4N0QA

Crystal structure of an abc transporter, substrate-binding protein from brucella melitensis 16m in complex with l-leucine using a crystal grown in a crystal former (microlytic)
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
344
structure length
344
Chain Sequence
DITIGVIAPLTGPVAAFGDQVKKGAETAVEVINKAGGIKGEKVVLKFADDAGEPKQGVSAANQIVGDGIKFVVGLVTTGVAVPVSDVLSENGVLMVTPTATGPDLTARGLENVFRTCGRDGQQAEVMADYVLKNMKDKKVAVIHDKGAYGKGLADAFKAAINKGGITEVHYDSVTPGDKDFSALVTKLKSAGAEVVYFGGYHAEGGLLSRQLHDAGMQALVLGGEGLSNTEYWAIGGTNAQGTLFTNAKDATKNPAAKDAIQALKAKNIPAEAFTMNAYAAVEVIKAGIERAGSTDDSAAVAKALHDGKPIETAIGTLTYSETGDLSSPSFDIFKWDDGKIVGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Leu/Ile/Val-binding protein homolog 3
publication title Crystal Structure of an ABC transporter, substrate-binding protein from Brucella melitensis 16M in complex with L-Leucine using a crystal grown in a Crystal Former (Microlytic)
rcsb
source organism Brucella melitensis
total genus 122
structure length 344
sequence length 344
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13458 Peripla_BP_6 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4n0qA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4n0qA01
3UK0A 5B3JA 1S8NA 3B2NA 3CU5A 5F64A 3UKJA 1RXIA 2VK2A 5KQLA 4KK4A 1USGA 1EFAA 1QPZA 2FTKE 1P6UA 3SQNA 2WJWA 2M98A 2E4WA 1DC7A 4KV7A 4PICA 4YWHA 5TQ0B 5KQPA 3O2JA 5EWLA 3KSMA 4H60A 4H3KB 4RK0A 3OMWA 3N8IA 4YR7A 1ZH4A 4NICA 4QPJC 3LMKA 2ID7A 3QLVA 5IUNC 1Z26A 3CHYA 5JS1A 4JP1A 4D74A 5JNUA 2WY2D 4WZZA 1QP7A 3KG2A 1XHFA 3HZHA 2AYXA 2KYRA 4LE1A 4LDZA 2PUBA 1AB6A 3I09A 3QX8A 2WJAA 4LDAA 4KK3A 4RWEA 2YHBA 3NHZA 4DADA 3EQ2A 4MGEA 2JK1A 2PAFA 3CLKA 3K9CA 5FBHA 1BAPA 2TMYA 4RS3A 1RZRD 3DLHA 2RDMA 4MS4A 1ZAYA 4PE5B 1EAYA 3SNKA 4QYMA 4F8JA 1QO0A 1ZDMA 4Z9AA 4RSMA 2AYZA 4DQDA 5C5EA 3R0JA 2LIVA 1FSPA 3RVKA 2JB9A 2OENG 3OO0A 4HYEA 1E6MA 3IP7A 4JB2A 3F6PA 4TLLB 3KYJB 4L85A 3CS3A 1Z2EA 2FEPA 2V0NA 5EWJA 2O20A 1FFSA 3DBIA 3RVSA 2I6FA 1D4ZA 2RJOA 5C5CA 1DRKA 3NNSA 2BGGA 4TMYA 5D2CA 2LP4Y 1U0SY 5HSGA 4IGAA 5CNIA 4HNRA 1KMIY 1Z2DA 2R4QA 2MSWA 3ILHA 2ID9A 2FEKA 3IP9A 3D02A 3LUDA 3O1IC 5B3JC 2FQXA 1OXKB 3H1FA 2CD7A 1C0EA 3HXMA 4IILA 1DCMA 3IP6A 3JS5A 1NATA 1ZN2A 4YCSA 3OQOA 2B4AA 3T6KA 5IX8A 1HEYA 3VNAA 1SXGA 1JBEA 1SRRA 1SXIA 2R47A 1M5UA 5T3YA 1RNLA 4KNYA 1NXWA 3OM0A 5T7BA 3O75A 2HJ9A 4MAAA 4MRMA 4MLDA 4YO7A 2FKAA 3NBMA 1NXTA 3EJWA 1GUBA 1QNLA 3E61A 3QEMB 4P98A 4Q6BA 1DCKA 4F06A 2QR3A 1QMPA 2PKXA 4GPAA 2WMYA 5EWMA 1D1PA 4WT7A 4XFKA 3GV0A 3LFTA 4Z4HA 1UDRA 3H5OA 1PEYA 3EAFA 1QQAA 2E4YA 1KGSA 3LOPA 1GCGA 3F6CA 2FN8A 2QXYA 3MYYA 3URMA 1K66A 2JRLA 4HNQA 4MR9B 2H0AA 5TQJA 1DP4A 4EYKA 4YGXB 3KCNA 3SM9A 4DN6A 4MQFA 2FXIA 4G0ZA 3TMYA 3RVNA 4JA2A 3HDGA 4EYOA 1ZGZA 5KQGA 4B09A 1ISRA 1FQWA 3KS9A 1R8JA 1L5YA 5TPWB 4Q6WA 4Y9TA 5TE9A 3O1JC 5JNRA 4WXEA 2A9RA 3RVPA 3SG0A 2P9HA 2FMIA 1ABEA 4MQFB 4ETMA 4KRFA 5ED4A 4Z4CA 1Z18A 5GQSA 3I45A 2PUEA 1ZHHA 3A3KA 2HQOA 1DC8A 3NNDA 4JASB 4F3TA 4ZPJA 4NCBA 2E4ZA 5IEJA 2HSGA 3UUGA 3HEBA 3P9YA 5CHYA 4QYWA 2HPHA 3QLTA 2IPLA 4WWHA 1VRVA 2PMCA 2MYTA 1DZ3A 3CG4A 4XLTA 6CHYA 2L17A 3LUCA 4Z4FA 2IPNA 1Y1LA 4S05A 2MSLA 1DBQA 3HS3A 3JPYA 3Q7RA 4CBVA 3EQZA 1JX6A 4D6XA 5IBQA 4MS3B 1DG9A 4Z4IA 4MR8B 4RV5A 1MIHA 5DGCA 5TQ2A 3ROFA 1M5TA 3IPAA 4O1HA 1IIBA 4JAVC 1ISSA 1W9HA 4QICA 4OLAA 2YHAA 2L2QA 3M9XA 4PEVA 3MIZA 4ETNA 2CHFA 4G0QA 1Z13A 1U04A 1JLKA 4N41A 1USIA 2CHEA 1BA2A 2QSJA 3LUHA 4MQEA 5HQJA 1QQBA 4EUKA 1DBPA 1FFWA 1NXSA 4YV7A 4ZYLA 3JVIA 5DTEA 3FDFA 5IULC 4PZ0A 3H6HA 2PL1A 1JH9A 2LBPA 3MM4A 5EWLB 2QU7A 1CEYA 5KI6A 5IEBA 2NZVG 4E7PA 5JNTA 2WRZA 2ZAYA 4GNRA 1XWWA 3OO1A 4MPTA 3N6VA 2E4UA 2OQRA 1XHEA 5DCLA 1Z25A 1CYEA 3MQ4A 4UHJA 2F8SA 1JHZA 2E4VA 2P4UA 3CFYA 1LJLA 3Q7TA 3OLWA 3HK2A 9ABPA 3JVDA 3DLBA 3TB6A 1Z17A 4WUTA 1YS7A 3KLOA 1OXBB 3KHTA 4P1ZA 3LTEA 2M1ZA 2MSKA 3H1EA 5KWSA 3VNBA 1SD5A 4F12A 3H6GA 4MS4B 1LK0A 2HQBA 1GLGA 3HUTA 4O1IA 3KLNA 4LE0A 3T8YA 1RZRA 2JCGA 1VPWA 3OLXA 4W5TA 3W9SA 1MB0A 1J56A 2IDMA 5DKFA 3LUGA 4YLEA 1GUDA 3TO5A 3T95A 1DRJA 1E6KA 1YVUA 2MYNA 5EWJB 1Z16A 3RVOA 3M6MD 1E2BA 2FSPA 1VKRA 2PUGA 4NV3A 3TX6A 3E3MA 4MS1A 3IDOA 8ABPA 4KQ9A 4EVQA 5BR1A 3ILYA 5KQMA 3OLZA 3Q15C 1JL3A 3QLVC 4Z9BA 2JVKA 1URPA 1CHNA 4Q7EA 1VLZA 2N9UA 3SAJA 4RZSA 2IPMA 4EYQA 3N0WA 2MYPA 1MB3A 5JNWA 3O1HB 1P8AA 2RJNA 3BRQA 4N0PA 3GT7A 2FW0A 5ABPA 1RXEA 3DGEC 3H5TA 2NT4A 1ZITA 2PJUA 2GBPA 4IF4A 1C4WA 4N47A 4MRMB 3T38A 6ABPA 4KREA 3OMXA 4LE2A 2B1JA 3CZCA 4Z4GA 3QLUA 3I5AA 4MR7A 1L5ZA 2JBAA 1JDPA 3CTPA 3BRSA 4FE7A 5IUJC 3LUAA 4FE4A 3LUKA 5EWMB 1PEAA 3MA0A 4N0QA 3Q41A 1D2AA 3O21A 4RK5A 4G0PA 4RKRA 5BQ3A 4EYGA 3F7NA 4EGSA 1TM2A 2FLKA 2JVIA 3QELA 5JS2A 1H9CA 2RGYA 3NNNA 3GBVA 1NXPA 1YIOA 1FFGA 1MVOA 2FN9A 5IUKC 7ABPA 3HDVA 4RY8A 5FBKA 4IMJB 3HJFA 5FWYA 1NXVA 1NXOA 3JY6A 2MYUA 3QELB 5JNVA 2IPAB 3C97A 3F73A 2R25B 4E7OA 1PUXA 1BVHA 2GI4A 2A9PA 3CNBA 2CWDA 1JF8A 1PNTA 5TPZD 3SY8A 5FWXA 4RXMA 2WWVD 4Z99A 3KYIB 4ETIA 5FWYB 3RVMA 1ZH2A 4RDCA 3RVQA 4EVSA 1Z15A 2GX6A 1USKA 1D1QA 3OLYA 5HKOA 1JFVA 2NZUG 2VUIB 3FFTA 4KPYA 4XARA 1APBA 1E6LA 3L6UA 4YS6A 4KFCA 2QZJA 3L49A 3LUFA 