4XLZA

N,n'-diacetylchitobiose deacetylase (semet derivative) from pyrococcus furiosus in the presence of cadmium
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
267
structure length
267
Chain Sequence
MFENVSTFEEAFNKLLKEVLEFNLENPFEDAKKVICIEPHPDDCAIGMGGTIKKLSDEGVEVIYICMTDGYMGTTDEKLSGHELALIRRREEEESAKLLGVRKIYWLNYRDTELPYSREVRKDLVKIIRKEKPDGVFAPDPWLPYESHPDHRRTGFLAIESVAFSQLPNFSNIDIDIGLKPHSVSFIALYYTHKPNYIVDITDLMELKLKAIRAHRSQFTDDIWETWEPFLRTVTMFYGEKIGVRYGEGFRVMPGLFYHITPFADLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Uncharacterized protein
publication title Multiple crystal forms of N,N'-diacetylchitobiose deacetylase from Pyrococcus furiosus
doi rcsb
source organism Pyrococcus furiosus
total genus 95
structure length 267
sequence length 267
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2015-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02585 PIG-L GlcNAc-PI de-N-acetylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10320 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold LmbE-like 4xlzA00
1Q74A 1Q7TA 4XLZA 4EWLA 3DFMA 5BMOA 5B2FA 3DFIA 4XM0A 2XADA 2IXDA 1UANA 3WE7A 2X9LA 3DFFA 5CGZA 3WL3A 5B2EA 4XM1A 3DFKA 4XM2A 3WL4A
chains in the Genus database with same CATH superfamily
1HURA 1W48A 4X1YB 3OLYA 4Y1FA 6Q21A 1MJGM 4ZRMA 3QEBZ 2CL6X 1YZVA 3FBWA 1XLVA 2W6PA 1CR2A 2DOKA 1KHHA 1SQ0A 2G9VA 5HK9A 1I7DA 2WHYA 2OFOA 2MSEB 3DGFC 1ZVKA 1B74A 1ZCBA 1QB7A 1IIBA 3WYAA 5AVUA 1V0JA 1QIDA 1P39A 4BKOA 1I4WA 4ZHQB 3VPGA 3TZHA 1A4RA 1CRWG 3PDJA 3KXPA 4GKBA 1C29B 4C22A 4JXZA 2ILTA 2OHGA 3OCUA 4MR7B 4OOFA 2WICA 4YMLA 3MF4A 5D86A 1W94A 1GQRA 2BEVB 1BD4A 4HGYA 2ZJ7A 5B2ZA 2DHCA 1ZNZA 5EHNA 3NANA 3CH5A 4BP8A 3PV0A 1W4BA 4OXIA 2D0IA 2IA5A 5FPPA 2GM4A 2DWPA 4JGIA 3LW8A 4GGMX 2GCGA 3HDHA 4Q9JA 5CR9A 4P38A 4HV4A 4JB0A 1XLUA 1XEWX 1DCMA 5INTA 4OXKA 2E6UX 3AM4A 3E5MA 3H1BA 4QGHA 1DO0A 3I09A 5KCMA 1QQTA 4MEJA 4CVNA 4EJSC 3LNTA 4IILA 1WTCA 2REQA 3CNQS 2R6AA 3I1FA 4UD2A 1I3OA 4KO1S 2ORED 4NH4A 3U6KA 3MAAC 4E5YA 5A2GA 4D0RA 3IP3A 1U8YA 5CD9A 3AETB 1Y7LA 5TMDA 1C8BA 1QG2A 1AV7A 3T1YB 4I3FA 5A4DA 2PX4A 3DNPA 3P9IA 4G8BA 3H42B 4KQHA 4J1TA 5A3SA 1NQAO 3TBFA 3KOXA 1A9XB 2JATA 4RBNA 3OOWA 2ZSDA 4RUKA 3K6JA 3DYIA 3H83A 1TM3E 2AJCA 3CPHA 4F38A 1HKHA 4BV9A 1T3GA 2CVOA 3U3KA 4DY4A 2DEUA 1D2RA 2VRCA 3FPAA 4GGPA 4HNVA 2AD1A 3CNOA 1C1DA 2JL1A 3FCUB 3KZOA 2R1VB 1RKXA 2B8NA 4DQVA 1FS5A 1NYLA 2Y1CA 4PNZA 5AVTA 3BMNA 4EHAA 2FGJA 4IUCS 2JFXA 1DQSA 1FLAA 3VPSA 4PYNA 1H2RS 1LNQA 3DT6A 2CLCX 3QVMA 2A9FA 5ALJA 3L1VA 3TM5A 2YZ2A 3GJRA 3P5SA 3VDXA 4ND5A 2GYYA 1VA4A 3R7WB 2C42A 4DIEA 3ZDCA 5DN6D 5FXMA 3TLGA 1NW7A 4B74A 3U60B 5HFJA 2C7GA 4U9IS 3AVWA 3LE8A 3EF1A 1DQZA 4F9FA 1O5IA 2QVLA 2V6FA 3AL3A 1HLFA 2C1XA 1IQUA 4JUAA 3D3QA 3SKYA 1LLUA 1M34A 3TIVA 1WP9A 2GPBA 4JITA 4LS3A 1SUBA 2QMHA 4BMYA 4ZJUA 3AR4A 1PZXA 3B9QA 3DDWA 3LP5A 3OHMA 3CPJB 3MUOA 2PX2A 2BJWA 1I2DA 1W73A 4DQUA 4MQFB 2XCRB 4CIWA 1WY7A 1GTMA 3HPRA 4GEKA 2IV7A 3MT0A 4QELA 3TSYA 1QK5A 1M8GA 1Y3IA 1ESNA 1AHNA 2UZ4A 4RF2A 4YAJA 4OGGA 1WNFA 3BGOS 1E9CA 4N0QA 4H3HB 3O21A 3DE1X 4JZKA 3WGJA 4FCWA 4F4HA 3NALA 3AKEA 2YOFA 2G9QA 2PVSA 5UKDA 4EZIA 1U28C 5HJ5A 3L4JA 3P2JA 3I1YA 4Y2JA 3WDLA 1M2GA 1C7RA 3RSCA 5H02A 2GF2A 3B3JA 3AHDA 4Z3KA 3IMGA 5J4VA 3AVXA 1DARA 3OJEA 1FSGA 1XVLA 1DC7A 2FW0A 1J33A 3G9UA 2MR5A 4LV5B 4JI7B 1KSHA 1IPFA 2YWGA 2C95A 1A97A 2PGJA 2YIVX 2Q3HA 3HSSA 4MDYA 4WOJA 4HVLA 5M34A 5CAEB 4M1EA 4DLXA 4ZTZB 4FYXA 5DZSA 1JHMA 1Z29A 1MO6A 2PWAA 3KKZA 3L2OB 5ITZA 2VT3A 4EH1A 4RHTA 4KO3S 1BU8A 1Z6QA 4D3FA 2BAGA 5AI6A 5H3CA 1CUJA 4HH1A 4ZHSA 4KQJA 4HF7A 3P2OA 3WIEA 4ALKA 2GF0A 5CUQA 4A8JA 5A04A 3TTYA 3WNZA 2WR8A 1T9KA 1HT3A 3QUCA 2RH5A 1ST3A 5DHRA 4WI1A 5DTIA 2NZVG 2OKGA 5TE9A 2I87A 1OXSC 3KJGA 3OM8A 1MC1A 5HDQA 2Z8YM 5GONF 1KWKA 1DCTA 1SUAA 4Y2PA 4D02A 1QNFA 1UOPA 2AI2A 1F9AA 1GPJA 2RGNC 4CKWB 3NHLA 1P1CA 1NTRA 3DDOA 3Q2OA 4X92A 3WWZA 1E98A 3GUCA 3WQHA 4NJOA 1G291 4B17A 2QX7A 1UMCA 2W58A 2CBGA 1J0DA 1MRZA 4RVDA 2QA5A 1MEEA 1MJFA 1YE5A 2HMSA 1V16B 5CA0F 3F7OA 1DBVO 1KF0A 3G5LA 3FIJA 3I32A 4AY5A 3K9FC 5BQFA 1YK1A 1K4KA 3ETCA 4PZEA 5T8KA 1FNBA 3ZZNA 1F4VA 1MN6A 2RK6A 1JFTA 1PWXA 4QGBA 3A70A 1UDBA 4WXRA 4MW2A 1HE2A 1J5XA 3BMOB 3JXEA 1KS2A 4HTAA 1GG8A 4U6NA 1F7UA 4TLEA 3DMDA 4ZVUA 1C1XA 1TZBA 5EP4A 2JCYA 3I6BA 5IAJA 4D6YA 1MB0A 4C4YA 1DXOA 4E4YA 4NV0A 3X2SA 3V4ZA 5DN9A 5TQ2A 1SM4A 2YQ4A 3C5CA 1ARZA 4GXNA 4UUPA 2ERYA 1HX7A 5TPWA 3AEKB 4KN8A 4ZMBA 1UFKA 4LBYA 2WAYA 2PYIA 2CC2A 4G24A 5LZ4A 3DFUA 3W9BA 1FRZA 3ICCA 3O8QA 3TNLA 3DVAA 3JR7A 4DLPA 1MZVA 3MRVA 2X5NA 1UPUA 4R5HA 5ENZA 5ERXA 3KQPA 4E32A 2QR5A 5KSPA 3GEBA 2EEPA 4EJSB 3UWOA 1N2CB 1Z6YA 3CKYA 3MT8A 4TN5A 3JQRA 3GRZA 3RVMA 5AVXA 4A6DA 4FKMA 1K9SA 4KXUA 4DBZA 1G3QA 1JLSA 5DOZA 1XZQA 4AW9A 4F3TA 5KSOA 2ONYA 3ZWVA 4RO0A 2DBRA 5L3RA 4CFSA 1OAOA 1V47A 1W88A 1TM1E 2Q0QA 1TVKB 3KAQA 4YRBA 3EMKA 1IH8A 2V98A 3LF2A 5KIAA 5K2OA 1V5GA 1YUMA 4L74A 4DDMA 1M0WA 2XDQB 4CL0A 2K7ZA 5EIWA 1TEVA 5JI3E 4FINA 3CMCO 4KZPA 1TUIA 4HXGA 5IBQA 2UZIR 1E1MA 2PMKA 3RJTA 1ATZA 2F3SA 2BJVA 3N2YA 3TVDA 1XDDA 2EERA 4OQYA 3VAYA 3QG1A 2OV6A 4XWWA 