4KYVA

Crystal structure of dehalogenase halotag2 with halts at the resolution 1.8a. northeast structural genomics consortium (nesg) target or150
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
303
structure length
297
Chain Sequence
HHHHHEIGTGFPFDPHYVEVLGERMHYVDVGPRDGTPVLFLHGNPTSSYLWRNIIPHVAPSHRCIAPDLIGMGKSDKPDLDYFFDDHVRYLDAFIEALGLEEVVLVIHDWGSALGFHWAKRNPERVKGIACMEFIRPIPTWDEWPEFARETFQAFRTADVGRELIIDQNAFIEGALPMGVVRPLTEVEDHYREPFLKPVDREPLWRLPNELPIAGEPANIVALVEAYMNWLHQSPVPKLLFWGTPGVLIPPAEAARLAESLPNCKTVDIGPGLFLLQEDNPDLIGSEIARWLPGLAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags De novo protein
molecule keywords dehalogenase HaloTag2
publication title Northeast Structural Genomics Consortium Target OR150
rcsb
source organism Synthetic construct
total genus 91
structure length 297
sequence length 303
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-05-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4kyvA00
2XMZA 5DNVA 4C4ZA 4DMCA 3BWXA 5FDFA 4U2FA 2IITA 3FVTA 3DDUA 3FVRA 1TRHA 5AOCA 2PKYX 4BE4A 1L7RA 3CCCA 3HRHA 1R4ZA 4BP8A 2VAXA 2LIPA 1IMJA 4FNGA 5T4FA 1FFAA 2BJHA 3O95A 4LYDA 1L7AA 5HF5A 3G9XA 4CIBA 2B9VA 1GPKA 2HADA 4L72A 5ALQA 5CT5A 5T4BA 1CUUA 1XRNA 5CW2A 3HI4A 1E8NA 4X85A 3I1IA 4H35A 3WL8A 4GXNA 4AN1A 4TGLA 5FOQA 3ESAA 1GQRA 4UBJA 2WSLA 4OB7A 3I2GA 1WPXA 1BU8A 2JEYA 2QUAA 3FLBA 4PQEA 1CUFA 3PUHA 2RIPA 4UBMA 4DYHA 1Q0RA 1VXOA 1WB6A 1ODCA 4EY7A 1ZIYA 3FNBA 5D3KA 2QXTA 2ZJ7A 4DMKA 5A7HA 3F9CA 1P0IA 2AJCA 2HA0A 2YYSA 2VAVA 1BS9A 4L9AA 4K5QA 1VZ3A 5AKJA 1Q0ZA 3UUFA 4BTLA 1X70A 1QIDA 5AK3A 2UZ0A 5CH3A 5AKIA 4QDTA 4LHEA 4BRZA 4J0KA 3VDXA 5ALMA 2BKLA 5AOBA 1QIFA 4X6YA 4Y2QA 2WIDA 4N8DA 5SYNA 1E3QA 2I3ZA 3O4GA 4WY5A 1CUDA 3R40A 5AKYA 1LLFA 1OCEA 1MT3A 4IH9A 3PUIA 4W1QA 3EIOA 3D4LA 1CUIA 2FJPA 1QJ4A 1DT5A 4GWLA 2YASA 2BUAA 4U2DA 2PL5A 1DWPA 2QVBA 3MUOA 1JFRA 3V1MA 4Q3LA 3PE6A 4B7ZA 1W76A 1CUXA 4F21A 5HZGA 4UBOA 1TCCA 5ALNA 1YB6A 4EUSA 3R3YA 4HZGA 2H7CA 1MO2A 4E46A 3FLEA 1GXSA 3L1HA 1Q84A 3H17A 1SCKA 4IO0A 1ZI9A 1XZCA 2YXPX 2ZSHA 3VVLA 4UUQA 1NU8A 1VKHA 1FSSA 2XUHA 3EQ9A 3LP5A 3KWFA 3SK0A 1HQDA 1USWA 2BCEA 2I03A 4E14A 4HXEB 2PX6A 3WJ2A 1YA8A 4AB1A 1XQWA 2FX5A 4J3JA 3C43A 3WWDA 5HF9A 1VE6A 2PVSA 3B12A 4UFNA 4GEGA 1AGYA 3WLAA 4G9EA 1CUHA 3NOXA 4EBBA 1A8UA 1G66A 4AN0A 2WM2A 5ALFA 4W1SA 4CCWA 3SC2A 2G5PA 4KAFA 3VKFA 5DTIA 1EB8A 3D2BA 1MAAA 1RWQA 1SFRA 5HF8A 1SC9A 5ALLA 2GBGA 1W4LA 2ZVDA 3QPDA 1FFBA 4FLFA 5JALA 5HK8A 1ZI8A 3WL7A 1D07A 1N1MA 1YSCA 3A2MA 5LZ5A 1EH5A 2JGLA 4Y2YA 1CR6A 5LZ2A 4MQLA 4Q34A 4OB6A 3UMJA 1A8SA 5ALVA 3OOSA 5AI8A 2WFLB 2E3JA 3HYSA 2BGRA 4U2CA 4ZV9A 3AIMA 1U4NA 1RP1A 4OCZA 1ZD4A 1UT6A 4UBKA 4WDQA 4A5SA 4WDRA 1ZJ5A 5LZ8A 1R3DA 1MPXA 3PF8A 1ZD3A 4KE8A 4BCBA 1JI3A 1XRMA 4EY4A 1JKMA 3ZV7A 1XRPA 1ODSA 3E0XA 3EF3A 2OAGA 1LPMA 2WU4A 1YAHA 3H18A 2Y2UA 3FSGA 4OU4A 1C7IA 1GZ7A 1J1IA 2ROQA 4BCDA 1IUPA 5CTAA 3AZOA 3WIBA 4X97A 2XB6A 2CJPA 1Q83A 1OILA 1XQVA 4Q82A 2PSDA 4DGQA 1BCRA 4BZWA 2ZYSA 3A6ZA 1WM1A 3QH4A 2QRUA 3R3WA 1VA4A 2W6CX 1U2EA 3FYUC 3I28A 3IIIA 3ZLUA 1P0QA 2XUAA 2B20A 1VE7A 5CBKA 1U8EA 1XZBA 1ZJ4A 3I2KA 4DSZA 3PFCA 1EA5A 5C8VA 3KD2A 2HA2A 1O6FA 3IB3A 5BWCA 1E89A 4PV7A 2HM7A 3ZPXA 1N5MA 2ES4A 5LKAA 4G8DA 3STVA 4OD0A 4A16A 3Q8WA 4MWSA 2OGZA 4HRYA 4CCYA 1CQWA 5AKHA 1WHSA 2RAUA 4PO3X 4WY8A 4X6XA 1VA5A 4K6KA 3CCBA 4X7BA 2WUGA 1TCAA 1W6RA 2PM8A 2ACKA 2CEKA 5H3HA 2OGTA 1UK8A 4B82A 4TVKA 1TAHA 1MNQA 1SCQA 3B3QA 2IIVA 5EFZA 5IVKA 5ALEA 4WFIA 2ECFA 4DTCA 3G9TA 4UBNA 3BJRA 5C81A 3S8YA 1MX1A 5C8XA 1K63A 1XZEA 1K8QA 1GPLA 4O08A 2ZYIA 3H04A 5K3FA 4BVJA 2FJ0A 4MYSA 2PUJA 2ZJ6A 3U0VA 3DCNA 4BDTA 1F0NA 4Y7DA 3WK7A 3WYNA 3K2IA 2OCGA 4CCYB 4TPKA 2QUBA 3WKCA 5DYYA 1N5RA 5HF6A 5JZ9A 2DR0A 2C0QA 1EB9A 3FWHA 3HC7A 4J0HA 1MN6A 4KJXA 3C6BA 4UBLA 3DL4A 3O9VA 3I2FA 3ANSA 1YAJA 1W75A 4H7EA 5LP1A 1UK7A 2PSHA 1PJAA 5CRIA 4DNOA 1M33A 4J03A 1NU6A 5AM0A 3I2HA 1J06A 4ZI5A 4OYLA 5K3FB 4Y2TA 1GGVA 4J0JA 2Z3WA 1WPRA 4F5ZA 5CH5A 5AHXA 3F8SA 4H0CA 3MVEA 1ZGCA 4BATA 2JBWA 4UFOA 2WFMA 4WJLA 1CUVA 1IZ7A 2C5GA 3HEAA 4Q05A 4G4JA 4Y2JA 2CUTA 4KACA 3WZMA 5BV7A 1XZHA 3I2JA 5EGNA 3V9AA 1CUAA 3O4IA 4FNMA 2QM0A 3H2IA 5CT9A 3ZI7A 2NW6A 5ISMA 1ZI6A 1H2ZA 5AK5A 4W1RA 5AI9A 5A7FA 1CV2A 3D7RA 2PBLA 4UBIA 1R88A 3WKEA 3BF8A 4ITVA 2Y6UA 3MUNA 2CMFA 2QR5A 1H22A 3CN7A 5DLPA 2PUHA 2WUDA 4BZZA 1CUEA 4GECA 5KREA 4H7HA 5JD5A 3VJLA 3WK8A 3AFIA 5AKZA 3WQHA 1JMYA 1G5FA 1LNSA 2HHAA 3RLIA 3NUZA 2H7XA 4XX1A 1XQYA 2XMQA 2DHCA 1E5TA 3IUJA 1LPNA 4B9EA 4B80A 2PSEA 3F67A 4QLOA 3WWOA 5J3JA 5LYYA 3AIKA 2XUQA 5AM1A 5FLKA 2DHDA 3WJ1A 3FSGD 3C87A 3IURA 4QDZA 4OB8A 1IUOA 1KEZA 2BGNA 1HDEA 3NGMA 4MQMA 1AC5A 1DQYA 1MNAA 4HXFB 3AIOA 1G4HA 1B41A 2JIDA 3DNMA 2C5FA 2DQZA 2DFPA 3ICWA 5K3BA 3RKSA 3WWCA 1QOZA 5CMLA 4RPCA 2VEOA 4G4GA 5AK4A 2VATA 4G4IA 1FFDA 2K2QB 5LZ9A 4BAUA 4KYVA 4DNPA 4X90A 3A2LA 1CUJA 5LZ7A 1IUNA 3HABA 3BIXA 3ESDA 2BFNA 1ORVA 2HL6A 4AO8A 1BE0A 3H1AA 3H2HA 2XUKA 5JANA 5JATA 4N8SA 3Q0TA 1P0PA 3DYVA 4FDMA 2OQIA 1ISPA 2X76A 2XDWA 4L3WA 1DWQA 3WYDA 4I3FA 4M0FA 1CUBA 4X93A 4UHCA 4U2GA 5ALYA 2C4HA 3PDCA 4AXBA 2GYWA 1LGYA 4KRYA 1F0PA 