3EMVA

Crystal structure of plasmodium vivax pnp with sulphate
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
246
structure length
246
Chain Sequence
b'MEGEMQRHIKLTKAQTTPVVLVVGDPGRVDKVKVLCDSYVDLAYNREYKSVECTYKGQKFLCVSHGVGSAGCAICFEELMNNGAKVIIRAGSCGSLQPTQMKRGDICICNAAVREDRVSHLMIYSDFPAVADYEVYATLNQVAEELKVPVFNGISLSSDMYYPHKIIPTRLEDYSKANVAVVEMEVATLMVMGTLRKVKTGGIFIVDGCPLKWDEGDFDNNLVPERLENMIKISLETCARLAKKYL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uridine phosphorylase, putative
publication title Conservation of structure and activity in Plasmodium purine nucleoside phosphorylases
pubmed doi rcsb
source organism Plasmodium vivax
molecule tags Transferase
total genus 85
structure length 246
sequence length 246
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2008-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3emvA01
1LV8A 2GUWA 4NS1A 4QAQA 3P0FA 4L5YA 1V45E 1WTAA 4OF4A 4TTJA 2Q7OE 4FFSA 3NBQA 4ECEA 3KHSA 3OPVA 3T94A 1U1DA 5K1ZA 1PR1A 5B7QA 1PK9A 4GLFA 3FWPA 1OUMA 3GGSA 3IEXA 1VMKA 4K6OA 1CB0A 3MMSA 1VFNA 1T0UA 3EUFA 1CG6A 3UAWA 5I3CA 4WKOA 5C80A 1RYZA 4TXNA 5IFKA 5EUBA 4U2KA 4H1TA 3OZBA 1RXYA 1A9RA 4OGKA 5DK6A 2A0WA 1NW4A 5F7ZA 1XE3A 1ODLA 4TYMA 3OZEA 1SQ6A 3MB8A 1ECPA 2XRFA 4F1WA 1TCUA 3ODGA 2HSWA 3OZDA 1NC3A 1RCTE 4I2VA 4IP0A 5ETJA 2HN9A 1TCVA 5CYFA 1V2HE 1M73E 1V3QE 5B7GA 1RSZA 4MCIA 4DA0A 3OOHA 1RXCA 5KB3A 4QFBA 5B7NA 3DDOA 4GKAA 4RJ2A 3UAVA 4WKBA 1OU4A 3QPBA 1PR2A 2QSUA 3KU4A 3LGSA 4JWTA 4WKPA 3BGSA 4QATA 4TXLA 4OJTA 2HWUA 4KN5A 1OTXA 2AI1A 1JDSA 1RT9A 4DA7A 2QPLA 1ODKA 4L6IA 2HRDA 3D1VA 5F77A 4BMXA 1T8YA 4GLJA 4F2WA 4YJKA 3BJEA 5CXQA 3LA8A 1T8WA 1RXUA 4BMZA 3FB1A 4R2WA 4UC0A 4YNBA 1A9OA 4D9HA 5IU6A 2PGAA 3PNPA 3K8QA 4R2XA 3PHCA 1V4NA 1V48A 1Z5PA 1Z36A 1RXSA 1TGVA 4G41A 4TXHA 1OTYA 1B8OA 1JDTA 5JPCA 4DAOA 4M7WA 3EEIA 3KUKA 1U1EA 1SJ9A 3KVRA 2P4SA 4TS9A 4TS3A 3LBAA 1ULAA 2AI2A 1T8RA 4MCHA 4OGLA 4JOSA 2OC9A 3OF3A 3EUEA 2A0XA 3DJFA 1Z5NA 4GMHA 5CYGA 1JYSA 4MARA 4QEZA 4JP5A 1B8NA 2B94A 2H8GA 3E9RA 1PK7A 2AC7A 4OY3A 1U1FA 4BMYA 3EMVA 3O4VA 1A9PA 1OVGA 4M1EA 3NM4A 1YRYE 1YR3A 1LVUA 4QARA 3O6VA 3UAXA 1Y1TA 4LZWA 2I8AA 1LX7A 5F7XA 1YBFA 2BSXA 1PW7A 1A9QA 4TTAA 3UAYA 2RJ3A 5F7OA 4WKNA 1Z37A 1Y6QA 2ISCA 4TTIA 4DANA 1TGYA 5EFOA 3NM6B 1ZL2A 1RR6A 4P54A 5CXSA 1OV6A 1Y1SA 4NSNA 3IOMA 2AI3A 3P0EA 3DF9A 3TL6A 1U1GA 3UAZA 1ODJA 2A8YA 1JP7A 5CCDA 1PR6A 1Y1QA 1K9SA 1Y6RA 2QDKA 4LNHA 4G8JA 1T8SA 3U40A 4R31A 2A0YA 4LDNA 4DABA 1RFGE 1VHJA 1SD2A 4G89A 4BN0A 4EB8A 1ZOSA 3DP9A 2IQ5A 1JPVA 4D8YA 1PBNA 1PF7E 1SD1A 5EPUA 1Q1GA 3OOEA 3SCZA 1JDVA 4L5AA 4LNAA 1G2OA 1Z35A 4E1VA 2OECA 2OXFA 4F2PA 3PNSA 1A9TA 2OC4A 5FAKA 1K27A 1Z34A 1JDUA 4TXMA 4PNPA 4YMLA 1ODIA 1A69A 3INYA 4TXJA 1QE5A 1VHWA 4X24A 1C3XA 1K3FA 1Z39A 4DA8A 3GB9A 1ULBA 2QTGA 4DARA 3F8WA 4EARA 3FAZA 3NM5A 1I80A 3PHBE 5F78A 1Z5OA 2QTTA 4OEHA 3K8OE 4F3CA 1JE1A 1N3IA 3KVVA 5F76A 3ONVA 4M3NA 4DA6A 3E9ZA 4YO8A 1PKEA 1PR5A 4NY1A 4D98A 1PR0A 3DPSA 2I4TA 1PR4A 4WKCA 5B7PA 4L0MA 1FXUA 2ON6A 1TD1A 1PWYE 3ENZA 3FNQA 3BL6A 1JE0A 3KVYA 4D8XA 4DAEA 3E0QA 3FOWA 3FUCA 1Z38A 1Z33A 4PR3A 5F73A 1Y1RA 4F3KA 4L5CA 1V41E 1NC1A 1U1CA 4QASA 5F7JA 3C74A 1A9SA 5CCEA 3BSFA 4D8VA 3UT6A 1JDZA 3OCCA 1YQUA 4LKRA 3OZCA 1YQQA
chains in the Genus database with same CATH superfamily
2C4NA 4LX8A 2ZYUX 3FPBA 1SH7A 1ACJA 1UBNA 1Z2OX 2ATIA 2WIKA 3TPFA 3AJRA 2COUA 1QJCA 3TW8B 3AUKA 3JTMA 3O95A 5FI1B 1GPKA 3LY9A 4ETMA 4V1CI 4NNOA 4Q7LA 5KDDA 3LUHA 4JQCA 2B78A 3KETA 4ILKA 2CD9A 3EGCA 3WSVA 3ZCXA 4ENWA 4H31A 3ZJ4A 4YMTA 5B3JC 5KJCA 1JSLA 1LK0A 3FIJA 4X93A 1ST2A 4N7MA 1FS4A 2IXEA 1HE2A 3DT8A 4G1EB 1FUUA 3D3QA 1CUHA 1J5XA 1IZ9A 1M2VA 1OKKA 1PLJA 1L8QA 1ZBDA 2O4CA 3KLOA 5DCLA 1U6JA 3WADA 1AKTA 3QLUC 1GGKA 5CH3A 1B6RA 4JITA 4JR2A 4GD3Q 2WBLC 2J59A 4K9LA 5H0IA 1GUDA 1LSOA 2FEWB 1J1ZA 1LF5A 1KO4A 3DGFC 3DKIA 2PUTA 1FQJA 2XUAA 4NATA 3WLJA 4TPKA 4ZIRA 4C22A 3LCUA 4O5AA 1Y9AA 3E7WA 3HDTA 1YZYA 2WG0A 3U44B 3IKLA 4OXYA 3L0BA 2ID7A 5PNTA 1IZYA 2IHVA 5ALPA 2AZXA 3HCDA 2J9ZB 3QNWA 3U31A 3L0SA 3RVJA 4R2HA 2CEAA 5DULA 3KSAC 2KYRA 4IDOA 3RYIA 1FYEA 2NXWA 3LM8A 1CJUC 2PLRA 4NEHB 1P7YA 1GTZA 3NBMA 3Q9NA 2JCSA 1Z62A 3E3OA 2X22A 4FDVA 1RMYA 3VAAA 1G8HA 3ZNOA 4QQKA 3HH8A 4R81A 5DCUA 5EHGA 4HP8A 4ZI7F 2Z9DA 1J49A 3IUPA 4BEBA 1H23A 5B1HA 3TL2A 4PE5B 4G0VA 1VL6A 2DUWA 4AO6A 3IMKA 1JHUA 2W6MA 4PZAA 2PKEA 2ONZA 4WKOA 5BUZA 1BCRA 5CEJA 4QM7A 2X4LA 3KAQA 1RYZA 3QA3E 4Y6OA 4NTZA 3G82C 4MUIA 3O9ZA 2AXQA 4EG4A 5CAEB 1S2NA 2CXXA 4BRZA 4DIKA 3MJTA 4WBXC 5D01A 2PR2A 2ENUA 5AKIA 5BN3A 4KPYA 1DC4A 1SBTA 1BAPA 5M5BA 2EATA 2P67A 1OXVA 3JQ6A 1XTJA 2B4TO 2Q5LA 4M9RA 3AUXA 3T0GA 4MCJA 5F7ZA 2VK8A 4ENSA 3K94A 1L8AA 3KSZO 1ODLA 4HNGA 4RADA 1SPXA 4B71A 2H0AA 4E4RA 4F04A 2LXNA 5DM0A 3C1OA 3VBEA 4OBBA 1GD1O 1ECPA 4LZOA 4WRRA 1XVAA 1G41A 4M38A 1GJRA 2GKOA 1YO6A 2DQZA 2XRFA 3HRHA 4KUGA 5C5DA 3EN0A 1ZL0A 1NVDA 2IL1A 4BJ1A 1WV0A 3W5VA 3F97A 1WDKA 3HKDA 1JZSA 1JPUA 1YU6A 1SUIA 1QIMA 2BUBA 3E35A 1BW9A 1UJ5A 4U7GA 5DJ5A 5REQA 2I9KA 2ZAGA 3C3JA 2WWIA 4V0ME 1FFGA 1POWA 2LDXA 3ADPA 4OLFA 4GGPA 4KXNA 3GLIB 2V9ZA 