4KYVA

Crystal structure of dehalogenase halotag2 with halts at the resolution 1.8a. northeast structural genomics consortium (nesg) target or150
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
303
structure length
297
Chain Sequence
b'HHHHHEIGTGFPFDPHYVEVLGERMHYVDVGPRDGTPVLFLHGNPTSSYLWRNIIPHVAPSHRCIAPDLIGMGKSDKPDLDYFFDDHVRYLDAFIEALGLEEVVLVIHDWGSALGFHWAKRNPERVKGIACMEFIRPIPTWDEWPEFARETFQAFRTADVGRELIIDQNAFIEGALPMGVVRPLTEVEDHYREPFLKPVDREPLWRLPNELPIAGEPANIVALVEAYMNWLHQSPVPKLLFWGTPGVLIPPAEAARLAESLPNCKTVDIGPGLFLLQEDNPDLIGSEIARWLPGLAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords dehalogenase HaloTag2
publication title Northeast Structural Genomics Consortium Target OR150
rcsb
source organism Synthetic construct
molecule tags De novo protein
total genus 91
structure length 297
sequence length 303
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-05-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4kyvA00
4B0OA 3H1AA 1JI3A 1DWQA 1ZIXA 3BJMA 1THTA 2OGTA 3CCBA 1PFQA 4KAFA 2R8BA 1OILA 3FVRA 5D3ZA 1H23A 4BC0A 2PU5A 1VXOA 5ALPA 4YK7A 4F0JA 2QTBA 1BEZA 3VKFA 1RYYA 4JEIA 4FOLA 4PSUA 4AZ0A 4U2BA 2C58A 3MGAA 2G5TA 2BGNA 1XZCA 2VT7A 3G9UA 5ALZA 4ZGBA 2PKYX 3HZOA 1AX9A 4C89A 3G9TA 4NZZA 4UUQA 4GEGA 4KRXA 5FDFA 4WJLA 4W1RA 1ZJ4A 4X85A 1FFDA 5AI6A 1XZLA 2ZYRA 5HFAA 1ACJA 4N5IX 4B83A 1JJFA 5AKJA 1QIHA 1J2EA 1HL7A 2OQIA 2JGKA 4H7DA 2CB9A 2EEPA 1EH5A 5E2IA 2GYVA 5IH7A 1E8NA 5CT8A 3DYIA 4HRYA 1P0QA 1JFRA 3L1IA 1XKLA 2I78A 1XZHA 4U2FA 4BRSA 3RARA 5AI5A 2CUTA 4FNMA 2J3QA 1XQYA 1XZAA 3WI7A 3WKBA 1K6EA 2RONA 3V1KA 2JGMA 4UBJA 1JMKC 1CLEA 2FUKA 3O4IA 4FBMA 1LZLA 4HXGA 2HA2A 3TRDA 1OCEA 3V48A 4QLOA 4DSAA 4KEAA 2PUHA 1K4YA 4LXHA 1BCRA 1BROA 2WUEA 5I9IA 3H04A 4LHEA 1BCSA 1USWA 3PFCA 5ALGA 4DMKA 3CN9A 4QDZA 4OYYA 2HDWA 2ORYA 4U2EA 1N1MA 2OCGA 3VISA 2QM0A 2GZSA 3AIKA 4PV7A 1K5PA 4AN0A 1CUSA 1CUXA 1DQYA 1TKRA 3WA6A 3Q8WA 2WHRA 4RNCA 2QVBA 5EGNA 2Z5GA 2HA5A 5K3FA 3WIBA 2WIKA 1TCBA 2XQKA 5ALWA 2D5LA 1EK1A 4Y2VA 5JATA 4X6XA 5J3JA 1WPRA 2PSDA 1ZI6A 5AKHA 5LYYA 4KE6A 4CI9A 3GZJA 4E11A 4WDRA 4C4YA 4LXIA 3STXA 3PDCA 1LPOA 1A8QA 2UZ0A 3MUOA 1E3QA 1ODTC 3ICWA 1HPLA 1UK6A 1R9NA 5E4JA 1MU0A 3G0GA 3FNBA 4ZRDA 1MO2A 4OB8A 3AINA 3LCRA 1G5FA 1JU3A 2WSLA 2B20A 3GROA 5CXXA 2OQVA 5EHXA 4ARBA 3U0VA 4X94A 3I28A 3FOBA 5AKIA 4A16A 5ALXA 4Y2XA 4UHCA 4DNPA 5YASA 3C8DA 4CFSA 3DOHA 2XMSA 5LZ5A 3WK7A 5SYNA 1P0IA 4WCVA 4K5QA 2QS9A 4MQMA 1WB4A 1YAHA 1YS1X 5AM5A 4FBLA 5ALKA 3FYTA 5K3CA 1QGED 1R1DA 4P9NA 5DYTA 1EB9A 5JYCA 1C7IA 3TEJA 4B0PA 1XZBA 4K6KA 5ALMA 1E89A 2HFKA 4UFPA 4AMYA 2BJHA 4J03A 4UBKA 3DD5A 5AKXA 5FPPA 4IH4A 5AKYA 3G8YA 2C0PA 2GBCA 2VA9A 3BJRA 4A5SA 5EI5A 4EB0A 3AUKA 3C8HA 3WK9A 2HRQA 1IUNA 3WJ2A 2WFZA 4NMWA 5ISMA 1DX4A 4QDTA 2C7BA 4E15A 4OUKX 3HI4A 2GYUA 4N8DA 2QZPA 1TIBA 3X3HA 5FV4A 4N5HX 1LGYA 3IUQA 4KYVA 4M0FA 4Y2TA 2VAVA 3F98A 3F96A 3FYUA 3S8YA 3WK6A 3IUNA 1FFBA 1VZ2A 2XUPA 3FWHA 1DT3A 3V1LA 2CZQA 3H1BA 2VJAA 4B81A 4MEBA 2B61A 4ZREA 3AZPA 3SX4A 2P8SA 5ALJA 2ACEA 3WLAA 2XMZA 3IUJA 3OURA 4CCWA 3D5EA 3E1GA 1QIGA 3C5VA 2PSFA 2PU7A 5AM4A 2JGEA 5FUMA 4Y2QA 1FFEA 2OXEA 1QTIA 4H7FA 4ARAA 4FMPA 5JASA 2WJ3A 3STWA 2QT9A 5HCUA 2CKMA 5D7BA 5A62A 2V98A 1W4LA 1QO9A 3VJMA 1O6GA 3D59A 3FBWA 3FVTA 1W76A 4AQDA 3UUFA 4CCYA 3LP5A 4X3CA 4MEAA 2XMCA 3CN7A 1XRPA 5HQ3A 4CG3A 3I2IA 1YAJA 4ZV7A 4BYMA 3WKDA 4LXGA 2B9VA 4F21A 3ESAA 1U65A 1CVLA 1Y7HA 2OGSA 3H19A 3G02A 5IVIA 1ORWA 5CURA 3JW8A 3U1TA 3DQZA 5ALEA 2EDCA 2IIVA 3AIMA 5ALVA 4UBLA 4BAGA 3WL5A 1NU8A 3IUMA 3ILSA 2Y2VA 3KWFA 4X91A 5EHNA 3M83A 4B7ZA 3C6BA 2GBGA 3G0CA 1TCCA 4BZWA 2AJDA 4PSDA 3VXKA 1P0MA 3VJLA 4MXDA 4BVLA 2VJBA 1LPNA 3ED1A 5ALUA 1X2EA 2OGZA 3R0VA 1R9MA 2ECFA 2WFLA 2O7RA 1Q84A 1E5TA 1LLFA 1LPAB 1IZ8A 3L1HA 2XUIA 3HEAA 1EI9A 4RGYA 1FFAA 5DNVA 1FFCA 2Y6UA 4Z49A 2VTVA 2WUFA 2PM8A 5CBKA 5ALYA 4J0DA 4FNGA 3JYHA 1L7AA 2XDWA 2CMFA 1KU6A 1VE6A 2QJWA 2K2QB 4MWSA 3D2CA 3PICA 2CEKA 2XLBA 3QZUA 5EIHA 1CUYA 4BCBA 3G0IA 4FKBA 3FYUB 4TGLA 4P08A 4WFIA 3HXKA 3WWOA 4JNCA 2JGFA 2XUOA 2WU3A 3ZWQA 4GLBA 3P2MA 3W06A 4AX4A 1EDEA 1ORVA 4M0EA 2HA4A 3HJUA 3QMMA 5HKAA 1CUVA 3GA7A 5FPQA 5AH0A 1XZGA 3EF3A 4YPVA 2PSJA 4AN1A 1ZICA 2BAGA 1K8QA 2XMDA 1DX6A 5LZ8A 1EHYA 2LIPA 3H0CA 1EDDA 1ZD2P 5BWCA 1KU0A 1UOOA 3WZLA 4CCYB 3JWEA 3NUZA 4X95A 3C43A 4PNZA 4G4JA 4DTCA 5HQ3B 3HLKA 1CUAA 1GPLA 2Z3WA 5CTAA 5HK8A 4C88A 4FHZA 5AKLA 1AMNA 2X76A 3E4DA 4F5ZA 1J07A 3B12A 2BGRA 5FKJA 2WUGA 5C8VA 2QKYA 1C4XA 1XROA 4J0GA 5AM0A 3M3DA 4GWLA 3T52A 5AOBA 4KR0A 1RP1A 2H9YA 1X70A 2CBGA 1EVEA 1XQWA 4BP9A 5AOCA 4FDMA 3WK4A 1ACLA 2OLEA 5HF6A 1ETHA 3WQHA 5LKRA 5JALA 5T4EA 4BE9A 3W2TA 1XRRA 1XZIA 1XZJA 5HKBA 1ZI8A 2VJCA 4IO0A 5FXMA 2X8BA 3K2IA 5JD5A 4QEKA 2WFLB 1UOQA 4UFOA 4MWTA 5H3HA 1XZKA 3WIOA 1QE3A 1JT2A 3KXPA 3QPCA 4DM7A 3G9ZA 4PF1A 4INZA 1H2WA 3LS2A 2HIHA 5JD6A 5E4TA 3BL8A 2WG1A 4ZWNA 3WWCA 5ALRA 5AOAA 5FOQA 2WIFA 3ESCA 3M82A 1AKNA 2ZJFA 1PJAA 2PSHA 4EZIA 5HZGA 5C7YA 1YA4A 4J0KA 2WUDA 2ZSHA 3C45A 3SWWA 2EDAA 2ACKA 4QDUA 3GELA 2O2IA 1NX9A 3D4LA 2XUGA 1T4MA 4E46A 5DTIA 4BE4A 3D7RA 1CR6A 4ZV9A 1YASA 2BUBA 1XZFA 4DSZA 5ALQA 