4XLZA

N,n'-diacetylchitobiose deacetylase (semet derivative) from pyrococcus furiosus in the presence of cadmium
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
267
structure length
267
Chain Sequence
MFENVSTFEEAFNKLLKEVLEFNLENPFEDAKKVICIEPHPDDCAIGMGGTIKKLSDEGVEVIYICMTDGYMGTTDEKLSGHELALIRRREEEESAKLLGVRKIYWLNYRDTELPYSREVRKDLVKIIRKEKPDGVFAPDPWLPYESHPDHRRTGFLAIESVAFSQLPNFSNIDIDIGLKPHSVSFIALYYTHKPNYIVDITDLMELKLKAIRAHRSQFTDDIWETWEPFLRTVTMFYGEKIGVRYGEGFRVMPGLFYHITPFADLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Multiple crystal forms of N,N'-diacetylchitobiose deacetylase from Pyrococcus furiosus
doi rcsb
source organism Pyrococcus furiosus
molecule tags Metal binding protein
total genus 95
structure length 267
sequence length 267
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2015-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02585 PIG-L GlcNAc-PI de-N-acetylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10320 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold LmbE-like 4xlzA00
1Q7TA 5CGZA 2IXDA 3WL3A 1Q74A 4XLZA 3DFFA 2X9LA 5B2EA 2XADA 3DFIA 4XM1A 3DFMA 5BMOA 4XM2A 4XM0A 3DFKA 5B2FA 1UANA 3WL4A 3WE7A 4EWLA
chains in the Genus database with same CATH superfamily
2IPOA 4ARAA 3LC1O 2XOKD 4FT2A 3CN7A 4IOMA 2BHTA 2QBYB 3AERB 2Z8XA 2EKLA 3KQTA 1C0EA 1SVSA 1LJLA 1RRPA 1YRLA 2F9FA 2VQ6A 2ZWMA 2E0IA 3D3QA 2Q3FA 4QXMA 4WNAA 5DLYA 4LXGA 1E3WB 3Q8WA 3QRWA 4RBNA 3IB6A 3R9XB 4BNNA 4I1SA 2FG6C 3D2AA 4ZZ0A 4DR5B 2I4TA 3H1PA 4R9NA 4X54A 2FK8A 3UB4A 3EZ2A 5BN3B 4E30A 4I2VA 1K86A 3GDWA 4D44A 4E2ZA 5MFPA 2QQGA 3OPQA 1OB2A 5ICSA 3PHIA 1OLSB 4P81A 3O8DA 2D1QA 1Z2AA 1M72A 3Q3IA 4MQFA 3TFQA 2QLFA 1W36D 1PNRA 4FNMA 1RBYA 4U6QA 4HDKA 5ES4B 3QGMA 3TBHA 4BNDA 2PWBA 3QWAA 4HH1A 2XIJA 1Y4UA 3RTDA 4XDZA 4M89A 2A1TS 5BYJA 3A7EA 1K92A 1JFFA 4D6PA 4TM8A 4DMGA 2AVNA 2GESA 5AVRA 4K9NA 2G28A 5EZYF 4RHTA 4XZ3A 3G8BA 3LU1A 2QVLA 1YZLA 2I80A 1Q57A 2ABWA 1SU6A 4B3BA 3T5GA 1PR2A 3SLKA 6ABPA 4E5SA 4R1UA 1Z82A 4JCCA 4FQ8A 4JOBA 1DDOA 1FBNA 5CX1A 4UARA 2DWOA 1PR1A 2X14A 5CH5A 3WMXA 2IYPA 3THRA 1V6AA 3K72B 1P2BA 3ZK8A 5JW6A 2DBYA 4NV0A 3N8DA 2Q3EA 2FWIA 2CUZA 5H80A 1OC2A 3F5QA 4F46A 2PS3A 1OVGA 5ALSA 1RQ2A 1P1RA 3EVTA 4PIPA 4AP5A 2QD2A 3JQDA 4QA9A 2HMAA 1JILA 5LPNA 1V48A 1BS9A 2FPUA 3IOEA 1SBTA 3KZMA 4DMHA 2FDCA 4ZO6A 1OI3A 2PKYX 1Q44A 4NBWA 5ALZA 5JXGA 1PS8A 1A82A 1ESDA 1XHEA 2HH9A 2QP4A 3DDOA 1YJCA 2I99A 4U7FA 2PY6A 1A96A 3CRRA 3RLFA 5IEJA 2XNHA 2VJLA 4RD1A 4AZWA 4LG1A 3HBAA 2HHLA 5KUTA 2WQZA 4F12A 4FQ5A 1KY2A 3QUCA 4HDSB 2JAOA 4HUJA 3EGXA 3GHYA 3L6DA 1JYFA 4H4DA 4HLDA 4LTDA 2GEFA 4P3NA 4Z51A 3BB4A 2YYAA 3CX7A 4OBWA 1LKZA 1F2TB 1F2UB 4CKWB 2GH1A 2WIKA 4CKYA 3V8NA 3TL6A 5AVOA 3OHPA 4PVDA 3RRXA 2WSIA 3KWFA 1KYWA 1RW4A 2HIHA 1S01A 2VP5A 2FETA 1B0AA 1N3LA 2IUYA 4RH3A 5A0FA 4JOCA 1DOAA 4I5DA 3CVYA 1UP6A 3GJQA 1G21B 1PWXA 1RR6A 1YI8A 1TZCA 1GSAA 3GJZA 3EIEA 3RHZA 3UBMA 3E5NA 2LIPA 5BR8B 4Y9RA 5LQJA 2Y6UA 2OHIA 4D4HA 2I7XA 1MIOB 4NOJA 3VU9B 2DZDA 3TB4A 3ZG6A 3C1AA 1FRVA 4RGQA 2XQIA 4WEOA 4YCBA 5ELMA 2RGEA 1ZINA 3QUQA 4Z8YA 5KYVA 5J59A 4ARBA 4TMTA 1U7XA 2O54A 1S2OA 1ID1A 4KV7A 4X63A 5JXIA 1LNZA 4XQCA 3HCPA 4GLJA 1U81A 2CXSA 5CBPB 1Q2UA 3I28A 1C1XA 4MJ3A 4V0RA 2QUBA 3A4VA 2XUGA 4R0VA 4D4IA 4D9GA 1PWEA 1YR1A 2R1VA 2JAXA 2OG2A 2PVSA 1KEZA 4GZ3A 4KAXA 3T38A 2HBZA 4ECAA 3VOAA 2DKNA 2OZLB 3ZZ0A 2C3PA 5ESXA 2IV3A 2OLJA 5BNZA 2HYIC 1O96A 4AL4A 7YASA 1ESZA 2WVGA 4ZDWA 3RUFA 4BKPA 5KWSA 4G5HA 1BXRA 1E3DA 1WNTA 3ENKA 5CA0F 4I36A 2VPQA 4L15A 3UAXA 3HXMA 3G79A 1WUJS 5M2QA 5U1PA 4RTOA 2GF0A 4Z99A 4BUZA 2XMZA 4YCNA 3NIDB 1VG0B 1IG0A 1JPVA 3C3CA 3FFWA 3KG2A 4Q93A 5M04A 4Q3LA 2AKYA 3C0KA 1DKLA 3AI2A 2OBLA 3CKMA 3OOHA 1S5PA 5L3QB 3HXKA 2DUWA 1CUIA 2CHEA 4L2IB 3VKGA 5BNIA 1P1FA 3IQEA 3N6VA 2IV7A 1FA9A 1JXOA 1S1CA 1YOVA 4E70A 3QM1A 4KQFA 3WGMA 4H3HB 3TTSA 1QCCA 1XJ0A 4PO9A 3GGSA 1Z4JA 2BELA 4C1NA 1U0LA 2BCEA 4L8GA 1E62A 1NTRA 5C8VA 1SVKA 3U4AA 5JI2E 3D9QX 1MQAA 1BX1A 2FLKA 4Q3CA 4YRAA 5I7AA 2ATXA 1SHZA 4AG5A 4EEKA 2AR7A 4H7FA 2WFMA 1SY7A 3VO1A 3AI7A 2PKXA 3VUFA 3DEHA 1IHXA 4PAGA 1KKMA 3SVZA 2Q99A 1AG9A 2R6FA 2ZIZA 3D3NA 3CZQA 4FKBA 4EL5A 1FU7A 4OYHA 2WG2A 1XPJA 3VHXB 2AMJA 5EZ6B 2HWXA 3D1VA 1KMHB 3HJGA 3ONEA 4BNVA 1FYWA 2FUKA 1BQ4A 3O8LA 4MV8A 3VR5A 3WZ2A 1F4PA 4BN4A 1KOGA 3CJRA 5E6RB 4D0RA 5K0SA 1NP6A 3QIAA 5I5GA 3OG9A 4OJMX 2JHGA 5KJ6A 1HKHA 3V3KA 2QQ5A 4K9QA 3BXXA 3AF6A 1GZ7A 1VBNA 3L0ZA 3O47A 2FHPA 1JA1A 3TBFA 1FDOA 1TU4A 4Q9AA 1JXMA 1YZHA 2E4AA 3C98A 1FB5A 3ZS9A 4YRJA 3QUAA 1YJAA 3NBUA 5FJJA 1KF0A 4OKNA 3R5JA 2G82A 4NENA 1E2EA 3WSVA 3H0CA 1DLJA 1GY8A 3TUIC 5I7RA 4YCSA 4NCIA 4ZVUA 1ZKMA 1YIAA 1S7GA 1DMSA 3KDPA 5EXDA 1C3VA 4C9BA 1XVLA 3CNLA 1F0NA 1FNCA 3FCEA 3M6UA 1ZU4A 5IBPA 1B4DA 1Z6AA 3RC2A 3OFKA 3T3HA 4CU2A 5B2FA 4NXNB 2RHLA 2QL6A 3RVKA 2LDBA 4LNHA 5IAEA 3KJZA 5CT8A 2DQ4A 4U4AA 3V4FA 2BRUA 2Q8NA 3CIFA 3UKDA 1AKRA 1M1NB 2EGHA 2YJ5A 1WUIS 3K0BA 1UODA 4FEYA 3N5KA 5ALMA 2ILVA 3SBXA 1EUZA 3HSKA 2R6AA 1ITZA 2BR4A 2C3OA 5I9LA 4W8GA 2CBGA 4X94A 2IE0A 3HWRA 4C14A 4B44A 2LD4A 4P32A 5JG7A 4PLHA 1NU6A 1RI3A 3D4BA 1ODJA 1F06A 