4UNRA

Mtb tmk in complex with compound 23
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
209
structure length
186
Chain Sequence
b'MLIAIEGVDGAGKRTLVEKLSGAFRAAGRSVATLAFPRYGQSVAADIAAEALHGEHGDLASSVYAMATLFALDRAGAVHTIQGLCRGYDVVILDRYVASNAAYSAARLHENAAGKAAAWVQRIEFARLGLPKPDWQVLLAVSAEDAELQQRTGAVYAELAAQGWGGRWLVVGADVDPGRLAATLAP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THYMIDYLATE KINASE
molecule tags Transferase
source organism Mycobacterium tuberculosis
publication title Structure Guided Lead Generation for M. Tuberculosis Thymidylate Kinase (Mtb Tmk): Discovery of 3-Cyanopyridone and 1,6-Naphthyridin-2-One as Potent Inhibitors.
pubmed doi rcsb
total genus 70
structure length 186
sequence length 209
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2014-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4unrA00
1ZM9A 4JLMA 1FMJA 4AK9A 4OI2A 2HT6A 1E96A 2G88A 2C2HA 2RGNA 2GVZC 4W5WA 1R5OA 4PHFA 1SKQA 1IXRC 1A2KC 1FZQA 5C18A 1ZM4A 2GHIA 5KUTA 3QKRA 1IJEA 2ZRLA 4MQBA 3HPQA 3ASZA 2RGCA 3QPWA 5DH9A 2CVHA 3A36A 3O8BA 3TR5A 4PC3A 1KKLA 5CB8A 1OB2A 3X1WA 2XX3A 5B57C 1KMHA 2OEPA 1US8B 1E69A 5L3SA 2ZJBA 2ZE5A 2QMUA 3BB4A 1SHZA 4GZMA 4XSGA 1ZC3A 1KDPA 1Z6AA 2ZJ5A 4CYMA 4AYWA 2XZPA 1I4LD 4OQXA 3PUWA 2FPLA 1NF3A 4RCZA 3ZQJA 4F4IA 1PV4A 1JR6A 2ZYVX 5DHFA 3PENA 5SZKB 1AZTA 3QPVA 4ZCMA 1JQLB 2ZS9A 1G8PA 2IYLD 4V03A 1ZM3A 2PBRA 4B48A 1A82A 1SXJA 3AGQA 4M1TA 1SZPA 3K09A 3UWKA 4A2WA 3AKYA 5IK2A 1OIXA 3VKGA 3TRFA 3SNHA 3U3OA 4YXWA 3KXIA 1E79A 2VP6A 4HLCA 4Q21A 5EXPA 1GZSA 2E9SA 2OESA 2ZSAA 4A8JB 1UKVY 4MYUA 4NONA 4PAOA 3QIAA 1P4SA 1YRAA 4ZV4A 1QHNA 2BWJA 5FBWB 2IWRA 3SHFA 1LY1A 2JIZA 2LCFA 3KKOA 3WY9A 2IYSA 3LBIA 3FHCB 2IX3A 5AUNB 5EE5B 4CVNA 1K5DA 3CRW1 3TW4A 4Q1EA 5G3YA 4MYTA 5BW8A 3A4LA 1ZD8A 4O3MA 3VHXA 4JVMA 2DBYA 2F3TA 4B3BA 4NYJQ 1P5ZB 5BWMA 3K9GA 2V6JA 4HAXA 4PQFA 4NHOA 2D2FA 2C78A 4A36A 3C5HA 1GNRA 1W5TA 1MO3A 1DG1G 2JJ2A 3A1SA 3QVUA 5KPJA 1XZPA 2BCJQ 3GP8A 1VDZA 3FGNA 1CEEA 4G5QA 1QG4A 2QROA 4LV6A 1Z83A 4JKIA 1IHUA 2G9NA 3TVTA 2GESA 2CL7X 4KITB 1I4DD 1DTSA 4Y0VA 1FW6A 3WP0A 1U81A 2W6IA 1HE8B 1JQJC 4IEIA 3OE7A 1OH5A 1XP8A 2J0UB 3B1VA 5LD2C 5CM9C 4BFUA 4DDUA 1KO4A 3EA5A 4TTRA 4WBSA 2WZQA 4C7OB 2HCJB 2QU8A 4BLOA 3AVYA 3U6KA 4M8NE 4TMZA 1GOTA 3RC3A 2FOLA 3B60A 2J87A 1OFUX 2ZITA 4RVCA 1SULA 3O8CA 5F9HA 1W4RA 4RZ3A 3WMGA 4AKGA 1FTSA 4YLGA 3MUFA 1N6KA 4XTCS 4A2QA 4FD2A 3FFBA 4JLOA 4LCBA 2ZRGA 1CLUA 2Q9BA 4ZKEA 4U5XA 1AA9A 2ZIAA 5F98A 5B30A 2QT0A 3QXSA 2YJTD 4ILEA 3DPUA 5JECA 3K0CC 3PCRB 4G1UC 2ZRBA 5EUMA 3SYKA 3B1WA 2ZSBA 2Z4SA 4Q7JB 2I1QA 4TL8A 4I1OA 4AC9A 3U7EB 4NYMR 2RKOA 5JEDA 1GM5A 4MDEA 4CEJA 2Z4RA 3LD9A 4Q18A 2OCAA 1KK0A 3A1VA 2ZU0C 4XSHA 1U8ZA 1XEFA 2J7KA 2AFHE 1OSNA 2WKQA 3VR3A 4HUTA 4IVQA 3BORA 5E7MA 4KAXA 3F5FA 3ZD6A 2ODNA 1KKMA 2GWHA 1U94A 1E1RA 1VCOA 3GEIA 2NZJA 4GP7A 1M7GA 2G1KA 1C1YA 4OHZA 2XTNA 1F2TB 2VHTA 1SHKA 1XTQA 3ADDA 1Q1QA 2LWIA 421PA 4IDQA 3RDPA 3HWSA 1KO8A 4P32A 4G5SA 3S1AB 4A0RA 3B13B 2KBEA 3VR2A 2IXGA 4NTZA 4P0TA 4W7SA 4A1FA 2VSXA 3I32A 3GJ8A 1OJLA 4IRUB 4CEJB 3U61B 2WWXA 2RGEA 2WWWA 3RLFA 4C2TA 4PHGA 4G5OA 1X6VA 2OM2A 5BYKA 5LB4A 4DLSA 4UNQA 3D3QA 2VRWA 1TNDA 6Q21A 2EVWX 1OFTA 5J47A 3LO5A 4PHTA 1P60A 5EXTA 4EQ6A 2QMEA 1LV7A 2C03A 1S1CA 4LHWA 1CJMA 1AS2A 1GSIA 2QN6A 1DO2A 3D6TB 1VG8A 1OFIA 3EZ2A 4I1SA 4DDVA 2OBNA 1FMLA 3TQFA 1MT0A 2OV2A 5E3HA 3DMDA 1Q3HA 5FI1B 3Q7QA 4PO8A 3B2EA 4C0AC 1R5NA 3PR1A 1W4CA 4E03A 3BXZA 5F3WB 3AF4A 3VHLB 1XPRA 1J90A 1RE0A 1VYUA 1G64A 1GAJA 3EC2A 1AKEA 4C0KA 2V8OA 3U3MA 1ZUIA 5LBIA 1NL3A 1Z07A 1CU1A 2OFXA 4GZLA 2JA1A 4M1SA 5KU1A 3Q5DA 1CXZA 4JVLA 4XD7A 1NI3A 4LHXA 2BIFA 4AKIA 3FKSD 4JS0A 3DVLA 2DR3A 2V1XA 2ZRAA 3TR0A 4BASA 1A2BA 2BBSA 4C0JA 4WVFA 1TTTA 4KYUA 4RD1A 2CXXA 4TTQA 3I3SR 2L0XA 2PX0A 1R0ZA 3FOZA 4R2HA 2ZRHA 4RSGA 4D4MA 1IY1A 1ZD1A 2A2ZA 4HAUA 4KODA 2OBLA 1R7RA 4TMWA 4V0NA 3NIBA 2W2TA 3DKPA 4V0MA 1JAIA 1TPZA 3RRZA 1KI6A 4FI3C 4Q48A 4NYIQ 2ODEA 2ZM5A 2PZGA 1Q57A 2BJWA 3OEHA 5EP1A 2R6AA 1GITA 2V6IA 1DO0A 4PC6A 1D6JA 2PCJA 3DO6A 1BIFA 4NE2A 2GCOB 2WMNB 4TYQA 2PJRA 3T06B 1XCMA 2F9LA 1XCGB 2P67A 1X1RA 2ZE7A 2CCGA 5C1BA 2P65A 4DC9A 1KJYA 3U6BA 2KB0A 2WJYA 2OO7A 1XXHB 4HAVA 2B7BA 1S3GA 4RD6A 4GNKA 4LJYA 1JB1A 4DCTA 2NIPA 3ASYA 3AV0B 3AVPA 3FMPB 4B34A 1JPNA 1YR6A 4HDCA 1G3UA 2DFLA 2ZPTX 4TLBA 2RCNA 2ZYWX 1YZUA 2GF0A 2IA5A 3GJXC 1E9BA 5FOVA 2PEYA 3IIKA 3I1FA 5B2ZA 3R9WA 3D8BA 2CE2X 2IYXA 1DAHA 5FPSA 5FOWA 4NBSA 4TQUS 5AJVB 4QBFA 4ZI3A 5K8LA 1E99A 3OF5A 1D2NA 3NDBB 4AURA 5EP3A 2C98A 3UANA 1E9EA 5JZVA 1ZNYA 4Q1FA 2R65A 4Q7MB 3NBYC 2GCNA 1II0A 1ZCBA 1W0JD 2ZJ2A 3NHBA 4L8GA 1KMHB 2ZVPX 4HLUA 1W47A 5JCPA 4LJ9A 2R62A 2VP5A 2QMHA 2DHRA 3SFVA 1SVMA 3HYRA 4UNRA 5IRCD 4KJZA 4CDGA 4LJ8A 1VCMA 3QKRB 2GK6A 1E32A 2ORIA 2QQ0A 3ZJYA 3K0EA 3H84A 2H7VA 1AGPA 3WMEA 2G1JA 5G53C 1Z2AA 3Q9LA 1J70A 1R0WA 3QXHA 2ZRPA 3FMIA 2F1IA 3PUYA 4C0BA 3N70A 1DAEA 5CDFE 4DLWA 1EX7A 3AGPA 4JMPA 3WP1B 4UXJA 1NNEA 3RRNA 1S2MA 1E1QA 3K70C 1XTRA 4GFDA 3DZDA 1T5LA 5JHHB 1TMKA 4YQFA 4LPKA 1G17A 1XMSA 1NRJB 2AXPA 3K09C 1CKEA 1LVGA 2VBCA 2ZR7A 3PUXA 3OIWA 