3EMVA

Crystal structure of plasmodium vivax pnp with sulphate
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
246
structure length
246
Chain Sequence
MEGEMQRHIKLTKAQTTPVVLVVGDPGRVDKVKVLCDSYVDLAYNREYKSVECTYKGQKFLCVSHGVGSAGCAICFEELMNNGAKVIIRAGSCGSLQPTQMKRGDICICNAAVREDRVSHLMIYSDFPAVADYEVYATLNQVAEELKVPVFNGISLSSDMYYPHKIIPTRLEDYSKANVAVVEMEVATLMVMGTLRKVKTGGIFIVDGCPLKWDEGDFDNNLVPERLENMIKISLETCARLAKKYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conservation of structure and activity in Plasmodium purine nucleoside phosphorylases
pubmed doi rcsb
source organism Plasmodium vivax
molecule tags Transferase
molecule keywords Uridine phosphorylase, putative
total genus 85
structure length 246
sequence length 246
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2008-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3emvA01
4QATA 1V3QE 3OZBA 1G2OA 1V2HE 1OTXA 1PWYE 2HSWA 3BL6A 1ZOSA 1Z39A 4TTAA 1A9OA 2OECA 4TXHA 1Z37A 5B7PA 1QE5A 4WKNA 1Y6RA 3FWPA 3E9ZA 1PR2A 1A9PA 3SCZA 3ONVA 5IU6A 2OC9A 4LKRA 3OPVA 1LVUA 4OJTA 1RYZA 4LDNA 4TS9A 1SQ6A 3KVVA 3FB1A 1XE3A 4JP5A 4I2VA 2BSXA 1RR6A 4F3CA 4D98A 4LNHA 5F7XA 3OZDA 4GKAA 4LNAA 5C80A 3NM4A 4TTJA 1YQQA 1U1CA 4TTIA 1JE0A 1U1GA 3K8OE 4X24A 2Q7OE 3LA8A 1Y1TA 1ZL2A 3D1VA 4OGKA 3FNQA 4E1VA 3KVRA 4GMHA 4UC0A 4D8VA 3PHBE 1CG6A 2GUWA 3DP9A 1VHWA 5F77A 3NM5A 2I8AA 1NC1A 3E0QA 3UAYA 4JOSA 1OU4A 4YNBA 1Z38A 3IEXA 1CB0A 1LX7A 3MMSA 1Q1GA 1Y1SA 5CXSA 3KUKA 3UAZA 5B7NA 5B7QA 5CXQA 1PK9A 5F7ZA 4GLFA 3P0EA 5CCDA 4PR3A 3IOMA 2RJ3A 1B8NA 4RJ2A 1K3FA 3K8QA 3UAWA 1RXSA 1PK7A 3EEIA 3OOHA 2AI1A 5FAKA 1VFNA 4U2KA 2H8GA 1PR1A 1ODIA 1VMKA 3TL6A 3KVYA 3OOEA 1SJ9A 4OF4A 3OZCA 4P54A 3PHCA 1RFGE 2XRFA 3F8WA 2P4SA 3FUCA 3O6VA 2OXFA 4WKOA 3KHSA 4QASA 1Z5OA 1ULAA 4K6OA 3GGSA 1PR0A 4D8YA 5EFOA 3O4VA 4H1TA 3OCCA 4F3KA 4EB8A 4TYMA 1ODLA 3EUFA 1RXYA 4G41A 1V4NA 4MCIA 2A0XA 1I80A 3INYA 4JWTA 4TXJA 3U40A 5F7OA 1RXUA 4DA0A 1OV6A 2AI3A 4BMYA 1Y1QA 2I4TA 1TCVA 5F7JA 4NSNA 4DAOA 1JDUA 1OUMA 1Y1RA 1M73E 1A9RA 5JPCA 1YR3A 3EMVA 1OTYA 5CYFA 1Z33A 2A0WA 1JP7A 2HRDA 2OC4A 4WKBA 4QARA 1YBFA 4DA7A 1PR6A 1SD2A 1PR5A 1Z5NA 4M3NA 1PW7A 3MB8A 4TXMA 3DPSA 1PR4A 1Z36A 1V48A 1V41E 3P0FA 4D9HA 3ENZA 1ULBA 4TXNA 4R31A 5K1ZA 4YMLA 1PKEA 4QFBA 1PBNA 1TD1A 3FAZA 4NS1A 1T8RA 5CCEA 2IQ5A 4OGLA 1VHJA 1WTAA 4M7WA 3LGSA 2QDKA 4G89A 5B7GA 3GB9A 4MARA 4TS3A 4DANA 1JDVA 4OEHA 4DAEA 3PNPA 2ON6A 1U1DA 3KU4A 2PGAA 4L5YA 5KB3A 1Z35A 4WKPA 2AC7A 4F2PA 1ECPA 1Z34A 1RT9A 3ODGA 4L5CA 1RXCA 1Y6QA 1YRYE 4F1WA 1JE1A 2AI2A 4FFSA 1B8OA 2ISCA 5F76A 3DJFA 1A9SA 4MCHA 4D8XA 4F2WA 4L0MA 1OVGA 4GLJA 4BN0A 1T8SA 1A69A 1T8WA 5I3CA 3BSFA 1K27A 3FOWA 1C3XA 2A0YA 5EUBA 3T94A 2QTGA 1ODKA 1JPVA 1K9SA 2HWUA 1FXUA 4BMZA 1T0UA 1ODJA 4ECEA 1JDTA 4TXLA 4BMXA 3UT6A 1LV8A 4NY1A 4R2XA 2QSUA 5F73A 2QTTA 4YO8A 1NW4A 1RSZA 4IP0A 1YQUA 1A9TA 1U1EA 1U1FA 5ETJA 4G8JA 1TGVA 4L6IA 3NBQA 2QPLA 3BGSA 5F78A 1JYSA 4QEZA 4DA6A 3QPBA 1TCUA 3DDOA 3LBAA 1PF7E 4PNPA 3OZEA 4QAQA 1TGYA 1N3IA 4KN5A 5IFKA 3EUEA 1JDSA 3NM6B 1V45E 4R2WA 1SD1A 3C74A 3E9RA 4L5AA 4EARA 1RCTE 4DARA 4DABA 3UAVA 5CYGA 3OF3A 1NC3A 4YJKA 2HN9A 5EPUA 2A8YA 4LZWA 4M1EA 5DK6A 3PNSA 1T8YA 3BJEA 4WKCA 3DF9A 4OY3A 2B94A 1A9QA 4DA8A 1Z5PA 1JDZA 3UAXA
chains in the Genus database with same CATH superfamily
3LZCA 4KQJA 2J5RA 2I1QA 2IYXA 4ZT6A 2XWJI 3W77A 3H9EO 1KWGA 4CKZA 1E3MA 2JKVA 3R6DA 4GR4A 4NFHA 4I8DA 3V2IA 1EZZA 1T24A 5KEIA 1MDFA 3EEOA 3QW4B 1HE1C 1K88A 4YMHA 5EVCA 5J4KA 3DDNA 2UYHA 4B8WA 3MG9A 3OU6A 1ZWLA 2FWMX 4L50A 4NCHA 3SAJA 5IBRA 1L5SA 2WT4A 3CS3A 3KOOA 5JI2E 4B3TB 2E4VA 2R6FA 1KEVA 1A3CA 5FO1A 1XFAA 4O2LA 4D9KA 4S2EA 3W3AH 2Q45A 1FXWA 1GR0A 2RB4A 3C8UA 3FWPA 1CT9A 4H27A 1ORDA 4M0PA 2QN8A 1IN8A 3V48A 5K6RA 3NJ4A 5C8YF 5L3QB 2QGZA 2Y68A 2YOHA 3OT5A 3C14C 3WC4A 2OC9A 3SXJA 1DRJA 1K08A 1G1MA 2VHYA 3BWBA 4GNRA 2OVFA 2VWHA 1SU8A 2I7TA 4NAHA 3STXA 3TLBA 4E4RA 1FYVA 2VWQA 4FYKA 3Q0IA 4PNZA 4F21A 2JI6A 2O7RA 3IJ5A 1XE3A 1WBJB 2IYYA 2YIJA 3G8DA 1H5QA 1QCDA 3JVUA 1K8ZB 3DOIA 1J9ZA 4BVJA 3GLGB 3HXKA 1CNEA 3DLAA 4X6YA 3L8YA 3ZHCA 4NCBA 2RKOA 1SCKA 4RF3A 2GPAA 4ABTA 1ZRNA 2QTVA 3K9CA 3O1JC 2Q7DA 3RYTC 4E21A 521PA 3I6YA 5E3JA 3MLEA 3I6BA 1NF3A 1UBTS 2EGGA 3EGWA 3RCBA 2O8NA 5C80A 3NM4A 1R8QA 4OXYA 1YZLA 4KYTA 3GZNB 5BSTA 3QPAA 3SQOA 1GTL1 3KHTA 4A0RA 3KZVA 2ZKLA 4PPQA 5H70A 5EJ2A 3DGEC 3D8TA 4GLOA 2AVNA 3PLNA 3RHSA 5B12A 5K0EA 4JR0A 3STYA 3SICE 1E0KA 4JOCA 5CP8A 3JPWA 1FC0A 4IZOA 2NP7A 1Z0UA 1DDIA 1KTVA 3AIMA 1DPFA 2O50A 4ZO4A 4HH4A 2C7PA 3T9FA 2JIPA 3KDAA 1K8RA 5L3VA 4X6XA 4C9BA 5LA6A 3TFQA 3NBKA 3JQFC 3TR6A 2DTEA 4CTJA 3AT1A 4WKGA 2QRUA 3FFBA 2Z2JA 3E05A 4UOEA 1KEPA 4O4LA 2EKLA 3AC0A 4Z0HO 2KLHA 5FLXA 5JD5A 2NSDA 1OLSB 3LI2A 5DW0A 1AG9A 3VHQA 1WZ2A 2WYWA 2EBFX 3OU2A 1E5TA 1AMNA 4PAGA 3CIOA 3GRUA 1RADA 4PSKA 2HJRA 3T34A 2I1VB 3FR8A 3TNYA 2Q3BA 5FV4A 3NYWA 2JLZA 4CT0A 4PG4A 1EFAA 2P1DA 1QZZA 1CW2B 3CRMA 4X20B 1FTSA 3RU2A 4G0NA 4PPNA 4BNDA 2VDLB 2QV7A 4RANA 1W25A 5HOQA 3CISA 2IGBA 3Q72A 4ZK2A 2ZAGA 4JDPA 4KMMA 1UPUA 5I8ZA 4YRAA 2C4WA 3B48A 3UAZA 4LJ4A 4UNPA 2WYOA 3UAXA 4LXUA 2RGEA 