5CT8A 2D5LA 3OG9A 3AUKA 4KR0A 2OLEA 4ZGBA 1WCYA 1KU6A 4GI1A 4QDUA 2HA3A 4NMWA 3S2ZA 4M0EA 4JYPA 3HJUA 3R41A 4YASA 5DTJA 3QYJA 5A2GA 2XMDA 2AJDA 3AZQA 3G0CA 1XQXA 5I9IA 1K4YA 4LIPD 4FLEA 5IKXA 1VXRA 3C5VA 1PFQA 1CUSA 3M3DA 1ZD2P 2OCKA 3V1KA 3M81A 2WHRA 3N0TA 1XZFA 4AZ3A 3RK4A 4Y2XA 4X91A 1CFJA 3W04A 1T2NA 3KXPA 3FOBA 1QO9A 3QMWA 4BYMA 1EDEA 1LZLA 2JEZA 5JARA 2XUOA 2IX9A 2XUFA 4N5HX 2XE4A 2O7VA 4QA9A 3QPAA 1WB4A 3NWOA 1CLEA 5K3EA 4MJ3A 5HFNA 1FJ2A 3JYHA 5CT6A 5AH0A 5EHXA 5AKXA 3WKDA 1QFMA 1DU4A 1HPLA 4ZRDA 4L0CA 1TK3A 4B0PA 3H2KA 1H2WA 3W06A 4EB0A 4PSCA 3BF7A 4MEAA 4FKBA 2OPHA 4P93A 4G1FA 4WFKA 1LPPA 2J3QA 4Q3KA 1LPOA 3WL5A 4F0JA 3ICVA 4QLAA 5JAUA 2XLCA 3R3ZA 4HTAA 5BOVA 3EQ8A 2HRRA 5ALDA 3FLAA 2BUBA 1RYYA 2HA7A 4OPMA 1ETHA 2QKYA 4U2BA 1R50A 4INZA 1CPYA 1CEXA 3RARA 3R3VA 1UK9A 4HRXA 4I4CA 5ALKA 5ALSA 1UKBA 4OYYA 1UZAA 1XZJA 4DM7A 5IVDA 4BDSA 2Z5GA 1UOOA 5BWBA 1MX9A 4LXHA 4H18A 4V2IA 1DT3A 2B4KA 3EQ7A 4WCVA 1J2EA 4EY6A 2VTVA 2Z8ZA 1A88A 4YK7A 3JWEA 2J3DA 4DLNA 1N8SA 3MGAA 5FRDA 2P8SA 2RONA 2GYUA 1K6EA 3C8HA 5KWJA 2AXEA 5IH7A 4OU5A 5ALPA 5T4EA 1EHYA 2ZYHA 1P0MA 4FFWA 1DINA 4DNFA 5SYMA 5I7UA 2RHTA 5FXMA 4P92A 3STXA 4NZZA 3ESCA 4B81A 1HLGA 1EX9A 4C87A 1UWCA 5LIPA 4CIAA 1CQZA 3M82A 1MU0A 4B9AA 5JAHA 3VXKA 1TQHA 3CXUA 4JNCA 5AO9A 4H77A 1YB7A 4GW3A 3DS8A 3H19A 1R9MA 5HK9A 2VQ6A 2Z3ZA 2XQFA 4G8BA 4HAIA 4P9NA 2WUFA 1G42A 4UHFA 4N8EA 2WQZA 2QS9A 4S0XA 1CUCA 4Y2SA 4BTVA 1ZGBA 4G5XA 4J0IA 4F60A 4BB0A 4J0CA 3DQZA 3G0DA 4PSUA 4WFJA 4RE5A 4HVTA 3U1TA 5AK6A 2XMCA 3C5WP 4X71A 3I1YA 4ETWA 2FUKA 4CI9A 4EY5A 3IBTA 2G63A 2V97A 5AI6A 2XQJA 1BEEA 1YS1X 1EDBA 3LCRA 2R11A 4IQ4A 1QZ3A 4C88A 3KWJA 5KWIA 5F4ZA 4E11A 4KE9A 4FOLA 4AZ0A 6YASA 3STTA 3X3HA 3EBLA 1FFCA 1UFOA 5DNWA 2JGIA 2QJRA 1QIHA 3C8DA 1JJFA 1ZOIA 3A70A 3KOOA 1XKLA 2JF0A 4J0GA 4KE7A 1GT6A 5EIEA 2PPLA 3C45A 3GROA 4PNZA 1XZKA 5CXUA 5CURA 2PSFA 5JIBA 4FWBA 1XLUA 4ARBA 1XZLA 2V98A 5EHZA 3PICA 4BP9A 4AX4A 5K5EA 5EI5A 1JU3A 3WZLA 4ZV7A 5JAOA 4ROTA 2VT7A 1XRRA 4UPDA 3WWPA 2XQIA 1H2YA 1EI9A 3N2ZB 4I19A 5AM2A 3BXPA 1QIIA 2RI6A 3PF9A 3E3AA 2O2HA 1CVLA 2VJCA 3ANTA 1TCBA 4ZWNA 1AZWA 1E8MA 3IUNA 3D3NA 3WK4A 5JASA 2CBGA 2WUEA 3BDVA 5AIAA 2VJDA 5ALTA 2H1IA 4BVKA 3AZPA 1THTA 1DQZA 2XT0A 1ODTC 2HU7A 4J7AA 2AJLI 4BCCA 2GBFA 3VISA 2HDWA 3FBWA 4UHEA 4X00A 1FFEA 1Y37A 1I6WA 2YH2A 3DKKA 3QBJA 4G9GA 5A62A 4B83A 1LPAB 2ZJFA 1W52X 3ZWQA 1Y7HA 2QXUA 2Y6VA 1Z68A 5AM4A 3FYTA 3I6ZA 3V1LA 3D5EA 2XUIA 4JUIA 4NVRA 5HKBA 4K2AA 5EHQA 3BJMA 3E1GA 3H0CA 3A2NA 2V96A 2PU7A 4B6GA 3HSSA 4C4XA 3C6ZA 4FBLA 4K6GA 1EINA 3OC0A 3SX4A 3IA2A 2O2GA 3FAKA 2B61A 3STYA 1LBSA 1SCIA 1BN6A 2ZYRA 3OPMA 2QOEA 5ALIA 1QLWA 4IH4A 3WK5A 5LLSA 1YA4A 3T4UA 1K5PA 5EIHA 1QE3A 3DOHA 5K3CA 1TIBA 2G5TA 4X95A 1SOMA 1AX9A 2W22A 1JJBA 2R8BA 5DYWA 4CG2A 3TRDA 1QIGA 2WU3A 2ACEA 4KE6A 5AJHA 4DMHA 2JGEA 4LXIA 4MEBA 3F98A 2OXEA 5JZSA 3VJKA 3LIPA 1XLWA 5K3DA 4CG1A 1BN7A 4Q1VA 1L7QA 4ARAA 2VF2A 3GBSA 1CUZA 1MTZA 2WTMA 3WA6A 3HZOA 4H7FA 4PSDA 5CXXA 4MXDA 1OXMA 3DEAA 4K6HA 5FPQA 4QWWA 2DQYA 5CT4A 4W9RA 4P08A 2ORYA 1UKCA 3VVMA 4N5IX 2XUJA 1CUWA 2DSNA 1BCSA 4W1PA 4KRXA 3GA7A 1QIJA 3WWEA 3IVMA 2GZRA 1WOMA 2QZPA 4QDXA 2WHQA 4QNNA 2GZSA 2QJWA 3WI7A 5A6VA 4X3CA 4XIIA 2WJ4A 3WMRA 4GBGA 4AQDA 4BVLA 1PV1A 1DX6A 1DX4A 2WIJA 3L1IA 3F96A 3IUMA 3IUQA 3H1BA 1QIEA 3DL7A 3FYUA 1UOPA 1BRTA 2GYVA 5AM3A 4BE9A 3K6KA 3H2JA 3ESBA 4CG3A 1UOQA 3PI6A 2O7RA 3BE8A 1W1IA 5I8PA 3QZUA 4C4YA 4Y2PA 1DWOA 4X6UA 3D2AA 1GPNA 2DCMA 1XKTA 2I3DA 1X2EA 4OUKX 4UHHA 4GHWA 5K3AA 5JADA 2WIKA 4XJVA 1ZIXA 1QFSA 3P2MA 4RNCA 3R3XA 2J4CA 2HFKA 3O4HA 2C58A 3FCXA 7YASA 3QMMA 3BIWA 2C0PA 4HS9A 2XMSA 3WK9A 1XRQA 4YPVA 2X5XA 2GBCA 5LKRA 3G0BA 1LZKA 2H7YA 4FHZA 3OURA 2QT9A 2EEPA 2JGKA 1A8QA 3WKAA 4QDOA 5ALUA 5ALWA 4PF1A 4IHAA 1O6GA 2JGJA 1QIMA 3AJAA 3W9UA 2WHPA 4HXGA 3FYUB 1TKRA 4FBMA 3C6XA 4KAJA 4MYDA 5E4YA 5AP9A 4C6HA 5JAPA 4FMPA 4MWTA 3WIOA 5IVIA 4JEIA 2XUGA 4Y2UA 5AKKA 1ZICA 2XMGA 2HU8A 1AUOA 1JMKC 1VOTA 3B5EA 1ORWA 5AM5A 2WFLA 4BAGA 5EHNA 4EA6A 2XUPA 1VZ2A 3KSRA 2O2IA 3G9ZA 3O4JA 5AICA 2Y1KA 4UHBA 1MJ5A 4EZIA 4GDMA 3WA7A 3QM1A 1AQLA 4M0MA 4QWMA 5AI4A 5E4TA 2QTBA 1CIJA 2HA4A 2HIHA 2BAGA 3M83A 2C7BA 4U2EA 3C6YA 3JW8A 3BL8A 3GZJA 3WK6A 4AMZA 3D59A 4XVCA 1KU0A 1E66A 3STWA 5IVHA 1HKHA 4E15A 2WJ6A 1QTRA 4YX9A 1BEZA 1IZ8A 3STUA 3ILSA 2Z8XA 3UUEA 3W2TA 5HCUA 3CN9A 4XWGA 2WHPB 4Y2RA 4BAZA 2BUCA 5ALXA 5C7YA 1WHTA 5CH8A 1ACLA 2XMRA 3DJYA 3TJMA 2RHWA 1EVQA 1AMNA 2CKMA 2OCIA 4DNQA 1UKAA 2JGFA 1JJIA 3G9UA 2CB9A 4X92A 4B0OA 1QO7A 2WTNA 2OCLA 2WJ3A 5AI0A 3ZLTA 3V48A 3VJMA 3DYIA 1VLQA 5E2IA 2I78A 2JGMA 2Q0XA 1R9NA 5YASA 4QEKA 2HU5A 1EXWA 1CRLA 2VJBA 1XZAA 1YS2X 1MAHA 4DMFA 2XLBA 4IH1A 2HA5A 1HBJA 3O0DA 3V1NA 1XZGA 1QIKA 1R1DA 3G02A 3GFFA 1J07A 5AKLA 3WL6A 5FUMA 3G7NA 3TEJA 2WG2A 5AOAA 3W9BA 1JT2A 2H9YA 4BBZA 1AKNA 2PSJA 2PU5A 3ZLVA 2GBIA 3F97A 3HXKA 4JYMA 1UK6A 1LBTA 4BC1A 1YR2A 3HLKA 5ESRA 1HL7A 3T52A 4PW0A 2WIGA 5DYTA 4ZREA 1ZD5A 3TGLA 3DD5A 4KEAA 4EY8A 2QMQA 3HACA 2HFJA 4EHBA 4DIUA 1NX9A 3I6YA 5JD6A 1XZIA 2X8BA 4BC0A 5FV4A 1EK1A 2EDCA 1XROA 2WG1A 2XUDA 5JD4A 1U65A 1C4XA 3D2CA 5ALJA 4BRSA 