4N0QA

Crystal structure of an abc transporter, substrate-binding protein from brucella melitensis 16m in complex with l-leucine using a crystal grown in a crystal former (microlytic)
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
344
structure length
344
Chain Sequence
DITIGVIAPLTGPVAAFGDQVKKGAETAVEVINKAGGIKGEKVVLKFADDAGEPKQGVSAANQIVGDGIKFVVGLVTTGVAVPVSDVLSENGVLMVTPTATGPDLTARGLENVFRTCGRDGQQAEVMADYVLKNMKDKKVAVIHDKGAYGKGLADAFKAAINKGGITEVHYDSVTPGDKDFSALVTKLKSAGAEVVYFGGYHAEGGLLSRQLHDAGMQALVLGGEGLSNTEYWAIGGTNAQGTLFTNAKDATKNPAAKDAIQALKAKNIPAEAFTMNAYAAVEVIKAGIERAGSTDDSAAVAKALHDGKPIETAIGTLTYSETGDLSSPSFDIFKWDDGKIVGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of an ABC transporter, substrate-binding protein from Brucella melitensis 16M in complex with L-Leucine using a crystal grown in a Crystal Former (Microlytic)
rcsb
source organism Brucella melitensis
molecule tags Transport protein
molecule keywords Leu/Ile/Val-binding protein homolog 3
total genus 122
structure length 344
sequence length 344
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13458 Peripla_BP_6 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4n0qA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4n0qA01
1D5WA 4RY9A 2MSLA 4EVQA 2L19A 1FQWA 1KMIY 4HNSA 2A9OA 3IP7A 3T6KA 2GWRA 4MYRA 1QNLA 1NXOA 3RVJA 1W25A 2FQWA 2QU7A 3N53A 4TLMB 2PUFA 2FQYA 4MR8B 3MF4A 2CWDA 4O1HA 4DQDA 5JNSA 4NQRA 3QLUA 3O1HB 4F11A 3KSMA 5FWYA 1TMYA 2L2QA 5T3YA 2RGYA 5IEBA 3URMA 1JBEA 3HCWA 4Z4EA 2I6FA 3H5VA 2LPMA 3C3MA 4W5OA 1M2EA 3JY6A 4HNRA 4EYGA 4KPYA 2MYTA 3MYYA 4H3KB 1M5UA 1KRXA 2E4YA 3K4HA 2LBPA 3LUAA 2FEPA 4L85A 3LMKA 3NNDA 4RSMA 2E4ZA 1GCGA 3CFYA 4WZZA 5CNKA 1EWKA 2TMYA 4LDAA 4JAVC 4LE0A 3KKEA 3HM9A 1ISRA 3EQZA 1JDNA 3F7NA 1NATA 4IGAA 5KQPA 4IRXA 1A04A 3DLHA 4Z99A 3H5WA 1QP4A 5DTEA 5D2CA 4DADA 2E4WA 4JA2A 4G0QA 2WMYA 1L5ZA 3MIZA 2L18A 5FWYB 3VNAA 3QX9A 1XHEA 3DZDA 1BDJA 4MQEA 5DLEA 4OLBA 4JB2A 1DCMA 3OO1A 3EAFA 4MGEA 3CG4A 5JNRA 3N0WA 3CKMA 4Z9AA 3GRCA 1LBIA 1FSPA 4RS3A 4EVRA 3KG2A 3KHTA 3C97A 4TN5A 2E4XA 4WT7A 3O21A 4OBBA 2FLKA 5IUKC 5CNIA 2JCGA 1I3CA 2FMIA 4EUKA 2QVGA 1JF8A 5E3JA 2A9RA 1JL3A 1U2PA 2NZVG 1OXBB 2MYPA 4XFKA 3OLYA 1BAPA 1A2OA 4G0ZA 4Z9BA 5KC8A 5DGCA 1WETA 1C4WA 4YGXB 3O1JC 2PLNA 1XWWA 3JVIA 2HPHA 1ZDMA 2AYXA 5F64A 4G97A 2W42A 2OENG 4RWEA 4LE2A 4EY3A 3N6VA 2FW0A 2MSWA 1FFWA 4OLAA 1AB5A 4Z4HA 1M5TA 5IBQA 1QP7A 2PUAA 1Z2DA 1IIBA 5ED4A 4PEVA 1NXPA 3NHZA 5JNTA 3DGEC 4UHJA 3OQOA 1GUDA 4YR7A 4W5QA 3IPAA 3JPYA 4MS4A 1ABEA 1K66A 4IF4A 2HJ9A 1PEAA 1PUXA 1EAYA 2IKSA 3I09A 2HQRA 1USGA 1JHZA 3IDOA 1QP0A 4QPJC 4G0OA 1CHNA 3LUKA 1Z18A 4LZLA 4XLTA 2FMHA 4TMYA 5JNWA 4QICA 5TQ2B 1A0OA 1BA2A 1K68A 3Q7TA 4YS6A 1L5YA 1VKRA 2IPNA 3E61A 3KYIB 3M9WA 1H9CA 1NXXA 4N03A 2V0NA 4KQ9A 4MS3A 1ABFA 5I4CA 2GX6A 3CTPA 4YO7A 5IUJC 4D74A 1JLKA 4GNRA 3T38A 4G0PA 2MYUA 3Q7RA 2IOYA 3QEMB 3QLTA 4MS1B 4F06A 4KMRA 1EWVA 3T8YA 3OLXA 1JFVA 3I42A 2XDYA 3HV2A 3SY8A 4RKQA 4ZMSA 1CEYA 3EDCA 5JS2A 1DP4A 3FFXA 3RH0A 4CBVA 5TQJA 1U0SY 1E6MA 1JFTA 1ZITA 1D2AA 3H5TA 3LUGA 2H3HA 5IUNC 3O1IC 5T7BA 3HZHA 1ISSA 3FFWA 2NT4A 2RJNA 5FWXB 4PE5B 3SG0A 3KJXA 4PICA 1HEYA 1ZESA 3CHYA 3CS3A 4ML3A 5TPZD 2RDMA 3HXMA 5JNUA 3KLNA 4MR8A 2FTKE 5TPWA 2PJUA 4JP1A 1Z25A 2WJAA 3H1GA 4LX8A 4YRZA 3MQ4A 1C0EA 3HUUA 3Q41A 2E4UA 1KGSA 5KC9A 5C5EA 4B09A 3G1WA 2A9PA 2NT3A 3KYJB 3N8IA 1Z16A 3LUCA 3RVPA 3RVNA 4QYWA 1RZRD 4NICA 1QMPA 3JS5A 3O2JA 3EULA 3OMWA 2YHAA 3SM9A 3JPWA 4KQCA 2QW1A 1RPJA 1P8AA 4PYRA 1F4VA 5TQ2A 1EFAA 4YWHA 2IYNA 2FQXA 2HSGA 3MA0A 3LUDA 3LFTA 4KV7A 5HSGA 4O5AA 2OQRA 3RVKA 4MS3B 3HUTA 2RJOA 4ZJPA 3TB6A 2VUIB 6CHYA 2MYNA 5EWMB 1GCAA 1JH9A 3H75A 1BVHA 3OM0A 5BR1A 4LRQA 2FXIA 2FSPA 1Z17A 3CRNA 3ROTA 1MB3A 3TX6A 3UKJA 3C3WA 1PHRA 1MVOA 4RV5A 4N47A 4EVSA 1DRJA 4FB4A 5KQMA 3OM1A 3E3MA 3LUHA 2PUDA 1DCFA 3FFTA 3I5AA 3UK0A 8ABPA 1LJUA 2CD7A 4N76A 3F6CA 2DRIA 2M98A 1DCKA 1Z26A 2FMKA 1FFSA 3HS3A 1Y1LA 4KK3A 4NV3A 1YVUA 4UHKA 2QSJA 5BRJA 4MR9A 2E4VA 3CU5A 3K9CA 4MR7A 1D1QA 1LK0A 1CYEA 3CZCA 1URPA 2P4UA 3H1FA 4RU1A 5FBKA 2ID9A 3LUJA 4P98A 3BRQA 2WRZA 2PKXA 4F8JA 4RY8A 2JVIA 5EWMA 1ZVVA 3QELB 4EYQA 4RY0A 3H5IA 2FKAA 2QVCA 3EGCA 4QYMA 3GV0A 5GQSA 4Z0NA 3GL9A 3JTEA 4RK7A 2PUCA 2AYZA 3BILA 3EJWA 1EWTA 4LDZA 1DC7A 2JVJA 1TVMA 2VYCA 5C5CA 1QKKA 4MQEB 1ZN2A 4Q7EA 3VNBA 1JWLA 3L6UA 4JASB 1RXEA 1YK0A 2F8SA 1Z13A 5HM6A 3RVRA 1AB6A 3ILHA 4E7PA 4Z4IA 3EODA 5GOTA 4WUTA 2IPMA 3W9SA 1QQBA 4W5TA 5HQJA 4Z4FA 2QV0A 2R25B 1R8JA 3IP9A 1Z2EA 2JBAB 3P9YA 4W5NA 1MAVA 2FMFA 2VK2A 5IC5A 3DBIA 1DC8A 1DBQA 4G86A 2X7XA 3QELA 3D8UA 2HQOA 4DN6A 1D1PA 3GBVA 1GLGA 5JNVA 3H1EA 5TQ0A 4RXTA 2WWVD 1VRVA 3FMVA 3NNSA 4MQFA 4MR7B 2WJWA 3O2QB 3NNNA 3RVSA 2VUHB 4RZSA 4S05A 4MRMB 4Q6WA 4EGSA 5BRAA 4Z4CA 3HK2A 1JFSA 4O1IA 3FGZA 3SNKA 2JRLA 4TLLB 1SD5A 4ZYLA 2CHEA 4W5RA 4KREA 1JX6A 4OATA 2N9UA 4PZ0A 4G0XA 4NCAA 4N0QA 3UUGA 3T95A 4N0PA 3C6QA 1M2FA 3LUFA 1QQAA 5CNMA 5EWJA 3TO5A 2R48A 1P6UA 3OMXA 1DBPA 3BRSA 1PNRA 4Q6BA 2A9QA 1JYEA 1E6LA 2NZUG 2JK1A 4XASA 1TLFA 3NHMA 2R47A 4D6XA 3H5LA 3HDGA 4ZMRA 4MPTA 1YMUA 3QLVC 2J48A 4WXEA 4RK4A 1YS7A 1NXTA 1U2QA 4RXMA 