4XLZA

N,n'-diacetylchitobiose deacetylase (semet derivative) from pyrococcus furiosus in the presence of cadmium
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
267
structure length
267
Chain Sequence
b'MFENVSTFEEAFNKLLKEVLEFNLENPFEDAKKVICIEPHPDDCAIGMGGTIKKLSDEGVEVIYICMTDGYMGTTDEKLSGHELALIRRREEEESAKLLGVRKIYWLNYRDTELPYSREVRKDLVKIIRKEKPDGVFAPDPWLPYESHPDHRRTGFLAIESVAFSQLPNFSNIDIDIGLKPHSVSFIALYYTHKPNYIVDITDLMELKLKAIRAHRSQFTDDIWETWEPFLRTVTMFYGEKIGVRYGEGFRVMPGLFYHITPFADLI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Multiple crystal forms of N,N'-diacetylchitobiose deacetylase from Pyrococcus furiosus
doi rcsb
source organism Pyrococcus furiosus
molecule tags Metal binding protein
total genus 95
structure length 267
sequence length 267
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2015-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02585 PIG-L GlcNAc-PI de-N-acetylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10320 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold LmbE-like 4xlzA00
3DFIA 3WE7A 5CGZA 4XLZA 2XADA 2IXDA 5B2FA 3DFFA 4EWLA 3DFKA 4XM2A 4XM1A 5BMOA 4XM0A 5B2EA 3DFMA 1UANA 1Q74A 3WL4A 2X9LA 3WL3A 1Q7TA
chains in the Genus database with same CATH superfamily
2EGGA 4EG3A 4PW0A 4NNOA 1QV6A 4HWPA 1J23A 3D02A 1A9XA 1TECE 2WYUA 4MR9A 5LYJF 4TYPA 3LHFA 1BGVA 1LDYA 4UZSA 5IEJA 1KWGA 1F5NA 1FSPA 1ZRMA 1CQJA 4JI6B 1T0IA 4R6WA 4WZAA 1Q92A 4XWKA 2WQ6A 3P96A 3INTA 5L7TA 4B6EA 1W4LA 3RKRA 2QL7A 3H83A 3MJFA 2FG6C 5BN4A 1T5BA 5AW8A 4H1UA 1IUPA 4JC8A 3HXTA 1BVUA 3T4XA 2Y1WA 4L02A 3K32A 1F4VA 1JW9B 3KFLA 5AHRA 1R0LA 1E9VA 1OASA 1OI3A 3QFCA 3M6VA 5JS7A 1P81A 1ZI6A 3TB6A 3MWDA 5IARA 2P2SA 2A1UA 1TKBA 2ECKA 4GX5A 1IXKA 4MV1A 4NJMA 3WDLA 4Z4GA 2JK0A 2QMZA 4O4HF 3BE8A 1CUGA 1YB6A 3NYIA 2AUTA 3ZWWA 2PUTA 1ADBA 5DX0A 5EJEA 1MAHA 1U0SY 1UM9A 4FB5A 2G9UA 1GNPA 5JAHA 5K8IA 2F62A 5IKOA 3B1FA 4URXR 3PFWO 2YR0A 1P1BA 3T1VA 4M8IA 4OI0A 3GCWA 4TOIA 3G8DA 3IP8A 3L9XA 2G4LA 3FMGA 4L8GA 5ER9A 3PDCA 4RABA 2AVNA 4P22A 2Q4TA 4OMCA 1C1HA 4Q01A 4ATNA 1FX0A 1KKLA 1AGRA 5EKSA 1Z3CA 1Z0IA 3GJXC 3STXA 3OUUA 3AHIA 1XSEA 2O2XA 3PGLA 2ZS9A 4LQCA 3CX8A 3DO6A 1QOQB 2CE7A 2RH8A 2J4FA 5C7OO 1RI2A 3HEMA 1K68A 3UJ8A 1PL6A 1P91A 5F9MA 2C95A 4X93A 1AQYA 2UZAA 1VHWA 2A2ZA 1A7AA 1BRMA 3PV0A 5CFOA 4CIYA 4OQLA 1AM4D 4R1OA 1PG0A 3OX1A 2YX1A 3KIPA 1XKTA 3SS8A 2HQOA 3IAS1 4O4LF 1CW2B 2QRPA 4M0KA 5ELMA 1ZICA 2AJCA 4R6XA 4IZOA 1Y1PA 1SHZA 3CNOA 3FHCB 2ZSDA 3BRCA 3IAUA 4MGIR 5EMLA 3T9EA 3UAGA 5A4AA 1C7ZA 3F5DA 3PHIA 4LMAA 1ISIA 3GRZA 1AKVA 4MNTA 3VZQA 4ZYUA 2C9CA 1VC2A 2CJWB 4A82A 1PJAA 1QGAA 1XLTA 4F92B 2CLKB 2C4NA 4AN4A 1FTWA 2OHVA 1I7QB 5FI3A 2G17A 2LNDA 3HUEA 5ALLA 3TL6A 1L3CA 1R0WA 4U9IS 1FSZA 2W6ID 4TLCA 3Q8MA 3WLMA 1DDIA 3D1JA 3A2NA 1H2FA 3UH0A 3BJIC 3SZ3A 3O0TA 3OESA 3A2LA 2IY8A 4N65A 4F21A 3V34A 4IH4A 4LY9A 1GZUA 1TIBA 2G4CA 2QU8A 4HDAA 1O9BA 5HEKA 3O7WA 4D6PA 4RZHA 3DMHA 3TQHA 1W6RA 5C5IA 5IVKA 4G09A 3BF8A 2WIJA 1ZR2A 2WWIA 1D1QA 4FUQA 4FJ1A 4RTNA 1PJTA 2EWMA 1N8NA 3LVBA 4R01A 2J9YB 2PHZA 2VNHA 1Y82A 2IY9A 2WVAA 3AU9A 3DKKA 1M1NB 3MCVA 1W5EA 2ZZKA 3MJHA 5EMHA 4R1MA 3WMWA 4KNVA 3BHNA 2GVZC 4KKVA 5JXGA 4B43A 4NS4A 3MTDA 3RJZA 3WJAA 4EY8A 4R0MA 4ODIA 4PZZA 3LZDA 2Z56A 2RC5A 4KW7A 4G5QA 2V5VA 1Y34E 4COOA 4NHOA 5CH5A 5HUHA 4LYAA 4RD3A 1AN9A 3FNQA 2CE2X 1JKJA 3ONFA 2A67A 3ABZA 3PEUA 1TTPB 2HU8A 5E7JA 4DTIA 5BW6B 2ZB3A 2PZEA 5BUZA 1ZKMA 3HCBA 3S81A 4GPEA 1H6DA 4QDTA 2TS1A 2IYLD 5JNLA 2OCXA 1LBQA 3DUWA 2ZU6A 2PUWA 3M7IA 3OTOB 5B12A 1DRKA 2G0NA 2MYUA 3MTBA 4BNUA 3PJRA 1G4AE 5JQGA 1GRCA 1TMYA 1ZNYA 1UWCA 1BW9B 4JUIA 1CR2A 3BZBA 4HHEA 3U7EB 1QK4A 3JQ8B 5FWYA 3IV9A 5F1KA 2XYRA 3F2IA 3W2FA 2QWXA 1QKIA 4WN3A 4M76B 2OCKA 2HD4A 1J25A 4Q4LA 3RRMA 1SD1A 1QCYA 5F7XA 3F0TA 3M83A 3HVUA 4HGRA 3W79A 3EXG1 1DX6A 5LA6A 1XDWA 1JR3D 5B2EA 5LP1A 3I42A 4HNUA 2F8MA 2JFNA 2DBQA 2JFXA 2PWAA 2Z04A 3RQSA 3TPCA 4EW3A 3LRPA 3KKPA 3PDIA 3AWDA 4GGMX 4I46A 4E5SA 1HF3A 2JBAB 5EKTA 4DMLA 4A6EA 3QTLA 4IIEA 5ED4A 2DY0A 4IGKA 4EVIA 1UBHS 2XB6A 5LMUB 1RP1A 1C30A 3HDHA 1E1RA 5CB4B 1U9CA 1V1MB 3EDCA 2IHJA 1IY2A 5SZIA 3RVDA 3ESBA 4CIXA 5KTPA 2OD2A 3SWWA 3UOAB 2HWUA 3OLZA 4YP9A 3ORSA 3KPVA 3ZH9B 4B83A 3L46A 5K0SA 5LWQA 1LJ8A 4TWAA 1UOQA 4RH3A 1B42A 3W6UA 4ZCRA 3F97A 3PU6A 1GP2A 5A9RA 4KITB 1Q11A 4TSFD 2PWZA 3RASA 3VV3A 2E4ZA 3OEEA 1H8EA 1Q15A 3NOVA 4C20A 5MN6A 3Q0IA 1Q19A 3L8CA 4AX8A 3KETA 4HX2A 1XEWY 2XMSA 3LPNA 4TKLA 4W7HA 2GD2A 3VAZA 1HZZC 1GCUA 3FUXA 4BIIA 3ZY5A 2G5CA 1TEZA 2HL6A 4FFOA 3GDOA 3QF7A 4E4RA 3SXJA 1UEJA 3ZCUA 1G38A 2FX5A 2VA8A 2WAYA 1GA4A 4RF3A 1P1IA 3WFZA 4CMAA 3WA7A 1PUXA 3AF4A 2IQ5A 4N3AA 3C6YA 5D1NA 3SBEA 1YSCA 2Q1TA 2HU7A 3N2LA 4QRHA 5FP0A 3VZCA 1C1XA 2GZ1A 3CM0A 3HKCB 3VH1A 2PQ0A 4AMGA 2FMHA 4LHZA 1DAEA 1E9CA 2PJUA 1AQUA 1XZAA 1NFRA 3P26A 2HM7A 3NDJA 3R0ZA 1NW6A 1QVAA 5FAXA 3VUFA 4BMOB 4ARVA 4OJYA 2I7TA 4HVLA 1NIJA 4B40A 2XODA 1UJ6A 2GJ9A 3PWSA 5ALXA 3LWNA 2VSNA 2Y6UA 3TQFA 3EHEA 3GGJA 2HMVA 5BXYA 1WOMA 5IANA 4MLCA 1ZVKA 5JJCA 5ABPA 2PBLA 3R5SA 4J76A 3EEBA 1H1LA 2A0FA 3UWMA 2DHEA 3AHDA 4NMLA 3QF4A 2OHHA 5LC1A 4MGZR 3T5CA 2OKCA 