1T0IA

Ylr011wp, a saccharomyces cerevisiae na(d)ph-dependent fmn reductase
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
185
structure length
185
Chain Sequence
MKVGIIMGSVRAKRVCPEIAAYVKRTIENSEELIDQKLKIQVVDLQQIALPLYEDDDELIPAQIKSVDEYADSKTRSWSRIVNALDIIVFVTPQYNWGYPAALKNAIDRLYHEWHGKPALVVSYGGHGGSKCNDQLQEVLHGLKMNVIGGVAVKIPVGTIPLPEDIVPQLSVHNEEILQLLASCI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure and Functional Characterization of Yeast YLR011wp, an Enzyme with NAD(P)H-FMN and Ferric Iron Reductase Activities
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase
molecule keywords YLR011wp
total genus 57
structure length 185
sequence length 185
chains with identical sequence B
ec nomenclature ec 1.5.1.39: FMN reductase (NAD(P)H).
pdb deposition date 2004-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03358 FMN_red NADPH-dependent FMN reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1t0iA00
2FX2A 3F2VA 2M6SA 5EMNA 1NNI1 1CZHA 1ZWLA 4J8PA 3ES9A 1FX1A 4QODA 1AKQA 5F12A 2D5IA 2R97A 1DXQA 3FW1A 3GFSA 1CZUA 1DXOA 3O73A 4FGJA 3OWHA 4XDGA 1D04A 4FGLA 2OHHA 3RPEA 1JA0A 2HNAA 2XOEA 4S24A 3UXHA 1FLVA 1H66A 3B6KA 4CETA 1QBGA 1C7EA 1D03A 4PTZA 2QX6A 2FZ5A 3B6IA 3TE7A 2FLVA 5FUQA 2V5VA 1T5BA 4BMPB 1WSWA 2V9CA 1JA1A 3FNIA 1QR2A 3NHSA 3NHFA 5LJLA 2V5UA 1WSBA 2HNBA 2WC1A 3NHLA 4QOIA 2KQUA 2FDXA 3EDOA 3F90A 1SG0A 1J9EA 5EA2A 2MWMA 3O2NA 3N39C 4F8YA 2GSWA 1AG9A 1CZKA 6NULA 2R96A 2ARKA 3W7AA 2A5LA 3OJWA 4XDHA 2QX4A 4BMOB 1J8QA 1ZWKA 5LLDA 3TEMA 5NLLA 2Z98A 3JSXA 1YDGA 5NULA 3NHKA 4N65A 4C0XA 4C76A 2ZKIA 3FJOA 1X77A 1QRDA 1B1CA 2MOKA 4HEQA 1OBVA 1YRHA 2FCRA 4D02A 3SVLA 1YOBA 3NFRA 3GAMA 2FVXA 4YALA 5F51A 4ZVKA 3S2YA 1XYVA 3ESYA 3F6SA 1BVYF 1GG5A 2AMJA 5LMCA 2X2OA 3W78A 5TGZA 1CZRA 1FTGA 2BZSA 2FZVA 3HLYA 3KAPA 1T0IA 3L9XA 3OJXA 3QE2A 4QOFA 4QOGA 4U7GA 1J9GA 3HR4A 1CZLA 4N82A 1OBOA 3G5MA 2X2PA 5FA6A 3EYWA 4NLLA 3U7IA 2FAXA 1F4PA 3KAQA 2QMZA 4U7HA 1QHEA 4QOEA 3QFCA 1YCHA 4YAOA 1FVXA 3N3AC 2BPOA 2F1OA 1AMOA 4C0WA 3W79A 3KLBA 1AKVA 3UXEA 3NHWA 1VMEA 4ZVNA 4YAWA 3D7NA 5ULLA 1C7FA 1AKRA 5BUCA 1RTTA 2XODA 4PTYA 3NHYA 5LVAA 1H69A 4LAFA 3LCMA 3ESZA 3B6JA 2QMYA 5F4BA 5LJIA 3FVWA 4FX2A 2BN4A 3FX2A 1FUEA 4GR9A 1RLIA 1KBOA 1YCFA 4YAUA 4LTNA 4U7FA 2BMVA 2Q9UA 4Y9RA 4H6PA 1AKWA 4N9QA 4R81A 2OHJA 4GI5A 4LTDA 5EAIA 1TIKA 2RG1A 1OFVA 1V4BA 3K1YA 4HS4A 1I1OA 5JROA 3OX2A 1FLNA 2N1MA 1KBQA 3F6RA 4PU0A 4ZVLA 2MT9A 2Z9CA 1YCGA 1XYYA 4NULA 1AKUA 4ICIA 2MTBA 4QOHA 5LBUA 5A4KA 1E5DA 1DX9A 2Z9BA 1TLLA 4H2DA 4DILA 1AKTA 1CZNA 2Z9DA 3ZHOA 4GQIA 5B3KA 3OVMA 1FLAA 4Y9UA 1CZOA 3OX3A 3P0RA 3U7RA 5FX2A 1RCFA 2B3DA 5LBTA 3KEGA 3N3BC 3NHRA 3QFRA 3TZBA 2OYSA 3GFRA 3K20A 1ZX1A 2M6RA 4YQEA 4CF6A 1J9ZA 1YKGA 3NLLA 4QOJA 3NHUA 3NHPA 1D4AA 2OHIA 5B3LA 2FOXA 4M0CA 1BU5A 3LT5A 3HA2A 4DIKA 3L9WA 1FLDA 1RLJA 1XT6A 1AHNA 1AZLA 2HPVA 2QR2A 4ZVMA 2QWXA 4C14A 2Q62A 4DY4A 4LTMA 3NHJA 4ESEA 3OWXA 3B6MA 2KLBA 3ESXA 3R6WA 4FGKA 1XI2A 4YAFA 4Y7CA 3GFQA 3OX1A 2W5UA 2QX9A 4LA4A 2QX8A 1SQSA 3W77A 2BF4A 4OXXA
chains in the Genus database with same CATH superfamily
5IVIA 3QLTA 1WUJS 1ULZA 1G2QA 3HA5A 4H7HA 3O38A 2J3MA 3UCEA 3D4IA 2BYTA 1QLWA 1AGPA 5B37A 1DKNA 3W6PA 2DTEA 1MC1A 2COEA 1UBGA 3I6IA 4P22A 4BO5A 1XTPA 1G5PA 3JVVA 2XOEA 3BWVA 2CHVA 4TKUB 3VVBA 1P9NA 1QBGA 4P3KA 2P7IA 4AFNA 4K7JA 5E2BA 3RNLA 2QYSA 1XCPA 1TRHA 2QT0A 4GQAA 4EQ6B 5KVAA 4YI5A 1LV8A 4QSHA 5E6SB 3BZUA 4PNHA 5CR9A 3RC3A 1KP9A 1V43A 4TLDA 3P9XA 2X76A 2ARKA 4IGFA 5CW1A 1Q7CA 4LZJA 5FYDA 1XXHE 4QGGA 1OMOA 1J8QA 4HLCA 4ZXPA 2RGNA 2TMYA 4ZEXA 1ZVJA 4S2EA 2RIRA 5KOHB 1X74A 2H1FA 1Y48E 3AOEA 3GJ7A 3NHKA 4CKWB 1SXJB 3JXEA 5LMZA 4HL6A 5C80A 3CLHA 3CW8X 4Q3LA 3V4OA 1CEXA 1YXMA 5GM1A 2W4QA 4DSTA 5K4GA 2JLSA 7MHTA 1EFRA 3ZHXA 3FMIA 2GN2A 4CKCA 2K7ZA 3GLUA 5JH7B 2B20A 2Q2VA 4ZZ1A 1JHYA 2Q3EA 3NT5A 4N0DA 4H0CA 3NIBA 2H5EA 5AI9A 5EMKA 3LKZA 2NSHA 1ORWA 3HB9A 4HEA6 4LE0A 4O4HA 3R76A 1Z2EA 5J2UB 2HDHA 2IYEA 1NZFA 4WZAA 2CLFB 3H6KA 4M99A 5K6TA 3D6JA 4JP2A 4GMXA 4HZUB 2ISSD 4UNPA 4YIHA 1KNXA 1K89A 4H31A 5TIIA 4TYMA 2C2WA 1BMFD 1D8AA 5E1OA 2V6BA 5EOVA 5CVCA 2WUFA 4MARA 2QV0A 4YY3B 3HC7A 1VECA 3T41A 3AKEA 4WHMA 1E3JA 4NJOA 3K6KA 3PA8A 4PS0A 1OREA 4Y9RA 4XPIB 1KQ3A 5B30A 5C81A 1N4AA 3H1EA 4FLFA 2ACKA 2XRFA 3LHFA 4H4CA 4YRMA 4PO1A 2Q3BA 3KPYA 4YGXB 5C4MA 4F5YA 1YUBA 4DQUA 4OLFA 3AFMA 3URKA 5KPDA 4LGYA 1BN7A 1BFKA 2E4WA 1EDBA 1JHOA 3LG2A 4YCNA 1JN0A 3BH0A 2YJTD 2XVAA 3GRAA 4R8MA 3EX7C 1RRCA 1DBPA 1E6LA 4FYXA 3GO4A 4M3NA 3HN6A 2GK7A 1KDZA 3TZLA 1U11A 5C8VA 4LDRA 1BQ4A 4FHGA 1I3OA 1ZJWA 1C3JA 4NE7A 1HNWB 1Q0RA 1KAOA 2WUEA 5K8UA 3WZ2A 3J7TA 1DAOA 1XU7A 1EWTA 2YIMA 3PKIA 2I8AA 3O4VA 1AKYA 1UZAA 3U61B 2C31A 4QARA 3HVJA 3TZQA 1IRIA 4M8KA 1EX9A 1XJ0A 3R8FA 2DFNA 4GH5A 3FNRA 1P1IA 4PLHA 1JPVA 2B7CA 1AQLA 1F51E 2BFWA 3RABA 4WGGA 2AZTA 3UJ9A 4MPPA 1KPIA 1PVDA 1Y9DA 3JPYA 3N0RA 4TT3D 4YRSA 5KJEA 1VMDA 4YFYA 3UJNA 4OHBA 3IQEA 5AUQA 1U8FO 4BO2A 5KWVA 4ZANA 1DTSA 1T8RA 4PZ9A 3MAGA 1RI3A 1MOQA 1ABEA 2IVZA 2IXFA 1OXSC 1RP1A 2QVCA 3F7OA 5HTOA 1C7EA 2RHGB 2Y1LA 3KVVA 2GXSA 1JBKA 2HCBA 3W6ZA 3WB1A 1T5BA 