4UNRA

Mtb tmk in complex with compound 23
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
209
structure length
186
Chain Sequence
MLIAIEGVDGAGKRTLVEKLSGAFRAAGRSVATLAFPRYGQSVAADIAAEALHGEHGDLASSVYAMATLFALDRAGAVHTIQGLCRGYDVVILDRYVASNAAYSAARLHENAAGKAAAWVQRIEFARLGLPKPDWQVLLAVSAEDAELQQRTGAVYAELAAQGWGGRWLVVGADVDPGRLAATLAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure Guided Lead Generation for M. Tuberculosis Thymidylate Kinase (Mtb Tmk): Discovery of 3-Cyanopyridone and 1,6-Naphthyridin-2-One as Potent Inhibitors.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords THYMIDYLATE KINASE
total genus 70
structure length 186
sequence length 209
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2014-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4unrA00
4DLTA 1Z0DA 3AVUA 4N3NA 5J4VA 1NN0A 1QBKC 3JZAA 1NVUQ 3OE7D 2CHVA 3K0CC 3ZQ6A 2H92A 4Q18A 2PZFA 4TTRA 2ZAMA 4TT3D 4PAQA 4B71A 4DJTA 1VDZA 4NYMQ 1II0A 5KNDA 3UK6A 2ZSEA 4RZXA 3WY9A 1SGWA 3SDZA 1G3UA 3MRSA 2H57A 4IDOA 2YNMA 3ZVLA 4LHWA 3TNFA 1HQYE 1D5CA 2OT3B 1XTKA 1GKIA 2FV8A 1JB1A 1XP8A 2WOJA 3BJIC 5DISB 2QGNA 2WKPA 4GOJA 2IYUA 3FVQA 4FMCB 3TSZA 1BKDR 1CP2A 3AF4A 3TVTA 3AGQA 3EAQA 1Z22A 2QMOA 3EA0A 1TPZA 1E9BA 2ECKA 1IXZA 3Q7PA 5EZ5A 3SHWA 3QY0A 5JHGB 1IN7A 5K8IA 1NI3A 1BIFA 1M8PA 4KLNA 3T35A 2UVQA 1P61B 1DTSA 4GPTA 4HDCA 4KU4A 1J8MF 2W6JD 2ODWA 2QP3A 4IOMA 5F3WB 4FMCF 3A6PC 2JLXA 1XTJA 1ZU4A 3MWYW 1YQTA 1KMQA 1VCMA 2ZPTX 4C4PA 4TMKA 3F3YA 2RGCA 4X8LA 1XD2A 1E2GA 2GCOB 2KE5A 4G0NA 3BRWD 5KSZA 5CB6A 4D26A 5JEDA 5FUXA 2N1BA 3SYLA 4TTPA 4II7A 4RVCA 2CLCX 3F0TA 2XITA 2EWWA 2PEZA 2QQEA 1KDRA 1MH1A 5JJKA 4U00A 3WRXC 2WWHA 1FUKA 5FL7A 1W49A 2ZR9A 3IIKA 4B44A 4X8MA 4TMWA 1SXJA 2QPOA 4DCSA 4TL7A 1AQYA 2WSSD 3QXXA 4RCYA 3ZZ0A 3CZPA 2V3CC 2GCNA 4PC7A 2X1VA 4QBIA 3ZZTA 3FDIA 1HA3A 1E1QD 1OFUX 1ZNYA 1OHHA 5AJWA 3MWLA 4B3BA 1IXRC 1Z0IA 2YINC 2ZS7A 4NTZA 3EPJA 1W0KA 4HB2A 5EE1A 2XTMA 3HU1A 4KVGA 1ONBA 3REGA 1R10A 4MRSA 4Z54A 4JJZA 1AM4D 2WSSA 2F55A 1BYIA 2MSDB 3FB4A 3MLEA 1BOFA 4EPXA 3U3KA 2WIBA 2P2LA 4U5XA 4C0JA 4C3ZA 1OXTA 1T4GA 1KZ7B 5DNYB 3BGWA 2IUUA 4HDQB 3D31A 421PA 3KQUA 3X1YA 2WKQA 1FFHA 3A37A 1I4LD 3OEHA 4JVLA 5C4MA 4LUCA 1YZUA 1CBUA 3IIJA 4WXPA 5KPJA 4RD6A 5DI3B 3W8RA 5EXXA 1FL9A 5F98A 4XVQA 2JATA 5HTKA 2R6GA 4HLUC 5DIFA 2R8RA 4LJ6A 4Q9LA 1E2FA 3A1UA 4C0KA 1ZJ6A 2IEZA 4GOKA 4CW7A 2W6JA 1R4AA 3RS0A 4C2TA 1EXMA 2QSZA 4KV9A 3EG5A 3ZYCA 2OCPA 5A0FA 4RZ2A 4Q4HA 2PLFA 4P32A 4IDPA 3ZVRA 1ZM4A 4QNRA 2NGRA 1XTIA 4GBMA 3PUVA 3WHLA 4YDHB 4AIIA 3K53A 1W4CA 2QM7A 5JZVA 4ACAA 2TMKA 2OCYC 1ESNA 4LRWA 3VKHA 4JYBA 4OJQA 1H8HA 1M7GA 4CGZA 4LJ9A 4B43A 5G53C 5HKKD 2J46A 4HLDA 4AK9A 1YE8A 3AP2A 4A15A 4I1SA 2C9YA 3S1AA 2XGJA 1F48A 4RZUA 2OHFA 4PPNA 4DSUA 5B30A 3TW8B 3FHCB 4A0GA 1D2EA 1W47A 3L43A 4IHQA 5FUVA 1FQKA 1T5LA 1XMVA 2C99A 3KUCA 5FOVA 3TE6A 4Z8XA 2B6HA 3L2OB 4JBXA 2RGNC 4L15A 3SZRA 1AS3A 1S1MA 2GNOA 2ZSDA 5CM8B 2AWOA 5FTMA 1KKLA 5EE0A 1MO3A 1NL3A 3MG9A 4NYJR 1YZTA 1JR6A 3WNDA 4X8OA 5AUPB 3RANA 4HAYA 4D25A 1C9KA 1A5TA 1KY3A 2OLJA 5IDVA 2ZI7A 2CNWA 2Z83A 2CE2X 4V0NA 5GJVC 3R9IA 2HT1A 4AC9A 3Q7QA 2OFXA 5AJVB 2GHIA 3VU9A 1ZBDA 4QC2A 4AG6A 2ZEJA 2JAQA 3QKTA 3GD7A 4O25A 5DE3A 2ZUDA 3C8UA 2QAJA 1UEIA 2DFLA 1VG1A 1XD8A 2AD1A 4M1MA 1U8AA 4NBSA 5A4JA 1E98A 1N0UA 5SZJA 1KAOA 4JL8A 3T06B 1JEEA 1OFIA 3CRQA 4UNSA 3IQXA 3KQKA 1GNRA 2OFWA 2XTNA 3I3SR 5DHFA 1T0JB 2IYLD 1GL6A 5DYIA 3LAWA 4EPTA 1O3YA 1UFQA 3E70C 3KJEA 2RGNA 4TSFA 4QRHA 4HUTA 2XZPA 4BEBA 2ZAOA 3IILA 1SKQA 1SVSA 1ZIPA 3OAAA 2ZRAA 2B7BA 2IYTA 4D4JA 4R71A 2NIPA 3QIAA 1EWQA 1G21E 2OEPA 1YR9A 2VEDA 3B7GA 4Q1DA 1NN1A 3JVVA 1Q1ZA 2A78A 3VFDA 1JJ7A 1QHSA 3FMIA 3MWKA 4PHTA 1CULC 1RYFA 2R6CA 3P1JA 1X1RA 1U2RA 3D7MA 3K0CA 2O8DA 1W4BA 4TL6A 2HYIC 2XSZA 3I8XA 3OAAD 1TMKA 3U4QB 4DKXA 2C9CA 3LXRA 3TH5A 2GVDC 3TAUA 1KMHB 4ZV4A 4WZAE 3AVXA 2W83A 1ZCAA 3WXMA 3SBDA 1QZXA 1T5IA 2DFNA 1ESMA 1NBMA 4LV8B 2LCFA 4WVFA 4UXHA 2WAXA 4PPFA 1KO8A 1YU9A 2QY9A 4HLUA 2XOKA 3BE4A 2JA1A 2BC9A 4FD2A 4E22A 2BEJA 3F5FA 2F43A 4NCHA 1NMZA 2HYDA 1N6KA 1ZINA 1XXHB 1R6BX 4N0EA 4LYAA 4KITB 4PAMA 1KO4A 2IWRA 3LY5A 1G3QA 5E7MA 2X8AA 5DH9A 3V4RA 1SXJD 2UZIR 2V6IA 3Q72A 2ZJZA 4OI1A 5JWHA 4Z1MD 4Y0VA 1NVVQ 3QKRA 5K8UA 5EP1A 3X1XA 3GJXC 3HYTA 1IN5A 4PAOA 4HEJA 2XNSA 3TR0A 2IYYA 3GLIE 2V8OA 4NCNA 1E0AA 4EPWA 5JRJA 1VHTA 1KAGA 1Q1QA 2G0NA 2V9PA 3B8HA 5FI1B 3SFVA 1TL7C 4NYIQ 1F60A 3RVBA 1IONA 1LS6A 2ZE8A 4M8NE 5E4FA 1P6XA 1P7CA 1UBCA 1R2QA 3BC1A 1SKYE 1W44A 2IHYA 2RGXA 3CPJB 1II9A 3GLHB 4Q9HA 3UIEA 2OCBA 4C7OB 3KTAA 1H8EA 2GVZC 4P3YA 1QHYA 1X1SA 1SXJC 1UBGA 4D2IA 1G8PA 1IY0A 4JSTA 1U0HC 5TARA 2QUZA 1AGRA 4A92A 3TMKA 1SVLA 1TF7A 1W46A 4Q03A 1XD2B 3OIYA 3NG1A 1KI6B 4ZDJA 4AI6A 2OBNA 1HV8A 4C0SA 2IWHA 1M6NA 4DDUA 2JLSA 2OAP1 3CZQA 4NONA 3RLFA 3EASA 1K6MA 2O0KA 2REOA 2XSZD 4ZIRA 2PT5A 2QRNA 1N6RA 1L4UA 1RRFA 2ATXA 2IXEA 2BHRA 1OHHD 3ND9A 4OHZA 2JDIA 3DPUA 2DR3A 3QPWA 3UMSA 1T8TA 3L8YA 4ZCLA 1NG1A 4YQFA 5GJBA 2FEOA 2J3EA 4FCWA 1E3MA 1KYIA 3PCRB 3T34A 4F92B 3LD9A 5DSZA 1XTQA 4TN1A 3RS2A 4PC2A 3REFA 3RAPR 3H84A 4NYIR 