1W1IA 5EIFA 3IUYA 3A2LA 2LNDA 1VCMA 2OAEA 2PPLA 2IHBA 3GLHA 1KH2A 1O8BA 1VPDA 1ZEJA 2DE0X 3SOZA 5LXTA 4DY4A 1T2DA 3GQVA 3RWMB 4DLWA 5JDIA 3ZYZA 2A5JA 2G8NA 1M1ZA 4MQEB 4B3CA 3SF8A 1XNGA 3V8RA 4X62B 2JFOA 3ZS8A 1N8NA 3OTWA 1QZUA 2WSSD 3BH6A 2RAPA 2VRCD 2XB9A 4PF1A 1N9GB 3WWCA 3NKLA 4RKEA 4EATA 3KLBA 3WZMA 2VT2A 3TO5A 3UEOA 1LS1A 3FRJA 4A26A 3Q41A 1J7KA 1YZFA 2RJOA 1NBMD 4MRAA 2JGNA 4AZSA 2PRKA 1ZGZA 5LVAA 1LBEA 1YMQA 3DWIA 3HCFA 3EMKA 5F52A 3DMRA 3GOQA 4JLPA 1UJ5A 2UUOA 1X39A 3KB2A 1OAOC 4E94A 4JENA 1S2NA 4LY6A 2ORYA 4Y6QA 2VH5R 3STXA 3WNDA 3ZE2B 3HSSA 2G5TA 2I3AA 1MPTA 4RANA 2V6BA 4Y7DA 4UDOA 3WP1B 3HLKA 2P69A 3OCZA 4QYMA 4O02B 1TYEB 1XEWY 4IX9A 4P33A 5EWLB 4DLLA 3WWDA 1YE8A 4EKDA 4G89A 4Y2GA 4F8YA 1GTMA 1UL1X 1QFXA 1VECA 4R1PA 1E18A 4V39A 4M3NA 4V1CB 3ZV6A 1X19A 2BE7A 2I1WA 2OV4A 1DQZA 4MTCA 3ERCA 1IK4A 5EJEA 4EYEA 3NJ8A 4EHLA 3ZV4A 4Z7NB 1RHMA 4F6RA 2HCTA 1OAOA 2OD2A 4YJHB 1KNXA 2ISCA 3TM5A 4B1FA 3A4IA 4TS9A 2QX9A 1JDTA 5CITA 2WWWA 1RRFA 4LYYA 4A5OA 4DV7B 2HNBA 2J6IA 2AI1A 2GCNA 4LY3A 2HAEA 4J1NA 4XX0A 2CSXA 2SECE 3D4LA 1DTEA 3VZDA 1FNSA 1A3CA 3JYQA 4NNJA 2GPWA 2X9NA 5DHSA 2V4ZA 5KX5F 4BO2A 2VYFA 2FOXA 3WJAA 1A9TA 1F60A 2FJPA 2FTKE 1JA0A 2BGJA 4ZOCA 1KFCB 4KPUB 3EA0A 3N8HA 1G20E 4WK0B 4A03A 3HCWA 4E09A 5I4CA 2Q29A 1FEZA 2BMAA 2XHZA 2ZYSA 1DAKA 5LZ4A 1WS6A 4A9AA 1YBFA 1ZSNA 2IPAB 2V7VA 1ETHA 2W6PA 5EYPB 5BVHA 2BFEB 5IN4A 1UJNA 4MROA 1AGNA 2F3RA 2R8PA 4MZXA 1ST3A 1JIQA 2J9RA 1JFVA 1QGOA 4WFJA 3WLLA 2N42A 4M0FA 5D5HA 3LXXA 2JFPA 2XZDA 4TVKA 5JWHA 4LJRA 4GZ5A 1FDWA 3BQNB 4KFSA 5H8WA 1VM6A 4XWWA 3Q3JB 2O1XA 4GOJA 3I30X 4RY2A 2R48A 4EEXA 5C3MA 3TGPA 2J6CA 3C7KA 1DIAA 5DE3A 4F56A 4HQOA 3J81A 3DBLA 2PGJA 1A9OA 5BSFA 3MAJA 4QXAA 4CUJA 1L4FA 1ESEA 2FZGA 5DM0A 4PTYA 1U80A 2G25A 2WLTA 3AR9A 1IZZA 1Z5NA 4KQ6A 3W5UA 4BGEA 4O25A 4WLNA 1AQUA 1Q7GA 4MQ6A 5KNCA 2ODAA 1WBJB 4BO9A 3QUTA 3SVTA 1IBCA 5J63A 2I3DA 5B3LA 3QPDA 5I47A 3F6SA 3UJNA 1Y9JA 5JH7F 4A2QA 1YCFA 3HMKA 3A04A 4JGBA 1NUPA 4O2LA 2IELA 3PTLA 5E2IA 2QGNA 4E46A 2P4UA 2VAXA 1NSTA 2ZIFA 3JQBC 3KDSE 4PFKA 4WVLA 4RELA 5CYPA 5EFZA 1JMKC 1JAIA 2BFCB 4ZJZA 2G5GX 4BMVA 2PMFA 5G2OA 3VKVA 5CFOA 1NG9A 2DLCX 4NBTA 2BM1A 2PX5A 1RKVA 3ACBA 2VLIA 3AR8A 1P2SA 3M9XA 3FSGD 3DUFA 3MD9A 1YOBA 2PMDA 4M1TA 3RGWS 1HETA 1MAVA 4D6YA 1JAYA 1OKKD 1ECBA 1SCDA 1SKQA 5ALKA 5FFMA 4D8TA 3IDAA 4AQYB 5DI3A 1XYYA 3Q12A 4D96A 3AOEA 4DEXA 3KZCA 1YO6A 1ZI8A 3KYJB 3GQBB 1T8WA 1UH5A 1ZGBA 2G83A 2GAAA 2OFPA 4I46A 1VA5A 3FDJA 5JYCA 4EB0A 1JZSA 1X14A 3HABA 3JQBA 4Q3NA 1QX4A 3GVCA 4PYNA 5TRTA 2NLOA 3VJLA 1CV2A 2XF2A 3QP9A 3LY7A 3NHKA 5FIUA 1PL8A 1ZXLA 2VBIA 4LBZA 2PX3A 2WJ6A 3DO5A 4YWJA 3TVDA 3H6GA 4CI0B 4LF7B 3K5WA 4BNIA 2C04A 1KGSA 4IIJF 2QN6A 5EVJA 3ZGZA 4Q3BA 1GUYA 1CY1A 4G2NA 4H77A 2FQQA 1Q1EA 4U5XA 3ER8A 2MSNA 1A97A 1ECGA 1M34E 2GJKA 4Z3OA 3L02A 3O91A 4H7IA 1CR0A 1FFAA 3RF6A 1V11B 4DADA 1XA4A 3ZX5A 1WB4A 3PNLA 3D7KA 3SF0A 1QFYA 1PG0A 3DEJA 1RDFA 2G0NA 2IZOA 4NARA 2O5EA 3WIEA 1W1UA 1UZAA 3MMZA 1P7WA 1N75A 3ELDA 4MGEA 3KSBC 4F9FA 1Y5LA 1E1MA 1HOTA 3KJQA 2I6QA 3UWOA 1Y7LA 3CLSC 3QK7A 3A4MA 3M1LA 1PTKA 1ZOLA 1PKXA 1RFGE 2ETVA 3LC2O 4WK4B 4ZOBA 2P1RA 2M6RA 1RJEA 4D25A 4DNPA 2YHBA 2HDWA 3CZ9A 4K8OA 1WHTA 1QQ5A 2BGKA 2Y1GA 3PD0A 3ZCSA 3ETEA 3BN3A 3G0HA 1DWPA 4W5RA 3VUEA 2I8CA 2ACEA 5BYBA 4ENQA 5L8VA 2IITA 4KXLA 1HO3A 1G9SA 1N5DA 3AINA 3FDXA 2QSUA 4HDAA 2H7VA 4PLVA 2IFTA 4Q4JA 3FPJA 5I51A 3KZXA 4WZBE 4D98A 1ATZA 2FHSA 3PCTA 2GHTA 4XGIA 5A9SA 1EVLA 1JR4A 5GZ6A 1TO6A 5IX8A 5FOVA 5KYUB 4BPBA 5EJGA 1XVTA 3DMTC 4UD6A 5KMGA 3FPBA 4D46A 3IUNA 4JELA 3W4IA 1GZSA 3RS7A 4U2DA 1KJZA 3SQMA 1Y48E 3KSUA 5C4MA 1NLYA 3IGFA 2D4HA 3DZKA 5KCZA 4Z4QA 2G63A 4WCFA 2OCAA 1COWD 3OIFA 4FBLA 3RC3A 1SKMA 1L6RA 1OBOA 1SHLA 1Z06A 2LVBA 2PGIA 3M4JA 4JFAA 5LP6C 3DJYA 1QZTA 4M1WA 2VWPA 1WZUA 1U3DA 3R76A 1AQNA 3GNSA 4GE3A 2AQIA 1P39A 1VSVA 3LDAA 5JCZA 2O6LA 2A9FA 4NRDA 1I3MA 4UQPA 4M9XA 2C96A 4IDEA 3BEDA 3URKA 2P6OA 3KOZA 1PG2A 1TKAA 1UFOA 1JQKA 4QUEA 2E9SA 1IUNA 4H27A 4ZJPA 2VP6A 2PLAA 1M1YE 3QV2A 4B3JA 1UIMA 4LI3X 2ENUA 1E6MA 4WE3A 1XX6A 2FRDA 1XDUA 1IU9A 2DEUA 4TXMA 1LV7A 5CIQA 1RSZA 3P9NA 3KZNA 3T6KA 3NHWA 4BX2A 1MBZA 3BWVA 1X74A 1U65A 2D7JA 1KIFA 2FLVA 2GUGA 3LOUA 4D1YA 5BMVF 4OA5A 3QMWA 5LP6A 2C4VA 4JLBA 1NVVR 1EB8A 4O4JB 5FLEX 3VXKA 4MO2A 2YCLA 5AM0A 5EE9A 1KO1A 1SD5A 2VZ0A 4DUGD 2QRUA 4LDPA 4KR7A 2E55A 1JAZA 2JD0A 1N9KA 5D3MA 2OE2A 4C0WA 1ONBA 5G0WA 2H52A 1X70A 2Q4OA 2VHCA 3D4PA 5HFAA 3S2YA 2OXIA 4II2A 1VTKA 2VP9A 3ZY5A 4EO9A 1H23A 5HM6A 4G65A 1P8AA 4UFOA 2A0XA 1RKUA 1T3HA 3LT1A 1U2GC 3O8QB 4LY0A 2QRHA 1GPWB 2V6GA 4YRMA 2QD4A 3HDVA 1DRKA 3HU2A 4M6WB 4EM6A 2ID4A 1DC5A 3BEOA 3LA6A 1N1GA 1E7MA 2HSDA 1YBAA 3BF8A 5ENDA 3ZEIA 2VPXA 1FE8A 1JEYA 2UYYA 1U11A 2W98A 4H7KA 1ZHHA 5JE8A 1KIAA 3PT9A 3R3JA 5JLAA 1K4MA 5TQ0B 2G6BA 2TRSB 2AC7A 1R7RA 4DLNA 1VE7A 3NAMA 3CF6R 5JSYA 4C7OA 1FXUA 2OQ2A 3WLEA 1H4QA 4F92B 3L6RA 4AUNA 3A4NA 1L3IA 1JBEA 5C35A 5DCUA 4YMGA 1FUKA 1FTQA 1SCJA 1KJ8A 2DWCA 3NXSA 3WFJA 3F0TA 1U2GA 4QTTB 1UM9A 3T7JA 1WOMA 1Y1LA 4GP9A 4EDHA 1FUEA 5CCBA 3PHLA 4WFIA 3JR3A 3QKRB 1OQAA 1T6ZA 2PUWA 2Q45A 3AB8A 3DMYA 3IUPA 3CURA 