5HMLA 3H4VA 1SC3A 1NVDA 2VK1A 1M33A 5TQJA 4XIGS 1SCBA 2W6MA 3DFFA 2DYKA 2R11A 2X42A 3GIDA 4UTZA 4WINA 5ALZA 3ROQA 3E81A 3GT7A 1JHPA 1S89A 3F8TA 3HNOA 1T2DA 1WCV1 3ZDYB 3I01M 4JGBA 1QS0A 1JWLA 5BN1A 3LPNA 4XM2A 1L5HA 2DUWA 3HC7A 1PGJA 2BD0A 5K0NA 1ISJA 1NQVA 2NNWB 3GIWA 3HWX1 3IJPA 5DGXA 4HUQA 4EJ2A 1OGJA 4BV8A 1ABFA 2PXXA 2DR2A 1HE5A 3DAHA 1V16B 4MGEA 4UHHA 5AIAA 1C14A 2Z3WA 4MP8A 3QVJA 4QGHA 5IABA 2GAOA 3O91A 3KFXA 4QX6A 4BC1A 5TPZD 4AULA 4MWSA 2A9OA 1A1VA 1PZEA 4JIMA 1GZ4A 1NLFA 3LP6A 2Q3MA 3KXPA 4CI0B 3SVLA 2AYZA 2NN3C 3ILXA 1N2HA 1ODIA 1ZH8A 5DP2A 1IEXA 2DR3A 4S0XA 5ES4B 3DZJA 1VMKA 4WQMA 3VKUA 3U16A 1HR0B 3L0DA 2R8ZA 3IDQA 4FQ5A 2B7CA 1Z6TA 3NT4A 5DKFA 1L5GB 2O8BA 1HQDA 3R23A 2IPOA 1UWVA 5L6MB 3RJMA 3E5RA 4RETA 1GQ2A 4XGNA 4Y2PA 4ENVA 1H3NA 4K9NA 1D2RA 4F5ZA 1ULTA 3M8KA 2FEWB 3GLQA 2K2WA 2XPCA 4MUJA 4RMJA 4G0OA 3VU0A 1UWLA 4M86A 3TXYA 2R44A 3Q87B 4HG2A 3F8WA 2IHJA 3OPYI 1Q3HA 3B85A 4RK4A 3SZRA 2JVKA 2JRLA 3P94A 4WKOA 1OCEA 5KQGA 5LR6A 1I4WA 2QNRA 1B93A 1PN3A 3O94A 1O9HA 2IDKA 2IYUA 4Y2JA 3CPHA 4BPRA 3IEMA 3G2QA 4BEBA 3FDIA 2GYUA 1RW4A 1JV2B 1YACA 3CN9A 3KUXA 3IP3A 4LHEA 1MVOA 4LXXA 1XXHB 3TEFA 4F06A 2JLWA 1JB9A 3LLUA 1M2EA 4MI9A 5AW4A 3R3YA 3WGUA 4UHKA 1PWHA 4MVXA 2WICA 2QSYA 3R3JA 2AC4A 2AF4C 3HQ4O 4B2LA 3AGPA 3ZW7A 4CTMA 3BMOB 5EWLA 2ZUVA 3E8XA 4K9QA 5HWSA 2FPPA 3Q7IA 4WY5A 2TMDA 1U3DA 4B3RB 3R8FA 3VDQA 4KUGA 4GBMA 2IZ6A 3FMFA 5A4FS 1P75A 2QNBA 4C5BA 1NLYA 2WINI 2EWMA 3T1VA 1TTPB 4MOWA 1HYQA 2NU6B 2ZP1A 1STOA 4JR1A 1V96A 1DUVG 1V6AA 4MRRA 4MRAA 4J1SA 2XWSA 4A0QA 3BBPA 3MTJA 4MIKA 1X8JA 1AO0A 2FSUA 1EESA 2ZJ2A 2QS9A 3A28A 1E2EA 2RBGA 4B4DA 4KGXA 5LQMA 3UF0A 3TSCA 1J5XA 3CH7A 3VU3A 2PX8A 4DDVA 4BKPA 2ZUTA 4UATA 3R7NA 1LRKA 4QUKA 4MWGA 4IKOA 2XKKA 5ALQA 1U2GA 1L7EA 2OQ2A 2QRMA 1CX9B 1AKTA 4CR7A 4IIFA 2J30A 5KYNA 3X1MA 2B2CA 1PQPA 4W7IA 2J9RA 2PEYA 2VHJA 2HBYA 1DXOA 1NXWA 5DNVA 5ARCA 3I52A 4L3VA 2GZ2A 2IU6A 4K87A 3L9XA 2Z56A 3IUYA 2WSBA 1D8TA 2VHQA 3U39A 5AFSA 1WMAA 5JALA 3V1UA 1DVRA 3O82A 4GM1A 3UC5A 4BZPA 2ZM5A 3QIAA 1YBFA 3B52X 3QUSA 2W9XA 4KIWA 4UQOA 5JCOC 1VLQA 4WEQA 3HKBA 3RE1A 3ZHVA 1PNRA 3ADBA 5B1HA 2IHKA 2XTAA 3IHKA 1XDUA 4Q9LA 3SEAA 1L7OA 1X80A 4AS1A 1PR4A 4LJRA 1AHHA 2Q6LA 1RYNA 4IXMA 1SXPA 2O8CB 3ZJUA 3IUSA 1CV2A 2HMTA 3GMTA 3U3DA 4I5DA 1MFPA 1V48A 1TB4A 4RD1A 4JC8A 1OC4A 1RVDA 4L7VA 1COWA 5ALSA 4QUHA 3QITA 4I8IA 3T7EA 1BZYA 2FAXA 1US8B 5DX0A 4OXIA 2FUCA 1ZM4A 2ZUUA 1TFUA 3ABSB 3DOOA 4F96A 3UJ3X 2WE7A 4GKKB 4IH9A 4AY5A 3AVXA 4DLRA 4RD0A 5BWLA 3SS7X 3KJGA 4LXHA 4MKRA 4XZ3A 3GEIA 3PXUA 4PO9A 3WLFA 4BO6A 3ANTA 3FXAA 2BFBA 1J22A 5CX1B 1EDOA 1UC4B 2D5LA 1BNCA 1CY6A 2WT8A 2WSSA 3PNLA 4MW6A 3WISA 4FM9A 2UKDA 2WFMA 2WPDA 1UBFA 2OV8A 1IUPA 2AK2A 2VYCA 2YC2C 2A9RA 4RPJA 5CNMA 5D84A 3PIIA 4JJEA 4UPEA 1O77A 3K9FC 3UBMA 3U7QA 3HV2A 4JUCA 1O6ZA 3QSYA 2BYTA 4BHTA 3M3HA 4L6AA 4AN0A 5T3UA 2QRHA 3H87A 3LUHA 3TE7A 4BBPA 3T0IA 1GKIA 5ICCA 2HDWA 3H8WA 4AROA 2CF5A 2ZJ5A 4GX5A 4JELA 2GXQA 2A78A 1C50A 2G40A 3VR0A 1YHYA 4AQDA 2PNFA 5EIWA 4O4JB 5CD9A 4U63A 4LX8A 1EHYA 3LKBA 3R7BA 4YEDA 1O4VA 1WKCA 1DLJA 3COYA 5LDDC 3GT4A 4CVNA 5M34A 2QMOA 5KB3A 2O8CA 4JEIA 2EFHB 4ES6A 3KQWA 3OM0A 2SKCA 2YWJA 5TEVA 3AJ8A 2IYQA 1Z0KA 3F6EX 5AXBA 1KH2A 4TUYA 3TCXB 1K5DA 3DDSA 1C4KA 1L5ZA 4EHJA 2ZYIA 3L9WA 4RVFA 1WM1A 3GG9A 3RBVA 5CDSA 4EPTA 3WJ2A 1LRJA 4C03A 1ZU4A 2ECQA 3L7OA 1NVVQ 4IWYA 4KP7A 1T2CA 5M04A 1RT9A 1MA3A 4G5SA 3GUZA 1DX9A 2WG1A 1PZXA 3V4FA 5DCLA 2OBYA 4D3SA 3WAGA 1LTHR 1AOXA 1IRXA 4RCYA 4X84A 4D56A 4RMNA 2M2IA 3MT7A 2RGUA 4I55A 3MQ4A 1JR2A 3G9QA 5CNJA 3KXDA 3SNHA 1I4EB 3TINA 1F0NA 7MHTA 3QP9A 1WMDA 3OCYA 4QOGA 1SEPA 1WU7A 5FUVA 4AP6A 1HDIA 4AUNA 3FCCA 4OK6A 3KZXA 2AI2A 2IH5A 3PJGA 1XROA 1ZCBA 2YHUA 3GFTA 1TEXA 4LOHA 1NURA 4EDFA 1VJDA 1L5LA 4OKSA 1ULHA 5DMXA 1H9CA 3BXOA 1E0JA 4RDIA 5DM60 1IG0A 1Q19A 3UHPA 4AMYA 2ANCA 1T8TA 5YASA 2AFIE 3HXMA 1JB1A 1G42A 1XX6A 4NYMQ 3LCVB 1EZ1A 3LBYA 3VX4A 3QVLA 2OCBA 1RWKA 3LOUA 3L05A 1UKZA 4NNPA 3MJRA 3T3DA 4FT4A 3ZWBA 5E6SB 5HIAA 3AERA 3GPCA 2R7KA 4BRZA 4RTLA 1GAXA 3EIFA 1NOKA 3X1XA 9GPBA 2QYSA 1R6AA 1T8WA 1JZTA 1NAIA 4GFDA 3RYFB 1AB6A 4RA9B 2GZ3A 3T4XA 4GOND 4AIIA 5DGIA 4BNHA 1E2FA 4KZKA 1B8UA 4GNKA 4JT2A 1AHIA 5LZ8A 4PN7A 1N2OA 4L22A 1ZVQA 3C3EA 3BK7A 3ADDA 1JBEA 2F3TA 3GPBA 4NS4A 4EOGA 2P5UA 4UBMA 3VNBA 2FPUA 2C3OA 4OB8A 3BA6A 1AZLA 2VPYA 2FETA 2MHCA 3PRHA 4P83A 4OX9B 4EYQA 2OBFA 1FEZA 1GDTA 4NY1A 2H1WA 1DQRA 3W2IA 2VA8A 2H08A 5JSKA 3LO5A 1HURA 4HXYA 2PRSA 3CUWA 1HE2A 3PJDA 4QOFA 4E3ZA 5JH7A 3HKCA 1BWRA 5JY6A 1UWKA 3P4UA 1VL1A 4OFZA 4LY3A 2WC1A 4FKZA 1RSZA 1NT2A 2HX1A 2IBMA 4NBTA 2JGJA 1XVLA 2PMBA 3KKQA 1JHZA 3RGGA 5JAHA 1JHVA 1MZPA 4JP1A 1YI8A 1SWWA 2RCYA 1N36B 3DYIA 4YCNA 4J07A 1N1EA 1FQWA 2ZBDA 3LOPA 4YLYA 3KLMX 1MIOA 4BLVA 1LK0A 3PLRA 2I87A 1QGED 4V0MA 3VZQA 3WAJA 3ENQA 1ENPA 3NT2A 4G37A 2P3SA 4XJVA 1D2AA 2HCFA 2Q1YA 1Q5PA 2WKSA 3FYSA 3NBQA 4R7ZA 3RVNA 1JYSA 1I10A 1AK1A 1W9MA 3PDCA 4QDJA 1VE6A 4NATA 4D3FA 4GW3A 5JR3A 2PMDA 3P45A 2BEJA 1NX6A 5AI5A 1UKCA 2M6LA 1J8DA 1MVLA 3C16C 2FDCA 1UBKS 5DN6D 1QH8B 1LTQA 1PL6A 5A4IS 1FJXA 1V1JA 3A2MA 1G3IA 