4UNRA

Mtb tmk in complex with compound 23
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
209
structure length
186
Chain Sequence
MLIAIEGVDGAGKRTLVEKLSGAFRAAGRSVATLAFPRYGQSVAADIAAEALHGEHGDLASSVYAMATLFALDRAGAVHTIQGLCRGYDVVILDRYVASNAAYSAARLHENAAGKAAAWVQRIEFARLGLPKPDWQVLLAVSAEDAELQQRTGAVYAELAAQGWGGRWLVVGADVDPGRLAATLAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure Guided Lead Generation for M. Tuberculosis Thymidylate Kinase (Mtb Tmk): Discovery of 3-Cyanopyridone and 1,6-Naphthyridin-2-One as Potent Inhibitors.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords THYMIDYLATE KINASE
total genus 70
structure length 186
sequence length 209
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2014-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4unrA00
4QOSA 2CL7X 4IKEA 4QHTA 4B44A 3EPHA 4LJ6A 3AKEA 1Q44A 2CHVA 1DG3A 1DAKA 2YNMA 2ZSAA 5L3QA 1GTVA 3VX3A 1YZQA 3Q5EA 4HUQA 2G1KA 4IVQA 2V7QD 1OLOA 4FCWA 3VU9A 2R65A 1E0SA 2FMXA 3EZ7A 2ZAMA 1D2EA 3NH6A 2UVQA 2FGJA 4OI2A 3RRNA 5B30A 3D7MA 3L0OA 1BS1A 4QNMA 2QAGA 2IK8A 1OXTA 4W5WA 1B23P 4ZDIA 2ZI5A 5FFMA 1YVDA 2JIZA 1E79D 4DSUA 2O8FA 1NKTA 1NG9A 4AY2A 3W5IA 1I2MA 2HUPA 5AUOB 1SHKA 1EX6A 5BQ5A 1KI6A 1DE0A 1E2QA 2E9SA 3CBQA 3I61A 1AK2A 3GD7A 3BAFA 1E0AA 3GJ8A 1W0KA 3LW7A 1W44A 3TUIC 2D2EA 2WWYA 1AQYA 2HF9A 3QG5A 2BEKA 4C0BA 3WYFA 4FINA 2D2FA 5IK2A 1ZM2A 2C5LA 3DO6A 2ZU6A 4OL0A 1KY2A 1R5OA 3BXZA 4V0MA 2OSBA 1N0UA 1KAGA 1M74A 1NVVR 4LWZA 3DM5A 2ZE5A 4D25A 1NMZA 4A36A 3RS2A 2V8OA 2GXQA 1KK0A 3OZXA 3AUYA 2O52A 2QPTA 2EWVA 1K6MA 4HDQB 3JVVA 4P4SA 5EE0A 5BWMA 4MGZR 4W5JA 3PEWA 1OW3B 3OIWA 3FOZA 4Z8XA 2ZRMA 5EP2A 1KI8A 2CNWA 2ZJ8A 5EZ6B 5G40A 2EFGA 2BDTA 3MGCA 3QY0A 2R44A 1Z8FA 4P0TA 1G6OA 4JT2A 1GDDA 3R8FA 2IHYA 1DTSA 1UEIA 2H92A 2RGAA 4V03A 4URYR 2EYQA 4G5OA 4HAVA 4B74A 3GLGA 1A2KC 4DDUA 1KMHB 1T3LA 3KQHA 2GJ9A 1EGAA 2GAAA 3ECCA 4GOKA 4R7ZA 2X1VA 4RKFA 4QNRA 4TMXA 1UKZA 1AJEA 3KJGA 4LC0A 4HI0E 2JLXA 1NBMA 4HAYA 4QC2A 2WWHA 1OF1A 3SFVA 1W7AA 1JQLB 3U61B 3PUWA 3TLXA 2YWHA 3GEHA 3HYRA 4ZI2A 3KJEA 5KSOA 1R2QA 2FEMA 4RFSB 1GNRA 4U7DA 4C2UA 1AIPA 3N70A 3ZS9A 1OFUX 3KXKA 3I72A 5F9FA 3THXB 5LDDC 4Z1MA 1YZUA 3K0FA 4EPYA 2HCJB 4AWXA 4PAMA 3U3KA 1P75A 3E5HA 2CLDX 2YKGA 3NC1C 4MKFA 1LNZA 1XTJA 2JLQA 3I5YA 3MG9A 2IYVA 3R7WA 1E1RA 4ESVA 3SQXA 3R7WB 3WMFA 4P32A 5SZHB 4I1UA 4DUGD 1SULA 2A5FA 4YONB 3RS4A 4B3BA 2JEOA 3NHBA 4IFBA 4LDJA 1QHXA 1UDWA 3H84A 3HR7A 4X8MA 2Z4RA 2ZJAA 5KOYA 2RGXA 1E3MA 1I4TD 2WHXA 4XIGS 2VLIA 4NTZA 3PUVA 4WBSA 2W6ID 1G20E 3FGNA 3LRPA 4MITA 1XP8A 3IIMA 1WRBA 1SVOA 4KVGA 4QBIA 3AH8A 1TQ6A 1G3UA 2ZJ5A 2C04A 2QU8A 1BMFA 4JYCA 4BRUA 5JSZB 3AVXA 2FH5B 1SKYE 3ZQ6A 4C30A 2IEZA 3A37A 3SZRA 1R8SA 2HT6A 2F9MA 1JAIA 3TAUA 1YRAA 2BC9A 4C0HA 1BO6A 1VMAA 4POAA 3EARA 4GRAA 3QKSB 2N42A 4IEEA 4RD1A 1ZD8A 1KI6B 1R0XA 5J40A 1OB2A 4C7OA 2A5YB 4PHHA 2DPXA 2J3EA 3B1VA 5LBIA 4DIDA 3D31A 4LJ8A 4L5BA 1VCNA 5TY0A 1W0KD 2K5UA 2ZRDA 5HR5A 1EWRA 4HDCA 4RCZA 5KDLA 1G16A 5JI2E 5G3ZA 2HF8A 3EG5A 1TQ4A 5DN6D 5IF9A 4QGFA 3HPQA 1J7KA 1FP6A 1OHHA 2ZYTX 4TT3D 1CJKC 3UMFA 1GL6A 3TK1A 4TMZA 1G7SA 1QDEA 2BWJA 3ZZTA 2PZGA 1W36D 2N1BA 3BS4A 2J7KA 2CL6X 3GMTA 1FL9A 3LH5A 4A1FA 4NCIA 4Q4AB 5EXPA 3KTAA 4U5XA 1RJ9A 4NYIQ 2P6NA 1R0WA 2BVNA 2XXAA 1E2DA 3MWKA 3CF2A 3U3JA 2A30A 1T5LA 1F2TB 2BJVA 4HB0A 3OEEA 2JJ8A 3DMNA 2RGNA 4TTRA 3T5DA 4M1OA 5LPNA 1W4CA 3B1YA 4JBWA 4HLDA 4QGHA 2OBLA 1CJMA 1HA3A 2JA1A 1CTQA 2OLKA 2IYWA 3G82C 2F7SA 1P5ZB 2ZSEA 3EW9A 2AD5A 421PA 4MYTA 2DR3A 1SVMA 2VRWA 1WA5A 4HZIA 4CVNA 3L0SA 1RRGA 2FNAA 1C4OA 3EIEA 5F9HA 5E7MA 5KNBA 2ZVPX 3D6TB 4UJ5A 2W6JD 1E2PA 3QVUA 2XNDD 1SXJD 1P61B 2OM2A 3M6AA 4KAXA 4LYAA 4A82A 4GZMA 1KDPA 1ZM4A 1IHUA 3WP0A 3SN6A 2QM7A 3HDTA 4D2IA 1H8HD 4DLTA 2PBRA 2OCYC 1A5TA 2P65A 3BBPA 2RB4A 3U6KA 1W1WA 1N6LA 3RRYA 3X1XA 2HLDA 2ZJBA 3QKUA 4LI0A 2G0TA 1P2UA 5E7IA 2B21A 3GJ0A 4BLSA 1QHHB 2AWNA 4JSYA 2I4IA 4XVUA 4ESHA 1QHYA 2IXEA 1E1RD 4KFSA 2JATA 3CR7A 1OH5A 1MO3A 1TQDA 1ZC4A 4JVLA 4YQFA 1E2EA 3A6PC 5JI3E 4RD0A 1ZVQA 2A5GA 2OZEA 2V9PA 4XD7A 1MABB 5IDVA 2A2ZA 2GCOA 3RDPA 1A7JA 1D8TA 1M6NA 2BCJQ 4UNNA 5K8UA 2CNWD 2HXSA 3VR4A 1EFCA 3A1VA 3K0FB 1BYUA 3GJ4A 4V0ME 3NTUA 3SI7A 2Z4SA 3P4YA 1MO4A 2DWQA 1MRNA 2BKEA 1G291 1Z07A 1RFLA 2O8DB 3BOSA 1X6VA 4BLRA 1EFTA 5L8VA 4MKGA 2J46A 4DSOA 4NONA 1UBFA 1S9DA 3ZS8A 3RYTC 4JLPA 2WAYA 4Q4LA 1KI3A 1XD9A 3CF0A 4MUBA 2PLRA 2PZEA 3VU9B 2J59A 3AVVA 4LBZA 1Z29A 3ND8A 3WRXC 4Y0VA 2GXAA 3X1DA 3ZIAA 4L15A 2WTUA 3QKRB 3ZZUA 4DEYA 3QENA 3BH7A 3EZ2A 2HDNB 4BZPA 4HDOB 4DT1B 5EE3A 2X77A 1IQPA 2X8AA 2ZVQX 5TARA 2ORIA 1GAJA 3OEHA 3LW8A 3P32A 4D4MA 1T9HA 4DZZA 2RGBA 4AYTA 1FNNA 2JCSA 4A8JB 4MKHA 2ZRHA 1BOFA 1XTSA 2F1IA 3U3OA 3U7GA 1NP6A 4MKIA 1WE2A 4PQRA 1RIFA 3LVRE 1U99A 4OK6A 3J81k 1S96A 1K8RA 3DHWC 3GLHB 1I4DD 3TH5A 1W36C 1I4LD 4M21A 1QZXA 4MRRA 2QAJA 1IJFA 2R2AA 1US8B 1XTIA 4IJMA 3PJRA 2F9LA 3EZ6A 1YU9A 2IL1A 1A1VA 1EFUA 1GNPA 3FHCB 5IRCD 1KKLA 3K0AA 2SHKA 1E9CA 1ZC3A 3CNNA 1DADA 3I4LA 3LLUA 4CEHA 2PT7A 2Q9CA 2IEYA 2DFTA 4MRPA 2WAXA 3VHLB 3VX4A 1ZNXA 2VF8A 4QM7A 1FX0A 2MSDB 1HV8A 3OAAA 