3ABSB 3PRYA 3JV7A 5KS2A 3FNFA 2XVXA 4K8OA 3C3KA 1NOJA 4GQBA 5CX1A 1D6SA 2LGJA 1T8SA 1X3LA 2XCQA 3PSHA 5CB0A 4BWVA 1P44A 3TG2A 5ICEA 3HI4A 1ZY2A 2GYUA 1GPBA 3JQCA 3QEJA 4K3UA 5L4NA 4RLHA 3DHEA 1ZJZA 1YR6A 4U5XA 2P9CA 4ZQIA 1JXQA 1UT6A 3SYTA 4OB7A 3TTWA 5LQMA 4GZ5A 4PCVA 2G9NA 2WWGA 4A16A 1VBFA 5EVJA 2QSZA 4Q3DA 2IWHA 3DE3X 1SOWA 5HKKD 5F23A 4C87A 3LOPA 4DCTA 3TXAA 3O4VA 1BDHA 1OFIA 1XRQA 3U4QA 1E1RD 3RC9A 5GM2A 4QBTA 3ICWA 1W4ZA 1UDAA 1ZBDA 3P45A 4PE5B 5IASA 2FQXA 2PZJA 1NASA 2GPTA 4JLJA 5JZMA 4NCJA 1IU9A 1GGKA 5ESWA 5AKKA 3ER9A 4JGGA 1YFZA 2FY8A 3GVXA 1SRRA 2YXBA 4O08A 3KTAA 3QVSA 5BW4A 4OMFG 1FDSA 4XJTA 3IIMA 1GLVA 1QV9A 4I9GA 3W7AA 4PPNA 3ER6A 2Q1TA 4PU0A 2WVHA 4ZVKA 3LD9A 4N18A 3TK1A 5L40A 1GKKA 2ISSD 3BGIA 1NMYA 1IBKB 5BWCA 1A8UA 2PS1A 3B38A 3MIZA 1NBHA 1Y5IA 1OJLA 1WM1A 4RIGA 2GBIA 3A28A 1H0KA 4RV4A 3K0FB 3LC1O 1SUCA 5H9VA 4E11A 2FDCA 3HRIA 2ZITA 2XQGA 2QTRA 3ABQB 3BM5A 3CW2A 3NH9A 3H5TA 5K99A 3FTFA 5BPFA 1JR3A 1JHRA 1HSOA 1Y89A 4JX8A 5ECDA 3K05A 3KX2A 5A1JA 1JLHA 3GXBA 3DZJA 2F2TA 1NC3A 2JKYA 1YI1A 3N0VA 5FTLA 3BQ9A 4UJ5A 3EFOA 3OQNA 4UOQA 3DMTA 4HWTA 1WNTA 4GBED 4LWPA 3UMJA 2YUTA 4WBNA 2H11A 4EDFA 1WZEA 1KU6A 4AL4A 4B6RA 3R7DA 1FMJA 2B2XA 3FZYA 5JCXA 2XVAA 3DTVD 3EEFA 1GSAA 1U9IA 4YCNA 1VGVA 1QYVA 2WC1A 3AI2A 4MOWA 1XPJA 1PWEA 2I4LA 4NHEA 1N0HA 1S8OA 2LE0A 4AUEA 2P3SA 1P1RA 2ATVA 4IXNA 1WDMA 2QXYA 4HFRA 2DKOA 4HYEA 3NQ41 3TZBA 1PT5A 3DHNA 5L95A 2HYDA 2EDAA 1S2OA 1NXQA 4WXYB 4HQKA 3CRMA 4MZXA 2I1VB 3PNVA 4RGVA 4H3SA 3COJA 5F21A 1DTSA 3OIWA 2JGDB 3QWFA 4M8LA 4F5ZA 4V1CI 2Q27A 4N54A 4F45A 3H0CA 5L6LB 3KV1A 4Y2VA 1GYRA 2PTGA 2DTXA 3KKLA 1TJ3A 2HIMA 2JH9A 5T4FA 3S27A 2WT9A 3GUUA 4MRMA 5DRYA 1ZSNA 3TQCA 4ZU3A 3GWGA 4MYDA 5D51S 4QDTA 5EMHA 4JLAA 5EIAA 4ZC8A 4C5CA 1RYDA 5GV7A 3HY4A 4LC9A 5BNZA 3NTUA 3Q7SA 2XWSA 4TMXA 5C1OA 3M82A 1SOUA 1WDLA 5DE3A 4XGRA 2V4ZA 3SQXA 1RJFA 1ZIYA 4LJ6A 1Z08A 3K15A 2PO7A 4DLSA 4EHLA 3C0KA 3KLPX 3I8SA 1X1DA 1ZLYA 2CHGA 3N1UA 3NO4A 1RI2A 2LCFA 3G8AA 4RDHA 1L7MA 4EYOA 1U65A 2BBWA 4KQCA 4XGKA 1BAPA 5G4KB 3ZDFA 4DCJA 5DN6A 2O2IA 1VYUA 2UYHA 5E2IA 4OEHA 4QM7A 4FHCA 2Q5JA 1UQUA 3NHAA 2XZTA 4DXAA 4G1MB 4DLWA 3B1JA 4OQXA 2FW9A 3I34X 1YJBA 1BHJA 1RIIA 1TKCA 4ERXA 4WECA 4PN7A 5I3ZA 1STOA 3E2MA 1E4OA 3CEJA 3EXG2 3F5MA 3HKCA 5FWDA 1XL0A 2TYSB 4F8YA 7ADHA 5KMGB 3KUKA 5DK4A 2OCAA 3FTCA 1TPYA 3GJ8A 3FPSA 3PI6A 1OCEA 1HEUA 2J9XB 2YW2A 3E9YA 3MRTA 1NSTA 2YJGA 3OU7A 1NX6A 3RV3A 3RSZA 1Z5GA 4GUDA 1SOMA 1L7DA 1Z0KA 2GSWA 2W4MA 4GOKA 4TWRA 4NDAA 4ZT4A 2BEUA 1E2PA 1O6ZA 3BC1A 3WOHA 5AUPB 2ZJYA 3P19A 3H9JA 4N0MA 4B45A 1G3IA 3OVMA 1WCWA 5D5PA 5IKXA 4H60A 2ZCVA 3CW8X 1T9GR 3IAS6 1ID8A 2QRNA 5ITWA 2G0NA 1C0KA 5AVQA 4FFBA 1YKFA 1XC7A 2FZCA 1RWNA 5IS2A 2IEDA 3GCZA 1Z88A 3H2SA 5IAKA 3RRZA 4LYYA 5JDCC 5JNUA 4G4JA 4QFDA 3IHTA 5DNCA 1SCNE 2EBFX 2AWOA 1R3DA 4UXIA 1SPBS 4GG1A 4KWEA 4NOKA 2C5LA 3FZNA 4EAQA 1W0KD 2V8BA 5FBKA 2DUJA 4R1SA 5BYAA 3H11B 2FXIA 3SJBA 3EHDA 3LS2A 3DD1A 3OZTA 4L5JA 5AK5A 1Y7PA 4ZU6X 5L45A 3TE7A 1RAAA 3RYHB 2F3UA 1AHPA 4D9IA 3L4SO 5DTJA 4A8HA 3FKSD 3MWKA 3R6WA 1OHHA 1CEQA 1EXNA 1XB2A 5EZ6B 2BHSA 3L7MA 5F73A 4MWSA 1PJ3A 2FR8C 3OTQA 1QPGA 3HN7A 1J8VA 2XKKA 1E6KA 3M49A 1FZTA 2VTVA 3SJZA 4K88A 4R2LA 2OAQ1 4IQFA 4TMKA 3C6XA 4LJ9A 1CIVA 2ZS7A 1XNRB 1WY5A 3JAWB 4QU8A 1ODJA 2IYLD 2OAGA 3IQZA 2QZJA 5AKXA 3I73A 5JQGA 3IELA 1JJAA 1ES9A 1JLKA 1MOZA 1PJ8A 2LVBA 4NONA 2F43B 1UXHA 4QXAA 3VYSB 1RC8A 1SIUA 2H63A 1SCAA 1V3UA 2A0FA 3E81A 3VKUA 4H1UA 3BWYA 5DM60 4HDSA 4O4IB 1T4CB 1YS9A 2AFIB 1L6RA 3LUKA 3MJSA 4I1SA 4YALA 4DJEC 1KU0A 1KY3A 3HJNA 4EHBA 5HW0A 1J1IA 4CTKA 1N33B 5IDXA 2PVPA 4MW0A 1TYZA 3AY6A 2XA2A 4PLTA 5DU2A 4RDIA 1PJQA 3ADCA 1HG1A 3I9JA 5FUBA 3IAAA 1R00A 3MMSA 4R7GA 4YUWA 1TEXA 1MP0A 3C3XA 4HQ0A 3R5SA 3MFYA 4Q3CA 1S7GA 4JBNA 5CLIA 1VE9A 3K9WA 4ZI5A 1XALA 3GJZA 1GQOA 1X7GA 4FGWA 4TYQA 5REQA 3V1MA 4EKYA 3LTNC 3GGPA 3RUIA 1GTG1 4RVHA 2H31A 1XVUA 4HXFB 4KWIA 4LHWA 1VL1A 3QUQA 5B53A 1ILWA 1K08A 1T91A 4ZJYA 1I7QB 1RQPA 2QTHA 4US2R 1EFRD 2AN5A 3PCTA 2QZZA 3CINA 1AKYA 1P7YA 3TAHA 1JBKA 2R6FA 4G0MA 4AZVA 2BBSA 4R1MA 4BLOA 5IFLA 2EKPA 4MTLA 1Z12A 4NLLA 3QE9Y 4O2AF 5MHTA 1J22A 2EX4A 2BDUA 5B36A 3R5FA 4JUDX 2O8BA 2ZE6A 2CUNA 3KJNA 3C3EA 2VYND 3A6GA 4Q9DA 3O8RA 3I2GA 5J1TB 4WUVA 2G71A 1WMAA 2Q07A 2RHCA 1VPDA 2W0MA 3EEBA 4X9XA 4DCUA 4YX9A 3EULA 1I5RA 4B3IA 4ZOLB 4AXXA 5HKBA 3OZEA 4M55A 1ZRNA 1T2CA 4Z3DA 3RTBA 1R64A 3D43A 4W8HA 3RT9A 3SSMA 1RHQA 3OEED 2J8ZA 3NBYC 1Y1QA 2Q6TA 3TLYA 3ZDRA 2LP4Y 2PZ8A 4BS9A 1CTQA 1EM6A 1XXHA 3FH0A 2BMDA 1KRXA 1A4IA 3HG7A 2BUAA 2ZYHA 3OF5A 3ZDXB 2XUOA 2YJZA 2FZ5A 3FNHA 4F6LA 2Q3EA 2PZMA 2Z04A 4FHZA 1FDOA 5AD1A 1Z35A 1ML3A 2ZTMA 1E3DA 2YZGA 4H0NA 4JC8A 4N5LA 4XJXA 3BH0A 4NBTA 2BSQA 1P62B 1J2YA 1HLPA 3FUTA 1K9VF 2A14A 1U7XA 1UZUA 3BZUA 3PRJA 4LBZA 1NXPA 1YI8A 2C07A 3IUPA 1ZNWA 1TK9A 1XRSB 4RK4A 3SLKA 4DMHA 1KOGA 1APBA 3P2MA 1IONA 1OZFA 4FD3A 1VE3A 2Q29A 3JQ6A 2HJGA 1GZDA 2W9XA 3EF3A 5H4HA 1IN6A 3G5AA 4G1FA 2FPUA 3U3XA 1Y5NA 4Z7NB 3OKAA 4UPVA 1JJVA 1KOLA 4K9RA 4DUYB 1P60A 2YWJA 3CUKA 1KK2A 3SI7A 4AJOA 1WWKA 2JKZA 5I7VA 1UAAA 1HT2E 2B69A 3C14C 5C1DA 3TRKA 5FA5A 4JYCA 2V9CA 