4N0QA

Crystal structure of an abc transporter, substrate-binding protein from brucella melitensis 16m in complex with l-leucine using a crystal grown in a crystal former (microlytic)
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
344
structure length
344
Chain Sequence
DITIGVIAPLTGPVAAFGDQVKKGAETAVEVINKAGGIKGEKVVLKFADDAGEPKQGVSAANQIVGDGIKFVVGLVTTGVAVPVSDVLSENGVLMVTPTATGPDLTARGLENVFRTCGRDGQQAEVMADYVLKNMKDKKVAVIHDKGAYGKGLADAFKAAINKGGITEVHYDSVTPGDKDFSALVTKLKSAGAEVVYFGGYHAEGGLLSRQLHDAGMQALVLGGEGLSNTEYWAIGGTNAQGTLFTNAKDATKNPAAKDAIQALKAKNIPAEAFTMNAYAAVEVIKAGIERAGSTDDSAAVAKALHDGKPIETAIGTLTYSETGDLSSPSFDIFKWDDGKIVGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Leu/Ile/Val-binding protein homolog 3
publication title Crystal Structure of an ABC transporter, substrate-binding protein from Brucella melitensis 16M in complex with L-Leucine using a crystal grown in a Crystal Former (Microlytic)
rcsb
source organism Brucella melitensis
molecule tags Transport protein
total genus 122
structure length 344
sequence length 344
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13458 Peripla_BP_6 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4n0qA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4n0qA01
3GV0A 4RSMA 4ETMA 3EGCA 5DGCA 3EDCA 3O1HB 1OXKB 1XHFA 1FFGA 3RVLA 3LUHA 3HDGA 1QKKA 3CHYA 3KLOA 2FMFA 3TMYA 5T7BA 2B4AA 1USGA 3KJXA 4XLTA 1ZGZA 1RZRD 4RK7A 5EWJA 3RVOA 3IDOA 3I42A 4MR9B 3D8UA 2IYNA 3LUKA 4YCSA 1Z13A 4KFCA 4WT7A 1Z17A 1P6QA 4NQRA 3RQIA 4OG2A 1FFWA 1P2FA 3SQNA 4B09A 4S05A 4N0QA 3LFTA 4JAVC 4O1IA 2JRLA 4KZKA 3CNBA 3OMWA 2IPLA 8ABPA 2YHBA 3QEKA 1L5YA 1TMYA 1GUDA 4LE1A 3H1FA 4S04A 1U2QA 5HM6A 3KHTA 4IMIB 1SXGA 4FB4A 1VLZA 1YK0A 2PL1A 3P9YA 3IP9A 1ZESA 4IF4A 5E3JA 4ZPJA 4O5AA 3H1EA 3H6GA 3OO1A 3H5IA 4Z4HA 5KQGA 4Z4IA 4P98A 4EVSA 2CHEA 1DC8A 5IX8A 5JNRA 3H5LA 4YR7A 1K68A 1JL3A 4RY8A 4Q6WA 2PUBA 2VYCA 2E4WA 2MYPA 4L4UA 1WETA 2P9HA 5GOTA 4LDAA 2JVKA 2R4QA 2WMYA 2PUCA 1BDJA 4RK1A 5JS2A 3F6PA 3C3MA 3CRNA 3ILHA 4N03A 5TQJA 3C97A 2GKGA 3KSMA 5PNTA 4Y9TA 1D5WA 4ML3A 4XXHA 4LRQA 3R0JA 1JFSA 1IIBA 2FMKA 3RVNA 3O75A 3GA5A 1Z2EA 4HNSA 1PNTA 4DADA 3KG2A 4XFKA 3HZHA 1DZ3A 3LTEA 3F6CA 4LDZA 2FEKA 4PYRA 1A0OA 1NXTA 4EYKA 3JPYA 7ABPA 1LJLA 4HNRA 5DLEA 3W9SA 3DGEC 4RK4A 2P4UA 1MIHA 3E3MA 1Z25A 3I09A 3MA0A 3L6UA 4XASA 4RDCA 1K66A 1KGSA 1XWWA 2JVIA 4YP9A 3C6QA 4MPTA 1LBIA 3QK7A 1F4VA 1P8AA 5KQLA 3SM9A 1NATA 4WZZA 2PJUA 3LUCA 1Y1LA 1HEYA 5ED4A 2QSJA 4MR8A 3QLTA 1U0SY 1KRWA 3FFWA 3CS3A 1URPA 2R47A 2L17A 4F11A 2PUEA 3BBLA 2L18A 4E7OA 1QP0A 1RPJA 2FQWA 3CFYA 3N0WA 5JNVA 1E6KA 4ZYLA 5DKFA 3ROFA 4N47A 3VNAA 1AB6A 3H5VA 3TX6A 1W25A 5ABPA 3LKVA 2IOYA 1BAPA 1LJUA 3O2QB 4MRMA 1EHCA 4EY3A 