1T0IA

Ylr011wp, a saccharomyces cerevisiae na(d)ph-dependent fmn reductase
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
185
structure length
185
Chain Sequence
MKVGIIMGSVRAKRVCPEIAAYVKRTIENSEELIDQKLKIQVVDLQQIALPLYEDDDELIPAQIKSVDEYADSKTRSWSRIVNALDIIVFVTPQYNWGYPAALKNAIDRLYHEWHGKPALVVSYGGHGGSKCNDQLQEVLHGLKMNVIGGVAVKIPVGTIPLPEDIVPQLSVHNEEILQLLASCI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords YLR011wp
publication title Crystal Structure and Functional Characterization of Yeast YLR011wp, an Enzyme with NAD(P)H-FMN and Ferric Iron Reductase Activities
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 57
structure length 185
sequence length 185
chains with identical sequence B
ec nomenclature ec 1.5.1.39: FMN reductase (NAD(P)H).
pdb deposition date 2004-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03358 FMN_red NADPH-dependent FMN reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1t0iA00
1AMOA 5NULA 1SQSA 1CZKA 5F4BA 3W78A 1D4AA 1YCFA 4FGJA 2ARKA 4NULA 1XYVA 4PTZA 1BVYF 3ESYA 3F2VA 5F51A 5A4KA 3NHWA 3U7RA 2X2PA 2MT9A 3F90A 4LTDA 2QX8A 4ZVNA 2XOEA 3N3AC 2FVXA 1D03A 5FUQA 1YDGA 5F12A 1QR2A 5FA6A 1FTGA 4LAFA 2MTBA 3N39C 3OX3A 4ZVMA 2A5LA 4U7HA 4QOJA 1CZNA 4OXXA 1C7FA 5JROA 3NHRA 4YAUA 3TE7A 2FDXA 1AZLA 2XODA 2QX4A 3B6IA 3KEGA 3NHPA 3NHYA 3ES9A 4QOEA 3QFRA 4DIKA 1AKVA 3KAQA 1J8QA 2V5VA 2N1MA 4C14A 3GAMA 3FJOA 2QX9A 2OHIA 4U7FA 1WSBA 4QODA 3TZBA 1D04A 1AKWA 3K20A 4BMOB 3UXHA 3OWHA 3TEMA 2HNAA 1YCHA 5LBTA 3W77A 4U7GA 1JA0A 2FCRA 3F6RA 3NHJA 4PU0A 1FLDA 3HLYA 1H66A 3LCMA 3O73A 1J9ZA 1AKTA 3NHSA 1FLNA 2FLVA 1CZRA 3LT5A 1XYYA 1DX9A 3P0RA 4R81A 1FVXA 3NLLA 4QOIA 2Q9UA 3ESZA 2HNBA 4Y9RA 5B3KA 2MOKA 4XDHA 3F6SA 2M6RA 1OBVA 1YKGA 2R97A 2WC1A 3OJWA 1BU5A 1CZLA 2QWXA 2B3DA 1AHNA 4CETA 2OHHA 2Z9DA 3O2NA 2FZVA 1CZHA 2RG1A 4XDGA 2V9CA 3FVWA 4Y7CA 5LMCA 2Q62A 2M6SA 3B6MA 3GFRA 1E5DA 4Y9UA 5B3LA 1ZX1A 1TIKA 3OX1A 3ZHOA 4CF6A 4QOHA 3U7IA 2OYSA 1T0IA 2V5UA 4ZVKA 3S2YA 3D7NA 3GFQA 1YOBA 1GG5A 3EYWA 2BF4A 3OX2A 4LTMA 3UXEA 1KBQA 4YAOA 4N9QA 1RTTA 4ZVLA 3SVLA 3R6WA 4GI5A 5ULLA 2FX2A 3NHKA 4H2DA 1YCGA 3NHFA 3K1YA 1AG9A 2X2OA 2Z98A 3FX2A 1NNI1 3FW1A 3L9WA 4C0XA 4F8YA 2FOXA 4DY4A 1AKRA 2FZ5A 2D5IA 4N82A 1ZWKA 5NLLA 4H6PA 5EA2A 3FNIA 1J9EA 2AMJA 4C0WA 1QRDA 5LJIA 1QHEA 3NHLA 3EDOA 3NHUA 5BUCA 3OWXA 5TGZA 2QMYA 3N3BC 3B6JA 4DILA 2QMZA 1OFVA 5LJLA 3ESXA 3HA2A 4FGLA 4J8PA 4YQEA 2Z9CA 1VMEA 4YAFA 1SG0A 1F4PA 1CZUA 3QE2A 4ESEA 2QR2A 4HS4A 1RCFA 2FAXA 1FX1A 4LA4A 3OJXA 3GFSA 1AKQA 3RPEA 5EMNA 3W79A 3JSXA 3OVMA 4PTYA 6NULA 2BN4A 2ZKIA 5LBUA 2GSWA 3B6KA 2KLBA 1CZOA 4FX2A 4BMPB 1T5BA 3L9XA 4NLLA 1OBOA 3HR4A 4N65A 2BPOA 4C76A 5LLDA 1XT6A 3W7AA 2BZSA 1I1OA 1C7EA 1XI2A 4GQIA 3KAPA 4ICIA 1JA1A 2R96A 2F1OA 4D02A 1X77A 1ZWLA 3KLBA 5FX2A 2OHJA 1FLAA 1TLLA 1RLJA 2W5UA 2Z9BA 5EAIA 1RLIA 1KBOA 1WSWA 3G5MA 2MWMA 5LVAA 1J9GA 4QOGA 3NFRA 1FUEA 1V4BA 1B1CA 1DXOA 4M0CA 2BMVA 1AKUA 4YAWA 1DXQA 1YRHA 3QFCA 2QX6A 4YALA 2KQUA 4FGKA 2HPVA 1H69A 1FLVA 4LTNA 4HEQA 4GR9A 4QOFA 1QBGA 4S24A
chains in the Genus database with same CATH superfamily
1W76A 1B2LA 2OY0A 2WT9A 3BMNB 1M2OB 2PCLA 3S27A 4HHEA 3R5XA 5TQ2B 1ZRSA 3QSGA 1TAHA 4DCMA 5I4KA 4KNWA 3BTUA 3Q3JB 4OHCA 4YASA 1GR1A 4ZT3A 4QGSA 4LKOA 3DL0A 2OC9A 3EE6A 1MD9A 1HLGA 2BAGA 4JODA 2H3EA 5BQXA 4KFCA 1JB9A 2LDXA 2GWRA 2O2ZA 1I4DD 4TV9F 5BWLA 1I0LA 1BA3A 2OSBA 3TR5A 1BVYF 2C8KA 3OUUA 4L4UA 2REQA 3F9RA 3R23A 2PT9A 2I6TA 5TX7A 5I4BA 3U56A 3NJRA 3I52A 4GSYA 4WK0B 2IBTA 1CQZA 1SKYB 4FMDB 1JIVA 1L4NA 1QS0B 2QYTA 2EZ4A 4I5FA 4LZJA 1JVBA 3D4BA 3VZQA 3WK9A 2O2YA 3COWA 4DQVA 3UGJA 5KC8A 4JKOA 2JFVA 3PVCA 2BM8A 4DR3B 3BIFA 4WFIA 2F55A 3H5IA 4N1AA 2GD1O 4DA9A 3QUSA 2DFDA 1DPFA 4TQ9A 1JU4A 3DC2A 1LDBA 3HBLA 3ZI4A 3ZVMA 3ODPA 3CLHA 1IZ8A 2BJWA 1C1DA 1T3TA 2QTCA 2BMFA 1LTQA 3MTGA 3P9RA 5K3SA 4PR0A 4UZFA 4CTOA 3FCCA 4LS3A 4CMEC 5LMNB 3JQRA 1CY6A 2VS1A 4LHSA 3RADC 1H9CA 3RF7A 4L4SA 5KQMA 1XU7A 1QE5A 4UM8B 4G89A 2NNLD 4Q4JA 1EDOA 4AZTA 4EUSA 4ENWA 4EM6A 1MDFA 1C9YA 3DCNA 5HF5A 4GG1A 1NJ5A 2WYOA 1JDZA 4UBJA 4BAGA 2GHIA 4DG5A 3JZMA 4UFNA 4BGVA 3QBDA 2ANCA 1NF2A 3ETEA 3V4OA 1HG0A 3W90A 4I9FA 1N3YA 5G4LA 3E9DA 4U7TB 3IEVA 4JZKA 3R7DA 1L7RA 4ER3A 2FJ0A 4BECA 2CF6A 1USWA 5JFGA 4UAUA 4ZXFA 3IUPA 1ZOSA 3OKPA 5IDVA 3GEDA 3MSCA 4KC0A 4HXYA 5F2EA 3OU2A 4O1HA 2ZJOA 1WVMA 2R2AA 1BFDA 2BONA 4JN6B 1T0UA 2HLDA 4OSEA 5C0OE 4XSHA 3CR7A 3RARA 4CHGA 2YYSA 2C9BA 2HZ7A 4CKEB 5HSGA 4M37A 4URFA 3L1HA 3I5XA 3IP1A 3Q7SA 1EFKA 1HQDA 1CCWA 1DKNA 3VU1A 1W59A 2NZ2A 2LCIA 3ROQA 3ZHBA 4D2IA 4OQYA 4F1JA 4X91A 2DQZA 1AVTA 5LP6A 5C1IA 1P31A 4TTVA 3B2QA 1YAHA 221PA 3ZPXA 1VE9A 3AB3A 4FOTA 1CY7A 4PLWA 2NW6A 2XEXA 4LJLA 2X1MA 4JX9A 3Q87B 2PZMA 3GRZA 1GN9A 1H2AS 4MJXA 3ZLBA 6AT1A 1Y6RA 1NUQA 2Q2VA 3D3JA 2TMKA 1V11B 1L5OA 2C9OA 2WWTA 3Q40A 4KDCA 3OUZA 4O4IB 4R5MA 4WOBA 1WHTB 2GEVA 4ARUA 5AW3A 1J06A 2NQ2C 3H1AA 5KMGB 1BE8A 2P5UA 5IAKA 4UBMA 3VR0A 3IVMA 4XIFA 4EFNA 4NPHA 1IY9A 3NIGB 4ZHQF 4HTFA 1J20A 1W4CA 4M8SA 3MYRA 1WF3A 1HRDA 1H2FA 2LBPA 5EJ2A 5H3CA 3F6PA 1DUVG 1ZIDA 2QMOA 2G67A 4Q00A 3PUWA 4JJ6A 3U81A 5C46F 