3O4HA 2XUKA 5JAHA 1F0PA 3H2KA 4MYSA 3DNMA 4H7HA 1ZGCA 2YH2A 2OCKA 4H7JA 1CUDA 1FSSA 3STYA 4L72A 1WB6A 2VQ6A 3L1JA 3G0DA 4OU4A 3AZQA 1WM1A 1TCAA 4B85A 2IX9A 1SOMA 3I2JA 1UXOA 2WHPA 3ZV7A 5BV7A 3IBTA 1XRNA 1VXRA 1LBTA 3BWXA 2FJPA 1SC9A 4UHDA 4LYEA 3IDAA 3DDUA 2DQZA 3W9UA 5EFZA 5F4ZA 2PSEA 1EINA 1CUGA 4UHFA 1Z68A 2VAXA 1EVQA 4OYLA 2AJBA 4B9EA 1CUWA 4GECA 5LZ4A 2HA7A 3G7NA 3LIPA 4HS9A 4UHBA 4JH0A 1JJBA 4BBZA 1H2YA 5CH5A 3OC0A 5AI9A 1JMYA 3F67A 1UK8A 2XUFA 2AJCA 4CG2A 1VZ3A 5CT9A 4AMZA 3V1NA 5AK6A 1Q0RA 6YASA 4Y2YA 1QTRA 2H7XA 2XT0A 1XRQA 4EY4A 2XUHA 3RKSA 2I3ZA 3B5EA 4Q05A 1F6WA 2B4KA 2HL6A 2G4LA 3VJKA 4RE5A 5AJHA 1CQWA 3FLAA 4BP8A 3O4JA 3FLBA 4NVRA 1W52X 4L0CA 5AM2A 3E3AA 4I3FA 5I7UA 2Z8ZA 2HU7A 4K2AA 4FLMA 4G4IA 3AIOA 3UUEA 1BS9A 4IQ4A 5JZ9A 4RE6A 3R3YA 2QUBA 2I3DA 5HF5A 2XQJA 2WFMA 3QMWA 5EHQA 4KACA 3QM1A 4BAUA 3F9CA 4DMCA 2VJDA 4BAZA 5DNWA 1VA5A 5ALOA 4Y2RA 3T4UA 5ALDA 1TRHA 2HADA 1BE0A 2WG2A 4N8SA 1EX9A 4D9JA 4E14A 4QNNA 5AKKA 4P92A 1QIIA 4EY7A 5T4HA 3BDVA 2WHPB 1L7RA 1UWCA 3DL4A 1A7UA 1GXSA 4J0CA 3W04A 1DTEA 4V2IA 2CJPA 2ES4A 2HA0A 3BXPA 3AZOA 3KWJA 3H2IA 4Y2SA 4EHBA 3RK4A 4RPCA 3F97A 2YASA 4BDTA 1B41A 1U4NA 4DYHA 2QJRA 2DHDA 1IVYA 4X71A 3ANTA 3I2FA 2WLSA 3I2KA 3B3QA 4WFKA 4XWGA 5HF8A 4QE3A 4J0IA 3HABA 5DLPA 4X6YA 3NGMA 4GHWA 3RM3A 3WKCA 5IVHA 4B84A 5IKXA 1XQVA 3V1MA 3KDAA 2DR0A 2JIDA 4P93A 4DLNA 4UBMA 1XLUA 5AK3A 1LPPA 1ISPA 3EIOA 2JF0A 4AB1A 4DNFA 1TK3A 2BKLA 3FSGA 2DQYA 5SYMA 1QOZA 5T4BA 3DCNA 4H18A 3R3VA 3DL7A 4DIUA 4U2GA 5AKZA 2RGUA 2XMGA 4B6GA 4X7BA 1QFSA 5AI4A 2H1IA 5C81A 1A88A 1R4ZA 3VVMA 4BRZA 5LKAA 2HA3A 2HM7A 5JANA 1U8EA 3IIIA 1VKHA 1U2EA 2E3JA 4H35A 1DQZA 3ZI7A 1GPKA 1P0PA 5ALLA 4H77A 4EUSA 3HRHA 4HXFB 1QIEA 2ZYIA 2VEOA 4WFJA 1G4HA 2YXPX 1VOTA 2BUAA 1HBJA 4W1SA 1JU4A 1Q83A 5ALIA 4H0CA 2W22A 3F8SA 3S2ZA 1AC5A 3QITA 1AGYA 1TAHA 1MNAA 1WHTA 1CPYA 3TGLA 2QXTA 1ZOIA 4Y9SA 2C5FA 5JARA 1CUZA 4Q3LA 1DT5A 5JIBA 1M33A 1K63A 1YA8A 4QDOA 1G66A 4ZXFA 1ODCA 3DOIA 4U2CA 5AM1A 5AIBA 1A8SA 3HYSA 4QA9A 4J7AA 3O0DA 4W9RA 1ZIYA 5A71A 1UK9A 4Q3KA 3G9XA 2WM2A 4QDXA 2WJ6A 4GDMA 5JAPA 2XQFA 2W6CX 2XUQA 1H2XA 3O95A 1MAAA 4JYPA 2RI6A 4QWWA 1OXMA 2J3DA 4ZI5A 2XI4A 2OCIA 1N5MA 3R41A 3A70A 2IITA 1F0NA 2ZVDA 1BRTA 5CT4A 3R3XA 4CG1A 5DWDA 1WPXA 1GPNA 3WZMA 1EA5A 3OM8A 1XZEA 5A7GA 4DMHA 5AK5A 2HRRA 5IVDA 2HFJA 3FYUC 2JGIA 2JGJA 1DINA 2C4HA 1S8OA 1VLQA 3H18A 5LLSA 4IH9A 2PX6A 4X00A 2XMQA 5KBYA 1LNSA 1UKBA 3R40A 1EDBA 1UK7A 5K3AA 5LZ7A 4QZVA 4JYMA 1MNQA 1HQDA 4DNOA 3WK8A 4FLFA 2Y6VA 4CIBA 2WHQA 5DYYA 4KAAA 1GKKA 1QIDA 5C8ZA 4BTLA 1BN7A 1J06A 1EK2A 3BIXA 3FCXA 4AZ3A 5DNUA 1N8SA 5A7HA 3CXUA 5K5EA 1XKTA 2R11A 3Q0TA 1XFDA 4GI1A 3BE8A 4Y2JA 4GXNA 1AUOA 3D0KA 1CUJA 2WJ4A 1N5RA 3I1IA 4Y7DA 1MN6A 5JD4A 1QIKA 5AO9A 5CRIA 3PUIA 4DNQA 1C7JA 2QR5A 4EY6A 5CT5A 4FFVA 3GUUA 3EQ9A 2QXUA 3G0BA 1DWOA 4ROTA 5AKGA 1CV2A 3ZLVA 1RWQA 4C01A 2PPLA 4AO7A 2DSNA 3M81A 4QLAA 1GQSA 4BTVA 1YB6A 3C6ZA 1CRLA 4G8DA 3I6YA 4BB0A 3V9AA 3AILA 2WU4A 2ZYSA 3DYVA 5I8PA 2RHTA 4DMFA 2G5PA 4H7EA 4XJVA 2VT6A 2QRUA 4UPDA 4B9AA 1E8DA 1JJIA 4KJXA 4X6UA 1WOMA 5FP0A 1ZD3A 3D2AA 1XLVA 2NW6A 3BF7A 1E8MA 4J3JA 4Q3OA 3MUNA 5HFNA 1R3DA 3C6YA 2VATA 5DTJA 3WL8A 4B82A 3W9BA 1CUHA 3WL7A 3QBJA 4OPMA 2BCEA 3IURA 1AURA 1BN6A 3FSGD 4UBNA 2WQZA 3K9BA 3ANSA 4AO8A 3PI6A 1JKMA 3HC7A 3N2ZB 1SCQA 1UZAA 4L9AA 3FLEA 5C8XA 1UOPA 4U2DA 1LBSA 1Q0ZA 1CUFA 1MPXA 3IB3A 4YASA 2O2HA 3PF9A 3RLIA 1XRLA 1IMJA 1CUIA 1F8UA 1QONA 3QPAA 3R3ZA 1QIJA 3WL6A 3WWEA 3D3NA 3WK5A 3IVMA 1W6RA 2VSQA 1D07A 1WB5A 4Y2PA 5E4YA 4CIAA 2C0QA 4J0JA 1W1IA 2DHEA 4PW0A 1Y37A 2X5XA 2XQGA 1ZGBA 3DS8A 4XIIA 4KE9A 3QPDA 3R3WA 2JEYA 4OSEA 4DGQA 3PE6A 1MX1A 5LP1A 1HLGA 1XLWA 4ETWA 3SC2A 5A2GA 5AI0A 4MYDA 3D2BA 4QWMA 3ZLTA 5CMLA 1AZWA 4TVKA 4F60A 3WKAA 3H2JA 4PSCA 1MAHA 4BDSA 4ITVA 1WHSA 4XX1A 3NWOA 1TQHA 2H7CA 3DJYA 2D0DA 5JAOA 1SCIA 4BCCA 5HF9A 5CT6A 2Y2UA 3I6MA 2ZJ6A 3W05A 4TPKA 5AP9A 4UFNA 2WIJA 3VDXA 2ONCA 3H2GA 3R3UA 5EIAA 1X2BA 4YX9A 4LKOA 3I6ZA 2GZRA 2BUCA 3QH4A 4BZZA 2Y1KA 2QOEA 3N0TA 4UBIA 3BIWA 4EY8A 3WWDA 3OG9A 5K3DA 1H2ZA 3A2MA 3DKKA 3CCCA 4X97A 3IULA 3ZPXA 4IH1A 1IUPA 1QFMA 4A23A 5JZSA 1YB7A 2OAEA 1CUCA 4S0XA 2HHAA 3WYNA 1KEZA 2PBLA 4G9EA 4L3WA 1I6WA 1SFRA 1T2NA 1ODSA 1GKLA 5ALSA 2G63A 2ZSIA 5KWJA 3STVA 2JGLA 2OCLA 4HRXA 2YYSA 4BVJA 3QMVA 3WYDA 4K6HA 3BDIA 5JAUA 4WDQA 4KE7A 4W1QA 1SCKA 5AI8A 4C6HA 5EHZA 1NU6A 2GYWA 5LIPA 1EXWA 4G8CA 4X92A 1CUEA 5ALTA 1AQLA 3K6KA 5FRDA 2OAGA 3TJMA 4UHHA 4OU5A 2ROQA 2RHWA 3A6ZA 1B6GA 2V96A 2C5GA 4OB6A 5A6VA 3O9MA 5JADA 3BF8A 3EBLA 2WIGA 1CUUA 3I1YA 1Y7IA 3KD2A 4HAIA 5DJ5A 3OPMA 4LYDA 1GZ7A 1HKHA 2J4FA 4H7KA 5T4FA 3QVMA 3KOOA 5BWBA 2V9ZA 4C4ZA 4GBGA 1A8UA 1BEEA 3C5WP 3PFBA 1CFJA 1IUOA 4BC1A 3DLTA 1ZI9A 5ALFA 2VF2A 4HVTA 1W75A 1R50A 1QJ4A 4UBOA 2PVSA 1VA4A 3WMRA 1ZJ5A 3C87A 2DCMA 2V97A 3ZLUA 3QYJA 3DEAA 3AJAA 1VE7A 3PF8A 4FFWA 4OD0A 1L7QA 4W63A 4X93A 3E0XA 4XVCA 3IA2A 4FTWA 2O7VA 1R88A 1MT3A 4I4CA 2HU8A 5HK9A 4UHEA 4J0HA 3ICVA 1MJ5A 1QIMA 5BOVA 3GBSA 4OCZA 2QUAA 5K3FB 2H7YA 4AO6A 1MTZA 4Q82A 1QO7A 2HA6A 4Q1VA 5CH8A 1IZ7A 4JUIA 5CH3A 3AFIA 4Y2UA 5AM3A 1XQXA 4BVKA 4LIPD 