4UNRA

Mtb tmk in complex with compound 23
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
209
structure length
186
Chain Sequence
MLIAIEGVDGAGKRTLVEKLSGAFRAAGRSVATLAFPRYGQSVAADIAAEALHGEHGDLASSVYAMATLFALDRAGAVHTIQGLCRGYDVVILDRYVASNAAYSAARLHENAAGKAAAWVQRIEFARLGLPKPDWQVLLAVSAEDAELQQRTGAVYAELAAQGWGGRWLVVGADVDPGRLAATLAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords THYMIDYLATE KINASE
publication title Structure Guided Lead Generation for M. Tuberculosis Thymidylate Kinase (Mtb Tmk): Discovery of 3-Cyanopyridone and 1,6-Naphthyridin-2-One as Potent Inhibitors.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 70
structure length 186
sequence length 209
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2014-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4unrA00
2CMKA 3DKVA 4NP6A 3WYAA 3CWZA 1J90A 3RSLA 3T34A 4IFBA 2VP6A 4EPXA 3B13B 1GKYA 3U7EB 1E9SA 3I1FA 4TT3A 1KK1A 2B7CA 3I3SR 3PUZA 3MRSA 3W5JA 3EPKA 5EXTA 1TF2A 2JATA 4Q5IA 2C9OA 3KJIA 4B48A 4HLQB 1P62B 1XFAA 3TE6A 2XGJA 1Q22A 2I4IA 1ZD1A 4PX9A 3LX8A 1HTWA 2WSMA 3BK7A 1D9XA 2H92A 3QIAA 3VU9B 3A6PC 4BWYA 4A9AA 5JCZA 3FOZA 4BPBA 2I3BA 3QVVA 5CM9C 2FEMA 2Z5FA 2ODWA 1K8RA 2ZR9A 1E69A 1XMJA 3AB3A 2BKEA 1KNQA 1SZPA 2ZUCA 3A1SA 1XDBA 3EPLA 3FB4A 4BE7B 4D82A 1W36D 5BYJA 4US2R 4RZ3A 4B76A 2QE7D 1S0UA 3B1XA 2X19A 1R7RA 1CRPA 1TPZA 3CH4B 1ZU4A 4TQ9A 2GF0A 4C30A 3AF0A 5TB5A 1KI6A 2QORA 1G4AE 3TSZA 1LVGA 3CF0A 4DWJA 1IHUA 2VSFA 3LO5A 3MG9A 4IEIA 1HY3A 1Q1ZA 2HYIC 5JFGA 3CRVA 3GJ7A 3HPQA 4B6EA 1X86B 3ND8A 3NVAA 2OFOA 4M21A 2VP9A 1NIPA 3P26A 2D2FA 1DAFA 1CJMA 3OE7D 4HYYA 1UEJA 2EYQA 2XXAA 4UQOA 2D7CA 1E9DA 5B2ZA 3ZZTA 2HLDA 3OAAD 4BLPA 3KQLA 1OJLA 2HEIA 4LYFA 1RPZA 1IXRC 2RGNA 2PEYA 1GFIA 5JLJA 4FWIB 1T9HA 2BMJA 1ZNWA 1E2PA 3A37A 2JLRA 3M4YA 5L3VA 3U7GA 4PZLA 1Z5ZA 2QT0A 3KJEA 3U7FB 1VCMA 3QEOA 1XXHB 1E0KA 3QKUA 5FR1A 2R65A 1ZW6A 1NVXQ 3EIHA 2NO9A 4PSVA 4Q1AA 4JT4A 5EXSA 1D5CA 3IDQA 1T3SA 3LLUA 1Z0AA 4IHQA 1E2FA 1E9EA 4B3CA 1FZQA 2W00A 4R98A 4KO8A 4PZZA 5FUYA 1RYHA 5JI3E 2IXFA 3VR6A 5KPJA 1NKTA 2Q3MA 3CW2A 1CJKC 4B34A 3DOEA 1OB2A 2QRZA 4TZ0A 4NCKA 1RIFA 3I5YA 2O5VA 3K9HA 1KY3A 1G20E 1KI9A 1U81A 3BC1A 4RD0A 2GJ8A 4EQ6B 2AFIE 1ZCBA 1HYQA 2JAQA 2VSOA 4WZ6A 4I1VA 5BN4A 1NLZA 1UBCA 3OIVA 5BQ5A 1LB1B 1JR3D 1KK3A 4EPRA 4C3ZA 3AEZA 4TL8A 3WXMA 1XJQA 2HXSA 1QHGA 4MDEA 2PT5A 1WCV1 2VP4A 3E2IA 2F6RA 4XVQA 3EWSA 4MYHA 1XP8A 2EFCB 4EKDA 5BN3A 1B23P 3U3RA 4DBLC 1XBTA 1HH4A 4TTPA 1W0KD 3Q9LA 4DB2A 1UJ2A 5DN6D 4FWTA 1CU1A 1BIFA 4YXWD 1FUUA 2V8OA 3O47A 2ZR7A 5IF9A 4F4IA 4GRAA 3DL0A 3K09A 3W3AA 4EPWA 2IYUA 4CRWB 1AM4D 2G77B 1NMZA 2QE7A 1GOTA 3GLFA 2ZM5A 1T0JB 2DFNA 3AVVA 5KOYA 1ESNA 4ZCMA 4CEJA 2Q21A 1CBUA 3TK1A 4B3FX 4A82A 2JGNA 3MWYW 1AGRA 1GNRA 5JRZA 2J5XA 4OJKA 2H18A 3QF4A 4M53A 1XTSA 2ZSDA 3V9PA 3B1VA 6Q21A 2QMEA 1BYIA 4A8JA 1CLUA 2IA5A 3QXSA 5FL3A 4Q9KA 2B6HA 5KNDA 5DIFA 1KNXA 2AKAB 2GCOB 4A6PA 3HPRA 3OE7A 1W4BA 1ANKA 2GK6A 3LDAA 4JKIA 3B9PA 4URVR 3PV0A 4HUQA 1J8MF 4XVUA 2PMDA 1SHKA 2WWFA 3OAAA 3EW9A 3MMPA 4AK9A 4X8OA 5DO9A 1GP2A 1Z28A 1W5SA 2QU8A 2NQ2C 2OFWA 2F9MA 1WMSA 2O8FA 4KODA 2GVZC 2QM8A 2HF8A 1D6JA 3LW7A 1YRBA 4S35A 1S3SA 3KB1A 3REGA 1X8KA 1W47A 1FP7A 4BFTA 2FFAA 4G5OA 3AVTA 2IS4A 3NC0C 4AURA 4URUR 2NPFA 1US8B 3W6OA 1IONA 2PT7A 2XB2A 1T3LA 1X1RA 1Q1EA 2R62A 3CF6R 1Z3IX 2G1KA 2W2TA 3CNLA 1EFCA 2BBSA 4TLCA 1FTSA 3RS5A 3QI2A 4DXAA 2WMOB 3VFDA 1JALA 1N0UA 2OLJA 1EFRD 3AH8A 1P61B 1XD2B 1VHLA 5CB6A 3AVWA 4TMXA 2NPIA 3SYKA 3NC1C 1D2MA 5DHAA 2BBOA 5FUWA 1GDDA 5FBLB 2MSCB 4HLUC 4ARZB 2IS1A 1J8YF 3AKCA 2WM9B 2KBEA 3TBKA 4C0QC 1XEXA 4YLGA 1IJFA 1FMLA 2CBZA 2KJQA 4UNQA 5C46F 4P4SA 1SHZA 2ZTSA 2ZRKA 1JR3A 2LKDA 3B9QA 3H84A 3BJIC 2WBLC 2ZRGA 4JIMA 4MGYR 1CIPA 3RC8A 3U4QB 1NVVR 3TGPA 2CHQA 3PJRA 2ZUBA 2GKSA 3U7HB 5DN6A 4RD4A 1KJYA 1W2HA 3V00A 2GDJA 4JSYA 4YXWA 3FMIA 2OE2A 3HJNA 3TRFA 3L0PA 3X1WA 2OFXA 3GLHA 3CR7A 1I2DA 2P6UA 1U8AA 3AVOA 3THYA 4CT4B 1XXHE 3IHWA 1XPUA 3A4LA 1G5RA 2YV5A 3KQKA 2RGDA 1L8QA 2NGRA 4EJSC 1YZGA 3A36A 4B47A 1LF5A 4FMDB 4RZXA 3K0SA 1ZU5A 4ZDKA 2WKRA 4KYUA 4MKHA 4XTRA 3SJAA 2F1JA 3CRRA 5FBRB 1TMKA 3GLIE 1W46A 3VR1A 2JLSA 2ZITA 1QG2A 4R71A 1WQ1R 1UBEA 1SVLA 2VO1A 3QEJA 5K8LA 3WP0A 5L3RA 4L9WA 5K8TA 2JJ1D 1VDZA 2ZE5A 2C78A 1XEWY 3QKSB 1M34E 2GJ9A 4Q66C 3T1VA 1VCOA 4LV8B 4EFLA 1G9XA 1KI1A 2BOVA 2VP5A 2ZYTX 4PHFA 4UJ5A 2OG2A 3WMFA 2JCSA 1G4UR 3IQWA 1HV8A 2FEOA 4ON9A 3C8UA 2HYDA 4LHWA 2RGBA 4X8MA 1E2IA 4LYAA 2K5UA 3ONWA 1V43A 2EWVA 3GFTA 2R44A 2ODEA 2CJWA 2VTKA 1RW4A 3IQXA 4DEYA 5JJLA 1QHSA 3QJYA 2RGEA 4DLRA 4X8LA 3VR3A 4DLSA 1P73A 2IYVA 5FFMA 4UNPA 1EFRA 4HAUA 2C99A 4MRSA 2ONJA 2JASA 4L5BA 2IYWA 3MJRA 4IDNA 4G5GA 4R2IA 5TVKA 4CVNA 2W2VA 2KBFA 2ATXA 1VCIA 4ZPXA 2CNWD 2UVQA 3TH5A 5D3MA 5FTKA 3FMFA 2VP2A 5F9HA 2WIBA 3VR5A 5E7JA 4B75A 5LB4A 2V1XA 1NP6A 2WJIA 1G3UA 4G5RA 4LBYA 3R8CA 5JS8A 4DVGA 4M0LA 1Z08A 4CEHA 1MRNA 2IYSA 2WJYA 2V55B 1VMAA 4A4DA 1KK0A 1OFHA 1XCPA 2X77A 3EA0A 3NBXX 4KI0A 1QZXA 1QHIA 4D4JA 4CIDA 1BMFA 4KHZA 2FV8A 1TQ6A 4ZDJA 2RH5A 4GPTA 1OXVA 4WBSA 1JXMA 4PSAA 3LXXA 5FOVA 3VR2A 2VEDA 2GJSA 