2JIZD 2E87A 4C3ZA 1NN1A 2QPAA 2A5YB 1Z6TA 3FE2A 2ZUCA 4MKHA 1DADA 2O8CA 1P61B 1X8JA 2FEOA 2GCPA 1C4OA 1UM8A 2AL7A 2YWEA 3HR8A 4AD8A 3QOFA 1FX0A 4I1UA 1RYHA 2NTYC 2ZUBA 1E4VA 1G8YA 2FV8A 3RRYA 2JLZA 221PA 5HCNA 1QZXA 2NPFA 1SXJD 1EGAA 2GXAA 1KK3A 1SVIA 2IW3A 4US1R 3ND9A 3RYTC 2ZI3A 5FUXA 3RHFA 1OB5A 1QDEA 1P7CA 1RZ3A 2NO0A 3U44B 3WRYC 4M1WA 2P5TB 4Q4JA 4QNRA 3TSOA 5CYPA 3EAQA 3MWJA 1G21E 3QBTA 2QTHA 3IEVA 3BC1A 3GLHA 4PC7A 1P2UA 3R8FA 1Q0UA 2C77A 2Q3MA 1TEVA 1NBMD 3EZ6A 1G4UR 2AD1A 3JZAA 2A3RA 2PL3A 1ZP6A 3QKSA 1CR0A 4TQAA 4B76A 3NVAA 3EW9A 3RS2A 4LHVA 4B32A 1G7SA 5FL7D 3LX8A 5DNYB 5F9FA 2F55A 1T3LA 1YQTA 2R8RA 4PZLA 1COWA 1XEXB 1ZUHA 1GL7A 1NVWQ 1WF3A 2EWVA 2J46A 2J7PA 4ZCLA 3T1OA 3MRSA 1QVRA 1KSJA 2ONJA 3PXGA 4D81A 4ARZB 2IUTA 4DVGA 5TMPA 1FUKA 4LJ5A 3CR7A 4FMCB 2QG6A 3EPKA 2GEUA 1I4TD 1P2VA 3B85A 2J0SA 5J4VA 5DI3B 1H8HD 2IYRA 4QL3A 1LS1A 1WXQA 1M1YE 1UJ2A 3ZIAD 5IHPA 3HR7A 5FBVB 2IXEA 1SVWA 3U3KA 2HYIC 4BFWA 2XTMA 3NBZC 2FG5A 2HLDD 2N42A 2WPDA 1ZC4A 2IEYA 2NZ8A 3KB2A 4LJ7A 3QEJA 4ESHA 4ZCIA 3AB3A 2YHSA 1KI8A 1NY6A 1XEXA 3CRQA 3CZQA 3LA6A 2ZQ5A 2V4ZA 2SHKA 1EFRA 1RIFA 3PVSA 2GJ8A 1OHHD 4LSGA 2FSGA 4EFMA 4M9XA 4Q4LA 1XTIA 3H2YA 3K0AA 1QVAA 3JVUA 3B1ZA 1K5GA 5P21A 4U7DA 1CBUA 1QHSA 5C46F 1TQ2A 1NLYA 3BH7A 4A15A 4QHTA 4ZIRA 3FYHA 4D0GA 5EZ5A 4MH0R 2GXQA 3BFXA 1Q1BA 1SXJC 2WKPA 4HAYA 2QGNA 1NVVR 4B3CA 4IDNA 1ZNXA 5DHAA 2GRJA 1CJVC 4LYJA 3KJGA 2ZRCA 1J8YF 3R7WB 4Q4HA 1FQJA 4V0KA 3MSXA 2C04A 2GVDC 3IHLA 1NBME 1KSHA 4Z8XA 3KKPA 2BKUA 5GJVC 4Z51A 1QHXA 3BOSA 4QJ4A 2W58A 4NP6A 1OV4A 1CS4C 3MJRA 4RZXA 5AUQA 1H8ED 4MGYR 4FWTA 3ECCA 2OT3B 4O2LA 4FMCF 2IHBA 2J0UA 2ZRIA 4X8OA 4MRSA 5FL3A 1JAHA 1X8KA 5D3MA 1NLFA 1Q3TA 2J5XA 4CEIA 4ON9A 2IBMA 3B82A 4KV9A 1QHIA 3H86A 3THYA 2CL6X 1N25A 4E22A 3PEYA 1WP9A 1BKDR 1E2DA 2WV9A 3KKNA 4UNSA 3A1WA 2VF7A 3IQXA 1UFQA 1TQ6A 1TQDA 2XNDA 3QKTA 3I5XA 2EFEB 1Q12A 1A5TA 1EK0A 3X1YA 1T4GA 3CIOA 1DBSA 4NPHA 2RH5A 3BH0A 1R10A 3K0FA 4DCSA 4L9SA 5FUYA 4CZ2A 5H8WA 1HQCA 4ZDJA 4CEHB 1SKYE 4IHQA 5FPHA 1PLKA 3G5UA 4PAMA 2YKGA 1R6BX 1BMFA 5G40A 3C15C 3GMTA 5TDHA 4BZQA 1O87A 1SVKA 3GLIB 2GAAA 4G0NA 1KK1A 1E98A 4OQLA 1BH2A 5AK0A 5KNCA 4K81B 4FIDA 4A0FA 4DSTA 3WBKA 3SC3A 3N5CA 1FNMA 1ZRHA 3HPRA 4F92B 2C5LA 1X3SA 2VHCA 2O8BA 2HDNB 2NPIA 1RW4A 1UKEA 5CLLA 5AJWA 1U9IC 1ZIPA 2NMVA 1R5BA 1II9A 3A1TA 3W5JA 1G7CA 4GDFA 1TF2A 5EE0A 1KGDA 2OLJA 4G01B 3VFDA 4AY2A 5AWFC 5HR5A 3GLGA 3E1SA 4D25A 2FMXA 2ZJOA 4ZPXA 3G82C 4IOMA 3Q5EA 1N6LA 1N5KA 1N6PA 5KDOA 1KTVA 1XDBA 2QPOA 1UADA 3K53A 3W34A 1CULC 1XU4A 4IOKA 4AKEA 1YHNA 3C14C 4KFSA 3SFZA 2ZI7A 1DAFA 2O8BB 2ZAOA 1QG2A 1QHGA 3CWQA 3LRPA 4F4CA 4L9WA 4ABYA 4EFNA 3PITA 3BAFA 1E2HA 2JGNA 1FPMA 4DB4A 2ANBA 1N0UA 3KB1A 2WM9B 1TADA 2WHXA 3A8TA 1NKTA 521PA 1P72A 3J81k 4RY2A 1IONA 3PUZA 2WAYA 4DJTA 1Z08A 3LFUA 2QTVB 4KO8A 2KJQA 2X2EA 1XJQA 1BYUA 4D4LA 1XEWY 1LF5A 2FZ4A 3SBEA 1M7HA 5FTLA 1RC8A 1U0LA 1XNJA 4OQMA 4QG7A 3SN6A 1XF9A 4PTLA 2QZ4A 4W5JA 3W90A 1AQYA 2O52A 4X8HA 3I4LA 2Z5FA 3GLFE 4PO1A 1RKBA 1GIAA 1HV8A 2PZFA 4JLPA 4UXIA 2FZLA 1MO4A 4IVRA 4JZKA 1E2EA 1VG9B 2F3RA 5JI2E 2BMFA 4E5UA 2D7DA 1G8HA 1JEEA 1GTVA 2CMKA 2RGAA 4QBGB 3U3JA 1CRPA 2FNAA 3B1XA 4EJSC 1YKSA 1Z0DA 4Q02A 1DARA 5LB2A 4TMVA 2FGKA 4US2R 5BN5A 4PAQA 1TX4B 4ZDKA 4MRNA 5FBQB 1VYVA 5B64A 3FVQA 5IF9A 1U98A 1XPUA 4AKHA 2FSFA 5BYJA 5FH9A 1NSTA 2D74A 3W6PA 1N6NA 2FU5C 2YOHA 1U9IA 1GKIA 1PLLA 5EQTA 2OCPA 3SOPA 1VKJA 4O25A 3ZVRA 3TUZC 2GTPA 4PC1A 4IDPA 2WWHA 3TJZA 3WMFA 5GADl 2ZI5A 5DYGA 5JWOA 1T0JB 2RGNC 1XEWX 821PA 1N0WA 1XCPA 2IWHA 1BO6A 1NP6A 1MV5A 4QGGA 1Q1EA 2JATA 1UDWA 1RRGA 4WXRA 2CK3D 2O8FB 2BOVA 2O8DA 2ERYA 3B78A 4PPNA 2FFQA 2VO1A 1XD2A 2Z0MA 1E2NA 2HXYA 1MH1A 4KFTA 3I61A 1FP6A 3HJNA 1OLOA 1CJTC 1DE0A 4EFLA 1N5JA 1XD2B 4DUGD 3QXJA 4RCYA 1T5IA 2WICA 4LUCA 1JNYA 2OFOA 2OXRA 4LDJA 1J8MF 5JSZB 4JLJA 2DWPA 2AKAB 1EFCA 3TUIC 3UK6A 1D9XA 4N3NA 4LBWA 1SKYB 4OHVA 4NCKA 3SU8A 1NVUQ 3DM9B 5CB6A 1TAGA 4DEXA 1A4RA 5K8IA 4M1YA 2I4IA 2O8DB 1OXSC 1XB2A 2IXFA 3UG7A 3CLVA 4FWIB 3T12A 4MGZR 4XWAA 4JLKA 1YVDA 3NWJA 2Q3HA 3SJAA 4F93B 2C8VA 2VSOA 1IN8A 1U99A 2VP9A 5A4JA 1M34E 2QSYA 2OHFA 4ACAA 1P2SA 1PUIA 5EUQB 4ZO4A 2O5VA 4ASUD 3KKQA 1OYWA 1WQ1R 2GA8A 2KWIA 2WOJA 2B92A 2AWOA 5KNBA 1Z0IA 3FFAA 4B2IA 2ZSDA 3QXCA 4C9BA 3K70B 1HT1E 3MJHA 2REOA 3BGWA 4N0EA 4Q9KA 1CRQA 1OE0A 2CDNA 2O8FA 1KYIA 4GSYA 5CK5A 4Z1MD 3QXXA 3RS5A 1ZIOA 2PMKA 1UBFA 3K70D 2OILA 1PVOA 2QBYA 4PANA 4C0SA 3U60B 4XJXA 4A4DA 2RGBA 4DSOA 2QA5A 5KOYA 3MMPA 1KMQA 1BOFA 4TL6A 2RGGA 1B23P 2Y8EA 3EZFA 3T1QA 4HI0E 1G3QA 3BB1A 2IUSA 2AHOA 3BJIC 3LBNA 1HQYE 2J45A 2W0SA 3KJEA 1JJVA 1G20E 5HKKA 1G7RA 3CBQA 3EASA 3B7GA 2HEIA 4DWJA 5DLQC 3N2EA 1FX0B 1UF9A 4MKFA 2CEAA 5C4GB 3CNNA 4QKQA 2AD5A 4A9AA 2JDID 4B71A 2XJ4A 4OHXA 1NN0A 2QMOA 4BEJA 4RKFA 3K8YA 1EFRD 4Q4AB 2ATXA 3RVBA 4BLSA 1IN4A 4OHYA 4BLTA 5J5CA 4EPXA 1M74A 2JLWA 1ZYUA 1RJ9A 2OLKA 4EKDA 4CT4B 5FUVA 1GL6A 3JVVA 3VMFA 3EWSA 3AP1A 1QRAA 1H8EA 2P2LA 2PJZA 1QBKC 3UXMA 3TH5A 1DG3A 1W1WA 1P3JA 3A4NA 3LY5A 4R71A 1S8FA 1YZKA 1Z0JA 5D3QA 4B3DA 3OIVA 4WZAE 2GAOA 1GVNB 2IYQA 2QBYB 1YZLA 2KI5A 