A 3RRXA 1DQYA 1CYEA 3A9SA 4EPXA 3JALB 4N41A 3D6TB 2QE7D 3PIIA 1K6JA 3TFWA 3N07A 4DUPA 5B6PA 1Y0BA 2PMWB 4KEAA 4BRWA 3LWDA 4JL8A 3IODA 3T3EA 3VZBA 1LJLA 3Q3JB 4RXTA 1W49A 3EVBA 4IZ6A 5T3UA 1PK7A 3KQQA 1ZUNB 4PPYA 1MPXA 2YXNA 1C7RA 1GN9A 4ITUA 4JBXA 4Y6LA 2J85A 4AJEA 1LQTA 3CLHA 3COYA 3BQNB 3E53A 4CDRA 2QZSA 1B6SA 1XZ8A 2HDNB 4LE2A 1JQDA 4M88A 3SYTA 4G56A 4JBWA 5AYVA 4HGRA 1CC1S 3W2GA 3EJ6A 4MRSA 1BH6A 4JLJA 3UUWA 2DHCA 3BMNA 1P9WA 3EFEA 4DCMA 2V1UA 3QEOA 1BKYA 2JI7A 1M2GA 1VIVA 3HXPA 3LMKA 4M8NE 3OICA 4QATA 5JH7B 1HR0B 3HBAA 1F2DA 5KJ1A 2CMKA 4BFVA 1SUBA 2AFHE 3U4QB 3KUDA 3WBFA 1T4CA 1UDCA 3R5KA 3KSAC 2VJMA 2GH1A 3QTLA 2P2ZA 4BKRA 4GL4A 3ES9A 4Z2AA 2RJNA 4RQAA 3ZDEA 3MS2A 3S1SA 1F9EA 1AQLA 3EMKA 4BC1A 3PQDA 4Q3BA 1YH3A 1VCHA 2BE7A 2CLKB 1T9DA 2FPOA 1NT4A 5ER6A 1QUEA 5EE0A 5JDIC 3TOZA 1IG0A 1JEJA 1G0NA 1RHQA 3A32A 3BHNA 4J0GA 3PENA 4QUJA 3CBGA 1Z12A 4AX4A 4UHHA 1LPOA 2X5KO 3LAWA 1KXJA 1L3IA 1TCAA 2FUEA 1BTOA 4JX9A 2XZLA 2XJ9A 1YHNA 2PH5A 1CY6A 3Q8KA 2WJ6A 3ZV6A 3ESZA 4MQLA 5GVRA 2DR2A 1G21E 2XDWA 4AUKA 4QECA 3EXG1 3O8DA 4OH1A 1CF2O 3AHGA 2XMZA 3NNNA 3S0JA 1KJIA 1IUOA 1C0IA 2O3TA 3JATA 4L0MA 5IT9A 1D04A 1OLXB 3MF4A 4BE4A 2Q28A 1VG1A 2QYSA 1FJ2A 3S29A 4RH1A 4YH1A 5AI4A 1OXSC 1P80A 2QE6A 3NIFB 3P7MA 1JR3D 3SSNA 4W82A 4RJKA 3SKYA 1XLTA 1ZM7A 2BMFA 3ENNA 4PWYA 1WXGA 4JELA 4QFMA 3W9UA 1XYYA 1T8RA 2J08A 1TYAE 4B73A 4L95C 5CB4A 1E61A 1FNCA 2ZIZA 2D7CA 3V1LA 5EJ8A 2B8JA 4DC1A 1XFAA 2KBEA 2P6NA 1V37A 2QP4A 1NVWQ 1QFJA 3NT4A 4KFSA 4R9SA 1QO0A 3GZJA 4L5CA 2ZJ2A 2A1UB 1USUA 2ZATA 5E6UB 2OPHA 5FL7A 3UCXA 4IO1A 4XWTA 1E3QA 1QG6A 2GBGA 3DUFB 2GN6A 1X9HA 