3QTTA 2Z8YA 4S35A 5EJ2A 3THOA 5IPFA 1X1BA 3NFYA 5AJYA 5CHEA 3SZLA 1GDDA 3NYIA 5IAJA 8MHTA 3H3JA 4S12A 4BO7A 2ZG6A 2FEPA 3AL2A 1KOJA 1JHVA 1P2UA 3EWSA 3MEQA 2OFWA 4HXGA 3DTVD 1MX1A 4UUAA 1TKBA 2X41A 3REQB 3IO5A 5FAXA 1SG6A 2HRRA 3RUEA 4YIHA 2PNJA 1L1FA 1E0KA 2GTHA 4ARZB 1A95A 1LQTA 2NQ8A 3KE9A 4EG8A 5BSVA 4NBLA 1Z12A 2AZXA 2PHZA 3WP0A 1NWHA 2I5PO 2QT9A 1WKVA 1OIXA 3LXUX 3AKYA 3QU4A 4NK5A 4Z4IA 3K31A 1TVEA 4UU8A 4BBJA 1XK7A 2RKWA 4I9UA 1GGMA 1X1RA 2XUQA 4NV1A 3MMSA 1JJ7A 4OG2A 4PZPA 1RQLA 4S1WA 4LFBB 4HNQA 4WZBB 4K1LA 3ROKA 4XSHA 1OE0A 2C9BA 1UWCA 2QD5A 4FNGA 5JPDA 4K26A 1P74A 3W2EA 1MAHA 4F7DA 1P7VA 1E63A 1OC4A 2G71A 3EGVA 4RAQA 4AQ7A 4PHGA 2ZJ2A 3QVJA 5G3YA 4QKQA 4FM9A 1EUCA 3B1XA 5K5EA 1MORA 3OM0A 3RHTA 2J5BA 1X7WB 3P97A 1I5RA 1WLSA 2I7CA 4OV6B 3S70A 1ODKA 1JMVA 2O1EA 1PJRA 4CDRA 4EJSC 5FPKA 4LTMA 1YB6A 4JASB 4ZVRA 3PYLA 5AW8A 4O29A 4Y2PA 3WK6A 1DI0A 2XGJA 4JBWA 2BJWA 3DXYA 4IJVA 4UCQA 2HREA 1E2LA 1LGYA 3ZX4A 3P2MA 1CEQA 2MMGA 4UVDA 2R751 3FOAA 3BL5A 2WINI 4G4IA 5JAOA 3D2CA 3SYKA 3AVUA 1CNEA 1EAYA 1NF8A 3EBOA 1KYYA 2MINB 3QE2A 4LCEA 5FULA 1FJGB 5AM5A 1J0BA 1SRQA 1OPRA 1ODCA 1NVXQ 4XGKA 5KB3A 1DG9A 5LUBA 4BFUA 4N3CA 4MRMB 3E22A 4U8HA 1VBKA 4RIEA 2PQ6A 4HXFB 1TOAA 5C5IA 1CEYA 1X7YA 4RKQA 3I8SA 2Y9MB 4K6FA 4EJSA 1SEPA 4XD7D 4YMTA 1J5XA 2FPRA 2IODA 5FA8A 2YWEA 1SO8A 5KJEA 5LMZA 1GN8A 2HPZA 2B1RA 2ZBFA 2J9FB 1E4EB 1AQYA 2IEIA 3CZ4A 2F3UA 3ESAA 4IV0A 4A16A 2P6NA 4DIUA 3HU5A 4J0HA 5A06A 2Y93A 4PCAA 2A30A 3EXEA 4EG3A 4JP3A 4IFBA 3T0FA 3NUGA 3EOAI 3IS3A 2FR8A 4RPJA 2GPJA 4RK0A 1JHMA 1PHRA 3M5PA 4HAWA 1E59A 3S5UA 2VJQA 1OASA 4B0PA 3B9PA 3PC8C 2I9KA 3E53A 3ABRB 5ARCA 2VAMA 1OGYA 1GNVA 4LOJA 4JR1A 3P2YA 5GJCA 4Q7JB 2WPDA 4ZARA 4P2BA 4BNZA 1OTHA 4YRGA 3EXHC 3SXJA 2W2OA 4H60A 3H17A 5H0IA 3ZNNA 4FGKA 1ULTA 4KX3A 1I1QB 4Y0AA 4B3DA 3B1WA 1ZY2A 1DAOA 1SBIA 2IE8A 2YOHA 1CQPA 2EFEB 1AS3A 2YV4A 2NV6A 2YXEA 3AEQB 3ZW8A 4ZHQB 2X8LA 4L3OA 4B32A 3G2QA 3F78A 3GL9A 1YVRA 3UHPA 4OP1A 3MLEA 4NMMA 1OCEA 4CEHA 2XCSB 1MAAA 4U7GA 1PGOA 3BK7A 3HJFA 4ZXFA 4HKTA 2EDAA 4ARSA 4B2IA 1G42A 3JD1A 1DTWA 2VDWB 4MS4A 4OAOA 3DKKA 3SYMA 3WQQA 1KS9A 1SVLA 5JAHA 4QOGA 3VR2D 2OUKA 1ZDMA 4NSNA 3EXHA 3LCVB 1KQPA 4LVNA 3FJYA 1FXWF 4LBVA 2FWMX 5DX8A 2DT8A 1UWLA 3SS7X 3K70C 3AVTA 1WRBA 5DBEX 3BIWA 4JQCA 4JC8A 3IO3A 4HH4A 1VIMA 4O59O 1CUYA 5D1NA 3V8BA 1VLZA 7REQB 3JD3A 2V9CA 4KUHA 5IASA 3GG9A 2FV8A 2RGUA 4HQ0A 1ZNWA 3QEAZ 1O54A 2AMFA 5H02A 3C45A 3ME5A 2I0FA 3IURA 1DKOA 2OG1A 3ZHZA 5K8IA 1JEDA 1M73E 3QBTA 5ALYA 1ZM4A 3DAOA 3WG9A 4AMYA 2W6QA 5GPBA 1ODFA 4DDTA 5K0LA 5G53C 1K5GA 1GPDG 1NF9A 3CB2A 4MUAA 4JXJA 1THMA 3DFMA 4UNQA 3FCUB 4JODA 4XM2A 2R2GA 1D2GA 3NH9A 1BS2A 3OIVA 1IBLB 2IRWA 1NUAA 5ALPA 4MAMA 4OATA 4P84A 2DQZA 3PI7A 3N39C 4MUJA 1OXSC 4WLFA 3H2HA 3OFVA 1R66A 2AN3A 2OR3A 5SZHB 3O4FA 5EOVA 3KQHA 1H5QA 3KUUA 3DWGA 2XB6A 3H11A 2YJ4A 3C3JA 3CH6A 1YC2A 3EIOA 5JYDA 2ZJ1A 3Q3VA 1F7VA 2AJBA 1RRMA 1LBSA 4LRQA 4M2LA 2BKVA 4CMCA 2GVZC 5K6RA 3LDFA 3CPJB 2ZZMA 3C6KA 4R1LA 1G4AE 1VI5A 4XFKA 4KJZA 1X80A 1UMCA 2AOUA 3A1VA 1H2WA 2XHEA 4HS4A 2GQ0A 4YP5A 1GWNA 4NTZA 1BVYF 4ZAFA 4TRNA 4MW2A 3KUKA 3K09C 3BX1A 4RVDA 4BDSA 2C5GA 4L3VA 2QYSA 4N03A 5DMXA 4DQLA 5LD2C 3KR9A 1VJDA 2CC2A 4CU5A 2EVWX 3DE3X 5GVSA 4P4NA 1ZNZA 4KE9A 3NBAA 3T3PB 4F5ZA 4EF6A 4RULA 5EWMB 1W5TA 1TMOA 4J2TA 4NJMA 2WM8A 4W6QA 2DWQA 3SHWA 3VYSB 4D9BA 2MR5A 3UOGA 1PV4A 1I3NA 3TE6A 4K6GA 3R7FA 4B76A 2YJZA 5CVTA 3IV7A 4C4PA 1BA3A 2JD2A 5FI0B 1I30A 1BDHA 3PCXA 2ZXUA 3F7OA 1SUPA 2GBCA 1XAGA 4MUIA 5TPZD 5GGYA 4HVTA 5DP1A 1EHIA 4QODA 2GWRA 4MI1A 4ZGWA 3RHSA 3DHVA 3E9MA 4NCNA 1QB8A 3Q6MA 5FHRA 4JIMA 4FONA 3D02A 4YRDA 3OETA 4YJFA 4I5IA 3KKQA 3N6RA 1YZGA 3K05A 4ZYZA 4Y9DA 3OZUA 1HTWA 4EA8A 1IK6A 2VBCA 5E2BA 2YXBA 5TQ2A 3CCBA 3EVBA 4LFAB 3HV0A 3TX6A 1GQ2A 3MAGA 3R3YA 1ZCAA 1XZDA 2ZB2A 3GW8A 3SHOA 3UMYA 2F1OA 4IEFB 4KLAA 5DV9A 5J4VA 2ZR9A 3B3GA 3BVPA 1TAHA 3HN7A 3RW9A 1BG6A 5IJ0B 3VTAA 4BLPA 5IF9A 1NVKA 4F85A 3MTIA 1MCZA 3QFCA 3FBWA 4R8RA 4E4RA 2BKLA 3QEKA 3VNSA 4DR6B 2BUAA 2UXBB 13PKA 5HTKA 3N28A 3TZEA 4MUXA 1UJ6A 1O95C 4HVLA 3Q10A 2I4OA 1QFJA 2PO5A 2VKQA 2V9PA 2YHIB 3LC0A 4LV5B 3R09A 2R47A 2F3TA 1G8FA 3G49A 4BATA 5BN5A 2QVCA 4TMVA 1ORWA 4EG7A 1FU8A 1NWCA 2JIZA 1ONNA 2YN4A 4L1KA 3VX3A 2B9VA 4UUQA 4YRKA 1PEAA 2YKGA 3CN9A 2A9PA 2QT1A 2CMFA 3NTXA 2XAUA 1TGYA 2XZTA 1RYBA 3U4IA 2J48A 1TRKA 1WZIA 3D6TB 1R64A 2OTCA 4WIAA 5AJVB 2QW0X 4GQBA 1GLGA 4JQZA 2FOLA 2PZ8A 1PJ4A 2WWTA 2ZPUA 1A7JA 1D7OA 4G0VA 4KR6A 4MW9A 5HKBA 2BTQB 4JBNA 3PQ7A 1X38A 4KRGA 2KSQA 1O95A 3IJRA 4B8ZA 3CU5A 2MWMA 1FUYB 2XITA 3HB9A 3LLSA 3LUDA 4GQAA 4XM0A 5K20A 5LOVB 1P4RA 1I14A 3DKPA 4TMYA 2FFAA 2AD5A 2BKXA 2W83A 1YZVA 4GLOA 3O75A 2YWJA 1WNFA 5EXEA 3RUCA 3I5YA 1AK1A 1MIHA 2YW2A 2ZCVA 4Z9FA 1Y6ZA 4DQXA 5JAPA 5EL0A 3UPUA 1G6KA 1WSWA 2ZZKA 4NIMA 1YHYA 4MWEA 3R0XA 4B80A 3BL8A 2WWRA 3GMDA 5F64A 5TR9A 5I48A 4NOLA 4UFPA 4IMPA 1Q0LA 2G4CA 3WMRA 1PT7A 3TL3A 1YS6A 4LBYA 1D03A 2QTTA 3QVXA 4II3A 4XDYA 2IS4A 3PNVA 5ALRA 4AWXA 3RABA 1Q0SA 3ZE1B 2Y0PA 4RD0A 3WQBA 4U2FA 3O82A 2W7TA 2BGGA 4JR2A 1ANKA 3B9BA 2B1JA 1CU1A 1AN9A 3VRHA 1JL3A 1KXJA 1XN4A 3HGTA 5KYGA 