1T0IA

Ylr011wp, a saccharomyces cerevisiae na(d)ph-dependent fmn reductase
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
185
structure length
185
Chain Sequence
MKVGIIMGSVRAKRVCPEIAAYVKRTIENSEELIDQKLKIQVVDLQQIALPLYEDDDELIPAQIKSVDEYADSKTRSWSRIVNALDIIVFVTPQYNWGYPAALKNAIDRLYHEWHGKPALVVSYGGHGGSKCNDQLQEVLHGLKMNVIGGVAVKIPVGTIPLPEDIVPQLSVHNEEILQLLASCI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords YLR011wp
publication title Crystal Structure and Functional Characterization of Yeast YLR011wp, an Enzyme with NAD(P)H-FMN and Ferric Iron Reductase Activities
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase
total genus 57
structure length 185
sequence length 185
chains with identical sequence B
ec nomenclature ec 1.5.1.39: FMN reductase (NAD(P)H).
pdb deposition date 2004-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03358 FMN_red NADPH-dependent FMN reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1t0iA00
1AG9A 4QOHA 1QHEA 3B6JA 4HS4A 1YCGA 1BVYF 3GFRA 4U7FA 3RPEA 4F8YA 3D7NA 3NHKA 1VMEA 1WSBA 2A5LA 3NHLA 2Z9CA 1ZWKA 2D5IA 1D03A 3OJWA 4FGLA 4YAOA 4N82A 1NNI1 4YAFA 5EAIA 2V9CA 4ESEA 2ARKA 1AKWA 3ESYA 1QRDA 2BPOA 4ICIA 5LBTA 3O73A 3OWXA 2QWXA 1CZLA 3HA2A 1FLDA 2Q9UA 3U7IA 3SVLA 3NHWA 3UXEA 1H66A 4ZVLA 4BMOB 2M6SA 2KQUA 1XT6A 3QE2A 4C0XA 1DXOA 3OX1A 5EA2A 3O2NA 5ULLA 3R6WA 1FUEA 2BZSA 5B3KA 3QFCA 3U7RA 3LCMA 3P0RA 2FDXA 1AZLA 2ZKIA 4QOIA 3KAQA 3B6KA 1AKRA 1AKVA 3L9WA 1XYYA 1D04A 4DILA 2X2PA 3NLLA 1I1OA 4Y9RA 1YCHA 4S24A 3QFRA 3JSXA 3KAPA 1J9EA 2FCRA 4DIKA 2FOXA 2BF4A 1QBGA 2QX8A 2W5UA 4ZVKA 5FA6A 3F90A 1SG0A 1TLLA 2HPVA 2WC1A 3TEMA 2MOKA 1B1CA 4XDHA 4NULA 1AMOA 3FX2A 5JROA 3NHFA 2OHHA 4NLLA 4LTMA 1FTGA 2F1OA 3NHUA 2RG1A 3EDOA 1FLVA 4U7HA 1T5BA 1CZUA 4R81A 2QR2A 3ZHOA 3L9XA 1CZHA 1C7FA 2OHJA 2QMYA 1OFVA 2QX4A 4ZVNA 3OX2A 1DXQA 1J8QA 3GFSA 1XI2A 4H2DA 3NHPA 2XODA 3FW1A 1ZWLA 5NULA 4DY4A 4FX2A 3N3BC 2N1MA 1D4AA 4QOJA 1FX1A 4J8PA 1AKUA 3W79A 3K20A 2FZVA 3UXHA 3W7AA 1AKQA 5B3LA 5LMCA 3W78A 3ESXA 2QMZA 3ES9A 3LT5A 4YQEA 2HNBA 3NHSA 3EYWA 2FVXA 2XOEA 3FJOA 4H6PA 3F6RA 4LA4A 4FGJA 3NHJA 3GAMA 2MT9A 1F4PA 2FX2A 5TGZA 2MTBA 1QR2A 4QOGA 2Z9DA 4CF6A 2M6RA 3F2VA 4YAUA 1BU5A 3HR4A 4C76A 1JA1A 4N9QA 4PTYA 4M0CA 5EMNA 5FUQA 1T0IA 4GI5A 2R96A 2X2OA 3ESZA 3K1YA 4GQIA 1RLIA 1CZNA 1YDGA 3KLBA 2HNAA 3G5MA 1KBQA 5F4BA 2Z9BA 2V5VA 1H69A 6NULA 1AHNA 1X77A 4HEQA 3S2YA 2R97A 4Y7CA 3N39C 4BMPB 2KLBA 5LBUA 5LVAA 1DX9A 1RCFA 1OBOA 4LTNA 4YAWA 1OBVA 3FNIA 5BUCA 3NFRA 1SQSA 1YRHA 4XDGA 1CZRA 1TIKA 1YOBA 4PTZA 1C7EA 3NHYA 3OX3A 3B6IA 1JA0A 3W77A 4C14A 4YALA 2MWMA 5A4KA 3B6MA 3GFQA 1KBOA 3HLYA 3TZBA 4Y9UA 4FGKA 1J9GA 4PU0A 5NLLA 4QOEA 1CZKA 3OJXA 1V4BA 2OHIA 3F6SA 4QOFA 4U7GA 2FZ5A 2AMJA 3OWHA 1FLAA 1FVXA 4D02A 3NHRA 5LJLA 1AKTA 3KEGA 1J9ZA 1CZOA 1ZX1A 4LAFA 2FAXA 4OXXA 2QX6A 4QODA 1WSWA 1RTTA 3OVMA 5FX2A 3FVWA 3TE7A 4N65A 1E5DA 2QX9A 4ZVMA 2OYSA 5LLDA 2BMVA 3N3AC 4C0WA 2GSWA 4LTDA 2FLVA 2V5UA 1GG5A 4CETA 1FLNA 5F12A 2Z98A 5F51A 1YKGA 1XYVA 1YCFA 2Q62A 5LJIA 2B3DA 1RLJA 2BN4A 4GR9A
chains in the Genus database with same CATH superfamily
3G9UA 3DZBA 4ZHQB 5EWJA 1DELA 3TN7A 3R7BA 1H5QA 4HS4A 1CUZA 2WD7B 4N01A 4NMXB 1U7ZA 4LWZA 4XYBA 4CQMD 1AKEA 3BRCA 3G0HA 2VK1A 1FUKA 1T29A 3M6VA 1MAHA 4I5DA 4RADA 4HB4A 5LQMA 1BRMA 3GFGA 3DMPA 1SC1A 4IV8A 1KFEB 1W88B 3AVPA 4NFSA 5K3AA 3KB2A 3MCTA 3KT3A 4KSBA 4P81A 3NHLA 2VYQA 1YL6A 1ZWKA 2FK8A 2UYOA 2V1XA 5K6AA 4AY2A 1QU3A 4N5HX 1QV7A 1Q7GA 1WSAA 5EL0A 3CONA 3HHEA 1ZEMA 1W5TA 3N2NA 1WG8A 3CV3A 5EWMB 4KPEC 3EEOA 4RD3A 5KCZA 1M2VA 3K71B 3MM4A 1JMKC 2RGUA 1U1GA 1FYXA 4GVLA 2HWXA 4TMTA 4LY0A 1OXVA 3UOWA 2X0DA 2VDJA 3W8FA 1Z28A 1WRBA 3N6XA 4BNMA 3B6ZA 2P9YA 1HE5A 2J9FA 2YFQA 3PT5A 4C3UA 4Q9LA 3R76A 3LVFO 3KBOA 4WBNF 1SELA 4AG5A 4BAZA 1WB5A 1XCGB 4ICIA 4RACA 1SC4A 4XYMA 5ALLA 3O73A 4E21A 4YAIA 4FONA 5HJ2A 3WSTA 4XGKA 1OI7A 2D1RA 3O38A 1P81A 1IG0A 1EFPB 5DYYA 3B53X 2FWIA 1J7JA 2GF2A 2ZUBA 5ALUA 5HF6A 3CX4A 1U8FO 2JEYA 2Q3CA 2VDRB 2HF8A 3E5MA 3MGBA 5C4IA 3OQHA 4CGZA 3HO6A 1PFQA 4TKMA 3CMCO 1AOXA 4NYJQ 5LYYA 4ENPA 3ITDA 4K88A 1JB9A 4MITA 1UOEA 2VSOA 1OXMA 1YT5A 2EOAA 2Q0SA 4L5BA 4IILA 1Z6TA 4YBRA 4OD0A 5ALFA 3EZGA 5E4JA 3FLEA 1LWNA 2IV7A 3V4PB 3HYRA 5EWLB 4F6CA 1KJZA 3DZJA 4JLAA 4BFCA 1E0JA 3I8XA 1OZ0A 1HG0A 1RYHA 2OBXA 1V8DA 2VP2A 1BHSA 3QE2A 2RH4A 1P1IA 1TXGA 2BTQA 4C0XA 2P35A 3CF2A 1SCUA 3I9NA 3QLVA 3ONNA 2WIAA 1F1BA 3JWHA 4HBZA 4OMDA 2NU8A 4CE6A 3EG9A 1XEAA 3CRMA 4CLDA 3R3VA 3OO1A 4QDKA 4MSUA 2R79A 4B3MB 4MQUA 2CJFA 3A4LA 4HZUB 1H9BA 3HDVA 4OIFA 1YS2X 1XPJA 2QUJA 2ZCUA 3FNRA 4LJ5A 4LUCA 4BNUA 1EH5A 3SZUA 4CM4A 1Y8RB 2C5SA 4KSCA 2VEOA 1N7JA 3NNSA 2ZAOA 4LJ4A 2JFPA 4YCAA 3N2GA 1YUNA 3I04M 1AKVA 3H1AA 2NTJA 4DLZA 3EODA 4TWRA 2R00C 5EIBC 2FR8A 2GM4A 1LPAB 2YTZA 4II2A 4R1PA 2EL9A 4UHHA 3UMBA 1BFUA 2ZANA 3V2IA 4DBZA 3GQVA 1TM3E 3T1YB 3L4KA 5ITZB 1QLJA 1XZDA 4EDFA 2Q2NA 4ZCMA 4N76A 2QTWB 2R8BA 4MQ4A 4JLMA 2ZIXB 3KHUA 4UZSA 2NU9B 4O4LA 1NLZA 4A7PA 2FHPA 1KMHA 3P27A 2D5CA 3PDHA 1IXRC 1MO5A 2O52A 2TMKA 2QXUA 3R5KA 1E2HA 1I24A 1ZP6A 2CXHA 4FC6A 2YICA 3GEGA 3NPAA 4HN4B 