4D0GA 3E15A 3WJ1A 5KYWA 3QLTA 1RRVA 1KO8A 2DHEA 1CE8B 2J67A 3H0EA 4GF5A 2XNKA 3CX6A 2AQ8A 2DKNA 9LDTA 2G6BA 1P7WA 2HK7A 4LEIA 3P9PA 4JKIA 4XYLA 5JZ9A 1U3WA 4LHZA 5IS2A 1J8DA 1M73E 3AI3A 1Z7WA 2B61A 4Q15A 4QUGA 3USES 1UKAA 3A11A 1V9SA 2JGRA 3DLAA 5IN5A 5E4YA 1R6UA 1BE8A 4A10A 2FPOA 2GD0A 1YASA 5JS8A 1U31A 3NG1A 4S35A 2PSEA 5ARCA 5KC8A 3OOHA 2LP4Y 4KQJA 1O9BA 4UEQA 1B26A 3RJZA 3DJYA 4Q9NA 2BFOA 4OQZA 1Z0JA 2YV1A 3FTQA 3TQCA 1I3CA 4FD3A 5BSKA 8ADHA 3WAKA 1C7EA 2V3CC 1C1XB 1NX6A 2PX6A 5ALGA 1QV6A 3GNTA 2HMYB 3WIUA 4F46A 3R8FA 3CUSA 1X7WB 3WQBA 2O23A 5I5EA 3NWOA 3LX4A 5CW1A 4DWJA 4AFNA 3RTCA 4AO8A 3HP1A 1E4VA 2WM8A 1RWNA 1ZK4A 3A8TA 4N3AA 3AJEA 4B1FA 4R3NA 3ED5A 1CUGA 2QA5A 3USZA 1RLTA 3GDFA 4DSNA 1M5TA 2PAFA 1Q14A 3CWCA 4UBOA 1LA2A 3ZD7A 1YKSA 3RBVA 1QPGA 2LKCA 4NQZA 1W44A 4C0LA 5JR3A 1YR1A 3P32A 2VYND 4DR2B 2RAPA 4I9UA 5DEIA 1RWKA 3BDIA 3D4PA 3O92A 4ZRMA 1VRCA 2NZ2A 1A0OA 1WB5A 2JLBA 2X5JO 3HYTA 5B6JA 2VUSA 2XQJA 3TW0A 1ABBA 1NRXA 3K4QA 3RT7A 3PK0A 3CSDA 1LLUA 3O4JA 1OFUA 3SDSA 2ZT6A 2QW0X 3I2GA 1QAMA 2A0UA 1HLGA 4R8KA 2O48X 3OBIA 2WQZA 1O8BA 2X7HA 2XMDA 5L3SA 4V0KA 3DV0B 3F5QA 2CK3D 1DFHA 1UIMA 4FT4A 5JNSA 4LFAB 1DRKA 1B8VA 1T2CA 2IEAA 1Z6XA 2QQEA 2WKWA 3DEKA 3KG2A 1K8XB 4D9JA 4KMSA 5MFZA 3DMPA 1L9XA 1W4BA 4Z6KA 1RC1A 4WBNB 5LA6B 1RQNA 1GAWA 5DHUA 4F5EA 2NTVA 5HBRA 2D5LA 3CNNA 4NZOA 4UUMA 3WIOA 2IYQA 4A2PA 4HGYA 5BSRA 2B7CA 2R7KA 4MUBA 4ZOCA 3DMRA 5AW0A 3EEIA 3P9KA 4ZT3A 4HV4A 3FLEA 3TI7A 1MVNA 1L5ZA 2H07A 1JSXA 3I1YA 4XVHA 1N9GA 2OV2A 1DAHA 2B4YA 4O02B 3PITA 1RI5A 4F9GA 1HT0A 5EXSA 2QQFA 5B53A 4BLWA 4LXIA 4OKIA 1SIUA 2QY6A 3JWIA 3OF5A 4DC1A 1XZEA 5EVJA 4RS4A 2ACKA 4UNSA 2X2PA 1YI0A 3MERA 3B3GA 5E8JA 4CF7A 2DPGA 2NM0A 4W6ZA 1V7ZA 2C07A 1YZFA 3DTTA 3FPCA 5BMVA 1QTIA 1V7QA 2GEUA 1Z2AA 2OC9A 1Z68A 1WCWA 2X0KA 4LJYA 5GM2A 3TD6A 4YPVA 4HSEA 1L7NA 5ANRB 5EEHA 3FBWA 3REOA 5LB2A 1IXZA 5LBTA 2RJOA 1JI0A 3A9UA 1AQ6A 2C2KA 2G5GX 4PO3X 3EXIB 4PSAA 2GOYA 1D7OA 1P60A 3Q1KA 5F9FA 5TMEA 2UUBB 2I29A 3R0JA 1JFVA 3I6YA 2KLHA 4AF7A 4IDAA 1C4OA 3TTXA 4QUEA 3Q5DA 4YJ3A 2OYSA 2W00A 3VPAA 4EKIA 2Z4SA 5CD9A 3NIWA 3VH3A 4RWEA 3ZZ1A 3MS4A 3QEKA 4OL9A 3UMSA 3TBKA 1SQSA 4GX5A 3HDGA 3JX9A 3I6BA 1YK1A 1WXXA 1Z3CA 2Q3FA 1R7RA 3BRWA 5K2MA 1N77A 5BNZA 3GLSA 5JY6A 2QR2A 3BUSA 3QPUA 4R6WA 1LVUA 3K2BA 1PZEA 1UP4A 4FNAA 3GJQA 4XUEA 5FI3A 5B1IA 4ZMRA 5KINB 3QPVA 2BGMA 1QNFA 4GUAA 5H70A 4B6FA 1HH4A 1M6WA 5D8DA 2H0QA 3H1FA 4B40A 4DQKA 2O8BB 1YBFA 3RAPR 4D8UA 4AUMA 5JAMA 3DTVB 1JKJB 3PR3A 2B1RA 2UAGA 2XNDD 3SICE 3UYLA 4R9VA 4E30A 1CD5A 2BF7A 2C2MA 5SY9A 2JI4A 1Z37A 2XUDA 3T3NA 2WQ6A 4YLEA 1E1RA 3L43A 5HM8A 3Q9UA 2W2KA 2QNIA 4P3NA 4Y1RA 5K0EA 3V8RA 4B3IA 2F1IA 2LKDA 3PGXA 4QZVA 3W3ZB 4KO2S 4PONA 4IIBA 1XQWA 4P1ZA 2YXLA 5CXSA 5D51S 4CHTA 1FW8A 4X97A 1ZISA 1YBAA 4PBRA 1WCIA 4LJSA 5H3CA 2VPTA 5FL7A 1ZWKA 3HVUA 3W3AH 4QKQA 5DLPA 1DKQA 5AK5A 3H18A 4Y30A 2JVKA 1FLVA 4EPXA 4H7EA 2A2ZA 4IJVA 4CR8A 4RDXA 1POXA 4UMDA 1V3VA 4GS5A 1XBTA 4NDNE 1BW9B 3A3PA 1LEHA 1IY1A 3L6OO 3N8NA 1J0AA 4UCXA 1FMLA 4MVYA 4KPFC 1LJLA 1BKSB 4ZO8A 3ZI4A 5EJ4A 3N0XA 4M0CA 4KUEA 3WOHA 1LX6A 2A3NA 2RH8A 4RK1A 1SCBA 2DXIA 1RZ3A 2BZ1A 3EF0A 4EFMA 5CCDA 3EBOA 5HG0A 1PR6A 3OM0A 4OQYA 3QE9Y 5JXIA 5CK4A 2E4UA 2JFWA 3SVTA 1NV9A 4S2UA 3T41A 1YZLA 2JFZA 4Q4LA 3DVSX 1SCUB 2K2WA 4B45A 1Z4IA 2IIVA 2XLBA 1Q91A 2KS6A 2WF6A 1Z22A 4MI1A 1PD1A 2ZE5A 2AXPA 1T8SA 2FVXA 3A27A 2O1XA 2J45A 2DBVO 1L7XA 3SAJA 3GLGA 3LC2O 5KI6A 2ZUEA 4NCHA 2R8XA 4MZXA 1HT1E 2EZTA 3TZ6A 1G9SA 1KK2A 2JB9A 3HVHA 3PGMA 5TV2A 2R25B 4CL8A 5M29A 3AMVA 5C7YA 4O6VA 1V1RA 3S81A 2GXUA 1KPHA 1Y37A 3TM4A 3K1YA 4GOXA 3UK0A 4B2PA 3LF1A 1R0WA 2J5QA 3CO5A 4KKXB 4WK2B 4BN4A 1MTZA 2QSZA 3KZKA 3O1IC 3IPXA 3NEAA 4WHMA 3Q72A 4EBBA 2O7VA 1T8UA 4BQFA 5FLEX 4JZYA 3IQHX 4ML3A 1IWBB 1RJ9A 4J7CA 3JD4A 1A8QA 2CHQA 4O4HF 4OIMA 4B2YA 4G65A 4TMFA 3ST7A 1TA4A 4X8OA 2J5BA 4ZPJA 3ORFA 3LWDA 1XU9A 3EXHA 4R1QA 3E48A 4QULA 3H1GA 5CDHA 3SCZA 2EFGA 4RHYA 4L5AA 1M34B 5BYKA 1UBGA 1KRHA 2JCVA 3BTOA 2YDYA 4RHUA 4EARA 1L5FA 3UC5A 2Q5HA 2V7GA 1PHRA 3PNSA 4PC1A 1V2GA 1OLXB 2GETA 2HXSA 4D9NA 3UHJA 1JB9A 4Q9IA 4LMAA 3HEBA 4ZT2A 5FLXA 1O57A 4L9RA 1R00A 2EJBA 1Y98A 2AC4A 4NABA 2PFSA 1KQPA 1QE5A 1VHWA 3OTIA 4IILA 2W6JA 2EGUA 2IUUA 2F8LA 5L3SB 4LWPA 5IDXA 2ZYDA 1DRJA 2X5NA 3RYFA 4O4JA 3I5XA 2YWCA 1K3FA 4QL3A 3EGWA 4OGFA 1NN5A 2XYVA 4MSUA 4PS0A 4IDBA 5KTYA 1EFKA 3F3SA 5JXJA 3IQFA 2C7VA 1PYOA 3HL0A 1N8KA 4X92A 1E0AA 1ZD3A 2NUTB 1YK0A 1ZVMA 1DIHA 1GDDA 4GP6A 3IBGA 2QI9C 2VPXA 5SICE 3QI7A 1T4CA 4MB2A 2IZ0A 1H2FA 4X6LA 4YMIA 4ARVA 1I80A 2C2HA 4IEEA 3M6WA 1P75A 3PTZA 3WGGA 1M33A 4EVIA 1MUUA 4Q1EA 2P2YA 4N9QA 3TLMA 2BDEA 4ERXA 3V4SA 4RMGA 1NVTA 1VSVA 4D44A 2OD7A 3RG2A 2YMLA 3C6KA 1SUBA 3WC4A 4RA9B 1WBDA 4LUCA 3BD9A 4AS2A 4YRAA 2H1WA 1OPRA 3D2AA 4CCSA 2JFVA 1KDPA 1PFQA 5JALA 1FMJA 1W5AA 1KPGA 1RVDA 1DT5A 3HBAA 4OJQA 1XAIA 1DXYA 4ZREA 3ZH2A 3E9ZA 5C1OA 2AN5A 3E7PA 4QNRA 1V1JA 3QX7A 1PR5A 3UMFA 1X94A 3ANSA 4J2HA 1TT7A 4HB4A 3LFTA 4OHWA 5CFOA 3VOAA 2Q07A 3T3DA 2GWHA 4F4IA 1B0UA 1RYNA 2WV7A 3KKNA 1L5VA 2D06A 3GJSA 5C4GB 3BB3A 2DHQA 4DUGA 2Z04A 3M8KA 4H3VA 