2ZWMA 4D6YA 3MCZA 5CYOA 2V55B 4DMGA 5FUWA 5FOVA 2M6LA 3F4KA 4NY1A 3ZQJA 1QGUB 5IT0A 1IHDA 1S2MA 5DIFA 5FUYA 2IHYA 4PGAA 4HZGA 2FRDC 3IDSA 2GI4A 4B3DA 1EM8A 4ND6A 1FP4A 1E6CA 2QQGA 5LOVB 1DRUA 1TW3A 3DGFC 1B3BA 4Q6BA 3K1JA 4W5TA 1QANA 1YU9A 1JQ3A 1T3GA 1UFOA 2XTNA 1ABBA 3W2GA 3ZDXB 4C0KA 3BWXA 3DVAA 4BEWA 5LL6P 3R74A 4Z4CA 4MHSA 1KO1A 2RHGB 1O94A 2B36A 1UBNA 4BGVA 5LJLA 3ZDBA 1CUXA 3IUSA 4FX5A 2VJNA 2XKAA 4H7HA 4K6HA 4DA0A 3JYQA 3DHWC 4Q02A 2D06A 3TQCA 1CNEA 1T4GA 3ORQA 1NQXA 2XNDD 1WMSA 3RVPA 3H84A 1DXYA 4ZVNA 5HIAA 1I7SB 1F6WA 3GF4A 3I9MA 3IURA 3A14A 4CM3A 3ERCA 3ZW8A 1JNXX 2J3KA 4KGVA 4L5CA 5KNCH 4CTKA 4JT8A 1F6DA 4B35A 4G5FA 3STVA 2O19A 1UJ4A 4UOQA 2B21A 4ZVVA 2B4AA 3R77A 2ZSIA 4UTXA 1T6YA 5IJ9A 2QR3A 3KUXA 4AFNA 4ZJZA 1M2WA 2WWRA 4LZZA 4NR0A 1X6VA 4TZ6A 4HWKA 1QIDA 1M74A 3G8CA 1YR8A 3ICOA 4I4NA 3T5BA 3QV1A 4BECA 4PX9A 3SS9X 3N1UA 1MAAA 5CA0A 3KAQA 2NZUG 1B8UA 4QELA 4E11A 3H2HA 3BGIA 2ZUTA 1HEYA 5B3JC 2YY6A 3L5KA 4HAWA 2XBUA 1DU4A 2XEDA 1Y1TA 2YTZA 1BGXT 1EP9A 1VSVA 2R5NA 3ITDA 3NBMA 5EPUA 4HNTA 5JYEA 1VKHA 3AFOA 4BGUA 2J1LA 1PV1A 1YZ3A 1DE0A 3EXHC 2ETVA 2GOYA 1E66A 3SZGA 3AF2A 1XD2A 1RQRA 4C5BA 4DR3B 3QVXA 5JZSA 3CX6A 1WX1A 1KPIA 1QC5B 2IPOA 4G0MA 2VAMA 4C06A 2J4CA 3VA7A 1ZCJA 4MWTA 3BXFA 1TAUA 3LLVA 2OFWA 4Y2YA 1G3RA 2CDCA 3B6ZA 3AJRA 2CXUA 5K3CA 5JI3E 1W48A 1WSAA 4WCFB 1GG8A 2FPGB 2ZTHA 4A6PA 1KZ6A 1A8HA 3R3VA 5CEEA 4FXPA 1ZIPA 5DHQA 3WK9A 2Z6AA 1YJ5A 4QXQA 5DDIP 3ZYCA 1G8YA 2YRWA 2VBGA 3RVNA 2CLSA 3UENA 4A0HA 4NC9A 1HNZB 3BREA 5DCLA 2XGJA 2XZPA 2YC2C 2ZIGA 5H3CA 3PQ2A 2AOUA 4R8RA 4TVBA 4Z0PA 4HDSA 4BUCA 3NCHA 1E3LA 1SC9A 2GZ2A 3OIVA 3OM1A 1JDNA 4R71A 1Z26A 2OO5C 2WFLB 4Q1VA 2W00A 4ZGWA 1SCQA 3K31A 2QRZA 5CK5A 2RI1A 2AE1A 3G79A 5D8DA 3VPHA 3ZU2A 5EHZA 5JQGF 1YRAA 1I5EA 3TFOA 3JPYA 3HJNA 3N7UA 3G2JA 1E64A 3WX0A 3QKTA 1HPLA 3TBHA 2EJVA 2Q3HA 4F6CA 3FN4A 3LL4A 1GLVA 3F7NA 2I6UA 3QXXA 4ZC1A 1UXHA 3A7EA 5A0TA 1K7EB 2VSOA 4WEQA 1EA5A 3HA2A 2PD4A 3GLQA 4U3JB 5I5GA 3U4DA 4BASA 1YOBA 2XQVA 4HDOB 2J6HA 3L6OO 1Z06A 3E3AA 3FTNA 3KDSE 2WJ3A 4MVJE 2HT1A 5LA6F 2E2WA 4KV9A 1LBHA 3DZDA 4S1OA 1Q0ZA 3WIVA 3ZI7A 4C7OA 2PGIA 3WLPA 2A9FA 2VF2A 3PR2B 3ANTA 4P3YA 2IYQA 5IK2D 1BVHA 2NT3A 3RSSA 3C6MA 3K9CA 4QLBA 1RFLA 3CVVA 4YLYA 3BH0A 1WWKA 3UCXA 1ECCA 2B5VA 5HRUA 4NCBA 3FNFA 3DE0X 3SY8A 1EE1A 4IF4A 4NXNB 1H4TA 5EQTA 5JYDA 1TLLA 1YB7A 1GCOA 2YWBA 3AVVA 2CNWA 2WFAA 1H0RA 2HIHA 4E12A 2VAPA 1C0LA 1PR5A 1SQGA 2A5FA 3FNHA 4HLDA 2XIJA 2WB4A 3GG2A 3V8RA 4Z3KA 5TF0A 3UCEA 1PT6A 3B2QA 4BRWA 4HNAA 4Z0NA 2B1IA 5K8VA 3W6PA 3WL8A 1JHQA 1N3IA 3COVA 4DT1A 1T6ZA 4MV7A 2I87A 2FLKA 3AM1A 4NNPA 4UHBA 3ADBA 1GTVA 4UATA 2PZFA 3V1UA 3PPXA 2OILA 1NXQA 3INRA 4Y7DA 2C2WA 2VHEA 2HHCA 3UT6A 3I4LA 1D3AA 1P8AA 5EIBC 5AESA 5AHKA 2R7KA 1RXUA 5B1EA 3EISA 3N2ZB 2C5AA 4P38A 5ALMA 4B44A 4J1TC 2FF7A 3IP5A 2JJ2D 5FLEX 3SSAA 2VRBA 4KN6A 3S0JA 1O5IA 3ODGA 1NI4B 4Z9FA 4YMHA 2ZRIA 1QORA 2PBRA 1M72A 1KFEB 1W96A 1NVAA 3C3AA 4M38A 3KQUA 2VJAA 4U00A 1AG9A 3PXXA 1V96A 1MIHA 2Y67A 1N2GA 3JV7A 2XCIA 1Q74A 3B89A 3RS3A 2AIRA 1NQTA 3GVIA 4IIDA 4R9VA 4TUYA 4NYJQ 4U6QA 1ORIA 4DWWA 2BR3A 5CXSA 5K2OA 2HXSA 3OAAD 5F12A 2W2OA 5C3UA 2AR7A 1E3TA 2Q2OA 3NHPA 4ROTA 4MW2A 1SD2A 3FMVA 3ROGA 4HN2A 3ESCA 4YJGA 5AI0A 1MO5A 4DOMA 1BHQ1 2W2PA 2OHFA 2FPPB 5AUNB 2I3GA 1TM1E 4QGBA 3JVDA 4FFVA 1XFDA 5G1OA 1KIFA 2C97A 4N8SA 5FPQA 3IPRA 4P7JA 1A95A 3RS4A 4B2IA 4WWHA 5I48A 1HDEA 1Z5WA 4OPMA 4O3MA 2P91A 1RWVA 1LNQA 1DCFA 1WCV1 2SBTA 3ORFA 4S0ZA 5EE9A 3DB1A 3VDRA 1NN1A 4G65A 5TC4A 3EW7A 4R41A 3NHYA 1K3TA 1UAYA 5A3QA 3L7OA 1T2FA 1A4RA 4RD1A 1Z15A 2PZJA 3TIFA 3WB9A 4B6SA 3BRQA 4WASA 1G18A 4DJFC 4OHFA 2FG5A 4YYZA 2G5PA 2JLRA 3N3BC 3C5WP 3L4KA 2D5CA 1JWAB 4J6FA 4KN9S 1GFZA 4XKJA 5LFAA 1VB3A 3O94A 3X1YA 3W2TA 2XV1A 1K06A 2HW8A 2WILA 5EXSA 1AZSC 4LSWA 1LX7A 4GPD1 1UBFA 4ALKA 2I4LA 1WQ4A 5GV7A 5HF5A 3RSGA 2PQ6A 4CNBA 2BTEA 4OU4A 3W5SA 1YVUA 1SK9A 1NVDA 5A7GA 4A2WA 2CVPA 4D1YA 4GI2A 4DMUB 5DBGA 3BXPA 2AFIA 1N5KA 3ZN2A 2G4VA 2XBLA 4U9HS 2J0EA 4UMDA 4XJXA 1JH9A 1EUCA 1M6VA 3MS7A 2BONA 2QQ5A 1RI5A 3NKFA 3H8JA 2R751 3OSUA 1M1YE 2W8ZA 5E2IA 1HYBA 3HVIA 3CR8A 4JC5A 4RKRA 5CA0F 3IEVA 3GRVA 1FCJA 3FIUA 3DWFA 5C32A 2QP9X 1XMVA 1XUOA 1L7NA 4JVSB 4QDXA 5EZYB 1DC3A 4IOLA 4BNDA 1P1FA 2V6MA 2ZJ5A 3OX3A 5TRTA 4XGKA 3ZOZA 1XEXB 5K6TA 4R8SA 1AHPA 2HCTA 4ISCA 5K8UA 1M5RA 1BWQA 4B6QA 2EERA 1RADA 1X7WA 2IFTA 1XC7A 2Y93A 2LIPA 3HU2A 4JKOA 4KBYA 4KOAA 4KU4A 4LSZA 4NZ9A 5AW6A 5EIXA 3IAXA 2HOQA 3LXMA 2EJBA 4U7FA 1POXA 4ER5A 2GHTA 1RJFA 4Z49A 3ZJUA 221PA 2AEEA 4HXYA 4AECA 5JJ5A 1E6EA 3GJ3A 1MIOA 1Z0JA 2GCGA 3FVRA 1OFUX 4AU1A 4UPDA 4ITVA 5ALRA 4QBHA 4OXKA 1HZJA 1JRLA 4PIPA 5F5LA 1I01A 1LBSA 5GOZA 1WXXA 3ZDAA 5JARA 3N7AA 4G8JA 2QLNA 1I9GA 2ADFA 3TKAA 5L4SA 2JHCA 4Y1FA 3DSRA 1FTYA 2RJ3A 1YDEA 3BWBA 3L7AA 4PHTA 4RV9A 5KX5B 1DDGA 3KV1A 1BE0A 4M1QA 5K3OA 3A1VA 3KQSA 1ZIOA 1R6BX 2ZIXB 3KCNA 1Y1LA 5E0OA 4P80A 1JG6A 1NRJB 4IDAA 4O59O 2IXEA 4WXPA 2WABA 1KAGA 2WM8A 3OZVA 4E15A 1J2RA 2ZYIA 1RLOA 4KYTA 5KB3A 4MQ4A 4HWGA 3TJRA 3ZU5A 1SFRA 5J4VA 1EQAA 3I04M 3MTIA 4RNDB 2REXB 2Z4TA 3DKRA 3GLSA 3MGAA 1AGYA 2KE5A 4QG7A 4WKPA 2IV2X 