2ZVPX 1MA3A 1SHZA 2P9QA 4L5JA 4BQRA 5IVPA 3HP7A 1YA4A 2W6NA 1RLOA 2WU1A 2XB8A 4Q03A 3IEKA 1L8OA 2E4YA 4DADA 5J4KA 1KAOA 4GOOD 4ZVKA 2O2ZA 3A1CA 3ENKA 3SEQA 4W6QA 5DXAA 2CZGA 1YOVB 1SG0A 4BMDA 2HCFA 2HT1A 2QRHA 1DAMA 2A6PA 3FPFA 1ADFA 4LDPA 4FI3C 4BTLA 3ZDXB 5KYYA 1I7PA 1L3IA 5FNVB 2CXTA 4YTEA 3ZUGA 3HZHA 1DBQA 1YB5A 4PPGA 1W52X 2ODBA 4DR6B 2H1HA 3UHJA 1DG1G 4IXDA 4KRXA 1B42A 2P3SA 4ZYLA 2F48A 5GONF 4LZZA 5ES4B 2XT9A 3CNLA 2O7NA 4EHIA 1U1CA 2X2EA 4J0IA 1XAJA 1KDVA 5K3BA 4O2LA 4UUQA 1QYXA 1R5JA 2B8WA 3WGGA 4C3VA 1KJWA 2AUTA 4Z51A 5KWIA 4TQAA 1M6VA 4JL8A 4EHLA 3DZDA 2ZYVX 4RJIA 1P2DA 1Z88A 2G76A 1CUSA 3KKPA 2WYHA 4G1BA 1I7SB 1TNDA 2PCJA 2ZG6A 5AI8A 5JAHA 5KYWA 3COSA 3GJ5A 3VHXB 4AKEA 5JATA 5JAIA 1C80A 2B9VA 3U1VA 4WHMA 4F8EA 1ZCJA 3K8QA 3QUSA 1UBUS 2ZIGA 2CMFA 1Y3BE 4C7JA 4AKGA 4ARIA 2VDLB 3HJCA 3ZIAD 1RU3A 4HNGA 1C7QA 2QUAA 4UU7A 5E6UA 4DGQA 5BN3B 4U9HS 1TTHA 1VI6A 4ZXPA 3HBMA 3KNZA 5KKCA 2HF7A 1E3JA 5T67A 2PSSA 4R6WA 3R7FA 1SCJA 1Z75A 4ZP1A 2PY6A 5FOVA 1E3IA 3NWBA 3ROFA 1TEZA 1D8TA 5JDIC 2OHJA 1M0WA 3PNVA 3D4LA 4MVJG 3JWPA 2VNKA 4LYYA 4NF2A 4XJTA 1XTRA 3R74A 1RXIA 2QTAA 2JHFA 3F8SA 1M1YB 5EJ9A 1JYEA 2JF0A 4OYRA 3WGTA 1TZBA 3D1JA 4B80A 5M29A 4M89A 4GBED 1BX0A 1MT0A 3KLNA 3OEHD 5A9SB 3G2LA 1NVKA 2WEKA 4B4WA 4YCLA 4A6XA 2R5NA 4PPFA 4PSAA 1XP5A 4RZXA 3D8SA 2CN1A 3CR8A 4NX2A 3RFXA 3SVZA 3ZZUA 5HRUA 4EYGA 2QZZA 2NUTA 4TWJA 4RDIA 3OM1A 3CPHA 5L4LA 2UUAB 4QU5A 2C3OA 3L0OA 5AM4A 2BSQA 2PS1A 3B2QA 3LIPA 3LYHA 3U4DA 5KYUA 2RHRA 1E9FA 1GZ6A 2C00A 3ISTA 4G1EB 2E18A 3IBYA 2AOTB 2QL9A 2NSYA 4JOQA 3PL5A 2C9MA 1U7UA 4RTSA 2EQAA 4ND8A 4ZKDA 2IIBA 2VYVD 1TO2E 3K7EA 2RGDA 3K0AB 2ZSKA 3NH6A 3NHAA 3PC7A 4GOMD 2PLAA 1U04A 2B7BA 5C35A 4CCWA 2VP3A 2GVNA 3DV0B 2A3NA 1JDTA 1R4NA 1SWWA 2BHNA 4V03A 3RC2A 4D4LA 4DKJA 1F3OA 1WXGA 4CM9D 5HP4A 1CRQA 2GD1O 2IYNA 1UXHA 4NATA 3FG9A 3MCVA 5EMKA 1V16A 1ISGA 3G8YA 4CDGA 4UVGA 3KSBC 1VJRA 1KP3A 2AG1A 1T8SA 4S1VA 4D6XA 4I6GA 2FK7A 4BNIA 2ZBUA 3RIEA 3B7GA 4BB5A 3CBQA 4PRYA 4CKYA 3GJ6A 4D7AA 2QVBA 3CLVA 4HQ6A 4ZPXA 3ZNQA 5JMOA 3EGXA 1KHHA 3G88A 1UIMA 3OX4A 5DCYA 4BX3A 3AI2A 3LWDA 3MGGA 4JC0A 3FDXA 5BSUA 1J4AA 2QMZA 4E09A 1WXDA 3H42B 2XCIA 2D4HA 3CX8A 3MGKA 3Q0IA 4ZQCB 3L6RA 2DOKA 1H1TA 3N05A 4LYFA 1L4GA 2VZEA 5DGCA 4MA5A 2PMEA 5J4VA 4QVGA 2AW3A 2O20A 4R3NA 2FFQA 3MCAA 2B1RA 1VKRA 2JJ1A 4B8ZA 3HADA 4E1AA 4BMZA 3IHKA 3QELB 4M9UA 3L79A 3A4IA 4ROSA 1I14A 3VTKA 3VR4H 2R48A 1U0JA 4EMUA 2DY1A 4IGFA 5DM2A 2VJYA 4PS0A 1QO7A 4CR7A 2P79A 1ABBA 2EDCA 3M4ZA 3NETA 2IHVA 4XCVA 1VCIA 2AB0A 3AHHA 3MT8A 1ZJ6A 1Y9DA 2HMAA 3KB6A 4TTAA 5KOHB 1RRGA 3G23A 5TJ9A 4HJRA 2ID7A 1P5JA 2ZB8A 3VZSA 2EEPA 3GV0A 1O8BA 2JLYA 3EIFA 2BFNA 2EX1A 3QNWA 4Y2UA 3WLQA 1F8GA 4DLAA 2C99A 4YJDA 5FNZA 2JLVA 2G1KA 1UPBA 2IUTA 2YJ5A 3PDWA 3OPYA 3Q8XB 4QLOA 1G0OA 2Z9DA 4MEBA 1MHTA 1ECCA 2ENWA 3FM9A 3WAJA 1QLWA 5CDGA 3O9VA 1WCXA 2X5KO 3EZXA 1CRPA 3ENZA 3N1UA 2I6TA 4NR0A 3TF5A 1GCGA 4XCQA 2ZJYA 3TD2A 2QV7A 4CM3A 2J59A 1WUTA 3LKBA 4BMYA 2QRVB 4JCOA 1VYHA 2P69A 3EWNA 4R05A 3VAAA 3SIXA 1BNCA 3UFXA 4I1YA 3WGMA 5JEEA 4BASA 4KYIB 2HK9A 3CRRA 1UADA 5B37A 2FF5A 4YRZA 4P0QB 3WRWA 1JDJA 4FDUA 1QRTA 4NE7A 1FFWA 1TK9A 2X2OA 4OBEA 3NDPA 1EFVA 3R0QA 4A5OA 2F43A 3LVBA 3UBMA 1P3Y1 5F9HA 1T3GA 1VDZA 1TA9A 2VKQA 1UDAA 4Q3OA 1VJDA 3RC3A 3TRDA 4C7OB 1FS4A 4LCBA 4F92B 3CZ9A 5EJ6A 4MPRA 1PR0A 4LPKA 4OXIA 1RABA 3JQGB 4FJ2A 4ESOA 1P44A 4GAEA 6PFKA 1ECJA 1FW8A 2Z9BA 3JARA 4YV2A 1PEKE 3CRQA 1MXHA 1KEEB 5IKPA 5HUHA 4UC0A 1X8JA 4UREA 3R24A 3MJVA 4J75A 5D1NA 4AZWA 5DJ5A 3K6JA 1EM8A 3AR7A 3GG9A 2PAAA 4Y7CA 5CA0F 1M2JA 3LHSA 2DQKA 2C31A 2GAAA 3KJNA 1U02A 1EAYA 4BTVA 4DEVA 5EJ4A 4M99A 1ZL2A 2K7FA 2KLBA 1MUUA 1QYVA 3HDJA 8GPBA 1KI8A 1YV9A 5JJIA 2QK4A 1ICEA 4LOAA 2IEGA 4FP9A 4PZAA 4PONA 1Z47A 3O3CA 5AI6A 1JG2A 1QZUA 1VYTA 4IDCA 3JWEA 1IZ9A 1AV7A 1O9BA 4MDEA 3FCXA 2VSYA 1MB2A 2X4GA 1FYDA 3L8HA 5IDXA 3QF7A 2YCLA 4K6GA 1A04A 3PPVA 2W98A 1Y3DE 1OYYA 3O5AA 2BBTA 2CK3D 3A06A 3LP5A 4KAXA 1ZG3A 1PJ4A 2WU4A 4GXRA 5A71A 3TUIC 4CLEA 5BUZA 2YUTA 4ZGBA 5BN4A 2JA2A 1PV2A 5CXQA 4R31A 2ZXUA 1CIJA 1E2EA 1BS9A 3TO5A 2ZREA 3AHGA 3KKZA 1J70A 2B1IA 3D2CA 2WV9A 4G0VA 3WQQA 2BR4A 2JFHA 2DFLA 1G20E 3JQ9A 1V5IA 3QHPA 4LYEA 2JAUA 4M36A 3L07A 4QSMA 5LP6C 5THXA 3GD7A 1E1LA 4IQGA 4KLZA 4UVHA 5T4HA 4C4TA 1RXWA 3WLOA 1P5RA 4HC4A 2YMLA 3EEBA 1JYSA 3FVVA 1L5LA 4I50A 4LDJA 3EMBA 2A5JA 2NYVA 2VL7A 4L4XA 4S1OA 3H6GA 5EN4A 1KYQA 4L4YA 1JA9A 4PQRA 1RKQA 4CM6A 1VBFA 1FMLA 3AQ4A 1U0GA 3DHWC 1OZHA 1ISJA 1JLLB 2BWJA 2P78A 4JR1A 2JJ2A 3I01M 3BTVA 4UATA 1EGVB 1XJ0A 1NF2A 1X0XA 3KHSA 4FLEA 1PGQA 4FEGA 2ZU6A 1KK2A 2ANBA 3WGLA 5BP7A 4NPHA 4REOA 5NLLA 1XDWA 5AM3A 3JYOA 3U5ZB 5A2QA 1XBTA 4NEGA 3C4QA 2QX7A 2AWOA 3PTLA 1UM9A 4TTSA 5JYEA 5AKGA 4H6WA 1ZBDA 2Y4NA 4LFCB 4BDSA 4X93A 4YMHA 5BWBA 3CKMA 3C3CA 1L1RA 1G8AA 2IEAA 2X15A 2WIFA 3CEHA 1GNTA 3FHJA 4UJ5A 4LF7B 2ZK7A 3OIYA 3RD5A 3G2OA 3GLHA 1UJ2A 2B5WA 2C3PA 4FTWA 4XWWA 1HYHA 2AFIA 4AROA 3AEKA 2KBFA 3G85A 4O8CA 3KO8A 4EY4A 3SIRA 4EY5A 4Z4CA 5LZ8A 4DCPA 5GIPE 2CNNA 3HACA 4X5OA 2I2WA 1ZMXA 2O8CB 4H15A 2FG7C 3JWJA 4NMLA 4DLTA 1EB9A 4Q7MB 4GPAA 4JLSA 1CR4A 