3EDCA 5FWXB 1BDJA 2L19A 1BDHA 2A9QA 1RPJA 4WXMA 3Q9SA 3KJXA 5CNMA 1TJYA 2FMFA 4KQCA 1A2OA 3EGCA 3FMVA 4RKQA 1YK0A 1NXXA 2JVJA 5TQ0A 4Z4EA 3O74A 5TQ2B 3BBLA 3OQMA 2W42A 2H3HA 3CKMA 4XXHA 3DZDA 1DCFA 3IP5A 1JDNA 4D6YA 1QP4A 1ABFA 2HQRA 3CRNA 4H3HB 1U8TA 3QEKA 3RQIA 5BRAA 1F51E 2FVYA 3A0UA 4RXUA 1W25A 5HM6A 3NHMA 4IRXA 1DJMA 4N76A 1KRWA 4F11A 4MQEB 2LPMA 1M2EA 3KKEA 3H5VA 1JFSA 4JOQA 4YRZA 3LKVA 4L4UA 3KTOA 3HSYA 3RH0A 3HO1A 1YMVA 2F8TA 1A0OA 3GWGA 1QP0A 1JYEA 1YTUA 1LBIA 4G86A 1QO0D 5CNKA 3HVRA 2PE5A 2PUAA 1ZGGA 4W5RA 2VYCA 4TLMB 3MF4A 3LKBA 1YK1A 3G1WA 3CG0A 3H5LA 3D8UA 3BILA 4ZMRA 4FB4A 3N75A 4PYRA 3OM1A 4RY9A 2E4XA 3BREA 3IPCA 1M2FA 2QW1A 1F4VA 2A9OA 3Q7SA 1Z12A 3O2SB 2FEWB 4NQRA 2PUDA 3GRCA 4RK1A 4RK7A 1NTRA 2FQYA 3C3WA 4G97A 1EWVA 3FFWA 4Z0NA 1ZVVA 1LJUA 3H1GA 3TD9A 5KC9A 3GL9A 4OBBA 3M9WA 4RU1A 3LUJA 1MAVA 3C3MA 5DLEA 2FMKA 3HUUA 1JYFA 5KC8A 3JTEA 3K4HA 1P2FA 3EODA 3HCWA 2PLNA 2DRIA 1A04A 2WB4A 3GA5A 2R48A 3JPWA 4MS1B 4G0MA 3N0RA 1I3CA 5GOTA 3EULA 3QEMA 1EWTA 3N0XA 4RK4A 1P6QA 4XASA 1EWKA 3GBPA 1NY5A 2L18A 4KMRA 4LX8A 3H75A 4UHKA 3QX9A 3HV2A 1KRXA 4W5QA 2QV0A 2XDYA 4RK6A 2ZWMA 2FMHA 2IYNA 5JNSA 1B00A 5I4CA 5BRJA 4OG2A 4G0YA 3QK7A 4MR9A 2FLWA 3N53A 4OTZA 3A0RB 4LRQA 3OQNA 1JWLA 4W5NA 4XAQA 3RVJA 2PUCA 1AB5A 1YMUA 1D5WA 4MR7B 1K68A 2VUHB 4ZMSA 2JBAB 4OATA 2LUOA 3DGFC 1GCAA 4O5AA 5TPWA 2GWRA 2NUBA 2J48A 4KZKA 1U2PA 5IC5A 2QVCA 4EVRA 1QKKA 4ML3A 1EHCA 1U2QA 2PL9A 1YS6A 3H5IA 1BDIA 4YP9A 2X7XA 4RY0A 2PUFA 1TMYA 1T34A 1LBHA 3FGZA 1SXHA 4MYRA 1TVMA 1PHRA 1WETA 4TN5A 2Q5CA 3HM9A 5PNTA 3FFXA 1DBWA 4N03A 3A10A 3I42A 3RVLA 3C6QA 4EY3A 3MMNA 4MLCA 5E3JA 4LZLA 4W5OA 3GYBA 1JFTA 2QVGA 3QLUC 4HNSA 4OLBA 4MS3A 4KVFA 4MR8A 4RXTA 4G0OA 4NCAA 5TPZA 3CZ5A 2IKSA 3OLVA 1ZY2A 4IMIB 2GKGA 3O2QB 4JB0A 3ROTA 2NT3A 3H5WA 5CNJA 2FQWA 3RVRA 4S04A 3C3KA 4ZJPA 3G85A 4G0XA 2IOYA 4M88A 1PNRA 3S99A 1ZESA 1TLFA
chains in the Genus database with same CATH superfamily
1AIPA 3OIVA 4ALJA 5LA6B 1NRWA 2NUAA 3WRVA 5JXGA 4C30A 1ZK4A 4MMYB 1NW9B 4KK4A 5AJYA 5G4KB 5LMUB 1MQAA 3UOWA 4AY5A 4YPVA 3U60B 1XCLA 1G5TA 3U2QA 4C4TA 4YECA 3KEGA 1HDYA 2I6TA 3IERA 4KV7A 3RHFA 1R9NA 2HWUA 3ADCA 2P6PA 3KSMA 5H68A 4AJNA 2IUSA 3V3KA 1ZG3A 2IRWA 3N8IA 2Q7XA 3E15A 1LKZA 3Q3VA 5E9AA 4JOBA 1DWPA 1GNTA 1D1TA 3GO4A 4X20B 3PI7A 1TL7C 1MN6A 1Q5PA 2EDCA 1GQQA 4UUOA 2JCYA 3DO8A 4M0EA 3L6DA 4IZOA 2BV3A 4C7JA 2AYXA 2IX3A 5F77A 5BVGA 4BMYA 1YAHA 2UYCA 1YRHA 3HKEB 1PFWA 4WQMA 2QRVA 3RBVA 4RWEA 5CA0F 4PFKA 2FG7C 2X76A 1D0SA 2WHEA 1EX9A 1XVLA 1ZICA 2OHHA 1SB8A 3ZCVA 2PS3A 5KOIA 2RGXA 3KXKA 3VI4B 4C2UA 4JLOA 3RWMB 1R4MB 2IEGA 5IAAA 5SV2A 2IYQA 1AQ6A 1MD9A 1P0MA 4D7AA 1I5RA 3PZRA 1P72A 3FH0A 2IYFA 2RC5A 5DEOA 4ZGGA 1QS0A 1VYVA 1Z5NA 3ACBA 1M5RA 2ZKLA 4G1VA 1D6JA 3DBIA 1FFSA 1G21A 3DDOA 3CX3A 3OZFA 4G36A 1I7NA 3UH1A 4BTVA 1FXSA 4HPJB 3ANLA 3HRIA 4MHOA 2Q45A 1QTQA 4OH1A 4QGFA 5IKEA 4NYJQ 5KB3A 3THYA 1X42A 1J21A 1CUEA 3OPXA 3VYSB 1XF9A 2G17A 4HNRA 4DBLC 4AP9A 4DSTA 1LI7A 2EJBA 2I2FA 4GOXA 4B3XA 1L4UA 5JPCA 3PCRB 1EE1A 5GONB 3VPDA 1SJ9A 1TYZA 2D1SA 2ZAGA 3UMMA 4Q7JB 2AH5A 4MYCA 3HXMA 1CE8A 1T43A 4A2WA 4RF3A 1YI1A 1RQNA 2AEJA 4DV0B 2R6CA 1NBAA 3OEHD 4R3NA 5JMTA 2WKPA 5F4ZA 3WKEA 3L9WA 4HAWA 4MPRA 1QHYA 4DLSA 3M2PA 1C2TA 1E98A 1QGZA 1EJ6A 2C5FA 2WT9A 4KWHA 2E6UX 1RKQA 2Q0SA 2CE2X 2R47A 4RE6A 1WBBA 1RMQA 1MJGM 3KB6A 2IW1A 4MUBA 2D2XA 3TG8A 2D2FA 3U6BA 1NXTA 2Y6VA 4BB9A 4BNDA 4LYDA 4CXMA 2X42A 4P0QB 1Z2OX 2N0SA 2IOQA 4J16C 4ITVA 1FVXA 3NTOA 3QVOA 5EESA 5L51A 5EWMA 1Y7HA 2B1QA 4H16A 1W5FA 2X0NA 4P83A 4WKGA 1OXSC 2BFFB 3RV4A 2I91A 4P7JA 1B0UA 2BR3A 2VJAA 4JJZA 1E96A 2RC6A 2GH1A 1ZI6A 3COVA 1NBWB 3H5OA 3DF9A 2JAUA 4KQWA 4V39A 1KMHB 4JODA 1Z29A 2JGDA 3URMA 2JRLA 2OXEA 3A6ZA 2QVBA 2ARKA 4QUEA 4G81A 2RIPA 4NV0A 3FB1A 3LK7A 4MI9A 3TLCA 2IUFA 4MW1A 4EITA 4RQAA 2DUWA 3D7NA 5JQGA 2H1VA 5FF9A 2AOVA 3PHIA 4DMKA 2JF0A 3OESA 3UWPA 1OXTA 3TIFA 1SUPA 4R31A 4I9HA 1YIDA 3GAAA 3JQFC 3HDJA 4MUMA 4PFQA 1PNVA 1S5PA 2DTXA 2FMIA 3MAAC 3NBKA 3RR2A 1Z07A 5T3UA 3DW3X 4BE9A 4YP0A 3E9YA 3I28A 3ASZA 2B8WA 4XYMA 3GEMA 1W88B 3N0VA 4L4XA 4L22A 1JIIA 5HS6A 2R3SA 4BMVA 4IHJB 3U17A 4URXR 1T35A 2PZFA 1E9SA 3W1EA 4JLPA 4RS4A 4NPAA 4A92A 2Z08A 2I67A 1TD9A 1WL8A 2JRCA 4Y7DA 2R6GA 5BOSB 3BGVA 3FPCA 3TE7A 1WP9A 4BNTA 4MDFA 2VUUA 3SHWA 3ITEA 5AM3A 3O7MA 4B6FA 2IYYA 4FHGA 3BWBA 4TSFA 2MYTA 4HGRA 4OMDA 1LDBA 5A62A 1NLUA 3JAKA 4UATA 3GP8A 4BFWA 1E20A 1ZX1A 2MOKA 1XK7A 3CEHA 3PXAA 2CE7A 3IVCA 4UTZA 5CDFA 1FSPA 1IQRA 1VP3A 5EP2A 3FHJA 1BE6A 2LIPA 3FWHA 3BB1A 2B6HA 5DXFA 1M7HA 2W00A 4HAXA 4KMOA 5DYNA 2JLRA 4ERNA 3K0SA 4F91B 1V5FA 1W59A 1Z0FA 3FCUB 1XA0A 4O1HA 4TV8A 2DBZA 1O5OA 5T8KC 1OBOA 1U65A 3UA3A 3S29A 4XYEA 1FXWA 2VUSA 3T5CA 1E1MA 5BP7A 1QRSA 5KINB 4EF4A 1PYGA 4JZYA 3H2JA 5KIAA 4M1TA 2ZM5A 1U04A 2OQVA 3IP1A 5F3WB 4Y18A 2H7CA 5JS8A 5G53C 5LB2A 1GA1A 4GKVA 4LX0A 1P1BA 1PSZA 1HTWA 3GFSA 1DBPA 4WDRA 3WRXA 4EYSA 1B3BA 2PKWA 4IRMA 4L57A 4AKHA 3AU8A 1FMTA 1STOA 2B7CA 2FR1A 4FCCA 3VVMA 2A9VA 3MM4A 4K6HA 5I4KA 1AE1A 1RS0A 1JEDA 3L1HA 5KI6A 4DLZA 3EPKA 4MAMA 1P0CA 4G4SO 3TB4A 5DM1A 4H7PA 4LCBA 4FFVA 2A0UA 4HADA 1JIQA 3P8ZA 3T41A 2QNBA 3KZOA 