1JNYA 3AVXA 2QAGA 3RS4A 2BV3A 5DYIA 2DBYA 4PO8A 1RYFA 4JLAA 4MA4A 4J0QA 4YMUA 4RKEA 1AN0A 1W5TA 2QMHA 3B78A 3RSOA 2XX3A 2C96A 1P2UA 3NEJA 4JLDA 3VQTA 1IN4A 2YJTD 3SC3A 1EWRA 1UKEA 2Q9AA 2DB3A 2A5GA 4MRVA 3DEFA 2HF9A 3VR4A 4B6FA 3V4RA 1II0A 5DI3A 1UKYA 3ZD7A 4LBWA 1L4UA 3IIKA 3K8YA 1E9RA 2OESA 3LBIA 2FE4A 4EJSB 4EDHA 1E9AA 2JJ8A 2R8RA 4DLYA 2ECKA 4AKIA 3BXZA 2QA5A 2ZRPA 5FBWB 2Q9BA 3T1QA 3LVQE 4KXFB 1N2CE 1G3QA 2J45A 2XOKD 4JJZA 3ECCA 1SVWA 1Q21A 2JJ1A 2RB4A 4LV6A 4C2TA 3W34A 5DH9A 2OT3B 1N6IA 5KSPA 1LW7A 5L3QB 3L0OA 1UF9A 1E79D 3DKPA 2J7PA 1PJRA 1ZMXA 5GJCA 1IQPA 4HDOB 4TQUS 1Y63A 2JLUA 3IUYA 4HATA 4RD2A 3TAHA 1ZIOA 1YZLA 2ZAMA 3FYHA 1P7CA 4IXMA 4Q19A 2G6BA 5J5CA 1SVSA 3FDIA 4LJ7A 2QL6A 2IUTA 4LBZA 4DIEA 4MRNA 5GVRA 4BZXA 5FUVA 2B21A 3A1TA 5SZHB 4E22A 3CR8A 2XNSA 4URZR 5SZIA 4HSEA 1KDTA 1OHHD 3TSWA 1ODFA 1XJ0A 2LKCA 1TQ2A 4P32A 4A6XA 4V0KA 3CPHA 3FHOA 3QE0A 3WYGA 5F9FA 2AKYA 2HUPA 4IJMA 2IX3A 2CNWA 1Z06A 4FN5A 2EVWX 1TF5A 1KI8A 1S9DA 3FE2A 3UG6A 4DLVA 3VKGA 2KI5A 4II7A 1NBME 5JI2E 1T5LA 3AQ4A 1OLOA 1KMHA 2ODNA 4ZI2A 1MH1A 3FMOB 2FPMA 4TMKA 1H8HD 1R5NA 1COWD 1EGAA 3KFXA 3ZH9B 1J70A 2Q9CA 3RDPA 2IF2A 4HB0A 3GMTA 4DT1B 4D26A 4JVSB 2VA8A 1XRJA 4DUGD 1KZ7B 1HUQA 3I8SA 3GCGA 3RABA 2O8BA 1CJUC 1CULC 1IXSB 4DJTA 3BFKA 4JSTA 2FPKA 2TMKA 4S2EA 3Q72A 1J99A 2RMKA 2H17A 5SZJA 4CEIA 2B8WA 221PA 1CXZA 4HZUB 3AGQA 5C1BA 3VX4A 4KFSA 4JBYA 4NTZA 4Q00A 4A92A 1YQTA 1XPRA 2FMXA 1AS3A 1G3RA 5J4LA 1M7HA 1WBDA 1XMSA 3OIYA 2Z4RA 1LF0A 3EXAA 3KL4A 4DSUA 1W44A 2QRNA 2FGJA 1ZM4A 4JLKA 4C0BA 3DPUA 3JZAA 4L9SA 3ICQB 4GZLA 3TSOA 4F4CA 4DHEA 4OQXA 4M9XA 1TL7C 2GCPA 2CLSA 2WJJA 1K5DA 3CPJB 4FXPA 4Q02A 4A0RA 2WOJA 3CKLA 2XZOA 2XOKA 4JKYA 5EE3A 4Q18A 2ZVQX 2ZVPX 3TQFA 2WSSA 3GLGA 1OB5A 1KI3A 2PCLA 1G3IA 1ZD8A 4MITA 4WOPA 4OHZA 4Q4HB 3IIJA 2DWQA 2HV8A 2ASEA 4M1KA 2OCYC 1C9KA 1C4OA 1DG1G 2JA1A 1KO8A 1E79A 4JYBA 4ZI3A 2C8VA 2J0QA 1XX6A 1AQUA 2V6JA 1YR6A 4GMDA 4QGAA 4QHTA 2REOA 3CO5A 1KHTA 4P4SB 2IBMA 4ZCIA 1G7TA 1XJCA 2A78A 4PXAA 3FFAA 2V7QD 3TAUA 2H16A 4JYCA 3AVUA 2ZJAA 3LX5A 2PZFA 1YVDA 2ZSAA 2J0VA 2OO7A 3PIRA 4NHOA 2C95A 4QRHA 3U61B 4TYYA 2Q0HA 2Q3FA 1HT2E 1OHHA 4I4LA 4HAYA 3ZGXA 2D62A 4JLPA 2ZPTX 4U5XA 4ACBA 1Z83A 3ETLA 4M1TA 2YOFA 4NBSA 2KWIA 4FI3C 1KKMA 1OSNA 2ZRAA 3SEAA 2O8DA 3THYB 5DSZA 2EW1A 3G0HA 2VHQA 2ZS8A 3LFUA 1DPFA 5FTLA 1OXXK 1IXZA 3K0AA 3BORA 1ZC4A 4IXNA 1YKSA 4OHVA 1QHNA 2Q3HA 1H8HA 4OYHA 5HE9A 2DY1A 1COWA 1UADA 1Q1BA 4G1UC 2QPAA 3H2YA 4DUGA 3UMSA 3ADCA 3H86A 1BH2A 1R5OA 5CJPA 4Z8XA 1SVIA 4Q4LA 3I32A 1GSIA 5HCIA 2L0XA 1LFDB 2J41A 3PITA 4X8HA 2ZI4A 3TR5A 3PVSA 4ZIRA 2BIFA 1FOEB 1ZNYA 4QHSA 1Q3HA 2YWFA 4ASUD 2BCJQ 2OHFA 3F5FA 3K0FB 1AZTA 2HXYA 3CLVA 1BKDR 2WPDD 3LAWA 4Q4JB 2IYYA 2Z83A 3AUXA 2O0KA 3KKMA 4V03A 1GZSA 4JL8A 4JLBA 5F3WB 3S1AA 2ZROA 1CJVC 2OZEA 5JSZA 3HP1A 3R7WA 5KSOA 2OBMA 2BBWA 1M7BA 5DGXA 2FWRA 4FCTA 1SXJD 4GZMA 1CTQA 4C0JA 3TJZA 5EP1A 2NOAA 3IHLA 4G0NA 4QKQA 1N6HA 1NN3A 1E2LA 2FSIA 1T8UA 1Z0KA 4PPNA 1DAMA 1AQYA 1FMJA 3U60B 1MR3F 1N25A 5L3SB 2AHOA 2F9LA 3RHFA 3CNOA 1EFUA 4LWZA 2ZYUX 1E9CA 5E4FA 5CK4A 1KOFA 2RGCA 1YRAA 4JJKA 1QBKC 3LV8A 2DFLA 2GBLA 1XZQA 1UDWA 2WKQA 1TTTA 5FPHA 4D81A 1FP6A 1KDRA 5AWFC 4QBFA 1E2QA 4URXR 1KZGB 4Q1FA 1I4DD 2GA8A 3IPXA 3Q7QA 3T15A 1ESMA 4TTQA 1AKEA 5A5GA 2GTPA 1ZIPA 2JLXA 3AGPA 4XH9B 1JAIA 1G64A 2W6ID 3SI7A 4AYXA 3B85A 2IT1A 1YHNA 5FI1B 4N1AA 4GOKA 5CYPA 2GJAA 1RJ9A 2GESA 1CR2A 2C5LA 2MMGA 2AL7A 1FTNA 4RFVA 1DS6A 1VG1A 1FNNA 4LK2A 5AUPB 4EPYA 2EFDB 2FF7A 2OXCA 3B1WA 4M9ZA 5TXGA 4CGZA 2J0UA 2FA9A 2ZU0C 5B57C 2AX4A 5SZKB 3LNCA 4DDUA 1FL9A 1JPJA 3MAAC 3UANA 5DISB 1GL6A 2VHUA 1II8B 4LBVA 4D80A 3ICEA 4M22A 4Q1DA 2IYQA 2ZRHA 3FHCB 4P31A 1NL3A 5KUTA 4IVRA 1E3MA 1OE0A 4FCWA 4GSYA 2QP4A 4LY6A 2IYLD 1QHYA 4NYJQ 2QZ4A 5IT5A 3U3KA 4NCIA 1A5TA 2G9NA 4TLDA 3PR1A 1VCNA 1MO5A 4B3BA 3GP8A 3PG5A 1G7SA 4OQFA 4RZUA 4BFWA 1G6OA 4QNRA 4ASUA 4L8GA 4JBWA 4IDOA 1ZC3A 2WPDA 3OZXA 5EXPA 3VHLB 4AYTA 2FOLA 4MGIR 4KBFA 2A5FA 1R0WA 2EFEB 4I81A 4UXIA 5AUNB 2FSHA 1IAQA 4FMBB 2NMVA 3A4MA 3L0SA 2BMDA 4NE2A 1LV7A 2RKOA 1E6CA 1SXJA 3NG1A 3L8YA 3I8XA 3RYTC 4C0AC 3NDBB 4GBMA 1UEIA 3R20A 4R9UC 4DDTA 1VG9B 4BLTA 4LJAA 2GRJA 4TSFA 1P9RA 1S96A 5C2JB 1N0WA 4DLXA 1T3HA 4ZKEA 1AA9A 2W6JD 3CRQA 3TUJC 2OCBA 1JECA 2PEZA 2W58A 1A82A 3GLIB 1NVWQ 4Q48A 3KTAA 3GEIA 3GPLA 4Q47A 3RWOA 4RFSB 4K81B 1G21E 1XF9A 4KFTA 3ZZUA 3EPHA 3CNNA 2P0EA 2I1VB 4LRWA 4UXJA 4A0GA 1T0HB 3IEVA 1GKIA 1E2DA 3BIFA 2FFQA 4E03A 3L0IB 4F93B 1KK2A 3BERA 5HZHA 4A0FA 4JLOA 1TADA 2XB4A 3SYNA 4RSGA 4DCUA 2YWEA 3E1SA 2AWOA 5G53C 1U94A 3GJ0A 3QKRA 4GNKA 1FQJA 4LC1A 3NH9A 2QPTA 4GOJA 4TLAA 5BWMA 1QVAA 1KO4A 4BEJA 4GOXA 3I5XA 1YE8A 2V4ZA 1TX4B 3KUDA 4TMZA 1G7RA 1F2UA 1DO0A 2AK2A 3B60A 1XCMA 5FBVB 2O8CA 4BFYA 2ZI6A 4QBIA 2VF7A 1KJZA 3UG7A 3PEUA 3PUXA 4URYR 3CH5A 1Z07A 3FTQA 3A4NA 1C1YA 3X2SA 1R8QA 2XNDD 2VQSA 4D4MA 1P2SA 1F60A 1OIXA 3NBZC 3QSYA 1GRQA 2DYKA 2QPOA 1VTKA 2P5TB 2FFHA 2ZREA 2VHTA 1AJEA 1P2TA 3D7MA 2IL1A 4JBXA 3BWDD 1M7GA 4IEEA 1NMXA 4OJQA 1R6BX 2JLQA 2BCGY 2IXEA 5HE8A 1OFUX 1TU3A 1IOZA 1P60A 2WTUA 2VIIA 2G1JA 3KXIA 