2G4LA 2XQGA 5ALGA 3QMVA 1YASA 5ALOA 2XMBA 2OQVA 5D7BA 2VA9A 5LZ4A 4JH0A 2ZSIA 2WKWA 4FFVA 4QZVA 3BDIA 4J0DA 3H2GA 3LS2A 1A7UA 2WILA 5A7GA 4H7IA 2RGUA 5FPPA 5FP0A 3G0GA 1ACJA 2VSQA 3QVMA 5HKAA 4FTWA 4G8CA 2WG0A 1B6GA 3G8YA 5AIBA 2AJBA 1JU4A 4Y9SA 2D0DA 1CUGA 4RGYA 3I2IA 4NS4A 5C8ZA 5HQ3A 1EK2A 3KDAA 2OGSA 2WFZA 5FKJA 1XZDA 3PFBA 3RM3A 3OM8A 1DTEA 1XFDA 4AMYA 3SWWA 4B84A 1WB5A 2XI4A 2WIFA 3LLCA 5ALHA 1QONA 4Z49A 5ALRA 3O9MA 3GUUA 1EDDA 4FLMA 3IULA 4Q3OA 4C89A 1GKLA 5AI5A 3FCYA 1H23A 4B85A 1LPSA 4Y2VA 3C70A 2J4FA 2VJAA 1IVYA 5DWDA 3ED1A 4D9JA 3QITA 2HA6A 2ONCA 4X94A 4A23A 3AILA 4H7JA 3DLTA 2OG1A 3W05A 2HRQA 1F8UA 4OSEA 5JZBA 1S8OA 5DJ5A 2CZQA 4AO6A 3I6MA 5D3ZA 4H7KA 4CFSA 3IDAA 5AKEA 1C7JA 5KBYA 1Y7IA 5D6OA 3GELA 1BROA 2XQKA 4ZXFA 5HQ3B 4LXGA 3G0IA 2V9ZA 4W63A 2Y2VA 1F6WA 4GLBA 5HFAA 5E4JA 3WKBA 3YASA 4AO7A 4DSAA 1MX5A 4QE3A 5JYCA 1UXOA 1LPBB 3R0VA 1T4MA 1XRLA 3DKRA 5AKGA 1VJ5A 2OAEA 2VT6A 5A71A 1QTIA 4KAAA 5ALZA 2EDAA 1QGED 3LIIA 1YCDA 1THGA 1E8DA 1GKKA 3E4DA 1X2BA 5DNUA 3K9BA 2DHEA 1CUYA 3AINA 3OTQA 1AURA 3D0KA 4UHDA 4LKOA 5EIAA 2WLSA 3L1JA 4UFPA 1XLVA 1EVEA 1GQSA 1XZMA 1H2XA 2AJ8A 3R3UA 4RE6A 3QPCA 5T4HA 4LYEA 4C01A 3DOIA 4H7DA
chains in the Genus database with same CATH superfamily
5TGTA 4C4ZA 4ESOA 1CCWA 5FDFA 4L50A 1T4DA 4N6GA 1K8ZB 2EL9A 2FR8C 3DF7A 2I4RA 3FVRA 5IUKC 1WMEA 3I4CA 4MUFA 5LYJA 1UT5A 2PKYX 2OFXA 3GT0A 4U1RA 5CFNA 4KLNA 3C5EA 1DGQA 3M1AA 2I6GA 1J0BA 2GCPA 2PKCA 1D2AA 2O1XA 4ZVPA 4QJ3A 3W2HA 2ZG6A 3ISJA 5FO1A 1IOZA 3R0JA 5FWYA 1E1CA 1HA3A 3CLRC 4HLNA 5J2TF 3MCZA 4FNGA 4L3OA 2BDTA 5FNZA 2IFTA 4CG3A 4IX9A 5E9JA 2ZUDA 1WSWA 4WCFB 5JYEA 2XSZD 1KQGA 3IXQA 4S35A 3LLMA 1BO6A 2CWDA 2BJHA 3O95A 3MLAA 4LYDA 5IT0A 2H08A 1QZTA 5HF5A 1T3ZA 1W36D 4RULA 5HTOA 3IIMA 7GPBA 1KKMA 4TLBA 1ZK2A 2NVUB 1U0JA 1CWUA 4U0KA 3M5WA 1QGOA 3FNGA 4JMPA 3RC1A 1Y8RB 4OHKA 1M6WA 1II8A 2B34A 1MX3A 3AM4A 4RH3A 5KTYA 4H35A 1C0IA 1C0PA 2YJZA 3B1ZA 8LDHA 1P7ZA 2I6TA 1U9YA 2FR1A 2YIVX 1JRLA 3FYCA 3WNVA 3ZIDA 1GQRA 5DW0A 2H5LA 4UCXA 1VKZA 3V80A 4OFBA 2PUEA 121PA 1E9DA 4O2RA 5EZ6B 3E22A 3W8EA 4LYFA 1KPGA 2OBLA 3EF0A 2J8ZA 3MT0A 3GZ4A 2B4QA 1DZ3A 4UM9D 3F3KA 5FOTA 5IDVA 5TQ0B 4KOEC 3A4TA 3X1YA 3JYQA 3QKTA 4DSOA 1SOVA 2H59A 2WJPA 3LWBA 2OFPA 2O5EA 1F8FA 1IH8A 1V16B 2RIPA 1BWSA 4G5RA 1DCKA 2NU6A 2Q3DA 2OAP1 3PRHA 4DYHA 1C41A 1Q0RA 4DDMA 1CQXA 3BRQA 4II2A 1P5RA 2XWPA 2ZULA 2Y92A 1NMSA 1QHXA 3KUCA 1R64A 3IV9A 4MYCA 3HH8A 3VHRA 2JAHA 3NM5A 1I7PA 3E58A 3L6CA 5IWAB 4IGIA 4G0NA 3MINA 4X3OA 4D0RA 4RNDB 5D3KA 3T3GA 2QXTA 3GP5A 1H2FA 2B0JA 4XTRA 3K8QA 3F9CA 1PX0A 1XYYA 2C9ZA 3T94A 3BXZA 1JLLB 4IDAA 1KSGA 2VFAA 4M1SA 3HVJA 3QXHA 2AMVA 1KDRA 5I9BA 5AVKA 1TQ4A 3FF4A 2Y1WA 4N3NA 5LLSA 4AM8A 4DXAA 3KSMA 5HG0A 3CR8A 3QV2A 4LJRA 3FSJX 5BPHA 3ZU6A 5BSKA 1J0DA 1RZ3A 3ZCUA 1C1XB 1UFVA 5ESXA 4Q9HA 4CM1A 1N2IA 1Q0ZA 2JI9A 4CMJA 2P6PA 2QX7A 4YJ2A 1TYBE 5LPNA 1QIDA 5AK3A 1IN4A 4JGIA 4WZZA 1EEXB 5BURA 4MZDA 5KNBA 5GOTA 5L7YA 5JO9A 1HDZA 1NURA 2F1HA 4FMDF 5CH3A 4PCUA 3IKJA 4A1OA 3R6DA 2A88A 3PE3A 4C06A 4TZTA 4D8TA 1N7IA 3ILVA 1K86A 2EFYA 3KHTA 3W1WA 5ALMA 3SQXA 2BKLA 2FHSA 5A03A 1J21A 4X6YA 1DC8A 4IXDA 3LGXA 5FCDA 4Y2QA 5EPUA 1PNOA 3QMPA 4R31A 4ZYXA 5ARBA 1Z36A 2WIDA 3EMKA 4KMMA 2WVGA 3L4SO 3WB1A 3ZCQA 2YNMA 1Z6PA 2OQ2A 4MO2A 5B37A 5SYNA 2NNWB 4TKLA 3ZBTA 4KNYA 3A36A 4MUIA 3DB2A 1XMJA 3MJCA 3LRTA 4RZ2A 5M3BA 3TIIA 4Z7OB 3JAWA 3R40A 5AKYA 5B4VA 3PXBA 5BPFA 3L7CA 2Q6LA 1IG0A 3BMCA 4FMBB 3VR5H 2QAGB 2YN0A 5HIAA 1IBRA 1PGQA 5JO0A 3PUIA 4W1QA 1Q1EA 1QOPB 3FPAA 3PNPA 4DLBA 1QJ4A 1DT5A 1W93A 2REOA 5B1EA 3L4JA 3C85A 5KCZA 4LNAA 3EPKA 5JFGA 4TUYB 4II3A 1GCAA 3D6JA 3D5TA 2YASA 5KVVA 1W0CA 3ND5A 1U2DA 4HMOA 3IUEA 4JOCA 4KZPA 3ZTTA 5HZKA 4KYIB 1G8SA 1H3NA 3AT1A 4YAEA 3ZBPA 2ZTHA 3QWHA 4EKYA 1E6KA 2AW3A 2VRWA 2C95A 3MTIA 1E69A 1N57A 1Y8CA 2AZTA 1V3VA 1CX9B 3PE6A 4Q3LA 4WOPA 5DEIA 3RRJA 4ZDJA 1CUXA 4HLUC 5JBNA 1X1AA 4GD3Q 2NUPB 5K8LA 3E7WA 4I55F 5DDIP 4UVEA 4M0DA 3RABA 2RBGA 2K2WA 1NNI1 2RAFA 3X2SA 1W9HA 4IGFA 2JBHA 3GI1A 3KJFA 3ZIAA 3LUPA 2CNBA 4GC9A 2P79A 4AMVA 5CDTA 5ITZB 4IINA 1MO2A 1YDHA 4E46A 5FI1B 1E18A 3TI7A 4FKZA 2VSOA 4KDFA 3FLEA 4ZI7F 2QX9A 4L6CA 4DLWA 5B3LA 1ZUHA 4V0SA 3L1HA 3NTUA 3PR1A 1Q84A 5EMKA 3S7ZA 3T4EA 3WYFA 4DZZA 2FQXA 1AN0A 3ZWYA 4IO0A 2Q6VA 5EIWA 2I8CA 2QMUA 4F45A 5E6UB 3ZDAA 1NI5A 3HCBA 4MUNA 4RSGA 3ETCA 5DM0A 5K0GA 3GO4A 4HNAB 2BR4A 1F06A 3ADCA 4PQFA 4TRRA 1VKHA 2D3WA 2G4CA 5K05A 2EGHA 1SURA 2GGSA 1D2NA 4L4SA 1GA6A 3BGDA 4JLJA 4BNJA 5ICEA 4DJ5X 1DRKA 4NHEA 2QAJA 2ATIA 5FOSA 5KOYA 1Y8QA 2P75A 1TQ8A 2BKXA 3MBKA 4BVEA 5CNJA 2AXNA 4HDAA 5H68A 1EVYA 4MKRA 4MVJA 1P77A 2H4WA 1RAIA 4UVGA 3EIFA 4RTMA 2FFJA 1JFVA 4KTTE 1YA8A 1RAFA 1ZW1A 4G4SO 3RC9A 2DWCA 1BTOA 2PYIA 2X9GA 4HQNA 4ZHQF 4X41A 5L95A 3F7MA 2Y67A 2FX5A 2Q27A 3NATA 2HJWA 2RGYA 5L7WA 4FGZA 1WCIB 4J3JA 4TWBA 4QPZA 4AJ2A 5CX1B 4HEA1 1OIVA 1V7ZA 2GJ8A 2C61A 3AYZB 1VE6A 4Y6LA 3ER9A 3B12A 1AGYA 2G9RA 3ZE2B 3K1AA 3ADBA 2RD2A 5DIFA 5TLSA 1JG4A 1CUHA 4NEQA 4EM6A 1GGJA 2LR0A 1A8UA 1G66A 1L5HB 4LG1A 2G80A 3TLGA 5KSOA 4KXVA 1NVBA 1JZTA 1JTEA 3N2LA 5K6AC 1WMFA 1WVIA 2X42A 3CZRA 2EGUA 2UVQA 