4KR2A 1I2CA 2EZUA 3N2ZB 2IIQA 1KO4A 2DUNA 2FFRA 4TTQA 4EZBA 1Y1TA 2V59A 1PI3A 1X92A 5BVGB 4W82A 4DM3A 2I6QA 2GJKA 3AHGA 1OLOA 4MOWA 1YZTA 3W8FA 5A9SA 4GXQA 1RHMA 2ERXA 4R3WA 1NHGA 3DFFA 1IHDA 3H6GA 3R6DA 3ACDA 1WSAA 2E89A 5JIBA 1GLGA 3BGOS 4MV3A 4K81B 1E2IA 3I04M 3SHOA 1SK9A 2PXHA 1USWA 4YTEA 2XNDA 3T8YA 4A9AA 1PG0A 2DPXA 2IEZA 1Y4ZA 3BXGA 4JZKA 5E1OA 4AW9A 3L4JA 1QS0B 3D7LA 3EVNA 1OH8A 4MVJG 4EHLA 3RFVA 2J7PD 2O5VA 4L5BA 4IH4A 4GP6A 1E0AA 1G21B 2ZQ5A 4M7WA 5TS3A 1JWBB 3I6IA 2DFDA 3L02A 3IOMA 1U2ZA 3ZWBA 3THYB 3A6EA 1L0BA 1QHGA 4GGOA 3WE7A 3UWSA 2PJRA 1BD4A 1TCUA 3S1LA 3NTRA 5CPBA 2PCJA 2R1UA 4Z7QB 1X7ZA 3QOFA 4Q7EA 3BFVA 2N9UA 1M1YB 3PX2A 2GSWA 4JBGA 3N3AC 4LDPA 3TSWA 1CE8B 1Z75A 1ECFA 3FMFA 5IM4A 3DTYA 4XPZA 5HZGA 2I55A 3AJ8A 4GI3A 4JBIA 4N0PA 4F3YA 1GG9A 2QN9A 3KIPA 2PQ0A 1Y37A 4I8IA 1RXEA 5AOAA 3UGTA 5IDWA 3I9LA 3R7DA 2QD2A 1C9YA 2EYUA 4X41A 4M0MA 4MRNA 4G5GA 2NPIA 3T38A 4OX9Y 1BCRA 4K3UA 1G18A 2A30A 3K2QA 1XTJA 4PG4A 3EEIA 4RD2A 4ZTZB 2E1RA 3Q0EA 4JYBA 3TNJA 2BRUA 2F1KA 3LUKA 1FMJA 4MA5A 5EWMB 3M34A 1IONA 2PGJA 3JAMA 2WU8A 3M1IA 3SZMA 1O89A 4MVJE 1DQPA 2HF9A 3AHEA 1G8HA 3QJ5A 4S0ZA 4TWIA 3K1TA 2QUJA 1JFFA 3TR5A 3NU1A 1DO0A 1YSCA 3ZGXA 1Y82A 1WMAA 2JGDB 2ABWA 2RGYA 4NYIR 2P78A 2WUFA 3SXPA 3IMFA 5F2NA 1Y6ZA 2LR0A 3KNZA 1CUBA 3OCVA 1CJCA 1PUJA 1MC4A 1Q17A 1FFGA 1RABA 1ZC4A 2GKSA 2Z2YA 3PRHA 5EIBD 4ZAGA 3IJ5A 3T0FA 2CDCA 1ATZA 4WLNA 1UBGA 3D7RA 1KEPA 4LY3A 1DAKA 3BORA 2P3QA 1KH3A 5EJ8A 1ABBA 1NXVA 4JU8A 4O63O 1PQ4A 2GO7A 5L53A 2AFRA 1RMTA 3DL0A 5GY7A 5CB4F 1BQ4A 4ATNA 4M9XA 4E5SA 1B1CA 4DCCA 3QSYA 3BXXA 2JLQA 2OHFA 2GKOA 1TZBA 1YDHA 3T1HB 1NW6A 3SY8A 2JDID 2QR5A 5AKEA 4H1HA 3CLSD 2HV9A 1FTNA 2OAGA 1E1DA 3OSZA 3PE6A 5FAKA 4O0LA 3JZAA 3STVA 1J33A 1XTQA 3TBFA 4LQLA 4RDCA 2AE1A 4OQ4A 5CLJA 3O93A 2X19A 1N3LA 2BMDA 4PC2A 4EMBA 1MIOA 4G5HA 2VUIB 1LVHA 2ZU0C 1WW8A 3KP1A 4IDOA 1QUEA 4MV4A 4NBLA 3RS3A 3SHTA 2FUG1 1RPZA 5CJ2A 2QUBA 2GMWA 1C3OA 3ZVKA 4QDXA 3QUAA 4HQRA 4Q3KA 4B17A 4IYJA 1UBSB 1LUAA 3BS4A 1COWA 4GLFA 1MVLA 4WXMA 5EN4A 4CL3A 1W36B 1N2IA 4Y0AA 2Q2WA 4ITUA 1NC3A 4H3VA 4KN6A 3IILA 3HPRA 1QIKA 2BFEB 3UANA 4AY2A 1RI5A 1YK0A 3V7YA 1NXXA 1ULTA 2GN1A 3ZE1B 2QI9C 4LF8B 3BBLA 4IQ8A 2WOOA 4FQ7A 4TV8B 2VT2A 2BM0A 3LKDA 2J7KA 3I5UA 3CURA 4G9GA 2C4NA 2OQIA 3R7FA 1YCFA 4DAOA 1MC5A 1B4DA 5GJWC 3IAM6 5FIUA 1JECA 1YCDA 4IRXA 1WMSA 4RGBA 4PHGA 1VMKA 1KKUA 1YJ5A 4Y2GA 5B30A 1NMYA 4G56A 2CY0A 4I4LA 1GR1A 4FW8A 3AXTA 1JA9A 1SC4A 3HSYA 3HO1A 1KYVA 4PZEA 1E3WA 4EG4A 1L5OA 2KQUA 3QNUA 2B4RO 5CNKA 2IYEA 4D57A 4QTYA 3LQ4A 3M33A 3NWEA 2JFGA 4HSGA 1TQ4A 4C5BA 4LDNA 1CY0A 3TECE 1Z4JA 3JRXA 1SVOA 3MF4A 2X13A 1SOMA 3DFZA 4GE3A 3NTQA 4I9UA 2VJOA 4URYR 4XJXA 3P2MA 1DO8A 5A3JA 1U28A 3FCSB 3SWWA 2O3TA 4BFSA 3AHDA 3HR8A 5KSYA 5F73A 3G2QA 2GBLC 2O3QA 2ZWAA 4L4RA 4PYRA 5EUMA 1ZCZA 2VWPA 4N1AA 4RSGA 4TRMA 4HFNA 3RNLA 2NSLA 3GCWA 4HN9A 1W48A 5AIAA 1NQVA 3S8EA 4IH1A 3CH7A 4J6EA 3ZY3A 3N74A 3OWXA 1KVQA 4RK7A 5HUJA 3RROA 4MW6A 1ZOLA 2BP7B 3KJEA 4PVDA 3JWHA 2YMMA 1Y8QA 3V1TC 4DQVA 2VH5R 3LBAA 2DZDA 3RSHA 3MSCA 2CUZA 4OBBA 4LF9B 2BZSA 2W98A 4RZUA 1HQKA 1PDVA 4GECA 1MAVA 2EVWX 1JXAA 2O1WA 3UOGA 3VNRA 1TW2A 4CQMA 3BRWA 3WWOA 4KQEA 2IIVA 1J1UA 1E63A 2WMOB 5AJWA 2YFHA 1ZI9A 4JBLA 4OUDA 2QORA 4Y6PA 4D9JA 5TT1A 2FSGA 3G1TA 2R6AA 2V9CA 2FRXA 4ZVQA 2P2CA 2VNSA 1T9GR 5FWAA 1G6HA 1BE8A 2W2OA 3TBKA 1N92A 3R0VA 4M1YA 5ENDA 3E3OA 2XD9A 4J1TA 3K16A 1DV1A 2FZCA 1IOVA 1NJSA 2SICE 3GRVA 3KYBA 3P52A 1EFRA 5AW9A 3WFJA 4B0OA 4DA6A 1EXVA 1OI7A 4RJIA 2O07A 1X7ZB 1SWWA 2PWAA 5IJ9B 1R8YA 4UZSA 1E5XA 4LX8A 4MI6A 4IZ6A 1T0BA 5KTYA 2DHQA 2QVLA 4Y6RA 4ZO7A 4BFTA 4MI3A 3RWBA 4OM7A 5JNSA 4Z9FA 1S4MA 2GNOA 2AG6A 3QKSB 1UXGA 3Q7PA 2R66A 3HVUA 4CTJA 4HVCA 3RKRA 4EBBA 4OTZA 4E14A 1YS1X 1YA8A 4JWKA 1GADO 1AB5A 1BCRB 1E2JA 5EMLA 3QQ5A 4OMCA 4YWJA 3GCGA 1X1SA 1ZUD1 1OU0A 4FGSA 3AR5A 4FYJA 4G4SP 5FUVA 1J1IA 2QZPA 1VCHA 4ZC8A 1R6VA 4E07A 4NBTA 1ZR4A 1PBNA 1MQ8B 1NPDA 4PGMA 2NUBA 1XDWA 2TSYB 3S70A 3ZWWA 3OEEA 3MTGA 3ETJA 2BLLA 4J91A 4JC4A 5DHFA 4HNAA 1QAOA 3DLPX 4Q7QA 1RZUA 3UPDA 5IVPA 2PIDA 2O2SA 3EDQA 1CVRA 1Y3BE 1QOQB 5ALJA 3S2IA 3H5IA 4M6WA 4AVYA 4JOSA 1I9CA 3CEPB 4M1QA 1RJGA 4B0PA 4MWDA 5KVSA 1V8BA 3OTGA 5K3SA 4QOHA 2EYQA 2Q9AA 4YBRA 4N6GA 1OBCA 2I7TA 2W6QA 5CLFA 1TCVA 2RHLA 4N5LA 3QUCA 1QTRA 3CCBA 4Y1GA 3VYWA 4C76A 4QULA 5HQ3A 5K3DA 1H94A 2EFDB 1L6IA 3CWZA 1R5BA 1MA3A 3OIGA 1DNPA 3GYBA 2NNLD 2WPNA 3ST7A 3ZYZA 1O95C 4GBGA 4ZT2A 1SC9A 3HXQA 2CLOB 3E84A 1VKZA 4GT1A 4RF2A 4XE5A 3V33A 1RAIA 4FLFA 2IITA 4AJHA 1V35A 1ZIYA 1BD3A 1W0CA 3H5WA 3NHBA 4X90A 5EXPA 3ERCA 2QQ5A 2IS2A 5E6RA 4M1KA 4S04A 2P9ZA 4C0JA 4LY9A 1XROA 3BBPA 3OA2A 4QQRA 1C3OB 3S99A 3G5MA 5DK4A 2P1RA 5FLEX 1WWKA 3K9HA 2AJCA 3VPXA 3ER6A 3GUHA 4KLCA 3HCPA 3EUFA 1UDXA 5F64A 3UHAA 2Q7OE 2VQ6A 1GLNA 3HLTA 4DRZA 3QEAZ 2VTEA 1H2RS 3BMXA 1TXGA 2W6ZA 3L1VA 2O3JA 3MT9A 4GOOD 2CFIA 4JENA 4RHEA 2PX2A 4HLCA 4PICA 1PEKE 4YWHA 1WXFA 4HDAA 1UQUA 3ORRA 4JLAA 1DELA 1DIOB 2GUWA 3IV6A 1MEOA 5IUNC 5JJLA 3P27A 1AH2A 3L1UA 1NC1A 5JS1A 1DJNA 1QF6A 2MT9A 2Z56A 2WA2A 4JLUA 3BTVA 2ERCA 5IT9A 1XZBA 2HC9A 4BIMA 2A67A 1RJEA 3BL6A 5LP6A 1QP7A 5D3QA 3EEFA 