3TNLA 5CXSA 4IRXA 1P2VA 4YRCA 4CQMA 3WGVA 1E2KA 5DHRA 2DG2A 2GO1A 3A7EA 1KI8A 2AE2A 2VNJA 3M83A 2OCPA 4GR4A 2DHCA 4R01A 1LY1A 4R1OA 1D2AA 2RI6A 3PRKE 2N9UA 2R7MA 2C97A 1W5AA 5A05A 2ZYWX 3QXXA 4H7JA 2JI8A 1M1UA 3ZEIA 1SCUA 5IFKA 1GTL1 3T4UA 2WMNB 3BMXA 1YULA 2AOTA 2WT8A 3OAAA 1T3HA 3QPUA 3EY9A 3E3LA 1X77A 3GR6A 3WLAA 1WABA 2QROA 4INJA 1I5OA 1FX0B 3KLMX 3OM0A 3FR7A 3UTDA 3KQLA 1W2WB 1FUKA 2NV6A 1JT9A 4E09A 5CMLA 5JI2E 1BZYA 5IDXA 5TGZA 4RPJA 1YB5A 4KXUA 2YV3A 4LJ4A 1E3QA 4S1VA 2MCFA 1H9AA 2FSUA 3BE4A 1C9DB 1SOWA 1U3TA 3G5MA 3BWEA 3EXFA 4B46A 2EFYA 4RJTA 1EP3B 3RWBA 4N54A 5IYZF 2DSNA 4AN4A 4ZMSA 4HGPA 2YXNA 5C8YF 1OI7A 2F8LA 3MMNA 3I2KA 1JWLA 4NATA 1YMQA 1KO7A 1JEYB 1E2JA 1ZAYA 4ND2A 3W2EA 2JJ2D 4RDCA 2Q4TA 4YCJA 4E2FA 5ICMA 2HRZA 3EIEA 3AESA 3L7DA 4O4IB 4GL4A 5JMPA 3WTBA 1OXUA 1T3SA 3T7EA 4DTIA 4OP3A 1B8UA 4PYLA 1T2NA 3CGGA 1QCZA 2VJYA 2C7PA 1OCEA 1Z3IX 4IMIB 4NEHB 4CM7A 2W6PA 4AKHA 1IHUA 2R79A 3CO0S 1MABB 2WMYA 3ENQA 4ODIA 1TGVA 4LX0A 4GGOA 2CDAA 5AVOA 1RWBA 1JIJA 3QV1A 4JUCA 5D2CA 4LQCA 4E46A 2PD4A 3R8XA 1R9GA 4NCXA 2QU7A 3SYLA 3Q5GA 1DOZA 3V9PA 2AFHE 2UV8A 1Z6XA 4LHEA 1ESZA 4BXOB 1KY3A 3AWDA 4PIVA 4G0NA 1FLAA 3PQDA 2OP0A 2X7XA 1IPEA 5IVPA 2HBYA 4B6EA 1YF3A 4KQIA 3ZLJA 1YR9A 3BIXA 1ZVKA 4RD2A 1L8AA 4BVKA 1U2EA 4OBWA 4R83A 5PGMA 5F21A 1ZDMA 4JK3A 4HFMA 3ROEA 4OSEA 2KI5A 3VPSA 1W2GA 4RF2A 5FLKA 4DIKA 3L43A 1VIVA 4IRUB 2CYCA 3CHYA 2A5GA 4IILA 4MQEA 2IX3A 3NDBB 1OZFA 1GFIA 3LC2O 1LNZA 2OFPA 2PLFA 5DMHA 4JA2A 1LI4A 3H6GA 4NCKA 1GPBA 4WLVA 3G49A 3BD7A 4P1ZA 4Z4IA 3J81A 1GQRA 1RQXA 2QX9A 3UV6A 3SDBA 3VDQA 3SFZA 2HB6A 3KV3O 1JFVA 1SXJA 1NNI1 2VP3A 2SKCA 4WJKB 1S1CA 3R8CA 1VJDA 5FNZA 4LE2A 1TKCA 2JEYA 1I6WA 2QRMA 3KBBA 2UVQA 3F1LA 4CKCB 1X1CA 3QI7A 4Q5IA 2EHDA 2ZYDA 1RWXA 4FUTA 4X95A 3V2GA 4EBFA 2EZ8A 3FFWA 3GYBA 5C35A 5JQGA 3QX8A 3EFOB 4WACA 2VDQB 4F3TA 1TLFA 4K9OA 2D06A 3N7UA 4LXXA 2V96A 3P8ZA 1JDZA 2NUPA 2W6IA 3QF7A 4GLFA 4Q7JB 4GZ3A 4RQBA 5EQFA 4YMUA 3EQ7A 1WZ2A 2J59A 2QI9C 1PDWA 4US1R 4F97A 3QLVC 4EKGA 1RBYA 1PJ4A 1P8JA 3H6HA 1C3LA 4MQFB 4UNIA 4W7IA 2PSJA 4YLEA 1BS1A 2VDWA 2WT4A 1N6NA 3RS5A 3JSXA 3S40A 3ZBUA 1AKMA 1B73A 3V42A 3F98A 3N75A 4E94A 4EYKA 4DREA 5JXWA 3RVKA 1ZRMA 1SQGA 3VYTB 3G85A 5E2AA 1W0KD 4G5OA 2FSVA 4IO1A 3E70C 5I9IA 3PT5A 1HT2E 1B7GO 5JCOA 4QTTB 5L40A 2BKEA 3AK4A 1GYPA 4B84A 4MWSA 3S2ZA 1ODIA 3PYXA 1QH0A 1J39A 1F06A 1SVLA 2IU4A 3MCTA 3Q85A 4X63A 3WDLA 3OFJA 3OQVA 1X1EA 1EK0A 1YCHA 4URXR 4I55A 4PLPA 1QGYA 5JCXA 2X6TA 1ZXXA 2FEMA 4L8GA 1BSVA 1N0HA 1E18A 1Q22A 1FFCA 4OFBA 3GLGB 1PGOA 5HJ2A 3HVRA 3C41J 2JEZA 1G3QA 1CLEA 4PC3A 4CT4B 4URUR 4HXFB 1QHIA 4TSKA 1QZZA 5FQOA 3FPSA 1GPUA 3EUAA 4NS1A 4KQ1A 3WKDA 2ZPUA 3KFXA 4ENPA 3GDWA 2UYOA 1FYWA 1PG2A 3W0LB 1E2GA 1Y4AE 1U2QA 4N9QA 2VDPB 3JQBC 4BNFA 4J1NA 1DEKA 2V9ZA 3D31A 4ERNA 2MU1A 1UWKA 4Q66C 4Q9DA 1NYQA 5AWFC 3W5VA 1GRNA 3F0TA 1SRQA 3ENWA 3M8KA 3ZHUA 4RJJA 3R77A 5DWVA 1RYEA 2XTMA 1P7ZA 2JZNA 3NWOA 5J2TF 2ZIVB 4QFBA 3P0RA 3G17A 4EYEA 3OUUA 3N05A 1ZI9A 3LUKA 3W9BA 1W88A 3OOYA 2WWGA 4PO8A 2J33A 3GD7A 5ES3A 3H83A 5DN9A 4ARZA 3BHIA 2D13A 4YTEA 4RKWA 3RRYA 1E9CA 1SWVA 1BHQ1 4RLHA 3SICE 3VR2A 3VU0A 3ZW9A 4BASA 2IOYA 3K0KA 3REQA 1KZYC 1KR2A 1E5XA 2UYHA 1BD4A 4OKNA 1NP6A 2G9UA 3ACBA 3B6EA 4B3HA 5K3AA 4CMHA 2HPVA 3EZLA 4G5FA 1L5VA 3NXSA 2VAWA 5CPFA 3IOMA 3QSYA 4MH0R 5CJPA 2DVMA 2XUDA 2ZI4A 2R4UA 5AH0A 4PFKA 1YC2A 4QUAA 3FNEA 2JFWA 1K2VN 3HY6A 1AUPA 5EXSA 1ESEA 3JATB 5EMNA 3Q1LA 1CZHA 1C9YA 3EQ9A 4INAA 2JBAA 3OZ7A 4Q7MB 1BGXT 1WZNA 3E23A 3TGWA 2XZLA 1W4ZA 5A9TA 3OEYA 1ZU5A 4MWZA 4N12A 3LHIA 3N7TA 1V1JA 4RD4A 5HCUA 1WCIA 3PUKA 4ZKEA 2XAAA 1MV8A 3LXUX 4BZPA 2BI4A 1FDOA 1FE8A 3UXMA 4ZVVA 3TIXB 3ZD6A 2HEGA 3IAUA 1JA1A 3F97A 1PD1A 3IL2A 2XE4A 2B69A 4GBGA 1I0LA 4TTJA 1TT5B 3IR6A 3NBFA 5DM2A 2ZUVA 2FN8A 2ZAMA 3K9NA 2PSDA 1FFAA 4CG2A 2C9CA 2PS0A 3W34A 4DLRA 4GUAA 4CG1A 1AG9A 4F7DA 4F4DA 3NATA 2I76A 1HYBA 1JHRA 2QD3A 2YS6A 5DHPA 4TZ0A 1TZMA 2CNKA 3F6CA 3K6JA 3STTA 2YQ4A 3R5JA 5TPWB 5LP6C 1SOMA 4LZPA 4AMYA 1GRRA 3C5WP 4NONA 1U9CA 2X8JB 4MIKA 1M5UA 3D7MA 1GQYA 4FGZA 3WIBA 2FG7C 5IBQA 3S8YA 1HORA 1P0IA 1T0IA 1LLDA 2CLDX 3L6DA 5CLQA 1AGNA 4GWGA 1JFSA 1JRLA 1N9GB 1ZXBA 3FPGA 2DJIA 2W6ZA 3IDOA 4PV7A 1ARZA 2ZEJA 4CDGA 4J7AA 1FRFS 4AIRA 5DM60 4Y0NA 2W70A 5EQDA 4C0WA 4J7UA 1WVIA 3EC7A 3FRJA 5FTJA 3ABRB 3SE0A 2GH1A 1U9IA 4ZMBA 2H9IA 5AJXA 4DV1B 1KARA 2EKDA 3C7KA 4DCCA 1U5AA 4G1FA 3QWBA 2H17A 1VB5A 5KYKA 3BGSA 1PT7A 4MW0A 1KMCA 1QRAA 4OHOA 4U9IS 3U26A 2ZR0A 5J2UA 1MR3F 3JALA 3AHJA 4DM4A 3HWRA 1ZD5A 2X1MA 1SCKA 4FFOA 3X1ZA 2GKSA 3H5NA 4H0NA 2NUTA 1O96A 3SZUA 2YVAA 1NN1A 1QMGA 1O54A 5HZHA 4LTDA 2H52A 1O8CA 1PI3A 2OGSA 3OO0A 4KITB 5JROA 1RLMA 1C3OA 1LU9A 2VT6A 4AQYB 5AW7A 2QYOA 2XQGA 4WK2B 1VLJA 3PC6A 1XAGA 1WLSA 3O8QA 2CGEA 3EVEA 5HKBA 4P36A 1N25A 3LP6A 3QE0A 1AB5A 2YHSA 5CLFA 1QR6A 1PZHA 4I55F 4RK6A 5KX5A 4C0QC 2Q9CA 4DCPA 4GKKB 4CF6A 2EGHA 3Q1KA 4WOPA 1OIVA 4ZJYA 1VP9A 3RRXA 1IVNA 5IF3A 1DADA 1RQRA 1FIUA 4WOCA 5GWXA 5EXPA 3U40A 4UHKA 5JWRA 2PMKA 3I53A 3IBCA 1UZNA 2NU9A 4I1YA 3ETLA 3I3OA 3WGNA 5BVHA 5C1DA 1UR5A 5JZVA 1M66A 2HTEA 5CT4A 3IUPA 3RKSA 