5KI6A 4ETNA 3A0UA 4MLCA 4KNYA 1ZHHA 5FBHA 1DRKA 2P9HA 2LIVA 1MB0A 5DCLA 3LOPA 4XAQA 1PEYA 1Z15A 3O74A 4G0MA 1YTUA 3RQIA 2YHBA 3GYBA 3OQMA 3ROFA 1QO0A 4MRMA 1JYFA 3OLVA 3IP6A 1VLZA 4RK0A 5DKFA 3MMNA 1U04A 4RK1A 3KS9A 3M6MD 2KYRA 2B4AA 3GBPA 3Q9SA 1EHCA 3GWGA 2IDMA 3SAJA 4YCSA 5B3JC 3CZ5A 4L4UA 2FLWA 3HDVA 1E2BA 2PL1A 1NTRA 1W9HA 2PUEA 3GA5A 4XXHA 2L17A 4OTZA 3O2SB 5EWJB 1PNTA 1ZH4A 1U8TA 4KK4A 5BQ3A 1USIA 5FWXA 2IPAB 1DBWA 3S99A 2CHFA 3RVQA 4YLEA 1ZH2A 1QO0D 7ABPA 2PE5A 1ZGZA 3KCNA 2B1JA 1YS6A 2GI4A 1TM2A 3QEKA 3LTEA 1XHFA 1E6KA 4YP9A 1T34A 3CG0A 4E7OA 3ILYA 3G85A 3Q7SA 3RVOA 3TMYA 4XARA 4MQFB 1QPZA 3OLZA 2JVKA 4Y9TA 4EYKA 4G0YA 3GT7A 5KQLA 2BGGA 4RK6A 1J56A 1RXIA 2O20A 3CNBA 2M1ZA 4NCBA 2FVYA 2JB9A 5CNJA 4MAAA 2GBPA 2IPLA 4KZKA 2F8TA 1P6QA 1F51E 1YK1A 2GKGA 3L49A 4P1ZA 1Z12A 3LKBA 5IEJA 1BDIA 4F12A 1DZ3A 2ZWMA 1SXHA 1JDPA 3HEBA 4GPAA 2WY2D 1APBA 4WWHA 4ETMA 3QK7A 3RVLA 3QLUC 4JOQA 1B00A 2PUGA 2MSKA 3D02A 2QXYA 4RXUA 4Z4GA 9ABPA 2QR3A 2PUBA 3DGFC 3LKVA 4IILA 5TPZA 3H6HA 3A10A 2LP4Y 5HKOA 1YIOA 3A0RB 3HO1A 5IULC 2ID7A 2LUOA 4KFCA 1MIHA 1P2FA 3CLKA 3H6GA 1NXVA 5B3JA 3HVRA 4N41A 2WB4A 5KWSA 3DLBA 3A3KA 5TE9A 4IMJB 4M88A 2FN9A 1D4ZA 1SRRA 4MR9B 2QZJA 4RK5A 2PAFA 4ETIA 3OLWA 3JVDA 3H5OA 2FN8A 1UDRA 3HJFA 1NXWA 3N0RA 2R4QA 3QEMA 4MS1A 3M9XA 3KTOA 3N0XA 4FE4A 2HQBA 3R0JA 5EWLA 3NBMA 1LBHA 2FEWB 6ABPA 3QLVA 1DJMA 4H60A 2FEKA 1LJLA 3IPCA 3B2NA 4YV7A 5KQGA 1SXIA 4MS4B 2H0AA 5PNTA 1GUBA 2NUBA 3MM4A 3F6PA 4WXMA 1DG9A 4S04A 5CHYA 4FE7A 3N75A 1USKA 1TJYA 3EQ2A 5TPWB 1RNLA 4OG2A 3HSYA 4H3HB 5ABPA 4LE1A 1YMVA 4F3TA 3TD9A 4JB0A 3RVMA 4HNQA 3QX8A 3F73A 3IP5A 5TQ0B 4MLDA 1BDHA 4KVFA 3Q15C 1ZAYA 4RKRA 4EYOA 3BREA 4RDCA 1NY5A 1SXGA 1KRWA 2JBAA 4IMIB 1FFGA 1S8NA 5IX8A 2Q5CA 3FDFA 4HYEA 3SQNA 1VPWA 5EWLB 3KLOA 2PMCA 1ZY2A 3O75A 4D6YA 1RZRA 3C3KA 2PL9A 1NXSA 3BBLA 3OO0A 4ZPJA 2ZAYA 5JS1A 1ZGGA 3I45A 4KRFA 1OXKB 3OQNA
chains in the Genus database with same CATH superfamily
1D5WA 1DOHA 1K08A 4FFPA 4H6WA 3TSZA 4DLAA 2R1TB 3AUKA 3M5DA 4N5IX 5DX8A 1SZJG 3G5LA 4RANA 4U6NA 2EXXA 4UC0A 4I66A 5LYJF 2HMYB 1CR2A 2B9EA 1T9CA 5EGNA 5I7HA 3NWEA 1M54A 4OB8A 1NXOA 5AWFC 1ZGBA 4BNZA 1RADA 2PUVA 5L4LA 8ADHA 5EC8A 3WB9A 2BKAA 1LWOA 2AFIE 1ZOPA 1UMCA 5BQPA 1DC6A 5LJIA 3HCCA 1C7RA 3RVDA 2CL0X 5CDTA 1GA1A 3V5NA 4CMAA 1JBEA 3FN4A 4EKYA 1O03A 1QV6A 3HUEA 4INOA 3WSTA 4F86A 2J0VA 4WCDA 1N3IA 1XNGA 1G2IA 4XQ9A 5ALYA 3VR4D 1XJ5A 2G83A 2QRUA 5DK4A 2LBPA 1HLGA 4ESVA 1XVTA 4XEHA 1NQXA 2X42A 1KFCB 4JK3A 1EFLA 1N8NA 1LSJA 4TV9A 1EWKA 1Z47A 4HMOA 4IQFA 1QHSA 3RYCA 4E07A 2PXCA 2WOJA 4DPMA 3H99A 4GRAA 1U1GA 4WAUA 1WMBA 3Q8XB 4Q4CA 3EDQA 3PC6A 3DLHA 5GINE 4B31A 3O4FA 1KVRA 2VJLA 3KC2A 1S3IA 2JC3A 3LA6A 4FI3C 4KE9A 4UHBA 5CB6A 3BYZA 2O8FB 1AX9A 2ZU0C 3L7NA 1Z75A 3CGWA 1P0PA 3RIGA 1XWFA 4HAYA 3E5NA 3L7IA 4KLAA 3UK6A 4CM9A 5M7EA 5SZJA 4HDOB 2DXIA 3TZ6A 5A5DA 1DKQA 3GLTA 4EB8A 1PS8A 3UEOA 4X45A 5HUQA 4MQEA 3ORSA 4H1VA 5F98A 4EHIA 2IV3A 2HUPA 1ODJA 4D57A 4Q3CA 4DDWA 5IW8A 4S0ZA 4F92B 4OX9Y 3E8XA 3C7AA 4RTQA 2AXEA 1PZFA 3VKGA 4G37A 4IJKA 4BLTA 2DTDA 3NGXA 5IAGA 2RHHA 3LPLA 2JPDA 1V1MB 4TQUS 3GN2A 2J41A 1RLUA 5EZYA 3LT1A 5DNWA 3V8EA 5J43A 3L8HA 1B6TA 1HO3A 1OFUA 3O21A 3FWKA 5A6SB 4H7DA 1ZUD1 3BH7A 1ZI9A 4QDJA 4Y6SA 1QGUA 2NZVG 4UUQA 5B6JA 3HB1A 3WK6A 2BTQB 1O1YA 4MWDA 5GGYA 1BCRA 2BN4A 1E64A 3M6WA 1O4WA 1E66A 2XVAA 4J4HA 2BMVA 1A8IA 4RZIA 1KPHA 4LRUA 1NKSA 4DVGA 4RWEA 4BQNA 3C4JA 2R6ZA 3CKKA 1JQLB 1QHGA 4LJ9A 5AYVA 3S2EA 1Z38A 4E09A 1Q22A 2UYGA 2XNSA 2ZB7A 3G0OA 3ZWVA 1YKSA 4M1ZA 3OF2A 4GGPA 5ALJA 4OM7A 2P67A 3EXIB 4EA8A 3KRTA 4X64B 2Y2UA 5CA1A 1JGTA 1A96A 3B2EA 5JSZB 4I3HA 4MS4A 3ZZMA 4L07A 5H80A 5HFJA 3D3KA 1VE6A 4IF4A 2XD9A 4OAOA 1C7EA 1RYMA 1AURA 1PUXA 1K86A 1EAYA 4CIVA 2PG3A 2V1XA 4K3UA 2YJ4A 3HP7A 4BMXA 1USGA 3IR7A 5CBPB 1QAMA 1DAEA 1YB7A 4P5DA 4BCBA 2FA9A 2GB4A 3BWBA 3M1IA 4WZAB 3GG9A 1QYVA 1YBMA 1D4OA 4YB8A 2W2LA 1VKRA 2ASEA 3MSCA 5C4GB 3CV3A 3DOHA 1TA9A 3CF6R 4B43A 2WDPA 3KTAA 4Z49A 4HAVA 1Z63A 3CB4A 4N54A 3TEMA 1PGOA 3COWA 3IODA 4WCFC 5JV5A 2C98A 1D6NA 4RSHA 1PFYA 4Q12A 1FNBA 2QG6A 3I42A 1BRMA 5DYIA 1NULA 1GNVA 2YS6A 1JKIA 3LC2O 1RCFA 4D8UA 1OWPA 3DUFB 3K9BA 1YB1A 4HFRA 1W581 1L5KA 3UV7A 4DNQA 2P1DA 4EMSA 1CUBA 2ICAA 2RJNA 5HK8A 3S2UA 5TQVA 2WE7A 4JI2B 4MUBA 1THZA 2VBFA 3OCCA 2CXPA 1U11A 1CRWG 1BGXT 1G8AA 2HV9A 2JHCA 4HSGA 4RSRA 3QYPA 2GM4A 1VIDA 5JXGA 2B3DA 3EOZA 1P2SA 2WJAA 3NBKA 2Y68A 4MICA 4I4CA 4DWOA 4DB2A 5A3RA 1YQEA 2GETA 3FNGA 1RAGA 3GRYA 4RL4A 2V7QA 5KC9A 1GAEO 5LZ2A 5C5EA 4XTCS 1JHXA 3ZE6A 2IS1A 3ZOZA 2B8NA 3O90A 4M55A 3NTVA 1ISIA 4UU1A 5GJVC 2R8YA 4D4HA 4YAEA 3K2IA 5E6RA 4OU4A 1SEVA 5H16A 3JPWA 3A1UA 1F0YA 4HHEA 2MSDB 2OXIA 4E6EA 2JGEA 3JAKA 4FDAA 1K06A 4J0JA 1CUEA 4PYRA 1U0JA 1SUFA 1YGPA 1HYHA 5IVDA 3MB5A 3HVUA 3HDTA 2I8LA 4MS3B 4JODA 3PNBA 3PQCA 1YAHA 3SF8B 4BMZA 2FWIA 3AETA 2D1SA 4I2VA 3H2HA 3UH1A 1DEOA 1J4AA 2QLLA 1H1TA 4OFZA 5G1PA 2IU0A 3NHPA 3RB8A 1LS1A 1PG5A 3AR6A 3EH2A 1JW9B 5CDYA 4DNFA 4MDYA 4BQIA 5HCIA 3DR3A 5LQMA 4P38A 3DEFA 1QK3A 4OMDA 3DYBA 2OCYC 2C2XA 2REXB 3NGLA 4J7CA 4NZZA 2C4KA 3QWAA 4UU7A 3T7DA 4IYRA 1I7DA 1IMOA 2GM9A 4D8TA 4RV5A 4YT4A 