2A57A 2Q1SA 5U4XA 1PWEA 1BVRA 1I24A 4QL3A 2UZIR 4MV5A 3GRAA 4O5OA 4ZZ1A 3EQ2A 3CJRA 2PAFA 5D1HA 3K9CA 1E3WB 1S89A 3UPTA 4OL9A 1XUOA 2DU8A 2AN3A 1J8MF 1FLDA 2Q29A 2QG4A 1AKEA 3SEFA 3VQTA 4ALIA 3PGJA 4B43A 4D8VA 4BX8A 4C0XA 5FLYA 5K4HA 3P4UA 2G28A 2PGDA 1TIPA 4M99A 2JFOA 4BP3A 1L5FA 2WHYA 3RVKA 4TLLB 5CA1B 2FN3A 1K6JA 1RE1A 2RCNA 3P9CA 1BYUA 3RVSA 2OQ2A 4KXVA 1WKBA 3E1GA 1M54A 1OI3A 4N5DA 4WK6A 5DGDA 5DWDA 3WLEA 4F7WA 2VHWA 2VRCA 3NNSA 4HDOB 1MP0A 2ZT8A 2ZBGA 5LCXA 1Z6XA 1WB6A 4CQMD 4NEHB 4AN0A 1UBOS 5AM4A 2KI5A 1N34B 4C88A 2KJQA 3Q72A 3LU1A 1PF7E 4B5KA 1OT3A 4H7IA 1T13A 2B83A 5A7HA 3I1YA 4UBIA 1P1JA 4LGMA 2Y77A 1K9SA 1NJ6A 4R1UA 2P9GA 1LBSA 4OUDB 1HUQA 5CM9C 4WKNA 3CISA 3UB4A 3AHIA 2GXUA 2Q1YA 1VMEA 4LTNA 3T7AA 1P2BA 3RJZA 4EKEA 2ZVQX 1XMXA 1RRVA 3L7MA 4EJ6A 2EEPA 3IAAA 5K6AC 1GUBA 2YJ6A 3E61A 4EECA 3L4EA 2HK7A 4B2PA 4FKZA 4PC3A 4XX0A 1J0XO 3S2YA 1QMPA 2ODQA 5A6SA 5FHRA 5ICGA 1EZ4A 4HK4A 1QKIA 3FDJA 4URVR 2OG1A 4CMHA 3GV0A 3PYLA 1FJGB 1NWHA 4DW8A 3DCNA 4OGFA 4DQKA 3C1TA 3Q6NA 4DWWA 1D9ZA 2E3JA 3STXA 3T9FA 3WIOA 2E4YA 4AMBA 4C07A 2FN8A 2Q4OA 4TXJA 3UWKA 1K66A 2N46A 3ZX5A 4D4IA 4BP9A 4TV9F 4B7UA 4RW0A 4TQ9A 3VR5H 3SJAA 5FEUA 4OXIA 1YZNA 4DAEA 2FXIA 2ZT7A 1ISPA 2V7UA 3DZBA 3EASA 1OLSB 2CLLB 2PKCA 2ZUSA 3K31A 1AUVA 4PR0A 2HSJA 3W8RA 1Z0SA 3D8HA 4KXFB 2CJWA 2QX4A 3JQEA 1ZXXA 3OOJA 1TB4A 3M3DA 4XYBA 2IC5A 3E58A 3F1LA 2CFOA 3AM3A 3D4LA 5AVYA 5IK2A 1NP7A 1N5MA 1CQJA 4HNAB 5AFSA 5ED4A 2UYGA 3LBYA 2VYQA 4L27A 5HOEA 4N7BA 4Z86A 1P0QA 1ZIOA 5KNDA 4M6WB 2OBYA 5E2AA 2J4FA 1C0IA 1FFCA 3WRWA 4EMTA 2JIPA 1WMEA 5GOZA 1US8A 2XZPA 3BOSA 2QTVA 1UDAA 4WJZA 4WHMA 2FWIA 5AKGA 4Z9XA 1L7VC 4QYWA 4UTXA 4YJ3A 4KQFA 1RR6A 4ZT4A 2DR0A 1Q15A 1R37A 3CZ9A 3L8HA 4JUFA 2FF7A 1XZ8A 5BV2P 1EUDA 5HQ3B 2VZ0A 1KAOA 1C30A 1XJQA 2QG9A 3B12A 3ET4A 3LDGA 4TXMA 5JD6A 3VKGA 2ZU6A 1WU7A 2PD3A 4ZZ3A 3C8ZA 1JSLA 1ZOOA 3OCZA 3EUWA 3JCZA 1JBQA 1G2PA 1WF3A 1OU4A 3AOGA 3J80A 2E85A 1WOMA 4ZEVA 4D9HA 5KQRA 1TTTA 2IU4A 2HCTA 3H87A 1Z36A 1NHWA 4IRUB 2OORA 3M9XA 1QCYA 1UJBA 3V8VA 5KTTA 3OX2A 5E6RB 4FDVA 3SVZA 4F2PA 4LF4B 4TUYA 1DX9A 1YCHA 2AJ8A 1AO0A 3USES 3P2EA 4RVUA 1TQHA 5REQA 1JQDA 2C4UA 3JD3A 4P81A 4WA8A 4B7AA 4EZEA 1JTEA 2GTPA 2QPTA 9LDTA 2GEKA 3O4GA 3PUWA 4OHPA 2WVHA 5DTIA 3T9CA 3AKZA 1UDCA 5D5PA 2PGIA 5I9MA 4LSWA 3H6HA 3OFVA 2IZ6A 2QW0X 5FYDA 4JI1B 2LBPA 3ZTWA 1T5TA 2ANCA 3EGIA 4LZWA 4ZOLF 2EP8A 2X22A 4PZDA 3T1QA 3L0SA 4D4JA 5AXBA 2X2FA 5CYPA 4F6CA 5TS2A 3L6OO 2WD7A 1AM4D 1UBMS 4JJ7A 1QZUA 1IZ0A 3WIDA 5LZ8A 4EX6A 1CJVC 4QBIA 4PAWA 4AZWA 4ZV4A 3A7DA 4UHJA 3QA9A 3L79A 5LP6B 3ZDAA 5HFNA 1JQAA 1M2KA 1YCGA 3LBHA 1SOAA 3F4LA 2VJKA 3TB6A 2HHCA 5AVZA 3QOXA 1RRPA 2VDVE 3RRNA 1BH2A 1EK5A 2M1ZA 3H1EA 3GROA 1OH5A 4IOLA 3I9V6 2XQIA 1U7ZA 4C4AA 1LK0A 4AICA 4HX2A 4AF7A 1Y4UA 1ZCAA 3Q3HA 2OZVA 4RAQA 2VRCD 4OJMX 3ZDZB 1NZJA 3S1AA 2GBGA 2P4EA 2JGNA 2GPBA 2XKAA 4DKXA 5HPYB 1EESA 3IHTA 2MU1A 3KALA 1YVUA 4G67A 4PLTA 1KBZA 3RVOA 1W75A 3DQQA 3ISJA 3M6MD 1N8TA 1ORRA 1QYDA 1SG9A 4DARA 1SUBA 1KA9H 2QV7A 1HV8A 1DXQA 1PL0A 1YB2A 3EOAI 1PV1A 4L78A 2JD1A 1JU9A 2OFFA 1R8XA 3K5WA 3WLKX 4FOLA 4XRRA 3C4QA 3N7AA 4IIFA 3X0DA 3TAXA 4GRIA 3GLGA 1N0IA 2ATIA 3MNFA 1QG2A 1V8OA 5CFMA 4LXHA 5KNBA 3B6JA 1E3SA 5BNWA 5HQTA 4KPEC 2JJYA 2O14A 1FUIA 4PRZA 1WTAA 3NAMA 1CQZA 2AT1A 4RL4A 2X14A 1IXYA 1N2BA 3EXIA 4B79A 2OHIA 4BNUA 5JO9A 2YJNA 1UKZA 4IMRA 4PS0A 1T9CA 5CW2A 2JARA 1UKBA 2JJQA 2ZJYA 3H5TA 5EE1A 1WP4A 1Z62A 1ZITA 2PJUA 5EQFA 1VGQA 5FDFA 3D64A 3E5MA 4U63A 2FUEA 2ZJ0A 2Z95A 4R41A 1QVWA 3CZCA 1ZWLA 4UUAA 4BNZA 1JJAA 3C1OA 1MAWA 1W6UA 1TJ4A 2WFZA 3CTPA 4C0BA 1OROA 4XX0B 3ZTTA 2QPOA 2BDUA 3L77A 2NP7A 5A6SB 3GEHA 4LGVA 5GVRA 3UFXA 4AM8A 3UGJA 4LOKA 3DWEX 3Q41A 3ZD9A 3U1BA 2BTQA 2GEVA 2YICA 5EEHA 3INTA 4OF4A 4WVFA 2F3TA 2XECA 3AL2A 4Q9HA 3I4CA 2QRZA 4XGRA 4QBGB 1O4WA 2PTGA 3GBVA 4IFEA 3T5PA 1MMFB 3GNLA 2PT6A 2WR8A 3RHZA 4M7OA 1AO3A 4CUZA 2B9EA 3FIJA 3OURA 3CCFA 1J8FA 1ZRNA 2HXSA 4G2NA 4MIOA 1ZK2A 2YWRA 3HO6A 3M6IA 4GLLA 2ZVDA 5JWRA 2CJWB 3VO8A 2ET6A 2AQHA 4OFWA 1SUCA 3EQ8A 1Z8FA 1G5HA 4WXYB 4C03A 1BGVA 1PBTA 1V4VA 2W43A 2R25B 3A3YA 3E53A 4FDUA 3PXEA 4H1TA 4Q9AA 4E7OA 4ZI7F 1KY4A 2GRUA 2GXQA 3F5MA 2VNAA 3X3HA 1VG0B 2P3LA 3IBCA 3TSYA 3BE4A 2ZZKA 1G7RA 3IYLW 4GKBA 4INAA 4RGYA 2VVTA 5BW4A 3EX7C 1G38A 5KHAA 1MT3A 3DB2A 4IDEA 3DDNA 1U0TA 4XM0A 2BFPA 5EOVA 3DR5A 3S81A 2LNDA 3RVQA 4G0VA 2VF2A 4LUCA 4ND1A 1FTWA 1US8B 3DZKA 1R88A 4IS3A 4JYPA 4ZGBA 5HKOA 3DSRA 5FULA 3ACCA 4YJ3B 4GEGA 1AV6A 1KFEB 4N6NA 1FTGA 1PL7A 4AKEA 3BTOA 2QJRA 3I9KA 1EUDB 4UTRA 4LJ8A 1C30B 2F43A 3EXFA 1RHJA 2D8AA 1RPAA 1V1MA 4TYNA 3H3XA 3PQDA 5CM8B 1YQXA 1EIZA 2EKQA 3IJPA 1XQVA 4KQCA 1MX5A 1U8XX 2EOAA 3LDHA 1DUSA 1QK5A 2EFYA 2Y1DA 2Z43A 5TQ0A 4A2PA 1JE1A 2QTTA 4ALLA 4LJYA 1E92A 1M83A 4OJNA 4NU6A 2HT6A 3LPAA 2QTZA 3V3TA 2E7ZA 2YN4A 3DXZA 4WCFC 3ZZ0A 5K1ZA 4X65B 4E94A 4TUYB 3WQRA 1PTKA 1M2NA 1PT8A 5L6LB 3CW8X 2Y9MB 1FUEA 3NJRA 1SBCA 4IQGA 4K46A 1H1LA 2HU8A 4RH1A 3RIYA 2AMYA 2FPIA 5REQB 5L7WA 3BULA 2A1TS 3V80A 2Y1XA 3DMTA 2WICA 3MWLA 4KG7A 3U4CA 1NKSA 3ANYB 2J45A 5EKTA 3G8AA 5LMNB 2LDXA 1GGHA 3P0FA 3RUDA 1SK8A 4ZVLA 4AQDA 5IRCD 5BQXA 2JAOA 3MINA 