2H1LA 3QPVA 5HTKA 4BEBA 1X1SA 2DFTA 1U90A 2PMKA 3B8HA 4V0OA 5BW8A 4XWKA 3DZ8A 1Z2AA 4BLSA 4FCVA 4U02A 5FTMA 1GVNB 3K1JA 1S4QA 3PQCA 1DAIA 1R2QA 2F43B 4LPKA 1F2TB 2WVJA 5DLQC 4Q9JA 1Q20A 2ZETA 4BFXA 1IY2A 5J4HA 1CR1A 4P4UA 5ANRB 5KSZA 1FQKA 2ZJOA 1QHHB 1I2MA 1R5BA 3K0CA 2IEZA 3WBKA 3K70B 1XU4A 1NSFA 5C4MA 3U2QA 4O2RA 3SJZA 4UNSA 1KAGA 3NDPA 3AP3A 4JLMA 2QI9C 4BASA 1Z22A 2ODBA 3TR0A 4MKIA 1NJGA 1W49A 2PZEA 1Z63A 5FOSA 4V0LA 3PUVA 2KSQA 3FKQA 1M2OB 3EZ6A 3AP1A 4TMWA 2XZPA 1UPTA 4BLOA 4KBGA 4QG7A 5LBIA 4LHXA 1HE1C 4XD7D 4PR0A 3U3MA 2E1RA 2ANCA 2P5SA 3EZ7A 5KDDA 1YU9A 1YZQA 2QBYA 1G6HA 5AJYA 2CVHA 2IK8A 2GEUA 3SN6A 1M74A 2RAPA 2RCNA 3EARA 2HDNB 1P9NA 2GVDC 4N0DA 2CE7A 1SVKA 2HJGA 4ACAA 2F1RA 3IILA 2JDID 3PEYA 3CB4A 1CP2A 1RFLA 2XTMA 3X1XA 2ZJYA 3BE4A 3ZQJA 1W0KA 4M1MA 2FH5B 5DYGA 4RCYA 4AKGA 1CR4A 3WYFA 3CUEF 2CEAA 5E3HA 1QDEA 4CF7A 1KSFX 3LD9A 2QENA 4Q21A 2WWGA 4LJ9A 4V0ME 3CX6A 1N5JA 4PO1A 4RKFA 1T91A 1N6LA 1ZNXA 2C9YA 3MLEA 5J47A 4QOSA 1ZINA 3GJ5A 1XTRA 1ZBDA 3WNBA 2ORIA 2XNDA 2O8EA 3ZJYA 2ZRJA 1OKKD 2J0SA 2GHIA 4L16A 4ABYA 2CL6X 2GEDA 1OH8A 1N6PA 4QHYA 3OFND 2FGKA 4C0KA 3AF4A 5CDFE 3DVLA 5M04A 4H9GA 5K8UA 1AIPA 1NVUQ 3IPYA 3LH5A 1NN1A 1NKSA 4PPGA 3DOFA 3KQNA 2R6DA 4PO9A 3FWYA 3THWA 2C98A 5KSYA 2ANBA 4HI0E 4CDGA 3QENA 1NNEA 1JQJC 5BYKA 2BHRA 2BMFA 2NTYC 4IVQA 1GG2A 3EIEA 3ZQ6A 2NO1A 4CT5A 2H7VA 3TW8B 1U2RA 4B33A 4TYNA 2WZQA 1G18A 3UXMA 1A1VA 4NMMA 1TAGA 2ZS9A 1OH5A 4Z1MD 4DCVA 1EX6A 3SHWA 1ELOA 2P67A 5TMPA 2BBTA 1T5IA 3A58B 3QPUA 1Q44A 4PFSA 1PV4A 1BS1A 3RRMA 5CB8A 4IVPA 1YZTA 2R6CA 1RRCA 2AD1A 4U00A 2PCJA 4ITRC 3AVQA 3QG1A 5EUQB 5F98A 3DZDA 3K09C 4ZKDA 1T6NA 1CEEA 1SKYB 1M8PA 1YR7A 4TYPA 421PA 3BFXA 2GXSA 3P1JA 3SJBA 1FX0A 2N46A 4XD7A 4NYIR 1X3SA 5E95A 721PA 2ZXUA 3THXA 1KDPA 4C7OA 3THOA 4KFRA 3B1ZA 3OEHD 3NKVA 1WBBA 5H8WA 4IRUB 3F0TA 4NPHA 5EP4A 1KI6B 1NSTA 3NWJA 1L7VC 2O0HA 4A8JC 5AUOB 2YKGA 2JDIA 1NN5A 4PTLA 4DCNA 2PX0A 2Z4SA 3NHAA 3QKTA 2GXQA 2P65A 3EWAA 5JJKA 2Z6VA 3U3JA 1W0JD 4FMCB 4DDVA 4KITB 5KU1A 3U44A 1GM5A 3SQXA 2ZJ2A 2YOGA 4BFZA 2MSEB 2JIZD 3BBPA 2V54A 2V9PA 3EPJA 1VHTA 3K9NA 2XXAB 1U9IA 3CM0A 1L2TA 1WXQA 3MUFA 1DG3A 1KO5A 4TZ6A 5EP2A 1W4AA 3TUZC 2ZRIA 4MYTA 3C16C 1OKKA 3MWKA 2GZHA 3KQHA 3WBJA 3RANA 4F91B 5CITA 1S2MA 3OFNA 1TEXA 4MUBA 4F7WA 3EZ2A 4A2PA 4QGGA 3ZZ0A 2ZE6A 4PAQA 4NH0A 1KSJA 4M1WA 2VF8A 2J87A 2B92A 5FOUA 2JJ2D 1S1MA 1JEDA 4TMVA 1UKVY 3VMFA 1GILA 2DWPA 4CZ2A 4HDCA 3BB3A 1G5TA 1BYUA 4KJZA 4YQFA 4PSKA 1RE0A 1MV5A 3AP2A 3X1YA 3FPAA 3H4MA 1ZUIA 3BB4A 4RY2A 1KJWA 1OXSC 4M9QA 3T12A 4Q7JB 5C18A 5GJBA 4DLUA 4O3MA 4LI0A 4IKEA 2P2LA 4HLCA 4NONA 3ZVMA 1GUAA 3OIUA 1E32A 2XSZD 3CX7A 3R9IA 4PHGA 3QBVA 621PA 1D8TA 3RVBA 5K8IA 1Z6TA 3JZMA 2G3YA 2VBCA 5AJZA 2ZJ8A 4DSTA 3IGFA 1G8FA 4KAXA 2D06A 1PLKA 1LY1A 3KDSE 1DTSA 5JEDA 4RD3A 2NO6A 4US0R 5LD2C 1VYUA 3QNUA 3OF5A 4P3YA 2A3RA 5JMTA 3I4LA 4DZZA 3BRWD 1EK0A 4G5SA 1RRFA 4WW0A 4MKFA 1P75A 3ZS8A 4BLRA 4OHXA 4C4PA 5JBQA 2RHDA 3GLFB 1KYIA 2GCNA 4I1OA 4PQRA 5FPSA 3OEHA 1XXHA 1OYWA 2UZ3A 1KKLA 3HYRA 4FMCF 5AR1A 1SVMA 4CEJB 4MRRA 4YMTA 5JCPA 2FJUA 3C41J 1AK2A 4OI2A 1E96A 2FZ4A 3QF4B 4MGZR 3EAQA 5CIQA 2NO7A 4TL6A 5J4KA 1W0JA 1EX7A 5A4JA 2MSDB 3JVUA 4G5QA 4A8JB 1RZ3A 5FOWA 3TQCA 2JLZA 2IYRA 3T1TA 3A8TA 4IOLA 1IBRA 4QNMA 2JIZA 2NO0A 2GILA 4A36A 2Y8EA 4HUQB 3MD0A 2GZAA 1RRPA 2REXB 3LW8A 1CKEA 3BOSA 4TLBA 3I62A 3LY5A 1KSGA 2J3EA 3CZQA 4JVMA 1JJ7A 3E70C 4Q7KA 2NZ8A 3SFVA 4B3XA 1NJFA 4EQ6A 3U5ZB 2O8FB 2A5JA 4NYIQ 1G1MA 3N2EA 5HZKA 4O2LA 3ZVNA 1KAOA 1GL7A 1CJTC 4PHHA 3J81k 1OW3B 4B43A 3UKDA 1O87A 1G41A 2KB0A 3FKSD 5FBQB 2WWIA 5A0FA 1SKYE 1YR8A 3UWKA 2QY9A 1ZM2A 2JJ2A 4LGMA 4WZAE 1JAHA 3EZ9A 5JEEA 2JLYA 3SBEA 2X2EA 3KXLA 1XCGB 2R6FA 3EX7C 1R0ZA 1IJEA 1E4YA 2WV9A 4FIDA 1OIWA 2BWJA 2EQBA 3DM5A 1B0UA 2ZJBA 1Z29A 5JHHB 2CHVA 5G3ZA 4BZPA 2ZE7A 2OCAA 2VSXA 3DDCA 4M4SA 3WP1B 2YINC 4TYWA 1AS2A 1RVDA 3OEED 3C5CA 4PHTA 3Q7PA 2DHRA 4A1FA 4U7DA 5IRCD 1WE2A 1ZJ6A 4Q9LA 4W5JA 5FTJA 1XEXB 4QJ4A 3MGCA 1AGPA 3GEHA 2O52A 3HU2A 3ZYCA 4BRUA 3ZIAD 4GFDA 1Z47A 1NBMD 1G291 1WA5A 1Z6GA 1YZKA 2W0SA 3TW4A 4NYJR 2GCOA 3R8FA 2HCBA 3ZLJA 5HCNA 3SZRA 2ZRCA 2ZSEA 1IN5A 4NCJA 3LWNA 1VG0B 3GJ3A 5FUXA 1NY5A 1MKYA 4HLDA 4PQYA 4W5WA 1DAKA 2EYUA 2OILA 3GLHB 4LC0A 3RS3A 4WIAA 2AK3A 1NG9A 5LD2B 3DMDA 2LWIA 4NZYA 1OXUA 2Z0MA 3HU3A 4TLEA 1KDOA 5EE9A 1XWIA 3A1VA 2PJZA 1Q1QA 2DCUA 4PANA 5JRJA 3TUIC 1US8A 1U8ZA 2CLCX 1E1RD 1ZYUA 4E07A 4QM6A 3R9WA 2YWHA 4UJ3A 1EFHA 4LSGA 1E2EA 2NZJA 3PCRB 4KLZA 5EE1A 4BGDA 4D4LA 5B58C 2ORVA 1TU4A 2RHMA 5G40A 5IHPA 1XD2A 2MMCA 5DNYB 5JWHA 4OI0A 4AD8A 1IN8A 4LCBA 2ZQ5A 4OL0A 4DDWA 1OH7A 1HA3A 3IKJA 1Z0JA 5EE5B 4B74A 4XTCS 3UIEA 2OM2A 3IIMA 1QG4A 3I72A 2GXUA 4N0EA 2DFKB 2C04A 2CL0X 3L2OB 4XSHA 3GFOA 4W5HA 5B64A 3TNFA 2IWRA 1L4YA 4PC1A 2ERXA 2PZGA 3HR7A 4C0LA 2CJWB 1SQ5A 3EIQA 2IYTA 3FKSA 3VAAA 3U4QA 1Z2CA 3TLXA 2ZE8A 1OXTA 2IS6A 3RRNA 1GIAA 3CWQA 2VP0A 2OSBA 3CPEA 3EC2A 1GL9B 4Y0AA 2EWWA 1GITA 3CF2A 2FG5A 2FNAA 3MJHA 2QTFA 3B1YA 4HAXA 2GXAA 2PH1A 3GLFE 4BQSA 1R10A 5G41A 3RC3A 4G01B 4DLZA 3OEEA 2D4HA 1G16A 1YR9A 2YWGA 4BFVA 5D3MB 