4C2UA 2GXUA 2XB4A 3QNUA 2QI9C 1G4AE 1UBEA 1FQKA 1XZQA 4XVRA 1VMAA 4D4JA 3RSLA 4K46A 4URWR 3QSYA 1G18A 1ZUNB 2KE5A 2X1VA 4Q1BA 1YRBA 4GL2A 4G3XA 3SS8A 3OFNA 1E2FA 3PIRA 5DN6A 3QY0A 4E07A 1COWD 3A4MA 3C41J 2R6GA 4EPTA 2JLXA 1XX6A 3SE0A 2F9MA 5KTYA 5L3SB 1E94E 1XMJA 3C8UA 1SXJB 4B3FX 1ZMXA 3VR1A 3CO5A 2DCUA 3QF7A 3PEWA 2ZSFA 1IN6A 3JZMA 1CIPA 1B0UA 2WKRA 4EPVA 4YMWA 4LWZA 4D2IA 1DAGA 4ZI2A 4KVAA 3NBFA 2ANCA 3NDPA 1FNNA 3EG5A 5JJIA 4LHYA 4XOIA 1JALA 4LC0A 5GJBA 3DEFA 2A5DA 1Z0FA 2OZEA 4FINA 4OHWA 3TVDA 4BLPA 4CF7A 2WSSA 2WPDD 2AKYA 1G6HA 1VG0B 1OH6A 1QHHB 1BS1A 3WHLA 3THXA 1IN7A 1U8YA 4L4UA 4EPYA 4PPQA 3CRRA 4Q47A 3HYTA 3P26A 1S96A 2BBOA 4I81A 1XFAA 3RS3A 1KJWA 3LXXA 2X19A 4PC2A 3L8YA 2ZEJA 2XXAA 2PZEA 4E09A 4NYMQ 4RZUA 2WAXA 2C9OA 4V0LA 4DT1B 4FMBB 3ICQB 2CJWB 2WWIA 4ESVA 4KXFB 3ZYCA 2FPMA 3DM5A 4MA4A 1WCV1 5B58C 4RD3A 3T35A 4NCNA 1GP2A 2RMKA 2GK7A 2QT1A 1NN3A 1QHHA 4KHZA 3PEUA 2Z6VA 1AK2A 2BMDA 4DEYA 1KI3A 3DZ8A 2N1BA 4GOJA 1KHTA 121PA 1RYFA 2XITA 2FDCA 1Z6XA 3DKVA 3CRVA 4P4TA 3S1AA 3QKSB 4A82A 4CRWB 4PR0A 5FTKA 4B33A 2WIBA 3UMRA 5DIFA 4Q4JB 2BVNA 4Q1DA 2PEZA 3C4JA 2E1RA 2H16A 3R7WA 4CIDA 4OI0A 4URVR 3GLHB 2IUUA 1AKYA 5EXSA 4ACBA 5CK4A 4D4KA 3M1IA 2GXSA 4KBFA 4Q19A 2A5GA 2ASEA 1ZVQA 4TYWA 1D2MA 4JJKA 1U0HC 3O8DA 4QGFA 1ZCAA 2ZU6A 1W0JA 5DISB 3FWYA 1N0VC 2QRZA 4TQ9A 1Z8FA 1W2GA 2VP2A 3X1ZA 4A0HA 4DRZA 3GJ6A 2CE7A 2R2AA 3T1TA 2EWWA 2Q3FA 2KSQA 4S2EA 4TLCA 3GLIE 2RB4A 4BZPA 3QG1A 4PPGA 2XXAB 1DEKA 2BCGY 4EIWA 1YU9A 3RS0A 3WRXC 4Z54A 4C0QC 5KYKA 4W9MC 2ZJZA 5FPTA 5G3ZA 3CNLA 2QE7D 4LRWA 1OYYA 4AYXA 5IT5A 1CJKC 1Z0AA 2G77B 2R6DA 4B35A 1XXHE 4QXAA 3IDQA 2YZ2A 4LV5B 5AUOB 3NBXX 1KOFA 4MUBA 2H1LA 3BD9A 2GJ9A 1VHTA 1UPTA 4XTRA 2JLYA 5L3QA 1YZGA 4D80A 1W49A 4FW9A 5TB5A 3GJ0A 2WMOB 4HZIA 3R8CA 2GCOA 3B9PA 5A5GA 4MYCA 1MR3F 5FOXA 2BJVA 3GFOA 3ZVLA 1KY3A 4U02A 5AJXA 1HA3A 2OE2A 2H17A 4AYTA 2QAGA 1NJGA 1YE8A 1W2HA 1UBGA 4JLAA 4DDTA 1P9RA 2G83A 3LDAA 1NMZA 2FH5B 4OK6A 5L3QB 3I73A 3U3RA 2BMEA 5HTKA 5FUWA 2HJVA 1N2CE 5JEEA 5JRZA 2IS6A 4IOLA 5IDVA 3FPAA 3AVXA 1DVRA 2EW1A 2FF7A 1F2UB 4RFSB 1VTKA 2DFTA 3AKDA 3EARA 4JT2A 2JLRA 1ZNZA 4FCWA 3I62A 4NL4H 4QFMA 1T91A 4BLRA 4OL0A 4DLTA 1XTJA 1KI9A 4EUNA 4IFEA 3KKMA 4R2IA 1BYIA 2VHUA 5GJWC 1ESMA 2EQBA 3BIFA 4PZZA 1KY2A 4XD7D 1EFUA 4TMKA 2GZDA 2YNMA 3OAAD 4R9UC 4HB4A 2IK8A 3C16C 3E5HA 5L3RA 4DSNA 4OQFA 4LGMA 1W36D 2J0QA 3LVQE 2IYWA 2NGRA 4Q03A 4BGDA 3VNUA 3CH5A 4JL8A 2QNRA 1GNPA 5JSZA 3HP1A 1F2UA 4RFSA 4MRRA 1T9HA 3H1TA 3ZZUA 2EYUA 3ETLA 1R2QA 1NVVQ 1W36C 1TU3A 1Z5ZA 5JJKA 4EJSB 4GBMA 3OEHD 1OXUA 3IUYA 1XXHA 2JJ1D 5EE9A 4P33A 1KSGA 2GEDA 3W8RA 4RD2A 1CR1A 2VP4A 2YOFA 3CH4B 3LQRA 2EFCB 5CJ2A 1JXOA 1OXXK 1AQUA 2QAJA 1N6OA 4A6PA 2MSEB 2ZRDA 3MG9A 1G291 3IO5A 3EPHA 2BV3A 3FKSA 3NC0C 2UKDA 2ZROA 1US8A 4UNPA 1KI6B 2H5EA 1Y3AA 1F48A 4QM7A 1E1RD 1IOZA 1GG2A 4HAWA 2CLCX 2WBLC 4B6FA 2JJ8A 4QRHA 2IYTA 4A0GA 5EP4A 4BRUA 1DPFA 1PZNA 5K8TA 3DDCA 1N6RA 3X1DA 3U4QB 1LB1B 4IVPA 5GVSA 4TWZA 3I5YA 4L15A 3UKDA 2HUPA 2MSDB 5J4YA 2JLQA 3F0TA 4JLBA 1MABA 4LBYA 4NMMA 3LVRE 5GJCA 3RRMA 1E9CA 4Q1AA 1NLZA 1W0KA 2QSZA 2IYUA 4BFTA 3KQUA 2DWQA 4B43A 1FTNA 1XWIA 1E2MA 5UKDA 5L8VA 1U8AA 1EG7A 1E9AA 1G8GA 2YC4C 3W5IA 3CUEF 2ECKA 4FMDF 5E95A 4PZYA 4V0OA 4C0HA 4QBHA 3EC1A 1F60A 4FN5A 2PLFA 5EJEA 2B8WA 3OAAA 4JLDA 1G3MA 4HUQA 4N1AA 5DYIA 4DT1A 1V5WA 2BBTA 2XB2A 1MABB 3AVVA 2QENA 1CP2A 3AM1A 3ZLJA 2J59A 1AN0A 2ZVQX 1NG9A 1MO5A 5FOTA 4F4JA 3EIHA 2O8CB 4JLVA 3K9LA 1J7KA 4LX0A 3ONWA 4OKSA 3RAPR 4DXAA 5DSZA 1T0HB 4IXNA 4O0MA 1UEIA 4HDOB 2H57A 1IM2A 3GEEA 4RD4A 5HCIA 2HF9A 2ZR0A 4P4SA 3THOA 3DL0A 1JR3A 5AJZA 2XTZA 2WIAA 1IJFA 1E9RA 3MLEA 2W6ID 2VPPA 4DIDA 4XWOA 1XD8A 4GPTA 4X8MA 4Q7LA 5EP2A 1KI4A 1R8QA 8OHMA 3P27A 1LW7A 2P5SA 4AWXA 4IKEA 4D26A 4NDZA 3IPXA 4QBIA 721PA 5E7IA 1GRRA 2WOOA 1Z47A 2JJ2D 1G5RA 2ZJ8A 4LYAA 4YMTA 3B8HA 4I1VA 2CHQA 3T5GA 2EFDB 3E2IA 3H0KA 5J4KA 1C9KA 4AIIA 3LH5A 1ETUA 4BWYA 2NG1A 2B6HA 4LPSA 1HTWA 1U0JA 2ZUDA 3KQLA 1Z2CA 1S0UA 3PV0A 2CLSA 1K6MA 4IOJA 4L5BA 4DZZA 2AWNA 3NEYA 3QEOA 2OSBA 4URZR 3TMKA 1OFHA 2Q9CA 4URXR 2W0MA 2QE7A 1N5LA 1Z3IX 4TLEA 4GMXA 3NH6A 4B73A 2IHYA 2X2FA 1CF4A 1LTQA 4KSBA 2QM7A 3P4XA 2VF8A 4Q4HB 2WWFA 3U7GA 1Z6GA 1MKYA 1S1MA 5G41A 3CRMA 3VX3A 3VU9A 1ZINA 4BPBA 1TEXA 2VHQA 3OE7D 5KO2A 2QAGC 1W44A 2DWOA 3MWKA 4YDSA 1G9XA 4GOXA 2A78A 2XGJA 4QM6A 3W8NA 1Z0KA 4WA7A 3SHWA 3IO3A 4OI4A 2NO6A 2YV5A 2F1JA 4JKYA 5DGXA 1TUIA 4MITA 4QGHA 5HE8A 3C7KA 2HT1A 3MD0A 3B5JA 5E4FA 3GJ4A 1II8A 3IKJA 3TGPA 2AK3A 2GNOA 3FDIA 3NTUA 1ODFA 4GI7A 3WYFA 4Q9JA 3W9YA 3V4RA 4DKXA 1E6CA 4M1OA 3LXRA 4DDWA 1KDRA 1JR3D 2IYZA 2JLSA 1JR3E 2QL6A 1I2DA 1Z29A 3B6EA 1DAKA 3I92A 3L43A 2ZI6A 4JSTA 2D2EA 1T3HA 1F3OA 2ZRJA 2FFBA 3KX2A 4Q1CA 4CEIB 4AI6A 4KYIB 2HCBA 3VAAA 3NC1C 3KXLA 2ZSEA 3BE4A 2VL7A 3THWB 2OUKA 1FFHA 1L7VC 1IAQA 3IEUA 4I99A 2A9KA 3CB4A 4IJMA 3QE0A 1G3RA 1NJFA 1VYTA 1IQPA 1ZM7A 5C4MA 1II8B 4PSKA 4JJZA 3B1YA 3EXAA 3Q3JB 4G5RA 4J0QA 3RABA 4BFXA 5BXQC 3KL4A 3U7HB 1E79D 1ZU4A 4L16A 4YXWD 4LYHA 1RPZA 3CZPA 5KSYA 2CLDX 4DCVA 1AZSC 3AF2A 1AM4D 2V7QA 4P3YA 3WBJA 4HZUA 3RS4A 5IK2D 