3TI9A 3OQVA 1NLUA 1SQ5A 2C03A 4B6PA 3AIOA 4Q4CA 2X3UA 4RJKA 3L02A 3K92A 2BGNA 2I1VB 3V8QA 1JRLA 4FNOA 2Q6TA 4JEHA 2GPYA 3V00A 1PJQA 2D8AA 4I6JA 4TWIA 1N75A 2A9OA 4FKBA 3K3PA 1OBCA 5F2EA 4DAEA 2WT4A 4EVQA 1OGIA 1KH3A 2FR0A 3SEAA 3H97A 3UKOA 2ZLBA 2B36A 1N34B 4KTTE 3T9AA 2BGWA 3JRWA 3M5WA 4TMXA 3SYNA 1C3JA 2C4HA 3PX2A 5FAXA 5CDSA 2HPZA 4KYVA 3VHLB 1PFGA 1N92A 5GZ6A 4HLUA 1K68A 4ZEXA 5IFLA 5J4VA 2IX9A 1F38A 4J7AA 4D79A 4P80A 2EKQA 1CRQA 4YEDA 2ONKA 3PC8A 2QRVB 1PEYA 2YJ5A 1E3DA 3G1TA 4EUKA 5EHXA 3LK6A 1AV7A 3TUIC 3COZA 5TT1A 3QBEA 4M8KA 2VIIA 3TNJA 5I01A 3WGKA 4KQ6A 4BP9A 2I2FA 4LMRA 4M22A 4QFMA 3C39A 4O2BF 4OSPA 4W1RA 1HYQA 1EK5A 3E5MA 3UMYA 2RD2A 4N8SA 4OMUA 4GBED 2IVFA 1XTUA 3SE7A 3R74A 1GAXA 3NHBA 4EECA 2IU4A 4I50B 4MS4A 3T5AA 2XZOA 1NQTA 5TX7A 1KIFA 1E3WA 1DBSA 5EJ2A 4MR7B 3SBDA 1M5RA 3BYZA 2ZXEA 5GVRA 4UEJA 1EQAA 3LUDA 1MW9X 2XJ9A 3NT5A 3CVXA 1ZUNA 2FQ1A 1FA9A 2WVGA 4L85A 4XOIA 3JQ9C 5CB4A 1GCAA 3QEJA 1CHNA 1WUIS 4J90A 1WBJB 4JAVC 5H80A 3SXJA 4XLLA 3OQNA 4Q9LA 4PAWA 2IT1A 1U9CA 4PYJA 4EX7A 1R8QA 3MTAA 4JELA 1QIEA 2PYIA 1LBSA 3LKDA 3CQ9A 3BD8A 3OSUA 4RORA 4WN9A 4Z9AA 2H85A 5FYDA 3WLKX 3ZWQA 1QWOA 1ZN7A 5IXYA 2AJLI 3GG2A 4TSKA 3IALA 3RM3A 2OFWA 1UMCA 3OE5A 1TLLA 3FR8A 3HDVA 3PF9A 3VPSA 5JNUA 2GN4A 5EIHA 1VXOA 2CZCA 4ZT7A 3UHPA 1HLDA 3I76A 4X3CA 1M3SA 2IPAB 1ZHHA 3M4JA 1SOUA 1H5QA 1W73A 4MVJA 1HUQA 3HA2A 1PKXA 1UPBA 4P7GA 1U04A 1R16A 4PHHA 3X1WA 3GPLA 2IZ1A 1KKUA 2F48A 4JFAA 5TC4A 2FMIA 4BKOA 2Y2UA 4EHHA 1TKAA 5HVNA 3CZ9A 4GR5A 1MKYA 4UHCA 1TZKA 4QECA 1OI3A 5EAIA 1E92A 4DPMA 2WHQA 1V0JA 1WY7A 2ZBEA 3EXHC 5EZ5A 1G66A 3SQWA 4JYBA 1XEFA 4QVKA 3G9TA 3ROFA 3D6MA 2AS0A 2WWWA 3CX7A 3I5AA 4FD2A 4F4UA 4MVJM 1RBZA 3N07A 1FPQA 2IOYA 2ZJ5A 1V1RB 2ETVA 3AVPA 1P39A 2C94A 1TVCA 1CULC 3LT2A 6NULA 2WHXA 1Y7LA 4RC9A 4YMSA 4CU5A 1U9ZA 2IWHA 1K8RA 1KEEB 1OGYA 4PHGA 4PZYA 4QU5A 2HXYA 5EUBA 2JARA 5LP6A 3S8EA 1KMQA 4BUCA 4I4IA 2QK4A 4ALKA 2PIAA 2EBUA 3WYEA 2IIBA 3WYNA 4COKA 3EDYA 1IMOA 2ZYGA 1TF5A 1NUSA 4GE0A 3M3PA 4Y0NA 4CM1A 2BLLA 3ZQ4A 1CUWA 2GPNA 3AR3A 1OI7A 1WULS 1TZJA 4Z9XA 1JJAA 4C2AA 2FPUA 2BI4A 3DZJA 3GQBA 2BW0A 5B37A 5CCXA 1KBOA 2Q4RA 2QD3A 2QT1A 3ZHTA 4O1IA 1P2VA 4HWOA 2PUDA 1P2UA 2WJ3A 1W4CA 4FXOA 3U4HA 4PQFA 1Q0HA 2IZ6A 4H7DA 1SM4A 1XCOA 4BX9A 2ZITA 1XYGA 1RQPA 3H04A 2YH2A 1OCEA 3JW8A 1M2WA 1SUPA 3HY4A 3K9NA 3EG9A 4R2JA 4DCCA 4H1VA 5IAKA 3VFDA 2X4IA 2GZ2A 4RMHA 4QXAA 4UZEA 3SR0A 1KZ7B 2I3BA 2PY6A 4GYKA 2A9FA 3ONEA 4HOYA 2R6R1 2G5TA 3JQEA 5JDIA 2CHUA 1VBFA 4I5IA 3SJUA 3JAKB 1J9GA 3D7SA 1Q7TA 2Q2WA 4EJSA 3FVQA 3TNYA 2PDAA 3Q3IA 1QR2A 2IC5A 4M54A 2B3TA 3P26A 3R77A 3OCXA 5ALSA 4OB6A 2ZUCA 3UJPA 4AQDA 4QT0A 4DLBA 3WQSB 4CTOA 1GKYA 2JAPA 3TMAA 4AJ2A 3T8YA 1F8YA 4FE7A 4U7FA 2JGDB 4ZK6A 3FDXA 5JNTA 1T4CB 2G09A 2E89A 1R3DA 1JIKA 4GOMD 4JK3A 4XGIA 2YZ7A 3PDIA 3N53A 1LRJA 3PQ2A 4PX9A 1RQ7A 3RRNA 1DAIA 4Z4HA 2FUCA 2UYYA 2WYUA 4ZU1X 2VHQA 2AFIE 3FPFA 2DPHA 3AR9A 1YJCA 2FZ4A 4ZEMA 4HEHA 1VLHA 2QLFA 4RKYA 2J8ZA 2LCFA 2FAXA 3AM3A 3CUWA 2DETA 2IV2X 4NMXB 3QPBA 4E13A 1I4TD 4WK0B 4CI9A 4RH0A 4WKPA 3QELB 5B64A 1SQ0A 1ZI6A 3HGTA 4MS3A 4OJTA 4Z1MD 1VSQA 4F06A 2QB5A 3M6UA 4N5DA 3WLTA 1TRHA 5CHYA 4B75A 2RHDA 3G5MA 1VL8A 1RWMA 1G21A 1Y42X 2PZMA 3TUJC 1A88A 4B6SA 4DOMA 1Z5ZA 2E5LB 2HA2A 1VE6A 3QVWA 4HLUC 4F4FA 1E60A 1WVGA 3MHTA 2CSXA 3WGTA 1E1CA 3ACBA 3G2OA 1M67A 3TAXA 2VXYA 2KB0A 4NZMA 4EF6A 4P34A 3EQZA 1NWCA 1YA4A 4Q4AA 4MRRA 3D2BA 2F55A 3ZLBA 2AG5A 2H17A 3ZS8A 4LF8B 3SZGA 1UINA 1RYMA 1DXOA 2I7DA 1IB6A 3DC7A 1Y80A 3H87A 4PYQA 2V9PA 4JLKA 3OQHA 4GLLA 1Q92A 2JFUA 2F17A 4ND7A 5EY5B 5EMMA 2Q29A 1IBLB 3IR7A 3FNIA 2CJWB 3BGVA 3GA7A 5C0OE 1GT6A 4DNXA 1N3BA 1II9A 3T6KA 3UW1A 1UDWA 1B0PA 3GY0A 3O8NA 3OU6A 4M89A 2GM4A 2ZIEA 3B12A 5U1PA 1LH0A 2E6KA 1DIRA 1OZFA 2VL7A 2GEKA 1BEZA 2CJYA 3HVJA 4LIPD 5DI3B 4DR5B 2ZUBA 1O97C 5K3OA 4OMFG 2BSAA 2BZGA 1UK8A 4ZCIA 3ER9A 2IV3A 3H9GA 1KVQA 1ZD5A 2ZE7A 2NU8A 3W2HA 4R8VA 3IQDB 1JXOA 1W1WA 4NK4A 1OTYA 4UDXX 5DTMA 5FFNA 2K87A 5DTRA 4JSYA 1GGHA 1NFFA 4DL9A 4DAOA 2JJ2A 4H7FA 2HSGA 3ASUA 3I1IA 3P9CA 1FYFA 4GZ3A 1DTWA 1NSYA 4KTVE 3PUYA 3VKWA 3ZCVA 3OZUA 3AQIA 1XZPA 4DIBA 2JGAA 3C5EA 3QI2A 3DMYA 1GZHB 4XX0A 4B76A 5CFLA 5L53A 2EHDA 4A15A 5K4AA 4TS9A 4YMHA 4GG1A 1H5UA 2PSSA 3A2MA 3DZDA 4X20A 2GZMA 1Z3IX 4PGHA 1H6DA 1XZLA 2WFAA 3K8ZA 4HZUA 4XWAA 3MW8A 4KR0A 1DLJA 1PR3A 2ZPUA 3LQFA 2BPOA 1NVKA 2YV5A 3DUFB 4JI3B 5IBRA 1XKTA 1TU3A 3RBZA 4IIVA 4KQXA 4KDEA 3TDMA 3RAFC 4LJ9A 3U39A 1KTVA 1R5JA 4HX2A 1CTQA 5CB6A 1T1IA 4HWKA 4LFCB 3U80A 1Z0UA 1R0YA 4GL2A 3MD9A 3AB8A 3FLMA 3KDPA 2YVQA 3WHPA 1B0AA 1JSRA 1YB2A 2J4FA 3N8HA 4G1CA 2CXHA 3RSOA 4R69A 4EY3A 5CA0B 2OCYC 5COBA 3U56A 4UBLA 4MDFA 2HD4A 2VQ3A 1LC3A 2I65A 1O87A 4RFSA 2FWMX 4M7PA 4WEOA 5DTJA 5FOSA 3TTTA 4B80A 3OT5A 4WUVA 1VRVA 4BQQA 5JXGA 1EB8A 1IWPB 5LP6C 3U7EB 4ARSA 3C87A 1A9PA 5LR6A 1UP7A 2VJYA 2TSYB 3OO1A 1UCFA 3U62A 4DJJA 1APBA 5CHEA 4ETNA 3EBPA 1G8FA 1XEXB 2HA4A 4QDKA 1FFWA 4AIRA 1NNSA 5KDOA 1ZJZA 2V1XA 3AZOA 4JSRA 5BV2P 3IIEA 1IONA 2AW5A 3WKBA 3KOWA 5BWCA 5AVUA 5KVCA 3CZPA 3NV7A 1ECLA 1WNTA 1NY6A 3NJRA 2QZJA 3NDRA 4IDHA 3JYNA 1FQKA 