1JG7A 4GVXA 2V45A 1EINA 3VV2A 4EYQA 1EFAA 2QROA 4A0FA 1B93A 1EFUA 4TWAA 1NQUA 3B13B 4DJEC 2J3DA 1Z6YA 1XEWX 2Y8EA 2WF9A 3FDIA 4JSYA 1U3GA 4BP9A 4M0DA 4K3UA 4IAOA 2BF7A 5IJWA 3LCJA 1NUHA 1UM8A 1T1IA 1YB7A 3FYHA 4V0KA 3R0JA 1J2UA 3BHNA 621PA 2N0SA 2A0WA 2ZUBA 3UV7A 3ZCXA 3GZJA 3NTUA 4J43A 4J0GA 3B6ZA 4Y2YA 5G1OA 4RVCA 2GKGA 4URFA 3BXZA 3DFKA 4KP7A 5A0TA 2HSEA 5ER6A 1SWVA 5ILOA 1DAHA 3OMWA 4P54A 1DJNA 2YUIA 2VXBA 4LX0A 3AZPA 2ZYUX 1WUYA 3LG2A 3Q8XB 3E5RA 4G6ZA 4XB2A 3ZHUA 4V1CI 2QN7A 3CO0S 5HRCA 2XWSA 3WX0A 4GI3A 1BQ3A 4JP8A 5DGTA 3OT5A 1Q6YA 5B1IA 5L3RA 5FEMA 2PT7A 2A9JA 4XDGA 2XCQA 4BQFA 3RD5A 1J0EA 2ODEA 4ZT3A 2H5IA 1HMPA 2XSZD 2H17A 3ZNQA 2J0QA 3WBKA 2O5RA 5F2EA 4JJ6A 2WT8A 4Y8VA 4S3MA 1GUAA 2RG7A 3FPFA 4WL0A 1LVUA 1D2NA 2I65A 3EFEA 3H9UA 4GP6A 4KXXA 3W6UA 4RW0A 2Q3DA 1NFQA 4WHMA 4BTLA 4HDQB 4G84A 1GILA 1T9DA 2VHTA 3H2YA 4MA0A 2CXHA 2A5LA 2Y1WA 3ZGXA 2D0DA 2VTVA 3LLMA 4MUBA 5DCLA 2H8GA 1JKXA 4JEMA 3ZZ1A 1OU4A 4O2AA 4IEIA 1CHNA 3CF2A 1ZM7A 3D3WB 3QWHA 3V80A 1AKNA 4ALIA 4M9UA 4F5EA 2WSSA 2VRCA 1E1QD 4LCBA 4M9QA 1G8SA 2WNHA 3H16A 3IH5A 5FPPA 4L16A 1ZOOA 1T29A 3N3AC 1T8PA 2Q1UA 3HRIA 3LBYA 4M36A 1TYDE 4PPGA 4U1RA 4ZREA 3UV6A 2EQAA 3V6MA 3BMNA 3PENA 5DK6A 1NBMA 1AZTA 1M2FA 4FXPA 4G1CA 3SNHA 3VX4A 4A0SA 2JEYA 4BMNA 2H29A 2FFHA 1YGYA 5KHAA 1WSAA 2WTBA 2QMEA 1Z0KA 5EGSA 2E82A 1G8JA 2KJQA 3U6BA 1RJ9A 5C18A 2BP7B 5EKTA 3OLQA 3IERA 2X1VA 1BNCA 1RAGA 3ZTWA 2LDXA 3S5JA 4AKTA 3OESA 5G3ZA 1JTFA 4MWZA 2VQ3A 3PQDA 4IF6A 2C03A 3TAXA 1VIAA 3J80A 4ZKEA 2X7JA 3JV7A 1K8ZB 1Y8AA 5CNMA 4BGIA 2XZLA 1ETUA 1QO0D 2QVYX 1MMFB 3D6UA 3LECA 3TTTA 5KYXA 3GIDA 4HNTA 3HGQA 4FFMA 3OQIB 4TXNA 4WKNA 2P6PA 5LWQA 5B1YA 3INRA 3NB0A 2HU2A 1WU7A 3PDWA 3Q8LA 2VOEA 3DAYA 2AK2A 4IPTA 4KCGA 2G06A 4PSDA 1CB0A 1ZMTA 2JGKA 3SIXA 1EFDN 1CJKC 1U0JA 5KYTA 3OIWA 1PK7A 2OWEA 3B1FA 5KHOC 3EEIA 4UNSA 2R5FA 4MB2A 1Z4OA 5FLKA 3W6OA 5AHRA 2C2GA 5C34B 5T7BA 1EJ6A 1N7GA 3G2OA 3JTEA 1SCAA 1OJLA 2KYRA 3EW7A 5EPEA 1RFLA 1MOZA 1QVRA 3OEHA 2CL7X 1FP7A 2O0LA 3IDFA 3LVQE 3KSZO 3PFCA 5FPQA 4EPRA 1WXWA 3E03A 3GLVA 4MUGA 3G7SA 5CX4A 3F6YA 3TOXA 2PUBA 1HI9A 2O8BB 4HLUA 2FH5B 4YHBA 4IDOA 1GG5A 4J1QA 3IULA 3WIOA 2UV8A 4YCMA 5CLJA 1I2BA 2YX1A 2X13A 1E7SA 3ZPXA 4CTMA 4ABTA 4WECA 4HGYA 5YASA 1KEEB 3PJEA 3MWEB 2KBEA 1E99A 3QG1A 4HN2A 4P1ZA 2GKOA 5AKZA 3A37A 2R68A 1ZIOA 4IBOA 4BECA 4DA9A 5IYZA 1CERA 4L4UA 4RWZA 1X2EA 3CR8A 3TEMA 3CZMA 3FNIA 5DNUA 1VOTA 2MR6A 3BIFA 3NTQA 4FWBA 4HDRB 4YO8A 3S2GA 4LDZA 2ZDGA 4AIRA 3ZHTA 2OAP1 3NDRA 5BV2P 4E07A 3KQNA 1YR2A 2ZATA 5FXMA 1BHO1 1K5DA 2JW5A 4G67A 4PC2A 1L3CA 1NAIA 2F48A 2YFYA 3OF2A 2PTHA 1R0RE 1EWRA 5DJ5A 2XZOA 3DFUA 4ZK2A 3KBBA 1NXSA 4DSUA 1QYCA 2RBEA 2AMYA 4RTSA 2QMYA 3E3NA 1JWBB 2GX6A 1Z8HA 4JUDX 1XCGB 5AW9A 3W06A 4UM9B 1VRCA 1OBHA 5I6DA 1U28C 1CUUA 1O03A 2JGLA 4AVYA 3RYHA 4C88A 1JB9A 1FRFS 3RJMA 1A9SA 1FVOA 1XVUA 1QHXA 5BR4A 3LWBA 3NIGB 1E6UA 2JRLA 1XP8A 2VUUA 3FCSB 4D57A 3DE4X 3HEAA 4XR9A 4BC1A 4E2WA 4M38A 2QENA 1YCGA 2WMOB 1GCOA 4EY3A 5HE8A 1K3FA 4H18A 4ME6A 3MBOA 2WTMA 1UC9A 1Z34A 3AXTA 3L9XA 5THQA 3RTGA 4YYEA 2Y1LA 2AXPA 2WT4A 4LQLA 4PANA 3NYRA 2HD4A 1JMYA 3WXMA 1DTSA 1EWVA 3H83A 3NHSA 1UQRA 3MBIA 4JLOA 5DT2A 4REMA 3C16C 1O2DA 5I7EA 1QX3A 1WCIA 3JQ9A 4D8UA 2BFDA 4BQIA 4D0SA 1K9VF 3LIIA 2ZTUA 3LY8A 4KXVA 3UGKA 1KAMA 3LQKA 1P1KA 1X9IA 1P5HA 2C59A 2RCYA 3LV8A 1LNQA 3BK2A 1YF3A 4RVHA 5ALTA 3ZDYB 1Z6QA 3JASA 4L4ZA 4LW8A 1L7OA 3AH8A 2WMDA 1KDOA 1U0FA 1YQDA 3KJGA 2HQBA 1L5YA 4MR9A 1P9NA 2Z2XA 4P86A 3OBIA 3UJ6A 2CLLB 2FEMA 4NY1A 4ETWA 5GJBA 2QUIA 1ULBA 2P2LA 3LVFO 3RQSA 1MOPA 3UJAA 1CP3A 3JALA 3VNAA 4YK7A 3WLIA 1IL0A 3IA7A 4KR0A 4P4SB 5AP9A 1XLWA 4IGKA 2CLFB 2PVCA 4JL8A 1DEXA 2YV3A 3A4LA 3FI0A 4BJ1A 3TPZA 2FSHA 4NPAA 4OI4A 3WLFA 4LJSA 4ZOAA 1YS4A 1JQBA 5LJIA 4BCDA 3SXPA 3ZU2A 3T99A 3TKAA 2IPXA 4P92A 1Y0BA 1JKJB 2PUTA 3A2MA 4GQIA 2VRWA 3NIBA 1YV9A 1W4CA 3W2GA 1C9JA 2Y68A 4TWBA 2BFAA 2AG0A 2O23A 2QMUA 1AOXA 2A0YA 4DTIA 2GEDA 4CNQA 1Y8ZA 1BWRA 3ODGA 4EBFA 3ZI7A 1ZD2P 3AKDA 3LQFA 3OJOA 4QHYA 1AUOA 3TIFA 2PZGA 2XOEA 2XNJA 3MGKA 3M0EA 1B43A 4KVAA 1XZJA 4LNUB 4RK4A 5E2AA 3SKVA 3G2HA 1LPNA 3H4IA 4PG8A 2HADA 2AFIE 4LHSA 1R6DA 5HQ3A 2FA9A 5T67A 4F21A 5KKNB 2UUAB 2J5QA 4MRPA 2PR7A 2QAGB 5DOZA 2NSLA 1ZGJA 3HZOA 1MJNA 1R6TA 2AZ4A 2FMXA 2ZWOA 3BGIA 3EGOA 3IKMB 4O6VA 3E9RA 3WYFA 4NK4A 1NAHA 3OPXA 4TXHA 4ALMA 2W22A 4NATA 1TQ4A 2OKCA 1TXGA 3MRTA 2G9NA 4I3GA 3A27A 2J0UA 4OOEA 5LP1A 1LJ8A 2FCRA 2BHNA 2G3YA 2GD2A 3BXHA 1H2HA 5JYEA 3VR3D 3I9MA 4TRRA 4JLVA 4GXRA 2F67A 3RIMA 1IG3A 1UMKA 4X85A 4YAWA 3AETB 2ZUEA 4B47A 5CIYA 4LF8B 4EQZA 2P2GA 3C41J 1MT3A 4AO7A 2O3RA 1VRWA 2YJTD 3GMIA 2H3EA 3B6MA 4BPRA 3QMVA 4C21A 1COWA 1JU9A 4AYWA 1BVHA 4D3ZA 4DLTA 3UFXA 4I55F 1VG9B 4BNWA 1E1KA 5K6TA 1LSUA 3U7HB 3F7NA 3SSMA 1XFDA 1HMYA 5PNTA 2NT4A 2BDEA 2R97A 3V2GA 4GPD1 4RDXA 2IHTA 3WXBA 1W9MA 3AR6A 3NBXX 2ANCA 4D9NA 3OC6A 2F17A 1DC6A 1VLLA 3O2NA 5CBKA 5I7SA 3GLFE 3CVVA 2YJNA 3L7LA 2NZVG 4WESB 3NORA 1P2VA 1BW9A 2B25A 3AF1A 1GGVA 1G5QA 2HRQA 1YMUA 2ZWIA 1D4ZA 1X8LA 2OCIA 3NKFA 4BNLA 1UOEA 1V39A 2EEPA 1PQWA 3PUVA 2L82A 3IIKA 1SXPA 2IBTA 3AGQA 3KTFA 1NOJA 1L7BA 1KHHA 