5IXJA 2HD4A 5KVSA 5FPQA 3GFQA 1K2WA 1KWGA 1Q20A 2I7XA 8ABPA 1M0SA 4MYDA 1RBQA 5T3YA 2G3YA 2XCIA 1ZSYA 4HZGA 2N46A 1Z62A 5L9AA 5DI3A 2M32A 3DFUA 2D1FA 3M5CA 2AC7A 1JX6A 1P3JA 2ECPA 3NUZA 5ALHA 3ZU6A 5DX0A 4X20B 2VF4X 4C2AA 2HADA 1LTHR 3OCUA 2RKOA 3SNKA 3MJ4A 4MUHA 1H2EA 2GX6A 2PU5A 1GUBA 5E3JA 4WKOA 2FPMA 1H8HA 4MVYA 4CU5A 1RYDA 5BPHA 1B2RA 1LPOA 1NF9A 2GM9A 3NTLA 1F1JA 3R9XA 2CBGA 3OPYI 4XYMA 4C08A 2R6FA 3AEKA 1PLLA 1WKBA 3NHSA 2E7ZA 3DNFA 3NNNA 4KSBA 2RGWA 1H6CA 3LS2A 2QPLA 2B1RA 2QJWA 3I92A 3ZXSA 3MJSA 4OFZA 4AKIA 3RQSA 3H9UA 3LYUA 4LXUA 5KDDA 4FI3F 5DWQA 5AM0A 1DIHA 2I3DA 1KC1A 1J2YA 1DE0A 1Q50A 2NVUA 3GJ3A 3SQWA 4LWQA 1KEUA 4C7MA 4EPXA 1KNQA 4TWJA 2GEVA 4NHOA 1O58A 5B4UA 4UXHA 4CLRB 5SYAA 4J0QA 4FMCF 4I14A 3AGQA 1STOA 3EVZA 4X7RA 3VYSB 2ZRNA 3SFTA 3OLXA 2FZVA 1K0UA 2DUWA 4W4TA 1B0ZA 3V34A 2VJCA 2Y6VA 4EO7A 4E2ZA 5D85A 3EMKA 4HDQB 1Z0KA 4PHHA 1FEZA 3QYAA 1NN5A 5CJJA 4GUDA 1RWVA 1IJKA 2FLWA 2OZKA 3GC6A 2I6SA 3IVMA 4TKUA 5EWMA 1K7EB 4R8KA 1VMEA 1H6BA 3BSYA 4MUJA 4MB2A 2CJYA 5T8KC 1W35A 2A3RA 2YXDA 4G41A 4Y1EA 1VRVA 3WOVA 4CMIA 5A9SB 1NX6A 1BA3A 3FPAA 1HK7A 1RVDA 1RYHA 1UP7A 2QGZA 4MLCA 1ELOA 4RHFA 4CZ2A 4FXOA 2PKXA 4QRIA 3VJKA 3I9OA 5JCPA 2ZBEA 3GGJA 3I30X 2OVFA 3FRIA 4V0MA 4X94A 5C52B 3T3MB 1ZEMA 3S44A 4JLMA 1Q84A 1ZONA 4WCFB 3JRNA 2X0EA 4HX2A 3T52A 3EG9B 3USCS 4YUXA 1XL0A 4YB8A 1AC5A 1CJUC 1UPAA 3HTXA 1NAIA 4DC1A 1KVUA 1E9AA 4PYQA 3WADA 5LD2C 1ODFA 2VYNA 5COAA 2I6UA 2QF7A 4LHWA 4XCVA 5IYZA 1T25A 3BJIC 3IQXA 3PR1A 5I7OA 3LL4A 4ZCSA 4US2R 4XWWA 3L0YA 2QTAA 4MRMA 5B1EA 3OT1B 4CT0A 3AETB 3IR5A 4HGZA 2X40A 3CRNA 1TPZA 1EZ1A 1MN6A 1VFNA 3N53A 3V2IA 1H5QA 2GXAA 1KFBB 1TU0A 3H2BA 3LHSA 4UHHA 1GZ5A 2EATA 2IHTA 1F20A 4K6FA 3L0IB 4ZCTA 4YP0A 1GDDA 2VQ3A 4P0TA 2QT1A 3R9XB 3GDOA 1P4RA 4KBFA 4AY3A 1S8AA 2YBDA 4B8WA 3GDFA 2V7EA 1XEXB 3QXSA 3AEQA 4EEZA 3C6BA 3ASZA 3DB1A 1RHRA 5CTAA 1BQ3A 4JX8A 4JJ6A 4EF5A 3WWEA 3ILVA 4X9XA 1W52X 1ZGJA 2CJPA 2W2MA 2X5XA 2CLKB 1Q57A 1YZQA 2EWVA 2VDLB 2FSIA 2WAXA 3ISJA 2I2WA 3IHKA 1DXOA 3U16A 2VUUA 5JS7A 1D04A 5A0TA 4MX8A 4EX6A 1QH8A 1VGQA 3AF5A 3C3MA 3OE4A 2OMKA 1LTQA 3PICA 4RZ3A 1MLDA 2Q4DA 3ZLTA 3VR4D 3B3GA 3ORYA 5HE9A 2X7HA 4I0WB 3MGAA 1XCOA 3LI2A 3SCZA 4DLXA 4EH1A 1EFVB 3DLHA 3U4QB 4D92A 4BQSA 4BAZA 4RVGA 1GQOA 2JAPA 1KI9A 2E4ZA 2QTCA 2WUDA 3AJ9A 1X1RA 2F00A 2ZVDA 3V7WA 4B74A 5KYWB 1A2OA 2FEWB 3N39C 5DKFA 5JC1A 2BGKA 4EY7A 3QXCA 5JSFA 5DLPA 3F71A 2V7VA 3N2LA 1W1WA 3B1KA 4I9HA 3A6JA 1IQRA 3CGWA 3JZIA 1A8SA 4JR2A 3LQ4A 4N6NA 4YAGA 5K01A 3E18A 7REQA 1M34A 4YDRA 4DR3B 4I6GA 1FS6A 4XFDA 2Q9AA 4XYLA 3CLRC 3KYCB 4KQHA 1TCUA 1W36D 2IXGA 2OZEA 3HZHA 5LQCA 3U49A 1LRLA 2OBYA 2A4KA 5DK6A 1P8AA 3DTTA 3RVJA 4R40A 3VKUA 4EEKA 2GF0A 1H5UA 3NONA 2B8JA 2GD1O 3IT0A 3KD2A 3LBHA 3O4GA 5TY0A 3EIXA 4HNGA 5IJAA 2AZMA 5FFFA 4YMWA 3JQPA 1JQEA 1UZMA 2I0FA 4MP6A 4NYIR 2X7JA 1BYIA 4WKPA 3X1WA 4BGEA 5FPYA 1QHEA 5ADUS 1P7VA 1O94D 2F1OA 2HGSA 4RPLA 5CVJA 1DC4A 1TEVA 2Q49A 3KWLA 1FP4A 3H2HA 4JJEA 4Q9KA 2QE6A 5CJ2A 1DQNA 3BJEA 5KZMB 2YTZA 3C8HA 5E7IA 1BVHA 3CRVA 1RTKA 1RPAA 4RXTA 3RAJA 1SHKA 5I47A 4YACA 1WXQA 4QYWA 5IAJA 1UP4A 5GVRA 3ZWCA 5K6AA 1EHIA 2BI8A 2PYZA 4H3KB 1G8KA 3H5WA 3U0BA 3QK7A 2B7BA 1EDZA 4A82A 4DEYA 2WYOA 3MTQA 2A8YA 2XHEA 3COWA 1M76A 1XV5A 2QVBA 3E2PA 4DLUA 4Z2YA 2LPMA 1F2UA 2H4WA 3PNQA 4N1AA 5H80A 4HR7A 3GRKA 3I05A 5HF5A 4C4XA 2PO5A 3BH7A 4Q4DA 5IC4A 1C0PA 1TIPA 1L9XA 3OZSA 4ZYYA 1YASA 1MH1A 3DLAA 1O0BA 1QBKC 4GM4A 3QKUA 4JKOA 2PQMA 3WO0A 1JHQA 3RRBA 2DWPA 4N7MA 5C5IA 4BTLA 4QELA 4JVOA 3W1WA 4EPYA 4LZZA 1C1XA 5AXDA 5I9NA 5JQGF 1FSSA 2WHQA 4Y9UA 3IMEA 2J87A 5DGCA 1N6RA 3KEGA 2ASEA 5BT9A 5BNIA 3D6AA 3EXHA 4C05A 4CFZA 2VCHA 3EC1A 2A7XA 1XRJA 4IV8A 2DMRA 3I6BA 4IWXA 3KWMA 5DMXA 5JO9A 2UZ1A 1VPVA 2PXCA 4I9GA 3EXIB 3I5XA 1W2HA 2RGEA 2DYKA 1RNLA 1XZDA 3AHIA 3HJAA 3UQYS 3LSTA 4WDRA 4MWEA 1O4VA 4DLSA 4LXTA 2MYPA 4OGWA 5C46F 3C3KA 3O8RA 2ZB3A 3G2LA 4B9AA 1PSWA 2DWCA 5CNJA 4I50B 3SM3A 4Z5XA 3PUHA 1MABA 4F2HA 2QQ5A 1DXHA 1ZBQA 1RACA 1L4UA 4M86A 1B3RA 3WRVA 4MKRA 3QOXA 3DF7A 3BZWA 2FEPA 1H0SA 2BEWB 4OMFG 3FW1A 2Q2WA 3LH5A 4D5EA 3PWTA 4FGJA 2R6GA 2W98A 4WBSA 4NMMA 4UE6A 5LQUA 2NO4A 2AUNA 2BE9A 1OILA 2P0AA 4G89A 1H22A 2C9OA 3OKPA 4TLCA 1U4OA 3OZRA 3SSMA 2HFJA 1MH9A 3FUXA 2UVDA 4MVCA 5CT6A 3C6KA 3FNIA 4RL4A 3UWMA 2QSYA 1OI3A 4HTFA 4PF1A 1K1EA 3V33A 2QRKA 2PUEA 3A1NA 3C7TA 2BKVA 3F90A 2OAGA 1JEAA 2FXVA 4QBTA 1D2NA 1Z5ZA 3EGXA 2FMHA 3N86A 1UF9A 4F3RA 3IX7A 5MFZA 2NPFA 1B26A 3NDRA 4J9UE 3LD9A 2HHAA 4C0XA 4CMAA 1B1CA 3TW0A 3G13A 4BFYA 4EF4A 1A9XA 3UK6A 1KYTA 1MAUA 2VEOA 1K7SN 2Z1DA 1AZWA 1TZCA 5KSYA 4MV9A 3REFA 2F3RA 5BRJA 1KTVA 2OO3A 4OCZA 4KRFA 1SA0A 3WLJA 2AQIA 1XDGA 1DDOA 3Q7PA 4P2GA 4YJDA 1GNTA 2QRLA 4WNIA 3IE0A 5DH9A 4ACAA 5A4FS 1S02A 4RZIA 2O59A 5LP1A 3VO9A 1LUAA 1AMOA 5SZJA 4R54A 3UXEA 4ESHA 2PMWB 3KT8A 1Z45A 1Z17A 4L07A 4V3CA 5BNTA 5HF6A 4WPGA 1J1IA 3Q9LA 2O06A 1XAHA 5MHTA 2DF8A 2VPXA 3CKYA 2XXJA 1Q83A 3PFBA 1NLMA 5EXEA 2QVYX 3P4YA 5DO9A 1JMYA 1R6DA 4KXYA 5G4KB 4BATA 5ITVA 2VHVA 1Y5IA 3G7SA 4XFJA 3EZFA 2R4QA 1BCRB 1Q92A 2PV0A 2ZK7A 4GPEA 4AO6A 3ROZA 4HS9A 4S05A 3QENA 4DCGA 4DVJA 