4KYVA

Crystal structure of dehalogenase halotag2 with halts at the resolution 1.8a. northeast structural genomics consortium (nesg) target or150
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
303
structure length
297
Chain Sequence
b'HHHHHEIGTGFPFDPHYVEVLGERMHYVDVGPRDGTPVLFLHGNPTSSYLWRNIIPHVAPSHRCIAPDLIGMGKSDKPDLDYFFDDHVRYLDAFIEALGLEEVVLVIHDWGSALGFHWAKRNPERVKGIACMEFIRPIPTWDEWPEFARETFQAFRTADVGRELIIDQNAFIEGALPMGVVRPLTEVEDHYREPFLKPVDREPLWRLPNELPIAGEPANIVALVEAYMNWLHQSPVPKLLFWGTPGVLIPPAEAARLAESLPNCKTVDIGPGLFLLQEDNPDLIGSEIARWLPGLAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords dehalogenase HaloTag2
molecule tags De novo protein
source organism Synthetic construct
publication title Northeast Structural Genomics Consortium Target OR150
rcsb
total genus 91
structure length 297
sequence length 303
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-05-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4kyvA00
5CW2A 1N1MA 1F0NA 1QIMA 2QXTA 4MJ3A 3ED1A 4BB0A 3AIOA 2B9VA 4N8DA 3PI6A 4L3WA 5K3BA 5HKAA 4H7FA 4UBMA 1E66A 3SX4A 4J0GA 4C88A 1Y7IA 4IH1A 3GUUA 2V96A 3HRHA 4AN0A 3D2AA 4UHHA 2VJAA 3FYUB 2JEYA 2XLCA 2VAXA 4W1RA 1H2WA 1J1IA 3WWEA 2WHPB 2OGZA 3QYJA 5C8XA 4GI1A 4M0EA 4PSDA 5FV4A 2HFKA 1QFMA 1T4MA 2DHCA 2J3DA 1FFAA 5JAHA 2VF2A 2HA4A 3I2JA 1QIEA 4FHZA 3WKDA 1JJFA 4FNMA 5AK5A 1Q84A 3G0BA 2IIVA 4F21A 4X92A 5CT9A 2BAGA 2D0DA 2AJDA 3STXA 3IB3A 3DNMA 1LPBB 3V1KA 3B3QA 3U1TA 4F0JA 4B80A 3VXKA 3PDCA 2OQVA 4PW0A 3C8DA 5HF8A 4ZV9A 3H2JA 1UOPA 2OXEA 1XZHA 4EB0A 1P0MA 2WHRA 4W63A 2QJWA 4OSEA 3MUOA 4OB6A 3OOSA 3FLEA 4OYLA 4J0CA 4OU5A 1O6FA 2HHAA 2HM7A 3O4IA 2HA7A 4C4ZA 1R3DA 1DWPA 4HRYA 3ZV7A 1D07A 1QIHA 1QZ3A 2XUQA 1MPXA 4OU4A 1T2NA 5A7GA 5AM4A 4X85A 2WIJA 1CPYA 5ALZA 1XZFA 1QIIA 3AUKA 1A8SA 3KD2A 4J0IA 5D7BA 2OCGA 3DQZA 3IA2A 1LBTA 1Q83A 1I6WA 1VA4A 2WU4A 4RE5A 5SYNA 1WB5A 3M83A 4MWTA 2QS9A 1JU4A 3FOBA 5AM1A 1ZGBA 5E4JA 5ALLA 5K3AA 2QT9A 1XZEA 4GECA 5K5EA 5DJ5A 3AZOA 3L1IA 5BWBA 2D5LA 1ZJ4A 3DYVA 4LXIA 1HPLA 1E3QA 1BCSA 1YAHA 2X76A 2ZSIA 3ESDA 3BDVA 1HLGA 4Q3OA 3I2KA 4RE6A 5CTAA 3S2ZA 5JADA 3FSGD 3TGLA 4BCBA 4DLNA 3G0CA 4BCCA 4HXFB 1E5TA 1G66A 2XUOA 4M0MA 4Y7DA 3T52A 5JANA 1KU0A 5A2GA 3WK5A 1LPOA 1JI3A 3IUNA 5FKJA 2WIKA 3WIBA 4H77A 2OLEA 3D4LA 5K3FB 1MJ5A 4CCYA 2V97A 5ALOA 3WWOA 2QXUA 3I1IA 5AK6A 4ARAA 3JYHA 1PFQA 2WIFA 3F9CA 1U65A 1EB8A 1QE3A 5D6OA 5C81A 4JH0A 2PU5A 1TAHA 4CG2A 2AJ8A 3GZJA 1LPMA 4IO0A 5E4YA 2JEZA 5EI5A 4HAIA 4I19A 2JGJA 4BC0A 2QTBA 3OG9A 1QTIA 1WB6A 4CI9A 5JARA 3OM8A 4M0FA 5AIBA 4A5SA 4TPKA 5AKYA 3DYIA 3VVLA 4X90A 3NOXA 4BYMA 4X6XA 1CRLA 2EEPA 2XUJA 4AZ0A 4PQEA 1CLEA 2P8SA 3CCBA 4E15A 3BE8A 2H9YA 1R9MA 2CBGA 1JJIA 4A23A 1W76A 5LZ4A 4UBOA 4X7BA 2PSEA 2RONA 4J3JA 3WKCA 1MU0A 4QLAA 3KOOA 4G4JA 4B0PA 4DM7A 4H18A 4UHFA 3W9UA 2PPLA 1R4ZA 2HU7A 3JWEA 5LZ8A 2ZYRA 2VJCA 3ZI7A 3E4DA 2XQJA 1XZJA 1CUAA 4PO3X 3IUMA 1UOQA 5E2IA 5EIEA 3C45A 5ALEA 3PFCA 4UFNA 1AKNA 1ETHA 4KE9A 4H0CA 1TIBA 4U2GA 1FSSA 2G5PA 5AKLA 3EIOA 4C4XA 4DSZA 2XUGA 4CIAA 4UBLA 5CT6A 2Y2VA 4LYDA 1E8MA 2HA6A 1IZ7A 3V1MA 1EDBA 1J2EA 4AN1A 4Y2PA 3N0TA 4OB7A 4QDXA 4BTLA 2GYVA 4RGYA 5DNUA 4MYDA 5SYMA 2ZSHA 2OGSA 3PUIA 5ALYA 5LKAA 2XE4A 2QR5A 2I3ZA 1P0QA 5K3FA 5T4EA 5JD4A 1THGA 3VJKA 3AJAA 3WLAA 4JUIA 5FPPA 4N8SA 4QWWA 1HDEA 4FLMA 2OG1A 4ETWA 3W05A 5AOBA 1QO9A 2XUPA 3BF8A 4BTVA 4G8DA 1CUYA 2WJ6A 4MQMA 5CH3A 3A2NA 1Q0ZA 2XB6A 4Q34A 3WIOA 5JAOA 3F96A 2WFZA 3KWJA 4KAJA 3QM1A 3KXPA 4C87A 4NVRA 5JAPA 3H18A 1MTZA 1DT5A 4EBBA 1W1IA 5LZ7A 5CT8A 2JIDA 2DQZA 1H2ZA 1MAHA 3WZMA 1A7UA 3ESBA 5JIBA 1GT6A 1ODTC 5HF6A 2CMFA 2DCMA 2O7RA 5K3DA 2XQIA 4Q3LA 3STYA 2EDCA 5ALUA 1XZBA 4Z49A 4V2IA 1ZI9A 1VXRA 2IX9A 3C5VA 4DNPA 1DQZA 1W4LA 2XMRA 5AKJA 1EVQA 2XT0A 3M81A 5AKKA 2CB9A 1EK2A 4D9JA 3MGAA 1MX5A 3W2TA 5H3HA 5AO9A 2GZRA 4GLBA 2G5TA 1AUOA 1QO7A 3C87A 4I4CA 5LKRA 5CH8A 1M33A 2PKYX 1QIJA 2ZYHA 5AKGA 2XDWA 2BUCA 1UK8A 3O9VA 3GROA 1MNQA 4PSCA 4AB1A 1XZKA 1GPKA 2QJRA 5BOVA 3LIIA 3R3UA 1XQWA 2HRRA 2GBFA 3IUQA 3WK9A 4OUKX 4E11A 1FFEA 5T4HA 4G5XA 3G9XA 5JD6A 3VISA 3YASA 1UZAA 4KACA 3DOIA 1GQSA 4X93A 2JGMA 4G9EA 4L72A 5C7YA 2WHQA 3K6KA 3UUFA 3I2FA 3V1LA 4X6YA 5CT5A 3RARA 1BS9A 1CQWA 1QIKA 2PX6A 4XIIA 1K6EA 1NU6A 5FXMA 1EB9A 2VA9A 3R3WA 3BIWA 3R3VA 2O2IA 3QVMA 4JEIA 3RLIA 2JGFA 4H7EA 1ZJ5A 5ALQA 4H7JA 3D2CA 5JAUA 4BC1A 4H7DA 4Y2SA 3OPMA 5A6VA 5ISMA 3WA6A 3B5EA 1CUJA 1SOMA 5JZBA 3NWOA 1UT6A 3CN9A 2XMGA 1CUWA 3I2IA 2BKLA 4Y2UA 5CT4A 5LLSA 2ACKA 1FFCA 3G02A 4ZXFA 5LZ9A 4P08A 3DLTA 3EF3A 2GBGA 4L0CA 2C0QA 1XQYA 1A88A 2DFPA 1CUCA 3I2GA 1HQDA 3C8HA 2PSJA 1XROA 3HZOA 4EY7A 2XMCA 3TJMA 3FAKA 2XMSA 2YASA 3MUNA 1CUDA 2XI4A 1UWCA 2VTVA 3FBWA 2ZJ6A 1OXMA 1ZI6A 1QIFA 3P2MA 5JALA 2B61A 2JGEA 5BV7A 3ZWQA 4HXGA 5FUMA 1QTRA 3DEAA 4EHBA 3ESAA 3AIMA 3WKAA 2QUBA 5ALJA 3DD5A 2HA5A 1DTEA 1FFDA 4UPDA 1K5PA 3STTA 4QDZA 5ALFA 2C0PA 1J06A 2C58A 3FLBA 4AO6A 1JMKC 3DDUA 1PJAA 1AX9A 4HRXA 5ALDA 5IVIA 5AIAA 3STUA 3F98A 3IULA 4B6GA 4Q1VA 4ROTA 3HLKA 4K6GA 3BL8A 3HXKA 1UK7A 1EXWA 1OCEA 3SK0A 4CFSA 2Q0XA 1HBJA 1Z68A 1TCBA 1J07A 1XQVA 4B82A 4YK7A 5ALXA 1XZGA 5DNWA 3FLAA 4C6HA 