3CO5A 4Z51A 4HAZA 3GFTA 2CBZA 2F1RA 1R6BX 4PZZA 4KBFA 2GHIA 1JR6A 5GADl 2RMKA 5LD2C 4QJ4A 5GJWC 1KI4A 2REBA 4V0OA 3IDQA 1XWIA 3UWOA 5FUXA 1WDTA 1PJRA 1XEFA 1LFDB 3GFPA 1QHIA 3ZH9B 2KBFA 2CMKA 4Y0AA 4B2PA 3K0AB 2V4ZA 4P4TA 4MUAA 5JEEA 5FBLB 1TUIA 2BM0A 3SR0A 2F3RA 1G3QA 4WZAE 4KITB 4NL4H 4N3NA 1E9AA 2ZRAA 1WCV1 2IYLD 1GKIA 4FD2A 3FFBA 1OHHD 2WWWA 2O0HA 3QF4A 2GCPA 1CU1A 4TL8A 3L0IB 5TV2A 621PA 2ZR9A 5K8IA 3THYB 3CB4A 1FZQA 1E9DA 4PPNA 3K70C 4TL7A 1AQUA 3B60A 3BWDD 3ZD6A 4C3ZA 1UKEA 2V6JA 4F38A 4YMTA 1LS1A 1IAQA 4JLOA 1NMXA 3VR6A 1CR4A 1P3JA 3IPYA 2ZRGA 3KFXA 1Z3IX 3B2EA 4O2LA 1LVGA 1ZM3A 3AF2A 5DLQC 1ZNYA 2WWGA 5FL7A 4B35A 1CULC 2AWOA 1KMQA 5EXSA 2C8VA 3PQCA 1U8AA 3FMPB 3FKSA 4PQFA 4JIMA 2BBTA 1E2FA 3IEVA 3ZYCA 1H65A 1UPTA 3GJ3A 3IEUA 4KFUA 1J99A 1KYIA 2B92A 2W6JA 1YZKA 3THWA 3QXSA 2B6HA 1VYVA 3RWMB 3GPLA 4ACAA 1Z22A 4B73A 1KHTA 3ONWA 2ZANA 3PEYA 4BGDA 1J2JA 5G53C 1KZGB 2VP9A 2ERYA 1WXQA 1E9RA 2GF9A 2IYSA 2YHSA 3B7GA 3U7EB 1TTTA 4CGZA 2FEOA 1FX0B 5HTKA 4GT1A 3K0CC 4BFSA 4ZDKA 4EPVA 5CJ2A 3QBVA 4OQNA 4LZZA 3VR1A 3QPUA 1CIPA 1JPJA 2ZS9A 3MMPA 4D81A 3VAAA 1E99A 2HLDD 3THOA 4D26A 4OI0A 2NPFA 4F92B 1KI7A 3P4XA 4Q7KA 1GL9B 4ASUA 2GK7A 5DHAA 5DI3B 4DC9A 4JVSB 3VFDA 5FOUA 4AYXA 3KDSE 3A58B 3FFAA 5A4JA 2GJAA 1DS6A 4JLBA 1S1CA 1Z0JA 2RCNA 1DAFA 221PA 1XXHE 4LOAA 1US8A 2EFCB 1ETUA 1IN7A 2OILA 4JMPA 3SHWA 2YVUA 1WBDA 5EXTA 1QHNA 1R4AA 5KUTA 2GJKA 5H8WA 5C1BA 1BYIA 1XD2B 2ZTSA 1OSNA 4YC7A 4F91B 2H18A 3QIAA 2IYYA 2LCFA 4MDEA 4OKSA 3TUJC 2O8CA 2VHQA 4D4KA 4M9SA 4RFVA 2R6GA 1EX7A 4PC3A 4PZYA 4TTPA 4Q00A 4EDHA 5BN3A 5JBQA 1CRQA 1P4SA 2PLFA 5H68A 4BPBA 3GLHE 4KFRA 4Q18A 2R6FA 3B5JA 1SXJC 2RGEA 1XNJA 1N2CE 1TMKA 2WJIA 3ZIAD 4M1KA 2VP6A 3I8XA 2OO7A 2ZJ2A 2ZYUX 1KOFA 2ATVA 1G5TA 3IQXA 3OFND 3NH9A 2FZLA 1VHLA 3H2YA 2C9YA 1ONBA 5J5CA 2YC2C 2HJVA 4FMCF 4QGAA 5EP3A 2B7BA 2AKAB 1P9WA 2VP4A 5FR2A 4IDQA 2RGDA 4YMWA 3QEJA 3KUCA 1S0UA 1G17A 1Y3AA 3S1AB 3H1TA 4BRWA 1E2JA 2FN4A 4CIDA 1NNEA 3KXIA 5CIWA 5M04A 2ZAOA 2FZ4A 1YRBA 3ZQJA 3KQUA 3PG5A 1QF9A 2G83A 2O8DA 1E2NA 4NMMA 4E09A 4FCVA 3B1XA 3AVWA 1Z6YA 1I2DA 4PAQA 3GEEA 3PV0A 3AKDA 4W7SA 3AP1A 1JJ7A 2JASA 1UADA 2O8BB 3U44B 1F2UB 2PX3A 4JT4A 2JLSA 2J7PA 2QL6A 3IBGA 4RD6A 3K1JA 2KBEA 3K70B 1IBRA 1AS0A 3FDIA 3B82A 3DZ8A 2QT0A 2GZDA 1UKVY 3FPAA 3LFUA 5AR1A 1E79A 2ZXUA 4LBWA 2Q3HA 121PA 2C03A 4LYJA 1NVUQ 4EFLA 3K09A 4D4LA 3W6PA 1JECA 1ZINA 5J47A 3RSOA 1XJCA 4NKRA 1S3SA 1NL3A 2ZJOA 4TYQA 2ZUCA 1E9FA 5J4YA 2XNDA 2UZ3A 5LB2A 4EFNA 2IBMA 2H17A 2Z83A 3QI2A 4EQ6B 3QG1A 3ZLJA 2ZRBA 4F7WA 4RD2A 3OE7A 4JS0A 5E4FA 4HB3A 1F60A 3Q8XB 3KX2A 1N6HA 3K9NA 4M9QA 2PH1A 3B1WA 3O47A 3U4QB 2D3WA 2XSZA 2ZRLA 4QGGA 4TWZA 4M9ZA 2YJTD 3R9IA 1D5CA 4HLQB 1IN6A 3CRQA 4O25A 1JPNA 4OJKA 4IFEA 4FN5A 4G5SA 4GL2A 1IY0A 3VMFA 3LVQE 1MT0A 3EZ9A 1QVRA 1LB1B 3TKLA 2KI5A 2Q9BA 2A5DA 1VHTA 2FX3A 3SQWA 2ZROA 3F0TA 1G7TA 2OUKA 2QMOA 4IOMA 5F2EA 1CRPA 1VYUA 3LNCA 4ARZA 2FJUA 4GMDA 1Z83A 1JAHA 3T35A 4D4JA 4LJ7A 2IT1A 2IS6A 5FUWA 4CYMA 1VTKA 4R71A 3ICQB 1Z63A 1RC8A 1E2HA 5AJWA 4JLVA 2BM1A 3EC2A 4QJ5A 1R5BA 3CF6R 3EWAA 3NC0C 4XD7D 1HE8B 4TMTA 1TNDA 3PUXA 4DDWA 1G18A 2A3RA 2CHGA 1ZU4A 3IO5A 4GP7A 2D4HA 2Q3FA 1YHNA 1OXXK 4PAOA 4P4SB 5FPSA 2AKYA 3WYAA 2HV8A 2FFHA 3E2IA 1II0A 2YOGA 1AKEA 2NMVA 2NO0A 3T5GA 2FPLA 4BZQA 1XZPA 2J0UA 3ND9A 4PSVA 2EVWX 1AN0A 2FF7A 3KUDA 2FA9A 1FFHA 4HSEA 3GLIA 4LJAA 2IUUA 3NEYA 2FG5A 1E0JA 1RVDA 1P9RA 2NO7A 4LV6A 5EP4A 2ZRNA 4DHEA 4C0KA 2XB2A 2KJQA 2FSFA 1UBGA 4RD4A 2BKUA 1Z0FA 2CJWB 1IM2A 4PHTA 3Q85A 2WKQA 5JS8A 1N25A 4MYHA 5F98A 2MSCB 2ONJA 3IHWA 4OK5A 2O0KA 4ASUD 2VEDA 2OT3B 4LJ4A 1DO2A 1XXHA 2ODBA 3CX7A 1KJZA 4OJQA 3MLEA 4TLEA 1WP9A 1G5PA 1Q1BA 1SXJB 1Z6XA 2FFBA 2J9RA 1MO6A 1ANKA 1D2MA 5FPHA 1P73A 1S8FA 2JLUA 4TZ0A 4G0NA 1NLYA 1R7RA 4B76A 5KSPA 4JL6A 4DRZA 4US2R 1G9XA 2CCJA 2DFLA 3GLFB 3B1ZA 3T61A 1E69A 3NBYC 4BASA 3TR0A 1U0HC 3AUXA 1W0JA 3BERA 4LRWA 4NYJR 1KI2A 1F2UA 1F5NA 4Q9KA 3RVBA 5CITA 3VKGA 4JJKA 3B9QA 3CZQA 1G7CA 5TDHA 2JLWA 3P1JA 4NDZA 3ZD7A 4JLNA 2NTYC 4XSGA 3RLFA 1E9EA 2GVDC 2IS1A 4FWIB 4WAUA 1Z0DA 4PSAA 4Q19A 2O8FB 4Q1BA 1PVOA 1ZD9A 4M1YA 2XITA 1II8B 1G21E 3IUYA 3MJRA 4OHXA 5J4KA 4BFXA 4JLAA 3OIUA 2WJJA 1N6NA 4JJZA 2V6IA 2ZYWX 1KK3A 3IIKA 4B3XA 4DCTA 2QMHA 3F5FA 2OLJA 1XXHB 4Q21A 4BEBA 2CK3D 2A78A 4FMDF 1WB9A 3AB3A 4FI3C 1QG4A 1YR9A 2TMKA 2OBNA 2VBCA 2VHUA 3T06B 5KU1A 3SE0A 3ADDA 821PA 3BRWD 4B3DA 3Q7PA 4ILEA 4DLYA 2RGNC 1N6OA 1ZMXA 1XCMA 5JEDA 2ZSDA 4UXIA 5KPJA 3RANA 4PC1A 1FP7A 1SVIA 1N3BA 1N5JA 4NCHA 3U2QA 2XZLA 4MH0R 1GITA 1OXUA 4Q4AA 3FE2A 4EPXA 2QENA 4FXPA 3F8TA 4A9AA 2WZQA 4L8GA 4CT5A 3OEED 3U60B 3NDPA 2IUSA 4DLVA 3IIJA 1JALA 1N5LA 4TYNA 4LV8B 4K46A 4EPWA 1D9XA 3B13B 1A82A 3KB1A 1F2TA 3PXGA 3VNUA 5AK0A 2D7CA 5BYJA 2NZ8A 3KKNA 3PEVA 1A2BA 1G1MA 2WOOA 3KTAB 2W0SA 3FYHA 4Q47A 3U7HB 1R5NA 2RAPA 5L3SB 2NG1A 1HE1C 2AXPA 1P72A 4BFTA 5EJEA 2J7PD 4ZCIA 5HCIA 4B6FA 3QXCA 1Z2CA 5FBQB 5JCZA 1OIWA 1L7VC 4LPKA 5DHFA 3TVTA 1EG7A 4LHVA 1W4BA 2LWIA 4JVNA 3UANA 2YZ2A 3U3MA 3W5JA 2ZR0A 2DWOA 3GJ6A 5HKKA 1KO8A 2OXRA 2QROA 1G64A 3GLIB 2W2XA 5LB4A 4KSCA 4L9WA 5B58C 