5CW2A 4GW3A 1QZ3A 4K6GA 3FAKA 2XB6A 7YASA 5KREA 3A2NA 3C70A 1UKCA 2AJLI 4WY5A 5A7FA 2GBIA 3LLCA 1YS2X 1E66A 1UT6A 2Q0XA 4HXEB 1XZDA 3FCYA 1YR2A 3VVLA 2OPHA 3OOSA 1UFOA 1PV1A 4M0MA 2PUJA 2I03A 3OTQA 3PUHA 3A2LA 1G42A 3LIIA 3EQ7A 1HDEA 1CUBA 2WG0A 5D6OA 5AIAA 3HACA 3GFFA 3SK0A 2FX5A 4EA6A 5KWIA 4KRYA 2XUAA 3C6XA 5LZ2A 1GQRA 1DWPA 4N8EA 2WTMA 3DKRA 5LZ9A 3I2GA 4NS4A 1THGA 1EB8A 2JEZA 1CQZA 2WKWA 5FLKA 4FLEA 3KSRA 1MX9A 2O2GA 4W1PA 3WA7A 1LZKA 2RIPA 3WKEA 1QLWA 2XMBA 4G9GA 2XLCA 2WILA 4BATA 4B80A 4PO3X 5AKEA 4G8BA 5IVKA 5K3BA 2OG1A 4KE8A 2XMRA 1VJ5A 2Z3ZA 2DHCA 3H2HA 1YCDA 5JZBA 1CIJA 2GBFA 4MJ3A 3EQ8A 1J1IA 5ALNA 2JBWA 1GGVA 3UMJA 3YASA 1ZD5A 4I19A 1ZD4A 1MX5A 5ALHA 4OB7A 2BFNA 2ZJ7A 1GT6A 5AHXA 2WTNA 5K3EA 1QIFA 1LPBB 2PL5A 2Z8XA 4WY8A 4KAJA 4MQLA 2FJ0A 3STTA 4O08A 3I2HA 3STUA 4BCDA 2XE4A 4HTAA 1WCYA 3WJ1A 4G5XA 4Q34A 2AJ8A 3WWPA 3MVEA 3HSSA 1H22A 3O9VA 4H7IA 4PQEA 2RAUA 2XUJA 5DYWA 1DU4A 4X90A 2ZYHA 4IHAA 5EIEA 2J4CA 2DFPA 1FJ2A 4FWBA 3H17A 2QMQA 2AXEA 2HU5A 1XRMA 4AXBA 1O6FA 4G4GA 2XUDA 5AK4A 4C87A 4EY5A 4C4XA 3ESDA 4EBBA 5AICA 1UKAA 1LPMA 4G1FA 2XQIA 1XZMA 1CEXA 5D3KA 2WIDA 3NOXA 5ESRA 1BU8A 1LPSA 1YSCA 4HZGA 3O4GA 5CXUA 3ESBA
chains in the Genus database with same CATH superfamily
2FHPA 3BZUA 1N7IA 4YV1A 3ZX4A 1NTOA 3H1AA 1M6YA 4KN9S 3ZD7A 2HWYA 4F2PA 1ZGHA 1CE8A 4HEHA 2J87A 4KWTA 4UDOA 5EE5B 3V80A 4BMDA 1G3IA 4CM9D 2M6KA 4FYWA 1GGNA 2IFTA 3BERA 4NDNE 1VLLA 3WGQA 1KEWA 3HQ4O 2REOA 3CGGA 2OGTA 4M99A 1B00A 5BN4A 1WCIB 1C4WA 3L3BA 2YTZA 4L9RA 1W85A 1TT5B 4WEQA 2IYTA 5D86A 3T54A 1ZG3A 2XH8A 4YCAA 1UIRA 3D8SA 1W94A 3B13B 1Y3HA 3GRFA 5D3ZA 4V0QA 2WE8A 4LN1A 1C0LA 1S1MA 4CM4B 1N6NA 3DHNA 3ISVA 3ICOA 3K92A 2HXGA 2ZUDA 4YK7A 1N5OX 3A6LA 1JZQA 3JD0A 2AOUA 1GEEA 3FGOA 3QEOA 1K5DA 4LBZA 2OORA 8ATCA 3VKFA 4EI9A 2ECOA 1TK9A 5DNYB 5I6DA 1IBLB 2IGTA 3HXQA 4I1VA 4JBHA 1ZLXA 2NUAA 2YINC 5J58A 3NRBA 4IIGA 2V9PA 2GRJA 4MMYB 3D7KA 4BMOB 1XZQA 4FOLA 3H11B 5TPZD 1S5PA 1IXYA 1BD4A 2H4FA 3GA5A 2WWTA 1OTXA 3LTEA 4MVJH 2B2XA 4O4JF 1ZJYA 2I4MA 2MYTA 4LXQA 4MYCA 5BQ5A 1LQTA 3CISA 4GI2A 3JWJA 1D1QA 2BGNA 3URMA 4BBJA 5K8TA 1BVYF 1XZCA 1ML3A 1PZFA 2X1VA 1JQJC 4HEA6 4L0DA 2HCRA 2VNIA 3RSOA 3IP6A 2Q7XA 1RQ7A 3IQEA 5FT9A 1AX9A 2VPWA 3O2JA 4QGHA 3TPFA 3GZNA 1RBQA 3OQ1A 3ZCUA 1H65A 4UUQA 2VYVA 3OESA 4KFRA 2P5UA 2IYUA 2CVOA 3DV9A 2X0FA 4C2BA 1IVSA 1RFLA 4WA8A 2ON6A 1DZ3A 1IK4A 4R2MA 3KVRA 2A67A 2PAAA 3INNA 1EG2A 3BTUA 4DB2A 4E22A 3GPDG 2VWGA 2OFPA 3GPBA 3GMDA 4GNKA 3FSJX 4LQCA 4FDUA 5AI6A 1MFPA 4YRBA 5IVPA 2ZYRA 2HGZA 1N1GA 1X39A 2DUNA 3KJXA 1Y8ZA 3ELUA 1KAMA 2GZ3A 4B83A 1UPUA 3MJHA 3HPQA 4KP7A 1TTTA 1MC8A 3PNOA 2J09A 1IPFA 2D2FA 1GLGA 4RZ2A 3U0BA 4AQ7A 1GA4A 1J2EA 1HL7A 3ODGA 2ZB2A 1Y81A 4J94A 4HDKA 3AX6A 2AYYA 1IWBB 2C8KA 1QZUA 2GPYA 4JKIA 4KVZA 1BWPA 2C07A 3CVJA 3EZGA 2OILA 4K05A 4NX2A 4X9XA 3FKQA 1KNXA 1L7OA 2GYVA 4R7TA 4BIIA 3GEMA 3I0MA 3MT7A 5JEDA 1L5FA 3EA0A 3NT4A 1PSZA 1Y5MA 2DT8A 3PC7A 5IH7A 3GDFA 3ENKA 4JP8A 1R4MA 3IUSA 3SIRA 3LI2A 4X66B 3DYIA 4AF6A 1M5TA 4CTKA 2FWIA 5D1NA 1N2BA 3WQSB 1JFRA 4Q9HA 2C20A 2OD9A 3E8SA 3TZEA 5HRAA 2AG6A 5FI5A 4BQIA 4F97A 2I78A 1Z33A 2O7SA 5F51A 1QDEA 3UK2A 1YDGA 2Q6OA 5KU1A 4RHCA 1Y5IA 4D57A 2ZDQA 1Y8CA 4NWIA 4UNSA 1W59A 1Y1QA 3AQ4A 4JLJA 2YMPA 4UEWA 5AI5A 4G97A 3IV9A 4HX2A 2NZJA 2J3QA 4MR7A 2QWXA 4BPRA 2P4HX 2FPKA 2QL6A 2H57A 3HLTA 5K4AA 2F48A 6Q21A 4NICA 2QN7A 3I8SA 3VNAA 1Z5GA 4EG4A 1BQEA 2FSFA 5DM1A 1Q20A 2GPWA 3P8ZA 1CETA 3UICA 4DE5A 1JMKC 3PKJA 1SUEA 3TRFA 2FPPB 3KBOA 5AXBA 1KBOA 4QYXA 3CVVA 1SRQA 2LCFA 1GKYA 5E6UB 5AVOA 3T5DA 4F3KA 2G7MC 3IHKA 2OHHA 1LZLA 4MVJG 2IPNA 1XOIA 4HYEA 5AHWA 1S4MA 3GLTA 4NBVA 2FWMX 2PUBA 1KMIY 3V48A 3F8WA 4OQQA 3ORYA 1RZRA 2AEFA 4DSAA 2XMPA 3ZJ4A 2X8LA 4WN3A 4EPYA 2B8NA 4JODA 5I5GA 1YU6A 1Z88A 1ZVJA 1DELA 1BCRA 1BROA 2HEGA 3NQ41 3P0RA 4R84A 4XD7D 3TD6A 3WNZA 2RH5A 1OFUA 4B74A 2H2WA 2O0MA 5LIRA 3EG9B 4G2NA 2KBFA 2EQBA 1BXGA 3IV7A 1L1RA 1STOA 1RWMA 1BX0A 1W5AA 2C2HA 2X1HA 2N3ZA 3SBDA 3PFCA 5ALGA 1W36D 5K0JA 1CE8B 1K88A 4MWZA 4UARA 2GCGA 4R5HA 1ORTA 5KCMA 4TVSA 5K05A 1DO8A 4EO7A 2I2XB 2CMHA 4LC9A 4WADA 1AUQA 5BN4B 3TWOA 4D45A 3ZUPA 4U2EA 1BGWA 3M2PA 1W85B 3VPAA 3M6FA 1N1MA 2C4MA 2XYGA 4OQEA 1OH5A 3S6JA 5EIBD 2Y8EA 4EKIA 1EWRA 3KKOA 3GVHA 1XAIA 2OO7A 3H3JA 1K5PA 3GDGA 1NMSA 1U4OA 3CRRA 3PD7A 4YAWA 1BYIA 2AOUB 5LVAA 2ZSEA 5THQA 1CCWA 3BAZA 3N6XA 4GOOD 5KQRA 1LKZA 1VIVA 3DZKA 4XCVA 1M7BA 1DTWA 2FFHA 5GZ6A 5IJXA 3C7AA 4WSOA 4IJMA 5D3MA 2V45A 1KAQA 1VJ0A 1V7ZA 2H18A 3GNLA 1FDVA 2NUAB 4B3XA 2WAXA 1WVGA 5EMKA 3LTNC 3VO2A 1HORA 4RNCA 1BKDR 2QVBA 1ZNYA 3EZ6A 3IDOA 1AB5A 2HA5A 3NKLA 1ZWKA 1VJGA 3CPEA 3H84A 4Q1AA 1P2GA 3HJHA 2OSVA 2PQ6A 4G0YA 1MG0A 3M6LA 1MIOA 1EK1A 1EFDN 3EA5A 2B3TA 3ECSA 1W0JA 1T8TA 3HU5A 3WRVA 5JATA 3L1VA 4FSDA 5J3JA 1O3YA 3EMBA 1GFZA 1SN7A 1ZI6A 2GN6A 4N5MA 4AG5A 1BDJA 1XXHA 3R3SA 4XQCA 4DMUB 1I7NA 1JI0A 1U1GA 2ECKA 1UC8A 3P5SA 4J76A 2IY8A 2W2KB 1YBMA 1GU0A 3GZNB 2XRZA 2ZRDA 4FHCA 2J5RA 3X2SA 4AKEA 2Y0DA 2C92A 1OI7A 1SCUA 4LMBA 1XI2A 2J9XB 1R6DA 3TFOA 4ZRMA 4ZVQA 3LW8A 3QPWA 4YRJA 2LCQA 4XGRA 1C3EA 3GZ4A 5B3KA 4W5HA 5KS2A 2PFKA 4RTPA 4LXIA 