4TSFA 1FUUA 4DHEA 1W46A 3ADKA 5JS8A 4WZ6A 1M2OB 3KJHA 3WNDA 4TT3D 2WSSD 3M0EA 1E2LA 2AK2A 1W0KD 4JBXA 3BFKA 5TVKA 4WAUA 1VIYA 1XTKA 3KUCA 1KZ7B 4LJ4A 1EFTA 3PEVA 3THYB 4POAA 3ZZTA 4B75A 4DLXA 4MGIR 4KVGA 2FJUA 3LAWA 2GBLC 4US0R 4DLYA 3HU3A 4JSYA 4ERNA 1LS6A 4O2RA 2XOKA 2WJVA 4DLVA 3FKQA 4IEEA 5FTMA 3QUSA 1G6OA 2QGZA 4DCNA 2FEMA 5KPDA 3QF4A 4A2PA 5JMTA 3LV8A 4LC1A 2JCSA 4LHZA 2C95A 3V00A 3U5ZB 2W6JA 4Q00A 1Z28A 1KO5A 1WBDA 2OBMA 2YYZA 5FBRB 3RWOA 4F7WA 3REGA 1E4YA 1TL7C 3A58B 3AH8A 4ZDWA 1L4YA 3ZS9A 3KQHA 3CR8A 5DN6D 3ICEA 5CYOA 3IILA 3LNCA 3PG5A 4BE7B 4LJ6A 2QUZA 1DAIA 4AG5A 1NKSA 3GLHE 2UVQA 1KI1A 5J40A 1J2JA 1E9FA 3CF2A 2O8EA 3EWAA 4YMVA 5SZIA 1TUEA 2IF2A 3AVOA 3PFIA 1GRNA 2JJ1A 4CGZA 2J41A 5ANRB 5LPNA 2ORWA 1AS0A 5KSZA 2BHRA 1GUAA 2IS2A 2BDTA 4HB0A 1P2TA 4N0DA 1S4QA 1P9WA 2G0TA 2ONKA 3CPEA 4HAZA 3BRWD 2OFWA 3UIEA 4XWKA 5JI3E 1UAAA 1JI0A 1WDTA 1SGWA 4MDFA 2R9VA 1JJ7A 3G0HA 2UZIR 3EIEA 2EFHB 2YVUA 2XSZD 5TARA 1UBCA 3L0SA 1E9SA 3FHOA 3SEAA 2JDIA 3TW8B 1RRCA 1L2TA 2GJKA 1RFLA 1KZGB 4TL9A 3W6OA 4OK5A 2O8EB 3ADCA 1Q22A 1M6NA 2CCKA 4DBLC 3VX4A 2ZRNA 2FX3A 2GJSA 4QHSA 1I2MA 2PT7A 4R98A 1TF7A 2ZRMA 3THXB 5LD2B 1CJUC 5FBLB 4LBVA 5JBQA 2XJ9A 3F3YA 4II7A 3AVUA 2WJHA 2F43A 1MOZA 4M9QA 2F1RA 4LI0A 1ELOA 3RSOA 4URYR 3U2QA 4BFYA 4ZDIA 2OCYC 4LJAA 3LWNA 3AUXA 4JT4A 1R8SA 3KZ1E 3RC8A 2FSIA 3WYGA 2XZLA 4X8LA 4B44A 2J1LA 1E0JA 3WNBA 2RGXA 3VR6A 3BH6A 4Z1MA 2G3YA 4DIEA 4KLNA 3AEZA 3Q7PA 1M8PA 3WYAA 1P6XA 3IPYA 5CIQA 4B2PA 1D5CA 2JLUA 1AS3A 3IIJA 1R0YA 3TAHA 3CONA 4M22A 4F38A 4B6EA 3GJ7A 1X8LA 2AX4A 3EA0A 3VR4A 3BFVA 5CIWA 5JHGB 5TXGA 1UKYA 2J3EA 2VIIA 2ZJYA 4DCUA 4QNMA 5BQ5A 1G3IA 5JLJA 2V3CC 2OXCA 2ZRKA 4H9GA 4JBYA 3ZDQA 4MRVA 2XEXA 4IXMA 1JBKA 3U4QA 3PQCA 1KO7A 1VHLA 4C4PA 2R6FA 3GLFA 3NKVA 4TYYA 3B9QA 3OEEA 4PQYA 1G5PA 2FGJA 4PO9A 3ZD7A 4RKEA 4UJ3A 5KSOA 4LZZA 2CCJA 3AQ4A 1AJEA 2FPKA 2F43B 3LQQA 1Z63A 2WTUA 2F7SA 4BEBA 3SQXA 3K0SA 5E7JA 2GETA 2PCLA 3L0OA 2GDJA 1YR9A 2UZ3A 2VEDA 4NU0A 4B74A 1L8QA 4PPFA 1WA5A 3NEJA 1VPLA 1KSFX 4OK3A 4NYJR 4QHYA 2C99A 1D2EA 3BB3A 1OKKA 4CW7A 2WJJA 5FFMA 4C0LA 4EQ6B 1SVSA 3CM0A 3D7MA 2DPXA 1FP7A 2PT5A 1KNXA 1SQ5A 3AF3A 1NMXA 2RGDA 3L2OB 1LF0A 3AVQA 4HYYA 4Q66C 1GNQA 3L82B 3X1XA 2DB3A 2G6BA 2P3SA 3CX7A 1N5IA 4GMDA 5A0FA 5LDDC 1EESA 3ZQ6A 4HB2A 4OJQA 1RRPA 1F6BA 2DFKB 1DOAA 2BEKA 2F6RA 4IW3B 2JLVA 4IFBA 1HT2E 4F91B 3KUDA 3SDZA 3OZXA 4M21A 3P4YA 3UMSA 4MYHA 3U7FB 2IS4A 3GD7A 4M53A 3HU1A 1HUQA 3A37A 2PLRA 2GJAA 3EZ9A 5FPYA 2QP3A 1MRSA 3CW2A 1J99A 4PQRA 2NOAA 1NY5A 3HDTA 3R9XA 2PX3A 3T61A 2QRNA 4KFRA 1G1MA 4BFVA 2IEZA 1E9DA 2CNWD 2Q9AA 4D0NA 3KXKA 2ODWA 4HZUB 2REBA 1GRQA 1O3YA 5C2JB 2A5FA 2FFAA 3TLXA 2GBLA 4RJLA 3ND8A 5H1YA 2XAUA 4EAQA 2Q0HA 4DLUA 1IY0A 4PSAA 4TN1A 1CR4A 1XJ0A 2G0NA 4PX9A 3KFXA 1XD9A 4LY6A 4C30A 5J4HA 2NQ2C 1X1SA 1T8UA 3QVVA 1Q44A 4LOAA 4B3XA 3RWMB 1YR7A 2EFGA 2AFIE 2B8TA 2X77A 2ZANA 3NH9A 3D31A 4UXHA 2YWHA 2HXSA 2LKCA 4G5GA 1ONBA 4HB3A 2YOGA 3V9PA 2ZE8A 1NVXQ 4KBGA 4TLAA 5AUPB 4HLQB 4B3GA 4JYBA 4I4LA 4WXPA 5EE1A 3I8XA 3IBGA 2YC2C 3AP2A 1WRBA 2K5UA 4GT1A 4HUQB 2QP9X 3T15A 5CLQA 3TKLA 2FSHA 3TNFA 2V9PA 3ZVMA 4D82A 3BK7A 1ZAKA 2D3WA 4BLQA 3N2IA 3L0PA 4YDHB 3OFND 1RRFA 4IDHA 5CDFA 1W48A 3OIUA 1JECA 2O0HA 3LLMA 2IYYA 2BEJA 1XTSA 1OIWA 3IBYA 4B2LA 2WVJA 1YR8A 3VTKA 5JCZA 2VYFA 3KQNA 3AKEA 2EYQA 3AF1A 3CWZA 2HJGA 2AR7A 1HURA 3BBPA 2VQSA 2RAPA 2V1UA 3TQCA 5CITA 2ZRFA 2REXB 3LLUA 1G41A 4V02A 2YWGA 1YJ5A 4Q5IA 1OH8A 1SXJE 1X86B 4V0ME 3F8TA 4JVSB 3UWOA 4EPRA 1XMVA 4W5HA 1KDOA 2FE4A 1DAMA 3GEHA 4HLDA 1E0KA 1KAGA 5KSPA 1XPOA 3ZGXA 1NIJA 2QY9A 1CTQA 2PMDA 1H65A 4MGKR 3MGCA 1OT3A 2ZR9A 5CJPA 5EXXA 4KI0A 4WOPA 1S3SA 3VQTA 3ADBA 2CJWA 1GFIA 1GILA 2I1VB 2P6UA 1G5TA 2A5JA 1BMFD 1KI2A 4PFSA 3BS4A 1YZNA 2B7CA 4TTPA 2C9YA 3K0AB 3UMFA 2ZYTX 4XVQA 2YWFA 4OI1A 1HEIA 2R6CA 2N46A 4HSEA 3SR0A 2P6RA 2CVFA 2A7QA 2F1HA 4NCHA 3W6NA 5HZKA 2XNDD 2GZAA 1U2RA 5HKKD 2H18A 3QPUA 2ATVA 2BKEA 1UKZA 3AP3A 2ERXA 1TQ4A 3TBKA 4GP6A 4WIAA 2BBWA 5JWHA 1OXTA 3OHMA 3GCGA 1HY3A 4ITRC 3LW8A 5FPKA 1E2KA 3EX7C 3V4FA 3QF4B 2QORA 3LX5A 1SVLA 5L3VA 2ZYUX 5HE9A 1KIMA 4TYNA 3GJ5A 1Z06A 1ZJ6A 1DS6A 1EX6A 3K9HA 2IS1A 1IY2A 3CKLA 3H4MA 3IHWA 4P4SB 1ANKA 4XIGS 3QI2A 2JASA 2HYDA 4XH9B 4UNNA 4NH0A 3WHKA 1FOEB 1VG1A 1HYQA 1JXMA 4ASUA 1M7BA 5KDLA 4D6PA 4TMXA 3MAAC 1OXVA 2GZHA 5TV2A 2V55B 4A92A 4UQOA 4OQNA 2ZS8A 1ZNWA 4FXPA 4M9SA 3KTAA 3GLFB 2A30A 2O0KA 1KJZA 1T6NA 4QC2A 3KDSE 4ZKDA 2IYVA 3QKUA 2P0EA 3T34A 1ZU5A 2EU8A 3Q72A 5FR2A 4Y0AA 2NO7A 4DLRA 4URUR 5CM8B 4LV8B 5AR1A 4TZ0A 2Z83A 3FB4A 2FFHA 2Z43A 3A1UA 3SJZA 4M1MA 3SJCA 4FCVA 3KFVA 4K8OA 4M1KA 5FOUA 3P1JA 3QENA 5D3MB 3SI7A 4YMUA 3THWA 1K8RA 2FN4A 3DOEA 2W83A 1OHHA 1UEJA 2VTKA 2VSFA 1S9DA 3GPLA 4ARZA 1E2PA 4DUGA 5KHOC 4Q01A 2P6NA 5AJYA 1FL9A 3MWLA 2W00A 4Q4AA 4QGAA 4WZBE 5JS7A 3FMFA 1XMIA 4TMTA 1VECA 3ZS8A 2HLDA 2KBFA 2MMGA 1D9ZA 5DI3A 3TSZA 1KK2A 2HF8A 2H92A 3TE6A 1NN5A 4TZ6A 2FA9A 3MWYW 4AG6A 4RFVA 2V54A 2CK3A 3LBHA 3OESA 3ZIAA 4A8JA 2NO9A 4H1UA 5GVRA 2GILA 3ZH9B 1E0AA 1NMYA 4MUAA 2ZI9A 5FR1A 1PLJA 4M9ZA 4YONB 1OPXA 3DMNA 4S35A 4U00A 4NCJA 2CNWA 