5CYOA 4LBYA 3GQBA 4PPGA 1ZAKA 1ZUNB 3DDCA 4LHYA 2QA5A 1ZJ6A 4IXNA 2O8CB 2BJWA 3R8CA 3NVAA 4PO8A 4UNPA 3ZVRA 4NCKA 2WJGA 1XF9A 1UJ2A 4X8OA 5A5GA 3T1QA 4UQOA 2AN9A 1GG2A 1HTWA 3KQLA 5IK2D 1NMYA 2CVFA 2ZSBA 2WM9B 1W49A 1E2MA 1W2HA 3W3AA 4O2RA 3IPXA 4S2EA 1E98A 3ZVMA 4NPHA 1BKDR 2VHCA 3R9XA 1M1YE 1CS4C 1NSFA 1FQKA 3PEUA 1ZCBA 5D3MB 5FBVB 5ANRB 3DOEA 3GJ7A 4RKEA 2X2EA 5FOXA 4LYHA 5L3SA 5FTKA 1JEEA 3GLGE 1GP2A 1TUEA 4PO1A 1VCIA 3KKOA 3NWJA 4W9MC 4DKXA 1W48A 4A2QA 2XTZA 1E9BA 3CH5A 2CHQA 2OCPA 4TLCA 4U02A 3VNVA 3AF3A 1OIVA 5KSZA 4M53A 4RJLA 1ZW6A 2ZI6A 2BMDA 4M22A 1N6PA 2IYRA 4BLPA 3REGA 5CM9C 4GP6A 1AGRA 4CW7A 5KPDA 2QN6A 3NXSA 1OPXA 2QM8A 4TLDA 3LLMA 1KSGA 3EIHA 3BJIC 4ABYA 1MABA 1II8A 3BE4A 3N2IA 1AGPA 2QGZA 3MAAC 2EYUA 1LS6A 2QPOA 4N1AA 1JXMA 2O8EB 1P60A 4JLMA 4YXWD 4XH9B 4R98A 2GXUA 5FPKA 4JKIA 2FFAA 2BIFA 2C77A 2XOKA 1HQCA 1E0KA 3PENA 4TYWA 1DELA 5CB6A 4UNSA 4H9GA 2GF0A 4HEJA 1E4VA 1XJ0A 1P2TA 3PIRA 4KLZA 2FFQA 4WZBE 1EK0A 1LTQA 1G8YA 1JI0A 4CF7A 1UKYA 4N0DA 1W46A 4QG7A 1U81A 3MWLA 2O0JA 5JECA 4XTRA 5BN4A 2QQEA 3EA0A 2ZJZA 3QKRA 2ZS7A 3VR2A 3WRYC 1JB1A 4MA4A 1TAGA 3TRFA 3E70C 2FSIA 4C9BA 2YWEA 3TW4A 2A9KA 1Q1ZA 3AP2A 2PL3A 4IEIA 4GSYA 3GFOA 4GOXA 4DCVA 2OCAA 3M0EA 4BQSA 5BXQC 5DN6A 4DXAA 5KSYA 4DB2A 5C46F 2CXXA 4DLSA 4V0LA 2VYFA 3EASA 4EAQA 4QHSA 2XTMA 2EQBA 4GOJA 4NCJA 2I1QA 2ODWA 4NBSA 2F1HA 5L3RA 3O8BA 5JJLA 5DH9A 5FI0B 3PFIA 1XD2A 2ZS8A 4XWOA 1KKMA 3ZVNA 3DEFA 1NI3A 3GLGB 3L0PA 4IOKA 5TMPA 2C2HA 2E1RA 1XPUA 1U94A 5FL3A 2AX4A 1RZ3A 3R20A 2RKOA 1G19A 4LV5B 4BECA 1X3SA 1CR2A 2QPAA 2FDCA 3B85A 4Q4JB 1F6BA 3T34A 3K0CA 4LY6A 4E22A 3EIQA 2QUZA 4DLWA 3O8RA 1G7RA 1IN5A 5SZIA 2GETA 4RCYA 2QT1A 2NGRA 2YV5A 5FUYA 3VR3A 2ZREA 2XTNA 1CBUA 4QXAA 4WVFA 2C78A 2ZI4A 3C7KA 3CUEF 3DZDA 3P20A 1L4UA 2IYZA 2CK3A 2DCUA 3RHFA 5EZ5A 3BIFA 3D3QA 3FMFA 2Y8EA 4PPFA 2AD1A 2H8KA 3FTQA 4KLNA 3TSZA 5C18A 3WXMA 1OV4A 2F43A 2ANCA 4X8HA 1IY2A 2NQ2C 2D06A 4OHWA 5DI9A 3TQCA 4A2PA 1P7CA 2HXYA 3A1TA 3GP8A 4PC7A 3W3ZB 4US1R 3I8SA 3AVUA 4NH0A 1SHZA 2VP2A 2OXCA 2XAUA 1C1YA 1IXSB 3GLIE 2ORVA 1CR1A 3I1FA 4Q1EA 1P2VA 1KTVA 3VKHA 2G77B 4PZLA 2RGGA 5G41A 1AKYA 4GNKA 1FTSA 2YWGA 4US0R 2R6DA 5SZJA 3LXXA 4TT3A 5FH9A 2WOJA 4LC1A 3LBIA 2QP9X 4Q01A 4R2IA 2YWFA 1OXSC 1FUUA 2ZE8A 1TL7C 4AKGA 2C95A 1VDZA 4IOLA 1E2GA 1Q3HA 2B7CA 2G88A 3AVQA 5FPYA 4AG6A 3WMGA 2IX3A 2JLVA 2UKDA 2CDNA 4A0HA 4PHFA 3QOFA 4Q4JA 2VL7A 2VSXA 4PXAA 4WA7A 1IJEA 1UF9A 5FUVA 2FSHA 3SC3A 3EPLA 4KSBA 3Q7QA 5B2ZA 3QEOA 5JSZA 4JLKA 2C99A 2F6RA 3WYGA 2QY9A 1AM4D 3FVQA 4O0MA 4RD3A 3CNLA 4EJSC 1QVAA 2IHBA 4EPTA 1COWD 2EU8A 3QXHA 1FW6A 1FQJA 4UKDA 4OQMA 2GAOA 3BFVA 4KHZA 4QRHA 5A0FA 2WIAA 3GLHA 2QRNA 3I62A 4RY2A 1AA9A 5JWOA 1ELOA 2MSEB 3RRZA 5BYKA 3SHFA 4OQLA 4B75A 1KO5A 1QRAA 4M2LA 3QSYA 4TMVA 3BD9A 3CX6A 1OFIA 3QF4B 1YR7A 5FBWB 1FMLA 2H57A 3HU1A 3E1SA 4G5GA 4D80A 2GNOA 1M2OB 4M1TA 4XTCS 4OHZA 3ZVLA 1TU4A 2IYQA 3EPKA 2C96A 4BE7B 2QTFA 3FHOA 1YQTA 5BN5A 3TJZA 4D0LB 2CEAA 1KSFX 1KJYA 1GIAA 4PFSA 3TGPA 3DMDA 3QKSA 3SFZA 4Q7JB 2EW1A 5GVSA 2HT1A 2XXAB 5K8TA 4Q9JA 4KJZA 4A0RA 2WSSA 4DCNA 2GTPA 1T3HA 3LBNA 3REFA 5AUPB 1X86B 3RS3A 2NO1A 2VIIA 3UATA 3VTKA 4KVAA 1EFRA 1XMVA 1M34E 4DB4A 5EXXA 1DAHA 1F3OA 3W34A 2MMGA 1EESA 2ZRKA 1DAEA 1II9A 1PZNA 3T1OA 2BCGY 2J0QA 2YOHA 2ODEA 4KBGA 1DEKA 1UFQA 4ZPXA 2JJ2A 1WMSA 2QTHA 3SJZA 4A0GA 1RYHA 4QBGB 4DDVA 2Q3MA 4I4LA 4FWTA 2JGNA 2VPPA 3UMRA 3SJBA 4HLCA 2QQ0A 4YDSA 2OBMA 1ZRHA 2IF0A 3K53A 5K8LA 1M7BA 4JBYA 3HP1A 2G6BA 3UG7A 1Z28A 5DGXA 3TNFA 3PUYA 2QG6A 2AL7A 2XOKD 1NBME 4ZDJA 4MYUA 3AP3A 3K9LA 4AI6A 5AUQA 1ZBDA 4DSNA 1Z2AA 2BBWA 2OEPA 5JS7A 1GKUB 3CW2A 1O3YA 4AC9A 1R0YA 5CK5A 2Z6VA 4YDHB 1OB5A 3IQWA 4A4DA 4A6PA 3DKVA 4G5QA 3QVVA 1KDOA 5CM8B 2Q9AA 1YZLA 3CH4B 4DVGA 1CJTC 3M4YA 4URUR 2R8RA 4WIAA 4DDTA 1AS2A 4CDGA 2P3SA 2QE7A 2W58A 2W00A 1SVKA 4NYJQ 4HLUC 4CEHB 3T12A 4KXFB 2MMCA 3ICEA 1Q12A 4MQBA 3OEHD 2ZIAA 2CJWA 4RVCA 3KQKA 4MRVA 2PEZA 1HURA 3CWQA 1VIAA 5G3YA 1G3IA 5EUMA 4Q02A 3JZAA 4GFDA 2P0EA 3IILA 3K70D 4LHZA 1RPZA 2NO9A 3C8UA 1YZGA 4V02A 1UDXA 2R6AA 4OI1A 4H1UA 3AF0A 5FOVA 1KY3A 2WPDD 1JBKA 4QM6A 2BHRA 1N6IA 5KO2A 5TB5A 2QBYB 5FL7D 4LX0A 1YR6A 2EFEB 4UXHA 4ITRC 5L3VA 1OYWA 1KK1A 4LK2A 4DCUA 4URVR 3W8RA 1COWA 2ERXA 3QF7A 1PLJA 3CONA 2X2FA 4LGMA 4WZ6A 2WKPA 2GJSA 3CIOA 3JZMA 5GJCA 3V00A 4K8OA 1MO5A 3BH6A 2V7QA 5D3QA 1TF2A 4Q4HB 2E87A 3C15C 4I99A 2PMKA 4AYWA 1XMSA 4A15A 1IXZA 1XX6A 1K5GA 1PLLA 3WBKA 1G8PA 3WBJA 4OQXA 1CKEA 1W2GA 4ZO4A 2CL0X 3ZZ0A 3B6EA 4LSGA 2IS2A 1XJQA 2GILA 4W5HA 5B57C 1NBMD 4ZIRA 4HZUB 4NHOA 2DFNA 3P26A 2QRZA 5DSZA 4OYHA 4EQ6A 1NN5A 1KO1A 3DM9B 4G1UC 2XSZD 3AQ4A 1Q1EA 4DLUA 3U44A 3G5UA 2QMEA 2ZETA 4WXRA 2HEIA 2P5TB 1N0VC 1X8JA 5KHOC 3CWZA 1XDBA 3QJYA 4TL9A 2REOA 5JLJA 3PUZA 2WSMA 4BFUA 4ZCMA 1MOZA 4IVPA 1DAIA 1EFHA 4NP6A 4U00A 3IHLA 3RC3A 2JLYA 3THWB 1Z0KA 1GWNA 3C16C 4N0EA 3TW8B 1GVNB 4XWAA 4AG5A 3A4LA 2ZRJA 2QSYA 1KMHA 3GCGA 1U90A 3L2OB 4TTQA 4F4JA 1DO0A 4KODA 1DOAA 1R8QA 1TADA 4D0NA 4HAUA 4F4IA 1KJWA 3O8CA 5FOWA 3WHLA 3RSLA 1SQ5A 1T0HB 4RZ2A 1HY3A 3T15A 2IYTA 2V54A 1S3GA 2C9CA 1UEJA 1WF3A 3THXA 