1P73A 3THYB 2GXQA 4QOSA 3HPQA 5HR5A 3OE7A 1NSFA 2VTKA 1NY6A 1UDWA 3IO5A 1C4OA 1RRPA 3SC3A 3W6OA 3ZD6A 1TTTA 1MT0A 1QHIA 1W5SA 2OAQ1 3VR4A 3FTQA 4Q7MB 2J0SA 1NMXA 1G3RA 2CXXA 5JSZA 1Z2CA 5EP3A 4BLPA 3ADDA 2C8VA 5BXQC 3CKLA 3I61A 4DCNA 3CBQA 3IQWA 3LX8A 3NKVA 3JZMA 4B3DA 1QVRA 4MA4A 2VP6A 3OFNA 3IDQA 5FI0B 3LX5A 1OIVA 3B82A 3W34A 3FHTA 3OEEA 1DELA 4G5QA 5CITA 3GLHA 1QHHA 3NXSA 1LNZA 1G5TA 4M2LA 2W2VA 2QGZA 1GILA 1G3IA 2VHQA 2AFIE 4A36A 4IOKA 4MRNA 2XJ9A 1U9IA 2Z4SA 4O2LA 1EFRD 5KTYA 1CIPA 2VSXA 2QBYA 3FKSD 2GZAA 4UQOA 3I32A 4PO1A 3FFAA 1N6LA 2OXCA 1EX6A 5ANRB 1N5LA 3AVYA 1DS6A 4I81A 3GJ3A 3NBZC 2NPFA 3WMEA 4A1FA 5C46F 1ZM9A 3PEWA 3AV0B 3H0KA 4IXMA 2Q3HA 2OUKA 1KSGA 3DDCA 3E2IA 2REXB 4OQLA 1SVOA 2RCNA 4IEIA 1IAQA 2BBSA 8OHMA 3ZVNA 5JJIA 3U61B 2FX3A 3VHLB 3ZD7A 3VR1A 3WBJA 1RJ9B 1CR4A 2A5JA 2FA9A 2X2FA 4IVRA 2VYFA 1HUQA 4QHSA 2ZSFA 1D9ZA 4QGGA 1CXZA 1X6VA 1XX6A 3FYHA 2WJVA 3QE0A 5LB2A 1Q22A 4C9BA 4PFSA 2W2XA 2JLVA 3K9NA 1W0JD 1JALA 3FE2A 3LVRE 1Z0KA 2SHKA 3I4LA 1TEXA 3QVVA 4LDJA 4OQFA 4XD7D 4TL8A 4D4MA 3I92A 3TUZC 1IM2A 1YRBA 2B7CA 3IO3A 5C2JB 1RRCA 1I4DD 4Q7KA 2V4ZA 1TU4A 1T9HA 3T5DA 2K5UA 2VF7A 2D3WA 4ZDIA 4XVUA 3EZ9A 3SOPA 1E9CA 3VR6A 3P27A 4GSYA 1QF9A 1UKYA 4M21A 1GITA 2ASEA 4HLCA 2ZJAA 2FWRA 2ZRMA 1VHLA 5M04A 2ZRKA 3MWJA 1NF3A 1ZM7A 1NVWQ 3IBGA 3PUYA 4XWKA 1SULA 3VHXA 3LQQA 4TMXA 4PO9A 3QKSA 2AX4A 1QVAA 4FMBB 4JMPA 1UADA 3TJZA 1E1RA 4JZKA 1F2UA 2GCPA 5CDFA 1OH5A 2ZI3A 1GP2A 1VG0B 2JLRA 1K5DA 2FSFA 1AS2A 4LV6A 5FR2A 2DYKA 2J59A 2G77B 2FH5B 4OHXA 2GBLC 2VP0A 4KXFB 4PPGA 3ZJYA 1L4YA 1YZKA 3P26A 621PA 3VMFA 2KBFA 4OHYA 3HU2A 2QAGA 3RNLA 3UKDA 4GI7A 4YONB 4QFMA 4DLUA 1DEKA 1MRNA 4V0LA 4ESVA 5CK5A 4Z1MA 2H8KA 1DOAA 4EJSA 1IHUA 4HUQB 4A2QA 4EFMA 1GL9B 2IYSA 4WIAA 4Q7LA 1KO5A 1NKSA 3RDPA 4B3FX 4M1YA 1NP6A 2WJIA 2CHGA 2ZS9A 4IRUB 4B32A 2VP2A 3RS4A 2ZIAA 5HCIA 1R8QA 3QF7A 4HAWA 4WA7A 4MITA 1XDBA 5JSZB 5L8VA 1NLZA 1A82A 3E1SA 1HT1E 1E0JA 2CHQA 4AKGA 4RFSA 4BFZA 3MGCA 1VYUA 2YOFA 4HUQA 5TVKA 1RFLA 1BMFD 2QN6A 3OIVA 4EQ6A 3NEJA 1YKSA 2AN9A 2NPIA 2GAOA 2QQ0A 2WJHA 1HY3A 4E07A 1AS0A 3EWSA 3KXLA 2V7QA 3TK1A 2BM1A 4G3XA 1XPOA 2ZYWX 1G20E 3DHWC 1T8UA 4PQRA 3R7WB 2WJGA 1QRAA 4LZZA 5EP4A 4B47A 2D2FA 5FOUA 5DHAA 1COWA 3CUEF 3R9WA 2C2HA 2CJWB 3K9GA 1KJWA 2R65A 3BBPA 5FOXA 2J0QA 5AK0A 2WWXA 3KKQA 1OYYA 1KKMA 2IUSA 2J45A 1U94A 3DO6A 4YMSA 3VR5A 2FFBA 4P31A 2MMCA 3ECCA 3FKSA 1UBEA 1OB2A 3O8CA 1B0UA 1IQPA 3LW8A 2DHRA 2YWFA 1FTSA 3GEIA 2OXRA 5FFMA 3WHKA 2YJTD 3QI2A 4L9SA 1G17A 4QHYA 4QKQA 4RKFA 4XTCS 5JRZA 2I1QA 2JGNA 3NHAA 2GJKA 4JLMA 5CIQA 4Z51A 1N6IA 2WWWA 4RD4A 3SJBA 3PUXA 5C1BA 1KK2A 1XWIA 1G7CA 1TQ2A 3MMPA 2A5FA 4BZQA 1MABB 4C0HA 4PC3A 2GJSA 5FPTA 1G64A 1Q20A 4OI2A 1I2DA 1M1YE 1PJRA 2CL7X 1HH4A 2CK3A 5IT5A 1OXVA 1E4YA 4DIDA 2GZDA 4HSEA 4TMTA 5IK2A 4ARZB 3FWYA 5EP2A 4CVNA 1XMIA 2OE2A 1Q1EA 1VCIA 4LYFA 5L3SB 2OO7A 4Q02A 2ZRIA 4MQBA 5SZKB 3DKPA 3RS5A 4B3CA 1OE0A 3QUSA 3AF0A 3Q5DA 3HDTA 4UNRA 1RPZA 1FOEB 2DWPA 1VPLA 2Q6TA 1SVWA 2ZRFA 2V54A 1G9XA 3IHWA 2OBLA 4JSYA 2WWGA 3LQRA 1LV7A 4PZZA 4BFWA 5F2EA 1XEFA 4L9WA 3EPHA 5EE5B 3GFTA 2IC5A 1S9HA 5JHHB 1E2QA 1M2OB 1E2EA 3OHMA 1JPJA 1Q0UA 2VHCA 3EWAA 3UMFA 4ON9A 2YVUA 4QM6A 2IYZA 3A8TA 3U3JA 3ASZA 2WICA 4DLXA 2AK3A 3Q5EA 4BFYA 1E0KA 2FDCA 1VIAA 4DSOA 3LBHA 1XPRA 2FPMA 3CRRA 4C2UA 4QJ3A 4JVNA 1KSFX 5FPYA 4EQ6B 2XZOA 2A5DA 2AXNA 4MYUA 2QEQA 3LW7A 1GKYA 2JLUA 1SKYB 1RC8A 1U98A 1N5IA 3LVQE 3M0EA 2JJ1A 1D2NA 4Q48A 1IJEA 4OHVA 3K9HA 4TYNA 1R0XA 2H1LA 4U02A 4E09A 4O2RA 2IA5A 2QPAA 5AR1A 2BMFA 4CEIB 2PL3A 3QBVA 1YR8A 2QU8A 5LB4A 4BFTA 5BW8A 3ICQB 2HJVA 5LBIA 3AF3A 1S0UA 2ORVA 3C14C 3IGFA 4ZCIA 2BM0A 3GFPA 3QXJA 1E1RD 1TQ6A 5TB5A 2GDJA 2GXSA 2OG2A 2GWHA 4D0NA 5KO2A 1Z08A 4CF7A 3RC8A 2CK3D 4C0AC 3U44B 4UNNA 5B58C 1KJYA 3CWQA 3NWJA 3W3AA 2O8CB 1ZW6A 1JXOA 1SHKA 2AK2A 1ZM2A 2EFGA 1XMJA 2PJZA 3CX6A 3H1TA 3KJHA 4NZYA 4ZO4A 1E1QA 5FR1A 4QM7A 3A4LA 2KBEA 2ZITA 3M6AA 4Q1FA 4A2PA 3Q9LA 1CU1A 3T1TA 2H16A 3EARA 4F38A 4DLSA 2ORWA 2F3RA 2A3RA 2ZJYA 2ZUCA 3VX4A 4DSTA 2ZRGA 3KJGA 1M7BA 3KJIA 1PZNA 1G6OA 3VAAA 1D2MA 3TKLA 3X1ZA 1E4VA 1NY5A 2F9LA 2ZJ8A 1XPUA 4M9ZA 1R0WA 3B85A 3CR8A 3QF4B 5DI3A 1U90A 1TQ4A 4DRZA 4A4DA 2GAAA 3HR8A 4URXR 1DG3A 4MRRA 3UMRA 1NNEA 4URUR 4MRVA 4K46A 5IF9A 3B9QA 4Q00A 5KNCA 2XJ4A 3CRW1 3SR0A 3GJ7A 1N0VC 1E2PA 3OF5A 4NCKA 3MCAA 2ZRJA 4EJSC 1XD9A 1E2NA 1MR3F 3K0FB 4K81B 1E32A 1KHTA 2VP5A 4ITRC 5FOWA 4LV5B 1NJFA 1FUUA 5EE3A 221PA 2FGKA 1D9XA 3BB1A 2WWYA 1G18A 1P9WA 2QAGC 3CO5A 1ZC3A 3ZH9B 2IF0A 1BYUA 4F93B 1YR6A 4HAUA 2GBLA 1KOFA 1KDPA 5FBVB 2ATVA 4HB0A 4IXNA 4XVRA 4CEJA 3RRNA 4Q1AA 5KSOA 1KI8A 3FFBA 3AVWA 1Q3TA 1UDXA 2XOKD 3GMTA 2VA8A 3EIQA 3PENA 1KJZA 4NYJQ 2CJWA 3QOFA 3AF2A 2J41A 3FMOB 4A6XA 2NOAA 2NZJA 2WPDA 5FOSA 1FW6A 4UXJA 1DO0A 1D8TA 4JLKA 3SQWA 3VKGA 3AQ4A 1ZMXA 4QGFA 2ZRLA 1JXMA 5JS7A 2QMHA 1WDTA 1NKTA 3LXXA 4JVMA 1ZRHA 5GVSA 1E9RA 3KX2A 4RFSB 4W7SA 4W9MC 1HYQA 1P4SA 2VPPA 4IOJA 3DVLA 2CL6X 4HDOB 1UAAA 3U6BA 3LWNA 1JAIA 1KI6A 4LGMA 1Z6XA 1N6PA 4MYCA 3SE0A 1VKJA 1GWNA 1VMAA 1ZNZA 1FZQA 3KDSE 3MFYA 3QNUA 3BK7A 4US2R 2IX3A 3WNBA 3QXHA 