3AL3A 3KOWA 3JRXA 2V7EA 1NYTA 2D06A 4EY8A 5K09A 3BWMA 5FADA 1LF0A 1X80A 5FI3A 3LUDA 1JE1A 1QCZA 4Z9BA 4RORA 4YRJA 5KAMA 2XTNA 4QNMA 1GT91 3R5TA 1FL9A 4AJHA 4ZDKA 3CRZA 1W4CA 1ARZA 2WAOA 4NCKA 2FMKA 5AK6A 4MVJD 5ERXA 4C0SA 3U5TA 3NBMA 3ZGVA 4O25A 3F5MA 1J56A 4I9HA 2UUPA 2P91A 3AR3A 2AFHE 4B32A 1V1MA 2FZGA 3WO1A 1K5GA 1Y8AA 5CDUA 2J09A 4MUAA 1XZQA 1XX6A 4BC1A 2BLLA 3RSZA 3MWFA 4AYXA 1ZCFA 1SUCA 2D74A 4PTLA 4HNAA 4NCXA 1IUKA 2ZUVA 3Q7IA 3V8BA 2W4QA 1PJQA 2O4UX 3OQ6A 3HUEA 4IG9A 4Q37A 2IPLA 2QI9C 2X4IA 1E18A 3ITKA 3DGEC 3GFRA 2QTNA 3A36A 3LKDA 1JSRA 4IFBA 4JJEA 1UOQA 4RK6A 3W6UA 1OGIA 2B0CA 4MINA 4EMBA 4KNWA 5E9QA 2P6NA 4V0MA 1HNNA 4F9FA 1U9YA 4N0MA 9GPBA 1WSBA 3P94A 1M2NA 1ZIDA 2NT4A 1AF4A 4JB8A 4WZZA 4DF3A 5AIBA 4RABA 3VZQA 1E1RA 3RI3A 2RB4A 1VI2A 1PJ8A 2B82A 2VCYA 4R4JA 3M5DA 3ULKA 4DWVA 2F3RA 5D85A 3T5PA 1O58A 2WHEA 4RVCA 2IY9A 5LMUB 1D03A 2C98A 3HDTA 1PK8A 2IZ5A 2YJ3A 4D4KA 1SXPA 3W6ZA 4WV3A 5JYDA 3PGLA 4G0UA 5DZSA 1DX4A 2BSAA 4ZOLA 5E3JA 1CNFA 5FBHA 3U62A 5FPPA 1U0FA 4EFKA 2B2NA 2H0RA 4DSOA 4R71A 5GV7A 1FFAA 2EFDB 4U0KA 2CMGA 3DWIA 3T3OA 3CT6A 2O0LA 3WG9A 3MSCA 1D09A 4O1HA 4D74A 2BC9A 2OAGA 4C2UA 5JMWA 1ZONA 3CZ4A 3ERCA 1FMFA 5BYAA 1A8UA 5AOCA 4PQYA 2W93A 3FSGD 3JWIA 3AZOA 1CZLA 2Z2ZA 1Y3AA 1E69A 3BS4A 3D6AA 2BUBA 2D2EA 2A59A 3EXHA 3I09A 5EVCA 4C78A 3SVLA 4URVR 3RS7A 1H66A 3EBOA 4PC7A 1TO6A 1U98A 2JIDA 2XDWA 3CNBA 1J97A 4G0ZA 3SYMA 1EFDN 3M1IA 1JJ7A 4ROTA 4A1OA 4FB5A 4NJEA 5CCDA 3WK4A 4PINA 3OZSA 3VNAA 4PSUA 1NTOA 4E94A 5LYJF 2IGTA 3LWNA 4GX2A 4H1HA 1ODSA 3WLLA 5IH3A 5ISMA 3O7MA 2I80A 3VPGA 4XVRA 4A2CA 1JEQA 5ICSA 2IXTA 1OTHA 4GLFA 1N2OA 4UZEA 1HTWA 4L50A 1VSQA 4UTZA 3SS7X 3AJAA 1JDUA 2C7VA 3BSYA 1DAIA 3BGIA 5AKLA 3T9EA 3R4CA 5EHNA 3EZ7A 2PUWA 3ZWXA 5ULLA 3P96A 4BMVA 4WAUA 3AVOA 1OX5A 3TZHA 1F2UA 5ALZA 3H2ZA 2UUBB 3KQLA 2ZS7A 5ALDA 4YQYA 1EX6A 4W99A 5AK4A 5MDHA 3RUFA 4CZ2A 4R8SA 2WUEA 3PCXA 1ZRNA 1QU2A 4QOIA 3GGGA 3LRXA 4RZQA 2QE6A 4KO8A 4ZICA 1FNSA 3DAOA 5KVAA 5KTTA 1LDEA 3MRSA 5TQ0A 4A8JA 4QU9A 4BRWA 4DSNA 1NFFA 2C96A 2HI0A 3LUKA 1CS0B 2Z6QA 1E5TA 5A4MS 2NUAB 3SJZA 2X9GA 4K2AA 4Y9RA 5KQRA 5KWEA 2R1TA 1I1NA 2W58A 2J48A 1DQPA 3I6ZA 4GZ6A 4BFWA 5A1JA 4GH5A 5LNK6 3UQYS 4GC9A 1M2EA 4NZMA 1S89A 4HX9A 4ECEA 5T3YA 1IQ0A 5DM60 3CB2A 2Y1GA 4AZ3B 2O05A 4MAMA 4V0OA 1UDBA 5J2TA 3U19A 1U2EA 2VJMA 3AOEC 2AA3A 2VTKA 3S1LA 2JLXA 4MS1B 2FFHA 1RPAA 1Q7BA 3W8DA 5JNLA 1D2RA 3UZUA 4IZOA 4DV7B 3E22A 1W5SA 2JAOA 3THYB 2QRPA 1DTSA 2G63A 1V9SA 1B0AA 3T94A 1NE7A 3ZDQA 4GGMX 4LHVA 2RH9B 3V1NA 3NOOA 4ALKA 5JFGA 5KUTA 3AR6A 3I4LA 4DE5A 3K6RA 1UWKA 4NBSA 1HQDA 1GRVA 3NKFA 4MUYA 5DFAA 3V3KA 2OXFA 3WNQA 1N32B 1VTKA 4XQEA 1B1CA 1RKVA 2A84A 3BZBA 3KYCA 4QJ3A 3W06A 4ZCTA 4PZCA 4M1KA 4XDHA 1YRAA 3EAQA 4QO7A 5A6SA 1D0SA 1GFSA 1X8KA 4U2DA 1YJXA 3AL2A 2XDYA 1L7NA 3H3JA 4BO0A 5FULA 4FB4A 5JAOA 4BX8A 5JROA 3H4MA 2C61A 4Q1BA 2IZZA 3HKDB 3PFNA 4DV2B 2ZUCA 4ZVRA 4QUGA 2JFVA 3BB1A 3HB0A 4NOJA 5BW4A 4DGSA 4FCWA 2E4ZA 4RNCA 5HF5A 1E1QD 3FBWA 3N8GA 3WGVA 5I8PA 1ZNXA 3SZGA 1Z0KA 1L1EA 1L4MA 1P7PA 3RYHA 4DBLC 2X0JA 4BO7A 2A33A 4HQLA 1IBMB 1C7IA 2CFSA 1OFUX 2H00A 4LRSB 4U3JB 4F7DA 1G7CA 2G36A 2OSVA 1M7GA 4DV4B 1I4DD 3ZVLA 4Z4EA 4KR2A 5JNUA 2OBFA 3RVSA 2R66A 3LWZA 4H9GA 2Z83A 3BZUA 5AKYA 4MVJP 1G5PA 1OI3A 1LI4A 3L84A 3IAUA 1CQJA 3GEPA 2JFWA 1SGWA 2BL4A 1V3UA 4OYLA 5CPBA 4IQ4A 4RVOA 4RK1A 5TXGA 1T4DA 3TH5A 5K8LA 2HK6A 1YCDA 2QIPA 2R3SA 5KTMA 1JVBA 4R2XA 4U8HA 2PGXA 3P9RA 4L27A 4D9BA 5ED4A 3DL7A 1I32A 4BNXA 3A9UA 3LBNA 2WTUA 2CFCA 4FMCB 1MAWA 4R8RA 5H5JA 5LQAA 1BA3A 3WC4A 2QW1A 1PVOA 4IXWA 4ZVNA 3PR3A 1MRSA 3ECSA 1OA0A 3ZK8A 3C45A 3NBQA 1CF9A 1S2GA 3CLTD 4KIUA 5TPWB 4FXOA 3VR3D 1YR7A 2ZRQA 1K86A 4MUEA 1IY2A 1LPOA 3I5AA 4F38A 3PQCA 2GK3A 1EGAA 2FSUA 4WUVA 3DXYA 2OP0A 4GU5A 3BH6A 2O2XA 4C2AA 5DYTA 5MFPA 4DIMA 821PA 2JIBA 5IDVA 2BJWA 2QUKA 2HBQA 1L7VC 4AO6A 3TI7A 1QV6A 1OSNA 3OZDA 1HPLA 3MJEA 1Y98A 1NONA 3NV7A 3UFBA 4FYXA 4R7TA 2ZIAA 1Y3CE 3KD3A 3FPAA 4LQCA 3WMGA 4MWCA 5LOVB 1EJ6A 1BHO1 1Q16A 3JZAA 5CB0A 4NYMR 3C5VA 4B75A 1Y6ZA 1BN6A 1XXHE 1GP2A 2H48A 2P3LA 2VK4A 2FFBA 2P9TA 2QSYA 1U65A 5F33A 1OQAA 3CX6A 1AXEA 4IVRA 3BVPA 5D2CA 4OMUA 3A1NA 2GX6A 3KFVA 4PNPA 2O8FB 3DULA 1T2DA 1T5DX 1VPVA 3ICVA 3W79A 3OPXA 2R1VA 4I5IA 4P34A 1JIUA 1YK1A 2EZ4A 1Z4JA 2FSVA 3UJ7A 1KI1A 5IVDA 1PGPA 1ODTC 3RABA 3AKEA 2FMXA 4HD8A 4XKJA 4KH0A 2IU0A 2A5DA 4IJWA 3QIAA 1Q44A 1H2RS 3ES9A 3KJGA 1PIWA 1SBCA 4JI1B 1BCRB 4UU0A 1NMYA 4JWTA 1RAHA 1OX4B 3WIBA 4B3TB 1Y4UA 1ID8A 3RNOA 3QX3A 4KGDA 1GPMA 2QN8A 3HBLA 3TSWA 4G0OA 1ZISA 2VWHA 1J23A 2H54A 1CDZA 1E2PA 1VKNA 3H5RA 1PNQA 1SXIA 4X63A 2A0KA 4KC0A 2H9AA 3VTZA 3W90A 4CEHA 2QLNA 4MVCA 1IUPA 2Q0XA 1B14A 1ZVJA 2D1YA 2FPPB 2FRVA 2R2GA 4ND1A 4RF5A 2IOFK 1D6SA 4TTPA 3H99A 1MAUA 4I4TF 1XEXB 3HJHA 4B81A 2FHSA 2Q5HA 4O63O 5A1TA 5JG7A 3TSYA 1IAQA 4ZDWA 3EYAA 2ODQA 4RZIA 5DK4A 4AIRA 4EJSA 2A9RA 4RF4A 3FHOA 4QREA 2P4SA 4GR4A 5AKIA 3GEHA 4AJNA 1X7ZB 1KOFA 1RWKA 2MYPA 4MUGA 5B4TA 3HM9A 1ZHFA 5REQA 1SBNE 1B43A 3OM9A 3T06B 4MW7A 3T9FA 3IXLA 4IW3B 4KLNA 1MABB 4BLTA 3EGDB 4OQZA 3EFBA 4JQZA 3BDVA 3R2JA 1HDEA 1ZXBA 1E1MA 4RJJA 1N2JA 