1LPAB 3PF8A 1AQLA 3R3XA 4EA6A 4X91A 5F4ZA 1UKCA 2JGKA 4DSAA 5AI9A 5YASA 4QLOA 2XQKA 3WKEA 1C4XA 1PV1A 4NS4A 3BXPA 3QMVA 4KE7A 4UBKA 3EQ9A 4ZV7A 2XUAA 5I9IA 1ORWA 3H19A 3IUJA 4IH9A 4BAUA 1F6WA 3ANTA 1YS2X 4Q3KA 1UKBA 4B81A 1H2XA 2Z3ZA 4AMZA 5A7FA 5AJHA 2PL5A 3I6YA 3WZLA 1Q0RA 5J3JA 1EX9A 2WUGA 3VVMA 2W22A 3A2LA 3I1YA 3A6ZA 3PICA 1WM1A 1YASA 1EI9A 5AK3A 5EHXA 1CFJA 4AO8A 2WUDA 1BEEA 4UUQA 2VATA 5CXXA 3C43A 3H04A 4FTWA 4J03A 4LYEA 3A70A 2GBIA 3HSSA 1UK6A 2WHPA 3VJLA 4MWSA 1XLUA 2PBLA 4ZGBA 5IVKA 1BRTA 4QDUA 4CG3A 4NZZA 1VXOA 2WKWA 2CUTA 3IDAA 5AM2A 1TCAA 3PUHA 3G0IA 3O9MA 4B84A 3WL6A 4B85A 4FFWA 4P93A 5D3KA 1TKRA 1IUOA 4AMYA 5CXUA 1WB4A 3LCRA 3QITA 1U4NA 4FBMA 1CEXA 3IVMA 4Q05A 2WIGA 5LIPA 3DKRA 4QNNA 5A71A 3WK8A 3O4JA 4FFVA 4BP9A 4PV7A 2G63A 5CURA 1EHYA 3V48A 4Y2QA 1MAAA 5AH0A 1R9NA 2X5XA 5A62A 3I2HA 3SWWA 1SCIA 3F67A 4JNCA 1VE7A 2OQIA 2RHWA 4EZIA 2ROQA 1S8OA 4DMFA 4DMHA 2XLBA 2QM0A 3TRDA 3O95A 2O7VA 3ZPXA 5EIHA 5HFAA 1CUHA 1AURA 2Z3WA 2DR0A 5C8ZA 3AZQA 1YA4A 1DU4A 2HADA 1U2EA 3C6BA 3ZLTA 3Q0TA 4BZZA 5HQ3A 3ICVA 1ZGCA 5AOCA 4BE9A 1XZDA 1BCRA 4LXHA 2CJPA 1CUGA 2WU3A 4W9RA 1XKLA 6YASA 2AJLI 2H7YA 2BGRA 1WPXA 5HFNA 4JYPA 2WSLA 5CRIA 5FDFA 3BWXA 3D59A 5AKEA 4FKBA 1AZWA 4FDMA 3VJMA 5ALKA 1JT2A 7YASA 4KAAA 1G4HA 1MNAA 4XWGA 1XKTA 4YX9A 2C7BA 1XLVA 5AI8A 5AKIA 5ALRA 4X71A 2OCIA 4ZRDA 3ILSA 1ZD2P 1AMNA 1ZI8A 2ZVDA 4BDSA 3G0GA 1WPRA 1ZOIA 3W06A 4H7IA 2WUEA 3DOHA 1QGED 5HF5A 4Y2TA 2H7XA 5HCUA 4GXNA 4OPMA 3AILA 4H35A 2WG0A 3WK6A 1XRNA 4OD0A 4WFKA 5AM0A 2ZYSA 1IVYA 4K6HA 3FYUA 1EA5A 1CIJA 1XZAA 3G7NA 3GFFA 1QONA 2QRUA 2JGLA 2VT6A 2OAGA 3W9BA 4WDQA 5FOQA 3JW8A 3E3AA 2HA3A 5ALNA 4HTAA 3RKSA 3KWFA 3OTQA 2XMBA 4G1FA 1GXSA 2NW6A 2G4LA 4DTCA 4K6KA 3QPAA 3I6MA 3GELA 4ZREA 3WWPA 1VLQA 3R0VA 3KSRA 1L7RA 1VJ5A 2WJ4A 1DQYA 1ZIYA 1VKHA 4XJVA 2V98A 1QJ4A 1KEZA 3G9UA 5KREA 3I6ZA 3E1GA 4WFJA 5KWIA 2AJCA 2HU5A 4KRXA 5E4TA 3STWA 5DTJA 3C70A 3GA7A 5BWCA 3D5EA 4J0DA 5JYCA 3KDAA 4MQLA 4NMWA 1VZ3A 3BJMA 3K2IA 3ANSA 1HKHA 3D3NA 5CMLA 5KBYA 1DINA 4MEBA 1DWQA 4X00A 1GPNA 1ORVA 4XX1A 1A8UA 4P92A 2HRQA 4DYHA 1YR2A 3EQ7A 4Y2VA 4Y2YA 2XUKA 2XMDA 4INZA 2Z8XA 4AQDA 5ESRA 5JATA 5AICA 2OAEA 2JGIA 3WJ2A 3V9AA 1ISPA 4GDMA 4BAZA 4EY8A 4OB8A 2VJDA 1SFRA 4UBJA 2XUDA 1E8DA 3WYDA 1B41A 1L7QA 5JD5A 1MT3A 5FP0A 1AGYA 3AFIA 4B7ZA 1BROA 1LPSA 5FPQA 1VA5A 3RK4A 1WOMA 3LLCA 3ESCA 4IQ4A 1SCKA 3DKKA 4UHEA 3N2ZB 2WM2A 3HJUA 3WL7A 5IVDA 3W04A 3I28A 1MX9A 5LZ2A 4HS9A 3R41A 5ALWA 1XZIA 2YH2A 3CCCA 5IKXA 5I8PA 3LIPA 5FRDA 1N5MA 2CEKA 4RNCA 2C5GA 5JZSA 1UKAA 2WQZA 5ALPA 3FYTA 4P9NA 5AKXA 3H2KA 5HZGA 3IIIA 3ICWA 3C5WP 3H0CA 2QKYA 4PF1A 1EDDA 4HZGA 1R1DA 1VZ2A 4BAGA 5JASA 1GKKA 2OCKA 4GBGA 1EH5A 1X2BA 1JFRA 1VE6A 3S8YA 5DWDA 3IURA 4Y2XA 3QBJA 4KJXA 5ALMA 1EK1A 1RYYA 1EDEA 4W1SA 2FUKA 3V1NA 2R11A 1SCQA 4KAFA 2RHTA 4WY5A 4FBLA 4FNGA 1QFSA 1G42A 3FCXA 1YCDA 4J0JA 4BZWA 3DJYA 3D7RA 5HQ3B 2PUJA 3OURA 1FFBA 1H23A 1MX1A 1XQXA 4UFOA 4EUSA 2V9ZA 3M3DA 2I3DA 2WTNA 2X8BA 4WJLA 1YSCA 4YPVA 1XRMA 4U2EA 4FMPA 1CUXA 1XLWA 5K3CA 1R88A 1NU8A 2EDAA 1DT3A 2FX5A 2H1IA 2E3JA 3U0VA 1ACJA 4BDTA 3DL7A 2J4CA 3FWHA 3F97A 3WYNA 1TQHA 1XRQA 4GHWA 2GYWA 4QE3A 4W1QA 3K9BA 4C89A 3AIKA 2GZSA 2QVBA 2HL6A 1H22A 5ALSA 3C6XA 4MEAA 1RP1A 4K5QA 2QUAA 3HYSA 1VOTA 2VJBA 3L1JA 4UHCA 1AC5A 1B6GA 4AO7A 4B0OA 2OPHA 4Y2RA 1DWOA 2WFMA 4QA9A 5LYYA 5K3EA 1LZLA 3DCNA 2Z8ZA 1C7IA 3X3HA 4DNFA 1L7AA 2XMQA 3H17A 1WCYA 4MXDA 3OC0A 4BVKA 4N5IX 5EHNA 3FSGA 5I7UA 3HI4A 1LLFA 4F60A 4OCZA 2PSFA 2ACEA 2AJBA 2OCLA 4N5HX 3ZLUA 1JU3A 4CCYB 1P0PA 2K2QB 3H2HA 2WUFA 4BATA 1K4YA 1UXOA 4JYMA 2I03A 3AINA 2RAUA 4DMCA 4CIBA 4PNZA 3G8YA 3WWCA 5AP9A 1BN7A 4X3CA 4O08A 2FJPA 4B9AA 1WHSA 3FYUC 4QWMA 1LBSA 2WILA 1MO2A 3HC7A 1XRLA 4UHDA 1R50A 3IBTA 4H7KA 4U2FA 1BN6A 3WKBA 2BUBA 1DX6A 3UMJA 4QEKA 1ZD4A 3QMWA 4I3FA 3G0DA 4FLEA 5AI6A 3PF9A 3WI7A 4Y2JA 4S0XA 2WJ3A 2HU8A 1IMJA 1GGVA 3EBLA 4F5ZA 4QZVA 1CUFA 2PVSA 3SC2A 2DSNA 3TEJA 2PM8A 1JKMA 4BRSA 1K8QA 4LKOA 3H2IA 1P0IA 3NUZA 4MYSA 4BVJA 2RIPA 2GYUA 2VT7A 4X6UA 1ZD3A 1CR6A 4X97A 5AM3A 1CUBA 3H1BA 3WA7A 3STVA 2HA2A 4C01A 1GKLA 2WFLB 3WL8A 5C8VA 4DNQA 3O4GA 1TRHA 4FWBA 2AXEA 1CUUA 1LPPA 3FVRA 4G8BA 4G4GA 1CUSA 1X2EA 5HK8A 4DIUA 1LGYA 1E89A 1N8SA 2WTMA 2PUHA 2BGNA 1JJBA 1TK3A 3VDXA 1LNSA 1XZLA 2W6CX 4A16A 2DHEA 3R3YA 2ZYIA 2ES4A 4FOLA 4KEAA 3FVTA 1ODSA 2LIPA 3BIXA 2C4HA 1Y37A 4J7AA 4AZ3A 4UHBA 5AKHA 5ALIA 5EIAA 3T4UA 4CG1A 2JF0A 1ZIXA 3PE6A 2PSDA 5HF9A 4N8EA 5EHQA 1NX9A 3VKFA 1IUNA 2J4FA 5IVHA 2ECFA 5AKZA 5ALHA 1MN6A 1SC9A 2IITA 3LS2A 1THTA 4G8CA 3WJ1A 4U2CA 3WWDA 5T4FA 1X70A 2XMZA 3DL4A 1YS1X 3WMRA 4XVCA 3BJRA 1G5FA 3EQ8A 2DQYA 3B12A 4BCDA 3BDIA 1E8NA 4U2BA 5KWJA 2WG1A 3QH4A 1ODCA 1XFDA 4GW3A 1GQRA 2XUHA 1CV2A 2C5FA 4J0KA 5DYWA 2FJ0A 4CCWA 1LZKA 2WLSA 4W1PA 2BJHA 5FLKA 4AXBA 4E46A 1O6GA 2ZJ7A 5DNVA 3R3ZA 3PFBA 5EGNA 2OGTA 5DTIA 4C4YA 2B4KA 2HFJA 2QMQA 4BVLA 1Y7HA 1ZICA 3GBSA 2UZ0A 3FCYA 1XRPA 3NGMA 3H2GA 4G9GA 5A7HA 1F8UA 3O4HA 4LIPD 4EY6A 4LHEA 1C7JA 1W52X 2YYSA 4GEGA 3D0KA 5ALTA 1OILA 3AZPA 1K63A 1BU8A 3QPDA 1CUIA 4HXEB 4BBZA 4WY8A 2JBWA 1UK9A 5AHXA 3RM3A 5CBKA 3UUEA 3M82A 2GBCA 