2JIZD 2WIAA 3RWMB 1Y63A 1YVDA 1CR0A 1EFUA 2BJVA 2XNDA 2ZR0A 2FU5C 5H1YA 3D8BA 3NBFA 4TQ9A 1Q57A 3L0IB 5KSPA 4BZXA 1FNNA 2D4HA 1SXJE 3AP1A 3O8RA 1E79D 4IJMA 1N6NA 3CNLA 4HZUB 1KSJA 4BFVA 2ZXUA 1G7TA 2DWQA 4D6PA 4W5JA 2YOHA 2HT6A 1WBBA 1U0LA 4LBVA 1E2KA 3K8YA 3PV0A 4LJ4A 1N25A 2VP4A 4TQAA 3GLFA 5TMPA 3BD9A 4I1OA 3I5XA 1E9FA 1T0HB 1MV5A 3HP1A 3W6PA 2OILA 1JI0A 1J70A 3AB3A 3U3RA 1U9IC 3WP1B 3CPEA 2IYRA 4LHZA 3QKSB 1JNYA 1G5RA 3LBIA 2N46A 4WOPA 2HXSA 2H7VA 3BH0A 1XNJA 1XXHE 3AKCA 3PUZA 2IEYA 1XXHA 3TAHA 1RVDA 3FKQA 3L0OA 2O8EA 1GSIA 1JR3E 4BECA 3RRMA 2C9OA 3UPUA 1OKKD 4R9UC 4FXPA 3TW4A 2XEXA 1L8QA 5DO9A 3KKOA 4TL9A 2ZYTX 3M1IA 4QJ4A 1UKVY 4PXAA 4YDSA 3AH8A 4LC1A 2YYZA 3DM5A 4JLNA 1E2JA 4QL3A 521PA 3K0SA 4POAA 1R5BA 4JBWA 4DBLC 3Q85A 1S8FA 1IN8A 2QMUA 3CF2A 3KB2A 1XZQA 4HAVA 4QHTA 1ZAKA 5G40A 4BASA 5CK4A 5CM9C 2RB4A 2VSFA 3NBYC 5K8LA 3HJNA 1UJ2A 3N2EA 1W36B 1G19A 4B3XA 4H9GA 1GZSA 3EZ6A 3AGPA 5F9FA 2JJ8A 1YZGA 2BKEA 4WXRA 3RRYA 1U81A 2JJ2A 5JS8A 2ZSBA 3EPKA 4MDFA 4B33A 3BFXA 2QT1A 2CLDX 5CLQA 5FUYA 3IBYA 2GXUA 1ZCBA 2KB0A 3BFVA 1QDEA 1G291 1OIXA 3WRYC 1KTVA 2ZJBA 3BH7A 4MGKR 1F2TB 2RAPA 4HI0E 4BZPA 4BFSA 3SEAA 1DO2A 1Y3AA 2A5YB 5J4LA 5CYOA 3LH5A 3IUYA 4EAQA 1UEJA 1QHGA 1CEEA 5EXPA 5JWOA 2W0MA 1G3MA 2ZI4A 3N2IA 4YXWD 1S96A 2HCJB 3ZIAD 4GDFA 1T3SA 3W5IA 4KCGA 4PHGA 1CF4A 1YR7A 5EUQB 3SFZA 4TYYA 3U5ZB 4FWTA 2F9MA 1OH7A 1GDDA 4TMZA 4MKHA 2QSYA 1EFRA 1KO1A 4GFDA 5JJLA 3LV8A 3U6KA 2X2EA 5B64A 3GJ5A 2G1KA 3THXA 3FOZA 1AZSC 2FSIA 1PLJA 2AL7A 2EWVA 2PBRA 2FZ4A 1DE0A 2F1IA 1MO5A 4OYHA 3W8NA 1IY1A 4OJKA 4LBWA 4G5RA 1UKEA 2EFEB 3C16C 4PX9A 4TLEA 2PZGA 4LHYA 5H70A 3EIEA 2ZUBA 2MMGA 4DB4A 1R5NA 3QVUA 1ZD9A 2QP4A 2DFTA 1RW4A 1K5GA 2AHOA 3HYRA 2OESA 1DAIA 2DY1A 1V43A 4DXAA 1HURA 5E3HA 3KKPA 1AK2A 2F1HA 4Q9IA 1CR1A 1W4AA 2FFHA 4GP6A 4A6PA 3DOEA 4NH0A 3ASYA 3OZXA 2YWHA 5D3MA 1M74A 4YLGA 1JBKA 3A58B 1W5TA 1A2KC 2V6JA 2IT1A 3AKYA 4IVQA 4MKFA 3K9LA 3A36A 4I1UA 3RHFA 4JBYA 4WBSA 2JJ1D 2EFCB 1EG7A 4XIGS 4AKHA 2VHUA 5JCZA 2WZQA 2UZ3A 1J90A 4LHXA 4D0LB 4QGHA 3QG5A 2ERXA 2QENA 1G1MA 5FPHA 2ZRDA 3GPLA 4KSCA 1JR3D 2ZI5A 1CRPA 1XTRA 1W48A 4IVPA 2F1RA 2ZYUX 5L3QA 2D7DA 1E9EA 1N0WA 2AWNA 5GJCA 2BMEA 2C78A 3GLIA 4G5OA 3CLVA 4LY6A 3K70C 2FN4A 3NIBA 4AWXA 1DARA 4LWZA 5E7IA 4A8JA 2FEMA 3V4FA 4XD7A 1QG2A 2ZI9A 2QA5A 1MO4A 1VYTA 2R6AA 2J87A 4KBGA 1JR3A 3AKDA 2E87A 2BEKA 4CEJB 4ERNA 4MH0R 4URYR 4UJ5A 5KSYA 4D81A 5LPNA 3X1DA 5BYKA 2C04A 1QG4A 2FE4A 4GMDA 4JLOA 1RE0A 2XZLA 1TADA 1BH2A 2QORA 3RWOA 2KI5A 2UKDA 2IYQA 1G7SA 3K0AA 4JT4A 3TUIC 2RKOA 1SQ5A 2HUPA 4KBFA 1DG1G 4HATA 4JLAA 4TLAA 1JQLB 1I2MA 4UJ3A 6Q21A 5JBQA 1P2SA 3LLUA 4HAZA 2C98A 4B48A 2CL0X 4KI0A 4V03A 1W4RA 5EXSA 1NRJB 2P6NA 4LK2A 3RSLA 3TSOA 4A82A 2RGGA 1W0KD 4GOXA 1KI3A 1WA5A 2WM9B 4A0HA 4DT1A 2H18A 3BIFA 2GZHA 3NH9A 2ZREA 1P72A 3ZQJA 2GEVA 5FBQB 3ZLJA 1AGPA 3RABA 3WBKA 1XEXA 5A5GA 4Q66C 3PG5A 3R8CA 5JI3E 3M4YA 1GNQA 4CYMA 2IK8A 2D74A 2QRZA 3KKMA 3EPLA 1KGDA 1XCGB 3UANA 4KFUA 3ZDQA 2GKSA 1X3SA 3B60A 2FFQA 2XXAA 1E6CA 2CCJA 4AKIA 4PQYA 4E5UA 4HLQB 1OJLA 4Q4JB 3KQLA 4LJ7A 5KDLA 1G8YA 1OFTA 1XZPA 3I1FA 1YZLA 3CH4B 1Q12A 2WHXA 4M1SA 1EFHA 1KK3A 5JCPA 2XB4A 4OK6A 2BCGY 5JFGA 4GMXA 5LD2C 4OQMA 4V0OA 3U7HB 2QG6A 1KI9A 2ZU0C 2O8FB 1WXQA 4HB4A 4LJ5A 4DUGA 2D62A 2D2EA 2OCAA 3UG7A 4AYTA 4TQUS 3GEHA 4IDHA 2NTYC 2V7QD 2R9VA 4B35A 4IFEA 1CJTC 3TUJC 2XXAB 2GCOA 2R6DA 2AXPA 4LC0A 1S9DA 1V5WA 2JDID 3CR7A 5HKKA 3IKJA 4B2IA 2ZU6A 2P6RA 1R0YA 3EZFA 1P62B 2YKGA 1E94E 3AF1A 4FIDA 4JKYA 2PMDA 4FWIB 1CS4C 1IXSB 4OI0A 4TLDA 3O8DA 3N5CA 3ZVMA 4EIWA 1GRQA 2G1JA 3KKNA 2ZS8A 3AUYA 1PVOA 1M34E 2E1RA 2HF9A 1GAJA 4KODA 2GETA 3GLGB 1Z63A 4CDGA 3X2SA 4DVGA 3TLXA 4V0KA 4C7OA 5J4KA 3K09A 4JLBA 4J0QA 1IY2A 3V9PA 2AKYA 4CRWB 1KY2A 1U8YA 3ICEA 2X19A 1MOZA 2HEIA 5LDDC 4LHVA 5L3RA 3ADBA 3R9XA 1EWRA 5FBWB 1GOTA 1YHNA 5CJPA 4BGDA 5KPDA 2B92A 4DIEA 3GFOA 1G8FA 1F5NA 1P2VA 2PX3A 4CEHB 1SZPA 2IXGA 3NDBB 1X8JA 4XWAA 5JI2E 2J0VA 1KDTA 3NC1C 5H68A 2VRWA 3QQ5A 4B76A 4M9XA 2RHMA 3SYKA 2HCBA 1R0ZA 2DCUA 4WZBE 1P3JA 3QEJA 5DN6A 2A7QA 2G6BA 1LVGA 2BKUA 2PZEA 4M9QA 4BLQA 4ZCMA 1Z3IX 2HV8A 4PSKA 1F3OA 5KUTA 4G5GA 3KFXA 4M1TA 1CTQA 1P2TA 3B1YA 4DHEA 2B8WA 4TLCA 3P20A 4MDEA 4A8JC 1E0SA 2ZTSA 3QKRB 5TDHA 4NHOA 2BBWA 1WMSA 5EXTA 5EJEA 1W36D 1NLYA 2FG5A 3DL0A 2IL1A 4R98A 2J0UB 1J8YF 2LKCA 4DDTA 4UKDA 1OKKA 4PSVA 4IDNA 4XSGA 4DSNA 5G41A 4LYHA 4JYCA 2P0EA 1MRSA 1ZUIA 2EFDB 4URVR 3K09C 3VKWA 3DEFA 4NP6A 2VP9A 4QG7A 2WTUA 2BIFA 2O8BA 5BQ5A 1CKEA 4BRUA 4AYXA 2O8CA 1E2IA 3KFVA 1OFHA 3PEYA 1CJKC 2OM2A 2JASA 4KAXA 2REBA 4H1VA 1Z6YA 1P9RA 1ZP6A 4PANA 3QEOA 5FBLB 4F4CA 1OB5A 4DLYA 1BS1A 4RZ3A 3C5HA 4N1AA 1L2TA 1Z6GA 2YV5A 4HAXA 5J47A 5B2ZA 4TYPA 2VIIA 4B2PA 5TY0A 3K70D 2QBYB 2C03A 4JLJA 3PITA 4M53A 2KJQA 4US0R 2O8FA 1DAEA 3A4NA 3SU8A 1XRJA 5J4HA 1CR2A 4MKGA 1W36C 2GA8A 2DB3A 3SQXA 2FZLA 2VH5R 1Z6TA 2F6RA 4IKEA 4RFVA 1E99A 4OBEA 1JECA 3THXB 4MUBA 1OXSC 1LTQA 2OLKA 4FCTA 1M7HA 2Z4RA 3OEED 3PJRA 1R5OA 1MO6A 1NN3A 1G41A 1RIFA 4Q01A 1AZTA 1NIPA 4Q4AB 3U3MA 1ETUA 4DC9A 3THYA 1Z0JA 2CMKA 4B74A 4JKIA 4KO8A 2A30A 1FP6A 