2JFVA

Crystal structure of enterococcus faecium glutamate racemase in complex with citrate
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
270
structure length
270
Chain Sequence
b'MIRLTDNRPIGFIDSGVGGLTVVKEALKQLPNENILFVGDTARCPYGPRPAEQVIQYTWEMTDYLVEQGIKMLVIACNTATAVALEEIKAALSIPVIGVILPGTRAAVKKTQNKQVGIIGTIGTVKSQAYEKALKEKVPELTVTSLACPKFVSVVESNEYHSSVAKKIVAETLAPLTTKKIDTLILGCTHYPLLRPIIQNVMGENVQLIDSGAETVGEVSMLLDYFNLSNSPQNGRTLCQFYTTGSAKLFEEIAEDWLGIGHLNVEHIEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTAMATE RACEMASE
molecule tags Isomerase
source organism Enterococcus faecium
publication title Exploitation of Structural and Regulatory Diversity in Glutamate Racemases
pubmed doi rcsb
total genus 95
structure length 270
sequence length 270
ec nomenclature ec 5.1.1.3: Glutamate racemase.
pdb deposition date 2007-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01177 Asp_Glu_race Asp/Glu/Hydantoin racemase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2jfvA02
3.40.50.1860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2jfvA01
1ZUWA 2OHGA 5EVCA 2OHOA 2JFXA 2GZMA 2OHVA 2DWUA 3OUTA 2VVTA 1JFLA 5IJWA 3UHOA 3UHFA 2JFOA 2JFQA 2JFZA 2JFWA 3ISVA 3UHPA 2JFPA 2DGDA 2EQ5A 3OJCA 4B1FA 5HJ7A 1B74A 1B73A 5HQTA 2DX7A 2ZSKA 2JFYA 3S7ZA 5ELLA 5HRAA 1IU9A 2JFUA 2W4IA 2JFNA 3HFRA 5ELMA 3S81A 2JFVA 5HRCA 3ISTA
chains in the Genus database with same CATH superfamily
1U0GA 2ZJ5A 1VB3A 3MMSA 4ML3A 3FNIA 4FW8A 3ZWQA 3KUDA 1H6CA 1NX9A 1OYYA 1UAYA 2CLSA 2NTEA 2VJMB 2H1LA 2ZDHA 3V8BA 3WLHA 5CIYA 3HL0A 2C29D 4NJOA 3IUQA 3OWXA 3VSDA 3NBUA 5I4CA 4BNYA 2XD4A 1GHTA 1T9GR 2HF9A 2OV1A 2YXNA 1U7WA 1U8XX 1RZRD 1U6IA 3FDJA 4FGJA 1QFMA 3H6HA 4QFDA 1XSEA 4TS4A 4QPDA 2H4YA 1XZAA 4P3XA 1C0IA 4MH0R 3K70D 1V6CA 5JCOC 1N25A 4Y6PA 1NLZA 1KE2A 3TPZA 2CBZA 2RKWA 3QKTA 4RF2A 3DEJA 1PEKE 1Q0QA 4MVJF 5GZ3A 4OQ4A 3AF4A 4YAJA 4CDNA 5C8VA 1G18A 3RVKA 4B8YA 1NG9A 4XGIA 1V5GA 1ODKA 2BV3A 3GNSA 3AEKA 3T0FA 1OIXA 2VHVA 4H6XA 2FR1A 1A95A 3HDGA 1XXHE 2HBRA 3LUFA 2TMYA 3N3BC 4TLEA 3OETA 4JLVA 5DTIA 5G41A 2O8EA 2BE7A 4XOIA 2HK6A 2W0MA 2EW8A 4HGNA 2EZ4A 4PNHA 1LVHA 1UODA 4XXHA 1NQAO 3EQ2A 2WWHA 3ZZMA 5E3IA 5E38A 3UJNA 3J81k 2BELA 3DD5A 4C2BA 1KQNA 5DNCA 4EUHA 2QUZA 3KALA 3GPIA 3FFTA 4LRYA 3M70A 3ZWDA 3ZW7A 4C0JA 3IQFA 2VSQA 4ZCIA 4GQAA 3W4IA 5BT8A 5ALOA 3HJUA 2V6JA 3PITA 3WLPA 4WZBE 4JIGA 5D7NA 4CZ2A 1W46A 8LDHA 4CLXA 4YWJA 5NLLA 1IJFA 2IIQA 5K8CA 4MWGA 3PBKA 3IPAA 3STWA 5CIQA 3EZ9A 3F5MA 3S0JA 1REQA 3JQ9A 2CWDA 1A4UA 1OXXK 1UKEA 1MTZA 1IG3A 2D5AA 4OJNA 2X41A 3U4DA 1BFKA 2EQAA 4C43A 3WHLA 2PEZA 5H68A 1H9CA 3W8NA 4X92A 3ZV5A 1NRIA 2B25A 2TYSB 2OHXA 3WKBA 4Y1RA 1WAMA 3PLRA 4U5XA 3TVTA 4B4VA 2YXEA 2G0AA 2E9SA 3AR6A 4MULA 1A5AB 1W0KA 2ZR8A 4MW9A 2E5WA 3KWFA 3KB2A 3AF1A 1XXHA 2R47A 4RH3A 4JBLA 1IJBA 4MV3A 2JLZA 5EJAA 5CCXA 3HJAA 4FGSA 4YRLA 2I4NA 5JNTA 2DFLA 4K87A 2RGCA 3ED1A 1UXJA 1ZVMA 2XI4A 3I3OA 4U6SA 1Y3AA 4AY6A 3ITDA 4J0GA 1QANA 3WKCA 4LTDA 4CU5A 1KK2A 1GM5A 2CV1A 2Z9CA 1NQWA 2ES4A 2MMCA 4CUJA 5HZKA 1IN1A 1R8JA 3GIWA 5JAZA 1CF4A 2FPIA 1ZHOA 4L74A 2IYNA 2OMKA 5AOVA 1GSOA 4BLWA 3BSYA 4P3PA 4U9UA 1W85B 5DLPA 1HXHA 2PUVA 2CLKB 4HZUB 4L76A 3TSZA 1J24A 1MO6A 3BF7A 5C8XA 4C5CA 1YT5A 2BFBB 2X1VA 4K28A 2PGAA 5B55A 3GB9A 4NMLA 1DTEA 4PLZA 1J9EA 2G7MC 4LEIA 5FKJA 2JZOA 2QVYX 1VLZA 2I33A 3FBTA 3KFXA 1Z83A 3OQPA 1QK3A 2JDID 4WX2B 1E2HA 1G8FA 3L0CA 3TD6A 4N40A 3ZD6A 2YWFA 4BMVA 3K09A 4LGCA 4N12A 4WCFA 3M0EA 1DEXA 3L7IA 1XO1A 3EC1A 3O95A 1KARA 4QLAA 1PDWA 1XC7A 1K4YA 1MRZA 4EM6A 3QOFA 5CEEA 1I1OA 3AW8A 3H42B 3QQ5A 1YDGA 4OHKA 4FBGA 1FVOA 5ERGB 1PV1A 3IJPA 1T5IA 5IDVA 1JIQA 2V03A 1YZFA 2JD0A 4GSKA 2ZBGA 4JYMA 1YRLA 4KLAA 4B6QA 5AKEA 2V8BA 2G0TA 1QB7A 1U8ZA 1KFJB 4B6OA 2JGFA 5K99A 1CP2A 2QJWA 2XQGA 2REBA 4H3VA 3N7TA 4YQYA 3M5WA 4KITB 2JJ8A 5BSUA 2CL7X 4HDCA 3UUFA 3GEMA 3DEAA 3AFGA 4GYJA 2PSFA 2XB6A 1JS1X 3Q88A 5E1OA 3V1MA 3FY4A 1ZG3A 1DE0A 5TQJA 2K6GA 2V3WA 2ZPUA 1C9YA 5ALIA 3VX4A 1JW9B 2WNHA 4D42A 4YT2A 4FZJA 1FFGA 2YY5A 5CA1F 1VXOA 1JPJA 3PJRA 1AZSC 3DVAB 3OAAD 1HORA 4KW7A 1F14A 4IDEA 2E4YA 3EA0A 4I1PA 1HT3A 1SFRA 1OBFO 1TO6A 2ZIEA 1RWMA 3E2IA 3M49A 5DVZA 4JXXA 2NXEA 1K7YA 2R4TA 2ALJA 4G1CA 1G7TA 3U37A 3WQHA 4BNWA 5AVUA 3EVDA 3H2KA 1WEHA 2CUKA 3MHTA 4I9HA 1TLFA 2VK8A 4JNKA 2NTJA 4QJ5A 4L8GA 2Q5OA 5ADVA 5ED4A 2FKAA 1CUZA 2C4HA 5BNZA 3OE7A 2QV7A 2Q3DA 5HQJA 1EE1A 1XZIA 3P2IA 4GM1A 1J07A 5IDXA 5ITWA 3G3EA 1OX5A 3FYUC 1Q57A 2J7PA 4FSDA 3O4RA 1I2MA 1WHSA 2P35A 1RZRA 1ZM7A 4NE9A 3LHFA 3WNZA 1Y8ZA 5AT1A 2ZZMA 1AUOA 4JEMA 2H6EA 1WBDA 3DM9B 1OF1A 1N5KA 2EBHX 3LWBA 3G49A 4FFRA 4Y2YA 3UBTA 2XYGA 4R31A 4MQ5A 3VR5H 3GAZA 1E2DA 3K3PA 2A30A 3OE1A 4UATA 1XAGA 4FILA 3F8SA 4NBRA 2GASA 4NARA 1HDYA 1RE0A 4YJ2B 3IUPA 1CJSA 4YJ3A 4M46A 1VIYA 1YCFA 5CT4A 4DE5A 1XDBA 2J59A 2VPXA 3OLWA 4FR2A 4N0DA 5IXYA 2VVTA 1T3TA 1D2HA 1Y7TA 4KYUA 3TKLA 1BXRA 5FIUA 3UUEA 1RRMA 3D0QA 3TLMA 2H2DA 5T7BA 3N2YA 1REQB 1D6MA 3EEBA 1UOQA 3NC4A 5JFTA 3NBXX 1X92A 4ALLA 2P69A 2ECFA 3SLGA 2IXEA 4LY0A 4ZZIA 1OI2A 3UJCA 2GFQA 3E4CA 1BGWA 1DHRA 1R4ZA 3A14A 1KBZA 1NUUA 1JJ7A 1XTKA 2G4VA 2O8BB 1TRHA 2OHHA 