4W1SA 4V1CI 5JISA 2Z6QA 4JV5B 3SC2A 4QOFA 5BVHB 3R7LA 4FZVA 4Y9RA 1KEEA 4KAFA 3UB3A 5DTIA 4UUMA 3BXEA 3D2BA 2Y1XA 1QRSA 2H1SA 3A1EA 1NJ5A 2FK8A 4RUKA 4EYGA 4B32A 2HK8A 4QT0A 1NWHA 2WTXA 1P7CA 5GGYA 3SVZA 4ARZB 2XY4A 3T7DA 3RC2A 5I47A 2GBGA 3GRFA 3FNFA 1MABA 2WV9A 3MN1A 5JXWA 2WF9A 5E4FA 3EIHA 3NJRA 1Z16A 5KYTA 4Y0AA 5EEHA 1SMKA 3CF0A 4OIMA 4GNRA 1GXSB 5HK8A 3WL7A 4QUEA 2KWIA 4YS6A 3S2SA 1IDOA 3TCKA 3UB4A 1YSCA 4KGVA 2ANBA 1EH5A 2JGLA 2QY6A 3V4ZA 5LZ2A 3MM4A 3OLWA 2B8EA 2P9GA 4YXWA 4ZAXA 1NXTA 1OPRA 3I30X 4MQLA 4L22A 4CODB 5FAKA 4NZOA 4Y8VA 3ZD7A 1DKPA 1NP7A 1T4CB 1YQDA 1ZJZA 2R97A 2ZJYA 3D7SA 1RRPA 3JD2A 4FGWA 2D8MA 4IIJA 3QQ5A 3QUBA 2V7GA 1PNRA 1PBTA 6REQB 5HJ5A 5DFAA 5KEIA 3HDYA 3UMYA 1L4KA 4Q21A 3ZVNA 3H7AA 1BYUA 1DBVO 3O91A 4I1SA 1NWCA 1U3UA 5CLGA 5BXQC 2WFLB 1HM5A 2E3JA 1GZHB 1P3JA 2BGRA 2LKCA 3BJIC 4K3UA 4HTFA 4NESA 1XE3A 3KQMA 1PQYA 5BN3A 3H75A 1Q12A 1ZLXA 1JEAA 2Y99A 2QQEA 4TTIA 5BQFA 3IAM6 4HAVA 1U5BA 4P7KA 1F7UA 4BJ1A 1RRMA 1JSXA 3ZK7A 1PVDA 3IQWA 3LRXA 4LWZA 2V8OA 4E2ZA 3DZ8A 3L0SA 4P5DA 4AKSA 1VDZA 5HGJA 1RLOA 3NBMA 3CVXA 3THYB 2V9PA 1DC7A 3HHPA 4QYXA 2Y4OA 4RJ2A 4D1YA 4EJ0A 4G67A 4REQB 2FMUA 1U0HC 4I66A 3B6MA 1SUSA 3HUDA 4N6OA 1N5IA 4JJIA 1MPXA 4ZQBA 5F77A 3M6XA 2Q6KA 1J2TA 1PJBA 3PF8A 4KE8A 4YT8A 1AS0A 3Q3EA 4LHZA 1JI3A 4H1VA 3B6KA 2VSFA 1W4RA 1PFWA 3TOXA 1PD1A 3HB1A 4HN9A 4LMAA 4M37A 1MGOA 4IJQA 2ZS8A 4OX9B 1N3LA 3KALA 3LA8A 3R4CA 4X84A 2R87A 5F3DA 2V0GA 1U3WA 5CIYA 1KMNA 2GJKA 2JBAB 3OPVA 4V1CB 2PQ0A 4RK5A 2BMWA 3U3KA 1RCUA 3T1HB 3DLHA 3KQSA 2LDXA 3ZXYA 3OQMA 1RNLA 3V42A 1D6SA 2CLLB 2OAGA 2HJSA 4RMGA 5ERYA 3RS2A 2O8CB 5LOVA 3TUJC 1V5GA 2BBSA 5CIWA 1OV4A 4A15A 1WABA 2P4QA 5I9LA 1ZM7A 2CXHA 1S4MA 3QWBA 4JASB 2PH1A 4TMYA 4UZFA 1RQNA 4OU4A 5HFJA 5ABPA 3FRJA 1DRUA 1W5BA 1M1YE 1NQWA 1ZMBA 2EZ8A 2OM6A 3ASYA 4ZVSA 4ND8A 1ZMXA 5PNTA 3ZXXA 5IM4A 4KSYA 3MERA 5AW7A 2QV0A 4ZK2A 1N2HA 3ZVKA 2I2AA 1I4LD 3JQFC 4N54A 1RQGA 5CTAA 2XX3A 4PBTA 1KSFX 2AC2A 4QXRA 5EJ9A 3RYCB 2CJPA 5EUMA 1NXXA 1QYRA 4H9GA 4B2IA 4CM8B 4GOOD 4KTVE 1XQVA 3B3AA 2C5AA 1FFXB 2NO9A 3GYGA 2B9EA 2WKSA 3KC2A 3IMGA 3M89A 2Z8YA 4KK3A 2ZRBA 3KYJB 4B7XA 4DLVA 2A33A 4JA2A 4PX5A 3U3XA 3UUGA 4EI7A 2ZYSA 1V71A 4MDYA 2VYCA 1UKYA 1NYTA 1XO1A 3DM5A 3E8MA 4XGKA 1EUZA 3FCOA 1KH3A 3H16A 4M7WA 3NAGA 3PKZA 3QHAA 4TTJA 4CQMA 3IQFA 3U2QA 3RHTA 1BHJA 5AFSA 1XTKA 3HY6A 1YZKA 2R6DA 2W6CX 1Z08A 2WWTA 3L6OO 4XWYA 3K94A 4U00A 4WLEA 1H1TA 3W77A 1KYIA 1ZDMA 1AT1A 1SC1A 2CJFA 2JC3A 1M1XB 5JAIA 5KDOA 5LNK6 4UASA 4E30A 1ZU5A 4J8PA 1U8CB 4G1CA 1EUDB 5AVQA 2N75A 1Z88A 5C0OE 1V8BA 1HDRA 4AYXA 3Q9NA 4DDUA 4Q19A 4P4SB 1DPFA 5IEJA 3MJRA 2BZ1A 4Y1EA 2N3ZA 4QIHA 3NC4A 3ZHBA 1U8EA 1XZBA 2P35A 3A4LA 1OD6A 4GGMX 2JVJA 5FHQA 3KAJA 3I2KA 4DSZA 3PFCA 1MLDA 1ODIA 2YBEA 1A69A 1SZJG 4F97A 4LDZA 5C8VA 3FLMA 5E9AA 2BSQA 2V6IA 4AJJA 2RCNA 2AZDA 5EKUA 2HA2A 2PS1A 3UXEA 2XYGA 4LF4B 5IKEA 3HWRA 4CF3A 1P19A 4DOMA 3AVYA 1O6FA 4PGHA 4AX8A 5K0CA 4LZWA 1JR6A 3VRHA 1ADYA 5JAMA 2MHCA 4XDZA 5KCMA 3VZBA 5GONA 3B8EA 4G56A 4B6QA 2XRZA 2F8SA 2B92A 1HSOA 2HM7A 2CDNA 3ETLA 4Z9FA 2GVDC 4QYSA 1OTYA 1YR3A 2VTKA 3B1FA 3IQXA 3L4KA 1XWFA 5LKAA 5FL7A 2A59A 3AI3A 1P2TA 3Q8WA 3HJRA 4MWSA 4MRAA 3RYIB 1DAFA 5AKHA 3JWPA 1BW9A 2NTEA 2MSCB 3O3NB 4U02A 2B21A 4Q1EA 1PWEA 5IYZA 4S1WA 4B73A 4CT4B 1ZUD1 2RSLA 3LH5A 5AD1A 2QM7A 3GBVA 3UF0A 1SXPA 4EW6A 2QU7A 4MQEA 1ZVQA 2OKGA 4Z1MA 3SC4A 3CLHA 3MYYA 3UWOA 1JIJA 1EFRA 3HMKA 5KNBD 4RD1A 1M1UA 1CQPA 5EMJA 4DG9A 4HDKA 2MSEB 5C1BA 1W6RA 1F12A 2JKZA 4LTNA 4QXMA 5DK4A 4RKQA 5EJ2A 3TPCA 4WK0B 3IEPA 1Q57A 3KKMA 4XX0A 2OXIA 4BIMA 1UIMA 2JAPA 2H4ZA 4OM8A 2OV3A 1I3MA 2A30A 4QAJA 3Q4GA 3HKEB 2ZZMA 2OT3B 3OQPA 2Q50A 1VL5A 2GZ3A 3K09C 5F76A 4O3FA 2QW8A 5DI3B 4C0JA 4M55A 3CEMA 2XCQA 3UHJA 1TZ2A 2NTJA 4MVYA 3C8UA 2YNMD 2P9FA 4GRDA 1UMCA 3IQIX 3ROQA 3AQIA 3RJZA 4B82A 2YYAA 3JVIA 4QKQA 1Y9ZA 2AQHA 1ZCBA 4CHGA 5ALEA 2O0KA 2Y1CA 4WFIA 2WWVD 1P31A 3KJHA 2QSYA 3IQDB 3ZKWA 2JLCA 2VHCA 4H4CA 3KTAA 3ND9A 1WUJS 3OMLA 4O4HB 5ICFA 1E63A 2IEIA 3S8YA 1EGVB 1FDRA 3N9IA 2RCYA 2JKVA 1BNCA 4ZQHA 2QLLA 1YU6A 3BCRA 4HGPA 3ZCXA 3KUDA 3I9LA 4XGIA 3JZAA 1R12A 4MJLA 3A1UA 4MQFB 1U2RA 3VJRA 3JYNA 2FAXA 4EARA 4LF5B 2ZYIA 6GPBA 3MIZA 3GEBA 4Y67A 1LRLA 5HKLA 1CQJB 1AUQA 5E95A 1R5JA 2VQFB 3H7IA 4WOKA 2GJAA 1L5GB 3UHFA 1G9SA 3TLKA 5JDCA 1GU7A 1N6IA 3UAOA 1VJCA 4A27A 4K8OA 5KTNA 4RD2A 2J41A 1GZSA 3MTEA 3VYVA 4Y7DA 3OOHA 2P78A 4ZMBA 3FETA 4XOUA 4Z99A 4TX1A 3K9HA 4NENA 5HKOA 4LRTB 1I9CA 3WYNA 1B00A 3ZIAD 3RJMA 4G65A 4YRLA 2TMGA 3KQNA 2H1OA 4CCYB 1L4GA 3IH5A 4IHJB 2QUBA 2YHUA 4OY3A 4TPKA 1G9TA 3T3MB 1PDVA 3ZQKA 3WKCA 3LLVA 3LT1A 3TW8B 1BDMA 1GPDG 4YRSA 3FZYA 2BMVA 3LC2O 4ENPA 2GMWA 3G82C 2NUBA 4KQCA 1N3BA 3DONA 2CMDA 1GA1A 1T36B 1PL6A 2C0QA 2JASA 2UKDA 3AR4A 3FROA 1EB9A 4R1PA 5DBEX 4DQ0A 1KZGB 4LSGA 1CR2A 1A9ZA 1XCGB 2WU8A 4JP2A 5EIFA 3BXHA 1E62A 3CBQA 2E1RA 3I2YX 2J9XB 3ZHTA 4BO5A 5I4KA 3EAQA 2FN9A 3PL5A 4L0QA 4TKZA 2W43A 1NJFA 4JLWA 3CE6A 3ESYA 1MN6A 1V2HE 1NOIA 1ZO8A 2EFHB 2B99A 7MDHA 5J4YA 4PPQA 1YZYA 5HBGA 5KKNB 3ETJA 4QRHA 1JDJA 2I4TA 2P5UA 2PAFA 3UKJA 2BMAA 5L6LB 1T9ZA 2JI6A 4Q93A 1L3CA 4TWRA 