4NBKA 3RLIA 3DJFA 3RU2A 3DT9A 1T2NA 4XYEA 3UAWA 3RGWS 4CDNA 1VJTA 4YXWA 4QU0A 3ZWOA 2ZJ8A 3E4DA 2OD9A 1VSVA 3TJRA 4XWYA 1EBFA 3USCS 3FI0A 3LC1O 4YA6A 2QTLA 3S2IA 3TSCA 3SHTA 4QXAA 3O03A 4HCJA 1Q21A 3GX1A 1C41A 1M34A 3MYYA 4LXGA 1F17A 3I34X 3WLFA 1QHHA 3GB9A 4BKMA 4OTZA 4B7AA 3WNCA 4J0KA 3RTBA 1JDVA 2VLIA 1GM5A 1UBKS 2WKWA 2XWQA 4AXXA 1P61B 5IKOA 1PF7E 1VA5A 1WDKA 5J23A 2XYPA 3C3DA 1JG6A 2Y68A 4MUNA 3C41J 3KLBA 4W7SA 2YYAA 4KO3S 3AM5A 1RHRA 1QAMA 4ANFA 3QEOA 2GBGA 2JLQA 4H0FA 4COKA 2D7DA 1Q1QA 5LFAA 5AK5A 4HBGA 3MXTA 1ZD4A 2Q3BA 3TTVA 4CXMA 3GVXA 1KYWA 3WDLA 4UM9B 3THRA 2QYHA 4KHZA 1MFZA 1AHNA 1GD1O 2H63A 3QTBA 4LDAA 4AFNA 4C21A 1P4SA 2FMHA 3L8EA 2MHCA 2GZHA 3ONEA 1WQ1R 1Q19A 3BL8A 3HN6A 2AEMA 2BFBA 3CNOA 1RKBA 3UG7A 4CQJA 1YB6A 2O2GA 3CVYA 4MA4A 4DV3B 3IEXA 3STHA 1ORTA 4BHTA 1YE8A 2BGWA 3QMWA 5H02A 1LWOA 1GPKA 4PVCA 2Q7DA 3RWMB 3KHKA 3RVQA 3MT9A 4IVPA 3CCBA 3Q15C 3AOGA 1NVWQ 3NIWA 2QQ0A 3NGMA 1FDOA 3UUFA 3W3AD 1FXWF 1Q1BA 4HX2A 2BMDA 4P08A 4ZCSA 1VSTA 4R9UC 4DV6B 5CCEA 1ISSA 3ZQ4A 4RHCA 3JD3A 3IE2A 3NRBA 3LOPA 2IW3A 1X7XA 1ZINA 3NC4A 4AS2A 4BVFA 3ZNPA 2JH3A 5J4YA 1VXOA 3G1UA 4BV2A 5L3QA 1DC3A 1NW7A 1P2TA 1YWGO 5HPYB 1T8UA 1YS6A 4ZYZA 3K9LA 1CY6A 1DFHA 5A03A 4EG1A 2GEKA 3MJDA 3B6IA 1UK8A 1QGDA 3CKKA 1Q0TA 2L2QA 1G60A 1CCWA 5TMPA 2WG1A 4PZPA 3K0FB 1NVEA 3MPUA 1GILA 1ND5A 2O8EA 2VT2A 3BEOA 3FTNA 3W0LB 2O8DB 5D00A 1LLQA 2PMBA 1JIVA 2CLMB 3MELA 4X8HA 5HHTA 4HVLA 1ENOA 3DMTC 3D3QA 3A1UA 2YHSA 2HHCA 4DYVA 4BE9A 1KIFA 5KYXB 2IITA 2VEDA 5BSRA 3U7EB 2FPUA 1SOAA 3OKAA 4KN5A 5COBA 1NKSA 5AOBA 4ALMA 5HE9A 4RGYA 5JCOA 1JKJB 1QZZA 1U2QA 1GPYA 2X3YA 1AO0A 4RGQA 2NTYC 1MB4A 3ORYA 2RHLA 4K8OA 1EDEA 1WU7A 3FRJA 2VP5A 1LQ2A 2G4CA 2L42A 4IDBA 2C5AA 3C85A 1U28A 4M8SA 13PKA 1HRKA 1R4ZA 1QVRA 2XLCA 4NBNA 1CUVA 9ATCA 4ZHQA 1Z62A 2P77A 3KPUA 3QJYA 4KQFA 4BBJA 2F1HA 2ACEA 3HBFA 4RVHA 5EKSA 2WD7A 2OPBA 3KEGA 1GQFA 1OCEA 2HNKA 3CF0A 5KQMA 2GCNA 2WNIA 1PT6A 4WXRA 4OM8A 3JQBC 4ZC1A 2IXFA 4ZHSA 5C53B 3GR6A 3W6OA 3N6VA 1ZJJA 1WXHA 3O9ZA 4HTAA 4KXUA 2QX6A 1XPOA 1W88A 2NXCA 2QAIA 2J45A 3U2QA 2FPWA 1XLWA 4G1CA 1E63A 5EMLA 1FNNA 3MCUA 2Z8ZA 2OWDA 3MN1A 3QKWA 5EWMA 4L4RA 1ONSA 3E27A 3AV3A 3SJUA 1NJ2A 1XZPA 3IOBA 2Y3IA 4BLPA 4HNUA 2OYSA 1M8JA 2QR5A 4R2MA 5HM8A 1V2GA 5LLDA 4BNTA 4FFWA 4M98A 2YDXA 3G2IA 3B9PA 3MHPA 5BWNA 1N2BA 3OFNA 2SKCA 5ALRA 4RYLA 1UKYA 1RXYA 4HSGA 1GG5A 5C5IA 1E9DA 1BIFA 3JV7A 2CC2A 3FZQA 3SF0A 5K20A 1ZH8A 1JEDA 5GJWC 5LA6B 1E6UA 3KHTA 1YKGA 4YRKA 4AF8A 1R8SA 2MMGA 1TF2A 3IQWA 3TNDA 1OT5A 1ZD8A 3S55A 1BMQA 3PDCA 5JS2A 5LJIA 3VQTA 1ZNZA 2JJMA 5AI0A 5KYTA 1EIWA 3O9MA 3W5DA 1W46A 4TVOA 1EFPA 2AZDA 3E0QA 3GGCA 4RANA 3SC4A 3B6JA 3ZBQA 3ZCRA 2I65A 1W4AA 1JNYA 4FZJA 4P3YA 1KQOA 4IVQA 2OV3A 2MSEB 1T5LA 2WQZA 4QFMA 3L1UA 4XIGS 1TEHA 2HFKA 1F9AA 2QN6A 2SHKA 3GOHA 3JVEA 4Z0PA 4C88A 4DJ5X 4XIJA 4JQSA 4OSOA 5KDLA 4OK5A 3A0UA 4M1MA 3DTTA 5EWLA 4D9FA 2OFWA 3WGJA 3WRVA 1N6LA 1YBMA 2J3EA 2NVUB 1UXGA 1QUFA 3M83A 5D3ZA 3IT0A 3SQXA 3OJWA 3TCXB 3F9IA 5B1HA 2ZI4A 3ANXA 3W7BA 3D8RA 1VIYA 4LRQA 4MYUA 1UJMA 1XGKA 2ZWVA 1IWOA 1XZIA 5J2UF 3DZFA 2IY8A 4OY3A 5B7PA 3HN7A 2K5UA 3OAAA 1BE0A 2DT5A 1EUQA 3TQTA 4OQ4A 4CKCA 1KZ9A 1NV9A 1M2KA 5JALA 1WDTA 2P30A 4HZUA 4ZAVA 1DVRA 1E9BA 1OWPA 2BGUA 2GM5A 2ZGVA 3B89A 4D45A 3KJQA 5BR1A 1T5HX 1WXQA 1Q1ZA 1Y8RA 4E5DA 4DCVA 2QRMA 2REBA 1OC4A 2WHRA 4I5GA 5G0SA 3OEED 3A04A 4RETA 4AAYA 4R68A 3RKSA 4KR6A 4N48A 2EU8A 4PGFA 2ZKLA 1RWXA 1PZNA 1TM4E 2WUDA 3G2HA 3JASA 5AI5A 3LYAA 4NBWA 4Y18A 1EP1B 2H1OA 1SMKA 2FEWB 4Q12A 5LDHA 1X13A 1GXSA 4N8EA 3UA3A 4NDZA 4PLWA 1Y1LA 3DJYA 5AD1A 2QMOA 4IHQA 1VBKA 2XB2A 2H59A 3EJ6A 1D1TA 1E3SA 1GEGA 1QIEA 2ZIXA 3V1KA 1NATA 1VZ2A 3R0JA 4B8YA 4BV9A 2JHAA 2NU9A 1RLMA 1L7MA 1UC4B 4DM3A 5DNAA 1JMVA 2XF2A 1Z5UA 1XT6A 3SQLA 1PFVA 2IYUA 2H7VA 3DE4X 1PJSA 1TIPA 2WW8A 3UAOA 4DNXA 2C2GA 3I9OA 1QG0A 3QU2A 4N6NA 1QTNA 3GFOA 1S8FA 2W6QA 3L82B 1H6AA 3P26A 4MS3B 5F78A 5JSUA 2BEWA 3ADPA 1X1QA 2B2CA 4YMUA 1NN3A 4HZGA 5FIUA 4EI7A 3L7DA 4O59O 1H8EA 4PAGA 4BKUA 1YOVA 2XYGA 1C3XA 1DEOA 1VIAA 3CRW1 1BEUB 3KOXA 3PKIA 4EKEA 3SJBA 3WMRA 4KE7A 5FNVA 3L0YA 3FWKA 1KZ1A 4ALIA 2A0WA 2BMEA 4W5HA 3QBEA 4F5YA 4UEJA 2CNLA 5EMHA 1ECGA 3BICA 2RHMA 3VC2A 2NP7A 2X19A 4ITVA 4KN6A 1FJHA 1THZA 1MBZA 1N0VC 1U7HA 4XLTA 1AQYA 3KX2A 2EJVA 3O3NB 4HAVA 1XYYA 2V7WA 1M0TA 2R8PA 1W4LA 2X2PA 3DBHB 4W9NA 4EZEA 2ZIEA 2O5RA 3ABRB 1CIVA 2NXJA 3RVPA 2XE6A 4ZYWA 2ZRMA 3KKLA 3L7KA 3IPAA 3PIIA 4MW9A 1SA0B 3MHTA 3FTQA 4R69A 4KWTA 3BA1A 2I8AA 4PICA 4ZALA 5LKAA 4RFSB 2SKDA 2VT7A 3N76A 3PNLA 4C4PA 1EPUA 2FWJA 3VHXA 3H5NA 2ADOA 1I9GA 5EJGA 1G98A 1P91A 2DSNA 1NMZA 1J2YA 5A3RA 2G67A 5C8YA 1QZTA 3LT0A 3T5DA 1DKNA 1WPXA 2C5LA 4CIWA 1V8PA 4IFEA 3TW0A 4BQOA 5GAJA 4D26A 4IEIA 1FRQA 2N9UA 3KOUA 2QRLA 2E4UA 2JGAA 1HDZA 3GLVA 2WVAA 3QG1A 3I12A 3QOYA 4D57A 4P0PB 3C5WP 1UBEA 4WUTA 3ZZMA 2CNOA 1Y6RA 2MOKA 1LJLA 3ILHA 2F9LA 2QN7A 4H77A 2EFYA 5BYJA 3ONVA 1MRZA 1LBEA 4N47A 3E05A 3E7FA 4BVLA 5ALMA 2EBHX 4LHYA 2Z30A 4YRBA 2BP7B 4QPPA 3DDUA 1A4UA 4QFCA 5EJIA 2CL6X 2FW8A 3X43A 4CFZA 5A9SA 5HKAA 4CMJA 3EZYA 4WKCA 1O03A 3GIDA 1WQ4A 3LLUA 1A5TA 1C1DB 