2Z0MA 2GETA 2Z4RA 4K6CA 4AW9A 3EVBA 4B2PA 1ELOA 4DADA 4N7BA 4AD8A 4C87A 1Z4IA 2H48A 4EIWA 2EARA 2MSNA 4G2TA 2VZ9A 2F3RA 2XADA 4ITRC 1NBOA 1TQ2A 2BHRA 4M8KA 4TS4A 1Y5RA 5LDGA 3LAWA 1JHXA 1YZQA 5TMBA 1GWNA 2J59A 5ALXA 4CTOA 4AMZA 4ZIRA 1UAGA 1JIJA 1KEEA 1YIAA 4J3FA 4AP5A 2UVPB 4UEOA 4YJDA 1Z17A 4XJTA 1ACLA 3D2LA 5J4HA 1OX4B 2WTEA 1WA5A 4MV9A 1NQTA 1AKYA 2Y0CA 2HNAA 1L4KA 1JAHA 1SHKA 2CXTA 1ENYA 2HWWA 1JHMA 2FWAA 2OCXA 1WIWA 4HMOA 3PPVA 2B21A 1KZYC 4RQTA 3U60B 4O3FA 5CEJA 5DTJA 1GPUA 1QAQA 2B7BA 4JUFA 4QA9A 1MH1A 1UT5A 4BO2A 4RVGA 2GCOB 2ZUFA 1XRPA 2JA2A 2YXNA 4JBHA 1DX6A 3FPSA 4BO5A 4YT8A 3DYBA 5JFOA 5T7BA 1ZVJA 2A9FA 3C3WA 3IVAA 3BD9A 3Q2KA 4MV0A 3QYAA 4MRMA 2Z6AA 2FA9A 1VKRA 4RZXA 3BFXA 4KE8A 3E61A 5HTOA 5CH8A 3IA2A 3CXUA 3N87A 4PS0A 1QVAA 1EFPA 1IK4A 1TRHA 3K35A 2OXRA 1H0SA 2Q5QA 3AW9A 3L0YA 3JQAA 4X6LA 1ZAKA 4DQVA 4B3DA 1CS0A 2O3RA 3CUUA 2FEMA 3Q8XB 2BFMA 4ENUA 1CJTC 1QYCA 2Z2YA 1V8PA 3ZU3A 5IKXA 4KHPB 4PGAA 1YBMA 1NJ1A 4JODA 4M6WA 4EGQA 1YONA 3ZHRA 4AO6A 4M83A 1QE5A 1RQRA 1PFGA 2IODA 3MVEA 4OM7A 5I7WA 2WRZA 5G41A 1H1DA 1MOSA 1BW9B 2JJMA 2QTBA 4FS8A 5IZCA 5JTUA 3PUZA 4Y2RA 3QGMA 5HILA 1EXNA 3BK1A 1HK7A 3MWEB 2EV9A 5LA6B 1IHPA 1YK0A 2QG6A 1A9PA 3UWPA 3ONVA 1IZ8A 2FVYA 3OZRA 1Z4KA 1BEUB 1FDSA 4M4SA 1P1KA 2WZCA 3C45A 4LC0A 4LDNA 1PL0A 4RQUA 4EUNA 2HMUA 2VOJA 3TZCA 2GILA 2X4IA 5ALNA 1OQAA 4MMZB 2MINA 4URFA 3EVFA 5JHHB 3CZRA 1N9GB 3KFLA 5FBRB 1TA0A 1GPLA 3MCWA 1IC6A 1PWXA 4AMVA 2BELA 4F3CA 2HYIC 4K9MA 3FAKA 3O0TA 4LNHA 1Q6ZA 1ID1A 4M1ZA 1R8XA 1H8EA 1M9NA 1P29A 1RWWA 2XTJA 1OYWA 3H7AA 2ATVA 1V4VA 1YS7A 2F1KA 1P4JA 4UNSA 4BAZA 1XRMA 4PRLA 3TECE 5BSHA 2ZIZA 5E3HA 3M6WA 1UEXC 1WF3A 5C81A 1YUNA 4ZVKA 2RARA 3EZGA 3SGLA 3ZDEA 2WTBA 5GVSA 1QMPA 1MO4A 3RFXA 4P8RA 2UXCB 3CR3C 2C94A 3HBMA 1J00A 1GUFA 4LC9A 1VZ2A 1HKHA 2BE9A 3MSXA 2Y1FA 5DNUA 2GHIA 4D8UA 1PSWA 3IH5A 5EXDA 5LBTA 4X1KB 3VR5D 1JLKA 3BE5A 3OTQA 4IGAA 1V9CA 4PLZA 1P6UA 5CVVA 1Z4MA 2O3SA 1E2HA 1UPTA 1GTSA 3JQ8B 3FNQA 4EQ6A 3AWDA 4KDCA 1GNQA 1DBRA 4PC7A 3ZHXA 4ZYXA 4KBFA 4YAUA 2GK4A 2WHEA 1O8BA 4XQCA 3EG5A 3Q5GA 2C88A 4AJEA 4WJLA 1CCWA 1K89A 3DT6A 2E48A 4DSUA 4JLKA 1YQTA 4FHFA 2BFWA 3BPSA 1E8DA 1OFVA 2HDNB 4NBSA 4UAVA 2H17A 2P4QA 1GRNA 3ZTWA 2JJ2D 2ZWPA 2ZB7A 1SKYE 4W8HA 3NYRA 4NYIR 3DE7X 1KYTA 1M5TA 5KTPA 2RGYA 1Q83A 1A9XB 2F62A 3CNEA 3RS7A 3OWOA 1Z38A 4PM4A 1NJ2A 2FZCA 3L6OO 2IHBA 2P9TA 2RBKA 3L7LA 3NEPX 3NHJA 3O8NA 3PZBA 1IQ0A 2ZPTX 1CUUA 4FHGA 3RAFC 3EMBA 4HO1X 4PZ0A 4ND5A 3UIEA 3TI9A 1JAZA 5HCUA 1C41A 1D04A 1OH6A 3S1AB 3WSTA 2PY6A 1BVUA 1RBZA 1LJLA 3EE6A 3KJFA 3CWCA 4LSZA 1K8QA 2Q0SA 3TDKA 1DAHA 3JV7A 1PTJA 2O5RA 4GBJA 4PVDA 4RPIA 1MT3A 3K0CC 5DXFA 4EMTA 2LP4Y 1DAIA 1G4AE 1XAJA 2VLBA 4PR3A 1NYLA 1YB2A 2WABA 2AFIB 3HL4A 4BFYA 3BB3A 3NRBA 3A70A 3CUVA 1HA3A 3PEUA 4TTPA 2BGJA 5COQA 3D3WA 3P2KA 1JHQA 2NWQA 2CE7A 4WI1A 3FLMA 3L04A 3P4XA 1WUHS 3KSRA 4FI3F 1LKZA 1NM5C 3P0IA 3A7DA 3MMNA 4B83A 4I55F 3LLCA 4NU8X 3PWTA 1F51E 1VCIA 4JT9A 3KSDO 4Y6QA 3LMKA 4WD3A 2YMQA 2IXFA 1NP7A 4KYIB 3HS3A 4W9NC 5IM4F 2ZVJA 5KSYA 1PX2A 4IDEA 1ID8A 1BH2A 3CT4A 5BNFA 5JO9A 5E6SA 3GNLA 1YU6A 1KEKA 1YV9A 4R1QA 3GJYA 1MRZA 1WHSB 1YSCA 2AYXA 3OX1A 1IHYA 5DHQA 1Q95A 1WDKA 1K7EB 4BO3A 4LYEA 2BM8A 4FFBB 2MTBA 2VJOA 4KU4A 4MQLA 3FUTA 1EINA 1JHDA 3WGIA 1SKQA 3IAHA 4WECA 2V1UA 4B3HA 2Z04A 4B4UA 3P0RA 3KUDA 1EEHA 4KK4A 3KPJA 1W49A 4P0TA 4F3TA 1UZAA 1KY5A 2EYUA 3P2IA 3NBUA 5EHNA 1HEIA 3KQUA 4C4XA 3MRXA 4QD3A 1NE2A 1E3SA 3FVQA 3PGKA 1VDMA 4ZMSA 2VZEA 1Z88A 4TWIA 5DU2A 3CEHA 1ISRA 1SBZA 1TCCA 1HSOA 1YQEA 2GNPA 3R75A 1Z47A 4WZAE 4CJXA 4XEUA 2OAEA 5B53A 1HPLA 1JKJA 2ZB4A 4WDQA 2R7AA 3O6VA 3OPNA 2B1RA 2QMUA 1YVPA 1N5KA 2R48A 2PE5A 2QBYB 1MAHA 1K7XB 2C99A 1V5EA 2YASA 3E9NA 3GJ4A 3RROA 4B6OA 3NT5A 3AEZA 2AJLI 3FPKA 1ZR2A 5IJ9A 1H5NA 3FMOB 2PM8A 5F1KA 3X1KA 4MCJA 3AF6A 1MH9A 1F4LA 2GHTA 2R87A 4Y1FA 3TUIC 5FTLA 3PXCX 1O96A 3HJFA 2WT9A 5G1OA 1ZICA 3NDIA 2YJZA 3ZZ0A 2P79A 4E22A 4R1PA 3G5MA 2DH5A 2JGAA 3KYDA 4D74A 2G77B 1ODLA 1FTWA 4IF6A 4YGYA 1Z25A 3D2BA 1H94A 2I2FA 3C6YA 2NV6A 4EZEA 4LE2A 5JBIA 5L9AA 1W5TA 1VLZA 1UQUA 1BYUA 2Y6UA 4DNOA 2HHHB 1N78A 2CDRA 3S2UA 2BN4A 4G5GA 4PPYA 1E2NA 3TKYA 5GONA 3HTXA 2AMLA 4RK5A 1VJ0A 1HKUA 5E38A 5PGMA 3T95A 4GYYA 1RYBA 1WQ3A 2P1ZA 2JH9A 2XMQA 2Y71A 1CUFA 4C4RA 3KQHA 2D62A 2VYFA 4BNIA 4YUZA 2CFIA 4NECA 5FNVF 2BGUA 1CEQA 3AO0B 3NVKI 1R12A 3SOZA 4JASB 2IYWA 3GLIE 4IMIB 3SEFA 4MVJM 2VDJA 2VI5A 3IDSA 1JKJB 3KVNA 1DG3A 4JXZA 2OBXA 1Z0SA 2PX3A 4XEHA 1JLLA 3R7SA 4AB1A 1D2GA 4ZFNA 1RHKA 3OJ0A 3AF1A 2QTLA 3O84A 1DFGA 1RBYA 2W6CX 2RH8A 3PR2B 4WXYB 2FQ1A 5BN3B 5E2AA 4GQBA 3VU9B 2CT8A 2HJHA 3P9KA 3IQIX 3NC4A 3BXHA 2BZSA 2NVWA 4S1TA 3WNBA 5FBWB 1K7SN 3EC1A 4D0NA 2H85A 1P2FA 2X7XA 2FQWA 2H18A 2WTAA 3QELB 1Y0BA 3ZWQA 3GPDG 1DBIA 1Z82A 3O3CA 4DCSA 1U02A 4OYYA 2DETA 1IIBA 3SKYA 1DKMA 1Y3CE 2NXEA 5FL3A 3VMMA 2HRDA 3V00A 1SVOA 2R8OA 1GLGA 4KQFA 2WF9A 4FZRA 2F9LA 3N3AC 1H6CA 1PHRA 2HRRA 2Q5JA 3OI7A 4I1YA 4RBNA 3ZHBA 1EP2B 1JJVA 1YRHA 1V4BA 4K2AA 3NPAA 4TKUB 4EZIA 4MUHA 3SZOA 2UVPA 1RPZA 4BB9A 3CZ5A 4G4JA 2AQHA 5JEDA 4HRXA 4Z4EA 1KHHA 2B34A 2JFGA 2QTZA 