5LZ9A 4PSVA 4HAOA 4PQGA 3E2MA 1JXAA 3BEDA 2PZEA 3R7WB 2LVBA 1T9HA 1MV8A 3WXBA 1Z0KA 4IXTA 5ALHA 4BYMA 5IKXA 4BJ3A 3BD7A 3STYA 1CIVA 3WB1A 3O92A 1NFRA 1BNCA 3O1IC 3QX7A 1Y7HA 4P32A 5J2TF 4G67A 4HJRA 1GPKA 1JTVA 1SVKA 3U3KA 3QBTA 3ZDFA 4CGYA 5BQFA 1R4MB 5HGXA 4D6PA 1AKEA 4MPTA 3IMGA 1Q74A 1H9AA 1GQYA 2NU7B 1QYXA 1NXWA 5DRYA 5B7GA 5CX1A 3KC2A 4H3KB 3STHA 3IOEA 4F21A 4IHKA 2IYRA 4B5LA 1CWUA 2DTEA 3ACCA 3BKWA 3A3KA 1JQ3A 1Q15A 4ER7A 2QYOA 2X0RA 2KPOA 3PBKA 1QP8A 4U0KA 1FVXA 4OHPA 3G6WA 2E1RA 4RTOA 2Q21A 4RV4A 3QE0A 1M8JA 3AVQA 3MQFA 3OHSX 4OQFA 1JXQA 1OUMA 2Q7XA 5BYAA 3LKVA 5EE3A 2VJQA 3DEFA 4K9NA 4QXQA 4ITUA 4DHWA 1O57A 1ABEA 1EFPA 4PQYA 4L51A 1B23P 3FMOB 3GMDA 3NTUA 1WPGA 4K8OA 3KWMA 3BBLA 1GPDG 2NVOA 1PJQA 1CJSA 1UFRA 1XUOA 2D54A 1X3LA 3PCRB 4NMXB 1QK4A 5GV8A 5CJPA 3TNJA 4YDRA 1NMEA 2ZVQX 3B9PA 4GICA 4L27A 5FWXA 4FQ5A 1VLMA 1YZ3A 3GGDA 2EKBA 2AI3A 3N6XA 3RQIA 3U40A 2RKWA 2ZUDA 3DYVA 4U7PB 3I09A 2W00A 3QU7A 2JVJA 2PLNA 3V2HA 2R6HA 3QJ5A 1PYGA 1QTRA 3E9QA 5CVCA 1W94A 2ZUVA 4IOJA 4EJFA 2PGJA 2B3DA 3LXUX 1K27A 2Z30A 3MCZA 2XWSA 3E4CA 2IV7A 2UXBB 1MQ8B 5SY6A 2WPDD 2VDRB 1G291 3DP7A 1ZXBA 5DT9A 2I2BA 4PC1A 1DJPA 2Q29A 2MHCA 2VSOA 1DBVO 4TMTA 1C7JA 1KDTA 1E4OA 2TRSB 3OP1A 3ZBPA 3G9XA 3KQYA 4BO0A 2EX4A 1SKUA 3FWPA 1I3CA 4TMWA 3ADKA 1Q2UA 2F90A 4EKDA 16PKA 2P9CA 5D85A 3UA3A 3ZHCA 3QVTA 4B09A 3IL2A 3GJYA 3TSWA 4FC7A 3ZZTA 4ZJPA 1UH5A 2OB1A 2GZDA 1F9EA 4HYTA 3Q8MA 5CUQA 2Z57A 1CUGA 3MWGA 3NV9A 2XQFA 5FR1A 3UPDA 4FB5A 2Q5JA 4D8YA 5KX5A 1G8GA 3AIMA 4OUKX 1LV8A 5EVCA 2Q4DA 1YF3A 3Q8WA 1YSCA 4IFTA 1JJBA 4PZLA 1DAOA 1UC8A 1QANA 2I1QA 4WCFA 3BGIA 3O93A 4JI6B 2HRDA 3GLGE 2DH6A 4E5YA 4NSNA 5K8CA 2GD2A 1JIQA 4CIDA 4MKIA 1FVOA 4N01A 2AFVA 1RKBA 1Z38A 3I4LA 5LD2C 1XWIA 1QVZA 1CJUC 2QN6A 1K3FA 2YV4A 4RELA 2IHTA 5ITWA 2QRVB 4GGMX 3IAM6 3UKDA 3A4TA 4LOJA 2IGTA 1P1IA 2Y71A 1IXZA 4TMFA 3WKCA 4LZOA 3X1JA 3ORRA 3NDPA 5ALJA 4BO6A 3VOTA 1M7GA 1WB6A 1YDHA 3CNBA 1LPBB 4KPUA 4BMNA 1ZRMA 4YCDA 3HBFA 3D0QA 1YOBA 1SZPA 2J41A 1JKJB 4V03A 1EBUA 1NTRA 1TA4A 1V7QA 4KUEA 2W0SA 3VDXA 5B2ZA 1ZNXA 4EGFA 4WBXC 4CMAA 2O5RA 4FHFA 2MMGA 2AOXA 1KI6A 3ZE2B 4AKGA 2J48A 2DTXA 3GN2A 1PVOA 3PC8A 1MMFB 1C80A 3L0DA 3UJ7A 3WC4A 3LZDA 4D4KA 4GI5A 3ZE7A 3I9KA 1JE1A 1XRRA 1ULZA 2X8BA 3JWGA 4IJUA 1UEIA 1SUBA 4UXHA 5E9QA 4PGMA 4KXVA 4K0RA 3BUSA 3AY3A 1I1HA 5HK9A 3T94A 1QHSA 2NVUA 1C0PA 1XQWA 4LPSA 3W4IA 5LXTF 1NL3A 3EZGA 3KPYA 1ENYA 3OCCA 3I76A 5IAAA 2ZT6A 4GUAA 3FCEA 3IP3A 2JASA 4NJEB 1KPIA 2PMWB 1Q0RA 3BMCA 3E1KA 3FPKA 2D1RA 3PE4A 3QENA 4X7MA 2PVPA 4TTQA 2WW8A 2PS9A 2RGYA 4AIIA 3K5WA 4DJJA 1UPFA 3O47A 1KS2A 1UM8A 3IGFA 5CVDA 1X14A 4BGDA 3KSZO 3GJZA 3LUAA 2B4QA 1NONA 3NR2A 3TRJA 4LRWA 3BBPA 5C31A 4BO4A 5HUJA 3N07A 3A27A 3A6HA 3O2QB 1RQRA 1UM9A 4II2A 4M9QA 3S28A 1LKZA 3WKDA 4YRFA 5BSEA 2QM0A 5C8XA 1ISJA 5KSWB 3V55A 3HM9A 1NPDA 3U3JA 4Y2YA 3CCFA 3KQPA 1TVEA 2BDUA 3T3EA 4C89A 2IYNA 4O4LF 3GLFB 2OGZA 1ZCFA 4DBLE 5JXIA 5MHTA 4I6EA 1USIA 3RS3A 2QI9F 1CW2B 1IIBA 1RSZA 1NUSA 5HCIA 5DYTA 4XVUA 3PITA 3TW4A 2IU3A 4G85A 2V4ZA 2XGSA 4IZIA 1WDMA 1B74A 2JB9A 4PIPA 3RU9A 4DWJA 1GARA 2CFTA 4Q7KA 1YK0A 5IDYA 1EJ0A 4A15A 3TLBA 4N0QA 1Y3DE 1UK7A 1ZJZA 3OETA 2ZR0A 5F7OA 3OE4A 4C7OA 2CFSA 2X8AA 4WZ6A 4US2R 3IMEA 3V9PA 4RFSA 1PDVA 1NY5A 4WXYB 2B8TA 4M8KA 3A4NA 4C0SA 1OTYA 4WEQA 1ES9A 1U2SA 3HJHA 1M2VB 4P3KA 2H3HA 1AHHA 1TRHA 1NC1A 1Z63A 1JVNA 5D5PA 2FZLA 4YAFA 4K86A 1S8NA 2R1ZA 4FUTA 3D7LA 4AKIA 1VGVA 2HT1A 2FYTA 1QGUA 2DR2A 3HZZA 4LE2A 3TW8A 5HRUA 1IY8A 2HPAA 5HJ7A 1YE8A 2PPLA 4FKMA 1XJWA 3F7NA 3P2MA 3HACA 4LA4A 2BZ0A 2FNAA 2FP3A 2O9JA 1MX9A 5FTJA 3P8ZA 4U2KA 2DFVA 3IVCA 4J6EA 4MQFA 4WT7A 4A0HA 2YWXA 5BV1A 2NU9A 2OP0A 3T9AA 2B6NA 1SOMA 3P5SA 5DDIP 4B85A 1KAMA 2E55A 3B1FA 3F9CA 1OA1A 2JK1A 3DFKA 4QC2A 1FRVA 5LKRA 3G7SA 1ILWA 4RU1A 3L1IA 4K9DA 5EKSA 2FW7A 1E66A 5DK4A 3IQEA 3BCHA 1U5BA 4PAOA 3IQGX 2VNJA 3NHBA 3IXLA 2DQYA 4CCWA 1GVNB 5JYDA 1X7ZB 4QU0A 5ALNA 4EUFA 4RSHA 2EJBA 5K3FA 4F5YA 4LOHA 2GK6A 3BRSA 5HCUA 2ZIGA 1NUPA 3ZQ4A 4YFYA 3SG0A 3B1JA 4YIKA 3D4NA 3ETHA 2B4YA 4G5OA 5D3MB 4A23A 1ZOOA 4DJFC 1AA9A 2VOEA 4G1EB 1LRLA 5JMWA 4DIMA 2FWJA 1YC5A 1K4YA 4TL8A 3O1JC 5FAKA 1X74A 2P91A 3A0RB 4D3FA 1ZSNA 3D3WA 5BR8B 3OT4A 2PUCA 5C1BA 3AWDA 4NLLA 1JIUA 4DIBA 4JASB 1C9MA 2EBWA 1N32B 1XGKA 3FOBA 4HDNB 5KYYA 3NGMA 2PXCA 4F85A 3QVUA 1P3DA 2X9GA 3JCZA 1PI3A 2R66A 5CDUA 1UBHS 1S9DA 1QH1A 5DE3A 2E4UA 5DOZA 5JOQA 2V45A 5SY9A 3WVNA 2Z1NA 3ITKA 5ESWA 3G8CA 1M3SA 4D4GA 5BW6B 2F1OA 2WKWA 4YJ3B 1PWHA 2ZFUA 1N0WA 3D3QA 3EPRA 3K1ZA 3MIZA 3W9YA 5TMPA 4AY2A 2ZRNA 3R3SA 2WBLC 1R0XA 1KIAA 3R1IA 3S2FA 2YN2A 2ASVA 4QAJA 2QZ4A 1EDBA 1R0RE 1IHYA 3I3OA 5JECA 2OECA 4JI5B 3GUZA 3PFHA 2HCFA 2HTFA 5GIPE 1XTJA 4IUYA 5L7YA 4UM9D 1A82A 1X7XA 3BA6A 3WMFA 3ZK8A 3VR3D 1H0RA 3GPLA 4LF4B 4LJ7A 3CO0S 2Z3ZA 4E21A 1SIOA 3EXHB 4L75A 4Y6RA 3QG5A 3TMKA 3HY4A 1LSJA 1T6YA 1N5IA 3M4YA 4XSGA 4E0BA 2DB3A 3T3IA 4BNDA 2FQWA 3M9LA 3KQLA 1ID8A 5KU1A 3UPUA 1YT5A 4ZYXA 2IIQA 1QP0A 2O7VA 3N8HA 2QPLA 1T0PA 3W1EA 4B3CA 2AXQA 1YJQA 1B6GA 1A9SA 4HJXA 4OMDA 1QVWA 5DMXA 5K6AA 3G9ZA 4MTLA 4QOGA 5AKIA 2H0QA 2AFHB 1W25A 1DADA 3IX7A 