4AN1A 4LDNA 3KNZA 1JHVA 4N3GA 2BFNA 1KNQA 2BGIA 5E4TA 4AZ3B 1OY1A 5IHXA 1OX4A 3RODA 1DKUA 1OLUB 3DG9A 4DC1A 2OCDA 2Q4DA 2D0IA 5EIBD 2PSSA 1HT3A 4M9RA 3EZXA 6LDHA 4W5OA 1NX6A 1P5ZB 3SR3A 5CU7A 1UEIA 5F5NA 2WG1A 1C1DB 5TLSA 2PNFA 1OX5A 4EARA 5HRAA 2AOWA 1Z6YA 2V3CC 3MFQA 5JTUA 1HYHA 4GKKB 5HJ2A 1Z8DA 1Q91A 5A9SB 1X8JA 3I62A 2C2KA 4NDNE 1JEQA 1LLUA 2BN4A 2OHJA 4HFJA 2NYUA 4MV6A 3C16C 4U6SA 4ETMA 1FFBA 3TAHA 4Q7MB 2IELA 3I23A 4WCVA 4L22A 5CM8B 3GEDA 3BCSA 2ZYVX 3WLQA 4HMPA 3CNLA 2ZWPA 4OY3A 3MC1A 3QV2A 1V41E 3ED1A 5EJGA 4E22A 1M10A 5KVAA 1J0DA 4EUHA 2I0FA 4ZC8A 3FTFA 3RYIA 3STTA 3RFXA 3HJHA 3ZJVA 3H5VA 2C4HA 2ONCA 1NAIA 1I80A 2OCLA 2PXXA 1V45E 2BKLA 3F6CA 1P0CA 1I4LD 4BNLA 1XZBA 4DA7A 4EUSA 5JZOA 4UTPA 4DR6B 2R2AA 3B9RA 1RHRA 3FYUA 1Q3KA 4MH0R 4RX1A 5K09A 2A0YA 1PDWA 1P1CA 1EG7A 2X0NA 1L0BA 3OPXA 4KXXA 2O8FA 4WNAB 10MHA 3FX2A 4J0QA 4LFAB 4L9RA 3M5WA 4ILKA 4ZAVA 1L1RA 5TQ0A 5AH0A 4DG9A 3IEPA 4OK3A 3QK7A 3QOXA 2HA5A 5EHGA 1VSBA 1SBZA 1HGXA 3KLBA 4WQMA 5CCBA 1DAGA 4UM7A 1K63A 1W29A 3D64A 2IHUA 1U28A 1CJCA 3RSHA 5BXQC 2FF5A 1G9SA 1M7HA 4HT3B 4ZYVA 3MCTA 1O0CA 3M3HA 1TO1E 3OTIA 3DAYA 1IPFA 3E82A 1ZUWA 4DCTA 1IZ0A 2QN2A 4F96A 3HGMA 3IOCA 1PR4A 5D84A 2WJWA 1NDQA 3K70B 4IDNA 1S2OA 1G19A 5CVTA 2OCAA 4FDUA 4CM9D 1V0JA 3HRHA 5L3ZA 5JW6A 1JBQA 1QMPA 4AF7A 1U8AA 2O1WA 3S5JA 1K7SN 3GFOA 2Z9BA 1WXWA 4O8CA 4RVOA 1VIYA 3OQBA 2PIDA 3JASB 5JI2E 1HLGA 1DC5A 2A4KA 2DY1A 2FPUA 3OWXA 4QNMA 1KR5A 4YRKA 4MRRA 4XTRA 5JD4A 2HHJA 3PDUA 4RA6B 3UOWA 2IXGA 3J7TA 2O2YA 1IHOA 2Q9CA 1HLFA 3DUFA 4AN0A 4D3YA 4WFIA 1EDEA 4X90A 1N5MA 2LGJA 2TMGA 3U3KA 2P3OA 1QM5A 2C2OA 3GFTA 1XDUA 4YJ3B 1R37A 4HUQB 1LK0A 1FNBA 1MD9A 4JZKA 3VR6A 4DQLA 2OQRA 3K1ZA 3NORA 4G67A 3TWOA 1L4UA 1PWZA 2H2FA 1EDZA 1V6CA 2GK3A 2NAFA 5DHFA 4KNYA 1QF6A 2WJHA 3CH6A 3GLRA 2IYAA 1D04A 3IJ5A 3EX7C 4UHJA 4BKMA 3LTNC 1VJRA 4ZICA 2X9GA 2Z3WA 4UEQA 2X8JA 2YOFA 4ITUA 3TVYA 4PGFA 5AUPB 3TCXB 4NIMA 1W9MA 3F1KA 4MIEA 4RK1A 2H3HA 3WFIA 1N1GA 2CV2A 3LJKA 2RHLA 5AW5A 4HGYA 3GLIE 1CZKA 3RR2A 5BR8B 5TSDA 3ANLA 2PKCA 4S24A 3VUEA 1D6MA 3ZS8A 4TRRA 2V7QA 3EIWA 2BBWA 3UV7A 5L4NA 3O47A 4B7ZA 4D8YA 5T41A 2IXAA 2CUTA 2EX0A 2R6CA 3NC0C 2V03A 5BNTA 3U3ZA 3ZIAA 3TDMA 1JQDA 4AWBA 2OCYC 1XJCA 4OFBA 13PKA 2G72A 1BXGB 4Q5IA 4X95A 5CX4A 2VC2B 4ED9A 3BQNB 4RMJA 1PL7A 4C01A 4DLUA 1HE5A 1KI9A 2VHQA 2DPMA 3THRA 2FWMX 4JD5A 2ZTVA 4CKYA 1RHMA 3UN1A 3SLGA 1OVMA 2GM3A 3QXSA 4WKOA 3KDPA 1R74A 4TWRA 5EUCA 4CQLB 4J0EA 5DNCA 5KNCA 4MUIA 1PWXA 1ITZA 2OORC 3K5HA 3KX2A 2J30A 4IVRA 2ZWIA 4KDEA 3WBFA 5C53B 1FS6A 4CN8A 1QGZA 3HSSA 2JJ1D 1Z2EA 5ESXA 1EWVA 3JWHA 3ROTA 3U1TA 4OP1A 1A27A 4YUYA 3GZTB 5DKFA 4XE5A 4BLOA 4X44A 5T5QA 4F72A 1XZDA 2VT7A 1NLYA 4IMJB 3PEWA 5CLGA 1NQ5A 2HWKA 4Y2SA 3ZHOA 1UT5A 4ZYTA 5A62A 3ICQB 2YRXA 2OZKA 3MYRA 4G56A 4TLLB 1JX6A 1D4FA 1DUVG 2VTDA 5H70A 4BFXA 1N8SA 3V7FA 5DNDA 1OKKA 1LPNA 4QLAA 1A8PA 1PP4A 3BM5A 3EA4A 3Q2KA 1VSUA 2H00A 4XVHA 3V7YA 3WK8A 4YJDA 1OH8A 3GP8A 1SQ0A 2ZDGA 3TZKA 2XUZA 1X15A 3K6SB 2BEUA 1FFXA 1DINA 4P4GA 3ZWOA 3A3OA 3KJIA 3KHUA 2XGGA 1KHTA 4PYKA 1U8FO 1FRFS 4BO1A 5EPEA 1UKCA 1TYBE 3NTXA 3HJGA 1SBTA 2QRNA 2WSLA 1W49A 1Z4PX 4V1CA 2Q6TA 4C0HA 5CFQA 3BEDA 1WUTA 5B3KA 2IH4A 3LCUA 4YRFA 3N87A 3HL4A 2FSFA 3CH5A 4AW9A 1DG1G 1IN7A 1SU4A 6REQB 3LP6A 4XA8A 4ETIA 3A2KA 3R75A 4F8JA 1WO8A 3OTGA 3E9QA 3IT2A 5JJBA 5AKIA 1SUBA 3ZZUA 4DIUA 2HV9A 4TX1A 3HDVA 3GVXA 4EQZA 2VDWB 2W83A 1H3NA 3DQQA 1XFAA 1EZ4A 4LYFA 3U26A 3W8EA 3ZV5A 3E58A 3KTDA 3LPCA 2PGLA 1JSRA 3V4VB 4B6FA 4RZIA 3LT2A 2JASA 1AQJA 1L7QA 2Z2IA 4MMXB 2F90A 3H8SA 3AVOA 5KREA 2WUDA 1T35A 2UAGA 1CFZA 2R6FA 2WTEA 4CM4B 2B83A 2FFHA 1Y9JA 2K2QB 4I55B 5DJ5A 1G8KA 1Y4DE 1EFLA 4BJHB 4E46A 4I1SA 2C2XA 5IYZA 3S8YA 4YONB 3M6XA 1K0UA 1XVIA 5DNEA 1Z6TA 4JP5A 2VJBA 3WGTA 2IYPA 4G0WA 5ECYA 4JHLA 4P7BA 2ERXA 3TW0A 1T6NA 2B20A 2X2FA 2F1IA 3ZHCA 3FGOA 1G3IA 4R2KA 3IUNA 2MYTA 3UEOA 4QTTB 1B6SA 2I4OA 3PS9A 1NJ8A 2HPHA 3H5NA 4KQCA 4K6CA 4MTCA 1IATA 1NG1A 2DUUA 4OQQA 4IXNA 3EXAA 1PTJC 5CITA 2BTQB 3OO0A 3A28A 4BFSA 1EP3B 1MAUA 4IIFA 4Q1FA 3ABOB 3B1XA 1CVLA 5D3MA 5DTIA 2X6TA 2GBIA 5J1TB 3GC6A 2E7ZA 1T10A 4UW9A 3H3XA 3R8XA 2EV9A 1GN9A 4BU1A 4XUCA 1H23A 1WLYA 3KP1A 4DCMA 1U0TA 3AUXA 7REQB 2PUVA 1P2UA 1ZUD1 3EODA 3IAFA 5BOSA 4K9MA 1XNJA 1OA0A 3OCYA 5HDQA 1RRVA 1RCTE 1TF2A 1XF9A 5JC8A 3E70C 3FG9A 3KYJB 3F6SA 3WHIA 2DCMA 16PKA 4ZZ3A 4E30A 4DLLA 4POAA 4LF7B 4MWEA 3QVJA 4GXTA 4N6GA 4DLSA 2ZVDA 2XMQA 5GADl 4AMZA 4XYEA 3FYTA 3MLAA 2Q9BA 4DZZA 3ZE2B 4X66B 3ENQA 4N54A 4K8OA 4JODA 4NDZA 4PBTA 5TB5A 2VR1A 3F3SA 4G5RA 4XQEA 3WHPA 1SCNE 4PICA 3ZI0A 4DNOA 4Z7JA 3U44B 1FYXA 4Y2GA 1F2TB 2W6JA 4GD3Q 3VR1A 5JISA 1YTUA 3TOCA 3LPMA 1NR1A 2H4FA 2N42A 5AO9A 4A1FA 3QFTA 1UBSB 4BFYA 4DBZA 2H4WA 2YN4A 1Z6PA 2KPOA 4PAOA 1DJPA 3ZNOA 3A1UA 5CDUA 2ZAMA 2NAPA 4JKIA 3EIQA 3Q98A 3RC1A 1PJQA 4V0SA 4GX1A 3UJCA 2CNOA 1KQ3A 1QX3A 1X1RA 2HA2A 4MEBA 4RPKA 2DPGA 1N6PA 2SKDA 4EL0A 4BZXA 3WQHA 1T8SA 4BB5A 4JQZA 1IYZA 1EZ1A 4HQ0A 4L28A 1W5SA 1M34E 1IWOA 1ISFA 1DO0A 1KVTA 1AXEA 1QAMA 1T43A 2QJOA 4C2AA 4PS0A 3EPJA 2NO6A 3AY0A 1I7LA 4FYJA 3OA2A 1QK3A 1QRAA 3UK0A 1YBMA 2WVHA 3TG8A 1M8GA 4PAMA 