3NXSA 4D0LB 3R20A 4Q9HA 1E2QA 2XNSA 3VNVA 2D62A 2QM8A 2WWGA 3IGFA 2CL0X 2J7PD 4H1VA 1L4UA 3GLGB 3UATA 4NKRA 2ZAMA 2J9RA 1V43A 5BN4A 5FL7A 5FTJA 1EFHA 2VA8A 4PXAA 1GKUB 4TYPA 2R44A 4KU4A 3M6AA 1OH7A 1G19A 3ZZ0A 3SQWA 4PSVA 5H68A 4P31A 1OIVA 3CF0A 4MKIA 4M4SA 2W2VA 1NBMA 1VCIA 3TK1A 1F5NA 2QQEA 2MSCB 3CPJB 5JRJA 1Z6YA 2OAQ1 3AF0A 2H8KA 3GLIA 2D4HA 5J4LA 2ZTSA 3GLGE 3AKCA 3SJBA 1YZTA 4QJ5A 1QF9A 4B47A 4HEJA 1WMSA 5SZJA 2ORVA 2Q21A 1W7AA 2IF0A 1CR2A 4Q9LA 1XRJA 3TSWA 5DI9A 2RHMA 1IBRA 2J0VA 2QAGB 3T1VA 3SYNA 1GWNA 3E70C 4NYIR 4UJ5A 1IN5A 4GOKA 5DE3A 1NSFA 2DYKA 5JFGA 4C7OA 3DOFA 1P75A 3FTQA 1ZM2A 3K9NA 2RHDA 4BECA 4Q7KA 5BN3A 4QOSA 4XVUA 3IIMA 2JEOA 3M4YA 3UG6A 4JL5A 2WJGA 3L0IB 2PH1A 1Y63A 4CT5A 1DELA 3EPJA 3ZVNA 3CF6R 4A8JC 1R4AA 2QPTA 2OG2A 1JEDA 1VCNA 2ODBA 1AIPA 4PHHA 3VKWA 3VR5A 2AN9A 3NG1A 4QJ3A 3UPUA 4HATA 5HZHA 2ZREA 1PJRA 1QHYA 3K1JA 3CPHA 3PUVA 3OEED 4FCTA 4KLZA 1E1QD 4Z8YA 621PA 1N6IA 1HH4A 3K0FB 4CEHA 2ZE6A 4UKDA 2ZJAA 3RS7A 2ZETA 3A6PC 3MCAA 4M0LA 1F2TA 2OAP1 3CNOA 4IDOA 4KCGA 2GKSA 4M2LA 1P62B 4LK2A 1NIPA 2LKDA 3FHTA 3I72A 1XBTA 1NG1A 4JLNA 4TL7A 4DB2A 1W5SA 5M04A 3REFA 2QP4A 4LYFA 1KAOA 2NO1A 4EDHA 1VIAA 3CX8A 1OKKD 2TMKA 2W2XA 3RANA 4HLUC 3TUJC 3EPLA 2FWRA 1G16A 3L8ZA 4RZ2A 1W36B 5TY0A 5JWRA 1RVDA 1E2GA 3P20A 4R7ZA 1KI7A 1OW3B 1ZD9A 1A1VA 3NHAA 3QJYA 4LBZA 3AVTA 1EWQA 2ZXUA 1GKYA 4HDQB 1ESNA 1Q1ZA 2YINC 3SYLA 1E2JA 1W4AA 2ZS7A 4BQSA 5SZHB 2I3BA 5K8UA 1IXZA 1EWRA 4NCIA 1MRNA 4KSCA 3W3ZB 3RNLA 3P32A 1IXSB 2BC9A 1P9NA 1Z22A 4JBWA 1ZBDA 3GJ3A 1Q21A 3QQ5A 5HPYB 1WB9A 4DLZA 1S9HA 5EZ6B 2HV8A 4JVNA 1TF5A 2Q6TA 4MRPA 4KFUA 3W3AA 5FI0B 4BUJA 3WNCA 3Q8XB 3KQKA 1KDTA 3Q85A 4MKGA 3O8RA 1N3BA 4OYHA 1G8FA 2OCBA 3X2SA 2WWYA 1JPJA 2B21A 3HU2A 4JIMA 1GDDA 3R9IA 4P4UA 2IT1A 2WSMA 2VP0A 3AVWA 2VHJA 1U90A 1R0XA 3LW7A 4BFZA 1EXMA 3SBDA 2VH5R 3K0CA 1XJCA 1YZQA 3KJIA 3TIFA 1MO6A 4JYCA 1LNZA 1G7TA 3AUYA 1W4BA 3CX6A 1WBBA 1TU4A 5EE3A 3BWDD 4OJKA 3IQWA 2ZI4A 4EPWA 3DHWC 3SZRA 1E0SA 2GEVA 3GFTA 3OIYA 4GRAA 3C5CA 4YC7A 5DO9A 3BERA 3KTAB 4WW0A 1KNQA 4BZXA 3I8SA 1ZW6A 4Q9IA 2D06A 2O0JA 3PJRA 5FTNA 3VKHA 1OF1A 2X8AA 3TAUA 4BFSA 2QTFA 4FMDB 2W6JD 2DY1A 3VU9B 2QEQA 1HE1C 1A7JA 3GFPA 5FOSA 5ELXA 3T5DA 3QG5A 1T8TA 4ZIRB 1KO1A 2XZOA 2GF9A 3MFYA 4A6XA 1N6HA 4TLDA 3FMOB 2XOKD 2CHVA 2XSZA 2DFNA 1D8TA 1LFDB 4RD0A 2C9CA 1GL9B 2D7CA 5JJLA 3EIQA 5H70A 2AXNA 3U44A 4OBEA 1P73A 2IC5A 2WJIA 2VLIA 2JAQA 1E3MA 1UDXA 4JL6A 1Q20A 5KNDA 1T3SA 2CHGA 2CBZA 2IL1A 4TT3A 1AGRA 3O47A 4YMSA 4DSUA 3EZ7A 5F2EA 3WXMA 4BRWA 1RJ9B 2BM0A 3QBVA 2BM1A 1PUJA 2BMJA 4EJSA 3GQBA 1E2IA 4NZYA 1SVOA 2MMCA 2C96A 1H8HA 4TSFD 5KDDA 2V7QD 1WE2A
chains in the Genus database with same CATH superfamily
2HSWA 1FXWF 4OH1A 4EGCB 4DM7A 5JYEA 1DRKA 3NT5A 1H0HA 1XK7A 1R5OA 2GVZC 1T8YA 4FR5A 4PHFA 4W5WA 4D8UA 4IH4A 1A2KC 4D92A 5EFZA 5K2MA 1NXOA 4MUGA 5K9ZA 2W43A 4YAWA 1J2YA 1KEUA 4MPJA 3ASZA 3M83A 4QATA 2YWDA 3QPWA 4ZK6A 5DH9A 3K6RA 4PC3A 5C34B 3MMZA 1X9HA 3UJDA 1LSJA 1GCUA 4OB6A 2VTVA 1ADFA 1RCUA 1QYIA 4Z7NB 4G5XA 4G89A 1ULZA 1FDSA 2ZJBA 3AUAA 4OVKA 4BKUA 4XSGA 1SHZA 1ZC3A 5J43A 1AQJA 3EXFA 3KK0A 4LXTA 1T10A 1KDPA 1DTEA 3NHSA 5K0BA 1QFJA 5EMJA 3PUWA 4U6SA 4F4IA 1JR6A 3OFVA 3ELWA 1RJFA 2IDJA 3ELDA 4HFMA 4KXLA 2GTHA 2VHYA 3LFTA 1AZTA 1N9ZA 4HYEA 3RYFB 3DBHB 1L7RA 4M89A 4V03A 4YJ2F 1ZM3A 4R1LA 3R6DA 5U9CA 4DM3A 4G0OA 5TQ0B 2EBFX 1O2DA 2YZKA 5HJ5A 5KMGB 1YS6A 3N8HA 3WA7A 4M1TA 2WJZB 1SZPA 1ZG3A 1KMNA 1RJEA 3K09A 3ET4A 1T6ZA 5IK2A 4A2WA 2OZVA 4L5JA 4IIHA 1PG0A 4LVNA 4YAEA 3U3OA 2H4HA 4HNRA 4BNWA 1C1DB 5EXPA 1UKVY 4PAOA 4G8BA 5KB3A 5HG0A 5B3JA 1E6KA 1YRAA 3QIAA 3WZ2A 4YHHB 4OIMA 1WXIA 2HF7A 4P86A 3T6KA 3CUVA 3HE3A 4F4DA 1V9SA 3ZDXB 5D5QA 1ZI8A 3ZNOA 3PL5A 2NSYA 5EE5B 5C5DA 4CVNA 1K5DA 2IKQA 3H9JA 2UYOA 4JELA 3L7DA 2BTQB 3M7IA 5G3YA 2E4YA 3KR1A 5D6NA 1ZD8A 3STXA 4CF4A 3DVQX 5BW8A 2F3TA 4TLLB 2CVOA 3V4VB 3QUTA 1VJ1A 5BWMA 4L7VA 3PC4A 3V7NA 1GPDG 1XI2A 3IIIA 1YJ8A 4RPCA 2D2FA 4JC5A 2ZSUA 2P9TA 3L8GA 4ZVLA 1CB0A 5DNUA 4RPKA 4Z9BA 3DMPA 1GCOA 1DG1G 3L4BC 1VZ3A 1SXQA 2BCJQ 2F1KA 4ZP1A 3FGNA 3IP1A 1CEEA 3U80A 2XVMA 3MRTA 1MZVA 5AIAA 2G9NA 1T25A 2ONCA 2CL7X 5KYUB 6AT1A 3DSRA 3I05A 4Y0VA 4Z0TA 3BE5A 2GD0A 3RSQA 4C6HA 1U9ZA 1FW6A 4LG1A 4R01A 5K0EA 4JR1A 2XXJA 1IJBA 2NTJA 3INRA 3AYXB 4QICA 3RM3A 2I03A 1OH5A 2X4GA 3GA7A 3GRYA 4HWRA 1QH0A 4X7PA 1KO4A 3GFQA 3C3EA 2WZQA 4D4HA 2GM4A 3QHQA 5BNTA 2Y1CA 2Q7OE 5KTKA 4KI7A 4Y2PA 3W5BA 2CLFB 4YYZA 4M8NE 4MS1B 4QTTB 1GOTA 3FYUB 4IYRA 1YB4A 5JCJD 5CA0A 1CY0A 2IVZA 1OFUX 3W04A 2ZITA 3FNIA 5A62A 3O8CA 2QN2A 3D4LA 2ATCA 3E9DA 3S70A 3KLBA 5F9HA 4NHEA 3RTEA 1W4RA 4RZ3A 3WMGA 3GJQA 4PLPA 1FTSA 4K9PA 1TUGA 5TPWA 4FD2A 5CCXA 3T5TA 1M1YA 3R23A 4ONEA 1CLUA 2Q9BA 4EY3A 4Q24A 4U5XA 5HIKA 2RB5A 4IQ0A 4DZRA 2UXBB 2UVDA 3DPUA 3RGWS 2J3QA 2PDAA 3SVZA 1B14A 2H52A 3P9XA 3NHUA 4RV9A 1EDBA 1FYEA 1K7FB 2I71A 2ZIWB 3U7QB 3QA9A 4I50B 5HUHA 5IS2A 5FNVF 4Q7JB 4LDQA 1K66A 1W73A 2RKOA 3T7KA 4C3VA 5ED4A 4Q3CA 2CXHA 4Q18A 4MS4A 3VVCA 5KJEA 1F8UA 1KH2A 2ZU0C 4P84A 4BBAA 1AMOA 4B0OA 3QPAA 3AQIA 1TZBA 1B6RA 1XEFA 3ZI4A 3VSDA 3L1JA 4G86A 2AFHE 