1KU6A 4DMKA 3HACA 4B83A 1QIGA 5AM5A 2XUFA 3QPCA 4TGLA 1CUEA 5AOAA 1YAJA 1GPLA 4BE4A 4LXGA 2XUIA 1TCCA 1UOOA 3C6ZA 3L1HA 4WFIA 2WG2A 3D2BA 4BRZA 4QDOA 3G9ZA 1W6RA 5HKBA 4Y9SA 2ZJFA 1EINA 2Y6UA 2BFNA 5JZ9A 3WK4A 5LP1A 4KE6A 4EY5A 4E14A 1ACLA 3HEAA 5IH7A 1EVEA 2CZQA 3QMMA 5AK4A 1CQZA 4PSUA 1ZD5A 1UFOA 2XQGA 1YA8A 4EY4A 3QZUA 5ALGA 3ZLVA 3R40A 4G4IA 4IHAA 3H1AA 2VEOA 2PSHA 4KYVA 1USWA 4WDRA 1CUZA 2ONCA 3WL5A 1CUVA 4ARBA 1U8EA 5AI5A 2ORYA 2YXPX 1YB7A 3A2MA 1BE0A 1IZ8A 4Q82A 4KR0A 4FLFA 2B20A 2BUAA 4GWLA 3CN7A 2RI6A 1QOZA 1HL7A 5DYTA 2O2GA 1BEZA 2Y1KA 2RGUA 3O0DA 4U2DA 4X95A 1WHTA 5DYYA 4RPCA 5AI4A 2XQFA 4HVTA 5LZ5A 2DHDA 2VQ6A 5ALVA 3HABA 2HA0A 5EFZA 1N5RA 4L9AA 4J0HA 4QDTA 3C6YA 5HK9A 2HIHA 3G9TA 4DNOA 4ITVA 1IUPA 5CH5A 1XRRA 2VAVA 4UBNA 4ZI5A 4X94A 1JMYA 4B9EA 2Y2UA 1FJ2A 5D3ZA 1CVLA 4UFPA 1W75A 1XZMA 3E0XA 2HDWA 3LP5A 1XZCA 4YASA 4WCVA 2WFLA 3MVEA 2H7CA 5DLPA 1H2YA 4H7HA 2Y6VA 2Z5GA 3Q8WA 4OYYA 4K2AA 3CXUA 2BCEA 3FNBA 5AI0A 3BF7A 1LPNA 1QLWA 2PU7A 2VSQA 1A8QA 1YB6A 4KRYA 3F8SA 2QOEA 4BP8A 4TVKA 2I78A 2CKMA 2QZPA 3DS8A 1QIDA 2O2HA 2WIDA 3WQHA 3WK7A 5EHZA 4ZWNA 2J3QA 5T4BA 1GZ7A 1DX4A 4AX4A 4KE8A 1RWQA 4IH4A 4DGQA 4UBIA 1F0PA 2R8BA
chains in the Genus database with same CATH superfamily
2IZOA 3SYMA 1CZHA 3QWIA 4WXPA 2QXTA 1HT0A 2VT2A 1T9ZA 1AGPA 4EKEA 4BKUA 1ZJYA 1NDQA 2IWRA 3ROQA 1PZEA 1E63A 4WOCA 5K0SA 1PV4A 1NJ5A 2I1QA 1DJMA 3FUWA 4DW8A 4L3WA 1QVWA 5FWXB 4JOQA 3K4PA 1PNTA 3Q11A 4MWBA 1SKQA 3LWNA 3U37A 3R7AA 3TPCA 3DLPX 3SX4A 2NOAA 3G2QA 3H83A 5IT4A 5L53A 2XNHA 3HKDA 4LDRA 4EA8A 1Y7IA 4JT8A 5FBWB 5EWJB 2C1XA 5EGSA 3KHKA 2Y4OA 3F90A 4TLCA 3VNSA 7ABPA 1ZDMA 4FPXA 4ZZ2A 3I8OA 2ZU0C 3QX8A 1QQBA 3H1PA 5ADUS 1PZNA 3D2AA 2VJAA 2EF1A 3NTXA 3AI1A 2AZMA 3E7FA 3TLYA 4B4KA 1EFTA 4XM2A 4M99A 2P1RA 3DEZA 5I7HA 4KPEC 1WBJB 1NQTA 1VHWA 3N2KB 1HLFA 3GFSA 4I9HA 3BWVA 1P3DA 3NJRA 1H2WA 1RCTE 1I1HA 2C31A 3P27A 2AE2A 1OYWA 1RPTA 2OVFA 2I6TA 1Y1KE 4KWEA 1UDBA 1Z2CA 3OMWA 2B6NA 3PC7A 5C8XA 2FFHA 2HXSA 1DTWB 5TQVA 4WXRA 1GOTA 2NUPA 3HB5X 2IT1A 3ANLA 4TV9B 5G3ZA 4YRLA 4N47A 4B31A 2HFKA 3JYQA 1A71A 3D8SA 2PL9A 4Y0AA 4ZVOA 2BGKA 2VBCA 3UUGA 3ZQJA 1PFUA 1IB0A 4ARSA 5HVNA 5AJXA 3SQXA 3GR6A 2IV7A 4E31A 1LD3A 1FFAA 4JYZA 4ZZIA 1T13A 1NQXA 1OJ7A 2X0KA 3WV5A 4BKQA 5JJKA 2ZB3A 1QFXA 3DNFA 2LKCA 1W48A 2VF2A 3MINB 1DPGA 1VMKA 5BN4A 3GGCA 3DMGA 2EQAA 4OMUA 1Y5RA 2ZBQA 3AUAA 3PYXA 5KTKA 5A4FS 3GUYA 1ZITA 2BEVB 5JSQA 1Z33A 2XDQB 2O23A 5HE9A 3G0BA 3ZYCA 2IIVA 4F21A 1QP7A 1VHLA 3ZDCA 2Q2WA 5GMOA 4YP9A 2SHKA 3GP3A 4DS3A 3GYGA 2AJDA 1GZVA 3A3PA 3EG9B 3ER6A 3N2YA 4ZEVA 4LOLA 3OPQA 1LPBB 1U90A 3A3KA 3V1KA 1JSLA 3B7GA 3R6DA 3BFVA 1A3CA 4KP7A 2O0KA 4XGKA 4ZAWA 4GGOA 1T5IA 4C0LA 1TA9A 3T1NA 1XZHA 1NJ2A 3T7TA 4JLJA 2GX6A 1ZM2A 1YK0A 4P84A 4W63A 1EHIA 3GJRA 3UUWA 3VA7A 5ADVA 1N5DA 1W25A 1UDRA 3OOSA 4FS8A 3DB2A 4F4CA 2CSXA 4F6CA 4OU5A 3W5CA 2Q3JA 1ZH8A 3RTGA 1LJ8A 1T5LA 3R8FA 4YMVA 2XGMA 3ZVMA 5KOIA 2FUG1 4FYKA 3SBDA 3LUDA 1Y7LA 4MUGA 3W04A 4P2BA 4EPVA 4FZRA 5LB2A 3PBKA 4YXFA 5HKOA 3ONDA 4YCMA 3HXLA 4M38A 5SZJA 3RUIA 3SHTA 1QZ3A 2XUQA 4ZT7A 1EVKA 4BWVA 4Z4EA 3R4CA 3OTWA 4X85A 1U9JA 2IP4A 1YUNA 3CW9A 2O06A 2XOEA 2QRKA 3OO1A 1XZFA 1E6EA 2LR0A 2WUVA 2JJ1D 2Q8PA 1YS9A 3AUKA 4C0XA 1QF6A 1Y9AA 3KD2A 4CPDA 1UR5A 3QPWA 5JQGF 3ROXA 1SUCA 2V1XA 3DQZA 4XFJA 1UM9B 4YP0A 4J4TA 1E1RD 3C16C 2ABWA 1ZMXA 2UZ4A 3DTNA 3CVYA 2YUTA 1H42A 4F45A 3N86A 4S1OA 1YDMA 1OASA 1ULSA 1VA4A 2A5DA 3BTSA 1X1EA 3ED5A 1Z5NA 3AEZA 1QS0B 5ADWA 1N9GA 3B13B 3EX7C 4CU2A 4CMEC 2WU4A 3PNPA 5KTTA 2SKEA 4M2LA 3OFKA 2IHZA 2JVJA 5CPBA 5CLJA 2FOLA 3V1YA 1WB5A 2QLMA 1ZGHA 5IBQA 2YIDA 3FOBA 4QFDA 3ZE8A 3E03A 5FEMA 2J3JA 4P3KA 5E4JA 1EP2B 1TLTA 2DPYA 1MJGM 1EU1A 2EG5A 5ALLA 3RGWS 2BR5A 1UFRA 2DLDA 1YQ9A 4ZO4A 4NMMA 3T9CA 1I7LA 4M54A 5H9VA 1VBMA 3ICCA 5DJ5A 1ZMRA 4HQFA 1XA3A 4I08A 4RFSB 1PD1A 3L1IA 4LYHA 5AUOB 5KOHB 1GIAA 1G98A 1ZA1A 1ZUWA 5BWBA 5DHRA 1XD2A 3TBFA 3SZGA 3DYVA 4QECA 1CVRA 1ZNZA 3O94A 3UZUA 5FV7A 2WZBA 4O1IA 4HUTA 3SBEA 4ZI7B 2E4VA 3BHJA 1ZWKA 4IR7A 4C7OB 5TJHA 2ZUVA 1X9HA 4X8LA 3IUEA 5ILQA 3V6MA 2ZATA 4BGEA 5CFQA 2PXAA 1QZZA 2WM9B 3AXSA 2P5SA 2YL2A 3FSGD 3PHHA 4O6VA 5AHKA 1LDYA 3G7UA 2OVBA 1KFBB 5I45A 1D0SA 2QSUA 1M6WA 3TGLA 1SCAA 3S44A 2Y92A 3L4BA 3SI7A 2BC9A 4RV4A 1JDJA 1RPNA 2FI1A 4OM7A 2GESA 1DBPA 1E5TA 1NW6A 4Y1GA 1AHPA 3I5XA 3NIGB 2GFQA 2V8BA 5A2GA 3WK5A 4NCNA 4KFSA 1ISMA 1WXQA 3QKTA 5K3SA 1UDXA 3WOHA 3EXHA 1QRUA 1P31A 4I50B 3I76A 4H77A 2FWNA 3DUFB 4BU1A 3CRRA 1OLXB 1S5PA 3NRBA 1UXKA 4HPJB 5K3FB 1B0AA 1KKLA 4L6AA 3WBFA 4QQFA 3FDJA 2PSSA 3FH0A 1KR5A 4LHSA 1MJ5A 4CCYA 3TAUA 1T6BY 4ZCMA 4FN5A 2PKQO 5K0NA 10MHA 3KJQA 5IJAA 2V97A 2D0IA 2OECA 3ROTA 2BFDB 4YRBA 1BMDA 3K4QA 4UC0A 1RI5A 2FK8A 3WLKX 3U7RA 2QXUA 2CXUA 2H1FA 2B5VA 3TXAA 1ZVVA 2RH5A 1AS2A 1P39A 1QHXA 2DKFA 4H3SA 1PFQA 5LBUA 2FGJA 3F9CA 3BMCB 1XCBA 1YE8A 1EJBA 1FYFA 1U65A 2JDIA 2CHQA 3EGWA 4RIEA 4E5DA 2XIQA 5C81A 3BIFA 3QX7A 3VYUB 4GKJB 4JH0A 2Q9AA 4UAJA 1M1ZA 5CJ2A 1RQPA 1ZQ1A 2JVIA 1WBBA 3WWZA 4O5AA 2D2IA 3B70A 3VHLB 4HH1A 4IO0A 1E2HA 1GTG1 2G06A 2Q1WA 2X5OA 5E4YA 3FNIA 1A04A 5EXDA 2JEZA 3KQHA 1ZUIA 4LXUA 3HBMA 