1ODFA 4AG5A 2IS4A 1E9AA 1XMSA 4M1OA 2QL6A 3EIHA 1Z47A 1TEVA 4PHHA 2QT0A 1E96A 4MGYR 3ND8A 4Q7JB 1VECA 2WJJA 1X8LA 1T91A 3L82B 3TQCA 4RD1A 2R44A 2QNRA 2OFOA 2AKAB 4XSHA 2QTVB 1FP7A 1COWD 4FMDF 5CYPA 3HPRA 4Q4JA 2YOGA 1A7JA 1TAGA 4DCUA 4IFBA 4OI4A 4BWYA 1PUIA 4MUAA 4JLDA 2VBCA 3CF6R 1U8ZA 5ELXA 3GLHE 3CRVA 1RRGA 1A2BA 3Q8XB 1E9SA 3K0FA 2Y8EA 3GEEA 4FMDB 4MGZR 1LF0A 2G88A 4KHZA 2ZVQX 2ZM5A 2RGEA 5BN4A 1IOZA 2HJGA 4IEEA 2IF2A 3FMPB 1KDOA 4MRPA 2ZETA 3BB4A 3H4MA 4KYUA 3ZS8A 4W5HA 1VCOA 2H17A 2WMOB 2CCGA 2RGAA 2L0XA 1VTKA 1PUJA 1AA9A 1SVKA 1FPMA 5G3YA 1T3HA 2ZE7A 4ABYA 2ZRHA 3B13B 1OT3A 1Z5ZA 2WWFA 3THWA 2G9NA 2RHDA 1LFDB 1Z07A 3BOSA 3AVQA 4AKEA 1Z0AA 3QXSA 3L8ZA 2CVHA 4Y0AA 2GILA 1GFIA 1F6BA 4BLOA 2GK6A 3I8SA 3QPUA 4S2EA 3KXKA 3PUWA 3K0AB 4NCIA 4O0MA 4V02A 4RJLA 1Q44A 5HZKA 1G5PA 1E2DA 3IEUA 3SYNA 1WF3A 5JECA 1XFAA 1G6HA 5FTLA 2B8TA 2YC2C 2GEUA 2I1VB 1EGAA 4GL2A 2ZE5A 3C15C 3LFUA 4JLPA 1WP9A 4A8JB 3OIWA 4URWR 2J1LA 1Z8FA 4G1UC 4Z8YA 1GTVA 1Z83A 4GNKA 2P5SA 5P21A 2VSOA 2W0SA 5BN3A 3WMGA 2PEYA 2NQ2C 3QBTA 4QGAA 4WAUA 5CJ2A 2IS6A 1CLUA 4U7DA 4HZUA 3RRZA 3BERA 3QPVA 5KDDA 1II8B 4DZZA 4MGIR 1N5JA 2Z43A 1TNDA 3WNCA 1X86B 1DAMA 5KHOC 4OL0A 121PA 4NMMA 5HCNA 1VG9B 2PCLA 2QPTA 1AJEA 4NU0A 1KNQA 1LW7A 4HB3A 3EX7C 4F7WA 1KZGB 1NIJA 1TUIA 2IYWA 4BPBA 1Z6AA 2VF8A 1GNPA 3THOA 3T15A 1JPNA 3L0PA 4Q4AA 2VHTA 3N70A 1Q1BA 3PFIA 2NO6A 4M4SA 4OKSA 2YZ2A 4KFSA 5J40A 3I62A 1KI2A 1A4RA 3AM1A 3ADKA 4AYWA 3AKEA 4BEJA 4P4SA 1YZNA 1P5ZB 4S35A 3T1QA 2KSQA 4P33A 5KU1A 4BQSA 4XJXA 3PEVA 5AUQA 3GLFB 1W2GA 1G16A 3KQHA 1NBME 3DMNA 4V0MA 1ZC4A 3SN6A 4QBFA 4LJYA 4MYTA 3K70B 1DAKA 4B3GA 3MAAC 3BXZA 2WV9A 1PLLA 5CDFE 2R2AA 3R20A 1E79A 2Z5FA 5L3SA 2NZ8A 1UM8A 3MSXA 3TGPA 4D4KA 1IN4A 1XEXB 2RGDA 1IBRA 3H86A 4M1KA 2ZRPA 2ZJ2A 5B57C 3SJCA 2O8BB 4UXIA 3CB4A 5KNBA 3KQNA 2ZRBA 4M9SA 3BB3A 3GJ0A 2HXYA 3NBXX 3TIFA 4BLSA 1LB1B 2A2ZA 2BMJA 4GRAA 1XCPA 1OXXK 4RD3A 3QXCA 3AVTA 2Q3FA 5E95A 1DPFA 5AUNB 2BJWA 3BORA 3KUDA 3LNCA 1EK0A 2PX0A 3GLGE 3IPYA 1S1CA 2QTHA 2ONKA 3EW9A 4BUJA 2ZANA 4PQFA 3B2EA 2BBTA 4I99A 3B1ZA 2EYUA 4LI0A 3T61A 1OH6A 1FQJA 1NN5A 2JLQA 3IPXA 4M0LA 4YC7A 3AVVA 4TYWA 2P65A 3CW2A 5HPYB 5FTKA 1HE8B 1ELOA 2J5XA 4K8OA 3V00A 3MD0A 3QF4A 3PXGA 4B73A 2O8EB 4XWOA 3HR7A 3H2YA 4KFRA 1DAGA 4TWZA 4LJAA 4DLVA 1S2MA 5UKDA 2CVFA 3VX3A 4ASUA 1OLOA 3TR5A 3GP8A 3TQFA 5SZHB 2PLRA 4HZIA 3A1VA 3U7EB 1ZUHA 2OBMA 4ZKEA 5TV2A 3B5JA 4PR0A 2FNAA 3G5UA 1BMFA 2GJ9A 3CF0A 4FCVA 2YWGA 1AQUA 1D6JA 3K0EA 5FL7D 3IIMA 1ZD8A 4PPQA 1SVMA 4ASUD 3X1WA 4Q1BA 3W3ZB 1GIAA 4C0LA 1G7RA 3P4XA 1GUAA 2GF0A 3SNHA 4PZLA 1OH8A 2O0HA 3PIRA 4RSGA 2GEDA 5C4GB 1P2UA 2GF9A 4A9AA 2JCSA 5FH9A 1KNXA 2PJRA 4CIDA 3QSYA 4GZMA 3C5CA 4LX0A 1W7AA 5H8WA 2NO7A 3NDPA 2QI9C 2ODBA 2IS1A 2Q0HA 4WZ6A 4I1VA 1FMLA 3WYFA 3ZIAA 5IHPA 2WJYA 3P4YA 5AWFC 3VU9B 3E5HA 1WE2A 4Q19A 4XH9B 2XAUA 2O8DB 1OW3B 3QKUA 3RYTC 2RH5A 2XB2A 3W9YA 1CJVC 5EE9A 5J5CA 2ZROA 3T12A 4HYYA 4OHWA 1GG2A 4M1WA 2FJUA 3SI7A 3CX8A 1DAHA 5FPKA 2YC4C 4R2IA 4XTRA 4BFXA 4JLVA 2F3TA 2I3BA 1N5KA 1R8SA 2QZ4A 1R7RA 1ZYUA 3GCGA 4D0GA 3AVPA 3BH6A 3NTUA 4R7ZA 1XF9A 2ERYA 2FF7A 1U99A 4QJ5A 4FINA 3UG6A 1BO6A 4F4JA 2IUTA 3TVDA 3NVAA 4P4UA 4B6FA 4NKRA 2C96A 2NO9A 1SVIA 5KYKA 1NVXQ 4ZI3A 2WWIA 3IHLA 4IW3B 2IW3A 4NDZA 2AR7A 4F4IA 2IYVA 2AD5A 4TT3A 1P9NA 3UATA 3TBKA 1J7KA 3B1VA 1GM5A 4DLZA 3C41J 5EUMA 4D4LA 3KB1A 3QJYA 1JQJC 2W6ID 1OYWA 3PEUA 4EPYA 1Z28A 1NBMD 1XU4A 4LPKA 4LSGA 2QE7D 2G3YA 2A9KA 2P3SA 4QBGB 4RY2A 1XJCA 3Q3JB 1E2LA 1N2CE 2X77A 2EYQA 2NO1A 1T3LA 1TQDA 2P5TB 3C4JA 3GJ6A 4AY2A 2BWJA 1DADA 2F1JA 3G82C 3OESA 4URZR 5IRCD 1AIPA 1QHNA 3CH5A 1VYVA 4PC6A 4A0FA 3B1XA 4KFTA 4LCBA 1NVVR 4EFLA 4BRWA 2Q9AA 3U60B 1WB9A 4B6EA 3D6TB 1GRNA 4Q9JA 4DWJA 1II8A 1VG8A 3PVSA 4DT1B 1OXUA 5G3ZA 1US8A 2VQSA 5EQTA 5KDOA 2WBLC 4JVSB 2Z6VA 1GKUB 5FTNA 1HEIA 1LF5A 1YJ5A 3BAFA 4NPHA 4DLRA 5FUWA 4TZ0A 2I4IA 1NMYA 2DPXA 3SS8A 3EZ2A 3NEYA 3O47A 1W1WA 1KO7A 1NLFA 4DDWA 821PA 3F8TA 2HDNB 1OSNA 2W2TA 3W5JA 2VO1A 2IYXA 5AUOB 2WSMA 3B9PA 2VLIA 3CX7A 3CRMA 3GJ4A 2A5GA 4LOAA 721PA 1ZNXA 2QMEA 1J99A 4D80A 1U0JA 1UPTA 1H8ED 2WMNB 4P0TA 2QP9X 5DN6D 1DAFA 4B34A 1WBDA 5CLLA 4UNQA 2JLWA 1C1YA 1TX4B 2DWOA 2Q9BA 4Q4HB 1T6NA 4RD0A 1G4UR 3VNUA 3UXMA 1HQCA 2JIZA 3GLFE 4Q4LA 4FN5A 1Q21A 2IXFA 1KMHA 1G4AE 2N42A 2ZE6A 4EPVA 3LBNA 4TSFD 1XJQA 4FI3C 2GJAA 2YWEA 2EU8A 2EW1A 2OZEA 3ZS9A 1E9DA 2WPDD 2KWIA 3PQCA 2W6IA 2W58A 3QG1A 4H1UA 1FX0A 4EFNA 3U3OA 2ZRCA 3A1TA 1PV4A 4XOIA 3U2QA 4W5WA 4Q47A 4KVAA 2ODEA 3K1JA 4QXAA 2FFAA 5KOYA 4JIMA 1RKBA 2D7CA 1O87A 3ZZUA 2CCKA 1LY1A 4PC1A 2NG1A 3JVUA 4N0DA 5BYJA 3I73A 1ZU5A 2IHBA 4GZLA 1E69A 4GP7A 2O5VA 3LLMA 1HTWA 5HZHA 2ZJ5A 2B21A 2HF8A 3CNOA 3WYGA 5TXGA 4X8HA 4TLBA 3U44A 4NYMR 3NC0C 3U7FB 1SXJB 5JWRA 1L7VC 1UBFA 3EXAA 5AJXA 1GL7A 4LYJA 5AJZA 4OQXA 3O8BA 2BOVA 5JMTA 2OSBA 5E7JA 1EESA 4EJSB 4KLZA 5GVRA 4DUGD 5J4YA 3R7WA 1FMJA 4NCJA 2DFKB 3U7GA 5DYGA 4P4TA 4L8GA 2BDTA 4JL5A 1F2UB 4L4UA 1UKZA 2ANBA 1KK0A 1FTNA 1GRRA 2LWIA 2GTPA 2G83A 4P4SB 5EZ6B 4Q1CA 4Q5IA 1DVRA 4C0QC 2PT7A 1Z06A 2ORIA 3B78A 5F9HA 4ARZA 3EC1A 4QBHA 1G8GA 