3DVLA 5H70A 4D0GA 2D74A 4PTLA 1CEEA 2FWRA 1NN0A 1KNXA 3H86A 1CJVC 4QFMA 3SJAA 2XZPA 3CX8A 3QUSA 3TMKA 3UKDA 4D6PA 3O8DA 2AK3A 3MCAA 1P6XA 1ZM7A 4OHVA 4NE2A 4WW0A 1VIYA 4BFWA 1OFHA 3X2SA 2J0UB 1W36B 4M1SA 3W90A 4GPTA 1YKSA 5UKDA 1J8YF 2ZRPA 3GJXC 1ZM9A 1U9IC 3SYNA 3TQFA 1WBBA 3NIBA 4Q9IA 1OH8A 5CIQA 5HZKA 3EPJA 2O8BA 5JHGB 1JEDA 1NN1A 3FMOB 2EWWA 1E9SA 1FOEB 2ZI7A 2P67A 1FTNA 4BLQA 1SKYB 5E3HA 1VPLA 2WSSD 1B0UA 4B2LA 1NVXQ 1M8PA 4Z1MD 1U0LA 1ZNWA 5EE1A 4L16A 1E2KA 2DYKA 2ZEJA 3RS5A 4BZXA 1XBTA 2OAP1 3T1VA 2BV3A 5AJVB 3CRMA 4M9XA 1HUQA 4PANA 5LD2B 4K81B 3S1AA 2IC5A 3BFKA 1S1MA 3MFYA 3PITA 4RZUA 5E95A 3AM1A 1NLFA 1E2LA 1Z5ZA 2O8EA 5P21A 2JLZA 4TYYA 4I1VA 2FV8A 4A6XA 5FOSA 2ZRCA 5FPTA 1OYYA 2GESA 4E5UA 4B6EA 1F48A 4TMWA 4HYYA 3LWNA 2JDIA 1UAAA 3W6NA 3PR1A 5HE8A 5KNDA 3TBKA 2OE2A 2WWFA 3D8BA 1ESMA 1KDRA 1G8FA 4AURA 1NF3A 3V9PA 1RRCA 2RHDA 4IW3B 4IDOA 5TXGA 5HPYB 2QMUA 1BMFD 2Z0MA 5KTYA 3LV8A 1XEXA 3L82B 2A5JA 2YOFA 2G3YA 3MWJA 3LY5A 1GZSA 2GEVA 2ZJYA 3FWYA 3B9PA 2B8WA 3KL4A 1J8MF 4A8JA 4FMDB 1CJUC 3TSWA 3WNCA 3X1YA 1PUJA 1GOTA 2N46A 2GRJA 3K0EA 3KKPA 1XD8A 4A8JC 3KFVA 4BEJA 3LXRA 2GWHA 1DBSA 1KIMA 5HZHA 1D2NA 1VECA 5CJPA 4E03A 4TN1A 3N2EA 4C0AC 2D62A 1QHGA 1LF5A 1M7HA 1RRFA 3AVPA 2FE4A 4JSTA 3LQQA 2XNSA 1GRRA 4TZ6A 2YYZA 3OFNA 5CYPA 4EFMA 1H8HA 1PUIA 1C9KA 4LBVA 4NYMQ 3RC8A 2PCJA 1VCMA 4B3FX 4L4UA 4TLBA 1KO7A 1Q21A 1IXRC 4DIEA 4KU4A 4GDFA 4ARZB 1UBEA 2FPMA 1Z0AA 2W2VA 2WJVA 3U5ZB 2RHMA 2I3BA 2W2TA 5JHHB 3K0SA 4BWYA 5FTJA 1NIPA 4CEIA 5E7JA 1VG8A 2WPDA 4CEIB 1RRPA 3OIVA 4EPRA 1VCOA 4JVMA 4TSFA 4UNQA 3IKJA 1QBKC 3QPWA 2IF2A 3K8YA 4OQFA 1JXOA 1E32A 3B78A 4B34A 1XPRA 3FMIA 4DLZA 1DG1G 1Z6TA 4EKDA 1JR3E 1FPMA 3UMSA 3HYTA 2H16A 3N5CA 1NRJB 4BFYA 1E94E 1OXVA 2REXB 2VSFA 4ZKEA 3K9HA 2PEYA 3RS7A 5H1YA 2ZQ5A 2ECKA 4B2IA 1JNYA 1R10A 1KAOA 4C0LA 4P3YA 2ZU0C 2GZHA 3BB1A 3UWKA 3VQTA 2NIPA 3UIEA 1T91A 1E96A 1NY6A 4IDPA 1X8LA 4FW9A 2L0XA 4C0JA 1L2TA 1OH6A 2AK2A 4AIIA 3G0HA 2NOAA 4TQAA 2UZIR 4HAXA 1S2MA 2V1UA 2OAQ1 4M8NE 1SZPA 3UG6A 3WNDA 4QL3A 1HT2E 1HEIA 1RJ9B 4RZXA 4F93B 4R9UC 1KSHA 3AVTA 2QNRA 4UXJA 4AKIA 2XZOA 1NVVQ 2WMNB 1CR0A 2QAGC 2GZAA 4ON9A 1NKSA 4TLAA 2HJGA 2NZJA 2FPKA 2J45A 1ZUIA 4MYCA 2ODNA 3GJ5A 3AF4A 3FHTA 2CCGA 3RS0A 2QGNA 1MKYA 3ADCA 1W5SA 1XEWX 3BORA 2FU5C 1OFTA 4LHXA 4X8LA 2DWPA 4JL8A 5EQTA 4EJSB 2R9VA 5B64A 1SVWA 4MDFA 4PO9A 4QHYA 3AGQA 1XMJA 2KB0A 4BUJA 4BFZA 1E1QA 2YC4C 4HB2A 2F55A 1EWQA 1IN8A 4XVRA 4C4PA 1A4RA 2QI9C 1N6RA 4XWKA 1RKBA 2R62A 3SBDA 3BK7A 3MUFA 5JRZA 4NU0A 2F3TA 4GI7A 5D3MA 2FSGA 1ZD1A 2ZITA 4G3XA 4PSKA 1E6CA 2IW3A 4HB4A 1H8ED 4IRUB 4HUQB 1NG1A 1NN3A 3U4QA 4OI4A 3TIFA 2BMFA 1N5IA 1X1RA 2JAQA 3EA5A 2QORA 2VQSA 4PC6A 2VHTA 3SNHA 1G6HA 2ORWA 3IO3A 5JMTA 4JZKA 2RGCA 2XGJA 3TUZC 3EAQA 1L8QA 4B32A 4Q1CA 4C7OB 4J0QA 2P6UA 1Z47A 1Q0UA 2QTVB 3ASYA 3RNLA 2ASEA 3W8NA 2I1VB 4Q48A 3VR5A 4XVQA 2CE2X 2QE7D 2BMJA 4KCGA 4XSHA 3TE6A 3GEIA 2H1LA 2ZUDA 3A4NA 4MRNA 4QKQA 4URXR 4UNRA 1GFIA 1GRNA 1Z0IA 1KI9A 2EFHB 1P62B 1ZUHA 3CNOA 5FOTA 5EP1A 1X8KA 2IYUA 2VTKA 1XEWY 1CF4A 2J1LA 3B8HA 3F3YA 1JJVA 5FI1B 5DISB 4DSTA 2AFIE 1T3SA 3CPHA 4B71A 2GBLA 3A36A 3C14C 3TVDA 3CPEA 1G4UR 3KZ1E 1U2RA 4G5RA 3L43A 2NPIA 1J70A 2AR7A 1G4AE 2IWHA 4OHYA 3KKMA 1YR8A 2Z5FA 3NBFA 2ATXA 3CKLA 3SDZA 3A8TA 3W6OA 3FKSD 3I32A 2AXNA 3AVOA 4ZDWA 3U6BA 5ELXA 3C5CA 1ZCAA 1W4AA 1KZ7B 3CRRA 1DPFA 3NHAA 1SXJE 1GM5A 4A2WA 2DB3A 2ZE7A 2R6CA 3NKVA 1KK2A 3OAAD 5JZVA 4AKHA 4P31A 2GKSA 2GXSA 2PMDA 2QZ4A 4Q9HA 2WICA 2JIZD 2QSZA 3U3RA 1T8TA 3OHMA 1TX4B 1T8UA 5KDOA 1XFAA 2BBSA 4CT4B 5C4MA 4NYIR 5DYIA 1TPZA 2NO6A 5EUQB 2A7QA 5JRJA 2WMOB 3SS8A 1AS3A 1YZTA 3C4JA 4QJ3A 2CE7A 2OV2A 3BC1A 4JYBA 1IN4A 1SXJA 5HKKD 1V5WA 3LO5A 2Z43A 1T0JB 4Q03A 1SGWA 3LDAA 4H1VA 2GCOB 1XB2A 2CCKA 3L8YA 4KYIB 3GLFA 2P6RA 4MGKR 2FGKA 2VSOA 4P33A 4EJSA 2ZR7A 1KGDA 3U7FB 1G5RA 4Q1FA 2IS4A 3KXLA 4KV9A 2FOLA 4DLRA 1ZP6A 5CB8A 3NDBB 1Z06A 4II7A 3AVYA 4NZYA 1Q20A 3WHKA 1T5IA 4V0NA 4OBEA 3A1UA 3AGPA 4TYPA 3HJNA 2J41A 5AUNB 1LW7A 2GEUA 2PT5A 4RZ3A 1CLUA 1W4RA 2B8TA 3KKQA 4TSFD 4ERNA 5JWRA 3NBZC 4A0FA 1BH2A 3DOFA 4GMXA 3UK6A 1DVRA 2QBYA 3K9GA 3AV0B 4PQYA 1Z6GA 1LV7A 2CLSA 2G1JA 3CZPA 2V55B 2YINC 3LA6A 1GKYA 3QBTA 4CRWB 4YMVA 3ADKA 5IHPA 2ZRFA 3CR8A 1MV5A 3MSXA 3UPUA 4TL6A 2HCBA 5JCPA 2QP4A 3H0KA 1OE0A 2KE5A 3LQRA 4Q1AA 1XZQA 4MGIR 3QXXA 1XPOA 2XB4A 4WOPA 5C4GB 1P9NA 4DLXA 4B3CA 4IHQA 4YLGA 1VG0B 1XU4A 3QXJA 3EC1A 3LAWA 3LBHA 3A1WA 5AWFC 2IXFA 1ZIOA 4AK9A 4B47A 4YXWA 2PCLA 4DEXA 4MGYR 5JJKA 1JQJC 3CRVA 1NVWQ 5GJBA 5AJXA 3X1ZA 1W47A 3KB2A 1HYQA 1LF0A 5L3QB 4A92A 2VH5R 3HWSA 1XCGB 1ZU5A 3SOPA 1XMIA 3NBXX 4E07A 2P5SA 1ESNA 1VG1A 3K09C 4BLTA 1O87A 1AZSC 2VHJA 1Q57A 2Q6TA 4FMBB 4Q5IA 4JLJA 3DKPA 3HR8A 3P27A 5JWHA 1R0ZA 2WWIA 3SJCA 1U9IA 1IOZA 1GRQA 1XTRA 4DT1A 4EIWA 2ANBA 5CLLA 4M0LA 2WWXA 4BLOA 2J0SA 1OIXA 3VHXA 2ZI3A 1GL7A 2C98A 3LD9A 3T1TA 1GSIA 2WIBA 1RYFA 1UBCA 1EFRD 1HH4A 4DUGA 4Q66C 4M4SA 1U8ZA 1VYTA 1MH1A 2ZRIA 1Z08A 1HT1E 2IUTA 1TQ2A 4LUCA 5AJYA 4TQ9A 4AKEA 4QBFA 3JVUA 3RAPR 3WY9A 2BMEA 2PJRA 3EXAA 4NCNA 1MRSA 4DCSA 1TF7A 2Q0HA 5FR1A 2JJ2D 