3LT4A 4PO3X 2R1UA 5G3ZA 5I01A 3QU7A 3VNSA 2NZYA 3H1EA 5JATA 2EWVA 2QD5A 1PG5A 2ZBFA 2OO5A 2OT3B 3DUWA 1JKMA 4KN6A 5ALYA 1RIIA 4FYMA 3WS7A 3LHFA 5B1YA 1PEAA 1LK0A 4KMSA 3L8MA 4LSWA 1WNFA 1CQJB 5GQSA 3ZE9A 4R0NA 1ZRSA 4L9SA 4TRMA 2C2BA 2WYOA 4OMFG 5EHNA 3VC1A 3A3KA 4IP0A 3RUEA 4YX9A 2GK7A 2K4MA 4RD6A 1RLJA 2O3SA 3AQIA 2XD9A 1PGQA 2QAGC 1J25A 1XD8A 4LX0A 1P4GA 3G68A 1NZJA 1QB8A 2X4GA 3IVCA 3NXKA 2EL9A 3GHHA 2XCTB 3N9IA 1HMYA 4U7FA 1DIBA 3PUKA 4BMSA 4GT1A 5DYNA 2CXPA 5IANA 1NWHA 2IKSA 3FKSA 2ZYTX 2FZLA 1NKTA 2ZIEA 3D64A 4HWKA 4OSEA 1CUVA 1JDJA 2DT8A 3EWSA 3KAQA 4UJ5A 2H5LA 1T2DA 4PN3A 3I34X 5CK5A 2PZJA 3KIPA 5IC5A 1JJAA 2ZI7A 4PZUA 4PG4A 2CVFA 4IXTA 3IKVA 1FNSA 3VU0A 2BFPA 4CQMA 5BN5A 2B4KA 5HW0A 3OUTA 4KUGA 4LX8A 3DNFA 1HI9A 4Y2HA 3K20A 1M34A 3I9LA 1V1RA 2Q9BA 1JYSA 1JBEA 2XB2A 4JLKA 3NEPX 4ENUA 2EL7A 4JU8A 4LXHA 1M73E 4P4TA 3WG9A 1J0BA 1Y7HA 1FZTA 4DRXA 1HNWB 4K8RB 1V3UA 4BQNA 1RNLA 1A96A 1T5HX 2MT9A 1GGJA 2W8ZA 4MR8A 1U8EA 3TSWA 3MWYW 3N0TA 5C1BA 2AOXA 3ZUGA 2WZDA 5CA0A 1OOEA 4IH9A 2SCUA 2Y1CA 2ZREA 3M0EA 2AVNA 1W5AA 4CR7A 4B8ZA 3S81A 1RI5A 1OZ0A 1SPBS 1KEUA 1T0IA 1XJQA 3BGSA 1X7YB 3HJCA 3OPNA 4HYQA 1TDJA 3BWDD 2O8CA 1GZHB 1V8BA 4MYHA 5COBA 4BVFA 2C2ZA 1GTSA 4D74A 2O3RA 2ZBVA 2ZJBA 3C98A 5DHTA 1IHYA 4BZZA 3PDCA 4FEAA 1PDVA 1Q91A 2NYUA 1DOAA 1UAYA 2RAVA 3MJEA 2BM9A 1B0UA 2UZIR 3MGGA 3R23A 4LECA 4A4DA 3PB3A 2RG1A 4IEFB 4RHYA 1E1KA 4ZCPA 4N7RA 1T43A 4B4OA 5F7ZA 5JZOA 1RQGA 3L7IA 1U04A 1DVRA 2CJWB 5AM3A 2H2HA 3L7CA 3LFTA 5DKFA 1P44A 4L2IB 4PBRA 1RC1A 3LVFO 3AW8A 2IYOA 1N3BA 4KX5A 4EHKA 2WM2A 3VMFA 5A0TA 2RGNA 4NE9A 1IDOA 1SVWA 4YMVA 3NIGB 5FQNA 