4F45A 3ASVA 4BO2A 2NX2A 2IIQA 2W4IA 2O7RA 3EGOA 3O1HB 4CLRA 3RUIA 5E6RA 5B3KA 4DV6B 3UK2A 1E1RA 5FD8A 4ITUA 4OHFA 5E1MA 1M7GA 5LLSA 2VF4X 4ETNA 3ETDA 1OZHA 5E38A 4P35A 3PXAA 5EJAA 3EXHB 5KSWB 4IDQA 2XMSA 4UVGA 3A4YA 2ZJ1A 2YS6A 3HWSA 1IXKA 4P32A 4G5SA 2Q6LA 4G4IA 4J03A 5BW4A 4BTEA 3VR2A 3ETCA 5AM3A 1QMGA 4P0TA 4W7SA 3ZDCA 2J6IA 1J9GA 1TA9A 3R44A 1V6AA 3GFVA 4RMIA 5G0WA 2WWXA 4JYZA 4BCCA 4EA7A 1PVDA 2G1AA 3ORYA 5LP6A 2DJIA 1FA9A 2UUPA 4CM5A 5EJ8A 3G6KA 4YJ2B 5AIBA 4DV0B 2IE8A 3JS5A 3KV3O 1CZUA 4DLSA 1U1DA 5CX1A 4Y6PA 5BYBA 1J2UA 4NK5A 2LNDA 2OB1A 4JYMA 2B25A 3LY9A 2N1MA 4X3OA 4A23A 4U2CA 4CQMB 1OFTA 4CKCB 3LO5A 2WJPA 4PHTA 4G07A 1DKPA 1R6XA 1S1CA 1T9AA 2C03A 1F0PA 2WT9A 5IAKA 3H17A 4Z9FA 3MIIA 1T3ZA 2X9GA 2JVIA 5CCEA 2D0PB 5WRFA 1FMLA 3IDSA 1TDJA 1M67A 3IP3A 3L8HA 1Z3CA 1YQWA 4EKNB 3B2EA 4A26A 1XA3A 1FCJA 2D2VA 2WKWA 5ARDA 4ZT6A 5K3SA 3W2EA 4CCWA 1W4CA 1B6SA 3RU3A 4Q82A 1REQA 1IWBB 3AF4A 2GKGA 3QX9A 1CJSA 3DW1X 3DEJA 4KQFA 3HCRA 5CB4A 1RE0A 2XDQB 3DMGA 5JSQA 1EVJA 1VJRA 3OLXA 1FU4A 1T5DX 3EC2A 1AKEA 3LI2A 4YGXB 4C0KA 3U3MA 3U26A 4TVSA 3B7WA 1ZUIA 5LBIA 1NL3A 2VDWA 1CNMA 4GZLA 2X9VA 4WLEA 3CT4A 3PQDA 4B81A 5LVAA 3E81A 4JVLA 3KQVA 3N8IA 1I7SB 3BSYA 4JS0A 4JI4B 2DR3A 4NQZA 5CVCA 2FKAA 1TJYA 4J16A 4WVFA 4ZT7A 4RTKA 2GPWA 3MA0A 1ISIA 1N4DA 5IJWA 3I42A 4FYJA 4KR3A 1QR2A 4D99A 2PX0A 2CF6A 4Z4FA 4YUWA 1GGHA 4G1MB 1DJQA 5ILQA 1IY1A 2NV2B 2A2ZA 1ZRSA 3W4JA 1SMKA 2BFFB 2O2GA 2OBLA 4TMWA 3SWWA 3K6SA 1L0BA 1ECFA 2RHBA 5LDHA 2HIAA 2EFYA 2W2TA 3PFCA 3EZLA 3IUBA 4V0MA 1TPZA 1Q91A 2O7SA 3N0WA 1CUXA 4Q48A 2BGWA 2QN7A 2C1EA 3BE6A 4I66A 3NBKA 4FGLA 3HCNA 3OEHA 4C0WA 2R6AA 1GITA 4PSDA 4CCAA 1TE2A 5L4LA 1QC5B 4PC6A 4EMBA 1DMRA 3VI4B 1W29A 1KDVA 2ZLBA 4JP2A 3KOYA 2K4MA 2PJRA 4ENPA 5ESDA 3BD6A 4C21A 2ZE7A 5EEHA 1GQSA 1WV1A 1RWQA 1E1LA 3Q3EA 3C6BA 4BO5A 4OG2A 4Q3DA 4RTLA 1A8PA 1BS2A 3SXUA 4P7FA 4JHXA 4JWTA 1E8DA 2EX4A 2WJYA 5FOQA 1ST3A 4RD6A 1Y98A 3OMXA 4GNKA 3CZMA 1JB1A 1BVRA 2JIQA 3FMPB 1ND5A 3OX3A 4S0XA 5AI4A 4DQDA 5KQLA 5LFAA 2DFLA 1Z5UA 1DBRA 3EGEA 3OKPA 1YZUA 1ZH0A 3TQQA 3AUSA 1WB6A 1SCDA 5DNWA 2IYXA 1E89A 3QOWA 5CA0F 1GAEO 1HDEA 5JJCA 3N86A 4LGVA 1NRXA 1V8DA 4JJEA 3AJEA 1P2GA 3CLUC 3PLRA 3AXTA 1DXHA 2C98A 4AURA 2LZ0A 3QYPA 3Q3VA 1TQHA 4RZHA 4XD2A 1JFFB 3DD1A 2XUQA 3FVTA 3P8ZA 1L5NA 5BQ3A 4FFNA 4KXVA 4MV1A 4PINA 3GDOA 1W0JD 3GN2A 3NHBA 4L8GA 4X93A 3K92A 4XASA 1Y9DA 1P31A 2YVQA 7GPBA 3FW1A 4WKOA 4BGVA 2ZVPX 3D7RA 1F1JA 2DPHA 1CDDA 4HDAA 5B7PA 2BSQA 3IEPA 1ZIDA 2ZIVB 4P4LA 3LT5A 3WYCA 2C88A 2QMHA 1M5UA 2DHRA 2B6NA 2NYVA 3HYRA 3AY0A 4UNRA 5IRCD 4KJZA 1LH0A 1ND6A 2P30A 1QGDA 1E32A 3R0ZA 2QQ0A 4KGXA 2M6LA 3ZZMA 3WL8A 4EVQA 4ZA2A 3KSRA 3BILA 4YQYA 3FSRA 5D1HA 5AW7A 2YMPA 2G1JA 5EERA 2O05A 1C7IA 5ALIA 5B1SA 4XIJA 3FHLA 1PR4A 1R0WA 4E32A 1WUHS 4B3SB 3B52X 2F1IA 3KUXA 1TVCA 3SXPA 1WEKA 3TD6A 4BO6A 4UUOA 1DAEA 3WLFA 1FRVA 5TQ0A 5KMGA 1PJCA 2X5NA 4RMGA 1FBTA 2IYAA 3PWZA 2D2IA 4IGKA 1RQXA 2I22A 1G20B 3NWOA 1Y3BE 3PI6A 1Y80A 3WDSA 4BQNA 2CLEB 5CA1A 5I47A 3E3NA 4KWCA 3RJTA 4MQEB 1T5LA 1UZLA 2QWXA 1H4TA 4ENRA 3SZOA 2P0AA 4I14A 4CGYA 3SY8A 1EJBA 3RFXA 3PFHA 3D81A 4MROA 2L18A 1AUQA 2QPAA 4CCYB 1G8JA 1VRWA 2H63A 2ZTUA 3FE2A 3VC1A 5IMSA 4MUIA 4RC9A 2AOTB 3GGSA 3X43A 1P61B 4ZAFA 1H05A 2IH5A 1UM8A 2AL7A 4AD8A 1QCCA 3HR8A 3PZBA 3HR4A 3S4YA 3QOFA 3VYUB 4EELA 2D5IA 5GM1A 3RU9A 1JI3A 1RYHA 1IB0A 1UDAA 2NTYC 2I54A 1E4VA 2FMUA 4H59A 4HFRA 1MXHA 2OOSA 4EGJA 3OQMA 2B5OA 4BCDA 2Y1FA 4RETA 3I5UA 2FPUA 1E3WA 1UOOA 4DC0A 4E3ZA 1EGAA 3OF3A 3PYMA 1KK3A 4RHYA 4F2PA 1RXWA 1OASA 5FUXA 1YJBA 3RHFA 2FRDA 1QDEA 4XYLA 1OB5A 1P7CA 1RZ3A 2QW0X 2PXAA 5AKYA 2UUCB 1T5OA 2NO0A 4I36A 5CBPA 3U44B 3PXEA 1WHTB 4Q4JA 4QNRA 3QMWA 5K0LA 3TSOA 3EAQA 4HS4A 3MWJA 4RLHA 3E9RA 3B6MA 4P6VF 1VIVA 2CMGA 2IUFA 5GY7A 1KERA 1VGQA 2ZWIA 3RB8A 3PRYA 2ZYIA 1JSCA 4PC7A 3OD5A 3HXKA 2C77A 3AM5A 4NVRA 3WTBA 3DE0X 4QOHA 1PR1A 3ST7A 1P0PA 1TM4E 1GU7A 2LCIA 3VPDA 2OCIA 1SIUA 1JDJA 2BEWB 2YZNA 1VMEA 1CUZA 4KRXA 4Q39A 5K0TA 3R3XA 3QP9A 5J59A 2C42A 1WZNA 3BQNB 3KU4A 1V35A 1RPJA 4LHVA 4OQPA 1XCOA 4XB1A 1Y3IA 3LX8A 4J3FA 4FNOA 4X0EA 2Q5HA 1UKBA 5KTTA 1R0CA 3IUEA 5H9WA 1HDOA 1V6SA 1G21B 1T3LA 1YQTA 2B4YA 2R8RA 2CFTA 1V37A 1COWA 4XGNA 5JBNA 2HA7A 1TZJA 2B3DA 4BVGA 3T1OA 5FDFA 3I28A 1QVRA 2RGWA 2ONJA 4OQ4A 1DWPA 5IDWA 3BZUA 4TV9A 4DVGA 4OY3A 2ID8A 4EHAA 2QG6A 2GEUA 3ISTA 3EUEA 1P2VA 1WPXA 1QAMA 3B85A 5J4VA 1H8HD 2H2IA 3JQFC 4HYTA 1ZHHA 2FG7C 4I4TB 3VU8A 1JWLA 3HK2A 1M1YE 2ICAA 3LHFA 3ZIAD 5IHPA 1QTQA 3FPJA 5FBVB 1S01A 2W4MA 1XWWA 2O14A 2XTMA 4HAOA 4L4ZA 2FG5A 2HLDD 5EPUA 4UBNA 5HK8A 4DJFC 2HZ7A 1CUEA 3AI3A 1M73E 3ITNA 1TGYA 4E11A 1QE5A 5KWEA 1UDCA 4PXYA 3AB3A 1JP7A 3CRZA 3IC5A 3JTEA 3DFKA 3CRQA 1WPQA 4HDRB 5CD9A 3FOBA 1O4VA 3LA6A 2V4ZA 4F1WA 1RIFA 1NQVA 3GO4A 1OHHD 4BWGA 5CB4B 2WMDA 1J0BA 4FOOA 3CEJA 3HCAA 1T2FA 3RIYA 2JD1A 3A6DA 4ZCQA 4FYIA 5C7YA 1XTIA 3K0AA 4EI7A 1QVAA 3B1ZA 1Y8RB 3SX0A 3G0CA 4CM9D 1VQ1A 1IBMB 5C8ZA 2JFOA 3JR3A 4J1SA 4BP1A 2JGLA 1MQ9A 1OC4A 4GM1A 1ZOOA 4ZXPA 2SNIE 4N7MA 3FYHA 1P9LA 3HCCA 4Z9YA 5EMNA 4MH0R 3VZQA 3BFXA 4R84A 1SXJC 3BG5A 1DXQA 1N2BA 