1Z83A 5AD1A 3LG2A 2Z6UA 1VE7A 3AF3A 1FRFS 3IKLA 4M8SA 3BF8A 4RMHA 3UK0A 4JT2A 1R2QA 3GQBB 1WKVA 2P6MA 5FO0A 1S2LA 3ECSA 1PE0A 2CNKA 2IIPA 3AI1A 3OPVA 4A16A 1E7SA 3I05A 5K45A 2ZREA 2FB9A 1WHSB 3OFKA 3RRFA 1ZIPA 1L8AA 1KTIA 2OB1A 3UCEA 3CY6A 2I4NA 1BHJA 4S3MA 4TV9B 2G9NA 3AW9A 2Z4RA 4BMDA 2SKEA 2O07A 4R0VA 2VHEA 3B3QA 1XPUA 4BPBA 1ZSYA 2P9ZA 2VF7A 2MT9A 3EGXB 4KWEA 3NH6A 1U65A 1L0BA 2YXBA 4R5HA 2EQAA 3EGCA 3EF0A 1SXJC 4B35A 4PYLA 1FDSA 4G1CA 4GKVA 4J4TA 4LI0A 2AYZA 2PUHA 4YGYA 4NZMA 4R8MA 4TQGA 5AJWA 5H9VA 3V97A 3WOHA 5IT5A 4QAQA 1ONOA 3H7AA 3WYBA 3JRXA 4XSGA 4BC0A 2ARKA 2JD1A 5ALVA 1T1GA 4U7DA 1QFXA 2IUSA 3G2LA 1ADBA 4HX2A 3EIHA 3PB3A 2W6CX 2YXDA 1OYOA 4PPNA 2FDRA 3EODA 2KSQA 5HTOA 4U5XA 2FOXA 3TMKA 3K1TA 1QQBA 3WXBA 2C20A 2NGRA 3HRKA 3P2MA 2H48A 3I28A 3UF0A 1QIKA 5CYOA 1CSEE 4EHJA 1ORRA 4Z54A 3C1UA 1YQXA 2IX3A 4IIHA 3ORRA 2OO3A 3GLRA 2A5JA 5IK2A 5AKZA 3W7AA 2UZ4A 2AJTA 1TU4A 1XTKA 1VL2A 4GI5A 4HS9A 4B2PA 4IM7A 1VPLA 4YFYA 3EAQA 3KOOA 2AKYA 1E92A 5KO2A 4ENUA 2P2CA 4MQFA 1GOTA 3DXXA 1KI7A 3B5JA 2PFKA 2ODBA 1CS0B 1QQ5A 1P0QA 2ZSKA 2L0XA 3VZRA 1WUKS 1O8BA 1ZXXA 1WRBA 2OLKA 3RS8A 5JT1A 2X9LA 2JRLA 4FR5A 2PU7A 3E35A 3QVOA 1H2HA 1WP9A 3Q0TA 1YGYA 2HA7A 4XVQA 3VU3A 3Q6IA 5I51A 1RLJA 3M6LA 3JR7A 4CL0A 5AVVA 2BCEA 4MITA 5ICGA 3UWDA 1CE8B 4X7MA 5BSRA 3NBQA 4LZZA 4C2BA 5BN4B 2BFBB 3QPAA 3EEOA 4CM1A 4JMPA 1O8CA 2G3YA 5H02A 4LCEA 1G3UA 1NYQA 2EV9A 4O1MA 5HWSA 4CM9D 1VL6A 3HVHA 1PQ4A 2NN3C 2DPGA 4XASA 1VDMA 1ECPA 2B83A 2HV8A 1WM1A 2ZDGA 3LW8A 4EHDA 3KXPA 2P40A 4OF4A 3IJRA 2I4RA 4PLVA 4B83A 1Y1TA 2GPWA 3BRCA 4MPTA 4UTVA 3EGOA 3G2NA 5AJXA 1K5DA 4QPPA 3WMEA 5KI6A 9ATCA 1JMYA 1Z06A 4MV5A 2EX1A 4LGCA 4DKJA 1NG1A 5C7IO 1ZHHA 2FPIB 2VTVA 3QTLA 4MJ7A 5KNDD 3NS7A 3QSGA 4NFSA 5KPDA 3K0FA 1CQZA 4OGGA 3P94A 2O6LA 2D1TA 3ZDQA 1LSUA 4UHHA 3EZ7A 4AX8A 1XZLA 4WKNA 2I2DA 4ITUA 4JQOA 5FNVB 4G4JA 1D6JA 5DHFA 4HQLA 3DUFA 4QNRA 4ZI2A 4I36A 4ZQEA 4JBHA 4R1PA 4TMTA 3W6UA 3GNLA 3VR2A 5JVDB 1U0RA 2F6RA 3D2AA 3HCBA 5CJ2A 4CIAA 1Z82A 3M6MD 2ZT6A 4AB1A 4YRQA 4WJKB 5DN9A 4YREA 2ZTUA 5MGBA 1GVHA 3N59A 4MKRA 4RF4A 4RTJA 1RBMA 2C3PA 1JT9A 3UAVA 2BH9A 5TRTA 4RJTA 1VA4A 3ANYB 3T5DA 2XNDD 2QTCA 1X7YA 5CB4A 4LEIA 3IJPA 4FONA 3KUCA 1F20A 4WOKA 5EG5A 5BV2P 2XCUA 4HX5A 4YV1A 2QRVA 3M33A 4LRXA 1KQPA 1DBWA 3UV3A 3P5SA 1R4MB 2CHFA 1H5UA 3RVQA 3A1FA 4UEQA 4LC0A 4HNVA 2FW6A 4NE7A 1U63A 2ODWA 1N25A 4HAXA 2EW1A 1IOZA 4KQWA 5B64A 2AOUB 3GFPA 2E6UX 4YP9A 1BMDA 2V3WA 2IP4A 5EKDA 1KH2A 2JJ8A 3V4LA 3ZLTA 2B2XA 4W1SA 3TGWA 4EPWA 5LU9A 5DV9A 1J56A 4DGSA 2CJXA 3I0ZA 1TA4A 4NK4A 4G5HA 2X8WA 1PK9A 3E0QA 2Q50A 4HDQB 5AIAA 1QVZA 2EBFX 2ZQZA 3OIVA 2CT8A 2A0KA 2BFFA 3RO7A 4NZYA 3ZDXB 5BNIA 5KIAA 2GR9A 1OBHA 2GKGA 4XWKA 2WKRA 2QM3A 2O1EA 4YMHA 1KGDA 3ZD9A 4H3VA 2PTHA 2UVPB 1SXJA 3M3PA 3MTJA 1KERA 3MQFA 2HWUA 3QXJA 4NS1A 2LCQA 3MIIA 2WINI 3DCYA 2G82A 3UO8B 2FNAA 4WN3A 1QWSA 1C7IA 5L7YA 3AFIA 3GEMA 1O7JA 5AUNB 1OQAA 4N9QA 2MSKA 5JYDA 2AOXA 3WZLA 2VSQA 4OHKA 1F6DA 1QHXA 1XTZA 9ABPA 4XDGA 1T0PA 3BWCA 3G7SA 4GYWA 5JS6A 5BYAA 3SX0A 1XTIA 4A5SA 5K8TA 3AIMA 1J0EA 4TM7A 2VNIA 3NX4A 1FDIA 2XWSA 2B92A 1MIHA 2ZUBA 4NBKA 5IN5A 3TUIC 5A5VA 5LIPA 3ROKA 5JR3A 1P9NA 2GS9A 3LC7O 5C1OA 4QT0A 1VYVA 4OLHA 1C9YA 4WKBA 1Q11A 1B8VA 2FN9A 5B4VA 1SRRA 2JGJA 2W0SA 4ZVRA 3DW1X 3WGZA 3B1WA 3EISA 2DCUA 3MTIA 1KL7A 4OHOA 1QQTA 1YH3A 5F2OA 2XYVA 2YY6A 5EVJA 3TAXA 4Q9IA 4F38A 3ITNA 1AKRA 3GRZA 4AU1A 5CDGA 3FLMA 3LS2A 3GUYA 4PLGA 3L7BA 4Q7LA 1JIXA 4OGWA 3COJA 1P44A 1IJFA 1CJSA 3R6DA 3WK8A 1GHTA 1KK0A 1PTJC 5H81A 3TD6A 4OHFA 1LZKA 3DXZA 3ZV3A 1CUWA 2XUFA 4DLVA 1DJMA 3AB8A 3LT0A 4FINA 3I2IA 4TVKA 2G4LA 3EOBI 2RBGA 1F0PA 1YT5A 3GT4A 4AECA 3DMTA 3NPAA 4B6PA 3OX4A 4B6FA 1OB2A 3EYAA 1IWOA 4O6VA 2VPWA 3C41J 3A3OA 2BHRA 7ADHA 3L0SA 5L3QA 4KXNA 2EP5A 3N75A 5CFNA 2EFJA 3A9VA 4HDKA 4OQMA 3ZQJA 5AOCA 1TJYA 3E53A 3LVRE 2CNNA 2G76A 4DJDC 3OM9A 3FE2A 3K1AA 2H17A 4L5JA 3UGQA 5ABPA 1GG5A 3L7AA 3QVSA 4IDFA 1FUUA 4RQUA 3UA4A 5FP0A 4N5LA 3GLFE 2GK4A 3LGAA 4GU5A 1XKTA 2YY5A 2K5UA 2J4FA 3H5NA 3UBTA 2BMJA 5F5LA 1W1IA 5EKUA 2WBLC 1MO5A 2YWXA 2YWHA 2C07A 2QENA 2P6PA 1VIAA 4IDPA 2I1WA 1Z8NA 1XTPA 1FLVA 4KWCA 3DFZA 1X42A 2AOTB 4JU8A 1N0IA 5K51A 3COYA 1UBUS 2I1LA 1GU0A 2DP4E 3OO0A 4NR0A 4MPRA 4EDHA 4Q00A 3FLBA 4KMOA 3W79A 6GPBA 1NX9A 3C15C 5BMVA 1LRLA 5DBOA 4TS4A 4MOWA 2PEZA 5ECWA 4F6RB 4HUQA 3IQEA 4YIKA 1DQNA 1FTSA 1ATZA 1IZ8A 1FQWA 3FCAA 5EKXA 3V8VA 4ZZ3A 2GJ8A 2BEKA 2HJHA 3WKDA 4KGZA 3ZVMA 2QTWB 2YVKA 4AZ0B 1X94A 3FDJA 5D01A 4FHDA 2BONA 2NO5A 3JQ8B 2REQA 5HFNA 3FTNA 3OESA 4IO1A 4KIUA 2YMQA 3QLUA 3QKIA 4ZQFA 5ADVA 3ZWWA 3KETA 1G1AA 1T25A 2JASA 5HF5A 4I6JA 1V5FA 4RTMA 1UIRA 4NSNA 4J0QA 4EELA 4XWGA 1GSAA 3A6HA 4N5HX 3K0AA 3WB1A 2FCAA 5IAEA 5BQOA 4Z8YA 2ZR9A 1JG3A 3MWFA 4NV1A 1UZLA 4RPIA 4ZYUA 4QD3A 2ZETA 2RH8A 3V4VB 3M6AA 3CVUA 4D3XA 4FYWA 4RSMA 3CNEA 5JPIA 4FFLA 4IIBA 1G4AE 2TMYA 3MG9A 4N48A 2VRCD 3X1MA 3DKPA 1SBQA 4IGAA 4FQ5A 5JCOA 3HXOA 1QH1A 3RC7A 5HM8A 2X3UA 1HLPA 3B8EA 1QHYA 1Y4AE 3QWBA 3SYKA 5IZCA 4OFBA 4ZO4A 1H3NA 1QOZA 1U1FA 4EGJA 4YUZA 3Q85A 1I94B 2P6OA 1HM5A 4B6RA 1YE8A 3VSCA 1SY7A 3QX9A 4ARZB 3DZDA 4EEZA 2WYVA 1E2UA 2SKDA 5D87A 