4KQ6A 4ZI3A 3JTEA 1EGQA 2RIPA 3OKFA 4NJEA 3ZHQA 4M0FA 1JP7A 4JX9A 3DFZA 1BG6A 1E9SA 2A6PA 2PFKA 4IOKA 3ONDA 4YRMA 3TNFA 2V97A 3M1YA 3CWQA 4HX9A 2BFAA 1UWLA 3W1EA 3EGOA 4ZFNA 4LSMA 1AIPA 3EA5A 4RYLA 4BVBA 1X7HA 1A2QA 2ADMA 3Q7EA 5LQCA 2JD1A 4EKGA 4B75A 3VR5H 1B1AA 3RT7A 1I3NA 1KEEA 4KHPB 4MWOA 4OMUA 3SJCA 3RJMA 3SAJA 1IBLB 1BHSA 3U3MA 4FEYA 4MV9A 4AKEA 1OI7A 1S3IA 4AZ0A 2Q6VA 4PPFA 4TXMA 2OPHA 4HO1X 1USGA 3EVCA 3MUEA 3IO5A 3HPQA 2JVKA 4ARSA 5BQXA 3I5XA 3TSZA 1KYZA 5JSUA 3NB0A 2FEPA 3K0KA 4Z2AA 5K20A 1OKKD 1V3VA 1YOVB 4BQQA 1EFRD 1UMDB 2FZVA 2R7LA 5DT9A 5P8WA 4Q7QA 1YJQA 2D2FA 3EWAA 3KEOA 4MVJA 4LOIA 5KTKA 4JJ7A 4TMWA 2QE7A 5ED0A 1FUKA 1VJTA 4V38A 4E5MA 3BFJA 3T34A 2ZM6B 2HREA 5CJ2A 1KKMA 1E7QA 1IN5A 2XIQA 2JLQA 3GP5A 1G8GA 2QT1A 4NQZA 4PC6A 4WK4B 5E4YA 1E2DA 3SC3A 4HB4A 4MWZA 2H7XA 3AXTA 4Y6GB 4IW3B 3P2IA 1JJ7A 3V7UA 1E9RA 2O0MA 3TQTA 3ZK7A 5JYCA 1WHTB 3LE8A 3IT0A 1I4EB 3X1DA 2A86A 4EBFA 4L4XA 3EZ2A 3IP7A 3VJRA 2AQKA 5EYPA 4DLNA 1BE1A 4ZT7A 5TIIA 3QX9A 5H9VA 2DR2A 3SZUA 2Y0BA 4XX0B 8ABPA 2FZLA 3KQLA 1DCMA 2AN3A 4FYHA 4DWOA 1PSZA 5HNKA 4LRSB 1AHNA 3ZU4A 1Q14A 1X14A 2OHXA 2UUAB 2XWSA 3VSCA 4RK4A 1GGHA 4D3XA 2JI6A 2ZR0A 1F1JA 4UNNA 5LIPA 5ERYA 1RWKA 1BSVA 4EYOA 1RCUA 4AZVA 2IX9A 3KWJA 2QMQA 3DV9A 3NV7A 2UXCB 2KBFA 4CIVA 1ODCA 3NLLA 1ZCFA 2QZJA 4EI8A 4B0PA 3H0CA 3IEXA 4LTDA 4Z53A 1U1IA 5F1YA 5AW2A 3ADKA 5ARCA 5HMLA 1X7ZA 1OPXA 4QQKA 3U7HB 4RZUA 3O8QB 2EFGA 1U2RA 1Z2NX 1Y6RA 3A6LA 4P81A 4LHVA 4OKIA 5KHAA 3RHFA 5ELXA 4AM8A 1GAXA 2OENG 3KYBA 1CEEA 1BXRB 2FCAA 3IO3A 3BXZA 2OC4A 4IUYA 5ALEA 1K9SA 3W7AA 5KYWB 5H80A 2NM0A 1X86B 2OLEA 1SXJD 3FH0A 3PFHA 4NBRA 1N7IA 1Q7EA 2HHAA 2ORIA 1C9EA 3VC1A 4ALIA 4F3CA 2VDQB 3DZBA 3L7YA 4D4IA 3K1AA 1PR0A 3L93A 3RRBA 5K01A 3M4NA 1POWA 1A7JA 1QHHB 4QATA 3QU2A 1IQRA 1AKTA 2UZ1B 2HCBA 2ZAGA 5DX8A 5FD8A 1I4OA 4Z7OB 5IAAA 3RVLA 3EVDA 3SVLA 2XJ4A 1OREA 2BGKA 1PF7E 4XASA 1NATA 3BX1A 1G20B 2VPXA 4UHCA 4L57A 5IYZF 4RVFA 4KDFA 1EG2A 3DTTA 3I6QA 2ONYA 4QXOA 4BHTA 1UKBA 2SCUA 4E33A 3W5BA 1QH1A 1DRJA 2ECPA 5BORA 5JBIA 3T1YB 2YVQA 3O9ZA 3I01M 4DL9A 2VNAA 3QHQA 4Y67A 1FDSA 3GA7A 4EK9A 5C1DA 1T5OA 5UKDA 2Q3MA 2H1VA 2P2ZA 1J8DA 3CUYA 2IGTA 4HRVA 1QWSA 2ZCUA 4DQXA 1P0PA 3ZX4A 2CL6X 4CKBA 3PXUA 3MPOA 4R69A 2W6JD 4J49A 5EP3A 1Y89A 5J4LA 4ZRMA 3NT4A 1DQRA 3ESDA 3GK3A 4WCFC 1Z08A 3UC9A 1PYGA 2E0IA 3F6YA 4JYBA 2X8AA 2NVOA 4G1UC 5D7BA 2C92A 4TV8B 3TIVA 4DKJA 1KFBB 1SRQA 3H97A 3PX7A 1OWNA 2QQFA 1EK5A 4QJIA 2ZQZA 4M1WA 1REQB 3ZU3A 1NSTA 1B0AA 1AQIA 2FR1A 3M9XA 4R81A 1TZMA 2GQ0A 2PM8A 3AEQB 3DCIA 6AT1A 4HWOA 3DC2A 4MAFA 1OYYA 2AMJA 2FW6A 2X42A 4FFSA 4G5YA 4YDRA 4CE6A 1RRGA 3KHTA 2VAXA 2OWDA 1O4WA 1XVVA 3UJ6A 1YZYA 4AMVA 1TUBA 1M1YA 1KGSA 3HCPA 1K7CA 3EB9A 4BB0A 3AY3A 4L15A 4UHDA 1J00A 3DKVA 5B5SA 4X20A 1W46A 3D5TA 2C3YA 3GJ5A 3O2JA 4QOHA 3LQ1A 5KIAA 2VF5X 5KHLB 3LY8A 1R0CA 2WQ7A 1JI3A 1FB5A 1QE5A 4RL6A 2R6GA 1GSIA 3PHJA 4ZMRA 1LWNA 2AJDA 1G21E 3HR8A 1QV7A 5DYTA 2AMVA 4E1VA 1TKRA 3BL6A 2AX4A 4DE5A 3BFKA 3OQMA 2OUKA 2XR1A 3ER6A 4M1SA 3WP0A 2ZRLA 1ZMRA 1DBQA 5MGBA 1UOEA 1A04A 3BOSA 3QLTA 1UKVY 4ZQCB 1NJSA 3HSKA 3UB3A 5KJCA 4RZSA 3AV0B 4CM1A 4C5AA 4C3UA 1BXZA 2LZ0A 3JQDA 3DV2A 1BEZA 1Y3AA 4XQ0A 3TPFA 1Z74A 2XB9A 3JQAA 4EGJA 1KAOA 1SOAA 5M04A 5LU9A 4D42A 2XWPA 4CLXA 1QHIA 2HXGA 4KODA 4CLRB 4B3BA 3JAKA 1P7YA 3OFJA 3U3RA 1M0TA 1EAMA 4FINA 1FRQA 1WUKS 3ROZA 4U8GA 4MI6A 1FBNA 1W52X 4ZALA 2Z1NA 2BEKA 2YYSA 3OCUA 5G4KA 3VPDA 1PN3A 2P9GA 1YA4A 4Z5XA 3O8CA 3F67A 3OG9A 1AB5A 5IXYA 3R7DA 1GEEA 1EYZA 3ID6C 4KWIA 4Q12A 3TBKA 3T4UA 1D1SA 1QDEA 2CFOA 4JENA 1TYCA 1AHIA 2EP8A 3LHIA 5D7NA 5HDBB 2OR3A 1SU8A 4KR7A 3TLJA 1LEHA 3IMGA 1RBYA 1S2LA 2HCFA 2O59A 2NLOA 2HJVA 2P2DA 2Y71A 3OT1B 5E1DA 4CT4B 4UBOA 1B6RA 1DELA 3E7XA 3L0YA 3OMXA 3ZVKA 4NMWA 4D9BA 5K0BA 4RTOA 4E88A 1JUDA 1O97D 1IU9A 2BW0A 2PGXA 1KSGA 1KTIA 4HH3C 2GASA 3ADOA 5LBUA 4G85A 3RVMA 2JGDB 2R00A 1SK8A 2KB0A 4D9IA 1WSDA 2CT8A 1UANA 1OTXA 4MVJF 4GZ5A 4K9NA 2ES4A 3T38A 4M88A 4PFJA 4XGIA 4B34A 2JGRA 4MCIA 4QX6A 1GAWA 1JQEA 3ZCSA 3G9TA 4YAKA 4N76A 3UGTA 1I51A 4CMEA 2W6NA 4XPZA 5G02A 1PK7A 1WPRA 3NNNA 3RVJA 5L6LB 4QD3A 2PS3A 4O02B 4A0GA 2PSEA 1F2UA 4JK3A 3DXFA 3G2NA 1SUCA 3D8NA 4C6RA 3U2QA 5IWAB 1Y5LA 3AJ8A 1K6IA 4UEWA 4WMLA 1QBKC 3PUVA 5TMEA 4PYOA 3TDKA 1ZIYA 3PYLA 4NPCA 5JO9A 2WV9A 2WTXA 3D6AA 2X7JA 2WU0A 1YNSA 3A1DA 1Z18A 4IHQA 4RFVA 4BWFB 3QWBA 4AO8A 4XVCA 2H52A 5CB6A 4RKWA 2IU4A 3QEKA 3PQDA 2NMVA 4JJFA 1NBMD 3OJWA 2PSFA 1ZISA 4OUDB 4QPZA 3L7CA 3F3MA 3ZGNA 1O9HA 1Y6FA 1HLDA 1PD0A 2N46A 4W9NC 3UFXB 1TZCA 3LI2A 2GAJA 1XDGA 3FOEC 3EK2A 4JUCA 5E8RA 2GHRA 2WUVA 3RUIA 2Q0XA 2BV3A 1ZC3A 1IOLA 2G1KA 1FDVA 2J32A 4DQ0A 1A98A 1O96A 1OZAA 1T2VA 2AOXA 2QAGA 1VPTA 2X58A 3BH6A 3NRJA 4H0CA 4M89A 2Q8NA 3RUHA 2IHNA 3H2SA 5HF6A 1LTKA 3IUQA 5ALQA 2W6OA 4YASA 1U99A 2QSJA 3G85A 3E7PA 5JNVA 4X1IA 4G84A 1XOIA 4EF6A 1DEKA 4J07A 4NNJA 4TTVA 4X00A 4X97A 2HJSA 3A32A 1ZOOA 2I2CA 2FMTA 3IOEA 1VBKA 2EBHX 3CISA 3O8LA 4LY6A 4NK5A 3FZEA 3GYBA 3PF9A 4HFMA 4PRYA 5IJWA 1U1GA 4ZWNA 1M5UA 1Y6JA 2HJRA 2BY4A 2ZJ1A 3BWDD 4PZ9A 5HOQA 3GLKA 5C31A 3ZE7A 2BMAA 2Q1WA 2W6QA 4ZN6A 2CEKA 4XCVA 1SVLA 2WU3A 3ML1A 