3BFPA 3EWSA 3NJ8A 4CI0B 3NDBB 1C9MA 1EMDA 4F3YA 1CRPA 2O8NA 2EX4A 1A9XB 5JS2A 1Q1BA 1PW7A 3AUYA 1SU8A 1MO4A 4KYTA 3VDNB 3KZCA 3Q7SA 3H2IA 1E94E 1XDBA 3EVCA 3SHQA 4E46A 3EMKA 3HGMA 1RAHA 3KXLA 4LI0A 4ZGBA 1UH5A 4RVGA 3S8YA 3ORHA 2ZWAA 4TTIA 5ILOA 1VG8A 3PQEA 3BXGA 3M1LA 4OXRA 1U5AA 4L02A 1O94D 5E4FA 4TWRA 3W2TA 3EF1A 4JOQA 5KHAA 2PMKA 5BRAA 5JDIC 1UFRA 4YMWA 2I54A 3TTYA 2CV1A 3EDRA 5IX8A 1GDHA 2H06A 1UPTA 3Q11A 5JRJA 5HKKD 1S02A 2BM0A 4P92A 3T1HB 3ZW7A 3FFWA 2VJKA 1UWCA 4QU8A 1KGDA 5JBIA 4BKPA 1UBTS 4BX2A 1PNVA 4B9EA 2B98A 4WZAE 4KQWA 2CL0X 3U48A 3RR2A 4EYKA 3CRVA 1P45A 3BXPA 4XJSA 1Z9BA 1EFHA 1P0QA 3ZVKA 4RD1A 4CEIA 5HS4A 2W2NA 4L51A 1Q0ZA 4LMBA 4MIOA 4NNPA 4RKRA 4KW7A 3ZTWA 1QFJA 3A9RA 3AILA 3MT9A 3K0FB 1U7OA 5AW4A 4AY4A 4K0KB 4KQGA 2VT7A 4DJTA 4EMTA 5JAIA 5P21A 1Y33E 3Q7RA 1Y1QA 4C7MA 2ZAMA 3Q3JB 1KU0A 1Y8RB 2NVBA 3PF8A 4YIHA 2X0RA 3QKRA 1W88B 1AE1A 1VG0B 1ORHA 3H75A 3L9XA 4H7JA 5AQEA 4ZVPA 5KBYA 2I4OA 2QUZA 3CR3C 3GQVA 1ZH2A 5C8VA 1P4GA 4CT0A 4PANA 4Q12A 1VLLA 1O6FA 2O2SA 1L0BA 4X91A 3VJKA 4WIAA 4YGYA 1W1IA 1C3LA 1W6UA 1ZITA 2YJGA 4QBHA 5KNLA 1J1UA 4OK6A 4BIIA 2Y66A 3RYTC 1ICEA 2RAUA 1KS9A 1S7GA 1ORWA 3MVEA 1CQWA 1WTCA 4I6GA 4IXTA 4C0QC 5DNUA 3PQ3A 2G04A 4YALA 5KKAA 2AT1A 1L7BA 1NYLA 3N76A 4EGFA 3ZD8A 3IIIA 5BSFA 5AJXA 3HSYA 2VJQA 4RIFA 5CYOA 3IHKA 2SECE 3PE3A 4U39A 3RIGA 1KJIA 1Z0AA 4KNYA 4MS3B 3D7LA 4HTFA 5L95A 5LQUA 3H1PA 3V1NA 5A6SA 1SOAA 4EW3A 1IN7A 3C6BA 2VNKA 4KXLA 1H3EA 2CVZA 3K9WA 4MHSA 2FUNB 1CR4A 1B43A 1SD1A 3N7TA 3FWZA 3D6JA 4Z7NB 3QWFA 2C00A 1BA2A 4HDCA 3EZ9A 3SZMA 2PS3A 1P8JA 1JDVA 1GV0A 1WABA 1Y3CE 2IP4A 2R00C 2VFAA 5CP8A 3UJ7A 1GGNA 3TTWA 3WYDA 3LXXA 5B12A 2EP8A 4EELA 1DJMA 4B3FX 4RULA 3OJFA 4Q4AB 2VHEA 5HE9A 4JP8A 4EPTA 2PS9A 2CMDA 1NZDA 4NBUA 1RZRA 4YRFA 1ZO8A 4PO1A 1T29A 2AX4A 3FNHA 4NWIA 1REQA 5CA1B 1AQNA 3RC8A 2O06A 3AR4A 1XZ8A 5HK8A 2BISA 2QS9A 3T3PB 3V48A 5BQXA 3Q3HA 3R75A 1M76A 5D3MB 5JE8A 1JN0A 4J1TC 3VHQA 2VHVA 1LK7A 1RQGA 4ZMSA 2I2CA 1VHTA 2D62A 1JXQA 2AD5A 1KU6A 1IOZA 4I8XA 1FRQA 2DY1A 3FBTA 4PQRA 5I4KA 3REQA 4JLVA 5KWIA 5KX5A 1OAAA 2X41A 1IG0A 5BNWA 4CN8A 2JKZA 3H1AA 3ZQJA 4ETIA 5JZBA 5CVJA 3QXCA 1PYDA 4RKWA 1OD6A 4RF2A 2G77B 1DTWB 2YMQA 2GCNA 3GYGA 1BHJA 3AO0B 5A4MS 4FNGA 4HWSA 4EVSA 2HPHA 1GEGA 1L4MA 1PQ4A 1KYZA 1DDOA 2IW3A 4U2FA 4GI3A 3HBMA 1QFXA 5F76A 3A4MA 5FNZA 7REQB 3C3EA 5IKMA 5TJ9A 1SKYB 1FEZA 4AS3A 2BFCB 3JD0A 3OZRA 2ADOA 2VHZA 2Z3WA 4Y67A 5IVIA 4ENUA 1LSUA 3U1TA 4DHWA 4RIEA 4FCWA 3E9CA 2PGLA 1MH9A 2RJNA 4FQ8A 3UWKA 4BNIA 1G8GA 1UZUA 3ICEA 3S6JA 5T4BA 2I4TA 2PSHA 4S1VA 3UJ6A 1E7QA 2B92A 2CJPA 2QG4A 4GFDA 1P2DA 3JQCA 3WMRA 3MJRA 3O90A 4FP9A 5DYWA 4YN3A 4L3WA 5TNXA 3G85A 2XZTA 3P1JA 4FTWA 4ZV4A 3WYCA 2QX6A 3T12A 5JAOA 1DL5A 1FYDA 3IUSA 2DPYA 1HDOA 2GNOA 1NFQA 4AJJA 1DO2A 2BTQA 2JFYA 5K3CA 1X1BA 3JQGA 3R5SA 5JPIA 2JH9A 4D9GA 1RPTA 5DB4A 2HEGA 2O8DA 1WMDA 4Q3NA 1IYZA 4KZPA 3UUGA 4TYWA 3SZUA 1YR9A 3MA0A 1ZI9A 1BKYA 1TA0A 4UW9A 5EWMA 3D0RA 3EHEA 4M21A 1KQNA 5B4VA 1O95D 5DHRA 1LDBA 4N41A 2PXAA 3E0XA 4I8IA 4A6EA 1MAVA 4ZD6A 1W25A 4KFTA 3E3LA 4J94A 2ENWA 4RU1A 1WXDA 4MQEA 4B3CA 5LUAA 5I7EA 3H5IA 5H7XA 3G2IA 4Z4FA 2VWQA 5IJ9B 3AEYA 3ORSA 2VJNA 2VRCD 4WA8A 3Q8LA 1DBWA 2YC2C 1ULTA 4U2EA 5IBPA 4ZQCB 1GITA 1OFHA 4ZO7A 3R0QA 4CV1A 5DXFA 3RFCA 1NMQA 4FXPA 2BFDB 1XJWA 2XEXA 3D7RA 1Q44A 5ER6A 1KAMA 3A2LA 2CUZA 1NUTA 2R7MA 3Q8WA 1BS9A 2HQ1A 2PVSA 3BVPA 5IT4A 4L3OA 4RMIA 1Y6GA 1F60A 2Q2OA 2PL5A 2ZQ5A 4MMZB 3D81A 4S0XA 2P9GA 5U4XA 3H05A 3ZV5A 2O2CA 2ZAIA 3IDQA 2JLWA 1UPUA 2C5FA 4DJDC 1I7DA 4F2GA 2Y1FA 4QAQA 3CYFA 1OZAA 1DFIA 3WICA 3CB2A 1T34A 1E9BA 1C7RA 1Q15A 2NXNA 1FPMA 3N28A 2IGBA 4XDHA 3WL7A 4D74A 4YREA 3TVDA 3RCBA 3E2MA 5DM60 5HGXA 2PUBA 4D26A 3R3YA 1JFFB 4FW9A 1CU1A 4KOAA 4ASUA 2NU6B 1QGED 4X9XA 2D7DA 2X5KO 3UXYA 5HZHA 1T5HX 3T3OA 2X76A 1P0FA 3OPVA 5GIPE 3QKWA 4YCDA 5JS6A 5K1ZA 5CDFE 1JSCA 5A7GA 3BBPA 1RWPA 1P9WA 4FHFA 4HWTA 2OEPA 4KDRA 5TB5A 1G9TA 1RI3A 3BWDD 1C0EA 2ZAYA 2R4QA 5ITZA 2YFYA 3O9MA 3UJCA 3VI3B 3RSHA 4Z5XA 1MB4A 4LY6A 3JVDA 2GCGA 1XMPA 4LXXA 4RM2A 5CBPA 1L4YA 2L42A 2HRRA 4ONEA 2AEJA 2WINI 2BLNA 5NULA 4DBVO 3NEPX 4FHDA 4G84A 2VAVA 2JS7A 5CITA 1C9EA 4M99A 4N49A 4QDZA 4OHYA 4R0MA 4ZZ2A 1DX4A 3N59A 1IXSB 4WT7A 2PBFA 2CDRA 1QGYA 2YJZA 1HFKA 1QE3A 4IM7A 1T0UA 4REQA 4WE3A 2F1JA 1X87A 4MV7A 2XKKA 2P9HA 5TS3A 3T3IA 1V8DA 3O93A 4L0QA 3CVVA 2NUAB 3F3KA 4AKTA 4KITB 1F2VA 4MVJI 16PKA 2BTOA 3KEMA 4MAMA 3OA2A 3SQNA 1A95A 1E1LA 1XTQA 2VZLA 1TX4B 4MV6A 3ILYA 4MV4A 4FGSA 1CVLA 1E58A 1U8CB 2VO1A 3GVXA 4OHKA 4U0JA 5EQDA 4EO9A 4Q24A 1K7CA 1NOJA 2ZRLA 3EVNA 4RJJA 1GFIA 3ETDA 4CLEA 4RCVA 4BIMA 4RX1A 2HPVA 4OREX 1ZGJA 1RS0A 2GGSA 1LDMA 1RXYA 1A9RA 1E9VA 4HKTA 4IVRA 5AM1A 4LYYA 1JT2A 1MB0A 3MZ0A 5AOBA 3ND6A 3O8BA 3HO1A 1ZOLA 2OGSA 3EIEA 3ZEIA 1J2UA 4E5PA 5D5HA 3G9QA 3O31A 4ZVTA 5JSFA 4MYDA 1KZGB 4BKMA 2YHBA 4FU0A 1L5RA 2EV9A 3IA2A 5KYYA 4B4VA 4R98A 1S4QA 2AR7A 4BVKA 4EY7A 4GZLA 2QRUA 4TZ0A 3SYRA 1TUGA 3WGZA 5HJEA 3E1SA 1XZKA 1ODCA 5A4DA 1QF6A 3TQFA 2WR8A 3VC7A 1B8UA 3JZMA 3GFFA 4LS3A 3DHYA 2X0NA 2QLTA 1VKZA 1LFAA 2XQVA 4OUDB 4WXEA 3QVGA 1N0WA 3ACDA 