1RJGA 4B6FA 1RMTA 2QRVA 5EIAA 3GU3A 1SK9A 3DC2A 3CRQA 1BE8A 2IYQA 4U2CA 4DUGA 3C85A 3S28A 3VNQA 3PHCA 1UT5A 5KOHB 3ST7A 3FKSD 3L7CA 1DUIA 4H17A 1OIVA 1R18A 1RM5A 4N5DA 5A5GA 3FTPA 3HVRA 4K03A 1G2PA 4BQRA 5EJMA 1LRLA 3FRHA 1HQCA 2GPYA 2HQSA 2IJGX 1PGQA 3DEIA 3IAUA 4RJ2A 5CYFA 5BN4B 4ZZIA 3WA7A 1B3RA 1GGEA 3I09A 3P0RA 1KI9A 3MMPA 1BFKA 5DBFA 1KTIA 2VDLB 3JQGB 2BFOA 4ZYXA 1UK6A 2V5AA 1U1CA 3N86A 4RTNA 2GMWA 1EJ2A 2EV9A 5CHYA 2ATCA 1E9RA 1QAOA 1RC0A 3GZTB 3MWDB 5FO0A 3GK3A 3UJBA 4RFSA 1ZD9A 1JH8A 3F3YA 2JGDB 3P9ZA 4HCJA 1RP7A 1Z5ZA 4IIVA 4TZTA 3GF4A 3MUFA 1WCV1 1QH8B 2IV2X 4UTZA 3TZCA 2ZIAA 4EYOA 1PZNA 2FPPA 4UBJA 3FDFA 4KB5A 3RSCA 2FJ0A 2BISA 4MYRA 4INZA 3SYTA 1M6HA 2O6HA 2B30A 1FFXA 4JYCA 1W29A 2Y1XA 4MJLA 3DXZA 3IAS1 1C30B 1TTHA 3DBRA 1Z4IA 1KO4A 3JWPA 4M49A 1WCYA 1EFKA 4E21A 2FU5C 1GGHA 1KI3A 2YZ2A 1K6JA 3AEKB 3PZRA 2HJWA 2R1TA 5H7XA 4DIFA 5SY6A 1JIIA 1RQPA 5TQVA 3RS4A 2WD9A 4OFBA 3THYA 2POCA 2Q7DA 4UPEA 4TZ0A 3DTVA 1TYZA 1DAPA 3NPAA 3GEMA 4KXWA 3EY9A 3KKZA 4QFCA 1JDBC 1WMAA 3JSXA 1NW9B 4PYJA 2CFSA 1KZ1A 2QX6A 4IRMA 1KDZA 4XVUA 5BRAA 3LP8A 3BXOA 5JD3A 1WD7A 1F38A 3CUYA 2YW9A 5LB2A 1Y5MA 1RRGA 1HRKA 1RWQA 3ECCA 4POOA 2Z43A 5LZ2A 4RVGA 3K0AA 4DJFC 1AMNA 4DDVA 3H0KA 3IMCA 4YDQA 5G02A 5DNAA 4ARIA 3GUUA 3P4UA 1GQFA 1WKCA 4OAQA 5THXA 4H6PA 3DNMA 4O1IA 2OT3B 1WTCA 4TWRA 3WGYA 4TPKA 1DWQA 3VAYA 2X0IA 1NW4A 5I01A 1TUGA 3I01M 3JR7A 5EXTA 1MJHA 1MR3F 1T9ZA 3ZE9A 4K2HA 5ESRA 3QBDA 4MIEA 5DGXA 1S3GA 4RA9A 5JJIA 3E81A 5AK4A 4X20A 1ZRHA 1DCFA 5DNEA 4DT1A 1RKXA 2X2PA 5LR6A 1YA8A 3S27A 4QUJA 2QU8A 2DR0A 3QYJA 1SHKA 4E5UA 3DVAA 4HLQB 1T5OA 3F90A 1WDTA 3W5JA 3TL2A 3BSWA 3K9NA 4Z49A 2XAAA 3EPHA 1UEXC 4CEJB 4X1IB 1WQ3A 4Q18A 1Y1TA 5DXAA 2YVAA 4K9MA 4WLOA 3OQPA 5K51A 1JBKA 3UCEA 5D1HA 4WN3A 2MT9A 3MMXA 5EWJA 2JBAA 3KTAB 3VYVA 2EJWA 5CVJA 4E22A 3JARB 4C3VA 5EJ5A 5K3BA 4OTZA 2CLSA 4H3KB 4WLVA 5DWQA 4MMXB 3EQ8A 5F1KA 3GCZA 4WXPA 4XD7A 4KRYA 4OU5A 4OUKX 4QNMA 4PU0A 5EZYA 4Q82A 4DLZA 5L7TA 3PXEA 4PW0A 5EI5A 1LQ2A 5EUBA 2K2WA 5TARA 1S7CA 2E4WA 1LK5A 3GH3A 1ORHA 3OEYA 3WLKX 3QE0A 2J3KA 4ETIA 4TQAA 1EM8B 1MHPA 1VLJA 4COKA 5JBNA 3FZEA 2AN4A 1L5LA 4D0LB 1G3UA 2VXCA 2FZCA 3DOIA 4PCLA 2Z08A 2G9QA 3ZY4A 3HG7A 2QRMA 2Q1TA 3EASA 2P2YA 3A10A 1FMLA 1TK2A 3U61B 4R3WA 3W8RA 1BVUA 1XZPA 4Z1MA 4WZAE 2G70A 1IPEA 2KI5A 1H1LA 4OEHA 3ROGA 2WZQA 1KK1A 2C42A 2W93A 2ON6A 2BEKA 1E4VA 2DKOA 2IHKA 1EDOA 3AG5A 4MI3A 4TTPA 4R6XA 4BB5A 4ROTA 4TM7A 1QHHA 4FFBA 5CDTA 1J8YF 1KOFA 1RCUA 1PG5A 2GPTA 4IL5A 3R3XA 3WOHA 5E4FA 5ULLA 1F8UA 1BU8A 1Q3TA 2QN3A 2Z9BA 3IQWA 3G2JA 3I42A 4JNKA 3VJMA 1ZG3A 4C0AC 4ZCRA 5FV4A 4FFOA 5KQSA 1VB3A 4IZIA 3WDMA 2Y1FA 2GASA 3NDJA 3RYCA 1JLMA 4WNIA 3IAS6 2BF4A 2FP4B 1SCUA 1CG6A 3MINA 5IKXA 3EVFA 1I8TA 1HEUA 2YR0A 3VR2A 4W8HA 4ALKA 3VJKA 1TW2A 3HHEA 4I3FA 3S81A 2PRJA 1PCXA 4L0MA 1JVBA 3AJEA 4NCHA 3UAOA 5EG5A 1H0SA 3W77A 1YQUA 1UPBA 3FY4A 3M6WA 3ESCA 1JV2B 3PRKE 2IYYA 4QDTA 2XH8A 4TL8A 1L2TA 3SMVA 3NMUF 5CB0A 1L5WA 3HJAA 3PA8A 3LUHA 4AUKA 1V71A 2WF8A 1NNEA 2WHPA 3Q7EA 1H93A 1SQ0A 4KO2S 1V6CA 2JFQA 4NMHA 1G5FA 1J1IA 1KP2A 4R40A 4A92A 3BMOA 4E3WA 3IBFA 5KSOA 5MGBA 2IHNA 3I72A 3BFVA 1ZK4A 2WMNB 3ETNA 5FH9A 4XPIB 4WXMA 4GXQA 1QF9A 3USZA 4YT4A 4KVGA 1JR2A 4QQRA 2ZM5A 4LF5B 4MS1B 5IT4A 2F8MA 2AD1A 1TZ2A 2WJHA 4KXYA 3N2YA 1UPTA 4RPGA 4DSZA 1GQQA 1R8YA 4YDRA 1ZWLA 3DL0A 4JU8A 3ZJTA 1G3QA 5GONB 3R7NA 1HE5A 1NONA 4IDAA 1V35A 4UAUA 3ORRA 3KVRA 3JYPA 3B9RA 4RZXA 3KVVA 2IDKA 1H4VB 3QXSA 5E7QA 1B6RA 1CUEA 4ALLA 4FNAA 4RMGA 4JLSA 5FNVF 1I2AA 4RQBA 3U7RA 1SAYA 4BC0A 4MVWA 5FOWA 1THZA 4WD3A 2VJKA 3QU7A 2IHJA 1FP2A 4EJ0A 1V9CA 1WXQA 2EWVA 3EDRA 3RSHA 3GLGA 1U8XX 2G36A 2VZ9A 3UB3A 4FFLA 3U9TA 2E4XA 4LHZA 4LJAA 4RPLA 1BDMA 1XNJA 4Z4FA 3S2FA 2IXAA 2I71A 3PVZA 5TC4A 5JSZA 3R7AA 1B26A 1LA2A 1U0TA 3BGDA 3SX0A 4PAQA 3U31A 5CA0A 2JI7A 2ZYRA 3STUA 4AJ1A 3U4QA 2P2CA 4OP3A 3MGGA 4HX2A 5A5EA 3LPAA 5IXYA 3GHHA 3U7QB 2G8LA 4OAPA 1XQWA 2PS9A 3K2BA 5CA1B 3PYXA 1HWYA 3HO6A 4ODIA 5EHQA 1WW3A 4J07A 5TT0A 4KPEC 4R1QA 4JB8A 3IVRA 4MRNA 3QJ5A 4DWVA 4S0XA 3UK7A 1I4EB 1W73A 3OP1A 1GGJA 1KXZA 1CJTC 3V97A 3CW8X 3U44B 3P27A 1CT9A 3U4DA 5A04A 5HJ7A 2EGGA 2I1VB 3LK7A 3PI6A 4WDQA 2HK6A 4C0HA 3ZWPA 3GJ7A 4PVCA 5E38A 5LN1A 3QXXA 4V03A 1NHGA 5AESA 2C2BA 3Q15C 4B84A 1AQLA 2QP3A 1VLQA 2RG1A 2AOTB 4DA8A 1QMPA 2NAPA 2QOEA 4AG6A 5HX7A 1K5HA 5ARDA 4ERNA 4LV8B 4RY0A 1VCOA 1SQ5A 4UBNA 4WXYB 4ZI7B 1F8YA 1P4GA 1UR5A 2X4IA 3QXCA 3R5HA 1ENPA 1I0IA 5EIBC 4RYLA 3HCDA 4I4LA 5IM4F 5C5CA 3SS9X 1W2GA 5HOEA 5CT5A 1C80A 4KIJA 4EPXA 4F2HA 3W5DA 4N40A 1I2DA 1FFEA 1ZA1A 2EJTA 2HBRA 3WWPA 3X1XA 2C83A 4HK4A 4UTRA 4FCTA 3CLRD 4QDOA 1QOZA 4FPXA 1N2EA 3F6BX 5KPJA 1JJAA 4A8HA 2R7AA 3FHOA 1GXSB 1J06A 3ER6A 3GFTA 1CY4A 3I0NA 2HW8A 2WTUA 2HGZA 3A1UA 3MT7A 3KSRA 5A7FA 3KYDA 2V0CA 2R7KA 5GP1A 1PTJA 2AC4A 2N47A 3I32A 1CW2B 4NR0A 4L0CA 1B0PA 3SD7A 1PK8A 2B69A 4N3NA 2ET6A 1QHGA 4B3HA 3PLAE 1MH1A 3PWTA 3H65A 4XUCA 5DIFA 5IUNC 3EFOB 4OA8A 3G5LA 4OXYA 1OFUX 3IUEA 2O2YA 4LYAA 3MM4A 2QJOA 4RC9A 4X71A 2QTHA 4GVPA 2NUTA 2JLZA 1QHIA 4LDNA 4Y6GB 1NFFA 2EBFX 4S1VA 5EEHA 2H8KA 3CEJA 4LZWA 3SFVA 2C1ZA 4QGBA 4M1QA 3LWNA 