1DAMA 2ZSFA 4KO8A 4LYFA 2ZE6A 2JJ1A 4PHGA 2G0NA 3FB4A 3MJHA 1Q3TA 3BB3A 4LCBA 3RRMA 1VKJA 2GDJA 3BGWA 3CRW1 1P2SA 3MD0A 2JDID 4GZLA 1OH7A 1OT3A 1YZNA 2QEQA 3WNBA 1TF5A 1BIFA 1E1QD 3DL0A 5GJVC 4HAWA 3SEAA 3I3SR 1PV4A 3TR5A 5IT5A 4KFTA 2PX0A 3AEZA 5DYGA 2GBLC 2F43B 2W0MA 1H8EA 4HLUA 1GNQA 1D9ZA 4Z54A 5HCNA 4DJTA 2DBYA 4LJ9A 4URZR 3I5XA 4B3GA 3X1WA 3RABA 5FTLA 1TU3A 4Q1DA 5GVRA 3EX7C 1NSTA 1X1SA 4HATA 1ZYUA 1HQYE 4IOJA 3Q5DA 4IDNA 3BH0A 2O5VA 2OFWA 5FTNA 3SYLA 2PZFA 3IGFA 3HPRA 1FUKA 1QHHA 1TEXA 2J87A 2OFOA 1OKKD 2H7VA 2XX3A 1V43A 3PVSA 2OCBA 4JBXA 1UM8A 2ZYVX 3AKYA 3OESA 4ZV4A 3NG1A 1ODFA 3EZFA 1KI1A 5CDFE 1GUAA 3Q3JB 1JR3A 3UXMA 5BW8A 4WXPA 1G41A 4LPSA 1YE8A 3QQ5A 4L9SA 4URWR 2GEDA 2XJ4A 3Q9LA 4Q4HA 4M1MA 3L8ZA 4I1OA 4LJ5A 4C2TA 3THYA 1U98A 4UJ3A 2QAGB 2BEJA 1FNMA 4ZKDA 1NY5A 2X19A 5TVKA 4EUNA 4CEJB 2ZUBA 5CK4A 5CDFA 4JLDA 2ZM5A 1E4YA 3A4MA 1EXMA 1E2IA 2VP0A 3BFXA 4D82A 2C9OA 4PC2A 4Q9LA 4YMSA 1RW4A 3OF5A 2WKRA 1XCPA 1KNQA 1W5TA 2OHFA 5EE9A 4PX9A 4F4CA 3HU2A 5J4LA 2HYIC 1XEXB 1Q1QA 4FCTA 1U8YA 3V4FA 5KYKA 3CPJB 3ZJYA 4TMKA 2VP5A 5DE3A 1QHSA 1VG9B 1N0WA 2DY1A 2GK6A 2DHRA 1J90A 2LKCA 2V1XA 2VF7A 4MRSA 2BBOA 2XJ9A 4JKYA 2D7DA 8OHMA 1S9HA 2DFKB 2WBLC 1N5KA 1M7GA 1KSJA 2OFXA 3TAHA 3R9WA 2PJZA 3FKQA 1G8HA 4ZI3A 3ASZA 5KNCA 4Q7MB 2IWRA 3QNUA 2HYDA 3W9YA 3MRSA 2IXGA 1L4YA 1CP2A 2VO1A 2WJYA 2KWIA 4R2HA 1NJGA 1T4GA 1KO4A 2BOVA 1XRJA 721PA 1D6JA 4B43A 4KI0A 3OE7D 3HU3A 1DARA 3LX5A 1G3MA 5DIFA 4CEJA 4ACBA 4I81A 4P4UA 4QBHA 2QP3A 5DI3A 4DBLC 4IVRA 1GILA 3H4MA 3I92A 1NJFA 2G9NA 3PCRB 2J5XA 1ZIPA 1CXZA 3ADBA 2V3CC 4ZCLA 5F3WB 1Z6AA 3KJHA 5DNYB 1MR3F 4C0SA 4G01B 521PA 5CLQA 4KYUA 1XTQA 3C5HA 4GBMA 1IONA 4PPQA 5J4VA 2F1JA 4LHWA 2CVHA 4C0QC 4S35A 2ZI9A 2WV9A 4B48A 2AHOA 2GA8A 3OIYA 4RFSA 4XJXA 2W6IA 2IA5A 3VKWA 2WVJA 1ZNZA 1G8GA 3BB4A 5JJIA 2W83A 5HE9A 3ETLA 4B33A 3I73A 3MWYW 4ZIRB 1Y63A 1QG2A 1TEVA 2RH5A 1SVSA 4FIDA 4I1SA 5DO9A 1T6NA 1N6KA 2ONKA 2KSQA 4JL5A 3SBEA 1OJLA 4V0KA 2J0VA 2H5EA 3DPUA 5JFGA 2CLCX 2Q21A 1DAGA 1PLKA 3IBYA 1WQ1R 5KDDA 4Q7LA 3A1SA 4RSGA 1K5DA 2GJ8A 3WP1B 3AF1A 3LX8A 4XOIA 2EFDB 1NLZA 4NYMR 1SKQA 3SU8A 2VA8A 5EE5B 2GVZC 4IXMA 4TQUS 3CLVA 3AKCA 1YJ5A 3EWSA 2XEXA 3ZGXA 3CM0A 1S4QA 4PR0A 2GCNA 3M1IA 4IDHA 4BFVA 1OKKA 1XTKA 3ZDQA 2P2LA 1G3RA 2AFHE 5AJZA 1RE0A 3RWOA 4AD8A 1U0JA 2WJHA 4O3MA 5FBRB 4CZ2A 3QPVA 3KJIA 1JR3D 5SZKB 2LKDA 5C2JB 3WMEA 3V4RA 2OG2A 3TSOA 2OESA 4OK3A 1NIJA 3NEJA 5J4HA 2IYXA 4DWJA 4HZUA 3SYKA 1FMJA 1AZTA 2ZPTX 1IY1A 5FTMA 3Q72A 3KQNA 4M1WA 1Q22A 3C41J 1SVLA 3QE0A 4LJYA 4FMCB 4YMUA 6Q21A 4Z8YA 3GLFE 1LY1A 1W0JD 4HUTA 2JJ1D 3QKTA 2JLRA 1KDTA
chains in the Genus database with same CATH superfamily
4BB6A 3TLAA 3I9FA 4BVKA 4QOSA 4ZEWA 4LAFA 4WCDA 2ZAGA 4KNYA 4IKEA 2AQIA 5F64A 1Q44A 3BULA 3E61A 2ZSAA 3EVGA 5L3QA 4KUGA 3ZJ5A 1LDMA 1L8AA 3OH8A 3LQKA 4K9RA 4MQFB 5T4FA 1E2UA 1RTTA 3BQMB 3VU9A 4YRZA 1G38A 5DNEA 2FGJA 2VPWA 1T35A 3EGCA 4JT9A 3QMWA 4EYSA 2C3UA 3WGGA 2H1VA 1QRRA 4ZYLA 3AL0C 2HRZA 3L0OA 1RR6A 2H2GA 1DC3A 1OXTA 3FYDA 2JH9A 3EEFA 5FHRA 4ZDIA 2PBLA 1J9EA 2ZWOA 5FFMA 2JIZA 3VAYA 3RUDA 5FNZA 5LQCA 1JLHA 3L4SO 1R6VA 5DSXA 1UJ5A 3U49A 4DFDA 4AF6A 1EX6A 4FDTA 5BQ5A 1DE0A 1YDFA 1AK2A 2NYRA 2NZUG 3D2AA 3JQBC 1WU7A 1MG0A 3IPRA 4L50A 3BCSA 5ADUS 4JLUA 1Q0RA 1W0KA 3RSGA 4F2PA 1QH1B 2G40A 2R1TA 2PWBA 4H31A 3SHOA 4XWYA 1AQYA 1RHJA 3SCZA 2GFQA 3LOUA 2ZBQA 3QUAA 1DGQA 1CHDA 2BEKA 5HZHA 3WYFA 4U2EA 3VH1A 5KWSA 1O9GA 3BZBA 1NTRA 4TMYA 3UQYS 4YAUA 1LH0A 2CDCA 3CNEA 4ZGGA 1NXQA 1QFSA 2C7VA 2L2QA 2XRFA 4EGFA 4FYIA 5AKGA 1KAGA 2PFSA 1M74A 1NVVR 3O83A 5EJFA 3WLJA 4O4IA 1IQRA 3LHIA 3V7YA 3AF6A 2XF2A 5CNKA 1YBVA 6LDHA 1K6MA 3JVVA 3W2HA 5EE0A 3OU6A 1PX0A 4MGZR 2Q2QA 4W5JA 3FOZA 4G1BA 2GZ1A 2XCLA 4S1VA 4IYRA 3O91A 4Z8XA 1SC4A 3T9AA 5LLTA 1UDCA 5G1PA 3DBIA 4KWIA 3JZDA 1FTWA 4NIMA 4Y9DA 5EMLA 4FNAA 1SCBA 3QY0A 3GRAA 4P0TA 5H9VA 1NJ6A 2G5CA 2QMQA 5FA6A 3KLMX 4BO7A 5AJHA 1UEIA 4R9SA 4B8YA 4QU9A 3ZD7A 2XKAA 3TQHA 3T4XA 3VR4D 3A0RB 2EYQA 4HAVA 3R0ZA 4R1MA 3WLMA 1KY5A 4IDCA 4ZHSA 3BWXA 3ZNNA 4DDUA 1U65A 1XOIA 1T3LA 4RIEA 1EGAA 5FFFA 3S5UA 1TAUA 3AG5A 2EJUA 2X1VA 3NONA 5LZ8A 4F12A 3KOZA 4RKFA 2V7UA 4UHDA 3KJGA 1ZI8A 3K9CA 2JLXA 1NBMA 4HAYA 4GM4A 4KTVE 1B6GA 2WWHA 2E4WA 1NVGA 4C2BA 5J58A 3U61B 3TLXA 4OUDB 2YWHA 4NLLA 5CT6A 5BQXA 3KJEA 4ISCA 1Z56C 3HJHA 1R2QA 4I1RA 4R9RA 5D3KA 1GCAA 1GEGA 1MAWA 3DL2A 5HSGA 4WSOA 1GARA 1Y42X 2AEMA 4EJ6A 3O0DA 1WR8A 3KXKA 3ROFA 1WXHA 3THXB 1UC9A 3K0FA 2P4HX 4MYRA 3FYSA 2C5FA 3E5HA 4LRUA 1WXIA 5ALWA 1U2DA 1XTJA 3I5YA 2CZGA 3IE0A 4J1SA 1SBZA 3HQ4O 4JITA 4RESA 1YQQA 2IYVA 4AO6A 4C87A 2FPGA 2KHZA 3JQRA 3UZUA 4ESVA 3WMFA 4R1PA 1CZNA 3TM5A 1DEAA 1WMFA 2HA0A 3M4NA 2ZRQA 5HOEA 4DUGD 1PAUA 1SOMA 2FZEA 3ICOA 1XZ8A 2G8NA 4B3BA 4K2HA 1A76A 4D9GA 4GOOD 3UWMA 3A6FA 2RGXA 4MLDA 5DFAA 4KRYA 2HQOA 3ZDRA 1E3MA 1NULA 2VC2B 3DNPA 3OZ7A 1W1IA 3CW9A 3PUVA 4NFHA 2RGWA 4EY5A 4OYYA 3RCBA 1VJRA 1VKZA 1IRIA 1YDHA 1SVOA 2BUBA 2DECA 2JFXA 3AH8A 3LXUX 5AM5A 5K3DA 2QZJA 3V8MA 1QFJA 3PXAA 5HK8A 2GMWA 2A1UA 2XUDA 1MTOA 1NLMA 3L6DA 4JR0A 3G1WA 1JDUA 3EFOB 3Q2OA 1WX1A 5EXEA 4WINA 