1G5PA 3CGWA 1WE2A 1CCWA 1Y6ZA 2HBYA 2ZTLA 4RQBA 1YS7A 1NMEA 1BFKA 4I19A 4N65A 4ARVA 3V2IA 4CN8A 1XRSB 2ZBFA 5JEDA 2QTBA 2JFYA 1H3EA 4P80A 4BU0A 3KZNA 3OG9A 4RK5A 1U9YA 1RI4A 3JYNA 4QJ5A 1E58A 3N75A 2AS0A 4CI9A 3NC0C 5DU2A 3RSZA 821PA 1OXXK 3AR3A 2PBRA 3G2MA 4ZMSA 4IOKA 4NEGA 2PFSA 1OTXA 1NXTA 1O95C 1MAUA 1WW2A 3D2LA 1JS1X 1LDBA 3TH5A 2FFAA 1KERA 1USVA 5GVSA 3CZCA 3PQCA 1N2EA 2C2WA 1TJ5A 2FEMA 4RD0A 2FN8A 2O3RA 2OUIA 3IQFA 4TKUB 4ZKDA 2Q0HA 4X90A 2F17A 3DHVA 3NOXA 1SVMA 1UDWA 3DCYA 4NFSA 3U1VA 4BGIA 4RY0A 4BZXA 4W7IA 2CD7A 1Y7PA 4UUBA 3WYGA 5DHUA 4F93B 1GRNA 1WD7A 2IF2A 4DAEA 5F7XA 2H06A 5G40A 3JVIA 3NZEA 5JQGB 4AZ0A 3FPJA 3BRWD 2P8SA 4IJWA 3T12A 4EM6A 3OI7A 4E15A 1QP0A 3M0EA 1RKQA 2H9YA 5IK2A 3RUPA 1JJIA 1DCMA 3DV0B 4KQHA 3I8XA 1JYFA 4GPD1 3QE4A 1QUFA 2HSDA 1RI1A 3QKRA 4P7KA 4D0LB 4M0UA 4PPFA 1NPDA 2J3MA 4YJ2B 4PY2A 1UC9A 2L18A 2F3UA 1B6RA 1DXQA 3LC7O 2BOVA 1BKDR 2L19A 2HIGA 5TMEA 4HEHA 2X3YA 2RONA 3ETCA 3ME5A 2QZJA 1UPAA 3OPNA 4MAAA 3RKRA 2NADA 3QVGB 2YJ5A 4U4AA 4B6FA 2HLDD 4QLAA 2J3HA 5A1TA 5J4KA 3DFMA 1FU7A 1KYTA 1K6IA 1I0ZA 2E4UA 2NO5A 1FYEA 2I4OA 1SZDA 3BORA 2PYDA 1ZLXA 4NU5A 1VIAA 5FR2A 5FTKA 2OXCA 1ABFA 1J23A 2V65A 4WADA 3HV0A 3CB4A 5FI3A 3JWEA 3RT7A 5LZ8A 3OZTA 4IV8A 3UICA 4A6PA 5IDWA 3ZI7A 1M6EX 1CHDA 1D1QA 1BVHA 1T9GR 3T3GA 4HKTA 1XZJA 4M6WA 3RF6A 3AYXB 3W77A 5HRCA 1NZDA 1Q0QA 1L4UA 3EZNA 3LCUA 5BQOA 2XEXA 1QRTA 7ADHA 4RGBA 4JN6B 4KR2A 1DE0A 3IPCA 2P8JA 1O0CA 4GOLD 3JQPA 1ODFA 4DRZA 4G0WA 1DWUA 4ITRC 2JFFA 1G3IA 4GXRA 3RFFA 4DV1B 4G8JA 2LXNA 5LU8A 3EIUA 1Y9DA 5JNLA 2XA2A 3PXBA 4P8RA 5I9MA 4C05A 4H0CA 1TIBA 1TVMA 2LCQA 3TLGA 1J2JA 1H05A 2DTXA 2OBYA 5DM2A 3QUTA 3JQ7A 2XE7A 3K1TA 1TKAA 4WXYB 4BQEA 4DMRA 3EIOA 3B9QA 3EW7A 3ZD8A 4HDNB 2BJVA 3IT1A 4GKKB 1F5NA 1YZKA 2Z1MA 5H82A 3PRYA 4GX0A 2YZKA 3HKBA 4I55A 3K0AB 4O25A 1I4EB 3QLTA 5IZCA 2D3WA 3LAWA 4UBLA 3TOVA 1SOVA 1N9GB 2A30A 4FMBB 1EP9A 3E15A 3BWBA 3IESA 3EIQA 5SZKB 4DRXB 4DV6B 4LYJA 1YDHA 5KVQA 4B7CA 1F6DA 1KMIY 2IJGX 1M2OB 2NZXA 1JLLA 3M6UA 2CV2A 1Z4OA 1IZ7A 2XTNA 3NAMA 2C1ZA 3HA7A 4DLZA 1G8FA 3I0NA 4IEEA 4AN1A 4E5KA 4RMHA 4EX7A 4ZCIA 5KNDH 2A58A 2F64A 2H18A 4Y2PA 2FKNA 2GZHA 1KI6B 3N0TA 4GICA 4KLAA 4Z4IA 4QDXA 2AI1A 4XUDA 5FOSA 3AB7A 2GYVA 2PRZA 1VGVA 1SQFA 1ZUNB 3A6KA 3EASA 3HWX1 1OVMA 4GBED 4MYDA 5AXAA 3VR6A 4DA9A 3PUIA 4HLQB 5JTTA 2ZRAA 1KVTA 3LY7A 1KQPA 2BFOA 1JLHA 4JQOA 4YGXB 5KHOC 2I4MA 3LHIA 5E9WA 1DC4A 2WWRA 2YUIA 3CVJA 4I46A 5TGTA 1TK2A 4MUXA 1M66A 1A69A 5C35A 5IMBA 4JUIA 1D2MA 2X1MA 3LX4A 1KNQA 5JH7A 4YAJA 3M89A 4YT4A 3CSDA 4Q6WA 4FLMA 4NBLA 1FVOA 1H1LA 2VHJA 1FLNA 3ASUA 1XDUA 1KE2A 1A82A 5AOBA 4MGKR 1AXEA 3WGMA 5C37A 1MA3A 4BTVA 1N8TA 4LJAA 4XIJA 3OT1B 2RGYA 5IBRA 4GG1A 1R8QA 3BZBA 1OZHA 1JSZA 4ZK2A 4QYXA 3M5PA 4PSKA 4YRSA 1Q95A 3UV6A 8MHTA 2ZW9A 1FF9A 1Z36A 3A2NA 1Q0ZA 4M9SA 1HXHA 1Q1QA 2A6PA 2FETA 1Q1AA 4M46A 2WYIA 4OYRA 1P7ZA 2BV3A 4K2HA 4UPEA 1TCVA 3K9FC 4LFBB 3BZWA 3KZVA 5EWJA 1X7YA 1V6CA 1SC1A 2HLHA 5TPZD 3IVAA 3QG1A 3S81A 2Z6AA 3G59A 2GH1A 4C87A 2FXVA 4YCLA 5JAPA 3AI7A 4JROA 4RJIA 3M6LA 5IARA 1RPZA 1T1GA 4C1NA 1EGQA 4IZIA 1DT5A 2E4ZA 2K4MA 3AEKA 4AJIA 4F8JA 1OYYA 3FHLA 5D3QA 1C1XA 3GH1A 2JIDA 3DVRX 4M9ZA 5JSHA 3MSXA 4ICIA 4BBJA 3LQKA 1AQ6A 1FRVA 4YJDA 721PA 5JIBA 4M86A 4D4MA 4NAUA 4EG5A 4MRRA 5AW3A 5HF6A 3UT5B 2CMFA 2DCMA 3KLBA 4FFDA 1QE5A 2O7RA 4X8MA 3LPCA 4DLXA 2FSPA 3W0LB 4G36A 4H31A 5BYAA 5F3WB 5T3UA 5K3DA 2H3HA 3FMPB 3RQSA 2YWEA 3RYFB 2Y27A 1RJEA 3EPKA 3U56A 3BM5A 2ZZKA 2EDCA 3CX3A 4BMCA 2O3TA 3HKEA 4D8WA 5JRZA 1F14A 4Q4DA 1T8WA 1Z4PX 5EUCA 1XZBA 1ZRNA 4FR0A 4UAUA 1IQ0A 5CM2Z 5IASA 4GRDA 1FZTA 3UAGA 4F7WA 3D7SA 1W4LA 4ASUD 3THRA 4Z8XA 1EUDA 2IU4A 3UM9A 5EMJA 3DMPA 3PGKA 3PPXA 3B3GA 4R41A 4EFMA 3KPVA 4KXXA 2UUBB 1WY5A 4DLUA 4HNTA 5HUHA 3D8TA 3OTGA 3CZQA 3EXEA 5AKKA 2CB9A 4DREA 5IJZA 3PDHA 4BQOA 1LX6A 3KE8A 2DWQA 4A7PA 1JIUA 3A14A 1SKYB 2O19A 2WYHA 2REXB 3W79A 4IZ6A 2QORA 1G8HA 1GZ5A 1UJ2A 3DEKA 2E49A 2UDPA 5H3HA 4JLOA 3UWSA 4AZWA 3VR2D 4DA0A 1J8DA 3BWCA 4OJTA 4F9FA 3BGOS 1U0JA 4L75A 5EEGA 3BWMA 3ZY3A 5KSPA 4UEWA 1QO7A 3SXPA 4EW3A 1WP4A 3UJ3X 2I67A 4N3GA 4DA4A 3DLBA 1JH8A 4KO3S 2BTEA 4DB2A 2VUSA 1JDNA 2ZRCA 1X38A 2XCRB 4BQPA 1T4CB 2PPVA 1KYVA 2ZYHA 4IIBA 4MA0A 1PL8A 3P0EA 1TKBA 1G3MA 4J16A 3SDZA 5JDIC 5CUQA 4FQ7A 4RZQA 1JUDA 1K0FA 5EL0A 2E9SA 3T4EA 2X0DA 1R6UA 1CS0B 1V9SA 3GROA 4YCAA 4DJEC 4OQDA 2RI0A 2E7ZA 1KK2A 5DGXA 2CL0X 4ZT2A 3T7KA 4G0NA 1X3LA 5J58A 4KVAA 5JCXA 4YRIA 4AB1A 1GPKA 1QBGA 2I71A 3BJZA 5BOVA 3LIIA 1OZAA 2J32A 5KDOA 4FUTA 4MVJP 3FN4A 4KSCA 5LQRA 1HK7A 1L4NA 1SH7A 1ZK2A 2NZVG 5ICFA 3VM6A 2DWPA 2QVGA 1IB6A 4V0QA 1KAOA 3TPFA 4ENTA 1GPMA 4R2IA 4B75A 3AQ4A 1DKRA 3KHSA 4RA9A 4I66A 1S9HA 2IXFA 1LTQA 4RZ3A 1E20A 5IDVA 4JXKA 1PJLA 1VI6A 1MQAA 3GJ7A 4OGWA 5TC4A 1PBNA 2FZ4A 2WEKA 3IPAA 2L82A 1W93A 5LMCA 2VWHA 1KBOA 2O1SA 4E4RA 1GQSA 3PI7A 2CLCX 3OLYA 2HK7A 1ZCZA 3PVSA 1PGQA 1ZWLA 1JHZA 2I4RA 2V7GA 3FKQA 3BH6A 2O3JA 1W2HA 3HFJA 1QE0A 1T2CA 1KYWA 3G5UA 4L72A 4TTJA 5IDYA 4B3HA 5DHQA 3H6KA 3AF0A 4LRTB 5TDHA 1JIJA 2ARKA 4PEVA 5K2MA 2FA9A 1QYXA 4LV5B 3COJA 3OBBA 2CDAA 1S2LA 3K6KA 5EP3A 3C3JA 3UUFA 5J47A 