2E5WA 1RP7A 3EDQA 3EZLA 5ITSA 4XEUA 3HV2A 2NU8B 5K3OA 3D2CA 1QYIA 1MORA 2AMVA 3JTMA 5IVKA 5TGDA 3WSTA 4D9EA 1AX9A 2QVZX 1XR3A 5HDBB 1TD1A 3QFCA 1CUIA 4RS4A 5DMHA 3K6SA 2V9PA 4FGKA 3RIHA 3NBQA 1RM0A 4DFDA 2VXBA 5EMLA 2CVPA 4RSMA 7MDHA 1W1UA 2GILA 4IHQA 4KI0A 3QPCA 4MR7B 1K4KA 4TMYA 4PGFA 5D3KA 4OI2A 3G5TA 4FP9A 4BXOA 2W93A 4UUPA 2OXEA 2EFCB 4Z4QA 1ELOA 3DE3X 3V6LA 4AB1A 5E0KB 2W70A 1IB0A 3A3OA 2BKVA 4D4JA 2FN9A 4PLZA 1WZUA 4YRDA 3JQ9A 4MH0R 4X62B 2GHQA 4CRWB 1DTWB 5CT4A 5JDCC 3TLYA 3TG2A 3LHFA 4Q3OA 3VH3A 3RRMA 4FINA 3EMBA 2D74A 1NBMA 3KJIA 1KIMA 4UE3S 4OB8A 4XUDA 4YS6A 2IEIA 2IW3A 2QNIA 1U7WA 3CX4A 2P2GA 3KUXA 5CBPA 2I54A 1D0VA 4E7PA 1EAMA 3AFHA 1NBWB 2IXEA 2FGJA 2OCIA 4UTRA 5DI9A 2PXAA 1YHZA 3EY9A 1XHEA 3GOQA 3V2IA 2QL9A 4D97A 2CVHA 5TS2A 1QCDA 2FLKA 2WHPB 3CLSD 4I08A 1IK4A 2VTVA 4Z0PA 5H7XA 3RBXA 3N3AC 4HN2A 3AEXA 2X4IA 3AHFA 3DUFA 2FEAA 2UUBB 4CKBB 3PDWA 3PXEA 4HMPA 1UKCA 3VSDA 1GU1A 3L1UA 2P41A 4MLPA 4OQZA 1N7JA 4MCIA 5BN4B 2H5EA 4DG9A 4NYJQ 2C83A 1GIAA 4D4LA 4AY3A 1G8JA 1PN3A 1KZ7B 1RYFA 5HPYB 4RF4A 2MSLA 1EVLA 4K6FA 5DYGA 1VSTA 1SNYA 2PQMA 1KI9A 3E70C 4G0OA 2X8LA 4G8JA 1K68A 5DI3A 3WA7A 1JFSA 1L7AA 4ZYWA 3NBMA 2X15A 1NBOA 3C3JA 2GA8A 1C7FA 2J6IA 1J22A 3ANSA 3D59A 3JQBA 1P6UA 1WUHS 3MWJA 1KYYA 1V6AA 3BWEA 1DEKA 3STTA 5LIRA 1I7DA 10MHA 3H2GA 4ZCPA 4E5SA 2NYAA 3FDIA 3ZS9A 4O5AA 3CX3A 5HRCA 3ZCVA 1GSAA 3BCRA 2JFOA 1OREA 3MBKA 2V1XA 3AVTA 4UUOA 1GUFA 1RCUA 1JEQA 1XJ5A 1T13A 3C3XA 2XMRA 1MQ9A 1ZISA 1MKYA 4TLLB 2XYGA 1VPTA 2VRNA 4PZAA 3FAZA 1CP2A 2E4AA 3GEBA 1XNJA 3NDIA 3QRWA 4Z8YA 5IMBA 4J0KA 1Q22A 1DOZA 1X9GA 2RJNA 3FLAA 3I04A 2IVZA 2ONJA 2KLHA 5ICFA 3WWCA 4RGBA 3VAAA 1IVYA 2RAVA 2VF2A 3DV9A 2F43B 4XJSA 4A1OA 3JX9A 1B43A 3ANMA 2QMHA 2WJJA 5AKGA 1AZWA 1HA3A 1UZAA 3CWQA 4XTCS 4YIHA 2LZ0A 3WZ2A 1PE0A 4ZTBA 1RJDA 3K0SA 3ELUA 1ZG3A 2FPMA 1DIOB 3C3EA 2ZUWA 3BB3A 3N58A 3G49A 4HLUC 4WXMA 5FNVB 5TPZA 4A8JC 3PEFA 5K4GA 4UVHA 3OOWA 2BHTA 3T4PA 1KH3A 3THWA 3OECA 4BB9A 5KYWB 1L1RA 1PKXA 4QUBA 1BX0A 4EGAA 2UYGA 1DS6A 2HRQA 3LTNC 3OP4A 1ZNQO 2VP6A 2PUFA 5E3IA 4NYJR 4Z7JA 3FB1A 3ZZMA 5BURA 4YRZA 1QF7A 5EGNA 3KUUA 4N49A 3PS9A 5EP4A 5DF1A 4Q3LA 4D3DA 3NPMA 2QL5A 4R1UA 3G68A 1FFDA 5C2JB 2FG6C 3WAKA 4CPDA 2LIPA 2PYDA 3OY7A 5TV2A 3AERA 2X7XA 4Q24A 1FFXB 3PC3A 4PLHA 1SD2A 2AOUA 2OO7A 2ZE6A 3TVTA 4WNAA 1TTHA 2QK4A 3FR8A 4H0CA 5E3HA 2WG2A 4FYIA 3EVEA 4UHEA 1SZJG 1Y9DA 3HNOA 2G1KA 2JATA 3GCXA 2YZMA 3A4LA 4ENPA 3B36A 3MGGA 1Y6QA 3O73A 1WXEA 1XDSA 1DAFA 2X6RA 1SURA 1FQWA 1YB6A 3DHNA 1FLNA 1NKTA 2OLKA 5AHWA 3VR2A 3OT1A 1RHUA 2FLVA 3T0FA 3K6RA 5E4JA 3A04A 1P33A 1PW5A 3GV0A 1KJYA 3LWBA 1D2EA 3H04A 5A3JA 2DM6A 1LK5A 5F78A 1DG3A 2A35A 4ND3A 1CS4C 1SIBE 5ARBA 4INAA 5AXBA 4FFSA 3RFVA 3JD3A 2A94A 1TJNA 2JF0A 2HHCA 5AKLA 2WUEA 3T5DA 2BMJA 1YA6A 1W36D 5EPUA 1Q0HA 3P9NA 3CNHA 3HWSA 2B94A 2MOKA 4O59O 2IC5A 5H4HA 3AFNA 3DQQA 2NM0A 5ER6A 9GPBA 4AKEA 5CPBA 1L4EA 4YT8A 2W42A 2B4RO 5EHGA 3AR2A 4YQFA 4EA6A 1KH2A 3SAJA 4TOIA 2O0MA 3L40A 1KTVA 1KJWA 2GXQA 3E81A 3P9ZA 1V4NA 3G88A 1MPTA 3L18A 2ZRAA 5FEMA 2OFWA 1SBCA 4BMSA 1JWLA 4E07A 1MFPA 1LBEA 3IHKA 4A73A 4CLDA 1QP7A 2P6NA 1QO7A 1RYBA 1W96A 2WVJA 1TOAA 3R44A 4OXRA 3IESA 5FPYA 3G2JA 4US1R 2WWXA 1BWPA 4YMUA 1GZ7A 1L5RA 2EG9A 2D62A 3IAS1 3CRVA 4L8LA 3NEPX 4PC2A 4QYXA 1A7AA 1QIHA 3C6MA 5GTDA 1E2GA 1VIMA 5ILGA 2IDJA 4M87A 5AVWA 5JJIA 5AM3A 1R18A 1RPAA 1IQRA 2FPGA 4UD6A 3AUSA 2B7BA 3BJMA 3I92A 2XW6A 4TWIA 4UDYX 5JS8A 1S1MA 4RESA 3G89A 3CRQA 4DA4A 4GGOA 4EVIA 1JECA 2ZRKA 2VSFA 4OPMA 1Q0SA 1ZBQA 3FYUA 3UHPA 4AJIA 4EY7A 2QMEA 4WKNA 4E03A 3QUQA 3PL1A 1QVAA 1JHUA 1NFQA 2PKXA 1INLA 5DW3A 4OHYA 2BGWA 2Y0CA 1RJFA 4D81A 3EVTA 4Z49A 3DNFA 1SBZA 2PSSA 1YZLA 1AGPA 2YJTD 3NBUA 1E6UA 2Q4BA 4JA0A 3UK0A 3ZDQA 1P2DA 1UBSB 2GD0A 2FUG6 2HBYA 4FYKA 2H2HA 4YFVA 5FUBA 3RIXA 1RACA 2RFLA 1V8DA 1VLVA 3ND6A 5DFAA 5DNDA 1DX4A 2PM8A 1ZJ5A 3PKIA 1C41A 5BV0A 3W9SA 3OU7A 1RYHA 4YMHA 1VMDA 3GARA 2HWWA 2RGXA 4AMVA 4IOMA 1SO8A 3H4TA 1LBIA 2AN1A 3IA2A 4I5GA 1Z4OA 5LNK1 4DBZA 2IYLD 3PDHA 2JLXA 3JD1A 2F2TA 5LYJB 3T5GA 4PZYA 5LCXA 3X0DA 2YQZA 1EQAA 3STUA 1QK5A 4A7PA 3TLCA 1O4WA 2B5WA 1YU9A 4BQOA 1D1SA 1Y9ZA 1Z25A 4MRNA 4P81A 2OAEA 3REQA 1RFLA 2FRDC 2AN3A 3EAGA 3RIEA 3TOCA 1ZIOA 3JD0A 5AFSA 1C2TA 4QIHA 3SYKA 1BMFA 1NI5A 4ALIA 4F04A 3IP5A 1ZUIA 2VR1A 1CYEA 3RASA 1LVUA 5D86A 1CHNA 2EFHB 5DBIA 1J0BA 1PWZA 4BMVA 2QF7A 5IJZA 1MAWA 3N2GA 4L5IA 3TI7A 5EHZA 3IMFA 2V7PA 1R0LA 3HCNA 3R41A 3QVMA 3GAAA 2AFIA 4IRUB 4RZSA 4PNPA 1VG0B 2CFOA 4WWHA 1B16A 1PR5A 2FPIA 4GNRA 4XX1A 5H1YA 5EPOA 4MA4A 3T06B 2IF2A 4R8MA 2VDJA 3W9BA 1IXYA 1R15A 4TWJA 1Z16A 1HLDA 1I0ZA 4MAMA 1HTBA 3E2IA 1GPH1 3WTBA 4DY4A 2PKEA 1ISMA 1ENZA 3RJZA 4GLJA 2FZ5A 1E79D 1LFAA 3AJRA 4GZ3A 1D9ZA 2GRJA 2JHGA 1DQZA 3EHEA 3ONNA 3T7KA 1H2XA 2IY9A 2I3DA 3RD5A 4IQ0A 2BRUC 2BFDA 3I0MA 2VJMA 2FW8A 1G7RA 4QUAA 1JMVA 4YK7A 1W2HA 1F5NA 2JHFA 1JT9A 5FFNA 2XVAA 1JRLA 2CNWD 2H59A 3B3AA 4EPTA 1T8YA 2PKRA 2ZAOA 1GZ5A 1C1XA 1KVRA 1E96A 1RAHA 3Q72A 3QVLA 1Y6GA 3LUBA 4K26A 1NTOA 2JGIA 5HUHA 1A97A 3A1EA 3I4FA 1XLWA 4J1NA 4RADA 1F6WA 2UZ3A 3RW9A 3IAXA 3KJFA 4WVLA 1YB4A 1DRWA 1JWBB 3DA8A 