2FEOA 2BF7A 4YT5A 5IKMA 4M83A 3NWPA 4Q3DA 1Q0UA 4QFCA 1SVOA 4KO3S 1ENYA 3OO1A 1H8HD 4IZOA 3AU9A 5F12A 4OAPA 1DQYA 3N0WA 1ENPA 3CLSD 2PLAA 3H9EO 5AI4A 1HTTA 1NW4A 3MBKA 3ZCVA 5DSXA 2QRPA 4DCGA 1JPJA 4EDFA 4LJRA 3ESAA 3NETA 3Q3IA 4Q24A 2PIDA 2YIMA 1ZSNA 3IERA 3GLGA 1W5FA 4OBBA 5H0IA 2DM6A 4OUDB 5K6TA 1K4MA 1QRTA 1ZVMA 4ZT5A 3OPYB 3CX7A 3NT2A 3PNSA 3OZDA 5CIYA 4YGXB 3WLOA 1M6YA 2EZUA 1M83A 3NJRA 3PGA1 5LZ4A 1UMDA 4AJOA 3EE6A 1EI9A 3AHDA 2OD7A 1ZWLA 3H4VA 1WCIA 4E3WA 1EXWA 1Y9EA 1BW9A 2MSWA 5DM2A 1YZTA 2HNKA 4JV5B 5CG2A 2VWQA 1M5TA 4MUNA 3WJ7A 1QIHA 2GZRA 1QG0A 4XGQA 2CUNA 5BSMA 4BMOB 5BP7A 3ZJYA 2PMBA 4QU5A 1V1JA 4JSYA 4PNHA 3R1IA 1ZIDA 5AXCA 1SB8A 2ADMA 2J67A 2H4XA 3IPAA 3JQ7A 4O59O 4YR7A 2Z3VA 1MHTA 2ROQA 1DQSA 3NANA 4U8HA 4DYDA 1AGYA 1AJEA 3V1KA 2IKSA 4XRGA 3TLMA 2E85A 1WUIS 3L05A 4C7VA 2W48A 2XNDA 2BKLA 2YMPA 4IXDA 4EM6A 2O7QA 2EFCB 5BRNA 5K01A 2WWWA 2FR1A 3CPSA 3IAM1 2A1TR 4YV0A 3WZ2A 3KKLA 1SXJD 3A25A 3L5OA 3CMMA 3DMHA 1SOAA 3JWJA 1N2OA 1V1MA 2Z95A 4XWYA 5AKLA 1SHKA 2H1IA 3IBYA 3NUZA 3QBDA 4OQFA 3W2EA 4CM3A 3DQZA 1XUOA 3T38A 3NYQA 3TLYA 5HE9A 4AKSA 4F1KA 5KTMA 4FT2A 4A15A 3BULA 1JFVA 1B2LA 2WF8A 4HZUA 2LDXA 1UJCA 4YI5A 2JCSA 3EDCA 4LVCA 3MMZA 3AF0A 3BQNB 5EIFA 1OU4A 4MV6A 2B99A 4ZI3A 5TQJA 1T2VA 2OOKA 1VSUA 4KR0A 4K6GA 5TMDA 4MUGA 3SQOA 4WY8A 1H69A 4HFMA 2X2FA 3RBXA 4HJRA 2ANCA 2YV1A 3FUVA 2HXSA 1PQYA 2HWYA 3CHYA 3Q7PA 4NYMR 1H3FA 4BXOA 4V0KA 2GEBA 4Q02A 1DI0A 1AXRA 3AY6A 2ORVA 1XPRA 4QM7A 5E1DA 2JLVA 2O54A 1BKSB 5ITZA 4UOZA 1AUXA 5JZSA 4AZTA 4EW6A 1V6SA 4RTPA 4EKIA 1HDCA 3H9BA 4KPUA 2NO1A 4NOJA 1Z5VA 2PMWB 5T8KA 2FWJA 2JIMA 3JVEA 1VE5A 4QYIB 2NUAB 4YPOA 4ZYXA 3PRYA 5KNCA 1RZRD 1E4OA 1E9AA 3K9NA 1FUEA 4CCSA 4V1CI 3OOYA 2N46A 1I2MA 2IDZA 2YXLA 3H4MA 2VDRB 1GL7A 2BI7A 1YSCA 2MMCA 3MWGA 3PR2B 3M81A 4A8HA 5KQRA 3AM1A 3GEDA 3VR2D 1RD4A 3EA0A 4WBSA 3ZGZA 4Y1RA 3QVLA 4YP5A 2ZJFA 3DWGA 3DCJA 3HCRA 4N3GA 3S5JA 1X9IA 3QF4B 1H2AS 4UZEA 3WQBA 821PA 1OWOA 1SPBS 1T2UA 3U13A 4CT0A 2DKNA 4C0XA 1C3EA 1PG2A 3KIPA 2ERCA 2C92A 2VUIB 1GTL1 2C9CA 2NU6B 1U1DA 2OYSA 4P92A 3NM4A 4BV2A 2OCDA 3IULA 1BVHA 4WCFB 4TL8A 2C8VA 2WJJA 4DNOA 2UXDB 4LGYA 4ZVSA 3RHTA 2W6QA 3UGJA 5BMVB 2P5SA 3PFGA 4XCQA 2V6FA 3CLTD 2GD2A 4NJMB 2J5RA 3RSLA 2M6SA 1GJRA 2Z1DA 3B6JA 3R24A 1LQUA 1D0VA 1J42A 2Z83A 3UA3A 5LQRA 1I7PA 2AHOA 3O8QA 3DF7A 1V8PA 2B7BA 2C7BA 1TXGA 2JEYA 2REBA 3CJRA 3EGDA 5I7OA 3DAHA 3PU6A 4M3NA 1WA5A 3GP3A 1ZN9A 3OFSA 3OHSX 3I8OA 4NECA 3BM5A 1NW8A 4ROTA 1H2FA 1ZW6A 3CU5A 3ZW9A 2AXQA 3CLHA 2ZI4A 3R3JA 2Y92A 1R8XA 1U2SA 4RVOA 3R7NA 4L95C 4BL5A 1VCHA 2J0EA 2P4UA 2DEUA 4B74A 3D1LA 1RKXA 3L2OB 2QVZX 1EGQA 3GQVA 1TM3E 4BEJA 1A82A 3CCCA 3ZCSA 3G6KA 1GGKA 3GV0A 1CU1A 2RD2A 2HUNA 2QLFA 1XDSA 1FFYA 1QP8A 5ED0A 1Z6AA 3FCEA 5THKA 3C6BA 3OFVA 5IBPA 1T6XA 2O57A 3A9TA 3U31A 4DNXA 4DQKA 4BGDA 4NYIQ 2OHJA 3A4VA 4JC0A 5KWEA 3L6UA 1U8CB 2W90A 4YCDA 1S3SA 4NDAA 2BT4A 3BHIA 1GL3A 3TLCA 1SM4A 4MGYR 2HCRA 3F8SA 3JQFA 4I46A 4U7GA 3CLRD 4J3JA 2ZAIA 4XPIA 1Z34A 4J6FA 1SCAA 1NVUQ 1FXWA 1BXKA 2HK8A 2ZXFA 3P9YA 1N78A 1SU6A 5DM1A 4WJZA 3TZBA 2PLRA 1FXWF 4M7RA 2XMBA 3IH5A 3IHWA 2IUFA 4RLQA 2X7XA 1YE3A 2ZJ1A 4B4KA 3L84A 3NTXA 4JFAA 3THRA 4PINA 1F5SA 2P3QA 4YDSA 2A3NA 3D9QX 1NMEA 2G8LA 2HRBA 3ZNNA 1EP3B 1KAGA 3ZUPA 4ZFNA 5IASA 2UXCB 1LV8A 3UWOA 2GEFA 3ADOA 4PG7A 2QN2A 5EE0A 2FRXA 8AT1A 1LTQA 2YVLA 3B3GA 5KDLA 1P1KA 2IYXA 1UK7A 5JU6A 2FOIA 2P9TA 3MZ0A 3OT1A 2ZK7A 4CIBA 5IJ9B 1E2DA 2RONA 4AP5A 2B8WA 2AZXA 4KZPA 4I0WB 3RC9A 2WHRA 1N2XA 1FBTA 1MB2A 3ER8A 1QV9A 1LQ2A 4X95A 2NVBA 4HDNA 1NIJA 4FYJA 1BFKA 4ZT4A 2CMDA 3HVKA 4NKRA 4XGIA 3TCKA 4KR3A 3G0CA 1GG2A 3NYRA 4BNHA 5KU7A 3GJTA 1WCIB 2XXJA 2WHYA 3O92A 4KR9A 3AV3A 1WAMA 5LBIA 3KZNA 1DRVA 1SU7A 2C4HA 1SHZA 2BUCA 4BTVA 4J90A 2NUPB 1E32A 3FYDA 3I92A 2AXNA 4LBWA 4DW8A 1HE3A 4EFKA 3QFTA 3MWJA 4OJMX 1Z6QA 2Q1XA 3JYHA 1JDJA 1JHVA 4DEXA 2FZKA 4JDUA 2GVNA 2YHIA 2GA8A 1E2HA 2AJLI 2HKIA 2P9GA 2Q3HA 3B9QA 3JQBA 1YS7A 4HBGA 3RK1A 4G01B 4JL5A 4EG5A 3NVMB 1CNFA 1TUIA 3RAEC 2VJMA 3SJBA 2VXBA 2W37A 3A04A 5JEDA 4QU9A 5TLSA 1DJOA 4NOLA 1Z15A 2H9YA 3GFRA 3VUFA 1K4KA 2NLOA 3AWDA 4P4GA 3MT8A 4P5EA 3OQMA 4N0EA 1RWNA 2FETA 5FA8A 4YWJA 2DHDA 2IEGA 5EKSA 5IZCC 4C3OB 5F2EA 1NRIA 3OIWA 5DKFA 2PBRA 3PZBA 2C9ZA 4F3RA 1UJ4A 4OXNA 2X4IA 4F3YA 2AN5A 2H59A 3TTXA 3AEQA 1WXGA 1OYWA 3EZGA 4YLGA 5DM4A 2AEMA 2BGRA 1R6AA 1R0LA 8ATCA 3B1JA 2Q7XA 3KAKA 1VI5A 3BC1A 3O2SB 1P1JA 2O52A 2QM7A 3GGGA 5FULA 1CE8A 2V65A 3RS7A 2IOFK 1USIA 4PQEA 3TZQA 1F0KA 2UUAB 3GK3A 1S1CA 2UYOA 4WZBB 4PYNA 3U16A 5FHRA 1DEKA 1H8HA 1FNDA 2IXGA 4N5DA 1B0UA 1A9XA 4PTZA 2W4QA 4GDMA 5CB0A 3JALB 5E2AA 1ISPA 1EVYA 1SBZA 1SCUB 2HMTA 1Z3CA 3CRQA 1TT7A 3H8SA 3QOWA 3W8FA 2YJ6A 1RR6A 3KOMA 4I8XA 3JQPA 1Q91A 3TOZA 4ZCTA 1GGNA 2ZROA 4M2LA 4DFDA 2FEXA 2GGSA 2WT8A 1CB0A 4JYMA 2C4VA 1O94A 3FWZA 4LGVA 2IHZA 4CMGA 3IHLA 4YMGA 1COWD 1Y1RA 3D4OA 3P27A 4K9SA 4U2FA 3M9LA 1JHPA 3M1AA 3T3MB 1LDNA 4FDLA 3DEZA 3FR8A 1XSEA 3SI7A 3I23A 1NUSA 3GMDA 1XAHA 3NGMA 1QTNA 4ZAZA 1WIWA 1PS0A 3EFHA 3ZY5A 1MEEA 2DSTA 4B75A 5JCXA 2IZ7A 4ER0A 4UFPA 2W0MA 1Z12A 2H5IA 4I4TB 4JQZA 4C01A 5KYGA 2Y1OA 4C43A 1V5EA 3HZOA 4ZEWA 3EQ9A 2OBFA 3HEBA 