4IICA 3IKJA 3IBFA 4OK6A 3G1UA 6CHYA 1SUEA 1L4FA 1RLOA 3FWPA 3KLNA 3ZKAA 1BS9A 2PX6A 2PUTA 2SKDA 2AXNA 3L7AA 3NANA 2A14A 3SEZA 1YZTA 2GXQA 4DG9A 5FXMA 1FFYA 2CJXA 3CLVA 2VSXA 5BYJA 2B98A 1XQ1A 4DWWA 3R3WA 3EXEB 3LGSA 3S4YA 1N1GA 2Q9UA 2WU0A 3AP2A 4Z1MD 1W9HA 2IA5A 1GQQA 1RJDA 2ZI5A 4RF3A 5CGQB 5I4KA 3EA0A 2YOFA 4M9RA 1QQTA 3VKVA 3CVUA 5JR3A 1P75A 1SUPA 2KW5A 3AUSA 1K5GA 3O9ZA 4PICA 4BKPA 4O8CA 4A0RA 3QOWA 2DBYA 1NYTA 2Q1SA 1PF7E 3MMXA 4DZRA 2DUUA 3DNPA 3U4QB 1E92A 3EY9A 3DP9A 2FWJA 4H7EA 2IDZA 4Q93A 5EUQB 1E62A 5GOTA 2HQBA 4JLSA 5ELMA 2IH2A 4II3A 2VDQB 2BLNA 3ZHUA 1CWUA 5KPJA 1N0HA 2W37A 1LVUA 4Y2SA 3EXHC 2VDWA 4KSBA 3LUBA 3HCOA 3UK7A 2IKSA 2P2YA 4NG4A 3OFND 4CYMA 3B5EA 3B5IA 4EUEA 2H52A 4XFKA 4EJFA 1KTVA 1KNXA 5AK0A 3IUPA 1OIVA 2L17A 3AERA 1J0BA 4P4SB 4JVLA 4V24A 1K4KA 5JZBA 1M1XB 2AE1A 3DE0X 4XW2A 4Q3BA 1YJCA 4NESA 3PHJA 1TX4B 1UBNA 3L46A 2X5KO 2EZTA 3B60A 4ZRMA 2W6JA 3L01A 4PC6A 1G21B 3GIDA 2F59A 2FPPA 4KN9S 3NUQA 4RDXA 3CN9A 3L8CA 4IG4A 4TMZA 2XEDA 3U80A 3NKFA 4QYIA 3NQ41 3ISJA 3ABIA 2BKLA 3GMIA 2YJZA 3HWRA 4G1BA 1T5DX 5DXFA 5DNDA 1JN0A 2PZEA 1FFCA 2R5WA 4DLPA 1MB3A 3VZQA 2G3YA 1U28C 2ZUDA 5BYBA 1P61B 2D5IA 3MF4A 1KEVA 1RJWA 2GBGA 4MKGA 4NCXA 1IY1A 4ARZB 2ATCA 3G88A 1DZIA 1P4RA 1XAGA 4DUPA 1XQYA 2WF7A 3V9PA 3OT1A 3ZTYA 2QTZA 5EXSA 3SS9X 4B6PA 1H1LB 2B8EA 2F3SA 1E7YA 2VCEA 3I2GA 3X1MA 5JPIA 3GLQA 2FWRA 3C8HA 3H3XA 4MW5A 4N3NA 2PSJA 3QUCA 3MTDA 1XVIA 4DLBA 3ABOB 2ONYA 1JJ7A 4TTIA 4Y9DA 1SVKA 3UXEA 1O5IA 3DFZA 1M10A 3HZOA 2W0MA 4CI0B 2ZB7A 1UBFA 1F7VA 2ZJAA 4KYIB 4IY1A 3TJMA 4MDEA 1GG2A 1NYQA 1OF1A 2OWEA 3FSJX 2YASA 4MZDA 2JCVA 5BRNA 1OSNA 4TTAA 4WLVA 4X3PA 5DRYA 2VTVA 3V8MA 3QA9A 2ZPUA 4BBPA 4JJGA 3R7DA 2XB8A 3A26A 3S70A 1JR3E 3A1NA 3X44A 5KNDA 2O5EA 3C8ZA 2F3RA 2PX5A 1U9IC 2B35A 3SQWA 4PYJA 2A2ZA 2C2ZA 2JGEA 2O2ZA 3FWNA 3QLEA 3T9EA 3WGNA 5K8TA 5L3SB 1ECBA 5KPDA 5KU1A 4C14A 4NHEA 3RWBA 1QTRA 1GRQA 4YBZA 1H4TA 4C3ZA 5BR7A 2CMGA 3PD7A 2IDMA 1VJRA 2ORWA 3W5HA 4EHBA 4O2AB 1JWLA 3JATB 3M6MD 2WNHA 3AIMA 1OI2A 4RNDB 1J0XO 1E0SA 3WIDA 3DD5A 2HA5A 1I13A 4JVSB 1J2TA 2CVQA 2ANCA 3QBDA 3ENWA 3K32A 4UPDA 2PS3A 4RIFA 2P9EA 2J30A 4P53A 1ECLA 3M70A 4YBRA 4Z3OA 5KVAA 3CX8A 4MHOA 3CLSC 4C0BA 1ZR4A 4ZGWA 1U6KA 4AZTA 3HVUA 2C58A 4RXMA 1NYLA 3NIFB 1ABBA 4QVIA 3DHYA 1EXDA 2NNLD 1TT5A 1YZUA 1IYZA 3OT5A 1JMKC 1GITA 3DDUA 3PEUA 2R4QA 3AGPA 4DJDC 1AX9A 1Z38A 2MSLA 5C31A 4AQ7A 4BO0A 1DOHA 3H84A 4YCDA 4WGGA 1V35A 2FRXA 2HI0A 2C95A 2EV9A 3HJRA 3ZV5A 3QU9A 3G8CA 4DANA 5E2AA 1Z8NA 4B6GA 5EE0A 5FUQA 2JFGA 4Q1VA 3MD9A 4YRMA 3LK7A 4BWYA 4TYWA 1CK4A 1PK7A 2IOFK 4ZTUB 3HLKA 4K6GA 3OLQA 3AOEA 1CQIA 4K9MA 3HXKA 4PGHA 4GKBA 1WWKA 1VBKA 1KHTA 2BP7B 3A7DA 3CQ9A 3QVKA 4E2ZA 5C7LO 3MWEA 3NHPA 2YFQA 1ZP6A 4XASA 2E5WA 1XC7A 1VRCA 2F3QA 1J09A 1ZNWA 2Y4NA 3IXMA 4KQXA 1HBJA 1Z68A 2JANA 3QVGA 3BWDD 2AMVA 2AVDA 4UKDA 4YRQA 5ALXA 5K4AA 2XF8A 1RJGA 5J23A 3TQRA 4BJ6A 2FEAA 3PF8A 1AQLA 2OBXA 2ZRQA 4L02A 1TA0A 2GN9A 2IYSA 2VZ0A 4X8OA 5COAA 4CKYA 4EA6A 2C5SA 2FSHA 3L0IB 4AWXA 4EDFA 1TM2A 2H1VA 3KVRA 2PGIA 1YHYA 3PHGA 4KXLA 4X63A 4ZALA 2DLCX 1Z39A 4GMDA 2IUEA 3C6MA 3OUUA 3DG9A 4RMGA 3S0JA 1N3BA 3K5WA 1TU3A 1MMFB 2NU9B 3NBQA 4DSAA 5YASA 1V3VA 1JDPA 3MELA 3FKSD 5GQSA 2W6IA 2WE8A 2XQKA 2WW8A 4B79A 4U0JA 5B4VA 2X3FA 1V4VA 1FXWA 1PV1A 3QVVA 4RZIA 4F5WA 3BXPA 1TTQB 3QMVA 4KE7A 2A59A 3NDJA 4B09A 4EWLA 1XMSA 5JQGA 3U7HB 3GPLA 4YWHA 1RYEA 1UBGA 2NUBA 5I9IA 5FI5A 2EX1A 1PZXA 3IUJA 5CVCA 3IEXA 1TGYA 5I9BA 3QFFA 5B7QA 1P5JA 1QRSA 1KS2A 1F6WA 1E4VA 2BN4A 1MVLA 3ANTA 5G4LA 5KAPA 3T5BA 3UXHA 4C0SA 3ZH9B 4AI6A 2EZ8A 5K8LA 4HN2A 2XXAA 5JD4A 5EJEA 2NP7A 3TNDA 1RAHA 1X15A 3O31A 5A7FA 5AJHA 5CITA 2WJVA 2PL5A 4X1YA 4OFXA 4OHRA 3QFHA 3LVQE 4UASA 3P0JA 2MJLA 3NWJA 2EJWA 3WZLA 2P2SA 1SAYA 4RSHA 3TL2A 3DDCA 4RK1A 4D9EA 4M0CA 2P30A 4XWTA 3RI3A 4DV7B 2H1LA 1QX3A 3D54D 3DZCA 3NAQA 4P5EA 1TXGA 4C5CA 3VAYA 3VVMA 5BW4A 3I1YA 1PR3A 2WZDA 4GZ5A 4LCEA 4M1EA 4NBKA 3F2IA 3RFTA 3AL0C 4EJ0A 4QGAA 3DLHA 1WM1A 1C1YA 1YASA 1E2FA 4RSGA 3GJSA 4JBNA 4DQDA 1U8TA 2QYOA 2GEBA 1O9HA 2FV8A 1H9BA 3TIXB 3RC9A 5D5PA 4C3VA 1JT9A 1G6KA 3QRWA 4EIWA 1DHTA 1DIRA 4UUQA 5F3RA 2AR9A 1QYVA 2XAAA 3L0SA 5FBLB 1NP3A 3C43A 3H04A 4QUBA 4GU5A 1YVUA 1OTHA 2XCLA 1XJ5A 4DHWA 4R8MA 5E8JA 1OPRA 3BKXA 2PHZA 5J2TB 1AXRA 3AUUA 3TKAA 3DEHA 4IJMA 1Q21A 1CS4C 4PYRA 5JECA 5BPHA 4MVJM 3DT8A 4MJLA 1I3MA 4LHVA 1ZNXA 2CNWD 1W5EA 2HWUA 2JIBA 1NWHA 2NACA 4MQ5A 5FCDA 3ZW9A 3LYUA 2FUEA 3KQTA 4LJ9A 4JVOA 1JDBB 2ZP1A 2ZRPA 3FUXA 5TS2A 4DF3A 4Q1AA 4P7BA 2QUIA 5DCYA 2Z9DA 1FXWF 2W8ZA 4MP3A 5KZMB 4IIJA 5LFAA 3T4XA 2C4VA 2HPHA 2WKWA 2CUTA 2VC2B 3CEAA 5K1ZA 2ZXEA 5TQ0A 1TCAA 1WY7A 2C4MA 3G0IA 2ZRJA 1JJVA 1HDZA 2YR0A 5TARA 3WL6A 4MI6A 2HCFA 1AKEA 1H9CA 1UEJA 3T3NA 4FFWA 4K6CA 3ZOZA 3TF5A 4BGDA 1CJCA 1KJNA 3NPMA 4HFNA 4LHXA 3KLMX 2LDXA 4D45A 4RTPA 4HBGA 4D41A 3O93A 2XVAA 2WTEA 4ZU6X 3VU3A 2MCFA 5FD8A 1UBOS 3AF4A 1KMQA 1NV8A 2C2HA 3QITA 2G80A 3EZ9A 4FD3A 4KWIA 2P77A 1CEXA 2AOUB 5D3MB 3TM4A 5A4KA 1KI2A 1L5MA 1V41E 4G1VA 4LSGA 5A71A 1UBHS 3MWDB 4PZEA 4GX5A 2OAQ1 3EG5A 1RWNA 4BP9A 5M34A 2ECOA 4D9HA 4PV7A 1OFHA 5FO0A 2FPKA 2AYYA 1O4VA 