3EXEB 4QNRA 1JU3A 4WD3A 5FA8A 1E8NA 3VYRB 5K0SA 3ZHTA 1G3UA 2NQ8A 2I22A 3KQMA 1I1HA 2A9KA 1YL7A 3K6SA 1F8UA 2EX4A 1Z36A 2X8AA 3NYIA 2Q3BA 2JCVA 2UVPB 3B2NA 4GXTA 2H07A 2LXNA 2IY7A 3M6VA 4NESA 1R8XA 2Z6UA 2XE7A 5B30A 4TTTS 2J4DA 1F8FA 3A11A 3GFSA 1RZVA 4B6EA 4B32A 3QENA 1Z82A 3GLKA 1Z6ZA 2X6QA 3LYLA 3AONB 4HGZA 5AM0A 4FXPA 4UTPA 5F2OA 2OZLB 2PKYX 4L4XA 3RYCA 3AXSA 3WAKA 3ZI4A 1IY9A 4C08A 4OLJA 3L93A 1W0KD 1RWBA 2AG0A 1ZESA 3O3CA 1DKLA 4LJ4A 4RJTA 2X8JB 5C8ZA 1QHNA 1ST3A 3BX1A 3WE7A 3FYTA 4DS3A 2I55A 2AFHE 3OM8A 5GGXA 3TVDA 2WPDD 4NYMR 2ZRIA 4X1YB 5LBIA 2OXTA 3IPYA 3TZLA 5B7GA 2BGMA 2PD3A 3HKCB 4R2IA 5L7WA 3BIJA 3QPVA 1NVAA 4Q05A 2PT5A 3UHAA 4CFZA 3LQKA 1WKCA 1EMDA 4I55B 1TK9A 4O2LA 5IEBA 4C7MA 1VSTA 2HX1A 3RLIA 4L78A 2G71A 2PXXA 1I13A 1NLYA 2HBYA 4F93B 3RFVA 4RKQA 4RMJA 1NLFA 1JVSA 3GG9A 1F2UA 3K0SA 2FR0A 3H9JA 3H65A 3L7BA 4DIDA 4E3ZA 1WP9A 2CHVA 4IJWA 1FTQA 4ZT2A 3KM0A 4I7EA 4GMGA 1DHTA 1VCIA 2CCJA 2D74A 4MVJP 4QYSA 5JWHA 3EXG2 2FLWA 3RODA 3SYNA 2JCSA 3ILVA 3DDOA 4BX9A 4EKEA 4XVHA 4AZ3A 3EWNA 1SOMA 4KGVA 4QUAA 5CG2A 4FYXA 4NU0A 5KOHB 3TOVA 4F3KA 3I34X 5ILQA 4OI4A 4EG0A 1CQZA 4JI6B 4XI9A 1CVRA 3B2EA 2NO4A 3BWVA 4M6WA 4BNKA 3KHKA 3WFZA 5JV5A 3ZUGA 1U9ZA 2AK2A 1XRNA 3JRWA 4K3VA 2SBTA 3JRNA 3KQSA 1I0IA 3TB6A 3X44A 3QGMA 3U5ZB 5C1DA 1FF9A 2VT7A 1PFVA 1JTVA 3TSCA 3DUFB 1MOPA 2B8JA 3OZ7A 2HQ1A 3MCTA 2YIJA 3IAHA 2YQ4A 2GDZA 5EN4A 1NW7A 1ZN9A 4HBGA 2VHQA 1A69A 1NATA 4O8CA 4BE7B 1II0A 3SC3A 2A9OA 2BFCB 1TC2A 3DQPA 2QLNA 1NW3A 1N6NA 1OH7A 2HWXA 1N0UA 5EWMA 7GPBA 5DO9A 5EHIA 2ZRQA 1EXNA 1DXOA 1JVBA 2QRHA 3G1WA 3G5TA 1JSZA 4Q1BA 2O7VA 4ZMSA 1BVUA 2ZDGA 3U7QA 3ZHZA 5DGCA 3U61B 2ZTMA 4OKSA 3FCAA 4PNEA 3ZDXB 3NASA 2ORWA 1QIEA 4BTEA 1VE6A 2HMSA 1TM5E 2D1YA 2HCBA 4WZ6A 4PQGA 2F3PA 1HMPA 4S3MA 4C2UA 3SC6A 3HU5A 3TQCA 3PPWA 1GLVA 1YR8A 3T95A 4ARCA 2G5PA 3GY0A 3LBAA 5ALHA 5HS4A 5FBWB 4DV3B 2E4WA 4INAA 1W5SA 4GZ3A 3NDJA 4LZAA 4B33A 5I9IA 2WFAA 1ZOPA 4W5JA 3RS8A 3WBJA 1IMJA 2QPOA 1RIFA 2ZTLA 3PC6A 3HR4A 4F7DA 3TW0A 4M8IA 5EE5B 1GN9A 4MR8A 2RC5A 3MWFA 2FPOA 4Q02A 3ZU2A 2EW2A 3NXSA 4FYVA 2IEIA 3PFBA 4V0KA 3G2IA 5KSPA 2WW8A 3E9QA 1SVSA 4NFLA 3FPSA 1ZNYA 2WKSA 1IWOA 2C2KA 2IH2A 1ORVA 1QIJA 2X14A 4Z7QB 4L22A 4BZQA 1JMYA 4IDHA 2NMVA 5A3RA 3SOZA 2QI9C 2FSGA 2CB9A 2H16A 1DNPA 1D2CA 1QLWA 2R8BA 2VJQA 3IXQA 4F5ZA 5KYWB 4R8KA 3AFNA 3LY8A 1LSOA 1H2WA 2BKVA 1NI4A 1GXSB 2XVYA 4ZJZA 2R66A 2NUAA 3CUTA 3KCQA 1J8FA 4JLKA 1UMDA 4HAVA 3ADKA 1SGWA 2XTAA 4X97A 4C3OB 2IEYA 2AFIA 4DSTA 4D9MA 2HWKA 4UDNA 2DM6A 4Q5IA 1G8AA 4BKMA 5ENVA 3GWZA 5JAHA 5HOEA 2J5BA 1JTEA 1UMBA 1KI9A 3MFYA 1UJBA 1YU9A 2I4OA 4OBBA 3VKGA 3EVAA 2WJGA 3KR0A 2VZ8A 3K70B 1X1AA 3NHAA 1CY8A 2R1VB 3IAS1 1EVLA 2BE9A 3GMDA 1V16B 1IWBB 1PX2A 1MX1A 1QYCA 3F1KA 1H9AA 3LYAA 4RQAA 5BYJA 2B5WA 4PN3A 5I3CA 4XLLA 3S70A 5HJ7A 4MRRA 1PDVA 3P9KA 2XRZA 4Y9TA 1Z29A 3ECAA 4J3NA 1XDSA 5T6BA 2P4UA 2CFIA 3A6LA 2DFTA 2J0UA 2XGOA 4ESOA 3CVVA 4X20A 3JZFA 2V7QA 2JI4A 2QX6A 3ZU5A 4ZK6A 3B20A 1MDBA 1OLOA 1GAQA 5THKA 4AYTA 4Q9IA 3G8YA 5KX5A 2ETVA 1T9KA 5I7WA 3GYGA 3PDHA 2YFYA 3QBTA 4ZGBA 4X20B 2XLBA 3SN6A 4ZCRA 2B8NA 3KIPA 2J09A 1QM5A 1UBCA 2GLUA 4FYKA 1PBNA 1Y33E 2CSXA 2BFOA 2VUIB 2IY9A 3G1UA 1J0CA 3H84A 5BN4B 1S8NA 2XWPA 5HF9A 4TZ0A 4M1KA 1WXWA 4JEIA 3AXTA 4J3FA 3F9RA 4ANFA 4BMNA 1ZJJA 5BW8A 5JQGB 1FDSA 4Z54A 4QNNA 3JD4A 4X7PA 4B4WA 1XRSB 3ZEAA 4D4KA 5ER6A 3QTTA 3BQ9A 1QV9A 4LOAA 1NF3A 3VJKA 1QYIA 1P1JA 1QAMA 1YULA 4WK6A 1Z8NA 1YQXA 1EBBA 1VRWA 2WZBA 5FUMA 4GNKA 4K0KB 3PRHA 3WGOA 3CJQA 3ESQA 4M60A 1GRVA 1G5FA 1EM8B 3JQ9C 3WGJA 3EIUA 3WL5A 4YYEA 1WXXA 3AB7A 3MGKA 4FNAA 1ORIA 2AE2A 4K8RB 4BRUA 2ANBA 4PO1A 3LHSA 2FWAA 1FXWF 1FUYB 2VUTA 2YL2A 3H3JA 4JBHA 2PDAA 2XVAA 3I73A 4UVDA 2F3RA 5FJIA 3DJYA 1AGPA 3S2FA 1N3BA 3OFNA 4P5PA 2H59A 3X1WA 5K8IA 1RLUA 2P79A 1U0LA 1IUKA 2A5LA 4WESA 1RIIA 1T8PA 4MR9A 3WQRA 1HQCA 1PGNA 4PVDA 4AJNA 1W35A 4YH1A 2GHRA 5KWJA 4M37A 4J1SA 1C7QA 1NUHA 3HWWA 3R3YA 1IRIA 5KNCD 1X77A 1AGRA 3KD3A 3PXAA 4MUNA 4AF6A 3B1JA 4BQEA 5B36A 4GXNA 1B93A 3K72B 4DL9A 3OBIA 2BMDA 4V0OA 5EJIA 5F35A 1XRLA 4BE9A 5T64A 1TA4A 5KQGA 1U2GC 3X2FA 3GLGA 3DE6X 3BD9A 1EUCA 1Z4OA 2X86A 1DJNA 1RQRA 2Q5LA 3PIRA 5I9SA 1T6BY 3C3BA 3D6AA 5LZ5A 2YVLA 3VTKA 1Z17A 4XX0A 3UHOA 1RMYA 3WGZA 3C8DA 1DMRA 2OGWA 4FDLA 3WGHA 4BTLA 3PA8A 4YAKA 2ONJA 1S7GA 1YBMA 2PQ0A 2ZREA 3N7AA 4KB5A 5A02A 5JC1A 1H4QA 4G0XA 2UV8A 3DDWA 2NOAA 5K05A 1QPGA 3LKDA 4FVTA 4IZIA 5IULC 5BV7A 2R1VA 3DKKA 5ULLA 1EFHA 3GRZA 4HH4A 1UM8A 5G0WA 3SC2A 2ZANA 1N2EA 1G7CA 2X5XA 2AJTA 3DB1A 3GEHA 5D8DA 2OXIA 2GZHA 2O2IA 2OMEA 3EHDA 5CX1A 1FUKA 5KAMA 2PUJA 2ADOA 4XUDA 1JKFA 4W1RA 3VA7A 3KKOA 5HFAA 2D0OB 3FUWA 3GCDA 3NCTA 3HKCA 3VO2A 3ZUPA 3FFAA 4DLAA 1R4NB 2JIOA 3BK2A 1GQYA 1L7OA 1GGKA 1MQ9A 1RBQA 3WADA 1P19A 2PL1A 1WABA 1D2RA 3EXHB 5I8ZA 5ADHA 4NECA 4UUQA 3WGKA 1TA0A 2ZDQA 3EBPA 1KI8A 3N5KA 1QRDA 1FQJA 2HBZA 3EIWA 2ZGVA 3I04A 4FYHA 2XXJA 3SZRA 2ZRGA 5TE9A 3PIDA 3O47A 2HHJA 3GVCA 4BWFB 3NEYA 4OFWA 1BQ4A 4JI8B 1N8KA 5E6UA 2JATA 2VF7A 4URVR 1THTA 3VC3A 2QLFA 2F1HA 1RJDA 2PU7A 3WFIA 5C5IA 3X1MA 2R3SA 2ZK7A 1XKXA 2B82A 4NS1A 4QDUA 1MZPA 4HTFB 5K8TA 1L7PA 1I33A 