4LDQA 2BGKA 2CNWA 1AQLA 1FP2A 1JLMA 1DFIA 4JK3A 4PYMA 3CONA 1Y3IA 1UBSB 4V0LA 5AI0A 4URXR 2B7LA 3F71A 4UMVA 1NMZA 3D1JA 5I5EA 4J9UE 2J32A 1Y8QA 1TQ6A 3ENZA 3HGTA 1RIFA 3N2ZB 3RT9A 2GD2A 1ULBA 1TZBA 3QPUA 3GEEA 4OVKA 1OLSA 4R31A 5E2IA 5HX7A 3P9IA 3ETLA 3GF4A 3I37X 3AU8A 2DMRA 3CRVA 3VZBA 5K0FA 3P19A 2Y4NA 3LFHA 1SVLA 1LBTA 3PX2A 5AK3A 4CV2A 4YRSA 2WAOA 2JIDA 1VBNA 3QVVA 4BWVA 5KSOA 1L5QA 2OHJA 5JC8A 3CU5A 2HNBA 3L8CA 2WJAA 5LQKA 1O94D 3PHHA 1YMQA 1SPBS 2QX7A 4I19A 3SIRA 3S8YA 3LUGA 5HQ3A 3U44A 2EKPA 1HNXB 2A67A 3V3KA 1YB7A 2PGLA 4Y0NA 1N6HA 4B3CA 2ZI3A 2C7VA 4OQYA 4REOA 1P2BA 4MMXB 2BWJA 3V6MA 1OAOA 4XVRA 3EDRA 5IDVA 4OEHA 3WL4A 5CCBA 4J0EA 4JJZA 2HA7A 1KJQA 2PXHA 3CEMA 1Z7BA 5DH9A 3SR4A 3IV7A 2IX3A 2J3MA 4BRWA 3H2BA 4HPJB 3PFWO 1NI4A 1VKJA 1GG8A 3B3GA 3A27A 4BMPB 3JQ9A 4OX9Y 1Z08A 2AN1A 3OEWA 3VNUA 4YA6A 2HB6A 4J7CA 1N7GA 2ZJBA 3THRA 4NIMA 3KSUA 5DNWA 1DDOA 1EAYA 2W6JA 3BWXA 1E5VA 4FMPA 4BV9A 1CK4A 2G1AA 5F1OA 4A73A 1E9VA 4BZWA 4H4CA 4ARIA 3ZWKA 4DMGA 2C42A 3GLUA 1M2VB 2DQ4A 1KP9A 4G5HA 4X45A 1DMSA 4LFCB 5IASA 3H5IA 4JYMA 2HF9A 2GXSA 3CJTA 4F1WA 1WO8A 3B7GA 2FW7A 1ZNZA 3IP8A 4N3AA 2GRUA 1OZHA 1DL5A 1OXSC 1ZI9A 1Z83A 2K5UA 3HB4X 1PW5A 1KO5A 3PGLA 4FYHA 4MWCA 3FSRA 5E7QA 4LJ7A 4R81A 2DG2A 4QBIA 3BDAA 4RZSA 3MS2A 4YRRA 2YN4A 5FUXA 5EHZA 5ICEA 2Q3DA 4W82A 3FYUB 5CK4A 1O0CA 2HT6A 2IPAB 2D4HA 1EFKA 6NULA 5KCZA 1V0JA 2WWTA 2VDQB 2IYNA 4UVEA 1NBMA 2HY7A 2ECKA 2O2JA 4HPXB 3RTAA 2OHFA 1YFZA 3DC2A 4N5MA 3I9JA 5F52A 1BX1A 5E9AA 5LFAA 1NF9A 5AW1A 3WO0A 3W8RA 4FHCA 4CMIA 3BOSA 4Y2QA 3ROXA 3E8MA 4Z6KA 1JG1A 5F51A 1GL7A 4C76A 5CXXA 1VBMA 4L51A 3A25A 4CKEB 5DNDA 5EMMA 4XSVA 2OVBA 1XVIA 4JBLA 2B98A 1DBSA 3VR3A 4EDHA 4CM1A 4EKNB 4OK5A 1E0SA 4EK9A 5HJ5A 4N40A 3V2HA 5IVKA 4CDMA 4DLTA 2OK8A 5BR4A 2LCIA 5IF9A 2WD7B 5DT2A 1S4QA 2EFEB 1JXAA 4FJ2A 5AVJA 4ZU3A 3UT6A 2G5PA 4CV0A 2WG0A 2PSSA 2DPXA 4ILKA 3EQ9A 5H3CA 1FZTA 3RVDA 3GEDA 2R4QA 4E2ZA 1WKVA 4GD3Q 3RF6A 3UKOA 1F06A 4OQLA 2P9ZA 2X9NA 3C5EA 3SBEA 5A1TA 1N75A 5CGQB 3L02A 2IUUA 4W5JA 5JS7A 3W8FA 2PZEA 1GRRA 4JJKA 5AXCA 2AHRA 1DZIA 2JGRA 1VKHA 3OZAA 3E1SA 3F1LA 3ZVLA 2HYDA 4EWLA 4TM7A 4ETMA 2P91A 3OCJA 4MYRA 1K0UA 3HFJA 5CA0A 2OBNA 2RK3A 1RWMA 1I36A 1Y4UA 4RLSA 3B51X 3UM9A 4FI3C 1KAQA 5JSZB 5T3YA 3NYIA 4B0PA 2JGDA 1E9BA 4DWVA 3KR2A 5AKJA 1E1QD 2QIPA 5ER9A 3V32A 4BNGA 2FSSA 2VT7A 4B5KA 2K7FA 2GD0A 2JBAB 2OYRA 4Q4LA 4F8EA 3EA5A 1CQJB 1UDRA 5EWMA 4YASA 2RHDA 4I1OA 1AGXA 1JG7A 2GBFA 5C0OE 2HIGA 3RKSA 4ARBA 4ZIRB 3ETEA 2Z83A 5HF8A 4MO9A 3FVRA 5J5AA 4FYPA 2R00C 5CGZA 2BI4A 5I9SA 2IPLA 3K1JA 2PYZA 2X8LA 3PRKE 2HCJB 9MHTA 2NADA 3QELA 3QYPA 4QAQA 3UJ9A 1NUUA 4YCDA 3U31A 2WD8A 4Z9XA 3K6SA 2YXPX 1W46A 2JHCA 4HWKA 3SIWA 3JQEA 4JQYA 3CTPA 2WDZA 2O5VA 5GY7A 3NUZA 4HI0E 4GR9A 4ZANA 4RD4A 1B0ZA 5C1OA 3B60A 1E8MA 1NM5A 4I50A 1PVVA 1DQPA 4YJ2F 3E03A 1V45E 4R2WA 3R3XA 3RYHB 3V34A 1JEDA 1ORVA 1QH1A 2BFEB 1ZWKA 1P1HA 5FO0A 3ZCQA 5IANA 4O5AA 3N8HA 4N3CA 2PGIA 3I5YA 4GPIB 1NBME 1FUKA 2ZRFA 4ONEA 1JJAA 1I3OA 1U8UA 5D3MA 3U9SA 5C1IA 1HT3A 2DPGA 2RG1A 3SS8A 3JQGB 1IPHA 1GGNA 3GP5A 1WXGA 3LQ2A 4KQGA 3EDOA 1F6BA 3MGBA 4PAMA 4HPWA 5H83A 1Y5LA 4X71A 2GCPA 3MGAA 1MAAA 1CVLA 1JDBC 2O48X 4LY9A 1IJEA 5EZYB 1VHDA 4UZEA 4MUIA 5K3DA 3DDHA 3UBTA 2I2WA 3NKFA 1GU1A 2PYDA 1KFEB 2ZXEA 1EVLA 1M6WA 4LTNA 4DIFA 1DKNA 2B5WA 4D45A 4LSWA 4EJ6A 1IZ9A 2OFOA 2C5LA 3K9HA 1R4NB 4MGZR 5FWXB 1FSPA 1I14A 4M1OA 2JJYA 2I3DA 1BTOA 1K0FA 2YWCA 3M70A 2QLLA 5AVSA 5ESXA 5HDBB 4KFCA 2IIQA 4CMJA 2FI1A 4WA8A 2H1LA 2Q5IA 3WS7A 2DSTA 2WIBA 3U4CA 1A9OA 3O1HB 3ONDA 1BE6A 5LXTF 1NW7A 1YAJA 2R7NA 1ZL0A 2ADOA 2DHRA 2XYVA 4RZIA 1UXHA 3BMCB 1SG0A 4JP2A 3ABQB 1ACMA 2Z8XA 2IEYA 2Y1XA 4L15A 5JYBA 4U5QA 4LOJA 2O7SA 1RJ9A 5GP1A 2CLDX 3PPIA 1LS6A 3F9CA 1NRWA 4LKOA 5HRCA 4QPNA 4F6LA 5IU6A 4ZQHA 4K6KA 4WW0A 1T0HB 1A7AA 2Z58A 3Q8LA 3OZWA 4ACAA 3M4ZA 1AGRA 4Q9DA 4FYIA 4Q3LA 1YJBA 1THTA 2CMHA 2G4LA 3GUVA 4YJ3A 2BFDA 3EA0A 5AOBA 4TS9A 3K70C 4S0ZA 2NP6A 1SZPA 3P2MA 2Q49A 1N5MA 3FB1A 4BNNA 1JRLA 4ZEVA 4HDMA 4X66B 1IM5A 2FLWA 2O7QA 1UMCB 3EVGA 4MZXA 4N7MA 4OIMA 3RSQA 1FSGA 2B99A 1OGIA 4KIUA 4JBWA 4X90A 4N3BA 5A02A 1ZJZA 4MRSA 4ENQA 2JLSA 1SBIA 1E1MA 5D87A 2G0TA 1V3UA 1J09A 3S6JA 2ASEA 1R4NA 1FS6A 3AF3A 4HWPA 3CA8A 1OFUX 4NENA 4EVIA 1VSUA 3GMSA 3CT6A 2ODNA 3Q3VA 4FFVA 5JYCA 5D5HA 4IQFA 1ISFA 3BXEA 2BSQA 1Z56C 2WA1A 2DFKB 5TS3A 1AKWA 5JRDS 3ZD9A 1MU0A 2EIXA 1REQA 1LPOA 1Q91A 1T5HX 1W2GA 4PGHA 1PRYA 1ZNWA 2DFLA 3H42B 4E70A 2EF1A 5HIMA 2PUAA 1L1EA 2I80A 3C3CA 3COSA 1YO6A 3PWKA 5K4GA 1OKKA 4FOLA 5IT9A 3V1KA 2H63A 1JR6A 5DBFA 2E6UX 4KFUA 4PLTA 2OWEA 5K2OA 4JLJA 3MCAA 1FPQA 1TT5B 3NBYC 1UH5A 4RA6A 4AN1A 1W88A 1E7WA 2RC5A 2WIDA 4BP3A 2XKAA 4R0VA 4JL8A 2IE8A 1E7MA 3HPQA 3L01A 4WLOA 5AYVA 1UXOA 4HLUC 3AM4A 2HXYA 1Y3FE 3HBJA 4I1SA 2PR7A 2VSOA 5EHIA 2OENG 3IO5A 3IRUA 3SS9X 3NC1C 2GJ4A 4RH0A 4A4DA 1W7AA 3HCAA 5EIXA 5IARA 3A4YA 3MTEA 4OKNA 5CIWA 1T5OA 3CX7A 2EL7A 2JDID 3DT8A 3B3QA 3JQ8A 1CB0A 3T1NA 5DBIA 1FOEB 4PG8A 1DB3A 1KK1A 3RVLA 3NHZA 1O9GA 1UMDB 4D9IA 1REQB 2PSJA 1G8KA 4G5RA 2FEOA 2MYUA 2O54A 1UKEA 1PNOA 3SHTA 3UK1A 2C92A 3MWDB 2E37A 3D8SA 