4KQWA 4HAYA 1MHPA 4TVOA 4UU8A 1VRCA 5DHAA 1JILA 2JFUA 2Q1WA 2IELA 4LYJA 4EKYA 2Q99A 3AR5A 3JQAD 2ZRCA 3GAMA 3JD0A 4KBYA 2PXCA 3R7WB 3SC2A 3WGTA 3KS9A 3MSXA 2H5IA 1W52X 2AFVA 4JQZA 4P53A 3WMWA 2EKPA 5B1IA 4B17A 4EYGA 3KKPA 2JAHA 4AN0A 1WW8A 1QHXA 3CB2A 1Q2XA 3ONFA 4P4NA 3TE7A 3AX6A 1CS4C 1EFAA 1K7CA 2JJMA 3MJRA 4FDLA 4RZXA 2RDMA 4FI3F 1YS9A 5C8YB 4UOEA 3DDHA 4W6QA 1TXGA 1N32B 2IHBA 1L4NA 1S2LA 1SZDA 4H7IA 2ZRIA 3ESAA 5F7ZA 1V1MA 5THKA 4REQB 5BRNA 4PRKA 2Q5EA 5FL3A 4WESB 1JAHA 1IBCA 3O4IA 4N82A 4UBMA 4ADSG 4AXBA 2WHEA 1U9JA 2XUIA 1EYZA 3IQDB 2J5XA 1EAMA 4TS4A 1VIDA 3WYEA 3E9NA 3RVRA 4K0KB 4P9NA 4IGIA 4BNZA 2CZGA 1N25A 1W94A 3QVTA 4DQLA 2YY6A 2VAXA 1WP9A 4UNSA 3A1WA 1H9CA 3DMFA 4TN5A 4NBNA 2QX9A 1M83A 2XNDA 1ICIA 3B48A 1MENA 2TS1A 2ZBPA 2RHLA 3CLSC 4UPEA 3KDAA 1EK0A 1R0RE 5DGHA 1AKRA 6REQA 1WPGA 2RH5A 1MTZA 3IV7A 2FSVA 3K0BA 3R6LA 4G5HA 5FUYA 1E7QA 3N05A 1DOHA 2P4SA 1I7QB 1SKYE 1LTHR 3MGBA 3G5UA 1ZA1A 3IKTA 2IXTA 4BVFA 4MB6A 1LBEA 2VATA 4UM8B 3GMTA 1CV2A 4YYEA 3NDRA 1O87A 1QGED 3C43A 1USWA 2FW6A 2FFJA 4G0NA 4E1BA 1JDUA 3GPIA 1OFVA 1QVZA 1TC1A 3BUSA 4OQLA 3HCWA 5AK0A 4K81B 2YXBA 3FTPA 4GMGA 4DSTA 3T3EA 2D1RA 2YXDA 3O95A 1TO2E 3QWIA 3RVMA 5BPFA 4E7PA 1FNMA 5H3CA 4F92B 3S0JA 5I6DA 4DPKA 3D6FA 2QTWB 1LSUA 2C5GA 1G1AA 1X3SA 3ZHRA 3MBKA 2HDNB 1ZVKA 1RW4A 3SIWA 3JX9A 1A9RA 1KYYA 1U9IC 1ONPA 2MYNA 2C7QA 1R5BA 2VJOA 2ZRQA 3A1TA 4Y6SA 1G7CA 4M1QA 5ERGB 1TF2A 3BXFA 1NF9A 1GN8A 3Q3CA 1KGDA 4HADA 5JALA 5IC6A 2XVZA 1PNVA 1O6CA 2RHCA 4AY2A 5EWJB 3INTA 1CF9A 3E1SA 4FJ2A 4JI1B 3RRXA 2QKYA 4PYQA 3LWDA 4GP9A 4TM7A 1XVLA 2DTXA 2OR3A 2EGHA 3GEBA 2BD0A 1JYEA 3O8LA 2QTNA 2CV0A 1X2EA 3K53A 1PJQA 1E1DA 3EXIB 4UREA 5EXDA 3W34A 2P9JA 5EHIA 3VO1A 1R12A 3G1UA 2GN6A 4EO9A 1DAFA 3ZHCA 2HV9A 1QG2A 4K0RA 3CWQA 4FVTA 4OMDA 2YJ5A 4NF2A 4CHTA 3BAFA 2JFVA 4K1LA 3TTSA 4DB4A 2HDWA 2HWXA 2ANBA 2WTMA 2DHQA 1N0UA 2BZGA 2WM9B 3A8TA 3R4CA 3UGQA 3P9YA 5JR3A 3J81k 1SUCA 4RY2A 3PVZA 3EGDA 3F5MA 4WKGA 1CE8A 5AKEA 2EZUA 1Z08A 1I1QB 5HWSA 4P80A 2R5FA 1BYUA 3EGIA 2NVUB 1L5SA 4QPZA 1OI2A 4CI9A 1YBMA 4CTOA 4N03A 4LZAA 2JFBA 4DV4B 2WNIA 4OQMA 4EY6A 4QG7A 2QVGA 1VLVA 4FWBA 4YWHA 5HS4A 4N41A 3BL8A 5FA6A 1AQYA 5EVJA 5IASA 4I9UA 1EUDA 1WOYA 3I4LA 4MJXA 4PLCA 1RKBA 4Z99A 5DOVA 5KC8A 1P44A 1GIAA 4ZRDA 3DFMA 5H0IA 4AJ1A 3EGWA 2E5LB 3ZJUA 1O97C 2YYAA 2WYHA 2Q6OA 2SKEA 4FYYA 4Y9UA 4X1YA 3OOEA 4F5ZA 2F3RA 4QAQA 5JI2E 1JEEA 5EJ6A 1BDBA 4IUDS 1GTVA 1I0LA 2RGAA 3U3JA 3ZG6A 1QHFA 3GPDG 2FNAA 5DHRA 5IT0A 4EJSC 1G6Q1 1DBPA 1XTBA 2XDAA 1GZ7A 1Z0DA 1ZLYA 1DARA 1HZZC 1JEQA 1FYFA 2DJ5A 2RHWA 2VSNA 3EODA 4N5NA 3B9BA 4TMVA 5JC8A 1VL5A 2JI7A 4KMOA 3FVWA 4M0DA 1NP7A 2R1VB 3MPOA 3ESYA 4PAQA 4YI5A 1NXWA 3JVEA 3QIVA 3RT9A 5BR8B 5I8ZA 5CCBA 1A97A 1VYVA 4I4IA 4O4LA 1N2XA 4WKPA 3RASA 3JYOA 1SXPA 1WVGA 4U1RA 1XPUA 1AD2A 1V1RA 2A6PA 3JQRA 2AN5A 4ZYZA 2FU5C 4O4HB 2YOHA 1D4FA 2ACEA 2FPGA 3JY6A 1VKJA 3D0RA 1P2FA 1EE2A 1RKUA 3TUZC 2GTPA 4PC1A 1C9MA 4IDPA 1ZH2A 3ZLTA 3TJZA 5GADl 2W6MA 2XW6A 2BI4A 5EKUA 5DYGA 1XEWX 1N0WA 1NP6A 2N3ZA 1U0OC 5A9TA 3DOOA 1UDWA 3GXBA 5IDQA 3U4MA 1RRGA 4E14A 3ZUPA 3VGPA 4C3OB 3NQ41 3SXJA 3K73O 2BZSA 1LPAB 2VO1A 3ODPA 3OOHA 2Z0MA 3VVLA 5A1JA 2FPPB 4KFTA 1UH5A 4RIIA 1FP6A 4EY7A 1Z8NA 1X70A 3KL2A 1MIHA 1P7VA 3MJCA 4GWLA 3HV2A 5GV7A 4KDRA 1N5JA 2IXAA 4IYJA 4RCYA 4EL0A 3KQQA 3V8BA 1JG7A 3WNVA 4LUCA 1OA1A 4HQLA 5CNIA 3TR6A 4LDJA 2VXBA 5JSZB 2AKAB 2Q07A 4KNWA 3DXYA 3TUIC 4HZGA 4LBWA 5CPBA 4WI1A 4MR7B 4C29A 2QTTA 3UUFA 3ORQA 4GPD1 3B70A 3K8QA 2LVBA 5CR9A 1A4RA 3JPYA 5K8IA 3QFFA 4M1YA 2I4IA 3UV7A 5LA6B 2XMBA 4QQNA 3CLVA 3G2MA 3HVIA 4FWIB 3T12A 2CXUA 3MB8A 1B2LA 1AB5A 1EK5A 1OPRA 2QTZA 4JLKA 4DR6B 1CUDA 1E4OA 4HTFB 3VHQA 2C8VA 5GONF 3I9LA 1DKNA 4CV1A 2QSYA 2XVYA 3W05A 1W35A 2OHFA 3TFQA 2W70A 5EUQB 2YMMA 5FJJA 1J5XA 2YZMA 5JSHA 4ASUD 3GW8A 2R60A 3H87A 1ULUA 1PJ4A 2FCAA 5IC5A 3PE6A 3EVZA 2P9EA 4B2IA 1Q7EA 3QXCA 3IP8A 4C9BA 2DLCX 1J09A 3MJHA 4P7BA 4CG0A 1A72A 2CHUA 1CQXA 4FS8A 4MRMA 4EZIA 3E61A 1OE0A 2O8FA 4ROTA 1ADBA 1KYIA 3N2GB 1MJNA 1WXEA 4G0PA 3ZX4A 3QXXA 3RS5A 3MNFA 4BN4A 1UBFA 1ZONA 5JAZA 2OILA 2PH3A 1OOEA 2V7TA 3K16A 4PANA 4RSHA 2QBYA 3RYHB 3SQDA 3JWGA 4B5KA 3U60B 3TRKA 2QTBA 4RACA 2JH3A 3CMMA 3KSMA 4A4DA 1YGYA 2G76A 3P9CA 4GLOA 3UFBA 3MMPA 4F97A 5IT9A 5DGDA 4B87A 4PBSA 3UENA 5SY4A 2QLFA 5EQDA 2Y8EA 2FPOA 2HUNA 1X1TA 2WU4A 3BGOS 2XA9A 3WYDA 4HFJA 1CY7A 1G3QA 1KJQA 2IUSA 3D59A 1AK9A 1X0VA 4U9IS 2P9FA 1WLSA 3NW9A 5FQOA 1G20E 1HQDA 1OX6A 1V8FA 2VK1A 1PJ3A 4ZYLA 2C0PA 3SG0A 5CT5A 1IPEA 4EA8A 3N2EA 5HOEA 3L6RA 3JQ7B 4OMUA 2OYCA 1CF4A 1R4ZA 3CNNA 3M81A 4K6GA 4CM9A 1U2TA 3O9ZA 1JSZA 3SX4A 1OYOA 2OSVA 4C4ZA 3O1LA 5AI8A 1Q0PA 1A50B 5BQOA 1RZUA 2BJHA 2CXTA 2QMOA 3UTCA 3B6KA 4H7PA 4YR9A 3ACBA 3L5OA 1EFRD 4BLSA 1H2BA 1SEVA 3FETA 5J5CA 3M6UA 4EPXA 4B3TB 5JAIA 5JO9A 4H35A 5M7EA 1XQVA 1RJ9A 1JKFA 2QN8A 5F2OA 1YBAA 4HNVA 3RVNA 4X44A 1N78A 1EUQA 2G7MC 1QBKC 2WF9A 3UXMA 3A4NA 3BIJA 2C4UA 5B2EA 2ZSHA 5SICE 3DC2A 3WNQA 3OIVA 3QVKA 3KD2A 1GVNB 3RVKA 2G5PA 2EDAA 3HXPA 1G4AE 4DSAA 1QO9A 2GKOA 3FPLA 1NWHA 3TRHA 2C59A 3RT7A 3QSYA 1IOWA 1G18A 1PVVA 1ZUNB 2FRXA 