2NSDA 2VHEA 2MHCA 3AEQA 4YRLA 5FRDA 3QTBA 3BZUA 3MTQA 3RUCA 4EW6A 2HTFA 1Y3FE 4LRUA 3N2YA 4R1PA 4FB4A 2XNSA 4N12A 1U0FA 2WWFA 1K27A 2XX3A 4FTWA 5AICA 4HBGA 2VCEA 3PC3A 2PM8A 1ITZA 2ZUTA 2A9OA 1GPUA 3LQFA 3N70A 1WV1A 1YFZA 3DYVA 2IOFA 2GN8A 5A2GA 5FPSA 1JR2A 3OJLA 2NU6A 3W6PA 2XSZA 4DILA 1MPXA 1YQGA 3THSA 4LMPA 3H1GA 4XKJA 4EB3A 4MVCA 3C4JA 4ZRDA 2BF7A 3DPIA 4CMCA 1T6BY 3O91A 4YP7A 2ZRNA 1B42A 2P5UA 3CPEA 4XQEA 2J8ZA 4N01A 3S1AB 1QE5A 4RTMA 2UU9B 2IEBA 4FDTA 1TQ2A 1UINA 5EZQA 1HE2A 4B74A 2ZYRA 3G82C 2Z8ZA 1V4BA 1AQIA 2A59A 1EJ0A 2BR4A 3QVTA 3WLMA 1IBMB 3DE3X 1QGDA 1GGVA 2RB4A 1VZ3A 2WB4A 3GA5A 4J3NA 4W7SA 3UMGA 3I83A 2HWWA 5NULA 3V7WA 4Z9YA 3BE6A 3T52A 3CF4G 2QTCA 4UAVA 1DKUA 5FFFA 1NUSA 4FHFA 5BSGA 2BFNA 4KHPB 3IQZA 3DP7A 4FEGA 5JNLA 4RTSA 3RADC 1K4MA 2L18A 3AVPA 3ENNA 3RUIA 1G9TA 3TG2A 3QX9A 2AZ4A 4WK0B 5M2QA 4BKPA 4TMFA 4FZ5A 4ZOQI 3R24A 4KBYA 3K09C 1TT7A 2YMLA 3CW9A 3EXIB 4NBSA 1YVEI 2EWWA 2IKQA 3Q3JB 1W76A 4KQIA 1MH1A 3HM2A 1BN7A 2B1IA 4QFDA 2BOVA 2C8VA 4CGYA 2PBLA 1QJCA 3D2CA 5HK8A 4AN1A 1JWAB 3H11A 1TKRA 1OHHD 3MRTA 5JSHA 3ZE6A 4KX3A 1NGSA 2H1OA 4A3SA 4D0SA 4Q7MB 3MIIA 3SZ3A 4JI4B 1VLQA 1TPZA 2F7SA 1QCCA 3TBHA 3GGJA 3IKTA 2Q07A 4FFBA 4WACA 4BGVA 1Y9ZA 3EAGA 2V6BA 4CTOA 3FOEC 4KW7A 1V8FA 3R5FA 3V4PB 1DAEA 3DNPA 2H0QA 1QKKA 1QWOA 2AXEA 2F48A 1L8OA 3FHLA 2J9FA 3YASA 4QPDA 1BDIA 2XUZA 2Q3DA 2P7HA 1IK6A 2BKXA 3WQBA 4D9IA 1ENYA 2B69A 3DMRA 4GOLD 1RZVA 1EM8A 3O7WA 3JU3A 1E1RA 1G291 2IDJA 4H7HA 4UHCA 4X7RA 3F49S 1HR0B 2ZBEA 2GVNA 2GAIA 2BSXA 3WMWA 4LPKA 4MRPA 4XWTA 2ZSDA 2IP4A 4OJQA 3ZIUA 4CUKA 1KMMA 5JCXA 3NHUA 3L43A 5D5HA 1LLQA 1MO2A 1SPBS 3B9RA 4URUR 2FW8A 1GPJA 3O9ZA 2AFVA 5F7OA 4RABA 2DWQA 2G8NA 4FUTA 1NPTO 4MITA 1S02A 4LSGA 3QGMA 1J8VA 2H8GA 3EQ9A 4EAAA 4R0MA 1PFVA 1PK8A 3WJ2A 3E9CA 3HJCA 3O38A 1T91A 1PP4A 2PGAA 4HB2A 5FI0B 5BR4A 5DK6A 1E5DA 2IKSA 4JEUA 5KZMB 2IS4A 4R5HA 1BXKA 2YHUA 4YNBA 3BIOA 1HT3A 3U0VA 2PS9A 1U0RA 5AVWA 2ACVA 4L8LA 4PYLA 1DUIA 2P0YA 3U3MA 1NMXA 4BO2A 5L6MB 3D6UA 1KJNA 2XXAA 3GWZA 1ONSA 2GF9A 3O4JA 3OY7A 3HXOA 1Q0ZA 1DI0A 4X60A 5KVAA 1NJGA 3U3JA 3VAYA 3UKJA 2K4MA 2F43B 1OC4A 3OX1A 2MSNA 3I1JA 5ALYA 2QD3A 4DSUA 3NWOA 2JA1A 4KWTA 4DM4A 2AQ8A 3SBOA 2VTVA 2PZ8A 3UH0A 5TQ0B 2IYZA 5JZMA 3LGXA 4B6RA 1XQYA 2WFAA 1T4GA 2VXBA 4ZRMA 1ZH4A 2C5LA 4DIMA 1K5GA 1Z7EA 1G5RA 3G8YA 5H80A 5KCZA 5I9TA 4C78A 3QMWA 2P27A 4ND8A 4AMUA 1SCBA 1WUJS 4UQPA 1H1LB 4HI0E 2JH9A 3RUHA 2FPIB 4BGUA 4I4TF 2NO4A 1ICIA 2YL2A 4GM0A 2NTJA 2R11A 3V8PA 2ZAMA 4CEHB 1F1JA 1VJ1A 1X1TA 2RGNA 2DKFA 4YRGA 2XQGA 2IUYA 1EQ2A 4AKSA 5JFOA 1JEJA 2FWPA 1EFLA 3CGGA 3PA8A 4O2BF 4X95A 1KZ4A 4PE5B 3IO3A 5GM2A 3SNKA 1ZH6A 3MINB 3AEQB 5HG0A 3VR2D 1RFLA 2C58A 1NWCA 2Q28A 4NE7A 5EL0A 1C29B 3PUKA 1P2GA 5FA5A 5C4GB 5B6JA 1LZLA 4PLFA 4RIGA 1A9RA 4AX8A 5AT1A 1EFDN 3AI7A 4AUNA 1SBIA 2JZNA 3GRZA 2QTWB 2O20A 2XSZD 5LQKA 2BPOA 4UM9B 2R96A 3ROZA 4OQEA 3EF3A 2A0WA 2RI6A 1OD6A 5FCDA 3X1KA 5CAEA 2EF0A 4GNKA 1VKJA 4IS2A 1JG6A 1A50B 2YIMA 2WILA 5AI9A 4NG4A 3VTKA 4PGGA 4BNMA 3FOZA 5LA6F 3H1FA 4CTNA 2NU6B 2PBFA 3QQPA 1U7HA 3QZUA 5BV1A 4OX9B 1T4BA 3O31A 2G9ZA 5EKSA 4TYQA 1BGWA 4Z2YA 3SZUA 3ZQ4A 4EUFA 1XTRA 3AVYA 1ZN2A 2BZ0A 3PFNA 2B4AA 2C1XA 3QTTA 1VA4A 4TOIA 3OQOA 1P33A 2Y1GA 3CQ9A 3EHDA 1JSZA 4D5EA 1OYYA 3M2TA 2DF8A 3QX3A 1X70A 4EK9A 4E11A 1VFNA 5DLPA 2VP5A 1DB3A 4KNYA 3W90A 3EXEA 1BQ3A 3LA6A 4MRMA 4IJVA 2Z2IA 4ZAXA 3CEAA 2QUHA 2EW8A 5A5DA 1DXYA 2XHEA 4B5LA 5KPJA 4OUKX 3TOSA 3JYPA 2NVUA 2HCRA 1QIEA 4UEWA 1MEEA 2Y1LA 2CXXA 3FTFA 3AZOA 3ZUPA 3D6FA 4YMHA 4LHVA 3OE7A 1HT0A 2GA9A 2H9YA 2UKDA 3PQCA 1EFTA 2H31A 2P2YA 2V6FA 3QE0A 4H0NA 4IIYA 5ALXA 2IXEA 3VMMA 4DN6A 1KKMA 3SZRA 3FYSA 2G1UA 4XZ3A 3OJCA 3H11B 3ABOB 1QIDA 1V4NA 2A5LA 4GR4A 1JU4A 4QGAA 4RO0A 2A92A 4PLGA 2JFYA 5C9ZA 5IWAB 2Z0MA 4B09A 2J5QA 1T2CA 5KWIA 2HREA 1FQWA 5B1HA 1XMPA 2ZROA 3KOMA 5DSZA 2WPDD 3G0HA 5AJVB 2FPWA 3MT8A 5KAMA 1QTNA 4FCVA 1XTZA 3DMYA 1UM8A 4FFBB 3W9YA 1NBHA 1W4LA 3Q8LA 5GONF 1MT0A 3LPCA 2CL0X 1G3QA 5CEEA 5KYNA 3F5SA 5EPUA 3GDHA 1NQ5A 5IBPA 1JEYA 4HXYA 2GXSA 3O95A 3CNOA 4GF5A 1YZUA 3C3PA 3DVRX 4UHEA 5ALSA 1N0VC 2H8KA 4NCBA 1NV9A 3D8SA 5C4MA 3HXKA 4TL8A 1EFHA 1D8TA 5JLJA 5L95A 2IPLA 3IFSA 5SZJA 4QA9A 5CM2Z 3C6XA 3FWZA 3WDSA 4I1RA 1OTYA 5CLGA 2ECOA 4K40A 5JDCA 1SXQA 2RG1A 3HP7A 3W2FA 1GAWA 2J59A 2J32A 5JD4A 2WC1A 1NDHA 2C8JA 2VTBB 5DW3A 2PVCA 3D59A 3RYTC 1DGQA 3QU2A 4Q03A 3WLJA 4B81A 4QRDA 2QTBA 5E3IA 3NIGB 3CJTA 4JAVC 3M6UA 1N75A 3JQ6A 5P21A 3ESQA 5T4HA 1DFHA 2YWFA 3I6ZA 4HWKA 5EG5A 4H7KA 3VA7A 1CZOA 3BDAA 1OV6A 4BFCA 2XXAB 1XEFA 2OCBA 5D86A 2VEOA 4AMGA 1NVVR 4LF5B 5CA1A 1MAAA 4F2HA 4ZZ2A 5LB4A 2D1RA 4W9NA 3UCXA 1MOSA 2CWWA 4BQFA 1N57A 2DAPA 2B8TA 2XWSA 5DX8A 1R3DA 1U3FA 2NXEA 3C6BA 3VAZA 2LD4A 5EJ5A 3KOXA 4HS9A 3ABRB 3DUWA 4TLEA 5K3BA 5KX5B 3Q5GA 1EGQA 2QPLA 1KAGA 4FZJA 3TQCA 3HY3A 4OL0A 3WL3A 3QHQA 3D6HA 5B64A 1W1WA 5BYAA 4TYWA 3AUAA 4FMCF 1AOXA 3SJCA 4WN3A 1BWSA 5H81A 2XPCA 3DQZA 4L9WA 4QX6A 1W96A 2QKYA 3WLIA 2VFAA 4AYXA 4IHJF 2VHXA 2DVMA 3H16A 2BGNA 3KXIA 2GLTA 3HDHA 1JDUA 2E18A 1ZSNA 1ZMXA 3NHFA 4R8KA 4CM6A 5K99A 5CK5A 2C3YA 3DLBA 1PS9A 3K9GA 5LU8A 3ZZUA 4B3DA 3KLOA 3KOZA 1K4KA 4KQJA 