2JJ8A 1PWEA 4Q5IA 3FMGA 1YR7A 1B76A 2CY0A 1RYNA 2CXXA 2HJHA 4DC9A 5A6SA 4EJ0A 4IRMA 3ER6A 2VPPA 3BIJA 3F5DA 2VSNA 4M88A 2DECA 4PX3A 4GPTA 4YRAA 4RCZA 1TA0A 4CCSA 2AJLI 2NZUG 3DPSA 5BSUA 1RWVA 3BHMA 4EP1A 1UBCA 2XUDA 3E22A 4M6WA 4F7WA 1M2NA 5T8KA 3SXJA 3IQZA 1IUKA 1X8KA 1AUPA 2YIMA 4GX0A 4EUEA 2DX7A 4MB2A 4MRAA 4R68A 4ENSA 4Y7DA 2GN6A 1DJOA 5JCZA 3S1AA 1V96A 3GXOA 3TZHA 1MAAA 1SWVA 3PSHA 3O31A 2FW0A 3SI7A 2O6HA 3AI1A 3FM9A 4DCCA 3TXYA 4IWYA 3SHFA 4FCCA 1XZJA 3MRTA 4PYRA 1OIXA 4XDYA 4ZJYA 1IZ7A 3QITA 2HGZA 1X9HA 4JJGA 3WFJA 4KK4A 2OXRA 4X7PA 5KNBH 1XMJA 3Q12A 3EPLA 1RZ3A 2IYUA 1I01A 1TO2E 4RTSA 1RPZA 3EVZA 1UWCA 3V7WA 2IKSA 2XMDA 1ZUNA 1VHJA 2ZSKA 2GPWA 2XTZA 3N53A 4MQ4A 1Q7GA 5J1TB 5CFNA 2XXJA 5LU9A 4N41A 2XUHA 1JLSA 1TEXA 4KFRA 3CMCO 1U8ZA 1DKPA 1PJTA 4R3NA 2G1AA 1UCFA 2VL7A 3RTCA 3WBFA 4OOEA 4Q1CA 4R40A 1A9OA 3UATA 3K0AB 4GVPA 1AE1A 1U2GA 2V6JA 3CISA 3CLSC 3KYDA 3SQXA 4IIJA 4CUJA 4OQPA 4MMXB 4PC6A 5I9SA 4KE7A 4F72A 4JB2A 4ZAZA 3L9XA 3AVOA 1E3LA 3DEAA 4D92A 3WNZA 1DQSA 4UCFA 3BEOA 4N65A 3JZFA 4N6GA 2P1ZA 2PIDA 2J8ZA 4JSTA 1K0UA 4XQ9A 3TO5A 1PJAA 2Q45A 4R8LA 4NAVA 3HWRA 3PWKA 1II9A 4GPAA 1O0SA 1TJ4A 1PO7A 1WP4A 2XITA 3OZDA 4BNNA 1E89A 3ZKWA 5I7WA 3ZWMA 2O7RA 1JALA 1GUYA 1EVKA 1ORRA 1XQ9A 1UOOA 3KAPA 2J87A 4CJXA 1X1EA 4KIGA 2FB9A 5HRAA 4O4LB 2QZPA 1EZ4A 5KWJA 2FPPB 2TMYA 2EP8A 1J2TA 2V65A 5H16A 3VFDA 4B79A 3K70D 2PZFA 4Y2UA 2EKLA 1G8FA 1EUDB 5K5EA 3GT3A 2WMDA 4B3GA 1EFUA 4KJZA 2ZLBA 3SF0A 4BQNA 1G8SA 1RZVA 3FF4A 1XQXA 2XKAA 3R5FA 1YZKA 1CUJA 2VCEA 1L7VC 4K1XA 1UPBA 2BWJA 3C3WA 1FRZA 2R1UA 5CFLA 2CHEA 3JALA 3TQQA 1SCNE 4OP1A 2WJPA 3HA7A 4BBZA 1RLJA 4BFLA 3GFPA 4D96A 1DIRA 1YQDA 2BTOA 2W5UA 2WOOA 3CA8A 1UMKA 4EX7A 4CQJA 4CE6A 2R9VA 2FZKA 1XEXA 5K01A 4DV4B 4U02A 1IHOA 2Z9BA 4HNGA 3B3FA 3EIFA 5DNYB 1O87A 2Y1FA 3EIXA 4E5KA 1FXUA 1XHLA 1Y5RA 3LHKA 1TK2A 1ESDA 2Q5CA 2W2VA 1DMRA 3M8KA 4OQXA 4G1UC 4ARZB 4OB6A 3UT5B 1Y4SA 3A1WA 1SCUA 3IUYA 2IEBA 1J42A 3RLIA 3D1JA 2GUWA 5FFMA 5JWHA 3VHXA 4GOMD 3D54D 3NCHA 4YQZA 1Z3IX 2I5PO 1SH7A 2H5LA 2MYUA 2XB4A 4KQIA 1EFRA 1FYXA 2VLIA 4CTKA 3KT3A 5KAMA 2H4ZA 2W6JA 2WNIA 4KHZA 3EN0A 1FFBA 4I19A 4AN1A 1U0FA 3PC2A 1Y3FE 4BKRA 4JCCA 5HW0A 3E4DA 1GJRA 4IIEA 2PMBA 3E0QA 2BHLA 3EEBA 2GT1A 2JCBA 4HY3A 1XCOA 4DCTA 2WQ6A 3RSLA 4EK9A 2KQUA 3GRPA 1GGKA 2BFPA 3IB6A 4LSMA 5COBA 5J40A 3G9QA 3L8EA 5C81A 2Z08A 4N3GA 1QFMA 4O2BF 4D8XA 2XZOA 1WEKA 2Q6VA 3M3DA 3OTHA 1XAHA 1AF4A 4U2CA 1S8OA 5GOZA 3VOBA 4LKRA 3DTVA 4TKVA 1GNQA 4KZKA 3SLKA 1HLFA 1KBZA 1U28A 4UQOA 3SZOA 1QBGA 3VVCA 1ZHHA 2ZBPA 1N2CE 1U0JA 1KSHA 1IZZA 1O6FA 3C6ZA 2FPWA 5AI9A 4OX9Y 3ONWA 5D3ZA 1O94D 1P0PA 5EJ5A 2IYQA 4ZYTA 3VRHA 2Z5FA 4ZEOA 1HDRA 3AR4A 1YCFA 2RKBA 2VCHA 1F2UB 4TS3A 1SPBS 1FRNA 4Y1FA 1JFFA 3H6KA 4J94A 4Q9HA 5DP1A 1FYEA 4MR9B 3JVVA 3S2IA 3WGIA 3E3LA 3GOHA 4KQXA 2BEVB 2QS9A 3ETDA 4UAJA 3SFVA 4M9RA 1R37A 3SC2A 1C8LA 2I71A 3OZFA 4KWTA 4KLNA 3ZDXB 4HS9A 4BCCA 2GAOA 2NZYA 4V24A 2CCKA 4CQLA 1N6LA 4R2XA 5G1OA 3U7RA 1OX4A 1W36C 2NIPA 1JDSA 2NXWA 3WR5A 4DEXA 1TB4A 5TPWB 1JR3E 1GFZA 2ZT8A 2I1WA 3NYWA 1IBSA 3PQ6A 5CW1A 5IASA 1OXSC 1LI5A 1QG0A 1RTKA 2B8EA 2SHKA 5TMBA 5FJJA 4LTDA 4EITA 4J7UA 1JHRA 2L17A 3QEMA 2XOEA 2UYQA 2OOSA 1Z0AA 5DHFA 1CD5A 4RHCA 4M9XA 1V2GA 3HGQA 5AVVA 2FVXA 3NTQA 1E1YA 1LJLA 2Y4NA 2PX4A 1YDGA 3OM9A 3B7WA 2R5NA 3KVRA 1G64A 2J7PD 1I8TA 1WTCA 3OQ1A 1WUJS 3K8ZA 4PHHA 4A5OA 3KCQA 2AZDA 4QWWA 1IJBA 1ISHA 2H9YA 1HYGA 1I5RA 2NNWB 3B2EA 3CKYA 2QLMA 1IWBB 3IOBA 4I8DA 3EW9A 4N7RA 8ADHA 1VYVA 5TT0A 3T7DA 4UOEA 5ESRA 3QBVA 1L7NA 3VZDA 3SF8B 4MW0A 4J2HA 4AZ0B 1R8QA 1LK0A 1OV6A 1R6VA 4LJ6A 1ETUA 1NUTA 1U3CA 2DHQA 4OM7A 3MCTA 1EWKA 4U3JA 5I47A 3NPAA 1CZNA 2YWRA 2NX2A 3AONB 1Z7GA 4W8GA 1RQLA 1COWA 1GEEA 3IPCA 4QKQA 4QLBA 4ES6A 3U4AA 4RK5A 2X8JA 3FMPB 2IZZA 4NU8X 1R74A 2DT5A 1KYIA 2DG2A 3EVBA 1PQYA 4D0SA 4ND5A 1O95C 3SYNA 5L40A 2P2SA 3V48A 1BXRB 1T2CA 1MN6A 2CUNA 2XT9A 2QX4A 2FSFA 4KE9A 1D2RA 2ADOA 2PA3A 1JJAA 1RBZA 4CBVA 5IT4A 1F60A 2NTNA 1Z8DA 4O4JA 5IJ0B 3ZUGA 3CF6R 4X97A 4UCQA 2J3EA 3GLIE 1Q0ZA 1NJSA 2IP2A 3X1KA 1F6BA 1EI9A 2XNCA 1C9DB 2CD9A 4ZOLA 1KEPA 1VIDA 4RZIA 3U26A 3I9V1 4BKUA 4BUJA 1AUOA 1TVKB 3CX7A 4CLOB 2PQ6A 1FK8A 3SR0A 3FJOA 5IZCA 2WIFA 1MB9A 2QM7A 3MAJA 2FF7A 3FMFA 3YASA 1N8NA 1N77A 3H84A 3GNTA 3DT9A 4AG5A 2XT6A 2R3SA 4M9ZA 4WI1A 4OTZA 3UG7A 4GS5A 4AG3A 3C24A 1WVIA 3BH7A 4D98A 1TUGA 2IH4A 5AVQA 1KJJA 1HTWA 3MS2A 4ZYZA 4H0NA 4LBYA 2B1QA 1XRJA 1WF6A 9ATCA 5CFZA 4X20B 4WLUA 2PT6A 3FTDA 5F1YA 3MMPA 1TIPA 3PFWO 3AZQA 4X8OA 1HR0B 4KGVA 3O9ZA 2BT4A 4HQLA 3ZW9A 4B3HA 2C78A 4XEHA 4E4RA 4LEIA 3SXPA 4PYLA 1U8FO 4QDOA 3CSSA 2P40A 3O4FA 3JSAA 1KERA 4ZK2A 5B6IA 4CCYA 1Y89A 2R751 1G0NA 4AJ2A 2CGEA 1G6HA 4LWOA 4UHJA 4DKJA 4ZWNA 4QVIA 4XKJA 5JAIA 3BWXA 4K03A 3MSXA 1AUQA 1J1ZA 3IO5A 4QQFA 3FKSA 2D0OB 1M2JA 2FPSA 4Y98A 3TZ6A 1M1YB 2P6MA 1HMYA 2P77A 4Y0AA 4EB3A 1N7IA 4NAUA 2NV2B 4KACA 3CUUA 4IMJB 2O20A 5E7MA 1E1CB 4DXDA 5IDXA 2L42A 4QO7A 1C1YA 4MJ7A 1I1NA 1JYFA 2ACEA 3K9CA 3LRXA 4J7AA 3FHOA 4PG5A 3KYCB 2QRNA 4GZMA 4LGVA 4H7DA 5BXQC 2AI1A 3GJ5A 1MOPA 1VLQA 3C3CA 1RJ9A 1RAIA 1T3ZA 4M54A 4MRRA 4N9WA 1QYVA 