2XZLA 3BWYA 3T54A 1V39A 2PEYA 1XTRA 4ME6A 2J30A 2EJWA 1UM9A 3NHUA 1AM4D 1JQ3A 4LBYA 4C4OA 1DIOB 1B00A 2OAGA 4N3AA 1KSJA 4ZRDA 1W44A 1NHGA 4W5JA 3M8KA 4R1MA 2VUUA 1WLSA 2AIRA 3HV0A 3GC6A 2V7BA 1S2DA 3AJRA 1N2EA 4GQAA 1NOJA 2GT1A 1AC5A 1Y1KE 2FP3A 2LGJA 3IAHA 3STXA 3ZR4B 2ZATA 2BELA 4YK7A 2PYIA 2QMYA 4JB8A 1TUBB 4UATA 4UCXA 2OCXA 5A71A 3SS8A 2CXQA 4J7XA 4Q9LA 3MWDB 4FXPA 1RMTA 5E2IA 4D3YA 4C87A 2OZLB 2OGWA 3PRHA 3H11A 3D54D 5CBKA 1JB1A 3PQ6A 3Q6NA 3OLWA 4H9GA 3NV7A 4QFMA 4GR9A 4J2TA 5DWDA 4XGNA 1G8GA 3TECE 2R4QA 1N8TA 3RF6A 1LX6A 3M9XA 3ECAA 5ARCA 2GNOA 5E7QA 4N0DA 5AHXA 4JLNA 4NU0A 1WSWA 1C7FA 1V1RB 4G65A 3QEOA 5AI8A 5BY2A 3R8FA 2ZULA 2GF2A 2V5VA 2ERYA 4L7VA 3UN1A 5EMLA 3OZFA 5KQGA 1OLSB 1MIOA 1WXQA 5EIXA 2H1HA 4Q82A 1Q44A 1KEZA 2J31A 4YMWA 5ILGA 2QQFA 3BN3A 1XTTA 5DGTA 4BIMA 5C8VA 5A62A 5FTLA 1J70A 1HYEA 3THXA 1RXWA 2HDNB 2ZSDA 1G6Q1 2ZIEA 3ABIA 2F4VB 3A6ZA 4TYWA 1PLKA 5HRAA 4TXHA 4BBAA 4E5KA 4FSXA 3AEUB 1Q6ZA 1IWBB 3KELA 3QA3E 4YUVA 5BN5A 5I7EA 3OM8A 3MUNA 4CLXA 4QE3A 4B3SB 3QX8A 3K20A 3BZBA 4FK8A 5TQ0B 4TWBA 3ZBPA 4C6RA 4DB4A 4O3FA 5JCJA 4WL0A 4AULA 5LYJB 3ORHA 2W11A 3W2IA 2G88A 1E7YA 1TMKA 3A6GA 3O5AA 1XAJA 1BVRA 5JCZA 2P8JA 2O4UX 5HVNA 4IIJB 2VSYA 5T5QA 5KREA 3OFJA 1ONBA 3ENQA 3L0ZA 1DTEA 2X8JA 1Y8RA 4KE7A 2ETXA 1GPLA 1L5WA 1KPGA 4M8KA 3T3DA 2VDOB 2QL9A 1E2MA 3KB8A 4G1VA 1MF7A 3NAZA 3PD1A 4M0CA 2O2EA 3FVVA 2B4QA 1FCJA 2VHVA 5LMUB 1GCIA 3WA6A 1IFXA 1LW7A 1XZJA 2Q4OA 4HSEA 1L5SA 4INJA 2IC5A 3SMQA 3ZGXA 2LRHA 3OSUA 4XGRA 1H22A 1UKCA 3ZHYA 5CCBA 2IKQA 3RVJA 4CKXA 1FRQA 1OX5A 2AJCA 2RBEA 4TLMB 5BVHA 3AHFA 1FYWA 3HN2A 1WE2A 3NYIA 1J0BA 4ZMBA 4YQEA 1RHJA 2OZPA 4B6SA 4CMIA 4P58A 4DMUB 3O1HB 1NQWA 2CXNA 3M6FA 3ZE7A 3CZRA 1HMPA 4MULA 5C1DA 2IHJA 5AK4A 4IFEA 1A97A 4ASUA 4CODB 4AUEA 1X1DA 1A72A 3CUYA 1ZL2A 2YNMA 4HDKB 2LCFA 1N6HA 2MINB 2ZJ8A 3C3MA 3A4YA 3QPDA 4TRJA 5JI2E 2H31A 1B2RA 1Y6ZA 2DT5A 2GPYA 4WI1A 2QW8A 2ZUWA 5BUQA 4R9RA 4GH5A 3ND9A 4GG1A 4L8VA 4L5AA 4DLSA 3ZWOA 2NTYC 2NSYA 2XGOA 2IHBA 1I6WA 3QY9A 5ALOA 5JZVA 1DAKA 3R23A 2BM9A 4G5SA 2J9FA 1KAEA 3FYTA 2O8EA 2FSIA 4RABA 1A04A 2DECA 4Z99A 1YBAA 4MNTA 3WRXC 2BTQA 4JA2A 3H4IA 3BL6A 4TTIA 4C1NA 5EPEA 1NJ2A 4BFVA 4PFJA 4PCUA 3ZE1B 4PZZA 2JZCA 3LX5A 2Q4DA 2PQMA 1XF1A 2W2KB 3F6BX 4WPGA 4QELA 5EXTA 3WGQA 3EWIA 3UFXA 1CC1S 4U8GA 2BZSA 4NS4A 2YL2A 5J1TB 1CQJA 1X7XA 4U00A 1XZPA 2EKDA 1LLDA 4BQQA 5BYKA 3DE5X 1RRCA 4YRJA 2DX7A 2JIBA 4PPYA 6REQA 4WACA 4C3VA 4PG4A 3DQPA 5EIBC 4DWWA 2H65A 4YAOA 2V7TA 3VPAA 5CR9A 3PVSA 3EWNA 1PS9A 1SCUA 1JNXX 4Z9AA 4ZVTA 4WKGA 5FLXA 1W36B 2LDBA 3ILXA 3IP8A 2F7SA 3OOJA 4M0UA 2AJDA 4X44A 5G40A 1GZVA 2IZ5A 5HILA 1YFJA 1COWA 4HDAA 3BTOA 4LQCA 2KBFA 2F67A 3ZLJA 2V4UA 2BR3A 4IWYA 3ML1A 4P4SB 2HJVA 5FKJA 3VPFA 2PBLA 1O2DA 1JEJA 5I4BA 1EINA 5K0CA 4DJEC 3KO8A 1F0NA 3DKIA 5H7XA 5KC8A 4WZAA 3FOCA 3SQLA 1NR7A 2GPSA 3JWIA 4OLFA 3TLEA 4DBZA 5EXEA 1KS9A 1M8GA 1KDTA 1OHHA 4G0NA 2BKVA 3TNFA 2OENG 5HIKA 1XMOB 1IN1A 5A06A 3MK31 4JROA 1VBNA 4K86A 3F7TA 4TSFD 4KQKA 3KEGA 4YJGB 4TOIA 3MAGA 2P1ZA 1C7ZA 1X2BA 1RWWA 3H3XA 4LJ6A 4Y3UA 1U3GA 2GN0A 2Q5JA 2WG1A 5EJ8A 1MVLA 2WG0A 2DR0A 4JLSA 3CVXA 3ZE8A 3OQOA 3DDNA 3MYRA 1RZVA 2DPYA 4N7JA 3SLRA 3UWPA 4ER3A 1GZ5A 3S8YA 2UYHA 4FFSA 3MAAC 3G82C 2HJ9A 2OCBA 4ZYTA 4WMLA 3I30X 4TKUB 3S27A 5JRZA 1AGNA 1PT9A 3N05A 4LWZA 4P7FA 4CQLA 1R5JA 2ZM5A 1MZVA 3QF7A 1T1SA 1XCOA 1YB4A 2HBQA 2VHJA 3I39X 4TSKA 4X41A 2YNMC 2ZBVA 3G23A 4FNOA 3L77A 3I4FA 3UHJA 2CJFA 4RFVA 2WAXA 4EF5A 2ATXA 4H0CA 4F4IA 2DETA 3KXDA 2D5LA 1UL1X 4IDCA 2ZPAA 1K68A 5IFKA 1JSLA 3O4VA 1E8NA 3E61A 3H87A 4C6HA 5CG1A 5CCXA 3RTDA 1Y7PA 3R7AA 3MVEA 5AW0A 1NXXA 4TYNA 4JLWA 1EP1B 2FHSA 3ZI4A 1CY1A 1KMMA 1WDTA 5F1YA 4LI3X 3HKCA 1BFDA 4CV3A 1DJPA 2UZ0A 5B1DA 2OQIA 3SJUA 4B3FX 4X65B 1Y3BE 4C20A 1XJQA 1CNEA 2DWOA 1PT8A 1F1BA 1QFZA 2O5EA 1U1EA 3E2MA 3E9DA 2M1XA 5IDVA 4F7DA 5LMZA 2QLMA 3ED5A 1XKLA 2IYAA 2HHAA 3PTZA 3DE7X 2Y0EA 1Z4KA 3BDAA 3OA0A 2R5NA 1T9ZA 3TXAA 4CEIB 1XKQA 4V0QA 3GJ3A 5EXPA 3ETNA 3FFWA 3RRMA 4FR2A 3D6JA 2CNBA 4B80A 4WE3A 1SZPA 1XNJA 1F2DA 1XK7A 3I6QA 4PICA 3ZK7A 2B6NA 2E3JA 3DV0B 4Y9SA 2Y2VA 4ALJA 5HUJA 2ACKA 3MN1A 5JNUA 1N3BA 2OD2A 1DAMA 4II3A 3K5PA 4U7JA 5CDHA 1N5RA 1BWPA 3OC6A 3QU2A 5AHOA 1JAYA 4B3GA 4IHKA 1UM8A 3I9LA 2OPHA 2IZOA 3V8MA 4KR7A 3DLIA 1CRQA 4YRRA 1ZC3A 1EVLA 2E4UA 1FZQA 2VNAA 1KGSA 4QULA 4M1QA 4B09A 1XXHA 2WZDA 5KKCA 2R00A 1WF6A 9LDBA 5ANRB 4QLAA 4TLDA 2O8CA 3GNQA 1TI7A 1EQ2A 4V39A 3RG2A 4KHZA 4OJNA 4TRNA 5KYYB 3ZY2A 4PZAA 1EFRA 3D43A 3RIEA 1D7OA 3QFFA 2OQRA 4PFKA 3RVKA 1UBEA 3HUTA 2A3RA 3R9XA 4F56A 5T8KC 4IO0A 1Q77A 4Q21A 4QUKA 2XB6A 3FNEA 5CDFA 3TB6A 2MYNA 5EWMB 4BWFB 2O0MA 1KJZA 2WV9A 3EYWA 1WBBA 3T61A 3DZIA 2DFPA 2BGIA 5HKLA 1CUSA 2N47A 3DO5A 1U7XA 3CRNA 2BYTA 3DE2X 3W2TA 4OQQA 2Q5FA 3IHTA 4OD0A 4X60A 1IJEA 1KP3A 1W2GA 2PSFA 1MVOA 3Q11A 1DTWA 1GKYA 1LS6A 4M46A 1Z4MA 3K8YA 3E3MA 4NZNA 1J22A 4A73A 1Y8QA 1UUFA 1JDUA 3TDKA 2HXGA 2YMMA 1C3OB 3TS1A 1Y1LA 4BFYA 4L16A 3H9QA 2DJ5A 4MVJP 2CHQA 4PYMA 4BCDA 4DR4B 2BFOA 2QPAA 3O47A 2D2EA 3GPLA 2AC7A 3NG1A 1S02A 5K8UA 2GHRA 4LHEA 3H1FA 5DIZA 3D2BA 2AB0A 3IVCA 3ADPA 3VH2A 2WRZA 4HQFA 5AKYA 2O2SA 1GTSA 1IY8A 