2Q6TA 2J87A 3NVKI 2XDQA 3ETHA 2R6JA 1K8QA 3CC8A 2VCYA 4FIDA 2AFHE 4MYHA 3WV5A 1RZRA 4D0NA 3EARA 4GI2A 3DULA 2FUG6 4QOGA 4C0SA 4QDZA 1LLFA 1T2NA 4MRVA 1ZP6A 4P0PB 2Z2ZA 3LUGA 3T95A 1YDEA 2VJDA 5CXSA 2VSXA 4GMFA 3AF3A 1PTJC 4NV3A 1SZCA 3Q40A 4FSXA 5AK3A 5CAEB 5BUCA 1ZAYA 4OYRA 5B2ZA 2UXBB 3F8WA 2ZB3A 4BIIA 2ZJ8A 4G9EA 3GW8A 1Z6YA 5F2KA 4AKIA 1G63A 3QFCA 5FUYA 3HBJA 2WTUA 4DHWA 3ZWAA 1VLZA 2Q0XA 2V7QA 2EZ4A 1FYDA 3Q0TA 4JUIA 2VBFA 2EJVA 2P90A 1ADJA 4PX9A 2QL9A 1V5GA 2CB9A 2QL7A 3II6X 4L1KA 2HADA 2O5CA 4IG9A 2IHNA 3COWA 2BMVA 4YLGA 3FPKA 2FW0A 2PZAA 3TYXA 2G3YA 1QAMA 2C9YA 1LLCA 3PPYA 4K8OA 4WFJA 2NO7A 3ZLVA 4MRMB 1B6RA 4ZYWA 4DJTA 1RC8A 3ZW8A 4WADA 4DPMA 1TVKB 5AKXA 5K0NA 3C98A 4FK8A 5F76A 5B57C 3MQ2A 1V3QE 2I7DA 4WOPA 4FE4A 3A9TA 3QITA 2N75A 3GJ4A 4ZQIA 2QMUA 3O8OA 1JGTA 1Q77A 4Q16A 2R84A 3Q2OA 4J7XA 3IUBA 4A6PA 4MDEA 1CV2A 1CZUA 1K08A 5BQ5A 1H9CA 5E7QA 1S1CA 3D6VA 4ZKEA 3UCFA 3IRUA 1M6VA 1OH6A 3LC2O 2QSUA 1XDDA 5A2QA 2EF1A 3A25A 2Q8NA 2FN9A 2HBZA 1N6LA 2AD1A 2EKDA 2PPVA 4YT4A 3WDLA 3RYFA 4GI7A 4CYMA 1E8DA 3C87A 1XO1A 3QNWA 4NFYA 3K70B 1JDVA 4LFAB 1QIFA 2IPAB 3JWJA 2HSZA 4FIZA 4MJLA 3LG2A 2RONA 1CG6A 2G80A 5AUPB 5I7VA 1UBLS 1HC7A 3H3JA 4BVFA 1RAHA 4Z8YA 5C8XA 4P4UA 2NLOA 2JEOA 1XZQA 2PV7A 2DFVA 1Z8NA 2IYAA 2OWEA 2QL6A 2A5YB 1CZRA 3A26A 3H19A 4Z99A 3GP3A 3C7TA 3PQ2A 1QE3A 2AMJA 1JEYB 2EW1A 3EZ6A 2OP1A 4BNFA 3JVUA 2DY1A 2IF0A 3RSCA 1N6HA 4N7MA 5GJBA 2IY7A 3OLYA 5DTRA 3KO8A 2WU1A 5DTQA 1DX6A 3ASYA 4U7HA 3L6UA 4KFCA 3RS8A 3LOQA 1XRSB 1Y7IA 1Z5GA 3G2LA 3PE4A 4Z5XA 1IY2A 2DPHA 1BDJA 2EBHX 3LDUA 3D8BA 4LOHA 5EFZA 4DMHA 1J9GA 2UVPA 4QJ5A 1OFUX 1HMPA 2QRMA 3AFOA 3E6AA 1U3DA 3VGJA 5EFOA 3ZY6A 2C9BA 1YBFA 1Z2PX 1UC4B 2PJDA 1G0NA 5D1NA 3LC7O 2Z6QA 3PGMA 3GIDA 4Z4EA 5L3QA 1D4AA 3DHEA 1RQPA 4ZDWA 1XPJA 4H3HB 3ZJYA 4E88A 1XTBA 1H6DA 3WYCA 4EO9A 3M0EA 2C96A 4V1CI 1YR1A 1O0BA 1JQJC 2CVOA 4Q0MA 1GKUB 1ID8A 4JI0B 1W25A 2BM8A 2ZSJA 1T8UA 1FFEA 1KEWA 5EP3A 1VI2A 3AZQA 1U2SA 2I29A 4MQLA 4F11A 4QDKA 1M2EA 3G49A 1P2TA 1V71A 1ATIA 1NUPA 3FUTA 2VYVA 3PFIA 4ZWNA 3VO9A 3LXXA 4BLOA 5BSHA 3I2KA 3FNGA 4Q9DA 5JQGF 1VG1A 1Z6TA 1FQJA 4MDYA 4HTAA 4GWKA 3CCCA 2OMKA 4WVLA 3MFQA 5JRDS 4HJXA 3DV0B 2CMDA 3VH1A 1EJ2A 1PD1A 1FZQA 1P1CA 5BMVF 5AI0A 2G5PA 5AOBA 1PFKA 3BILA 3WISA 1FFYA 4ALMA 5BSTA 5IN4A 1EQAA 2HRCA 2G9QA 2IL1A 3C6MA 4Q3BA 3MJSA 3RT9A 2FZEA 4WJKB 2P9JA 3A8TA 3VR4D 5MN6A 2IXBA 1FJXA 4OI1A 1NVKA 4HLUC 2QZ9A 2OCYC 1T0PA 3GD5A 4U2CA 3GMIA 4TLBA 4G89A 3KRTA 4TROA 1TC2A 3OOYA 4L8WB 5KBYA 4RK1A 4FD3A 2DLNA 1DE0A 3ICWA 4C7OA 4JX9A 4NONA 1ADGA 2ISCA 1J25A 1UPTA 3OWOA 4FBMA 1NX6A 2ZPTX 3HKCA 1H2AS 1Z82A 2BGIA 3LXUX 4IOMA 4JJ8A 4EHAA 1JDTA 5DLEA 1BXRA 3K94A 3JTEA 2AZTA 1NQOA 2L69A 4YI3A 1C8VB 1GGKA 3KQVA 4AG3A 3OU6A 4TV8F 5JCZA 1DKLA 1IZ8A 2ROQA 2PLNA 1C8BA 1ZZGA 1I1NA 1AGXA 3RU3A 1FXWF 3ZGLA 3ZXUB 4M0LA 4MVYA 1W9MA 3TIVA 3LL4A 3LQ1A 1I3CA 3U7EB 1DEAA 2VWQA 4RD4A 1XRLA 3VR3A 4D3DA 4F3KA 4MQ4A 4XTCS 4RK4A 5J4YA 3PJRA 3D5QA 3WWZA 3BH0A 1P75A 2G25A 3OOEA 3H5AA 4QRHA 2BFDB 4HRXA 5I7AA 1AQJA 3ZD7A 5KVCA 3U4MA 5JXWA 2XBUA 1NQWA 1SKQA 1R0KA 2XUAA 1QXSA 2V6JA 1WIWA 2C0CA 1J5EB 2OV1A 2ZWMA 2HK6A 1IAQA 1LI5A 3THRA 4ME6A 1E79A 4WE3A 4BVHA 2O3UA 1N6KA 4HDRA 3UV6A 2CXSA 2ZSBA 3LFUA 1Y81A 4I1VA 4BMOB 4F4DA 3GPDG 1LDGA 3RTEA 3VPAA 3PKJA 2Q3CA 4LRWA 1QGUA 2P2NA 3DVAB 3I0ZA 2Y1KA 2VNKA 3R4VA 4S1VA 4JI8B 1J0EA 3HBAA 4I5FA 1XCOA 4YCMA 5IH7A 3KR9A 2J48A 3O8OB 4KZKA 3GLFE 4CRWB 7ADHA 4QPZA 4C3VA 1PS0A 4U1RA 1YFLA 2WJGA 1GITA 4TWRA 2MJLA 1M6VB 5FPTA 4RHCA 1L5VA 3P26A 1TZCA 4M1OA 1I6WA 1NVXQ 4JBXA 2Z6AA 5LQSA 4NX2A 3HWX1 1ZUHA 4J7UA 3TW4A 4MUFA 1GEEA 4EG1A 1ZRMA 3PWSA 2VUTA 5H4GA 5ICEA 2HU7A 3BRCA 3RYFB 3BFJA 2GSDA 3IUNA 4KTTE 5PNTA 1XLTC 2J6CA 3KKKA 3QKRB 2XUFA 3FFXA 2IOHA 4HPWA 2C54A 3TRJA 5E3HA 2JFFA 3UMCA 1YKGA 3T1OA 1TAQA 1U9JA 3GJ8A 3PVSA 4B9AA 4PSDA 3RSOA 3ZDXB 3VU9B 1CJTC 4MR8A 2CXRA 3WWYA 4DVGA 2RFLA 1KXZA 2RHDA 1Y89A 2Z4SA 2JIOA 3FYUC 4CDNA 4D42A 1M7GA 1D0VA 1P4SA 4KPGA 2IE8A 2ZIUB 3C6YA 1B2LA 4A6XA 4JJIA 9MHTA 1E3DA 3N76A 1UEIA 4DDHA 3PWZA 5KYWA 1PWZA 1SKBA 3RS2A 1J22A 2JEYA 4DBLE 4F4FA 2WIBA 2Q62A 2UVPB 1ZM2A 4A8JC 4Q48A 5BSWA 1Q11A 4AO8A 5C53B 1HQCA 2FZLA 1Q14A 2YVLA 2EEZA 3TN7A 3RRZA 2IXFA 2J9XB 1KSJA 3DBHA 5E8RA 4BMDA 2E21A 4EY7A 5L3QB 2B61A 4IO0A 2RH8A 4H60A 3WRYA 1SH7A 1E7WA 3E81A 4E08A 1QDLB 1XMSA 2FWMX 4B3TB 1RAEA 3H3FA 1DJLA 4J0GA 4YRQA 1XHLA 2ZFUA 5H59A 2FEXA 1HYHA 4GZ6A 1TMGE 3IUQA 2V7XA 4IDDA 5EUCA 4B2YA 1D2HA 1SD2A 4PYNA 4F84A 2NUPA 1B6SA 2G76A 3SZGA 5BXQC 2YOFA 3KZKA 2PXAA 2PKEA 4XOIA 2H4XA 4PPFA 4ZDJA 2CFSA 4OAOA 2AOUB 3N2LA 4DYDA 2E55A 2WG2A 1JHXA 4NNOA 4PZZA 3BKXA 2D3TA 3GLKA 4Q3AA 4LC9A 5A6VA 2FSSA 3GVXA 2RDMA 3FZGA 1ZBDA 3MSXA 2OYRA 3DDUA 2FYTA 2P9FA 3SBEA 1JAZA 1KP9A 3E1SA 2GJ9A 4DQDA 3BXEA 1CQIA 2Q3EA 5EQJB 4RTRA 4AJ4A 3OO0A 4A82A 3O3CA 2XKJE 2G9NA 2JLUA 2W71A 5JCPA 2XRYA 3DLIA 3CS3A 3HABA 4XGKA 4B9EA 1ML3A 1N8KA 2EATA 1G8GA 3G8CA 5HZKA 2AR7A 5AOVA 4C0WA 4CTKA 5JCJD 1JH8A 5AQ1A 2V65A 2ZLBA 2YV5A 1H6BA 2D59A 1Z2DA 3NEPX 4TRNA 2MSWA 1UOPA 2O0MA 2XGOA 3IAFA 3K9NA 5ALQA 3L07A 4WUVA 5ERXA 1PKXA 1OXKB 4DPLA 4EUEA 2EU8A 2XW6A 3RB8A 1GT91 1KS9A 