3W90A 4LBZA 4O3MA 1HT2E 2O52A 2EVWX 2QM8A 1EFTA 4DDVA 2J7PA 3DZDA 2WAYA 1G8HA 3MJHA 3G0HA 3PR1A 4NL4H 2FMXA 1QHXA 2XNDD 5BWMA 2MSEB 1XEWY 2GK7A 2J7KA 4PHFA 4B75A 4JJKA 4ZKDA 4CT4B 1E2HA 3I5YA 2O0JA 5FOTA 3DZ8A 4OK3A 1WRBA 1CJUC 1OF1A 2P6UA 2JLZA 2RMKA 4Q1EA 4L16A 3AUXA 3CWZA 2WOOA 3DMDA 2QAGB 1AKYA 4R2HA 1NJGA 2YHSA 1EX7A 1MABA 5CIWA 5DI9A 2R62A 4MYHA 4I4LA 1ZM3A 1RZ3A 4ACBA 4C0BA 3FMFA 1Z29A 4DCVA 2BBOA 1N6OA 4RKEA 1S4QA 1W0JA 2J0UA 3LO5A 3QENA 1WQ1R 2G0TA 4KSBA 2ONJA 3AEZA 4YMVA 1KI7A 3CPHA 1VIYA 2PMKA 3UWOA 4JT2A 4CEHA 3BFKA 2QROA 2P67A 1J2JA 1NSTA 2DBYA 2PCJA 3DKVA 5FPSA 5SZIA 3WMFA 4A2WA 3WYAA 2ZI6A 3HWSA 2BV3A 2NO0A 3KXIA 4IOLA 4JS0A 3SJAA 4DEXA 2JLYA 3THWB 1JAHA 1OV4A 2ZR7A 4DB2A 5L3QB 5CB8A 1HE1C 4KYIB 4ZI2A 4EKDA 1TF5A 2Z0MA 4F91B 3SJZA 3L0SA 1VCNA 2ZVPX 3TRFA 2JEOA 2V1UA 2NMVA 3CIOA 5AJYA 2OV2A 2IS2A 5BN5A 2J7PD 5JEEA 3IEVA 4C30A 1TUEA 5FBRB 1K8RA 2ZYVX 1CRQA 1S3GA 3AVOA 2GXAA 1W2HA 3GLGA 4CT5A 4YXWA 2CLSA 5HE9A 2LKDA 5C18A 3I72A 1WCV1 2F7SA 3RS7A 3VQTA 2Q9CA 3FHOA 3KZ1E 1DBSA 1I4TD 1XEWX 2BVNA 2GRJA 3EC2A 3HU3A 1GVNB 2FGJA 2GESA 1JJVA 3CM0A 3P32A 3ZGXA 3NH6A 5LD2B 4TYQA 2CBZA 1OPXA 2FSGA 5FTJA 1N6HA 1YZQA 3RSOA 3EZ7A 4RD2A 2C77A 4DLWA 1XCMA 1XJ0A 2Q21A 3A4MA 1KI4A 4ZDKA 2XTZA 4FW9A 3UWKA 1PLKA 1XBTA 3A1SA 2XX3A 1Q3HA 3GLIB 1ANKA 4CZ2A 5L3VA 2QE7A 4ESHA 1NG9A 1A1VA 5GJWC 4CEIA 4V0ME 4B2LA 1EFCA 1MKYA 4TZ6A 2ANCA 1Z2AA 1S3SA 3MUFA 4E03A 1ZIOA 2HLDD 3NHBA 4BLTA 3VTKA 5JLJA 1CJMA 4LJ8A 2J9RA 1AN0A 2IBMA 4WW0A 4EUNA 1Z0FA 2RGBA 4AD8A 4BFUA 3A1WA 4OQNA 4AURA 1AKEA 2Q3MA 4UNPA 3FPAA 3TSWA 4YMUA 2PH1A 3LA6A 1N3BA 1KI1A 2C5LA 4DCTA 1UF9A 4ILEA 2CNWD 4PO8A 3BS4A 3MJRA 2HLDA 3ADCA 5DLQC 1TF2A 5GADl 2E9SA 1H8HD 4EDHA 1H65A 4MKIA 2D06A 1SHZA 2V1XA 2WVJA 2FPLA 2EFHB 2FSHA 1KK1A 1XB2A 2ZJOA 3R8FA 4M22A 3W6NA 4DEYA 2VL7A 2ZRNA 2CEAA 3SBEA 2ODNA 3LDAA 3VR3A 4ZIRB 1IJFA 2WKRA 1F2TA 3DM9B 3C7KA 3FGNA 1B23P 3VNVA 4RCZA 1FNMA 4Q9KA 1YRAA 4QNMA 4US1R 4GT1A 2C95A 2CE7A 3RS3A 4PTLA 4JL6A 1JEDA 1RJ9A 1E2MA 3S1AB 4BE7B 3GQBA 2H5EA 3T1OA 4TMVA 1ZNWA 3BWDD 2QTFA 3RC3A 1P75A 4NE2A 2CDNA 1TU3A 3DOFA 3B6EA 4YMTA 2EQBA 1X8KA 2VHJA 3AP3A 3OIUA 2V55B 4D82A 5IK2D 4BLRA 5HE8A 1KSHA 2BCJQ 3SHFA 2BMDA 2JJ2D 3WP0A 5FL3A 1LS1A 4OK5A 4A0RA 4IDQA 3T5GA 2ZQ5A 3LRPA 3T1VA 4L5BA 5DGXA 4ZPXA 3CONA 3ETLA 4EPRA 3CNNA 3EA5A 5D3QA 3B1WA 3KTAB 1ZVQA 2ZSAA 4TTQA 2AFHE 1ZUNB 1QHHB 3GJ8A 4LPSA 4G5SA 1KIMA 3J81k 1FX0B 2GJ8A 4KJZA 4PZYA 3VR2A 3U4QA 4LBYA 1P60A 1ZD1A 3OFND 3OEHD 1XTSA 4Q21A 2F43B 3D3QA 2MSCB 1OIWA 4ZDWA 2W00A 1RYHA 2FPKA 3ONWA 1US8B 2R6FA 4YMWA 1IN6A 5K8TA 5D3MB 4PSAA 2FOLA 3KL4A 4G01B
chains in the Genus database with same CATH superfamily
2HL6A 1JL3A 3MRTA 3UGJA 3AFOA 1WNFA 5J4VA 3JZAA 2GASA 3DEJA 3K0CC 1K6IA 1PAUA 2PZAA 4Q18A 4RY8A 4IMIB 5B1IA 4TT3D 4IHJA 4J0JA 2P2CA 4QOHA 4DJTA 1VDZA 5M7EA 4JLUA 3B2QA 5KNBD 5D3ZA 1UMKA 3SBOA 2XCUA 1G3UA 4XR9A 2X6QA 5LQSA 3STWA 5E0KB 1LSSA 3T0IA 5LYJF 3PCXA 3X3HA 2FMUA 1A9OA 3ZU3A 3IPLA 4YT8A 1K3FA 3ZVLA 2FW0A 1D2CA 4LHWA 3TNFA 2QTMA 2OT3B 3QLVC 4Q3EA 2YUIA 3LC1O 2FV8A 3QFHA 1BMTA 5DISB 1ULTA 3ZYZA 2B2XA 3S81A 2WKPA 2W4QA 4K9NA 4FMCB 3TVTA 4P5DA 3EAQA 3AZQA 2XWPA 3NWPA 3SKXA 4LRQA 4IV8A 3BTSA 1KEEB 1E9BA 2YXEA 5FOQA 1C0IA 1TT5B 4XDZA 4XXHA 3RBZA 1WO8A 3SHWA 3SR3A 2W98A 3C3KA 1XU7A 1BIFA 1ISMA 2M98A 1UEXC 2A0XA 2Z5VA 3NJ8A 4GPTA 1TCCA 2C59A 4U39A 4CL3A 3OJWA 3QSGA 2W6JD 4PLGA 3O1JC 4BHTA 5DVZA 2JLXA 1XTJA 1ZU4A 4EKNB 1HDZA 3KEQA 3EWNA 1YQTA 3C3AA 3HDHA 4ICIA 4TMKA 3VH3A 4RGYA 2PR2A 4UNIA 2R0QC 3DOHA 4DC1A 2DEUA 1WXDA 4EGFA 4G0NA 4D26A 1DXOA 3IESA 1R9NA 2Q45A 3ICOA 3S2IA 3TI9A 1VHDA 2JAWA 2YZMA 3AEKB 4PQEA 4TTPA 3SYLA 2A9RA 5A05A 1WF6A 3B48A 2XYPA 4FEEA 1CY4A 1P8AA 3BXXA 4KR7A 4U00A 4JUAA 3VNSA 3PPXA 5FL7A 3KELA 2DR0A 3PDWA 2DX7A 4MI3A 2UYOA 1PT7A 1AA6A 4P0PB 1DIRA 1SXJA 4NMHA 4B80A 4RXTA 4DCSA 1AQYA 4FHFA 1WETA 2GF2A 4RCYA 4L5JA 3ZZ0A 2FCRA 1NI4B 4TSKA 3W2TA 1H4VB 4P81A 4YAEA 2QTCA 3ZZTA 4PV7A 1C8VB 1HA3A 1OFUX 1SCAA 5M2QA 1WDMA 3I04A 5H81A 4L4YA 7GPBA 3T0FA 1ZJZA 1W0KA 3AJRA 1TE2A 3K94A 3TNDA 4HV4A 5I9BA 5EE1A 3REGA 2XTMA 5IJZA 4OQQA 1MRZA 1ONBA 2YVLA 3VR6D 1C7ZA 4JJFA 5JXHA 2VWHA 2ZATA 2WSSA 4MW6A 1EXDA 3IVGA 4EX6A 1NQOA 3MLEA 4EPXA 2E89A 4ZT3A 3W78A 4IGEA 5BVGB 5L95A 4HS4A 1V16B 2RB5A 4FSDA 2P2LA 3G1UA 4MWBA 5BV0A 3VGPA 1SOWA 3WJAA 2OC4A 2WI8A 4ZHSA 5ADHA 5FFFA 1H3EA 5AFSA 1OXTA 3PUHA 3WSWA 3P9CA 3AHIA 3A26A 3USCS 2H9IA 2VP3A 3LQ2A 3OCYA 1CUGA 421PA 3MRXA 3TQTA 1FFHA 4N12A 5JZBA 3RYHB 4W5NA 2HLPA 3A37A 1I4LD 1DBPA 1Z8DA 2VUSA 1QBGA 4LIPD 4LUCA 3IIJA 2ZGVA 3PA6A 4I4TF 4UCFA 4FGJA 4S1OA 5LMNB 5K3AA 3L7YA 4L75A 4XVQA 5F98A 3TSAA 3E0QA 2GPJA 3KZKA 1E2FA 3COWA 4C2TA 1CFJA 5GPBA 1K5HA 5L53A 1RZRA 2QSZA 1SU7A 1HF3A 2QX9A 4KV9A 3IOBA 4E11A 2G06A 4C22A 2PUCA 3PXCX 4ZAXA 2BMVA 4JFAA 2IZ6A 5A3JA 5CYFA 1HPLA 1KEUA 2QSJA 2OMKA 1HO3A 4YDHB 1LX6A 3UMVA 5F64A 4NIMA 3WHLA 2XTJA 1W4CA 4I3GA 1H3FA 3WZ2A 2JFGA 4KSYA 4P83A 4ACAA 5JZVA 1AU9A 5KWSA 2G8LA 2C3MA 2PZKA 3Q8MA 2WD9A 1RACA 3KRTA 4JYBA 1M1UA 1ZIDA 1H8HA 3GPIA 4LRWA 2ZBFA 4RK1A 2K7FA 3L4JA 5CX4A 3BIXA 3TQRA 1W1IA 