2W9XA 3ZW7A 5I4KA 3A37A 2FP3A 4LE0A 3AUAA 3IP5A 1JAIA 5AP9A 1FDUA 3C6XA 5B2EA 4RQAA 3DUFA 2ZB2A 1IPHA 3O8QA 1VMAA 3ND5A 1KYZA 4G86A 4LE1A 2WNSA 1ZLXA 4OL9A 4EG4A 4TV9F 4IILA 1OLUA 2ZTMA 3HY3A 5AW7A 2WP0A 3QKSB 1PZEA 5A02A 1XUOA 3IR7A 5EJIA 3PNKA 4RD1A 3KZVA 5J40A 1PR4A 1OB2A 4C7OA 5LBIA 1CP3A 5JZMA 4DIDA 3D31A 1CG6A 1XQYA 3A4TA 3JRXA 4LJ8A 4ZOCA 4X61A 5DK6A 3TOCA 5HR5A 1EWRA 3FVRA 4FDUA 3VDRA 2HF8A 2VPXA 5IF9A 3HPQA 1FP6A 1T10A 2HMAA 2ZYTX 1XMOB 4M86A 1EVJA 3JY6A 4LHEA 3UMFA 3EZNA 3KZKA 1OX5A 1OVGA 3TK1A 2PX2A 3CW8X 1U6KA 3LLSA 4KPUA 5LA6B 1K6XA 2JFQA 3L49A 4WN9A 3ZCVA 3EEOA 1W36D 1I0IA 2CL6X 3GMTA 4A1FA 3H9GA 2Q8QA 2ZTLA 4Q4AB 1KOJA 5DHTA 1G0NA 2VF5X 4LY0A 3V97A 3N7UA 1B73A 2XNJA 2XY4A 4U2DA 2P6NA 1AOXA 2BVNA 3ETDA 3ZIUA 5C7YA 1E2DA 4NQRA 2XXAA 3MWKA 3U3JA 2PKQO 3OEEA 4L57A 3DVRX 1B8NA 4MP3A 1GQYA 1AT1A 3IJRA 3C3WA 4CKEA 4ZYVA 4TTRA 5LL6P 3VO9A 2JK1A 2UUOA 3T5DA 5BWMA 4H60A 2PPLA 1N4DA 3WI7A 1DFHA 3RAJA 3QUBA 2XCIA 1KS9A 2OBLA 2RDMA 4F6CA 3OP1A 5I5EA 3L40A 3WSTA 3V1YA 2JA1A 4O4LA 3BMXA 4S12A 1GNSA 3LYAA 3EVCA 2IE0A 1DLJA 2IYWA 3MMNA 2UYQA 1YC2A 3KT6A 2QJWA 3G68A 2DR3A 2FZKA 3DOIA 2JI7A 1KEUA 2JAUA 1VPWA 4HZIA 1WA5A 2M2IA 1G2PA 1P2DA 1RRGA 4AQ7A 1AV6A 4A73A 2HMUA 4KWHA 3D6TB 1BS2A 3QVUA 1QGDA 1ODIA 1A4XA 1D4FA 1K6EA 4F06A 3PTLA 4CM9A 2AEFA 1WKVA 3LQ4A 4ND1A 2P9JA 2VH1A 4A82A 4GZMA 1KDPA 3ZHUA 1U2TA 4V3BA 3K8QA 4UE2A 5H5JA 3UGQA 4YAWA 3VYUB 1JT2A 2BP7B 4O1MA 4UCFA 2Z08A 1OC2A 3SN6A 2AUMA 1DV2A 5THKA 4CMIA 3PFGA 4O5OA 1LVHA 4Y18A 1A5TA 2P65A 3BBPA 4X94A 3ZDXB 1CY8A 2GYVA 2O2SA 1UJCA 1GQRA 4GEKA 4LMPA 5IMSA 3HUUA 3RRYA 4RJIA 2ZJBA 3OFSA 4UEJA 4BLSA 3FPCA 1E9VA 1P6UA 4JSYA 4X20A 5JVDA 1DQRA 2PL5A 4WGFA 1C9DB 1HFKA 4OHBA 3E82A 1QHYA 4FGZA 4ESHA 1F14A 2IXEA 4OA8A 3H8WA 5DW0A 5FWXB 1Z35A 3H11A 4KFSA 1GG8A 3CR7A 3BPSA 2JKYA 3L05A 4J07A 3QE4A 4E08A 1ZD3A 3BIOA 1TQDA 1ZC4A 1YE5A 4X3PA 3FDJA 2J4DA 4YQFA 3NETA 1GDHA 3W05A 5JI3E 4RD0A 4BY9E 5JSUA 3S44A 2WIFA 3CG4A 2NM0A 3RDPA 4RJTA 1MW8X 4UNNA 1M6NA 1ZMTA 5K8UA 2CNWD 1UQRA 2HXSA 1L1FA 3VR4A 1EFCA 3SZGA 3EJ6A 1HL7A 1BYUA 1K3FA 4LKOA 3ZCUA 1A97A 2VAPA 3LPLA 3Q6MA 4KL8S 1T5OA 5JNLA 3SI7A 3V3TA 3FYTA 1BE1A 2PV7A 2W43A 5DEIA 1T6ZA 1NU8A 1G9TA 1CSEE 2VYVD 5MN4A 2BGRA 5HXAA 4X1YA 3D3JA 1HFEL 4ND5A 3PWSA 5JUWA 3M6VA 3GG9A 4LMAA 4B8ZA 1EFTA 2GCIA 2C3YA 3KJNA 3PFHA 2P9CA 3PC3A 2VDPB 1I10A 4CKZA 2IOQA 3SXUA 1L5LA 1F17A 5IC4A 2QIOA 1S9DA 3AXSA 4LZOA 3HRHA 4IJQA 1ADJA 1IWBB 2O2GA 3RYTC 1VB5A 4UEKA 1Z5VA 1XD9A 1VCHA 1MC4A 4E12A 5I01A 3AVVA 3VU9B 1PZMA 4LBZA 5JOQA 2CFOA 4I4NA 4OJTA 1LSUA 1NHGA 2I78A 2HDOA 1USIA 4I5GA 2R1ZA 1PYDA 3GVIA 3L04A 3QKRB 3RRXA 4U7FA 3L9WA 5BN4B 1RHKA 3MGBA 4EG6A 2FXIA 5KZMB 2QUBA 3WL6A 3PYXA 2Q2WA 3W9SA 3D2LA 4ZFNA 1GGMA 2H8GA 5KWIA 3PDUA 1Y1QA 1YHZA 2ONYA 1B16A 3DHVA 2C8LA 3IKVA 3BZUA 3OM0A 3NOQA 3ELYA 1UJBA 4IWNA 1GUDA 1UFKA 2YV2A 3OMLA 2ZRHA 3WKDA 2F1IA 1Q1NA 1PE0A 1NWCA 1NP6A 4CHTA 5ARBA 1RIFA 3WIBA 4AS2A 1IEXA 4IR7A 4Z49A 4W5RA 3VC3A 1U99A 2ZTHA 4GSLA 1S96A 1IDN1 4KIFA 1NW7A 3CXRA 4MINA 1I4DD 5DNWA 3RYCB 1M66A 4R1QA 1I4LD 1USVA 4MRRA 3C3AA 4YJHB 3RT1A 4MS1B 4GKJB 2Y9MB 1QS0B 4XDGA 1RHQA 2NO5A 4CG1A 4JC5A 4XIIA 1E60A 4D3DA 1M6HA 3EZ6A 1YU9A 1GEEA 4HF7A 5IRCD 3K0AA 2XH8A 1ZC3A 3ULKA 4CEHA 1PR3A 2PT7A 2Q9CA 1R4MB 2JAXA 4MRPA 1E0DA 1SR8A 4J75A 1Y6JA 2VYND 4J91A 2BFBB 4ZT6A 1ZNXA 2VF8A 4P82A 4AY3A 1J42A 1FX0A 1HV8A 3JQEA 4PYOA 3SF8A 5KS2A 1VHWA 7MDHA 1R00A 5BV7A 2F1RA 1YB5A 3I6YA 4MNTA 2NQ8A 1VLLA 2O2EA 3AWDA 3VNSA 5BN3B 4ETMA 5ICGA 1PFKA 4HVLA 5LD2C 2F00A 3A6GA 1OGJA 1STOA 1T2NA 3MT0A 2REBA 1VLHA 3E35A 3OCWA 4V0OA 2Q4OA 2IGBA 3UWOA 4UBIA 3ENVA 3GJRA 4EYKA 1PJRA 2DT5A 3HB9A 5DWQA 3WLOA 3KSZO 2I4OA 2TS1A 4EY7A 2ZBDA 2PJUA 3HEMA 4CPDA 4P4TA 4ZQHA 3ZCQA 1Z73A 3DTNA 3N2KA 3H8JA 1AQIA 2BM0A 2HCFA 2R47A 5C5CA 1CF9A 4Y1GA 1G3QA 4ZO6A 4KITB 1Q0QA 1VJGA 1T15A 5AI0A 4NL4H 1UBLS 2IGTA 2ZRAA 4R54A 4C08A 1OHHD 1HLDA 1NU6A 2B34A 2O0HA 2WWWA 2GCPA 3DF7A 4IG4A 4TL8A 1RABA 3GYGA 1RXSA 3NRJA 1NUUA 4GI3A 1SCAA 4JC4A 5EWLB 4D57A 1VSTA 3V8EA 1I6WA 3F4LA 4CI9A 3JQCA 3UMBA 2H5JA 2QLJA 4XGIA 2G7MC 4ARBA 2UZ4A 3K70C 4TL7A 1SC6A 1EVLA 5CX4A 3OUZA 5DM4A 1F38A 1ODCA 4O4HF 3E9YA 2X0FA 4N41A 5KQMA 2P0AA 4F38A 2I3AA 3TGWA 2JFPA 1MF7A 1JEYA 1U9YA 3HFGA 4HWSA 4L5CA 1MEJA 3KFXA 3B2EA 4CF5A 3R5KA 4ZCSA 1WMDA 1QC5B 4E88A 4NICA 1IL0A 5KVCA 4NPCA 5AESA 3FMPB 3BTUA 1J0CA 3FKSA 3R3XA 4BNHA 3NHZA 1TOAA 2HJHA 3Q1KA 3R3VA 4M6WB 2I03A 5CDUA 2CBGA 2A0YA 1U3GA 4J29A 3G6KA 5C51B 3IEVA 2FOXA 4AZ3B 3BJMA 1YZKA 4PZPA 5BRNA 5JJ5A 1GLVA 4ZHQA 5H0IA 3THWA 4HQLA 4MVCA 3NV7A 3V42A 5IKEA 4XVCA 3RWMB 3WOVA 1JL3A 5IYZB 4FB5A 2OHVA 1UP4A 1KHTA 3R9XB 4NZMA 2IEBA 2B36A 2HM7A 5ITZA 3FUUA 2ERYA 1U7TA 4CLDA 3BRCA 4YAIA 5IT9A 2GF9A 3MCUA 4HNHA 2C9DA 2GSWA 3V8VA 2DLCX 4UVIA 2XBUA 4M7OA 4KNWA 1RIIA 4LWQA 4RKRA 5GTDA 1Q7TA 4EHBA 4LZZA 1QANA 4FGWA 3VR1A 4KR6A 3NRBA 2WU3A 1WNFA 1CIPA 1BDMA 5FB3A 4MS1A 5F77A 2ALJA 4HDNA 3VAAA 1Y8ZA 2OG1A 5MGBA 2NPFA 9LDTA 3DDZX 1KI7A 4RZIA 3P4XA 5EKUA 5CA1F 3G8CA 1GL9B 3QW2A 4YRFA 1NHWA 3S28A 1QZ3A 3WLLA 2R68A 3RGWS 1WSBA 3UTDA 3VFDA 4HQRA 