2VDLB 2QQ5A 2NNWB 1DL5A 4GU5A 2DPXA 2FPPB 1QGZA 2XHEA 1ONNA 4JUFA 4P58A 3HM9A 4YDQA 1OFTA 4EHBA 2WA1A 5HCNA 4P0PB 4DW8A 1XHLA 2FFBA 2PX0A 3D6JA 2IPMA 3G6KA 1TPYA 3NX4A 3GLHB 3WMRA 5KNBD 1JMKC 1B73A 1YACA 3NAZA 3OEHA 3LKVA 5EKDA 5DE3A 3WDLA 4P7GA 3O73A 4IXTA 5FWAA 5ECDA 4ZU1X 5KI6A 2J4CA 5D87A 3HYLA 1FU7A 3DEYX 3HQ4O 4MCHA 3USCS 5AVXA 4OX9Y 4AS2A 1TU3A 2EJBA 4CQLB 1GPAA 3GA5A 4LZZA 2J9RA 4L6AA 2YYZA 1COZA 3HBLA 4A6DA 5EE0A 1VL8A 3UJHA 3VU8A 4Z4IA 1SEPA 4HX5A 3RKRA 5DI9A 5EHNA 1M2FA 4MUEA 4OOEA 2CMGA 4HXYA 4Q4JA 4RVFA 4BJ3A 2ZB4A 1ILWA 4GSYA 2OK7A 4PFKA 3P9SA 2G1KA 2HZBA 3LUKA 3U56A 4U7HA 3HP4A 2NQTA 3SGLA 4A16A 2C57A 4CKCA 5JD5A 1XRJA 3I83A 5JROA 4WLNA 4ZC1A 2P5UA 2GEBA 3PGKA 2M32A 4M53A 5CH5A 2PIDA 4EYOA 2VXCA 3RIEA 3LLMA 1K3TA 5MFPA 5F2EA 1XWIA 3OPYI 1J2EA 5IYZF 3HZZA 2PSEA 4UUNA 4LJKA 3EY4A 3TO5A 1QQBA 2HA4A 2A1UB 4C6SA 3LX6A 1BW9B 3OF5A 1P4HA 1TM3E 3RRYA 4HUJA 3HDVA 1ZGCA 3L8GA 1YA6A 1Y5IA 1NBHA 1G7RA 1DCTA 1JR2A 2DY0A 4CRWB 5JH7B 4NJEA 3IA7A 3M6FA 3QLJA 3EFEA 5C5DA 5IASA 4W6ZA 4E5KA 3BD8A 3WQSB 3TECE 3SSNA 2NAPA 4D9HA 4OQYA 3TW8A 4YR9A 3ADCA 2QNBA 4IVPA 4JUIA 1BE8A 1G98A 3OY2A 3S3TA 5I47A 2NTYC 4NU6A 1G8MA 2C7VA 3HP1A 3F8TA 3L77A 3KTDA 1ZJYA 3G7UA 4I6JA 4I4NA 5IM5A 3G9XA 4CTKA 4FN4A 3I2IA 3AHEA 3FZYA 4PZCA 3DP7A 3QF7A 4R41A 5DGIA 5KTRA 2XGJA 1S0UA 4LQLA 4J90A 2H85A 3VR2D 5AO9A 3VVLA 4P0QB 1N2SA 2VRWA 1Y98A 2A58A 1TIPA 4F11A 2H1SA 1NULA 3HB9A 1N5RA 5LP1A 3RS2A 4IFBA 5AOCA 2WIDA 3MBOA 1OLSB 5F9MA 1UQTA 4AROA 4BRZA 5LMCA 4X0EA 1S2MA 4O08A 2NT3A 2FPUA 3Q87B 1IQRA 5FQNA 3N0VA 4IUYA 4Q18A 3WZ2A 1NU8A 4FEAA 4S24A 1T2NA 4HAIA 1YQUA 1PJLA 4K9KA 5H59A 3ZWVA 4XFKA 1SCUB 4H18A 3ROZA 3H9CA 4KMSA 2ISCA 4EJ6A 1F6WA 3OZUA 3K8ZA 4CW7A 1E1YA 2JBAA 1RCUA 2WJ3A 5CNKA 1HZJA 1USWA 1I7SB 2Z6AA 2EDAA 3KAQA 4OHXA 1EBUA 3DL2A 4EL5A 1JA1A 3STHA 3R0ZA 2QVXX 3GXBA 5K20A 3OZTA 4V03A 4FX2A 2AEJA 4HEJA 1GQOA 1XPJA 4ZARA 3M8KA 3SR0A 2ZP1A 4DMKA 1WDMA 2NU9A 1O77A 3BXFA 5JCJD 1TKRA 2P41A 1QTRA 2E49A 2PMKA 4KDRA 1FCJA 3CR3C 3W1VA 1M74A 3UIEA 3GEEA 3QFCA 1E2BA 1MKYA 1RVV1 4FFBA 3VRHA 2W2KB 3T7RA 2ZI3A 4HFNA 4N6GA 1Y1QA 2P91A 1SVWA 1R74A 4BCBA 3PLAE 1WHTB 1H6BA 1ZQ1A 3ZGLA 3KELA 1T5DX 3PUZA 1MEJA 2DGDA 2H3EA 3C70A 3FVRA 2CGEA 2NYUA 3H9QA 4D4IA 1G1AA 4P36A 3F98A 1JDZA 2RHOA 2ZUSA 3F2VA 2Z5VA 4OREX 4HDRB 4RD3A 3VUFA 5LQNA 1U7OA 1M76A 2C3YA 1H5UA 3OQJA 3TI9A 1GFWA 5A0VA 1H2YA 5C80A 1XVIA 1CETA 1O3YA 2AI2A 4HPWA 5AK4A 1I3MA 4A5SA 3USES 1V7PC 4AQDA 2XBLA 1L5NA 3O4IA 2OT3B 2A0WA 2QG4A 4O3FA 3ACDA 3QUSA 2CLOB 2XOKA 1DI0A 2XOKD 3OUTA 1PSZA 4U4AA 3TRFA 3FSJX 1ZD5A 1TYDE 2VH2A 4QX6A 4ENRA 5A2QA 3MIZA 4O8ZA 2WD9A 2NU6A 5G1OA 3GROA 1U8CB 3LDFA 3ZY5A 1CUUA 5IN4A 1Q6ZA 5J2TB 3OQMA 5THQA 3OE7D 4D74A 1KZ6A 3OEYA 3GRRA 3V97A 4GDFA 1GQ2A 1PWZA 3DB2A 3T1NA 1N8SA 1KYWA 1WUIS 4KAAA 3CISA 5GQSA 1PNRA 1KZ9A 1Y7LA 5AI8A 3FWZA 2DSNA 3IHLA 3IKMB 3FOCA 4IEFB 2ZCVA 1T4BA 1SCKA 3NETA 3FCOA 4WFQA 3TE6A 1XTBA 1YZHA 5HS6A 1DQNA 2A9VA 4XGKA 1NG1A 1IBSA 1X8XA 2QZPA 4WOBA 2QBYB 5HHTA 1T91A 4H1WA 1DB3A 2VNIA 3R3WA 3CH5A 1QCCA 1EB9A 3DE1X 3GW8A 4JVMA 4AWAA 4DCNA 1G5RA 1E1NA 1PT9A 4L4ZA 4QBIA 2X7JA 1P1CA 2YY6A 2FTKE 1UKYA 4BGIA 2JLRA 2IOFA 1OZFA 1U3TA 2Q1XA 4ZAFA 4GICA 3ZJUA 3M5DA 1QC5B 3HFJA 2EF0A 2Q7XA 4Q21A 1QZXA 1Q7RA 3CW8X 3NWOA 4XIFA 2XEDA 4EDHA 1V4VA 1VLVA 4JI0B 5A5DA 4QWWA 1RC0A 2O6LA 1SQ6A 2BMAA 3VV3A 4KPYA 1ISIA 3B7WA 5GONB 4FCVA 3IXMA 4EDFA 5AK0A 1N6IA 3U7RA 1W5AA 1ZRSA 2AR7A 1X15A 4PHTA 4CR6A 4RELA 2PTGA 1ISRA 3SD7A 3AGQA 3UK2A 1VHQA 3R3JA 3TH5A 1SURA 2XCIA 3LHIA 3GRKA 4EENA 1RKVA 3EVZA 1GTJ1 4NEQA 3JU3A 1RPNA 1HPLA 1GGHA 3TLYA 2IXAA 3MINB 4S1NA 1PGPA 4B83A 2HMYB 1NQUA 4LOIA 2PH7A 4JBYA 1NNLA 4BNIA 4LDZA 1KKUA 1K7FB 4KCGA 1XLVA 1KDZA 3RCBA 4Q3NA 4Q9NA 2OAEA 4H1HA 4ND3A 4WKBA 3LV8A 3ZX5A 5IBCA 3E4DA 1H8ED 2J32A 4HQOA 3WFJA 2HHLA 3CPEA 2IDJA 3AY0A 3QNUA 3K6JA 4M55A 2V6MA 4EVRA 3T1YB 3C7AA 3DE7X 1ZD9A 3KHSA 2CXUA 5ICEA 3FMIA 2C1ZA 3OO0A 4G6ZA 1KU6A 3RT1A 5TEVA 2PFSA 1N2HA 1IIRA 1OXMA 2X42A 4LJ5A 2ZAIA 3T3MB 1PG5A 4AY5A 3STYA 3IAEA 3RS0A 1NY5A 3OUZA 4YQFA 4QG3A 1MUUA 2YJGA 3QIAA 2DLNA 2XE8A 1T29A 3NR2A 5TS2A 3NPAA 1F17A 4TKZA 3D0OA 3O8RA 3K9GA 2WNSA 3UPTA 1BS9A 2JGDB 5DNYB 1FDIA 1JWLA 5ADUS 3TQHA 2YYSA 5JYDA 4IWNA 1IK4A 3T3HA 1C0KA 3MAAC 2ORED 1A8QA 3CJTA 3NCHA 4HLQB 1PLLA 4WBNB 4K40A 4MR7A 1YOVA 3WIOA 2EZTA 4R2JA 2DPGA 3UANA 1Z6QA 4S1OA 5AVWA 4Q00A 3RU2A 4G89A 2ZVQX 5FOTA 2GXQA 1XAJA 5LMZA 2WQ7A 4AY2A 1CG6A 4JLBA 1WCWA 1R8SA 1VGQA 3HUDA 4NBLA 2CLDX 4RPCA 4TSKA 2FWMX 5MN4A 2QR3A 5F7XA 1E20A 3QNMA 1U0JA 2WR8A 3QVMA 1DCFA 1NVVQ 3RB8A 5JJBA 1K1EA 4RV5A 3T5TA 1OIVA 3AFOA 4HEA1 5A4MS 4CKCB 1GZ6A 1XNQB 1KC3A 1GPNA 1RU3A 4GE0A 4X1OA 1AZTA 2YXPX 4MMYB 1SOVA 3V42A 1P5HA 1PUIA 4XOUA 1J8VA 5EIAA 1F06A 5TB5A 1P2BA 5EJ7A 4BO1A 3RTDA 2X4IA 3PA6A 1Z4JA 5AH0A 5D86A 4FU0A 1TMGE 1SH7A 4G07A 4RCVA 3S27A 2ZRKA 1VYUA 3NUGA 3I2HA 4HNAA 3UV3A 3VPDA 2WBLC 2W6CX 2Q2QA 1E9FA 4AKHA 2I1LA 3S2YA 3I2JA 1SR8A 3H5LA 3B1ZA 1UR5A 2LDBA 4EA7A 5TQ0B 3TIVA 2QRQA 3FVVA 2AXNA 1PHRA 4BBPA 1YZGA 4A2PA 3ANSA 1PW7A 1C4XA 1UPTA 1VSVA 2BF4A 3HCAA 2F3QA 3U39A 4GWLA 1PBTA 2EWVA 2WSIA 4R1PA 2CVQA 