3GW8A 1ANKA 3JCZA 2RI1A 4GBGA 4MKFA 4R68A 4RD3A 3SN6A 1REQB 1DAEA 4P0TA 5BQPA 1HRKA 1K5GA 4CF4A 3ABRB 3DYBA 2GTHA 1DIOB 2A5DA 1ZIDA 3ANXA 3FCOA 4XGNA 2M6RA 3L7YA 5GY7A 2VDKB 1V3UA 1V2HE 4Z0HO 4RHTA 4PCUA 4A8TA 1V25A 1J20A 1X1AA 3KL2A 4G0XA 1OAKA 2WP8J 2VSNA 3T1TA 1SHTX 1HMPA 1IZ8A 2QGFA 2Y9MB 4WVFA 4UUBA 3W2FA 3W79A 1XXHA 3ESCA 1PQUA 1FNBA 2IU0A 2JI7A 4A1OA 3MUFA 4HUTA 3Q7PA 1Q77A 5E1OA 4ER0A 2FEKA 2R65A 2HHAA 3JS5A 4OQ4A 4JU9A 3V7UA 3X1JA 4ZVKA 4CVNA 2BZ0A 3HYCA 2ZI4A 5CK5A 1IQ0A 4UFNA 2VNSA 3U1VA 4YLGA 1G3IA 1GPNA 1NUQA 1Z5UA 1LI5A 1Z25A 1H2EA 1OU4A 1GUFA 1NBIA 2OBNA 1PX0A 3FD8A 1O9HA 2FCAA 3Q15C 3M4XA 3Q0EA 4R1LA 3ZE2B 4A73A 5EUCA 3HK2A 3BGWA 3FUUA 4RGYA 4QATA 2FSPA 3G5UA 3MPOA 2CZQA 1CY2A 1CCWA 5CM8B 4YP7A 3DCNA 4KN5A 5FA8A 4UHFA 4DA7A 2PX8A 4DY6A 4RELA 1RJGA 2W4QA 2QPLA 3BKXA 1G4AE 1ODKA 4FGLA 4HMPA 4W8OA 3T1VA 4G81A 1OLOA 3GT4A 3H8JA 1JWLA 1MB9A 3VI4B 3K09A 5IDVA 4BMXA 2WD8A 4ARBA 4DPKA 2WU4A 2ZI3A 5A04A 4YXFA 4FN5A 2LBPA 5MHTA 1CVIA 1HTTA 2DC1A 1Z7YA 2QAJA 3PQDA 4WK6A 2OAQ1 1KZHA 1RXUA 4BMDA 5ESWA 1XX6A 3AT1A 3K6JA 2BTQB 3S2FA 3HU2A 3KEOA 3C0KA 1B1AA 1YHZA 3DW1X 2BM1A 3LXRA 3I9LA 1P6QA 5EE3A 3AF5A 3Q7TA 4EJMA 3C1TA 5DXAA 1NP7A 4HB0A 5JJKA 1N2XA 1D6NA 2N0SA 1JKFA 4HS4A 4U02A 4N0DA 3SZLA 5KMGA 1CDZA 1ZD2P 3U09A 2EKBA 4D0NA 5IANA 4R2XA 5AK0A 3AOEA 4BNNA 1V4NA 4IS3A 1PTJA 2CKMA 3A2NA 3NYRA 4GRIA 3ANLA 2R48A 4JLOA 4FZ3A 2A9PA 3TIXB 5FJJA 5GJVC 4B3MB 5E6RB 4N47A 2V7QA 4XUCA 3MWDB 2B35A 1VP9A 1X9IA 2P2SA 4JYPA 1PSZA 2BBOA 4Q3EA 1JQ3A 4HDOB 3K1AB 4RVOA 4ALMA 1JEAA 1HZZA 2D2VA 2G06A 4BFCA 5EHIA 3UK1A 4Q01A 2JD0A 4I5FA 1VCHA 1M1XB 3ILVA 5H68A 1ZK3A 3LKZA 4PG6A 5IH3A 2A33A 4FPXA 3I58A 3IQEA 5TIIA 1U1EA 3S0JA 2FFHA 3A1NA 4KO3S 1T6NA 3L7BA 3G8BA 3B36A 3QU5A 1BX0A 2IS4A 2OO5C 3ZWXA 3JQFA 1BEUB 1PJTA 2X23A 3FY4A 3KFVA 2R60A 3F4LA 1LXCA 5IW8A 3BRSA 4TS3A 4LISA 5KOHB 3VPXA 2BP7A 2GNPA 3SYKA 1I2CA 1H6AA 1TEZA 1W36D 1GXSA 2DKFA 4OFXA 4KH0A 4OGLA 2OORA 2HA5A 4MH0R 4BPBA 4PPYA 1NVVQ 4ER3A 1P77A 1RLIA 2C9OA 2X5XA 4BWVA 3O2JA 4P84A 2BF4A 4X54A 2G0TA 2EFYA 5D00A 5JCPA 5CYGA 1PVVA 4QEZA 4MARA 2VXCA 4C6TB 2B9EA 3P4XA 4KXMA 3CWQA 1EX6A 2D2IA 1U8UA 2GEVA 3K20A 3WGUA 1WEKA 1QJ4A 1XDUA 2IBTA 1U7UA 3VYVA 2B94A 3ROQA 4B2IA 4YP6A 3NJ4A 4CM5A 1BDJA 4X94A 3W9BA 2KWIA 1B1CA 1FP4B 1GL6A 1U2RA 3AV0B 4HRAA 4IJQA 5HF6A 2ZYSA 5B3AA 1E9SA 2J46A 3QW4B 3TNDA 1JQEA 5CJJA 1RD4A 2B69A 2C9YA 3EMVA 3O4VA 5LDGA 3LHSA 2QQGA 3K2EA 1Z7EA 4F38A 2P9JA 1OYVA 1WKCA 1YL5A 4P0PB 2PU7A 4PYMA 4BO1A 4NEQA 3W6NA 2C3UA 4K6GA 2KW5A 4HVLA 3U9TA 2CYAA 4NPAA 4ZGGA 3U4DA 3IS3A 4FLEA 4I3HA 4P7KA 1FDRA 1S3IA 4RAQA 4LZZA 2PH3A 4M9XA 1ZWLA 3E6AA 4IL5A 1KSJA 1R0RE 4B34A 3VKGA 3FCAA 2W2LA 2C58A 2H51A 3DFMA 4Y2PA 3UB2A 4TTAA 1EUQA 1WXIA 4MYSA 5I47A 4PQEA 3JTEA 4GI2A 2H1FA 3CPSA 2IEGA 2RBGA 3K70B 5JCOA 2RHHA 2H5IA 1U8AA 3CRRA 2B5OA 2P9YA 3LNTA 1HORA 4D81A 5ELXA 3QPAA 4PZEA 5JNVA 1L4KA 3A3NA 3RVMA 3WY9A 2PWZA 5IZ4A 3JATB 3DLBA 5AJYA 3VH1A 1DHRA 1FSPA 3D2CA 4XIYA 2A1UB 1L7OA 5ICGA 3GLIE 3M7IA 3H1TA 3LPDA 4DSOA 4J6FA 3DWEX 3TMYA 4NOJA 4D9FA 3A1TA 3CNQS 4BCCA 2EF1A 3CLHA 3GJ3A 1IPEA 4EF4A 3R3ZA 3WYAA 3PEYA 1JWAB 1SMKA 3WNBA 3GR6A 3A4IA 1M8GA 3O8QA 2AGVA 4OQPA 5AOVA 3JYHA 3UFBA 3WDKA 2IE8A 2O2EA 4B47A 4ZU3A 5JDCA 1IXYA 5BYBA 2PLFA 3D6UA 5GWXA 4RLQA 2IHJA 3ZDFA 3ADBA 3TVTA 1QYXA 2GBFA 3H3FA 3WMGA 4DR7B 3X1KA 2BFNA 4C4ZA 4H0CA 3B1KA 4NCNA 2F9MA 1IHXA 3DA8A 4MJXA 1JR3E 2CDNA 2IPMA 2Z3VA 3QXGA 4G9BA 5FFFA 1N6NA 1YR2A 3BWYA 1BNCA 1JP7A 4ZAFA 1RRCA 3I3SR 1XGKA 4AG5A 4BO7A 4TV8F 2VXBA 5B5SA 1BMFD 2PLNA 3C3DA 4BKUA 4MV5A 2OFOA 2QUHA 2V7WA 3LY5A 3NH6A 3WGNA 1L8XA 1JUDA 3X2SA 5ALTA 5ENDA 4G8JA 3HUTA 4F1JA 1M6VA 4URWR 1ILEA 1EP3B 1ZEMA 2FPGA 5DIFA 4BHTA 3NDJA 3CZRA 2ZJFA 2Q9BA 2HIGA 4R31A 4Y1FA 3CLSC 1NBMD 1VHDA 2IUEA 2OXRA 1SPBS 2NZUG 1R10A 1XVTA 3E2PA 1PGQA 1N2CA 2NU7B 3K09C 4TRJA 1USVA 3GI1A 2PL1A 3N1UA 5HM6A 5HXAA 1W85A 1ILWA 1O8CA 3B82A 2P3QA 3DP9A 3OX2A 3VDMA 2JGJA 4JUDX 5KSPA 1FSGA 1AQLA 1JPVA 4YFYA 4OOFA 1NT2A 4XB2A 1BTOA 4OHMA 1NDQA 2ASEA 1D2MA 1EBFA 1NONA 1RW4A 1P44A 5ALWA 4CODB 2OZEA 5IF9A 1COWA 2QQ0A 3MWEA 4NDZA 3DOUA 4AMZA 3ZXXA 3WLHA 3KQUA 1FU7A 1BHSA 4PZZA 5BYJA 4CJXA 1UEXC 3AOEC 4IZIA 5EPUA 2OV8A 1PTJC 4QHSA 2XB6A 3M5PA 5F12A 1PFUA 3ZTYA 4AL4A 3M82A 2Q4DA 3WTBA 3P2YA 1HM5A 1A7KA 1G2OA 1O2DA 1Z35A 6YASA 2QVLA 7ADHA 3VR6A 1HYBA 3LRXA 2IWRA 2OXFA 3I61A 4DG5A 2NSDA 3L8DA 2I6SA 3SJZA 4YRCA 2GBLA 4B7XA 4YUWA 2V7UA 2OC4A 3ABIA 4ZI3A 3BHJA 4ZOLA 2M6LA 4M60A 5K0LA 3AOGA 1S96A 4TXMA 2Z2XA 5T6MA 4JSTA 3SHOA 4YMLA 2FJUA 3EY9A 2BGIA 2J3LA 2V9CA 3INYA 4AS1A 3V1YA 4ARZA 1TZMA 4X24A 4UQOA 1FNDA 4XFKA 3JYPA 3JQFC 3PUJA 5K6TA 1IDN1 5F33A 2J9YB 3K2IA 5EZYA 3AZPA 4BFZA 2I55A 1LLDA 2I2BA 2O14A 3CLVA 4C5CA 4G37A 1WOMA 1JTEA 1QANA 3NUZA 4C78A 4C7OB 3LXMA 3QXJA 3R0IA 4HWGA 4QNMA 4QPZA 2G9NA 3OG9A 2J9GA 4WCDA 2MU1A 2XE7A 3PTLA 1D2NA 2FJPA 1T2FA 2NVUB 2IYOA 5BVGA 3FAZA 2OORC 5AI4A 2KJQA 4MITA 4ZYWA 2QLMA 5LLDA 4OH1A 4OEHA 4C7VA 5J4KA 2IFTA 2HF9A 2XUOA 3IV6A 2P9TA 3CEPB 5FF9A 3HXKA 4RV9A 5L4NA 5B36A 2N3ZA 1VJCA 3VNBA 3V3TA 1FSSA 1LBTA 1V8OA 1ZRSA 1QDLB 3ONVA 4HJXA 