2ZRFA 3DWIA 2LCFA 3LLVA 4G1VA 4M7OA 1NYLA 4ZT4A 1HT2E 2BBTA 2OAP1 3Q2OA 5TQVA 5K3AA 2F3RA 3ESZA 3MT8A 3PJRA 4E46A 2QL6A 1TQDA 2ODEA 1CDZA 1O77A 3A70A 4Q7EA 1GAJA 1W581 2FR0A 5E7QA 4B3FX 3PWZA 2ETXA 1GUZA 1FFYA 1QH8A 3AJDA 5DWDA 3IUMA 1AHIA 2UYOA 2AKYA 3CH6A 5AHRA 3VDRA 3B70A 3HGMA 3W2GA 4Q7MB 1FW6A 2VPTA 1FFSA 2VHWA 2WKSA 1C8KA 3A7EA 4L7VA 4P4NA 1WMAA 1UJ2A 1FPQA 1JQLB 3FPEA 1R4ZA 3PKZA 4M7WA 4C4AA 2WVAA 3P9XA 1ZBDA 2YICA 2KM1A 4JJ8A 4M1QA 4OH1A 3RYTC 4E4TA 2IHNA 3NT2A 4D3SA 2W2OA 2HO5A 5C8YA 4XSVA 3AW8A 4RVHA 3SP1A 4GDFA 1IM5A 2PK3A 2OO5A 2NVBA 2JHCA 3KALA 3WMWA 2WR8A 5IHXA 1LDMA 3GCZA 1ADJA 4CFZA 3L4SO 3WGZA 1NC3A 3W7VA 2AYZA 1E0KA 2P0AA 3IV6A 3LC2O 3TIFA 1E2NA 2XD9A 4MW9A 5TY0A 5JD5A 5A02A 4FFRA 4LHZA 1NHGA 2Y93A 3G8BA 2D1TA 3N2LA 5IKEA 4LXTA 4GBMA 2QY9A 4YP5A 3ZGNA 2KB0A 1NRJB 1JG6A 1XVLA 2HLPA 2X3YA 3KXIA 4HGQA 2GXSA 2VSQA 3SXUB 2V54A 4CM9A 4IR7A 3ECCA 3DYBA 2DXIA 3VHLB 1OWMA 3SX0A 2DCUA 5CR9A 4QARA 4BVGA 4ZEVA 2PGIA 1XTZA 1HK7A 1Z34A 4YECA 1JILA 1S89A 2O06A 4NJMB 4D82A 1FJXA 1MO3A 3MCWA 1XD9A 4LW8A 4R2HA 3T12A 1NLMA 3GFRA 3O5AA 3IIJA 1E5DA 4KW7A 4LOIA 5REQA 1D6SA 3AF3A 3LYUA 3S1SA 5F3WB 2ZWMA 4KL8S 2D7DA 2ASEA 1UXJA 3RBZA 3JQAB 2V8OA 1Y1LA 3RKSA 1A7UA 1U3DA 2P2NA 3PUVA 4TTIA 1DKQA 1VGRA 2J9YB 2RHGB 3T99A 1J1UA 1K8RA 1GCGA 2JIZA 3WL4A 2BFEB 4F5WA 1X1QA 3DZKA 1W46A 1Z88A 3OOJA 1VCNA 4TQAA 1ST2A 2E1PA 1AGYA 2YRWA 1H4SA 3LQ1A 1YD7A 1FJ2A 4BIMA 1MFZA 4FHEA 4GMHA 3A9RA 4LDJA 4EAAA 4RK6A 2IS4A 3F8TA 2H6EA 2X58A 4ZKEA 1NRWA 5FPPA 3QX3A 4DCOA 1R8JA 4C7MA 1V7PC 3JWEA 1HOTA 2AMYA 5K05A 1CEEA 5JS2A 2WTNA 4MEAA 1SJ9A 1QRAA 3UXEA 4M1KA 4PYKA 4EDFA 1Z83A 3P2JA 5G0VA 3TL6A 3I28A 3KHTA 1ZP6A 1N8SA 3AVPA 3N59A 1F0YA 3H17A 3ZDRA 5L3VA 5ITZA 1X80A 1ZGBA 4DYVA 4CM7A 2CDRA 2JPDA 2V4MA 3NNNA 1NW4A 1EVQA 2WUDA 5JMPA 4MGKR 1Z82A 4QT0A 3TR6A 4DMGA 1UMDB 3ZUPA 1MJFA 3MQ4A 3V32A 4KKVA 1IJKA 2IOFA 2Q3BA 3LQYA 3K53A 1QR6A 4RXMA 3ELBA 4E3ZA 2WLSA 2X2OA 1FNCA 2AT1A 5A4FS 1JDPA 1OYOA 2HHAA 1ZK3A 4DUGA 5IG2A 4C0QC 1T1EA 2IX3A 5HE8A 3ASYA 2IFTA 3E82A 4J0DA 4YY3B 1KU0A 3QHPA 4DPLA 3W6OA 3W5JA 2XJ4A 2HHHB 4UW9A 1IEQA 2F1JA 1VYTA 2OB2A 3AF2A 1Z75A 3GVXA 2QRJA 2EL9A 2P79A 1DXHA 2AKAB 4P8RA 1Z0FA 3GRVA 2Y05A 3DOUA 4D74A 3V1KA 5IWCA 1NVTA 1KQ3A 3NNSA 1CXZA 3VUEA 1ULAA 3FKQA 3LT4A 3N8NA 4N3CA 3QPUA 4XA8A 5AJYA 5F5NA 5HILA 4Q01A 3PHGA 5KNLA 3T3GA 4TLAA 2Q6IA 3CPHA 4GDMA 3WSVA 2FZCA 4POOA 1ICIA 3P7MA 4GF5A 5KB3A 1CB0A 1ADGA 1LH0A 3T1VA 2JIRA 1QRDA 1EHCA 3DLCA 3EGXB 4JNKA 2JAUA 2A5YB 4KBFA 1O1YA 2A7XA 1XZCA 3DVLA 4C0AC 2BF7A 5B55A 1MOQA 1MRZA 4HGNA 4LECA 4V2UA 5BMVA 3THYB 3M6FA 1C3OB 2YOFA 4Z7QB 2YVUA 4CU2A 4QICA 3AFGA 3L43A 5CEFA 2P1DA 4J3JA 1IBRA 1ZHFA 2EHJA 1EFHA 2QMZA 1OFVA 2ACWA 1WMDA 4RK7A 1WY7A 2GH1A 5D2CA 4MITA 1AMUA 4AY5A 5EKDA 2K6GA 1U7XA 1CT9A 4Q15A 5U1PA 4M0UA 1U2DC 3OAAD 1TYZA 1N2CB 1YE5A 4Z3DA 1SXIA 3SDSA 1U0NA 4BLSA 2A9KA 2Z9CA 1TU0A 4LMPA 1VJGA 3GWZA 1KI3A 3DWGA 1YV9A 4MDFA 3ZHZA 4JLOA 2HIMA 5DLPA 2GN9A 4LC9A 2WJWA 4UMDA 3H87A 1ZYUA 1ZM3A 2H1FA 1MVLA 3W06A 1L3CA 3MB5A 4RNCA 1ECPA 4HS4A 1RCFA 4QGFA 4B46A 3MD0A 3DKRA 4MS4B 5IYZF 1N2HA 3IAM1 2G5TA 3EIUA 4LBVA 1T43A 1HEUA 2CLLB 2HA4A 3AUKA 3BXFA 4FGSA 5HOQA 3M4XA 4JI4B 4WXPA 1JR4A 2O5CA 1I32A 2DHEA 4DVJA 4Q9DA 3H3JA 4Q1AA 4WY2A 4KVZA 3QF4A 5G53C 1J2EA 1ZIYA 2RGBA 4D1YA 1J99A 3WWYA 2YZKA 1X8JA 2X9LA 2Y6VA 5DCUA 4CM8A 1D5CA 4UPEA 5KNDD 1ZZGA 1Y7IA 2H2WA 3IRVA 2EW2A 4EA7A 1GTSA 3O8QB 3F4KA 4F11A 2PBFA 4HDKA 2AA3A 1WW8A 2WSSD 3BMOB 5JNVA 4PZUA 5CYFA 1DAHA 4CF3A 2EKZA 2JAHA 2YY7A 3NIBA 3ZIAA 2DMRA 2OR3A 1YGPA 3F5QA 4D45A 3FR7A 1AHPA 2CXHA 2EV9A 3DDUA 1CZOA 1E69A 1T1GA 5T6BA 4H6WA 5CB4F 1WE2A 2JLCA 2MSDB 4TTTS 1E3TA 3DFZA 1SZDA 3BD6A 4LK2A 4NZPA 5FPTA 2ZAIA 5KOYA 1ULUA 2WU4A 5HKKA 1O08A 4ZPJA 4PG7A 3PPIA 4C76A 1V39A 2VO1A 4OBWA 4FB4A 2E6UX 2WNHA 4J90A 4YCNA 3PFIA 3LP8A 3QUAA 3TQHA 4B45A 5KBYA 4WLOA 3KR2A 1DO8A 1OIVA 4JITA 3SSAA 3ADDA 4FKBA 3PWTA 1C7EA 1QQTA 2ID7A 2K4MA 3HRIA 4IYRA 2VDWB 4M0DA 2FE4A 4GQIA 3HUFA 1V0JA 2GN2A 1YKSA 2Q8PA 3SE0A 4F71A 1G98A 1BHJA 4XGKA 4UE6A 1GNPA 1Q7CA 1MO6A 4M0LA 4NZZA 4Y6LA 1KXZA 2GHRA 3VV3A 3AESA 3H3XA 3Q7IA 3UAOA 4ZYUA 2O7QA 3GLIB 5FCDA 4P35A 1PEAA 2IYPA 4LRUA 4I1OA 2ZIEA 3V1LA 3LD9A 2A3RA 3L46A 5TDHA 3WAGA 1YVUA 2OM2A 2WZBA 3FPAA 2OGSA 3LPLA 1SOUA 5LZ4A 3HUUA 4DPKA 1KL7A 3IIMA 4FK8A 4KWIA 3AL3A 1PJZA 2A1TR 4JHXA 4U0JA 1UBNA 2YV1A 3RS4A 5GV7A 3T35A 1QOZA 1P1CA 5JQGA 3ELWA 1JZSA 3AKDA 3MZ0A 1MR3F 1GRQA 3OF2A 3PUXA 4F6LA 4ND2A 2XTNA 4WFJA 3RO7A 5KTRA 5J2UA 4A9AA 4FLMA 3RUDA 3SQWA 1VG1A 3NXKA 3H4IA 3V4SA 1Y81A 2H17A 3NANA 5SICE 4B4UA 2Q8QA 3JQFA 4HWOA 1BVHA 2HRCA 5FA8A 2V1UA 5HQTA 4OXQA 4UTZA 1OGYA 3R8XA 3TTYA 1D2NA 1P3Y1 4QUGA 2BMEA 1XC7A 1U4NA 2HWKA 3A1VA 2D7JA 3HE3A 4X65B 1OXMA 1OH6A 4IGKA 3ZOZA 1CR6A 5EXTA 1GU7A 1RPTA 1E32A 2ZYSA 1DQNA 4RMGA 4BL5A 4TQUS 5IRCD 3N2KA 2V7QD 1Y3HA 2WF9A 4GPD1 4OBEA 3TW6A 2GFQA 4BEBA 3ZV3A 1K2WA 2VP9A 3ZU2A 5LQKA 5ETJA 2NWQA 2R7NA 5CD1A 2NT3A 1CE8B 4YCSA 1FBTA 2DBYA 1DKRA 4QXAA 2YMPA 4U8GA 3GELA 5BV7A 2SNIE 2ZROA 1KI4A 2V03A 4B3JA 4DG8A 5ALLA 1H69A 2DWUA 5CTJA 1Z4QA 1T35A 2DUUA 3M4NA 5ARCA 1EVYA 