4O2BA 4EYQA 4Q9JA 4EF4A 4B33A 1FTWA 4GECA 1MCZA 1XMSA 5YASA 3KEMA 3RSOA 1JR3A 4ZCRA 1NPTO 3JTEA 3P97A 4LSGA 3HA2A 2XH8A 4P86A 2IK8A 2O0KA 3CE9A 4UVGA 1T0UA 1O9HA 4Y1RB 2AFIB 3MGBA 1Y3IA 3PC3A 1AQ6A 4Q4AA 4TUYF 1OJ7A 2BFBA 5C32A 2J9FB 4CN9A 1PWHA 2QX8A 5EPUA 4IXMA 1SHLA 2G9UA 2MWMA 1Q0SA 4BEWA 4JH0A 1SKAA 1FMTA 3BSFA 3RS2A 3V7UA 4YJDA 1U9JA 1TLLA 3HXQA 2RG7A 4CIDA 2UU9B 5JAQA 2WFMA 2G7MC 1LFDB 2X22A 1VTKA 2WSSA 4KUHA 3PQFA 4A8PA 4WFKA 4GPZA 1IQPA 5IC5A 1QC5A 3DBIA 4XYBA 1G5TA 1DC8A 2Z09A 4LXXA 3KQLA 5A6VA 3TCNA 1X74A 3E15A 4JN6B 3UUFA 4NMXB 4ZHQB 5EP4A 1XZFA 2P4SA 1D5CA 3N8GA 1HE1C 5JXIA 4V03A 3SDZA 2Y0DA 1JXOA 1H0HA 5FH9A 1XQ9A 2AW5A 2J7PD 2JJ2D 3S55A 4Z1MA 4ZDJA 2C7PA 1UBSB 1Z0FA 2CUTA 3AXTA 2VUHB 2IY7A 2HPZA 3O0DA 3Q0IA 4GAEA 4GVPA 4XM1A 3U7FB 3OT5A 3BTSA 4R8SA 2Q2VA 2H4ZA 1CJVC 2FPIA 5H3CA 2OYRA 2Z8ZA 3SNKA 4P93A 5TJHA 4KAFA 3SFZA 2FW8A 2QYHA 3ETCA 4BFXA 1C1DB 4E4RA 1B16A 4RDHA 5FUXA 2GTIA 1R6TA 1JX6A 5FNVA 5K3FA 3VPHA 3ELWA 3UQYS 1GG9A 4G0XA 1ODTC 1H6BA 3KXLA 4NCAA 3IKVA 1B1AA 1V3VA 1X7YB 4K9NA 2IVFA 5H8WA 4COOA 4BZZA 3P9NA 1P6UA 1NKVA 2QRVB 1LNZA 4Z9XA 3ZNPA 5K09A 5IM4A 4YMVA 4QOIA 1PFVA 3ENZA 3VOSA 4AQYB 4G56A 2XXAA 3EIOA 3GLFA 1T8UA 2GF0A 2OXRA 5F5NA 4HNUA 3KCQA 1VQ1A 3IX7A 2I2WA 3VAYA 1XZCA 2BFPA 2Y05A 5ALUA 1XX6A 3FOFC 3TKYA 1OHHD 1DG1G 1E1MA 1YUBA 1GPMA 2XDQA 4GWGA 4ISCA 3EIFA 4JC8A 4YMIA 1HDIA 3KJFA 3W5UA 1CJMA 2FPGA 3CBGA 1Z5UA 3OPYI 1AT1A 3RJZA 4PWZA 3DAFA 1E0DA 4R9NA 5MN4A 3R5FA 3CPJB 4LY3A 3VDNB 3VSEA 2ONKA 4X20B 1NUAA 1BE6A 4I08A 6PFKA 2VAPA 3B13B 1PJTA 4RGBA 1DBSA 4ROSA 3TTWA 5EXSA 5FF9A 4RK1A 2XUOA 2ZANA 1X8XA 1YQDA 5H82A 5TDHA 4EB3A 5C1IA 1T9GR 3IB3A 3BE5A 1IK6A 3FSGA 3H2JA 4MJXA 1U2GA 3SHFA 5B3JC 3KLPX 4L4UA 1MKYA 3LW7A 5DTJA 1ZD2P 5IAAA 2P9CA 4CIWA 1JG7A 2PGOA 3K70C 3ZIAD 7YASA 1VGQA 1R00A 1YI1A 2G1KA 2I0FA 3KDPA 2Q3BA 3Q8WA 3TH5A 4EUFA 4PO3X 3KB6A 4G41A 2YFQA 3X1ZA 3FMFA 5EQDA 4I4LA 1NLUA 5BWMA 5JLJA 2SCUB 3ADBA 5FOVA 1XKXA 2BUBA 2Q6VA 4JJZA 1CZNA 1QAQA 4FD3A 4U1RA 5DBHX 3S99A 2J3IA 3UVEA 3ZC3A 4JQCA 5B36A 2UZ1A 3NAMA 2WFLB 4FGJA 4BZWA 2BFMA 1ZOOA 3E9RA 4IX1A 4ZO6A 5AVTA 2VPTA 3LWBA 1HK7A 2MDTA 3ANNA 3DL2A 4HLUA 4WQMA 1DX9A 2QAGA 4XWTA 3CG0A 5DP2A 2O59A 4RNCA 1JDBB 3GHHA 2QRGA 2YCBA 3I8SA 1JR2A 2QTMA 1U7HA 3IOEA 4R54A 421PA 1L6IA 2RGRA 1SUPA 2GSWA 3LLSA 3UW1A 1GXSB 1MV5A 2XTZA 1YDEA 3UUWA 3UFBA 2YX1A 3UB3A 4E08A 2BKEA 2QRQA 4HNGA 2H63A 1P6QA 2XCOA 3IS3A 3WLTA 4OX9B 4P1ZA 4OFXA 1G7TA 5C51B 4PN3A 1E4VA 1EK0A 3TJRA 4M0FA 2JAWA 2YHSA 5E4FA 1YBHA 3NWBA 3ZPXA 2ONZA 4IICA 1GUYA 1Z5WA 2GBGA 4HB4A 4RQTA 4DSNA 1T2EA 2XSZA 3BMCB 2Q27A 3KZKA 3OURA 3KT6A 3ZEAA 1A7UA 4XX0B 1UDBA 2EEPA 5CDSA 721PA 3D02A 5K99A 2ZSBA 3CLTC 4J49A 4L3OA 1DFGA 1H94A 4DMLA 4H77A 1YONA 3LKVA 4IILA 2AJ8A 2W00A 5CIWA 1A4IA 3GFGA 4BV9A 1PZNA 5T4FA 3RKSA 3LVBA 2G9QA 4EW1A 3FIJA 1QAOA 3LCRA 3I1YA 4KWHA 4YVFA 2JA1A 4O2AF 5LZ7A 4QG7A 3F47A 2J9RA 4JD5A 3RROA 3LYUA 5A4FS 4N41A 4V1CB 4S1PA 2CSUA 3DTTA 4MXDA 4PBSA 1TMOA 5CXQA 2I9KA 1PJ3A 2O4CA 2ZWIA 3LUPA 2ZPTX 4KXFB 4R71A 5IP5A 2PVPA 3WSWA 1S9HA 1C1XA 1FDUA 3BGVA 5G2OA 3H5OA 3U3OA 5FBWB 3ZVRA 4I55A 1J49A 1YC2A 4IOKA 1Y82A 1N32B 2AOVA 4ZDIA 1K9SA 1D03A 2P4HX 3R9KA 5FUMA 3KJGA 2Q49A 1X7GA 3M5WA 5HW0A 2QUJA 3A6PC 1QF7A 1RAEA 1WB4A 1Z5GA 2HRRA 2QPLA 1KNXA 2CFCA 2DBZA 4UM9D 2BKXA 3B3AA 5EHNA 3TLJA 2NQ8A 4DG5A 3AM4A 2QSYA 3NH9A 1LZLA 3Q8MA 2B2CA 2J07A 4CKZA 1OZ0A 1BJKA 3IVRA 4K6CA 4MK4A 3FBWA 1OH8A 1DG9A 2ADFA 1O97C 3LO8A 4PC1A 2ZWPA 3B60A 1DV1A 3WB0A 4AURA 5CAEA 3ZDCA 3VKHA 4DLBA 3ICPA 1WPXA 3BWXA 4JLAA 5HEKA 5CCEA 2G80A 2VF2A 4R7GA 4QFBA 2VXCA 3I53A 2ZIZA 3CUSA 1A88A 3RU3A 3NKLA 2V0CA 5KX5A 5DNUA 1NY5A 1XALA 4G5OA 1HNXB 4FIDA 4YCAA 2IY9A 4NIMA 3J81A 2WTMA 2WHPA 5ALGA 2EJCA 1YD7A 2HWWA 3GDOA 5TC4A 5DHTA 1M1ZA 3O75A 4D6YA 5DWVA 4AY2A 5KTSA 3SBXA 2ZB8A 4ZT3A 4GXNA 1EA5A 3OBBA 3V3TA 4E5PA 2OR3A 2VUSA 5EJ9A 4LYYA 3HK2A 5BSHA 3DSRA 4BLQA 2DPHA 3DMNA 4AJLA 1BYIA 5KNBD 4M1KA 3GD5A 3KWLA 3SJ7A 4DHEA 2AUNA 3IP7A 1JLSA 3E4DA 1TYEB 1EZ4A 1LA2A 2CVHA 5KWVA 4DV2B 1UMKA 4D25A 1UIMA 5B7QA 1KJ9A 5IBRA 1OWNA 5K3FB 4MO2A 2C8KA 5KOYA 3NFYA 1OUMA 1LRJA 1RBQA 1T5IA 3HZRA 3ZWAA 4E2WA 2FWAA 1TMYA 1JHUA 1S3FA 1W88B 3U7JA 4Q05A 1P8JA 3PQ5A 4PW0A 2P2ZA 3DZKA 1MB4A 5CLQA 4BP3A 2A1TS 4FCVA 3RRXA 4GKJB 4UM9B 1EEHA 1JZQA 2BZ1A 2FPGB 3OE4A 3DZJA 4LKOA 2Y9MB 3HGMA 4FJ2A 4L5CA 4ND8A 1E63A 1UEXC 4WZBA 1BWQA 3LPNA 4RFLA 3T5MA 3ZW7A 3OCWA 1OTYA 4UBJA 3RUCA 1Q74A 2JLXA 2J6CA 3VYSB 1SBTA 4L8FA 1SA0B 3OU2A 2IU4A 3CC8A 1MAHA 1BW9B 2K4MA 3RSFA 2IYFA 3GVXA 5JNLA 2JG3A 3PYMA 4OPMA 4ENPA 2ATEA 5JQGF 4BAZA 1PJLA 3D7LA 5DCUA 5BR7A 1KC3A 2VP9A 2K2QB 3JCZA 1Z7YA 1EDDA 3R75A 5EZ6B 1RLTA 4TVSA 2RGWA 3PPIA 4ARVA 3ICEA 3K0KA 1PL8A 1UKVY 1W5TA 2G0NA 4Y1GA 3D8BA 3A8TA 4D80A 2EKQA 1PBTA 4HRXA 2ZRJA 3GMTA 4TLBA 2WDZA 4LF7B 4RJIA 2CJWA 2NVUA 2OBBA 3HDYA 4HPXB 1GAXA 1NA5A 1K9VF 3NDIA 4MIOA 3N0TA 3L0CA 4HGPA 3OQVA 3RFVA 3H19A 4GQIA 3EAFA 3GGDA 4JT9A 4NBRA 1KK2A 2FJ0A 4ECAA 5JAHA 3IMFA 1WW8A 2GKOA 4BX9A 4JBXA 1IBSA 1MDBA 4OHZA 3NVKI 2QBYA 1ZNYA 2PLFA 2OUKA 1SC4A 4UUAA 3SM3A 4PC2A 3WRXA 2F3QA 4AI6A 2HDWA 1O4VA 4NJEA 5LZ8A 4D99A 3OX3A 4OA5A 5J9FA 5E6SB 