1OBFO 1WD7A 4JD5A 4AYXA 2GJAA 5AHKA 2F4VB 1JPUA 3TL6A 1DS6A 1MAUA 4JLBA 4WBXC 5GONF 3QLJA 2X1MA 4NBUA 2PQ6A 2DLNA 4IV0A 1DAFA 2OO5A 2JHCA 2Q3EA 1XXHE 3V9AA 2Q4RA 1SUCA 1NDHA 1ETUA 2EFCB 1UXGA 1EWTA 3RUAA 1ESCA 3SHWA 3DLTA 4X97A 4PNEA 2NP7A 2JPDA 1D09A 1QHNA 1R4AA 3ML1A 3VPHA 2O23A 1YMVA 2GJKA 3QLTA 3HMQA 4LOLA 4MV9A 4TGLA 4XIFA 4BU0A 4QUBA 4C4SA 5C1BA 4IHJB 1XD2B 3GGJA 3GGDA 4NBVA 4WJZA 3GH3A 2VJBA 3GRKA 3QWAA 4XQEA 4YC7A 4B5LA 3PHIA 3UXHA 1QVZA 1NBWB 5J2UB 4MWOA 1J8VA 2AR0A 2LCFA 4GWKA 4TV8A 1JA1A 3CEMA 2CSXA 2MYNA 3EXEB 4D4KA 2O8CA 3B12A 3MJ4A 3VTZA 3R3JA 1JV2B 2I2AA 4IY1A 5BN3A 3LTNC 3RBVA 4KH0A 3LC0A 4KFRA 1RQ2A 1XZCA 2JAPA 1C80A 1SXJC 1XNJA 2I99A 1TMKA 2J3HA 2WJIA 2EBWA 3NCTA 3W2IA 3ZIAD 3LPMA 2BMVA 3GEBA 3N07A 4KK3A 3D4BA 1OFUA 1FXWA 3I8XA 1MHTA 3F97A 4TS4A 5IM4A 4RHUA 3KWMA 2VJQA 2J67A 2ZB8A 2IEDA 1X7XB 1DT5A 3IQXA 3EIFA 3OFND 2XWPA 4KBYA 4G9BA 3NH9A 4M0PA 4DLBA 2QLBA 4ZI7A 4YUYA 2WPNA 4JBHA 1A5ZA 1MC1A 2ZULA 3NHFA 4PXYA 2WUGA 5COAA 5J5CA 1CNFA 2H3EA 2H48A 1D4AA 1ESZA 1S5PA 2FJPA 2YC2C 1WXWA 4FMCF 2AKAB 2FWNA 1NYRA 2VP4A 2XB8A 4R16A 5BWBA 3EH2A 4E4TA 2DH5A 1ZOIA 3TM4A 3VZBA 5B7GA 4YMWA 4L8FA 3ZE9A 3QEJA 5HBGA 1S0UA 4ZOEA 2C4UA 2B0CA 1AHNA 2O2CA 4GSKA 4H59A 4OM7A 4YGXB 4O4LF 2AG5A 2Q99A 2X0IA 3FIJA 4J1NA 3TLBA 3UPTA 4OJYA 4BRWA 3KWLA 3KT0A 2DQ4A 4C4TA 5LYJF 4GC5A 3D3EA 1CRWG 1Y8AA 4Q3KA 3AT1A 5M04A 4KR0A 2EHJA 2ZATA 3QI7A 4NK4A 4QDUA 3PG5A 2WWVD 3KPJA 4RY8A 3TDNA 3U81A 3ZQJA 2I3ZA 4WNCA 5L4SA 2O8DA 1OCEA 3KG2A 2JIQA 4FCVA 2P90A 4FC7A 2IOHA 2Q3CA 3BGIA 3FM9A 1EZZA 3PDWA 2XUZA 3EXG1 2JASA 4TXHA 3GAFA 2DE0X 4FDMA 1PGQA 2Q3DA 5AMXA 3T3OA 2REQB 3U44B 4G5HA 1F2UB 2JLSA 4RD6A 2DAPA 3CX4A 3KTOA 2YHUA 1G60A 2KBEA 3IV7A 2O57A 3ACDA 4ALMA 1AS0A 4FZ5A 4QPNA 3DZ8A 1AXRA 3KXDA 2HH9A 1QRDA 5LMNB 4LBWA 1NQ5A 4L51A 1PFGA 2IQ5A 3VC7A 3ZLUA 1NVUQ 2X7JA 1UWLA 3OJEA 1JECA 4K2AA 4MGEA 4MPPA 4OGGA 3W6PA 4WI1A 4PAGA 1SCDA 1F1JA 1XJCA 1XKQA 4FKZA 1S3SA 4HAIA 4MKZA 4NKRA 4AXXA 5DYWA 1ZSYA 2XNDA 1HZJA 1T1EA 2UXDB 5LB2A 1GGHA 3QI2A 4MEBA 3M89A 3RD5A 1RXCA 1THGA 2FSVA 2WEKA 2WT9A 3S68A 2Q0SA 2ZRBA 5IABA 1MORA 1PU2A 1F60A 3KX2A 4M9QA 2OB2A 2JFUA 3ZI7A 3AR4A 1M67A 1S2DA 1P1CA 2J3MA 2PKXA 4INZA 4YRAA 1EK5A 4GYWA 3F73A 1E1MA 5HRCA 2IUFA 4O25A 1XZAA 3AJ9A 5F12A 4B9AA 3H04A 2PVSA 3KYCA 1HO3A 1N1GA 4HYQA 3EZ9A 1A9TA 1BXRA 2XMSA 1QVRA 2HFKA 1JP7A 1LB1B 2AT1A 5TEWA 3TXAA 5E2AA 4K9SA 1VHTA 3F0TA 3AR7A 4V1CA 1G7TA 3GLSA 3BDIA 2Q6VA 3DULA 1J2RA 4IH4A 4Y2UA 4O4IB 1VYUA 4R7GA 4LNUB 4DBLE 4GMDA 1YJXA 4CI0B 2FCRA 2P11A 4IXTA 2HHHB 2VPYA 2IT1A 2IS6A 2IZ7A 3OURA 3WYNA 4EGAA 1TK9A 3PFFA 5JO9A 1RC8A 4MHSA 4DMKA 2VXCA 1PS8A 1EGHA 1Z6QA 1BA3A 4KH1A 5AJWA 2BM1A 2WAOA 4TS9A 3S4YA 4BKUA 5DNVA 4ZYZA 4Z9FA 4RTMA 3QE9Y 5KYXA 3PUXA 5EFZA 4LW8A 3IO5A 2AXQA 1GTG1 2FR8A 3DDNA 3K2EA 3T95A 4GP7A 3WICA 4MR9A 2UAGA 4P4SB 5K3FB 5FPSA 1CFJA 4MAAA 3IT0A 2FFHA 2XD9A 3HSYA 1DQSA 4I3GA 3PDJA 2YOGA 5D7BA 1QGUB 1KEPA 3B2QA 3SZMA 3EXEA 4B84A 3T5GA 1NONA 2FPLA 4YI3A 1YV9A 1XZPA 1FDIA 2EAUA 3NGMA 3ND9A 4IMIB 1KDZA 3OLYA 3V6MA 4I2VA 4PSVA 1UJNA 2EVWX 3B8EA 2FF7A 4ENSA 3T1YB 2FA9A 4HSEA 4IP0A 4R8KA 3WLAA 3GLIA 1ODKA 3NEYA 3ZDBA 1RAHA 2VZ0A 5B3AA 2NO7A 4LV6A 5EP4A 1N9GB 1YQUA 2WDPA 4JOQA 2KJQA 4TPKA 5AM1A 5H59A 3SE7A 1APBA 1DCKA 2R85A 4CGYA 5DEOA 3HUEA 2IXTA 2BKUA 3I52A 3PZRA 5TQ0B 3PGMA 4R1OA 4OSOA 3L7LA 3Q85A 2WKQA 4L4ZA 1PJTA 1U1EA 4PHTA 3PE3A 3S2SA 3IDSA 5C8VA 3IHWA 2RG7A 2CV2A 5KQSA 1X92A 3T5PA 2O8NA 3VA7A 3D4PA 1T2UA 4CM1A 4MR8B 3G1TA 3TXXA 3KB6A 1TM1E 1X1BA 2DFPA 3RE1A 2OBFA 1UJMA 5B7QA 3LY9A 2XMQA 4R0NA 1WP9A 1SU6A 4FLMA 3BXXA 1Z6XA 5DGIA 3JRNA 2FFBA 2BTQB 5B1SA 4E3ZA 1ANKA 1KEEA 7GPBA 4J4TA 4MW4A 4XPIB 4B76A 5KSPA 3U17A 4PU0A 4CDNA 2JIOA 1OYVA 3T61A 4AJ2A 4RVDA 7YASA 5FYDA 3H3FA 4CMEC 4NYJR 1KI2A 3E2MA 4Q9KA 5JSHA 3RVBA 3G79A 2XQFA 1PR6A 3EG9B 3EQ6A 3GA5A 1ZJWA 3CZQA 5DM0A 5LOVF 2AYXA 2VJDA 2C5BA 4BBZA 4I8XA 4X7PA 1A5SB 3ANLA 2NZVG 4BVHA 4N76A 3PTAA 3GOHA 4QUAA 1PR2A 2PD6A 2VDRB 1CJCA 2VZ9A 4GBGA 2PMEA 2IV2X 2GVDC 3M1YA 4AZVA 4B4OA 3KAKA 1QK3A 4QRIA 5D7NA 4RGYA 4Q1BA 2V97A 3UJ3X 1CRLA 1V8FA 2YBEA 2YJ5A 2ZSJA 3E3MA 4ZODA 3UUWA 4TSKA 3ECAA 1G21E 3RVDA 3IUYA 3WRYA 2GARA 5K01A 4OHXA 4DW8A 3T3NA 3LYLA 1FY2A 3B6JA 5C37A 1ZW1A 2BUCA 1WEKA 5ESRA 1SPXA 3EFOA 1N4AA 2V6IA 4MLZA 4OY3A 2ZYWX 2HQBA 3IIKA 3ZY5A 4B3XA 1NW4A 4P53A 2CDRA 3FH0A 4WFKA 2YMQA 3KLBA 3F5FA 2QN7A 2W6PA 3G85A 4QQRA 4Q7QA 1N3LA 1YR9A 4ARSA 2TMKA 3R7FA 3S8EA 2VBCA 2ZCJA 1M2VB 4YUAA 3TQQA 5KU1A 1W6UA 5EJ2A 3D6AA 3ADDA 3BRWD 1DEOA 1BQEA 4HDSB 3RNOA 3ACBA 3FSJX 4PG6A 3FROA 1O6ZA 2C0QA 4WXYB 5G4LA 3UXYA 1RWPA 4EYGA 4XWWA 1N77A 1N6OA 1BEEA 1PQYA 2GFHA 1LV8A 4QLBA 2WVHA 1JSCA 5L6MB 5LQSA 3WGMA 1N3BA 1SPBS 4Z9XA 3U2QA 2YXEA 4E5MA 3PRYA 1S4MA 1FPQA 1BX0A 2JGMA 3B9BA 1L7MA 3L6UA 3F6BX 5AQ1A 1R6UA 5KI6A 1Y9EA 3ILYA 5LYYA 2JIBA 1S6YA 4FXPA 2XB6A 4OXIA 1TTQB 4MPTA 2WZQA 3K9BA 3OEED 4Q9AA 1SG0A 2KPOA 1VL2A 1L5RA 4HL6A 1Y6RA 2O2IA 4DLVA 3IIJA 2I76A 4YX9A 2JH3A 4NWIA 2BGLA 4QVIA 3U16A 1F2DA 4N82A 3I05A 3KQYA 1D9XA 5KCMA 3NHLA 2I54A 2VT7A 3DLPX 4F96A 4WBNA 2PLWA 4MS4A 1K4YA 2D7CA 