4M3NA 3DYIA 3KPJA 4A91A 1HLPA 2GVDC 4PLTA 4KH1A 2G83A 4GPEA 2BI7A 2WJVA 1DPFA 1II8B 1TL7C 1E1QA 2BP7B 1XCPA 2CLOB 2VPZA 4YHHB 1YTUA 2YQ5A 4NMLA 3BL5A 3BRWD 3VTAA 1BGXT 4ZCLA 5TLSA 1EG2A 4L5JA 1BZYA 2W4MA 1SCQA 1ADYA 3NHZA 2BFBB 3OPNA 4E70A 3CGWA 2J1LA 5JVDA 1QZUA 4WFQA 5ALEA 2D8MA 1BXRA 5I8ZA 4BAGA 1E3LA 4M8SA 5JRDS 1DCTA 4NBNA 4H6XA 3L1IA 4Z3OA 1X8KA 1P6XA 1U2PA 1WRBA 4B8ZA 2DB3A 4BVLA 821PA 1FFHA 1Z6YA 2JFHA 3H19A 3ZZUA 3TEFA 3OPMA 5MN4A 3RHZA 1OHHA 1DE0A 1E1RD 3KB6A 5JCOC 1J23A 1FX0A 1X7ZB 1R0ZA 2PH5A 3NQ41 4ZHSA 1PGJA 3PQ5A 3WK7A 3N6VA 1JFLA 3RRYA 2C3YA 1QP7A 1GGVA 1NR7A 4ZI2A 4V38A 3O7MA 1SD5A 1JKMA 5KYGA 1OXXK 3O3CA 4DR1B 4O0LA 2ZJ6A 4F3KA 1SQFA 4LF5B 2P9QA 4J1SA 5GP1A 3GCDA 2DULA 2PXCA 4MQFA 3T38A 3QVTA 1TJ4A 1NVGA 3UTCA 1Z28A 1V35A 1RKQA 3NRBA 2WE8A 1JILA 2R6CA 2WJHA 3ETLA 3Q3VA 2SCUA 4L0CA 1MRSA 3FNEA 3LE8A 1MXFA 2EW1A 5CMLA 4HZGA 4P5EA 4O2AF 4UVHA 1RQRA 5JDCC 2F3PA 3TTVA 1RWOA 1H66A 3OE1A 4WWHA 3MINB 4TVKA 4XE5A 3JPWA 4DSTA 2HRCA 5HZKA 5I7SA 4NZ9A 5C9ZA 1CQPA 4KX5A 5DTIA 3U3XA 4G4GA 1DEXA 1N8NA 3CF4A 2C54A 1WCXA 2PQ6A 3FDJA 1DG9A 3TNLA 2FFJA 3ZDXB 1I7PA 5DX8A 4C01A 3ESZA 5KVSA 2ZE6A 1QRTA 2QN9A 3BIXA 3PPXA 5LOVB 1THMA 5IAEA 3D4IA 3V4OA 1ZRNA 3ZCQA 1MA3A 2FZVA 1KIMA 2NO7A 1AKMA 4KWHA 1H0SA 1KR5A 4RD2A 3EGDA 3INNA 3W5IA 2ZYAA 1GG9A 2TMDA 2DPMA 5I4IA 1N6PA 3NBQA 2DBYA 4MGYR 2Y0PA 4MR8A 3LAWA 2J9RA 1U1DA 4IHAA 1E2IA 2RK4A 4Z9YA 5EJMA 3F7MA 1C7JA 4ZZ0A 2J0SA 2JW5A 2R4TA 3U7IA 1TKRA 3HWX1 3ZY6A 2NT4A 2ZBFA 1V8BA 1N0UA 3D7NA 1AKRA 3FRHA 4L4XA 4LTMA 2QWXA 1WSWA 5EJIA 1HYEA 4B3XA 2BHRA 3ZWKA 5K3AA 2V98A 2I1LA 2OQRA 1GNTA 1QMPA 3GGSA 3WQRA 3I9MA 1O03A 1QCYA 3G2KA 2BJHA 3IEXA 1EZZA 4LGCA 1I9GA 1YMUA 2ZSDA 3KJIA 1T13A 1QX4A 1U6IA 5FD8A 3IE1A 2B1JA 2P6PA 2UZ3A 3PCRB 3RVOA 3K73O 3WKEA 4GYYA 3WKDA 2OM2A 3MIIA 4BLPA 3QTBA 5AI8A 1J2EA 3EUFA 3B89A 3IVMA 4FYIA 5A9RA 4LJKA 3HJUA 4BVHA 3P2KA 3HCCA 1VFPA 1WV1A 4OXXA 2XWQA 3DCJA 1AF7A 4Q03A 4YRIA 1V6AA 1P1RA 3R3SA 4GKKB 1ZUWA 621PA 3ABSB 3B6MA 1JG1A 3BQMB 1ICIA 3LA6A 1YZNA 3B52X 4CKYA 1JIJA 2DHRA 2EQAA 4WNAB 4JFRA 3L77A 1M34E 1WPGA 3L1JA 3LIPA 4KRYA 1UM9B 4Y0AA 2WYVA 4B6QA 3CNOA 2W98A 3DLTA 4GI5A 4QWWA 1K0UA 3OZBA 1L7EA 2JI8A 3Q0TA 4BMYA 1G19A 1EB9A 1QR6A 3MYYA 1RAFA 2EFJA 1AKQA 3H8SA 3HNRA 4LJ8A 2JLUA 5CTAA 2FDCA 4HGZA 2H4XA 3DYVA 2ZSKA 3ICOA 3I32A 2FNAA 3LCCA 2IZ5A 3PEVA 4IDQA 2YICA 4RFLA 4TYMA 1GPWB 2QT0A 4U3JA 1UJCA 1Z8DA 1EA5A 2C8LA 4PWYA 4CLXA 1CUAA 5IT5A 1GTMA 4Q39A 3N2NA 1N6OA 4RANA 2VWHA 5DNDA 2VJMA 4F1WA 4JOBA 4TL8A 2H2HA 4KPUB 2HWXA 4NOLA 1N5OX 1QYIA 2YZGA 1GUAA 3DDSA 3LQ2A 1H22A 5EVCA 5HW0A 3O0TA 3UYKA 2ZR7A 1MF7A 2AN1A 2Y0EA 3FYTA 2AJ8A 5LYJB 2ANBA 1E59A 4BJ6A 1UM8A 4J76A 2QRNA 4HR7A 5G1PA 4EZIA 1P8AA 4E1BA 1LD3A 4NLLA 3Q2IA 1RWQA 1WD7A 1QIFA 4CM4A 2QTCA 1N5IA 1UZLA 1GO2A 1VL0A 1VJ5A 3AEXA 3IVRA 3LCJA 3MLBA 3O8LA 2BN4A 3RRZA 2MSWA 4C04A 2Z57A 1HYHA 1VMAA 1Z4NA 1ZN9A 3H84A 3ZE9A 4NF2A 2QMOA 1I8TA 2GASA 4MP3A 2JAOA 1WQ4A 1MR3F 2XT6A 3E23A 3EDMA 4HFMA 4RY2A 4BWGA 5G0WA 2UDPA 1GSIA 2OZVA 5KYTA 1P62B 3D7KA 4BO6A 2JLXA 3M5CA 1RXCA 1YCHA 4KSBA 4TT8A 4G63A 3S44A 3W8DA 5KB3A 4TQ9A 2X1MA 2IW1A 4N65A 2EX1A 4LJAA 5FWYB 2QN6A 4I1UA 4N3GA 4BC0A 1P4SA 1QVRA 3BTUA 4BVFA 1DCKA 4DCVA 1C8LA 5E3HA 3KEFA 3PWZA 1ADGA 2W6ID 3MGBA 2DPLA 4PRKA 5CIYA 3AWIA 5J47A 5GTDA 3DBIA 2Q46A 1S0UA 4JP2A 3T4XA 1THZA 1ZCBA 3BQ9A 1F0PA 4PAGA 4B7ZA 3IHLA 4UJ5A 3VR5H 1DV2A 2E87A 2O3QA 3AETB 4XQGA 1GU1A 3AXSA 2H7YA 2IEIA 2O7RA 3KQPA 4UE2A 5FR2A 2GFHA 1WSBA 2UU9B 3OE4A 4K6HA 1ESZA 4M2LA 2GJAA 4GLJA 2H1VA 1BXRB 1CT9A 4IDPA 3JQAA 4L7VA 2VKQA 4LYFA 2JJ1D 4BLUA 1V4BA 5KJ1A 2Q1SA 3B2EA 3EIWA 4UAJA 3FOFC 1Q11A 4RIGA 4BMZA 2EWVA 4JEMA 4AB1A 3CKYA 5AKXA 3LFUA 1X8XA 3BWMA 3HKEA 2CUTA 2ZWVA 4UM5A 5H83A 2VQDA 3FXAA 4Y1EA 5LUBA 1PEAA 2P35A 3U81A 1U2TA 2IYRA 1GQQA 1KSFX 2NG1A 2PV0A 4YNBA 1A9OA 5EINA 5AXBA 3TCNA 5AVOA 3PWTA 3NT2A 2PUEA 4MQLA 2HH9A 3I4LA 4FFDA 3UK6A 5KNDA 2XADA 1Z6ZA 1ZMRA 1PT7A 1NE2A 3IUYA 3NKFA 4CF6A 4UOZA 4J0CA 3EPLA 4DUYB 1N7JA 2ZSJA 4F60A 4WGFA 2CD7A 3MWFA 4RD0A 3C3MA 5BO5A 2ETXA 4JLJA 3IP7A 4IIUA 3F4KA 1YC2A 2E4VA 1KMIY 3AVQA 3OJOA 2NYVA 5BV8A 4HPJB 4JX8A 1FJHA 4XI9A 4AMUA 4TXHA 5FADA 4O3FA 4HRYA 5F51A 2CEKA 1VKNA 2FMFA 2C8KA 4XYEA 4NH4A 1EJBA 1CY0A 1L4UA 2WG1A 4GVPA 2AUTA 2EZ9A 4IIJA 1NW8A 5AUNB 3A6EA 3C6QA 1AO0A 3ZHUA 5JH7B 3ASZA 3BB4A 3UMRA 2GK6A 3KJHA 1IY2A 2QDXA 4YECA 1E5QA 5FA5A 2V6IA 3K7EA 4U5XA 4ARIA 3KVRA 4TLLB 1LBEA 1E0SA 2P78A 2F3UA 1RJWA 5G1NA 3H5LA 4JB8A 4BAUA 1XN1A 3D5EA 2OBYA 4BNKA 4TRRA 3E8MA 3B5EA 1Q57A 1A3CA 2PUWA 4XEHA 5DO9A 2GJ9A 4L15A 1R4AA 4DG8A 5IAAA 3PSHA 3HDQA 4WY8A 3VU1A 3RVLA 1YVPA 3IURA 2I6XA 1Q0RA 1MXHA 2CFIA 3LQYA 4MR8B 3W2IA 4OQQA 5G4KA 5BWNA 4Q4JA 1U7HA 1I3LA 1Z5VA 2ZI9A 3H3JA 4MJLA 2CWDA 5CJ2A 2PS0A 3PWKA 1ORTA 3ZGVA 5KJFA 3UCEA 2X6RA 4JJ8A 4CM8B 5GONB 5J23A 3G8AA 5DZSA 1JKXA 3DONA 4QXRA 3E9RA 3GAAA 2IX3A 1MDFA 4M8IA 1Q0TA 5GIOE 2JGLA 4K9MA 3E9MA 1YR7A 2X1VA 1E4YA 2AYYA 2CSUA 2V74B 3NTUA 5DWDA 4BATA 1YAJA 3JVUA 5DCWA 2WSSD 2H57A 3FNRA 2WEKA 4Q9KA 1ONSA 4YJHA 1LDYA 1EFVA 1KJJA 1P7PA 2R1UA 4EWLA 5U9CA 1FVOA 4GM1A 2Q6IA 