1EWQA 4MVJD 3O1JC 4BNFA 5IZCA 4D98A 4A82A 5CD1A 3LLUA 1OFVA 3J7TA 4IWNA 4K9LA 4FYWA 3WAJA 1TFUA 5KTRA 1NP3A 4Z0NA 2GCNA 4RAOA 3RH0A 3ZDBA 3VKWA 2NAPA 1T1IA 2NMVA 5A6SB 3R7AA 1QK4A 4LYJA 1A8IA 3WIUA 3KQPA 2CB0A 2IEZA 4B47A 1K27A 5CRIA 5HHTA 1JR3A 3GCXA 4PPFA 1JV2B 2B7CA 2OPBA 2YYZA 6AT1A 5BV0A 3W5UA 3A4IA 3EJWA 4RTLA 4B6FA 1U80A 1AKTA 3I2HA 3PD7A 4CCAA 2YMQA 3NDIA 3HFRA 3CNLA 1FUUA 3MRSA 1A04A 1WNTA 4OYLA 4YJ3A 1U0GA 5CDUA 1VPWA 4L5AA 1W36C 1UJMA 5LBUA 1WPRA 3CUVA 3L06A 4NOJA 5CH5A 2JCXA 4OJQA 3F8SA 3TDKA 1QTQA 3RSSA 3U61B 1JEQA 2G5CA 1PKEA 1RJWA 2QT1A 1RXCA 3DW1X 2JBWA 1TADA 3JQAA 4IRMA 4UFOA 4J2TA 1CR0A 3P0FA 1HQCA 3T9FA 4WJLA 2FWNA 1HFEL 3FGNA 3WFJA 4CIVA 3U7HB 3G5LA 2VPTA 4M36A 4ND1A 5JR3A 2CCKA 3RRYA 3SDBA 4RA6B 1R00A 1ZITA 4BX8A 2CUTA 1OE0A 4L2IA 1JEYA 4D9IA 2K5UA 4C0QC 1H8EA 3PDHA 2PRSA 2D13A 2D59A 4BNDA 1X80A 3FDIA 2XRMA 1OX4A 2OHJA 4EHJA 2VH1A 2WQ6A 2Z43A 4FNMA 1NVVQ 1XEXA 2FPIA 1MXHA 1XQ6A 1AKYA 3TTSA 1C30A 4ZD6A 2PKXA 4FUTA 4O1MA 1TT7A 2C31A 5LJIA 5FAXA 2JAOA 3H97A 1Y3AA 2X6TA 4TQUS 4RCVA 5ANRB 3AWDA 4YXWD 1QE5A 1WMDA 2GKSA 2NW6A 4S05A 4U3JA 1CG6A 3FRHA 3VFDA 4IS3A 4QPJC 5A7FA 3I9MA 4KXFB 4JQYA 4NY1A 5EJMA 4MUEA 4P36A 2ZIEA 4UBIA 2BVNA 1R88A 1ESCA 2H0RA 2OD2A 1H5NA 2Y1FA 3AQ4A 4JVSB 3TEMA 4RKRA 3UJCA 4BP1A 4MR7A 1ZRNA 3MUNA 1R0SA 2CMFA 1OFGA 4MPPA 3EDRA 3UWMA 1H22A 4A10A 5JJKA 2RHJA 4NV1A 1O5OA 3AM5A 3ZXIA 1M3SA 1Q0HA 4GL2A 2PT9A 2VJKA 2YZMA 3V97A 2AD5A 1I36A 2P8JA 3S7TA 4ER5A 3UT0A 2YDYA 4I4LA 1NTOA 2EJCA 2IUEA 4K9PA 1PEDA 3G49A 1IE3A 4JBGA 1WDTA 4NCHA 1KQOA 3AFIA 4WBXC 3VJLA 3P9QA 3X1JA 5HX7A 3RU9A 1JVNA 1F4VA 2XCSB 2FEAA 1JAIA 3ESZA 3LX6A 4FC7A 5CM9C 3RG2A 4B3DA 3BZUA 1NXSA 3ME5A 4NWIA 4HFNA 1K97A 2Z0MA 1FJXA 1XQYA 4HN2A 4HC4A 3OLCX 5JSZB 2AFRA 1XJ0A 5BR8B 1VL8A 2OP1A 3C3XA 3BCHA 2DHCA 4GPIB 4HAWA 4C6SA 2YZGA 1U3TA 1U6JA 2J6CA 3LUHA 5IJ0A 1JMVA 1HE2A 5J4KA 1MR3F 4ZICA 4FP9A 2ERYA 1Y1QA 4ZQEA 5E1BA 4LF7B 3IBFA 5I7AA 3VPAA 1T2DA 2FOIA 1QP8A 1PLJA 2FW6A 4B80A 2G09A 5B6JA 4HQ0A 1KTIA 4G1MB 3V32A 4MUGA 2PANA 3KJNA 3SVTA 2PH7A 1S2NA 1OYWA 2ZRKA 3KSUA 5LXTB 2QLTA 3F67A 3TR6A 4ZJZA 1SUWA 2IV2X 4W4TA 1FYVA 1X7YA 3NANA 1VB3A 5FYQA 3AUSA 4QJIA 2M1ZA 3R9IA 1OASA 2VPIA 4QAQA 2IDZA 3NBQA 3SQWA 1XTQA 2DHDA 4I50B 5DIZA 4LDNA 2D0OB 3IURA 4HP8A 4OB8A 2O06A 1ZEMA 1P9LA 1KEZA 2LVBA 1IXRC 1HDEA 4BRWA 1AC5A 1XVTA 1IEXA 1G4HA 1RAGA 2INGX 2JIDA 1ANKA 3FH0A 3OIVA 4HK4A 4KIJA 2FEKA 4GOMD 4GX0A 3PEYA 2DQZA 2PX0A 1I5OA 1KYTA 2R47A 1ISFA 1TEVA 4MUXA 1J99A 1GRCA 2BEUB 4XYBA 5D84A 5K3BA 3WWCA 1QOZA 2Y71A 3S2IA 5CDFA 4G4GA 3F7OA 1XU7A 3F1KA 2CK3A 3DV9A 1HDXA 2Z4SA 2ZYAA 1FFDA 3D8UA 4G4IA 1MD9A 4BAUA 2A4MA 2JA1A 5JT1A 3QJ5A 3BTOA 3BQMB 1CY4A 1N2JA 3C6MA 3LUGA 2BTEA 3HABA 3BIXA 4XRRA 5A9SB 3SZMA 4IXMA 3TAXA 3RS5A 3MC1A 3ZWVA 5B7NA 4OHWA 1WXEA 4C0AC 1OROA 1FY2A 1MCZA 2C99A 5DX8A 3X44A 2UZ1A 3ONDA 4PLTA 1GZ5A 4YMIA 5T6BA 2WKPA 2NYRA 5F33A 2ZSDA 3IFSA 4BXOB 3DYVA 4L4UA 5L51A 1LU9A 2FR0A 5LQCA 2NU7B 3I5UA 1P60A 1VLZA 3CX8A 3NRBA 1FUEA 1KJZA 1V4BA 2GJ4A 4LAFA 3UBMA 5KQRA 1U90A 1DWQA 1PSWA 1KY5A 4FFBB 1U1DA 4RJTA 5M34A 1R0LA 2YZKA 5AT1A 1HURA 2GK6A 4BHTA 1W59A 2PAAA 2XJ4A 3GPDG 3K0BA 1CUBA 2R2AA 1WXIA 3GLFA 3G2QA 4HZIA 4UHCA 1HLPA 1AKMA 4WECA 4FD3A 3CZQA 3A27A 1Y7PA 3KZ1E 3MMXA 4OKIA 5DGCA 3OZVA 4ENVA 4QVIA 1RC8A 5JLJA 2FWPA 3LBHA 3PDCA 2HLDA 4ZVRA 2XZDA 4GOXA 3B7GA 5IJ9B 1Q74A 2NWQA 4GVPA 2DJIA 5DYGA 1QHEA 4S0ZA 2GM9A 3URKA 4ND3A 1TJ5A 1OLUB 4FXOA 4G0OA 1DG3A 3OG9A 1BX0A 1MJFA 2H2HA 2QZ4A 3K73O 4BN0A 1KNXA 1SG9A 3DZDA 2CHVA 1M2OB 4OLJA 1P3Y1 4WK6A 1CHDA 5EXTA 4C08A 2UUAB 1WIWA 2FE4A 7MHTA 1EXDA 2Q4RA 4JBNA 1PG2A 2FG5A 1EFHA 3B6ZA 1F2DA 3W0LB 1G20B 5FL7D 3KHKA 3LDFA 4CMEC 1NMZA 5KHLB 4PZ0A 1E0SA 1RFGE 1NHWA 1MGPA 3KYDB 2Z57A 4DQDA 3TNDA 4ZHSA 1BWQA 2OV2A 1K8XB 3NYQA 5EKSA 1Q50A 1YJ8A 2O2YA 1RM5A 4AMUA 3NUGA 1Y82A 5DNDA 3ZWCA 3AU8A 4IW3B 4EJ6A 4R1SA 1BWRA 5C80A 3N5CA 4OQZA 1ZM3A 1CQIB 1W4CA 2C1ZA 1DHTA 3I37X 3ROMA 3FMPB 2D7JA 1H2BA 2ZIZA 1JG1A 2W2XA 3LF2A 4MA4A 4OHCA 4Z1MD 1EFRD 5DTJA 3BD8A 4P82A 4MK4A 2HHLA 3QU4A 1JHOA 4AAYA 3UPUA 1GFIA 1POXA 1P4GA 4UNQA 1L1RA 2HXGA 2VL7A 4N01A 4LIPD 2CHFA 2VJYA 4KQ6A 1K7YA 5IKXA 3RUAA 4BL5A 5JEEA 1VXRA 3RS9A 2GNPA 1PFQA 3M3DA 1T6ZA 3P7MA 4YAIA 2FSIA 4OSPA 4A7PA 1CBUA 1Z2NX 4M22A 4PFQA 2WHRA 2YW2A 3RSQA 2W8BA 1W5AA 4RELA 5GWXA 4IVRA 3RSFA 4AZ3A 2QG6A 4KMSA 5BT9A 3GFRA 3KKQA 4PR3A 4M9UA 4N0PA 4AJOA 4CIYA 1EIWA 3MPUA 3HVKA 2YVUA 1QQBA 4R2XA 1IXZA 1WXDA 1Y81A 3WHPA 4LYHA 5AXAA 1YQEA 1JPVA 2EYQA 4FFDA 2RGEA 1GNSA 1T2NA 4LRYA 3TE7A 1N6RA 1QO9A 2R7MA 3N2GB 3QMWA 2B6HA 1EDEA 2FP4B 2I0FA 3H5LA 4MO9A 4PLHA 5J1TB 4FE3A 1I3OA 2JEZA 3RVPA 3X2FA 4BX0A 1QK3A 2CNWA 4NPAA 4UD2A 2IX9A 4LDQA 4N5HX 5IAAA 1RWWA 5AYVA 2LE0A 4JVMA 5MF6A 3R3SA 4EZBA 1D6NA 1NYLA 1O0CA 2O3RA 1IZZA 5K3EA 1MAVA 2CL5A 3V1UA 4BJ3A 3H9GA 1HT0A 1YE3A 3LP6A 1LTQA 4E31A 3H99A 4A0FA 4XPZA 5AH0A 7ADHA 4Q1FA 3TGPA 2I3BA 1A50B 2VZ9A 2EC5A 4Y98A 4A8HA 2FX2A 2YWCA 3BCUA 1U0NA 3FWKA 4P7FA 2YV3A 2H1LA 4PU0A 2QYHA 1L7OA 1CP3A 4ZRDA 2PN1A 3PHJA 1UADA 5BOSA 1XHEA 2DH6A 2ZUEA 4KNVA 4MVJM 4EB0A 1H2WA 4I81A 3VI4B 4PSCA 4MEAA 4KR7A 2ZUUA 