3SSOA 2W2XA 5EHZA 1EPUA 3HKCB 2F9FA 3KQNA 2BR5A 2WNIA 4KR7A 5FTJA 2ZM6B 4TSRA 2OCLA 5KYGA 1BXRB 2CL7X 1HEYA 1L9KA 1JKJB 1PT6A 1H6AA 3QUTA 3B9PA 1GRVA 4MPPA 4Y7CA 2R5WA 1PJZA 2AFHB 4DQXA 2ZXUA 4NWIA 2O2XA 3SOPA 4JELA 5HS4A 1ZM3A 2WAMA 4C89A 5I7EA 5I8ZA 2UUPA 2CUNA 1N1DA 4QOEA 3DKRA 1TM5E 3FNFA 3KJFA 3NBMA 3AG6A 2B30A 2J33A 3GLHE 1ENZA 4PZCA 1WG8A 2YZ7A 4JSRA 5FXMA 5F3RA 3D6JA 3OF2A 1RYEA 3MAJA 4GMXA 4HFRA 5F3DA 1YBHA 3N2GB 3OZXA 3UN1A 1D1PA 3BFPA 3DUFA 1OILA 4H7FA 1I33A 1GQRA 3QKUA 5DGTA 2KWIA 3ZHZA 4ZCTA 2O2EA 4U2GA 4DIDA 5CDSA 2DSNA 3ZU6A 3O8QA 2WU3A 4BV8A 4BWFB 4UAJA 4YP1A 1L3CA 3V9PA 3W34A 2CLFB 5DM60 4HDRB 4BNIA 1KFKB 1RBYA 2AXQA 1DP4A 5TEWA 3LV8A 4J49A 1J5XA 5AW7A 2H1FA 2H59A 2I33A 3CVWA 1QGUB 3IEKA 3OQVA 5CR9A 1FK8A 1PWXA 2I8CA 4EYOA 3L0DA 4NKRA 1FVHA 1KJ9A 4BXOB 4I1SA 4C0AC 3RF6A 1KVRA 3JWGA 4MP6A 4PRYA 1GNQA 2GUGA 3EVZA 1Z4KA 3LP6A 4Q6WA 3PD7A 4D6PA 1B0PA 3W3ZB 3H18A 5FFMA 4RVOA 2EKBA 3N2KA 4OHXA 5I4BA 2AKAB 2GYYA 3JQ9A 3OHPA 4X0EA 1ABEA 4GX0A 3OZWA 4OIFA 3O3MB 3V4FA 3T1YB 4C01A 2ENUA 1ULSA 2GLXA 2HW8A 4H0CA 3SQWA 1NN0A 4WOKA 3M9LA 1OVMA 2WYUA 3KPUA 4B7ZA 1F0KA 2PUWA 3GLFA 4G07A 1L4EA 2HQOA 1FS4A 2G7MC 2JGMA 2V7PA 4HH3C 2OO5A 3FKJA 5DCYA 5K03A 1IBLB 1FY2A 2AOTA 2ZE8A 3B3GA 3ORSA 3U4IA 4E5MA 1CF4A 3TZLA 4NOJA 5DNCA 2PQ6A 3RFTA 4UU1A 3R5JA 1L7NA 3ZVMA 1KBQA 1RD4A 4J43A 2HJSA 4PBRA 2HMTA 1CT9A 1LGYA 6CHYA 3G0BA 1S3SA 2H5EA 2IY9A 3DQPA 4FD2A 1GKYA 4KI0A 4LCJA 1JNXX 1GVHA 4HB4A 4QLBA 4XWYA 5AHXA 3EJ6A 4JY7A 1XVIA 4ZCSA 4D6XA 3JALA 4MR8B 2OHVA 2OD7A 4WZAE 1MAUA 2Q5IA 2XWPA 4MCHA 4F4CA 1V7CA 4OU4A 1KI6A 5FWNA 1R9JA 2P4QA 2OPBA 2Z9CA 3ZCXA 4G24A 1E9VA 3JYQA 5EE0A 3QPWA 2GBIA 3KUXA 1PLLA 2GARA 4NFHA 5KYWB 4NAUA 1OAOA 3ZYCA 5FKJA 3RU7A 4ISBA 1N7IA 3HG7A 3ZIAD 4BKQA 1USIA 5JO0A 5EXDA 4GIBA 4Q3NA 1VYTA 2C04A 3VHXA 4YV7A 5KTKA 4Q93A 4UM8B 3R7WA 1SVNA 3G8DA 4KR9A 5IULC 1WU8A 4X6UA 4IWNA 1VDZA 3DBHB 3QXSA 4ZQHA 3HBLA 4F4UA 5BSUA 3KEOA 1N0HA 4EAQA 4EVIA 4TMXA 2R86A 1Z6PA 1TDJA 2JCXA 4OAQA 3ROMA 3UMSA 3QWAA 5E6SA 1D9XA 4ARBA 5JCOC 1XYGA 5FPKA 1V8DA 4KXYA 3RTBA 4EA7A 3PNKA 1HE3A 2PL5A 2I4LA 2GXAA 1E58A 1YC5A 4DLVA 5FUQA 2Q3JA 3FRHA 3L0PA 4LVOA 4XIGS 4RCYA 3WAGA 1VLHA 1ZW6A 4AI6A 1EFPA 2NUPB 3HN6A 3JYOA 3TOCA 3QOWA 4OP2A 4C29A 1Z17A 1M2JA 2Q8PA 2Y2UA 3FUVA 3PB3A 3T35A 1FFXA 2OHJA 2YN2A 3T3HA 5LUBA 3AL0C 2EG9A 4DS3A 2C2XA 5F4BA 1YD7A 5F9HA 2I3AA 3OZVA 1XVAA 2Z30A 4JQSA 4D8UA 4RLFA 5KJ1A 3OTQA 2AN5A 1CQIB 4UUNA 1XQXA 3I8SA 4Y9UA 3L4SO 1FPQA 3K0AA 3C4VA 3KSRA 1B3RA 1YA6A 4FSDA 3QSGA 3EGXA 2PU5A 3W7VA 3MBIA 1KI1A 1Y48E 3UAWA 1QHSA 1Q1ZA 1PGQA 5IJAA 2YQZA 4FDMA 4F1WA 4NJMA 4YJKA 2G40A 2H9AA 1FU8A 3SX4A 1A4IA 1TA4A 4Z9BA 2RGRA 1XZMA 4PZPA 2I4TA 3BIWA 3QEJA 3V9AA 4HGYA 3KB1A 1M6HA 4QGBA 3GP5A 4PQYA 5BORA 2H4YA 3CT6A 3DE6X 1VSVA 2OUKA 2XYRA 3O1HB 3ESDA 4C14A 3PRKE 3UWOA 2QJOA 5H70A 4XLLA 2ZAOA 3ITKA 4QTUB 3DXXA 4N49A 2FR8A 3P9XA 4BEJA 2VT7A 4R51A 4GMHA 2GBPA 2GCNA 4RGQA 2VZLA 2ALJA 4LN1A 5KTSA 4KREA 4RESA 4F45A 4F8YA 4M83A 1VCNA 1X14A 4FFLA 3PIDA 4F6RA 4XGQA 4TPKA 3REQA 5LP6F 2BGTA 5IUJC 3LUAA 1HZJA 2NP6A 4J75A 4N7JA 3TINA 1U6JA 1T26A 3CUUA 5TMEA 3KETA 3LL7A 2NU7A 2XLCA 1KORA 3OZTA 1H8ED 3ANMA 4WPGA 5F2EA 2ODAA 2JVIA 2ZPAA 3EA4A 3BWMA 3O8QB 4W9RA 4DABA 2WHQA 4Z1MA 2A4KA 2O8EA 4OHZA 1IUOA 2QP9X 4ZP1A 2QRLA 3DE1X 1BKDR 3ONVA 3NNNA 4UEKA 5K3AA 5LMZA 1P29A 4RVNA 5GZ3A 4TKUB 4YRMA 5DX1A 1XA3A 1CQWA 2H1WA 2QT9A 3A32A 1DMSA 1N3IA 2ASVA 2PX6A 1XKTA 4F97A 1LSJA 2V58A 3OIWA 2AN4A 3C3JA 4PAGA 1ZMRA 4TZ0A 5EIEA 3FKSD 3W2TA 3IQIX 4MVJM 3LY5A 4FQ8A 5E4JA 5LYJF 2VF4X 2AQIA 4QXMA 4RIFA 2A5DA 4AYWA 1DXOA 3VSEA 1A9XA 2KM1A 1NTOA 3N2KB 4MZXA 2A9PA 2KSQA 3EZ7A 2ZRHA 3LX4A 5C35A 4UU0A 3GFOA 4IWYA 3VVCA 1DJPA 4RXMA 1RPNA 1DBVO 2ST1A 1X7YB 1TD1A 1EG7A 4K0RA 2GVZC 3TZEA 3VISA 1MU0A 4AY4A 4D4GA 1HFKA 2W48A 3ZWVA 1AHPA 3GLFB 3PEVA 1X0VA 4ARUA 2C61A 2K2QB 1IM5A 4AO6A 5B3KA 5LXTA 3D8NA 2Z83A 2X8LA 3KYCA 3AFMA 1JG3A 3CSUA 1LRJA 2RGAA 1BDMA 1TKBA 2D62A 2JCVA 3IAS6 5JTTA 2B21A 4HY3A 3ZW9A 3BXZA 1AMOA 2J0SA 3TL6A 2ATCA 3FPLA 2ON6A 3ETLA 2WINI 3D4OA 2YZNA 3EGDA 3Q9SA 3QVXA 2RHBA 1EM6A 1WKVA 4X85A 1QH1A 1U7DA 2C9DA 2C5GA 3IAHA 2Q9UA 3JD2A 4U7JA 4J0HA 5IM5A 4EB0A 3VU8A 4AQ7A 3FOWA 3HVJA 3Q9LA 2WDPA 1KI6B 5DNVA 4IIJB 2CUKA 3F78A 3RAEC 1NG9A 4WD3A 4WZAA 1V7PC 3RHTA 4F86A 4O59O 4ER5A 4MRRA 1SCUA 4L7QA 3WHKA 3G9TA 2V55B 1E1KA 2P5YA 1XP5A 4YCJA 3WLAA 3H5VA 4UXHA 4DF3A 5BVHB 4QSHA 2J3KA 3OPYA 3PQ3A 4L4UA 8ADHA 1Z63A 4E22A 1WE2A 3CXRA 3UY4A 3ELDA 3LYUA 1LJ8A 1T6XA 3LQ2A 1JYEA 4KLNA 4EFKA 2PUAA 1D7OA 4BN5A 3I4FA 1L4MA 1T4CA 1ZHFA 4AT1A 5IYZB 4TS4A 2Q4RA 4JR1A 1TT5A 1T0HB 2O0JA 4IGKA 3BE8A 2XOXA 2VG8A 5E6SB 4U2FA 1E9RA 2JFZA 4RKEA 3K4PA 1W36C 5EE5B 1CX9B 1OGYA 1Z73A 2M32A 3DKIA 4WOCA 1ESDA 4GXRA 5CDTA 1FYVA 1EFPB 2ZRBA 3BREA 4GVPA 1EG2A 4EY6A 4IR7A 5HUQA 3SI7A 3TI9A 3GUVA 1Y8RA 2QW1A 2A0YA 5LBUA 2FEWB 2I76A 1U5AA 1R64A 2HDOA 2ONKA 4IEEA 4YJ3F 2J5BA 4LSMA 4ER0A 3NDBB 1QRUA 5C32A 3A4NA 4TWJA 3GEPA 1XRNA 2HRRA 3BXHA 3DV2A 3T4UA 2EX4A 3M9WA 4JLJA 2BWJA 4NF2A 1CETA 1L4KA 2EJWA 1KC1A 1QRRA 2H07A 3N7TA 4MQBA 5DGIA 3WRXC 5KC8A 3NQ41 3GFTA 3K0AB 3REGA 5CEFA 1GQSA 1V7ZA 4TTIA 3KQTA 