3FDFA 4O29A 3IAUA 1EHYA 2KM1A 1JI0A 3KTAA 1WV0A 3UWMA 2FW0A 4QRIA 4CETA 3V48A 4ER7A 5IWAB 4MRAA 4EUFA 5J63A 3UJHA 2OXFA 3A9SA 4XJSA 2ID9A 2TRSB 2X5XA 3GGJA 4GEKA 4TT8A 2Z2YA 1SCIA 1F2TB 1E0AA 4W6ZA 3FUVA 5DOVA 4JP2A 3ZV3A 5GADl 3NHAA 1QHNA 2AR7A 1LLUA 2RHWA 4R2HA 1NMSA 1Y81A 2DJ5A 2XLBA 2JIZA 4TWAA 1G2QA 1ZH2A 2N9UA 4MUBA 2IS2A 1C30B 5H16A 4MUIA 4TWRA 1UL1X 1XNJA 4MINA 5E7QA 4NR0A 3SBXA 3QEBZ 2PA0A 4F2DA 5K4HA 2O7VA 3FZGA 4L4XA 4AX8A 1LRKA 3LCCA 5IULC 3LHSA 3I32A 2ID8A 2DX7A 4ZYXA 1EFDN 4H08A 2DRIA 2ZWMA 4HFRA 4R1OA 2Z3WA 5KSWB 1RVV1 2OG2A 1BE8A 3R6LA 4OBEA 1GZ6A 1A2OA 1Y1RA 2W2LA 4JMLA 3F2VA 4PU0A 5CVJA 1EBFA 1N6KA 1TMOA 4UQLA 3RTCA 1JR3D 1GRRA 3G8DA 4C03A 2UXDB 4N6NA 3SHQA 1J9EA 1RM5A 1GTMA 5JPDA 2O7QA 3KQMA 1YA4A 4JIMA 1F51E 1DU4A 2JHPA 5BVHB 1B73A 1W2WB 1U2EA 2VYQA 3QU5A 4H2DA 3GL9A 2IXEA 2K6GA 4K05A 4B4UA 3Q0TA 1C50A 5F64A 4GZ6A 3W1VA 4BNDA 1A8HA 5KQGA 4JJIA 4LBWA 2FYTA 5CB4B 3UMBA 5F7ZA 1E1LA 4BE9A 3HGTA 4BO6A 4PWZA 2C9MA 3ZLBA 4LRWA 1S8AA 4CKZA 3ILVA 1GA4A 2V55B 1BCRA 3PT9A 2C84A 1G9TA 1SNYA 2CJPA 3GLVA 4YLGA 4C7JA 4W9RA 3WLHA 3HCNA 4MWEA 1XKLA 3VVBA 4OMCA 1K9SA 6YASA 2AJLI 4JJ4A 3QOYA 1HC7A 4I2VA 4EEZA 5ILOA 3K8QA 2VBIA 2D7JA 3ZUPA 1WPXA 2FMUA 3WWYA 5HFNA 1SXPA 1COWA 1J90A 4XUGB 5EPOA 2R97A 4J6FA 4WK0B 3UOGA 3INYA 4BVFA 3BWXA 1WKVA 3JQ6A 2O7NA 2IEZA 3ML1A 3EUWA 4N6GA 5F1PA 4YHHB 3D4NA 4FKBA 1XDZA 2EL7A 3DDZX 3QY0A 2QLTA 3VJMA 4Z8YA 1H0KA 5K09A 2H16A 1HV8A 4UULA 3DWEX 1J1UA 5EIOA 1IH8A 1M1NA 3NDBB 1Z6AA 5AI8A 4BLVA 1NVVQ 4G4SO 4MUEA 1X1BA 3P9ZA 1JHQA 2JFQA 3TTXA 1P6QA 1IHOA 1XTIA 4Z4QA 4EL5A 1XYYA 1DAOA 1K08A 2ZBUA 3EDQA 3KPWA 3NR2A 1DIGA 1L5RA 3MFQA 4MJXA 3P4XA 2QM7A 5KKNB 2PFGA 2BM1A 4RULA 2CSUA 4BDSA 1Y8ZA 1EP3B 3NT4A 3BE6A 3L1VA 1SU4A 5A0TA 3PWTA 4PX3A 5HSGA 1AKYA 1Y6QA 1HTBA 4TS1A 2ORVA 4KTVE 3SHWA 4IKOA 1X0VA 3LMKA 1KI4A 1Y42X 4Y2TA 3OOEA 4Y9UA 2H7XA 3JAWA 4N18A 1GD1O 4BFUA 4JSYA 2ZVPX 2QY9A 3GCXA 5DF1A 1XRNA 3J80A 1G38A 4OD0A 4WFKA 2R8XA 3FPGA 4YROA 3T5GA 2ZYSA 4WRRA 1BFUA 4GKAA 3ROFA 3ZCQA 4EPRA 4YRNA 1YOBA 3HO6A 3E9EA 4B3RB 4D92A 4HWPA 3GFFA 5GJWC 3CB2A 3UMVA 1C4WA 4EVIA 2UYGA 2BI4A 4I5IA 3AR4A 2RG1A 1P1HA 2O0LA 3DZ8A 2WIAA 3II6X 2XYVA 4Q1BA 3KSMA 1VMDA 4RTMA 4NEHB 2ILVA 3E3AA 4NJOA 3AVTA 3NHWA 2H2IA 2YNMC 4LY6A 2AF3C 1GNLA 4XGIA 5BSGA 4BY9E 1FSPA 2HOQA 2HJGA 4YR7A 4Q4CA 3OQ6A 1H3FA 2I9PA 3E9NA 3PLAE 1EUCA 1DBVO 4HX9A 4N0PA 2QZ4A 4EB6A 1PHRA 1GXSA 1I3NA 2A4KA 3GNTA 1M6NA 4OQPA 4Q9DA 2GJ9A 3SXUA 2FSFA 2RH4A 3IV6A 2G4LA 4BVAA 1PAUA 3KQPA 4TTQA 5FIUA 4DTCA 2O2CA 3LT4A 1Y5LA 2PBFA 4JUAA 3L43A 3OFJA 2FPMA 2C92A 3L41A 4ZREA 1GVHA 1NVTA 2AEJA 2XCIA 3L4SO 2PUEA 3PITA 3A58B 4F04A 5B7GA 3R0VA 1RQNA 1K6JA 2JIMA 2H9IA 3IELA 3OZEA 1L7RA 4QOIA 4QYWA 2YJGA 5DEOA 4A91A 4L9WA 3U81A 3WAGA 3G9UA 3KB1A 3ZE6A 1JA0A 5KREA 1P77A 3GCWA 4GYJA 3H1FA 1Y98A 4LG1A 1GHTA 1Y8AA 1SPBS 2HUPA 3NBFA 3N2EA 4IFEA 2GRJA 4CT5A 5KWIA 2XD4A 1N2CB 1AZLA 2FF5A 5LVAA 1MW9X 1YR1A 2BM9A 3I4FA 3GGSA 1O2DA 3RSCA 1ECPA 4I1PA 1QYWA 1L4BA 2GLUA 5LXTB 2XSZA 8ABPA 4WAUA 3C70A 1XMOB 3WSVA 5BWCA 4TL8A 4NSNA 1N57A 2WAOA 4FT4A 5EP4A 1PTJC 2JAUA 1BE6A 3KDAA 3CWQA 3KSZO 3NEPX 1JDTA 3RSFA 2GLTA 2HCBA 3R5FA 3CX4A 4WT7A 4S12A 2X9GA 3WGQA 4MKRA 1LJUA 2R9VA 3CS3A 3ZY2A 4E2YA 1E9BA 2XZTA 3KNZA 3SM9A 2BBOA 5D6NA 2AOTB 1YQQA 4NJEB 3NIWA 3QE3A 3IOMA 3OM0A 3U7QA 2IHKA 4JQZA 5HQTA 1F8GA 1NNUA 1ORVA 1DCTA 4MPTA 4P92A 1WXIA 3OUTA 3THYB 3PGJA 3N7UA 3MTAA 2GN4A 2YHIB 1ES9A 3WMGA 4DIKA 4LCJA 4F1WA 4Y2VA 3NBZC 2ZJ0A 3K6JA 3QUBA 5EE9A 3FW1A 2PUWA 4P83A 2Z8XA 5GGXA 1FNNA 4EH1A 1MC8A 2A5LA 2FSIA 4OHKA 5DI3A 2BISA 5JATA 3CC8A 2WAYA 3TQHA 5JCPA 1ZA2A 1YTUA 1ISPA 2FZGA 1MDFA 1YQEA 1F9AA 4EJSB 1V8FA 2Q21A 2H4ZA 3S3TA 4IG9A 1HQYE 4XWAA 4PPQA 1E8DA 2A88A 4YMWA 1XEWY 3QVSA 5EKTA 1RYMA 2RGNA 4TZTA 4LQ4A 2LBPA 1E9VA 4FYVA 5LSAA 3MB8A 1UUFA 1JVNA 3DMFA 5DM4A 3FTCA 4M3NA 1TYEB 2BSQA 1U7WA 4WHMA 5JD5A 2JLAA 8GPBA 2NVUA 3A4YA 1AGYA 1USGA 2G8NA 2DBVO 1A96A 1LPSA 1Z0SA 5FPQA 1VA5A 5FULA 1NRIA 3RK4A 2C5EA 1WOMA 3LLCA 3CZMA 3M6AA 2UYOA 1FJXA 4RAOA 2LP4Y 5JS8A 4DDVA 2Q2NA 2DBZA 2D2VA 2VHTA 3KQKA 2F9FA 4OL9A 4B3CA 3ZGVA 1SD2A 2WM2A 3AUYA 4RZUA 4CKCA 2C29D 3M5CA 2G67A 3UHPA 4BMYA 2D8AA 2F1JA 1IEQA 1QZXA 1XA4A 1NNSA 4UTNA 1P91A 2YICA 5TX7A 4PLHA 1MX9A 2XVXA 3CT6A 4HMOA 3UAZA 5KYUB 1VE5A 1WZIA 1OGJA 3NOQA 1J70A 1E7WA 4PX9A 3SXJA 1FRZA 3I62A 3LLSA 5ED4A 3R41A 4A03A 4AD8A 1WW8A 3DDHA 1AQIA 1RLUA 3B9BA 3T61A 1C80A 3CWCA 3EPPA 3SC4A 5B4UA 1T2FA 1XI2A 3ORQA 2E6UX 1R4MA 3IT2A 4UEOA 1YI0A 2RBGA 4GOMD 1QH1A 5JJIA 3DAPA 3RS7A 5FRDA 3I6BA 2HBZA 1N5MA 2HHJA 1ISRA 3VR6H 5K4GA 4FE4A 4R0NA 1AK9A 2C5GA 4MUHA 1L9XA 2POQX 2FX3A 4XGQA 5CW1A 5JLAA 3S5JA 5I4BA 3R7WA 1LK5A 5JH7F 5JZSA 2D1SA 1O87A 3GEIA 3WGZA 1N33B 1N7IA 1DELA 1GPUA 4RLQA 1YBMA 4F86A 1SD1A 5AT1A 4CT4B 4GNKA 4L0MA 2PZJA 4MHSA 5D51S 3WP1B 3JRXA 3O1LA 1BX0A 4WUTA 4F3NA 3MS4A 3EGOA 2V9PA 5HZGA 2VHEA 4J16C 1JXOA 1PKEA 3T0GA 5JDIA 1G63A 4G24A 3I45A 2C2GA 3C5WP 4FYJA 4HLUC 3RYFA 3P52A 1KGSA 3A9VA 4L28A 5I3CA 4PF1A 1CR2A 1PKXA 2YN2A 1EDDA 3OH8A 4KSYA 1OZFA 2K2WA 3LRXA 3H9JA 5EE3A 5HW0A 3LHFA 4MDHA 3DPUA 4RSRA 2I0FA 1RMYA 1R1DA 