1HDGO 4KQMA 1BD3A 1U7DA 1MVNA 2X0EA 3B5IA 2VAPA 3L6EA 4QPDA 4AZTA 5F4BA 1D03A 3KJZA 4WZZA 2H65A 3C3AA 3UHJA 3KL2A 5TC4A 3ZW8A 2VSQA 4C20A 4CL8A 1K3FA 1WY5A 4V38A 1GEEA 1XA3A 3K8QA 2B6HA 5DGDA 2QQGA 5JBNA 2VCEA 4GVXA 4DV2B 4JX8A 4R3NA 3T3IA 3N5CA 1J2TA 1P9LA 1E7YA 1XU7A 1XZDA 3FMGA 3TMAA 3W5UA 4ISCA 4U0JA 3BMNB 3UCFA 2PUVA 3NKVA 1XTIA 2HJSA 3I62A 5BNWA 3ZLVA 3G0CA 1XPOA 2I1LA 4R3WA 4RKYA 2ATCA 3R9XB 1Z5GA 4Y67A 3SIPA 1LB1B 2C07A 4Y6PA 3S2SA 4UFPA 1ZI6A 2WVHA 3C5VA 4EGFA 2H8GA 1NPYA 2PUHA 4LE0A 1VM6A 2Q8QA 4RVUA 5FPTA 1SZDA 4ARUA 2B9EA 2XBMA 1NUHA 3N75A 2ZRJA 1BVYF 5LUAA 4KX3A 4F4JA 3WZ2A 1ITZA 5GMOA 3Q7PA 4ZRMA 3IEIA 3L1KA 3NWOA 3Q3EA 3TQSA 3S27A 2W22A 4IMJB 5HIIA 3TL6A 3A58B 4KPGA 2LBPA 2YWDA 2H9IA 2BZ1A 3GVCA 3C5HA 4ZCMA 1K92A 3D6UA 1ZESA 2VXYA 4LYJA 1PJBA 4O4IA 4OF4A 4RAQA 4DG8A 2O6LA 2PNJA 3WRXA 4Z7QB 2NU6A 3QFRA 3IBGA 3KV1A 1TYCA 3I73A 1P9WA 2EQBA 2W4QA 4WMLA 3OZCA 1A8PA 1M1XB 4AF6A 2J6CA 4ASUA 4QICA 5CYPA 4LQ4A 3LXXA 4WTOA 1QWOA 4RTJA 5JOQA 2HU7A 1KZHA 2PHZA 3TLEA 2IYSA 4JN6B 4JDUA 2IEZA 1R6BX 5AK4A 3R74A 3ESZA 4PAWA 4X8HA 4D92A 4QASA 1E1DA 2HMYB 4AKSA 3GLRA 2COKA 4G9GA 4QDOA 1NW6A 1W48A 1PR0A 1SO8A 3A11A 4D42A 1CHDA 1XAIA 3V1YA 4D8YA 2V9ZA 4O2RA 1YJ8A 3PYLA 5CM2Z 3GFOA 3H5RA 3HBNA 4MPRA 5EFOA 3F1KA 1E3QA 1L4YA 1Y4ZA 2XXJA 4MV6A 3ICOA 2YY7A 3OCCA 4GEKA 4KFSA 3GRZA 1DKQA 3ZWOA 3I5UA 4EBBA 4WK2B 2AMFA 1ISIA 1E2PA 1E18A 1V9SA 1ZK2A 1J56A 1KYZA 5A0FA 5IWAB 2HQSA 1CUJA 5FUMA 1A96A 1DAGA 1XBTA 4BPBA 1Q22A 3GUYA 3RSZA 3BD7A 1XDGA 2CVQA 4NC9A 8GPBA 2Z2ZA 4GYWA 2NT4A 4PO3X 3STTA 4CF4A 2O2YA 3E15A 5K8LA 2A0XA 4LZJA 2JANA 2C4UA 4IHJB 4ZTBA 3N8DA 3OIGA 4NYMR 4DVGA 1OFGA 4UM7A 1XVTA 2QZ4A 3WWZA 4C4YA 1D4FA 2ZANA 3VM6A 3D4BA 2AI3A 1UADA 1C0KA 4EB6A 2C9ZA 3LC0A 2NLOA 3OSZA 4Q9KA 5DGCA 2QRZA 1QV6A 3I0MA 5JQGA 5GINE 3PHIA 1SUEA 4WZ6A 3ROFA 4FNOA 3KEOA 3INNA 1V7CA 2P6PA 3FSGD 3K9NA 4FNMA 2QN1A 4GDMA 5K01A 2IYEA 1RQGA 2XZOA 4PXSA 4JBIA 1Z2EA 2OGWA 2WNSA 2EZ4A 2FF7A 3GI1A 3TNJA 3DFMA 4IDAA 3FN4A 2J46A 4RXTA 3CN7A 2WB4A 1IY8A 3JQ6A 2EZUA 2VEOA 1J8YF 3ND6A 4JBGA 4P4SB 4XH9B 4NBUA 1Y9EA 2AFHA 1MGOA 4JVSB 5CURA 5GM1A 1TVEA 1E3EA 3LRPA 1QUFA 1PIWA 1FFDA 1QH8A 2VZ0A 3RM3A 3U3XA 4BRSA 1HFWA 3O2QB 5E6UB 4DV6B 1FQOA 1FUEA 5GGYA 1JTFA 2PKWA 1R0RE 1HM5A 4X7BA 3HZOA 1F5SA 3TZHA 1HNWB 5KOHA 3PRYA 4HEA1 4DA7A 3WK5A 3ZY6A 1N5JA 3A9RA 1GCGA 3GA7A 4GSKA 1Q16A 4ZV7A 1HOXA 2PGXA 1Z5VA 3W6UA 2HPZA 2V98A 2VBFA 4OMFG 4C88A 1J7KA 1GNTA 2BMAA 2NXCA 3MB8A 2Y1EA 1J97A 3CX6A 4E07A 1OT3A 4NENB 2R6GA 2D7DA 1U99A 2O1WA 1OXUA 4RKWA 4LCEA 5TQ2B 3WXBA 2D8MA 1I51A 2Z5GA 4R41A 4BU1A 1XIVA 5K8JB 2W6ID 2Y1GA 2ZWOA 2H57A 3H4IA 2RB5A 2VXOA 3QXJA 2X9QA 3SX2A 5HK9A 1MV8A 1N2GA 2GCOA 4FZJA 5KDOA 2RIRA 3BXZA 1YRAA 1XCOA 1SUWA 3OZ7A 5HGJA 4H3KB 4RF4A 3OX3A 3JD0A 1D6MA 1T8RA 1YB4A 3AK4A 3C1TA 4FP9A 4WNCA 5FPQA 2EW2A 3S5JA 2DQKA 2IQ5A 1XMXA 2NQ2C 2UYOA 1U3CA 2PZ8A 2ZJAA 4J7AA 1E6WA 4LVNA 1KJ9A 5JSUA 4XDHA 3WV5A 3Q3HA 4MKXA 3WMFA 1P44A 4WOCA 5LQJA 5E6UA 4O2AA 2FSPA 1C7EA 1MEOA 3NHBA 2M9MA 4U8GA 1USUA 4KOEC 2J9FA 3P2JA 4EYGA 3TF5A 4N3GA 4DYVA 2IZ7A 3R0XA 4YAEA 3FYUA 1R0BA 4XX0B 5BPFA 1DT5A 1K8XB 2LZ0A 1MW9X 2VYQA 1Z7YA 4IUCS 4NONA 4OHOA 3KJQA 4OV6B 4XTRA 2NIPA 4H35A 5LJLA 1OZ0A 5TRTA 4FYWA 1NQOA 2ON6A 1OZGA 5G40A 1U3TA 2PBZA 4LJLA 5K6AA 1YRLA 3K1AB 1GZVA 1SBYA 1TYZA 4EATA 5E4YA 1SG9A 1XOIA 2ZYWX 4P81A 2AC7A 2BPOA 1KS9A 1TM3E 4D26A 2XWBF 2OWDA 3NV9A 4M38A 4Y8VA 5CCXA 3TCNA 1G98A 2PFKA 1N9GA 5HS6A 3JATB 4O4JF 2WJ3A 4UZSA 5ES3A 5AVYA 3TFOA 2GJ8A 1BMQA 1RS0A 4YHBA 5L53A 3R5FA 2WUEA 3JXEA 2DECA 3LDHA 2R8BA 4JJFA 2NV0A 2UZ3A 1QIHA 4B3JA 2JEZA 1P2DA 1KYVA 4KPUB 2VJMB 4O4LF 3JZFA 1EFVB 3DKVA 5BV1A 2ISCA 1NBWB 2BEVB 4BOYA 1BXGA 1QJCA 2AE1A 3IDFA 1SAYA 3EGDA 2QVGA 4DLXA 5F5NA 4LRXA 5B6JA 2CMKA 3UUEA 4CV1A 5DHSA 3CPJB 2IUYA 1XN1A 3EZ2A 1DEOA 1L4UA 3DV2A 4AJJA 3NIFB 1MX5A 1XZQA 3KKZA 4WZBE 1O94C 3WK8A 5I3CA 2HPAA 4MVJF 1F6DA 1V8OA 1XPRA 1JH8A 2XOKD 3A31A 3K05A 1KNXA 3UG7A 3OQHA 2AX4A 3ZHOA 3ZE8A 5SY6A 1BMFA 1UDAA 1U7PA 1WUKS 3H3JA 2XCIA 3GJ7A 2I6UA 2PVPA 2VL7A 5JAOA 5A4JA 3KDSE 2OGZA 2PZAA 3WE7A 4B3GA 2AT1A 2VP3A 4HNHA 1XL1A 1V8BA 4JL6A 1L0BA 3GRYA 3G2IA 1YA8A 4DXAA 4KPYA 1VYUA 3R09A 5JSZA 1G9TA 3MJ4A 3TZ6A 3O4RA 3THWA 2FX2A 2VCYA 2L19A 3AERB 2J08A 1G5RA 4HUTA 2I2BA 2DE0X 3S2EA 3FUUA 4MEJA 2XYQA 2IYRA 1AF4A 3PXXA 3CLTD 4DBZA 1WL8A 2V97A 3NX4A 4C0QC 1M2GA 4C6TA 3FI0A 2H0RA 3T3EA 1N6PA 2ZRAA 2F8MA 1V16A 3HXQA 3H11B 2JCBA 4GL2A 4JI1B 1U6IA 5IC6A 4ARSA 3D0QA 5H0IA 1XL0A 1NG9A 1RE0A 5CB6A 2X5XA 4IFIA 3RVMA 5IVDA 2FZVA 3N9IA 4EPWA 3BICA 4RTOA 1EGAA 1P62B 2P9QA 2V1XA 2VF2A 3C1OA 3H0KA 3OE5A 3VRHA 3H8SA 3E3OA 2K87A 1V7ZA 1QUEA 3D6AA 3O0DA 4OTZA 2RGNA 3R7WB 1PCXA 3CLUD 1HEUA 3DOCA 3W2TA 3QEAZ 3IP7A 2HU2A 4GI3A 3IE0A 4MYDA 1P18A 1NG1A 1KSHA 1TCUA 1PQYA 3JZAA 3N0VA 3O3OB 4WXPA 5ALIA 4B73A 2GKOA 1LSOA 3OX2A 3KZMA 4V0OA 3T8YA 4NXMB 5LP6C 4O29A 3N2NA 3S44A 2OV2A 1DEHA 5TMPA 2AS0A 2D2XA 2PWBA 3RFVA 1EGVB 5BQ5A 2WHYA 2HIAA 4KR3A 1X94A 1O6GA 3FNBA 5DOVA 5K3OA 3F47A 1SBTA 1RAFA 1OZFA 3ITEA 1SCIA 1M1YA 1YOBA 1ZX1A 2FPGA 2XNJA 3B78A 4CM8A 5J5VA 4EMSA 5BPHA 