4G1FA 1NFFA 2WP8J 3L77A 4WFKA 3SU8A 3QRWA 1LPPA 4Q3KA 2VNAA 4E03A 4EQ6A 1RE0A 4D3DA 4Z7NB 1UQTA 5L8VA 1DOAA 1JH8A 4QLAA 3OSUA 2XLCA 4HTAA 1JX6A 4CKCA 1GD1O 2V6FA 3CF6R 4CQMD 2X7HA 1E7WA 2UUOA 3EQ8A 4DLUA 4E88A 3HB0A 4XUDA 5T6MA 2OP0A 4OP3A 3CRQA 5SY4A 3RK1A 3DZJA 5DNCA 3ZN2A 3KR0A 5JXHA 3FLAA 4ZTZB 2MYPA 3DDNA 4U5QA 4BO7A 3C3BA 3R6LA 2E87A 2BLNA 2ZAYA 3MWJA 1BGVA 4UTXA 1GILA 3SJ7A 1T9HA 1NRJB 2FVYA 3JV7A 4GICA 4ALMA 1SXQA 2FPGA 3I9FA 5CD9A 4PPYA 1Z5OA 2TS1A 1JQLB 1R50A 2EKPA 2H63A 4NP6A 4WV3A 1TVKB 1Y63A 1WL8A 1CEXA 1EFUA 1BMTA 2DPYA 1BJRE 1TTTA 4OF4A 5BSHA 3GJ3A 3L7OA 1T26A 5ALSA 3UZUA 2GLUA 4P4TA 4GGPA 3BK2A 4DPLA 3SSNA 4ZN6A 2UUCB 4MP8A 2WYHA 3F6BX 2X4LA 3BWDD 1J5PA 1SUIA 2CVQA 1I94B 2VPPA 3JR7A 2I7DA 4URZR 4LFCB 4BDSA 1KORA 3DEJA 4L8GA 4Q4AA 5AK0A 4ZGWA 1M34A 4RD0A 1HE5A 3E5RA 3PLAE 1QC5B 4S1PA 1JR3D 3ZLBA 2B4KA 3EQ7A 3FUWA 4WCVA 1SEVA 2VTVA 4LOKA 3FYDA 2IEBA 2Z8ZA 3SLKA 3QOFA 5E6SA 5EXEA 4LYAA 4DLNA 5KX5F 1KOGA 5AJVB 4BKMA 1S3SA 4M2LA 3SDSA 4JB3A 4AJKA 1N8SA 5DULA 4JZYA 1A95A 3NFYA 2P8SA 1A0OA 2GZAA 3CG4A 2FZWA 3NTXA 3P4XA 4E6EA 3ZDRA 5B12A 1OW3B 3PQ4A 1XPOA 3K1YA 3THSA 3QPUA 1NDHA 2I29A 2BF7A 2IIBA 3G7SA 2ZWIA 4LHWA 2OVBA 5CDGA 4XR9A 3ZGOA 4PFKA 5T4EA 3WXMA 1EESA 3JQAD 1JXMA 3LWDA 3BEOA 1TQDA 3E70C 4OKSA 1E4YA 3I4LA 4DNFA 3ZDFA 2CVHA 3TSCA 2HQBA 1X8LA 3IJ5A 3LV8A 4MS3B 2O7QA 5FXMA 1FQOA 3DBHB 4P92A 3MT9A 3STXA 1PHPA 5ER9A 3Q8KA 3RTGA 5EVCA 2P0YA 2GA9A 5FIUA 3ON5A 3TTYA 3S2UA 3W2IA 3GMDA 5I48A 1VLVA 1Z5UA 3I73A 4OI4A 2ECPA 3JQDA 1H8ED 2VG8A 5IJZA 4C87A 1UWCA 5LIPA 1WQ3A 4E13A 4CIAA 4KQWA 1T5HX 3N0XA 3LFUA 1E0JA 1B76A 4M46A 4B3HA 1CVRA 1WXQA 2H1FA 3QE0A 3WG9A 3AEQA 1YMQA 3GIDA 3ZXSA 2ZXEA 1ICEA 2J33A 4C2AA 2XODA 1OFUX 2V1XA 3EW7A 3CR3C 3DDZX 3SBXA 4E94A 1YZVA 3H5OA 4RAQA 3P2EA 2MR6A 4HVLA 2CVPA 4EB6B 3VYWA 5TE9A 2BN4A 5FFNA 1S2IA 3BA6A 3EDCA 5HCIA 1UC5B 3COWA 3OF3A 2I7CA 4JNCA 3ZWAA 1PJ2A 4GW3A 3ZH2A 4MR8A 3H11B 3G7UA 1R9MA 3H19A 3EFOB 2XB2A 4XVRA 3IEVA 4YBZA 4J9UE 4YLEA 1I3NA 2PEZA 5BQXA 1XB2A 2VSNA 4XWOA 4G8BA 4XJSA 1V96A 4JI2B 4NFLA 1UINA 2FUG1 3BHNA 1M66A 2HO5A 3BUSA 4R9UC 4HT3B 1D8TA 1Z8NA 2D0IA 3OX2A 3QELA 2Z9DA 3LY5A 1GGNA 2O0MA 3P2JA 4PZPA 3TLYA 1N0IA 2UVPB 3GP3A 3HUEA 3LVQE 3SQLA 3HKCA 3CVVA 1JHPA 1REQB 1VSBA 1UBGA 2OD9A 4MV0A 1E32A 2VDMB 4WKCA 4DWVA 1NVTA 4J49A 4G5XA 4RXMA 1OH8A 3W34A 4DA6A 4DCMA 5AQ1A 3K9LA 2OHIA 2VWPA 4QPDA 2VTBA 5JSUA 3T1OA 3D3WA 1L1FA 3H13A 2AR9A 5JSQA 3COPA 4F60A 2X41A 4G0YA 1RWOA 2CSXA 4FEGA 1QYXA 4PSUA 5H0IA 4WFJA 4FYHA 2LZ0A 2MMGA 4XEUA 1B1AA 1H66A 4HVTA 3WC4A 3HN7A 3JZIA 4IOJA 4LJ5A 1W1WA 3WISA 4KK4A 3ZX4A 4BFWA 1MO4A 3FMIA 2R8RA 1NXOA 1TZMA 3NP7A 5DGIA 3PRJA 1RKUA 1IN8A 1AKWA 1RZUA 1YRYE 4DY4A 2A5LA 2D1FA 2H51A 2Z8YM 2YNMC 3GB9A 1B74A 3M3HA 3E9YA 3MCAA 4XUEA 2H16A 4HGZA 3RUHA 4JYZA 1SZDA 4CI9A 4EY5A 3AVXA 4BASA 4LDJA 5BRAA 3LKZA 2PD4A 4OAPA 4C5BA 2WAOA 2K7ZA 3F4KA 1K08A 2SCUA 3MMSA 2JRCA 2V97A 1PBNA 4H2DA 2H48A 2XQJA 3GU3A 3NASA 4HF7A 5AI6A 1G18A 5C8YA 3JSXA 2R11A 3BGIA 4P58A 1UPAA 3EXFB 3FKQA 4KE9A 4FOLA 1E6CA 4I9FA 1Q1AA 5FUYA 3OC6A 3QEOA 3WWZA 1E92A 5SY6A 4NU5A 3STTA 4UQLA 2CLKB 5I7WA 1U2DC 2IW3A 1H1LA 1J8FA 3GJSA 2BRUC 3L18A 3IP1A 1UBLS 3AIIA 1U3FA 4V0NA 3IS3A 4YACA 4RK4A 4DG5A 2WWIA 4MULA 2HPVA 1C9EA 1VJGA 3NEPX 2XIJA 3EXHA 1UQRA 2CK3D 4IM7A 3TJRA 5HWSA 1H0SA 1M0TA 2P77A 4E5NA 2J9ZB 3SEAA 1BEUB 1L7EA 1XMQB 2BL4A 5U4QA 4I14A 1I0ZA 1LBEA 1BCRB 4MNTA 5B58C 2JKYA 3GJ4A 3AVPA 2Z3VA 1ZX1A 3I9V6 4KE7A 1SZPA 1GT6A 1L5FA 1RR6A 3C45A 3FZNA 2K6GA 3PV0A 5DTEA 5E2BA 1KDPA 1Z45A 2Q2WA 2WYUA 4J7UA 2IODA 1YZ3A 3FPLA 2FDRA 1CS4C 2HRDA 1C9MA 3VNVA 1W4BA 2PUCA 4MKHA 4KWTA 2ZSAA 1NR5A 1MQAA 2ZANA 3ABSB 1JQEA 2FB9A 1BXRB 4RZIA 1L4HA 2V98A 2FXVA 1I01A 2G4VA 2XTMA 4YRQA 1NW5A 1FDIA 3AKCA 3IEUA 3NTVA 4J16A 5DXJA 4BP9A 4KVGA 3F5MA 4AX4A 4Y1FA 3D8HA 2HQSA 5KTMA 5JSHA 5EYPB 2XNJA 5K5EA 2JLZA 1KI6B 1XTTA 7REQA 4ZV7A 3TZLA 4R2IA 5LQNA 1WBDA 1LWNA 2B69A 2GPTA 2ZJZA 4LHXA 2C7QA 4ZDIA 3GJZA 4QBFA 3MAAC 2ZUBA 4UPDA 4CNBA 1JBEA 4JA0A 3GLIB 2XVAA 3WYGA 2A1TS 1EI9A 3OZIA 4QYWA 2F7SA 5AHWA 1AQ6A 3AF6A 3UOGA 2PWYA 4ZO7A 3X1MA 2HLDD 5IARA 4LZOA 1QUEA 1YFKA 1W0JA 3RTDA 5F51A 3TTUA 4IX1A 4C01A 2VP0A 4QYIA 2E4XA 5EIOA 4PIPA 1CVLA 2XOKA 2VJCA 5JCOC 1FDWA 3SEZA 4LZJA 3LZCA 1NF2A 4UPVA 1L7PA 3EZFA 3FWYA 4ZWNA 3ZH9B 1AZWA 3WB9A 2O0LA 1E61A 3T06B 3L41A 1LBIA 1G1AA 4C3OB 2HWXA 4PG6A 1JBQA 2MIIA 3B9PA 3KCQA 4MDHA 3AY6A 5INTA 3DKPA 3NS7A 5JASA 2C8KA 1BWPA 1YE5A 2PJDA 5CJPA 3AJ9A 4K9MA 3OCUA 2ZSJA 3BDVA 2PTGA 3H5IA 5FNVB 2HKIA 5COAA 1JUDA 1WMSA 2VJDA 4DLKA 2FG6C 1IOLA 3AZPA 2VPWA 1THTA 2GUWA 1M1YA 1FRZA 2WWXA 2H2FA 1DJLA 2XT0A 3EMVA 3M6AA 1LBHA 2JH8A 3DFIA 4P7BA 2HU7A 2Q1SA 5BV1A 1DQSA 2P6NA 2R84A 3C4JA 2G9VA 4L4ZA 3PC6A 1CZNA 1ECCA 3FY4A 4LV6A 2D4HA 2I6UA 1G4UR 4CBVA 1UBTS 3FBWA 3ITNA 4Q3NA 4DDVA 1TYZA 1Y37A 1YDGA 3L0IB 3OZ7A 4B5LA 3FKSA 5LB2A 2IK8A 5ICSA 4JJGA 1PSDA 3HA2A 4YRPA 3KKNA 3F3MA 5FLXA 5D00A 2AD1A 5A62A 1WMAA 2YHIA 2FN3A 2ZJFA 4M1WA 1PR1A 2I4OA 3GJ0A 3S5JA 3GJ8A 1IFXA 1GPJA 4A6XA 4CMGA 2CBZA 1PJ4A 3JQGB 2H9AA 4D0NA 2QXUA 4GMHA 2FMKA 1IWPB 1R5BA 1V6AA 2BIFA 1HDIA 2H3EA 3FPJA 