2C9OA 2FEOA 2MSNA 2ZRMA 4L3OA 1KMHB 1PJBA 1VZ2A 4QEDA 2H5JA 4OHXA 4QIHA 3K71B 3PEYA 1RI3A 4K46A 4MCAA 1CFZA 3QU7A 3GRUA 3H75A 4FZJA 4Z2YA 3BXFA 3SNHA 1JHYA 3L7KA 3V6LA 2P0AA 3FPLA 3QVUA 5DWDA 1NFFA 3PUKA 1OWPA 3WFJA 3AEKB 3KVNA 1JG6A 4KJXA 3PKZA 2ZQZA 1EK1A 1PGOA 2YDYA 3PC8A 1KJ8A 4ZCTA 2CF5A 2P9HA 3O7MA 1G0OA 1I7SB 2WMNB 2ZUSA 3HYRA 4GP6A 4I81A 3OJCA 2WSIA 3D64A 4D8YA 1DUSA 1ODJA 4EUNA 2XRZA 1I5RA 1WS6A 2R11A 3V33A 2I7CA 1KJIA 5IF3A 1JXAA 1VL6A 3FTDA 3L7BA 4GXTA 5KHAA 4WY5A 4FBLA 4QTZA 1TUGA 1AMUA 3JTEA 4UNIA 4AF8A 2MINB 1WP9A 5KWVA 2JAWA 2BFBB 3EC2A 3VH1A 2FQWA 4ZYZA 4J0JA 3MMPA 2V7WA 3R7BA 1B3RA 2AD1A 3D7RA 4HDQB 1ISJA 3CRVA 2ZM6B 3TIIA 1S8NA 2DQKA 1GQ2A 2ZKLA 1KARA 2C8LA 3HNOA 4UNRA 1BX3A 4TMVA 1G19A 3IKTA 2WWGA 2WSMA 4KTTE 4OEHA 2IHNA 3Q6NA 1MX1A 2ZDGA 4EB8A 1DKUA 2HK8A 2QTHA 5DRTA 5EG5A 2I3DA 2C97A 1U0OC 1FLVA 1BX1A 2X8BA 2O8EA 3HLYA 2YJ6A 3KR2A 3FHJA 3H8JA 1HG0A 3SFZA 3QF4B 2RK3A 2NP6A 3WHPA 4BUJA 2ZRLA 1HE1C 1UP4A 1Q7RA 4PLVA 3TSYA 3UK1A 4EGJA 3O75A 3Q41A 2B9EA 2J7PA 1FX0A 1HDGO 1KSHA 1QM5A 1WSDA 2Q07A 3KKEA 3PLRA 4DIBA 1XLWA 2OCXA 4L4YA 3CEPB 1QOPB 1T8PA 3JQFA 1D2AA 1GTJ1 1NU8A 5L40A 4R3WA 4DCOA 1FTWA 4ONEA 4RO0A 4D2IA 3RUFA 3CUWA 1WXDA 4WKGA 5C8DA 2I65A 2A3RA 3AT1A 2IYWA 1EJ0A 1J2YA 4IIJB 1CDOA 2AC7A 3AL2A 1O0SA 2IY7A 1UBCA 3QVXA 2WSSD 4PC3A 5AXBA 5TJ9A 2EGHA 1N0UA 2QUHA 1MEJA 3ROGA 3U49A 1K6XA 4QTYA 5A5EA 3RQIA 3U0VA 3LHDA 4CT0A 4KDCA 1ZIDA 2GTIA 3K0EA 2I76A 3A9CA 3LH5A 2MYNA 4P7GA 4UARA 3NG1A 2IEBA 4HQ0A 2ID4A 2JS7A 1XPUA 3GCZA 3KZ1E 4WXHA 2NVWA 1KOLA 4EHHA 3F97A 3T9DA 4L95C 2IVZA 2GCNA 3CRNA 3INRA 1JYEA 5CP8A 4PIVA 3HJAA 4NULA 1YHZA 4QE3A 2A9PA 4FCTA 4R8VA 3WBBA 3HG7A 2D1FA 1OX5A 3L49A 3A32A 1KZ4A 1PWEA 3GGGA 2O8BA 2QJFA 2GZSA 3KM0A 4XIGS 2PV0A 5AVZA 1SXQA 4YUVA 2R8RA 1B15A 4P34A 2HU2A 3ANNA 1XTRA 2DC1A 2Z57A 2HL6A 3RSGA 1H22A 3KKZA 4AAYA 4Z86A 5IAEA 3T7JA 3JD1A 1FDOA 2OZLA 4MEAA 3LRTA 1RP1A 3ERCA 5HJEA 4PGGA 2HEGA 4KMSA 1ZVKA 4ND8A 3RDPA 1B2RA 3T34A 3QYPA 4KWTA 4M9XA 2J5XA 5B5SA 1OBFO 1TAQA 2F4NA 5BUCA 2VJBA 1ZMOA 1ZZEA 3EH1A 2J9GA 2VJMA 5C8YB 1A4RA 2FTKE 3VI3B 3A28A 1V47A 1J6UA 3OOWA 4KOAA 4NBWA 2ZIGA 4UVDA 5HIJA 1E98A 1KEUA 2X0JA 1QWOA 4GS5A 4TM8A 1VCMA 1EUZA 3GAMA 3VPFA 5LYYA 2BSXA 4LC0A 1OXKB 1NJ6A 1LZLA 3JRWA 3RSQA 3T9AA 4AMUA 3BD6A 3BCHA 4DR6B 1EVZA 1N2BA 3MRVA 4L07A 2VPTA 1JEJA 2A5YB 2MU1A 4EDHA 2ZI3A 1OXBB 4QD3A 5EINA 1E2MA 2JARA 2VRNA 2IQ5A 3LVFO 3OC0A 2YXNA 5JE8A 2Z6QA 4US1R 1VJTA 3HJCA 4KQ6A 4DLWA 4N5IX 5B64A 4BO2A 1XZQA 5I7UA 5JISA 1BXRA 3HI4A 2JW5A 1YBAA 4HB2A 1Z12A 3MAGA 5FO1A 4AKHA 1ULUA 2P6MA 2RI1A 3HRKA 4N40A 1GQYA 2NXWA 4GMFA 4JT9A 4O0MA 4IM7A 4POOA 2CT8A 1EFUA 2W4QA 2OA0A 4WUVA 1NHWA 3LJKA 4CCYB 4MTCA 2ZE6A 3CCFA 4M7WA 5KJCA 4G5OA 1ISGA 2WJAA 3HTXA 4NMXB 4DQLA 3NKLA 1K4YA 2FH5B 1JG3A 1TIPA 1FFHA 3TINA 4BMZA 1J99A 1Y5NA 4TL6A 1BOOA 3EWAA 3PC8C 1F17A 1MBZA 3WB1A 3GDOA 2CLFB 2P2ZA 3OETA 1FYWA 4PNZA 1LCIA 3TN7A 4BKMA 3C7DB 4U8GA 4JJKA 4UTPA 4TT3D 2XV1A 2PJRA 3LDGA 4O08A 4HMQA 3K9CA 4NZPA 1WHSA 3OJOA 3DBRB 2FN3A 3ASVA 5LQJA 1JG1A 5AVKA 4PNPA 4QWMA 4ILEA 2P3LA 3HM9A 3N3AC 4IVQA 2ZB4A 2P3OA 4Y6QA 3ZGLA 1T6YA 1E2NA 1MO2A 1NR5A 2WJHA 1U0GA 2J6HA 2WILA 5C0OE 2ZR7A 2YXEA 5KNCH 1TZ2A 1EVIA 2DUMA 4AP5A 4GH5A 2BCGY 1M1YB 1R50A 1K3FA 1A9RA 2OZLB 2WJPA 3AEXA 121PA 1U3VA 3PX2A 3B36A 3WKBA 5LJLA 1ZC4A 1DX6A 2Q1UA 2VDUE 1IPHA 1DBWA 2AOVA 3CV3A 5H7XA 5I7FA 5JC1A 4Q7JB 1F60A 1W0JD 2HMWA 4M7RA 1SJ9A 4J0EA 1C9EA 2PZMA 2WA1A 2JLWA 4FLEA 1YCHA 3WNQA 2W2KB 3FF4A 1A5AB 3LNTA 2PNFA 4CEJB 1HRKA 4FYXA 3DHEA 1FP4B 2RJOA 3AF2A 3OOJA 4QDJA 5IU6A 5JFTA 3QUSA 2O57A 5CDFE 3L0CA 2D3TA 3SYRA 2UZ1A 2IEGA 2WJ3A 1T2EA 3BERA 2MR5A 3IIJA 3VQTA 2YWDA 2HIAA 1KVQA 1OHHD 2X6QA 1PUXA 1GGVA 3QNMA 5FTJA 4CFYA 4D1YA 1MTOA 3C85A 1WUIS 5J4HA 3TEJA 4G5HA 1DKPA 3RRBA 3U3DA 2WB4A 1NE7A 3RS9A 4B3IA 5HIMA 1BVRA 2ICAA 1JKMA 1RZ3A 3AHIA 4A9AA 3SJCA 1GN8A 3FDZA 2VDJA 2VDKB 1KJYA 1O03A 3B5JA 3DAYA 1F1JA 2HYDA 3K0CC 1FFXB 3NCHA 4BRSA 1C1DA 1D9ZA 3N28A 3D4OA 3IERA 1P0IA 3B3FA 3NUZA 3GFGA 4UM9D 4GPTA 2IE0A 2FUNB 1RZUA 3WTBA 1LS6A 4N7JA 4WDQA 3AUTA 3M1YA 4I9FA 3Q7QA 2CFSA 3CH6A 5HXAA 3R0JA 2JJYA 1ZUHA 5IEJA 4R0MA 5B58C 1WUKS 1PQUA 1S3GA 3L7YA 4P2GA 3TL6A 2XKAA 4ER5A 2BI8A 2HN9A 2XUZA 5ARBA 1GKLA 4DSUA 2RARA 2BELA 4JEUA 4EB3A 4G85A 3LO5A 2MWMA 3R44A 3A1EA 4GKVA 4CQLA 3OY2A 1KRXA 4XGRA 1P2UA 5DH9A 4JFRA 4HMPA 5DN9A 3FVRA 3NBXX 2P9ZA 1DSSG 4G4GA 3Q98A 4CEJA 3ET4A 2I6GA 4ADSG 2IH4A 1H93A 3IJPA 3MTBA 4PYKA 2QENA 1XF1A 4WMLA 1ZH4A 2ETXA 4G84A 1XD2B 1TK3A 1QPZA 2QSYA 1LNSA 3MA0A 3PFIA 5KJ6A 4XLTA 2W6CX 3I42A 2XDYA 3JQ9A 4RTNA 2GMWA 2DHEA 2RC6A 3PNOA 4BN0A 2P6UA 1QV6A 4EEKA 3BCSA 3AY0A 3NTUA 2FK7A 2W6MA 2GDJA 2NSLA 5EZSA 2CNNA 2VG8A 1O94C 2YS7A 3FVTA 4A27A 2R68A 3PD1A 2C0CA 3RREA 4FYYA 4EQZA 3MTEA 2C4HA 3IRVA 5AKHA 5ALIA 2P6OA 5EIAA 3T4UA 3T1VA 4LNHA 3D1LA 2IYUA 3V5NA 4BMDA 2QW0X 2BGTA 5CFRA 1FNMA 1T5TA 1UWVA 4XVQA 1XKXA 1D03A 1NX9A 2DHQA 4LA4A 1IUNA 3D1JA 3R5KA 4TKLA 4ZTZB 4NMHA 3LTNC 3HSKA 4TVBA 5EE5B 1I3LA 4K8RB 3ROKA 3EGDB 2VPQA 1XEWX 4D4JA 5GM2A 2ECFA 1CDDA 1BHQ1 2I2BA 3DDWA 4XCVA 5JMTA 2ZJ2A 5DNCA 1E3IA 4RLSA 2HK9A 