4OB7A 1MGOA 3NOOA 4RVDA 2WT8A 4OJMX 4KSBA 1XTJA 3KWMA 4XJVA 2OYSA 1V9CA 1RKVA 2NO1A 3I6IA 3LD9A 4R7TA 1Q0PA 2WQZA 2O1XA 2XLBA 1IEWA 1KZYC 1NXTA 3HCCA 4XD7A 3ZWMA 2DPLA 4PYIA 4Z1OA 1XCMA 1FW6A 3ILSA 5ENVA 1P3JA 4LOJA 4BMZA 1AA6A 3K9QO 3A25A 3CVUA 1CUUA 4FZJA 3QPCA 1N9GB 2V9CA 1KZ7B 3QKUA 4ZVOA 4RVCA 4H1WA 5T57A 5LQDA 4JI8B 3CFYA 3KTFA 4HCJA 4GW3A 1YR1A 2O3QA 3LIPA 1RPNA 3P8ZA 5E4FA 5IPFA 1EM6A 1CBUA 5EHXA 4MW4A 2GSWA 3CCBA 2CCJA 2IYTA 4HVAA 1NBOA 3FZQA 1AC5A 3H9QA 2UVDA 1X42A 2AOTA 4HEJA 4ESEA 3GV0A 3ZGXA 2GYVA 2QMUA 3QEOA 1VLMA 5E2BA 4G25A 2R8RA 3K0CC 4PO3X 1CIJA 3T15A 4DS3A 5A7FA 2ZCJA 2OT3B 4Q19A 1CYEA 2CC2A 5EE5B 5KQRA 2GZAA 1EE9A 3GGCA 1O6ZA 3GLIA 4RJ2A 4M9SA 4S1PA 3VR3D 3QLUA 5HRCA 4F3TA 1I10A 3EASA 4F86A 3C7AA 3DL7A 2P4HX 4RBNA 1BYIA 4C7MA 4BS9A 1P72A 1OU0A 2JH8A 4M46A 2HF8A 5LP6A 3CGWA 4CR8A 2P1RA 1T2DA 3AW8A 3HLYA 4PX5A 4ETNA 5HYVA 3LS2A 3R9XA 1NVGA 2C5BA 1JNYA 2RH4A 5LZ8A 4N0DA 1OTYA 4JXZA 2CD7A 3E84A 3G2LA 4REOA 5J59A 3IP3A 3EDMA 1MJNA 1BFKA 1IHXA 2GZDA 4HTFA 5TGZA 1B7GO 1VBNA 1FFGA 1Y7HA 5AOVA 1TC2A 3DJYA 4RDCA 1L4EA 4LXYA 1NFFA 1NVWQ 3LPDA 3JQRA 2PK3A 4U7JA 3W90A 4BFCA 3LDHA 5GZ1A 1GARA 3T5DA 3N70A 4DJDC 1CVIA 2JVJA 2HO4A 2VDUE 3FDJA 3KJHA 3QKRB 1XMSA 5GONA 2Y1DA 1MQ9A 4DSAA 4DR7B 5DYIA 2VL7A 1JDVA 2PH1A 3RVOA 4AG3A 5KBYA 4X6UA 1U2QA 2V8OA 2ZRGA 5A4KA 3IPXA 3G5AA 2AG0A 3A37A 3GDFA 2GHQA 3BPSA 1N5JA 1Z0AA 4CTJA 1TMGE 3OCXA 3K09C 4U0KA 3BE4A 2VOJA 3D1LA 1PFVA 1QG6A 1S3FA 4LYYA 4ZT3A 1OCEA 3WLSA 3BMQA 3RIXA 3ONWA 4R1QA 5JWOA 2E5FA 1Q95A 2N1MA 3HFSA 3U39A 4CM7A 5BURA 1VE1A 5HIIA 4G4JA 4M37A 3JSXA 2QDKA 5E9AA 3TGPA 5FWXA 1OHHD 3QKWA 2R8ZA 2WF8A 4Q1BA 1ZD4A 3A2MA 3ZQUA 1TRKA 2VJMB 1D4OA 1R6TA 1EK1A 2CB0A 5B6PA 2F43B 4JYZA 4JYAB 4IX1A 1NLZA 2ZWOA 3K8QA 2M1XA 5LXTB 1R2QA 4IIHA 4Y2XA 1Z5PA 3WLOA 1P2DA 3REFA 4KFCA 4M83A 3E9DA 2JJYA 5GMOA 4TL6A 3U09A 3FFBA 1E2QA 4CKCB 4JZYA 5BY2A 4RF5A 1Q20A 1ORRA 5KNBH 1FXWA 2F4NA 4HSEA 3PNPA 3PC6A 4ZDIA 4ZIRA 2PBZA 1IXYA 1L1EA 1ZNQO 2QEQA 4XQCA 5K6AC 4KFSA 2QTNA 2ZBFA 3E81A 2PV0A 1LDBA 8OHMA 3L4JA 3EEFA 3N86A 3JVEA 3ZHRA 4RKFA 1E3WA 1HT2E 4UE6A 4FDLA 1CUVA 4IHAA 3R5KA 1GZVA 5KTMA 2P9FA 1U3UA 2QUHA 5D1HA 4PO9A 2Y0DA 2PX5A 1OXBB 2GESA 1Z7YA 1R4NB 4H7FA 1C9YA 1I4DD 3K70C 2G28A 3VR5A 4KWEA 1IY1A 1KJZA 4UBKA 1H9CA 2ZTUA 3IAHA 2DHQA 4N8DA 4AJ1A 4CG1A 2AV6A 2NXCA 3JALA 1P73A 4OP2A 3MGCA 1M1ZA 1VGQA 1P4SA 1X39A 1DWUA 1KY5A 1RM0A 3VO2A 1T5DX 1V39A 3L7IA 1GDHA 1KAMA 5A7HA 2JLCA 4HNRA 2WY2D 3VH3A 3O1HB 1QX4A 4BNTA 1VPWA 5CGQB 3BCRA 3SSNA 1Y7TA 2FEOA 3OZXA 3DBLB 3TLAA 1P1KA 4CM8A 5JCXA 3ICEA 1QZZA 2DE0X 2GLXA 1BH2A 1R12A 3ICVA 2XD4A 1DJOA 5H02A 2JFWA 1X9GA 3KLOA 3COSA 1ZJWA 2WC1A 1AB6A 2WWFA 4PG6A 3L40A 1PR2A 4NK4A 2LUOA 2IK8A 3H9GA 2G67A 3DTNA 4QGHA 2VCHA 4H7KA 1AK9A 3EGIA 4GIBA 5ECDA 5FB3A 4MYDA 5FR1A 2WM3A 3PCXA 4GP7A 2UYHA 1CY1A 4A92A 4IVPA 3AOEA 1XXHE 3WC4A 5GIOE 3M89A 3OT5A 2ZRNA 5DWQA 2QT9A 1OV6A 3D0OA 4YROA 1G3UA 2UDPA 2QZ4A 3EGCA 1UPFA 2VPPA 2YINC 3OBBA 5FTWA 4H6XA 1QYXA 4KXMA 2JLSA 4N9WA 2G8LA 3PUKA 1R3DA 3K9BA 2Q3DA 5J4HA 3MJ4A 4IEFB 5F51A 3WLRA 1TM5E 2FWNA 4ZHSA 1PGOA 4JXXA 4DA4A 3IOYA 1M2JA 1S6YA 1Y9DA 2FPSA 4HLUC 2X1LA 1DI0A 3LGSA 2GZHA 4KUHA 4B33A 2XCSB 3D2CA 1QHEA 2VRCA 4UTRA 2P4QA 1CF4A 1ZEMA 3WYFA 1Q1BA 1HZZA 1E1CA 4RHTA 2IYUA 3FYHA 4UZFA 4WINA 3R1IA 5TJHA 3RC9A 4GDMA 2ID8A 3QUTA 2QTVB 2O54A 3ZE1B 4KE7A 3FPKA 1FDOA 4NMXB 4J91A 2OGWA 2VSFA 4N3CA 2OXCA 1NMEA 4FFPA 5A06A 5H8WA 4MYUA 1UK8A 5CVEA 3F3KA 3SSMA 5FFFA 5BWLA 3LVFO 2WTNA 4HWSA 5CBPA 2WWYA 1K6MA 2PCJA 4I5EA 5ER6A 1JHUA 4XQ9A 2NADA 1GZ6A 3WA6A 4XQGA 1M34A 5CIWA 4KE8A 1F1BA 5IJ0A 3CVWA 3GMSA 4BZZA 2PQMA 1ZH4A 2FE1A 3SVTA 4I14A 4GI1A 4UEOA 1OYVA 5DGCA 7AT1A 3KT0A 2H0QA 3R7LA 2G5TA 3RTDA 1S2GA 5BVHB 4Q9JA 1NTOA 3IVRA 3P0FA 3RSCA 2IZ7A 2O0LA 1RZRD 3SQXA 1AV7A 5KSWB 3ZBQA 4LX8A 2GM9A 2PYDA 1ZINA 4BFWA 3ZS9A 5HF8A 4H31A 4ND4A 3TTXA 2QUKA 1VRWA 2QPOA 3BHMA 2REOA 3LFTA 4FNOA 2O5EA 1T6XA 3T7KA 1RAGA 3L0OA 2YWEA 1BJRE 4JT4A 1M0SA 3TLBA 5A5VA 4JNCA 2QTBA 3NWEA 4EO9A 3EVZA 3O3OB 3WOVA 2Y77A 3ZE8A 5ALTA 5LP6F 3QVVA 1U3TA 2FUCA 3VYVA 1PK8A 3S1AB 3NTOA 3RD5A 3AI3A 5TPWA 3QE4A 1NIPA 2FW8A 3K1YA 1CUEA 1P5HA 3HKDB 3A6ZA 1JQAA 2IYNA 3Q1KA 1NQWA 1YHNA 4HLCA 1QO0A 3FIJA 4NHEA 3FB4A 4XM1A 3T7AA 1USKA 1VKJA 1O87A 2A88A 2PE5A 1BU5A 3OKPA 2G25A 4QUBA 4TPKA 2ZYWX 1SQSA 2NXWA 1UJ2A 3L8EA 1NBIA 3I28A 3R7NA 1ZRNA 1N6HA 3VSBA 3AVQA 3KOZA 1NUHA 2ZBGA 1VE5A 1G63A 5GONF 4W5NA 3ODPA 4QUGA 1DBPA 1I2MA 2ST1A 2E6UX 1W5FA 3W6ZA 1U0LA 4YJKA 2GCOB 4W5WA 1U5BA 3BTUA 2IHKA 4O33A 5FBWB 1UXIA 1BJKA 2JIMA 1BQ4A 2WNIA 4HLQB 1COZA 2V7TA 3K0BA 1AKNA 1SXPA 3O8BA 3GRAA 4A0RA 2GM4A 3ZQ6A 4H3VA 3G0IA 5D2CA 2BE7A 3S2UA 2HX1A 1L7VC 4GBJA 4ZVMA 5HCUA 1E3SA 4DWJA 2D5LA 1OXUA 3ANYB 2K7ZA 3NBUA 3OMLA 1RMQA 4G37A 4JQCA 4NJOA 3K70D 3BXHA 3GYGA 3EEIA 1VJ0A 4YIHA 3ZD8A 4FYVA 2P9CA 3NNDA 4NAUA 1UJNA 1U9IA 4IWNA 1U4OA 1YBAA 2X86A 5DP2A 3MGBA 2PPVA 2YH2A 4FZRA 3FWYA 3ZGZA 1HSOA 5BSMA 3TR5A 2GJSA 5C7IO 3MPUA 3IHWA 1I7DA 4OLFA 2VA9A 5C7YA 1UFQA 3EXHA 2IEBA 3KJGA 5DNVA 2ZYAA 2CBZA 2PCLA 3CLRC 1Q0LA 3C6XA 3KV3O 4K9SA 4FMDF 4FK8A 5EEHA 1TAHA 4JUDX 1WJGA 3BGDA 