5DZSA 1LF5A 2BFEB 1VJDA 1E3DA 2QRVB 3EVFA 4JT4A 2E82A 3Q7RA 5P21A 3ZWWA 1JAYA 4GRDA 2GN1A 4BNMA 1E5VA 4BFSA 2P3QA 2F1KA 3TG8A 1SU4A 5AJHA 1QIIA 2CUNA 3AJ9A 2Q5FA 3T9EA 3RS3A 1USVA 2P40A 1O54A 3RYHA 2WJ6A 3HP7A 4YMHA 3DAGA 7ABPA 3RPEA 2BTOA 4P7FA 2ZKLA 3CWZA 4JODA 3WRXA 4TV8F 1E2EA 5FO1A 4CVNA 1SQFA 3OQ1A 1LU9A 4O1HA 4TRNA 3R9KA 3WG9A 1U28A 4FUQA 1I0ZA 3C45A 4MYSA 1L4KA 1NZJA 4H16A 3H6KA 4IQ8A 1YRYE 4OFXA 3PU6A 4PAOA 4RH0A 1V96A 4C1NA 3H8SA 3B9QA 3AP2A 1WXQA 2GCOA 4TYNA 2JFPA 3S1LA 1NI5A 1C1DA 1G5PA 2OZEA 3K53A 4RM3A 1WQ3A 2IE8A 2DUWA 1IZ8A 2IF2A 4TV8A 1Q21A 1ZK1A 3I5AA 1QHGA 3FRJA 1IZ0A 2JEZA 4EFMA 1JAHA 1TQ2A 1S7CA 3SJCA 1RPAA 3O1LA 4LMBA 4EA9A 4G37A 4JIMA 2N1MA 2AMJA 4OGGA 5A3QA 1L5KA 4BCDA 1AHNA 4A10A 1KY2A 4O1IA 5CR9A 5HP4A 4PQEA 1E0JA 3WSWA 3ZY2A 5IC4A 3NM6B 1HLDA 2GZMA 3THRA 4L27A 2O57A 1NVWQ 2WWWA 4MB2A 1XLTA 4BP1A 1R9GA 1MDFA 2Y3IA 1OGJA 1P9LA 3HZOA 4PSKA 1XNHA 2B0CA 3I09A 4II3A 1YR9A 4Q3KA 1EUYA 1N2ZA 3CNQS 2HF7A 1JH8A 1UDWA 3TE7A 5A3JA 3MRVA 2OO5A 3M4YA 5K01A 4DA9A 2Y77A 4Q7QA 2VTBB 4HKTA 4MGZR 3Q8XB 5LBUA 4QUJA 4B3GA 1ZIPA 3A6EA 1LW6E 4IQ0A 4R1TA 5IUNC 4XSHA 4D45A 4PW0A 3DOOA 1F4LA 1QYRA 2QTHA 4RSRA 2ZIFA 2FZCA 2GEVA 4W99A 2B1IA 2E37A 1Z6TA 4JJFA 4AD8A 2O8CA 3QU5A 1XRQA 1R2QA 5DTEA 1MFZA 3PUIA 4QQ8A 3VAAA 3W8RA 3EYWA 3GI1A 3CUEF 3PT5A 1XCBA 1DPFA 1J9GA 1KOLA 4CE6A 4CT5A 4KX3A 5KTYA 3ELYA 3ETGA 4PFJA 1HDZA 5AQ1A 5KYYB 4UASA 1HA3A 2HLNA 1ESMA 4GBED 4C0XA 3LGSA 1ICIA 3ZJYA 2A9QA 3DMRA 1WLYA 2D2VA 3P2JA 3QPDA 2E85A 2BSAA 4Y7DA 4GVLA 4UZSA 1WMFA 4RLQA 4MV9A 1KMNA 3I1JA 1X1BA 2X7XA 4B80A 1LBTA 3AUTA 1QTNA 2IW3A 2WJPA 2WWFA 1QUEA 2YH2A 2G8LA 3V48A 1OHHD 2GCOB 1YUMA 2AFIB 1AK9A 4GVPA 1RFGE 5DM60 3OOEA 5UKDA 5I7VA 1WMSA 1LCIA 4PPYA 2YJZA 1PR0A 5GP1A 2A9FA 1NQVA 2PAFA 3NT5A 4PX3A 2C4TA 4RBNA 1FFEA 5KYWA 1V3UA 2GHTA 4I81A 1NW4A 2RJ3A 4QO8A 5DTJA 3M81A 2IXGA 2PEYA 3GH3A 1HNWB 4GX5A 3LI2A 1F48A 4J03A 1KMIY 1PD1A 3G2NA 3IP1A 4NDNE 4RE6A 3OCJA 5DI3B 3S2GA 3J7AC 4E2YA 4JQCA 4ZREA 5HKLA 5F9HA 3BC1A 2Q3LA 1RJGA 1N9ZA 4GQIA 2WHQA 3PWTA 5CB4A 2BZ0A 2EJWA 3TD2A 3A7EA 4G26A 5AW2A 3T4UA 4HQNA 2FW7A 1LQTA 1FRQA 1ZMXA 1U2QA 1O03A 2ODEA 1CUBA 3BL6A 3EPRA 5BSVA 2DR0A 2ZUBA 1WBJB 1C30B 1ULSA 4MQFB 2GCEA 4WQMA 1KF0A 2LE0A 3ELBA 4LRSB 1USIA 2H7VA 3KXPA 3G0HA 1DDGA 1E6CA 1IHPA 2CLCX 3L0BA 4Q9DA 3IAAA 4URFA 3FTCA 4XQGA 2V1XA 5LDHA 1ZW1A 3DEFA 2P6PA 5IC5A 4A8JA 2ZYWX 1XRPA 3D4PA 3MMPA 3BSFA 2AL7A 1QFZA 4RTPA 4CF3A 1G3MA 4EHKA 3N07A 4K2HA 3L7OA 4DAOA 1DV2A 2RH8A 4JSYA 1SXJC 3OPNA 5FAXA 3N8GA 2A9RA 4YS6A 4BO3A 1IFXA 3KPJA 3OLYA 4HWRA 4C14A 2F9FA 1FLDA 5JASA 2HU8A 4NOLA 1RWPA 3ED5A 5K4AA 5BR1A 3QELB 4UHCA 2W8ZA 4ZANA 4P80A 4BLSA 1Y3DE 4QU0A 2XMCA 1XZEA 4JSRA 2GBGA 4ROTA 1IN5A 1ZJ5A 4X1KB 1BHSA 1NFRA 2LDXA 1ZSVA 3A05A 3LT4A 1JT2A 1Z5NA 1DWPA 1RM0A 4CFSA 3NHKA 4M3NA 2V5UA 4QUGA 3H16A 2EEPA 2P9JA 2JGJA 2XADA 5JNSA 3QYAA 4HCJA 3V1NA 2BN4A 1I5OA 3IBGA 2DHDA 1VE1A 4FFVA 3HWRA 1Q7EA 1KSFX 1DOHA 1XE3A 1ZVJA 2XODA 1YV9A 1NDQA 3EG5A 2WJWA 2XMZA 3CH7A 4GZ5A 4N3NA 4C7BA 4HNTA 2YJTD 5JD3A 4C30A 3ZD8A 4BLOA 4OQPA 2DYKA 4A6EA 4F04A 3EZNA 3PYLA 2I2CA 4TUYA 1E9DA 1BH2A 2C7GA 1Y4AE 1RYYA 4JZKA 3SCZA 4AG3A 1XU9A 3X1KA 3VPCA 4TTQA 1IATA 3ABRB 5CXXA 3D4IA 3QTBA 3KKZA 1MT0A 5H9VA 4BNNA 2DQKA 2CSUA 5IH7A 2PBRA 2VCYA 3D7SA 1SVKA 1VKOA 2G1PA 2PZJA 5KVAA 2I3DA 4A5OA 1ABEA 2FU5C 1NBIA 3KBOA 2O5CA 2HADA 3UXYA 4BFWA 3VOBA 4TZKA 1E4EA 3H99A 4QUIA 3D4BA 3R7FA 5JD4A 1N9GA 1R5BA 2PH3A 3IX7A 2DB3A 4J94A 4GR5A 3G23A 3WIDA 4PYJA 4HDSB 3WL3A 1JLLA 4GX2A 3ZW9A 1BX0A 1KEPA 3RK4A 1VLLA 3GAAA 5YASA 1SVNA 3OFKA 5I9LA 2PR2A 2QTRA 3K6RA 4LF7B 1KVUA 1QVVA 1VKRA 1GUAA 1VP9A 3IMEA 1CNFA 1ST2A 3CF6R 4I50A 4PPNA 4XTRA 3ZDDA 2QTWB 2ACVA 2YBDA 1RYBA 1N6HA 3AUKA 2BDTA 5TARA 3ZCSA 4IV5A 5B58C 2A59A 3VUEA 1KHHA 3F6RA 2RG7A 2LBPA 2P6RA 4EF4A 1CXZA 3FB4A 3GLFE 1JGTA 4XGQA 4DEYA 1YU6A 1LDNA 3DTYA 3GUZA 3JXEA 3K9HA 2IUUA 3U4IA 5CITA 2HAEA 3AUUA 1MORA 2YRWA 2QM7A 1JDNA 1HDXA 1DZ3A 3D4OA 1TMYA 3EXFA 3FR8A 1WVIA 1ZH0A 4PCUA 3ZX4A 4JKIA 2YUTA 3BMNA 3JV7A 4DC9A 1ZXLA 3RC1A 4PG6A 5H8WA 4BL5A 3D6UA 4OD0A 1EX6A 2POQX 2CN1A 4BYGA 2C88A 4CGZA 3UT6A 3WBKA 2UXBB 3AINA 2VTKA 4J1TC 3ONDA 5KB3A 3HABA 3GJ7A 1ARZA 4TKLA 4TTVA 1UPUA 4B71A 3OEEA 4DZTA 1QX4A 3L7AA 4I19A 3ZLJA 5BWNA 2QMQA 4E5PA 2R44A 4MVJD 1Z5UA 2CL5A 5FI0B 4F5YA 4HDNB 4IIGA 4LSGA 5EG5A 5AESA 2R6ZA 3GLFA 3NZEA 5BNIA 4F8EA 2IH5A 1NV8A 2ZRLA 2XMDA 2NZUG 1KDRA 3P9IA 3T3IA 2AFRA 4B7AA 3U4AA 4KOEC 1QO9A 4FR0A 4AMZA 5HF5A 1G5IA 1PJTA 1KK3A 1RYMA 3BXEA 4Y2PA 3WWDA 4UBIA 2BHNA 3FOWA 2QXYA 2PL9A 3KQOA 4LW8A 1P60A 3BWMA 3SQNA 4BB0A 5CFLA 2AN5A 3NWEA 4URHA 4NZYA 4DY4A 3P0EA 4QXPA 3RYCB 4DLNA 3AVWA 3ETHA 4P34A 1H4TA 2X5NA 2HJRA 2OAP1 2PGDA 1Q7BA 2F7SA 1P9OA 3UWPA 3O5AA 4DUPA 3SHWA 1ZGZA 2E4VA 1WEKA 2ZTUA 4PTLA 4BMPB 2BKUA 4IJUA 3S5UA 4JT2A 4ZQBA 1QQAA 1P0MA 4MLPA 3BZBA 2J5RA 2JA1A 1JVNA 2KB0A 3O4VA 3RDPA 4HQRA 1QRTA 3IEPA 1QP7A 2H1VA 3QQPA 2W83A 1MB3A 3R44A 1FYFA 2FOIA 3HG7A 4Z3DA 2ZE7A 3EJWA 3ZS9A 2BFPA 4UNNA 1TTTA 4H4DA 2EBWA 1J1UA 1M6EX 3OZDA 4X63A 3W06A 1N3YA 2C9YA 1TTHA 3R6TA 3MGBA 2H5IA 1XPUA 1IY2A 3JAKA 3KCNA 2PLNA 5DGDA 4C0LA 4C4TA 