2NIPA 2EQAA 3IJRA 4LGYA 4YAGA 5ENDA 1RWPA 4FHCA 2GN9A 2ZS9A 2PYZA 4O2BF 3SZLA 3FYTA 1I2CA 2CZCA 4OQFA 3RU3A 2I6QA 4G97A 2X0FA 3NHJA 3VU8A 1R66A 2A57A 1SVOA 3A26A 1JDVA 4XD7A 5FPTA 5FPSA 1KC1A 2JLYA 2D5CA 2XA9A 4N03A 5HKBA 1U7TA 1GARA 4G63A 1T9GR 2F8LA 1T2EA 3AW9A 1N7GA 4TL8A 5F64A 3R7NA 3BJMA 3NDJA 5ADVA 4MR8B 2QIOA 4HJRA 2DKFA 5IJAA 2W9XA 2W6OA 5HJ7A 2CNWD 1UP7A 1UJ6A 3EEYA 3FR7A 3K8YA 2CE7A 3CZ5A 3KJQA 3T34A 3CF4A 4B6GA 1EXNA 2V7EA 3RSCA 3AI7A 4LX8A 1L8LA 3C6ZA 1VCMA 4RKWA 4RY8A 1RAAA 3NC1C 5D8DA 1ZUWA 1TT5A 2CV1A 1ZJJA 3GGDA 2R4TA 3IBCA 4LRXA 5IBRA 4EJ2A 4B33A 4A8JA 3MWYW 1GO2A 3HCRA 3N7UA 3ZEAA 3EIEA 3FOEC 3SJAA 2D7DA 4Q1CA 3HO1A 2FZLA 5JFTA 2B6NA 2XV1A 4YIKA 1FVXA 1IY1A 4XH9B 4H16A 5JJLA 4Z4IA 2G07A 1AUXA 1RQ7A 3K1ZA 3SC3A 5AJWA 1JDUA 5LYJF 1SCIA 3AUJB 4FYMA 5AJYA 1BN6A 1HETA 3TK1A 4IFTA 1VG9B 1VYUA 3U40A 4XIJA 2B2NA 1J33A 1X7XB 4X7RA 1T5IA 4HDOB 2ZSUA 1YR9A 4NCJA 4UU7A 4OL9A 3WK5A 2QSUA 4J75A 3FUUA 3KWMA 4HN4B 1YA4A 4O25A 1UDWA 4UEOA 4ALKA 1ZUNB 3HGTA 5C8DA 4JOBA 3LE8A 1C1DA 5EIHA 5A4KA 1UZUA 3DOHA 5K3CA 4OXIA 1XTVA 3SJCA 3LHIA 4ERXA 2G5TA 3GJRA 4DCCA 1Z15A 4QRIA 3H0EA 2GZ1A 2F3PA 4X95A 4JL8A 2GUGA 1NOJA 5LMNB 2OO7A 1AVTA 1VI5A 2D5BA 3OPXA 4HYTA 5CEFA 1FU7A 2DJ5A 2P27A 5DM2A 2E4AA 2GD2A 3CISA 4NYIR 1A3CA 2C5SA 4ZZ1A 4YJHA 2A92A 3TRDA 4B40A 3ADPA 4KR6A 4KE6A 3HKBB 3CWCA 5B53A 4MITA 2BLLA 1WNFA 3EPPA 4C03A 4DSUA 4P0QB 1GAEO 3C97A 1JA0A 1JIXA 4RZSA 4NDNE 3B6EA 5T5QA 2ZI4A 3E1SA 2IYYA 4KV7A 3KZKA 4N3AA 1PJLA 4YDSA 5FBRB 2XXAB 3M4XA 4LA4A 4O29A 4DJJA 4DV2B 1RMYA 2ORVA 3DBRA 1AGXA 2X0KA 4V39A 2BFEA 2VHYA 1BN7A 4Q1VA 4P4UA 3FG9A 2WA1A 4CMHA 5JWOA 4EDHA 1NONA 4F04A 1TUBA 5IRCD 4XQ9A 2UDPA 3C15C 1CUZA 4WINA 4OREX 4RY0A 2BOVA 3GEDA 2VCHA 4GR5A 4HWTA 1J23A 4H7FA 4O4IB 1ZJYA 3OZAA 4OKNA 1NBAA 1E79A 1H05A 1GZVA 1QR6A 2Q3MA 2UZIR 3TIFA 4WVLA 1AXGA 4XM2A 1E5QA 1OXMA 1Q77A 2E37A 3DEAA 3KVOA 4GVXA 5FF9A 2AFHA 3UCXA 4D6XA 4RVOA 4AQ7A 2CXSA 3LCMA 4DJTA 2QORA 3E82A 4K6HA 1B1CA 1SKQA 2VYFA 3O7MA 1UEJA 1OI4A 3E7DA 2PFKA 5I45A 2P1ZA 5IFLA 1VL2A 1C4OA 5TPWA 1WOYA 3EGVA 1XG5A 1P2VA 5HTKA 1M54A 4P08A 2D06A 3GJ6A 3C74A 4ZT4A 1AXEA 4MVJG 3QXXA 3TZCA 4B43A 3PFNA 4FK8A 3VVMA 1DOZA 3IAAA 3QF7A 1J9ZA 2R1VA 2XUJA 3NYIA 2XB4A 2YV2A 2W93A 3NTRA 4OBXA 3QU2A 2XE8A 3EUFA 3B1YA 3N8NA 4FEAA 4KRXA 4W1PA 5TSDA 3RWOA 5BP7A 2BGKA 4PYQA 3BB4A 5IXYA 1P4AA 2WNHA 3JAKA 3MS7A 4QQNA 1OAKA 3IVMA 4JJ6A 3ZWPA 4RKYA 4YJ2F 4WNAA 2WPDA 3TL2A 2Z4TA 1SBNE 2YS6A 4W7SA 1HXHA 4MJXA 4CCSA 5HMMA 4QNNA 5A6VA 2QJWA 1KOJA 4BNZA 1DBPA 2I6SA 4R3NA 4RIEA 4X3CA 4OH7A 4XIIA 5CA0B 4PLCA 4AJHA 1UBKS 1WR8A 5LLDA 3TDMA 2BW0A 2Q3BA 1GRRA 2IYTA 1QCZA 4BVLA 3SKYA 2L17A 1KAGA 1DQRA 1AOXA 2QRHA 1M10A 3IUBA 3ANXA 3DEHA 3C3YA 5JSYA 2H0AA 3E9QA 1TF5A 3NHYA 4KIFA 4XM0A 1C3JA 1P2FA 3B82A 4TV8B 5BNTA 2WB2A 3U48A 3IUQA 4DR4B 4MGEA 2QE7A 2V3WA 3R5XA 3I42A 2QRZA 4R2WA 1QIEA 4BFZA 1EE2A 2QLFA 1J8YF 3B51X 2E4ZA 4BEBA 4EP1A 3FYUA 2A0KA 1EWVA 4FZ5A 1UOPA 5FPHA 4EEXA 3R9XA 3NAMA 5AUNB 4HEJA 1KY4A 1J42A 2VP6A 3OFVA 5D6NA 1RZRA 3BMXA 4PQGA 3ZV3A 1PU2A 1W85A 1TAQA 1ETUA 1QHHB 5BQ3A 1XLTA 3PITA 5KWVA 1ULBA 3HEBA 2WZDA 3DE5X 2DWQA 2E4VA 4YCDA 4Q48A 1W1IA 3OJXA 4NLLA 4P5PA 3QU7A 5JS7A 2H5IA 2A0XA 4JXZA 2HK7A 1IBLB 4X6UA 3D2AA 5J2TB 1WXWA 2DCMA 2DETA 3KV3O 3BB1A 4UHHA 5CEJA 4R1MA 2PUBA 4GHWA 5FADA 5K0FA 5MN6A 1IM8A 1D0IA 4W9MC 1ZXLA 2WIKA 2A1IA 3HBLA 3N0RA 5KINB 2WHEA 2DXIA 4RNCA 1MHPA 2A5JA 3NHBA 4L5JA 1CDZA 3U7FB 1E2MA 2GF2A 1ISJA 3PK0A 5A9TA 4FHEA 4EUEA 5E8JA 4JI5B 4DBLE 3KHSA 2REXB 5TGDA 1AK1A 1CRQA 5F1YA 3CKKA 3H4VA 1WDMA 4PVDA 4EK9A 3BIWA 2CUNA 3EZ6A 1A9XA 3DMRA 5L3VA 1HK7A 2FPPB 1PZMA 1GCGA 2ZUTA 4M53A 4FB4A 2NZ2A 3K9CA 4HS9A 4AKIA 5E6RA 1BHSA 3N58A 3V7FA 4HMQA 2HGSA 3MHPA 3DTTA 2GCEA 4R54A 1JQ5A 4UOZA 3I61A 1XRQA 1NQVA 4MLPA 4XW2A 4OLFA 2GBCA 3R24A 2YWDA 4FQ8A 1LZKA 1HR0B 1EWKA 4U6SA 5KVAA 4TQAA 2XF8A 2QRMA 3RSOA 4HSGA 3ZGVA 4EFDA 5MHTA 2MINB 4M1EA 3ETGA 5IDQA 1O0BA 3G89A 1KEPA 1EQ2A 4Q1DA 1X13A 3NBXX 1T1EA 1WCXA 1OC4A 2EEPA 1KE1A 4ZIRA 5K0JA 2UZ4A 1R8JA 3LMKA 4UREA 1YGYA 3PWZA 4EI2A 2Q8PA 1GPAA 2W2NA 2YWBA 3HFGA 4QSMA 3MOGA 3LOQA 3I3SR 2HI0A 3KT6A 1Z6AA 1ZUIA 2FSVA 4WZAA 3V6MA 1YBMA 3SHTA 3QF4B 3L7AA 4MVJF 3W4JA 1APBA 3Q0IA 1PR9A 1OREA 3H2YA 1JECA 2EG5A 3W9UA 3LQ1A 5BSWA 4GKJB 2QP9X 4Q3AA 4F3KA 2ZTLA 1XALA 1P17A 4MYDA 4H27A 5E4YA 5AP9A 3WE7A 4C6HA 4D5EA 3HU5A 5BV8A 2G77B 1QB8A 3QSGA 4MWTA 4DXHA 5FTKA 4FE4A 5IVIA 4ETNA 1PTJA 2XUGA 2ZIXB 3NV9A 3JWHA 1CZUA 1U8FO 1W96A 2NACA 4ZJPA 1T29A 1JIKA 2DT5A 2IYQA 1II0A 5C7OO 1KDYA 2FZGA 3E2PA 3TPFA 4WZBB 1FP2A 2I6XA 5JQWA 4KLAA 1FX0A 4N41A 4G0XA 3OY7A 3JD3A 4JSYA 2AS0A 2HEGA 4G24A 2YMLA 3TXXA 3R0IA 3WB2A 3C3WA 2EFEB 4BV2A 4EF5A 3NG1A 5M29A 3Q7IA 4FMDB 3SZRA 1L5VA 1WX1A 4QM7A 3HXMA 3SC6A 1QCDA 1X15A 2P3LA 3NV7A 3E18A 4OHVA 3T8YA 5AICA 5P8WA 3UM9A 3QKSA 1W0JD 2DMRA 1MJ5A 3B20A 2XR1A 5D87A 4GDMA 3T5CA 3UJBA 4BLVA 3WA7A 2ERXA 1NDUA 2F1JA 3UT6A 3HUFA 5A4AA 1AS2A 1K66A 1AQLA 2XOKD 2ZBDA 5IZCC 4M0MA 4WIAA 1UC9A 1NSYA 3OM0A 5E4TA 2QTBA 3D3JA 2HIHA 4O4LB 3EC1A 4LZZA 3VGPA 1XTJA 2QR2A 2ZJBA 3ZY5A 2JFVA 3VO1A 2Q3FA 3SE7A 1AE1A 3C6YA 3JW8A 