5C0OE 4RVUA 5HKKA 5EL0A 5L3SA 2BHRA 2EFEB 3V7FA 3KT0A 4QFCA 5D3QA 4MLPA 5KKAA 3CCFA 2SCUB 4CEHA 1NHGA 1E1RA 4PZUA 6YASA 1Y8ZA 3EQZA 1GL9B 2YWBA 2XXBA 4E4RA 2QMOA 4FBGA 3UJDA 4Q4AA 5FPKA 1MOSA 1X8LA 1Z2CA 1ITZA 1K88A 2MIIA 2VTKA 1A7UA 3NORA 1D2AA 4GICA 4D92A 2RGAA 1IB6A 4XTRA 5KNDH 2PT5A 2QYSA 2RDMA 4UCQA 5F1YA 5C5DA 5BSUA 1XGKA 3VPXA 5HJ2A 3ZE6A 4BNFA 1VPEA 2NSLA 3BG5A 2R97A 5AKEA 3PIDA 3B1KA 5CT9A 3OURA 1G4HA 2O2ZA 2QDXA 3IUSA 4P22A 3BQNB 4PF1A 1X2EA 5FI3A 5IBPA 2QW1A 2OK8A 4RWZA 2E5FA 1N5IA 2J9FA 4I4TB 4UREA 2GNAA 3NM5A 4DMGA 4NF2A 3REQA 3STUA 1ZP6A 4X8LA 1I4DD 2RHGB 2QN2A 1U2GC 1A50B 4G0UA 2YWHA 1DG1G 1A9PA 3GLFE 3UIEA 2AC4A 4UU7A 2QLBA 1Z15A 1EEXB 1PQPA 2VDUE 2VPIA 3ZY6A 4AQYB 2GPWA 3PNBA 1I0LA 4LZNA 4B6EA 3AOEA 3CVYA 4J94A 2XXAB 3L5KA 1LW7A 1X7ZA 2VSNA 4R8MA 4WTOA 2NVUB 3L7KA 5KU1A 2QTVA 2QT9A 4LJYA 3A9RA 4DQDA 4GR9A 4O3FA 1E92A 3OA0A 3SXPA 2EBUA 1B6TA 1RWKA 2A4MA 2RCYA 3ELBA 2JJMA 4KDCA 4PZLA 2FUG1 3S1SA 2YHUA 5A4JA 5A3RA 3B6JA 5ENVA 3GZNB 1ORDA 1KORA 3WC4A 1JZSA 5KVCA 1P6UA 3SOZA 3W5SA 2VOEA 2GFQA 5KPJA 5GJBA 3HV0A 1N1DA 2LV8A 4HFMA 4UE6A 1W4RA 2WNHA 2XVZA 3DBLA 2H4YA 1V6CA 4IRUB 4R8KA 4DDUA 5HIKA 4LNUB 3VV2A 1UPBA 3OX3A 4HVTA 1CY8A 5EEGA 1IHOA 5C18A 3HWRA 4MVJG 3QV2A 3EEYA 3QE0A 1JU3A 2K5UA 2R1TB 5AM2A 3KL4A 2RC6A 1UXJA 2CFTA 4JVNA 3IKVA 2NAPA 1X1TA 4RHFA 1SKAA 2FZLA 4ZAVA 3KJXA 4YJGB 1SVUA 4YFVA 3PD0A 4KFSA 2BFCA 2NU9A 4ZMSA 1OB2A 1XEWY 5F5LA 1JYSA 3CH6A 3H4VA 3ZWCA 2TMYA 1ZONA 2O8NA 1U1CA 1TCUA 4J2TA 4N49A 2HGSA 3ZOZA 2YWDA 4DNQA 1RYMA 4L3WA 3PQEA 1R15A 3DHWC 4R1QA 2OXTA 1NI4A 3W2EA 2O9JA 2QSUA 4GVPA 2W2MA 3OESA 4KJZA 1Y6FA 1EK6A 5AI0A 2IELA 3KK0A 2EL7A 1F2TA 3GLRA 4JT4A 3KKPA 2XBUA 4WFQA 4YGYA 3LGSA 1KAGA 2Q1YA 4XEHA 1NY5A 3UH0A 4E1VA 2KMLA 2VTEA 4AICA 1X13A 4C2AA 3E0QA 1V8FA 8ATCA 1IY2A 1WS6A 3AESA 5YASA 4DJ5X 4LX8A 5IJWA 1GO2A 1R4AA 1RM4A 5A02A 2JI9A 3ANTA 2OBBA 3NXKA 4DF3A 3PCRB 4ZFNA 1F2UA 2J09A 2R11A 3HBMA 1EDOA 4HDMB 3Q2IA 2X4IA 1D5CA 1MORA 1UBNA 4IO1A 4PG5A 2K6GA 5DWQA 2P6UA 5EXPA 4JU8A 4XWOA 2IH5A 4L27A 4ZCSA 4L5BA 5F7JA 1H6AA 1FFXA 5F2OA 5LQSA 1ODIA 3I2FA 2R8ZA 2I7DA 4M8SA 2IYTA 5KNDD 2E85A 3OY7A 4KRYA 1KNQA 3G5UA 1IVSA 5D3MB 3D0OA 3G3EA 1XA0A 1QFSA 2YN2A 3GLUA 1Q7BA 1ZAYA 1PWZA 2HA4A 1NMQA 4DLKA 3WJ7A 3GDFA 1FP6A 4TYPA 2I7XA 4QEKA 4CLDA 1UFOA 2G36A 3GEHA 1J2TA 6GPBA 3QA9A 5DP2A 2LD4A 2ACKA 2RGWA 4WLUA 2FPOA 3ORQA 2NACA 2C2XA 3O92A 2YWEA 1KJJA 5E3IA 4Q4CA 1IY1A 1KSFX 1BGWA 1YIAA 4CLXA 1XMJA 3JVUA 2JBHA 4XTCS 1EESA 2WSBA 2FPWA 4B34A 4DVGA 1W0KA 3W3AD 4RM2A 4L9AA 3SFTA 3SYRA 5A4AA 2V1XA 4I1VA 1OXBB 1N1MA 4PAMA 1RXEA 3AHIA 4H17A 1WPXA 2FN8A 2GAFA 1EI9A 2ONKA 2VF4X 2VSOA 2BZ0A 2O3JA 3GFVA 3K2IA 4DEVA 4HEHA 4Q4JB 3UY4A 3F3KA 3IUEA 3FKSA 1NF9A 1OLOA 2IP1A 5LZ2A 2DLCX 1T4BA 2FPXA 1KYYA 4YJ3B 3ZY4A 4CN8A 3AXTA 3HADA 5CFLA 1QVRA 3L7JA 4WNAB 3Q3CA 4DHWA 4GXQA 2D1TA 4X84A 4Z7JA 1JMKC 4TRJA 5DLPA 1QR2A 2PYZA 4QAQA 3M4XA 5FAKA 1ZK1A 2QLTA 1YJCA 1X80B 4IDHA 5FORA 2VDJA 4MVJE 2AN4A 4UBJA 1T2DA 2I3BA 1ZJ6A 1PF7E 3G8YA 5JCJA 3QJ5A 1HLGA 3ESQA 4HR7A 3UKJA 3FPCA 4NH0A 4YRLA 1JHYA 3O4JA 2PSHA 1YB1A 2TS1A 3SIRA 2YFHA 5G0SA 5KB3A 1CJMA 3PB3A 1BH2A 1RYEA 3SYMA 4CV2A 3O03A 4B3GA 4NJEA 2ZPAA 1R4NA 2XZDA 1ZEJA 5LOVF 1LK0A 2XRYA 4C21A 1XTTA 2FDXA 2WWFA 3V3TA 5BMVB 1E63A 3BJMA 1SOAA 3EH2A 3KLMX 4Q18A 3HCFA 3OQHA 2HSGA 2BGJA 4LYDA 1WBBA 1E20A 2O06A 4WNIA 2IBTA 1Z5NA 3WQSB 2Q49A 3T3MB 1A69A 1H8HD 4ZDKA 4GOOD 2EW8A 1AK2A 1SXJB 2JFZA 4AZWA 5BV0A 1K6XA 5JFTA 1KC1A 4UEKA 5EJ8A 1FTWA 3DUFA 1JV2B 3F49S 3QEKA 1P1IA 4H3KB 4BV8A 4FYWA 3KU1A 4FJ1A 2IOQA 2REXB 4AO6A 521PA 5PNTA 1JAZA 3HH8A 4QWWA 1MABB 4PSUA 1Z8DA 3C4JA 5HUHA 2QQ0A 1U63A 1NBME 2DG2A 2J41A 2UUOA 2WK1A 3GFBA 3D7KA 1LPOA 2C58A 3CKMA 4MV0A 4ER0A 2CDNA 1GKUB 3RRFA 3C43A 4L5YA 3AF6A 1KO5A 1UIRA 1RRPA 4NU0A 4RA9A 3TUIC 4C4TA 1PL0A 3RAJA 3P9QA 3G7UA 5K05A 1H8ED 3F6BX 4GM1A 2FEPA 4IOMA 5EGNA 3MLEA 4HJRA 1WKBA 1P0PA 1JYFA 2WIKA 4RKYA 2DTDA 2JH3A 4KLZA 2DVMA 4R3WA 2FG6C 3EGOA 5FFMA 3UO8B 2VYNA 4F04A 3HCBA 3KJFA 1VP3A 2YHIA 4DNOA 4P31A 4L75A 4IIJB 1SB9A 5F2NA 4FMCB 3ZXXA 2EC5A 2NUAB 2OHOA 3QXSA 1C0PA 2GPSA 2PSSA 3ND7A 3WSVA 1SG9A 4HTFB 2CBXA 1MG5A 2H4JA 2D2EA 3OEEA 4MQEB 4G9EA 4ZT2A 4WOPA 3C8ZA 7REQB 2O1EA 2W6ID 4RFVA 1EFTA 1T9BA 3GD7A 2XMSA 4EPYA 2C7RA 1PP4A 3D8RA 3FETA 5DIZA 1JUDA 3T7CA 3CUTA 4B80A 1D1SA 6REQB 5HJEA 1OU4A 4YPFA 3O9ZA 5AKLA 1JT2A 2DCMA 3V8EA 3W5VA 1E77A 1QOZA 2ONCA 3FPHA 3IAXA 3DV9A 4EVIA 4FYMA 5KX5F 3E3MA 4KMRA 4TWJA 2DSNA 1K5DA 4GE3A 4MGZR 5DHTA 5FWYB 1N8KA 3OIFA 1DKRA 2ZR9A 4L57A 3PNLA 3VDNB 4F86A 3N05A 5EXSA 1KI2A 3VC3A 3FOAA 3PXBA 3THYA 2ZAGA 3OFVA 4EFNA 2IBSA 1W5TA 2BR4A 4TVSA 1QF6A 2BMAA 4QHSA 2AG6A 4NWIA 2JLVA 1NVWQ 1QBGA 3W2IA 2RIPA 1RHMA 2C0PA 3HBJA 4O4HA 4WKOA 5ILQA 2VJKA 3A1EA 4I5IA 3RYIA 5A3VA 2OCXA 4YCSA 1NJFA 3FIUA 2EKLA 2W6OA 4C3VA 2ZATA 1C3JA 5FOUA 1OX5A 3T35A 2L19A 3NLLA 4CU5A 3P20A 3CJTA 2GXAA 1WKCA 4OBBA 1R10A 3RRMA 3UK1A 3V1KA 3VKWA 3S2EA 4CG0A 4Y67A 2YJ4A 3W5JA 1CEXA 1W8DA 3LT0A 4NFSA 4L6CA 4ZKEA 3HXPA 3E7FA 1KYWA 2DHEA 4P9NA 1PJBA 3B2NA 1QAQA 2IHBA 1RPTA 4RQUA 1A2QA 2OD9A 3KQQA 2PGLA 2NYUA 1QB8A 2JK1A 5CFMA 1QPZA 