2PGIA 3NALA 2DERA 2G07A 1JF8A 1GQSA 1HMYA 2I7CA 2QVGA 2R66A 4IUBS 4RA6B 2ZRDA 1YRWA 5FOUA 2G70A 4D8WA 4DJ5X 5FQOA 3ESDA 1C4WA 5I7RA 2NXCA 3O1JC 3D6VA 1VMAA 1CVIA 1UPAA 4BE4A 3CVVA 4G85A 1ZDMA 4HTAA 4PTLA 5F64A 3D7RA 3FCUB 3EMDA 4AKTA 5LDHA 1V8BA 3WISA 1WKBA 2PBFA 3A1SA 2WW8A 2A94A 2Q6LA 2X3FA 1YRLA 4Z4HA 3DZGA 1CJUC 4KH0A 4FMCF 3WDKA 1OZFA 3O73A 1PL7A 4GR5A 4KR2A 1MX5A 3SJCA 2H4JA 2B0CA 5EERA 1WW2A 3K5IA 1PFQA 1Q3TA 3GP8A 2W6PA 1D9ZA 1HGXA 5LQSA 3G1UA 4X3PA 1AKNA 1NM5C 1YULA 1BX0A 3H1BA 4QPJC 1E5XA 2OV6A 4HP8A 3JQEA 3P9PA 3LXUX 1E20A 4YRPA 1J2EA 1WSDA 3NHWA 3GZTB 5AOAA 4H7KA 1NVTA 4FP9A 5ITWA 1LDBA 3IRUA 2YWCA 4EUEA 1EGHA 5DIFA 1DQRA 2V0NA 3GEHA 1BNCA 4ZP1A 2Z58A 1T15A 4ALKA 3EG9B 2HEGA 2HMVA 4D74A 2DGDA 1CULC 3ENWA 2PS1A 5J2UB 3Q7RA 3QEMB 1TQ6A 4RIIA 2PWPA 4X63A 5JAZA 3JQAD 2QTLA 1CZOA 1X86B 3FNHA 2WLSA 1WXXA 4P35A 2EATA 2VL7A 1NSFA 1U3WA 4KV9A 1LI5A 4NYJQ 3RVBA 3DE4X 3CIFA 3WK7A 1M73E 1MPTA 1CFZA 1W7AA 3TDMA 2BFDB 2GPAA 2QVLA 4BKPA 5K7SA 4UBOA 3DJFA 3VO9A 2P9BA 3C6ZA 2GAIA 4PSCA 2XB4A 4E12A 2R6CA 4J0FA 1E2NA 4XPZA 3ZWBA 1ZESA 3CS3A 5LLTA 1QTRA 1I2BA 4OMUA 3KLNA 4G26A 1Y37A 1NM5A 3BA6A 1GTVA 3O38A 4J91A 3S2GA 4JI6B 4EJMA 4RD0A 5KYWB 1W4LA 2HLDD 1RE1A 2XRYA 2E48A 5LA6B 3HSKA 1KIAA 3V4ZA 3WWEA 1ZH0A 3Q5DA 4AN1A 2HLPA 5MFPA 3OF3A 5C81A 5I9SA 4AKHA 4GOLD 1C29B 2B78A 4JY7A 3WNZA 4CWAA 5IVPA 4ZAYA 5DM70 3L8EA 1R4NA 4B9AA 5L45A 1ORDA 3W5SA 4PC6A 1KYVA 3PKZA 4W7HA 1JI0A 1W48A 1E79A 2JAXA 3EGDB 3MT9A 4C78A 3KQWA 3KXKA 4H7JA 2QTVA 3UG6A 3EXHA 3ITDA 3I0NA 1TZMA 3F3MA 3O8NA 4EJ2A 4ZI7B 4JI8B 4JHLA 3RUDA 4HQOA 1NJ6A 4DF3A 4KFTA 4DRZA 5E4JA 1PZEA 2O7NA 3A7EA 5TSDA 2GH1A 5K8VA 4RHYA 2RGNA 4Y6GB 4JCOA 4D7AA 4UU8A 1BMTA 2JI7A 4GP6A 4J07A 2C8JA 4Y18A 1DCTA 1YCFA 1QXSA 5JSYA 4BNFA 2AEEA 5MF6A 1EUYA 2O2DA 2A4MA 2FUKA 1X3LA 3GIDA 4KGXA 4WDQA 4ZVUA 4IGKA 3UH0A 3U19A 1C81A 3LCVB 4XTRA 1HT2E 4QDXA 5K0ZA 3DUWA 5FR2A 1C9KA 2XGGA 4WZ6A 2DUNA 1LC0A 2XUZA 1A3CA 1XVVA 1XU7A 4JMLA 2VVTA 4DM7A 5B57C 3BMOB 3SYTA 2WU0A 1IY1A 1FS4A 1S4MA 1Z6YA 2PD6A 3KZVA 4WERA 3WR5A 2AEJA 1DIBA 2HA5A 3F3KA 3OE5A 1EB8A 4Y2SA 3VH3A 4C2TA 4DQXA 1PR5A 3IALA 1BHSA 1LSOA 1UBKS 2C2OA 4FEEA 1YF3A 1T9AA 1SA0A 2AI2A 2UUOA 2PU5A 3IHKA 4X9XA 3HUDA 4ER6A 2FWMX 2H1LA 5JYBA 1JEYB 2C54A 1KMNA 1IG0A 3CCBA 5J3JA 5H70A 5DZSA 1E8MA 1ML4A 3TIGA 4KDCA 4X85A 2XUKA 4QYTA 3P9XA 2GZ1A 2IUUA 1ZVVA 3CGGA 2ZIXB 3QP9A 1ZM3A 4PLTA 5CVJA 4II2A 4WEOA 1XZ8A 3QHQA 2PS3A 2OK7A 5BWOA 5KNDA 3K70D 2HQSA 1I4OA 1Z4LA 1J23A 1RS0A 2AZ4A 2W43A 3MFQA 2VK1A 4L2IB 2NO6A 3R9XB 4C0BA 3FOZA 2PJDA 4QUEA 2BEWB 2AN4A 3OJWA 1SWVA 1V9CA 2OMEA 4FWBA 4KRYA 1ZS9A 4ZPXA 3EUAA 3UXMA 3WYAA 3LIPA 3EGVA 2QLJA 1X9GA 4YT8A 2HZBA 4JCCA 4ARCA 4LXHA 1Z39A 4BGUA 2VRNA 1AQJA 4FB5A 3W9SA 1B8NA 4NXMB 1WXWA 3PL1A 4W5TA 4AY4A 1ESEA 3HWRA 2P62A 1LBQA 1RQLA 1VPTA 1TLTA 1WNTA 4CL3A 1ZI6A 1EK5A 2YCLA 3E27A 5E9WA 3VZBA 3WL5A 4CEHA 1DTWB 3C70A 1M9NA 3K0EA 4NWIA 2XWJI 5CA0A 1A71A 2IZ0A 4XA8A 4E46A 3FUWA 4N01A 1DE0A 4CR7A 1XB2A 4MUEA 4Q4LA 3K1AB 5JNVA 5C5DA 4UCQA 3IAFA 4D02A 4XX1A 1E4EA 2ZSFA 5AW3A 2D2IA 2FDCA 4DJFC 3ASUA 1NSTA 2BHLA 1I6MA 3W6OA 4MRMB 1Y5IA 4CF7A 4J16A 2NU8A 3P4YA 1J2TA 4JKYA 5E6SA 4CM4B 4POAA 3VTAA 4JSTA 4J1QA 1JNYA 4Y9RA 4TLLB 1OGYA 2ZYWX 1Q57A 2ZW9A 1B0AA 3L1IA 1E9EA 1U3UA 1F2VA 3HXKA 2W93A 4CKCA 3SN6A 2CMGA 1TTQB 3GGPA 4PANA 3RC1A 1QQAA 4FZRA 2H2DA 2FPRA 4EY8A 1VI6A 3CUKA 5KUTA 4FCWA 4MRAA 4JI3B 3BRSA 1DAGA 2IT1A 3WWCA 3LC1O 2XWBF 1E6LA 2BZGA 1KU6A 3G0GA 5K05A 1EWYA 5JY1A 3PA6A 1TCUA 1NNEA 4D8XA 1J39A 1DT3A 1I33A 4W1PA 2PGAA 1SIWA 2RHWA 5H3HA 3BGDA 3JATB 3EA4A 3IDZA 2IYQA 2RHCA 1K5GA 4TT3D 2Y0BA 4KBGA 4M9UA 4GI3A 4WXEA 4ETNA 4PRLA 5HTKA 8LDHA 2XHEA 3DNPA 3GI1A 1KZ4A 2FY8A 1TVCA 4MPDA 1XFDA 4UNRA 1BGWA 4KVAA 3ZNOA 2ZCJA 1ZA2A 1DRKA 1TD1A 2GRAA 4HNAA 4IH4A 4KO1S 4KQ2A 4S0XA 4Y98A 1A9XB 4ZEVA 1DIRA 3JSXA 1JKFA 1ENZA 3I34X 4BRSA 5JJ5A 1D09A 1WY7A 2D7JA 3CO0S 4G36A 3LTNC 2G5TA 4G0MA 4EUNA 4RD1A 2X4LA 2IXFA 3KTAB 3U7QB 4NHOA 3KPJA 1AZLA 3MMNA 4TROA 5F33A 4PLZA 4EGAA 2QPTA 3U3ZA 5AM1A 4HAZA 5F35A 1G38A 5KYTA 3JQ6A 4LYDA 1G5RA 1Y4ZA 1U2ZA 3ECCA 3JQGA 4DUPA 3LHDA 5AK3A 1LVGA 3LIIA 3NOXA 4OI4A 3WGYA 3HDVA 3WNQA 4MUKA 3HO8A 4MW9A 4B87A 4F2DA 4ONEA 3ZLUA 2EFDB 1ZMRA 1MRZA 2R1ZA 2BMFA 1LNQA 2RAPA 4HDCA 2IXDA 2IHNA 4F0JA 3W7BA 4QYSA 4P22A 2OFFA 4MKZA 5IF3A 3BWVA 4FFBB 4MI6A 3VSAA 2G08A 5HDBB 3VVCA 1I2CA 1Z4QA 5HBGA 4CL8A 1OKKA 3L8DA 1FLAA 4H6VA 4C7KA 1UT8A 3OG9A 4B8YA 2BFEA 3LPDA 2ZIGA 3OQHA 1J8VA 2ACVA 2OZLA 3FI9A 4QBFA 5IAOA 4GYYA 1HRKA 1IHUA 1E1RD 2BGKA 1MT0A 2ZG6A 3AR8A 3QVGB 4B82A 5LOVF 1OFUX 1KC1A 3Q7SA 5J1SB 3NM5A 2FHPA 4KWIA 2HA6A 3I3OA 3DMDA 1XLUA 3I64A 4ID3A 1CVRA 1LV7A 2DFVA 2W4MA 3G0IA 5T57A 1Y4UA 2B35A 1C5KA 3QKUA 3CNBA 3AILA 4UEWA 1ETHA 5BSUA 3NEPX 4UMFA 4BWVA 1MC5A 5M34A 1SKUA 4XFDA 4YEDA 3LECA 3WWDA 4X61A 3JAKB 1IMJA 4O4LF 5BUSA 1G21A 2Z43A 3ASYA 3O9VA 1P6XA 3LBIA 5CFLA 4QXPA 1II8A 3DHYA 5B55A 2AZMA 3FF1A 2G72A 3EWAA 1CRPA 4R81A 1KIFA 1N7IA 2HSZA 3DEHA 3TX2A 2GPBA 1FSGA 1JAIA 2DY0A 3L6CA 3J81k 1P4HA 4M8LA 4E5DA 4FNGA 1JG2A 3ZXUB 5JS7A 5B53A 5FTWA 4YRSA 1T0HB 2MU1A 4RXUA 5D51S 4IRUB 1O96B 2QR3A 4JXKA 3V80A 4B3CA 