2QLJA 4N8EA 5F4ZA 3FWYA 1MEJA 2VAVA 4C7OB 4WXHA 4EA6A 3LZDA 3HUFA 2DUNA 4ZT3A 3NOQA 1H8ED 1RCTE 2B2NA 3ZCPA 4HAZA 2A5GA 5AM1A 4EYEA 4XWAA 2I4IA 3A3OA 4E7PA 5CYGA 2P0EA 5FRDA 3I28A 1I24A 3I04M 4DCGA 2W2TA 1ZEJA 2AXQA 5EESA 5KDLA 3PEVA 4G4IA 4TZ6A 4LZWA 1ZOLA 4UOZA 4CMEA 2DHQA 1DE0A 3RSHA 2YDXA 5TS2A 1RQLA 3K6KA 4NX2A 2O23A 4M9XA 4PRKA 1B3RA 1O5OA 2HA0A 5FCDA 2MINB 3FLBA 5JFTA 1XZCA 5FXMA 4D99A 3HVHA 4IHJA 1C9DB 4P80A 3WK4A 1WDTA 2B36A 5KNDA 4Z0TA 4CCWA 3QE9Y 3T9AA 2B94A 2OT3B 2RH9B 4KV9A 3QVWA 2E6KA 2WDPA 4S3MA 4ZVUA 1FMLA 3LA6A 2XNDD 1NNEA 4G3XA 1Q84A 2RSLA 3QLJA 3KV3O 5KKNB 2EBWA 2V7BA 1WXQA 1NV9A 2CNLA 1GDHA 2VQ6A 3I23A 4IO1A 1DXHA 1QGUA 4DUGD 1FP4B 5FUWA 1EP3B 2H5LA 1C1DA 4MQEA 2B8EA 1G8JA 4YRTA 3CIFA 2OECA 5JXGA 2R68A 1M2KA 2DC1A 4D9MA 5AWFC 3WFZA 2JEYA 3PUIA 2XCRB 3EQ8A 5KPDA 3FYDA 4PYOA 5JS8A 3LCCA 4UARA 4DC0A 3D5EA 3IDOA 1JAIA 3LF2A 1Q1EA 1S8FA 3L7MA 3TKAA 2AMYA 2ODTX 3GLHA 5CG1A 1W4RA 5ALTA 2I9PA 4F9TA 3NXSA 1P9RA 1UDXA 2B78A 1BHJA 3EAQA 1MNQA 1Y4DE 3IULA 3ORRA 1XC7A 4LKRA 3SSNA 4DIKA 3S8MA 5BT9A 4AXXA 2HV8A 3T4EA 4YAGA 2CXHA 2NTJA 1MXFA 3AHEA 3UENA 1S4MA 2QMHA 5A3RA 4G85A 3VKVA 1TPZA 2P2SA 2Q9UA 4ZCRA 5KYXA 2BSXA 2C20A 3Q11A 5HPYB 1POWA 4C5CA 4FJ0A 3V4RA 4OHXA 4PS1A 5REQB 1KNQA 2PL9A 2ISSD 1SXJB 1X1CA 4I4TF 4KWCA 3RG2A 3MT0A 4DCVA 4TVOA 3UYKA 4RACA 1GSHA 4YP0A 4ALJA 2YX1A 3OQPA 2ZATA 4TQ9A 3ZZNA 2ZS9A 4PNEA 3GCDA 2R6R1 3NP9A 3I61A 3PHLA 3VNRA 3BQ9A 1ZD4A 4JSYA 4MRPA 1YU9A 4PEVA 2CJYA 2Z5VA 1WJGA 4OAPA 3KB8A 4Y2TA 2CVHA 4PFJA 2FOIA 2XMPA 1T5LA 3GEPA 5C2JB 3REGA 3K0HA 4QVKA 3ZE7A 1EUDB 3ETJA 1F8XA 1KMNA 1E66A 1PLKA 1XUOA 1A9XA 4OYHA 3F49S 4DDHA 2GNAA 4E1VA 2DZDA 4YJHB 3Q3IA 4OSPA 3C85A 3UK0A 1ZW1A 2ATXA 5EJAA 3ZWXA 2QY6A 3PHBE 1EFLA 3DNFA 3DP9A 1JU9A 5F77A 4ENPA 4JEHA 1UR5A 4DYDA 1OASA 1XI2A 3LF1A 3JR7A 3NGMA 5C52B 2HA6A 1UP6A 1A8UA 4L75A 4RHCA 1N2CE 1CZNA 4FUTA 3CF4A 4IIEA 1ATZA 1YJQA 4LE1A 5D3ZA 3IEXA 1XALA 1RQ7A 2HCBA 3EF3A 1Q1GA 3ZEAA 1LWNA 3PX3A 3C39A 4RA6B 5KNCD 5MN6A 1WDLA 1HFKA 1LW7A 3GPLA 3TIVA 3HE3A 4LOKA 4H1UA 2GEKA 1ZN7A 4AWXA 3OZFA 4YX9A 3V1TC 4ESVA 1P1IA 2GPBA 1JECA 1Y9DA 4QXRA 5KDDA 3KWLA 1YBVA 4BLPA 4BNXA 3KETA 1GXSA 2XMDA 5L7TA 1PU2A 3EF0A 4OA5A 2BBOA 5TGDA 4BLSA 1F8FA 2F4NA 2GR9A 2GAIA 2Q2VA 5EJ5A 3G0DA 4K05A 4IG4A 2AVDA 1CJSA 5DHFA 2ZJYA 4V3CA 4YQYA 1MENA 1MPTA 5BSKA 5GGXA 1MLDA 3RRYA 1VL0A 5FUBA 3VYUB 1EMDA 2VDWA 4GWGA 1IUOA 3O1LA 4J1TA 4CEHA 3I4FA 2RONA 1QGZA 1JTEA 4YCAA 4QM6A 1P60A 1TAQA 2Y1LA 3AFMA 3AP3A 1JA0A 4M49A 2EU8A 5E4JA 5FAKA 4G0VA 2QJRA 3A1FA 3HHPA 4DM7A 3SZGA 1WTCA 2W6IA 3ZLUA 3IHTA 3O9MA 1IY2A 3S7TA 3CSDA 3WA7A 4ZODA 3B89A 4N41A 3H65A 3A2NA 4OHPA 2OKCA 5BQ3A 2ZW9A 2W42A 4U8HA 2BEUB 1MJNA 3IIJA 4DUPA 4X94A 1QB8A 3EOZA 1P17A 4MDHA 2HRCA 3FZQA 3PGJA 2X76A 4PZDA 1XTUA 2G1JA 2W2VA 3N0WA 3PQCA 5HQTA 4S1WA 4HQ6A 4JYAB 1WZNA 1CDZA 3RRNA 5A5FA 4G0MA 2IS1A 2HHLA 4IGEA 4OD0A 1G19A 4RS4A 2AG8A 3SF8A 3FUWA 3PEYA 3SYRA 4H59A 2BMVA 3VX3A 4GRIA 2GM5A 3L8DA 4M89A 3WIVA 4LF9B 2G0NA 3ZCTA 3KJIA 1ONNA 1YCGA 4YV0A 3FUCA 2O06A 1SG6A 3MPUA 3NU1A 5ITZB 4Q15A 4F92B 3DAGA 1B8PA 3M6AA 3B6IA 2IW3A 3MWYW 4O08A 4W1QA 5DNEA 2A5YB 2XGJA 1WCXA 4HP8A 2HMVA 3N28A 5AI6A 1QH0A 4M9ZA 5K9ZA 1OWLA 1L7DA 1X1TA 1YKGA 3FI9A 3N2GB 3O4VA 4LRYA 2ZIFA 1A1SA 4Y2VA 4EH1A 5CB0A 1UBHS 2IOHA 2A0UA 2Q46A 3A1DA 2H06A 3D6NB 3GJZA 4TMYA 5EZQA 4HMPA 3URKA 4EF6A 4TYMA 4Z5XA 1GM5A 3CQ9A 3KKEA 4UVIA 2QAJA 5I9NA 1Y9ZA 3ESCA 4UJ3A 1X2EA 2P4UA 3AF0A 5L4SA 2YXLA 2OFXA 4ZEMA 6AT1A 3JD3A 5KJEA 4DR7B 3E9EA 3VPDA 2YOGA 5CT8A 2RAVA 3UEOA 1S8AA 2AW3A 3TH5A 4KITB 2Q1UA 1X9GA 5K3FA 3O93A 4IKPA 4H1WA 4D4MA 1HSZA 3ZQJA 1H4TA 1FXWF 1YULA 5U9CA 1C3EA 4WH0A 4TLEA 1YRBA 3CCCA 4I66A 1TTHA 4PSUA 1EVEA 3WXMA 4UQLA 2CCJA 2EC5A 5AJTA 2H4WA 5DBHX 3KB1A 821PA 1I13A 4AO7A 4U6SA 1NXQA 4QG3A 2E7ZA 1AE1A 4QHSA 1YR2A 3DB2A 3BEDA 3GFQA 2QF7A 5K0LA 2C31A 2W2MA 4Q3BA 2C9CA 1WSWA 3EUWA 5LU9A 1F6WA 2JBAA 3QIVA 2ZBFA 1ISPA 3IB3A 1LDEA 4J4TA 1KGSA 2I62A 1CB7A 1JT2A 1NI3A 3QWFA 3WIBA 4D43A 3FG9A 4EJSB 4OLFA 3QXXA 1GGEA 1KYWA 5H59A 2Q3CA 1RHJA 2PSEA 4KLCA 1ZGHA 1M73E 1XLTC 1QO0D 2XECA 4QFCA 1YR3A 5E0KB 4BIMA 3JQCA 5K8UA 1EX6A 2NVUB 4RO0A 4H7DA 2VTVA 1TJ3A 4FC6A 4X93A 5TPWB 1QX3A 5JADA 2QTRA 3ZLBA 4UREA 3KQQA 1L9KA 1AV6A 1V3TA 2CUZA 5FOXA 4C3OB 2IGTA 2H2DA 2HTEA 2GM3A 1Q7EA 4D9BA 2FN9A 2CXXA 2ZYUX 3MGGA 2B1IA 3DMTA 1GVNB 5G0VA 5KJFA 3A04A 3FMPB 3N76A 2NUBA 1DC7A 2Z4SA 4DOMA 1WCIA 4OHBA 4MTLA 1S9HA 1R0ZA 2JHAA 2OXEA 3NCHA 3UV3A 4ICIA 3VKFA 2R79A 4ENTA 3KB2A 4P34A 5BW4A 3AKYA 1SUPA 2RHMA 4GAEA 5F98A 2GLUA 2ST1A 3VZRA 3B9RA 3IBYA 3Q2OA 2F7SA 3ZU2A 3HDJA 3FNFA 3I12A 3H2JA 3K5IA 4WV3A 4OP1A 1Z4OA 3SMVA 5EZSA 4A91A 4H60A 5H8WA 3OJLA 4PYJA 4JBNA 4IUYA 1LD3A 3R9IA 2X5JO 3EIXA 3LC7O 1DIHA 3EC7A 4RV9A 3T35A 2A30A 2ZUBA 1XEFA 3DUWA 4QFBA 2HO5A 2J6IA 3MS4A 4RXMA 1O95D 3R0JA 2XMZA 3C1UA 4CKWA 1CUYA 2JD1A 2XCLA 3GFGA 4RS3A 2GVDC 4TL7A 1RI5A 3D7RA 2XB4A 2F55A 2GRAA 2WA2A 3G7NA 1KJZA 1DO2A 2NVOA 1W2WB 2E4UA 2ZIXA 3EZFA 1VB5A 4ZHQA 1AC5A 4JLDA 1GUDA 3K32A 2MWMA 2I22A 4YXWA 3LWNA 3Q85A 3ZXSA 2B92A 2XSZD 3M1IA 1EJ0A 4KRXA 1VE7A 2XBLA 3EAGA 