1PUJA 1OPXA 1XMIA 5CYOA 3T06B 3AM1A 5J40A 1UM8A 1E2JA 4QL3A 4M1OA 3ZIAA 2WAYA 5EZ6B 1NBMA 4PC7A 4Q01A 2V7QA 4NYMQ 2KE5A 1E9FA 4CEHB 3SOPA 3QXHA 3QXXA 4MGKR 2BC9A 2EFHB 2REBA 4RCZA 2V3CC 4ZV4A 4F92B 1LS6A 3VNUA 1NMYA 4OQNA 3FVQA 1GRNA 3QKSA 4R2HA 2ZRDA 4OHWA 5KDOA 3GD7A 2QAGB 4JMPA 2GK7A 2YZ2A 3K0EA 5CK5A 2XITA 1H8ED 2AR7A 5BN5A 3ZVLA 5DE3A 3KKOA 3W90A 1DO2A 3HR8A 3WHKA 3Q85A 2JLWA 4Q9IA 4P4TA 2QTHA 4MKGA 4GP7A 5DI3B 4JLNA 4B3DA 4UKDA 3T5GA 4BFUA 4ZDIA 1HEIA 1E1RA 4POAA 3BFVA 5CLQA 2BMEA 2RGXA 4JZKA 2AXNA 3B7GA 5TARA 4OK6A 5HKKD 3RRYA 1GWNA 2EFGA 2G0TA 1P5ZB 3SR0A 1OFTA 1WRBA 4MH0R 2F3TA 1K5GA 4IOJA 4JS0A 1EG7A 1N3BA 1ZNZA 2CDNA 1ZP6A 3UMFA 4LUCA 4PQFA 1JPNA 1J7KA 4RJLA 3SYLA 4ZDWA 5GADl 5GJWC 3GJ6A 4ZO4A 3OIWA 4PAMA 4OHYA 1JR3E 2PLRA 3KKQA 1NIJA 1TQDA 2OV2A 3RAPR 3NHBA 1IY0A 1X6VA 3JVVA 3QXCA 4K8OA 4Q4AA 4UXHA 4AG6A 3SQWA 1Y3AA 4HLUA 2F1IA 2H8KA 1E4VA 5LPNA 3WHLA 5EUMA 1K6MA 3KXKA 4EPTA 3PEVA 3AF2A 3HYTA 1JBKA 4WVFA 2YC4C 1N6KA 4Z8YA 2F55A 3BS4A 2VPPA 5IDVA 4D0NA 3U6KA 2N42A 2ZSFA 1Z8FA 3UMRA 3K70C 3GLHE 2BEJA 2F7SA 1JR6A 1XPOA 4TN1A 1HQCA 2QAJA 1ZM9A 4QC2A 1G8HA 3CBQA 4L4UA 1R0XA 3TMKA 2YVUA 1SGWA 1A2BA 4DC9A 3C15C 2QEQA 1G8PA 2SHKA 4D4KA 5J4VA 2WKPA 2WJVA 3PEWA 2WMNB 2P3SA 4OI4A 2QGNA 4NKRA 1AKYA 1LTQA 1N6RA 1HT1E 2IUUA 4NU0A 5AJWA 4EJSA 1Z6YA 1KMHB 3CONA 3KKNA 1EFTA 1N5IA 1SULA 3LRPA 2XTNA 3P27A 2VHJA 3N70A 4D6PA 3IBGA 4KSBA 2XAUA 3U6BA 3MWLA 1A2KC 1XD9A 2R6GA 2B8TA 1XZPA 2W6IA 1JI0A 2O8BB 3A1UA 4YDSA 5E7IA 1LS1A 3EC1A 1GNPA 2H5EA 521PA 4BZQA 2UZIR 3N2IA 2PBRA 3T1OA 4YMSA 5L3QA 4DB4A 2IWHA 1UBFA 4KSCA 4CEIB 3UATA 4C0SA 2ZJ5A 1H8EA 4C9BA 3LBHA 4IDQA 3VKWA 2YYZA 3KZ1E 5KDLA 4F4JA 1EESA 4HAVA 4OQMA 1R0YA 2GF9A 3O8BA 4HDQB 1UDXA 2CCJA 4EIWA 2IHBA 3P4XA 3W6PA 1DVRA 4WXPA 3UWOA 4DLWA 1ZD9A 3BAFA 3H1TA 3EZFA 1PLJA 3CZPA 2O0JA 2Z43A 4C0HA 4BUJA 5HKKA 1PUIA 2ZI7A 5HPYB 5JECA 1VYTA 2I1QA 1QRAA 1Z6AA 3A1WA 3G5UA 2ZANA 1G19A 1Q57A 2QP9X 1G8GA 1ZUHA 4Q7LA 3QUSA 2ONKA 3GLGB 4EUNA 3P20A 1YZUA 1JJVA 2BM1A 5BXQC 2CXXA 4QBHA 1IN7A 4K46A 1LNZA 2IW3A 4P33A 4A0HA 3O8CA 1DOAA 1JEEA 2R6AA 2CLDX 2PX3A 2GBLC 1TNDA 2Q6TA 2XJ4A 3GJ8A 1NLYA 1N6NA 821PA 4B2IA 1DELA 5IK2D 4MYCA 4BFSA 2BJVA 3MCAA 3E5HA 1BOFA 1JQLB 1U0LA 2CVFA 4HB3A 2V1UA 3NTUA 4HAZA 2B7BA 1D9ZA 1UBGA 4LJ8A 2J59A 4AY2A 2HJVA 4DT1A 4Z54A 1OT3A 4EFNA 2ZSBA 3GJ4A 2WAXA 2BKUA 3D31A 2FSFA 4HZUA 2YC2C 3LBNA 3L82B 1S1CA 2W6JA 1OV4A 4AG5A 1W2GA 1U0HC 5C4GB 5DHFA 5H1YA 2BJWA 2OAQ1 2ZRMA 2O8DB 1E2HA 1N0VC 1KY2A 2DWOA 4IDPA 4V02A 5H68A 4JVNA 3BGWA 5DI9A 1UAAA 1NLFA 4CYMA 2D74A 3K0AB 2CCKA 3Q5EA 4LOAA 3CX8A 1P72A 1AZSC 3C14C 3ADDA 2FN4A 1KO7A 2YOHA 3SNHA 4AKHA 1DAEA 4UNNA 2AN9A 1XEWX 3PENA 2F1HA 3HU1A 4QGHA 3L8ZA 4Z51A 4LHZA 1Z0FA 4B71A 1UKZA 1I4TD 1S3GA 3SS8A 3T5DA 1M6NA 4PAOA 1CR0A 4Q4HA 3MWJA 2ZJZA 2QN6A 2QP3A 5AK0A 5EP3A 2HCJB 4BRWA 2YNMA 1U98A 2AD5A 3EG5A 1E99A 1ZM7A 2QQ0A 1DADA 4LPSA 3ASYA 4KV9A 3K53A 4CW7A 4R7ZA 4ZIRB 1W1WA 3W8NA 1KO1A 1MABA 4OK3A 1E94E 1XEFA 2FU5C 3Q3JB 1G8YA 3P4YA 4I1UA 1NF3A 3ZDQA 1S8FA 1E1QD 1W4CA 2IHYA 4Q7MB 2RGNC 1G5PA 3SFZA 3GFPA 1U8YA 4E5UA 2D7DA 1VPLA 1SXJC 2PLFA 5CM8B 3S1AB 5JSZB 1RKBA 2CHGA 2RGAA 3KKPA 1KI4A 1UFQA 3R7WB 3C5HA 5UKDA 3FGNA 4TL7A 3QPWA 1BMFD 2ZRBA 2QSYA 2X8AA 4MUAA 4B44A 3KB2A 3WNDA 3AF1A 5FPKA 5L8VA 4H1VA 4PC2A 4TYQA 1VECA 3LVRE 3IBYA 2V6IA 5FI0B 1JXOA 2A30A 1IN6A 2OEPA 4LJ4A 1BO6A 2VL7A 4GMXA 1HE8B 4GI7A 4KU4A 1GRRA 5IK2A 3D8BA 4KYIB 4O25A 4XWAA 3TKLA 3MFYA 2WIAA 3Q5DA 3ADBA 2LCFA 1E0JA 1II9A 1X8JA 1MO6A 4HB4A 2QGZA 1TUEA 2JEOA 3EA5A 5JHGB 2XJ9A 3H0KA 2IXGA 4OK5A 4MYUA 3X1DA 2AFHE 3C7KA 1KI7A 3KUCA 4FD2A 2FFBA 4LV5B 2WICA 4Q9HA 4WXRA 3RS0A 4QXAA 4DKXA 1QHXA 4LZZA 2C9CA 2J1LA 4ESHA 4YMWA 4XIGS 2P6RA 3SBDA 1A4RA 4XSGA 2FX3A 5FR2A 3ND9A 1OF1A 4XOIA 1SVOA 4EAQA 1GAJA 2FDCA 4GP6A 1RJ9B 1E2GA 2ZIAA 3K0FA 5FL7D 2WWYA 1VG8A 4GDFA 2J7PD 5AJVB 3CRW1 4Q4JA 1W36C 2GNOA 4KLNA 5D3QA 1R8SA 4RD6A 1E2MA 3W6NA 2ORWA 5TV2A 2J0UB 1F3OA 5GJVC 4IFEA 1DEKA 2OAP1 1Q12A 4HAWA 2WHXA 3GLGE 2P6NA 1Q0UA 4P0TA 5FPYA 1FUKA 4RZ2A 2J7KA 3DM9B 3VNVA 2HT6A 4QBGB 4HZIA 4NCHA 3AKDA 4DRZA 1V5WA 2AXPA 3F8TA 2XTZA 4E09A 4I99A 2R2AA 3RLFA 1Z6XA 3NH6A 4B32A 4LJYA 5L3SA 3C4JA 1KI2A 1EWQA 4JLJA 2OUKA 3IO5A 2VYFA 5EZ5A 3VTKA 4URWR 4LHVA 4A2WA 2ZRLA 4KCGA 1AS0A 1XTIA 1PVOA 2ZI3A 3BH7A 3GJXC 3R9XA 1E1QA 1KMQA 3VHXA 4Q4AB 1MOZA 2G88A 3ADKA 2WJGA 1XTKA 5LDDC 4OBEA 5H70A 3CIOA 3I73A 3ZS9A 1N5KA 2ZI9A 1DAGA 2ATVA 4FINA 1E2NA 1G7CA 1XB2A 4OQLA 4WAUA 4KFUA 3I61A 4HEJA 3NIBA 1J2JA 4D25A 5J4YA 1SXJB 2GWHA 2IYZA 3K0CC 1R4AA 2W83A 3NXSA 4YDHB 3KJHA 2A7QA 1NG1A 2AWNA 3LLMA 3T35A 3VU9A 4NDZA 3SHFA 3OESA 1I4LD 4GL2A 2OXRA 3K9GA 4FMDF 2WWHA 2E9SA 1ZRHA 3OHMA 2A9KA 1E98A 1VIYA 4US1R 3WMEA 2VH5R 3WY9A 2WJHA 3KTAB 4ESVA 2ZYWX 2E87A 3BB1A 1VIAA 3CRMA 4OKSA 2CCGA 1ZUNB 3AVPA 3TIFA 4D0LB 4DEXA 4HB2A 2IS2A 1DARA 4B35A 1NN0A 1II8A 2C77A 2ZRNA 3LQRA 4LDJA 4M8NE 4Z1MA 3RWMB 5KNCA 5KPDA 5FOTA 3ZD6A 2VRWA 4JL6A 3UK6A 1NVVQ 3PUYA 3LA6A 3B82A 3PUWA 2WSSD 1QVRA 2W0MA 4LJ6A 5EQTA 5HR5A 1N5LA 5CLLA 1DE0A 4ILEA 2QUZA 1FNMA 1WP9A 5LB2A 2R9VA 4LJ5A 3UPUA 5FL7A 