4BNUA 1CNMA 2QMZA 4A26A 3W4JA 2B92A 1O6CA 3EMDA 3F0TA 1AS0A 5IWCA 1CUJA 2LPMA 3LVFO 2BFFB 2A2ZA 2BIFA 4UOZA 5IBRA 3EPHA 1T35A 3OMXA 5FUVA 4C05A 4DIMA 1LTHR 4AZVA 1P4JA 1QC5A 3CNHA 4UPVA 5L3SB 5JECA 1YQQA 1I4EB 4K7JA 1ENPA 2RB4A 4MLCA 1E89A 1CQWA 1I1NA 3GEGA 2BMEA 4V1CI 2CCGA 2QGZA 4J0HA 2QAGA 1CY7A 4MIKA 4IL5A 2A33A 3K05A 3IC5A 1P6QA 4FJ1A 3AVXA 1ETUA 4DYDA 3SQWA 1WOYA 2B36A 4EGSA 5DIFA 4CF7A 1SXHA 3QVGB 2HV8A 3H7AA 3WLTA 4B79A 3RV4A 2J31A 2XRFA 4QYMA 2XEXA 2Q1UA 2BTEA 2AGVA 3D3NA 3T7DA 3QF4B 4TM8A 3KQKA 5K8JB 3RIXA 1CF2O 1YA4A 3DC7A 3G9UA 4US1R 1OW3B 2HA0A 2D2FA 421PA 4D8YA 3OUUA 1GR0A 2GO1A 2LRHA 3IV6A 4RANA 1ZQ9A 1JQKA 1CR4A 4IHJB 1DIRA 2ZR9A 5G3YA 4CKEA 2ROQA 4UQLA 1EP2B 3CEJA 2OV2A 3P2MA 1QIFA 3HO8A 3PFFA 4PLPA 5IYZB 3RH0A 4L3WA 4OL9A 1AB5A 9ABPA 1RTKA 1YJXA 3IP6A 3AIOA 2FP4B 3IDAA 5ALNA 3PJEA 4WXHA 5HIAA 3ZHQA 3R9XB 5DSXA 1ELOA 3EAFA 4RD0A 3TMKA 4BP8A 4C4XA 4URXR 1IVSA 4MRSA 1TAGA 1RP7A 3V32A 4EABA 1AO0A 3WJ2A 2X1HA 2ZIWB 4R9VA 3R41A 1USGA 3P2YA 2HA3A 3NKLA 3PFCA 4OFZA 4WECA 2P65A 4HLCA 3VPXA 4R1QA 3RUDA 4J1NA 2ZM6B 4BN5A 4D4HA 1NMSA 2GA8A 3B3AA 4ZAZA 3DNMA 3V7WA 4Q3AA 3VH2A 4D57A 4DY6A 4X41A 1KY4A 2Q6TA 2FUG6 1UINA 2YY7A 2X9GA 3Q7EA 2FPSA 3A1WA 4E5MA 3H83A 1R5JA 1WE2A 1WHTA 2I6TA 4JYCA 1Z07A 1DX6A 2YHBA 4B4DA 3OVMA 4X6UA 3GRVA 3OI7A 4Y1FA 3S2IA 4HL6A 1NX6A 3A7DA 3UGJA 3GH1A 4QYXA 1MJNA 4XM0A 3RG2A 4O4IA 4P84A 3FYSA 2B21A 3KP1A 1MRSA 1CIVA 4RZXA 1H4VB 1NT4A 2R48A 3G2OA 3F6PA 2XB8A 5HKKD 2C3OA 1WG8A 3N2EA 1JAZA 4LFBB 2G06A 1R0BA 1Z2EA 4GUDA 2YC2C 1MAAA 2JRLA 3R9XA 3I9MA 5CLJA 2CXXA 4PIPA 1N7HA 4P3YA 5JSQA 4YQZA 1JSCA 5JNLA 4UUAA 2OM6A 3BCUA 4WKPA 3MILA 2XA2A 1X7XA 5ENDA 4JX8A 1CZKA 2BEKA 4ICIA 3ADPA 4NBVA 4F60A 1R4MA 8AT1A 1R88A 1Z2DA 1PJSA 2XE6A 3GQVA 3H9UA 4BAGA 2WYWA 3EGVA 4LAFA 4QAQA 3GJ3A 2W0SA 4QBFA 1DSSG 4P4SA 1O9GA 4FFDA 4PLGA 1IG0A 5F3DA 5T6MA 1ZITA 1EGAA 2VHZA 5HZGA 1IXSB 1NE2A 1Q0SA 3JWEA 3O3NB 1GUBA 1U8FO 1U3VA 4RX1A 4CKZA 3THSA 4FM9A 2IEGA 4DA8A 3EOAI 1T2DA 4JLWA 1SC9A 4TMZA 3D3QA 2DFDA 1FP2A 1Z63A 1R6UA 2J6CA 3V33A 1N7GA 4HH1A 2BP7B 4BEVA 5CB6A 2F1RA 4ITRC 1LH0A 1AV7A 4BQIA 3CX3A 4NYIR 8GPBA 1RI2A 3MJRA 3QMVA 5HK8A 1JQ3A 1QGOA 2B4QA 1U1CA 4QBHA 4A6PA 4E88A 3JVUA 2V98A 2VWQA 4TTAA 3FPEA 4NBKA 1SPXA 3BWCA 4HGQA 5FL3A 2QBYA 1OILA 4HQ0A 3OPMA 4DWVA 3G89A 4Y2TA 5FBRB 3U7JA 5JI2E 4K3UA 5CPFA 1GG9A 3TBHA 4ARIA 3CHYA 4KBFA 1Z2NX 1WUJS 5ESRA 3IHWA 2HEIA 4KQCA 3BWXA 4N47A 3SE7A 3VU3A 4D8XA 1JIIA 4TWIA 1HE5A 1E63A 2GBIA 5KYTA 3GPLA 2OENG 2OBMA 2I3GA 3D8TA 3GDGA 1IEXA 3JTEA 1V5FA 1RWQA 1ZNXA 2VS1A 4IHAA 5L51A 2RD2A 1JB1A 1BN6A 4US0R 3VZQA 5BY2A 4E22A 2NV6A 1ISSA 2WFMA 4GEKA 1XKLA 2XOXA 4EG8A 1PZEA 4N5NA 5CB0A 2AFHB 3ETDA 3UMYA 1LFAA 1NZDA 1PL7A 1T3LA 3KE9A 4EA6A 4Q6WA 1DT3A 2J48A 3BIWA 3UMFA 4HB2A 4A36A 3DVSX 4GKAA 1NMQA 3KJFA 3ET5A 1KI2A 3ZTWA 4X65B 3E1KA 3U7HB 2O59A 1F8XA 3HBFA 4J0DA 4MTLA 1M2OA 1V11B 5JS8A 3TB4A 2QYHA 2JGIA 1CS0B 3GFPA 2UZ4A 3TTXA 4EHJA 2ECPA 2JH9A 5AJVB 1YFZA 1MIOB 1SHTX 2LNDA 2YZ2A 2Y1DA 1AKUA 4I1UA 2OV4A 4N0QA 5FFMA 4YCMA 3K2IA 2HJHA 3UHJA 1OYWA 4W9NC 1O57A 4XJXA 4ZO9A 1HLGA 3BB1A 3QVVA 3OIWA 4OX9B 3BKXA 2MYNA 1VCNA 1K0UA 3O2JA 4RA6B 5E4JA 2WYUA 4OP2A 4X7RA 2YHUA 4EB6B 4M1ZA 1XN1A 2OAQ1 3F74A 3ND8A 1GZ5A 3GUYA 3JQBA 1H23A 3NHRA 2BM1A 2FPMA 4G5HA 3AETA 1ZRHA 2HGSA 2XIJA 4DJJA 1GY8A 2HWWA 1TJ5A 3Q40A 2FZ4A 3FMOB 3SC2B 1CQXA 4BAZA 1EFKA 1HSOA 2ZPAA 4UXJA 3S1AB 4AN1A 4EZBA 4OGKA 1H2ZA 4S05A 2XSZA 2ZIAA 3NI2A 1DINA 1I5RA 5IVIA 2UZ0A 3C5EA 1E0SA 2BR3A 4YK7A 3OT4A 2C4MA 4BO9A 3A1NA 3TRIA 2A1UA 2XMRA 3NANA 2WOOA 4YN3A 2CK3A 2Y2UA 2QRKA 3DE4X 3D3WA 1J5EB 1QG0A 1U5BB 3EF1A 3ENVA 5JANA 5LJLA 1OLXB 5LP6B 1WX1A 2ZUFA 1WD5A 1SD5A 1IMOA 2EVWX 3ZZ1A 1V48A 2O23A 2V7UA 4RADA 1LBEA 1XZJA 3FTPA 4R1LA 5TF0A 2QJFA 1MC1A 1Y6RA 2CE7A 4RVNA 1B76A 1CWUA 1ML4A 3L6EA 2QP4A 3A27A 3QEOA 1QG2A 1XD9A 2PZKA 3AKYA 3L84A 2GESA 5LB2A 4CN9A 2AKYA 2HN9A 3KXIA 3SP1A 4BV8A 1INLA 2CNOA 3N9IA 2AR0A 3FMGA 4CIWA 3IOMA 5EMNA 1PNTA 3R24A 2GCGA 1LBSA 2W2PA 1DBVO 5LA6B 4C89A 2G07A 3EWSA 4RAOA 5LP6C 3A8TA 4KQIA 1EESA 3JALA 4QICA 5H7XA 5B7QA 3L02A 3O4GA 3ZDEA 2H1IA 1MZVA 2P2SA 3MB5A 1QVWA 1IDOA 2PRIA 2H1RA 4TTIA 5KHOC 3ZJTA 1TTPB 1ISHA 2G63A 4CLHA 5JHGB 3PB3A 4RD1A 2WSSA 1EXMA 1AIPA 1L3CA 5ERYA 1P33A 4V2UA 4B7XA 2AWOA 3ESXA 2HRRA 4TWBA 2XJ9A 3L06A 4D26A 1H2HA 3KSUA 1U3UA 3QOYA 2Z0MA 4FZ5A 4IIYA 1MEOA 5ESWA 5TSDA 3TEMA 1Z22A 1CE8B 3VDNB 1SRRA 4L0CA 4YRCA 5HRCA 1RJ9A 4L28A 2I7XA 3AJDA 4KDCA 4LJLA 4WBXC 4DJTA 3ODGA 4RH1A 4RL6A 1VBKA 2FKNA 1VI6A 2GRJA 1L6IA 4D9JA 3RUHA 3LYHA 1GG5A 3H0CA 3N8NA 1DV1A 5H80A 5FOSA 3I37X 2CLLB 1JJBA 4HN4B 1ZKMA 5H16A 3OSUA 5KQSA 2AB0A 1SCNE 3K0FA 3QBVA 3TYXA 1AQJA 1A9OA 1NAIA 3SHTA 4ERNA 1NBAA 3C24A 1DAGA 5SZHB 3B1YA 3VGJA 4LF9B 4XWWA 2Q6KA 4R3NA 3ZXXA 1IE3A 2VP3A 1AHHA 1T2CA 3T5CA 5CAEB 1OXVA 3AVOA 4NBUA 2H52A 3I8XA 3AI1A 1E99A 2PA0A 5FEMA 4YRPA 5FWNA 2GPTA 4Y0VA 2RBGA 5E1MA 3LTNC 1X8JA 3IOEA 2HA5A 2AOUA 3GP8A 2WAAA 2OYRA 2EXXA 4JD5A 1R4NA 1CUEA 1EHCA 1D1QA 4G9EA 3Q6MA 2IYEA 2Q8PA 1EIWA 2E4AA 3OQOA 3CE9A 1CUCA 1DIBA 2RK3A 2YQZA 3EC7A 4L4SA 4RTOA 4CF4A 2F43A 1Y5LA 2HF2A 1NN1A 2I7CA 