4HDMB 4XYGA 4F12A 1L3BA 4IX9A 8OHMA 2ENWA 1TJ4A 3MQ2A 5I6DA 1NBMD 1UZNA 5BURA 1NRXA 1ZGCA 1LQTA 2UYQA 2Y8EA 1BXZA 3MWKA 3QKUA 1X14A 4ZOEA 4G2NA 2ZE5A 1VI5A 2QWXA 1JR3A 1R10A 1T13A 1M2NA 4PV7A 3KQTA 3RBAA 1VRWA 1DP4A 1V1RB 4KIGA 1W36B 1INLA 4EGSA 2IYTA 1ECPA 1ZJYA 3AHGA 3CB2A 2GEBA 3IR5A 4JI2B 3M2PA 3OM1A 3VH1A 4FKBA 1ZBQA 4Y2UA 1Z2OX 2HRBA 3OZGA 1FK8A 3CLSC 2H2GA 1CIVA 2HGSA 2MJLA 2V6MA 3A14A 3EB9A 1QOZA 4G1VA 4LGYA 1Y5NA 3AZPA 5A6SB 3TQHA 3UVEA 3BKXA 3IAAA 3NS7A 2ORYA 1G5QA 4CRWB 4CUJA 3ZDAA 5DGTA 4R6WA 4JR2A 1D6SA 5FKJA 4BKMA 5AW3A 4RZ2A 1W47A 3HDQA 3I6IA 4BB5A 3E7DA 2YNMC 4TUYF 3E9MA 4I1PA 4GPBA 4IVQA 5F76A 4J2HA 5TARA 2I65A 4FUQA 3BRWD 1SGWA 3QX7A 1S0UA 2LIPA 4ZA2A 2O07A 3EGOA 4FGJA 3EG9B 1EK6A 4UW9A 5CLQA 1ONBA 2XD4A 4L5JA 4F9EA 4WXRA 1KU6A 4DBLE 1I6WA 2VH2A 4EO9A 3KHUA 2E4AA 4BQQA 3NI2A 1YBHA 4LOLA 4NBLA 4WBNB 5B5SA 5B6PA 4A1OA 3P1JA 1GYRA 1NI4B 3WYDA 3WRXC 1KE1A 4EI8A 1IN5A 3BSFA 1G7RA 3QEMA 1C3XA 4B3BA 5H80A 4ZVNA 4KMOA 4IQ0A 3VMFA 3TVTA 3U6KA 3PA6A 1BGXT 4ARZB 1E2LA 4F7DA 3NDBB 1UBGA 1V7QA 1ZD2P 3KLPX 4K81B 1KZGB 3PUYA 4IMRA 4IQ8A 5B58T 3DKKA 4UE2A 4ERXA 2UXDB 4HAVA 3NPMA 4BE9A 3ZJYA 2I8LA 4DCCA 5I7HA 2JAUA 3UK7A 2QRPA 5DTIA 3OQMA 1D4OA 4YRMA 4G4SP 2EEZA 3DV0A 3QJYA 3I2GA 5JWRA 4Q9AA 1EJ6A 2L17A 4R2XA 4GOLD 3VI4B 3WNVA 4P7BA 4B8YA 5JW6A 2B1JA 3PPXA 3REQB 2DUUA 1DV2A 2OLKA 4TMWA 4BJ3A 3AFNA 3ZWAA 1E77A 4DDUA 4MR8B 2O8EA 3GD7A 1HY3A 2JFVA 1D2NA 1S2IA 1H2XA 4OJQA 3X1JA 2CBZA 5LSAA 3HL0A 4HGYA 2B0CA 5ED0A 3AETA 2O59A 3H0CA 1U6JA 3N59A 1KMQA 4I4TB 2CEAA 4ZC8A 2WFLA 1TCBA 3Q6MA 2WF8A 4O59O 2OAP1 3SVTA 5AXAA 3DO5A 3U7GA 2QY9A 3M6VA 2H8KA 4BZZA 1S9DA 5IJWA 1O1YA 2CHUA 4JMPA 4A23A 3F7TA 1Z2NX 3RVKA 4ZYUA 1KI6B 5DTEA 4FHDA 4LZNA 4ND4A 3SYKA 4DLSA 3PE4A 3EXG1 3HYTA 1JQAA 3B8HA 4RPHA 1E6LA 2Z2IA 3RNOA 3EPRA 2OCKA 1T3HA 2VS1A 3RLFA 4ODIA 4RWEA 1QHNA 3W7AA 3LDAA 4UBJA 4DMMA 3WB2A 3RD5A 1PTJC 3B1WA 3OKCA 4C2TA 4YN3A 1FP1D 1I5RA 2UZ1A 4PBRA 4ZTUB 1E1RA 1LSUA 4ZRDA 1Y7PA 4K5QA 3NHYA 2X0DA 1M7HA 4YWHA 3SZ3A 3ORHA 2EFJA 3PCXA 1OH5A 1UXJA 2IH2A 1PEAA 4IFEA 1QV9A 3FPLA 5IT4A 5D01A 3TGLA 1PE0A 4OPMA 4UD6A 1GJRA 2BUCA 1EWKA 2OBMA 3BB4A 1YL5A 3E9RA 4LNUB 3T52A 3SFZA 4HAYA 4M0UA 1U8ZA 2H11A 5SZKB 4FT2A 4HQ0A 5DCUA 3UAVA 1EK0A 5JMTA 4Y7DA 4ZCQA 3MUOA 3NANA 4K2HA 1FIUA 3G89A 1ZUWA 1XO1A 2ES4A 4IRUB 2J87A 1Z0DA 2X41A 5TT0A 4WADA 3FD8A 1Y8RB 4NARA 4RGVA 1I6KA 2R85A 2YCLA 4F4CA 4W5OA 1E89A 2IF0A 4BTVA 1RLJA 2YVUA 4XWKA 2FPPB 2ZZMA 2ZBEA 2ZS7A 4R1UA 1V9LA 3GN2A 3RFTA 1AN0A 3RVBA 5F5XA 5FYDA 3U4QB 3MAGA 4DCNA 3OD5A 1F14A 4K6FA 3GZJA 4I08A 3PXBA 3ZQ6A 4TLBA 1J1ZA 4LX0A 4MA0A 2IIVA 1W4LA 3I6MA 4PONA 2J7KA 1TZKA 1ESMA 3PQ3A 4BBZA 2HK9A 1RLOA 1KDTA 5E9JA 2C7QA 4HAIA 4CQNA 2VXBA 4ETIA 4LXYA 3LQ4A 2B8WA 3TTSA 2HZ7A 4QYTA 5HQ3B 3U44B 2W7TA 3V7WA 4BQIA 3OE7A 5JS1A 3FNRA 4LHYA 4DJAA 4PBSA 1ZLXA 3DC7A 3M2TA 5AVWA 1L4LA 1F8YA 2PKXA 3G2KA 3RIHA 3R6LA 5CVEA 5JO0A 1Z37A 2G9RA 3FCUB 3LIIA 4XTCS 1U8FO 1C80A 5B7PA 1WPGA 4M8SA 2VIIA 2Z43A 2XCQA 5IVHA 1P1BA 2II6A 3GK3A 4GXRA 4UHDA 1BS9A 1NPDA 1WP9A 2QQFA 2QP9X 1S01A 4D5EA 4WJKB 5AM0A 3DDZX 1RXVA 5LCXA 2G06A 3TSZA 4HZGA 2D5CA 3D59A 2XUGA 1TZJA 3TWOA 1IRIA 1MD9A 3DMYA 3IVGA 5E1OA 2D2VA 2H1VA 2HK8A 2M6SA 3HCWA 3CR7A 3JQDA 4WLFA 3T41A 3VYVA 4JP5A 2QRVB 3HUTA 2D2IA 2IEAA 2XW6A 2OK7A 5C5IA 3JALB 4K9LA 1JDBB 3B2NA 4F3RA 1X80B 3OZDA 4NH0A 2W2PA 4IXNA 5K5EA 3FBWA 1EX1A 4JLAA 2NUPA 1DAFA 2AXNA 1F4PA 3ITDA 1CS0B 5HW0A 3KQOA 1VJCA 2REQA 4MI1A 5HK8A 4TTJA 3PE3A 1A27A 3U7JA 4Y0AA 4A10A 4N0EA 4EHLA 1ILEA 4U9HS 1WV0A 3DV9A 1VQ1A 2BBSA 1N1GA 3NAZA 3UK6A 1IIRA 5BNZA 2JJ1D 3N8GA 1NUQA 4EITA 3T38A 4QNMA 2X6RA 3CKLA 4ZJYA 1RKVA 4Q03A 1X1SA 2Q7OE 4LYAA 1IN1A 1K8YB 3WGYA 1VC2A 2QYOA 4C0LA 4LF8B 2PRJA 2O8FB 1NMEA 3D0OA 4FE3A 2PPLA 3BL8A 3AU9A 4OHWA 2AFIA 5TVKA 3SSAA 1QDLB 3HXPA 4MI6A 3CVVA 4ZQEA 3KZ1E 1H42A 1HDEA 3COWA 1RJDA 3F9RA 3LFTA 4A27A 1PVDA 1NR5A 4JKIA 5EJ9A 3WGQA 2B5VA 2ZE7A 4ER6A 4QZVA 3AEQB 2MYTA 1GGMA 5THQA 4ZAXA 1JU3A 1NC1A 2A57A 3LPCA 4MPPA 5T4FA 3SEQA 5I4IA 2D74A 4J3NA 2CXQA 4QDZA 1KS2A 3PD1A 3U37A 5BWBA 5F3RA 5HIJA 2AKYA 4MMYB 1PKXA 4FZVA 3TM5A 2VYND 1NKTA 3E8SA 4O1HA 4LF6B 2F3UA 3F3MA 2QKYA 2PZGA 1EIWA 3TD6A 1ZCJA 2P9EA 1D7AA 2EL9A 3QSGA 1Y1SA 3VR6D 2CUKA 4PLHA 1C1XA 1J20A 4JSTA 4KIJA 2BW0A 4O4LB 3LCMA 4JBXA 1JKMA 3D43A 4DILA 3PNMA 1JYFA 3ADOA 3IMKA 1P7PA 1OGYA 3M4JA 4U1RA 5INTA 2YZ7A 3UQZA 5CTJA 3UJPA 3OZIA 4TSKA 4F6RB 3CBQA 4ND8A 5I4CA 4ASUD 5A6SA 1AY0A 4RL6A 4UPDA 1AMOA 4BBJA 1V2GA 4HK4A 3GW8A 3QU5A 2ECPA 1BVRA 4URHA 3MTDA 2JGDB 5TQ0B 3FDJA 3WQQA 4EQ6B 3B1XA 3NBFA 5EERA 4DA9A 2QRJA 3QBTA 5B6IA 2AXEA 4ZT7A 4ZVTA 1FNDA 2RI0A 2QD2A 3UAWA 1WBDA 3OKAA 3SM9A 4A2WA 3QVMA 3S7ZA 1F3OA 1RXSA 1R27A 2DPYA 4EG6A 1N5IA 4E94A 3KAKA 2A58A 3MJEA 2NACA 2XMBA 3UT5A 2D8AA 3LUKA 1L7BA 2WAXA 4RK6A 4M8IA 4U7TB 4U7DA 2OM6A 2V5UA 5CFZA 4B3FX 3PJRA 3A3KA 5J2UA 1I7LA 4N8SA 4S04A 2RGNC 2O2IA 1J8FA 3IL2A 4QU8A 5C4MA 3GBPA 5FBLB 5K3CA 2OAQ1 3K0CA 4RAOA 3FDXA 3U0BA 4U39A 2CLCX 3LPDA 1VE5A 3NAGA 2F8LA 3L0IB 1EGQA 1UP7A 4YRFA 2QTMA 4FWIB 3RABA 2L69A 4CIDA 1H8HA 3K5PA 2BGMA 1P7CA 2IXTA 3AQ4A 5D8DA 