5HJ5A 1K8QA 1NBWB 1VBFA 1IL0A 3MJDA 3PFIA 2QVCA 1R8YA 1E8DA 1W59A 3CX3A 4YQZA 2OV3A 4E5YA 1DKNA 1RXVA 1W34A 3X2EA 1MA3A 2R7NA 4DMHA 2GCIA 3QELA 1GYRA 3A9CA 3CBGA 3EQ9A 1XRMA 1QOPB 4KWHA 4WI1A 4HY3A 1ZM9A 3RB8A 2WJZB 1QTRA 3KBOA 1MJFA 3GVPA 5JJIA 2Q27A 2VJYA 3IOBA 2WA1A 4CFZA 4FYXA 4CN9A 4EQ6B 4ZYYA 5FAKA 1X3LA 3B8HA 3I2HA 3DLHA 3UB2A 5B7QA 3GA0A 3VR2A 2OO5A 1LBTA 3O03A 3REGA 4H0FA 1TTTA 3CVOA 2LE0A 3NHBA 1J97A 1TM2A 4NCXA 4ZCSA 4W9MC 2O8CA 1SVWA 3VNRA 1E1YA 3RVQA 1X38A 3KEMA 3HHPA 4X3CA 4PY2A 4A3SA 3HWSA 1DCKA 1E18A 1EJBA 4MICA 1ZUNA 3WLKX 3VO8A 1YRLA 2Z1DA 1N6KA 5AKXA 1EK0A 1V2GA 2YV1A 6ADHA 1L5LA 1FNNA 2JVIA 4KAXA 3NT5A 4DCOA 2C00A 3QYFA 1W25A 4NBUA 5C4GB 4MQ6A 1YO6A 4NRDA 5HHTA 5LNK6 1T29A 4S12A 3EZ7A 1DJLA 3FPSA 4GRDA 1UCFA 2BFFB 4P4SA 1K08A 4DBVO 3KJEA 5IWCA 2JLZA 3UMYA 2ODAA 1U2GC 1JKIA 3QI7A 3A06A 4KPGA 1G1AA 2IITA 3JAWB 2ZEJA 4HEQA 4MRMB 2EARA 3V2IA 3NUGA 4KLNA 4FYIA 4IH9A 2QTCA 2MMCA 3OLVA 3WKBA 4WBSA 4ZGGA 4ZEOA 3AF1A 1GRRA 3MINA 5DI3A 4CDNA 1NPDA 5BVGB 5JNUA 3OJFA 2NYAA 3GUYA 3JQCA 1YB5A 4F60A 1RLMA 5DWDA 1DV2A 5AJZA 1V8ZA 3UJ3X 1G8HA 4ZYWA 2BFEB 4ZJUA 3IA7A 1JF8A 3IXMA 2F55A 4KK4A 2F1HA 2QJRA 2WJJA 4JIMA 1KBZA 3ZHYA 5C5CA 3K2EA 3P5SA 3V4PB 4DJ5X 3T7JA 5JXJA 5MF6A 1NW3A 1SKBA 3OZGA 3P4XA 1WHSB 1A5TA 1P4HA 4N7JA 3PJDA 1R6UA 2H92A 3V00A 3ANNA 1MO3A 2HQ1A 2R8YA 1FW8A 1G21A 1TTHA 3PUHA 3L8MA 2CHVA 2ZREA 1NDHA 2WSSD 3K9HA 1IJBA 3DOHA 5JDCC 4PPNA 2AWOA 1JZSA 2HIGA 2QL6A 2ASEA 4JLWA 4AKSA 1BCRA 4W8HA 1GL9B 4F1KA 2DB3A 2H3EA 4OBXA 4A36A 3ELWA 5LD2B 4ENTA 3NXKA 5THQA 3ROEA 2X1MA 5F7OA 4HMQA 4A73A 3TLEA 1MO2A 2OP1A 1TJ4A 1IVNA 2H8KA 2HNBA 2IEDA 5F2OA 1PV2A 4RHUA 3C70A 3D7MA 4BL5A 4I9UA 1NQOA 1VL6A 3ZWYA 4CG3A 4EFKA 2AFRA 2G83A 5CPBA 5FL3A 2AHOA 1W2GA 5GVSA 3ZWBA 1PT9A 3PD0A 2EEPA 3Q11A 1O54A 1TGVA 2VP6A 3OC0A 4X71A 5ITWA 3LCRA 4AYWA 5J2TB 4U8HA 3AP2A 4X6XA 2AN4A 3BFXA 3K0AA 3OJCA 1FYFA 4G1EB 1JQKA 4M1OA 1HK7A 1KRWA 2ZQ5A 1P75A 1YIDA 3E3OA 4GI7A 2ZROA 2RGNA 4F3NA 2YWGA 2J3MA 1HM5A 2IVZA 3PFKA 3FRHA 1IOZA 1TJYA 3FFTA 4N9QA 5AK5A 2G6TA 3PFBA 1X2EA 3SEFA 3ADDA 4GMGA 2E9SA 1XJWA 5BWCA 4R84A 4FU0A 4ZVPA 2HMTA 4EEKA 2HK7A 2EFYA 1Z7EA 2Y8EA 4AJ4A 4KAJA 3ZLBA 2HYDA 5DCWA 1BDIA 2R3SA 3DZJA 2YFKA 3PR1A 1Z4LA 1P2BA 4JA2A 4NYJR 4BDSA 4TZKA 3DEIA 4GWKA 5KTRA 2AS0A 2TSYB 5A6SA 3DE4X 1ZPDA 1PL0A 4GVXA 3EJWA 4RSRA 1GHTA 3CLRD 1TTQB 2XLCA 1NP7A 1BA2A 2A58A 2W71A 2W98A 2WG2A 1UPTA 2WHYA 1ARZA 5EN4A 1LPBB 5JSYA 1EZZA 4WPGA 1D2RA 4F4DA 3QE9Y 4F93B 1D2MA 4KQ2A 2Z6VA 2VTEA 4JI2B 1PK9A 2MT9A 3IQZA 5FLKA 3GFGA 4AURA 1I30A 1U9JA 4ZHQB 1PT8A 3VVLA 4DQUA 4JYCA 1ORTA 1WPXA 3LUFA 5CMLA 4GYWA 4RENA 4L4UA 3EG9B 1P9LA 3P0EA 3LU1A 1LBEA 3LBHA 1G59A 2Z8YA 3N8GA 3H6GA 5LB2A 3GMDA 2HMWA 2AZTA 3ZCTA 2OD9A 3G2IA 3VZPA 4YRGA 5ALHA 2QMYA 3EH2A 3HDTA 4ZAGA 2P4SA 3AFHA 3RM3A 4PBRA 1NV8A 4HXGA 3CRRA 5JROA 3P27A 2I91A 2ZZNA 3CUKA 3WWYA 2AI3A 3H13A 3PFFA 1V4VA 4OL0A 4ZMBA 1PLLA 3MGKA 4OGGA 4YPOA 3GN1A 5EEGA 1TYAE 2AYXA 1S4QA 5JH7A 1E6MA 2V1XA 4NOJA 2UYGA 4XSGA 4F9EA 4AMUA 2FSIA 4Y9UA 1JYFA 1U8CB 3BDIA 2J0VA 2ARKA 2ZUWA 3AY6A 3LYLA 2FUKA 2X9NA 4DC9A 2BMEA 2OPBA 2GMWA 1E1DA 1NM5C 1OV4A 3W3AA 2DRIA 2GAFA 2CXHA 2XVXA 2A1TS 1CQIA 4IZHA 3AGQA 1KOFA 4WY5A 4YCDA 4FE7A 3SHVA 4MKZA 2JGEA 1EUZA 1FLDA 1AX9A 1NUQA 4UTVA 2OXFA 5GY7A 1AMNA 3R5FA 4J0CA 4C7XA 5M2QA 1H2WA 1W4BA 2JEYA 1S0UA 3PUZA 2AMFA 4IJWA 4P7GA 2A3RA 2Q1XA 4PZYA 4D0RA 4JAVC 4P2GA 2Q3EA 4BNFA 4NXMB 4OMFG 4TMKA 1IM8A 1GCIA 5GWXA 1X7YA 3M3DA 4A0SA 4J16C 3OF3A 3AKZA 1J6UA 2M2IA 3WLTA 3D3QA 1YR2A 3A26A 4MKHA 4AL4A 4Q4DA 4QHSA 4DKXA 1SUFA 1Z7WA 5AP9A 3VZSA 4Q7LA 1PNRA 4U2EA 5JAMA 4EH1A 2JFYA 1TCUA 3D6MA 3KYDB 1IN4A 3ASYA 2ZRMA 3OFVA 3S2GA 4LXIA 1U4NA 1PR6A 3IE2A 1JWBB 3WYGA 1TT5B 3T3HA 1FS5A 4QWWA 3CN7A 4BMSA 1PCXA 5ICCA 3OTQA 5BQFA 1Y7LA 2MINB 1G6HA 5LZ5A 4QGAA 4XGRA 1OPRA 1Q1AA 3VPBA 4J9VA 5T8KA 4NE2A 4ND8B 3T9BA 4AWXA 2VWPA 5IDQA 1EGVB 1XMQB 3KUCA 3ROPA 2ZRCA 3SSOA 4B4DA 5D3QA 3KD2A 3MMPA 4B3XA 4RTLA 1U1DA 1BE6A 3H65A 2J48A 1EI9A 1ECPA 5IN5A 3OICA 5HE9A 4CF5A 3JWIA 4HFRA 1XCJA 1RAIA 3GGSA 2CFTA 2WICA 3B7PA 2UZ4A 1NRIA 3K4QA 2YZGA 1DOHA 1J2UA 1TVMA 2B6HA 1JDPA 1QHXA 2ODWA 3OOJA 1YC2A 2QN8A 4NMMA 3KXKA 5FYQA 3VXKA 4F4UA 2Q5LA 5A1JA 1QYDA 4UBLA 5CT5A 3ZCPA 2Q7OE 3QWFA 4DB4A 1N78A 1I1NA 3K2QA 3MTAA 5JJLA 4H1VA 4JLVA 4BC0A 2FPXA 2DR0A 2GXSA 1ZH8A 3QITA 4JS0A 2P2CA 4WTOA 3LQFA 3TINA 2I1VB 4ZV4A 5KTNA 1AUVA 2QJTA 2W6ZA 2YHIB 1C0IA 4UU8A 1UK6A 2BFDB 1HURA 3U1VA 1R8SA 1U8YA 4LY0A 4J0FA 1AS2A 5LQUA 4MR7A 3RS2A 3WBBA 3E15A 4TMZA 2GPBA 2X0RA 1SVKA 3TB4A 1LQUA 3LXUX 1RYYA 3W1VA 1VZ2A 2VPZA 2C57A 3HKBA 1VRVA 4ZKEA 3E7DA 1Z6XA 1HQDA 1T5LA 1VDZA 3PXBA 1C50A 4LS3A 4H3HB 4XWOA 3AKDA 3I4FA 4KFRA 1YB2A 1PHRA 3S6JA 2GK4A 2VXOA 1Z4KA 3DJFA 4AF6A 5EMMA 2VP3A 2CMDA 5HQ3B 1FP6A 3G0HA 2I8CA 3FHLA 1ZSNA 4C7KA 1EBBA 4ZO8A 1L5GB 1MDBA 1WU8A 3C2QA 5FDFA 4PVCA 3B6KA 2I6TA 3HNOA 4IF6A 1G41A 2IWHA 1YGPA 4KXWA 4H17A 5DHSA 3HUTA 4LWZA 4E6PA 4UULA 1I0LA 4EB6B 2EW8A 5BSGA 4RTSA 2C98A 2BBTA 3EWNA 4GYKA 3U61B 3IRVA 4Q16A 5A4DA 3BQMB 4WAUA 4H7IA 3E4DA 4BNGA 5FBQB 1TL7C 1HA3A 2I1LA 5BN5B 3UMFA 3AEZA 4DNXA 2QORA 5AVJA 1O4VA 