5BW6B 1Z16A 3WYCA 2P2SA 3RVPA 1IULA 3DCJA 3ENQA 2GCPA 4HGZA 5T57A 3ICWA 1V3QE 1V3UA 1SQ0A 1VSTA 2FZCA 2H9IA 3FTNA 1A9QA 3QLUA 3V33A 1Y34E 1O97D 4MGZR 3VPDA 4B8WA 2XSZD 4Z9YA 2BYTA 1R9NA 2HPAA 4GE0A 4A8TA 1E96A 3G0GA 4HDKB 4ZOLA 3LL4A 4FEAA 1KZ4A 3SJAA 3WAGA 3EGWA 1DHRA 2PMDA 3NHBA 2B20A 5PGMA 4HX5A 1FU4A 2VWQA 2OQVA 1R4MB 3I39X 3PNVA 4K3VA 4A92A 3VNQA 2WMNB 4Q18A 1XK7A 3ISTA 5E7IA 5DXAA 4HATA 2ATXA 3R0QA 1CKEA 4G0MA 4IBOA 1KPGA 3EC2A 4KQHA 1CZKA 1CZOA 4K6MA 5CYOA 1U2TA 3KZNA 4A16A 5K6RA 2AMLA 2JH8A 3ZWPA 2I8LA 3PZRA 3CT4A 1A5AB 1JLHA 1WKBA 4JLDA 1KZGB 2KHZA 4NYIR 3JZAA 4DIOA 3C8DA 4CFSA 4G56A 1EAYA 4D9GA 5BUQA 1SR8A 3DOHA 4MYUA 1NXVA 4YALA 4IIJF 1XQ1A 5H1YA 4CFZA 4B3RB 4MR7B 1J22A 2H3EA 5JXWA 4YEDA 2O1SA 5BP7A 2JI4A 2OBNA 1QG4A 1TLLA 2QS9A 1WB4A 4MQMA 3VYWA 2NTVA 2QN8A 3PHHA 4B7CA 2QF7A 1I9CA 3CVOA 1KK1A 2CNWD 4YMLA 5I4IA 4FBLA 4IIEA 3ZE8A 1T9HA 4RTOA 1PVDA 1UBCA 1RLIA 4CDNA 1UIMA 1PAUA 2SNIE 4NYMR 3ASVA 1ORHA 4LJAA 4IUYA 2BL4A 2HHLA 4DA4A 4NNJA 1DBSA 2QE7A 2VF8A 3L7BA 4IV5A 5CIWA 5BRNA 1F1JA 5I7AA 4LNHA 3LKZA 4FGUA 5IM4F 2ZIWB 1RQLA 2CNNA 1E89A 2IPAB 3K6SB 4N47A 1JBQA 4URYR 1BCRB 4AMYA 1TUBB 1M76A 3BQNB 4QRIA 1B2RA 4J0EA 4UBKA 1YZKA 1Z7BA 2YJNA 1Q3HA 3HWX1 3MTAA 3RASA 1JWAB 1RAHA 1RAEA 1VE9A 4Q9DA 4KI7A 2GBCA 2I7CA 3P1JA 3RGWS 1BXGB 3X1YA 2CY0A 4F3CA 1DFIA 4ENRA 4X20A 2YY7A 3F5DA 1AM4D 1Q2UA 2D1QA 3BWYA 4H6XA 2HHJA 2FHSA 3AUKA 1YR1A 1XPUA 2ZZNA 2A2ZA 3IVGA 4JOCA 4LX0A 4QUIA 2C2GA 1CJMA 1Q1BA 2FWNA 3NEYA 2BC9A 4BFUA 3L93A 4PFQA 2QIPA 3BIOA 4PYMA 1IM8A 3WJ2A 3WQBA 3S8EA 5FBVB 4BLQA 1CDOA 5CIQA 5ICGA 2YZNA 5ISMA 3E9CA 1PJZA 2P7IA 1NQXA 1VLZA 3RAFC 4N48A 3UG6A 3FYDA 1XCLA 1A97A 1FSFA 4MW4A 5AVUA 2GYUA 1NP6A 3OMWA 5A04A 3K70B 2AZDA 2OP0A 3EOZA 3SKYA 2VL7A 3K1YA 3X3HA 4E5UA 4PGAA 4M0FA 1NJSA 4Y2TA 5IWAB 1L5QA 1KDOA 2AZMA 4W7IA 4UUNA 2VAVA 5TGZA 3F98A 3RIGA 1XPJA 1WF3A 3FYUA 2WDPA 1H3NA 4ZU3A 1DTWB 2WTXA 5D3MB 2B1QA 1P3Y1 4YQZA 5I9SA 4I1RA 3AESA 3ROFA 3ITKA 4TZ0A 3LQ2A 1L3IA 2XUPA 2QAGC 3FWHA 4PG4A 1WY5A 5DU2A 5BYJA 4PY2A 1DT3A 3RSZA 4ITRC 4B2LA 2WWXA 4HGQA 1FDSA 5LXTF 4MEBA 5GY7A 1MIOB 1CW2B 4AMGA 2FEPA 3MS7A 4NU5A 5A9SA 3D7MA 5ALJA 3UWPA 3ID6C 5EJ2A 2EJCA 3M6UA 4UVEA 2P6UA 1C9JA 1D09A 4LZPA 4CCWA 3VNRA 1XXHB 3H86A 3HR7A 3MWDA 3M9LA 3C3JA 1SRRA 1QIGA 1SXJD 5CUQA 1ICEA 1VE3A 2V1XA 2NX2A 5J4KA 1YNSA 1QVAA 2EAUA 5AM4A 2PLAA 1SCUB 3KQVA 4TLAA 1ESMA 5DASA 3AUJB 3CJQA 4I99A 4XARA 2KPOA 4Z2YA 1FFEA 2OXEA 3I32A 3R44A 1QTIA 2BFDA 4YUYA 3UENA 4Z51A 5JASA 3R76A 4JYZA 3QY0A 4TTJA 4JJ6A 5B55A 5C1OA 3AT1A 2PWPA 3DEKA 3QG5A 1E0SA 1TU0A 2CKMA 5KKAA 4OQDA 5E9JA 2ZS8A 3GLIE 2V98A 3TEFA 4JU9A 2BGIA 4JT9A 3PKZA 2XODA 4ZEXA 2QRKA 5B57C 3ECAA 5JCJA 3X0DA 2QTMA 1W76A 1PUIA 3FOEC 4ZCTA 4MJ7A 3PCXA 2I6GA 3K35A 2XMCA 2NTJA 4B8YA 1XRPA 4UPEA 1EK0A 4X3PA 4XTCS 4ZOLB 3HDHA 2DT5A 3WKDA 3QOFA 4BX3A 4ZHQA 3IPCA 2VHVA 1EP9A 3TL6A 4G1EB 2A1TS 4ZMBA 1X7HA 2QGNA 3HY3A 4WFQA 4OXIA 4YRLA 3BSWA 3ESAA 4KODA 5AVQA 4XEUA 1Y7HA 4RM3A 3VR3D 2X0DA 2RGGA 5JSYA 3GJ0A 5SY4A 1ECBA 2OE2A 4HKTA 2JCVA 3E6AA 4FZVA 3TAXA 1HRDA 3FYCA 1PUJA 1C9DB 3DQZA 4JP2A 5BRJA 4I5EA 4OM8A 2AMJA 3UCFA 1LJLA 5KX5F 3B6ZA 1J0BA 5F23A 1JHAA 1RVV1 4H59A 2R5WA 4F5DA 4YMUA 1QP8A 2VRCD 4L73A 3WL5A 1ZEJA 2X2OA 3FZGA 3IYLW 1DAKA 1TZKA 4U39A 3ILSA 4ISBA 4TTVA 1KWKA 4IHQA 2GEFA 3KWFA 3D8UA 3U9LA 4Z6KA 5BYAA 3KZOA 2O59A 5CGZA 3CZ5A 2QROA 4QU9A 2P1RA 5DLEA 1M5UA 1G7RA 3Q6NA 3MN1A 5C8YA 4DQUA 1TCCA 3TMAA 4ZAYA 5CJJA 4DLXA 3SM9A 5E3IA 3CBGA 2CLHB 4MXDA 5HIMA 1NC1A 2YC2C 1GG5A 3QUQA 2EKPA 4HNGA 4RLFA 3E53A 3RFFA 4EAQA 2R7LA 3B3AA 3KHSA 3OD1A 1P33A 4BKPA 4ME6A 1H42A 5AXAA 1D1TA 4PYOA 5CFNA 3IILA 2W83A 2G1JA 5ANRB 3VKUA 2VDWB 3D4PA 3LECA 4FDVA 1ZMBA 1S8AA 2B4YA 1R9MA 4HJRA 4PX2A 2ECFA 5B30A 3TW4A 3LDUA 2QVYX 4GMGA 2HMWA 1LPAB 1U9YA 1O95A 4TKMA 1TD1A 1I4OA 1VBMA 3SI7A 1L4MA 2H0QA 1QBKC 2PRIA 3H9BA 3M5CA 4FP9A 4OATA 2XUIA 2I87A 3HEAA 1EI9A 1NL3A 2V5AA 2WNSA 2QK4A 3BE5A 4X20B 3KR9A 1X77A 4GVXA 1L5HA 3TDKA 3DPSA 3KE8A 4JC0A 4MV3A 3WLJA 3CMMA 4KQCA 1ZIPA 3K5IA 2PM8A 2VK1A 4NPHA 3FSEA 4BNZA 4V2UA 3T9DA 1L7AA 2A0WA 1Q0PA 1VKNA 4LI0A 2CMFA 3IAAA 4LFBB 4YFVA 5C4MA 1G8FA 2C57A 1GG9A 2JI6A 2OBBA 1QR2A 3E9ZA 3LHFA 3OX4A 4ZALA 2CVPA 1HM5A 4YRCA 1P2FA 1T9ZA 4EHLA 5KMGA 4MWSA 4M1EA 3CNNA 3VNVA 1UPAA 4TKZA 4DA8A 3CPJB 4NK5A 3QZUA 4ZV4A 1ZIDA 1XQ6A 2NTEA 3AR7A 1CUYA 3QLTA 5JHHB 1F14A 3L0IB 2DZDA 2OB1A 4FXOA 3IBSA 4F2HA 1Q44A 1QF7A 1T43A 1OTYA 3VSAA 2JFPA 2EP5A 1LRJA 3GLKA 3IP3A 5F2OA 3TVYA 1FYEA 3FYUB 3S2EA 3M6AA 2HD4A 1PWHA 3LXRA 4P08A 3HXKA 1L7EA 3JPWA 4R01A 1OWMA 4JNCA 2D4AA 3DBLA 2JGFA 4E7OA 4F46A 3ZWQA 2YJTD 3AESB 1OFGA 2A6PA 4GLBA 5EZ5A 3QWFA 3KOWA 3BJIC 4RACA 1W8DA 2PZJA 3Q9UA 2YN2A 4BEWA 2I2CA 2H8GA 2HA4A 3Q3CA 4QQFA 3D0QA 5A9SB 2J33A 3DMFA 3B3JA 2YWFA 1ENZA 1KE1A 3QMMA 5CNKA 1CUVA 4MCHA 3W5SA 4DZZA 4V0SA 2BGGA 2ZGVA 2ZUEA 5I51A 4ZQBA 3ADDA 5AH0A 3A9SA 3DE0X 4TWAA 1XD9A 3MWDB 2PSJA 2P8JA 3DFKA 1JLRA 4X61A 3IIJA 4XEHA 4RX1A 4P7GA 5H0IA 1FXUA 2V5VA 4AG6A 4YAIA 4KK4A 3BFJA 1NUQA 4BO5A 1B93A 1KR2A 1P8JA 3ICQB 5A4AA 2ETVA 4U00A 2DQKA 1N4DA 4OBBA 1TVCA 1QR6A 3H0CA 4D92A 4XDHA 1F12A 2BCGY 