2IPAB 1ZNQO 4C4ZA 5CA0F 5AK6A 1B0PA 3WBBA 3ZDAA 1WB5A 3NV9A 3N2NA 5GOZA 4LXIA 1Q77A 5DX0A 1FSGA 4I0WB 1OAKA 1J8DA 1UFKA 2OFPA 2YS6A 3HDHA 3E9YA 3WNVA 1TJPB 2A35A 4RLSA 4YAWA 3V4VB 4CKYA 1IU9A 2V5AA 1SG0A 3EASA 3A36A 3QKSB 2I4MA 2ZS7A 3DE2X 4XLTA 3M4NA 3VNRA 3RE1A 3GLIB 1S01A 1PT7A 4DADA 1CEQA 1FZTA 4UW9A 3ZDZB 2AW5A 4NQZA 3AKEA 5T4FA 3PQ5A 4CDRA 4HR7A 4K6HA 3F67A 3RSCA 4YP6A 3UCEA 3IUNA 3KR1A 1XELA 3C98A 3H1BA 1GPKA 3N2KB 5CCEA 5F1PA 4FFPA 2FSHA 4O33A 3VPHA 2A84A 2BC9A 3PUKA 1QH0A 1W4RA 2XUKA 3HN7A 1JWBB 4C4SA 1X7GA 2Q2OA 4MR8B 3UMRA 4EGJA 2F1JA 2D2EA 4J2TA 3UFBA 3GL9A 3K2BA 3O90A 1SXPA 1ULBA 3QWIA 5TQVA 3DMTA 5C7LO 1IBKB 1BKDR 4MI6A 4FMCF 1ETHA 2B9EA 1GNPA 5LLDA 1F6DA 2CKMA 1SN7A 3I45A 5IMBA 4UE6A 2F62A 2N46A 2RBEA 1UFOA 2JLAA 4MPDA 4OBWA 1P0QA 1NQ5A 1RHMA 1JE0A 3GGCA 2W6JD 3CF4G 2W6JA 1OFIA 3OCVA 4PZ0A 1R0CA 2KWIA 1D4FA 4TMFA 2FUCA 5G3ZA 3W6UA 1W34A 1PLKA 1SOAA 5CVUA 1T4DA 5E0OA 1XF1A 4COOA 2JG3A 3IIMA 4QELA 5LBTA 1UMDB 3O91A 4HHEA 2YWJA 5G0VA 2HB6A 4GQBA 1GYQA 5C31A 1CJCA 2D13A 2RGNA 2VJDA 1A7AA 2WHRA 4OTZA 4PU0A 1K7CA 4ZCQA 3P0FA 4OL0A 1A9QA 3UGTA 1RZUA 1S3SA 1SULA 2NO5A 2WKPA 2ZRHA 3R0IA 5JQGA 3EIEA 3TJRA 3R5TA 4IOLA 1T0PA 1A7KA 1H05A 5BMVA 5I48A 3MSCA 4PPGA 3DEIA 5K0TA 2BFDB 2QT9A 4LMAA 4UM9B 3SBEA 2WM2A 1HR0B 2YC4C 2I4IA 3HY3A 3L4JA 1M2VB 5AM4A 4R7TA 4N3CA 1LI5A 4BNXA 1C7FA 1PYOA 4WL0A 2F2TA 2ZITA 4M0KA 1UMCB 2CD9A 2II6A 1I4OA 1O6GA 1S89A 1WXEA 1T1GA 2OPBA 2PKCA 1WR8A 3RNOA 1WSBA 5B64A 2OUIA 2RHTA 2Z8YM 1Q0UA 1FW8A 4D3DA 4XW2A 4HJRA 1JEJA 2WJIA 4WZAA 1SD1A 1KYTA 4E5YA 3N8IA 3TLAA 2ZIVB 1ZC4A 3Q41A 2EG5A 3L0ZA 3EVBA 3AVTA 2Q6OA 4M99A 3JQFC 5LMUB 1JXMA 4BNHA 1HRDA 2FI1A 4MV4A 2VQDA 4I9NA 5SZKB 1OD6A 2DKFA 3LC2O 1TYCA 2E2WA 3VNAA 4Y9RA 3C3CA 1QTIA 3SYTA 5EPUA 3Q3EA 1D8TA 3CIFA 3FLAA 3MT0A 7MHTA 3D7LA 3O38A 1HKHA 4LHVA 3HY4A 4KXWA 1ZISA 2YVQA 2IGBA 2C9DA 4U2EA 1YBHA 1RFLA 4Z7NB 1H1LA 2W43A 2IZ5A 1L5YA 1P5JA 2XF2A 3PPXA 5K0EA 5KSYA 1J39A 4DCSA 3KTFA 2J7PD 2H48A 2YIVX 4HDKA 4IDOA 4OI2A 5F12A 3RC3A 3L5KA 3ZWPA 1XJQA 2YXDA 1B0UA 3OOHA 4RDHA 3RS4A 4QBGB 3KNZA 4IIFA 3SF8B 3TMAA 4BKQA 1HQYE 3QUQA 2BJHA 2P2GA 4RJIA 3DBRB 1PS9A 2WIFA 4K1XA 1HL7A 4MUKA 1E5DA 3RR2A 4Z9AA 3I30X 4QVKA 1VI2A 2X2OA 2DCMA 3A32A 1Z8HA 1UIMA 1JKJB 2OCYC 3C48A 2BEUA 1OTYA 2AUNA 3CH6A 4EEZA 4TMKA 1B14A 3TGLA 3QPCA 2MWMA 2H4WA 3GNTA 1DWUA 4QLOA 3A2LA 3UYLA 3VXKA 1ZLXA 1NMEA 2VA9A 2BCGY 4PZZA 1ZWLA 3H97A 3LT1A 4NJMB 2NVBA 2XA1A 3ZQUA 4Z5XA 5M5BA 1OB5A 3R4VA 3DOIA 1T4GA 5SZJA 4F96A 2AV6A 3BWDD 3TIXB 2JFFA 3S44A 4A8PA 5BSEA 4ENQA 2BMVA 4FZRA 1T13A 4EQZA 4F8YA 4CQMA 5ELMA 4X71A 3O7WA 2FYTA 3OIFA 4ARVA 4XVRA 3MOIA 1E9AA 4M1TA 1QGUB 4N18A 2Q9UA 4A0SA 2O0KA 4RMNA 4M22A 1U2GA 2AZDA 2G04A 4PIVA 3EXHC 4RFLA 4WKOA 4A15A 4AMBA 1L4BA 1MW9X 4Z8YA 4BGUA 3PRKE 4YRTA 4QGGA 5CDSA 3VHXB 4A0QA 4IMIB 3QHQA 1WDLA 3ROQA 4YJ3B 2XYVA 3QBEA 5KTSA 4R8RA 3ZWMA 3C8MA 1D09A 4DLSA 1R8YA 1YR3A 1T2UA 4HWTA 3HI6A 3MWLA 3M5PA 3VZBA 4UEOA 2XUAA 2OZLA 3P26A 1A77A 4LYDA 2ZSFA 3IAM6 2Y93A 3BILA 4BX0A 3TLCA 2Z9BA 3QFFA 2GJ9A 3ITEA 2GCIA 4HNSA 1PT5A 4YIKA 4UHKA 1MW8X 5L4SA 4MW5A 1N57A 3SG0A 2KJQA 3OT1A 3TL6A 2I2WA 1S3GA 1B8VA 3M82A 1AJEA 3CVOA 4U7TB 2JGAA 1KK1A 4JNCA 1QO0D 4WFIA 1W6UA 1TYAE 4LA4A 1NN5A 3MGAA 1C3LA 3OU6A 1PT6A 4LDNA 3Q5EA 4Z0TA 5F73A 2PX3A 3U7FB 5KYKA 1UEJA 3FTNA 3OURA 4S2EA 5KEIA 4N65A 2BY4A 1KQ3A 2PS1A 4C7VA 4J07A 4ZI7B 5EVJA 5LUBA 1J06A 3LUAA 1NVEA 3P19A 3BE4A 4GM0A 4ETIA 2JGRA 1T4MA 3SMVA 2FEWB 1Y1LA 4CIAA 1F3LA 1GJRA 4HX9A 1N6KA 5EFZA 3JX9A 1RWNA 1EWQA 2DBYA 1X6VA 1LEHA 3LBYA 3LH5A 4EG1A 3KTOA 4UE3S 3NBQA 4HRYA 3U0BA 3ZIAD 3VR4A 4RZSA 1ZRMA 1ICEA 2VO1A 1DJLA 3K9NA 3Q3HA 2AI1A 3NBAA 1PJ4A 2GPYA 1R8QA 4WXEA 1TZKA 4II2A 2COEA 3ZC3A 5CBPB 1RYDA 4MEAA 2EGGA 2BGLA 2IZZA 2YFQA 4TV9B 4R9SA 3KQHA 4EY3A 1S4MA 3Q3IA 2X76A 2ZR7A 5CJPA 4DG9A 5C7IO 4RHTA 3KZNA 2CY0A 3L8FA 3C3JA 3K0CC 2WJVA 2ZJOA 4R0NA 2GS9A 4U2BA 5JDCA 4G85A 1OXBB 3QX7A 3I42A 3VH3A 3V8MA 3I6ZA 2KM1A 1X7YA 1WHSB 4BU0A 5F4ZA 4GWGA 1L5HA 1G1MA 1KSGA 1NPDA 3E3LA 3PGA1 2KYRA 2AG1A 3EMKA 3HO6A 1MX5A 3BCSA 1EUQA 3VU9B 2Y1LA 3FIUA 3T6KA 4NCJA 1KBOA 1R5OA 1T8TA 3EAGA 4FDTA 4NI5A 4EKIA 2XGMA 5KU7A 4RVCA 2IYQA 4Y9UA 2GLXA 4WOCA 2WAYA 4PSCA 2VK4A 3G9TA 1YRHA 2ZJ0A 4UAGA 1JHPA 5LC1A 3IOYA 4BP3A 2UYOA 2QJOA 3VR1A 3OMWA 5JO9A 4BUJA 5BSKA 4TROA 1EI9A 4O4LA 1JDBB 4M89A 1V7QA 3MWJA 3T4PA 4RKWA 4RPHA 5F3WB 4MVXA 1KPHA 1KXJA 4ON9A 5ALGA 5GM1A 3VTZA 2BFBA 1N2IA 1Z4NA 4ZV7A 3FHOA 3ROXA 1RR6A 1Y63A 2MHCA 3A1TA 3IPRA 1MJ5A 4KUEA 4K03A 1E79A 4X66B 4N41A 3UYKA 5LUAA 2QV0A 1E96A 1EAYA 4MQ4A 3VISA 5GINE 1CV2A 1H8HD 1YTLA 3RF6A 1XEXB 3K4PA 4QIHA 3IVAA 4X44A 4AVYA 1WU8A 1BHJA 3D5QA 3H1EA 4MGEA 3ZGVA 3ZJVA 3EY9A 1FNMA 4IDQA 1JHQA 2WF6A 3ETJA 1WZ2A 5AKYA 2G5TA 1CB0A 1QJ4A 3Q3JB 1BXZA 1FNCA 2V5VA 2Y05A 3U9TA 1CIJA 5JT1A 1ZR4A 1W7AA 1P7CA 3KHUA 3M6MD 4BB9A 3MCAA 4HEQA 4F91B 3LVRE 3TZQA 1F38A 3ITNA 2C78A 2RDMA 2XWSA 2MINA 3QVGA 4L4YA 1XWFA 4MPRA 4RO0A 4HNHA 4KFTA 3HUEA 4JU8A 3RJ5A 4EEKA 5JH7F 2JAOA 2FK7A 2VKTA 3VAZA 3W9BA 3X1YA 3BXPA 3ZXIA 1KERA 3NKVA 4POAA 3ZGZA 3HYNA 2I1WA 4M21A 4I5DA 1W1UA 2XUFA 2C0QA 4C4YA 5CLQA 5BQFA 