3KKQA 1DV1A 4MKIA 1CR0A 4RV4A 2H85A 3HP1A 3K0EA 4IDQA 3IUYA 2ZXFA 3D8BA 1USIA 3I2YX 3L9WA 1E0SA 2CV0A 1J42A 4BO2A 1F38A 4IIJB 3E23A 5JAPA 2A30A 2XAAA 4O2BA 3H99A 1XVLA 3BGSA 3LGXA 3TW4A 3DMTA 1NTRA 4OB6A 1IB6A 1NKSA 3RDPA 3AERA 3L0DA 5DBEX 3ZXUB 4HZUA 7ADHA 3FCAA 1Z16A 3I30X 2W6PA 4KI7A 4KTVE 5F9FA 2NTVA 2ZBUA 1SC4A 2PAFA 4CR7A 1BCSB 3FYSA 4ILEA 5DM2A 5LBTA 2XMDA 1GFWA 2OV8A 1PVDA 1I7NA 4WBNA 5FA8A 3C39A 3LM8A 3NRBA 3SM9A 1G5FA 2NO7A 1XNGA 1Y63A 2DQSA 3B36A 3PQEA 4M6WB 3WGNA 6ABPA 1T91A 3MXOA 4DLVA 3AR8A 1E9BA 2I7CA 4UOEA 2RGYA 3B6EA 1GU7A 3TD6A 1E1MA 2G07A 5TEWA 1J8QA 2KLHA 4Y6OA 2GK7A 3A1EA 4QGFA 1NURA 2N75A 2IU0A 3SF8B 3WMRA 4AC9A 4CM6A 3IEIA 1J9EA 4QTYA 5IRCD 3QKSB 1ZXBA 2FW9A 2ZYDA 4LZJA 1ZK3A 3OM0A 4IZ6A 1ZGZA 4GMKA 1YULA 4DQKA 4I3GA 2GRUA 2Y4OA 2YOHA 4Q24A 4X3OA 2FSHA 1CERA 3CA8A 3E03A 3OEHD 3HY4A 5IKPA 4R9SA 1BMDA 1UMCA 4JOQA 3VMMA 1RLJA 1C9DB 1U5CA 1U6JA 2EJTA 2PS1A 4POOA 2NZXA 4YAEA 5MFZA 1PJ3A 1NJ1A 4WXHA 3IAM6 1L5KA 3PA8A 3HU5A 2O2SA 3MMNA 4KXYA 5KNBD 1ZD5A 2C1EA 1XTUA 2A7XA 4HK4A 2XMCA 4L4SA 2JATA 3PJGA 3VR4D 2F8SA 5K3FB 3PRKE 1GKUB 1XXHA 2QM8A 3CF4A 3L6EA 3VNVA 4RLQA 5JH7F 1WZEA 4H3KB 1WXIA 4AP6A 4TT3A 2ZETA 4LF4B 4H27A 2ZRAA 4D9GA 4GSYA 4DR4B 2C5HA 1XTZA 1Y5MA 1X80B 2GYWA 2RHMA 5B30A 2XZLA 3BGVA 4BP8A 3C98A 1W85A 2VQEB 3BKWA 4HL6A 1UP6A 3FSGD 1C2TA 1E79A 1N92A 2PWPA 2Q4OA 3D6UA 3DT8A 4KX5A 4B2LA 3VVBA 4K6MA 4ARZB 3MUOA 1E60A 1DAMA 1Y3CE 3HXMA 1C7RA 2JFFA 3PJFA 4RD2A 1ATIA 4YV7A 3DMPA 2PN1A 3S4YA 3SP1A 4A1OA 1CJSA 2B4TO 4K9QA 3V2HA 4M7RA 3WGJA 8GPBA 3RPEA 2OQVA 4ZJYA 2VHUA 2ILVA 4MZXA 4DPMA 4RVHA 5B6JA 5JY1A 1JYEA 3TMAA 5BSFA 1XWWA 3P32A 1KI8A 5M29A 4EHDA 1IG3A 2ZUSA 3H5AA 3R3YA 1UBLS 2DSNA 3JCZA 2CVHA 4YP7A 2REBA 5E7MA 5BNWA 5CDGA 3CZRA 2CYAA 5BNZA 1JG3A 5JDIC 3JQFC 5JSZA 4OM7A 4B48A 5GM2A 1ZZEA 1FYVA 5BYKA 1ML4A 2FZWA 2GCPA 1YA8A 4GBED 5LKRA 2BEJA 1UM8A 2JB9A 2VNSA 5F1OA 4ZMSA 2DHDA 3CSDA 3BILA 3SC4A 5ADVA 1AMUA 3UV6A 1QG2A 1YRQA 2NXEA 4G4IA 4R8LA 1UDRA 1CLUA 1UZLA 4A2PA 2QK4A 1WV1A 2BD0A 4G07A 1J8FA 1QLHA 2GUGA 5EXEA 1BO6A 3ISTA 5FNZA 1VTKA 2BMVA 4X7BA 4OIMA 1BDJA 3HYLA 1MB0A 4QIHA 4YNBA 2ATXA 2PGAA 3ASVA 4GXNA 4Y6SA 3WZMA 1ISSA 4FMBB 1UAGA 3LUBA 1A9YA 2C54A 2W43A 3OHMA 1MV5A 2BGTA 4D9EA 2BDEA 2J6IA 1F9AA 1FSFA 4L2IB 2H5LA 4DYDA 2JD0A 1SXHA 1ZH2A 2WFMA 4G5GA 5B1SA 1ZCZA 3D3WB 4RD4A 1D0IA 4K86A 3B13B 4C0LA 2YZ7A 3KFXA 4J43A 4IXMA 1ZWKA 1OBOA 4LVOA 1HETA 2VDKB 1ONOA 1V35A 2H7VA 3PIIA 5D5HA 5EA2A 4EM6A 5AVUA 1L4BA 4NOMA 3RYHB 3JYLA 1DFGA 1G2IA 4A8JB 3WMEA 3U16A 3TTWA 2OCGA 1U9ZA 2O9JA 3G1WA 4I4TF 3GJQA 1E2GA 1YQXA 2FI1A 2JGJA 2COEA 3MZ0A 4U9UA 4QVIA 5IKMA 2GAOA 3T3IA 4KH0A 5IKEA 3NBZC 3RFVA 2QBYB 1Y37A 3ORRA 4PZAA 4BOYA 5J1SB 1SMKA 1D2EA 1AK2A 3HB7A 3T0IA 1Y3HA 3D0QA 2BFBB 2IUEA 2G5GX 3FCCA 1KERA 4IP0A 4P54A 3MJCA 3EFOB 3OZ7A 4UVGA 1M6WA 1RYEA 3JATB 4OKSA 1QHGA 3RKUA 4DPKA 1SA0B 4BVLA 5JZMA 3GFBA 3STYA 5E7IA 5IASA 4UASA 3F9CA 2I1WA 4RZ3A 1FNCA 4AUKA 3UV3A 1NBEA 2HLHA 3G6WA 2YJGA 4O2AB 2WZCA 3SVZA 3EDRA 3CLKA 4AMBA 1RI3A 4HUTA 1HOTA 1JFVA 4IQ0A 1GNLA 1CY4A 1RYMA 1QF7A 4RSHA 2PL3A 4XSVA 1ZXLA 3H0KA 3O4HA 5HS4A 1UBTS 2DC1A 4ZEXA 2JA2A 4KLRA 3TAUA 4DCCA 1WS6A 1VRCA 1SOUA 3NKLA 3AO0B 4JL8A 3LQQA 4UPVA 1T2AA 3KR1A 5C1BA 1XCLA 1HI9A 3UPDA 4S0XA 2NUTA 3OKAA 2ERYA 4FZ5A 1B4DA 2BZ1A 3CZQA 2WPDD 4K81B 3TXXA 3PVSA 3D7RA 4RU1A 5D6OA 2VXBA 3G2MA 1FUIA 3PPWA 1MGPA 3EA0A 1B8PA 2QJFA 3AG5A 3IB3A 1GQOA 3IKJA 6CHYA 3ETGA 2JIBA 4AROA 3CSSA 3HEBA 2I67A 4LF6B 2ZRJA 3JYPA 1ZWLA 1FTNA 2OMEA 3BIOA 4RE5A 1AJEA 3HJCA 3U9LA 4YV2A 4MYCA 1ZS9A 5MN4A 4O2BF 2JG3A 2HJWA 2ILTA 2PXAA 2QR2A 3BVPA 3G1UA 4G97A 4Z9YA 4FT2A 4HDRB 1E94E 3MTGA 2CVQA 3ECSA 3RFFA 2ZJ6A 4WE3A 1SNYA 1WCXA 3C4QA 1C41A 4BMDA 4DIFA 4BLRA 2XSZD 3ZDEA 5G3YA 2GN6A 1WBJB 3MSCA 4OGFA 1TQ8A 1VHQA 3LUAA 4WD3A 4YCAA 3T5AA 3SMVA 1TUIA 3DDWA 2GEUA 3EZNA 4N8EA 4WBNF 2WD8A 1NG9A 3KQQA 1ZMXA 2XZTA 1BN6A 2IXDA 4MVCA 4TWJA 5ESRA 4AAYA 1XQVA 5AW0A 4ND2A 4TYYA 3GN2A 2R5WA 3IQDB 1J1ZA 1OWOA 4NF2A 3PHLA 5A05A 4BFTA 2HHHB 5AJUA 3C74A 1X7XB 3I05A 1MB2A 1AXGA 1L4NA 3FI9A 4MW7A 3RUDA 4BFVA 1Q2XA 2PH7A 5FF9A 3NTLA 4RELA 4BQNA 2YMPA 3NWOA 4KFTA 1S02A 2A9PA 4TKVA 1EVIA 2QV7A 2B9EA 3BMCA 5MN5A 4OQ4A 3PIRA 1IY8A 1LY1A 2HLDD 1Y3BE 3I5AA 1E4EB 5BV7A 5I7SA 1AV6A 1RLIA 3KJNA 2CDRA 4HGPA 2JIRA 3TS1A 3ZDDA 1FDIA 1CZOA 2VO1A 5KQLA 3CJTA 3AZQA 4QBKA 5G0WA 4MCHA 4AIRA 3G9ZA 3TNLA 3IIMA 1VJDA 1XU9A 1H3FA 3V6MA 5HKKD 4HPXB 5CX1A 3RIGA 1NJ6A 3GH3A 2ZSJA 2XUIA 5I7EA 4D6XA 1QGDA 4QUAA 3R0JA 4OHXA 1QFZA 1JBKA 3J81A 1OH7A 1Q84A 1TEVA 2KQUA 2P11A 3EXIB 3OPVA 2Y0PA 1JFLA 3N2KB 1BX3A 2RGUA 5KOJA 2C4WA 2JNWA 4MEAA 1U2ZA 4CMIB 1WZIA 2NNLD 1MPXA 1XQYA 3E9YA 3E27A 1BXKA 3HZRA 4XWTA 1Z4IA 5JMTA 3CVYA 1UKAA 3AEUA 2QPTA 4CL0A 2R97A 3FJOA 1FTSA 1QZUA 1TO2E 4IVNA 1AA9A 3W0LB 3WNCA 3AESB 4EMBA 2AWNA 5BT8A 2CL5A 1QGUA 3T7IA 3K6KA 3EAQA 2Q5QA 3ZWNA 4YQFA 1XQWA 2M1ZA 4K6KA 5B57C 4WA7A 5I7RA 1QQ6A 3G82C 4OLAA 1A50B 2NW6A 5KJ6A 4R8VA 1RBMA 2YWCA 2VQFB 1L8AA 1MB4A 3OLXA 1T5IA 2GK6A 5K0CA 1OAOA 5CLQA 5B7NA 4Y1RA 4D4KA 3DDZX 1OI2A 2G1AA 2YN0A 5CK4A 1U04A 1OXMA 2JBWA 2IBMA 1SUSA 3IB6A 2R6ZA 4U0JA 2P4EA 3H19A 