5P21A 4B3GA 1GNQA 2UKDA 3QKRB 1ETUA 4W7SA 1WF3A 3EASA 3D3QA 2QSZA 1NRJB 4AWXA 4DSNA 3MSXA 1EXMA 2D3WA 4W9MC 4IW3B 1WDTA 1F2UB 4D2IA 5F2EA 3LXRA 1W36B 2O8CB 4TWZA 2J9RA 2VLIA 4QJ5A 5EE0A 3ASZA 2QM7A 2OBNA 2IF0A 4V0MA 1HQYE 2QMOA 2ZUDA 5G3YA 5TY0A 3AKYA 1VKJA 4HUTA 1RC8A 1KIMA 2FSGA 4JT2A 1X8LA 3FFBA 3I92A 3SJCA 1W48A 3W3ZB 2GAAA 3K70D 1T4GA 2IYXA 4NL4H 4PZYA 1FW6A 4AYWA 1TQ4A 3IO3A 4FW9A 4EFMA 2A2ZA 1NY6A 2OLKA 3DO6A 1MT0A 4Q1EA 3AKEA 5B30A 3GLIA 3K9LA 3Q8XB 3U3OA 5CDFA 5KHOC 2D2EA 4KVGA 4IOKA 4Q1CA 1VYVA 1E2KA 5TDHA 1O3YA 4RFSA 2CK3D 1GKUB 1OFIA 1E0AA 3KJGA 3L43A 1FFHA 5JWOA 1U99A 2DR3A 1M1YE 1XMVA 3GQBA 1W4RA 2ZI5A 2N1BA 4OI1A 4PPQA 3QXJA 4YC7A 2IUSA 2GJKA 4A2QA 2DPXA 1G3MA 3NEYA 3M6AA 4NYMR 3T61A 3SDZA 2A5DA 3B5JA 3V4FA 1JB1A 2H57A 3NBYC 4B73A 4B2LA 4EPVA 2J46A 4KVAA 2X1VA 2ZRFA 4H1UA 1TUIA 4YMVA 1XD8A 3BH6A 1ZCAA 3WRXC 4XWOA 3F3YA 121PA 3FHTA 3WNCA 3KFVA 1CF4A 4RVCA 5EJEA 1H65A 3RS2A 4PC3A 3HWSA 4QFMA 2FZLA 1PZNA 2BEKA 2G83A 4Q1BA 1NI3A 4AIIA 4LX0A 5ELXA 2X2FA 2ZYVX 1TF7A 3HDTA 4UNRA 5FPTA 2IC5A 5JZVA 5KTYA 4GT1A 2QBYB 2WWXA 4QJ3A 2QMUA 1N6OA 3AF3A 3RNLA 3WMGA 2XSZA 1E9BA 1D2NA 3QF7A 2XEXA 1P4SA 2QNRA 5E7MA 1ZAKA 3O8DA 1W7AA 1P2VA 4M9SA 8OHMA 2F3RA 2QAGC 4BECA 3AV0B 4DIDA 1OH6A 5AUQA 5JWRA 4TL9A 1GTVA 1P9WA 2YHSA 1MABB 1U9IC 1XTQA 2RGGA 4XVRA 4XJXA 2C03A 1CRQA 3RRZA 5FH9A 1SXJE 4DSOA 4TT3D 3SU8A 4TMTA 4MQBA 2ZAOA 5AJXA 4RD1A 2F43A 2ZR0A 1F2TA 3PFIA 4C2UA 3BH0A 4M1YA 3B6EA 4JL5A 1QHHA 2GZDA 4YONB 2QTVB 2O8EB 2QT1A 2VHCA 3B2EA 4I1SA 4NCNA 1P6XA 4ZCLA 1SKQA 1G17A 1ZM3A 3QY0A 1Z0IA 1PLLA 1RRGA 1TEVA 3KX2A 1ZVQA 2OCPA 3KQUA 5JS7A 1YJ5A 4V0NA 1T8TA 4TTRA 2HT1A 1U0JA 2QQEA 1F6BA 1MO4A 5CJ2A 4QM7A 3THWB 4MDFA 2CK3A 4AC9A 5CIWA 1IM2A 1F5NA 3QQ5A 3QOFA 3FMPB 4DCSA 2PJRA 1Z0DA 1HURA 2BM0A 4N3NA 3M1IA 1KSHA 3X1ZA 3RS7A 3W8RA 4ARZA 1FPMA 4JVLA 4M2LA 4LYJA 2CE2X 2FPLA 3NBFA 5EXXA 5KO2A 3ZVRA 3REFA 3P32A 1E0SA 4B2PA 2QG6A 1OYYA 4DLTA 1QF9A 3LQQA 4IDHA 5FOXA 5FTNA 2ZS7A 2NIPA 3W5IA 5KNBA 3VKHA 4A15A 5GVSA 2WOOA 1ONBA 2ERYA 4JLVA 4D0GA 1OIVA 1XTJA 3DMNA 4L15A 4WA7A 2WWWA 3QG5A 4BLQA 4DCTA 1KGDA 3W9YA 4Q03A 2BDTA 1MO3A 3AUYA 2EU8A 3IEUA 3WRYC 2G0NA 1WB9A 3QBTA 1IY1A 2W2XA 2GETA 1F48A 3GEEA 1MRSA 4ERNA 1Q3TA 2C2HA 2HLDD 3DHWC 3D6TB 2JLVA 2XZLA 4M1SA 1P3JA 1A7JA 2A5YB 4LYHA 2BVNA 4O0MA 1FX0B 3PXGA 3SE0A 2PL3A 1XNJA 4LHYA 4PC6A 3BD9A 2QROA 4QGFA 3TVDA 3VX3A 3THXB 4C7OB 2NG1A 2IEYA 4PPFA 1DAHA 4G3XA 2GAOA 4Y0VA 2ZU6A 4TQAA 5KYKA 4AI6A 3AVYA 3G82C 1S9HA 2OBLA 3QVUA 4AKEA 2GEVA 4IOMA 3M0EA 4TSFD 4MRPA 1YZNA 2ZEJA 3TVTA 1D2EA 3O8RA 3N5CA 2CL7X 4WZBE 4F38A 1KTVA 1DBSA 5JJIA 3U44B 1CS4C
chains in the Genus database with same CATH superfamily
2WVHA 1A8PA 5CFPA 1D6NA 3OSZA 2H7XA 5GM2A 3MUNA 4F9EA 1MAUA 3B13B 1R15A 1DINA 1E9SA 3I04M 1FY2A 5A4AA 4D8TA 3I3SR 5A0FA 1J2RA 3PUZA 1M1XB 2XQVA 2NUPA 1W6UA 3UB2A 2XUHA 3M5PA 2GDZA 1LVHA 5BSVA 4JXZA 3HZZA 4YJHB 4Z99A 5B53A 3ZDXB 5IT4A 3KO8A 1BHSA 1Y1KE 1QTQA 5ITVA 4UBIA 2PX5A 4GEKA 5AVWA 2JAHA 1XFAA 2Y1DA 3DAFA 4PX9A 1RWMA 3LYAA 3SC2B 4CKCB 1B3BA 3EVBA 3BK7A 2H92A 3QIAA 4UHDA 1MP0A 4ZVVA 3A6PC 2RI0A 4A9AA 2AEJA 1XKQA 4JJ8A 5JSFA 5ERXA 3PRJA 3FPLA 4FYYA 3PFBA 3M6VA 2Y1FA 5DNCA 2AOVA 1K8RA 1T2CA 3JQBA 4LE1A 3KVNA 2I76A 3BXEA 2CFRA 5DTMA 2RBGA 5LXTA 1QRUA 1U31A 1ISPA 2ZT7A 2QWXA 3EYAA 5F1KA 2JBAA 4WZAA 8ATCA 4B7UA 4DM4A 4BE7B 2FWBA 2XMBA 5BYJA 1LLFA 2GPTA 3O5AA 5J3JA 2JL1A 2YV4A 5IXSA 1KYZA 2FF5A 3ENKA 1FTQA 3DVAB 5A3QA 3W5DA 3H9UA 1B42A 3JQ6A 3OQVA 2R5WA 3KJNA 1C30B 3RYFB 1I6KA 2ZJ4A 3JYPA 5LZ7A 2JKYA 3M1AA 1L1RA 4P5EA 1IHUA 2VSFA 3LO5A 5LBTA 4IEIA 4URHA 4Q1VA 2HYIC 1U0SY 3D7KA 3DB2A 3ND8A 3NVAA 5EHNA 1PN3A 1YMQA 2O2XA 2VP9A 3E7PA 5KNDD 5IC5A 1UODA 1T36B 2LP4Y 3ETDA 3G88A 3HWRA 3I9LA 3BCHA 2EYQA 4RIHA 4PSDA 5CURA 4B7XA 2PUDA 2D7CA 3ZE7A 5CX4A 3H8VA 3NR2A 4N47A 2HLDA 3BEOA 4YH1A 4H0CA 4BLPA 1KFJB 4RTOA 3T9CA 3D54D 5JSYA 2WFAA 2G72A 2WILA 5J2UB 1GFIA 1CS0A 4I3GA 5SYNA 4J76A 2Y05A 4MQEA 3U7GA 1GUZA 4NEQA 2QN1A 1U2PA 1MTZA 4FT4A 3VGJA 3ZHBA 1Z5ZA 5L3VA 3U7FB 2VRCD 3CIFA 3PCTA 4WK6A 4B4UA 4CJXA 4MJ7A 2C9ZA 4MRMA 5BWCA 1XXHB 4OGFA 4II3A 4RE5A 4EB6B 2R65A 2HF7A 2Q2WA 3NWEA 4MK4A 4Q1AA 2C8JA 3I9MA 4JT4A 2XE6A 1N7HA 4JK3A 5AKIA 2IHJA 4FLMA 3C3PA 1ZHOA 2ES4A 2OQIA 4B3CA 2GD0A 2ARKA 4PZZA 4IO0A 4JR2A 1DRVA 3K6KA 2CKDA 3AM5A 4F8YA 1X70A 3QYAA 4FGJA 1NKTA 1BGVA 2XQJA 4YRRA 4BNIA 4CM1A 2VYVA 3VPFA 1K1EA 1NV8A 3DOEA 3L06A 3ESQA 3ZK8A 5BNWA 5IFLA 3G9UA 1OB2A 10MHA 1SC3A 1T3TA 3V7NA 2EZ8A 2ZBUA 4DA8A 1Z68A 4DWOA 1A71A 3I5YA 2O5VA 3PZRA 4E5SA 2XA1A 1M6VB 4A8PA 2G8NA 5MGBA 2BRUA 3PPIA 3ZWXA 5AM0A 1PFYA 3MLBA 2GJ8A 2XT6A 4EQ6B 4IZ6A 2AFIE 2QD4A 1HYQA 2VJPA 2VSOA 4GVLA 1NLZA 1UBCA 5BQ5A 4X3CA 4RIFA 4HL6A 2IIPA 3ZTYA 1JR3D 1KK3A 3K94A 5L9AA 1L7DA 4RPHA 3AEZA 3F7OA 5AQ1A 2MCFA 1GDHA 1QHGA 1XQ6A 2Q5FA 2VP4A 4ZQBA 4LKOA 4BP3A 2F6RA 4EKDA 1EX9A 2FUCA 4BO2A 3KD2A 1KGSA 1N5RA 3RFTA 3DL7A 5IDQA 2OFFA 3EDQA 3L4KA 1O96B 3ZBTA 4DBLC 4MWSA 1A27A 3GRCA 2ONYA 4Q05A 2IPMA 3VOSA 2Q5IA 2JGMA 3ELUA 4LSMA 4R3UC 5ICCA 3LHSA 3BK2A 2ZR7A 4FSHA 3F9CA 4U2FA 3HTXA 5HNKA 3EXHC 5BNZA 1YB5A 1HG1A 