1L5LA 3QXXA 1O96A 2D1YA 3R9KA 1H2WA 1F0YA 2Y1DA 3MCTA 1U3UA 5AKHA 2JS7A 4I2VA 5U4XA 3SIPA 3CRW1 4R05A 1TM4E 1U0SY 3L4BC 4JJFA 4M1SA 1WBJB 4RF5A 1J97A 5K0CA 2YC2C 4LFBB 2C9CA 3W5DA 4HNAA 2RHJA 4NJMB 3RJMA 2XUKA 3TWOA 2QB5A 5I9NA 4RJKA 1VP9A 1FPQA 3MB8A 1XJQA 2DPYA 1NNEA 2IPMA 1Q2XA 2YWRA 5J1SB 2X0IA 2HKIA 2C84A 4RF3A 1Y6JA 3CGGA 5SYNA 1CETA 2E3JA 4GGOA 5SZHB 3CRRA 1Q21A 1MAVA 4O4LA 1IY9A 5JXIA 1CS0B 1HFEL 5KYXA 3IMKA 3M1LA 4DDHA 3HXOA 2Z6QA 2PH7A 1DQPA 3A25A 2ZCJA 2D1QA 1X7HA 3F6PA 3VYTB 4XIYA 4BE9A 5IT9A 3IVCA 5G0TA 2BUBA 1CLUA 3F1LA 3R4VA 1RP1A 5JS1A 2IZ5A 2AMFA 4PHTA 3WBBA 2XLCA 4FYKA 4YONB 3R3WA 2WAOA 1VA5A 1F8GA 5A6SA 3P94A 2XITA 4H7KA 1I30A 4U9UA 2B25A 4O4JB 2I1LA 4CG3A 2OBNA 4JHXA 1FTGA 1YHZA 4OIFA 5C7OO 4N9WA 2YNMD 4HDAA 3LCRA 3D0KA 4KX3A 2Q4BA 1YULA 5FIUA 5GZ1A 1L4HA 1Q14A 5I48A 4OU5A 4I55B 3L8DA 1DAOA 1F1BA 1O6FA 3D7SA 5JMOA 3ZW9A 1EUCB 4PZ0A 1UC8A 5CG2A 4XGQA 1DDOA 1DWUA 2IP4A 2G28A 2PLRA 3KR2A 1H2FA 1WMFA 3DZ8A 2OVBA 3HJBA 4DSUA 4OY3A 4FS3A 4RZ2A 1XN4A 1HPLA 2JLXA 1NQXA 1M7BA 4MX8A 4LN1A 4LEIA 5D00A 1YQTA 3IBGA 4XDZA 2FPIA 3R8CA 3QQPA 3DAYA 1NV8A 4KMOA 4PFSA 5HMMA 2B94A 4WZBE 3ZXYA 4IKOA 1NE7A 3BGSA 3KUCA 4J43A 3L05A 3N0XA 5FF9A 4Y2XA 1N2OA 3GRFA 1PSWA 1QRUA 3RKSA 3SS8A 1QDUA 3NU1A 1KDYA 4E5DA 5CDYA 3U5TA 3EPJA 4OMDA 4XCQA 3F2IA 1R6BX 3KQWA 3BWBA 3RYFB 3KXLA 3TAUA 4LKRA 4AU1A 2O2EA 3MM4A 3LY8A 1NX9A 2YRXA 1PJ2A 4RZHA 3TYXA 5C5IA 3VUFA 1ZICA 3ZGYA 2AMVA 2DT5A 4J0DA 3USZA 1TLLA 4FFSA 3VH2A 3WLRA 3SVLA 3WKAA 2DLDA 3OPMA 1RAFA 3ZWMA 4ZZ0A 2XTMA 4DSTA 2NAFA 2HK6A 3D2CA 1H94A 1SKQA 1TLFA 2DPGA 1XCOA 1XRNA 4YR9A 4D99A 1JSCA 5KNDA 2A1TS 2X3YA 2IYSA 3QXCA 3V8VA 5IYZA 1G8HA 2F9LA 4TVOA 1BEEA 5K5EA 4R84A 3UQYS 1IC6A 3CLSD 2ZEJA 5DB4A 1X1QA 1BKSB 1Z39A 2FX3A 2C3YA 3GRKA 2X0RA 4JH0A 3WA7A 2ADFA 1SH7A 4OBWA 3UXYA 3BCSA 4JP3A 3DQQA 3M2TA 1F3OA 2AT1A 2NU7B 1RVDA 3AP3A 1G6Q1 3OCWA 1T5IA 2WFLA 3E9DA 3PG5A 3ZH9B 4B33A 4FWTA 4NCAA 1EXWA 1YTLA 2NUPA 4JLMA 1SHJA 2WYVA 2Z3ZA 4BFSA 1XQWA 3ZE0B 3HYRA 2QRUA 3GGGA 1EX6A 1CERA 2ZBQA 4HSEA 4R69A 1EG7A 5LZ8A 2CSUA 4OM8A 2DZDA 2HU8A 4WZ6A 1A9ZA 2X2EA 4O2BB 4E22A 5C8VA 1QGYA 4Z4IA 5JZBA 1KP3A 4E1BA 1W36D 1DTEA 2REBA 1RYYA 3NHSA 3SJUA 3T5GA 3VZPA 3C97A 2B1IA 3ZDZB 2JAWA 5KNCA 1BFDA 3L7OA 3KAPA 3KBOA 3SC2B 2PFSA 1F51E 2A59A 4ZI3A 1CQIA 3JQ9A 3T7IA 2B7BA 3JQ7A 1D7AA 5F4BA 1GQSA 4ZVOA 3SE0A 3ST7A 4II3A 1HDYA 4G5FA 2MMGA 2PUFA 1XZNA 1LVGA 4NDNE 2A1IA 2JF0A 5GGXA 3BORA 2X9NA 3QLUC 4EIWA 3K9NA 1VLVA 2X23A 4HLUC 5IT0A 3C5EA 1RLJA 2BMVA 3NNSA 3TXYA 4NPAA 1NHWA 4QGAA 4R9UC 3A6LA 4C0LA 1CY1A 1W76A 2RGXA 2J5RA 4DLRA 5BN3B 4LV8B 2VF5X 4HBGA 4LGMA 1VG9B 2JFQA 1XQ9A 3QSGA 1FMLA 3S68A 5JMPA 1M5RA 4DZZA 3AUXA 1AB5A 5F64A 1NUPA 2GA9A 1P74A 4KH1A 1E2DA 5E8JA 4M49A 2R5NA 4KTVE 1EFHA 3OT5A 4B2YA 1W1IA 1F2DA 3BICA 1F3LA 1XAHA 5JV5A 4J8PA 2I6TA 4B5KA 3INRA 3G1TA 1HEIA 1SD1A 4K03A 2WMDA 4F5EA 1TFUA 2XUPA 3BRSA 1NVXQ 3R9WA 2A58A 3ANLA 3ICPA 1G9XA 4ESEA 4V2UA 3W1WA 4MVJF 5C31A 1UC9A 1P2SA 4FS8A 3LY9A 1YRAA 3ZHUA 4TV8B 2FSGA 5BY2A 1GIAA 4KZKA 3WGZA 3GROA 2Y92A 3DNMA 3LSYA 1JSLA 1WZNA 2IX9A 2YXLA 3CZRA 1L0BA 1AG9A 1EB8A 2ZR0A 4FEEA 2VQ3A 2ORIA 3QLTA 4RVFA 3DOFA 1LJUA 4N4AA 1MA0A 4JNKA 5C7LO 1CUAA 2I2FA 2ZB3A 3MGCA 4FZ3A 3H3JA 1ZIXA 4U9HS 3FBTA 4CIYA 1GL7A 2VIIA 2BFBA 4BAZA 1H8EA 2C2OA 4A0FA 1E5TA 4IJ6A 4ED9A 2V1UA 4EMSA 5C32A 1UXGA 4RACA 5AM3A 1US8A 4ZRDA 1D5WA 1YXMA 5AXBA 4BO4A 4MVJP 2YS6A 1PFGA 3QFHA 5I8ZA 1HQYE 2HH9A 4G5HA 1RLTA 2I4NA 9ABPA 5C1PA 3GW8A 2Q6IA 3R3HA 1K8ZB 4PG8A 3KZMA 3I83A 2Q9BA 4IY1A 1QLHA 3BN3A 5BNTA 4TPKA 1XCJA 3V3KA 4RHYA 1HFJA 2B99A 5EINA 5C8YB 4COOA 1URPA 5MFZA 1W85B 1X1AA 2I9KA 5IVPA 4YMSA 3HKEB 3PPYA 1ML4A 4ZCRA 2FPPA 2H16A 3S1LA 4TQUS 3VU1A 2PRIA 3KSRA 1ZM3A 1HQDA 1WPRA 3IBCA 4MCAA 4QLAA 4MGHA 4BVKA 1XE3A 1OTXA 2OVFA 3K8ZA 3KUDA 4R83A 4NK4A 3ODPA 5F1PA 2KWIA 1RLMA 2VT7A 3NXSA 3HU2A 2NT4A 3Q2KA 5GINE 3CKKA 4E33A 1L8AA 4A82A 1RJ9A 2AE1A 3KSMA 2WWXA 2X0FA 2Z8ZA 1BDIA 2AXNA 1LPBB 1FA9A 5ISMA 2FHPA 1CWUA 2WHQA 3OZIA 5FQNA 2PJUA 4M53A 5AYVA 5K2MA 2XOEA 3KB2A 4WV3A 1Y3DE 4NMWA 3IA7A 3ZEAA 3RH0A 2PU5A 4BCCA 2HJHA 3HJRA 1QGED 4CKBB 4HEJA 3B7WA 1LC3A 4KAXA 2GZ3A 5ALFA 3SJAA 1XCPA 4CCYA 1SVNA 2R8YA 4RLSA 4CXMA 4C7OB 1KSJA 2GEVA 4QNMA 3CQ9A 1OFUX 4UPDA 2QRQA 1U5CA 5BN5B 3OM9A 1PNOA 4D0LB 3RK1A 4D7AA 2NYRA 2L69A 2Y0EA 4DBVO 1I4EB 3RT7A 1A9QA 2EYQA 1E9DA 5CEJA 2O6LA 3M70A 4LRSB 1I7SB 3HHEA 4OP1A 2PEZA 3K70C 1REQB 3OZCA 4FIZA 2ZT7A 3OI7A 3WRVA 2XX3A 5FTWA 1OWLA 3UXMA 1FU4A 1W4CA 3OT1A 2XYVA 1VPLA 4P08A 5ALEA 3INYA 2I55A 2DX7A 4GBMA 4KI0A 1GJRA 3GJQA 4NMLA 4TLCA 3GQBA 1OT3A 2DQKA 1EK5A 1ACLA 4EITA 4EUKA 1EDBA 2PDAA 4AKSA 1KPHA 2VK8A 4CMCA 3Q3VA 4RD0A 5B1DA 2Q6VA 3WRXC 7MDHA 1YS4A 1THZA 3F0TA 4WL0A 4G3XA 4CYMA 5J58A 1VI5A 2W6JA 1PX0A 2CHFA 3OT4A 5IJXA 5T41A 2HCJB 2ZSUA 2BLNA 4KB5A 4HAUA 3WYBA 3M34A 2ZJOA 4C03A 1XNJA 4MWZA 1MJHA 1D4AA 4C3UA 3CHYA 5EWLA 1LLDA 2LR0A 3O3CA 2AG0A 1FNDA 3R75A 3SZOA 3C16C 1J1ZA 5AKYA 3B1XA 4ONEA 4US1R 1XDZA 2Z58A 4P33A 3TVYA 3VPDA 1F0KA 1SCBA 4FDAA 3RYCA 4OP3A 1W19A 2HO4A 1T34A 2HJ9A 1AURA 1YOVB 2X77A 4NG4A 4M87A 4D9FA 1BEZA 4Z8YA 3H5OA 2JW5A 4XM2A 