1CYDA 3HXLA 3EGXB 4R8SA 4DIFA 3AF4A 3L84A 3ICOA 3QYAA 1N3YA 3CUKA 2FFBA 3F2VA 3L7JA 4GX2A 4QD3A 3PC4A 4OOEA 3F74A 4TUYF 4NJMB 2DERA 2Z8YM 3N0XA 4RA9A 3S2ZA 4CFYA 3THWA 4XASA 4KBFA 2WTXA 4BVKA 2ZK7A 1P3JA 2GFQA 2YWHA 1A97A 3KQWA 4JVLA 4C6SA 4BVJA 1OY1A 2HWKA 2XB8A 1RKUA 4NZNA 4J8PA 5BYJA 3TQFA 4AKTA 4CLHA 1LVUA 1V48A 4UNSA 1NN3A 3D2LA 3H1AA 4MXDA 5FPYA 2FHSA 1U11A 3WG9A 4CKZA 3TTYA 4UTPA 4G01B 2HNBA 3FF1A 5IT5A 5JTUA 3DHWC 3KTDA 4GSLA 4FYPA 2YNMD 4MVJD 1VKHA 2HIAA 4RTKA 1S6YA 1AZWA 3H0EA 4N65A 5J23A 4P7KA 3IX7A 3KELA 4XQ0A 2IYLD 3I52A 4DLXA 4F6RB 3REQB 1XDZA 3BJIC 2VK4A 4Y9DA 4MH0R 3C5CA 2VSOA 2C7GA 3H2ZA 5TPWA 3TZBA 4HBZA 2ID8A 3GLHB 3AZPA 4XUDA 2GWRA 1GDDA 2NU7B 3N8NA 2GPWA 4BMSA 2MINA 1W73A 2VCHA 4OHCA 1U2PA 2HNKA 3CZRA 3WXMA 3LRPA 2O8EB 4U7FA 3AVQA 1VL2A 5LVAA 2JIMA 3GT3A 1LQTA 4BLQA 3GEIA 2QX9A 1E8MA 3LTNC 1Q7TA 1E2UA 2GR9A 2XA9A 4YP9A 3SVLA 4KR0A 4WESA 1PWYE 2Y0PA 3KVRA 4J3JA 3NIBA 1W5BA 4QNRA 2FPKA 2OV3A 1YH3A 3Q3EA 4LI3X 4QSMA 1U2GA 1I4WA 2V8BA 2Q6VA 3BD8A 4KYVA 2QQGA 3USCS 2R8OA 3FJYA 4IW3B 2AFIE 1QR6A 1W4AA 3IAXA 4DNXA 3CR8A 2DQSA 3I42A 3LJKA 3ADBA 1CZHA 1E4OA 1RHRA 1D0IA 2JANA 2OV6A 4BV3A 2QMYA 3NP7A 4XWKA 5CTJA 1PKEA 4MSUA 3WLSA 2ZTHA 2VPXA 4R0NA 3GHYA 2YIJA 1T15A 3M8KA 4N9QA 4XM2A 5TPZA 4JYCA 2I65A 2BRUC 2VHUA 2H4FA 4UBNA 5CNJA 3SIWA 2CVPA 2Q5OA 1QH8B 3R3HA 4FFSA 3RRFA 2XXBA 4F72A 1QKJA 2DFLA 1HDGO 3KDSE 5A7FA 4KBGA 1HG1A 1RP1A 2QLFA 4LOLA 4N82A 5JAZA 1Z5PA 4YRDA 4X7BA 4L4YA 3VAAA 3UK0A 4DB4A 4MKXA 3THXA 2XR1A 1IWOA 2CXNA 4RHUA 5KQLA 5IJ0B 1PO7A 3IESA 1VMAA 5BSEA 4HWSA 2W37A 1U2TA 3ZC3A 2CNLA 3VPSA 3AJEA 3RTDA 2VLIA 5KKCA 4RTJA 3M6WA 3MJHA 4ED9A 4FLMA 3I62A 5D00A 3NAZA 5T5QA 2C5EA 3GJ0A 1KJJA 3IEUA 3O82A 4DBVO 1YKSA 2CVFA 3A6HA 3BUSA 4FWIB 2C95A 3ZVRA 5LZ4A 2XUJA 4WZAB 4M0DA 2C4VA 3MUEA 4LISA 3OPVA 3PQ5A 2YHIB 5L3SA 2FN7A 5CEJA 1Y98A 1CY6A 1SCUB 5JLAA 3TW6A 4YQFA 4Q9LA 3HYNA 1I94B 2QYSA 4ZT6A 1UPXA 4P3YA 4HQNA 3KKOA 5MHTA 4LVCA 3EFOA 3QIVA 3UUEA 1SBNE 2R5NA 3AVVA 1VL5A 4HUTA 1CS0A 3OPYB 5HUHA 4XCXA 4K6CA 3JV7A 4GBJA 3PXUA 5J5AA 3T61A 2G1KA 2HBQA 4JUAA 4TKZA 5EIXA 3IDQA 5ICCA 1MHTA 1NDUA 4M8NE 4DXDA 5H5JA 1PL6A 1RADA 4IVRA 4XDYA 1TT5B 5C5EA 4KAXA 3HH8A 2YVUA 3L8EA 4Q1VA 1E64A 3BDVA 5G02A 4AO7A 3IQGX 3IP7A 1E1LA 2KPOA 1GYPA 4KUHA 2D0OB 2WIAA 3VH2A 4X3OA 1T8WA 1DC5A 2O6HA 1GILA 1H0SA 4HGOA 1WMBA 1II8B 2GZAA 1KYWA 2C1EA 2PZEA 2QMHA 1KEZA 2HK8A 5C5CA 1Y8RB 3AI3A 1KFBB 3BCRA 1FNSA 3JARB 1VPDA 3ILHA 3BAFA 3PHBE 5HE8A 3UJBA 5IAOA 4AC9A 2WAXA 1Y1RA 1DXHA 3HJRA 1QIMA 1XEWY 2QN8A 2C20A 5DBFA 1U5BB 4RVSA 5JALA 2QRUA 3U7GA 4FEYA 3SD7A 4BLSA 4DBZA 4UE2A 3P94A 4QQFA 5IVIA 3ROGA 1GKLA 4AS2A 5IPFA 1H69A 1IEWA 1YB1A 4RZXA 4DV7B 4I3HA 3M6LA 5LR6A 3WGJA 1N7HA 2QB5A 2YS6A 3DCYA 3EK2A 1KDRA 5JW6A 4KO1S 1CRQA 4X84A 5T3YA 3T4XA 1NIPA 1SZPA 1JALA 5IANA 2R00A 3NVMB 4LXIA 4DA7A 3KX2A 2OV2A 1Z34A 4P8RA 1E3EA 2XE8A 4HNGA 3GMSA 3PHLA 4XWWA 3WFZA 1U28C 1RKXA 3THWB 2VBCA 3W7BA 1Y7PA 1LSSA 1H2WA 2NYRA 4J0QA 3T54A 2YXBA 3KQQA 2G0AA 4D44A 1JRLA 1DPFA 5E6UA 3T4PA 2HXYA 1YL5A 4HNHA 3VHQA 3GEBA 4EGCB 3AW9A 3F6RA 1L4HA 4KNWA 1THGA 1FNCA 1W52X 1YBVA 3AF5A 3F6CA 4WRRA 4KJXA 3VBEA 1MTOA 2CGEA 3V8BA 4NCHA 4R54A 1JW9B 2VQSA 2H0AA 2Z1NA 3OPMA 4ZHQA 5C1OA 3DL2A 1RWQA 1C1XB 3EEOA 3NM6B 4K9RA 4ZEWA 3BXFA 1WHTA 3O47A 3OG9A 1QFJA 5L4LA 1NKTA 3BSFA 3E5NA 4OLJA 3GLQA 3IUEA 3KS9A 4HFMA 1IUKA 5TPWB 4XJVA 2NU9A 4EFLA 4YUVA 2FX5A 1D2GA 2MINB 1L7RA 1OOEA 2ZTUA 2P9HA 2I6XA 1JHQA 2RKOA 4LYHA 3P9RA 4R16A 1LTHR 1JB9A 4II2A 1EYZA 3GNTA 4J1TC 4Z4CA 4YH1A 1ANKA 1FSFA 3EDOA 3P96A 4ESOA 5JDIA 3LNTA 2FGJA 5CA0A 3D7MA 4DQLA 2ORVA 4FI3F 4Y1RB 1VSUA 2JIZA 4H7EA 2WQ7A 4LJ5A 3NWJA 3SIXA 1QGOA 1RHKA 4ZVSA 3IIIA 1AZLA 4EUSA 1Z4LA 4F8EA 2CNWA 2IV2X 3G9XA 1KARA 4I9NA 1D2CA 3A6JA 4RLQA 2HF2A 3WDMA 3PT5A 4J0KA 2COKA 2X5JO 3T3IA 1BCSB 2PRJA 2IQIA 3AGQA 3I32A 1NLZA 4IKPA 3U7QA 1WPQA 3ITDA 1N0UA 4HZIA 4KGZA 2IPNA 3WHPA 2AFIA 4IDBA 3W5CA 5JVDA 5AUNB 1B76A 1GNVA 1TEHA 1ZN7A 5DN6A 3DE2X 2V4UA 4DMLA 2HYDA 4LVNA 1E89A 4N8DA 5DYTA 4CIAA 4UCFA 2QENA 4KWEA 3CVYA 1B8UA 1NNEA 1VJCA 1VBMA 3A14A 4N3BA 5JSZA 4EFNA 4AJ1A 4IUDS 3SFVA 3MIZA 4WA7A 1PYDA 1E7RA 2N1MA 5IKXA 1FSSA 1GYQA 1QP8A 2VDKB 1JEOA 4EKIA 3OF5A 4O4HA 1K5HA 3HFSA 4TT3D 4CIBA 2ZZMA 3Q8MA 5A3SA 1QQBA 1KR5A 3M3PA 3G2PA 2FQ1A 5ELMA 5LN1A 4WNAA 4ZC1A 2Q5HA 2I5PO 1QRTA 1C3JA 1O94D 3ZWKA 3HXTA 1XGKA 3FDFA 1R8SA 3B1ZA 3VH3A 3WNZA 1O96A 2JLXA 4PZ0A 4WXPA 4C22A 1CUYA 3QXJA 3QVGA 1RWBA 2H1LA 1Q84A 4PZLA 1N25A 1Z45A 3KQYA 5BO5A 3ZY5A 4JSTA 1NYLA 1LWNA 3FOAA 2E4UA 3TPCA 4KUGA 4R9SA 2QRKA 2PBZA 2D1QA 1JLSA 2W0MA 1XHEA 4L76A 1NZFA 1JJIA 1P7VA 2NV2B 4V02A 3HVKA 4O2LA 4HSEA 4B3MB 2QF7A 5HCUA 4XUEA 4J4BA 3B89A 3IOYA 4CHTA 2BEVA 3K2IA 3W2HA 4Z7OB 1REQA 9ABPA 1TK9A 1YQUA 1YI8A 3R3WA 2AW3A 4MEJA 1HLGA 1G8FA 4LY6A 4HO1X 4W7HA 4DR7B 1H0RA 2UDPA 3W1VA 1A8PA 3KZMA 4F12A 2GAJA 4KXQA 4Z7NB 1KYIA 4QUIA 3BE5A 3HYLA 4D4MA 5DYWA 4ZYXA 3K0KA 2GGSA 2GEFA 3SQDA 4ECEA 3G9ZA 4HDMA 1MB0A 1ZSYA 3RYIB 4LQCA 1A9XB 1OWNA 3MGAA 4G0WA 4D46A 2NO9A 6GPBA 4HN2A 3UXYA 4BO0A 3K0FA 3EWNA 1T3LA 5DNEA 1JJBA 1RWXA 4FMDF 4OBWA 2GM4A 2AWNA 3M4XA 3OM9A 3HI4A 1Y6GA 4KNVA 1V11A