1ND6A 3VHXA 2A86A 3KYJB 2ZUCA 1WO8A 3NTXA 1BEZA 5AI4A 1V3TA 3PRHA 1FLNA 4KFRA 1YV9A 3NEJA 4FYIA 3W8RA 3PEEA 3A6KA 3LYHA 2Z9CA 1K8QA 2DSTA 4NULA 1XEXA 5HGXA 3SMVA 2B0CA 3OMLA 3Q0TA 1QYCA 5KX5F 5LXTF 3OQMA 1GPLA 1IU9A 3NWEA 3G1UA 1V1MB 3TKYA 4N6GA 4NQZA 3W3AH 3MEQA 4QGAA 2XQFA 2QUJA 4A4DA 3TOZA 4PZDA 1BKSB 3DTVB 4UW9A 3IO3A 2XB4A 4BN5A 2FRVA 3OPVA 2BGUA 5BSGA 4OEHA 5I7UA 2MDTA 2PWPA 4JUFA 1W87A 2ST1A 1S01A 3OPNA 3S27A 1G4HA 4TVKA 4KO8A 3GJRA 3JTEA 3KALA 4KQEA 2OHIA 1UM9B 2G40A 5JXJA 1NG1A 5BWCA 1EWKA 3E3OA 4U2CA 2LCFA 4P84A 1X8KA 1T6BY 5CP8A 5ELMA 4EQ6A 2K4MA 3SX4A 5HXAA 5JQGB 5AUOB 1PR9A 3BZBA 5AMXA 4YT5A 3TCXB 3WMEA 3CIFA 4V0LA 1K06A 1HQYE 4U7PB 1E1RA 1KSFX 2QLJA 2ZLBA 1M1XB 1TYEB 2MIIA 3JYNA 5JCOC 3LOPA 1LI5A 3UJPA 1XQVA 1YQTA 2DWQA 4REOA 3ROFA 1TAGA 4RZ2A 1T0JB 3UW1A 5CH8A 4GOND 3VGJA 4BMNA 1LKZA 1EH5A 1WUIS 1XTRA 3IPXA 2DBVO 3JCZA 4M54A 2BKUA 4UE3S 3VA7A 1M1YA 1O95A 1QVAA 4E5YA 1TJPB 1RZRA 3FETA 4LSWA 1M0WA 1FJHA 3ZQUA 4G9BA 4PHGA 4R9SA 5DBIA 1UMCB 1JJAA 3P4UA 1X1TA 4EVSA 1GGFA 2XD4A 1EESA 4MR7B 4F4HA 1M6WA 1SUWA 4L6AA 1UKVY 4X1KB 5JTUA 1BNCA 3GUUA 2V54A 2C61A 2Z4TA 1E1RD 3GVHA 3DVRX 3LDFA 4LVCA 2QX4A 4PBRA 4L5JA 1Z07A 5ALEA 1H05A 1PKXA 5HOQA 1T1IA 2BJHA 1F9AA 1SBNE 1ZCAA 2WIFA 4JVNA 4Q9HA 2IEZA 3Q12A 1B8PA 1M54A 1QKIA 3CR3C 2BP7A 3U7FB 1KIFA 3K09C 1ZD4A 4NBRA 3AEQB 3AT1A 5FB3A 2GETA 2OQ2A 5FUBA 4O8CA 4DJEC 3WGJA 3IKTA 1ZJYA 1NXXA 3QOFA 4UU7A 1FMTA 3BFJA 4I6JA 1DBSA 3HU2A 4UJ5A 1G20A 1W85A 2B0JA 3RB8A 3J7AC 4B3RB 1ZBDA 3GP8A 5HW0A 3Q2KA 2CXUA 3PUJA 1BEUB 3B82A 4ZO9A 1PR2A 1G42A 3I39X 4O0LA 1JS1X 4HYQA 1V6CA 1LTKA 3QUSA 2GEUA 5IBCA 4LNHA 4K40A 2C2HA 4B3IA 4GEGA 4CMCA 2WKPA 3VU9A 2GF2A 3JAMA 2QRQA 3GBVA 3SYTA 3BXGA 4K03A 3AKDA 4XOUA 5LJIA 4PSVA 5TNXA 1CHNA 2QENA 4TV8B 4HV4A 1N6HA 1UM9A 1PGNA 1US8A 3C87A 3K1AA 1PHRA 5JATA 1NJSA 1YZ3A 1PN3A 1I30A 4NU8X 4G8DA 1G4AE 4C3ZA 4YRAA 2CXNA 2UYQA 5DBOA 5BSMA 4BLTA 5FL7A 1N78A 4PQYA 1TVKB 1BXKA 4J16A 1RI1A 3M1IA 4MWDA 1A5ZA 1Z4QA 3T35A 4Z7QB 1AKUA 2B9VA 1EFUA 3OP1A 2ZBGA 3NTVA 1XEWX 4BNJA 1MRZA 1XRNA 4G5GA 3IT3A 3OOHA 4AYTA 1TD1A 2FPUA 4KR0A 1K08A 4M1KA 2XUFA 2QBYA 3OVMA 1C50A 4YCLA 3G2KA 2IWHA 2JHCA 1EVKA 4L50A 2OV2A 5DYGA 4A0GA 5A2GA 4PLVA 4OK5A 3BGDA 4YYEA 1TAHA 5K0GA 2YIDA 3VKFA 4O1HA 3TQQA 2EXXA 2G9NA 3ETJA 3IXQA 4O2AB 2OB1A 3EBLA 1U2GA 1E4OA 3LUHA 2ZTLA 3E61A 1UQUA 1T29A 4GPBA 2P62A 3QKTA 4KI7A 4L02A 4XM2A 3KB6A 4N48A 3O92A 3TRKA 2QR2A 4EA9A 3ASYA 4HDRA 2IRWA 3BN3A 3O93A 4J7CA 2BM8A 5CRIA 1VHDA 3CZ5A 1YIOA 1L7MA 4KDFA 1PR1A 1OV6A 4XA8A 5AP9A 4UTZA 2P9HA 3NS7A 4DY6A 2PM8A 1UC5B 1DC3A 3A4YA 2IQ5A 4MVWA 3AERB 5DSZA 3QJGA 3WL3A 3JYOA 3LLSA 4QYTA 1FFXB 3HDYA 1XXHB 5JPDA 1GDHA 4LYGA 2FA9A 1W8DA 5L3RA 2FMXA 3AX6A 5DWDA 4HWGA 3VVLA 5HMLA 1UDBA 4ON9A 4PIPA 2YHAA 3G5UA 2X4DA 4O4JB 5H82A 2WV9A 5DGHA 4KYVA 4IH9A 2R25B 4N5HX 4RDXA 1CUHA 1X2EA 4CMIB 1A2BA 1ODSA 2WNIA 2ZAOA 3CUWA 3BIWA 3DXXA 3ED1A 4JP5A 3RUPA 3EDOA 3R0ZA 4HPJB 2TMKA 4OJKA 5DT2A 1C2TA 3NVKI 3VX4A 1PUIA 3PC8A 1FFWA 1HRKA 1BXGB 2AMLA 3GZ4A 1DEOA 1HTWA 3EN0A 4IOLA 1MC4A 3X3HA 1KY2A 2G88A 2NU7B 2E49A 2XYHA 3HYCA 3OE7D 1UPBA 2F90A 4K8OA 2FW9A 3K1JA 3INRA 1SXQA 1DMRA 4GAEA 4EYQA 2ZIGA 3BK7A 2JH8A 3OCYA 2R11A 1I14A 1OFGA 4COOA 2EJTA 4D9MA 5A1JA 3OQ1A 1GNLA 3V1MA 3QFSA 1MENA 1V0JA 3QQPA 3AVUA 3PHIA 2QR5A 3Q6MA 5IHPA 4AECA 5JAOA 4V0SA 2WJYA 1Y8QB 3FMVA 3H8WA 4UEKA 2VQEB 1IB6A 2FLKA 1V4VA 4WXRA 1QFZA 4KU4A 3B6ZA 4Z4QA 3QX7A 1GKLA 3WBFA 1QPZA 2F8SA 1UWCA 5ALIA 3UKDA 3WQRA 5HKLA 2PUDA 2UXBB 1DEXA 3H13A 5ANRB 3U9LA 5KC9A 3HSYA 2VHEA 4M8SA 2V7BA 1ICEA 3FDIA 1W5TA 5ULLA 3C6YA 5DIFA 4YV1A 1ENZA 3L7KA 3FYHA 1DU4A 1NC1A 3KYDB 3NHYA 4IWNA 2WY2D 3U7JA 4D98A 4TMVA 1PWHA 3MCAA 4XPIA 4V1CA 3ADBA 5FBHA 1JKFA 3CWCA 1LDYA 1JIIA 1ML4A 2PJZA 3HR8A 4UULA 3U3OA 2OO5A 2GEJA 1XVTA 5G4LA 4IDNA 1FXWF 2BEVB 2PGLA 3HZRA 3KR1A 4Q01A 1VJTA 4WUVA 3F7TA 3X1MA 1C7IA 2GZ2A 5AQEA 5LZ8A 2H7VA 5AOCA 3O4FA 5ADVA 3IE1A 1ISSA 2A67A 3BBLA 5CB4F 1AN9A 2OWDA 3DDOA 4BTEA 4DDMA 5DM0A 3SQLA 1BRTA 1FDRA 1PJ3A 4ZQGA 5E9WA 1PX2A 5EEHA 4I9FA 1ZGZA 5CB8A 1WXGA 1R6TA 1CUFA 2OZVA 3OT5A 5B36A 1UADA 2VJBA 3CCFA 3Q98A 3SEQA 3EA4A 4CNQA 3AF0A 4PXAA 3ZHZA 3B5IA 3DR3A 4FR0A 4EUFA 3SKXA 1PVVA 2WBLC 5IK2A 4DUYB 3TIVA 3IC5A 1C0EA 4PRLA 4RORA 4KVFA 3K20A 4B75A 1VQ1A 1LF5A 3HYLA 4S35A 4C07A 5I8WA 4L7QA 1N5DA 1X7WA 2G7MC 4NFYA 2P2DA 4EI8A 5BN4A 5CFZA 2ZJOA 3GEHA 4H15A 4N6OA 4Y18A 2ZT7A 1ZI8A 3C8DA 1XZ8A 5CLGA 4ER3A 3LE8A 2Q27A 3QU7A 4ENWA 1XLVA 1RLJA 3GIWA 2WJVA 2NV2B 4TS1A 3CH5A 4W8OA 4ZVMA 5H7XA 1ILWA 4B0OA 4IBOA 1XRLA 4Z9BA 3MAAC 1FYEA 4RD0A 2WEKA 3HK2A 1M72A 3K96A 1O8BA 5KYTA 1U02A 4IKPA 3OSZA 4LJSA 2RGXA 4JBGA 5EIBD 3MSXA 4GG1A 1UBSB 1J0EA 2O50A 3MMSA 4D4HA 3BQ9A 3U1TA 4KXFB 1Z0FA 1UBNA 4Z0NA 4X3CA 5C8YA 1XVVA 1T0PA 2XT0A 2CK3D 2NZUG 4RIEA 1P1JA 1K66A 3MGCA 4H7DA 4AY4A 2ID4A 2ZIXB 4D0GA 4EX7A 3PLAE 3MJCA 1W59A 3NO4A 4IIXA 4WUTA 1FXSA 3NAMA 1IONA 3RSSA 5K0JA 1DAIA 2NZYA 1RXYA 5J59A 3JQFC 3O75A 2VRBA 3GG9A 5IEJA 3BGIA 2H2WA 2G08A 4HEHA 1EVYA 4MLZA 4MW5A 2MINA 4E22A 1KZHA 1ORIA 2OB2A 2BEKA 3TFOA 1X80A 2Y0BA 1K6XA 1XJ5A 4J7XA 5LYJB 1RRPA 4OXRA 1F8UA 