3WRXC 4LJ7A 2HXSA 2G72A 2B4YA 4OOEA 3RUCA 3WAKA 4DFDA 5BMOA 5KVQA 1Q1NA 3LCRA 1VLHA 1WUHS 4YT2A 1YIDA 4HDRA 3T1HB 1P3DA 5FO0A 3F7OA 2XUFA 1N3YA 3IUYA 4K87A 1XP8A 5KNCD 5A0FA 5L3VA 4EARA 3KT0A 2Y05A 1WIWA 2GAIA 4KRGA 3BX1A 4RY0A 4TKVB 4D9IA 4BEVA 5HCUA 1A7AA 3K0AA 5FWXA 4JI5B 1FLVA 1QYDA 2QB5A 3NATA 1G6KA 1R6XA 4GEKA 4L22A 2ATCA 3U7QB 3W8NA 4DQKA 4L9WA 4GBMA 1U0BB 4YFYA 2W2VA 3I0ZA 3DV0A 1Z38A 1MZVA 1F0KA 5JRJA 4XB6B 5KSPA 3M6LA 5AXCA 1CW2B 1Z22A 3E23A 4JC4A 1ENZA 2DCMA 1FUUA 1H1LB 1YIAA 1N36B 1ZM3A 1L4BA 2AG0A 2PRSA 5KSZA 1B15A 3DS8A 1C9NA 2ZE5A 1YQEA 5EUMA 1JAZA 4HAUA 2GYUA 3NEYA 4DCUA 4JXJA 3TL3A 4YRAA 3BDIA 3DHVA 1G55A 3RANA 5KNBD 3B9BA 4RV9A 4BNHA 2BD0A 2GN1A 1JEJA 2AN9A 4NS4A 4PE5B 4JMPA 4D9CA 2HCTA 3CZMA 3N2ZB 4BGDA 2H2FA 3AVUA 3DKPA 2YRWA 2NG1A 4IYJA 5IEJA 3WZLA 4FN5A 3C3WA 1UODA 4OAQA 1ZJZA 2XODA 1XELA 3OMXA 4JJGA 3BK1A 4BVGA 4GE3A 4XVCA 5KC8A 1MG5A 3KSUA 1FSFA 3N7UA 5FL7A 1JTFA 1IZYA 3D7KA 3T3PB 4PWYA 2DF8A 3AR2A 5CB8A 3A2LA 3HWRA 1ZVQA 4DXDA 2NZJA 4B6RA 1KBZA 2Y1LA 1P6XA 1SOMA 4K6HA 4TTJA 1XHEA 1P4JA 3AH8A 4QOJA 1ZN9A 2YOHA 4J3JA 4RNDB 5JT1A 4CEJB 4Z3KA 2C2BA 5DLPA 3OLVA 4TMVA 3EQ2A 5LXTB 3GN2A 3DAPA 3Q8KA 5EJAA 1MJGM 1THMA 4RFLA 5JTTA 2HRCA 3HSYA 1OXSC 3JYPA 2WABA 1A7JA 1MCZA 3QHAA 4UTXA 3K9GA 2QRGA 3HCBA 2JAXA 4HUQB 2JGDB 1XEFA 5EQTA 5EXXA 3AY7A 2FSGA 4HLUC 4PXYA 1ATIA 1TQHA 2FWAA 2ZUUA 2JRLA 1QHYA 2DWQA 1X7WB 3UAZA 4IH4A 4WECA 4XUGB 1YRBA 4OGWA 4OYHA 2OB2A 4IIBA 2WSMA 3IALA 3BWBA 2BY4A 3X2EA 3FPJA 4G5GA 3SLKA 3K0SA 4PYLA 4IDFA 4AYTA 1JP7A 2OECA 4N8DA 3ZY2A 2WT9A 4PRZA 4V0LA 5K3EA 3HRIA 5IVHA 2C4WA 3DL4A 4W5JA 2A9PA 1DLJA 4JI7B 1JQ5A 5ILQA 1NBME 1VLQA 5DBOA 4MZDA 3LX6A 5FPKA 2XA1A 1A8IA 5ILOA 1MN6A 4LJ8A 1U9ZA 3GFBA 2RGEA 4RDHA 2ZUFA 2EVWX 1E20A 1LK5A 5K8IA 1KJYA 2BI8A 2C5FA 4L95C 4O4HF 5I45A 2GFQA 1NOJA 4P7FA 2WJ4A 1T3HA 3WDKA 1DT3A 4BEBA 1RP7A 4IPTA 4FGWA 3UUGA 5EHZA 4K6CA 5F9FA 1C8VB 2Y1CA 3CX7A 1PEDA 3KKOA 4C7OA 4E3ZA 3UB3A 2Q21A 1L4YA 3FKSD 3A7DA 1Z6GA 3C39A 4TTQA 4UAUA 4HDCA 1JQBA 4X97A 3JQGA 4L78A 4MV0A 1TU3A 3UMYA 1LFDB 1T9GR 1GDTA 4KYUA 2H7CA 2QT0A 3LPCA 2NUBA 5KOIA 4DB2A 5J40A 5CEFA 2BH2A 2VVTA 1RFGE 2ZRPA 3ABQB 3LT4A 3JVUA 2WAMA 1E2QA 3K16A 2II6A 1PJAA 1Q95A 2CXNA 1W75A 1K88A 3IBTA 1NW5A 4IIJB 5U4XA 3GA0A 3SD7A 4MLZA 3KPJA 4P7KA 3HYNA 1XR3A 4RMIA 1MPTA 1KZGB 3AVYA 1T34A 2RHGB 5BWCA 2JLWA 3PQDA 1R0SA 2UVPB 2ZR7A 4BPRA 1NI5A 4AWXA 2JEZA 3FJ1A 1Y7TA 5AUQA 1IXKA 1KO7A 1GR0A 1PJRA 3D6JA 5B1IA 5MN5A 3WK6A 2E4AA 2W6ID 4EUKA 2AL7A 2BT4A 1K63A 3LL4A 3LT2A 4BBZA 4CFSA 1E5LA 3ESZA 1D8AA 2P2ZA 1N5DA 3GLQA 4WDQA 4QGGA 3ENNA 4JKYA 3PUHA 2R85A 4TOIA 5I9MA 3UH0A 2BELA 1I4EB 1M8GA 3NMUF 2FJ0A 1XYGA 1A3CA 2HNAA 1TT7A 3IR5A 1RPNA 1KBQA 1GARA 1NJGA 4Q39A 4NCBA 2PV0A 3GZNA 5AHKA 1UMDB 1DAFA 3MT0A 1DMSA 1HLDA 4UCQA 1YAHA 2QPTA 1ZA2A 3I9FA 5HOQA 1TCCA 3ELYA 4YMTA 1SUFA 5T4EA 5KKAA 1KGSA 1YUBA 1R0CA 4QBGB 4Z9XA 2OYCA 4J7UA 2R6JA 2JHCA 4KBYA 1C3EA 1LD3A 4D80A 4IF4A 1LNSA 3U7GA 1J0DA 1U4SA 1U7DA 3CCFA 3NVAA 5FORA 2B37A 2BUAA 3H8WA 1DAOA 3O8BA 2ASVA 4RJLA 3V7WA 1PJ3A 1RCUA 4GT1A 3EIQA 1PR3A 4ARBA 2P1DA 5H3HA 1WVIA 2HJGA 2Z56A 2CNDA 2XNDA 2XUIA 3OCXA 4TL7A 2W0MA 4G0QA 2IEBA 2PFKA 3GDFA 1RQ7A 3WVNA 1RT9A 2P3QA 3I9JA 1DIGA 3CLRD 3KM0A 1PW7A 2IKQA 4GXNA 1VL0A 4G36A 4KDRA 1NUSA 4Y2GA 4CKZA 2PPLA 1NFQA 4JU9A 2FYTA 1T4CB 3BMOB 1NI4B 3O8QB 4YAEA 2HV8A 3H0EA 3JAKB 1ZOPA 4JWKA 2RGCA 3V9AA 4R41A 3LSYA 1CR2A 1KDTA 3FKJA 3KSAC 3B85A 4EUEA 3E70C 2B1JA 4R1OA 1E5XA 1UR5A 2V65A 1R27A 5AW6A 2UXDB 4QBKA 2PUHA 1SCAA 1ZN8A 4BY9E 1M1NB 2J6BA 2P1ZA 1E94E 4KODA 4WASA 4ZEXA 1OH7A 5BV8A 2JJQA 3CEPB 4LECA 5EUQB 3QUTA 3S28A 1CG6A 1NR7A 4OXKA 4XJVA 4N7RA 1TQDA 2AUNA 2CLIB 2WM3A 5KVSA 2C84A 4DMCA 2FKNA 2OGZA 5B6IA 4NXMB 3S1AB 3WWZA 4HR7A 1VIMA 1I36A 6ABPA 3UV3A 2H4XA 1KA9H 1WPGA 1W29A 3OPNA 4CM1A 1ABFA 2V7BA 2NYUA 5SZIA 1Q20A 5ICFA 4K5QA 4BO4A 3NCHA 1LNQA 2FY8A 1IHYA 1TW2A 2AJDA 1T5TA 1SEPA 3M1AA 4AJOA 4LK3A 3UPTA 1F6BA 5DP1A 3EUAA 1C5KA 4CTJA 4AMYA 3O8RA 3A05A 4PQGA 3GMIA 4D0NA 1GZHB 2QVCA 1GPUA 1RYZA 3G8DA 3B3JA 1E3WB 1WQ3A 2ID8A 3EVAA 4HPJB 3EXIB 3S6JA 1LBSA 2HU5A 1CUGA 2P65A 2W6CX 3FCUB 3OETA 1P2GA 4FHCA 4HYYA 1V4BA 4IOLA 4L51A 3UT5B 5JSZB 1VG1A 4IHJF 3AKDA 1Q0RA 4D0SA 3AUTA 1QM5A 2XQFA 4IGKA 4LXHA 1HNZB 3D3NA 1ZMBA 5DW0A 2EATA 4V0QA 1P0PA 3FMGA 1KS9A 5FWAA 5ADUS 4RIFA 2YWXA 3DEYX 1YR1A 4Y3UA 2DHEA 2OCKA 3OE4A 3O8OB 3QKIA 4OHUA 4D5GA 4NHEA 2H7XA 3L2OB 1U7XA 1GQ2A 2I99A 2DQYA 3CF4G 4NWIA 2TSYB 5FBWB 1NRJB 2FAXA 8ABPA 4J91A 5EP2A 3QVVA 3H4VA 3PQ7A 1QOQB 3WFZA 3ILVA 4DTCA 3ZU6A 1R7RA 4I46A 2H1IA 4Y2VA 4JROA 3RBXA 3S8YA 3CLRC 3FMIA 4RPLA 2PD6A 4BB9A 4P9NA 4Z3DA 3WZ2A 2JIOA 1I6WA 4M54A 2GPTA 1M6YA 2XX3A 3UN1A 4C9BA 2IDJA 1M6WA 2QI9F 2WTBA 5HSGA 2VPTA 2GCEA 1KOJA 1QYRA 2EKLA 2Z5LA 2AMFA 1NC1A 3HKBA 3KQPA 1QIHA 4G1VA 1Q91A 3F4LA 4I1IA 2C59A 3N3AC 2JBAB 5FQNA 1J90A 1IFXA 3DNFA 1FMCA 1WBJB 2PX4A 3KXDA 4RY2A 1NBHA 1ECFA 3SF8B 4A92A 1SC9A 1QH1A 4GKVA 1C81A 2XKBA 2XUZA 2EJCA 2JFOA 4DR5B 4LCEA 5E0OA 1MTZA 1O3YA 3WMWA 1G42A 2WSSD 3KWFA 2BN4A 2ZSFA 4QULA 4E32A 3H18A 3C3BA 4UBKA 1GGJA 2X9QA 1KO5A 1QHEA 1QSGA 1BVYF 2IUUA 