4EPWA 2W6NA 4NZOA 4CRWB 4EY7A 1NXVA 1W8DA 2WU4A 3GLFA 1QBGA 1GRVA 2RHJA 5JVDF 1YRLA 3IMEA 2DFNA 3WWYA 3AVVA 1BDIA 1ESNA 3TPFA 4N0MA 2QUJA 3TK1A 3S1LA 2P8JA 1DIHA 3DLAA 4QXOA 4IQ4A 1AGRA 1GNRA 5JRZA 2J5XA 5K3CA 2OFPA 3VPGA 3ANYB 1Y4AE 1PHPA 4UPVA 1IPHA 1XTSA 2ZSDA 3C3CA 2XADA 1PZGA 1VLVA 5BR4A 3DE7X 4C7VA 4X95A 4UU8A 5E1BA 2IA5A 3G5MA 3IP9A 2B6HA 4Q9KA 2VN8A 5KNDA 3QUCA 4ML3A 4XPZA 4REQA 1N8NA 1W4BA 3LDAA 2YIMA 3LZDA 1Y9DA 3UWSA 3HB0A 3PV0A 4HUQA 1J8MF 4TRMA 2PMDA 4GXQA 5DBEX 1HGXA 2Q3DA 1W73A 5EIXA 5E1OA 1XK6A 3O4RA 2W8BB 4K03A 4X8OA 2A9FA 3HKCA 2OHGA 5I4BA 5M29A 1RM4A 2QU8A 2F9MA 1EK1A 2LDXA 4H3SA 3IAM6 3K6RA 4O4LA 1XLWA 4KODA 4OBXA 3ZKWB 2VRCA 3AY0A 3W1WA 1SNYA 1WKVA 1S3SA 2D5IA 3NKFA 5K9ZA 1X1CA 1X8KA 1FP7A 4BYMA 5KOJA 1RM3A 1WX1A 4WY8A 4TWBA 3V8RA 2IS4A 2I6FA 3VGPA 4F2HA 2NPFA 3EAFA 1US8B 3TTUA 2XB2A 1E6LA 2DOKA 1C80A 1WUHS 1GRCA 2F17A 1XLUA 4FLFA 4WRRA 3FTEA 3CF6R 1Z3IX 2G1KA 2XUDA 2BBSA 3M34A 1O5IA 1Z74A 3QI2A 4M55A 1YB4A 1U2TA 3IQDB 4C88A 4DILA 2G4VA 2DUUA 2WLSA 3D3EA 1DXYA 2VJNA 5DWQA 1P61B 3BSSA 1VHLA 2C8LA 3ZCXA 1SC1A 2I9PA 4H4EA 4TMXA 4CIVA 4PZPA 3NC1C 1DRKA 2B1GA 1IOWA 2RJOA 5DP2A 1N2CB 2BBOA 2MSWA 3LOQA 3PWKA 3IUNA 1JDZA 4YMLA 16PKA 2C2WA 5FBLB 3RYHA 3H5IA 2GM3A 4WN3A 2KBEA 3LY8A 1UPCA 2EBWA 1IJFA 1FMLA 4UNQA 1SHZA 3HQ4O 3JVEA 4ITVA 2VQ3A 4LDRA 1JR3A 3HSYA 5GGXA 2BTQB 2DU8A 4I36A 5FEMA 3FG9A 1BXRA 3BJIC 3H84A 2ZUUA 4CMKA 4PNEA 1Z4JA 1P3DA 2YJZA 1K4YA 5AVSA 5IKPA 4CG1A 3U4QB 1NVVR 1EZ1A 2VQ6A 1HSZA 1RIIA 2GKSA 3IDAA 3UJ9A 3JD4A 4H6XA 1LD3A 1DCKA 5AW8A 1PTJC 1W2HA 1MU0A 4YBRA 5AKEA 1QPZA 4X1YB 3TRFA 2CHEA 3L0PA 3WLAA 2HRRA 2A0XA 1E2UA 3WQBA 1I2DA 4ZOQI 2YUIA 4NJMB 5I4KA 4ZOCA 1DX6A 1NU8A 2B34A 1X15A 2R6ZA 3IHWA 4PICA 2D4AA 1G5RA 1NVGA 2WHYA 2RGDA 4AWBA 1H4SA 3LA8A 4FIZA 4GMGA 1QIMA 5A4IS 4XB6B 3OH8A 1YZGA 2GWRA 4L3WA 5JYBA 4B47A 1QM5A 4FMDB 3VR4D 4IV5A 1J0CA 3HDQA 2J9ZB 3K0SA 1ZU5A 3H1FA 4MKHA 3OP4A 3IR6A 3HJRA 2ZSKA 3F6CA 5TQ2B 4RZHA 2ZITA 4FFVA 3BJEA 3OCXA 2ZVDA 3HBMA 4R71A 4KV7A 4ZJPA 1ESEA 2PSEA 4EUFA 2D1RA 1P2GA 1QJCA 3DBIA 1H6CA 3QUTA 2GI4A 3H1PA 4L9WA 5K8TA 3ZR4B 5HSGA 1PAUA 2NUTA 1P31A 3GFQA 3GRUA 1AKUA 1M34E 3R3VA 5IAKA 2GJ9A 4Q66C 1WXFA 5JG7A 3ZJ4A 3ORRA 4P3OA 2Y4OA 1G9XA 1KI1A 2VP5A 2WU3A 2OG2A 3C85A 3AOGA 3EXFB 4HFNA 3CUUA 5CH8A 2VKQA 1HV8A 2FEOA 2G0AA 2P90A 3FA2A 4LW8A 1AUPA 4EY8A 3EGVA 3TFWA 1P1HA 2FPPB 2HYDA 2ZPUA 4NOMA 2JI9A 1X7HA 5TMPA 4X8MA 4GPZA 3NOQA 4QUHA 2ODAA 3FPFA 3TQQA 3I58A 4MYRA 4BRSA 1CERA 4OM7A 5AVVA 2PIAA 4I66A 3JVDA 5CNKA 3EQ9A 3PLAE 5JJLA 1MZVA 1EA7A 1QHSA 2FW8A 3CKMA 2RGEA 4U1RA 5AW9A 2VF4X 4N01A 4DLRA 3K9WA 4X97A 4X8LA 5AVZA 1P73A 2IYVA 1PJCA 4MR9A 1ZGBA 2HJ9A 3QVKA 2C99A 5LYJB 5B55A 3U62A 1MENA 1NXSA 1P81A 4OB6A 3MJRA 4LYEA 3WGOA 2CVZA 4DW8A 4G5GA 1A76A 2ORED 4H7FA 4R2IA 5TVKA 4E7PA 1UZMA 4KH0A 3WRXA 3K71B 1VCIA 4DQ0A 5KWVA 3TH5A 1C9JA 5D3MA 5FTKA 3SICE 2VK1A 2OV1A 2ZSHA 3LT2A 4KIUA 3V1LA 4BUZA 4BC1A 2FUG6 1JYFA 4B75A 3WLIA 2QR2A 5IUJC 1YXMA 5AW0A 2HMAA 5KQSA 4BZZA 4DPLA 3UC9A 3W1VA 3R8CA 2NUAB 4DM3A 1E77A 5JS8A 5D2CA 3WIVA 3MWEA 1Z08A 2GEBA 4MQ5A 1CZKA 1XZDA 4UBOA 1RMQA 1V39A 2YWXA 2V55B 1NBHA 1VMAA 3H1BA 3NAZA 3OQIB 4A4DA 1KK0A 1OFHA 1PQUA 5IJ9B 1RKVA 3NBXX 4KI0A 1CB7A 4URFA 5SY6A 4KHZA 2FV8A 2UAGA 4ZDJA 4U9IS 2RH5A 4AKTA 3Q9UA 3ZNQA 1B2LA 4MO2A 2QR5A 3IPRA 4KLAA 4BKMA 2VDUE 2GJSA 3ZXSA 4FGLA 1A4UA 2CJXA 5CVCA 4DLNA 1EHCA 4NIMA 1JVSA 4QLBA 2ZJ7A 4PO8A 1IU9A 1RYFA 2BZSA 4JLAA 1C1HA 1AN0A 1W5TA 2AR0A 3B78A 2PDAA 3UH0A 1GKKA 2COKA 1Q0ZA 2E4UA 2I3DA 2ZVJA 1IN4A 2O3SA 4RORA 4BVHA 1TCCA 1IVSA 2XE8A 4IDGA 1EWRA 2Q9AA 2YV2A 2DB3A 3MB5A 3GEPA 2RIPA 2HF9A 4PV7A 2AYYA 3VR4A 3V4RA 3DEKA 4RESA 5AD1A 1UH5A 4EMSA 2ZIXA 1L4UA 3IIKA 2OESA 2FE4A 3U4GA 1TGVA 1ULSA 3FYUC 4EDHA 2W6ZA 3C6MA 2ZIFA 4IJUA 1Y4UA 3ZBUA 2D2VA 1P1FA 4FYIA 4F3NA 4C03A 1EX1A 3EOBI 1PBNA 3LP6A 3M4ZA 3A6KA 3IVCA 4FHFA 3GRVA 3W4KA 1G3QA 3H5TA 5IASA 4DYVA 2XOKD 1XP5A 1QTNA 3ECCA 4HCJA 3W7VA 1GR0A 2RB4A 2CYCA 2FOIA 1KHHA 1TC1A 4LV6A 3W34A 4C2TA 4YDQA 1VDMA 4C7XA 1N6IA 2CT8A 4WKGA 2UYCA 4INZA 2AQHA 3CY6A 4Y2UA 2G1PA 4V0SA 4TSKA 3JD3A 2O54A 1E79D 5JAZA 2R5NA 5DYYA 1R4NA 4QBKA 1Y63A 4DV5B 3GLFB 4DSZA 1KEEB 2SICE 2Z9CA 3FRHA 4Y6LA 3UK0A 1YQQA 1ZIOA 4L0QA 4RU1A 1CYEA 1BHQ1 3CUTA 1T8PA 4ZVRA 3P2KA 2G6BA 3UMBA 5KREA 4UOQA 1JVNA 1JDPA 1KY4A 4LJ7A 2QL6A 1BFKA 2Z5GA 3HZHA 2AMJA 2JRCA 4LBZA 3W1EA 4DIEA 2HGSA 4E4YA 3JALA 1BJTA 4HGPA 3REOA 3VZPA 4BZXA 5SZHB 1C0PA 3A1TA 4AQDA 4E22A 1N32B 4COKA 3ABRB 1J8DA 2NT3A 4UZFA 4ZANA 2ROQA 1O95D 3UJAA 3V5NA 2APJA 4F6CA 1JA1A 3I9NA 3PDWA 2L17A 1ODFA 3E5NA 3PNQA 1SBCA 1TQ2A 3GN2A 1WBJB 1GNSA 2J07A 3ESZA 3FHOA 1S2IA 1KZHA 4BGVA 3QE0A 3FDJA 4K6GA 1PR6A 5F9FA 4WQMA 2HUPA 3N39C 2IX3A 1RRMA 4LVUA 1KI8A 1S9DA 2CWWA 8ABPA 1P4RA 1XUOA 5K3EA 2OGSA 4BXOA 3L4SO 4INOA 3WGVA 5JI2E 4K9LA 2YWCA 3AUSA 2WSYB 1OYVA 1ZONA 1WV1A 3EIWA 4N3BA 5HDBB 1A9ZA 2A92A 1DOHA 4NJEA 4RFLA 4D8YA 4IVNA 4F5ZA 2A0YA 4A0QA 3T5CA 4TMKA 3QWAA 3CH7A 3M5DA 3KDPA 4XCXA 4P0QB 3DMRA 2W2LD 5HUQA 2Q9CA 4AX4A 4HB0A 3E18A 3GMTA 3R5HA 1VQ1A 1QH0A 4DT1B 4JVSB 3NEAA 5A2GA 4D26A 1MJHA 1GG8A 