1HTTA 2XYRA 1LPSA 1WIWA 2XSZA 3TUIC 1MU0A 3BDIA 3T3IA 3O5AA 1SCDA 4M1YA 4NNOA 1SUAA 1KYXA 1U1EA 3BXEA 4EA8A 1J5PA 5BY2A 5JMTA 3SVLA 3ZY4A 1F7VA 3GAAA 2DH6A 4J4BA 2WM8A 3AVYA 1F2VA 2GESA 4P4SA 2NV0A 4HQ0A 3K9FC 1QGED 4OHPA 1PJBA 2OHVA 1NWHA 3QEKA 2B4TO 2ADOA 4IXTA 4OBEA 3AZPA 3SS8A 4UAVA 3KE8A 1E3WB 5IKMA 5DTIA 2VBCA 2H00A 2C5BA 4HNSA 1T3ZA 5IC6A 4W5WA 4WA7A 5CB4A 2X2FA 5AVJA 1QVZA 3BTOA 2PD3A 2DECA 4R2JA 2WINI 2ECOA 4NCIA 4YHHB 4RV5A 3D1JA 3GGPA 2HMUA 4K5QA 5K3OA 1R3UA 1AKRA 2F6RA 2JDID 3TLJA 2I4TA 4J49A 4ES6A 3ADPA 1W1IA 4W5RA 5AOAA 5FI5A 3U5TA 1QV7A 1S2LA 2BFOA 4FX2A 5IT5A 2IHVA 5JNLA 3ZNQA 3TZ6A 3AJEA 5C4GB 2AZXA 1EDEA 4A0QA 2C3PA 1N75A 4Q1CA 4A1OA 4DQXA 4LPKA 4UD6A 2CY0A 3D8HA 4ARIA 3TX6A 2OHJA 1DJPA 3DKVA 4GI5A 5AW5A 2VHQA 2ZIEA 1Z4LA 3GLGE 3TDKA 1G5FA 3LW8A 1XWWA 1JFTA 5BYAA 3FA2A 3OQIB 1Y1TA 3KEOA 2JFFA 4QL3A 1N2OA 1NUUA 2ZRCA 3CW9A 4KJXA 1ZRSA 3AUYA 3DO5A 3IUEA 3SC6A 5BOSB 3TFQA 2OK8A 1USGA 2ZSEA 3CZMA 3VR3A 1XN1A 1BFUA 2YS7A 1XPUA 1U0FA 2AF3C 3HO8A 3PTZA 1X7DA 2P0YA 1WZIA 2P4SA 2YV1A 4UARA 3A06A 5LBTA 2C95A 3PL1A 4RKQA 1SUIA 1E2QA 1OZ0A 1IZ7A 1YTLA 3FI0A 4BNXA 2CUZA 2BTQB 4H08A 2PANA 1SBTA 3ZY5A 5KJCA 1NVBA 2PTGA 4H16A 3OAAD 1NV9A 5AI6A 3HG7A 1JLRA 1GZUA 3AYZB 4TRRA 2CF5A 1OA0A 1KU0A 3EDQA 1LSSA 1UM8A 3N2KA 3F7MA 4UXIA 4KVGA 2EGGA 3U3DA 1PJ2A 2G1JA 3ESXA 4P4GA 4EHDA 1VI5A 3N70A 2OUIA 4FBGA 3GCWA 4I4LA 4GKJB 4KXVA 3PE6A 5H3LA 5T64A 4HEJA 4EGAA 3THYB 4E51A 4IHQA 1UBHS 4DCOA 2HHLA 4KYUA 2M6SA 2Q8QA 5KTYA 4FSHA 1LX7A 2JAUA 1UC8A 4IP0A 1ZR2A 5HS6A 1MJNA 5G40A 4NP6A 2JATA 1LWOA 2JIMA 4G0MA 5FPSA 1O89A 3OUTA 2FSHA 3QVSA 1NVMB 1HT1E 1UXOA 2JAQA 2PCLA 2Y27A 2Z6QA 4EY8A 2BGGA 2Q1WA 5HK9A 1JH8A 1KRHA 2BHNA 2WHPA 4QBIA 1TECE 2BFCA 1E3WA 1KK1A 1R4ZA 3AESB 4X85A 4LVUA 2Q7OE 1H8EA 1QR2A 3FMFA 3NHFA 4AO7A 2H0QA 3VR1A 4C21A 3LT1A 4MQMA 1ZMOA 1OTYA 2TSYB 5HKAA 1L7BA 1MEEA 2GYWA 3UENA 4R84A 1MX9A 3HO1A 2VSFA 2DPHA 3OJWA 4WXPA 3JVIA 2AKAB 2FZGA 5JAQA 4L0CA 3L7BA 1QAOA 4BP9A 5AT1A 4GLLA 2H1OA 3TZCA 5A3RA 4F9TA 5I01A 1V8DA 2W83A 1XCJA 3DOIA 5AM3A 1T9AA 1AS0A 1B6TA 2YXEA 4MLDA 5EZSA 3SBEA 1C7QA 4Q02A 2YYAA 1PL8A 1INLA 1FRVA 3S2FA 3L9XA 5DTQA 4URZR 2OCBA 1Y98A 3EHDA 3DMPA 1E2UA 3B3QA 3KT0A 4NF2A 2GEBA 2HJRA 5AR1A 1GSIA 4RV9A 3JASB 3HLTA 5KJFA 2HA6A 3GVXA 4AUEA 1KEPA 1BWSA 4WLFA 1IQUA 2IY9A 2VDKB 2CN1A 3R9KA 1ZH2A 3OSUA 2Y67A 2X0NA 2G0NA 1B4DA 4FN5A 4M0PA 1TMOA 3SQDA 1RTTA 1M67A 1XVLA 2F43A 2EJUA 1E2MA 4O33A 5F4ZA 4B3GA 4Q37A 3ESZA 1A1SA 1SVKA 2B8TA 3JQ9A 4W7SA 1CUBA 4DG8A 3CVOA 1EA7A 1NUTA 4XTCS 2I6QA 1XD2A 2JH9A 1CR4A 2XUHA 1EE1A 2CFSA 1OH5A 1L5WA 1Z7WA 2NNLD 2VP4A 4KZKA 4WN9A 4MW6A 2ENWA 1XTSA 1PYDA 2ACWA 2ILTA 4MKFA 2GCOA 4NRDA 1AB6A 4JASB 2A88A 3MW8A 1KYWA 5A3VA 1D9ZA 1IQPA 2O0LA 3GP5A 4JB8A 2AX4A 2N1MA 5H1YA 1PWEA 3T54A 2MT9A 3TPFA 4MUIA 1JLLA 2COKA 1QDUA 1E5DA 2I34A 2SCUB 4HQKA 4JLUA 3TTVA 3UWKA 2D1YA 3T7TA 3FWKA 3K30A 3VPAA 4G1MB 1Q7TA 3IMKA 4FZ3A 2HCRA 2IF2A 3EAFA 5TT0A 4EENA 3I9KA 2BONA 3EXFB 1DG1G 2ODPA 2OUKA 1QCYA 3F74A 1JR3E 4YROA 1QO0D 3ZZ1A 4QXAA 1BGWA 3T3EA 3K0BA 4OATA 4CG3A 1ZK3A 5GMOA 5J5CA 1ONPA 2J3KA 4YJ2A 3FTPA 1VBFA 4RJKA 2LVBA 1J0AA 2HIHA 5K9ZA 2GK4A 1FLDA 3JV7A 1E0DA 2ZU0C 4ASUA 1Q6ZA 3SSOA 2EG5A 3TSWA 3ILSA 4Z9FA 4CM8B 3PFCA 5CIQA 5HILA 2XWQA 2BELA 2B4AA 1MRSA 3LRTA 5ED0A 2FE4A 2GAFA 1XLUA 3O9ZA 3GN2A 3WR5A 2R7KA 3QRWA 1T5HX 2G1UA 2H6EA 1JR6A 1D8TA 1I2MA 4RK7A 1DELA 1SKBA 2GN6A 2O23A 5CHEA 5F12A 3AHGA 3N0WA 3OC6A 4NU0A 3UAOA 4EY4A 1YONA 4UFNA 1RBZA 1SCUB 1WVMA 3HZOA 2GPYA 1GLVA 4DAEA 4FGLA 2HZ7A 1YMUA 4B3XA 3MTGA 3ICVA 1CDEA 4YIKA 2XGOA 4ZAFA 5GINE 4FFBA 4L8YA 1IMOA 2B92A 1H2AS 1N5RA 2XYGA 1WMBA 3ZGLA 1NT4A 1W6UA 5J23A 4NABA 1NSTA 1B42A 1K7YA 1YJCA 1ZLXA 2QTRA 3COYA 3BD9A 3HJUA 3EGEA 4BKQA 4E12A 2N47A 1W29A 3E6AA 1LCIA 1XZJA 1E9FA 2ZYVX 3D6UA 1KMQA 2QPAA 1C1YA 2Z8XA 3DVQX 2VT7A 4Z4HA 2XNDD 3CZQA 4ML3A 2C03A 1D2EA 1Z4KA 2XTJA 3G3EA 4KN5A 3SYMA 5LLDA 3O3CA 4FZVA 1I1NA 3OZFA 1D2RA 2B37A 1Z28A 1ZM3A 3PFHA 1OR8A 2JG3A 5FORA 3NCHA 3GAMA 3OTHA 3VKHA 2C84A 1PTJA 3H4IA 4IY1A 3HO6A 2IEIA 1G8YA 5BSEA 1CIPA 2XIQA 3PHHA 1VYUA 5HKKD 1OGYA 5HJ7A 3KCQA 1G2IA 2E82A 1C0LA 4FP9A 4MDEA 2HK7A 4RFSB 3T4EA 1MNAA 4N0MA 4B79A 5I7VA 4FEAA 3K4HA 4PGHA 2IPAB 3P2OA 3MWKA 1L5NA 4KXQA 4BB5A 3LX6A 1FFSA 1VBMA 2QTZA 4BQPA 3H18A 4Q3BA 4IIUA 3AP3A 1KJYA 3FHOA 1YL6A 3FWYA 2NW6A 3MQ2A 3X0DA 1GD1O 2ZRBA 1NVAA 1NZJA 1RKUA 4DE5A 1Z35A 4GD3Q 3LPNA 4LDQA 1Z2DA 1ZW1A 5LKAA 1EP9A 1Q0PA 4NYJQ 3K70C 3THRA 1KR5A 2PZJA 3LWNA 5EUBA 3TLKA 4GP7A 4MRMB 1PLJA 1U4NA 1YRAA 3KO8A 3WLHA 4PLCA 2BP7B 3FUUA 1FRNA 1YQWA 2Q5IA 4BRWA 3I62A 4C7VA 4JC4A 5I7SA 3N6XA 4PO3X 2DM6A 3VNVA 1V2HE 3T6KA 2HHCA 5HUJA 2GCIA 3NC1C 1T5IA 1FDWA 2GJSA 3A3YA 3S2EA 4ABTA 4DIUA 1P29A 3RK1A 1XSEA 2C9YA 3PUIA 4DEXA 3D64A 4JBWA 4OQLA 4X3PA 1PX0A 1ADFA 2FJUA 2MYTA 3V4FA 2KB0A 3OY2A 3B3AA 3LXRA 4R1TA 1VLZA 4RMIA 5IC5A 4ZGGA 1Y3IA 13PKA 1ND5A 1KFJB 3LQYA 3Q10A 5KS2A 1UT5A 2GHIA 2GM4A 1Y5MA 1DOHA 4H1WA 4PANA 1E98A 3PQ2A 2HK9A 5E6UA 2YINC 4DJ5X 1X42A 4X8HA 1D4AA 3BWMA 3SBDA 3LY5A 1HLPA 3STHA 2R7NA 1S7GA 3FWPA 4TV8A 4CQNA 2I4OA 4NBSA 2AXNA 2WIJA 3SF8A 2O2JA 