1VJGA 4LJLA 4PZCA 2HIAA 4QGGA 2MSDB 1A82A 2HB6A 1NU6A 4BB6A 1D0SA 1DXHA 1RM5A 3N0WA 4DUGA 3GZNA 3I6YA 3OIWA 5D6NA 4JNKA 1US8B 4JI4B 2NSDA 4OOFA 4Q15A 1JYSA 5B37A 2ZJOA 1E6WA 2EFEB 4B3HA 2J7PA 3KE9A 1FUUA 4UQPA 1KI4A 3CVJA 2R8OA 4PGGA 4PR3A 2LRHA 5EXPA 3UATA 4GZ6A 1BS9A 4D57A 4CETA 1T9BA 3ND8A 3K0FB 4HSGA 1FYWA 4HXEB 4PSVA 1H66A 2GETA 4B3IA 3UJBA 3WJ7A 5AW1A 1KORA 1YE3A 3MHPA 3TZHA 3NV9A 1E77A 4BFZA 3LH5A 1OB5A 3HR4A 1NNEA 3PI7A 4R1LA 4CV3A 3Q8KA 3B1KA 4WKCA 3CG4A 1O0SA 4R2XA 3UAWA 2NZ8A 2V98A 3F74A 4IO0A 3ZDFA 2EQAA 5AI6A 3UAZA 4C4TA 5LYJB 1Q0QA 4MUGA 2IBSA 1JHRA 1A9RA 1P8JA 3WHLA 6GPBA 3BXEA 2JLWA 1Q77A 1SIUA 2EYUA 2NV6A 2XE8A 4R2JA 1GTJ1 5I7OA 1B0PA 1NYRA 2WJPA 5ALDA 4YPVA 1WUJS 2W8BA 1HFKA 3R3JA 5DWVA 4L0CA 4JI5B 3G2HA 1ANKA 3HBAA 1WQ1R 2HH9A 2ZR8A 3WI7A 3ZY3A 1VHDA 4HNVA 1KOLA 2LTAA 4CRWB 3DYBA 2EFHB 1UKZA 1OILA 3TQOA 5JASA 2NPFA 1GQ2A 2O57A 3ZBTA 4ENQA 3T3PB 3SHFA 4LZPA 4G5XA 3RFUA 4QDJA 1I1OA 4A5SA 1IQUA 2IW3A 2VDRB 2VWGA 2FPMA 2HCRA 3RARA 3K6JA 5DSTA 4F8EA 5CDFE 1EK6A 3IJEB 4DCSA 1CSEE 3ABRB 3JQBA 4NCKA 1NUUA 3UZUA 2BMJA 1YJCA 5BQPA 5PGMA 3QG5A 1AF7A 2WJVA 3RHSA 9MHTA 2QRKA 3IHTA 3RF6A 2D0PB 2H4JA 5DB4A 1A1SA 5L3QB 1YHYA 4JLJA 5KYTA 1VIVA 5DASA 2L69A 2ZKIA 1EBUA 1QMGA 1N2OA 4BBJA 1ST2A 3N6VA 4M2LA 4QO8A 1HORA 3KVNA 4J0IA 4OP3A 1UIRA 2XKBA 4JB8A 4B7UA 4TLEA 1JSZA 3RS8A 5IT5A 3EF3A 4DNQA 5A6VA 1W36B 1QYIA 2AG1A 2UZ3A 1V5IA 1MX1A 2XCQA 3OD5A 4WUVA 1WUHS 4XVQA 3HV2A 2YRFA 3JWPA 3SYMA 3U3DA 5I7WA 2FSGA 3KTAA 2WAXA 5DU2A 2O05A 3UHAA 1IOWA 1RDFA 1H2YA 4C7VA 5TY0A 4O4LB 1JHAA 3ESAA 1BD3A 2XGOA 3ZXIA 5AVYA 1G4UR 4TL8A 3B3GA 3M1LA 2UUPA 2XRZA 1N5RA 3KRTA 5A5GA 3PZBA 5EVJA 4OG2A 3QIVA 5A5DA 4BO6A 2O5CA 1PGJA 2QJWA 3HGTA 1G5TA 4WLVA 4D43A 1Y1QA 4IFEA 5GGYA 3UXEA 3X0DA 3DP7A 2FPOA 3JQGA 4HH1A 4LI3X 1KE2A 1T5HX 3WWDA 5AOBA 2PZLA 2D7CA 2GAIA 2OZVA 3NATA 4MCAA 1EUQA 3TSYA 1JJBA 1SKAA 2WYVA 4BCDA 1HMYA 2FW7A 1TIKA 3HZOA 4TS4A 4WBXC 1SOMA 1XAHA 3GJ6A 1E9DA 5T4HA 3SYRA 3MM4A 4LNUB 4YJFA 4NABA 1YS2X 3QVWA 4YMIA 5H3LA 1I5OA 3L3BA 1N36B 3GUVA 4LWOA 3TCKA 4JY7A 2QX7A 2Z83A 5FI0B 3LECA 1WMEA 3V5NA 4DLYA 4YAFA 1U0RA 5JO0A 3I01A 2ACKA 4JCCA 1BS2A 3C5CA 5FO0A 4E21A 2VH5R 4QFDA 5C8VA 2Q4RA 5EIOA 3L4BC 1Y8RA 3KOYA 4Y8VA 4CTNA 2PLRA 1U8TA 2JIQA 4JLAA 2DBRA 4C07A 2PS9A 1ZZGA 1UMBB 2HY7A 2SECE 2Y4NA 2Z3VA 3CXRA 3GP3A 2FQQA 4H7JA 4TMTA 3ZNNA 1V3UA 3KOMA 3K73O 4BJ5A 2NP6A 3HWX1 1XRNA 2D2XA 2O2HA 4ZCLA 2PMKA 1D07A 2QX8A 3QU4A 3Q4GA 5LD2C 1XZJA 1RYBA 3DE3X 4KPUA 3S3TA 3UYKA 3VKUA 1CVRA 2FN8A 2ORVA 4YHHB 2IIBA 2JIZD 2FR0A 1KYQA 4LQ4A 1GPH1 1H2ZA 2B5OA 1J70A 2JAQA 1FLVA 2KHZA 3LQRA 3TNYA 1EFHA 2RG7A 4W7IA 2ZPUA 2XVZA 1VSQA 4HDQB 5KVQA 3CEJA 1RKUA 5I9BA 2ISCA 2YW2A 5AD1A 4IINA 4C3ZA 2K6GA 5TGDA 2CVFA 3ASUA 3WGOA 3NALA 4FHFA 2CXRA 3HFRA 3M81A 3RK0A 1YI1A 4I0WB 4MB0A 3VU8A 2H18A 2XTMA 5KSZA 4RTJA 4LHEA 4B8ZA 4UAUA 4D4JA 4YV0A 5G40A 2CCKA 5ICGA 3M1IA 1T1SA 2LCFA 1KAHA 5K0GA 4IDFA 2GD6A 1OT5A 1TQDA 2R8BA 3PC8C 1YZKA 2MSKA 5HM6A 4KO4S 2OHIA 1R5JA 4OI4A 3UKOA 1A76A 1NN0A 5C0OE 5KPJA 4CKEA 4LXHA 3H3FA 5EMKA 3PX3A 1ZHHA 4KE9A 3U13A 3WQRA 2OSBA 1G9TA 1H93A 1MFPA 2G36A 2G0TA 1GZDA 1X8KA 2Z5LA 4DLAA 1HKHA 1U5AA 2C9DA 3H9UA 3DOEA 5IF9A 1J2YA 4MUYA 5DN9A 4WADA 2ZSBA 2NU9A 1DBRA 3KKEA 1PGQA 3A11A 3P2JA 2YY5A 1VL2A 4M7PA 2Q7DA 1TD1A 2CZQA 2LVBA 3DE7X 1ESDA 2DWUA 5JRDS 4Z7QB 3MA0A 5TMBA 1KDTA 4QEDA 3GFVA 4R1PA 2AH5A 4J7XA 4X91A 1ZLXA 4UU7A 2ID4A 4BAUA 1WETA 1Z0ZA 4I5DA 3NW9A 3DFUA 1XCGB 4LX0A 2XMBA 4R3UC 3VYSB 1NRXA 3R2JA 5LB4A 4R1UA 2UXBB 1EHYA 5JANA 2ZIUB 1O77A 1UOOA 2W2VA 5JLJA 3A27A 1Y9EA 3CCCA 3D4LA 1DNPA 5EXDA 1YA6A 1DAFA 2C9ZA 2BM1A 5E6RB 3OQIB 1B6GA 2IKSA 2JDID 2R6DA 4IG9A 1BHJA 2NV0A 2PRYA 3K4PA 3U7RA 4B73A 4E1BA 4F4HA 3QBTA 5AOCA 1ZGCA 4OXNA 1A8UA 2XMRA 3KQNA 2RKWA 4HTAA 4C89A 4YJHA 5JBNA 4HGZA 5EWJB 1CR6A 3C7TA 3D7LA 2YJ6A 4PG5A 3H6HA 3THWB 3A4IA 1Y3FE 2E3JA 4NEHB 3ROFA 1PJ8A 3BXGA 2WSYB 3H87A 3GZJA 2I7XA 3SR0A 4XUDA 1A9XB 1FMCA 3PQFA 4MR9B 1D6SA 5EMJA 1FE8A 3FKSA 4RAQA 5FUXA 4CMBA 1CQJB 1FTGA 3BHJA 4WZAB 2Q4EA 3FMIA 3CZAA 3GQBA 2WSIA 3OCJA 4ON9A 2GBFA 3QVUA 2EKZA 4H7DA 3WGMA 1MOZA 3EIOA 5ADWA 3UMSA 3EIHA 3AUFA 1T8TA 3PGVA 2EBFX 2RBEA 3FRIA 1E99A 2P41A 1PFWA 1CNMA 4U63A 4Z9XA 3ZWAA 4BGEA 4YCMA 4NV3A 3HUFA 2IKQA 1RIIA 3LOPA 1JALA 3I3OA 5BW5A 4XAQA 3E22A 5IKXA 1E9EA 5BP7A 4IO1A 3MWDB 2ZJAA 1P31A 2A1UB 5AW9A 4NJMB 2WTBA 3L8FA 4PNZA 2ZQYA 5FCDA 3ZY6A 1JE0A 1OLSB 4GLLA 4HBZA 3VI4B 3V8NA 2PKQO 1UBGA 3I1JA 2A9OA 1UM9B 4RV5A 1TK3A 4DSOA 4JLSA 1WW8A 3PD1A 3VC2A 1QK5A 2DQYA 4ND3A 1HDYA 1ZP6A 4EYQA 3GWGA 1P7ZA 1ZK1A 1Z75A 3AHJA 3IDAA 4E13A 3GRCA 5CXUA 2GWHA 4LC1A 3FPEA 4C14A 4L27A 2YJ5A 4MPJA 5B3AA 4CIBA 3WGUA 1R27A 1YRHA 3C3DA 3EF1A 4G4SP 3ZD7A 1FX0B 3ZCXA 5F2NA 3L8GA 5E9WA 2PX8A 3LHDA 3SMQA 4HH0A 4OA8A 2CLEB 1EHIA 9ABPA 1UZNA 3CO0S 5AJYA 4Q1EA 3GBPA 3HPRA 1E5XA 3HJBA 3L2OB 4B5LA 1YFJA 1VHJA 4D8UA 1RQXA 3UK7A 2I33A 1PEDA 4QXAA 3RTAA 5L45A 3VPFA 4NE9A 3FD8A 1FU7A 2X0KA 5BWOA 1U7HA 2VLBA 5L51A 3DOCA 4R9UC 5FTKA 4P93A 5AHOA 4D45A 4NZZA 1SKQA 1QG4A 5JVDA 1XTKA 2GR9A 3C8UA 1OH6A 1ZA1A 3DL4A 5F5XA 5H9WA 1THMA 1QYWA 4QBFA 5EZQA 1DHRA 5I9MA