2D5AA 4CM5A 1RFLA 4QBTA 4EWLA 1T4MA 2PHZA 4BX0A 3I2KA 3FI0A 5ESDA 4BE7B 2R3SA 1DTSA 3PJRA 3OT4A 4K9KA 4X6XA 5LA6F 5B3JA 5CT8A 5GZ1A 1P2TA 2AX3A 1ZBDA 3KE9A 3VR6A 5KWSA 3JYQA 4B73A 2R6JA 3W4IA 3GUVA 1E3SA 1G8FA 2GYWA 2V96A 1GU1A 3RLFA 1F7VA 1JHMA 2PAFA 2QAGB 3C3EA 3AHIA 4FMDB 4AWXA 3UWKA 3RRNA 5HMMA 3SVLA 4HGZA 3WGVA 2E9SA 2P77A 2XAUA 4Q9AA 4W1QA 5BN1A 2HCBA 1DG3A 1Z29A 4MROA 3N0XA 2FRDA 1TX4B 3OVMA 5AM5A 3NBMA 3AVWA 1FK8A 2NSLA 3E23A 3EMBA 4UW9A 4DM3A 4AVYA 3M4ZA 4DLRA 4M38A 1GL9B 4Q4HA 4JXXA 2YN0A 1Z0UA 2RC5A 3G2IA 4TTJA 1A8QA 4ZD6A 3WLEA 4YPVA 2CJYA 4WXMA 2VP4A 3COZA 3CRMA 3F5MA 1L5QA 1P7PA 2CEAA 5IJXA 1G41A 4L50A 3ZWCA 1E1YA 4LJLA 1E1NA 3B9BA 5AI5A 3UV6A 2JW5A 3DZBA 4NENB 5F77A 4L4SA 1KTVA 5AKEA 1H6DA 2PZEA 2QZPA 3TR0A 2ZRMA 2ZVQX 3FSJX 4XOUA 4ZK6A 3PTAA 1ZAYA 2CLHB 2J85A 4K5QA 2QPOA 2FU5C 2VHTA 1ZNQO 1O95D 2X8LA 2IYTA 1P75A 4JJ8A 4AJ2A 1SWWA 2B7LA 2A9VA 3KR1A 4A8JB 3VC1A 4EZBA 5EWLB 2RI0A 1RTKA 3LK7A 1BCSA 1C30A 3WQHA 2FJUA 1JR4A 3DDUA 3WIBA 4BVHA 4FOOA 3LY8A 4YJ3A 4ZV4A 3I45A 2EOAA 4G5YA 1UJBA 4O25A 1FU4A 1UPXA 1TC2A 2J59A 2B4KA 3U4HA 1GZ4A 1WZUA 2L19A 2QUZA 4E32A 1L7DA 3HB7A 5IK2D 1YJXA 2QI9C 5AK0A 4AG3A 2GWRA 3EFOB 5KJCA 3FUUA 5CVCA 1Q1NA 1QNLA 1WZEA 5EINA 4PCVA 3W7VA 1UKYA 4UAVA 4WCFA 3AJAA 3FJ1A 4OL0A 1HQYE 4P54A 3BFPA 3FJYA 2HWKA 4XB6B 3BFJA 5ALQA 4LVUA 5AVUA 4K1LA 3SC3A 3AVXA 3KSMA 3CT6A 3HJGA 3CXRA 4W5WA 5ADHA 5FWYA 3DQQA 3VU9B 3QFHA 3KR2A 4MWSA 3LU1A 3VKFA 5FFMA 5E7IA 4YUXA 3CZ9A 3O8OB 3QM1A 2I6FA 1NR1A 2JHPA 3FRHA 3PEEA 2FPXA 3KQNA 4J94A 1MJGA 2UAGA 4G1UC 1A8SA 4Q1FA 2B37A 3QW4B 3GZ4A 1DEHA 1G8MA 2IYVA 2WWYA 3WTBA 4KPYA 3DZFA 3DDWA 3LMKA 2OEPA 2M32A 3FNQA 2WE8A 3WHLA 3ZKWB 1NDQA 3CW9A 5CNKA 3WRYC 3NBUA 4MYSA 2GM3A 3SSAA 2V7XA 2CFRA 3RAFC 1X7WB 1QWOA 4M8NE 3VNSA 1MVNA 2F1JA 1OILA 2C3MA 2H4YA 3R6WA 4UVDA 1UWCA 1NVEA 2D5BA 3H5WA 3WK5A 4UNIA 4EPVA 3IEIA 5D2CA 4UKDA 1Z74A 3SU8A 3TOVA 1E6CA 4FJ0A 4B8WA 1G4UR 3PPYA 4QJ3A 3ENNA 1XRSB 4DDMA 4UNPA 4TKUA 5FWNA 4F45A 1ORIA 1XHEA 1A2QA 2H29A 1R88A 3COVA 3JQQA 2WKPA 1YU6A 2CL6X 1R8QA 4ZQBA 5GPBA 221PA 2QEQA 1DOAA 3CG4A 1AKMA 3MT0A 5H68A 4C9BA 2V3VA 3MJ4A 3RTBA 4RHTA 5FI0B 4Q4JB 3EQ6A 3ZYCA 4AS3A 4BNDA 4C0WA 4KBFA 5I4IA 4BV3A 1PF7E 3TB4A 1UOEA 2VG8A 2XCLA 5JRDS 1TK3A 4YXFA 4KSYA 4R7TA 2WJ4A 1HFWA 3CWZA 1O0SA 5CNIA 2K7FA 3AVQA 3CNOA 5ALIA 3TSWA 1M6WA 3ZJVA 3RYFA 2RBKA 1D2CA 5JYCA 4KX3A 1SBIA 2PLNA 2ZE5A 5B7GA 4OB6A 5AVSA 2AYXA 3D4BA 3CEPB 4NZPA 4W99A 4U7WA 4AS1A 3KDAA 4K9PA 1GIAA 1T2FA 1WMDA 3DB1A 4M9RA 3N74A 4UCWA 3U0BA 4Q3KA 2N0SA 4QHSA 1R6XA 2X0EA 3ZXYA 2GTHA 4V3CA 1I4WA 5C4MA 3HVIA 3FPCA 4H6PA 4QXMA 5DK6A 5DGHA 4UHJA 1PSDA 4MI9A 4EUHA 3N2EA 4W5QA 3ITEA 4TVOA 1Y7HA 3EVCA 4ESEA 1G2QA 2FXVA 4YP0A 5FFFA 5FTKA 4QQNA 3KPVA 3OCUA 4CDRA 1KJ8A 3WGNA 1NN5A 1MJGM 1PR0A 1P45A 1XXHB 2APJA 1JHZA 2O14A 2ZI9A 4I99A 4LZOA 3IUSA 3PE6A 2H4WA 5IWAB 4D26A 2Z30A 4XLTA 2V45A 1PL6A 5JQGA 4GZ6A 1I0LA 1SOUA 2ZS8A 3KT3A 2Q2QA 1YB5A 4H4EA 4MVYA 4D4KA 5EPOA 2J08A 3QVUA 1ECJA 4O4JF 3W5IA 3VPBA 4AJEA 1Y3AA 1WKCA 3T3PB 2ZIAA 2GCPA 3HNRA 3FUTA 4IJ6A 3U09A 5LL6P 2HNBA 3PUHA 2JFNA 1IM8A 5B7PA 2ZYSA 2XUQA 2G4VA 2YKGA 2VDKB 3AW8A 3B70A 4QUIA 2PZGA 3C2QA 4BDTA 3EMKA 3G2OA 2H08A 4QUJA 2K6GA 1M2NA 3S7TA 2ORYA 1W4CA 2I2CA 2NQTA 4IIVA 1CNMA 4MAMA 1FP2A 3W4JA 4BFTA 4DLTA 4RHEA 1KJQA 3ZNQA 1T1RA 2OY0A 4HLCA 1YS2X 5AO9A 3SG0A 4IH1A 1HG1A 1W2HA 2JA2A 5I5GA 3TCXB 4RTSA 4MEAA 1NNSA 2BRUC 3QWHA 4IBOA 1RCTE 4NENA 1NF2A 4RJ2A 1HFKA 2J5KA 1LD3A 3PFWO 5AJZA 3S2YA 1OFHA 3PHJA 4EEKA 2AQ8A 3HI6A 1G8PA 3MQ4A 2OGSA 2E0IA 4MWBA 2YW2A 5FLEX 1PEKE 5P8WA 4ZU6X 4GZ5A 1MO3A 5L3QB 521PA 4HVAA 1HYGA 2V6MA 5GONB 3PCXA 3MINA 3CPHA 3R7BA 3EULA 2H3EA 1FP7A 3HXPA 3SM9A 4BB5A 4A7PA 3AZOA 5JI3E 1T9GS 2MIIA 4REQA 3FPJA 4DCVA 1EFAA 4MQUA 4LC1A 1GEGA 3WK4A 5I7SA 3F5DA 1P9WA 1V11B 4QDZA 4K05A 3F6RA 4BUJA 3RTAA 2P0AA 4N8EA 4TTAA 2WD7B 1GV0A 1UJMA 2WSSD 3RKRA 2GQ0A 3CRVA 4BKRA 2V6IA 1Q0PA 1RHUA 2CLEB 3JSAA 1JH9A 4TSRA 4JEUA 3BA1A 1FZTA 4H1TA 2V6JA 4HDRA 1E2LA 2ZIWB 3NBXX 5IMBA 1YS4A 5HYVA 4YYEA 3JQ9C 2JFGA 4KJZA 5GOZA 2ZXUA 4I3GA 2FFHA 1QK4A 4X3OA 4BZXA 2CL5A 1E9FA 1MN6A 1P18A 1PHRA 2GXQA 2PGNA 3K9GA 4XUCA 3G1TA 4B32A 2Y1CA 4ARSA 1CUZA 2VDQB 5E38A 1EFVB 3R0XA 4ZJYA 4WFQA 2Z1MA 5ALZA 1X9HA 2ZUTA 5DHAA 4B6EA 3L1VA 1WXHA 3F5QA 4D3DA 2F1IA 1EQAA 3SR3A 2HSDA 4JEMA 3PNVA 4NV3A 1IONA 5GJWC 4DXHA 1PYGA 1B15A 3MTEA 3V33A 1Z36A 3L8MA 1L1EA 5AVZA 4MKIA 2CV1A 1Z5PA 5C7OO 1Q0TA 3STUA 3NLLA 1E94E 5BOSA 3ZD7A 1D1QA 1YQWA 1PKEA 2CUKA 1GRQA 1QC5B 3CURA 1M72A 2P27A 3BRQA 1TUBA 4RY8A 5D00A 2JVIA 2PZBA 1E9CA 1RP7A 5DTMA 3DNFA 4MYUA 4RY0A 4AJHA 3H5IA 4L27A 2QVCA 4I6EA 5LVAA 2Y3IA 1WB5A 4EW2A 5A2QA 1OJLA 4FHCA 1U28C 1VKJA 2XCQA 2Z5LA 4L74A 2COKA 3ZGNA 2PUCA 4NPCA 4B3DA 2J5XA 1JV2B 1XP8A 2JGRA 2R6AA 3KTFA 4EG3A 3NC1C 2ODAA 1K6IA 1PFUA 4Q7EA 2AFVA 4JOCA 1DB3A 4JASB 1RXEA 3A11A 1BU5A 1KU0A 1V9SA 3EVTA 4QSHA 3RANA 1IG3A 4G4SO 4ENTA 1HFEL 3Q3JB 1Q1GA 2B0JA 3ILHA 3BCHA 5FEUA 3F46A 1JE1A 2FZGA 4S1VA 3TKAA 4EKNB 3MMXA 3MD9A 4Q1CA 2OGUA 4EI2A 3A4NA 1KE2A 3E7XA 1ZIOA 3PA8A 2LKDA 1QR6A 4B3XA 3UYLA 1TF5A 2HRQA 4U0JA 4WZAE 4C14A 5LD2C 2JDIA 4ARZA 5BR4A 5KTKA 4TWIA 4TMFA