1G38A 1QHSA 3B6KA 3KJFA 5B3JC 4J0EA 4JJFA 1PP4A 2WV9A 1OWOA 1OZGA 4EFLA 3OQHA 1FNBA 3LPDA 4KRXA 4X64B 1YH3A 4Q9LA 2JHPA 3F6EX 3SEAA 4W8OA 2PWYA 2GEKA 4B6EA 4C0KA 3Q8KA 1C1HA 1C9DB 2XE8A 2ZS9A 3D8TA 1VC2A 4MS3A 4BUCA 2GKSA 3NNNA 4C29A 4CHGA 1H5UA 3OKPA 2ZR0A 3CX6A 1T1JA 2FW9A 3FF1A 2PSSA 4HNHA 3WLRA 3ZZMA 4BNUA 3JVUA 4EELA 5HKOA 1DLIA 3RUDA 2H4WA 1G60A 5B36A 1ORDA 3ZW9A 4CMJA 4G23A 3FSJX 5J4LA 4P35A 5AM2A 1VA4A 1RE0A 1I6LA 4HXYA 5B3JA 3RVRA 3U3OA 1IOWA 1U2RA 4Q02A 5G4KB 3UJ8A 2O8VA 2C4KA 3WDKA 5CB4B 3RFVA 4ZC1A 2V3WA 5DT9A 1QK3A 2QRJA 4F38A 5JAIA 3MUEA 3O1LA 1E1CA 3QMPA 1VKOA 2JLWA 3EEBA 2I78A 4NU6A 3ZJUA 4MP6A 3K5IA 4Z54A 1AHHA 1V1RB 2JJMA 3AIOA 3U62A 1JI3A 2Y71A 1ZM3A 2RI0A 3UAGA 1B16A 3BJEA 4A8JB 4QUDA 3UTCA 5JRJA 4PR0A 1P9RA 3PUJA 4RVFA 1SH7A 2A5DA 4B8YA 4QZVA 4F1KA 3F47A 4DLRA 4FHZA 2K6GA 3LUGA 4JLJA 3DO6A 4G24A 5FTKA 4P4GA 3TZHA 4AZ3B 3CINA 3NHBA 5BMOA 4MW6A 4LOKA 3ZN2A 3PK0A 2ZTLA 3CWCA 3H97A 3G8AA 1IWBB 3PA6A 1W4RA 1KMMA 1ZH2A 4DB2A 3QMMA 1Y6GA 2ZAMA 3MXOA 4B46A 4L8LA 1KWKA 1EXNA 1RRCA 4LC0A 4PR3A 2E5LB 2CVZA 4KMRA 4DB4A 4UAGA 5DHTA 2FPIA 1V9SA 4TKVA 4NHEA 2AUNA 1E7YA 4IUBS 5HEKA 1ZC4A 2ECFA 1NIJA 4IS2A 3RYFB 4C7KA 4LEIA 4W5HA 4FYHA 2IYRA 2WDPA 4MQ4A 1KAGA 5LMCA 2KS6A 2RB4A 1ZK2A 3AVQA 4MWDA 2C2OA 1JJFA 5EJ4A 1GO2A 1NW3A 2B8EA 2I3GA 3J7AC 3IX7A 2ZRCA 5CFPA 2XLCA 4FJ2A 1AXEA 4DILA 1ULZA 3PQ4A 3KETA 5DWVA 2DKFA 1ZN2A 2VDVE 3QVSA 2XSZA 5KX5A 1ACLA 4CDGA 4DARA 1DQNA 2VYQA 1X94A 1K7CA 3OUUA 1DV1A 1CPYA 3G2LA 3MYRA 4RQUA 4UM7A 4UMVA 1BOOA 2KMLA 5DTQA 4M9RA 2RHTA 2GDJA 3KVNA 3OKAA 3WO1A 2W4QA 4JA0A 2ZYTX 3FMOB 1QB7A 2XT9A 1GA1A 2D00A 2Z4SA 3HUTA 1J9EA 1BEZA 1FSSA 4LUCA 1KTVA 2H9YA 1MXHA 4MDHA 4MKGA 1P7CA 5KNDA 3X1MA 3T9BA 5E9QA 1N2XA 2X7HA 3NG1A 7GPBA 5CG1A 1KQGA 2E4UA 4UOQA 3QEJA 1Y7IA 1E1QA 1RM0A 4N8SA 4XTRA 4E2XA 2L42A 4AP6A 1DQRA 4J4BA 4O33A 1FX0B 3TIIA 2G5CA 1JWLA 2C5EA 4FLMA 4GGMX 3ELUA 4C6HA 1ABFA 4UM9D 1EWTA 2CWWA 4O4LA 2EFJA 4PS0A 3DVRX 3PNSA 4P3PA 1EE9A 5GM1A 2Q2VA 1F9EA 2B4QA 4BV2A 3U5TA 4KAJA 1T3ZA 4KBYA 4B7ZA 2ONZA 5A3JA 5JH7A 3VR4H 1O0SA 4IYRA 3EFHA 1GEGA 4Q7MB 1KO7A 3ANXA 4QHSA 5AUNB 5JTUA 1CVIA 2GZMA 1XQXA 4IIJB 2Z6AA 1R0YA 4B6JA 4ESOA 2ZU6A 3HE3A 1CD5A 1UBEA 3G6KA 2NU9B 5E6UA 1Q83A 3WADA 4DYVA 2QX8A 4PGGA 1F0KA 2AXNA 2ZSBA 3LGSA 4AKIA 3LUKA 3DXFA 3OCCA 3U4CA 1II8A 2O0HA 1OV6A 3OQ1A 3ND6A 1RPNA 3QPUA 3CZRA 4RV4A 4U9UA 1T1SA 3HR7A 4G4SO 1QKIA 2ZSJA 1NQXA 2DUNA 1SBQA 2X86A 2XKKA 3E9YA 2AUTA 4FSHA 2ZTSA 3GCGA 4MI6A 3V00A 1SVMA 1FQOA 5AI8A 3T7DA 5LWHA 3I2JA 2X22A 4NNOA 1OX4A 4TRMA 2CWDA 3JTMA 3HSYA 4DWJA 1P6QA 1RVDA 3HB1A 1UMDB 3WBFA 2VYCA 3LT2A 4DMFA 1GKYA 3OI7A 1E66A 1TM5E 2DBRA 3HLYA 4NMXB 2JLUA 2PGAA 5KYWA 5ALWA 4OX9B 3UTDA 3DOHA 1C8VB 1UBRS 4WOPA 1FL9A 3MCUA 4EO7A 4F4FA 2A9VA 1EP2B 1XNRB 3HPRA 3UC9A 3DLCA 1PQPA 3WY9A 1NVWQ 1OXMA 1IM5A 5H70A 4CETA 3BRWD 1NQ5A 4Q39A 4CE6A 6CHYA 4V0SA 1UFQA 3PFNA 3M6XA 1TMGE 2APJA 3GA5A 4AZTA 3MBKA 1Y7PA 1HYQA 3LX8A 5H9WA 1LSOA 3R7DA 2G07A 3GAMA 4JUIA 4G63A 1XQ6A 2E4VA 5HUJA 4RHXA 2NTYC 4HTAA 1P3JA 2BD0A 4H6WA 4C76A 2FZ5A 3ELBA 5ICCA 5ABPA 2JKVA 4RNDB 3OPYB 3I62A 2GZSA 3TLBA 3L7JA 5AI6A 2WA2A 3KKKA 1YZ3A 1BEEA 2ZS8A 5H9VA 4ESHA 1TZBA 2HRDA 4CTOA 5HZKA 1I36A 1H2EA 2B21A 1H8EA 2VEOA 4GKKB 1C0KA 1IHDA 3BWBA 1G20A 4B3TB 4LWQA 1XTUA 4C7MA 4URHA 2HHHB 3MJEA 3NT4A 1VCIA 3T0IA 1N5IA 4RJJA 3PC7A 4KIFA 3ZU3A 3OE7A 2M98A 4FLFA 4WGFA 2PIDA 5JSKA 4C2AA 1XRSB 3PEYA 4IS3A 2Q3HA 2VHXA 4M1EA 4HHEA 4ZOEA 1EU1A 5JD4A 4D99A 4DIMA 4RQTA 5TGTA 4ZIRB 4HYYA 2DR2A 4KGDA 1KP3A 2P78A 3C5VA 4KE7A 2BCGY 1O6GA 3GMSA 4G5FA 3KB8A 3BIXA 1T24A 2W58A 3AESB 1LEHA 3L4BC 1Z7GA 3SQXA 1E5TA 2A2ZA 5IKEA 1B73A 3JAWA 4L75A 5HGJA 2A1IA 2DHCA 3VSEA 1GTG1 2HK8A 3B12A 2X0EA 3FYUC 3AVWA 3QY0A 1D6MA 1F2VA 4DPLA 2A86A 2AEFA 2UDPA 5EIXA 1OH6A 2FPXA 3M1YA 1ZAYA 4IH1A 3A3YA 1LH0A 5LZ7A 3S55A 1L7EA 1TYBE 1UBKS 3L8EA 1FP4A 4F3CA 1JNYA 2JLYA 4I1PA 5ECGC 1E9EA 3KWMA 4RXTA 3DYBA 1G17A 2JJ8A 2ZI7A 3N07A 3F67A 3F96A 4HUQA 2FN9A 2QTRA 2Q27A 1C29B 4NMWA 2HHCA 3FNEA 3IHWA 1YBMA 5CJJA 3SKXA 4EK9A 4F3KA 3OQ6A 5AW2A 5L51A 2QI9C 1JT2A 2CYCA 3HN2A 3ZHCA 1SC4A 2EKZA 3FDZA 4XA8A 1QH1A 3G9QA 4OHKA 1AVTA 1TE2A 3CLUC 2VT6A 3FYUA 3E4CA 2HMWA 2ZSEA 4QG3A 3E58A 1BDIA 3M89A 4GMKA 2QD3A 3GJ3A 1TU0A 3G85A 4X8OA 2P4EA 2O52A 2AN5A 3QVGA 1IHOA 3EVEA 3R3UA 5BRJA 5BMVA 2AG1A 3KJHA 3WOVA 4DFDA 4CNBA 2NSDA 2GBLA 3OZXA 4KQJA 3UK6A 3TLJA 4N7BA 2BDUA 3SLGA 3W4KA 4X41A 1HH4A 4NICA 4AJ2A 2CUNA 4CDMA 2FLWA 2EL9A 2WAXA 5F7ZA 4R7TA 4LYGA 4EVSA 3GDFA 3QQPA 4LC1A 4BO0A 4QFDA 4LGCA 1EDDA 4HVCA 3RH0A 4KITB 4EHBA 3PIRA 1A4UA 5CLLA 5CYGA 1AKUA 2VNIA 3E82A 5B1SA 1DEKA 4DLYA 2WUWE 2O8DB 2QS9A 3PF9A 4DLVA 4MR8B 5CIWA 1EEXB 2VUTA 4WBSA 1JAHA 1EK1A 1SUEA 4OBBA 4LWOA 2GN2A 3SJCA 2XRZA 5FO1A 3OKCA 4EA6A 2PV7A 2C9DA 3Q3CA 4M7WA 5K8JB 5JS2A 1C3JA 3ICCA 1T2VA 3EF0A 3G82C 4OHUA 2I76A 3BREA 1M34A 3HCEA 2BFMA 1USWA 3P94A 1TJYA 3QOXA 4GZMA 1DRJA 4CLHA 1QDEA 4TKUA 3UH1A 4GOXA 4LZLA 3IPAA 1PBNA 3JXEA 1SKYE 3SJUA 4N7JA 3B85A 1CUZA 5EY5B 2ZAYA 1UZUA 3C70A 3EW9A 3O3CA 4B43A 3N3BC 5CK5A 4CM1A 3TG8A 1R5OA 1G3RA 1TUIA 2E7ZA 3JD2A 4HPJB 4KBGA 4U7TB 3VR3A 1FQWA 