4ZCQA 4GSYA 3TLKA 1K5PA 2L0XA 1X6VA 5IT5A 3OIDA 1WTAA 1QE0A 3INTA 5M7EA 2OMEA 1KZYC 4BCDA 1LI4A 1GZUA 3EC1A 3EBLA 4BRWA 2FE1A 4PSKA 3FYSA 4JWTA 1JKMA 1P4HA 2I3DA 4TOIA 3IPRA 5CT6A 5LA6B 3EDOA 2VHTA 1RR6A 2XGMA 3HB7A 1UOQA 2E21A 2OBXA 1H0HA 5AO9A 2ZP1A 2ZSIA 2G8NA 4GWGA 3P26A 1VJGA 2Z8YA 3E9CA 4GSKA 1T36B 2GZMA 4MRSA 3WJ2A 2FW1A 3HA3A 5CDTA 1P4GA 2DLNA 3INGA 4MSUA 3VZRA 3C8MA 1TLTA 5EMLA 4H77A 4ASUA 2WKRA 1MB9A 4WZAB 3A4YA 3HA7A 1HXHA 1NJGA 3A04A 1TTQB 2H2HA 2YNMA 4IYRA 4U7DA 3HXKA 1QGAA 5GV8A 2CGEA 1EWVA 4FQ8A 4R2MA 2ECPA 4IIBA 4X44A 1BMFD 2XMCA 2Z56A 3FZGA 1ONNA 3IE1A 1NVAA 1XD8A 2QTAA 4D57A 3BL5A 4ZQGA 3K32A 3DF9A 4JLWA 2QT1A 4LPKA 4TT3A 4NENB 4OKIA 3BRWD 2NU8B 3FDXA 1FP1D 1MG0A 5EE0A 2XD4A 1VKHA 3WGUA 4WSOA 4FJ0A 5ED4A 5C9ZA 1GXSA 4IEFB 4NBKA 4D44A 1Z75A 4DR4B 1OTYA 3ADKA 2QY9A 1Y1KE 3EDMA 3QTTA 5JTTA 5CIQA 4QD3A 1E69A 2IXFA 3SK0A 5H9WA 1OILA 2A94A 5EWJA 3WLLA 4Z7OB 3L5OA 2GEUA 1NGSA 2XCUA 5KQSA 3ZIAA 1M6VB 3AERB 5CH5A 3IEMA 1QANA 2ZTVA 4NZYA 5C53B 1RBMA 1XTQA 3SKXA 4MW1A 2BGNA 3A4IA 3AYXB 3FF1A 4ZI7A 1VGRA 1Q7RA 4YAOA 4Z1MA 4BN0A 4J3JA 2PH5A 4HZGA 3RDPA 1VBNA 1LDEA 1KFJB 1G8MA 2ZWOA 4EMBA 3K8YA 1FTSA 1G55A 1TT7A 2ZYAA 4NNJA 4IDBA 2Q7OE 5B37A 4AJ9A 5ARBA 4BIIA 1U02A 1ULAA 2IODA 4JS0A 3VI4B 4D5EA 2H3HA 3RAGA 4U0KA 2IEBA 1NIJA 3E3LA 1Z0UA 1O95D 2E0IA 1ZGGA 4NECA 3LMKA 3FW1A 3SS9X 3RVPA 5JALA 4LPSA 1JXOA 2H48A 1SG6A 2QPLA 1BKDR 3R5TA 3KOUA 2JCGA 1NMSA 3DT8A 4I1OA 4NAHA 2CLLB 4BQSA 2H07A 5K9ZA 4AS1A 1N5RA 1LRKA 2P2DA 2GN6A 4P3YA 4QJ5A 1IM2A 5JSZA 2WF6A 3ML1A 4S1NA 5E2BA 5I9TA 2BKUA 3PUIA 2X13A 1LQTA 4YJ2F 4DAEA 2ZIFA 5LM3A 2GN1A 2H00A 4E2FA 1X14A 2CNKA 2ASEA 1LS1A 3KZCA 4Y30A 4XVCA 3U7QB 1UFVA 3L7DA 5D1NA 1FEZA 1JIUA 4KLCA 2BGRA 2PFKA 2NZ2A 3GL9A 2IPNA 1J0AA 2PR7A 1POWA 2IYUA 3Q0IA 4KCGA 4KG7A 4MO9A 4S3MA 3C15C 3UUGA 4C5AA 5C51B 4AI6A 3DUWA 3V4FA 3CW9A 3QNUA 1N9GA 4TS9A 2DQSA 3ZGNA 1Q20A 4RZSA 2YFKA 3IUQA 3WFJA 4RMIA 5CDHA 1R6UA 4WN9B 5EP1A 3IR5A 2MJLA 1COWD 2I4TA 2YVAA 1O97D 2HMAA 3L7YA 3PFFA 4HDQB 4N3CA 4UBIA 1C9JA 5FQOA 1YCFA 3K6KA 1NOIA 4L5IA 5D1HA 3U7EB 4QVIA 4OVKA 2GZRA 1QAMA 3B78A 2AMJA 4E15A 3D4LA 1HMPA 1PTJC 3HVRA 1ZM7A 2HRZA 2RMKA 4O1MA 5JS6A 1SU4A 5L53A 2HHHB 3VZCA 5K6AC 1WMEA 1QYCA 4EO9A 2P77A 3NS7A 3U39A 3TGWA 1HZZA 2DY1A 5B2EA 1K8XB 2FRVA 1J8FA 1RKQA 2BEVA 2D59A 4H4DA 4OYLA 5GWXA 1I4TD 4AKTA 5BURA 4EA8A 1CF4A 3D3KA 2OFXA 4F3YA 1JHQA 2GK7A 1FX0A 3C6KA 3NT5A 4OG2A 5BSGA 5GTDA 2I34A 4IH1A 3EWIA 3VNQA 3PE3A 4Z9AA 1RXIA 4F4UA 5CBPB 4IV5A 3N58A 3NGMA 3QX8A 3SDBA 4CLHA 1VGQA 1D6JA 1WPQA 3AFHA 3NAMA 2Y0CA 3OZAA 4YXFA 2HI0A 1SBIA 3RIYA 3HU3A 1SBHA 4XD7A 5HCIA 5KTRA 2D74A 5LQNA 1DRWA 2KI5A 1L5FA 1N2HA 4HC4A 4C2BA 4B8YA 1X38A 1F4PA 1T26A 4NCKA 1I8TA 4TQAA 3DVQX 4PAQA 4YQFA 2EJWA 2LKCA 2HDNB 4P8RA 4MCJA 3M6WA 4BFXA 1XTSA 4TSFD 2ROQA 3K72B 3PGLA 4DRZA 1E9FA 4R98A 2OLKA 2QRVB 1QFMA 2A92A 2RC5A 2WZCA 4UBNA 5B12A 3OPVA 5DGHA 1EVYA 5B3AA 1ODTC 5JXGA 1UMDB 1ZJ4A 4EX6A 3AVOA 1S6YA 1XT6A 2AQ8A 5B1IA 4OI1A 5CDGA 4ZALA 3N6RA 4AIRA 1M1YE 1U8ZA 2KQUA 4YO7A 3FROA 1DV2A 4FB4A 2R1VA 1U3FA 4O29A 3MHPA 4BOYA 1MDFA 3KQYA 3OTIA 1VLLA 1LDGA 1BD3A 2A0WA 3H05A 2OBLA 1KQPA 1QP7A 2YJTD 2V3CC 1TI7A 4N7RA 5TSDA 1J8YF 2M6RA 4B73A 1MX1A 3GJ3A 3GGDA 1GPLA 4RMHA 1CHNA 5I5GA 4G4SP 3ELDA 2HRRA 2W90A 1O1YA 2P6OA 4JN6B 4BPRA 4EKEA 5FCDA 2ZYIA 1KKLA 3DE7X 3D7RA 4R8RA 3R7WA 4MYHA 2CV0A 4FOTA 3T5TA 2BDEA 4ZGGA 1RDFA 3E61A 1NYTA 3H1EA 3OZVA 4F8JA 1RPAA 2WUGA 1SC4A 5KI6A 1DC8A 2CXSA 1GCAA 2VAMA 2FMIA 2FZ4A 2IF2A 5E8RA 3SF8A 3TBKA 4GZMA 5JROA 3O7WA 4UHKA 3WLHA 4Q7QA 4P36A 5JDIC 3DL0A 5DP1A 3COZA 3QRWA 2OYSA 4Y0VA 1II8A 1T8PA 1XCLA 2IKQA 3W6OA 5LJLA 3OMWA 1T24A 4FR2A 5CX4A 3HEBA 1Z7YA 4ARUA 2GMWA 1LK7A 3C87A 3OETA 5F78A 4AP9A 2G1JA 3D5TA 4OYHA 1XQ6A 1TVCA 2WY2D 4E1AA 2EFJA 3SDSA 2MINA 1M8JA 4H6XA 4WKGA 4MUIA 1WEHA 2CVQA 3DJFA 4WACA 5D7NA 3PWSA 3TR5A 1EWQA 4UVIA 4B47A 2Q0SA 4NESA 5AM4A 1E9EA 2WLSA 3ORRA 4FN4A 1MIOB 4Q4LA 3E7DA 5DWVA 5B3LA 1H0RA 3CZPA 3L1JA 3IEPA 4A2CA 1EAMA 1E2FA 1PQWA 1YJ8A 2FWAA 3HDVA 4L8WB 4QE3A 1CZKA 4UUQA 1L5OA 1SB8A 3E1SA 2GBLC 2OFWA 3MK31 4KXNA 3PYXA 1QHFA 4ZDWA 3QLVC 2IS6A 3DXFA 3MPOA 4M0PA 1XI2A 1H3EA 4OFZA 5ERGB 2IGBA 2CZQA 2H1LA 3AP1A 4G5GA 4QXMA 4DQLA 2NPFA 1KZ1A 1DHTA 1LQ2A 4EA9A 5FBHA 5CAEA 1WA5A 1CVIA 4FBMA 5FUWA 3OQPA 3N9IA 4X24A 3EZFA 5L4LA 1Y8QB 3CNLA 3WL4A 5ADHA 4MQBA 4TTPA 3NPAA 4X41A 4TYYA 3GA0A 2O2HA 4V0LA 4J0FA 5NULA 3EZNA 1QYXA 3OJWA 4REQA 4PXAA 4I81A 2Q50A 3ZVKA 4ENUA 1BU5A 4Y2YA 1J5PA 3JQFC 4LDNA 3GPIA 3UJPA 1ACMA 2DWOA 2GLXA 3JZAA 1KDOA 3QLEA 2QZ9A 3AZOA 1N1GA 1Z4IA 4EG0A 3CLUC 5I7RA 3V8QA 1IWPB 1OX4B 2PX5A 1AQLA 3OPYB 2Q3CA 4U0JA 3G2KA 2ZYWX 2P3QA 4KFUA 3PQFA 4QTZA 1W25A 2AK2A 2BGWA 1CUWA 1GD1O 1QORA 2ODEA 3O83A 3KRTA 4L9RA 3PBKA 4D9HA 2AHRA 4CKWA 2LTAA 2X5XA 1BGVA 4JLKA 4PCLA 4KVGA 2J4CA 3SJ7A 3KEFA 3MTGA 4LY3A 5TPZA 3GNTA 4Q82A 1QG4A 3USCS 1P1FA 4PX9A 1U4NA 3VNBA 4LZPA 5I6DA 4G25A 2JIMA 1QS0A 3GMTA 1LTKA 3LPDA 3Q7QA 1NJ2A 1WVIA 1F9EA 1V16A 1PL7A 2LIPA 4NY1A 4JB2A 2X41A 4R5MA 4JYMA 2AZ4A 1D6MA 1AKQA 2JGIA 1OGJA 1YMVA 3IQEA 3KYBA 3L6RA 4C1BA 4I50B 4F5WA 2VUSA 4WXMA 1Q0HA 1Q17A 3C3DA 2WSIA 