3TZKA 4AQDA 5HKKD 5JZ9A 3TCKA 3MW8A 3JAMA 4EB8A 4F86A 4AK9A 1YE8A 4TS4A 3ANLA 4I1SA 2C9YA 2I3AA 1XA0A 4RY0A 3S1AA 3PSHA 2AFRA 2Q8QA 4OMUA 4PPNA 2A86A 3HE3A 1JDZA 4L8YA 4D1YA 3L93A 3OZAA 4FW8A 3L9WA 3FHCB 4LN1A 1XFDA 1D2EA 4CNQA 2ZIXA 3L43A 3EIOA 1ADJA 1KEWA 1V2GA 1FQKA 1XMVA 2C99A 2OBXA 2WP0A 3C5EA 3MS7A 4MVJH 5FOVA 3BKXA 3RBAA 4D96A 4XAQA 4Z8XA 2B6HA 3PNOA 4RSMA 3K5HA 3X2FA 1DUSA 1MA3A 1XQ1A 2EBWA 2H4XA 1EVLA 2WJPA 3AOGA 3OMWA 4LXUA 5CM8B 1V16A 3M6IA 2O7NA 2J5BA 1HX7A 5FTMA 1Z2DA 4C4YA 4D79A 4QVIA 1MO3A 2DLDA 3CN7A 4PN7A 2G72A 3BRQA 5HIKA 3PRKE 1Q7RA 1ADFA 1DDGA 4HWKA 5EQFA 4AY3A 2HGZA 3D4BA 1DUIA 3UPDA 3GLIB 1NP7A 3ZK8A 2D6FA 3WLQA 2CNKA 2QQGA 4NNJA 1RMQA 3GCDA 1TIKA 1PL6A 2GHIA 2NXJA 3DKRA 3PGXA 4WK4B 2AFHB 5ECYA 4AG6A 4QGSA 2BYTA 1X0VA 1ADGA 3W6ZA 4D57A 5C32A 5EFZA 1G8MA 1H2EA 5JAOA 3DAPA 2QLTA 1UC8A 2CMFA 1UEIA 1K8YB 2DFLA 1VG1A 1XD8A 2A9PA 3LE8A 3N6RA 4WOKA 3CEHA 4QZVA 3EDQA 1LPMA 3KLMX 4E32A 4ZAWA 1CDDA 3GELA 5SZJA 1U1DA 4R1MA 3OZBA 1OFIA 4IXDA 4BXOB 3IQXA 3KQKA 2OFWA 3I3SR 5F1KA 3G68A 2L42A 4EPTA 1RJDA 1VE3A 2D1FA 2CFIA 1LLQA 3PNMA 4Y2TA 3L6UA 4HUTA 1XLWA 2PFKA 3FY4A 4BE9A 2D5IA 3QU2A 4YCJA 5LQMA 3IILA 3LM8A 1QR6A 1B73A 1ZIPA 4JN6B 3X0DA 1Z74A 2JGEA 4RHEA 3OAAA 2ZRAA 2AHRA 5DNWA 1J4AA 3MGAA 4PBRA 1NP3A 1G21E 4UM8B 1ISHA 5BSFA 1E4OA 4BX2A 2H29A 3JVVA 3LQ1A 3VKFA 1KZ1A 4YO8A 3IEKA 4CQJA 3DF9A 1HNWB 3FMIA 3MWKA 4PHTA 5ELMA 2R6CA 4N48A 2I4LA 1X1RA 4OUDA 3D7MA 1XC7A 3K0CA 2VZ9A 4FFRA 4KVZA 4M8SA 2O8DA 2AZMA 4N41A 2GK3A 1G2PA 3SSAA 5K6TA 4LNHA 1ADYA 3EVFA 1LPBB 1O8BA 3A70A 4IIDA 5AYVA 1W5BA 4ND4A 4P38A 2C9CA 4FYJA 1VRWA 2Y71A 1MDFA 1WX1A 4PYNA 5KTNA 2GVDC 1YK1A 3VDNB 1BWSA 4J1NA 4LSWA 3SYRA 5TJ9A 4GX2A 3PQEA 3FOWA 3WJ2A 4CM7A 1T5IA 2YUTA 4JITA 5GV7A 3N8GA 1NBMA 4M88A 4DLPA 4F8EA 2Q5FA 4WVFA 3CR3C 1RMTA 4A8HA 5I8WA 2V7BA 1A4XA 4OGFA 4WCDA 1ABBA 4DV6B 3H1PA 4PLYA 2AG0A 1J23A 4DIOA 1TM7E 3HVUA 1U7WA 1R74A 3BE4A 5BR8B 2BC9A 4FD2A 3KWMA 1RAFA 1TKBA 1MP0A 1MIHA 1P29A 2F43A 2YQZA 2RGUA 2F90A 1T1GA 1L8XA 1UDCA 1XXHB 2HYDA 3DEHA 2L82A 3GRFA 3H6KA 3EEYA 3IJEB 4LYAA 5H3LA 3ESZA 4F4HA 1VZ2A 5E7MA 2AUMA 5I7VA 1SXJD 2XQFA 3MTGA 4S2UA 3NVKI 4LXGA 2DXIA 1B1AA 4HMPA 3AYZB 2QX8A 4F5WA 2ZJZA 3F6YA 4N3AA 2CYAA 2OHOA 4MUXA 4DYVA 2WB4A 3X1XA 3GJXC 3B20A 4J29A 2AR0A 2I2DA 2IHZA 4NENA 3LTNC 4P22A 3ZGLA 1S01A 1WPXA 1PD1A 1QU2A 4JB0A 5JRJA 1V8PA 1VHTA 4G5XA 3IUSA 1NI4A 2G0NA 2V9PA 3MF4A 5FI1B 5KOIA 4JBHA 5K3DA 3FA2A 1ZJ4A 3VI3B 4Y2HA 3V7WA 2NSHA 3ZCTA 1IONA 1J39A 2ZE8A 1T4CA 4WFJA 1UBCA 4DQKA 4IIJF 3GFBA 1SKYE 1W44A 2BAGA 1EVIA 1O1YA 2IHYA 2RGXA 3GLHB 2OCBA 3N75A 4QECA 4EA7A 1G98A 2FETA 3O4FA 4BJ1A 4DMGA 4LF9B 5F3RA 2GN9A 3DFUA 1I7NA 3ABSB 3FCOA 4AN1A 4D2IA 4ENQA 1Z0SA 2J9FB 5EJ8A 3FETA 1DXYA 2YVQA 1B42A 1X0XA 2QUZA 1AGRA 1F17A 1K8XB 2ZB7A 1UOEA 1B3RA 3IULA 2QRLA 4LYYA 1W46A 3JQGB 3R9KA 2ZTHA 1KI6B 1YV9A 5FIUA 5IPFA 5IAJA 3B6JA 2W37A 3CZQA 2OAP1 3TMAA 1EHIA 3GDOA 1UT5A 3IAAA 2FQ1A 3G8AA 2REOA 4K2HA 5TGDA 6AT1A 1Z37A 2V7TA 3A32A 2BHRA 1OHHD 2V3WA 2JGDB 3DPUA 2GB4A 1GQRA 3EIFA 3TIXB 1NG1A 2D0DA 5BMVF 2H5IA 3QOYA 3HKBA 1NHGA 2FEOA 4HTFB 1E3MA 5GJBA 4PVDA 4F92B 3JQFC 3LD9A 3MGGA 4B81A 1XNQB 2JAOA 1FDOA 2YDYA 2X3YA 2PAAA 3H84A 4NYIR 4XI9A 3BQ9A 1X1TA 2E37A 1ZO8A 3T5CA 1XJWA 3F5MA 3GG9A 3P9SA 4ARVA 1NSFA 2NACA 4RMHA 5MDHA 1KWGA 1XLUA 2HBZA 2PD4A 3EIXA 5AM5A 1QHIA 2I7XA 1W5SA 4V3BA 4MP8A 2QBYB 4D9JA 1JA0A 3FTQA 3NHZA 1L6RA 2V6BA 3QIVA 3TTVA 3AFMA 2CXXA 3IP5A 4V0QA 4CKEB 4ZGGA 3AJEA 4KAJA 2FPIB 3DCJA 3IPRA 4KXNA 4DR2B 2HJ9A 4KTTE 3GHHA 2YNMD 3CZ4A 5EIHA 4DCNA 1KQPA 2HDWA 3NKVA 4QDKA 2VQFB 1QVRA 4MA4A 2NSJA 1S2DA 2G5TA 4MW4A 1OFUA 4F2DA 2BHLA 4FE4A 4G89A 3LX5A 3FW1A 1MEJA 1L5HB 2J6CA 2RAVA 3TM5A 1DELA 3R8XA 2XR1A 1W93A 3GLHA 1WULS 4NARA 5ECDA 4RH3A 3GEBA 4BC0A 5CH3A 2XKKA 3HWRA 3EQ6A 1FQWA 1GILA 4F1WA 1IMJA 5EHZA 1FFCA 1G3IA 1I1QB 1Z7GA 1N2HA 3F6EX 3H5TA 3HTXA 1ZITA 3X1JA 4WUVA 1E77A 3H5IA 3LL7A 4ND8B 1ORWA 1ZFNA 2N47A 3UENA 4G9BA 2X1HA 4O2LA 1UJCA 1UFRA 5KTYA 3TRHA 1HRDA 2YS7A 1YI1A 1R3UA 3FKSD 2BR5A 4DMCA 7ADHA 1RWKA 4IIJB 5HXAA 1UBSB 3DV0B 2O06A 4I1RA 3AVYA 1P7WA 3EQ8A 3GJ3A 3NBZC 1PG0A 1RPAA 4A1FA 5DZSA 1ZM9A 1NVBA 1K06A 3H0KA 1K6XA 1NWCA 2CYBA 5CT9A 1KSGA 3U26A 5C1OA 2JKYA 3E2IA 3S2GA 2OV6A 1O97C 4M7WA 3B1JA 4LX8A 5B4TA 3SJUA 3USZA 3OTOB 4N8DA 8OHMA 2BBSA 2PM8A 4CLOA 1LJUA 1KY5A 3ZD7A 3FNQA 3G49A 4ZOLB 2A5JA 3JQAB 1WZIA 4KN8A 4D6YA 1D9ZA 3VU0A 3FYHA 1V11A 3QE0A 4LJSA 2WJVA 4ND7A 4UQLA 1HLGA 3LKVA 3ZDCA 4FBGA 1XAJA 1JFFB 4QYWA 2JLVA 4OXIA 2ONCA 4BL5A 1M6HA 3FE2A 3V4VB 2GLXA 2RH4A 4N49A 6ADHA 2FMTA 2JIPA 4OJTA 4OQFA 4R16A 5JT1A 4UCWA 3TJRA 4WMLA 3TUZC 3I92A 5HMLA 1YRBA 1ISSA 2GN0A 3IO3A 4PLHA 3GLQA 5LYYA 4HH0A 1MXFA 2VQ6A 1TU4A 1L5VA 3NAQA 2VF7A 2D3WA 2PPVA 4M86A 4PQGA 3PNBA 2PLWA 3WYNA 3SOPA 4BNHA 4DCOA 3P27A 1E3JA 1EVZA 2IU6A 3ORSA 1V8DA 4HLCA 1ZUWA 4N5MA 4WADA 4GUDA 4AUMA 3BA6A 1ZBQA 3QE3A 1QVVA 2ZJAA 1TAHA 4HQ6A 2Z3VA 3HUFA 1WUYA 4QUHA 3RB8A 5CFOA 5KYXA 2WVGA 1FJXA 1VHLA 1ORTA 1NF3A 1VLMA 3RIEA 3VO2A 1RM3A 2PGNA 3MMXA 3PUYA 4E6PA 2P3OA 4QNNA 3RT7A 3M9XA 4C43A 2R1VB 3QKSA 4DYHA 