3O4HA 4ITUA 5ADHA 4PM4A 1X7WA 1QDLB 4CWAA 1IXSB 3JY6A 4DJTA 3WZ2A 2H2GA 2AFHA 2ZYHA 3EEQA 4CEIA 2B8WA 3FJYA 1YQXA 1CXZA 3KPVA 4W1QA 3AGQA 3TLEA 5C1BA 4QUKA 4LG1A 1ACMA 1UMDA 1VBNA 1WMDA 4NTZA 3ZWCA 1EUDA 4A92A 4TWIA 1YQTA 4CM8B 4IGAA 4D41A 3VC3A 5EJ4A 3NHSA 3OIYA 1FPQA 4M0MA 1UXIA 1Y8ZA 1LF0A 1NW7A 2B4YA 4DR2B 5BMVF 3EXAA 3FNBA 1RPTA 3W5AA 5DXAA 1ZM4A 3ZOKA 1HYGA 3DPUA 5KCMA 4KMOA 3E22A 2IU0A 1UMCA 4ZU1X 2QRMA 4DABA 2O0MA 3IAEA 2I5PO 5D6OA 3PDCA 3PLRA 3MSCA 1D09A 1TL7C 4J4BA 4M9XA 4OQXA 2CXQA 5JCOA 1E8NA 2CLSA 3CPJB 3WWOA 4FK8A 1APBA 4JI8B 4RVUA 3CE6A 4UD2A 2WOJA 4A0RA 4YRBA 2XZOA 1ZAYA 2Q50A 2XOKA 5K3AA 1MJGM 5FV4A 4GF5A 4Q18A 3CVOA 3BYZA 1L5QA 1QOQB 1ZD8A 2UUPA 2WT4A 1W9HA 4FHZA 1XL1A 3IIJA 3QI7A 3CW8X 4M1KA 1UWCA 1YIOA 4JDPA 3IP6A 1NDQA 1E79A 4JYBA 1B2RA 2H1IA 4HLNA 4R8MA 2P27A 3WGLA 2FSVC 2N1MA 1QIHA 3DV0A 2JEYA 1TVMA 3QVJA 1N2IA 4GC9A 4QHTA 1UANA 3SZUA 2REOA 3CO5A 3HO6A 4YMGA 4J9UE 3T0IA 3IE0A 4P4SB 3PI7A 2VXBA 4D3DA 1G7TA 1VJ5A 4BX9A 3DMTC 3IQHX 3LUGA 4OQDA 2Q1UA 4PXAA 1ZI8A 4Y67A 3PGKA 3IFSA 4JYCA 1Z4PX 3AVUA 2F4NA 1JE1A 2XAAA 4E4TA 1YVDA 3KOMA 1O95A 3X0DA 1YL6A 1NP7A 2C95A 3DMGA 4GPIB 4I4LA 1NPDA 4AUEA 4JI2B 3RBAA 3IE2A 3NW9A 2PKRA 3EFOA 4MQFA 4YB8A 5C4IA 3A7EA 4U5XA 4YI3A 5AJUA 4NBSA 3K0HA 4QUJA 5I3CA 3IHKA 4G4SP 3NM4A 1IUPA 3HVIA 1IG0A 3WISA 2WZDA 2O8DA 1KEKA 1UKBA 2B5VA 1VP3A 3D59A 3FZGA 3IULA 4LECA 1PJZA 4YV2A 2FPUA 1K5HA 1XRQA 2ZS8A 1ISMA 3PNYA 3S2EA 4POOA 4YRSA 5JH7A 4FCCA 1DPFA 4ZEOA 1IM5A 1GGEA 2H4XA 1M2OA 4RKYA 1F20A 3K0AA 4LQ4A 5THXA 1VPTA 2H0QA 3X43A 2AMLA 3HUEA 3FOWA 3JWPA 4CM4A 1ZJWA 3FJOA 4OHVA 3SMVA 3L40A 5ETJA 2Q3HA 5F9MA 2BE9A 1DP4A 2FI1A 2YXBA 3JAWA 4Q37A 4WJKB 3TLMA 3LUKA 1ZA2A 4JXXA 5EKDA 2W2LA 3WGYA 3HEAA 3K31A 1E66A 1T8WA 4KXLA 2BEUA 4D9IA 5JSUA 3R3HA 1BMQA 1ZITA 4F96A 5JPCA 4R1UA 4CFZA 4OGLA 3H86A 1XQYA 3OUUA 5IAJA 1G20B 4Q4LA 3I32A 1DJLA 1ZGZA 1FRQA 1YAHA 5EUBA 3S99A 2FY8A 4RLSA 2J41A 1OXMA 4IMIB 2ZI4A 1EKXA 1L4MA 4ZYUA 4C7MA 4WEQA 4JC5A 1WTCA 4MDYA 5JO9A 1FOEB 1ZNYA 3E8XA 3I5UA 1Q3HA 1IH8A 3ID6C 4IQ8A 3BILA 4YCDA 5HMMA 4Q3BA 2OHFA 2I2AA 3K0FB 3RF6A 4A8TA 3MBKA 4RLFA 2IYYA 2Y77A 4GKBA 4RTNA 4V03A 3KCNA 1GZSA 4JLBA 4V2UA 4EJ6A 1A9RA 4EZBA 5BQ3A 5M3BA 2FPOA 4R1QA 2H2WA 1T8RA 5DYNA 2OZEA 2JGFA 1BFDA 5TMBA 5DNWA 1YHYA 1EIZA 3HP1A 3BCUA 4GRIA 1NNI1 4GI3A 5KSOA 4JP1A 2BBWA 1SA0B 3OPVA 1M7BA 4DCJA 3RO7A 5BOSB 2O07A 4FCTA 4IUBS 2HBQA 4U6SA 3L8MA 4HYEA 3GP5A 7YASA 3FVWA 3ESCA 4OU4A 1ENZA 3DT8A 2FSIA 3NWPA 1N8KA 5CX1A 2JFQA 4I2NA 1FMJA 1PSZA 4E32A 5DBIA 2PR7A 3SLGA 1PG5A 3TD9A 2XT9A 2V03A 5EVCA 2HIGA 4OXIA 1MHPA 3IEIA 4DXHA 2PYIA 2P77A 3GGDA 2ZYUX 1E9CA 5E4FA 4ZRMA 3WKCA 1P19A 3KJFA 5CA0B 3G2LA 1QBKC 2B25A 4JJKA 4YT5A 2DFLA 4MP3A 5FULA 2EJWA 3U49A 2QF7A 3PDIA 4EY5A 5JZSA 1XZQA 3L04A 5CGZA 5D3ZA 3DP7A 5AWFC 1O54A 1Y5RA 1Z7YA 4G5HA 4QBFA 4RCVA 5L45A 2O5CA 2XEDA 4J16C 4FR2A 4KMMA 1QE5A 2GA8A 3IPXA 3T15A 4TTQA 3BQMB 1ZJJA 3IXQA 4FDMA 4W5TA 1IBCA 1G8KA 2DTEA 4Q7QA 2QE6A 5K0JA 3PYXA 1ZIPA 3L3BA 1ND5A 1G64A 1P91A 1L7RA 3BDAA 4JI1B 4Z7JA 1JWAB 4AYXA 3B85A 1L9XA 4C2AA 5L6LB 2H4YA 3DPIA 3H3XA 3GNSA 4LXGA 5FI1B 4N1AA 1WU7A 2GESA 3KKLA 1PFGA 2DWCA 4QPNA 3UM9A 4HKTA 3TRDA 3DGEC 1PYOA 2XLBA 1IEXA 2H2HA 3M49A 4A10A 4DNPA 1X74A 6ADHA 2EFDB 2OXCA 2X8JA 4M9ZA 4N7JA 3FUCA 1PJTA 2R7NA 2BPOA 3OA0A 3DE4X 5B57C 1FQOA 2GH1A 4G63A 5KTTA 3RS9A 2AX4A 5SZKB 3ZVKA 4ZK6A 4YUYA 5KC9A 1TYCA 4UEWA 1JPJA 2VHUA 4G4SO 4BQQA 3W5SA 4UZEA 2A86A 4W7HA 4M22A 5CYGA 1XXLA 7ABPA 2R7AA 4GZ5A 5KUTA 1EE2A 2X1HA 2X23A 3PQ8A 5LQJA 1DOZA 3BSWA 1OE0A 2B5WA 1ZOIA 2YBDA 3R6LA 2ZYAA 5HX7A 5JAHA 2IYLD 4MAFA 1CUZA 1WCIA 2QZ4A 2AX3A 1DIGA 2XMPA 3DT9A 3O8QB 4NDNE 2VK8A 4B3BA 4KKXB 3F3KA 3GP8A 3O1HB 3E15A 3MOSA 2PVSA 4EYQA 3SYRA 2BHLA 1G6OA 4QNRA 1BKYA 3U48A 3QKIA 4JBWA 1SU6A 4BO1A 4IDOA 2JFFA 4R1MA 1D0IA 3VHLB 3V8QA 4FN4A 1FC0A 2JBHA 2IEIA 5I7UA 3FKJA 4BQFA 1GCUA 1JDBB 4OB8A 2A5FA 3MTBA 1LXCA 2EFEB 2GN4A 4QO7A 4QTZA 4UUNA 4WKBA 4Y1RB 1DWQA 3TL6A 2WTAA 4ZTZB 1IAQA 4UDXX 2Q0SA 2GGSA 3HCAA 4RMGA 5LUAA 2P6MA 1H1LA 3L4BC 4XA8A 1E6CA 1F8YA 3L8YA 2XCUA 3IUEA 4GQBA 2YS7A 2CFCA 4C0AC 2HQ1A 2WE8A 4AJJA 3GUHA 4HEQA 3EVEA 4EHLA 3R20A 3QPCA 4XGNA 4AP5A 4R9UC 3FAKA 1EYZA 4JB8A 4DDTA 1VG9B 5BV7A 2BMVA 2GRJA 4M98A 5FWYA 1VIMA 4PQGA 3TE7A 1VJ0A 1XIVA 3Q5GA 1Q0RA 3R6WA 3Q0TA 5JJBA 4L0MA 2W58A 2XMGA 3AXSA 1D1QA 4XM0A 3NP9A 4YAOA 3UJPA 1RCFA 3TMAA 3NTQA 2PMWB 3IP3A 3IELA 3DE5X 4K81B 1PNTA 3I28A 1KXJA 3ZZUA 5LKAA 3EPHA 1JHMA 2VPTA 3Q8WA 1BFUA 1RE1A 2I1VB 3FLBA 4LRWA 3GQBB 4ZVOA 1FJGB 2G7ZA 1SAYA 4CG2A 1EWVA 4HQFA 4YRGA 3IEVA 1E2DA 1NATA 4XGQA 5HTOA 4ZC1A 3L0IB 2EFYA 4J0KA 3VOTA 1CQZA 1RJDA 3HVJA 4EVIA 2H06A 2B4AA 3EUFA 1TRKA 5BQFA 3IUPA 3ELBA 2V8BA 3PL1A 2ZT6A 4MUFA 2PKQP 4JVOA 3E58A 5DVZA 5H4GA 2FSUA 1CUSA 1X39A 4QOJA 1UQRA 2IEAA 1C8LA 1M66A 3GJ0A 3QKRA 4GNKA 2GPJA 1FQJA 2V59A 3A9VA 3NP7A 4LC1A 5DBGA 5BY2A 1RQ2A 1KYQA 2QPTA 1KVSA 3A3KA 4FOOA 1QVAA 2AN4A 4OAOA 4WCVA 1W5EA 3QHAA 5DULA 1TX4B 3RIYA 5I7VA 3KUDA 2EIXA 4S04A 3B60A 2WTNA 4CLRB 2O8CA 2FMTA 3DQZA 2Y99A 2UZ1A 2ZI6A 4D3YA 1ZH4A 4GMHA 1JHZA 4LVOA 5AHRA 2GZ3A 