3IQIX 4UHHA 3FGZA 4QE3A 3PQ5A 2NWQA 3TZBA 1VHDA 2QTBA 3ACCA 3N05A 1G6HA 4TMZA 4OQXA 4GZLA 5DM60 1RHRA 2CZCA 3HWWA 3C3XA 3I4CA 3UO8B 3DKIA 3MOGA 1IMOA 5J2UB 3VO8A 1J5PA 2WFLA 3D6JA 2XCTB 1DDIA 1PR6A 1KMNA 1D3AA 1RQGA 3MNFA 4J49A 4JSRA 1ZITA 2OCYC 3C8HA 3BMXA 2YINC 1J2JA 3EISA 2DF8A 4IV5A 3CMMA 4LZPA 3ZDXB 1VI2A 4CCYB 1L1RA 3JYLA 1IAVA 1WCXA 2CZQA 2GCGA 2OLEA 3FBTA 1LWOA 2F7SA 3JQCA 4LV6A 4Q4HA 5H3LA 3M34A 2X40A 4GGPA 3M83A 1XZHA 3L4SO 3L6BA 3VZBA 2Y9PB 4FFVA 5I7VA 3R44A 4PS1A 4NFSA 2L18A 2VF7A 4G5XA 3ZUPA 4YUXA 1ISGA 4WACA 1IOLA 4Y2JA 2EARA 2V1UA 4QOSA 2HU7A 3ORQA 3AQ4A 4P36A 2OAGA 2CN1A 1QLJA 1GNRA 4L3WA 3E70C 3LQYA 5HUHA 1CDZA 1YQWA 1Z4LA 3QPVA 1OBFO 5HVNA 5H81A 3GDGA 4XLZA 4BTEA 1I32A 1AQIA 1Q17A 3ETGA 4RA6B 3LBIA 3NTOA 3M82A 1W35A 4QIHA 4FMDB 1Z38A 2AWNA 2VYVD 2L0XA 4MEJA 4MKIA 3SSAA 4D9MA 1TJPB 1T36B 2WR8A 3NRCA 4CTJA 4HQFA 3PNOA 4A7PA 1AQJA 3TH5A 2IDMA 2FSGA 4Y3UA 5AKYA 1ADJA 4ALNA 5FI1B 3L06A 3VC7A 3YASA 1GZUA 4FXOA 2ASEA 3FG9A 3HU3A 3NW9A 5FWYA 2IHYA 4RESA 1H2FA 2C4NA 3DHNA 1KE1A 2P6RA 2XCRB 1GRCA 1LDNA 2FUCA 2ZJ7A 4RHFA 2WWGA 4UTOA 1X7ZA 4A82A 3SJAA 1E2MA 3BTUA 4G0QA 8ABPA 2ZULA 1M1YA 1TLLA 2PSHA 4U9HS 4Y18A 1G59A 1NW6A 2YBDA 3UJ3X 4U0JA 4A2CA 1DIGA 1VSBA 1XU4A 3BORA 3UBTA 1NMXA 4LJ6A 2P30A 1FDRA 1VJTA 4J91A 4A2PA 4K9DA 2FZKA 1M2GA 4QD3A 2GEUA 3PL5A 4U3JA 3MQ2A 5EA2A 1Z56C 1M6VB 1UDCA 4OB8A 3A1EA 1C4OA 1Q3HA 2C88A 1XTRA 3C6MA 3E7WA 1NX9A 3LXRA 3R20A 4GU5A 4JWTA 4JX9A 1R5JA 2HKIA 4OK6A 5AUOB 1FSGA 3MJRA 1N78A 2QTNA 1LLFA 4LXTA 3L40A 3R7BA 1NHWA 1C3OB 2B1GA 3PEVA 1C9KA 1V95A 4FDMA 3BIOA 4ZQGA 2PXHA 1TB4A 3TD6A 3WGJA 1KZHA 4F9EA 4DDWA 1UBNA 1U63A 4MR7A 3GRPA 4K0KB 5BSTA 1V7ZA 3TTYA 3KLPX 5FUYA 4CFSA 2VFAA 3VKFA 3TOCA 4REQB 2XVAA 1DMRA 4ZICA 1NQAO 2CB0A 5CEFA 2H06A 2R4TA 3GRFA 3LYHA 4JI1B 1WA5A 2X6RA 5T5QA 3FOWA 1M7BA 1AKWA 2PCLA 2GFIA 4BIIA 1QPBA 1U8AA 1UT6A 4KZPA 3OA2A 4L9SA 1AUQA 3EC2A 5L40A 2Z57A 4QQKA 1XQYA 3JCZA 4CKXA 3BTOA 3S2UA 3N7UA 4ROSA 4F3YA 3PITA 1XZMA 5EUQB 2E4YA 2Z9CA 4G0PA 2Q07A 4EY6A 9ATCA 3OCJA 4MWTA 2ZSUA 4Y6LA 1H9BA 1YBVA 1MXFA 2EP5A 1BCSB 3GGJA 1IN1A 1QH9A 1M2JA 4F72A 2X0JA 2EEZA 1ZIPA 1D0IA 1LLDA 1SUDA 1T9BA 4KI0A 5DHPA 2OWDA 5EQDA 3NM4A 3V33A 2OHOA 2EKQA 2QVGA 3LI2A 4KAFA 3KYCA 3ZHSA 1CY7A 4HWGA 3SR4A 4YAKA 1YULA 1NM5C 4IJQA 1C8BA 1DUSA 1XA3A 3WRYC 4R8VA 1Z6XA 2WTXA 4GWLA 4S2UA 1QU3A 1IJKA 2XDQB 3NNDA 1VKZA 4FKMA 4IWYA 5HF5A 1Z0ZA 1N92A 4U5QA 1PAUA 1SG9A 1XZIA 3EXG2 3U40A 4BASA 1VGVA 2YC2C 3T94A 1YA6A 3L05A 2J85A 3EB9A 4A73A 4FGUA 4RE5A 1G7TA 3IQHX 4O4IB 2HMUA 4CTNA 2P3LA 1N32B 2GTIA 3GJRA 4PFQA 4WBNB 1U0BB 2CD9A 4BO6A 4GR9A 5EMMA 3AIIA 4A0RA 4EGFA 4D26A 3ZIUA 4A2WA 2IH4A 2ZWPA 3C3BA 3HPQA 3ORHA 5E1DA 4BMCA 1FRQA 2JLSA 4RABA 3WRYA 5EKSA 2JFGA 3ZH9B 5JZVA 1RYMA 2Q0XA 5A6VA 1QOQB 1Y5NA 4HDNA 1EE1A 1RAAA 4DE5A 3W6ZA 2P9GA 4MRVA 4DS3A 3FIJA 5DTIA 2CXPA 4RKFA 5BVGB 3T5TA 4UAJA 4N7MA 1SC9A 1R88A 2CK3D 2VJMB 4EECA 3EAFA 4JVSB 4PYKA 5ADVA 1JG1A 4NE7A 4YNBA 3MT9A 2HM7A 2D5IA 2XUFA 4Y1RB 5EC8A 4FGSA 4X97A 3ZHBA 1JEJA 1JQ3A 3VI4B 4F4UA 5KSZA 1RPTA 4KNVA 121PA 1SU7A 2ZTHA 2X8AA 3IXQA 1CQJB 2WWFA 3NONA 1NXQA 2UXCB 4KWTA 1NL3A 1PW7A 1Q95A 2HEIA 2QY6A 3LY5A 2G09A 4WW0A 1B15A 1DJMA 2JFHA 1K63A 1ID8A 2C8LA 4IO0A 4MPJA 2I1QA 4XFDA 2X9LA 4NCAA 1EFHA 3DPSA 2WIAA 2X0DA 2CGEA 5KVSA 4CLDA 4KSCA 3ZGVA 4IXTA 2AF4C 1FMTA 2H48A 1BGWA 2QTLA 3BCSA 3KAQA 1CFZA 4Y2RA 5HTOA 1AGXA 2X0FA 4YJKA 1SCIA 2A14A 2AW5A 2CLMB 2FXVA 3ZV3A 1U0GA 2ZQ5A 5HHTA 3HM9A 4ER7A 2IYNA 4I19A 3WV5A 4FYVA 3KKOA 2HU5A 4TL6A 3MYYA 1UZNA 2FMFA 4EG6A 2O8CB 4E7PA 1JA9A 3LRPA 2ZP1A 1H2BA 3E7XA 3N9IA 3VH4A 4HLNA 3GUYA 4G9BA 3LBHA 2X5JO 3KAJA 5DFAA 3RT1A 2DSNA 2XGSA 1MAWA 5LQSA 1KVTA 1M2VA 3I6BA 2QA5A 3F4LA 4YJGB 2YZMA 3M6IA 3A7DA 2GDZA 2HBYA 4WOKA 1X3SA 1V7QA 1T5HX 3FTQA 1XLTC 1K7SN 1TU3A 2XWJI 1MABA 2XMCA 5SICE 3CFYA 1R4AA 4TZ6A 1A2BA 1JU4A 2BGMA 1TKRA 1N2SA 3B2NA 5INTA 2YJ3A 2YQZA 1NATA 3QXGA 3PHBE 4QU0A 4EMBA 4LOIA 1GP2A 1D9XA 1Z4MA 3JQFA 4RETA 3UT5A 2YQ5A 4K9LA 5EERA 3FVQA 2W8BB 2AB0A 2GN9A 2OBNA 4MYTA 3W9SA 3Q11A 1EYZA 1TZJA 4MV9A 3KTOA 3OCXA 1Y8QA 3LHDA 3E18A 3RRBA 3T7AA 1DEOA 2YC4C 5DYIA 1RLTA 1T4CB 2PH5A 3NPMA 2RB5A 4G8CA 1ND5A 4QVKA 3T3IA 1C7EA 4CIBA 1PSDA 4PPQA 4GI7A 3WK5A 1P0MA 3WJ7A 3UNXA 3G0OA 2O8FB 1W34A 2D7CA 1GSIA 3BH7A 2BKAA 5LXTF 3IP5A 4U02A 1VPTA 2CB9A 2CLOB 4GDMA 3F1LA 1CE8B 3SYRA 1JAXA 4PLPA 5GADl 1CYDA 2C07A 2OOKA 3N53A 3JATA 3ED5A 4LBWA 5FJIA 4C0BA 4BNMA 4CM3A 5A7HA 3P96A 4AJHA 1JP7A 3QFRA 1A2QA 2EC5A 2RJNA 2WTAA 1J8DA 2B8TA 2VJBA 2QVZX 3C7TA 4IFTA 4J2HA 3ZBUA 2OP0A 5ICFA 4P4LA 2IUTA 3SZ3A 4YXWD 1AU9A 5KI6A 1U8ZA 1BMTA 3PT5A 3LGXA 1AUPA 1J22A 5A4IS 2JH8A 1W48A 1X9GA 4PNPA 5BW5A 3JVVA 4JB2A 2H6EA 1XEXA 3DBVO 1V5WA 1FFDA 2OESA 4Y2TA 1U1IA 1FFSA 3VC1A 4HUTA 1DBIA 3GWZA 1EFRD 1GYRA 2X23A 2ZWVA 4CG1A 5L3VA 2HJ9A 3FAZA 4C0XA 4URYR 2PFSA 5IC4A 1PVOA 1H05A 3DE0X 2BFFB 4FQ7A 1QLHA 3KT0A 2BEVA 4PWZA 1MGOA 2IL1A 3M2PA 4G9GA 3CZAA 3P1JA 1X8JA 4EY7A 1ZCFA 2P4HX 2O2DA 3D5TA 3ETCA 2ETXA 3IAAA 1PJLA 3AUXA 4Q48A 3TR6A 3MSCA 1EFPA 1ARZA 4R5MA 3E7DA 1N1MA 2X8BA 4R1TA 1RJFA 5FT9A 5DLDA 1S3FA 2WM3A 5AKIA 3A9SA 5C4IA 3GBVA 3BKWA 