1VA5A 4XIYA 1XRLA 4K6GA 1PDOA 1BFUA 1ETUA 3BTVA 1DKRA 1IAQA 4ZO6A 1G3UA 2EIHA 4CG0A 2IU4A 1XEAA 2G17A 3X2EA 3D8RA 2PEZA 3WLEA 5AKZA 1D2EA 1RFGE 4JMLA 3DTYA 2KI5A 2YFHA 1N5OX 2IPNA 1E7SA 4R2MA 5J5CA 1E6EA 2VDPB 3B9PA 3OLYA 1LBEA 4RA9A 3DHVA 1CZRA 3DSRA 4A6PA 1G8AA 4OHVA 1E9CA 1ENOA 5AUQA 3HFSA 3OWHA 1Z5OA 3KQVA 3QV1A 4DM4A 4B9AA 1K6XA 2EFCB 3D7NA 3QYJA 1XCLA 4OBXA 4PZ9A 5B57C 4CCAA 3MTBA 5HUHA 5DTRA 5G4LA 3ISVA 3BRWA 1C1YA 2JRCA 3L46A 3TM4A 5KWSA 1U1IA 1S02A 2JS7A 4K40A 1FRZA 3K30A 5KNCH 3WSWA 3AP1A 1ODFA 3IT0A 2WM9B 2SKDA 3HWSA 1JHRA 3N6XA 4DCMA 3FKSD 2EDAA 3K5WA 1K75A 4RMHA 1Z29A 1AZWA 4RSRA 2FMFA 1K3UB 4BIIA 2D1QA 5DLYA 1Y6FA 2ZBPA 1GFZA 4ALIA 3H05A 3QFCA 4IIBA 2PUDA 3TBKA 4E12A 4HYTA 1L5VA 1SA0B 3CF2A 4MIEA 3WGKA 4ALNA 1SRRA 4NBWA 3JPYA 4ZCLA 4BVLA 2X0RA 3PUWA 5B30A 2GAAA 1OBHA 4M54A 2XDAA 3DP7A 2IS4A 1ZOIA 4KXXA 3V2GA 1DXQA 1PDWA 2QAGB 2R25B 2B4QA 3ODPA 3UV7A 4M9RA 5GV7A 4LMBA 4CXMA 1KEUA 1A8QA 3ICCA 2JAPA 1NQ5A 3E53A 2CHFA 5I9LA 1F17A 1E94E 4JB2A 4LYHA 2G9ZA 2Z57A 3UATA 2PMKA 2B8JA 2PMFA 1FVHA 2FZKA 1ZSYA 1TMKA 4YP7A 4QXQA 2CV1A 2YVLA 2ZLBA 4FZ5A 1P3JA 3CW2A 2QK4A 3DLHA 4XM0A 2X7HA 3RLIA 1PL7A 4KO4S 1N6LA 5AVVA 1AB5A 2FRXA 1U11A 3FTQA 3THYA 2R1TA 2V7UA 1O2DA 3G02A 1M6EX 3AHDA 4U6QA 1PJ4A 2Z8ZA 4Q3NA 3ND8A 5BRAA 2XDQA 3BCSA 1HMPA 4MHSA 3VNAA 1J99A 3L7DA 1UJMA 1ZZEA 4H08A 1BHO1 2OC4A 5FWDA 1M6VB 3H2IA 2C2WA 4JROA 4CNBA 2ZI6A 4YR9A 1ECJA 4B2YA 4J0IA 2KW5A 5HA5A 2GH1A 4AJ2A 3GD5A 4MV1A 3Q0EA 1JWBB 1C9JA 1SQGA 1GUAA 1XB2A 2YC4C 3QRWA 1Z28A 4YRJA 5BV0A 4TXMA 4PO8A 4CIBA 1KO7A 3LECA 4B7AA 4Z8YA 1ZI8A 2DCMA 4DSOA 1SXJA 2PQ6A 4I8XA 3HB7A 3QXGA 4WOJA 4ZQCB 3U3MA 4FFDA 1I3LA 1UF9A 3TO5A 3VDMA 1QIIA 5T8KC 4E2FA 4QBGB 4DDKA 4O1MA 3TXXA 1H2YA 2REQB 2IITA 4KH1A 4YPFA 5KQPA 4NR0A 3TRKA 3GMIA 4X92A 2OEPA 5F3WB 3PD0A 4NV1A 1GTVA 1R15A 4B85A 1TIKA 5BMVF 1RD4A 3WLNA 3JVEA 2QMQA 3AXSA 1LV7A 1PG0A 2DWPA 3ZU4A 2HTFA 4JOBA 2VNJA 3M9LA 3OMXA 3PL1A 4NVRA 1W5EA 3HKBB 1G5TA 4NAUA 2Q4TA 1E6CA 2QJTA 3MW8A 1CUCA 5CNKA 2XAAA 4JLVA 3QNUA 3L8FA 1NDUA 2HIMA 4A3SA 4DY4A 2ZBRA 2PT5A 1GZ5A 3GEHA 3JYQA 4OG2A 4IVNA 2Z09A 7YASA 1T0PA 3F2VA 2FR8A 1S2DA 1Q2XA 4PTYA 2NSYA 3SYTA 3AR6A 1U5AA 2XGSA 3VVCA 3CLVA 4GRAA 3PKJA 1CQIA 2XCUA 2WJJA 3K9GA 5JPDA 4BZQA 4JLSA 5MFZA 2PIDA 2C95A 1P0CA 1Y1PA 1CERA 3GAFA 4JITA 3T9DA 3BB1A 4QECA 1OLXB 4H7EA 1W0JA 3D4OA 1W35A 1ZM2A 2I3ZA 1W85A 4LMRA 1MABB 1RJ9B 4FNAA 3A3NA 2FNAA 4KRGA 2IDJA 4TKLA 3WGNA 4FW8A 5CDYA 5DNCA 3VQTA 1HL3A 2GJ9A 3DLPX 1M2OA 3BN3A 1J0XO 1FLNA 1VLHA 3B2EA 2ZIXB 2I66A 2AXPA 1UKAA 2ZYSA 3NV7A 5I5GA 4R9UC 2V6BA 3DE4X 4XFJA 2BP7A 1D1TA 5AM4A 5DXAA 5H7XA 1R6VA 4ZCTA 4A36A 1XJQA 2WMNB 4FGKA 3PNOA 2JAWA 2VYNA 4FJ1A 3GLFB 1KR2A 4DC9A 5JJKA 4XD7D 2F6RA 3SC2A 4RTSA 3FCXA 1V5WA 3BXFA 3B1FA 4QYIB 3U9TA 3M4NA 4RQAA 3BQNB 4YMVA 5A05A 2PUWA 2QMEA 3S4YA 2O14A 5IBCA 1HF3A 1L6IA 1ONPA 2H31A 1M10A 3OH8A 4OM8A 1ML3A 2V54A 4NCKA 4PR0A 3LGXA 1X1EA 5IAGA 3SJBA 4A6EA 1VXOA 3K9WA 4C4OA 1FFBA 3DZBA 1MDBA 5F1YA 3MGCA 2XA2A 5GADl 3DDCA 3UCEA 3WYGA 3OQNA 1C81A 3I01A 3KP1A 2VTBB 3QU7A 3CRNA 5LN1A 3PFIA 2GI4A 1JX6A 4F2WA 4Q7KA 1DQYA 1OVGA 4REMA 5EZ5A 4ALLA 2NQ8A 5T4HA 1E9DA 3AIKA 3U09A 4JYBA 1EE1A 2C61A 3HDHA 4WOPA 3AL3A 2IZ5A 4YDRA 4XXHA 4DUGA 2GDJA 4MHTA 1SD5A 1NX9A 3Q7RA 4QOSA 2A1TS 3PPYA 1P7ZA 4KVZA 4BL5A 4B17A 1UKVY 4RQBA 3WV4A 2C59A 5CIQA 1J8QA 1Q3TA 2R8XA 1I01A 1EM8B 3DHWC 4E51A 5BRJA 4F5DA 1H6AA 4Q3KA 1ODKA 1JPVA 2X8BA 2B37A 3MYRA 1O4WA 3EH1A 2J67A 3NUQA 5ITVA 1XTZA 5HZHA 2Q9AA 2FFBA 4Q21A 1QAMA 4X95A 2EX4A 1PZMA 4P33A 2C4VA 4AZSA 5CFRA 2FTKE 2ZFUA 5FR1A 3B1YA 3PE6A 1XZMA 1XZAA 1J2UA 3T3MB 2F1HA 4UEWA 4U7GA 3COJA 3C4QA 3FZEA 1XP8A 3TSYA 5IG2A 1TL7C 4CGZA 4C7JA 3R0QA 1EFRA 3N70A 2EP7A 4ZQBA 5H1YA 5ADVA 2QSUA 3MLBA 4BFUA 3PL5A 1CQJA 1MC1A 2OZPA 5EWMB 2ECFA 2V74B 4S05A 4YO8A 1AHPA 4HQLA 5A06A 2G08A 5KNLA 2YYZA 4EY7A 2C5AA 4U2FA 5DSTA 3L1VA 3FCYA 4B84A 1DTSA 4MQUA 2X5OA 5CBKA 1TA4A 2OFWA 3RSFA 3NNSA 2XTMA 3V4ZA 3AR4A 1O08A 3ZBPA 3IKJA 3BAFA 3HCPA 1TJPB 1FUIA 3G2LA 4GUAA 2DHDA 2PX6A 3F6RA 1R0YA 2V6JA 1DDGA 1YDMA 2DKNA 2HSJA 3A4LA 2UZAA 4YAWA 5JI3E 3I9MA 5ALKA 3A3PA 3MELA 4EO7A 1UBJS 3LQRA 3RREA 3O90A 1HLDA 4PINA 3FCEA 3SJ7A 3AR2A 1R6DA 4FOOA 2MT9A 2C4TA 4YAKA 3M5PA 4BX8A 2ZQZA 4L95C 3M3PA 2VPZA 2CYCA 1QX4A 1NXTA 3ONNA 2WD7A 3BEOA 2O1EA 3CGWA 3SE7A 4B4KA 3UJ6A 4C2UA 2C54A 2QX8A 4PRZA 1AS0A 1RI4A 3CX3A 1NNUA 4B75A 3WKEA 2GEJA 2NSHA 4JB0A 5LIPA 3EUEA 5TV2A 4LS3A 3I9V6 2WIGA 3LPAA 1P2VA 1V3VA 2IX9A 3OFVA 5THXA 3N6VA 4UEKA 2LKCA 1O54A 1KL7A 2YHIB 4MUGA 4QLBA 2HUPA 5CRIA 1CUXA 2WSIA 6REQA 2XITA 1XLWA 4OQ4A 2NUTB 2XT6A 1ZBDA 1USKA 1SB8A 2CJPA 2F48A 4M0CA 3CKMA 3CNHA 5LMCA 1XEXB 5CUQA 1NVUQ 1ORTA 5E2BA 2EG9A 5LQCA 4HRVA 2ZIUB 4XQ9A 5E1BA 4KAXA 1A2OA 4R2HA 4A8JB 3KE8A 3MILA 1G6HA 1ZD3A 2A33A 1HETA 2ZRPA 3IV9A 2BKUA 1L5FA 4OH7A 5KVQA 3K2QA 4M1EA 1TAUA 2VA9A 5CT9A 4FB4A 1CY8A 3G1WA 2FN7A 4AJ1A 5JLJA 4DLLA 3TOSA 1Z73A 3Q2IA 4UCWA 4JJGA 3ZGNA 4YPVA 1WSBA 3HVUA 3U9LA 3C7KA 4QM7A 1KEEB 3DF9A 2HK7A 3EEBA 4H0FA 2R6CA 4OY3A 4UE6A 3CWZA 4BGUA 2YV5A 1P4SA 1XRSB 3H2ZA 4KK3A 4FIDA 4Z4CA 1UDCA 2FUNB