3LBYA 1J56A 4Q1BA 4PYLA 3EH1A 3NYIA 2O2YA 4OF4A 1ADCA 1GPYA 4CMEA 4G3XA 1W5AA 5LMCA 3PIRA 4E07A 3QY0A 2O3TA 2R6GA 2P5YA 4NBKA 2Q3DA 1SK8A 1FUIA 4E1AA 4F46A 4Q1VA 4B4DA 4ZTZB 2XE6A 5DASA 1GCAA 1SXJB 2KMLA 3IEMA 3MBIA 1KS2A 1TA4A 3C8MA 3B9RA 3VR1A 5I9NA 1UMCA 3ZDFA 1IN6A 1XVVA 2HREA 4OAPA 1B0UA 1N0HA 4DNOA 3U9LA 4OBXA 2I4MA 3HACA 4R0NA 4UD2A 2AFRA 3MT8A 4FMPA 3WLSA 3EG5A 4OHRA 4LHYA 3DLCA 4IIJB 3BCUA 2BGGA 5GJBA 1JU9A 3DEFA 3EOAI 5IC4A 4IMRA 2VYVD 2ZTHA 1KVUA 1VBKA 3K96A 4UHHA 2VZLA 4LY3A 1VP3A 4OGFA 1Z0FA 2OZEA 4WZAB 4X62B 4BLPA 4FZJA 2WPDD 2DULA 4ZQCB 3WGKA 1YC5A 4H4EA 2X8BA 3DTVD 3TI9A 3GBPA 1QU3A 1OUMA 1NT2A 1OX4A 1VLMA 3BJRA 4D56A 3TJRA 4GS5A 4PPQA 3SZGA 4J8PA 1M2KA 2XCLA 1WXWA 3P26A 4PGHA 3QWBA 1S96A 2OO5C 4LYDA 5K0GA 1XFAA 1ZWLA 4MW6A 4C06A 3N0RA 5AW2A 5KQPA 3F8WA 1Q77A 5E9JA 5JXGA 1BGWA 1USUA 2Z09A 1RRKA 3MJVA 4I5EA 2XXAA 2PZEA 1YV9A 2ZB7A 4D9MA 1PNTA 1CS0A 4RZUA 3RFCA 4I5DA 2P3QA 1X7XA 2C9OA 4HEA6 4V0LA 4ZYYA 3IBCA 2ZZMA 2CJWB 3RSZA 4AJ4A 2W4QA 4OFWA 5I7RA 4L4RA 5CJJA 3KPJA 1SFRA 3EDQA 4DIUA 3OTOB 2AMFA 3WJ7A 2RMKA 4QUJA 1N7IA 16PKA 2GK7A 2WILA 2A3NA 2Y6UA 3B89A 1ZK1A 3Q0TA 2LRHA 2DG2A 2WM8A 5ES4B 4UCQA 3DDZX 4BMDA 3K6JA 5JZMA 1Q17A 4GOJA 121PA 4EI2A 4G25A 2GYUA 3FTFA 3MTIA 2G08A 5TC4A 5FP0A 4Y2RA 1MAUA 5AW1A 4A82A 4CRWB 2D00A 3JQPA 4YJGB 6GPBA 4E21A 3WQQA 2P78A 2GFHA 4ZAVA 1HE2A 2BVNA 2GK3A 2IYOA 2PEZA 3F6PA 4Q1DA 1L5KA 3MC1A 3C4JA 4HH4A 1FTQA 3TQRA 3AL2A 1LK7A 2AMJA 1SUAA 3GLHB 1U0BB 1AKYA 2Q50A 1RQGA 3MT0A 2ZXFA 3V34A 3EF1A 3AXSA 3M1IA 3RTGA 3KQTA 4Y2JA 2GXSA 4HTAA 5FYDA 1SEPA 1XFDA 1ZL2A 2OCLA 1RAGA 2ASEA 3EC7A 3LCRA 4JJKA 4EA9A 4E33A 1Z36A 3O8DA 4QGFA 2GD6A 1W0JA 4E5MA 2YVKA 4CM8A 3EEIA 3NAZA 1HKUA 3O5AA 4DRZA 5EZYA 1WVMA 5LKAA 5DK6A 4TLCA 3GLIE 2EBHX 2RB4A 1C30A 3UBMA 4BZPA 4PPGA 4OOEA 4OLFA 3RS0A 4LOKA 4Z54A 5KYKA 5IZ4A 5HIMA 5F23A 3TM5A 5KAPA 3PA8A 2GM3A 3GUZA 2GR9A 3HUEA 3TLZA 3FJ1A 2ZB8A 4LRWA 4IICA 4V39A 3FJOA 4AYXA 5AW3A 4R3NA 2D6FA 2VDUE 3H2HA 4X00A 2VUUA 4CMBA 4YJ2A 2HMUA 4KN9S 3IDQA 4TXJA 1QFZA 5AUOB 3TCKA 1N2ZA 1KOFA 3V1MA 2BGJA 4BJ3A 4YRDA 3BULA 3RS9A 3BXHA 2GJ9A 3QPDA 2CLMB 4GX2A 4EA6A 3KVRA 2JLYA 1YZGA 4FLMA 3JWJA 4Y8VA 4D80A 3OCYA 3OQPA 4FW9A 5TB5A 4QU9A 2CJPA 3V2GA 4EVIA 1E6LA 3JQQA 3WFIA 3OQVA 4PLTA 3TTTA 1N77A 4MVYA 4L8WB 2GCOA 1MB3A 2VBGA 5JDCC 2Q4BA 1PYDA 4MYCA 5A5GA 1YZ3A 4TWBA 4M55A 2I2FA 3W5AA 1DB3A 3JQBA 1KY3A 5AJXA 5FWXB 3GB9A 1RPNA 5IKMA 1C0IA 4ZDJA 4UHKA 3HXTA 4RULA 4TRNA 5JCXA 4X45A 1JAZA 1CYEA 1SUIA 2HJ9A 1GPWB 4DMHA 2Y2UA 4B80A 2H17A 4B2YA 4AYTA 2QNIA 4XRRA 4JP5A 4ZVRA 4CQMD 1ZVMA 1PT6A 1XQ6A 3R6GA 4J3JA 3IELA 4JUIA 3LDAA 1KH3A 2QM0A 4ZC1A 2VJNA 5JVDB 3ZHQA 3SE7A 1YDGA 1KFJB 2FPPA 1Q0ZA 2M6RA 3T95A 3MCZA 4LE2A 4AMZA 2HJVA 1N2CE 4CWAA 5JRZA 3KLPX 4CL2A 3H04A 1HYBA 1CVLA 1RP1A 3OJXA 3TNDA 1AX9A 1RXVA 1ZISA 4A73A 1F2UB 4RFSB 4WGFA 2BGRA 3D1JA 1MG5A 5MFPA 3LPNA 3HRKA 3I62A 3CNEA 4MI3A 2C84A 2FX2A 4W8GA 3A9UA 1T91A 2I1LA 2OV8A 3NNNA 1XTJA 4EUNA 4IFEA 5KWIA 3PX7A 5IVKA 1BWPA 5D2CA 2YYSA 1IQRA 2PSDA 4LN1A 1S8NA 4BGIA 1EFUA 4TMKA 3AESB 5K5EA 3L7JA 3V7FA 3K4PA 4ZQBA 1W36D 5KNBH 3HKEA 4Q03A 1RMTA 4BGDA 3C39A 1A5BB 4ISCA 2QZPA 2OORA 3NKFA 2DBZA 2Y99A 3J80A 1NXTA 4ED9A 1Z2EA 2ZUVA 2CJXA 3HP1A 3A70A 4MRRA 2D1YA 1XF1A 3BJMA 5EMLA 2EYUA 2VKQA 3ETLA 2BP7A 3A05A 3HMKA 2E49A 1R2QA 1X1CA 3OQ6A 4N5DA 4RVHA 4BRZA 5HM8A 5IW8A 1YBFA 1P7WA 2X15A 4UU0A 5REQB 1V71A 1ODCA 3C24A 4MP6A 4OLAA 3OX2A 3ZY5A 1USIA 1H69A 2ES4A 5AVOA 4B3HA 1IEWA 4FR0A 5KQGA 2ZM5A 3Q88A 1JFSA 2ZJ4A 4O5OA 1Y1RA 4P33A 2ZSIA 1N7JA 3EXG2 4OFBA 2FF5A 2ZAGA 3T4PA 3F7TA 4RIHA 3L1HA 3LXMA 2Q5QA 4KQHA 4ND7A 1RWWA 3OECA 1YF3A 2Z8XA 2O1SA 1CX9B 1FFEA 1XYYA 2EFCB 4DAEA 1U1FA 4OQDA 1JXOA 1OXXK 1RYBA 1V8BA 4YMIA 4F3RA 2P4EA 1FK8A 5HQ3B 5A04A 2JCXA 3RADC 3MD9A 2MSEB 4R8LA 1QAQA 5FIUA 1KY4A 3CUWA 2YWXA 3EPHA 5ILGA 5EJ7A 3NC0C 4KJXA 4TLMB 2GN4A 1US8A 3ZY3A 4UNPA 1EJ0A 3FX2A 4I3FA 1F48A 1GG9A 2R96A 4QM7A 1IOZA 4NLLA 3NPMA 3QELB 5CURA 2BFEB 2WIGA 2BGLA 3ZNNA 1DV1A 1CEXA 3IEKA 4GUAA 4MVJI 2FUG6 4L27A 3UGKA 4B8WA 5K8TA 1LB1B 1Q19A 2A59A 3UVEA 2HUPA 4B8ZA 1AN9A 3WJ1A 1ULHA 3BMCA 1MABA 3PJFA 3OT4A 3PYLA 3VRHA 1DCTA 4LBYA 3MMXA 3LVRE 4XB2A 2ADMA 2GD2A 3RRMA 2YBEA 4Q1AA 1NLZA 1W0KA 2QSZA 2IYUA 2R00A 4BYMA 4GEGA 1EHCA 1P5HA 3TG2A 4HNQA 3HSSA 3TCXB 3DONA 1E2MA 5UKDA 1MV8A 4UHFA 1EG7A 3GOQA 3M9WA 1K92A 1O0BA 4FMDF 1FFXB 2HRZA 4QO7A 3RKSA 3EC1A 5EHGA 3QTBA 5L95A 1SPXA 1TUBA 3I2FA 5EJEA 3OAAA 2PX8A 4HXYA 3G5AA 1GNSA 4HUQA 3X44A 4YGYA 4PZAA 2O54A 4N1AA 3O2JA 5DYIA 3M4XA 3WKDA 5JH7F 2Q5CA 3I04M 4W4TA 2PNFA 1XQ9A 1MABB 4V0SA 4KW7A 2ZAIA 3AVVA 1CP2A 4DQXA 2FXVA 3P9IA 3ZLJA 1FDUA 3P9RA 1NG9A 1QRSA 2OY0A 5IEJA 3HVRA 3FLBA 4JLVA 3K9LA 5T4FA 5KKAA 2RIPA 1R27A 1P7PA 2VNHA 3ONWA 3G2PA 4LX0A 4OKSA 5AKGA 4DXAA 1W96A 3DXZA 5DSZA 1YNOA 5F35A 4KKXB 4JROA 4EBFA 2HJRA 2JK0A 1V3TA 2CFIA 1KEEA 13PKA 2QTMA 1O5IA 2ZR0A 4HS9A 1ZD2P 4KPUB 3THOA 3H83A 2F3PA 3IVMA 3MLEA 3PZRA 1KXJA 2W6ID 4QJIA 4AF6A 3ZHXA 3NOXA 1RQRA 1W93A 4DIDA 5MDHA 3FF4A 1XD8A 2IPNA 3VPXA 1GGFA 4X8MA 4Q7LA 4R54A 4X61A 5EP2A 1NJSA 1KI4A 2F8MA 1XC7A 2IOFA 3DAYA