1TEVA 4TZ6A 2Z09A 4TUYA 3D7SA 4ENQA 4H7JA 4Y2RA 4G0UA 1YBAA 2D0IA 2EIHA 1RI1A 2FDRA 3X1XA 4W5JA 1CDEA 3GROA 3TSCA 4NOJA 2ZIWB 3GRRA 4IWXA 3LPDA 2FN7A 2ZYAA 1J56A 2JAOA 4DV2B 1WNFA 1VFNA 3UBMA 1FSSA 2GJ4A 2JEYA 2JJ2A 1P5FA 3RRYA 3WXMA 4BHTA 3ADCA 4NULA 3LF1A 5JT1A 1E8DA 1YH3A 3PQEA 3NRBA 1NXXA 1UOEA 4QUKA 5F1OA 5I7HA 4I99A 4PIVA 1WL8A 5TB5A 1KVTA 2RHRA 3X1DA 5AJHA 4CYMA 5JXHA 1VHWA 5DX0A 4EELA 3OJLA 3U4DA 5JI2E 4CEJB 2OZKA 3B85A 1ODFA 4BYGA 5JNTA 3THXA 1HFKA 3CM0A 4XM0A 5JXGA 4OFBA 3R0ZA 2DFNA 1F9AA 4P4UA 3R8CA 4HYQA 3DBHB 4CKXA 2AHOA 4R2WA 4AVYA 2Q6KA 1HZZC 2XOKD 4D5EA 1N2OA 1IBMB 1FTSA 3O75A 2QTLA 1R9MA 1BD4A 1GG9A 1VE6A 3B7PA 4M9SA 2R5FA 1BXGB 4DR2B 4G0QA 1R10A 4A2PA 1N78A 1W4RA 1FYDA 4JWKA 2AQ8A 4G5GA 2JIDA 4FZ5A 2M1ZA 1OKKA 4URHA 3FPFA 2HI0A 3UK7A 3NM4A 3GUHA 3HKEA 4NQZA 1VYHA 2E48A 3IILA 3QKRA 3TKAA 1XDZA 3BD8A 3WK5A 3SVTA 1N2IA 1ZD3A 2ZWPA 1L5YA 2N47A 3EZXA 5HEKA 4NIMA 4U6NA 2O07A 4GIBA 4CIBA 1EH5A 3BB1A 1P4JA 4P3XA 3E7FA 1YS9A 2AEEA 2ZRQA 4RKYA 3USZA 1ESCA 4RIEA 1AQJA 3Q0TA 1LX6A 5GJCA 1OFUA 3K9WA 5D84A 1N5JA 3HB9A 4C4SA 3KQQA 4O33A 1WCIB 5CNMA 3PQ4A 2DKNA 3VGJA 1I10A 5BOSB 3KKOA 3MTBA 3KNZA 2FHSA 4F4CA 1TUEA 3HR7A 3DE0X 3TYXA 3WRYC 5CYGA 1Z8FA 1LPMA 5K0LA 4E88A 2BM0A 3SHTA 3UYKA 1KYXA 2BEWA 4TWBA 4RTPA 2RONA 1N6KA 4H1UA 4IINA 4NV1A 3X1YA 4BQIA 2PDAA 4QREA 4EO4A 1MXFA 1OLSA 2QX9A 1ULHA 4OYLA 3MBOA 1B15A 2A0UA 3NAMA 1KI2A 3HHEA 4O2BB 2YWJA 3IQDB 1CQJB 5KTPA 2DOKA 2CBXA 5ALPA 1C0LA 2ODPA 2MR6A 2Q1YA 2XQKA 2VXCA 5ALGA 1ZGHA 4TZ0A 3LI2A 2QYSA 4QT4A 1RJGA 4P2GA 1FMTA 1QPBA 2JZCA 4ZZ3A 5KUTA 3WIDA 4COKA 3AKZA 4FCVA 4K46A 1XFDA 4A0FA 5J63A 1C0KA 2YUIA 3EGDA 3IMKA 2V7EA 2O8FB 2BSAA 3RNLA 2VAVA 1HC7A 1ZS9A 1XV5A 3KBOA 3PC6A 1Q19A 4K6OA 1NX9A 4NBRA 2QP9X 5AHOA 4O5OA 3TGWA 4EG1A 4Z1MD 5BR1A 5ADHA 1TQ2A 3DAPA 4DQDA 1CY1A 3AR9A 3GJTA 4K6KA 4ZQBA 5B2EA 1LI7A 1W19A 3ZHRA 2V4UA 3FNEA 3LWDA 4IH1A 4IDAA 4F5DA 5EN4A 4G37A 2OD7A 3OCXA 4EYEA 3Q98A 5HXAA 2FSHA 4YJGB 3EDRA 4FDTA 4QXPA 4LNUB 3OX4A 2NADA 3BFJA 4FXOA 5FBQB 1RWPA 4HPXB 1VL6A 4MWEA 3OMXA 3ZXUB 2GM9A 1RVDA 1YR9A 4BATA 2OT3B 3AR8A 1KMQA 3RVQA 3T5BA 4KIWA 3M6LA 4B44A 3PXBA 5HS4A 3OKCA 2NPOA 4EFKA 2I2DA 2ZG6A 1AURA 1G8AA 3D43A 1Z5WA 4KAFA 3BHJA 3O9MA 4PPYA 3ZNPA 4ZAFA 2PTGA 2O8DB 3H2BA 4N5MA 1O6GA 1E5XA 1DX9A 1F3LA 2CDNA 2C8LA 3IMCA 3A6DA 2C7QA 2GBLA 2BUBA 2I99A 2DJ5A 4IO1A 5CEJA 3R7FA 1SC3A 2MSNA 3ASUA 3N8KA 5A0FA 5BSVA 4HWPA 1NU6A 5F9HA 4DR6B 3LUGA 3DE1X 1R0YA 1P5RA 1HE2A 4I1YA 4IKOA 3FIJA 4MV3A 1JKXA 4GX5A 5D01A 5IPFA 4NU6A 3BTOA 1DQRA 1FUIA 1OXXK 1PNOA 4PSUA 3QPVA 2MINA 5A04A 3RT9A 4RF5A 1OBVA 2OHOA 2Z1DA 4EEKA 3AL0C 1S3SA 2ZR9A 1HT0A 1LZLA 4LCEA 2J0SA 3B2NA 1R6DA 2NUPA 3DVAA 1RQGA 3MS4A 1XDBA 3NJ4A 2HRZA 4PO8A 3UAVA 4BLPA 4DJTA 2IEGA 3K0CA 1GPAA 3PI6A 4Y2JA 2O2SA 3VZCA 2HMTA 3LPCA 3O4GA 4K9PA 2I3ZA 4IWNA 4PV7A 4C3ZA 2ZTSA 4MKHA 1ADCA 3CX8A 4R0VA 5C5DA 2HXSA 3LW7A 4K87A 2WICA 3KFLA 4CKWB 2NXJA 3P2KA 5KHOC 4BUZA 3T4UA 3U3XA 4RVUA 4Y1RA 1EWTA 2PZAA 1NAIA 3KT8A 4G8BA 4HZUB 3RVOA 4LMBA 4XZ3A 2ZI7A 3TNFA 1X7YA 5CLJA 4Q7LA 1C3LA 2NO4A 1AT1A 3KZKA 4HUTA 4X7BA 5JSFA 3EA0A 3GLHB 4I5DA 5FT9A 1SKAA 2POCA 3IEMA 2UUCB 1ONNA 1QJ4A 4RS3A 4MUGA 4C7XA 1YJBA 4LHYA 2IHVA 2IT1A 3C4JA 3UC9A 3W6PA 2AG0A 3TQIA 3RS0A 4QTYA 4ALLA 3HXOA 3EH1A 1PG5A 3U4CA 5SYAA 3OQNA 2AJBA 1DCMA 4D9IA 3VDQA 3LCJA 2IS1A 2WA1A 3B6MA 3LQKA 3LT0A 5KQSA 2PKCA 3BSSA 4QVGA 1OY1A 3FSGA 4DBLC 4ARCA 4P93A 4ZICA 1F20A 2A9JA 3CRRA 3BMQB 4R8KA 4BFZA 4BE7B 3MN1A 4QL3A 1Q0PA 1YNOA 3F97A 1LWNA 2BZ1A 2ZJ1A 3AI2A 3JWJA 4A1FA 3ZHUA 1P4RA 3IXMA 4IX9A 1YQQA 1SKQA 4B3MB 2XKJE 1HUQA 1GPLA 1RKXA 1IY1A 1TT5A 3D3NA 2ALJA 2VJLA 3KYBA 1KP3A 2XNDD 3AKYA 4FEAA 3OEYA 4FEYA 3PTLA 1A76A 1FOEB 1GFSA 1T0IA 2CWDA 5AKZA 3COJA 3C85A 1A8HA 2JFFA 1RQ2A 3NUQA 1IVNA 2FCAA 3HZOA 4MIKA 3M5PA 4F9GA 4QHYA 3KUKA 3MAAC 4OI4A 5IFKA 2BSQA 1V1JA 2ZYGA 2W98A 2Z6VA 4H59A 4Q82A 5HKLA 5C53B 4AZ3B 4DT1A 1VCHA 2HT6A 3I9LA 3LSTA 2BF4A 1CG6A 3LBYA 4LTMA 3W7BA 2VKTA 4UREA 3IJRA 3H6GA 1E77A 2ZDGA 1RNLA 3OQMA 2QTGA 2QRPA 2QUZA 3GJ0A 4O1IA 1W5SA 4HQ6A 1O94A 4HXGA 2YWBA 1J2RA 1U8EA 2AZMA 1ENPA 3DQPA 1FQKA 3FNFA 5DO9A 2DUJA 3GRCA 4BMYA 1P2VA 2FRXA 1NWHA 3PUYA 4TSKA 4B1FA 4O2AB 2YL2A 1BEEA 1JJ7A 2VG8A 3A6FA 1EE1A 3A31A 1T9DA 3BL6A 3CZMA 4FOLA 3W05A 1AKMA 3DBRA 3GL9A 3SY8A 1WP9A 4B4VA 4ZZ2A 4JU8A 6CHYA 3HVRA 3WO0A 5JDIA 3ICOA 3K9HA 1XKQA 1N0VC 5CA0F 4GOXA 3NTVA 2H1SA 4CM4B 1S2IA 5E6RB 4RVOA 4UEWA 4MTCA 3TLKA 3TZKA 1LRKA 3AVWA 4WZAA 1QVRA 3TSOA 2D06A 3SKVA 1RS0A 1WAMA 2R4QA 1CUYA 2VA8A 1USKA 3QPWA 2G9QA 1X92A 3FRIA 4JX8A 1FS4A 1UBKS 2VXYA 3LX4A 2GLUA 1CEXA 1Q91A 2V7WA 3CEJA 3S2ZA 3ZW8A 4DDTA 4L4YA 1VCMA 4YAEA 4YT5A 3RSZA 2W8ZA 1FUKA 5EA2A 4WBNF 4TTAA 2P6PA 4JB3A 1V3VA 3E7PA 3KVYA 5HMLA 3D0KA 2XUGA 3UO8B 3M5WA 2OAGA 1NYQA 3H8JA 1LA2A 2Z1MA 3FKJA 3OESA 1YDMA 3TRIA 5P8WA 3NHLA 5JC1A 1EB8A 3WIUA 5B30A 4BO1A 1NF3A 2AK3A 2G09A 4IG9A 1JQAA 1K7SN 3VZBA 4OQ4A 3MCUA 3RJ9A 4ZGGA 4DE5A 3D4IA 3F4BA 1I6WA 1QGYA 1BN6A 3ND7A 4WFKA 4I4TF 2XTJA 4BNGA 1J33A 2ST1A 1JG1A 1QH9A 2EX1A 3HBJA 4R51A 4EO7A 2JBHA 3OFNA 4P38A 1DARA 2J4FA 3H16A 4LVNA 5LJLA 3W1WA 3F6BX 