4AT1A 2EYQA 4EB6B 1E1YA 5CUQA 3KPYA 3ELBA 2ZT5A 3F46A 5KQRA 1G1AA 1R64A 4B9AA 2FDXA 4IRXA 5MFPA 1MQSA 3DXXA 4JYCA 1NVWQ 1PG0A 3FUTA 1QVWA 4JR0A 3T9FA 4UM9D 2Y67A 2BSXA 3ITEA 4EG0A 2II6A 3OLWA 2ONJA 2DQKA 1E1NA 4I55F 4M1YA 3ZIDA 1N9KA 1QUEA 2FSSA 4UPEA 5FWXB 1A1VA 4S1PA 4NS4A 3ZUGA 1NJ8A 2GF9A 3CLUD 5FA6A 1TKCA 4GU5A 3HCFA 4GSLA 4I1RA 1ZVVA 3W5CA 4AJ4A 5BWLA 3PQ6A 2WE7A 2PH1A 4J0GA 3ZWWA 1IEQA 3W6OA 2HOQA 1MTOA 3CKMA 3PNKA 5JYCA 4DM3A 3V2GA 4CMBA 1BXKA 2O7SA 1Q12A 1QTQA 1IAVA 1JFTA 4I1PA 2N9UA 4TMWA 1BWPA 2CXRA 5AMXA 3HJFA 4KQFA 2WZBA 3IERA 2GKSA 2QLBA 1NXTA 1P4JA 1DADA 1RQXA 2GR9A 2JIZA 3W3AA 4IJ6A 4YO7A 2OZLA 3SQLA 2YBDA 1WZNA 5A3VA 4XWGA 4BGUA 1P2SA 4UREA 5ALLA 2EYUA 5J2UF 1CUIA 3RYCB 4FBGA 4ARAA 3SEFA 3MRXA 1MO5A 2FPPB 5FPYA 4DNPA 4BNFA 5AW8A 2XLCA 3HFRA 1O96B 3IGFA 1KZYC 3EISA 3UHOA 4UE6A 4K5QA 2DQ4A 1QDEA 4DWWA 1RRMA 1MX1A 3GJ7A 3NC4A 1O77A 2HA0A 3PNQA 1IJKA 4FLMA 4B09A 2X4DA 4CKBB 4IVNA 1ZAKA 2XNHA 2XT9A 1AS0A 1HRDA 2YZKA 3E18A 4UEOA 2PQ2A 1IUPA 3CKKA 4BO3A 3RDPA 2RC5A 3N2GB 4Y6LA 2GJ4A 3DZBA 4RGQA 3HLKA 3ONWA 1ZG3A 1T3LA 1IUNA 1KEVA 3NASA 1GLVA 3PSAA 5FBLB 3EFOB 3PYMA 1AKEA 2HC9A 1T0JB 3ZE6A 2NSLA 3AY0A 3I2FA 2HI0A 2O8EA 4OLAA 3PIDA 1W2WB 3AF1A 3KDSE 4GKBA 4DABA 2GCEA 4L4RA 3DHWC 3WGMA 2QP9X 4M0FA 3NX4A 4CCYA 4PFKA 2GA8A 3GFPA 4F96A 2YFQA 3NNSA 4G5SA 3CVUA 2HHHB 4KFCA 1JJ7A 1QHNA 4D8YA 1Y3BE 3ICVA 4YRKA 3N0WA 1J9ZA 1OXKB 3V8NA 3ZNPA 1MT3A 5EOVA 4R7GA 1Q5PA 2RKWA 1YUMA 3L4SO 2LNDA 3CVOA 3LLVA 1ISRA 1VBKA 2CGEA 3OPYA 4KU4A 4D9CA 1GNRA 2G1AA 3VQTA 4OXQA 1XXLA 1DEOA 4LXUA 1IVNA 5FUVA 3DCIA 2HTEA 2I33A 5K7SA 1YONA 1H2YA 4NU0A 5GJWC 3G0CA 3E05A 2HDOA 1P17A 4I7EA 4LNAA 5EA2A 2VBIA 5AM0A 2RFLA 1M75A 3SYLA 2Z6VA 4FB5A 4QO8A 1C30A 2OAEA 4I2NA 4QLBA 3R7LA 3O1LA 2PPVA 4N0MA 1Z0KA 1K27A 1HG0A 3L8FA 3QE3A 4MJ7A 4XA8A 3NLLA 3EXEA 5AOCA 3L1UA 3KYJB 2EKPA 3P4YA 1U6KA 3BXHA 5H16A 4KWEA 3Q4GA 1BRTA 1XIVA 2ERCA 4PTZA 1U63A 2W37A 1UT5A 2C88A 2GZAA 2RK3A 3N8IA 4HEJA 1X1QA 2CVQA 4PX5A 1UUFA 3AY7A 3RAJA 1SNYA 2JJ8A 3TX2A 2XQFA 5F1OA 5AUPB 1SEPA 3I8OA 3LHFA 3HY6A 2H2GA 1BG6A 4FFWA 4IIJB 5F78A 2QV0A 1UBHS 3K0CC 2Q50A 4DV0B 2CV0A 4Y2XA 3HR7A 1QO7A 1U5BB 4UULA 5T4HA 2ATXA 5LXTB 1UBKS 2IY7A 4S1TA 4BZZA 3PP8A 4BRSA 1YE5A 3QIVA 3TD9A 1F8GA 1P3Y1 1OXSC 5BSHA 3RRMA 3WB2A 3JAWB 2OXIA 3VR2D 1KJWA 1SZPA 4PNHA 2ERYA 2HFKA 3CH6A 5B1SA 5TSDA 3E9DA 2OBMA 4X63A 4KZKA 1AX9A 1YRHA 3GDHA 1ADFA 3C2QA 4K28A 1Z45A 2VQSA 3F9CA 5G3ZA 4DGQA 4RTNA 4ADSG 3EEOA 4IIEA 5HMLA 5T8KA 1KDZA 4AMBA 1XQ9A 1RYDA 3L7MA 4M0LA 3ZW8A 1JG4A 2BAGA 2FGKA 2OSVA 2P69A 3CWZA 3A1CA 5EQTA 4TYNA 3L6DA 4MDHA 4R2KA 5GV7A 4ZZ3A 4PICA 1X77A 3HPRA 3GUUA 4QRIA 5MGBA 3L92A 3AHFA 3WL3A 4IINA 4US0R 3DR3A 5JCJD 4G2TA 2H4WA 4NDAA 1KI7A 2FN9A 6LDHA 1KI3A 3OTQA 4HX9A 3LKVA 3SIPA 3CIOA 1GPBA 3BEOA 2ZGVA 4ZVMA 4EYGA 4DF3A 4DLYA 2D54A 3T06B 3C98A 3AEKA 1UBRS 4FR0A 1AHPA 1RPAA 2JCBA 4HPXB 4DWOA 3MC1A 4PR3A 2QX9A 1E4OA 4DS3A 1QIJA 3KTDA 2DPXA 4DADA 2CUKA 2QM3A 1B6GA 3AF4A 2AEMA 3O2QB 1PSDA 1AGYA 3R6DA 1T3ZA 4K03A 4MIYA 2GFIA 1U7PA 4XGKA 5JXHA 4EKEA 5JHGB 3ANMA 3BCHA 4Y9DA 3NBZC 4J3NA 1ZJWA 2IUFA 1NFRA 4BQNA 3IAHA 3ICPA 4S12A 3ONFA 2OPBA 1T9CA 2V7VA 3S29A 5KWVA 2O2YA 1MP0A 2C95A 1HX7A 2AKEA 2HJWA 2VS1A 3AY6A 5AHKA 3HBFA 3QU9A 3Q8XB 1D04A 4EQ6B 2BFFB 3F67A 4GRAA 4G36A 1U3GA 3KVNA 3P8ZA 1JPJA 2QTAA 3F98A 4IOKA 3LYUA 3ZIUA 3EDOA 5FIUA 2HW8A 2FEPA 1HDIA 1TK2A 4LRYA 4MYRA 3A32A 4Q19A 3BK1A 2EARA 4M7RA 1G55A 1UKBA 4QELA 5B58C 2V6BA 1NJ5A 2V7TA 4BYGA 5EWJA 4EGSA 3VISA 1NBEA 3E70C 1NVFA 4YWHA 2JLVA 1N57A 1TOAA 2E1PA 3BMXA 2GPWA 5LKAA 1OZ0A 4G5XA 3UK7A 1BS2A 3MRSA 1QORA 2VDOB 2WF5A 4LZLA 4MRVA 5EPOA 5HP4A 4O4IA 3WBJA 3R7BA 3DE0X 3S1AA 1XTVA 2WM2A 2W8ZA 2XF8A 5EHNA 2CY0A 1XPUA 2I62A 2I3DA 1SCAA 3S2IA 3SKYA 3U7FB 1F6DA 5EG5A 4KXYA 4FYXA 5CVDA 4BVGA 4EVRA 5KOIA 4M4SA 1HDCA 4EA6A 4EYSA 1SOVA 1NQOA 4RCYA 4EGAA 1JI3A 1N3LA 2GBCA 2J3JA 4EY4A 3V46A 5KPDA 1E4EB 1HL7A 3UXHA 4NCJA 4UBKA 2X14A 3D0KA 4R2LA 4KHPB 2AEEA 2MYTA 2Z58A 5LP1A 4V0MA 3H5TA 2NUBA 3OIFA 4EB0A 4HNTA 2YY5A 4DLTA 3QKIA 1VHLA 2RG1A 2R5NA 4TV9B 4YRRA 4D46A 1GU7A 4R54A 3K0SA 2XUFA 1V37A 3FCEA 3RSSA 4QOEA 1IULA 3EIXA 5A05A 4AG3A 4BWYA 1EX1A 4H1WA 1M2OA 1PK8A 3R9XA 3GFGA 3MHPA 5KSOA 3CS3A 2YJTD 1D1TA 4QJ5A 4NOMA 2D6FA 1DQPA 2ZB4A 2O8EB 1CG6A 4HN9A 2B6HA 2ZIWB 4G0MA 2AIRA 1WP9A 3LI2A 4LF4B 4UUAA 1ZX1A 2A5JA 3MT0A 3EMBA 2DFDA 4CCYB 1HFJA 1KXZA 2YV3A 4BU1A 3THYB 1ZMXA 1WDLA 3DKVA 4BE7B 4PN7A 2VQ6A 2HJVA 3JQ8A 4CLHA 2YQ4A 3HB5X 3PDUA 2BFAA 4U2KA 5EZ6B 1SKBA 3HWSA 4OSEA 4EO7A 1ML4A 1SUAA 3OX4A 1K7EB 1EHIA 5FUBA 7MDHA 3U7QA 1GPUA 2AHOA 1Q0QA 3H5AA 4YUZA 5BXYA 5JYEA 3G17A 3V8PA 2ISQA 4DGSA 1Y3IA 3GLFB 2CLLB 2JEOA 3BTSA 4D3ZA 3IEIA 4BJ5A 2R4UA 1H9BA 1XFAA 3MWJA 2VSQA 2VTDA 3A1VA 4FOSA 5DN9A 3WRVA 5CLHA 2FQYA 1MENA 1QFMA 3TQIA 4HAZA 4RK5A 1Z0DA 1P2GA 3S1SA 4R0NA 3GMIA 1U4OA 3FPGA 2Q3JA 1CUUA 5FQNA 3RS0A 1RCTE 1C0PA 4RVSA 3WMFA 4BNWA 1WR8A 4UUOA 4E4TA 4E7OA 4URXR 2YRXA 3TF5A 3HN2A 5E1MA 1QP8A 1J2RA 5A3JA 4I9NA 2GTIA 1OB5A 4KN9S 4R7ZA 2DUNA 2FX5A 3AJAA 5ETJA 1T15A 2QMEA 3GFQA 3SJBA 3NTLA 1OT5A 2OYRA 1GQOA 2QPOA 3V32A 