1WMBA 1VYHA 2AX4A 1QVAA 1UXHA 5E4JA 3B3QA 1JA1A 4HY3A 1JHMA 4JMPA 1E1KA 2NO5A 4YP1A 5I4BA 4P2GA 1E1RA 2A14A 2GCPA 3KYDA 4MKXA 1P4JA 3HN2A 3DLAA 1CCWA 4YVFA 1I3KA 1K5DA 1GNSA 4Z4HA 4JVOA 4QYXA 4IVNA 2J59A 1IEWA 1O4WA 3K9CA 3VTFA 4KXFB 1DOHA 2NTNA 1L4YA 3P26A 4HEHA 1NXVA 1QH9A 3GRZA 2QAGA 2UZ1A 3NRBA 4CKXA 5IYZA 4IDGA 2R1TB 3WYEA 2O5EA 5GQSA 2AEEA 3R5KA 4R9RA 2UAGA 4ESVA 3FHLA 3KQQA 4F5ZA 2GTHA 4PYMA 4MQEA 2UZ4A 4HUQB 1GL9B 5EYPB 3UHFA 3CGWA 2IYSA 4Y2QA 4BAZA 2IOYA 3GJSA 5EWJA 2CZCA 1XRQA 5DLYA 5FO0A 1O94D 4G0OA 1JIXA 4UHHA 3RDPA 1EVKA 1RC0A 2Y9MB 3EB9A 2VRNA 1NP6A 1SNYA 4JR2A 5LP6C 2VJNA 3ROZA 2JL1A 1LNSA 1OZHA 4IRUB 1UC4B 2VP2A 2O59A 1J9GA 1ZH2A 1OFVA 5HCIA 1R8QA 1NJSA 1PNTA 1NNLA 3PLAE 1XDBA 3FNGA 1YRLA 1NLZA 2WUFA 2QRMA 2QTRA 4U0KA 5IZCA 3CVUA 3E1SA 1YDFA 1E0JA 2CN1A 3BL8A 3ASVA 4RFSA 2LPMA 2QRPA 5A0VA 5KYYA 3MGCA 2VTBB 2HIMA 4LE2A 1TKAA 1GXSB 3QMMA 1GZVA 3PR2B 5BN5B 3BEDA 3E81A 4MQFB 3VRHA 4C1NA 1ABEA 2GAOA 3LPDA 3PLRA 3WGYA 4HKTA 4Z0TA 2GPBA 5EKDA 3FUUA 3OOYA 4PSDA 5I6DA 4J0EA 4Q34A 2BM1A 5FTWA 3W4KA 1R3DA 3GUCA 1G20E 1OV6A 3WDMA 5A7HA 3FM9A 4ZYTA 2WJGA 5CA1F 3LUCA 1OA0A 2ZSHA 1A50B 1SKAA 1Q95A 2PYIA 3OLYA 5FADA 2D2FA 5FOUA 3AINA 1NXTA 5DHAA 5DKFA 1COWA 1MENA 2C2HA 4PG5A 2W4IA 1KJWA 1OASA 2Y1DA 3IEPA 5AT1A 1XAHA 4KQEA 1BGWA 3IA7A 4P5EA 1BA2A 2XA1A 4FILA 5FOXA 2D1RA 4ZTBA 1JEAA 5D8DA 5K4AA 3KKQA 1P44A 5DN9A 1NZJA 2G7ZA 2OK7A 4EJ2A 1HRKA 2OV1A 4O29A 3RV4A 1JFVA 4RTLA 4B7UA 2QYHA 4AS2A 4DV2B 3DO6A 3GLUA 3R24A 4YMSA 3TXYA 2OP0A 3TW6A 1FPQA 2FFBA 4M87A 2HBRA 4K26A 1QUFA 1X77A 2ADMA 3ECCA 4MP3A 3BCSA 4FS3A 5C7LO 3WNQA 2OHJA 2X4IA 4REMA 5DBGA 4Z5XA 5DMXA 4KFCA 1G2QA 1I3NA 5IKPA 3E15A 1IQPA 3LW8A 1PFWA 2YWFA 1XNRB 2VHEA 1HMYA 3QEAZ 5FFMA 5BQXA 2AN3A 2YJTD 1H4TA 1O95A 1G17A 2V5VA 4QHYA 2Z9DA 1NJ2A 5JRZA 1ODIA 1N7HA 4IJWA 3NHAA 4ZHQF 4YNBA 2JJQA 2ZT7A 4U4AA 4Z51A 3SJBA 2WWWA 4RD4A 4YQZA 2P41A 3PUXA 3I4CA 1KK2A 1WKBA 2WUGA 2G4LA 4IZHA 4MWCA 2ZIZA 4RLQA 1TQ2A 3I2KA 2A5FA 4ZCSA 4DBZA 1NQ5A 4RYLA 3UJDA 4C0HA 4PC3A 1NBWB 2C7GA 2GJSA 1N34B 4ZVMA 3PC7A 4CQLB 1M1YE 1SZJG 3U1TA 3L6BA 4TS3A 2CL7X 4ZOBA 1UAGA 3AUAA 5LZ5A 2CXPA 1ZSNA 2P6OA 4RE6A 1HOXA 4BN4A 1CZKA 4PONA 3QBEA 2PE5A 1FMCA 1E5QA 1PZMA 5CH5A 2RHWA 1XCOA 1ZL2A 2OE2A 2VPQA 3N07A 2P2GA 5L3SB 1SCDA 4RA9A 1WU7A 4X61A 3RS5A 1R9JA 1SH7A 2CC2A 3AF0A 5LBUA 2R6ZA 3K0KA 3CUUA 5KREA 1N8NA 4P3XA 3Q5DA 3HDTA 4WE3A 3DEKA 1PN3A 1Q19A 2DWPA 4P35A 3ZQ4A 5HUQA 1WDWB 2RH9B 1KYTA 2RHLA 3DT8A 3VUEA 3U56A 3JAKA 1VLLA 4TRJA 1FEZA 1BZYA 2A0KA 4P36A 1UJBA 4CE6A 3VDQA 1YR1A 5KTMA 3CMMA 4Y7DA 2GVNA 2WWGA 3ECSA 2EIXA 3MZ0A 1D1PA 4YLYA 3MFQA 1Y9DA 4L9WA 4UE3S 1H2AS 5EMMA 3EPHA 2V0CA 1V5EA 2IC5A 3N7UA 4DCJA 1E2EA 1PWZA 3R6TA 1CT9A 1CUBA 1JPJA 3UMFA 4ON9A 2YVUA 3GWGA 4QM6A 3OIDA 4TWAA 1QKIA 3RG8A 4QC2A 1E0KA 1YNSA 1LDNA 4DSOA 3RGGA 5AKGA 1U7XA 1XPRA 2WLSA 3CRRA 4C2UA 4MEBA 2VYCA 1QZTA 2FPGA 4JVNA 1KSFX 2ZB8A 3DE0X 2A1TS 1VBFA 5TPZD 2H5LA 1N7JA 1GFZA 1RAHA 2A5DA 2ZKLA 4MYUA 3DXFA 2XF8A 4AP6A 3LW7A 4JJIA 1GKYA 1R00A 3FTFA 4I5FA 1PNVA 1LPNA 1SKYB 5CTAA 1U98A 1N5IA 2D2XA 3Q2KA 4IWXA 4LOIA 3GPBA 3PQDA 3HVIA 2JJ1A 2R8ZA 4I50B 2VUIB 3N1UA 1IIBA 2B35A 1R0XA 4E09A 4LGVA 4E5SA 4F97A 3LNTA 3A6KA 4XFDA 3VAYA 1CDOA 1KF0A 4N01A 1YJAA 1HT3A 1YR8A 3FROA 1EWKA 2ABWA 5LB4A 2I8AA 3IURA 4ODIA 4GGOA 4JQZA 4GLFA 4PXSA 3KOYA 5KQRA 4MHSA 5B36A 3HLKA 1FDVA 3OJFA 2HDOA 3WV4A 1E1RD 1Y3IA 1K5PA 2WF5A 1IY9A 4IICA 4EELA 4ZAGA 3K96A 4E6EA 4WXMA 1Z08A 2N75A 2FSVA 5DW0A 4CF7A 4C0AC 5KO2A 4UNNA 1NDUA 4XDHA 3NWJA 1U8EA 3CWQA 2AGVA 3V34A 1ZW6A 1C7IA 1JXOA 1VCHA 1YC2A 1E1NA 2AK2A 3E9MA 3H1TA 1QE0A 3NYIA 3BGVA 3U3MA 4DSZA 2RAUA 4ZO4A 1R0KA 3IT2A 3QLUA 4NNOA 5ALSA 1DHRA 4IH4A 2Z9CA 5FR1A 5BN1A 3A4LA 2KBEA 4CMAA 2RFLA 2X40A 3FNHA 5K99A 3QEMB 1GR1A 4UPDA 5SY6A 1QRSA 2FSVC 4F38A 4DLSA 2ZJYA 5I9IA 3VX4A 3OZCA 2ZRGA 3KJGA 4MEJA 1GSHA 1ZH4A 3TLAA 4XX0B 2P62A 3VAAA 1RQNA 3HH8A 1D2MA 5DYYA 3TKLA 3X1ZA 1JTVA 4N6NA 3FLEA 1QQTA 2ZJ8A 2CYCA 3IPCA 3NRJA 4MUHA 4OXQA 4HQOA 4DQ0A 4PZ9A 1SKMA 1POWA 2HK9A 3ZE0B 1U3VA 1EJ2A 1NW5A 3LCUA 4TGLA 2Y1KA 4WY5A 5DI3A 3RKRA 1EAYA 1AHIA 4C0WA 2J9XB 3KKKA 2Q2VA 4A4DA 3MINB 4G67A 4GEKA 3CZ9A 4URXR 3I1YA 1SXIA 2ZYDA 4MRRA 4A3SA 3BCUA 2J32A 1EXWA 3R5TA 4KWTA 4WLOA 3KLBA 1YQDA 2PSDA 2PYDA 2ZZKA 4FEGA 1E2PA 2O8NA 3X44A 4N6GA 2LTAA 4A8TA 4E15A 4RIEA 2ZRJA 3DE6X 1PP4A 5C8ZA 1RWPA 1X3LA 4PG6A 2J6BA 2HNKA 4Z4FA 1XXLA 2D2IA 2YCBA 4PGMA 4YP0A 5JANA 2C3PA 3VSDA 4OLFA 1WY5A 5FULA 4BNDA 5EE3A 3HSKA 4GOOD 1D9XA 1YU6A 3U19A 1G18A 2X2OA 3S4YA 10MHA 3EEIA 1C3JA 3QWIA 4V0SA 5G0WA 4FQ7A 3VR6H 1MQAA 2GBLA 1EE9A 4MV6A 2Z3WA 3WBFA 3G8YA 3ZDDA 4DDKA 1FMFA 2BGIA 2B4TO 1Z45A 4CF5A 1Q7BA 3O90A 1HG0A 1YGYA 4DR4B 1NA5A 3IUNA 3ONEA 1Q3TA 1UDXA 1MW9X 1QAMA 2XOKD 3KXDA 2FI1A 4J3JA 1G6Q1 2VA8A 3EIQA 2IEDA 4NYJQ 3H5RA 5JLAA 5G1OA 3OLZA 2FOIA 4ZYZA 3VYSB 3FMOB 5IN4A 3NS7A 2NOAA 3JYPA 2HMWA 4P6VF 5AOAA 2X3UA 1TM2A 1DO0A 4JLKA 4LWOA 3L7DA 1C41A 1U2GA 1X9GA 5U4QA 3W3AD 2GUWA 1T2FA 1JXMA 3DFKA 3VSEA 2QMHA 4GBGA 5I7WA 5TQ0A 1QYCA 4JVMA 1ZRHA 3LUAA 4CKBA 3BD6A 1GPAA 1E9RA 1E62A 3UHPA 4Z3OA 4RFSB 3Q3IA 