3T7DA 3H5LA 5JXHA 1CEEA 4X93A 2HFKA 5CA1F 4CG2A 3BMOA 5J2TB 4ILKA 3C3WA 1TVMA 2RCNA 2OAEA 2R62A 4EKDA 1Q19A 3D6FA 2GK3A 3LLVA 4M88A 1JHPA 3O26A 2IIVA 1IL0A 3KFLA 4KGVA 4BVAA 3IQHX 1QPBA 3FN4A 4YCBA 1QZTA 2FG5A 1BMFA 3KCQA 3EIEA 3UAVA 2QAGC 1OT5A 1J9GA 4V0SA 5JADA 3ETGA 1YU6A 2PAFA 3WKBA 3KL2A 3K9HA 4WHMA 2ZQ5A 2OV8A 1KO4A 3IJPA 4D9MA 2FJ0A 2WM2A 3IQFA 2V4MA 4HAXA 1R8SA 4IZOA 4BTVA 4EF5A 1P33A 2X1VA 1N2CA 4QRIA 3ZI7A 5DGTA 3TPCA 1O89A 1KKUA 2R6CA 4EG3A 1XX6A 3DDUA 2JASA 2VF7A 4HG2A 4P82A 1K7XB 3L07A 4J49A 1H1DA 5COQA 5D84A 3NJ8A 3CURA 5HGJA 5TDHA 1FYWA 3QIAA 1GY8A 3PI7A 5FLXA 1F6BA 2BKXA 1OWNA 1GT91 4J6FA 2VHVA 5K01A 4ISBA 4E30A 1F7VA 1TVKA 2J1LA 2RK4A 1W49A 2RHOA 1I5OA 2HIHA 3RFVA 1FDTA 3KTFA 4UCXA 4ZYYA 2JVKA 4W9NC 4BMZA 1VJTA 2P7IA 3LKDA 4OU4A 3CLKA 4UD6A 2DQYA 4IMJB 3MMNA 2G80A 5FRDA 2AOUB 5IBCA 2OSVA 3JARB 4XQ0A 2Z2KA 2FSPA 2GJ4A 1K75A 2AMYA 1S2IA 1V8OA 4PTZA 4EYEA 4L4RA 1U0OC 3VHRA 4NBRA 4JLPA 1O95A 1U8FO 4F9TA 2MSDB 3NBQA 4K2HA 1E4VA 4U4AA 1N8TA 2YYYA 2AOXA 4UJ3A 3BK2A 3UV7A 1XCBA 2RGDA 1FLVA 1GTJ1 2R86A 2WWWA 1ZSYA 3ORHA 3RABA 3BD7A 3PZBA 1IEXA 2QTGA 2H5JA 5HP4A 1M2EA 3UCFA 1S4QA 1SUPA 2AFRA 1DCFA 1KHTA 3O90A 2B4AA 1Q1BA 1L7RA 4D0NA 1GAXA 3H9QA 3KJQA 2YC4C 3NHPA 3QV1A 4GOXA 4KKXB 1N3LA 1JR4A 3ABRB 3DHYA 2P4HX 3H9UA 5E9JA 2PT6A 3U7IA 1SUWA 3DLBA 1A72A 4WESB 4EHDA 2I67A 3EOBI 3M6AA 3ZZTA 4S1VA 3R8FA 1ENZA 2XYRA 3F78A 4LFCB 4CKCB 4C0HA 1EQUA 4LA4A 3Q8KA 1XAGA 3U17A 4LG1A 3VR6H 1TJPB 3LCMA 1JT9A 1CUIA 1P3Y1 1WL8A 1F6WA 2VWHA 1YK0A 4OJTA 1M2FA 2Y6UA 2D7CA 4JL5A 3TNYA 3NT2A 1QCDA 1N6HA 2G1KA 2OO7A 3FFTA 1OLSA 4HYYA 1GZ5A 3L0PA 1KO7A 1GG5A 4BNLA 1O94D 4X8MA 4BTEA 2CMFA 1FNCA 3AJ9A 5FR1A 2HN9A 4RAQA 2J6BA 3BF7A 4MLZA 4LWZA 1PT7A 1S8FA 1X7WB 2ZUUA 4C7JA 1AKNA 2UYOA 1QC5B 1XWFA 1QE5A 2WE8A 1U0EA 2JDID 2XNKA 1CJUC 3EPRA 4RMGA 4Z9BA 4BFVA 1Y9ZA 2VF2A 3BA6A 3ZCUA 1N5OX 3SHFA 4D8WA 3EXHC 3DQZA 3K0FA 4P0PB 3V7NA 3L8ZA 3A9SA 4B3JA 2QS9A 3RD5A 3N6VA 3RS4A 1LC0A 2VHQA 4MV1A 2FEWB 4K1LA 3ESZA 4YH1A 1LPAB 4UUAA 5TX7A 5HPYB 1IG3A 5BSTA 4CT0A 3NVKI 3W1EA 5HOEA 4PXYA 1FQOA 1IZZA 2OORC 5CFZA 5JS7A 5DJ5A 1LPPA 1P0MA 2ZCUA 1MOPA 4AMGA 3CNNA 2FCAA 3EY4A 3R74A 3OPXA 2QVCA 3PGVA 1WUKS 3ED1A 3UBMA 1YDWA 5BR8B 4FT2A 2D62A 2J30A 4FGSA 4HI0E 1P7PA 1RIFA 3DAOA 3ZDAA 1GNQA 1HNNA 3MJDA 3PS9A 1JALA 4C6RA 2AEEA 2O7NA 3MJEA 5A6VA 2C82A 1I3MA 1XTJA 3KQHA 4Z4FA 3RASA 2Z09A 1G9TA 1L5GB 2BEWB 4RXMA 1N2ZA 4RXUA 3HL0A 4CF4A 5L7WA 1FFSA 7MHTA 4BRZA 2JGDA 4TSFA 2P2YA 1EDZA 4Z8XA 3QK7A 3EGDB 2JVIA 3AHJA 3TIFA 1GNPA 1FP4B 3AWDA 3PXDA 3EQ6A 4NAVA 2O3TA 4L2IB 3TL3A 3P9XA 1L4FA 1HTBA 3T7JA 3X1MA 2O5RA 4Y3UA 2F1RA 1W0CA 3OJCA 4JUIA 2BFNA 1LFAA 3PWKA 3Q15C 4KOAA 5IDVA 2OFPA 4BVFA 3ILYA 1XTKA 4FX2A 4KVAA 3EC2A 4F2DA 1Z9BA 2BL4A 2P30A 2R48A 3OFSA 1V43A 3HMKA 3PK0A 4RSHA 1Q3KA 2HF8A 2NPIA 2NVBA 4YREA 3LCUA 2PWPA 1FSSA 1JQAA 1BHSA 1T6XA 2EZ9A 1KOFA 2FMKA 2FQQA 2JEZA 3DWIA 5K03A 1YR2A 3N8GA 4JI2B 3LX8A 4NV3A 1WV0A 2C3PA 3QBVA 3GP8A 1M66A 2PKRA 2A35A 4OJMX 4E13A 1LBSA 1WD5A 4J1TC 5THQA 4EL0A 3GRVA 1Z28A 2J08A 2OCGA 2YN0A 3AEZA 4ML3A 1TAQA 3ZV3A 1U81A 3FFBA 5B58T 4CUZA 3AQIA 2QAGB 4CODB 1R6DA 5BORA 1S3GA 1RYNA 4ZCPA 3RIXA 4R2KA 3MQ4A 1ENYA 2CLFB 3OKFA 3B1VA 1JHZA 3MD9A 3PQ7A 1JG1A 3QYFA 3HWWA 1R27A 4RSGA 4A27A 1O57A 2IYVA 2GYWA 1QKJA 4FYVA 1JA9A 5KMGA 3RC8A 3W9YA 2Y05A 1GLGA 4LY0A 3R3VA 3VR6D 3IAS1 1DL5A 1HORA 3VR1A 1KGDA 3RF7A 1KAOA 1H23A 1DINA 4GOND 1K6MA 1X92A 3H1FA 1OZ0A 3K2EA 3QPUA 4IHAA 3O93A 4AK9A 4CU2A 3JWEA 3WTCA 1NQTA 4TXJA 1ZO8A 5HRCA 1C14A 5DDIP 5HIAA 2RG7A 2PBLA 3N8IA 4WBNF 1Q1NA 3ONVA 5FNZA 5LDDC 1E8MA 2P2GA 4G65A 2D1RA 4Y0NA 4MWEA 4DLAA 3DC7A 1NC1A 1PT6A 1J90A 1P0FA 4HAWA 5MDHA 1CZRA 1KJIA 5BV2P 3WGGA 4CM3A 1GSIA 4JSYA 2PUBA 4DUGA 1UJ6A 3QVTA 4RH1A 3N74A 2VJDA 1MHTA 4K2AA 2RBKA 4I36A 4FUQA 1X9HA 4E31A 2CSXA 2DFTA 4NYMQ 1FUUA 3DZCA 1L1FA 3EFBA 3H11A 2GD0A 3QMPA 3EXEB 3IPAA 4HZUB 3QBTA 3RFFA 2R8PA 3IQXA 4PC2A 5KYKA 1B00A 3RYHA 3DEKA 4QA9A 1J8DA 3NR2A 2HV8A 3ZHSA 1K7EB 1L8XA 2GARA 1YQDA 3ZWOA 3PFNA 1DKUA 4ENRA 1Y3FE 1G21A 2XIJA 4YQYA 1SHKA 4PPFA 5KOJB 2X1HA 2PANA 4GE0A 2VNJA 4ABTA 1G38A 4UNQA 2VAVA 4PNHA 5HX7A 4ZCTA 1NRXA 4ROSA 4ZVQA 3UGJA 1V71A 1QIMA 1Q6ZA 3THXB 3R6LA 2ZG6A 4ICIA 3TJRA 1YR9A 1AF4A 3PJFA 4FOSA 5DFAA 3AIOA 1N5KA 2Q6LA 3C5VA 3GZ4A 4FWBA 3G1WA 1QHHB 3M6XA 1GSHA 5JXWA 4XOIA 1PZHA 3CH7A 4H7FA 4LSWA 1SBQA 2X5KO 3JQPA 2W6CX 1EGQA 3KWLA 3O1JC 4NE9A 4JNCA 3UUFA 2G1UA 4RFSA 3V4RA 4BMOB 1WZ2A 2F43A 2W0SA 3P27A 1OI4A 4RCZA 3LLSA 1GAJA 2ZIVB 2VQDA 2HQSA 5DT9A 2AFIA 4E2WA 3JSXA 4LMAA 3WXMA 5EMKA 1SQSA 4KX5A 4NOMA 1EFVB 1ZGAA 1U04A 2P4QA 5AJVB 4M36A 2YQZA 2VSYA 3GGSA 4Q7LA 2R6GA 4R3UC 2JAPA 1E9VA 3H5IA 2AS0A 5ESRA 3T0GA 1YO6A 2B37A 1SXJD 3TOXA 3V48A 3BOSA 5AHXA 3ZHTA 4A8JC 3EZ2A 4AN4A 5AJHA 3GNSA 4CMGA 1MJ5A 4CEIA 4S12A 2IFTA 1GCGA 5LP6A 3QW4B 3ZWAA 1SKYB 3EPHA 5DNVA 3DDHA 3ETHA 1XTZA 3GGJA 5LU9A 2P2LA 5BRJA 1FNMA 1C7IA 2P4UA 2B1JA 2NTJA 4Z0HO 2OY0A 3B8EA 4DB2A 1K7FB 4M6WA 3O3NB 1PSZA 4EGJA 3UFXA 1CB7A 2OCIA 3ZN2A 3NZEA 1LVUA 5ALQA 2YXEA 5A03A 2E5WA 2V6BA 4I99A 1KMCA 1PZEA 4WKPA 1H6BA 2B20A 2CT8A 1AGNA 3I01M 4G26A 5IKOA 4C0BA 