1WETA 1Y6FA 5BO5A 9GPBA 1Z07A 1W4LA 5AXAA 1QR2A 3SZLA 4D45A 4CR8A 1HFKA 4FYWA 3WGUA 4D4MA 3AHIA 3O92A 1SBIA 3L7LA 4QXPA 1IBLB 2FFHA 1H4VB 3KQTA 4L8WB 4G0WA 2Q5LA 2FEXA 5HIJA 1YE3A 2VHTA 4IX1A 3MBOA 4XVHA 2IL1A 1MXHA 2H29A 2H0RA 3E7FA 4H7HA 3FUXA 3BWDD 4IEEA 3I37X 1ZCJA 3JAMA 2Q0XA 4DUYB 3KSUA 5JZ9A 1OFUX 1TU3A 4TYWA 1IOZA 1RC1A 3L79A 3KXIA 4A5OA 5HQTA 2IITA 3T9AA 1Y1TA 2H9IA 3QPVA 5AMXA 5KYVA 1G5HA 4ARUA 1U90A 1WIWA 5JYCA 5BW8A 2J9FB 3VZBA 2UYQA 4FHDA 4J94A 3TNYA 5J23A 1E5XA 4AKIA 4XE5A 1FTWA 1GVNB 1VI6A 2P75A 2VJAA 3AFOA 2HWWA 1FS6A 1HZZA 1O8BA 1PEDA 2JFGA 3K1JA 5FI3A 1R2QA 1QRRA 1Y1SA 2NZWA 2WVJA 1VIDA 4Q9JA 5LZ5A 2G40A 3UAXA 1PKEA 2BGIA 3JWIA 4R4JA 5CB4F 4XWWA 4CMJA 1O9HA 2NLOA 2QDXA 3USES 5HZMA 4HWRA 1R5BA 1I2MA 4BNYA 4E2FA 1BC5A 3KT0A 3ZK9A 2IEZA 5TT0A 3VHRA 3WBKA 4KEAA 3EDRA 1NSFA 3R3SA 2QTBA 3A32A 3N28A 4LMPA 5AK4A 5C4MA 1EDDA 1KOJA 3NDPA 2XECA 3P8ZA 1X87A 5KTKA 4JUBA 2FMKA 1L8OA 3FD8A 3MILA 3RTDA 1W49A 2PZEA 4ZEXA 5KWEA 1Z63A 3IAFA 3SM3A 4J0DA 4RNDB 3CVVA 2EZUA 4PS1A 1B73A 2XZPA 1MN6A 1NC1A 1I7LA 3GVHA 4I55A 4Q3EA 5F12A 2P5SA 4RMJA 1OGYA 1W93A 2VK4A 4UULA 1YZQA 1YQDA 1PT5A 2QBYA 1P5JA 1DJPA 1DUIA 3EEYA 3G85A 2CVHA 3PD1A 3QK7A 3SN6A 2HK8A 4E2YA 2VT3A 2RCNA 2DSTA 3EARA 3PX3A 3ZPXA 1KDVA 1GA1A 4J90A 3TKAA 4N0DA 2CE7A 2HJGA 4PLYA 1U9ZA 2F1RA 3WL3A 1RABA 2JDID 3G9QA 1L4FA 2I8CA 2VFAA 2P1RA 1SHTX 2XGMA 3DG9A 3HH8A 3LBFA 4GYWA 4NATA 3PEYA 5EJ7A 2P6OA 4BVGA 1CP2A 1IMJA 2QYSA 3X1XA 3BE4A 3G49A 4IINA 2GPYA 4CLXA 3IQZA 5DYGA 2RE8A 4RCYA 5B4TA 4OG2A 2HX1A 5E3HA 2PLAA 1JFFB 1DPGA 2V7WA 1CUAA 2QVXX 2PUHA 2V45A 2WWGA 4MTLA 4YJ3A 3FOCA 4YLEA 3ROPA 4PO1A 1U4NA 2X6TA 3ROTA 2I3AA 3MLEA 4HNGA 2JJYA 4QOSA 3O84A 4V3CA 3TLJA 5MFZA 1IHOA 3S2IA 2XDQB 4IIFA 1KMIY 4RYDA 1XTRA 2ORIA 2O8EA 2QTVA 5B36A 2QG9A 3IAHA 2J0SA 4L16A 4JEUA 1IQ0A 5FNVF 2GEDA 3F2IA 4QHYA 1QGOA 2FGKA 2OCDA 3MW8A 4HNRA 2OLEA 2P2NA 1YBMA 5CDFE 4D7AA 1WSDA 1YB1A 4BMXA 2WJ3A 1NVUQ 2GYUA 2PXHA 1MJ5A 1SBNE 3LH5A 1NKSA 1FFBA 3IEKA 3MJTA 4PO9A 1T2UA 1WVGA 3TGLA 4LXQA 2VQFB 4HI0E 1Y1PA 1NNEA 1TUBA 3B6JA 3JXEA 2XXBA 2BHRA 4FUQA 4I5FA 2NTYC 5EI5A 1R0KA 5K0GA 1A88A 2BRUC 1SUSA 2ZT8A 1I4OA 4CT5A 3AR9A 2EKLA 5K99A 5C52B 3E9NA 1MOSA 4BKQA 4R7TA 2NUPB 4NMMA 2ZS9A 3GFBA 4FYMA 4PIPA 4XQCA 4Z1MD 1PL7A 1SOMA 3ER6A 5DW3A 3SHWA 1ELOA 2K7FA 1LZLA 1R6VA 2R5FA 3QPUA 3A58B 2HRZA 1BS1A 1CRWG 1RLJA 4I4NA 4IVPA 3QTLA 4J1QA 5DGTA 1YVEI 4BIIA 2YQZA 1P0PA 4AZTA 5ES4B 1MUUA 2FCRA 2PFSA 2D54A 2Q5QA 4U00A 1K0FA 3D3NA 2OGWA 4GVXA 3T1YB 3Q41A 5DRYA 3JQAD 1SC6A 3I30X 3WK8A 1W2WB 1NVBA 5C81A 1KZ1A 5EJ8A 1NZFA 3HN6A 1CEEA 3A2NA 5LXTB 1CUVA 4B6JA 3ADOA 1YR7A 3BMOA 5IBCA 5JXGA 2D1FA 1ZGHA 4WZAB 4PEVA 2N46A 4L4ZA 4XSVA 1YQGA 2DCMA 3TRIA 5BSHA 4HWGA 2ZXUA 3D2CA 2D59A 1ATZA 1PJBA 2IYPA 1JHXA 1P18A 2XD9A 3K15A 1JAXA 3F6PA 3KEGA 4MP8A 1NONA 2JFWA 2ZLBA 1CZLA 4NPHA 5IVDA 1E6UA 4ADSG 2QX4A 5C8VA 3HADA 1MQ9A 5FLYA 2JDIA 3I9FA 4UCWA 4WKPA 2WJZB 1NN5A 2QQGA 3F47A 3LUAA 3N7AA 4PTLA 2PJDA 4QWMA 5SY4A 2GXQA 4XUEA 5CA1B 5LDHA 4I4TA 3MHTA 5JJKA 4QRDA 4ZAVA 4DDVA 5KU1A 4LA4A 1GM5A 3SQXA 4NEGA 1TLFA 4BFZA 2WD9A 4KTTE 3DZKA 4ZCRA 2OZPA 5C35A 1K88A 2JIZD 3LL4A 2V54A 2YTZA 3W5BA 1VHTA 2W2KB 2J6IA 3OPMA 3MOIA 1U9IA 3G8CA 4I8IA 5KQMA 3MUFA 3OFSA 2F00A 5EKUA 4BDTA 2DZDA 1WXXA 3BXFA 4FDAA 1H69A 3DCYA 5IAEA 1DQZA 3HYLA 4J1TC 4D6YA 5BORA 3VJLA 2FWAA 3TUZC 1C0KA 5AQEA 1XYGA 1U0RA 1CS0B 4MYTA 3X2FA 1CFZA 4M89A 4MQEB 3MWKA 4TWRA 2IODA 3EVCA 2X22A 2Y71A 3LCJA 4GR9A 3GELA 4MVJP 4PGAA 1LPBB 3RANA 4GOLD 4MRMB 1L5RA 1VMDA 1RYNA 4D4GA 4A2PA 4QGGA 1YI0A 2CHFA 3LDUA 3OIDA 2ZE6A 1U11A 2CLMB 2YDXA 5FA8A 2XY4A 4NARA 4KNWA 4KKVA 4MWZA 2IIQA 1LBIA 3RC9A 3GZTB 4JH0A 2P2YA 2TMDA 3HG7A 2YNMC 1PYDA 2PH3A 3KQSA 1H22A 3PYLA 3FWNA 2GBCA 4LNHA 4KO4S 4LHSA 3VMFA 1GILA 2DWPA 3NMUF 4AQYB 1U0BB 1JEOA 1UXHA 3BB3A 3WXBA 2CVQA 1SXQA 3I2HA 3OZUA 2AJTA 2CGEA 3FWZA 4R2MA 4RXTA 3FPAA 3H4MA 1ZUIA 4I6GA 4NLLA 4B5LA 1OLXA 1O6ZA 1WO8A 4V1CA 1XNRB 1OXSC 5LMCA 3MJVA 3DNMA 1YIAA 5C7IO 3SLKA 3GEGA 3F74A 2X3FA 5J58A 2J3IA 2R4QA 2PUGA 4ENRA 2P2LA 3ZVMA 5A1TA 2ILVA 3HA2A 4ISCA 1E32A 4R1TA 4ZI5A 2OPHA 1T2VA 4ETWA 1B8OA 5DTIA 1ZRNA 1OBOA 4BQNA 1G2OA 621PA 1PS0A 3RVBA 2C7OA 1LDMA 1RI3A 3GIWA 1PJAA 3D8NA 3GPIA 3INYA 3N7TA 1FVFA 2GQ0A 4QATA 1BD3A 1WULS 4KAXA 2QL9A 5JU6A 2GNAA 2C7VA 2XODA 1VL2A 2JGKA 1NT4A 3A04A 4RD3A 5LD2C 4WFKA 1CV2A 1F0NA 4P3YA 4G86A 3TQOA 1IIBA 5HIAA 5FFFA 5JMTA 4CN9A 1NJ8A 3BRWD 4O2AA 3SSMA 2IZ1A 1RRFA 1JEYA 2QRVA 4MKFA 1AH2A 2ZZNA 4BLRA 1DC5A 1U3UA 3BL5A 2A58A 5JBQA 2RHDA 4AJOA 4F3TA 3EFHA 2NU8A 4HUJA 4PQRA 1YQWA 2BGRA 4RVGA 4D6XA 2BFPA 2TS1A 4E2ZA 2R6JA 5IJAA 1KKLA 1M0SA 1GZ6A 1HE4A 3UW1A 2IXBA 4NRDA 5JCPA 3CX3A 3C41J 1U02A 5GTDA 4CKBA 3K8OE 3HRHA 3AW9A 5DCYA 3OO1A 2VC2B 4XYBA 4KUEA 5B58T 3RJ9A 5KJ1A 1M0EA 1EX7A 1QUFA 3GIDA 2MSDB 1W85A 1H1DA 1EVKA 5ITZA 1N2SA 4JNKA 4MGEA 2JI6A 1JLMA 3M3DA 3E81A 4D44A 4M0EA 2JIZA 1QG0A 2B8JA 2Y8EA 4HUQB 4R6XA 5FFNA 5IU6A 3K7EA 2WU0A 1HNNA 3NQ41 3DLCA 2JPDA 1DRWA 1KIFA 1WKCA 4BP9A 2ZIWB 3OLZA 4Q7KA 3E70C 3HKCB 4Z2YA 3T1HB 4GICA 4RKRA 3FY4A 2NZVG 4G4JA 1DZIA 2JFPA 4O4LB