5BN4A 2A9KA 3WRVA 2VWGA 4YMSA 1PKXA 2F4NA 2FW7A 1OBOA 5HIKA 4LNUA 2AZMA 3ONWA 3RFVA 5K8CA 1NXPA 2Z9CA 5UKDA 1Y4DE 5JNRA 2P2DA 2R8EA 1NBIA 2NM0A 4HDRA 3IHWA 4TKUB 1TOAA 4IIJF 3ZE1B 5IVHA 1HKHA 4FX2A 4NMMA 4BE7B 2WT8A 1AG9A 3RG8A 3W5CA 1G41A 4FFRA 3DKVA 2Y1GA 3TSZA 1RACA 4YX9A 4JSRA 4CTOA 4N7RA 1YC5A 2FA9A 4O8CA 3STUA 3UEOA 1JB9A 2W6ZA 4DEVA 3D7KA 3G0OA 4WA8A 3FKSD 4YHBA 4Z7JA 3EUEA 3CN9A 3IEKA 5HCUA 4KITB 5KNCH 4LFBB 1TZKA 2AI2A 1QXSA 4BU0A 3M33A 4OJYA 1PL0A 3M9WA 4I55B 1BG6A 1WHTA 3GFOA 3I53A 4JUDX 1QQ7A 4E7PA 3QVTA 1IZ0A 1HYGA 4R8MA 3NVKI 3PFKA 1LK0A 3BQNB 3B9QA 1PFVA 1TO1E 5BMVA 2V45A 4EG5A 1EVQA 4DL9A 1AMNA 2ST1A 1Y7LA 2MDTA 3HS3A 3B2QA 2OZKA 4CIWA 2OCIA 1CHNA 3PYLA 4HWKA 4V38A 4DNQA 1ZQ1A 3Q5GA 1V9LA 2CMGA 4AKEA 3GEHA 3CIFA 9MHTA 4ZZ3A 1CZRA 3T5AA 1QHIA 1IONA 4XD7D 1JJIA 3M5PA 3MS4A 3K71B 3G9UA 1IPHA 1RHQA 1TK2A 3AEKA 3E0QA 3PLRA 2YOGA 2Q5LA 3EVFA 1OBVA 3B6IA 5KJ1A 3PQ7A 5HKKA 1X7GA 4QELA 2FWMX 5EMMA 2R8XA 5B1DA 1HDYA 3EOAI 3GJ5A 5TY0A 5G4KB 4AUEA 2LDBA 2OCLA 4RZQA 4K0RA 3TNLA 2OBBA 1G21A 4LVOA 4UMEA 4OXQA 3S8EA 4MIKA 3EN0A 1M0EA 1EJ2A 3D6VA 1GRQA 3ZWWA 4EF4A 1VHQA 2Q5FA 5GIPE 1I10A 5CB0A 3JALA 1DC6A 4X54A 1U3CA 4MS1B 3U13A 4S1OA 4BKUA 2N47A 1IBKB 2O3TA 4XYLA 3PUWA 3WL3A 2IP1A 2X8JB 4DLAA 3NIGB 2ZJ8A 5TEVA 5CJ2A 5DHRA 2BGTA 5LQRA 2WK1A 3EY4A 1E9SA 2BGIA 2QPOA 3P27A 4HNSA 4I4TB 2QT0A 4PM4A 5IM4F 4LFAB 4B3RB 3QFTA 3PXGA 4G25A 3RTAA 5KOHA 1RADA 3VU3A 3NGLA 3M0EA 1IL0A 4ER0A 2WTUA 1Z4KA 3GQVA 1MAHA 1FIUA 4DMFA 1PR2A 3LCCA 3D6TB 4GYYA 4KSCA 2XLBA 2JZCA 3DAYA 3FTDA 2FP3A 3KTOA 4YRCA 5ECYA 2VHXA 3TLCA 5AW5A 4CQJA 3GC6A 3GGCA 4K6FA 2AFIB 1L5ZA 1QOQB 1VJ1A 4GC5A 3RHZA 1XZGA 4G0PA 1K3UB 3EFEA 3KELA 3ZY6A 4WOBA 4Q4HB 2FVXA 3D3QA 1I24A 4JD5A 5CYFA 5AKLA 3WL6A 5K4GA 1JPUA 3EWAA 3H4MA 1YDEA 5KYVA 4Y6RA 2FLVA 3HBAA 2F3RA 1Z62A 1PK8A 3A04A 4TL7A 3OTOB 1FSPA 4OX9Y 2WP0A 2I1VB 2O50A 1S1MA 3I04A 4TS4A 3UAVA 1OB5A 3IR5A 4MUMA 3ZLVA 1F8XA 4GUDA 4ZCQA 4FMCB 4OK3A 2IYVA 2M98A 3HXKA 4JYMA 1ZN7A 3RIMA 2E4YA 3HLKA 1RCFA 3IOYA 2PT6A 2IV3A 5IDYA 3RYTC 3X1KA 1X19A 1QRTA 4K9RA 2YDXA 1GEEA 3I8XA 1A82A 5IT4A 4Z7QB 2CMHA 5JU6A 4NYMQ 2WIGA 5F98A 1FDTA 4EAQA 3QOWA 2HHHB 3FDZB 1PUJA 3S27A 2G17A 1WY5A 5HE9A 2P30A 1Y9EA 3K96A 2PKEA 4RS3A 1ZMRA 1E79D 3S4YA 1T5TA 3R5JA 2IX3A 5F9FA 3FMFA 4RS4A 4QBHA 4KEAA 1XVUA 1OLSA 2A1UA 2DBRA 2VDUE 1SBCA 3NALA 1IULA 1EU1A 2EKQA 4IICA 1ZG3A 1YRBA 5ESWA 5GONF 2IH4A 4JLPA 4OAOA 1NX9A 4HS4A 1P3DA 3BERA 2HF9A 5BN1A 3DBLB 2H54A 2HBZA 5JD4A 2HJGA 3O1HB 4RPJA 2X15A 3GAAA 4NMLA 1G9XA 3D2CA 4H6WA 3V00A 3ESXA 4CM9A 4DIDA 1M67A 1DBSA 3B3FA 2YWRA 1IEWA 2XQGA 2IXFA 4U7PB 3RUEA 4BFVA 5ALGA 1C0KA 1YASA 2XMBA 4KMOA 4XIGS 5IYZF 3EIXA 1O5IA 4I1VA 5GGXA 2IZZA 4JH0A 3TS1A 5IHXA 1KVQA 4PWZA 2QZSA 5GV8A 2WKWA 3NH9A 4D96A 2HZBA 2PLWA 4YBRA 3RUFA 2CNNA 4QO8A 2GK3A 2NQTA 2WPDD 5F3RA 3UMVA 3UXMA 3IDSA 4YFVA 3P71T 3PKJA 3MTDA 5C31A 2KJQA 3TL6A 4BV9A 1O58A 5EJEA 4IP0A 3T3HA 3LCJA 4LZPA 3EPLA 1B15A 4BZXA 3LS2A 4C4RA 2PNJA 2IZ6A 2VOJA 3QI2A 3GUCA 3BD6A 1RQ2A 3E2IA 2NLOA 3E35A 5CVJA 4YREA 2ZR0A 3E3LA 3ORHA 5FPYA 5FPPA 4X1IB 3VHQA 4YV2A 1WAMA 4PANA 3H2SA 4XJXA 4CEIB 1NVUQ 2MU1A 3DDHA 4IKEA 4KVZA 3FHCB 2QE7D 1P4JA 4L9SA 4OQXA 4F6CA 4YJFB 2P9QA 4L4RA 4B34A 4FTWA 1SCUB 3FTFA 3D8SA 2XWQA 4I2NA 3AHCA 5H3LA 2VDWA 2R66A 1KAHA 2WG0A 4NJEB 4DV3B 3RJTA 1J9GA 2IYSA 4MQUA 1PV2A 3MUEA 3IAXA 4PTZA 4XVHA 5CX4A 1C5KA 1SNYA 1C7QA 4HAUA 2ZSKA 1RZRD 5GQSA 2RGDA 4DT1B 3AVQA 3EGWA 1E2PA 2HTEA 5EVJA 4BMSA 4NYJQ 1ZXBA 5HQ3A 2DM6A 4AY3A 3PFIA 2VT3A 4UHJA 4R0MA 1ZVMA 5DKFA 1QCYA 5LL6P 4MPJA 1JEDA 1JG3A 1XFDA 3NKLA 4LDRA 1DB3A 4HJXA 5CA1A 3FNQA 3SWWA 2WF6A 3LTEA 2G1UA 2ZQZA 2YYYA 4FQ5A 4B84A 1OBFO 3B7PA 4OK6A 1ISHA 1CB0A 2C57A 2ODBA 4TS1A 5COBA 3CVWA 4ZCTA 5TR9A 1RLUA 2H52A 1F14A 2QD4A 2RHCA 3L6RA 4CKBA 2P3QA 1MF7A 4U7DA 4IS2A 3U3RA 1VJ0A 5EFOA 1Y48E 1EP2B 4RKFA 3EARA 2FKNA 1SM4A 1KF0A 3F3YA 2VNSA 5HGXA 3AJDA 4CUZA 4M8NE 1E3IA 3FDJA 4XASA 2YICA 3L7NA 4K03A 1DQNA 2DX7A 2ZI7A 4MGHA 5EUQB 2DSTA 2XEXA 4P84A 5E9QA 3GUUA 4ZJYA 1UXKA 4FYKA 3SFZA 2OHGA 2OZLA 4H1WA 5BUZA 4A2CA 4IDNA 3LDUA 1EDDA 3O8DA 2IPMA 1D9XA 2R85A 2JZNA 1NFRA 3IBGA 4PN3A 1U0EA 1V1MB 5DBOA 3OE5A 1E2JA 2NUTB 2VKQA 4XYMA 4DLRA 2P2YA 3QPVA 1T6BY 4BPBA 1JXQA 1UM8A 2LXNA 1FNCA 4ZGGA 1C50A 3REOA 1MW8X 1SUAA 2PMKA 1FSGA 4UMVA 2WPNA 4OH1A 2I2WA 1IVYA 1HFKA 1QDLB 2J3HA 3CJTA 3L7KA 2ONJA 2IA5A 1B0AA 3ETHA 4FYPA 5F1KA 4E6PA 5BQPA 2ONCA 3ZGNA 3E7PA 3RKRA 5CNKA 1KO1A 2VDOB 4X94A 4DQKA 2ZRLA 3UOAB 1G20E 3B5JA 2I67A 2PXHA 4OEHA 2IWHA 3BL6A 4HMPA 3SPXA 2ZI9A 4MUYA 4MUKA 1SVKA 4ND5A 4PYOA 2Q0SA 5DOZA 2L19A 2HRQA 2AQIA 4XI9A 4ZZIA 2OHHA 5ADHA 3URMA 3BXGA 4C3ZA 1F8UA 3CC8A 1NQOA 1UMDA 1Z4OA 4LXXA 3WMWA 4C7MA 4M49A 1WULS 4RU1A 2B7BA 3ITDA 4X20B 3RS8A 4AO6A 2Q4EA 3SQOA 1BFKA 4DZTA 3F46A 1ZL0A 4HLDA 1TLFA 1ZPDA 4M89A 3RE1A 5K4AA 4BFUA 2Z56A 4OV6B 5AKEA 3KZVA 2QEQA 1RT9A 5C1OA 2IEGA 1Q22A 3QE2A 2QR3A 2XQKA 1NR7A 2I1QA 1FW8A 2Q1UA 1D09A 3AFOA 3PEFA 4ZXFA 2OFWA 5HS6A 3PQEA 1OMOA 4TWZA 3JQBC 1ISIA 1R8QA 2OENG 3RVJA 1OFHA 3KEGA 1X1BA 1YB2A 4A0QA 4WCFA 1C14A 5DEOA 1VGQA 2NXCA 1BDIA 3WKBA 3YASA 2AOWA 2HYDA