5KOJA 2H1LA 1X15A 1SPXA 3HCNA 4Y2XA 2XOXA 4K9NA 3GJTA 3E8SA 4G2NA 4GL4A 4JFAA 3TW4A 1YBFA 1M2HA 2WJ3A 3DLHA 4YMWA 1E60A 4AXBA 2R00A 3OHMA 1C9EA 2PMFA 4MJ7A 4RLQA 5H59A 2Q49A 4HMQA 2AFRA 4JLNA 4O4IB 3TDNA 4YMSA 2ZSIA 4L02A 2I55A 1I4LD 2B8EA 1QYIA 2C54A 2P4EA 2R86A 4L72A 1ILWA 2IYRA 4P6VF 2Z0MA 4NNOA 2WG0A 4D97A 4M37A 1KY2A 4KE8A 1Y7IA 4NH4A 1GGVA 4IGEA 1XROA 2CLKB 2R68A 2VUSA 2PQMA 3ISJA 3NVMB 4MW6A 3VKHA 2BI7A 3I30X 3VR2A 1HC7A 5DI3B 2XRMA 4Y6SA 3EGEA 2GXUA 1LF5A 3WWYA 3Q8LA 2I3BA 4MQBA 4MRSA 1WCIB 3WIUA 4BAGA 1V37A 3FWNA 1U8UA 2VPWA 3C98A 4IJUA 4LXQA 4MP8A 5EAIA 1NFRA 4DJEC 1QF6A 2J9ZB 2ZJZA 3PBKA 5M04A 2RGAA 2I7TA 4BMNA 5SY9A 1AB6A 4WDRA 5G0UA 1AKWA 2PCLA 3UJHA 1WNTA 4MVJF 1IL0A 4X8OA 1RYYA 2VAXA 1DPFA 5LBTA 4YJGB 2FGJA 1YQTA 4P53A 1ZM4A 3IJPA 3THXA 4LSGA 3KUXA 3LQYA 2WJHA 2A9VA 5EZYB 2GNPA 3WIVA 4Z54A 5I51A 4JI2B 4II7A 3D3KA 4HDKB 1KRXA 4QARA 3WGOA 2Y66A 2ZJAA 3LPNA 5HF8A 3ZDCA 2C2MA 3NHWA 2OV4A 4TYPA 5CW1A 3SS8A 3UM9A 3V4RA 4B3CA 1CS0A 4AUNA 2A78A 2NUAA 2V4ZA 2HF2A 4DEYA 2G5PA 3T4UA 2PKCA 1GLNA 1E4OA 2QE7D 4QRIA 3KAKA 1U11A 4IGAA 2JPDA 1TPZA 1W0JA 1CY4A 3HN2A 2LCFA 721PA 2GVZC 2VA9A 3LM8A 3FVRA 1OR8A 3Q0TA 4AZ3A 3K53A 4D9NA 4Q1VA 3ZS8A 1Z6YA 3C3AA 3W2FA 3E7DA 2X0NA 4FNGA 4MS1A 4PQFA 4UDNA 4AMUA 4BVAA 3FETA 2QVLA 4ASUA 5EKDA 1N0IA 4WZBE 3DHNA 3DVAB 4WQMA 3D6NB 4CTOA 3SY8A 3A14A 3CM0A 4BO2A 1LA2A 4PFSA 1V5EA 2VDNB 1N2XA 2LWIA 5I4KA 4OXYA 4KXVA 4QHSA 2R9VA 1L5RA 3WZMA 4AMVA 5BW8A 3KSRA 3BOSA 5IULC 2HJRA 1FF9A 3B7PA 1V6SA 1X7GA 2YRFA 4P4GA 4TUYF 4EG6A 4NI5A 4EYSA 1QQ7A 4Y2PA 5L6LB 2AMVA 4RK7A 4MP3A 1DL5A 3RF7A 2C7BA 1SQ5A 4GPIB 4HGPA 1QK3A 4ZMRA 1W36C 3EWAA 2H2WA 1WBBA 2C8VA 4RTQA 5ARCA 3A70A 4BXOB 2DQ4A 1XZGA 3EVTA 1NP7A 2GZMA 2B30A 4LZNA 3S5UA 5J5AA 1JR6A 3FB1A 1NL3A 3HKDA 4YVFA 2ODEA 3C8DA 2RBKA 3CLHA 3JSXA 1Z4MA 1M2FA 2DSTA 1BOOA 2Q8QA 4EEXA 2EQBA 3QXHA 2BONA 3T1VA 5FWDA 2C07A 3USZA 1N78A 5ENDA 1KWKA 2XRZA 2CDRA 3LZ6A 3QGMA 2C2OA 5HIIA 1DDIA 4Q47A 4F4IA 1CFJA 2DR0A 2GS9A 4GE0A 2QY9A 1D0IA 4F71A 1C3VA 3M8KA 4RQAA 4UEKA 2DWPA 4U3JA 1JTEA 4GHWA 4OLBA 1JFSA 2CLCX 3OC0A 4LISA 1SU4A 2WR8A 1EFAA 2XT6A 4WMLA 3C14C 2KS6A 3B70A 3A1VA 3STYA 1Z36A 3NUQA 4F4FA 3TEFA 2GZSA 2N75A 1PR6A 1UAGA 2NN3C 4KXMA 4XVUA 3PQ2A 5TDHA 4AN4A 4LGYA 3TEMA 2HO4A 1XMVA 1YS4A 2FZKA 3IHWA 1DJLA 4PV7A 1JU9A 2E4WA 4RIGA 1X3SA 3WWCA 4GECA 3B5EA 4M0FA 2GXAA 1F3LA 3F7MA 2AE2A 1W19A 1XCBA 3LY5A 3UQZA 3E3MA 4LF8B 4EYKA 2KX7A 3BHJA 1XDBA 1U8EA 2IZ7A 1G3QA 2YQZA 3KT8A 5GOTA 3C3KA 4DMMA 3L7LA 4O29A 3NOVA 4I81A 3PNKA 4K6FA 3VH1A 4CIXA 1VA4A 1ZI6A 1X86B 4HUJA 2AOXA 2GF0A 2OHHA 4OXNA 4X8LA 3I2GA 1PS8A 2NT3A 4FYKA 2PUBA 4ZI3A 2I7VA 4AMGA 4GDFA 5E0KB 5KVVA 1KARA 3CUSA 2GN2A 4NSNA 2QQ5A 3OT1A 1FFXB 3TW6A 2OHGA 2AHOA 3RJTA 3ROZA 1NLMA 1UOOA 2CLFB 2XCSB 3SN6A 5M7EA 1XZNA 3G79A 3LUHA 4MQMA 2R7NA 3UB4A 1JECA 2OZPA 1Z83A 3MB8A 1CEXA 2C57A 3IUEA 5FHQA 4XYLA 5IF3A 2Q27A 1Q7RA 2C2HA 1E2KA 4I5FA 2QZ4A 1XNGA 5JWOA 3MWDB 5LOVA 4XWKA 1TJPB 1RJWA 1WD7A 4YJ3A 1P18A 2O3UA 3KSMA 1LDMA 1UJ4A 2OHOA 3E9EA 1JDPA 3AUJB 1R1DA 5HUJA 1NYRA 3O74A 2O8FA 4HRVA 3D02A 5L95A 1YNOA 2DXIA 2FJUA 2OCDA 3NT5A 1TYEB 1YQQA 2Q29A 3L1IA 5YASA 2R65A 4P7BA 2RIRA 3OX2A 2PKYX 2SCUB 1TVKB 1DEXA 4I3FA 5FDFA 4JGIA 5FTNA 1XKTA 3ZTTA 2IBSA 2AMYA 2F1JA 1OTYA 2RBGA 3MUEA 2HQRA 3ANNA 521PA 3NG1A 5BO5A 1UJNA 4HB0A 1KOLA 5GP1A 1A96A 2QYOA 3R3UA 2JLZA 4TQ9A 3ASUA 4ZAXA 2CVOA 1BCRA 3RIHA 4OUDB 1OX4A 2ZATA 4Y2HA 2PBZA 3AX6A 3UV6A 3BTUA 4P38A 1R88A 1RI2A 2ROQA 5NULA 4BYMA 1QP0A 5HWSA 3MJFA 3MD9A 1EVIA 2I1LA 2WHXA 1JQJC 2FFRA 3F67A 1D4AA 3VKWA 2VYNA 2XDQB 1E99A 2LIVA 1IJEA 3C6QA 3GFTA 3Q9UA 5BSFA 4L3WA 3GLFB 1G8HA 1I5OA 1TZJA 1W73A 4KZPA 1V25A 5F9MA 5JAMA 4CM9A 2OZLB 1I0LA 1NM5C 4OHYA 1Z45A 2I91A 3ZN2A 1XF9A 1R10A 2JH8A 2JZCA 3CEJA 3L4BA 2RJ3A 1YVPA 4K0KB 1X7ZA 1F8UA 2NACA 1IEQA 4R1QA 1K2WA 4KK4A 4WGFA 2UZ1B 3CJQA 3G5AA 3ZJ5A 3D6HA 2W6MA 4AS1A 1T3LA 3CBGA 2PKRA 1MABA 3EASA 3U13A 1U94A 1GADO 1HOXA 1GLVA 1T13A 3E82A 2HT6A 3ND9A 2L17A 2I78A 3MBKA 4URUR 3WNVA 1GFWA 1Z73A 3KL2A 4FM9A 5IJWA 4RXMA 3PLNA 4KPUA 1H9AA 1E96A 1HLFA 5IT9A 4FMPA 1JJAA 2IYZA 1E9EA 5BMVB 4RVDA 1IB0A 4FGUA 3WSWA 2DTDA 3TW8B 4S0XA 4WJLA 1OLXB 2YJZA 3TQHA 1ST2A 2GPWA 2R4QA 1LBHA 2Q46A 1Q6ZA 2QPOA 2Q1WA 4RTKA 1J5PA 2C9CA 2F90A 2R87A 2Y0PA 4RHFA 1RXSA 1SXGA 3U48A 2W7TA 4G9GA 4BPBA 3OMWA 3VJLA 5KINB 2IEYA 2ABWA 2HM7A 2DAPA 2EQ5A 1OIXA 3C48A 3HVHA 4FGJA 4OOFA 3RF6A 4AUEA 4D3YA 2EWMA 3FXAA 1VHWA 3K0CA 3JYQA 2PUAA 3QYAA 1G2PA 2RK6A 1NXTA 3WK8A 3TQFA 4DPKA 1G4UR 3WKBA 4CLXA 4YACA 4B6FA 4BFVA 3R40A 3KJZA 3AXSA 4GNRA 5L40A 2Q6TA 2Z6AA 2CYBA 5HK9A 2IODA 2BE9A 4NAUA 2UU9B 2IBMA 1HUQA 3DMGA 1QDUA 1JX6A 2FVYA 2GK4A 2GYYA 3AHJA 3PVCA 5CTAA 4DNFA 2ZULA 5FL3A 1V4NA 5IC5A 1YTLA 5LP6A 3PQ6A 3SXUA 1G5QA 1X1BA 3U4CA 4FNAA 1ZR4A 2H4HA 2WJGA 3GEIA 4TRNA 3FMOB 5CYGA 4K9QA 3QTTA 4M53A 2O5EA 2P68A 1PJBA 3HCWA 2FETA 3LBHA 4JBIA 4ZVOA 1EFLA 4C06A 5BW5A 1U63A 3JR7A 4GRAA 5DCUA 1QPBA 2Q07A 2BGJA 4B44A 4RK4A 4Q4CA 1EX7A 4DS3A 2RHDA 1BJKA 4PZYA 4N0EA 4RCVA 4AQYB 1RS0A 4L2IA 5ELMA 4ARVA 3VH2A 4CI9A 5FUQA 3DE6X 4YP0A 3OTOB 1J8DA 3BB4A 2JI7A 1JVNA 3J80A 