4DCOA 2WJZB 1MV8A 2WYUA 1QH8A 4P53A 2C5FA 1GNVA 1Z47A 2VUHB 2I2CA 3FCEA 1KVSA 1UWVA 2VNIA 5T8KC 4CCWA 3B5IA 1U0HC 4YAIA 4D45A 3NKFA 4BQRA 4PGFA 1QIJA 2OCKA 1TZ2A 4ZU1X 4J4HA 1CPYA 4L3VA 3WMEA 4NBWA 1CP2A 5HIMA 1A9YA 1R5JA 4AY2A 2YMQA 1DMSA 4HJXA 2ZDQA 2QTTA 1B6GA 2AKYA 2QMQA 4OQNA 1GN8A 2I03A 4P4UA 3DQPA 3RVNA 3TPZA 4GIBA 3QUAA 3BZWA 1YD7A 2I2DA 3FDZB 1VFNA 4LC0A 3GCWA 2VKTA 1V7CA 1FUIA 2ZTHA 5LCXA 3UFBA 4ZOEA 2HNKA 3Q3HA 2FW7A 4DANA 2GS9A 3SZ3A 2H5LA 4YP0A 1ORWA 4RIFA 3P0HA 4HUJA 3IR6A 5G3YA 3W2HA 4KXVA 2VT6A 1BROA 4NE7A 2J3LA 2YIJA 4H27A 5FV4A 4I1PA 1A04A 3FRIA 1FRVA 1D9XA 3FTNA 1FYEA 1NLUA 1XHLA 3F6SA 5T7BA 2AJDA 1AKEA 4CTNA 3ZJ4A 1E1YA 1YZNA 1PSDA 3Q8WA 2CJXA 1Y1TA 1OAOC 1XL1A 4H4CA 4YUXA 1Y4DE 1B8OA 5BT8A 1UM9A 2ZRCA 4QUHA 1B0UA 3N7UA 4EA6A 3O2QB 4QBIA 5HTOA 3NIWA 5FH9A 2DERA 3AJEA 4R2IA 4BZXA 2EEZA 4YA6A 2IF0A 3UF0A 1ZN2A 2HK8A 4OQMA 4PHHA 2WU0A 4RNDB 4RTOA 3I5AA 4W5NA 2I3ZA 1TF5A 4XUGB 3DBRA 3I3OA 4UKDA 5K3CA 3SZGA 3W8FA 5E3HA 1E3SA 2CNOA 3GPBA 3NOVA 2XSZA 3NUZA 3UMYA 4KR6A 4OLAA 4PR0A 3TW0A 3RKRA 2F3QA 1J49A 3EOZA 2YHBA 3UGTA 2P0AA 1DPGA 1V3VA 1O94A 3JWPA 3RUCA 3S5JA 4A1FA 4F2WA 3FAZA 3ONNA 4Q47A 1GUYA 1ZXLA 1U1DA 4I4TA 3K30A 1U3CA 1P31A 4Q05A 4UULA 1VKJA 3BIXA 2EAUA 3GF4A 1U1IA 4IHKA 2NYVA 1T3ZA 3IQGX 1GYQA 1VB3A 3TLGB 2J5QA 4XIIA 1LBIA 1X86B 2G83A 3KOMA 4BFYA 1R6TA 4MIYA 4MPRA 4TV9F 5IVKA 2RAPA 4IL5A 4H1HA 2CDAA 3D64A 1NLZA 1RFGE 2XXAA 2B1RA 2IX3A 1WQ4A 3KS9A 2NVUA 1M34B 1UPFA 1JEYB 3P9CA 2I78A 3R7AA 4R4JA 4TTAA 1PG2A 4GO1A 4JAVC 4YY3B 4HKTA 1ULSA 3UOAB 4L8FA 5E3JA 1CS4C 5JD6A 1TMOA 3HM9A 4GI3A 4R31A 1S3IA 2A88A 2B92A 3CUSA 1IY0A 3IO3A 2IYPA 3MTQA 4OHBA 2IRWA 5ER9A 3GZNA 4FXOA 4ALLA 5IRCD 2ICAA 2X9VA 2C3UA 1TFRA 2Z83A 3HEMA 3ZV7A 3HR8A 2MSLA 1SKMA 2A0XA 2GAAA 3CZ5A 2FWNA 1LV7A 1Y1LA 3HKDB 3TIXB 1N8NA 1O87A 2GXUA 3K0CA 4OXRA 1R0KA 2C8KA 1G42A 1LFDB 1NDHA 4DIUA 3M1IA 4XRGA 4BO3A 4EB6B 4IUBS 2E49A 1ID1A 4V1CA 3OIUA 5AK0A 1T9DA 4RKRA 5EJAA 2QG4A 4AZ3A 1E1QD 3GY0A 2FFAA 1XMQB 3UK2A 1C7ZA 1IG0A 3H0EA 5DRTA 4B87A 5IDWA 4QM6A 1TJ4A 3EIFA 4JHLA 1YR8A 3LKBA 3PRHA 4ZAFA 3EEQA 2I6GA 3BDIA 3CA8A 3R7BA 3VKFA 4A5SA 5IH7A 2HSDA 1YB6A 4LGYA 2GNOA 3TEJA 2I71A 3DMTC 5ITZB 1A8IA 1U0RA 5GM1A 4P3NA 4ZZIA 1EFLA 2ZKIA 3M9WA 5EC8A 3ZZUA 1W5AA 3K6RA 2ZIWB 1M1ZA 4BFTA 5KOHB 3QPAA 3MCUA 1C7QA 1K97A 3RUAA 1E2HA 2ZIEA 4P3OA 2WSSD 1U9IC 2C2GA 3DXXA 3JYOA 3K5PA 1N5LA 4KYIB 3SBDA 4WK6A 1NVKA 1KBQA 1UBTS 3HUDA 3U9LA 3DFFA 4RMJA 4RPIA 4CCAA 3GRYA 1ZH8A 1JTVA 2UZ1A 1RQ7A 2WM8A 4BC1A 3I9KA 2X8JA 4J7UA 2RBEA 5EJ4A 2FI1A 1L7OA 3FR8A 4FKZA 3LFTA 5CB6A 1OXTA 3NHKA 2GK6A 4QUBA 5EJ7A 3BJEA 2E89A 2VWQA 2SKEA 7AT1A 4HDMA 2Q5EA 2UYYA 5D85A 5KAMA 3MOGA 5HQ3B 1IXRC 2CN1A 3ZW7A 5FI5A 3GEEA 1JKFA 1WB4A 1ZGBA 3TH5A 5HA5A 5I01A 5IUJC 3OFKA 4L4SA 4RJLA 5K7SA 4GZLA 2YDXA 2QUHA 2YWXA 4NMXB 4TYWA 4H16A 3VR6A 1XMSA 1GZHB 1PR9A 1RACA 3MA0A 1PRYA 4I08A 1JHXA 2V97A 1VLHA 3JQEA 4M3NA 5CB4F 1ZXXA 3BUSA 3TDMA 5E6RB 5CCDA 5HG0A 2XV1A 4MKGA 5JAIA 3UJ6A 1SELA 4R9VA 1XWIA 1TQHA 3TEMA 2XYPA 2AYZA 4BNMA 1F4LA 5E4FA 4KK4A 5TQ2B 1BA3A 2O7VA 4E70A 1JXAA 4RK6A 1I3LA 3BEDA 5TPWB 1L7BA 1W96A 3TSCA 4P0TA 4DT1B 3I04A 3T61A 5K3FA 1N78A 4ZVMA 1O0CA 3IDOA 1YQWA 2V7XA 1B41A 2H4ZA 2OZLA 4LI0A 4LZLA 4DTIA 2FUCA 4XSVA 1XEFA 4LOLA 4F92B 1K89A 4G4GA 2GPNA 3R3UA 3JD1A 4Q4JA 2YVQA 5AVZA 1QO9A 1QYWA 1OB5A 2Y27A 4P7FA 5F76A 4BN4A 4MXDA 4F12A 4U7JA 5HE8A 4YJ3A 5CH8A 4DLVA 4WLFA 3AU8A 4OA5A 2NTVA 3EXFB 3VC7A 4FW8A 2C9YA 2GEKA 3BS4A 2RHRA 2QUKA 4EG4A 1W46A 1JHDA 4FFMA 4KXMA 2QK4A 2JEYA 1N5DA 1K66A 1WDTA 2VXYA 2BGIA 2XQIA 3VC1A 2IDZA 3KHUA 5CHYA 5MF6A 3B52X 3ISVA 4EGFA 1JRLA 1K8RA 2PBRA 4PLFA 4RD3A 4WGFA 4UZEA 3L84A 2O5EA 4FFNA 5AXAA 2X6TA 3G2OA 1CKEA 2AX4A 3L7LA 1H9CA 1QX3A 4Q39A 1EEHA 2P6RA 2QNIA 4XX0B 4PEVA 3I6MA 3ZI4A 4C43A 1FFYA 1JIQA 3LUJA 3B3GA 5LYJF 1B93A 3MJ4A 2ERCA 2RGRA 1SIWA 3CUUA 16PKA 3OJLA 1YBFA 1BWRA 5A3QA 5GGYA 1HF3A 1TO6A 1T5HX 4RH3A 3EXG1 1AE1A 1ICIA 1RM0A 2MR6A 5ALSA 3ICOA 1JILA 1XZAA 3W77A 2BJHA 4YP9A 3QQ5A 5T4BA 4EB3A 2D0OB 3PHLA 4XLZA 1LBTA 1SXJA 1T0BA 1XTUA 1TF7A 3WP0A 1TTPB 3T4PA 1UBFA 2O07A 4QPPA 5IWAB 1KJ8A 1P2FA 1KH3A 4OSOA 5CXUA 4IIDA 2RHWA 2OXFA 5EYPA 2CL7X 5CU7A 3ADPA 3NP7A 1X94A 1BE1A 3FPJA 3OOJA 1SQFA 5ALHA 5DSTA 2V7GA 4YB8A 1VBMA 1G59A 1FYXA 2P8JA 4G0ZA 1EPUA 1MABA 4UVHA 5G0VA 3BSWA 3O4FA 4PBSA 5FL7D 4GSLA 3PXUA 3NIFB 1JKXA 3EIUA 3OZBA 1XZIA 3AI1A 4J7CA 1CVLA 4MCIA 1G6KA 4WBXC 1O0SA 4DOMA 3HP1A 1RYHA 2FSUA 3N0WA 3UWKA 4X95A 4EYQA 2AR0A 2V5UA 3IKMB 1OASA 2NLOA 3E2IA 2AFHA 4I9HA 5C3MA 5IVIA 2JHFA 3R6TA 3KTAB 5B5SA 1P9WA 3A58B 4P92A 3GBVA 1UOEA 5SICE 3DDNA 5IJ9A 2K87A 2ZUBA 1UH5A 3LQRA 3PITA 3IR7A 4WOKA 3JD4A 5JSQA 5F3DA 3IRUA 2CXPA 3TCNA 2H18A 4DIOA 2QX4A 3PU6A 1DX9A 2FGKA 2ZAIA 2ZAYA 1JAYA 3GRUA 2FEXA 1SK8A 5BR7A 4YT8A 3K92A 1INLA 1MC4A 4RY8A 4ALMA 3TZCA 2EX0A 1JDVA 1I1QB 1E1LA 3OZUA 2WZDA 4AN1A 1P5FA 1FVHA 3AR8A 3JRNA 4I19A 4QARA 4PFJA 4MQEA 5TV2A 2E87A 3NHWA 2VT2A 4FFWA 4YRIA 7REQA 4LOJA 1N3IA 3E4CA 1SFRA 2AVDA 2VI5A 3HV2A 4HQ6A 5A4KA 2FA9A 1T5LA 1AN0A 2ZT6A 1D2HA 2R1UA 1IJFA 1O54A 3BRCA 3LPMA 3PQ6A 2VP2A 6REQA 2HBYA 4W5RA 1B7GO 4C4OA 