3OPYI 4GRAA 3JR7A 3RS8A 3KJIA 4GI7A 2RC5A 4RK5A 3ZX5A 4CM8A 4BVFA 2O2EA 4D98A 1KSJA 2BR5A 3ITEA 4KWEA 3TUIC 1YE3A 2QSJA 3WZLA 2LXNA 1AS3A 1J9ZA 2F8MA 1RMYA 1UBLS 3MGGA 4PAQA 4PPYA 3ONWA 3VR5D 1FF9A 1N77A 2FETA 4F9FA 1J8DA 5JMPA 5DNCA 1CRZA 2P41A 2GEUA 1C50A 4RKRA 4XR9A 2HX1A 2PFSA 3IR6A 4G4JA 5C2JB 1O9GA 2Q6TA 4EI8A 2HI0A 1EQ2A 1E2PA 1R2QA 1N2CA 4BGDA 3UTDA 1NQUA 2BFBA 3EC7A 4FHZA 1A04A 4YFYA 4DDVA 2ZFUA 3J7AC 2BR4A 3NCTA 4F5ZA 5B7NA 1NY6A 4EMTA 1M9NA 2LD4A 5P21A 2P2NA 2WUGA 2QNBA 3AKZA 1C4XA 3RF6A 1SD1A 3LBFA 4TT8A 3KPYA 1MFZA 4TMFA 5C0OE 1TRKA 4KR0A 3AVYA 5F1YA 5F3WB 3E1KA 5HJ7A 1X74A 4YJFA 1Z0ZA 2QLLA 1ZLYA 1JDNA 3F2VA 4B6SA 4EZBA 4JX8A 3UJ3X 2HH9A 2PA3A 1SOUA 2NLOA 2XGSA 5FD8A 1FP6A 5CFLA 1XQWA 4FZRA 3QVUA 3IO3A 4Z4CA 3UMRA 2J59A 2PRZA 1VJ1A 3QU4A 1KY4A 4AECA 3ZGOA 3H5WA 1ACLA 3PEUA 2IYAA 1CB7A 3TLMA 5KSOA 5C8YB 5HF6A 1KDVA 2IYOA 3F5QA 5LKRA 3TGWA 5JALA 1I1NA 5T4EA 2H1RA 5KNDD 4CF4A 4BE9A 1U0NA 1GNPA 2OBFA 2V7QA 1XZIA 1NI3A 3ENWA 4Q4LA 2FTKE 1F2TA 1NNI1 4DIBA 4ZC8A 3T34A 2ZRGA 2JB9A 5IN4A 1YB4A 1VI6A 5L4LA 1G6HA 1RLOA 1I0IA 2EL7A 1MF7A 3I3OA 3LE8A 1QFJA 4CUJA 1P6UA 3ANYB 3D0OA 2EP8A 4LZAA 3ZHVA 5HUHA 5I4CA 5JD5A 3GLHE 4B2IA 1R5BA 2ODWA 1VB3A 1U90A 4U1RA 3TOVA 3N58A 2Q28A 1BXKA 3ORQA 2OZEA 3K2EA 2DJIA 1XD2A 4KDEA 4MWTA 4UFOA 3O4RA 4DM3A 4EATA 3GLGE 3PGMA 3ZTWA 4TUYF 1SOAA 3KKKA 4RU1A 3ZHZA 3C0KA 4M1WA 1NSFA 1WSAA 3QPCA 1L5HB 1NQTA 2ZAMA 3ZCTA 3U6KA 2DM6A 3G9ZA 3HCNA 4QPZA 3L8EA 4W4TA 3D6FA 1W36C 3LS2A 2F59A 2HIHA 2YNMA 4P5EA 3BL8A 4JITA 5ARDA 3RFUA 2WG1A 1JL3A 1Q50A 1HTWA 4QT0A 4F45A 1NM5C 3SU8A 4YRMA 5L6MB 1YL5A 5HQTA 2QI9F 4R1QA 3T3EA 1EXMA 4IJUA 3OOWA 1NYRA 3DVLA 1XX6A 1U3TA 2DU8A 3WIUA 2PSHA 3Q9LA 3CLHA 1J5PA 2CK3D 3WL3A 3ZZMA 3IDZA 2AG5A 4B4OA 4DRXA 5EIBC 5KMGB 1JIQA 1XT6A 4C4PA 2TYSB 2GM3A 3CNOA 1CYDA 5TDHA 1NVTA 3WYBA 3KVNA 3RVQA 1II8A 1V16B 3MJEA 3OAAA 4D02A 2HRZA 3HFRA 4JL6A 1K98A 2ZSBA 3EXEA 3ABZA 1FC0A 2RBKA 2WT8A 2Q4RA 3KFXA 4M9QA 1MBZA 5AJXA 3VOBA 5C7YA 1Q6ZA 4GT1A 1FNNA 2WUDA 2ZSHA 2QRZA 4Z54A 4ETNA 1QYXA 4CDMA 3C45A 3DBLB 1GGMA 4HH3C 2R3SA 2ACKA 4MLZA 4QDUA 1TLTA 3VSEA 5BUZA 1ZH8A 1ZOPA 4ADSG 3GELA 2IXFA 1TC1A 2KBEA 4DWVA 4CKYA 4P58A 5LNK1 1DE0A 2I22A 1HYHA 3OIGA 1I36A 3BTSA 3BXFA 1G3MA 3SYLA 3DOCA 1T4MA 1XL0A 3AR5A 4PVCA 3HNRA 5L4NA 4WV3A 5DRTA 4OGFA 1Z8DA 1WUTA 5EPEA 1XTQA 3VH4A 3D7RA 3HA2A 3TGPA 4JXXA 1QO0D 3SIWA 1OE0A 4IQGA 1Q91A 1KE2A 1XZFA 4DSZA 3A0UA 3KU1A 1H5NA 1TO6A 4AY2A 2GAOA 5ALQA 2VP3A 2YQ4A 4YRGA 1YHYA 3TSAA 3EUAA 3INGA 3D02A 3NIGB 1F0PA 5G0TA 4DXDA 5CVVA 4DCGA 3ADBA 3QK7A 5CHEA 1W5EA 4PZAA 1YRYE 2IDMA 4UVDA 5G41A 1NC3A 5JJLA 4H7HA 4A6DA 1JKJA 1Z06A 3H4VA 1UZUA 4CM8B 3GBVA 4N6NA 2FOXA 1RPJA 4L72A 2OBLA 1XU4A 2XEDA 4QODA 2GN1A 4DCSA 3VZPA 3MWEA 3SFVA 1BTOA 2GUWA 4FZ5A 4N9QA 4KH1A 1NATA 2C97A 1C81A 2UUAB 1WU7A 1ZY2A 3HHEA 1HEUA 2R6AA 3FBTA 2MSNA 3FRIA 4FT4A 5FLXA 1YQTA 4A2PA 1JR3D 3GJ4A 5IT0A 4TRJA 4IKEA 3ZY5A 1QV7A 5FOVA 3N6RA 1TCAA 5FQNA 3FOZA 4PSVA 1FX1A 3ZWYA 4DR3B 4WECA 4A5OA 5COBA 5CDGA 1Y8QA 4JBXA 5IUJC 1G8HA 2O2DA 3MWKA 1CDDA 2B6NA 2BFBB 1L2TA 4QUKA 3U9TA 2IX9A 1QKJA 3DDHA 4REOA 3GUVA 2J6HA 8AT1A 4UXHA 5J1TB 3L0BA 4INJA 3LY7A 5LQRA 5IJAA 1C4KA 2W2VA 3HXTA 4ALKA 1VXRA 1LBTA 1Y0BA 3BWXA 3PIRA 2FJPA 3N2YA 4II2A 4PZCA 2Q50A 4UHDA 1XCGB 4PE5B 3HA3A 3K6JA 3QLVC 3GIDA 1N4AA 3TZCA 5JEEA 1ZHOA 3DDUA 4WZBA 2NADA 4QIHA 4YJFB 1XDWA 2HF2A 2PCJA 3P19A 5DGIA 2SBTA 3Q1LA 1A9OA 5F4ZA 3U4DA 4AK9A 3GG9A 2WWYA 2QPAA 3S3TA 4MVXA 4EZEA 4CQLA 5J2TA 4LJRA 1J56A 2XAUA 3OEHA 4NI5A 1ZR2A 4OYLA 3TCNA 4NCIA 4FI3F 3CRNA 3EZYA 3LCCA 3DW3X 2HA7A 4MUMA 1NVAA 1TU4A 1T9GR 2BY4A 1MDBA 4XVQA 4D79A 3KT0A 4XLZA 1G8PA 4P3KA 1G291 3CKKA 3PRKE 3R2JA 2PRSA 1F2TB 4KV9A 2NO9A 4WY2A 1JR2A 5E1DA 5A3RA 4RH1A 4DV0B 5GJWC 3PC8C 2INGX 4YRPA 1ZXBA 1UBTS 3OC0A 2FPMA 4JVNA 5AI9A 3CUEF 4XFDA 2AYXA 3RT7A 2H1CA 2VZEA 3LBIA 5JS6A 1ND6A 4BGEA 3MT0A 5LQDA 1Z2EA 4IDNA 4YT8A 2I2FA 2Z2XA 3GFBA 1VZ3A 2WT4A 1IWPB 4OHCA 4Y98A 5DMHA 1SG6A 3I9MA 3T3DA 1RPZA 1XD2B 2YHIA 2ST1A 2HXSA 2JJ2D 3V1NA 4CL8A 5A5EA 5K4HA 5KNCD 1Q0RA 4EFMA 3H1TA 4C2TA 1U8ZA 1CQJA 3C98A 3WISA 3BILA 1AMOA 3T7TA 3DP7A 1Y4SA 4Y2YA 3W78A 1QTRA 3BRQA 4TKVA 2ZTHA 1ZZGA 3ET4A 1K4MA 4EY4A 2XUHA 4OK6A 2PWBA 1LNZA 1DLIA 4ALJA 2CKDA 3EVGA 1LVHA 2MSLA 3EVCA 4AC9A 4BUJA 2XA9A 4YY3B 3DPUA 4INOA 5HCNA 2BCJQ 3C3DA 2Y05A 1OH8A 1NG9A 2GXUA 3JQRA 4U7PB 1NHWA 3OPVA 2B4KA 2R79A 4G5QA 4ND7A 4HRAA 5FTWA 3KKLA 1MENA 1M10A 3WFJA 1GITA 4BNHA 2F2TA 1CQWA 4PYNA 4QRDA 1KYWA 4M83A 3UHOA 4I5FA 3VOTA 3N28A 4DRXB 3BGOS 1CNFA 2HJHA 3LUJA 1M72A 1TM5E 1X1QA 3O4JA 4KE8A 3MLEA 1TK2A 3G88A 2YBEA 2YWEA 1RKXA 2J6CA 4HJXA 1II8B 4I2NA 2WOOA 1NBMD 2XBUA 3Q3JB 4DCCA 3EXEB 3H5RA 1I7SB 3CZ9A 5SZIA 4LHZA 1ZK0A 4ZICA 2IH5A 2ZSAA 3RRYA 2JVIA 3U7IA 5HJEA 2J3JA 1V41E 5I7UA 4Q00A 3OI7A 4QECA 2CUZA 2Z8ZA 2OMEA 1DIOB 4I1SA 1UANA 3PGLA 1M6NA 1U81A 1MC4A 2KYRA 1T2VA 5HZKA 5I5EA 2R48A 3UXYA 5BVGB 4FLMA 1SU4A 2IKSA 5CAEA 1FLVA 4RVOA 4G4IA 1FU8A 3EPLA 1NF3A 1B14A 4ALNA 1KYTA 1V1JA 5KNDH 3QFRA 1Q57A 2UYCA 1UMCA 4V1CA 4PO8A 3LVBA 5LNK6 2HSZA 2JAWA 1R12A 2WPDD 4OH7A 4RPJA 4DDUA 3PTAA 3PEWA 2PGNA 3TOZA 