2IIVA 3COZA 4PX3A 3KKNA 1SY7A 3PEVA 4ND4A 4ENVA 2EOAA 3NYQA 3OE4A 3SSAA 2QLTA 4ROTA 4XLTA 3T4EA 2ZSIA 2FVXA 3BWYA 3EGWA 3K6RA 4NOMA 1JHDA 1LLCA 2J7PD 4BFTA 2EQAA 2VK2A 4C78A 5EJEA 2ZWVA 3OQJA 3ZX5A 1L7VC 1E62A 1WB5A 4AQDA 1NVKA 3AW8A 3E9EA 4J9UE 1OI4A 1W4BA 2P91A 4IXWA 1NRXA 4IYJA 3GNSA 2YZ2A 2MU1A 2YJZA 4IMRA 1E6MA 4JK3A 2OXRA 3M6IA 1G64A 3QFSA 2O2XA 4D9HA 5IF3A 3NYWA 4EHDA 1UQTA 5B58C 4LBYA 2EKDA 4G36A 5E7QA 1INLA 1AF4A 2PUHA 2ZVJA 3D59A 3PGVA 3TFQA 4WBNB 1THZA 1SXQA 4K40A 2BFAA 1QVWA 3NWBA 4C3UA 4Z4CA 2C58A 4BUCA 3ZWDA 2YMLA 1KEWA 3B51X 1IAVA 1IJBA 4ISBA 4WK4B 2H2HA 1J56A 4PO8A 5THQA 2JHGA 3ZVRA 4YCBA 4L6AA 2WJ6A 1IATA 1SHJA 1UJ2A 4X8OA 4ZGWA 5AW3A 3QK7A 5EZYA 3JAMA 4C4YA 5C5DA 2AN9A 3PD1A 1G8AA 4DNFA 1E4EA 1NMYA 1YS1X 2WM9B 4I5EA 4MS3B 3AEQA 5BSGA 1NRWA 1E98A 1NBIA 3ORYA 4NPHA 1HZZA 1Y3DE 4HVAA 3BFJA 3DMRA 2VHCA 4DCGA 4YCLA 2OQIA 2SKEA 4ER7A 1CS4C 1NJ8A 3FCAA 3AI7A 4XWGA 1S7GA 4LXHA 3IEPA 3DOEA 4BC1A 2FUEA 2E5WA 3QVGA 4V24A 4LYHA 4XLLA 1C0KA 3GQVA 4DCCA 4PO1A 1AKVA 3KKOA 4PYKA 3NWJA 4PLZA 5T6BA 1TLLA 3RSZA 4DA6A 1T5SA 1E9BA 1THTA 4NHEA 5F9MA 2WE8A 5JT1A 1KP9A 1ODJA 4F85A 4DIOA 5KSZA 3GLGE 4WUTA 4M53A 3NEAA 5JD4A 1WWKA 3KETA 1U1IA 3IP6A 1L5KA 1RJFA 3AHJA 5L40A 4BLPA 4GX1A 1SC3A 3REGA 2O5CA 2WF5A 1LA2A 3CGGA 5KPDA 4YRBA 4YJKA 3S1SA 1CVIA 3QPDA 2QM8A 3HCWA 3JQBA 1K68A 1VL0A 3LLVA 3OZDA 3HV0A 1AGPA 2HEGA 2V9CA 1P81A 2JKVA 2QGZA 4C06A 3ONVA 4ZICA 2EYUA 1LS6A 2SKDA 5TGZA 1J5EB 9GPBA 5HNKA 2O8EB 1P60A 4JLMA 5EN4A 4XH9B 3RAEC 3BIJA 3JWEA 5DLDA 2DQYA 1J4AA 2FZWA 2QWXA 2Z9BA 1U8XX 4QTTB 1E5QA 3ANYB 1WD5A 1M33A 3RFVA 9MHTA 2YIVX 2BGUA 4H9GA 4UNSA 3VTFA 1PFQA 4JYZA 2PGAA 3PIRA 1KRHA 2WF9A 4PBTA 1JI0A 4CF7A 1N2SA 5LMUB 5EHXA 2JFZA 3TDKA 1RJGA 2OHGA 5BN4A 1QDLB 4Q34A 3LQ2A 2R66A 2ZJZA 3QKRA 2ZS7A 2BRUA 4JIGA 1JB1A 4MA4A 5GOTA 3VR2A 4BKRA 5BWNA 2FSIA 3DHEA 3RU7A 4AZWA 4UASA 2A9KA 3S2IA 3P71T 1VA4A 3AP2A 5BMOA 2PL3A 1X7GA 3IUSA 4HBZA 1HX7A 1KAEA 2OZVA 3GFOA 5FADA 1X7WB 2GPWA 4WDRA 1ACMA 1LBQA 4BQSA 4IM7A 5EJMA 5BXQC 2XQVA 3CSDA 3D4NA 4DXAA 5CDHA 3LKDA 1JILA 4YRQA 4EAQA 1E7SA 2NUAB 2AFVA 3FY4A 3G2HA 4C7BA 1C0PA 1SO8A 2EQBA 4GOJA 4NCJA 4HN4B 4BC0A 1BHQ1 4IDEA 3CCBA 3STYA 5I48A 5F7JA 3FNGA 5DMXA 3WTCA 1E7RA 5DH9A 1XD2A 3DEFA 2AN5A 3I9MA 3M6UA 3GLGB 3RF6A 3PWTA 3AUUA 4AFNA 3DMFA 2YRFA 1XJWA 3HCPA 2AX4A 5FL3A 1XPUA 2HRRA 2EGHA 2C42A 1GGVA 3RB8A 2ETVA 2JZNA 1G8SA 2FWAA 1FRQA 1K7CA 3B85A 2FDCA 5A4DA 3N0TA 5IARA 3OQPA 2R751 2FX2A 3ZY4A 1Q7EA 1Q6ZA 1C3OA 3ZYZA 1ONOA 2Y2VA 3WV4A 3SEZA 4CIBA 1MEEA 2P7HA 1CX9B 1SG6A 2ZREA 2H1IA 1VFNA 1MVNA 4QXAA 2C78A 1HDEA 3DZDA 4J3JA 3BK1A 4QASA 4HRVA 5EZ5A 2PBFA 3FMFA 1CUFA 3GGCA 4D02A 3DOCA 2H8KA 3FTQA 1VZ2A 2VXBA 4FJ0A 3TSZA 5C18A 3AR2A 3DGFC 3CVVA 1YO6A 1TVKB 2NQ2C 1YA8A 1QE3A 3IELA 4NV0A 5DI9A 2FFJA 3TQCA 2FMKA 1L7EA 1QGUA 4US1R 1TK3A 3I8SA 5AJUA 5EMNA 5E1MA 4XYMA 1GPH1 5A1TA 5DV9A 3IQGX 1U2EA 2E48A 1U2GC 1UIRA 2IEIA 2V7TA 3PGLA 3FZQA 5DULA 4PZLA 4PN7A 5FAKA 2RGGA 1EXDA 1AKYA 4H2DA 4BMNA 4RA9A 1BKYA 4UZEA 3UB2A 2C29D 1NMQA 4E1AA 2YFHA 3K92A 4XJTA 3ZH2A 1XZJA 1TLTA 1X0VA 1U2SA 1W73A 2I4RA 4ZO7A 1OXSC 2J9ZB 3LY7A 2IQIA 4AKGA 2C95A 4N18A 1VDZA 4CLEA 2P1DA 3GPBA 2FPIB 1IXKA 2G88A 2PZKA 3AVQA 5FI5A 3Q6IA 4GE0A 4QPJC 5KJEA 2JGRA 2UKDA 3OWOA 4Z2AA 4ALIA 3EVNA 4JOSA 3ZDZB 4QDOA 1IZ8A 4Q4JA 4YT4A 5HJ7A 3DE2X 3JATA 3GRVA 1L1QA 3ERCA 5K0ZA 2WZDA 1UF9A 4ALKA 2WU4A 1ILEA 1SJ9A 3G2QA 1XVIA 5H16A 3PDIA 4P8RA 3D5TA 4PV7A 5JSZA 2C99A 4PLPA 2G4CA 2F6RA 2QY9A 3QTLA 4JP3A 2EKBA 3AY3A 3FVQA 4O0MA 5KOYA 3FUXA 5AKXA 5E38A 5HIJA 3HNPA 2EU8A 1XI2A 3QXHA 4M0EA 1T2CA 5BO5A 2IHUA 4Q7EA 2PRKA 3F46A 3QTBA 2I1WA 4HNQA 2QW1A 1OXBB 3BFVA 1YMUA 4KHZA 4MDYA 2X9NA 4LS3A 2WIAA 2QRNA 2FKAA 5K99A 3F9CA 4CODB 3I62A 1CD5A 2CHEA 4UHFA 5E6RA 2OXTA 3ROXA 5JWOA 3G5TA 1KYQA 3DCJA 2H7YA 3V4VB 1UDAA 3JD0A 4ZQBA 1SOAA 4DSAA 2I80A 3AO0B 3LT2A 1QRAA 2PYIA 4M2LA 3QSYA 4TMVA 1YNOA 4X1IB 5CYFA 3TCKA 3DVSX 3ZWMA 1L4HA 4AMUA 5FBWB 2RHTA 4D80A 3E1SA 3L01A 4OHZA 1TU4A 2OC9A 2VCEA 1NYLA 4G5FA 1ORTA 5AOVA 1T2AA 1XCJA 5EJ6A 4TZKA 3D6JA 3MUNA 1KJYA 1L5NA 1LWNA 1JFVA 3WC4A 1GIAA 2HGZA 1GY8A 1RPJA 3QY9A 4PFSA 3CVWA 2B4QA 3DMDA 1AY0A 2XXAB 1E3SA 1XMPA 3NHJA 3OF3A 4WNAA 3KE9A 3O1LA 4U9UA 3MT9A 3PI6A 1F12A 4DCNA 2GTPA 3TPFA 3M34A 4K8RB 2WIGA 5AUPB 4MCIA 1X86B 4HTFB 1W25A 3TNJA 1ULSA 3C3PA 3FI0A 3ICWA 4KVAA 1YC5A 1XMVA 2C61A 3H0CA 4NJOA 5BRAA 1AH2A 2F4NA 5JS2A 4UVEA 2W4QA 3ZDFA 1DAEA 1II9A 4YRRA 3ZY2A 4ODIA 5AI6A 2VUTA 3LHDA 1TO2E 3P9XA 2HO4A 5A03A 2RJ3A 4J9VA 4KACA 3TW0A 3UAOA 5KYGA 4ZPXA 3UCEA 1IXYA 3HKDA 5F73A 1WMSA 3FGPA 1X2BA 4MUNA 3W4KA 4A0GA 4QBGB 5ILQA 5I7HA 4FWTA 2VFAA 4OUKX 3BF7A 3ORQA 2QQ0A 4YDSA 3C6YA 4OJNA 1GYQA 1ZRHA 3NTRA 2WHPA 1ZONA 4M0MA 2FQQA 1I4OA 1DC7A 1BE6A 4H17A 4RLFA 3UG7A 3GMSA 1E5LA 2FW6A 3MWEB 2AL7A 2B2CA 4TVKA 5ALRA 1KWKA 5A04A 1VP9A 3LP8A 3AP3A 2VKTA 3K9LA 3LPAA 3O95A 2PX4A 1F2VA 3NJ8A 4DBZA 5J2UA 1A27A 2C3MA 1G20B 2ACVA 5JS7A 1XA3A 4WKOA 5JAQA 3WGKA 4C4RA 2Z6VA 4JHLA 3G0OA 3C7TA 2PMWB 1RYMA 1WHSA 3DKVA 1JG7A 3FCXA 5BT8A 1GADO 2QRVA 5AKHA 5TX7A 1T9DA 4AUMA 5TC4A 3O26A 4Y1FA 5DM1A