4ZAYA 1T15A 2W2PA 3WQSB 2O1XA 4C43A 2O5CA 2JA1A 4DA7A 3SZRA 2G1JA 4P4SA 3OTGA 4ZO9A 4W8GA 4EPXA 4L5AA 1RLIA 4D9GA 1O94D 1NPDA 4EA9A 2IE0A 1I9CA 1YVDA 4YGYA 5CHYA 4PIVA 3KZVA 1SZJG 1C30B 3DE0X 2JEOA 2HK7A 3REQB 2BJHA 4FHDA 4XUDA 1PNOA 3G5MA 2F8MA 4HDQB 4I9UA 5CYPA 2NZXA 1PKEA 2D5AA 3F5QA 1T4BA 4A23A 3LP6A 1SXJB 2HX1A 1B26A 1C4XA 2R8XA 4JJ7A 4RVUA 3B6EA 4M49A 1R16A 2ODWA 3ILYA 2JFYA 4IXNA 4H1UA 4TV9F 3K0FA 2EW1A 1EU1A 2OQIA 3NR2A 1E0SA 4HEQA 1F0NA 4KQ6A 2X9LA 4Y30A 3SYKA 4DLLA 1YHNA 2CLDX 3RTCA 2LZ0A 1D2GA 2Z8YA 4L7VA 4MQLA 6LDHA 5DNWA 1KYYA 1AU9A 2GEFA 3G7UA 4FYMA 4K9PA 5D01A 3N58A 1Q7EA 4WEQA 4DC0A 1RQRA 3QEMB 1W93A 3FFXA 4G84A 3AUUA 2WUWE 1PYOA 2PT6A 3PQEA 4WTOA 2KYRA 3BIJA 5KYXA 3Q10A 2BJVA 4YV0A 3ZLBA 1ZEJA 1T1GA 2RFLA 4AY4A 1GNLA 1LDBA 3X1KA 2WJIA 1EJ0A 1ZIYA 2WD9A 1LVUA 4K9LA 1JKJA 3SBXA 2M9MA 1G8YA 1IUOA 3QFHA 5L45A 5I7UA 5BUCA 3HBJA 3TK1A 5DGTA 4X8MA 2H1CA 4MQ5A 4XDGA 4ALNA 1JDZA 1OH5A 1NG9A 1XNQB 3K4PA 4P3XA 4PG6A 2UZ3A 4KOEC 3I6QA 1GSOA 4MVJH 4X92A 3QOFA 1O95D 1QANA 5AWFC 3UEOA 4AN1A 4CWAA 5I7SA 1RWWA 1VG8A 5IXSA 3U4QB 3D4NA 4ZMBA 2ZJOA 1TMOA 4EVQA 1DIOB 3M3PA 3F74A 1U2DC 2GEDA 1O4VA 3F3SA 5SICE 1SD2A 3K96A 2ECKA 1IONA 1VHJA 1KEWA 2J9RA 4FFNA 3ZOKA 4WLEA 2V9PA 2HU8A 4D9JA 1SUIA 3OLYA 3SXPA 4TLLB 4KQXA 3CVOA 1Z3IX 3TJMA 1EXWA 4KIGA 3RT7A 5BQ5A 3RVRA 2PKEA 1JHZA 5DLDA 2GR9A 4MV8A 3DBLB 1ADCA 3F9RA 3FHLA 1MEEA 2JI8A 3G2PA 3KOYA 4TMKA 5EXTA 2MMCA 2DKNA 2HPAA 4KQGA 3WLMA 4EG3A 5IUJC 4A0SA 1C1HA 4AURA 1Y6FA 2C5GA 4LYDA 2EIHA 4MR9B 1O87A 1Y4DE 2R8YA 2Q3MA 2GBLC 3ADKA 1CQWA 4IS3A 4C4XA 1OLSA 2RI0A 5T4FA 3ELDA 4JT2A 2HRRA 1JQKA 2CL0X 2PD3A 1ZGCA 3KP1A 4P58A 2Q0HA 2O0JA 2ZSUA 2FJPA 4RM2A 4IIUA 3IMKA 3EIEA 3OJXA 1DJPA 4IZHA 4WLVA 4Z1MA 1B41A 3QKRA 4HB2A 3K94A 4GKAA 4TM7A 4UEOA 4YQZA 5IJXA 5LA6A 3S8MA 3T0IA 3B8HA 4JS0A 1P74A 1FFDA 1NXQA 4IX9A 3WBJA 5HQJA 2C4VA 3AGPA 2WWXA 4Z2AA 2C58A 3HLKA 3UWDA 2C8KA 3TLCA 4F4DA 1GAXA 1J39A 4C4ZA 4ID9A 1XB2A 3I8SA 5MHTA 3WS7A 4XSVA 3PC2A 4GYKA 1WXXA 2F00A 2XQVA 3DUWA 1N3BA 4JYBA 5JO9A 4JELA 4B1FA 4DZZA 1DIBA 1ZOSA 2ZU0C 4IOMA 3FNGA 4D4HA 4EHKA 5J4HA 1CUXA 1JHXA 3L43A 4TKLA 5JQGB 5U4QA 3UYLA 4R2LA 1XZHA 2OM2A 1QIFA 3GNQA 4K81B 2OGSA 1XQYA 2SBTA 5I7EA 221PA 4WCFB 1CDEA 2W2LA 4X0EA 3C97A 1J21A 2GSDA 3SX2A 4BEWA 4EO7A 4YT4A 2BM1A 1OI4A 1HNWB 3BCRA 3DFFA 5IMSA 1A76A 1BX3A 2NVUA 1OE0A 4RTPA 2JLCA 1Y6GA 4ZVMA 3TZEA 3JYHA 4RHTA 1AQNA 4IFTA 3UXMA 4O2AB 3DM9B 3L7BA 2Y0BA 1WW2A 3BGWA 1TZ2A 1ZD5A 4PN3A 1WVGA 3OOHA 4C0WA 1YF3A 1S01A 2ZS8A 4WN9B 1QDLB 1QX4A 3MMZA 5ALPA 2WVJA 1L5GB 5CH8A 5IBQA 5E6SB 3AG6A 4YRQA 4B3DA 1MB9A 1RYMA 3F8TA 4MPPA 4Z5XA 3OCVA 2V03A 1DQRA 1WD5A 2J7PA 1FUYB 2CY0A 4X7RA 3TLBA 5I4BA 2RHTA 5DO9A 1U1EA 3HCDA 5L6MB 3M4XA 1BHJA 2QGFA 3C8MA 3EUWA 4KX5A 4QOHA 4HFMA 5JI3E 5E1MA 2IU3A 2RARA 1RPZA 5H9VA 2XMSA 5I3ZA 4LI0A 4G67A 1WF3A 1US8A 4H27A 2HBRA 2WU3A 3A4YA 2CF6A 2F17A 3GDHA 4I6JA 1SCQA 2YWRA 4PLFA 5JZOA 2C4MA 3LO5A 5HUQA 3HXKA 5ALQA 3IP9A 5AJYA 4EGCB 2X7HA 2ECQA 1K7YA 3TZKA 1C9DB 4UBNA 2PT5A 4YDSA 3VOBA 3LDGA 1TF7A 1T9DA 2A2ZA 2JGIA 3DAHA 4OJTA 1VE5A 3AIKA 3OLWA 1DJOA 2W2KB 4N8SA 4YAFA 4IJQA 3KPVA 3BXHA 4J94A 1DG3A 1DBIA 1Y9ZA 4MS3A 1MFPA 2EKPA 3W6PA 1ZC4A 1F1JA 3H2YA 4INJA 4PAMA 3MINB 3GY0A 4CJXA 4ESEA 1NY6A 3HWWA 3X1XA 5KOJB 3Q3HA 2AR9A 3AERB 3PUYA 5CDYA 2Y8EA 2QENA 2PH1A 4GMFA 3AKZA 4QQRA 3D8TA 4LJYA 1HEIA 4UHCA 1AC5A 2VUUA 3RAJA 1BZYA 4C4YA 3C2QA 3H87A 3COWA 2C2WA 1X8XA 1NUAA 1PBTA 2V7UA 3LHDA 2QTVB 5CDFE 1F0YA 2DR3A 1Y33E 4J0JA 3U1TA 2NNWB 4OJMX 3X3HA 3HXMA 1QUEA 3TQSA 2V3CC 421PA 5FA8A 3DBHA 3HXTA 5IF9A 3EAFA 5LNK1 2JJYA 4GSYA 1P0FA 1SK8A 3TM4A 1HT0A 2HYIC 2FN7A 4TYMA 4L5IA 4B34A 1M10A 4J6FA 4FR0A 4GI1A 2WPDA 5KNDH 4RFSA 4X90A 1MVNA 1XQXA 2NUPB 3V4ZA 3TI9A 1SUDA 4FBGA 3VOSA 1AB5A 5BVGB 1UJ5A 1UKAA 3ABSB 5TQ2B 4DMGA 2VCEA 2G5TA 2AI2A 2G1AA 3BCHA 1SD1A 3DOIA 4B40A 1SOUA 4MV3A 3TL6A 2ZRBA 5I7HA 2M6LA 1KVRA 1ISRA 2ZIFA 4KFUA 3DG9A 4F9TA 2HU2A 4PBTA 4G26A 1S2MA 4M1TA 3HKCB 3DMDA 4DA9A 1DUVG 1ISIA 3EZLA 4P2GA 4DM4A 2V7QA 4GFDA 1JE0A 5THKA 3H8VA 4C08A 5EHXA 3LQKA 1ZD2P 4J3NA 2WI8A 2VXBA 1QTQA 1AZLA 3A6GA 4N9WA 1K6IA 1KIAA 2Q5LA 5LUBA 3F1LA 4DLBA 1U1FA 3PK0A 2LP4Y 3PRKE 2Z2JA 4R8LA 5EJ7A 1W1IA 1DPGA 1KI6B 2BP7A 4JOSA 5H3LA 3TLMA 1DOAA 5FJJA 2NV0A 3GRUA 2P6UA 4QXQA 4R54A 2UYQA 5AVTA 1T5IA 4I5EA 3UYKA 1ZW1A 4AT1A 2LD4A 5C5EA 5LZ9A 3ZWNA 3T4XA 1F4LA 2AIRA 2WM8A 1LPPA 1MO3A 1TU0A 2AVNA 1C1DA 4YAKA 1NT2A 3LVRE 3QFRA 4KH1A 1PE0A 3OKFA 4RU1A 5IYZF 4GVPA 5FWNA 4IXMA 2O54A 3RC1A 3T5BA 3FPHA 3EVCA 3C5CA 4UHDA 4C22A 5ALXA 5LD2C 3NIGB 1N6PA 2LCIA 3LG2A 5FFMA 1BMDA 4FDTA 5H68A 3NYQA 1MV5A 1AVTA 1N1DA 1YS9A 1Y1TA 3G9XA 4OA5A 4C6SA 4TKVA 2ZYAA 6GPBA 1AX9A 1Z8HA 4GLJA 5FI5A 3CCCA 4Q4HB 3T7IA 1I7NA 4MUJA 1WPRA 4JVMA 4K6KA 1TT5A 3U7QA 4ZT5A 1T2VA 1WZCA 2O9JA 4YHHB 2GD2A 3TL2A 3TXXA 4XTCS 2XDAA 4AX4A 2JLSA 2ZRDA 4HT3B 2P0EA 1FPQA 1L5VA 2ONZA 1UBSB 1KJNA 4LRUA 1Z6QA 1H1LA 1P80A 1QG2A 2VPQA 5FRDA 1KI9A 2ONYA 1DINA 2D5BA 3TFOA 3COYA 4M83A 2PH5A 1K3TA 2R62A 1W0KD 2A1UB 3D3WB 3H9EO 3LQFA 3Q1LA 4A2PA 3MXOA 4PO1A 5EE1A 2OQVA 4Y6GB 3F97A 4BQPA 4EG5A 3DDCA 5I7FA 1OASA 