3D3KA 3NANA 1N0IA 1QOQB 1GTG1 2D5LA 3H65A 5BORA 3RBZA 2H63A 3JPYA 5KQMA 3H7AA 3L0PA 3BULA 4IFEA 4BMYA 5AVOA 2WU0A 2ZDQA 1JDUA 4KXNA 2O0HA 3MXTA 5H9VA 1CJTC 3F8SA 5K3FA 3H2GA 2A30A 1F20A 2PG3A 4JXKA 3WR5A 3HKCA 3ZEAA 3AP1A 2OQIA 5SYMA 3DR5A 3W8RA 1DBSA 4ITVA 2G76A 1YS2X 2QXYA 2OK7A 3D7SA 1SD2A 3DNMA 3EFBA 3L4KA 2E5LB 1M2VA 4WNIA 1YXMA 1P1HA 4D4LA 5DSZA 3ZWKA 2ACVA 2X42A 4PYLA 2H17A 1ZBDA 4URZR 3WMEA 1DTSA 5IM4F 1PZNA 2HF2A 3DZCA 4G3XA 3UV7A 2QZJA 2C99A 1E1CA 3G85A 4N0QA 5EP3A 4DLUA 2C0PA 4MGHA 1UJ5A 2YXEA 3TINA 3HXOA 4G26A 3KOMA 2WKSA 1JJVA 3KZXA 3QWHA 4IPTA 3ORHA 2NV0A 3I5UA 4FKZA 2O2XA 3ID6C 3V46A 4BN0A 4HCJA 1B6GA 5D3QA 5EP4A 3UXYA 4W5RA 1QRUA 1MBZA 3WB9A 2HLPA 1QVAA 4Q48A 1DAIA 2YWFA 3TZBA 3U40A 1UBGA 1F5NA 1F5SA 4RJ2A 1JHPA 2CLHB 1MXHA 4KW7A 4R8RA 4C76A 4BQIA 1WF6A 2H8GA 2ODEA 1Y34E 2DHEA 1RW4A 6REQA 2MSKA 4ND7A 4O4JB 2WB4A 2C98A 1C3EA 2R5WA 2W0SA 3OM0A 5EWMA 3KTDA 2C4NA 2AZTA 1J8VA 2TS1A 3AF3A 2EGUA 5IVPA 3T1TA 1B41A 4JQYA 3WLQA 1S8OA 4KIGA 4X64B 1KU6A 3B48A 3HBNA 1R27A 1U2RA 4ZYWA 3B1KA 1ODFA 1IY2A 2H2AA 4IEEA 4NX2A 4R8SA 1JFLA 1LFDB 1JXAA 1QZXA 3C2QA 4MYDA 4N0MA 2ZTHA 3A26A 3IDAA 4QGGA 4HT3B 1IAVA 2JLUA 1Q7RA 4TRNA 2EBUA 4EAAA 4CF7A 3GJQA 3O9VA 2CD9A 2X15A 3FOWA 4ZI7B 1IHUA 4HGNA 3ZDCA 3UUGA 4Z1MA 1PBNA 2X6QA 1E4EB 2I29A 3I8OA 2GXSA 3OZ7A 4FYVA 1U7XA 4NS4A 2ZRFA 4ZAYA 1E5DA 4QOSA 1CUXA 4DGSA 4CU2A 1G6KA 4JJAA 1TKBA 1YRYE 2WSMA 1HDRA 1Z34A 1JHRA 4B33A 4C7MA 2WFZA 4B4KA 1YZVA 3VKWA 3KT8A 2BELA 4XB2A 5LMCA 4BO3A 1Z0FA 1JG7A 3VDQA 1C7FA 2RGCA 1ZGGA 2ODQA 4M8LA 4MR9A 3MOIA 1HT1E 2Z83A 4L85A 1NVEA 4L15A 3S70A 5ALOA 3WRWA 4FSHA 1DRVA 4RDCA 