2Q9UA 3AYZB 4IBOA 4B3XA 4FSXA 2D7JA 4BMXA 3LNCA 4L4YA 3T12A 3TKYA 4ZIRB 5FWYA 3ENWA 4HS4A 3PT9A 3RVKA 3WNCA 3K9LA 3PIIA 1WW3A 1DEXA 1RYZA 1TZKA 3E5RA 3IOYA 3PHHA 4ID3A 3L8YA 4MRVA 3LWZA 3EZ9A 3LT5A 4KFTA 5DEOA 4CM4B 4D4IA 1KS9A 1V8DA 3KOYA 5A9TA 3VOAA 5LXTF 4O2AB 1G7SA 2HWYA 3KR9A 3QJYA 3VYRB 4BNTA 4H7PA 2KE5A 1SCDA 4PGGA 4OH1A 4UFPA 4U39A 1SUDA 2HCTA 2LIVA 2HMYB 3WMGA 4CHGA 4BV2A 1DHRA 3T06B 4W5QA 1GU7A 1H93A 5EZYA 1YONA 2JI8A 1L1QA 2R2AA 5H3HA 4BU0A 2CMHA 2WINI 3UXHA 4G5SA 4H1TA 5C3UA 2V65A 4UHHA 4MGIR 1SURA 1G8GA 1QV6A 4HQRA 2E4XA 2C8VA 4N5MA 3A6HA 1IMJA 3GYGA 3PE6A 2NYAA 1XZJA 4JVMA 5REQB 1YQ9A 1BJTA 4ZAXA 2OO5A 3V1UA 4TLAA 5AUOB 2OG1A 5DXAA 1Z33A 4MWDA 4E4TA 4E5KA 5MN6A 2HBQA 1LS6A 1YS6A 3VDQA 4BO2A 4OHRA 3MCWA 3B89A 4WK4B 5D3ZA 2I6XA 3AF5A 3BL8A 1CE8A 4DV3B 4GWLA 1HK7A 2DF8A 1A8HA 4KAJA 2OV4A 1ZYUA 1T5DX 1V9SA 1O58A 1YSCA 1T6NA 4TL7A 2IYWA 1IULA 5FFNA 4MS4B 3TI7A 1BJKA 1QM5A 3H1AA 4LKOA 1QG0A 2XUHA 3FJYA 5FFFA 1FFHA 2F7SA 1WVGA 1HDZA 2W98A 3NWEA 2R6HA 2ID7A 2CXHA 3IE0A 5CG1A 4MUYA 4KGDA 2XCSB 2OO3A 3AUYA 3EDYA 3JW8A 4BQIA 3MJCA 4CLOA 2Z2YA 4JUCA 4M38A 1G19A 5K8IA 1DX4A 3HKCB 1CS0A 1E3QA 4B3HA 4YMVA 3MTDA 4II7A 3ZWWA 3RFUA 3U7GA 1H2BA 4JBYA 3U0BA 5GVRA 3IIKA 4B9AA 5HM8A 3EY9A 3CIOA 3IKLA 3G0GA 4GKKB 1USGA 4UM7A 3OWHA 3BTUA 1OYYA 3OX4A 4HVCA 1E2BA 5CGQB 2QL7A 5EWMB 3PXGA 3CN9A 5CT4A 5K8CA 5LNK6 1PK7A 2G70A 1W0JA 4JCCA 4KUEA 1NZFA 4NKRA 4FFBB 2I54A 3D5QA 5HQTA 1RYFA 1K3TA 1DT5A 1CFZA 1ND6A 4HK4A 2CXQA 4JC5A 5ADVA 1FDIA 1SXIA 2OZKA 5EFOA 4O4JA 4RZUA 3NWJA 5ED0A 4DV7B 1J20A 2O7QA 3SU8A 4FB5A 4X0EA 3RREA 3CTMA 3AOEC 3B6IA 2D06A 3BGVA 3BMQA 4J9UE 1O5TA 3P52A 2H2DA 4RMNA 9LDTA 1DV1A 2W2QA 1MOQA 4NYIR 1GUBA 3N87A 2ZJZA 3STYA 1W93A 2G4CA 4RQAA 3I5UA 4YYEA 2QORA 2ZI7A 3OF2A 4ZO4A 5EA2A 4ZD6A 4E3ZA 1MNAA 5I7SA 5KQPA 4YGXB 3ESAA 2R8EA 3LX6A 3ZY3A 3G5TA 3OY2A 4RM3A 4WN3A 5AVSA 1XMOB 2VH2A 3GN2A 4E14A 2ST1A 2WM3A 4LVOA 1Y7HA 4ZVSA 1UBUS 1X7XB 2O8DB 2WUWE 1Z4QA 4TX1A 4EK9A 3C3YA 2H1SA 3PD7A 3K4PA 5H59A 3VR5D 1IQRA 4R40A 3WNDA 4XFJA 2KW5A 2DKFA 4Q7KA 1C0LA 2A5LA 1ZJ5A 2E4UA 2Q2NA 3CSUA 3DOCA 3FDFA 1RW4A 4RPLA 1MZPA 1P0CA 1W5BA 1LWNA 2FFHA 1IHYA 4AF8A 5A2QA 4C0XA 3HVJA 1GQYA 4BX3A 4HWSA 1EU1A 3ENZA 1Z73A 4M60A 1XPRA 3QVJA 3HVIA 1SG0A 1K06A 1H2YA 4X3PA 3TL6A 1GADO 3FYDA 2BKEA 2RHTA 4AAYA 3OTOB 4DV6B 5U4QA 1T0JB 1Z83A 4RZQA 4YRAA 5LP1A 3W5CA 2QTLA 4DNPA 3WYNA 3IFSA 3V9AA 3UTDA 4W8OA 4WVLA 5DLYA 1AV6A 2HLDA 3CY6A 3DJYA 1W5EA 4MUFA 5AP9A 3IEVA 1QVWA 4E5NA 2RSLA 3HZRA 2B3DA 3AWIA 2QZSA 4FDVA 4MRNA 3I9FA 3ZLTA 2ZUEA 4O4LF 4JJGA 4B7UA 4IDNA 3E3OA 1VHTA 3VTAA 1GNTA 1XD2A 3B82A 1ESDA 3P2EA 4QSHA 2AKAB 2XNDD 3FLBA 1U8TA 3DKKA 2ZBDA 3M9LA 4ARSA 5B6JA 3GJ5A 1NBAA 4IHJF 4BAUA 1VJ1A 4PRLA 3G8BA 5T64A 1WUYA 2NU7A 2O8VA 3DA8A 1DUVG 3VBEA 1H2HA 1U0JA 2WV7A 3T4UA 4A0RA 2JIPA 2ESRA 4LXHA 3V55A 4AUKA 5AW9A 3Q9NA 5JTUA 1BDMA 3Q0TA 1KQNA 4AX4A 1Z26A 2CLMB 4BZZA 4O2BA 2YYZA 3CT4A 1Z62A 3ORFA 2X8AA 4BFWA 2JKVA 3RKUA 5BW8A 3W4KA 3AVYA 4B3BA 2YV5A 5CMLA 2YBEA 2O8BB 4OH7A 4HWOA 2VK1A 3T9AA 4B4WA 2VSQA 3OP4A 5IKMA 1X1BA 2C99A 1M6WA 2X3UA 3SC2A 1EX9A 5TT1A 2OHJA 4RULA 1AKUA 1OPXA 3MWDB 5TEVA 3X2FA 4OL9A 3GCGA 1KAHA 2VUIB 2IBMA 3QEOA 1QU2A 1DBWA 1N4DA 5DBOA 4TL9A 3AY3A 2POQX 4O3MA 2B8TA 2L2QA 2QE7D 3A6FA 1DAEA 2FV8A 2PAAA 5KOYA 1R0SA 2J7KA 4Q7MB 5KYYB 1VPVA 3ZBTA 1XXHB 5D01A 4MPPA 1GNRA 4OGKA 3TQHA 4D1YA 5BPHA 3P0RA 1UK9A 4G86A 4AZTA 1U3DA 2Q4DA 4PR3A 4AS2A 3IKTA 4DZRA 2F3TA 4P86A 4KR7A 5BN3A 2CK3D 1PZNA 3C70A 4YCJA 2F90A 2F8SA 4DTCA 4ENVA 4IGKA 1Y6QA 2R7KA 4JLVA 1GCOA 1DQYA 1K1EA 2GERA 5F7XA 1XNGA 2ZK7A 3ZU2A 1K6JA 3GLIE 1OWPA 4XM1A 3FFAA 3WY9A 4A8PA 4B6SA 3PP8A 1C7EA 2GRAA 1YZKA 4V0KA 5H1YA 3ROZA 2CWWA 3CXRA 1SXHA 1CF9A 4KE6A 1KKMA 4Y98A 4HT3B 3TZKA 3W4IA 4P5EA 3D2AA 4F2HA 2WIAA 2VZLA 1RP7A 4TQ9A 3UT0A 4PIVA 4OQEA 1IPEA 1UBJS 2P91A 4JQZA 4NBLA 5CITA 1P9RA 1WJGA 1HDIA 1SMKA 2EGUA 2MTBA 5KTOA 1YRBA 2VDRB 1OA0A 1ZFNA 3OOYA 2PL9A 4TV8A 5L3SB 2R79A 2QUAA 2QE6A 3U4IA 3IAEA 1U7HA 4X60A 5DCWA 5FNVB 4AJKA 5FL7A 1ORIA 3RVRA 4CEHB 1E5LA 3DMYA 1A27A 4Q3EA 5LLTA 1WBDA 4M0MA 4V0ME 3EWNA 5BWLA 3GGCA 3WB1A 1IUNA 5BWMA 4Q4AB 5L7TA 4MA4A 1JS1X 3DCJA 1OMOA 4BO0A 4IYJA 2V45A 4WY2A 5EE5B 3CUEF 1WVMA 3SNHA 1S89A 2M1ZA 1CZNA 4I1UA 3IOBA 1HSZA 3LWDA 3F6YA 1YASA 3M4YA 1RZRD 4TZ6A 3EA4A 4W7SA 4UAGA 2NQ8A 3H16A 2PCLA 3OLWA 3V33A 4TXMA 1D4OA 3BB3A 2AJTA 4J4TA 5LOVB 4JEIA 5KJCA 1NJSA 3BXFA 4F72A 1YE8A 3K1ZA 5KJ1A 2W2KB 1NULA 2FETA 4Y6PA 3M6IA 1B6RA 2R85A 2GNPA 2QAIA 3DCIA 4RY2A 4O59O 3A9WA 4I1RA 4JQYA 3SXUA 5C8YA 3TW6A 4NU8X 1VB5A 2ZZNA 3ONFA 4INAA 1SZDA 3L49A 2XDAA 4Q1FA 3HKEA 3AEXA 2HO5A 3WDMA 3FGOA 3MAGA 2VQSA 3KDPA 5I3CA 1L4BA 4M1WA 2BFFA 1K27A 3FRHA 1Q44A 4HN4B 2FN9A 1H4TA 1XQVA 5THKA 4KBGA 4XX1A 2DPMA 4F3RA 3PQDA 5IAAA 3AP2A 2EFDB 1EH5A 2K4MA 3H75A 1FMTA 2ZIZA 2L17A 3PDHA 1A8SA 3H2KA 2RAVA 3O75A 2PQ2A 3JD2A 5A71A 5C81A 3IVGA 3FWPA 3CV3A 4E5VA 4IJWA 1WCYA 1JA1A 1G63A 1NF2A 4ZA2A 1WRBA 5A4IS 1L7AA 3UMBA 3BPSA 4LXQA 1PK8A 3ENNA 4CKBA 2OECA 3GUYA 1SVMA 3ZZ1A 5ECYA 3LY5A 5CVUA 3RC7A 4GDFA 1LEHA 4HGOA 3GZJA 4PO9A 3OE5A 5BN5A 2RKWA 3Q8LA 1ZC4A 3O0DA 1ISPA 5JSHA