2II6A 3R3YA 4FOSA 4Y1FA 3PGA1 1MG5A 2I3DA 3RG8A 2D06A 1SXJC 1NN3A 1YBHA 1RNLA 2XQJA 1OFTA 4D6XA 3IMGA 2AOTA 1GVHA 2PZEA 3L79A 1XMSA 1L8LA 3QMWA 3QI7A 4MUEA 5B1SA 1HDCA 3Q12A 1EVKA 2I1QA 1GGFA 1LXCA 3CZCA 4LSWA 3MTEA 3DW1X 4WX2B 5EHQA 3AVTA 4AX8A 2HJGA 5J23A 4C9BA 2EBHX 3KRTA 1JKJB 3J80A 1D2NA 2JKVA 4P7JA 4CV0A 2WMYA 1VA5A 5A5FA 1W5FA 2H0AA 1JPNA 5ILGA 4Y2RA 3T06B 1L8QA 2M6SA 2OGUA 3GMSA 4YT2A 4N9WA 3CVUA 3MWEB 4GSLA 4DQXA 3LCUA 5FCDA 5K8CA 1GUBA 2HWXA 4FX2A 1AHNA 4E09A 1KJ9A 1SKYE 1WXXA 2YZKA 4WNCA 4MX8A 3HUDA 4N8SA 4R9RA 5JSFA 4D9JA 4YAGA 2NZYA 1SXHA 2C61A 3CC8A 3JCZA 4BB9A 1E59A 2XOEA 1NXSA 4H1UA 4I6GA 1QIIA 1YIOA 3WLMA 1EAMA 4V0ME 3MCTA 5CLLA 1KI1A 3DZHA 1Y8QB 4JBWA 2FR8A 2CFTA 5HMMA 2JZNA 4I9HA 3OFSA 3HJBA 3VV3A 5CR9A 1GZ4A 4TLEA 2BGTA 3FDXA 5CFPA 2PFGA 2QZSA 1YS6A 4TMVA 1NVFA 3DV2A 5EXSA 1PZEA 3VDNB 4WW0A 1CRWG 1QH8A 3Q0IA 1K8ZB 1LCIA 1DQRA 3JQCA 4RHTA 3GD5A 3H5IA 1KXJA 4OXKA 4V2IA 2CJPA 1C30A 3BXPA 1YV9A 1NR5A 2PH7A 1E77A 1LSSA 4PNPA 3SZGA 3TCXB 4WZBB 1N5KA 4FYIA 5BSTA 1TGVA 1UADA 3LFTA 5DTQA 5HEKA 4GX5A 5CW1A 3Q1KA 1JAZA 4Q9AA 4WLUA 1XFAA 4Q1DA 1S2DA 3E5MA 3O75A 1X8KA 4Y2SA 4ZVRA 3I12A 3SVZA 1Q7CA 4M1ZA 4R3UC 4CQLB 5J2TB 2YRFA 1A1SA 4MW6A 4MRRA 4QULA 4YS6A 5F2KA 1XHFA 4C29A 3ZH2A 3G2QA 4RPCA 5FUBA 3VDQA 1KR5A 2JHFA 2QRHA 1HT1E 1ZCJA 2NQ8A 1QPGA 4QYTA 4RXMA 3LBYA 5SZJA 3ZE1B 2J0EA 4WZAE 1YD7A 4BDTA 1I2BA 3BA6A 4PYRA 2ZRKA 3M6VA 5AW1A 4JELA 3N2NA 1JQEA 4Q9IA 2DHDA 2ZU0C 4GGMX 1IVYA 4ZCMA 2A35A 3ZJVA 1ESDA 5G4LA 3L92A 2NAPA 1CJSA 3BXGA 3GFSA 2FW7A 3T7IA 1D2HA 2E48A 2VYVD 3I2KA 2W6OA 1MOPA 4M4SA 4WFKA 5GINE 5HF8A 3DEZA 4DAOA 2DYKA 2I55A 2FN8A 1BO6A 1J9GA 2CC2A 4G0OA 3DLHA 1IMOA 4D3DA 3WGJA 1HOTA 2WA1A 3HABA 2C83A 3AI1A 3LY5A 1L4KA 5LKAA 4BLOA 5E1BA 4ETIA 3V4SA 5DYIA 3AI3A 5DLPA 3N8IA 1AOXA 4X6YA 2YHIB 2CFCA 3ZV6A 4GHWA 3VYVA 2DY0A 3PNLA 3BFVA 1JG4A 4X0EA 4Z7QB 3RM3A 1CQJB 4XI9A 2IF0A 3TPZA 3AK4A 2NP6A 1FS6A 1VDZA 3NFRA 3ZCVA 1XTRA 2G72A 4FFDA 4KGXA 4TKVB 3UKOA 1SKMA 3GEPA 3U26A 4QD3A 4ZEOA 2IWRA 2YJZA 1TLFA 3V1MA 3VPSA 5BSEA 2JIDA 2X7XA 1L4FA 4FEEA 2RGXA 3CF4A 4RMIA 2F9MA 4HQ6A 2OV6A 3FNRA 4OIFA 4YACA 4BEBA 1E94E 3S28A 3DMHA 2W2QA 2QJTA 3DHWC 1P1IA 4I1PA 4P93A 3PXDA 5HG0A 3H42B 1XZPA 3ZGLA 2XE6A 3Q87B 4JENA 2FRXA 5A5VA 1HZJA 3NOOA 1T1GA 3VH2A 5AUQA 4JDPA 4KXUA 5SY6A 5CFQA 3E9DA 1E1YA 2W11A 3H9CA 5ECYA 4O3MA 1TK3A 2BFOA 2BKLA 1I7PA 2FPLA 3U3OA 4UJ3A 2XDYA 3I09A 3EBOA 4GVLA 3ND6A 1YVUA 2DQYA 4BKRA 3DVAA 4ZAGA 1ZFNA 2VF4X 4NKRA 3WNVA 1YQQA 5T4BA 1HNWB 1UKYA 2G1KA 3NETA 4UNQA 2WOJA 3ZS8A 5JNRA 3E9YA 2ZB3A 3I9V1 1H0SA 1T5LA 5DHAA 4U2GA 1A4XA 1PEYA 2WP0A 3N53A 3ZE6A 4OI0A 4FR0A 1QFSA 1YTLA 3TLKA 2O6HA 5C81A 2HRCA 3VVBA 1IYZA 3EIWA 4HPWA 3RCBA 3TD9A 4ZZ3A 1U80A 1U1FA 3OJFA 3QFCA 1GDDA 3DNPA 5CAEB 2EFCB 3VVMA 4BRZA 3ZYZA 5JANA 1M8PA 2AUMA 3ZIDA 2WIAA 3IIIA 2W6PA 3CUVA 2GA9A 2E3JA 1EWKA 1UMCB 3AUTA 1T1EA 3PS9A 4RYLA 3RBXA 4V1CB 1L8XA 4QOFA 1JW9B 1AUXA 3OZ7A 1E7QA 3HRHA 2R2GA 4MVCA 2JDIA 3NG1A 1DAMA 1Z3IX 2C99A 1RJEA 1OFUX 2AOTB 2B3DA 2C2MA 3C3KA 1L7MA 2M32A 4RVNA 4XH9B 4HB0A 4DWWA 3M4JA 4WFJA 4PN3A 3RODA 2YXPX 4ZHSA 1KKMA 1U0FA 4DKXA 1OXUA 4W1SA 2RH4A 5ALIA 1DCFA 3DQQA 3QTTA 1G8GA 3KQMA 1UBHS 2PX5A 1AVTA 1A9RA 4MGKR 1KSFX 4N7JA 1WHTA 1X8JA 3MUEA 2R62A 4R81A 3LOQA 4IXMA 4ZT4A 5JJ5A 2G3YA 3LX5A 4U5XA 3TGLA 4NCAA 5LCXA 1E6UA 3DP9A 1T8UA 3AJRA 4HQRA 4RCVA 4CEIA 2Z1MA 3IUYA 5DWQA 2P27A 1NN5A 2J5XA 4KO4S 4Q3LA 3WLRA 5GZ1A 4UASA 2JD1A 1P5RA 4ARZA 3GFRA 4KNYA 1M33A 2FQ1A 5A9TA 3K8QA 2Q7OE 1K63A 5KC9A 2ASEA 4QASA 4KI0A 4HS4A 5KOHA 1QG0A 1ODCA 3ROQA 4HBZA 2J48A 2GJSA 4AL4A 5CD1A 1VG1A 1IK6A 5IHPA 4KFSA 3RVOA 2Q5QA 4PS1A 3Q5EA 3OOJA 2OC9A 4W9RA 1CY6A 1QFYA 4YRRA 3K70D 3U56A 4ZCLA 3F6CA 1GQOA 3R77A 4QDXA 5A4JA 4JVLA 1QH8B 3IOCA 3NBXX 1BE8A 4O3FA 3HH8A 2D5AA 1ZO8A 3F6SA 3KOZA 4HLQB 2V55B 4F96A 4NBLA 1IN4A 1GPWB 1C30B 5D5PA 1G63A 3ZV4A 2ZUCA 3HFJA 4BN0A 2MR5A 1SCDA 2P6RA 4BE7B 1D6NA 4G81A 4QTUB 1IPHA 1FPMA 3OZAA 5I7EA 4C7VA 4CF5A 3ZV5A 2RI6A 1EHIA 1IHOA 1SUPA 4EYGA 2UZ4A 3ESQA 2VTBA 1YGPA 1J8YF 3L77A 3B5IA 3ENNA 1FY2A 3HNPA 4LA4A 4OMDA 4TL8A 2FRDC 5TQVA 4DVJA 3V55A 4FOPA 1L5VA 5H5JA 2OCIA 3SZ3A 3EZ2A 1DDIA 1X9HA 2XIQA 3EVEA 5BVHA 5FHRA 1HDGO 4QAJA 1W5BA 4YJHA 5KSZA 2EX0A 2HK8A 3I9JA 4GPIB 3NX4A 4EYQA 3GJ3A 3R3XA 4IQ8A 3LXXA 1IM5A 3PQEA 4RHUA 1J9EA 4S1VA 4KR6A 1T6YA 4KXFB 2C3MA 3GRUA 8ABPA 2YYAA 3KOYA 3BWDD 2IS4A 2WDZA 2IYXA 2OD7A 4A0FA 1B76A 5E95A 3W8NA 2O48X 1A8IA 5JC8A 3OM8A 4UM7A 5A7GA 4A27A 1U7TA 5EMMA 3M5WA 4BECA 1U5BA 5J43A 3PPXA 3FHTA 3ETLA 1GPUA 1UBKS 2D3TA 4F12A 1YBVA 3G8DA 4LXXA 4U7DA 3QE9Y 1SVWA 3J81k 4RORA 1PS9A 3GG2A 4S05A 1E7MA 4XIGS 1F4LA 2JGIA 1IHPA 3JQAA 3SJCA 2JGJA 2ZI5A 2JFNA 1CG6A 2G25A 4DC0A 3H18A 2QMEA 4JKYA 5LLSA 4F7WA 2D1RA 3N39C 3D6JA 1YRLA 2JAUA 3UPUA 2WKPA 1NJ2A 1JUDA 3CGWA 2HR1A 5J1SB 1QGZA 4GQAA 3UTCA 4OKIA 2DBYA 5KBYA 1LNSA 4I8XA 4W9NA 4EK9A 2QD5A 3KXLA 1QRDA 4IZ6A 4QDJA 3T7KA 4WESA 3TQOA 4C0KA 4QLBA 1Y4UA 4OXXA 3PLNA 4U7JA 4P0TA 4ZYLA 2BKUA 4Y9DA 1Z39A 3DVAB 2JI7A 3ODPA 4IIBA 4P33A 4DNOA 4FLFA 1FTWA 3F46A 1R9JA 4OKNA 2WHQA 5IDXA 1SMKA 4KAAA 1GKKA 1W4AA 3PHCA 3ZVNA 4UD2A 