4HVTA 5F23A 2VF7A 5DTMA 3H5IA 2PX6A 1T24A 2GFHA 3GMSA 4EVSA 3A27A 1E6CA 3LSTA 1MORA 2VHYA 3OCJA 1QLHA 2WT8A 3S2FA 4UXJA 5I3CA 1H93A 1LRKA 3QFTA 1U8YA 1P1JA 3TINA 3T0GA 2OT3B 1G9SA 5J3JA 3VO2A 1O6BA 5E2IA 1SIBE 3P0JA 2JGFA 4YO7A 3U3RA 5G4LA 5C31A 1PEYA 5LQKA 2ZITA 5FOSA 1Y4SA 2FPIB 4CEJA 2QRUA 3AGQA 1V11B 1SPBS 2H7YA 3HL4A 4Q3LA 1F8YA 3IVXA 5ICMA 5D8DA 5CT6A 2DC1A 3HDHA 5HKKD 3HQ4O 2G1PA 2ZAYA 3H0KA 1LSUA 3RR2A 1LV7A 2I3ZA 2WWHA 3FYCA 1K08A 1P75A 5LQJA 1NWCA 1JAHA 1OVGA 2FG5A 2PS3A 2TECE 3DFIA 3HJBA 4FZ5A 1HT3A 4HUQA 2JGDA 4FYIA 4U4AA 2V7PA 4Z8XA 4TXJA 2EGGA 4AW9A 3D0OA 2FW0A 4UU8A 1USUA 3ZJTA 1UIRA 1G2IA 1X7WA 4RXUA 1PQPA 3V46A 2NO9A 1H0KA 4P3KA 4DT1B 3JD1A 2GN6A 4JUBA 3KWMA 1GNQA 4URYR 5JC8A 4OHVA 5JH7B 2BRUC 3SCZA 4KPYA 3KDSE 3DCIA 3FF4A 1VSBA 3CNHA 4W8HA 3P7MA 4ZKEA 3AI7A 3PKJA 4RELA 2W90A 2FWBA 1BYUA 2Y1DA 1NJ6A 5JC1A 5LMZA 2FPSA 3H1BA 5EXDA 3QXGA 3WQRA 5B5SA 2OO7A 1G6OA 4EPRA 1MLDA 1BS2A 2O3QA 3GRFA 3JQFA 3K3PA 3R3JA 3O2JA 1L4EA 4LKOA 1UXOA 1FQOA 3M6AA 3GPIA 4RJKA 3GVIA 2Q3EA 4FT4A 1NURA 3M82A 3N0TA 4NDNE 4NIMA 4OKIA 4EHFA 2DETA 3OI7A 4HX5A 3I5UA 2NP6A 1DEAA 1IHPA 1ZN7A 3FYDA 4ATNA 1JW9B 1QHGA 2CXQA 1XU4A 3TX2A 2ZBPA 1SQ6A 4FOOA 2EJWA 1E0DA 2V6MA 1TECE 4JIMA 3T99A 1R5OA 2VAVA 5I9BA 4UQLA 1B7GO 1W96A 3A6DA 1Q3TA 2UUCB 2JGJA 2DECA 1G8FA 2P9EA 4JEUA 2EZTA 3QPDA 4MARA 4NYIR 4MJXA 4WGGA 3LA6A 2EWWA 3VSCA 3IBSA 4F3RA 1DTEA 3YASA 4AZSA 1MC1A 3I5YA 1KQ3A 1RYFA 1SOVA 3E18A 4CL0A 2EKBA 3VSEA 4M46A 4R0VA 5B3LA 1FFBA 1QMGA 2DY0A 3KQTA 4EHDA 2G07A 3NAMA 4I1PA 5D3QA 5AM1A 1OBCA 5EIAA 4YNBA 5IFLA 2O4CA 1HT2E 4N6GA 3ZE6A 3IODA 1R8JA 2FZWA 2HNBA 4Q3DA 4OX9Y 1PSDA 1Q6YA 5KX5A 3EYWA 2XTMA 3J7AC 1GEEA 3R7NA 4E07A 3CTMA 3DKRA 2EFCB 4J2OA 5HE8A 5BSVA 2QGNA 5A5GA 2UVPA 2D8AA 4IUYA 1N5KA 2AH5A 1K3UB 2G80A 1E2IA 5IDQA 2ZB7A 4CT4B 1I3NA 3IPRA 2O19A 1T2AA 5K01A 1SCKA 4YJ2A 3K6KA 2BHRA 4EY6A 4FK8A 5CJPA 1S3IA 1JILA 1OFUA 2GN8A 3EQ8A 1XK7A 1C29B 3SAJA 3SKVA 3TZQA 4FFDA 3UPDA 1I4OA 3GC6A 1SXQA 4H0NA 3VO1A 3C6YA 5I7RA 4LZAA 3N9IA 1EVJA 1TCVA 2GN4A 2HD4A 3UICA 4MTLA 3W3AH 4CM8B 1QR2A 1ZUNB 3OQOA 4MVJM 3IJEB 2I6FA 3MK31 2IKSA 3TLGA 3IESA 2CVHA 2UXBB 3GJ8A 4JEMA 2QMEA 1JHQA 4YN3A 4OHCA 1ZRSA 4PZ9A 2YWCA 4XIYA 3GT4A 1E1CB 1MVOA 2VH2A 3L3BA 4RA9B 5FF9A 4CN8A 5K7SA 3DEHA 1IY8A 1XWWA 5E9AA 3HR4A 3NONA 1FFSA 3FTCA 4ZZIA 1AZTA 2AX4A 5ECYA 4DYDA 1JA1A 1TO1E 1VHTA 3DMTA 4BO9A 1NQUA 4IH9A 4M0CA 1I7QB 2EEZA 1DCFA 5GGXA 3K8OE 1T4CA 3BMOA 1NI4A 3H05A 5DM4A 3HKEA 3SEZA 5L8VA 1MJFA 1YASA 4WX2B 1A5SB 3U09A 1XRSB 3X0DA 3K1YA 3DUFB 4M7OA 3LC0A 5AESA 4Q3KA 1RCTE 4POAA 2BDTA 3WIEA 1P2VA 1M1NA 4Q4DA 1OPXA 2PKQO 5H80A 2A4KA 1E58A 2R8OA 2JZOA 3VDRA 2ZP1A 4EPYA 4UAVA 5GOZA 3V7YA 2AFIE 3GXBA 3GPBA 3HY6A 3S1AA 2CLHB 3RJZA 2NTEA 2PR7A 1QXSA 3EPRA 3JQBA 1HOTA 3PP8A 3S2YA 1PTKA 4QHYA 4G8JA 1Z8DA 1CFZA 2MINA 3STXA 1QNLA 3I3OA 5E3HA 4JGBA 5FI1B 5KSWB 1XTBA 3KQVA 5F7OA 3BCSA 4EENA 4P92A 4KDEA 3NWPA 1N34B 1DX9A 3PI7A 5CLJA 1LUAA 3TTUA 1XC7A 1ZAKA 3PENA 3QEJA 4PNZA 5AM2A 4LTNA 2YZKA 3VBEA 2BEJA 2Q2WA 5EJ5A 5FLKA 2WTEA 4FNOA 4YV7A 2LUOA 4JVSB 1N5RA 4MUIA 4QZVA 4BFZA 1OU0A 5E7QA 2G9UA 4EHBA 3PNOA 4BRSA 1KK0A 1P9NA 2HLDA 3OKCA 1NV8A 3M33A 3RK1A 3UT5A 3VZPA 4DRYA 5FLYA 4E03A 5HFNA 4MW5A 4HNHA 1LTQA 3EB9A 3R20A 5JO0A 3JQDA 4HH0A 4CPDA 2J5RA 3RQIA 1UJCA 1CWUA 1W2GA 4DTIA 2GA9A 3HEBA 1UWVA 1ZBQA 2XTAA 3B1JA 4J4HA 3KLOA 3T41A 2B92A 3E1SA 1SUBA 2WFMA 5KTKA 1HYEA 1PJZA 2QMHA 1CK4A 3CN9A 3O8OA 4PZZA 4QAQA 3FVQA 4S1NA 3ZLTA 3ZPXA 4EGFA 4A36A 3VDXA 4ZCRA 1TAUA 3IT3A 2PUEA 2GILA 3GLTA 4OBBA 5CXUA 3NBUA 1ZD3A 1VE9A 3LH5A 1G3IA 3TPFA 5JV5A 3L1HA 3X1YA 1OB5A 1L8LA 2EF1A 2AF3C 2UZAA 3R6TA 4S35A 4Z9AA 4R8KA 3IBCA 3PQ3A 3G0IA 5B1SA 4KI7A 3FPEA 3QU9A 4LQ4A 3O2QB 1WV0A 3A1DA 1Y1SA 2G08A 3QWHA 1LVGA 2ZYRA 3IP1A 3AL0C 4W5WA 1MQ9A 1QCYA 3A32A 4G3XA 3JX9A 1ST3A 4PG4A 3GPLA 2DHRA 1RC0A 2ETVA 1KKLA 1GA6A 2J9FB 2J30A 4NYJR 1AF7A 1O9GA 1WULS 2WHQA 4AB1A 2UV8A 5T4BA 2JBAA 4U6SA 3BGVA 3PRYA 5IM4F 3RAFC 1GZ5A 4TTIA 2VJLA 2QLBA 4AJ4A 4DV1B 4IQ0A 3TJZA 1NI3A 3GZTB 2ZBVA 4ND4A 1KMNA 1UKEA 2OSBA 2WF7A 1Z63A 1ZC3A 2GB4A 4FFSA 2EFGA 3H7AA 5CUQA 2FP3A 2NIPA 4C29A 4BX9A 1FLAA 4PYJA 1SB8A 3I2HA 2BZ1A 3LQQA 3NASA 2GJKA 4OHFA 3TMKA 3ZE2B 3UCEA 3NHRA 3GCXA 5LJLA 1AKTA 2IYVA 1EBBA 1IEVA 3UJAA 3EEIA 3KCNA 4OUKX 3FRHA 2DP4E 1Z07A 1N25A 2R6CA 1YJAA 1RXUA 3HWSA 3EXG1 4HDMB 4W5RA 2GEBA 3QF4A 4ZO6A 4NCJA 2VR1A 4QODA 1L5FA 2O3JA 2PAFA 5ERYA 3ANMA 3LA8A 4QSHA 4YCMA 3OQVA 3GF4A 3K9FC 3GLIE 2O6LA 4OI2A 4EW2A 1JKXA 3EE6A 4L6AA 4AKSA 1WV1A 5AVWA 5K0BA 4AP9A 3LPDA 1SCUB 2NU8B 3WOHA 4E5SA 4JSRA 4QTXA 3AF2A 3DFKA 3EG9B 4ZU1X 1J07A 3E3NA 1U31A 4N0DA 4UASA 1JBKA 1ZQ1A 1E2NA 3NHMA 1KF0A 4TVBA 3B3QA 3H11A 1ETUA 5EVJA 1Q57A 5F76A 1LBIA 3TLYA 1R3DA 2P2YA 2Q5CA 1YD7A 3A6JA 4NL4H 1Z3CA 3O90A 4Q66C 4Y1RB 1RHJA 4YECA 5T6MA 1ZMTA 4OFWA 1GUDA 1E2MA 1UKBA 1MDBA 2OHVA 3G7SA 2FMFA 5FOWA 3ZY5A 1VJ5A 2UYGA 3BC1A 4MNTA 4FX5A 4AJ2A 3AEXA 4NMMA 2DE0X 1GOTA 4YJGA 5DASA 5K0NA 3WK7A 4ZJPA 1M83A 2FQQA 1XCMA 1QS0B 3RUHA 1NMQA 1P9OA 5EZYA 4DDTA 4A2QA 4V1CI 3M6IA 1O97D 4HDKA 2IYEA 1GSHA 2W83A 3PXUA 4F8YA 2C8JA 4JZYA 4XFJA