2R65A 1YO6A 1AU9A 3VMFA 2QSYA 4RPKA 4LZPA 1SXJE 4MAFA 1MX3A 1KNXA 3QE3A 3CS3A 3GAFA 4ZOAA 5JZOA 4ARSA 2C2BA 4Y2RA 3A6PC 3GCXA 1ZU5A 4CMIA 5CVVA 1BQ3A 1L7XA 1AX9A 2X23A 3ZDYB 5BNTA 3LSTA 4N9QA 2GUGA 4JJIA 3U31A 5JFGA 1DBSA 2QX7A 1QHHB 4BV3A 1WXIA 2XMGA 3EH1A 3FPBA 1P2SA 2FZ5A 4YJHB 4AO6A 1N2JA 2FVYA 2AQKA 2JEOA 3F3YA 4G86A 2B83A 3B13B 4LQ4A 4R6XA 4EJ2A 5AK5A 5TT0A 4HDAA 2VDOB 3JTMA 1TO1E 5KTKA 2ZROA 4U63A 2QMYA 5GGYA 2WDZA 2Z8ZA 1DIAA 1KJJA 4AZ0A 4ZQHA 1CJUC 3DR5A 5B57C 1PS0A 3SZLA 5JTTA 4YP9A 1FYVA 4AN0A 2ODNA 3HJTA 3VU9A 3VNUA 1UP6A 1JHDA 1GAWA 1L2TA 1O94C 2EF1A 1QZTA 1YQWA 4BNJA 1ODCA 4NXMB 3IESA 4TYYA 2BR4A 5FPQA 3BTVA 2OVBA 1OI7A 4IYJA 4J0KA 3HXTA 1I30A 3JSAA 5EUBA 2B4YA 3ONEA 2HK9A 3F1LA 4UTXA 4AS3A 3BD6A 4OYHA 2QM3A 3KSRA 1T9AA 1FUUA 1X7ZB 4ZOLF 4IGAA 1HEIA 4ISBA 2DH5A 3B78A 4M9ZA 1E2JA 3R8CA 3TFOA 1I2CA 3L1HA 4C29A 5IDQA 5J4HA 4CODB 1TJNA 3K4QA 3GUUA 4PZLA 5G0UA 4LJRA 4UZEA 5E6SB 1V8PA 3ANLA 1UZUA 3C5CA 4IIXA 1W4LA 1W76A 2J87A 5HJ2A 4KHPB 3GLTA 4LOJA 4I4TB 1DRVA 1PKEA 2J1LA 4PQFA 2R8OA 3M83A 1W93A 2BZGA 2JBAB 1QG4A 2VHUA 4D0RA 2EGUA 1OAOA 2Z1MA 4C4RA 3BHNA 2I7VA 4R1UA 5JYBA 4GLOA 5BR7A 1AUQA 4G25A 1CF9A 2DKOA 2V96A 3W5HA 1UP7A 3DXYA 4IW3B 1E3MA 1IZZA 1M8KA 2X0FA 4DKJA 1AA9A 1PQ4A 4HB3A 4D2IA 3EXFB 2XLCA 4HQKA 4DR7B 1BO6A 1EX1A 4PAWA 2CHFA 3PXXA 5IHXA 2X22A 2XQVA 3RSSA 3U2QA 5I45A 1IZYA 2BHTA 2WEKA 3REOA 4HDQB 3ASYA 4PYKA 1NFFA 3M1YA 1HLPA 4DM4A 1WBBA 2VWGA 3ONWA 3KFVA 4HQFA 2NO1A 3KDSE 4B3SB 2FQYA 4Q34A 4MJLA 3AL3A 2PJRA 1ORDA 2VNSA 1M2WA 2EFDB 4QUHA 5KYUB 5HQTA 1DDOA 1CC1S 2W98A 5CBPA 4DB2A 3T7SA 4J7AA 1HE2A 4JB2A 5A9RA 2H2IA 2H2WA 4JZYA 5FUYA 2M1XA 3VZCA 3PVCA 3ZV3A 3PHCA 4TQAA 1EP3B 3DEZA 1UOEA 4CM5A 4XIIA 4HO1X 1R9MA 3OH8A 1T34A 1O8BA 2G83A 1RAIA 4DNPA 4ARZA 4PZDA 4LWPA 3L7KA 3V6LA 4BVHA 3L0OA 3O1IC 4FLMA 1VE5A 2VCEA 4D99A 1L7EA 2WUVA 1S2IA 3LXMA 4Z0NA 3AHHA 3LWDA 1AK2A 4QUDA 2NPOA 4OBXA 4RPJA 2CE2X 2R5FA 3PD7A 4JKOA 1DO0A 3HV2A 4OHRA 3Q98A 4YRBA 2CV2A 2ZUCA 1XMQB 3ZVNA 2W93A 3O8QA 3ONNA 2V4ZA 5AM3A 4GEGA 5BVHB 2UYYA 2WHXA 4DLBA 2D0PB 3KDAA 2ZUUA 3CZRA 3DGFC 3LOUA 1EUZA 4KYTA 4MVJG 2VRCD 3EMVA 5A03A 5KOYA 2I29A 2DULA 1QBKC 1FP7A 4DMMA 2ZYTX 4R2WA 5CK4A 3WLJA 1UBTS 3RI3A 2NU7B 2O52A 4E03A 3C6BA 1Q7TA 1L5RA 3O8BA 2PZAA 1FP4B 1C9JA 3JAWB 2RKOA 2GKOA 3P20A 4M9RA 4B8WA 4XYLA 1P81A 2WUDA 2PIAA 4HTFA 3ILSA 4MI3A 5L3QB 3IH5A 4IWYA 4K6KA 2X15A 3OICA 2LD4A 4H27A 4ZT3A 3CZ4A 3IQZA 2OBNA 3N8HA 1BJTA 4R68A 1TVKA 2DFNA 2CXNA 3QKUA 4AURA 2OORC 3MNFA 1J7JA 2GJ8A 3HMQA 2N75A 2DUNA 3DHYA 3JYQA 3NALA 1C81A 4IDGA 5BO5A 3ZHUA 4PN7A 2F4VB 3K5WA 3G82C 2H2GA 3MOSA 3SS8A 3C1UA 4LHZA 2CC2A 3U16A 1F0PA 1Z0JA 3COJA 3REQA 4AJ1A 2VDUE 2HPAA 5L9AA 3NBFA 3JQ8B 3R6DA 4I3GA 3U5TA 1Z7GA 3W8FA 2FDCA 1BMTA 4TLAA 5FL7D 3DXZA 4BMOB 1UDAA 1OTXA 4KRXA 4QFBA 5FI5A 3PDIA 2FJUA 1Q2XA 1YAJA 3L46A 3OZCA 4OYRA 1IAVA 1X74A 4UU7A 4DRXA 5HW0A 3B51X 3KSAC 5CYFA 3BRWA 4LRXA 4DCUA 3BSWA 1DG1G 1QXSA 4CV0A 4W9NA 1UFQA 1G5HA 2O48X 5KWIA 1P72A 2Y6VA 3UQZA 4LRUA 3LUJA 2OC4A 3UWMA 4B3IA 2XITA 4UREA 1J2RA 1PR4A 4JGGA 1TD9A 3ES9A 1LNSA 1T9HA 2ORYA 3UAYA 3UUGA 4PM4A 4AF8A 1R6XA 3OZEA 5K09A 1R18A 4IICA 2FW1A 4Z9YA 2CLHB 2XCUA 1KKLA 3KVVA 3CX7A 1C7ZA 3Q8WA 3QWHA 2IUYA 3DFIA 2D59A 1I4TD 4I4LA 2AEFA 1VA5A 1SQ0A 4N7RA 3AK4A 2W2NA 4XWYA 3PKIA 1PF7E 3R8XA 5JY6A 1HGXA 4LNUB 2JK1A 4CQMD 4ZEOA 1SK9A 1CZOA 3AV0B 5FWYB 4NZZA 3SBDA 5AW3A 1R1DA 3PRYA 4FFNA 4RF3A 1UQUA 1Y34E 2CHEA 2QF7A 4L8VA 1ECCA 1EA5A 1UXHA 4JBIA 5HX7A 3W1EA 1O95A 2C4NA 1AUPA 5HZMA 4HYQA 4NDZA 4IHQA 3PHLA 3QXXA 4EMBA 2GEFA 4CL8A 1GTL1 2WJAA 4ZP1A 2D7CA 5FTWA 4FGLA 5A62A 1LQUA 3JW8A 3RS5A 1MGOA 3SMQA 2WKWA 2GBFA 4XD7A 4AUEA 2FWJA 1UC4B 3JYPA 4G0VA 2BMWA 3PXBA 5T41A 3BFXA 2O7NA 3CXUA 5EWJA 1RBMA 1H0RA 4ZYLA 2Q3FA 3NHZA 2NZYA 3DKRA 5DCWA 5DNWA 3W5SA 4JA2A 4MVJA 3C15C 3RREA 3DTVB 2F3TA 3WQQA 4YJGA 1XD2A 2QZJA 3ZEIA 4H6VA 5IKOA 1KRXA 1OFVA 5J2UB 2FE1A 3H2SA 1L5FA 1DAHA 3WLSA 1X1CA 3RVSA 1XDDA 1FLAA 2C9OA 5IJXA 3RSLA 4X60A 4HWGA 1ZIDA 3L6DA 1AZLA 2J9FA 1YTUA 1UBFA 4IBOA 4TXNA 1JXAA 5JRJA 2FX5A 4H7DA 3KYBA 4C4AA 3KSDO 5CFZA 2GJ4A 5TGZA 1NOJA 1VB5A 1IUPA 2RONA 1W5BA 3V1TC 4DMGA 5KTNA 3CONA 2UZ1A 1NDHA 3PUYA 1IB6A 4PO8A 4MCIA 1UIRA 3U9SA 3ENNA 3PNKA 4GMHA 4D8UA 5B5SA 1BAPA 3TXXA 3DH0A 4ZCSA 5FR1A 2WU3A 3MHPA 1OT3A 4IX9A 1VXRA 3TUJC 4DPLA 1BDHA 2IS2A 4O5OA 5EIOA 2FGKA 3L01A 1SQSA 2V6BA 3WAGA 1M34A 3EBOA 3AUSA 4G9GA 2PMFA 1HFKA 1MJGM 1PVVA 3F7MA 3LW8A 1AHIA 3QHAA 1WUHS 2NO9A 4ARUA 4UTRA 4LY9A 1I5EA 5JDCC 4AG6A 1BGXT 1FTYA 1V16A 3K0AB 1V2GA 1Y42X 1O94A 2FFAA 4WGGA 3FXAA 1P0IA 3CLUD 3CX4A 2WB4A 1PP4A 3D1LA 2CVFA 3LRXA 5B1DA 5JAQA 5JPCA 4UE2A 1RLJA 3NTRA 4ALKA 1IHUA 1DEAA 1UMKA 3X43A 4EO4A 2P68A 3KUUA 1VP3A 3IS3A 3LO8A 3JAMA 3LL4A 5BWOA 3RIMA 2JHPA 3HUFA 1VSQA 1QX3A 3EEQA 3P97A 2OCDA 2FPGB 2NZXA 4C6TB 4ZMRA 3GBVA 1YR6A 3O82A 1F20A 1K8XB 2I1VB 5DX1A 5FBVB 5FWYA 3F7NA 4POOA 4LNHA 1BCRA 1Z9BA 2ENUA 2CHQA 2VRCA 3IIIA 4LTNA 5ALXA 5ICMA 4IXDA 3ZE0B 5KQPA 4ZYXA 4TMXA 5FFNA 5HILA 1PHPA 2UZ1B 4CNQA 4FE4A 2C95A 2AK3A 3IV9A 1Y1RA 3O75A 2RH5A 4O2AB 1CUYA 1NUQA 1Q17A 1Z0UA 5A7HA 4PG8A 4YAUA 1SCDA 4RVSA 1JAIA 1BN7A 