1W6RA 2W0MA 2ZE5A 3A3OA 3LNCA 3EK2A 4UXHA 4DCJA 5A5VA 2X4LA 4YP1A 4B8WA 3NHRA 3ZKWB 4X9XA 1BXGA 1VPVA 3B36A 2ZJ0A 1TCUA 4KJXA 3V7FA 4CF5A 4E33A 4JT8A 2C54A 1CXZA 3A2KA 2WD7A 1DCKA 3DTYA 3I6MA 3KFLA 3VC2A 1C3LA 3OLWA 2ID9A 4J7AA 3KEFA 3B1ZA 4C2BA 3BSSA 1OXKB 1VXRA 2LWIA 4GMGA 1II9A 3KEOA 5CCDA 2QSZA 4ZVPA 3LUPA 4D41A 4RORA 1S02A 4NECA 1G98A 3AL0C 3CE9A 4S1PA 3WNZA 3WK8A 1QM5A 2FEKA 3TSYA 1XSEA 3ZWDA 4AF6A 1FBTA 1RP1A 3DT8A 2OO3A 1A5TA 3PWZA 3G2KA 4JEIA 1SVOA 1MO3A 4IIUA 4ZVTA 5AKLA 1MC4A 3R77A 3I6ZA 3BRSA 1V8OA 3DB2A 4LYHA 4LPSA 4QICA 2HN9A 1H2XA 1Z0DA 1MTZA 2NUAA 2YWCA 5HA5A 3SYNA 2P2SA 4RK7A 4OP2A 5L95A 1TM4E 2WJZB 1P81A 2Z3VA 4TLDA 1TYCA 2Y0BA 1Z2NX 2IEBA 4YIKA 4I14A 5BSHA 1LV8A 1FTNA 2I4NA 1PI3A 1UOQA 2IYEA 2HZBA 5AKKA 5HIMA 5HF6A 4D6XA 1PT9A 4XPZA 2HTFA 4JXZA 2GXUA 4IZOA 4MNTA 1DBSA 3VO9A 3HUUA 3C4QA 5TMEA 2N1MA 2JAWA 4E5DA 3BG5A 5HNKA 3Q6NA 1SXJE 1V5EA 2VTKA 4PO8A 2B4YA 1M67A 3EPLA 1NMSA 3W5BA 3GFQA 1C41A 1E2QA 4CFZA 1E9BA 6PFKA 3F6PA 3KQVA 4M37A 4MICA 1V1JA 3VBEA 4ZYLA 1Q2XA 3D59A 1ZO8A 3P26A 4IRUB 4Z0TA 5CDFE 1OPXA 3MTAA 1RTKA 2PAAA 5TQJA 2BH2A 3I1YA 3RIHA 1SA0A 5C7OO 1ZRSA 2O50A 3ZR4B 5B58C 1IM2A 4XCXA 2IP1A 4RY9A 5B58T 1AGRA 1IB6A 3JZIA 2F90A 4QPPA 3UAYA 3VNVA 5LQAA 2YWDA 3RJ5A 3IL2A 1RCTE 3UPTA 2B4AA 1TCVA 2H9IA 4CKWA 1JLLB 1T3TA 1MG0A 1K66A 2FYTA 3FOCA 1A76A 5I8ZA 3L4KA 3ZGNA 3LRTA 1R5BA 1TL7C 3DSRA 5EUCA 4F0JA 2O4CA 2P41A 3RIEA 3MW8A 3LSYA 5C5EA 3I9OA 1W5FA 1WEHA 5KNBD 1WV1A 1RLMA 3V6LA 1HFKA 5FBVB 1PL6A 1BD4A 3AUKA 3BMQA 4LPKA 3RRNA 2ZSDA 4PGAA 1PDVA 1EWQA 1A8QA 2J67A 4UNNA 4BE7B 5ETJA 3QA9A 2K5UA 3OCYA 1E2HA 4FE3A 4P7GA 2RSLA 3D0QA 5EXXA 1ZKDA 1H42A 4M0LA 2VF5X 2QMOA 2WYHA 3C3MA 5C81A 3T1QA 3COJA 2CJWA 2ZYWX 1BGXT 4UBMA 5D85A 4PBSA 1KBZA 1XMXA 5ILGA 1MGPA 1PJCA 4OH7A 3BXGA 1HG0A 2QTWB 3CRW1 3LM8A 4ZK6A 2ZJAA 3VAAA 4IJMA 2KQUA 1SQFA 3EODA 4GPBA 2WIGA 2OFXA 2XGGA 2YNMC 3B38A 4ZWNA 4GSKA 5JVDB 5MN5A 5EE5B 1LX6A 2ZANA 4M1KA 1BJRE 2IGTA 5LYYA 2G7ZA 2ZBUA 1Z15A 4TUYF 1QZ3A 2NXJA 3P2KA 5J2TF 4EG4A 3PL1A 4ASUD 4CKEB 5K0ZA 1O8CA 1OOEA 3AU9A 4YV7A 2E5FA 4CN9A 1Q6ZA 1QIJA 4U6NA 4G8JA 3UUGA 3I6YA 1CJSA 1RBMA 2BBOA 1S8NA 4JBYA 4D8YA 5C32A 4QNRA 3E5HA 2A33A 3L5KA 4GZ6A 3VKWA 2Q2WA 2ZBPA 2RGYA 2VPTA 3ZWKA 2GYWA 5A4KA 5LIRA 1EBUA 3L6CA 1FIUA 2CXNA 4DV1B 3JQ7B 1KEEA 2AA3A 1E2PA 1CIVA 4HS9A 1E2GA 5IAKA 5F3RA 3QHAA 2GZ2A 2G9RA 4KIUA 4K05A 3VZSA 1FFCA 2P2ZA 5H16A 1T2EA 4MYSA 3O4GA 4CEIB 1BMDA 2Q50A 2SNIE 2WUEA 2ZAIA 3I83A 3N7TA 4PZYA 1CLEA 4A6DA 4YAUA 3VHLB 5AR1A 3FVWA 3GT7A 5B2EA 1IB0A 4JBXA 3T8YA 4FHFA 1T4MA 2H54A 2Q1WA 3R5TA 5E7IA 1GFSA 1Z4QA 1B23P 5TEWA 4MKHA 1ILEA 4OYYA 2VSNA 4UC0A 2R4QA 3ZEAA 1GKIA 2YMQA 3BGVA 2W6JD 3G0GA 5K3SA 1FUUA 3OIUA 1GAEO 4D3YA 1A04A 1DKUA 5E4TA 3A58B 5CNKA 1NW7A 1Y3HA 4ND8A 3WSWA 1MTOA 3DONA 4C4OA 3O4IA 3LQQA 3BHIA 4R8KA 4UVEA 4WY2A 3FMVA 4YALA 3VOSA 3O8RA 3RRMA 3KJIA 3L79A 4LXQA 1E3EA 3ZIAD 3SQOA 3VOBA 1C4WA 4BS9A 4JEUA 3ZQ6A 2C3YA 2I55A 4R81A 5AJZA 2BJHA 3CY6A 3D6AA 4ZVMA 1SXJB 4IHJB 4P3YA 4OLFA 3VISA 4OUDA 4IVPA 2D2VA 4UDYX 5ALHA 3HVHA 1IBKB 4FZ5A 1G1MA 3FB4A 3RJTA 2Z1MA 3DL2A 1FYFA 1ZS9A 2FUEA 4DBVO 5D87A 1EXVA 2C3UA 1T5TA 1WVMA 1XAHA 1OLXA 1QC5A 1I3KA 2XX3A 4DBLC 1QU2A 1GYQA 3COYA 3NHZA 2HZ7A 4FN5A 2AFHE 2FOIA 3KPJA 1W47A 1KYQA 2HDNB 3NM6B 4JLNA 4RAOA 5D86A 1YS1X 3HY6A 5ALDA 3HS3A 1RYHA 1VCNA 2DECA 2J5XA 2ZK7A 3IA2A 4JHLA 1YIOA 4OQQA 4U2KA 4DSOA 1SFRA 1VJ5A 2GVDC 2QTVB 3FFAA 3QU2A 4L8YA 1C1DA 3NT2A 1V5GA 3FGOA 1KO8A 1SKAA 2ZI9A 2CHQA 4D81A 1L4KA 2WJPA 1KEWA 1R6VA 3P0EA 1KY3A 4WWHA 5H3CA 4PV7A 4GVLA 1SD1A 3OJ0A 3CUEF 3QBEA 3GT3A 4YBZA 4PSUA 1HE2A 1N1EA 1R4NB 2OGSA 3EXIB 4JYBA 4QXRA 3BRWA 3FHCB 2PH3A 4YVFA 5E7JA 1A8HA 5AVZA 4MAAA 5G4LA 1T43A 1T5IA 3K1AA 1JUDA 2YHUA 3QFSA 2OYRA 1U2SA 4BWGA 4KO4S 3JAKB 3V2IA 1F8XA 1I4WA 1GZ5A 4ZYVA 1ZHOA 1YR8A 2BMJA 1R12A 3H1GA 1A7UA 1Q20A 4IVNA 4XRRA 3UPDA 4LSMA 1DSSG 1NPDA 4O4HB 2WYUA 6Q21A 2CJXA 1P0PA 2I2WA 3M4NA 1P1HA 2DM6A 2ZRGA 1CR4A 3E7FA 4OQPA 4I4TB 2A3NA 1VHJA 4GE0A 4E5VA 3NC1C 3UENA 2J5KA 3L07A 3NDPA 1JPNA 3IV6A 2PRSA 1A7AA 3PGVA 2GM3A 2B4KA 3G5TA 1IZYA 4QELA 1G2IA 1ZJYA 3M1IA 2BTOA 4DIBA 3R6DA 1RZUA 2NVUA 1UF9A 2IU4A 2CF5A 2DUUA 3GARA 4U7PB 4QYWA 3ZGOA 4ITVA 4PN7A 3EUFA 1PR4A 3SGLA 4CLRB 2GK4A 1JIVA 1MRNA 2ACKA 2GOYA 3DZJA 1ODTC 3THWA 5T8KC 2L17A 1BMFD 5FQNA 5JXJA 1HKUA 1CDDA 3HWSA 4J16C 1DINA 2PBLA 4QJBA 4S1TA 4EX7A 5CXQA 4LXUA 4WK2B 1OX5A 4CM4A 3L2OB 3ILXA 2CBXA 3DMHA 3I1IA 4G5OA 3IQGX 2FPGA 2B2NA 5DBGA 3WYBA 4F9GA 3D1LA 5K05A 3T4EA 4BGDA 1UXJA 4OJTA 4DMMA 3NVAA 4X84A 5CXSA 3AUJB 3ZV7A 1SVWA 2C8JA 1SZJG 3A0RB 1H0RA 3H7IA 2VP0A 3DV9A 3OSUA 2QM0A 4NAUA 3UANA 1G8AA 2WA1A 2G9VA 3MC1A 3MG9A 3H5OA 4RX1A 2VCHA 5FL7D 4YUAA 4UZSA 4G5GA 1TYAE 5LYJA 1NBAA 4DWWA 3SC2A 4LRWA 2BE9A 4UNPA 2NYVA 4EG0A 5KOYA 3Q7RA 4P4TA 2MJLA 4I55A 4TS4A 2WQ6A 1NGSA 1R00A 2V4MA 2VHWA 2EP8A 1XTIA 3NP9A 4O0MA 1AB6A 3U49A 1FW6A 2P8JA 1E2IA 4PRLA 3TPCA 3BE4A 4UHDA 5ECWA 4DCPA 3SVLA 4ALJA 3T1YB 2GCOB 5EE1A 2CBZA 3LO5A 1RIFA 2O07A 4XWYA 4YR7A 4TWZA 4CQMD 1D1TA 2HLNA 3H8JA 1RI5A 4TV9F 1WETA 1BJTA 4KODA 4YP6A 3WBJA 4YDHB 1MB9A 4QBFA 5A3QA 4C05A 2YV1A 3GEBA