4YP7A 4ER0A 1NDHA 4O1MA 2H63A 1QGED 1SK8A 3ESXA 3MUEA 1E6CA 4WESA 1U2TA 4MGHA 4BFXA 4RNDB 5CT9A 1ODSA 3LBIA 2OCGA 4L3OA 5AM4A 2JGRA 4YQEA 3VJMA 4FFBB 3H0EA 3T1HB 1XNGA 1JHDA 1YMUA 4G41A 3WYCA 4C2UA 3JS5A 1TUBB 5HTKA 4HNQA 5F7JA 5G4KA 1RWQA 1QZZA 3L82B 4GYJA 5JC8A 2X13A 1DIHA 3VPGA 5LZ7A 4R05A 2B8NA 3B5JA 4JI1B 3K70B 4ER6A 5JARA 3PE3A 1KEVA 5J5VA 2YMLA 1PFVA 1UDWA 1X7ZA 3D4OA 4JA2A 2PJRA 4M21A 1C7IA 2GAJA 3DKIA 4WUVA 2Y0PA 1CU1A 2DULA 3G82C 1V1MA 2WM9B 2BMWA 2VDNB 1PYOA 3FI9A 4BNLA 2YHBA 5C35A 4FEGA 3OCUA 1B8UA 3WWOA 1JBQA 2H4HA 3ZYZA 1ESNA 3Q7RA 2GEKA 2ZT7A 3RPEA 2GYYA 3AHGA 2ON6A 1SQ0A 2XECA 3RAFC 1RT9A 3MTQA 1W9MA 3OQBA 3R9XA 4FR5A 1VPWA 3VR5D 2R8OA 3INGA 2REQB 3VGPA 5D6NA 4ACBA 3PNYA 1M0EA 4LY0A 3F74A 3ZDDA 3OHMA 3QU2A 1GRRA 1W9HA 3SX2A 3DEHA 3AB8A 4AICA 4KOAA 4A0RA 1KFBB 5F1KA 5JCXA 3U19A 2JH9A 1SIUA 4MOWA 1Z37A 1Z4MA 3BORA 3QOXA 1ZGAA 3UMFA 2AKEA 1JLMA 3HADA 4B3SB 5EOVA 4B6JA 3TLXA 1FRFS 2QLTA 2BMDA 4ZQFA 1AQIA 3OPNA 5LWHA 3ZQJA 5IBQA 1C1DB 3V2GA 3GF4A 5KQLA 3ZU6A 5ALSA 5E1BA 5M34A 1Q0UA 1O6CA 2FKAA 1XKXA 2CYBA 2FPOA 4J16C 2J31A 3A1SA 1P39A 3S2SA 1U7HA 5FHRA 5T4HA 5C80A 3RODA 1RLMA 2QAIA 4OXKA 1PT9A 3VPCA 3DTTA 1K98A 1ZN2A 1W88A 2WDPA 3MWFA 1X39A 4TYQA 1V9SA 1COZA 2QQ5A 2R96A 2P9YA 1Z8HA 1E7RA 1Z2NX 1HNWB 1VRCA 5CDGA 1GOTA 1TM7E 3JYOA 3K6KA 1YKFA 4R7ZA 3RIYA 4XWGA 5T4EA 2WSMA 1DBPA 2VC2B 1CF4A 3CH5A 1UWKA 1Z7EA 3AKEA 4DZZA 2VZ9A 4EABA 3ZTYA 1T91A 4RVGA 1FLAA 2IF0A 3OQHA 1TLLA 1AY0A 1ZGGA 3LBAA 4HRXA 3JQAD 4PHTA 4QSHA 4D0NA 1P1JA 1UBJS 3DKVA 1ZR2A 2GAFA 5A0TA 2AFHA 2R84A 4B3IA 3IDAA 1IN8A 3DB2A 3FB4A 3EAQA 5MDHA 1EFLA 2MCFA 3QU9A 4H4DA 4B4OA 1SU7A 2GFIA 1RLIA 1U8AA 2Z4SA 1SU4A 4B83A 1Z17A 5AUOB 3EZ9A 1J2UA 3NG1A 4AUEA 2BKAA 3U6KA 2QIPA 4GD3Q 4F8EA 2FWRA 2O52A 2WAOA 1HQKA 3CNLA 3DO5A 2O2CA 3F9IA 3H8VA 1HM5A 3LQFA 1U4OA 1XAIA 3OQIA 4MDHA 4QDZA 4Y67A 3VMMA 5LP6B 5U9CA 2QN7A 3EISA 3EXEA 3VH2A 5T67A 1CPYA 3HFJA 4FCTA 3QI2A 3EMDA 1FUEA 2XNHA 4IAOA 4LDRA 1IG3A 2ZCUA 4CR6A 4PO9A 4TT8A 3D3EA 2GNOA 1OCEA 3L92A 1KYQA 4OREX 1QIKA 3DPUA 1XNQB 5M04A 2NO6A 3UMSA 4DANA 3T1TA 2B7LA 1S2MA 3KVNA 1X1AA 1SC9A 2C9YA 4ZT5A 3Q3EA 1JKFA 4X92A 1IVSA 1XTPA 1ZGJA 3RANA 1D0SA 4YALA 2FWPA 2ZEJA 2O3QA 4HTFB 3M4JA 4FVTA 1YVEI 1YHNA 4O63O 4AUMA 3PL5A 1XOIA 3SX4A 1S8AA 2C4KA 2EZUA 1Q84A 4MV5A 4KGDA 4BJ5A 4BNUA 1ZC4A 3WJ2A 1KFJB 2PMKA 2LKCA 1QWOA 2HMWA 4KU4A 3NVAA 4X95A 2QI9C 5HF8A 2ZUSA 3UUGA 3FRHA 1CZKA 2IS6A 4BQQA 3FZGA 2XGGA 5C1PA 3PX7A 2NSJA 1WUTA 1B7GO 1QTNA 2GPSA 5CGZA 3VNAA 1K92A 1XZNA 4Z53A 1ORWA 5KINB 1AK9A 3RYHA 3FWHA 4RTQA 1NYRA 1FZTA 2VP0A 3O8LA 4MWGA 1XWWA 2DFPA 5HFJA 2HTEA 2VKQA 4R6XA 2ABWA 5CX1B 2E4VA 3C8UA 5DNVA 3WBJA 2JGKA 1N9GA 3EDYA 1RHJA 4MKZA 4F56A 1WU7A 2RHTA 2FVYA 1VL1A 1UC5B 2NYVA 5JMTA 3BREA 3MPUA 1IUOA 1KE1A 4JVNA 1FRQA 1Z26A 4KR7A 4BE4A 4RJJA 1BEUB 3JW8A 3FTPA 5CDFA 1IG0A 1M0SA 1K5DA 1V8BA 3OM1A 1UXKA 4I0WB 1DTSA 4P3PA 4EYOA 2BGKA 3BYZA 1CS0A 3UKJA 5JMOA 3EVDA 1V16A 3K0KA 3KV1A 4O02B 2IHZA 1U8CB 1I4EB 2FRVA 3BFPA 4M86A 2G4VA 1XLTA 4RVSA 2XGMA 3F5FA 4O4HA 5ERXA 5ICMA 5EC8A 2QBYA 3F8WA 3OZ7A 2G8LA 1A27A 1NLYA 1VJRA 2QE7A 3WGJA 1WNTA 3MMNA 1N9ZA 4LZPA 5FWXB 4FFNA 3DLHA 4JC4A 5A5VA 3IPLA 4JJFA 4JUCA 1IZ9A 4BOYA 4YAJA 1P81A 1ATIA 1AA6A 3C3AA 3PEYA 4YMLA 3CQ9A 4L57A 1NVAA 3A1NA 3N39C 3QHQA 5JAPA 1P91A 4C4PA 4QYMA 5B6JA 2BFMA 4ZI2A 1O0BA 2QPAA 2QNBA 1KJIA 4ZV9A 5EIOA 4AYXA 3CNQS 2RH4A 3DOFA 1MH9A 3L4BC 1GRCA 5CLHA 3S40A 4J0IA 1W85A 2WSLA 3ORYA 2ZXFA 5DYIA 4DWWA 4YCBA 4YAUA 3Q6NA 4B3BA 4H6XA 1P4AA 2QSYA 4Q9AA 2UYHA 1M1XB 1GY8A 3I2HA 1NLZA 3LUPA 1YVDA 2UZ0A 4EW6A 1P4SA 1JEEA 4L85A 4EG3A 3M6VA 4GL4A 3K9BA 4J4HA 3FOCA 4JMPA 5DIFA 3FFAA 3DTYA 3U9TA 1JR3D 4YV7A 1Q83A 1VLZA 2OFOA 3ELYA 3ITEA 4ZN6A 1F7UA 4YT2A 5FBKA 2G7ZA 2HU2A 4L3VA 4PIMA 3UK6A 2OWEA 1J8QA 2E5LB 2QN8A 5KYWA 4GKKB 4OA5A 5KX5B 5BO5A 3ZWKA 3PV0A 1KK0A 4FTWA 4NMWA 5AJZA 1JHMA 1TZBA 2GJSA 2ZWVA 3L1KA 1XPRA 3TUIC 3FVTA 1EAYA 1E7MA 5CA1A 2OHIA 1V5FA 3ITNA 4WCFB 5FLEX 2Y9MB 3EA4A 1D4OA 1PG0A 2QN2A 2G6BA 3GJ6A 4GRIA 2X9VA 3CLTD 3IQWA 4KAXA 1TC2A 4KQKA 4B40A 2DAPA 4K6HA 3LBFA 5AM1A 4ARIA 4MR8A 2OZVA 1IMJA 1BS2A 1FCJA 3O6VA 1NHWA 4G84A 1UBMS 3B9QA 3HJBA 1VG8A 3GPIA 2BUCA 1K6MA 4JP2A 5DZSA 1OPXA 5BWMA 2G36A 1JHZA 4LC0A 3IEKA 3UXHA 1EK6A 2CBZA 1ZAYA 4N7MA 2JEZA 4Z2YA 1E3SA 1OXKB 1YR1A 1GA4A 4KRYA 3WMXA 1XPUA 3KSUA 4KPUB 3ZD6A 1CULC 2R8BA 2E49A 1AOXA 1XDGA 5IT5A 2BR3A 4S12A 1YZNA 3I4CA 3KU1A 3L06A 4PNEA 3ROEA 1KI6B 1C7RA 1YIDA 2H1WA 4K3VA 4R8RA 2PGOA 2GK7A 2WAAA 2A9QA 1XTQA 4XJVA 1GGMA 2G3YA 3GYBA 4NZMA 3O1LA 1WUYA 4ZOEA 3G85A 1ZQ1A 2Y0EA 3WE7A 4AKHA 2ZJ0A 4N76A 4UHBA 2HREA 4DL9A 3AL2A 4X8HA 5F2OA 2J07A 4QM6A 1H66A 4JI8B 2W2PA 1MT3A 5U4XA 1J9ZA 1E1QD 1AKTA 1DRJA 1ZVQA 1WD7A 3DCYA 3KWJA 5ES3A 3X1MA 3KR0A 4IIJF 2P6RA 5E4YA 6Q21A 3BMCB 1ZH4A 1SB9A 4AP9A 1V26A 4PYMA 1O9HA 2L69A 5LFAA 2VLBA 4QSMA 3I1IA 3BXOA 4KGXA 3HYTA 2VYNA 3W3AH 1GQSA 4XQCA 3QKIA 3IBFA 1D6MA 2C2HA 2IY7A 1WV1A 1MJHA 2Y3IA 1X38A 4IIUA 4TRJA 5F52A 3ZDAA 1VDMA 1X1CA 1D1QA 2G17A 2WFZA 2Q9UA 1M66A 1UM9B 1DFGA 1PT6A 5EMKA 2X2EA 1QB8A 1GCUA 1Z6AA 3HMKA 1XYGA 1ECLA 1VBNA 3EOAI 4D46A 