1L4EA 2C5BA 2YWGA 2Q9CA 5G40A 4EQ6B 2PT7A 1XK6A 4QOGA 5C9ZA 1N0HA 1MC5A 1PW5A 1WRBA 3QKSA 4R54A 4PS1A 3RASA 3OSZA 5CFOA 1CUGA 4G01B 4X6YA 5H5JA 3BOSA 3TAUA 2ZYSA 3WTCA 4F6RB 1PTKA 2QRLA 3DBOB 4FP9A 2I1QA 4KXNA 1JG4A 2OZKA 2PD6A 5J5AA 1C4WA 1BEUB 5DLQC 5JBQA 2Q3CA 4LNAA 2G1UA 3MD9A 5ALUA 3LBHA 1NKSA 1L4NA 2CBGA 1SM4A 4P4NA 2QD2A 1GG2A 3EPKA 3BYZA 1PJ2A 1SBTA 3IHTA 1SKMA 1OCEA 3TDNA 1FQOA 4X8LA 3TJMA 2G72A 1H6AA 1E1DA 3T0IA 2AF3C 5JLAA 3AIIA 3F5FA 4JASB 4NMMA 3ZWYA 1M6NA 1ONOA 3K6KA 5AXCA 5AI4A 3WGNA 1OB2A 4YJFB 1QFSA 5I7AA 3GFVA 3FYHA 1SU8A 3JQQA 1JJVA 4M1EA 2IYSA 1HH4A 1SBIA 3J80A 4LHYA 5AK3A 3NGLA 3ORFA 4Z1MD 5IVPA 3GOHA 2X0NA 1E5TA 1P77A 1XVAA 2XKJE 1G21A 1KK0A 4QRIA 1EVJA 4JBWA 4PPFA 4HNVA 4QRHA 4JXJA 5KSZA 3ZNPA 5B7PA 1JE1A 3CF4A 2JGLA 5EXTA 1OH6A 4EFNA 4FFSA 4OY3A 5CB4F 4X3OA 5M3BA 5EZ6B 3R6WA 3BL5A 2JH8A 1E18A 3QITA 4HNRA 4DBVO 1LD3A 3A06A 5B6PA 1O87A 3EFOB 3LDGA 3IR5A 2BH9A 2RB5A 5IU6A 3JAWA 2IP1A 4MHSA 3VO8A 2AX4A 3NOVA 4U7DA 1ACJA 3CO5A 4RNCA 4QSMA 2WIAA 2P9TA 3ESZA 4MP6A 2W2TA 1Z0SA 2NU7A 3DNPA 1SXQA 5F78A 5K0CA 1F2TB 1EU1A 2CVOA 3FAKA 2JVIA 3NOOA 4K81B 1AKRA 4BGDA 4CEJB 5J5CA 4I3HA 3ZZ0A 4Y98A 3WOHA 1J8YF 3PNLA 2FPLA 3AY3A 3WIEA 3HCWA 2ENWA 2RI1A 3T9CA 5E7QA 1Z12A 4BCCA 4PC1A 2OO7A 5TLSA 3DV2A 3A28A 2PUBA 4PANA 5EWJB 1N3LA 1EA7A 1R0SA 1A76A 3NRCA 2QZSA 4IUDS 3ZWXA 3KQQA 4BWVA 4D4GA 2OP0A 3A9UA 4MS4B 2FOLA 3T9BA 4EARA 1EK2A 4JLMA 4EI9A 3BUSA 3FDZA 3G0IA 2JFNA 4REQB 4C7OA 4O4IF 4ZT5A 3AY7A 1NM5A 2R6GA 5IH3A 4UTOA 4X54A 3R3HA 3B7GA 9MHTA 3IHKA 1XRRA 1XKTA 3F5DA 5DWVA 1E1RA 2UUCB 4LXXA 1W36B 1P3JA 4NYJQ 2LP4Y 1W19A 4QXAA 3GJXC 2IBTA 2EP7A 3N86A 1LZKA 3I2KA 3CYFA 1WB6A 4IYRA 2CEAA 2UXDB 2FMIA 1P2TA 2PH1A 3EC2A 4NL4H 3RNLA 4Z99A 1JQEA 4RTLA 1XA4A 4W8HA 3HJFA 1VRVA 4QJBA 4BNLA 3THXA 3H5WA 5TGDA 3KEOA 4RD4A 2FNAA 4AKSA 2OFOA 3QWAA 5LZ8A 1SC1A 1EFUA 3W0LB 4DDHA 3QVTA 1QO0A 4HZIA 4LJ8A 5GAJA 2O0LA 3D3WB 1C9DB 4RHXA 1GRQA 1H3NA 5BQPA 2NN3C 1WMDA 4BO6A 1CR6A 1JJFA 1QIMA 5AW0A 2Z5FA 3W5AA 1YR1A 4O4HA 4X24A 4MA0A 5AHKA 3AHIA 3CBGA 3I64A 3D6NB 4PGMA 4X6LA 3WWCA 4EJFA 4Q3DA 4C4PA 1FE8A 4PXSA 1M8JA 3EQZA 3FZQA 3C6XA 3DFUA 3DMYA 1BNCA 4KUHA 1T0UA 4KLRA 4AJEA 5TEWA 4U2DA 5DBOA 4BBZA 5IT5A 2PQ2A 5C1OA 4AZSA 4BFYA 1EFPB 4HNUA 4FFLA 5AKHA 3JD2A 4L9WA 4X3CA 4K2AA 5K3AA 1MPTA 3I04M 3BMQB 4WTOA 1YDEA 3MJDA 5LM3A 1M5UA 3BRSA 9LDTA 4I1VA 1UT6A 3B48A 1PL0A 4B84A 1VKHA 5TQ2A 3KRTA 1E2QA 3B5EA 1TUIA 4HB0A 3E9MA 1MN6A 2VPZA 3HJGA 3HL4A 4TQ9A 4EUNA 3ZVKA 1YJQA 1G9SA 2H2FA 4JR0A 3TCXB 1WMBA 1P31A 1E9VA 3C85A 1KH1A 4M2LA 4PF1A 2AQIA 1OSNA 2FN9A 1QKIA 1J5XA 3OESA 4G0PA 4KMRA 1DLJA 2FOXA 3LK7A 4PSAA 3W77A 4EMUA 2ZIUB 5K0GA 1ILEA 4U2CA 2Y68A 2PZFA 3ND7A 5HFNA 1J6UA 2AS0A 5AVRA 4RZHA 5JVDF 4OXYA 4I14A 4DBLC 5HIJA 1SHZA 3BERA 3ESBA 3FCCA 3K2EA 3T4EA 5H83A 5LNK1 4I4CA 4YMSA 4US2R 4U7PB 2O1EA 2PLFA 2QTFA 5ALJA 3DJFA 4YBRA 4HWSA 2EBFX 1RQ2A 1FDWA 2D1TA 3PEEA 4AI6A 5C8YA 1U3CA 4NZPA 4XGRA 4GL2A 2CXSA 3Q3VA 1MH1A 3QUCA 1KIFA 3ROMA 2AJDA 2Y1KA 3JD0A 1AZWA 4EKYA 1V3TA 3T7KA 3CH4B 2K2WA 2I4RA 4DR2B 3DLBA 2RAVA 5DP1A 1CUFA 4LE2A 4F21A 5GONF 1S1MA 4U8HA 3OCUA 3D3JA 3ZWNA 4XWKA 2AIRA 1LPPA 1MXHA 4Y1EA 4HDMA 4M86A 4BVEA 1T0BA 2D2XA 3WO0A 2B4RO 4CV3A 1JR4A 1ZGHA 1ATIA 3LQQA 2V7WA 3URMA 4G1VA 5F7ZA 1N92A 1NBMA 5FP0A 5ICFA 3PQ3A 4IFEA 3RBVA 2IDKA 3F6SA 4FYWA 4IJKA 3KLNA 1NWHA 2P5YA 3JASB 5JARA 3HVRA 4GRIA 1KAEA 4HLDA 3DOJA 1O6ZA 2COUA 3B8EA 3UAWA 2EIXA 3KPVA 1BJKA 1WDWB 2FSSA 3AUXA 1JILA 3NHJA 3N0XA 4ID9A 2R84A 2Y27A 1DTWB 5JXJA 4LZJA 3EPJA 4FMDF 3GX1A 4YVFA 3UM9A 4PNPA 1SIUA 2ATEA 1BMDA 5CIWA 3T61A 1SY7A 2H0RA 1DRUA 3C3AA 4P9NA 4DJ5X 4E4YA 1V3QE 3N76A 2C4WA 1VA4A 3GA7A 1SXJA 4KO8A 2X1LA 4R69A 4EY5A 3M4JA 3LL7A 1Z4QA 4OI1A 3SJUA 2IEZA 3U81A 4BNZA 4BBJA 5LNK6 2WLSA 1Z0FA 3RVPA 3ZZUA 3FX2A 2GPWA 4KMMA 4KV7A 2GEJA 5I6DA 3HR8A 3PE6A 2R7AA 1RAAA 2NU8B 5JOQA 3FOFC 1K97A 1JFSA 2EX0A 2FSIA 3PVZA 3BAFA 2YVAA 2BD0A 4O63O 3PC7A 3QVWA 4AUKA 3I61A 1FMLA 2V9PA 4IM7A 5LDDC 2HU7A 3BM5A 3STXA 1XQ6A 1YK1A 1RHKA 5FF9A 3KAKA 4O2BA 3DZGA 3IXLA 4OKNA 1EINA 4OXRA 4JV5B 2XW6A 2QN3A 1XTTA 2JJQA 2JCXA 3SX2A 5IYZA 3NO4A 4NFYA 1W88A 3GZTB 4NR0A 2KBFA 1PZNA 3WRYC 5HJEA 2I9KA 1DRKA 1EQ2A 1XZBA 4JROA 4IDAA 4IH9A 3VQTA 3NHMA 5ED0A 5KQLA 4KWTA 2NSDA 4B48A 1UQRA 3A9WA 1O95D 3D2CA 2PO7A 3EFBA 5KDOA 2WJZB 2VP6A 2HSEA 1ULHA 1HOXA 3A1EA 1SXJB 1PR9A 3E82A 4GRAA 2QLBA 2GM9A 4UQOA 1M5RA 3DXFA 4RA9A 4EJSA 5B3AA 2MINB 4MCJA 1Z74A 1E7SA 2DRIA 2YW9A 4OH7A 3ZLBA 2FWNA 4Z7JA 5D84A 2C0PA 1AQYA 1GPWB 2NO6A 3TOXA 1DTWA 4GI7A 2BH2A 2G9VA 4DDMA 4GDMA 4LCEA 4ZAXA 4MA4A 1ULTA 4CM8A 4TYWA 3N0RA 1R0LA 1MO2A 2FSVC 1ISGA 4GPIB 1KEKA 3LGXA 1CIPA 1LV8A 1W1IA 2ERCA 3JASA 5LOVA 4FPXA 4FGWA 5C46F 4XX1A 1R37A 5A6SA 2Z08A 4TLDA 4EY8A 3B6JA 5BWCA 1TXGA 5T5QA 1ONSA 1KQGA 2WE7A 2IS4A 3CN9A 2B69A 1K4MA 2W9XA 3CKYA 2ORVA 5DYGA 1ID1A 3NGMA 4R4JA 4K88A 2AKAB 2QTGA 2Y1EA 4IIJF 1DUVG 3KJEA 4CMIB 2GZSA 3N53A 4CQJA 4IHJA 1XQ1A 4UVIA 4F4IA 4FSHA 1ZOSA 1N2CE 3OLQA 1ZKDA 2XAUA 3E05A 4YFYA 5E4FA 2DT8A 2E4XA 1K86A 2QGFA 3VX3A 4NPCA 4LJ6A 3GGJA 3IVRA 2Q3MA 4PZUA 1WUYA 3BH0A 1GFSA 4E2XA 3TEFA 2ZT7A 3CJRA 3QLVA