2P40A 3CLSC 1IZ9A 4L57A 1E79D 1DHTA 2WVJA 1Z7EA 4MTCA 1AXEA 4PCAA 4PQFA 3DLIA 5T4BA 1I4OA 4A8JC 1Z0AA 3EQ2A 2ZYTX 4KXNA 5L6MB 1O97C 1DRVA 2GM3A 2G71A 3G2MA 2QTBA 5JNSA 3WRWA 2V55B 4H0FA 1XEWY 2FDRA 5CDGA 4B44A 2OV3A 4BCDA 1F8FA 4FDLA 4L3VA 3ZE9A 4G4JA 5AI8A 3HFGA 2JC3A 2Q3HA 1E2BA 1BE6A 1TYAE 3NTOA 1XF1A 2C3UA 3H9BA 3RVMA 1TCAA 3VR5H 4ZK2A 3AR8A 3PR2B 4WX2B 1XN4A 4TN5A 2DKFA 1RYBA 3T99A 3DFIA 3L1JA 4RDIA 4I1VA 1E7QA 4X7BA 1VL5A 4OM8A 4EEXA 4L9WA 3VU3A 3O8DA 3BD8A 5IN4A 2ZT5A 1JFLA 1ATIA 3MVEA 4DRYA 4MV0A 3VC2A 2WILA 1UFKA 4RHTA 1RQLA 5AVUA 4PC6A 2V65A 5LWHA 1FP6A 1EYZA 1Q3TA 1ZA2A 3RV3A 1R4MB 4KKVA 3B9BA 2PT6A 1NUSA 2ZULA 2OG1A 4M1WA 4PZYA 3RROA 4IGIA 3C8MA 5A4JA 221PA 1YA6A 4E6EA 1XDDA 3F9IA 2Z6UA 3DJFA 3G59A 3LDHA 3HXKA 2WYHA 4TTVA 1X8LA 4R1SA 5EL0A 1AO0A 5ARDA 3NXKA 4R8VA 1LZLA 1K6JA 1QU3A 5J2TA 3THXA 3PWZA 3HN7A 4UBOA 1J9GA 1EXMA 1RHQA 4N82A 3TTYA 1DNPA 4WL0A 5K0LA 1KHHA 4JHXA 1HOTA 3ANLA 1KZ9A 3USES 1NP3A 4WI1A 1N6OA 2JZOA 4F06A 2HH9A 1SULA 3N3AC 4IDPA 421PA 1N5OX 1A7KA 1V5IA 3I09A 3JWPA 4G0QA 2AOVA 1X1BA 1C7FA 4KFUA 4U2EA 3TF5A 1IJFA 1NI4A 2VXBA 3GJ0A 3RYTC 4AJJA 3LCMA 1HC7A 5E3HA 4L08A 2QLNA 1FPMA 2D2XA 1Q1QA 1THGA 3IEIA 3DMTA 3SX2A 3GBPA 3VXKA 4B4OA 4Q4AA 3G7UA 2FG5A 4DQLA 3FGZA 4IGEA 5K05A 5LIRA 3UB2A 4C4ZA 1DZIA 4RW0A 2POQX 3RTDA 1NXSA 5EJIA 1ESDA 3HCEA 2FP4B 1A3CA 3EAGA 4ARVA 3FH0A 2FPRA 1Z0UA 3OJLA 4ER7A 1T0HB 1G19A 3L8GA 3MS7A 5LLTA 3UB4A 4MGYR 4C4PA 4DLYA 4FDAA 4DR4B 4TKVB 1IDN1 1P1KA 1C3OB 4GE3A 2VDUE 4NCJA 1E58A 2PSFA 3UFBA 3H2ZA 2IY8A 1TZKA 2FPKA 1U7XA 2VJDA 2VOEA 1MG5A 3GVPA 2PBFA 3IV9A 5AJHA 5EUMA 4QEKA 4KPUA 4D3DA 3JVEA 3SZ3A 2RH9B 3CZRA 4QT0A 1DJMA 3WGGA 1HT0A 1HQDA 3IOEA 4DN6A 4NH4A 1XTQA 5A02A 1AV7A 3TR0A 5JUWA 4NFLA 1OBFO 1PSZA 4WKNA 5K8VA 2L82A 3ELUA 4HQLA 4IX1A 3H2KA 2QI9F 2W2KB 1IATA 3DEKA 2PGIA 3I72A 3LVRE 3QKIA 1QUEA 3T5PA 3IESA 1EFLA 2JLQA 1HYQA 4RPCA 1P61B 2QX8A 2XSZD 5AVXA 2ZXUA 4OOEA 1E1QA 5KYVA 1THZA 3KM0A 1L4HA 5JSUA 2OMEA 3K05A 2NUAB 5CK4A 4XIYA 4URWR 4E5MA 3PPIA 1M2EA 1JMVA 2NADA 3LPAA 4GL2A 4N3NA 4FDVA 1I3KA 4KNWA 4H1TA 3M49A 5DGDA 4WT7A 2ZTVA 2P2NA 4NCBA 1ENOA 1A9RA 4B4UA 3EDYA 3ZCTA 1WZEA 1QYXA 3P32A 2QX6A 1TEHA 2VHWA 1GNPA 2VRCD 2QZSA 3DTYA 3M2TA 4FSXA 4KPGA 2WU8A 3F3YA 2HJHA 3GEIA 4BPRA 1S9DA 5EKDA 4EKNB 5I4KA 5LXTB 3QVOA 3QHAA 4QPCA 1RFLA 4YMLA 4ZT4A 2OM6A 5F3WB 2MWMA 4YJ2B 1DI0A 3L8HA 1I3CA 1T4CA 1SG6A 5F73A 1X9GA 3QKWA 3P19A 1ZP6A 3W1VA 1N7JA 1OWLA 3P1JA 5FWDA 1T34A 2XCLA 1Q91A 4W9NA 3DZHA 1C8KA 1UPFA 4CL0A 4PFJA 4D02A 3MCWA 3EFEA 2FW8A 5CAEA 5CIYA 3ZY3A 2HBZA 2J3IA 1O6BA 1NMEA 3HRKA 3HVHA 3ZCRA 3ZDCA 2C8JA 4TMYA 4LMPA 2GBLC 4LFBB 1NE2A 4LOAA 4G0YA 2QD1A 4P7JA 2ATIA 1CZLA 4WKBA 5BXYA 2H1VA 3MPOA 4BQQA 3QUAA 4UASA 5L4LA 4HAOA 3PNSA 3P9PA 2F8TA 4JELA 3KAQA 1MO3A 1ZGBA 3W2IA 4LRYA 3VVMA 2HYDA 2O5EA 1U1IA 2D1SA 2JW5A 4OK3A 2O3JA 5I4BA 1L1QA 4HCJA 3RS4A 3K5PA 4GHWA 1R6UA 3E2IA 2B4RO 2PR7A 4XCXA 3FTEA 5DDIP 3VZCA 4KLRA 4OYYA 5K0CA 1H4SA 4RFLA 4RY0A 1RD4A 4YCBA 3WWCA 1XJWA 2WA1A 1YACA 4LRWA 4MKGA 4M7WA 1IXKA 4WECA 5CCXA 1XO1A 4GM1A 2MSLA 3QH4A 3TQFA 2YMQA 3IQDB 4P38A 2J3HA 3WFJA 4OQPA 2JAXA 4P7GA 2CYAA 4KODA 4RTLA 1I1OA 1N5IA 3MOSA 1XQYA 3BXFA 1VHLA 5H3CA 4JJKA 4Z4GA 3W8DA 2LWIA 2G1KA 5G3YA 4EO4A 4M1QA 2MTBA 5ADHA 2IEAA 2IHJA 2D74A 3DCNA 2A1UA 2CMGA 2R62A 3EIHA 4ND1A 5K4AA 4EJMA 1D1SA 1GNVA 3VNSA 4BFZA 3PHGA 5B3KA 1JHPA 3OX3A 3RJMA 4JT9A 3VKVA 2IYRA 1CD5A 2JHPA 1YZGA 1HNXB 4L15A 2IS2A 3PHBE 3PCTA 4HWSA 4I9UA 4WK6A 1NN3A 2HJVA 5ALZA 3UUFA 2VYCA 3WMXA 2EFGA 2MYNA 4WZBA 3VH3A 1GARA 3SC4A 1M9NA 3UMRA 1ZKMA 1NBOA 4ZHQF 3L9WA 4WLEA 5ALYA 1SHTX 3GGOA 1IN4A 3VPCA 4QULA 2EQ5A 3IVAA 4WD3A 4F91B 5J47A 1RXUA 1E63A 2CFIA 4Y2QA 1VCMA 3INGA 3ZGVA 4FEEA 1UDCA 1YHNA 4LGMA 5LA6B 4N7BA 4QNMA 3DOCA 5FRDA 4KCGA 2I66A 3IOCA 2FX2A 3Q3IA 3N6VA 4G3XA 2ZE5A 1KEZA 1RI5A 2G6TA 1HLGA 1JIUA 1WV0A 1Y3DE 4TSFA 5F1OA 1ZM7A 3Q2IA 4GPZA 4PYJA 2Z56A 1WW2A 1U9IC 5IP5A 1NVVQ 1OWNA 1JP7A 1KEKA 3MQ4A 1YZHA 1O95C 1Z83A 1FLVA 4U7WA 1Z5UA 4NENB 5H70A 1RMYA 2JGKA 5GY7A 2DC1A 1JV2B 1II8A 2YZ7A 1NOKA 3MERA 4L76A 2JFPA 2B21A 3EY4A 3FDZB 1H2HA 2FOLA 4TSRA 2LKDA 4D4GA 3W5BA 3HWX1 3OMWA 4B7XA 3NDPA 1X94A 2F7SA 3U37A 4R5HA 4OH7A 5IAEA 1A77A 4K81B 2BGTA 2ZB2A 5TQVA 3ICOA 4WBXC 2AVDA 3U6KA 5BMVF 3AL0C 3PXUA 1XPJA 5BR4A 1IXYA 1G8SA 1NOJA 1VYTA 3R24A 4YONB 4C20A 4EKDA 1JAHA 1KVRA 1P77A 1RRVA 4IVPA 4HBGA 1N0VC 3Q6IA 4IZOA 4KQGA 4Q21A 5GAJA 4BV3A 1E3SA 3H3FA 2DP4E 4KO3S 3CZCA 4KN6A 1BVYF 2P2ZA 4IX9A 4FYMA 4J2HA 4K6MA 3A11A 4CIDA 5THXA 1JSXA 4ZVTA 3SF0A 4XOIA 4A0HA 4LJ7A 1H4VB 4UXJA 4PY2A 1CR1A 2WR8A 1W44A 2NSJA 2BMFA 1X0VA 4KIUA 4LZAA 4QOFA 1GSOA 2KMLA 3ECAA 3V8EA 5EZYB 4XX0A 2RG7A 4ZYZA 4V0ME 5BSKA 3ZXUB 1M5RA 5JBNA 4ZJUA 1AUQA 1JLSA 2E2WA 1MC8A 3R5SA 2GCOB 1U8TA 1ES9A 1F2TA 5THKA 5EIOA 4CN9A 1XTZA 4PYMA 2QIPA 2P27A 3KYIB 1YI8A 3LK6A 1XRRA 5CU7A 2FG6C 4CMKA 3ET5A 3ESAA 1W88B 2CB0A 3U4HA 1W46A 3EF0A 3MC1A 1M0TA 4ZK6A 3PKJA 4MR9B 1UFQA 3TNFA 5KQPA 3PIIA 4UUBA 5F4BA 4O4JF 1N2GA 2XB9A 2X22A 2YV2A 2FPIB 3P27A 3TW8A 1TUBA 1V5GA 4B3CA 3YASA 3L7YA 3HV0A 1K27A 3F8WA 3SZRA 1QORA 1EJ6A 4QFCA 3ZWBA 