3ILYA 1OLUA 1QIDA 5CNIA 1U0HC 4RD2A 3BPSA 3CX8A 4RNDB 1FK8A 1GFIA 2YC4C 1VI5A 3BIXA 2GXQA 3EW9A 2C9ZA 1RE1A 1NVXQ 2BZ1A 2AWOA 3NONA 1EUZA 5ADVA 5DOVA 5IAOA 5A7HA 4RTNA 2NV2B 1XKTA 2EYUA 3DMTA 3Q0TA 3QLEA 5PNTA 3PR2B 3H6HA 4G1CA 3KQSA 3RJZA 4GI1A 4E4RA 1XEWY 3A4TA 4LY9A 5KTPA 4O4LA 3F4LA 2EZ8A 1FRNA 4HLNA 1FOEB 3NYRA 1G4UR 3FAZA 3R8FA 4M53A 2I76A 3CG0A 4YI3A 5DULA 1AQYA 2VJYA 4QHSA 4EHHA 1CUJA 1KGSA 3CO0S 2VHXA 5KWVA 1FFXA 1MN6A 3I6QA 3CVWA 3RSGA 5JD4A 1TM4E 3IVRA 1QIKA 1R5OA 1SIWA 1E79D 4RF5A 1SU6A 2O0JA 1LQ2A 1E1CA 2ISQA 4PLZA 3PUIA 5CRIA 5A3SA 5G02A 4HDQB 3DEJA 1DJMA 1PHPA 4HP8A 4MGHA 1JRLA 1OPXA 4EY6A 3KHTA 3ZU6A 5MFPA 3E70C 3H7IA 2H4WA 2QIOA 2WF8A 1DWOA 1WHTB 1QYDA 2NZUG 1D2AA 2QZJA 3JYOA 3N3BC 2RKOA 4RW0A 5CCDA 3WMGA 4JROA 3UA4A 1CV2A 1VYTA 1N3YA 4CGZA 1ZW6A 4TTAA 3O1LA 1JGTA 4CEIB 4URFA 2FEOA 1Z22A 5CVTA 4NXNB 1E2NA 3VNSA 1IONA 4C01A 2C9MA 2XKJE 4ARZB 2DSNA 3M81A 1LDMA 4Q9NA 4DUYB 3D4BA 4FHGA 3ER8A 4UDXX 5J2UA 5KOHB 4QICA 1YB6A 1R0KA 3B1VA 2CEAA 4PM4A 1TAQA 1T1JA 2F00A 2HSDA 1WP9A 3IAFA 2VBFA 3WHLA 3ZJ5A 1OBCA 4KLAA 1XMXA 2MDTA 3BB3A 3CEMA 2N75A 4RSMA 1OA0A 5CVCA 1IN8A 4EG0A 1JALA 2RAVA 4Q1BA 4KRGA 3ESRA 2ZPTX 2Q4DA 4Y67A 2BELA 3S1SA 3UW3A 1Y1SA 4JL8A 3DYVA 2IH2A 3QTBA 2P9GA 4ML3A 5I8PA 3WHPA 4WKGA 3L7MA 4LHVA 2QX9A 1RWXA 3K09C 2HV8A 1MVOA 2GMWA 2G5PA 1GSAA 1TD9A 3FCAA 3Q7PA 4QELA 4ER3A 2Q4TA 4JLNA 1P7CA 2A9JA 2DUUA 4J29A 3O2QB 4BWFB 1B1AA 4B9AA 3OQOA 4TXJA 4MQEA 4OV6B 4Q48A 4QDKA 3F3SA 1JHMA 2H9AA 3PFWO 3ITNA 3SF8A 4DXAA 4YCNA 2P2CA 1TF2A 4AKHA 5BVHB 1W0KA 2L82A 4YJHB 1OB2A 1OGYA 4RKQA 5DLQC 3ZCQA 2QNRA 3BK1A 2QRNA 4CM7A 3C6YA 5DTJA 3WL8A 1F8FA 2WPNA 1JHRA 1HK7A 4ZVMA 5GZ3A 2WQ6A 5TVKA 1VLMA 3QHQA 1KMQA 3A8TA 1GGHA 1KAOA 3GEGA 1KI3A 3WL7A 3QBJA 1JSRA 2VNKA 4IXTA 5C46F 3LX6A 4KDCA 1ZKDA 2F6RA 2GAJA 4EFNA 4MW2A 1CZUA 2BCEA 1ULSA 1NKVA 2AG0A 3IURA 2J31A 3CUYA 3ROGA 2AF3C 3I5MA 1TZMA 3K8OE 2ZIZA 1U5BB 5BT9A 4WN9A 1T0UA 2PLRA 3FSGD 1KYQA 3MWJA 3SHWA 2JLYA 2H5JA 3DE2X 5FAKA 1ATIA 4IUBS 3RJMA 5JECA 4OL9A 3ZUGA 1H1TA 4TKLA 3HZHA 4BV8A 4DC1A 5KVCA 4ACBA 1CVRA 4DDKA 4MWBA 3JQAB 4ES6A 3BWCA 1BOOA 3AHDA 3FE2A 3REOA 1UZAA 3C5HA 3NHYA 1N7GA 2UZ1A 3BK2A 2XIJA 4L9AA 2ZK7A 1Y1PA 4AUEA 1W88A 2O2CA 1HQYE 2PLWA 5DIZA 3PWSA 2K2WA 4D82A 1CUFA 4YGYA 2OV4A 4B40A 1MPXA 1Z8NA 3IB3A 3NM4A 3C8MA 5ED0A 3OIDA 1VL6A 2A9KA 5AUPB 2C9DA 3I9OA 5K3SA 4KWCA 1E9VA 1U0JA 1O94A 1TZCA 1N9GA 1U3GA 1YZ3A 1V5WA 1TMOA 4WESB 3KKNA 4S1PA 2VT3A 1XRLA 1IMJA 1F8UA 4MS4A 4JUBA 1G38A 4CEJA 1G1AA 2O3JA 3P0IA 4XUDA 1U9IA 3CVXA 1XAGA 1SC6A 2FK8A 2NGRA 2Z04A 1ZM7A 3HJNA 5EXEA 3WV4A 4AF8A 3ZWXA 4YUWA 3S81A 3VNUA 2F90A 1OLUB 5KYKA 4LXTA 3BWEA 4IUDS 1GV1A 2C0QA 1XEWX 1TQ4A 1V8BA 2QDKA 6AT1A 5ICFA 1ZJJA 2D1SA 4YPFA 3EMDA 3MSCA 1MIHA 3ZD6A 5LBTA 4I4IA 4RD1A 3R3WA 1KMHA 2HWKA 1BH2A 5F2EA 4EEZA 2BSXA 1C1DA 3FOWA 1R5NA 4DV3B 1M2GA 1F2UA 4O4LB 4A91A 4DQLA 4RSGA 3OIFA 1ECGA 4LAFA 4ETWA 3L46A 3SC2A 2ZRMA 5H59A 1FP2A 4BFYA 5AI0A 4Y6QA 2NP7A 3U16A 1FFXB 1TVMA 2P4SA 1AZWA 2C7VA 3OPNA 2ZAOA 2JAXA 3DC2A 1WG8A 3EASA 4RWZA 4OJNA 1E1CB 2I34A 5AJZA 3GVIA 4IJVA 4UC0A 4F60A 1C9KA 3INYA 3FTEA 3E61A 1NBAA 1K7CA 3EZ7A 5TRTA 3TFQA 1OGJA 1TA0A 1ZINA 3Q7SA 2VHTA 4OGKA 1MAHA 5L3RA 4BDSA 1E5DA 1XBTA 1PR5A 2YR0A 4MKFA 2JRLA 5DCLA 4YCSA 2H92A 3IUEA 4KZKA 4WJKB 5M34A 4DQKA 5C8DA 4KHZA 4C2UA 5FJIA 1VPLA 1VMEA 3AG6A 4RA9A 3MS2A 2I2AA 5EMHA 2GK3A 2C7PA 2XA1A 2ZBRA 4W6ZA 1HLDA 2GSDA 4TMWA 1T0IA 4BCCA 1E20A 4LRXA 2W0MA 4ECEA 4LVCA 1DMRA 1IG0A 3MBOA 2QM7A 4TVBA 3QKUA 1SWVA 1TVEA 5DEOA 1DJOA 1O96A 3B1JA 3E3LA 5IJWA 2P4QA 3IBYA 2EGGA 3D6TB 5CYFA 4IR7A 5J2UB 1P2DA 2MTBA 2WAYA 2BTOA 1I5OA 2POQX 4GD3Q 3N8KA 1OREA 1J25A 5KJCA 1V11B 4G24A 5AP9A 3C16C 4BLVA 1ZVQA 2WIJA 2JK0A 2ONCA 4R9UC 4LDNA 1ZYUA 5BQ3A 2E4WA 3HBNA 3U39A 3FMFA 1DO2A 2B4AA 1SCJA 2GVDC 2JCGA 4MSUA 2O9JA 4NPAA 3EULA 1U8YA 5EIAA 4Z0NA 4QVIA 4YX9A 4LKOA 4BLUA 5K2OA 1E1QA 1M2KA 1JEAA 4ITUA 4Q1CA 4C21A 3O03A 3GO4A 4P80A 3AW9A 3VR4D 1XCPA 4BFVA 3IVXA 4MLPA 3A3YA 1IU9A 3H1GA 2EV9A 3TG2A 3QOXA 2Y1KA 3NUGA 2DBZA 4BV9A 4MQEB 2GERA 2P9QA 4M9SA 4E5SA 4JR1A 3SF8B 3BIWA 5EE1A 4PPNA 4H3VA 4EY8A 3WWDA 5K9ZA 1IBKB 5K3DA 3A2MA 3DKKA 3NZEA 2H1WA 5FADA 1FBNA 4KOAA 4X97A 2F17A 5GV8A 4HDAA 3WLEA 2B83A 4B46A 3OIYA 3RFCA 2ZS7A 4WBSA 3V8NA 2GDZA 1DQPA 4IH1A 5DSXA 1YB7A 4HFMA 2I1LA 2OAEA 1MO5A 1QFXA 4GRDA 4L6CA 1QKKA 4S0XA 1N2CE 1VFNA 1X19A 4WT7A 1P7ZA 5I9MA 1KEZA 1IOVA 4RH0A 2R44A 4L3WA 1F06A 3LSYA 3C48A 2R87A 3IKLA 3HN2A 3SOZA 4AJIA 4WN9B 1P6XA 3HWSA 1VPVA 4R2JA 1I6WA 1U1DA 1X13A 1QE0A 3A05A 4I4TA 3UGQA 1TJNA 3KQUA 3FTPA 3G7SA 1T2NA 2QN2A 3WLPA 5HX7A 5DKFA 4WERA 4NATA 3TE7A 5ALSA 5F7JA 1CWUA 2RJNA 3SX0A 3FFAA 2H07A 2PZLA 4DDTA 2UZ1B 2ZRPA 1YI0A 2OHGA 1O87A 2A3RA 1TW3A 4WWHA 4RBNA 1W88B 3G2HA 2MSWA 3AV3A 3QKRA 1BFKA 4KE7A 3HB5X 4R54A 4A36A 4J2TA 2NPOA 3WJAA 2P0AA 2OHJA 3JQ9A 5J5VA 3DHEA 3Q6MA 2QN6A 1Z2NX 2PGJA 3PPIA 1SUDA 1NU6A 1NKTA 1N9GB 2ODBA 1JDSA 4GMHA 1G98A 4MQ6A 1DKOA 3MMPA 5GJVC 2FDCA 5LIPA 1XDGA 1JIIA 1MRSA 1S9HA 4MS4B 4BHTA 4CEJB 1T9CA 5KVQA 1Z4PX 2H2GA 3ZK8A 3K6KA 1KDTA 3FDIA 1KEEA 2VRWA 5CGQB 3QOWA 3T0IA 3VPCA 2G09A 2I4NA 