2RGNA 1MVNA 5F7XA 4EW3A 1M2HA 2VRCA 3WJ7A 3NVKI 3O2JA 4U9HS 4XYBA 3IBCA 2IYTA 2AVDA 4P0TA 1NMYA 4FT2A 4N12A 1CR2A 1XF9A 2ADMA 4F86A 4HT3B 3TGPA 2ZW9A 1GTZA 1SHLA 1KZ4A 3O84A 2WMNB 4WY5A 2X1HA 1G7CA 2ZIZA 4DBVO 1VOTA 3DZ8A 1P2FA 3HCWA 3BE8A 2HMAA 3BQMB 2J3LA 3M4ZA 3SM3A 4C7OB 2YVQA 3LP6A 3O8DA 3JVIA 3PXDA 3VI3B 1HE4A 3UFBA 1EWVA 4RFSB 1Q92A 3HVHA 1XBTA 4FHDA 4DRXA 9ABPA 3AINA 2OV6A 2VWQA 1IU9A 3GK3A 4ONEA 3FMIA 4EHHA 4M98A 4MW5A 1BGXT 1CUFA 2MU1A 2R7LA 4H7HA 4AO6A 1PFGA 4QBIA 4Y2PA 1I4WA 4U7WA 4BB5A 3K2BA 5HVNA 2PVSA 2C7VA 3KB2A 5ABPA 1H1TA 2HYDA 1XCPA 4XGNA 3TW8B 1FNMA 1XTTA 4EARA 3GJSA 1D1PA 1YVRA 3ZNNA 5JHHB 5FWNA 1OI3A 2WIDA 2EBFX 2YS7A 2QXUA 2P6UA 2ZWOA 3LVRE 4HLNA 3RC3A 2G5CA 4EB8A 1L5GB 5C4GB 2WP0A 4MVJD 4CI9A 1YIAA 4CG3A 3GFGA 1LJ8A 1XCMA 2JBAA 1POXA 1IQ0A 2WPNA 2NU9B 1GYQA 1A50B 2CKMA 2Z2YA 2FKNA 3LPAA 2VWGA 4GC9A 1XVVA 2A1TS 5ALFA 3IURA 3VZSA 1ZLYA 1QGAA 4MJLA 1Y3AA 4J2OA 5KTSA 3QA3E 1DV2A 4IIXA 4XR9A 2RHCA 1T9GR 1U5BB 2PQ0A 1QBKC 4C4ZA 3VR4D 3BM5A 3PR3A 3EF0A 4WN3A 3MYYA 4IFEA 3OZEA 4RWEA 4ZI5A 4BN4A 1W4AA 3C41J 2Y77A 1ZGCA 3OQ6A 5K3FB 2XCLA 3S2YA 4KH1A 4FW9A 2XD4A 3WNDA 1KQGA 4UHFA 4B3TB 1LNZA 4AS3A 4HCJA 2DVMA 4N48A 1OW3B 3R5HA 5F77A 1T8WA 1DC8A 3EZ7A 3W8RA 2ZVJA 2QRKA 2YCLA 3AXTA 5L45A 3K9QO 4Q4CA 3ABOB 1CIJA 1UEJA 3D3WB 3B60A 4YJFA 5FBHA 3SSMA 4V0OA 1RTTA 4NBNA 3W8FA 1XN1A 1QQ5A 3FTCA 1JR6A 3JVDA 1SBYA 4KRGA 4X84A 5F5XA 5LOVA 1BCRA 2J9ZB 3HXMA 3W5IA 3N5CA 1KARA 4G5QA 2WINI 4LRSB 3T7CA 3TQOA 3T5AA 5LDGA 5KYYB 3ILXA 4MHOA 2WSYB 4URYR 3WYBA 1CF9A 1AQLA 1J8DA 2XCQA 3DFMA 3S6JA 2ZUFA 2PX2A 2W37A 3H5RA 1L7MA 3GDOA 1KTIA 3C6XA 4ZTZB 1JE0A 3DF9A 1JB1A 3EZYA 3TUZC 5EIBD 3R4VA 4MA0A 5DCLA 1V47A 4B81A 2ZDHA 3IEUA 4JC0A 1Z4NA 4K9OA 4G5FA 1PSZA 2GN4A 1AS2A 1S3FA 4RDHA 4F8YA 1XTVA 1RJEA 3AM5A 3BICA 2D5AA 5JYCA 3EEOA 4B7AA 3L8GA 2BDEA 2GEFA 4Q16A 2VVTA 3QFHA 4UM5A 4AJNA 1RXYA 4LZLA 1SA0A 3D4PA 1BXZA 5FBRB 5T3UA 5C1OA 3MTJA 2Y1DA 4KREA 2XV1A 4ZO6A 1QRTA 4I14A 5L4SA 1ZVVA 3EUWA 2BHSA 3E03A 3I53A 5G3ZA 5TR9A 1HI9A 1YZFA 4ZKDA 4QYWA 1PEYA 1NJGA 2IEAA 3T95A 4EEZA 1CNMA 1QHNA 2Q3FA 1X7XB 3E9MA 4Q19A 4ZI7F 4IXDA 2M98A 2PLRA 3OPYA 4OJNA 2RBGA 5AIBA 4YXWD 5I8WA 3QE4A 2ZWIA 2ZTUA 3UKOA 1W47A 3K9FC 1MC8A 4YREA 5FL7D 1D2CA 2RAUA 1ZCAA 1SWWA 3D8HA 4E70A 1I3KA 5IKPA 2D2IA 4BNDB 2VNKA 1DNPA 3IAEA 2P9QA 4PLYA 1DRKA 3LO5A 2NQTA 3LTEA 3OCYA 1IPEA 3MAGA 5AQEA 3TCKA 4WE3A 2O0KA 1ZRHA 3LDHA 1ZD4A 1NOKA 2QAJA 5IW8A 5TSDA 1I2MA 4YO8A 1P77A 3ZTWA 3A2KA 4Z4IA 4RO0A 2GARA 3EFOA 2EGUA 2WF8A 3CNEA 3EXG2 1NM5C 3L05A 4BGEA 1ZNZA 5I45A 5EZ6B 2NGRA 3UY4A 4ZOLF 1N1MA 3C7AA 3LQ2A 4FGLA 5DVZA 4FBGA 5A5EA 4B3RB 1ZM2A 1GKYA 1OVGA 1TJPB 4O0MA 4CMBA 5JUWA 3ICQB 4TTJA 1GAQA 3R40A 4BRZA 2BI8A 2R4TA 3LV8A 1BXKA 1T3LA 3K6SB 2YC2C 3TLJA 1K7XB 3JQ6A 4QHSA 4RGVA 4UULA 1RPJA 1Z5GA 4NCXA 1GYRA 1GRVA 1WS6A 2REXB 2OGUA 3MOSA 4OLBA 4PE5B 3KJXA 5F4ZA 1JTFA 5INTA 3T54A 1M34E 4KP7A 4KQWA 4DA6A 1QKJA 5IVHA 4E7OA 3JPYA 3U3RA 1ZI6A 3ZJ4A 4JLNA 1CDOA 1NZJA 4BXOB 5KOHA 3B8EA 1VJ1A 3MT0A 3M9WA 3N74A 2FLWA 2QXTA 3LHSA 3P0FA 3VSEA 2GYVA 2CLCX 1C9KA 3BXHA 3L4EA 3CUWA 4RY2A 4UU0A 5A9SA 2XCRB 3SKYA 1W0KD 3TW0A 2Q8NA 4OI1A 5EIHA 4V0NA 3UOAB 1HBJA 4PC7A 1QPZA 4Q9KA 2VEDA 4HNTA 3AUYA 4EF6A 4GPIB 5EMNA 3W79A 1EK2A 1MO5A 2BCJQ 4TRMA 1M2GA 1GDTA 1TZJA 2ENWA 2CNNA 2ZB2A 3F96A 1T9AA 3R3YA 4S1VA 1SQ6A 3AR3A 1ZL2A 3MGBA 5DHSA 5GM2A 1AK1A 1JAZA 4Z1MA 3CHYA 3Q7EA 2XTAA 5CB0A 5CBPB 5KNCH 2PFKA 4MB6A 5DULA 2PXHA 4RD6A 1C8VB 2JAPA 3B38A 4AWXA 5HZGA 1WHSA 1R5JA 2C31A 1KY4A 4MQLA 3FPBA 2GRUA 2IP1A 2YJ5A 3E7WA 1RYZA 5KWVA 4GP7A 1HF3A 4R1OA 3QTLA 1XZQA 3DUFB 4U00A 3PGKA 2V0NA 5FV7A 3C8DA 2Z8YM 1X1TA 4MCJA 1NNSA 1NQ5A 3I6BA 3M82A 4YONB 1X70A 2YNMD 2NU6A 2I91A 4PCLA 1OWLA 3E9NA 4WKOA 1D8TA 2E6KA 2G71A 4FE4A 3RSOA 5IUKC 3JAKA 3KQUA 4DDUA 3AQIA 4UAVA 1N25A 2IPLA 5DSXA 821PA 3FETA 4UNRA 3OIGA 3H9BA 2K7ZA 5THQA 4P0QB 3I0ZA 2ET6A 4OKSA 5CVTA 4AKTA 2YHIA 3EJ6A 4C21A 1LBQA 2J1LA 1JDNA 2J4DA 1QB7A 2ZXEA 3UT6A 3WB2A 4CL3A 1XU4A 3FZYA 4EIWA 1P60A 3G1TA 2O2GA 4F2DA 2R79A 4FX5A 1SXPA 3AEYA 1AKNA 3E27A 4TSRA 4NXMB 3L0OA 1Z2AA 1NN1A 2FI1A 3CNOA 4LJYA 3KOUA 3H0CA 3S68A 4Q39A 3V4FA 3ZU4A 4EY5A 3ZHTA 4Z51A 5JSHA 2H52A 3MD9A 4F4DA 5CW2A 4QDUA 1VZ3A 2WB4A 3VTKA 3IOYA 2JW5A 2AFRA 4HAYA 1JEQB 1NE7A 1PR0A 2R8ZA 4GM4A 1UAGA 4RFVA 4HFJA 3HCDA 3NQ41 2IYZA 2WHEA 3DE2X 4FDMA 4DWVA 1TIBA 2AJTA 2GF2A 2I9PA 4LWQA 1T5LA 4TMVA 1EEXB 3SMQA 3DMPA 4YYEA 5IMSA 2BCEA 3C3PA 2I3GA 3KZMA 2YWDA 4GPEA 4AMGA 4B6QA 4KE6A 3TCNA 1NY6A 5JD4A 3CLTC 3K30A 1WXFA 3ELDA 2J7KA 3UMJA 2JLAA 4A6EA 2IU6A 3AC0A 3ZV4A 3FVVA 1CC1S 3QNMA 1FNNA 3QLVC 2QRQA 4V38A 3VVLA 1T36B 4FWBA 4DYHA 2OV2A 4IH9A 4B6RA 1R88A 3FA2A 4J0GA 5BN5A 4TM7A 4CM5A 3CGGA 4M0CA 1RP1A 3C2QA 2IIBA 2VF4X 3D6JA 3THWB 4OXIA 3JRXA 2IY8A 2ORYA 3CPEA 2PQ2A 3FHJA 2WWIA 1VTKA 2J5QA 3Q0EA 4JBLA 5GVSA 1HT3A 2ISSD 2FFBA 3U7GA 1X6VA 3WK6A 1PJCA 2YJ3A 4BKQA 4KQFA 3C7DB 1BA2A 2SECE 2Q9BA 3GH1A 4PHCA 4YJKA 2X0FA 2HPZA 4GH5A 3TPZA 5EKUA 2NVWA 4QBHA 3GZNB 3KQMA 3AERB 5AVKA 5TQ0B 2PUAA 5K8IA 4GI2A 2W6IA 3OZAA 4ZCTA 2AOUB 3G2KA 4WNAB 2DUMA 2W6MA 4DNFA 3N1UA 1N5KA 1GUAA