3I58A 4MVJF 1X86B 5LDDC 2EV9A 1TEZA 3K94A 4RA9B 3GUVA 2PZEA 3T1VA 2FSFA 2PUCA 4LV6A 4G9EA 2B6HA 4FZJA 1L5HA 1RWPA 5BR7A 5CDHA 1N4DA 2HLDD 3QXGA 4TWRA 2Y6UA 3QVKA 4AU1A 1Z4IA 5I9LA 3NR2A 3AOEC 3VISA 1O6FA 1P6QA 2IYZA 2JVJA 3KE9A 1QRSA 1BJRE 2GASA 3OKAA 2IXDA 1SU8A 2JFHA 3PUZA 3UMFA 2MSNA 3QFRA 2LDBA 4K8RB 2VDOB 2HOQA 3QXHA 1V1MA 2H0RA 3RTBA 2V0NA 4PQRA 1U90A 3FPKA 2QM8A 1K7FB 4JCOA 4RL6A 4BMDA 1TJ4A 2EWWA 2IH4A 2I2CA 5IT4A 3TXAA 2HIMA 3AKYA 4U8HA 2QSZA 1J07A 4I1PA 2AW5A 3G2IA 5DNDA 2BFDB 2F62A 1AHNA 3QYPA 4DPMA 4DL9A 2AA3A 4HX5A 2BMEA 4ECEA 4F4UA 1PZNA 1Q14A 5HM6A 3ADCA 5FNVF 3MTAA 4DLTA 5J2UF 3H1GA 2WPDD 2PBRA 2VH5R 1IWOA 2IU6A 1PJ8A 3A1DA 3PVCA 4UZEA 5ESDA 3SJAA 4AJ2A 1OH6A 3CVVA 2CVFA 4XM1A 1WTCA 1ZK2A 1H8HD 4X65B 1T1GA 2P6MA 1TW2A 3FCXA 1DFHA 4BNGA 4HSEA 2XMRA 3GPCA 5J4KA 1M6YA 4BKRA 3P2MA 1NMQA 5IU6A 5DLEA 3RVSA 3ODPA 3C4QA 5TJ9A 3L7JA 4X24A 3WJ1A 5CEJA 3JYHA 1DKPA 2HXSA 2HSZA 3TK1A 4D79A 2E4XA 2IYUA 5L3VA 3TVTA 1KEWA 1YZNA 3JWGA 4GYWA 2EX1A 2ZR7A 2JLCA 2FRDC 2H7YA 2XTAA 2A92A 1XCGB 5BOVA 2VOJA 3HZZA 1A4IA 4OB6A 1Y1PA 5FUWA 3QSGA 4EVRA 3EA5A 1FTWA 3EUWA 4M6WA 2P2GA 4O6VA 3EPKA 3CF4A 4RNDB 4Q16A 1GZDA 4IV5A 4OL9A 2P9GA 4NBVA 3GLFA 4BZXA 4CQMB 2IGBA 2J31A 2ZANA 1RAHA 2HWYA 3P4XA 5F2OA 5ALXA 4UTRA 4CEJB 3WNZA 1OH7A 2MHCA 3C70A 4UFOA 4LMAA 2ZI6A 4A8HA 1MJGM 3DFFA 3RD5A 4ED9A 1E77A 4ZVKA 3NP7A 4EFKA 4K6GA 4FB5A 2FR8C 1DUIA 1NN0A 2JHAA 2X2OA 3PGJA 5K51A 2OCKA 4BKPA 2QRVB 1UFVA 1D1TA 1EINA 2JCVA 3BRWA 4M1EA 2YASA 1E4EB 1C4XA 4BO1A 3D8NA 3HR4A 5HRAA 4YASA 1MBZA 1I3LA 4C78A 1UKBA 1R6AA 1E5TA 3FKQA 3LC7O 1IIBA 3DE6X 2DBYA 5SICE 3WRXC 2GPJA 3DOHA 2AVNA 5KOYA 1VP3A 2A9VA 5M29A 3R7SA 3URMA 3VOSA 1E6UA 2ZAYA 3NHWA 5FL7D 3W4IA 2G4CA 2UVPB 3HJTA 1YZYA 1GPNA 5CM2Z 3AIMA 4KL8S 2OGWA 4DIOA 3DMRA 1A50B 1UBCA 2O0MA 1NW8A 2HEIA 2P0EA 2Z5LA 4AZWA 4DDVA 2W9XA 4D56A 2J4DA 1DJLA 1T4CB 3KZXA 2G80A 2PIAA 3N9IA 3HXMA 2V5AA 4JLOA 4QDZA 1UEXC 4HLUC 3ADDA 4IJMA 2QTMA 2UUOA 3HKCA 4EG1A 1KAEA 2BF7A 1NJ5A 4MUNA 1OHHD 3T3OA 2I54A 3NAGA 4MHSA 2C9MA 3F6RA 1YB2A 5BYJA 3E03A 2ZRMA 3EXIA 1TF5A 3RO7A 4K6KA 5EWLB 5LA6A 3BF8A 3JVDA 2HDNB 3C8UA 3MPUA 4HTAA 4BE4A 1NXPA 1XRSB 4AMUA 4ZYUA 1DBWA 1ACJA 2A9KA 2GRJA 4GO1A 1QHHB 3ZVMA 4RNCA 2PX3A 1ODCA 2BFBB 2PLRA 1J7KA 2LUOA 2OYSA 2NXNA 1N92A 2Q5HA 3DPUA 3HN2A 4N49A 1YKGA 1VKJA 3OZWA 1LVUA 1U98A 2X5OA 3H87A 3MRSA 4GMKA 1CVLA 4QFDA 2QW1A 2WAAA 3AIOA 1KPGA 3C5VA 3GUCA 1X2BA 1LPMA 1OIWA 3QP9A 2CXHA 2FWNA 4NCNA 1VRCA 2AHOA 1D9XA 4HFNA 2GEDA 1JEDA 4LC1A 4DUZB 4RK4A 4Q3NA 3GQBB 5TMEA 2X8AA 1NJ1A 3GT3A 2YL2A 4ZALA 2NO9A 4A2PA 1TQ6A 3NPAA 2A7QA 2PUJA 1Z38A 4W6ZA 5CD9A 2ZQYA 1K6EA 4JZYA 5AI5A 1JHMA 5KWIA 3BXHA 4J3JA 1SBQA 1WUTA 1XNGA 1MJGA 2H7CA 1SD5A 1M2GA 2I2AA 1GFSA 2PL9A 3LTNC 2X5KO 4YRRA 4IIJB 4LHXA 4TS4A 3VPHA 4ANFA 2QRJA 5K8TA 1CZUA 1OLSB 3Q8KA 2C8KA 1DWUA 1ONOA 3E5MA 4B3SB 1I13A 3GJ5A 2ZI7A 4RK5A 5K0NA 3RYIB 4Z4CA 2DWOA 5B64A 4P3NA 2PWAA 1PNRA 2C5AA 5ALSA 4BP3A 1Z34A 4R6WA 4MS1A 4YO8A 3R74A 4ZCIA 4GDFA 1ZKDA 4V03A 2OQVA 2O7SA 1R0RE 1JJIA 1P91A 2XBLA 2L42A 4QUBA 5AK6A 1XKXA 4QHYA 3LGAA 4NV1A 4HPWA 3NP9A 4KQFA 1ZMTA 4XVRA 4I1SA 2J41A 2C0PA 1UFRA 2IK8A 3A6PC 1T5TA 3EPPA 2A57A 3RYHB 2EGUA 2MSEB 4PPYA 2P11A 1T9HA 2JIPA 1XE3A 4MQBA 5GP1A 3WQBA 1A7JA 3DOJA 4QVKA 1TM4E 2QN1A 4J6EA 1ISJA 2W71A 1GV0A 3C85A 1Z82A 5B12A 4MSUA 4IRMA 1OJLA 3U7GA 3Q2OA 1L4GA 2P2YA 3K5WA 4JVSB 2YCLA 3FOBA 2GLUA 1Q44A 3ELYA 2QNIA 2WHPB 2JS7A 3HXPA 4P4NA 1V8OA 4CYMA 2D1QA 2HIAA 2Z8YM 3L4EA 1G6HA 1NVUQ 4AJEA 1FFYA 3QFCA 4PCVA 4TWZA 1KRXA 3WLTA 5TX7A 3W4JA 3OZBA 3CURA 3E22B 3RJZA 4LF7B 3QW2A 2GFIA 5CXQA 2GVZC 2L19A 2VPQA 3FNBA 3LPLA 2XGJA 4RMNA 2WF9A 5DNVA 3OURA 3H17A 2WHYA 2DUMA 4OUDB 1E4EA 1J0CA 2Y8EA 3ZWYA 2WZQA 3IT2A 3L7NA 1XBTA 2AEFA 1NMYA 4O1MA 1TUIA 4HSGA 1HSZA 3MT0A 3CXRA 2JARA 4B2LA 3QNWA 4PBSA 4PYKA 1PF7E 1QYIA 1TJ3A 2OXRA 1FXUA 1SZDA 4GOOD 4RUKA 1V7ZA 3GBSA 3I2FA 5AFSA 4YRPA 1U28A 1AGXA 1PYGA 2V8BA 3TVDA 4Z53A 1NUPA 2J3DA 3EW9A 3QPVA 3LV8A 4JLNA 4WFIA 5REQB 5BNWA 1M6NA 1IEXA 2PAAA 4JR1A 5ER6A 3WWOA 4OLJA 4Y2TA 1QXSA 4C3OB 1Z0IA 2AOXA 2H4JA 2HDOA 2OGTA 1I2DA 2ROQA 2ZTUA 1POWA 4N7JA 4QUHA 3WYDA 3FYDA 4EOGA 4IMJB 2D59A 4OQZA 4F8JA 1ZCZA 2M1XA 3T1TA 1Y89A 2R5NA 2QG6A 3D4PA 2XQVA 1Y8RB 1JQ3A 1QNLA 3DA8A 4JD5A 1E9VA 3QA9A 2J7PD 2O2DA 2RGBA 2BFPA 3LCVB 2OYCA 5B3LA 1QRRA 3KBOA 1ECBA 2GBFA 4KLCA 4JCCA 1BCSB 4QM7A 4QECA 5LQJA 2HYIC 3B51X 1MX5A 4CCYB 1HZJA 3T7JA 5KINB 4L4ZA 3LHDA 3N2NA 3LKDA 3E7XA 3OPMA 2EVWX 1SQSA 3OLWA 4RHUA 1OGJA 1XFAA 1LDMA 1VM6A 4QJ3A 5G0WA 3C16C 2G5TA 1NSYA 1GPYA 1TVKA 2G63A 2WJ3A 2Z5GA 3EZ7A 4GMFA 1JXAA 4IHJA 5LQSA 3ZPXA 5ICGA 1W7AA 4RZHA 4F2PA 1MJ5A 1ESMA 1E8DA 1RWKA 5CM8B 5AKGA 5JXHA 2H2DA 1UJMA 4LGCA 4X6YA 2J5QA 5ERXA 4S24A 3UXHA 3KSAC 5ER9A 5IDVA 4M9RA 4RF3A 4QHSA 4QEDA 2Z8YA 5CURA 4JJFA 4AF6A 4EJSC 2X13A 2OEPA 4ME6A 2D2VA 3LWBA 2IP4A 2GZRA 1QGDA 5FPTA 4JFAA 4O3FA 2FDCA 4B33A 1DAFA 1DRKA 1MA3A 5ILGA 2CK3A 3R7LA 3EH1A 5JALA 1J9EA 5AKEA 3GRRA 2EWMA 5FUYA 2X4LA 3DT9A 5D86A 3SBXA 3RSZA 3WLMA 3CG0A 4ZTUB 4ZQCB 1KQOA 1H1DA 1YCDA 1AOXA 1E1DA 2WKQA 3AOGA 3OM8A 4ND4A 5THQA 1U8ZA 2QUKA 2XF8A 