5C7IO 4EZBA 3H0KA 5B7GA 2VUIB 2DWQA 2F4NA 4DV3B 4DIDA 4OHXA 1DXHA 1FFDA 1LZLA 4PBTA 4JBLA 1SKYE 4EHDA 4RFVA 1UP6A 1Z8NA 2WUWE 1RTKA 3AH8A 3RTDA 3BMCA 1J39A 4CMHA 1DINA 2TECE 3T7DA 2R96A 3D0QA 4OXNA 2AFVA 1HOTA 1K75A 1LPSA 2J6HA 2V55B 4X84A 3SS7X 1AOXA 1QO0A 2GYYA 3DDOA 3RH0A 1S2MA 2KBEA 4D4GA 3LHIA 3MCWA 5DRTA 5JW6A 3CCBA 2Q3EA 4ZZIA 4HY3A 1TFRA 3KJZA 4ZT6A 4JI5B 2CXOA 4K40A 4EHKA 1MG0A 2ILTA 4PLPA 3QRWA 2O8CB 2GRUA 4YR7A 2IHYA 3QE0A 3N58A 1DAMA 2ZR9A 3WK9A 3ASVA 3SI7A 2YS7A 1N33B 2XGJA 1MPXA 4FKZA 2WWGA 3MXTA 3HO8A 4I19A 3RSCA 4K6MA 1YJAA 2R3SA 2G0NA 2D0IA 4JDUA 4QG3A 3K5PA 3GG9A 4YJKA 4NK5A 3OZSA 3WMEA 4DMCA 4N6OA 3VGJA 2XY4A 2GBPA 3R0XA 2IRWA 2D7CA 1YKGA 1JLKA 1SVOA 2ZROA 4H7PA 4MW2A 1J9EA 1W34A 2CBGA 2ZIFA 3FJOA 2JHPA 3DQQA 1UXIA 2VF2A 3AEZA 4LDQA 3S2GA 2F59A 3BMOB 3R3WA 1F2UA 2PYZA 1ULSA 4XIIA 2OZKA 3DVRX 1GILA 3JWJA 5TS2A 3RUAA 2TRSB 4DXDA 1C8KA 3RB8A 1DTEA 4IICA 1KERA 2FMHA 4MYHA 2WVJA 2Z0MA 5FPSA 4AWXA 1TAGA 5K8CA 1RFLA 4FI3C 1VE9A 2H00A 1P18A 3F6RA 1XAHA 1FS6A 1CP2A 3KR1A 5JWHA 5ICCA 4KE8A 1FJXA 3ZJUA 3UK2A 4TTTS 3N6XA 1H1LB 3OEEA 1T36A 4QOSA 1KP3A 1E9AA 1T1JA 1XJ5A 3CLRD 4X95A 4HAOA 4GUDA 4L2IB 4LDAA 3OMXA 3QX9A 1S8OA 2W2VA 3WTCA 1YDGA 3IP6A 3F49S 1QFYA 5HR5A 2GDJA 1JHOA 2OR3A 1D1SA 4F0JA 2OP0A 4E09A 1QKJA 1SRQA 1KVRA 4Z3DA 5IXSA 2XKJE 1WPQA 4DDKA 3FM9A 1Y4SA 3TM5A 6PFKA 3QZUA 4CLRA 3RPEA 4RVFA 3LU1A 2WOJA 2R8BA 4OV6B 5E6SA 4BFSA 5EWJB 3EGIA 5A4IS 3J80A 4MVWA 1NAHA 4IUDS 4AX4A 3A9TA 2AI2A 1D0VA 1FFSA 1S6YA 2PANA 2J08A 2R6DA 1G16A 4YP5A 1GARA 5CH5A 2RHGB 3CLTD 3ZK9A 4BFLA 4UBJA 5ALYA 1M1YA 4DA4A 1JQKA 1E9FA 5JAPA 1QK3A 4AN1A 3OF3A 3BK2A 4HAYA 2BJVA 2X9GA 4ITRC 4GVXA 1DEKA 1QQ7A 1MIHA 2PX5A 3BH0A 3R5HA 4BZPA 3PQFA 1JG7A 3HKBA 3NBYC 5FDFA 4QXMA 5JNRA 4KQ2A 4B3DA 2BVNA 3QY9A 1PK7A 1G1MA 4DC0A 4RPIA 4BMNA 1CSEE 2VPQA 3HYRA 3G2JA 2C4TA 1GYRA 2OXEA 1NMEA 4HXGA 1M2FA 2BFPA 1EM8A 3LWZA 1RKBA 3G0BA 1TUIA 4IGEA 2OKGA 4XJVA 2M98A 4MWGA 2BYTA 4QUHA 2C1XA 1GRNA 3R7SA 1SC4A 1A2QA 2WWTA 3TRIA 3VVLA 4AZSA 1R5BA 1G4UR 1D1PA 4LE0A 1CFZA 4V0NA 4EEKA 1CYEA 5CNKA 4P4GA 2MTBA 2QR5A 4FBLA 1SIWA 3B3JA 1ZXBA 3G0OA 2YYSA 3QBJA 4CKEA 2H2IA 1RPNA 1A4XA 2QPAA 3Q3GE 1FFAA 2E4AA 2J7KA 2WZCA 3Q10A 4LF9B 3JQ8B 4FKMA 4V24A 1JR6A 4GBJA 1RHRA 1PJBA 4H4EA 4ND1A 5EIBD 1DLIA 4RZUA 2ZB2A 5IZCA 3SLGA 5I7OA 5IM4A 1R4MB 2GN8A 1ZNQO 2R1VB 1XMOB 3U7QB 3C8MA 1CR6A 2H16A 2REBA 2GJSA 1XQXA 1YBHA 4ZO6A 5LL6P 1V7PC 4UTOA 4Y2UA 3ZDQA 3ZDCA 1ZA2A 3HCEA 1I24A 3OKFA 2FA9A 5ECWA 1D3AA 5SZJA 3VKVA 3IB3A 2GHQA 4BCDA 3LCRA 1B00A 2DH5A 2FSUA 2Q62A 3W5SA 1H2BA 4OJYA 2ZFUA 1BVYF 1CRWG 2FRXA 4Q00A 1PX2A 1JHVA 3TD2A 3WZLA 1WQ1R 4F5ZA 4RZSA 2FR8A 5BT9A 3NWPA 2C4VA 3PLRA 1XK6A 5E9WA 3NGXA 5D85A 2HBQA 4L08A 4UEWA 1IJBA 3AVVA 2UZIR 2R9VA 4CM7A 4JB2A 1HPLA 3BWCA 1JAIA 3HACA 3PNVA 4J1QA 3TRKA 4BJHB 1W6RA 3F9RA 1M0EA 3A2KA 5B2ZA 5L3QB 1HY3A 3A6KA 1M1NA 3E03A 1DUVG 4NV0A 4TMVA 1EJ6A 3GEMA 1N5KA 1TNDA 4LBWA 5J4HA 3AEQA 4BUZA 3GLQA 3V8BA 5IKPA 1EXDA 1PFYA 2WD9A 2NP6A 2GERA 3C4QA 1T5DX 3FTCA 4AJNA 2Z1DA 1ISHA 5CIWA 2ZRPA 5A71A 3WIEA 5K0FA 4FE4A 3U40A 3BMCB 3FZYA 1EFTA 4ROTA 1P0MA 1SVSA 4B82A 3CNEA 2POCA 3PG5A 3ZGOA 2QMHA 3LUGA 4N01A 2ZRBA 3KXKA 3LBFA 1FBNA 2F3RA 2BH9A 2V7XA 2HQOA 3C5WP 4G09A 4M9ZA 1KHTA 4DR4B 3HV0A 1DIGA 4D9EA 1LW6E 2YWFA 3COJA 3DDWA 3LSTA 1B76A 1HTWA 2XBLA 1YA6A 2YNMA 3FTPA 1H2AS 1A8PA 3KX2A 2FSGA 4JJFA 4XXHA 1MEEA 3UT5A 4B44A 2ZXUA 5U4QA 2COEA 2D7JA 2ZS9A 3DE5X 5J3JA 1IUKA 1YI1A 4C4RA 1P1BA 1W59A 2RHOA 1NLMA 3EOZA 4JH0A 5EKTA 2C1ZA 5HQ3B 1PF7E 3F0TA 1IL0A 1E61A 1Y89A 4N40A 3OEHA 1LQ2A 4HX5A 4IIXA 3RK4A 4PYKA 1ZH8A 3JY6A 1KETA 5LQNA 4GQAA 1KFCB 4O4HB 4C5AA 4HVCA 2O2DA 3RS9A 1HGXA 1VG1A 4W7SA 2L69A 4OBWA 3DL0A 1WXHA 5HCNA 3UM9A 5DP1A 1VGQA 4QXQA 4FHGA 5EERA 3P52A 4UFPA 2ZYVX 1VHQA 1ZCFA 5YASA 4CIYA 1C1HA 1OBFO 2Q4OA 4RENA 1P74A 1Q22A 3DDUA 2E37A 4XIGS 3WP1B 2YUIA 4TT3D 2QRZA 4P4LA 1W47A 1JGTA 3MBIA 4PNPA 2EIXA 1E7SA 2FOIA 1IBMB 4I4TF 1ODIA 1I7SB 5CLQA 1MW8X 1GV1A 1R88A 5ERGB 2J85A 2Q9AA 1PSWA 3NDIA 1OMOA 3Q6NA 4IWNA 3ODPA 3QU7A 1GZ3A 1EDEA 3AM4A 4XQCA 3ETEA 1GM5A 3B1XA 4JNCA 1SU4A 3GB9A 3O91A 1E2QA 5KC9A 2QTGA 4FDMA 3M9LA 4ND3A 1R9JA 3PD1A 2VDWA 3PFGA 1T36B 4P83A 1JAHA 3DBOB 1U94A 1NN0A 3NMUF 4KLRA 3D0OA 3DAYA 4HF7A 4M98A 4JYZA 1ESDA 3G0IA 3ORQA 3QV1A 1DOAA 1JJFA 1SELA 5K3SA 3TLJA 5JLAA 3ZBPA 4D4LA 3BCUA 3AUSA 1DO8A 1E5VA 1N0HA 3BILA 3NXSA 5ECGC 4EEXA 2FZGA 1RYFA 3GT7A 3WNVA 3LTNC 2ZYHA 1G9XA 3W1EA 1JE1A 1KEWA 1Q7CA 4Q48A 4RY8A 3ZU6A 1M8KA 2RSLA 2C7BA 2ZB8A 2PWYA 3MTIA 3EZ2A 2NNLD 1YUNA 3LLSA 3UN1A 4CLRB 5J2TA 4KN6A 4DMRA 4CLDA 4UJ3A 5K9ZA 1ZQ1A 2QP4A 1CUSA 4BNDB 1JR2A 4RVCA 2NU9B 4EHLA 3CT4A 2A5LA 2ZRFA 4EOGA 3L6EA 2HLDA 4W5WA 4IV0A 5AXCA 4D98A 5BVHB 1V7CA 5LQJA 3H42B 4QYTA 2EGHA 4UXIA 7YASA 4OHVA 3WDMA 4CDGA 1CQIA 1PR0A 1M1YB 3QXXA 1LKZA 2NQ8A 4FMCF 4HXEB 3CCCA 1EVEA 1Q0LA 3L9WA 4TLCA 3W5BA 1O3YA 3R5XA 1QRUA 4A36A 1KRWA 4N12A 4PZLA 3EEYA 3QENA 2IDMA 4X45A 4DA9A 5FLYA 2ON6A 1CFJA 1WA5A 2W2LD 1TD1A 3BORA 3CM0A 4RZQA 4XWYA 2Z56A 4XW2A 3H16A 1JHPA 4Z0NA 4IF4A 2V45A 1QC5A 3KOOA 2KHZA 1JE0A 3JQ7B 1NF9A 5IYZA 5KWSA 1DWOA