1I4OA 1WW8A 1UKVY 2P6OA 4L75A 4P5DA 3UV6A 2FXIA 3NEJA 3PLNA 3T5BA 1GAJA 3H4VA 1ATZA 3CJQA 1SMKA 2GTPA 4P80A 4KLZA 3TG2A 3K70B 1XZKA 2M9MA 4EZIA 4H15A 1EYZA 2HFKA 2AZDA 3PPYA 1Q0HA 1EJ0A 4M3NA 5I4BA 1SKAA 4MIKA 2QPOA 2XUAA 1DO8A 4OCZA 4YP6A 4G9EA 4CMCA 1USWA 4IMIB 2V5AA 1HTTA 3NAZA 3KPYA 4H0CA 3UJPA 1QJ4A 5D7BA 3JV7A 3NRCA 5EGNA 3DE4X 3G2OA 1DIHA 3CVJA 3D4OA 3AETA 3VZPA 1WU8A 2A35A 4MEJA 4OQEA 1XRLA 1HDXA 2JVJA 1MVLA 1A4UA 1U4OA 3DW1X 3JYLA 5EC8A 5B1HA 4NOJA 3T4PA 3AXSA 1TKAA 1VMIA 5CFZA 2GJAA 4LXYA 2WLTA 1MW9X 1KYXA 3LBYA 5M5BA 1EFVB 2RIPA 5JQGA 1X7ZB 5TEVA 3RANA 3FTNA 3GP8A 1YU6A 5LQUA 3D8SA 3SCZA 1OTYA 2PKXA 5TT0A 3TCKA 1HDYA 1AU9A 4M9XA 1EM8B 5D6OA 4DWWA 2CC2A 4IJWA 3UOWA 1I5EA 5K8CA 1BA2A 3MTJA 2F48A 3FB4A 3RHFA 5JYBA 2C5GA 4NYJR 1ISPA 3TN7A 3VSBA 3VZDA 1OFUX 5LQAA 3ELYA 1QUFA 3RJZA 5GIOE 3AUSA 4QM6A 5JJKA 1L8AA 1SC9A 3O4HA 2ONYA 4MQEB 3FLAA 2B0CA 1SQ0A 3W2EA 3AUYA 5I7RA 1SU6A 1KWGA 5CLFA 1SOMA 5LKRA 5JNVA 3IA2A 4ANFA 1IBSA 3PKZA 1N6KA 1XHLA 1CR1A 1E6WA 3L6BA 2BGUA 4G8CA 1EGVB 4KDEA 3RJ9A 1CR6A 3L49A 4LVCA 3VMMA 5HR5A 4EB8A 1A8HA 3PKIA 1LW6E 2RGEA 1FTQA 4KDCA 1BMFD 4FMDB 3VPCA 2R2GA 4LZZA 2WTNA 3EXHC 2PUHA 4YRIA 1EFDN 3GFBA 3CMMA 3GCXA 4PPGA 1PJQA 3N7AA 4B9AA 1M8PA 1IZ9A 1HQCA 1WDLA 2VZ8A 1GD1O 4ZCSA 2NSHA 4J0CA 1WZEA 1KJ8A 1C80A 1XCMA 3BMNB 4JB2A 4LZAA 5ALLA 2HMVA 4NTZA 4CL0A 2JG3A 1Y4ZA 4QOGA 1QF6A 1JI0A 4DJAA 1FYXA 3ZU3A 4FMBB 3UBMA 1LRKA 5IHXA 4KR7A 1IN7A 1NP3A 4YDRA 2VT6A 4HWSA 1X8XA 3IVGA 1RCFA 1T4CB 1T8PA 1X13A 2VJMB 4IEIA 4N47A 2IY8A 4YTEA 4GXNA 4KK3A 4BGUA 3D0RA 2Z98A 4ZYYA 1Y6FA 1OH7A 5D87A 3Q6IA 1C7IA 1QLHA 3AUTA 1ZKDA 4UHKA