3PKJA 4D56A 1V11B 2ZRIA 4DARA 5IAOA 2ZBGA 2VTEA 3GNLA 4EF4A 1J0CA 1FC0A 2IITA 4MAMA 3LGAA 1AT1A 1QUEA 2B8NA 2FSSA 4U2CA 5D7NA 3DZJA 3Q85A 1BQEA 3LOPA 1P1KA 1YCFA 3WWDA 2I1VB 1W85B 1JBQA 3LQRA 1YS1X 1OX4A 2J9RA 5LPNA 4QGFA 2QX7A 1UMBA 3BJRA 2UUCB 1BTOA 1EM6A 5I4IA 4CF4A 2JASA 1PS0A 3B12A 3HWWA 3K4HA 4LXQA 4MPDA 4PGAA 5DSTA 1NURA 3GDHA 4XQ0A 3NH9A 1KH3A 4PQGA 1KY2A 3OEYA 5CYGA 5KWJA 3WXMA 4FW9A 3HNPA 3DAFA 1WTCA 2ZU6A 3T5PA 1APBA 2IRWA 4C78A 1GQRA 5EZYB 3OEED 4I7EA 5LWQA 1JPUA 1CKEA 2XUHA 3FDIA 4R4JA 3MTGA 2DTEA 2C5FA 4J0KA 5KJ1A 3FCEA 4FXOA 1P1IA 3OZFA 4CCWA 3D7KA 1VLJA 1P2BA 3F6EX 1DJLA 1O6CA 2EARA 3LNCA 2CK3A 3IHKA 3ZZ0A 4BLUA 5LDGA 4BUZA 1ZCFA 5KNBA 1ZRMA 1VL1A 1O6GA 3CTMA 3U5TA 1XMVA 4M1OA 5A02A 4PXSA 4B3TB 5EJAA 1RQ2A 3TKYA 1T0HB 3PFBA 2C9BA 4TLDA 1Z25A 2ZIXB 1MB0A 4L9RA 1BCSB 2B4KA 5E7MA 3WLOA 4GVLA 2VYVA 1FFSA 5FWXA 3FFAA 1LNZA 5KOYA 4NMLA 1O6BA 3GGDA 4ZVQA 1WLYA 4OP2A 5CA0F 2BFWA 2FPXA 1PJCA 4N1AA 3SDSA 4PBRA 4EJ2A 1PTKA 3FCYA 2ON6A 3B7WA 1KDPA 1RJ9A 1AHIA 2DH6A 2ORIA 3DGEC 1XTJA 3OT4A 4ID3A 4YIHA 1KAGA 3BD7A 5TF4A 4RA6A 3VR5H 1ECFA 4AWBA 5HGJA 4O4HB 3UGTA 3ZHRA 2G08A 3H5IA 1YACA 1ZK3A 1LEHA 1YK1A 2J5BA 4UU0A 3K0SA 2XHEA 4KRFA 5REQB 4IAOA 2F1HA 2OV1A 3KX2A 4LE2A 1OA0A 2X19A 1T8SA 1Y8RB 2D13A 2DY1A 5CBPB 2RHOA 2GOYA 1IN7A 3QPDA 2PD4A 3ABQB 1Q74A 2OD7A 2X40A 3HCAA 4HH3C 4KXUA 4NPAA 3LLUA 1Z17A 4O2BF 3KXDA 1WNFA 2YV2A 2KHZA 5E6SA 4EKIA 2OHGA 2PWBA 3D8RA 4INOA 4LE0A 4PBSA 3OU7A 3RM3A 4DLAA 4C5BA 4BX8A 2HLDA 2EBFX 2WDPA 1ORIA 3MRXA 3FPBA 3E05A 1Q0LA 1WCV1 3HCDA 2GBCA 2H11A 1W581 5DGCA 1TCUA 2X8JB 3Q2KA 2R84A 4DXDA 3DW3X 3C3AA 1POXA 2XNCA 3DAOA 3MCVA 2VK2A 1N4DA 2PGLA 1OQAA 3QQ5A 5BSEA 3WZMA 2ZS9A 4XXHA 1WXFA 4EPTA 4X66B 1WQ3A 2XKKA 2XUFA 4M49A 2EERA 3AVQA 4TGLA 3UFXB 2H1RA 3LXUX 1ENOA 4M1YA 1M83A 3GJ0A 3UWPA 2C5HA 3EOBI 4C06A 4BE4A 1QORA 1R4NA 1Z5ZA 5GONF 5KDLA 1CQJB 1KR2A 1UOOA 3C6ZA 3OEHA 1IHXA 3HKDB 2BFEB 2G70A 3L1HA 1VPWA 2H2WA 4GMGA 1TA4A 2RSLA 2BM0A 2CFOA 4LDNA 4O4LB 5CFLA 1NIPA 1Z37A 3TECE 2Z04A 3ZVNA 1H0RA 3IAHA 5JO9A 1W6RA 2WICA 4IQGA 4K88A 3NHFA 3P0IA 4J94A 3BCRA 4WLOA 4AS2A 5NLLA 4C21A 5KEIA 2FPOA 1EINA 5D1HA 4ISBA 3V8RA 4CE6A 1YDEA 2ATEA 4KK3A 5FQOA 3SIPA 3H2YA 5KIAA 4N76A 1BC5A 3ESYA 2HMTA 3D3JA 2HSZA 2QBYA 3N2GA 5JZ9A 6REQA 3JQFC 4Q4HB 3PNMA 4QXQA 5LP1A 3GWGA 2XWQA 4TTSA 1A2BA 2OHXA 3R1IA 1ZZGA 1S2GA 2HB6A 3PEEA 5F76A 2MTBA 1ACLA 3HEAA 3K1AB 5KVVA 1NKSA 3B89A 1L7OA 3PZBA 4E13A 2BGIA 3ZQUA 4BV2A 2P7HA 4FQ5A 2X8LA 3P9SA 5THXA 5LQUA 2LWIA 3QG5A 1UM8A 4QJ4A 2V7VA 4LJKA 3RIEA 4P31A 3WGUA 4G5SA 5ED0A 4E5MA 4P0TA 1A4IA 3T38A 3JVUA 1SQ6A 1YA8A 2OSBA 3SJBA 1SC3A 5TE9A 1KYIA 2R6JA 3KU1A 2PMDA 3M3PA 1AKMA 4NQRA 5SY9A 2BSAA 4EY4A 1Z5OA 2IPXA 3W5UA 2GUGA 4EHIA 4Y2HA 5JWHA 1HY3A 4G4IA 1UC4B 4FWTA 5BV2P 1D3AA 3DEFA 1PLKA 3ZZTA 2W2TA 3M8KA 5T6BA 2Q6TA 3AHHA 4A0SA 3DFUA 3DHWC 3TI7A 2VNKA 1U8EA 1RXEA 1V5IA 4P4LA 5AI5A 1VYUA 2P6PA 5TLSA 2Z1DA 1GAJA 1ZJWA 4BQSA 5DYGA 1LBQA 1ZD9A 3UHOA 3ZIAA 1G291 3PQ5A 4KFTA 4RCVA 1BE0A 5F3DA 3R9KA 3HR8A 3PDJA 3OY7A 3LX5A 3UCEA 2OXRA 2PT7A 1MVOA 3PCRB 4EJ6A 1QOZA 3S1LA 1HL7A 3KPJA 1IIBA 5C1IA 1PK8A 2EU8A 1BEZA 4G0VA 1R4MB 2E1RA 4BFWA 1XL1A 4I36A 3DOEA 4HL6A 5IM5A 4CV2A 5L3QA 1PO7A 1UMBB 2Q5IA 1JHUA 2ZS7A 3L07A 1GTVA 2VYVD 1U2SA 1M7BA 1ZY2A 1YVDA 2CWDA 3IV7A 4GNRA 3W7AA 2EATA 1AA9A 1W44A 2H65A 5IJ9B 3OUZA 4FWIB 5AI4A 5GVRA 1PSDA 3GEPA 3GRRA 4C08A 4EHFA 4B43A 3W5IA 3HB9A 1Q5PA 3GN2A 3G2LA 3HJTA 1QHEA 3IMKA 2HA0A 2G9UA 2RBKA 1FBNA 1UBEA 1UEIA 1Z6YA 4OM8A 4EFLA 2HYIC 3QVLA 4J0HA 3W4KA 2CUNA 4JX8A 4MQ4A 4A82A 4QDTA 1D6JA 3L6BA 3C6YA 4MV6A 3E5RA 2XA9A 2IXAA 3AF1A 5LA6A 4YDHB 3K1AA 2H1CA 1K86A 5CA0A 4Q7LA 4B33A 4YAKA 5KX5F 1D4ZA 4TWJA 4ITVA 1BU5A 4N03A 3U3XA 3KHTA 1XRRA 4QAJA 5BUSA 2GB4A 3WAKA 3DVLA 4BFXA 4UQOA 5IC4A 1R0YA 2OOKA 4QYTA 4HZUB 2UXCB 4S0ZA 4XKJA 1ZS9A 3W2IA 5DE3A 4ZI5A 4U9IS 3LF1A 1IHYA 2XTZA 4X94A 1B42A 1N34B 1FZQA 1DQNA 4TZKA 1CTQA 5FWYA 3QNWA 1I2BA 2G72A 5AVVA 2VP3A 3COVA 2DH5A 3KVYA 4O1HA 3TLCA 1I51A 1SO8A 3QU2A 2B5OA 1KY5A 4HDSB 4OHFA 4NJMB 4GP7A 3VSCA 4E2WA 1PL7A 4W5NA 4R2JA 2RCNA 2WUWE 3VMFA 3B51X 4HEQA 2PUFA 4J7CA 1AN0A 2HDWA 3AF5A 4TMWA 2VEDA 1XZCA 4YASA 2KBFA 1YZHA 4MRSA 1P7PA 3Q3CA 4HQRA 5EYPB 1IDN1 2HY7A 3DONA 4EKGA 4IV5A 1ZOOA 4OX9Y 2H7CA 5JNVA 5MGNA 1TZCA 3HDHA 3LWZA 3NLLA 1XHLA 4HRAA 1TRKA 2BFFA 3FGNA 1ZSNA 2WTBA 4CKBB 1T36A 2B36A 4IDQA 1YMQA 4GPAA 3QOFA 3NS7A 4PS1A 3FNBA 2E1PA 3SSMA 1UKZA 1ISIA 1LK0A 1QLWA 3GVHA 4PC1A 3Q3GE 1YB6A 1X7WA 1D2EA 4RLFA 5IKPA 4X1OA 2G5GX 2QOEA 2RGNC 2VWGA 4KV9A 1V1RB 3GVXA 2DCUA 1FFXA 3K7EA 3TR6A 1XT6A 1CJMA 4PAQA 3H9QA 4ZIRB 1YIDA 3A3OA 1OU0A 3CGGA 2YZ2A 2G9NA 1X1SA 3P97A 2Z83A 4IDCA 2QD4A 3UJ6A 2QAGA 4NBUA 5A5DA 4KW7A 3RC1A 5G0VA 2F00A 1YJQA 2IYEA 4UMVA 3TJZA 1V3QE 4Y9TA 4BNJA 4ENQA 1ZR2A 4QO8A 1OR8A 1D2HA 1YS6A 1SXJE 1L8OA 4CMGA 5B7PA 5CCXA 4ZT6A 5BN3B 1CEEA 4FT2A 4URHA 5H4HA 4MIKA 2QNRA 3DM5A 2HGSA 4KC0A 1M8GA 1VQ1A 3FAZA 4C0JA 3MGGA 3R5XA 2FG6C 1L9KA 2C98A 1Y7TA 5G0SA 1CW2B 2R8BA 2QNIA 4K9SA 1V5GA 1QIMA 4OHVA 4PIMA 5KVSA 1G5RA 1NJFA 3GVPA 4ZARA 4F46A 2YXDA 3AIOA 2ZT8A 2HCRA 2ODAA 3PPWA 4MW2A 4N8DA