4W7SA 5GWXA 1HYQA 1P4SA 1XRLA 3A3YA 4HDOB 5FWDA 4EHNA 1UAAA 3JASB 4WBNF 1U9ZA 3WK7A 5JROA 1JAIA 1EK6A 2JGJA 1KI6A 3L01A 1CR6A 1GPDG 2QWXA 1VMAA 2JAPA 4BVAA 3QNUA 4NFSA 4ITVA 3MFYA 5JUWA 4WCFB 1NNSA 4C4XA 5EJ4A 3R0ZA 2SCUA 1I3LA 1Y63A 3CEJA 4GXNA 1Z17A 2XNDA 3ZBTA 4GI2A 2OVFA 5E2AA 2Z2YA 4ZYXA 3K1AA 4CU2A 3L49A 4XLTA 4BZXA 4CIXA 2Q29A 1O95C 2ECQA 1SXJE 3AP1A 2ZWIA 3ICVA 3O8RA 2I34A 2XT6A 4IJMA 3FCSB 3L8MA 4F6RA 4C6SA 3GAFA 1SC4A 1SK9A 2HWYA 3QVWA 5IM4A 2A1IA 4N5DA 2DWQA 1AO0A 4UUBA 1Z36A 4W5JA 2HT6A 5AJTA 2A9QA 4LBVA 1E2KA 1VPWA 1N25A 3WHPA 1CQJA 2Z1MA 4L6CA 4WGGA 1J2TA 2JCBA 5LXTB 4QUKA 2ZDQA 4AJIA 5TMPA 4I1OA 1IB6A 3I5XA 1SAYA 1NDHA 4CMKA 1WY7A 1J70A 2OILA 3K4QA 3U3RA 1O9BA 1P1IA 1CY6A 3HGMA 1VE7A 2IYRA 1J33A 1JEQA 1H2FA 1H0SA 1ZSVA 3FGZA 1NF2A 2N3ZA 2N46A 2PVPA 5C80A 1PJ8A 1PT8A 4L4SA 2A4MA 2QN8A 3MAGA 3R3WA 2ZIGA 4OFZA 1RVDA 5LC1A 2FDRA 3FKQA 3ZWOA 2GBIA 3I05A 2FPXA 1UBRS 1ZXBA 2AMYA 2JD2A 2C9OA 1FYFA 1LZLA 3IUPA 3OZFA 3RJ5A 1EIZA 1PWYE 3AEYA 3GBSA 4U7JA 3O94A 1XHEA 3ZGZA 3G6WA 2PUVA 4RC9A 3SHTA 3PUIA 5EY5B 3NT5A 4CMJA 2IP1A 1U9CA 1FXWA 5TNXA 3WC4A 5KJ6A 3AL0C 4PXAA 5I7UA 3OHSX 3M3HA 4C4RA 3THOA 5FF9A 4JLNA 4LVUA 1E2JA 1SBTA 4ER0A 4CF3A 1Y1SA 1R5BA 2YJ5A 1KQGA 3MT0A 4ZYWA 2VDVE 3ZQUA 4QXPA 3N8DA 3OF3A 1YNOA 2BISA 4QHTA 1I0IA 1V4NA 1BQ4A 1QTNA 3EVBA 2GBGA 4ER7A 2RB4A 4RIIA 4E4YA 2XNHA 4TPKA 3K7EA 4BNGA 2XRZA 4JFRA 3N2EA 4YA6A 2X23A 2Z9BA 1Z73A 3GYGA 4W6QA 2I33A 3P96A 2XD9A 2VYND 1GZSA 3KR9A 3X1MA 2JJ8A 4WXRA 4U2GA 2WQ6A 4J16C 4UAUA 2AXEA 1Z35A 3RRYA 1Y4UA 3BMCA 5JS8A 2NX2A 3GJQA 3EPKA 4B33A 2OORC 4B84A 1ZNQO 1XLTA 3H0CA 5FUYA 1AHHA 3NUQA 1FSFA 3H05A 3HGQA 2KB0A 3AU8A 4JODA 3E5NA 3DB1A 3RHSA 1JHVA 3WRYC 2O19A 5A06A 4O8CA 4KQ9A 2VF5X 3BH7A 1F2TB 3RTCA 3ZHRA 3FOAA 4RACA 4BN5A 3SEAA 1Y3AA 3CUWA 4F60A 2WUEA 5J4LA 5CYOA 3JZDA 5DMHA 1QHGA 1MJ5A 1NVKA 5AXDA 1CEEA 2D5AA 1L5QA 2YWJA 4LRYA 2Y92A 1CUVA 3DHEA 5K9ZA 4GDFA 1T3SA 3E35A 4L5AA 4NATA 3I4FA 5DWQA 1KU6A 1G0NA 4KCGA 1IN1A 3NP9A 4G1CA 3EHEA 5EUQB 3SFZA 5B2EA 5IJ0B 4DR6B 2F9MA 2FPPB 1GGFA 3DVAB 3GUZA 4Q9AA 4JA0A 4EEKA 3OCUA 4X1KB 1H9BA 1WCIB 3FLAA 4GFDA 1ZDMA 3L8HA 4J1TC 4B40A 4MZXA 1EDOA 4YUAA 2QN2A 2NU6A 3N0TA 1SM4A 3HYCA 3U31A 1C9EA 2X2EA 2DKFA 2QXYA 1JEQB 3IHKA 2DECA 2VT2A 4XWYA 3V1YA 4CCYA 1QH8A 1CVRA 2WYVA 4G5FA 1C30A 3FOZA 2AL7A 2FZ4A 2PBRA 3C8ZA 4KPYA 2F1IA 3GU3A 1BC5A 4AECA 4AJNA 1MVOA 3LUGA 1IY1A 1CP3A 4OF4A 4LBWA 4OJKA 3SICE 1PD0A 4GZ6A 4PX9A 3C16C 3GGDA 4YDRA 5FPQA 2PWZA 3AQIA 3OD5A 4ENWA 4KO1S 1SCJA 3C3XA 1DEHA 2IH5A 1W36C 3A1NA 4PPYA 1RZVA 2B99A 3EXEA 2UUCB 2DFTA 2ZBQA 3OWHA 3UKOA 4M0CA 1K5GA 4LVOA 2AVNA 4IG9A 3ZY3A 5IFLA 4CM3A 2JBWA 1NRWA 3F6BX 2DB3A 4CCAA 1V43A 4DXAA 4XLLA 4ZQFA 3E9YA 3O7WA 2F1HA 3QELA 3CEAA 5HILA 2FFHA 2PV7A 3NHUA 3UJNA 1D5WA 2IY9A 4MZDA 2OPHA 3JVDA 1V8ZA 5IKXA 1TYDE 4OMDA 4R1OA 4RL6A 4C4OA 4KWEA 2E82A 5CEFA 1L4MA 2P2ZA 1X1CA 3KYBA 4IRMA 3S7ZA 3WLHA 2XYVA 2DH5A 1AUOA 2ZUUA 2CBGA 1OYVA 1L5YA 1JBKA 2HRRA 3RJTA 2XW6A 4OVKA 3IPAA 3D4IA 5LU9A 3BJEA 1PL7A 4BLUA 1A2KC 4IVQA 3IA2A 1KTIA 3PHHA 3A36A 4I1UA 4JBYA 4WBSA 3PNLA 3HCOA 2JJ1D 4XLZA 2EFCB 5SV2A 2CFCA 4XIGS 2ICAA 5IAGA 5JCZA 3GWZA 2WZQA 3ZCVA 3RNOA 5FLXA 5LUBA 2JZCA 1EGHA 1IZ9A 1A76A 4LHXA 1F6DA 1Z2PX 2EG9A 2G07A 1RWQA 4EA6A 4O2BF 3BRCA 4IPTA 1EFAA 3M6WA 3RBXA 2ZRDA 3JXEA 3QUQA 1JR3D 2IODA 3GLIA 2AWNA 2GPAA 2C78A 4YCAA 1PDVA 3AR2A 4YJ2A 1HT0A 3IAFA 3K70C 2SNIE 1LLCA 1ZICA 2FN4A 2HSEA 2OXFA 4G9GA 4OEHA 4OQ4A 3R7LA 4AWXA 4EHLA 3WZLA 1DARA 2X3FA 3E05A 3GOQA 3MNFA 2C20A 5JW6A 4G8DA 4AM8A 1N5DA 1T2AA 1MO4A 1VYTA 2R6AA 3TZBA 1GQYA 2JGKA 1EUCB 5FX2A 1YUBA 4WN9B 4EF4A 4AZWA 4E5VA 3F46A 1GGVA 4HDMB 1TC2A 1CS0B 4UJ5A 3NQ41 3JYLA 4WJZA 4CFSA 1G2IA 5HRCA 2FE4A 4P7FA 3EXHB 2JK1A 4XWGA 4JLOA 5F76A 3WIDA 1IH8A 2QRQA 2A92A 3NVMB 4MPRA 4FYKA 1KFEB 3VZCA 1T0BA 1G7SA 4JT4A 5KCZA 3VSBA 1MW8X 4RS4A 3V8MA 2RKBA 2QL9A 2QVXX 4RKQA 3IBCA 4BO4A 2XWSA 4GP9A 1P2SA 3LLUA 4HAZA 4U9UA 1S2NA 5CVUA 4CN8A 1FUIA 1N2BA 1PQWA 4V03A 2BI4A 5EXSA 1AKQA 1NRJB 1RBQA 2QM0A 1S89A 3ZJ5A 1CUSA 2DSNA 2P6NA 3AIKA 4LK2A 3TSOA 3C3EA 3EFHA 4FNAA 2WDPA 4I55F 3WV5A 3KYCA 2NZVG 2XA9A 4GOXA 1DG9A 1TJ3A 1WXHA 1KI3A 2WM9B 2H18A 4CLOB 4F4FA 2B25A 3HBFA 4NWIA 1OLSA 3OUTA 4DA7A 3NI2A 4WACA 5GINE 5CFZA 2QG9A 2XQVA 1NKVA 5DXAA 1AGPA 3S8YA 1QYVA 5E38A 4GMFA 3FOEC 4G9EA 5H82A 2C5SA 3R8CA 5JI3E 2VS1A 3IQGX 4WNCA 3JYOA 4CYMA 3CSDA 4ALIA 1HNNA 4U2KA 4CTNA 2IHTA 3KKMA 3STHA 1KXJA 3FYSA 1SQSA 3QX9A 2PQ2A 2H1RA 4BBAA 3CV3A 3SCZA 3B60A 2FFQA 1AG9A 3AEUA 1R18A 2CCJA 4GRIA 3LCJA 4AT1A 3QBDA 2LBPA 1P91A 4J90A 3A06A 4EZIA 1SWVA 5ICSA 2QD3A 2XVYA 1SQGA 2CFOA 1VSVA 1XZPA 3D3EA 3QKIA 3CH4B 3F3MA 1V4VA 3QJGA 3R6DA 1KIFA 1EFHA 2WJ3A 2ZFUA 5SYNA 3NHJA 4HGNA 4F3CA 5JD5A 3HUUA 3G3EA 3TTWA 1KEZA 5JCPA 4ZTZB 2AEFA 5DCLA 5JFGA 3AUJB 3OT1A 1BU5A 4GKAA 1XKTA 2QG6A 1TLLA 3PD7A 5B4UA 4HB4A 4L5IA 3EC7A 3SKVA 4DUGA 2D2EA 3QU9A 4AYTA 1BFDA 3ROTA 1HZJA 5B3JA 2PSSA 3DONA 3V8QA 3K16A 2A7XA 1JPVA 2NTYC 1K6JA 3AUKA 3UC9A 2CDCA 1T6BY 5CT5A 3TUJC 3U3DA 4B35A 1NYRA 2W70A 2XXAB 2R6DA 1S9DA 3EBOA 2YRFA 2I4RA 4UTRA 3CR7A 3TIIA 4DR1B