2RHWA 4U5QA 5ENVA 1RC8A 4D4JA 3P71T 3ZHRA 1NNUA 3B53X 3K9QO 3SFTA 2EZUA 2A8YA 3H87A 3RIEA 5JJKA 3VHQA 3ABSB 4OB6A 1HE1C 5A6VA 1G21E 2XVXA 1O4VA 3O9MA 3RIYA 5IS2A 3IA7A 4DAEA 3QX7A 4KFCA 4L02A 4QNRA 1XEFA 3BF8A 1KMHB 1OIVA 4JLOA 2JCYA 5EWMA 3RU3A 4EGJA 2WM9B 1C1DB 5I7RA 3W5BA 3NDBB 4LOKA 5ED4A 2DKOA 3JQBA 4S1NA 1F2UB 4TLCA 1TZ2A 4KN8A 4NFYA 1WUYA 1Y7IA 3URKA 3BRWA 4NLLA 3SC2B 1M1XB 4M76B 2GF9A 1VIYA 5GPBA 4ZEVA 1U9CA 4LYDA 5BSGA 2GO7A 4ZKDA 3W6ZA 3C6KA 3U44A 4E1AA 2W9XA 3KOOA 5DSTA 2AN4A 4ANFA 2ZVJA 3G5TA 1QF9A 3E58A 1SKAA 3U48A 4M98A 5JVDA 1V0JA 1XYGA 2A5YB 2WYWA 1R8XA 2IL1A 3H0EA 3LX4A 1YB5A 3WGYA 3KZXA 5CHYA 2VH5R 4MQBA 1JFTA 2ZTLA 5BR8B 4RA9B 4DM4A 4P53A 4E5NA 1ZXLA 4MRPA 5KTSA 3O4FA 4JK3A 4GYWA 1ZI9A 1QYCA 5ALFA 1W75A 3FRJA 1R50A 2IP1A 2WU8A 3GLRA 3DB2A 4I46A 5HTOA 5E0KB 2QG6A 1B73A 4UBOA 1O96B 4V0LA 3WMRA 1UKVY 2O2YA 3B7GA 4A9AA 2G4VA 2WTBA 3KV3O 5A03A 1TQ8A 1NQ5A 2DCMA 3ZLUA 4IL5A 1JN0A 1Y5RA 1WXDA 5KU7A 1FRZA 4W8GA 1A5BB 2J85A 4QO8A 1XRJA 3RHFA 3VAYA 1GN8A 2R4QA 3EBPA 1KJZA 3MQ2A 1GPBA 3OEWA 1VSUA 5FJJA 3T3IA 3MT8A 4OD0A 4X1KA 5TB5A 2KJQA 2BMWA 2CFSA 4JLWA 3CT6A 3LP6A 3QFHA 5TGDA 4M89A 4D9MA 4E5YA 3IA2A 4DR6B 4M8LA 2HSJA 2X8WA 4EW3A 4B43A 5IJ9A 1T3ZA 5H83A 3I58A 4B1FA 2H48A 4I4CA 1L5NA 3UEOA 3FMVA 3BHJA 4MVJD 4U9HS 2QSZA 4J0HA 4EHFA 3SR3A 2JLUA 2VK2A 4LF8B 3EDQA 2MIIA 1R00A 3PLRA 2LCIA 3U4QA 1IG3A 3H6GA 1SUIA 5ERXA 3NATA 3MLAA 1QH9A 3LNTA 5KKNB 1OROA 4PYIA 4N0DA 4MA5A 2QUAA 3Q8LA 1VP3A 3SDBA 5J4VA 4FM9A 3WGOA 3JSXA 4W5QA 1KIFA 3OPXA 5K3FB 1A2OA 1I9GA 2FPWA 4UAVA 4ZANA 4AO6A 1MTZA 2PWZA 3QPVA 1QO7A 2G67A 2PKQP 3DHYA 1RQPA 3L9WA 3AJEA 1E2DA 2GZ1A 2YRWA 2R7NA 2AKYA 2RGRA 5CB4A 4NECA 5CH8A 4JUIA 4E2WA 4G3XA 3AFIA 3AUXA 1MQ8B 2ZJ8A 4I4NA 2PS1A 4MP8A 4OEHA 1D2MA 4Y2UA 3UAZA 2ZIEA 5C35A 3QVJA 5CW2A 1VTKA 3E3OA 5CYPA 4CLEA 1RWNA 2XB6A 3AF6A 7YASA 4C5BA 4I4TB 2ID7A 3WO1A 3HDGA 2ZJ1A 4G85A 5EJEA 1G55A 2E55A 4L75A 2BZ0A 1RQRA 4J6FA 5C80A 3RG2A 3DAYA 2CV1A 5H4HA 3GGPA 1JPJA 4XYGA 3WIVA 4NE7A 1GUYA 2Q0XA 3AVQA 2P79A 1BU5A 2C2XA 4MV1A 1O1YA 4WK6A 1K3TA 4OG2A 3PPYA 5KVAA 1T24A 3TJZA 1YO6A 4RIHA 3TRHA 1Z56C 2AXQA 5DO9A 3VVLA 4BWGA 1YRHA 1B1CA 3A36A 2OPHA 2Z5LA 4DREA 2OCAA 3QKRB 4R83A 1UFOA 3AM5A 1RKUA 4KPUA 2PUJA 7AT1A 2I03A 1EWTA 1QVRA 3MOIA 4XE5A 2V54A 4Z0PA 4EEXA 1Y42X 5CFZA 3ORRA 3JS5A 2H1SA 3KHUA 1JMVA 1GUFA 1FRQA 1UXIA 1ZL0A 4NQRA 5I4KA 1FLAA 3N74A 4JWTA 4WINA 4DV1B 2DR2A 2B1JA 3EMKA 3B9RA 2NVUA 3NWEA 5AIAA 2YVKA 3Q0EA 3I9KA 3HACA 1I3MA 1G64A 5LQCA 5FPTA 4YONB 4DIEA 1KEEB 4JBIA 4HLDA 1G2QA 2X41A 4KRYA 1ZN9A 3LCJA 1GCAA 3UAYA 3SHTA 4WTOA 2ZJZA 3Q3IA 4MWCA 2XUAA 1SKQA 2V7VA 2XQVA 1NRWA 1UJBA 2RMKA 1P74A 3C6XA 3L7KA 4IAOA 3RABA 3HKEA 3WLLA 4NJOA 4XLTA 3WGTA 5LZ2A 4N8EA 1W7AA 2QR2A 1CR1A 1KC3A 1L5MA 3NNNA 1P62B 4Q4JB 4Z1MA 2XE8A 2WTMA 1HKUA 2A1UA 2VDQB 4UEKA 3NHLA 5LZ9A 3O93A 3ED5A 4BY9E 2RKWA 3FDZA 5EWMB 3K0CA 1EFKA 1NMZA 3BVPA 3IALA 4ZOBA 5CNMA 3U62A 3GLFA 3C15C 5MN4A 3LOUA 3PHJA 1E0DA 3U7HB 1EB8A 4NZ9A 3RIXA 4R4JA 4GE3A 2E4VA 5MFZA 1KDPA 1C0PA 1R74A 3QEKA 2WQ7A 5T8KC 4ALIA 621PA 2GPBA 5FLKA 3K72B 3D43A 2Z57A 1GPDG 2CW5A 1EXDA 3LAWA 5TPWA 3RJ9A 5DM0A 1MX9A 1NVGA 1U98A 1JLMA 2AW5A 3GP3A 3O82A 4JCOA 3WGIA 2FR1A 3FR8A 4JC5A 5DBFA 3U44B 4C07A 4OREX 3WKEA 1RWPA 2ANCA 3WWZA 3KSAC 4DJAA 2J32A 1S2MA 4G9GA 1SJ9A 1Y5LA 2XLCA 5GJCA 4W99A 4FC7A 4WHMA 3RW9A 5JVDB 1M67A 3CRZA 4LRTB 3E84A 5EP3A 4Z9AA 3TFWA 3UOWA 5DLDA 5KNLA 1IC6A 3EYWA 4BVAA 3ER9A 3UMGA 1G8AA 2IHVA 2Y99A 4ZOLF 4QOEA 4IYJA 5IVKA 3X1WA 1W25A 4X5OA 1P9RA 1RI3A 2FZWA 2R7AA 3F6BX 2QVZX 1UBOS 2XMRA 3OM9A 3PHBE 4IO1A 3FNIA 5THXA 2OEPA 4EPRA 5FORA 3FTQA 4LWQA 1J2TA 3FUXA 3O26A 4RDXA 3VZQA 1DC8A 3Q98A 4PCAA 2DHCA 2HN9A 5JZBA 1Z36A 3GU3A 2IV7A 2FPSA 1PK8A 3DT9A 1X7GA 4K9OA 1CC1S 2V0CA 1AK9A 3PC6A 2G8NA 2X0NA 5IAGA 1F8YA 3OKAA 3EY4A 1IIRA 2DLDA 2JBWA 4AJ4A 1P4AA 2HIGA 2OBYA 3B5JA 3GRCA 2PKWA 3LV8A 1ZD5A 4G0NA 3BC1A 4Q7LA 2GESA 3QELA 1DPGA 2O3SA 4MQ4A 4OB7A 3U4QB 2IXAA 1JECA 1GT6A 3GH1A 3NP7A 3TIVA 1S2LA 1XA4A 4WZZA 1S2GA 3C3AA 4X1KB 2WTNA 5SY9A 4DJDC 1N78A 1U2DA 2N42A 4Q15A 1GZHB 5I4BA 4B35A 1A4RA 1JFVA 3ZHXA 3MRXA 2Z8XA 5IJ9B 2J5QA 4U7TB 2HPHA 2WD9A 1L9XA 2FP4B 5AVTA 5JYDA 2LPMA 4GM0A 4NBNA 4L7QA 5CDFE 4CR6A 5LQMA 4YRNA 2FVXA 3STUA 2P6OA 4FINA 2XE4A 4PTLA 4MB2A 1F3OA 4HTAA 3MMSA 2B4RO 2R8XA 5B37A 3DM5A 3TLAA 3V7NA 5IAEA 3PNMA 4ACAA 1GSIA 4Q34A 1FZTA 1N3LA 5K99A 3O92A 1IWOA 4M7PA 3GCWA 2GZ2A 3O8RA 3V8PA 1H22A 3DUFA 4INPA 4RCYA 3QVLA 2DULA 4HC4A 1JLKA 3C7CB 1MOSA 1RWOA 1TM7E 3VM6A 2HK7A 3FWNA 5CB4B 2IUUA 3TZLA 1ZISA 4RTLA 5JI3E 4PQEA 2WK1A 5CK4A 1FTGA 1PR2A 2ZXUA 5ARCA 4L5AA 4F5YA 2HBZA 4TYMA 3DB1A 4TMXA 4TRRA 5DF1A 3ROMA 5DDIP 5A6SA 3CMCO 5IULC 5F7OA 5K0BA 1HE8B 3MIIA 5DBOA 1UFRA 4IHAA 3PUXA 3IXLA 3N2EA 3ZW8A 3JTEA 2HDNB 4OQXA 3MCZA 3BSSA 3C2QA 2ZRAA 5JCOC 5JU6A 1ADCA 1ECPA 2FEMA 3H17A 1JXQA 3ZGNA 1L3BA 3DBIA 3F78A 2RGBA 1RYNA 2PQMA 3KLOA 1YWGO 3USES 3GRYA 3G68A 3PX2A 4AXBA 2DWOA 2VTBB 1IY8A 1RC0A 5JS2A 1ZD1A 5CFMA 4JQYA 1KYYA 1RT9A 3IEXA 5IN5A 1T5BA 4EBBA 4MWGA 4LYFA 3B48A 5HM8A 1UODA 4G1FA 4A73A 2QGZA 3HFGA 2E9SA 2IYNA 4O5AA 1QVVA 3NNSA 2YWGA