4JI1B 3ZI0A 3ZWKA 3HYNA 3FVQA 1P72A 1GLNA 4ID3A 4MS1B 5L3QA 4EHNA 3F78A 4MVJI 4BMCA 3N8DA 4HDNA 4YDQA 1U8XX 4OQYA 1L4BA 3K0EA 3RIHA 1MPTA 3D8BA 1P73A 3OZXA 4I6EA 1SHJA 5TQJA 5C5EA 3QBVA 3DC7A 3N8IA 3TEFA 3K70B 3PEUA 2QTNA 5CGZA 3ZVKA 4MR8B 2WKRA 4P3XA 4B80A 4L78A 1SK8A 2FAXA 1JAXA 1KVQA 1YNSA 2ON6A 3MIZA 1A8QA 2DFKB 1OB5A 3C7DB 3L79A 3EG5A 1FFBA 1KQPA 1M1YB 2FUG1 2OECA 1C30B 2Y1CA 4HG2A 4RAQA 2XMCA 3RBVA 1N2HA 4AM8A 3D0OA 3DZIA 4YEDA 2PS9A 3OCJA 4FFRA 4GLJA 4ETIA 1NVTA 3SS7X 5JZSA 2FN9A 4MS4B 5JNTA 4NDAA 5GZ3A 4TV9A 4TQGA 4P35A 4DVGA 5EY5B 5BW8A 1XGKA 2ABWA 3ZWPA 1ST2A 1AHHA 5I8PA 5CX1A 1YTUA 2AN3A 3AEUB 3S6JA 2E85A 4GI3A 1WDTA 3JZMA 3OU2A 1QC5A 5DNEA 3RBAA 4I81A 3WGKA 3O6VA 3FKSD 2R84A 3QEJA 5JSKA 3V1UA 4OYHA 3NDIA 4YVFA 1E3LA 4G1UC 4O5AA 4DLZA 4W9MC 2RHCA 4M9UA 4UM5A 2XB8A 1P4GA 4AKEA 4EA7A 4IG4A 1PFYA 3JRXA 5SZIA 2P9ZA 2P2SA 3VUFA 5JSZA 3CVWA 3ZDXB 2CF6A 1W96A 2O5CA 1P4SA 3PPYA 1CF2O 3QUTA 3E4CA 1WZCA 2QS9A 4IR7A 1RXVA 5EYPB 1RM3A 2V3WA 4W63A 5HR5A 5AK0A 2GK3A 2WLTA 4HAYA 4QQFA 3WLEA 2G9QA 1AH2A 3E9NA 1KQFA 2WE7A 4JYMA 2ZIWB 4ERXA 3HCDA 4NCAA 5H5JA 1S6YA 2EP8A 2PZLA 4MTLA 2AG6A 5EKTA 1Q74A 3VR6H 2C4WA 5KU1A 2VZ9A 5AHXA 3H04A 3BE6A 3B12A 2D0IA 3EUEA 1MOPA 1HYHA 2Q50A 1IVSA 1VPEA 2GTIA 2HQSA 2F1RA 5DP2A 2YYSA 3VOAA 1D3AA 3PVZA 3A31A 2GBLA 4OY3A 5HDBB 3IEXA 4H3HB 5GVSA 3FPFA 2EIXA 2P8SA 1QOPB 3E3MA 2V7GA 4PG6A 4I1UA 4C6RA 1SZCA 2EU8A 4BVHA 2WJ4A 1ZNWA 1Z6PA 4TOIA 2XNSA 3GA0A 3B8EA 1R50A 3DHYA 5FUQA 3GA7A 3MXOA 1WW3A 4UEOA 4S1PA 2AQ8A 4UTXA 3UBMA 5HUQA 2P78A 2ZU6A 4D43A 4R1UA 2J5RA 2PTHA 3M89A 3MJEA 4IJ5A 4DBLC 4HNUA 5LL6P 2A9JA 4D3ZA 1MT0A 3KDPA 3LUAA 1RJ9A 3EQZA 5EHXA 4CFYA 3T7CA 3AVVA 2XE7A 3ICQB 3R4VA 4JJ4A 4D9KA 5MFPA 1WD5A 2CFOA 3FZGA 1IHPA 4O59O 5F7OA 5IT9A 3IV6A 5IKPA 2X1HA 4FPXA 1FNSA 1G7TA 1B0PA 1G5IA 4JXKA 4DV6B 4RVOA 1EZZA 4MYRA 4B5LA 2FCRA 3HNRA 4R7GA 2B34A 2PGAA 3ORRA 3ER6A 4RVCA 4A36A 3THOA 5HS4A 4XWGA 1E2EA 5K6RA 2C3YA 1WM1A 3OBIA 2XPCA 4V3BA 4OYRA 4FMBB 1EDOA 1XALA 2J5KA 3GWZA 5D5PA 4B5KA 5GJVC 3FFAA 1KDRA 5JD6A 3ORHA 5BUZA 5F1KA 2DFLA 5KTRA 1XU4A 4J03A 3CRMA 3KUKA 4UEJA 1BAPA 2DY0A 4GSLA 4L75A 3MJFA 4B7ZA 2G06A 2YWCA 1NVVR 4G56A 4WESB 4AYWA 2A1IA 1AKVA 3WA7A 4BC1A 1ZIYA 1ONSA 1EBUA 1A9PA 5C1IA 5IABA 3K9CA 2CV0A 1CF4A 3IB6A 2C07A 5FLEX 1EJBA 1CUVA 3HS3A 4F12A 5L53A 3RWMB 3L0ZA 5J40A 1JKMA 1I01A 2B82A 4H9GA 4KJZA 3WNDA 2F3SA 3NWPA 3SZOA 2J0QA 2WSSA 2X4IA 1NQ5A 2VXOA 3KKPA 1JPJA 4J75A 4NSNA 4PVCA 1XCMA 1HSOA 3ZV4A 5T67A 5GIPE 1U94A 1GKUB 1MAAA 3TOXA 2IS1A 2ZROA 3RODA 2XD9A 1CY0A 3KSZO 2BEUA 1L5ZA 3TKLA 2XGGA 1J2JA 2FFAA 3ZHBA 4EGFA 2XXAB 4LX8A 4QGFA 5CVTA 1PFUA 1U1GA 1I6MA 2CLLB 4FT4A 4ALKA 2QTVB 3AB8A 1C0IA 1Z18A 4FBMA 1ZJ5A 3ZZTA 5DJ5A 1D0VA 5I8ZA 5BR1A 4GOLD 4Q4JB 1NQWA 4BNIA 2IPOA 4DNPA 1XZAA 2NP6A 2Z09A 3UCFA 1R18A 2HW8A 5JHHB 4NV3A 3HB5X 2CLEB 1D4OA 1VIYA 2H7XA 5D5QA 1O08A 3L6RA 2GJ8A 3NM6B 2H1WA 1VSVA 1XTBA 4MRSA 1N9KA 1W4BA 3CIOA 1WF3A 2QN8A 3H65A 1L5QA 4YS6A 2K2QB 5EIHA 1WHSB 1U3WA 4AJHA 4KDEA 5FWAA 4BJHB 1BROA 2QE7A 1L9KA 2J6IA 4PX5A 2W22A 4QXRA 5JWHA 2OQRA 2ZQZA 1T24A 3RK4A 3VC3A 4ZICA 3D3WA 1DBIA 2Y4OA 4XQGA 3GEMA 1XMPA 4ZARA 3CX7A 1TTHA 2AGVA 5BV2P 4C0JA 3OWHA 3E9DA 2AUMA 3EZYA 3CS3A 3JD0A 3T7DA 5JZ9A 1WKVA 3HCCA 3DBVO 5EKSA 4OSOA 4H3SA 5IMBA 2IEYA 2PUAA 1G20B 1W85B 2VPZA 4DG5A 4IZ6A 4KYIB 2ERXA 2UZAA 3ONNA 4RVFA 3WWZA 4EB6B 3CUVA 1DINA 1I2AA 3IEKA 1XTKA 1BYUA 2I8LA 2PGDA 3OIGA 1N2CA 3PC8C 1A9ZA 4M0UA 4C0SA 3F7NA 4AS3A 1AJEA 4NICA 2OKCA 4ZQIA 3SIRA 1L5SA 4FDUA 2AEJA 3EZXA 3OFNA 4XB6B 2A5DA 5IZ4A 4IIVA 1FTNA 3L8MA 3VGPA 5J4YA 3PWSA 3X2EA 3T7RA 3KQVA 1UANA 2WLSA 4E5KA 5HWSA 3ICEA 4UEWA 4RCYA 3TBFA 2FTKE 3DE5X 3ZBPA 4G5RA 4A6EA 2EW1A 5KYWA 3PV0A 3GK3A 3UATA 1CY7A 2O20A 3MGGA 1RADA 1GU1A 1XTVA 3N0VA 1FQOA 3W6UA 5AW2A 2VHTA 2I91A 4BNHA 5A7GA 1GCAA 2I99A 1HOXA 2BPOA 3KHKA 1SEVA 4URYR 3EXG2 2PH7A 3NM4A 4B87A 5HFJA 3WDSA 5I7RA 4MS4A 3UMJA 3JQCA 1YUMA 3MWFA 4KUEA 2AC4A 2YWJA 4HNAB 4RAOA 4RZXA 4A2WA 4AW9A 4GKBA 3BWXA 4ZV7A 1SQ5A 2FQYA 3T4XA 1P31A 4PAWA 4NZNA 3E22A 1M7GA 1E0SA 2OZLB 3A7DA 5FO0A 3PNVA 5LYJA 5WRFA 1GG8A 4HLUA 2YVKA 1JF8A 2XUKA 4P32A 1U0NA 1ZICA 2IYYA 5TS2A 1E60A 3SWWA 1FW8A 5E1MA 4DHEA 1F3OA 2QMHA 2QZPA 3ML1A 2BCEA 1KAQA 3OX2A 1G8PA 4YR7A 1GPH1 1RWWA 1FUUA 2ZJ1A 3ABZA 4DBVO 2JGEA 4A10A 4JLBA 4JEIA 3IKVA 3Q7QA 4RKYA 4DDKA 5JE8A 3ZLVA 4AT1A 5TPZD 1RKBA 1RR6A 1TC1A 4HC4A 4TTTS 5EHNA 3QY0A 3ZBTA 4LN1A 2CMKA 3NRJA 4CTOA 2A9RA 3JARB 4N0EA 4XTRA 5BQXA 3TZBA 3M33A 1J8DA 1R64A 4DIBA 5DP1A 2BFNA 1Z06A 3U1VA 3FAZA 3I6YA 1F5SA 3JQAB 5JVDF 2ZBQA 2Y1XA 1SPBS 1MHPA 3CA8A 4D3XA 4EATA 1GNSA 4QRHA 2HF2A 1P1RA 4HXYA 1ZHOA 3I9FA 1JDVA 3DMHA 3GRYA 3MM4A 3OM9A 4RPGA 1G38A 4EMUA 1WB9A 1DKQA 2PFGA 1YAHA 3A14A 3GZJA 1P5JA 2C0CA 2ZYGA 4RMGA 3ZBQA 5ETJA 5P8WA 3DAOA 4FGWA 1U3DA 2V58A 5IM4F 1I6KA 4LA4A 1PQPA 2W90A 1QH8B 3ZNOA 1B43A 1YK0A 4DAOA 3IB3A 1U9YA 1NT2A 3ICPA 5CT8A 5CD1A 1A04A 1P62B 1PRYA 5TARA 1ZH8A 5KUTA 3OD1A 3B38A 1QHFA 1DARA 1TUEA 2CT8A 5BV1A 2IYOA 4H18A 3PUVA 2P8JA 3SYKA 3TECE 2FZEA 2VK2A 3WYGA 3K71B 4YMTA 2W8BA 1XVAA 3BX1A 3I2GA 3NGMA 2JDIA 1NQTA 2BEWA 5SY4A