1VKRA 2WJAA 3IP7A 2FW0A 2VUIB 3FMVA 3OQMA 3ROTA 3E61A 2FMIA 1ZH2A 3EQZA 1RXEA 2AYZA 3UUGA 2LUOA 1MB0A 5GQSA 4LE2A 2LIVA 1M2EA 1EWVA 1DBQA 2HQRA 3C3WA 4GPAA 1JLKA 5IUKC 4D74A 5JS1A 4JASB 4YWHA 3GYBA 1MVOA 3EODA 3QLUC 1SRRA 4YGXB 2RDMA 1JYFA 1H9CA 3HXMA 1Z26A 4P1ZA 2GI4A 2L19A 2J48A 2GX6A 2WJWA 4QICA 1PHRA 1Z12A 2FN8A 3GBPA 1SXHA 4EYQA 3IP6A 3T6KA 5D2CA 5KQMA 1NXOA 2HQBA 1CEYA 2X7XA 5CNIA 5TPZA 1Z18A 3OQOA 1E6MA 3OM1A 1YTUA 1DC7A 3RVRA 2M1ZA 1YMVA 4DN6A 5T3YA 1W9HA 1M5UA 3LUFA 3GBVA 3OQNA 1ISRA 4XARA 4MS3A 6ABPA 2FEPA 1A2OA 5EWMA 2E4YA 4QYMA 1I3CA 1ISSA 1OXBB 5EWJB 5JNUA 1DRKA 2LBPA 1JDPA 2XDYA 1TM2A 3L49A 4OLBA 2A9RA 1QO0A 4KV7A 4LE0A 4YV7A 4WXEA 4G0QA 2I6FA 4UHKA 5EWMB 2QVGA 4GNRA 2NT4A 2CWDA 2LPMA 4H3KB 1MAVA 3OLZA 4PZ0A 4RS3A 1ZVVA 4G0MA 2FLKA 1D1QA 3RVKA 2RGYA 3EJWA 4KK4A 2IPNA 3EULA 4Z99A 2FXIA 2JB9A 5HQJA 4RV5A 4HNQA 4D6YA 3LMKA 3LKBA 3I5AA 3MF4A 5DCLA 1TLFA 3KYJB 4MLDA 3HUTA 2MYUA 1JX6A 1CYEA 2PL9A 1AB5A 4WUTA 4E7PA 4MGEA 1ZDMA 4N0PA 2QZJA 2TMYA 3FFTA 3H6HA 3UKJA 4MLCA 3O21A 3Q7SA 5IULC 2VK2A 2IDMA 4WXMA 1ZN2A 5TQ2A 3N8IA 3BRSA 3RVSA 1JYEA 3HEBA 4Q7EA 1EFAA 4F8JA 5FBKA 1DCMA 1YIOA 2E4XA 1PEYA 2A9OA 2V0NA 4OBBA 1L5ZA 1PNRA 2H3HA 2IKSA 4IGAA 3HJFA 5TQ2B 4ZMSA 3A0UA 1NXPA 3T95A 1R8JA 3QEMA 1E6LA 5IEBA 4RK5A 2Q5CA 2ZWMA 1LBHA 4MQEA 4RXTA 5CNKA 5JNSA 3F73A 1GUBA 1QP4A 2BGGA 1USKA 1NXSA 2QXYA 3CG4A 5JNTA 4TN5A 2O20A 3IP5A 4QYWA 4YO7A 3HO1A 1USIA 1ZAYA 3A0RB 4RKQA 3QEMB 1C0EA 3OO0A 4H60A 3QX8A 5CNJA 1PUXA 1YVUA 2NUBA 4JA2A 4MQFA 3FGZA 4MQEB 2NZVG 2PLNA 4YRZA 3UK0A 1JDNA 3ILYA 4G0OA 4NV3A 4RK0A 2WY2D 2F8SA 2FTKE 4KK3A 1BDIA 4DQDA 3CZ5A 1ZH4A 3OM0A 2GWRA 3EQ2A 1B00A 4MR8B 4PE5B 4G0PA 4Z4FA 5IBQA 4RXMA 1DJMA 5JNWA 4FE7A 5BRAA 3CTPA 1C4WA 3G1WA 1F51E 3N0XA 4M88A 2B1JA 2VUHB 3O1IC 1T34A 4CBVA 5IEJA 1DCFA 1VRVA 3DLBA 2LP4Y 4Z9BA 5TQ0A 2JBAA 3LUDA 4HYEA 4MRMB 3HS3A 3DZDA 5BQ3A 2MSWA 4D6XA 3LUAA 1TVMA 3SG0A 3OLYA 3OMXA 4Q6BA 3T38A 3GL9A 5HSGA 4Z4EA 5TQ0B 3H1GA 3Q41A 2JCGA 2JBAB 2PUDA 1QNLA 5BR1A 1APBA 4G97A 1FQWA 2E4VA 4KPYA 4NCAA 1P6UA 5TPWA 4W5QA 1QQAA 2PKXA 3CG0A 4ZMRA 1Z16A 9ABPA 1RZRA 1CHNA 1DBPA 1MB3A 4UHJA 4ETNA 1DP4A 4Z0NA 2A9QA 2DRIA 4Z4GA 2MSLA 4H3HB 2FEWB 3KLNA 4EGSA 4W5NA 2FN9A 4W5RA 2CHFA 3MM4A 5TPWB 4G0XA 1FSPA 4TLMB 4TLLB 4MAAA 1RXIA 2IPAB 1Z2DA 3Q7TA 4RY0A 2KYRA 1NTRA 2QVCA 3RVJA 3SNKA 2PUFA 1DBWA 3NHZA 3O1JC 4Z9AA 3JPWA 4KREA 3A3KA 3KYIB 4F12A 1BDHA 3MMNA 4EYOA 3Q7RA 2YHAA 3QLVA 2HQOA 5KC9A 5KC8A 4OTZA 4ZJPA 5FWYA 3FDFA 2FSPA 4RZSA 4MR9A 2HJ9A 4OLAA 3CU5A 3DBIA 3G85A 2N9UA 4JB0A 4MS3B 1JFVA 2RJNA 3Q15C 2NZUG 3M9XA 2M98A 1UDRA 3JVDA 3LUGA 2PMCA 5FWYB 1DG9A 1NY5A 3S99A 4G0ZA 5TPZD 1JHZA 1U8TA 1YK1A 3HSYA 1QPZA 3MIZA 2JVJA 1EAYA 3OLVA 4RXUA 3N6VA 4JOQA 1DRJA 3NHMA 3JY6A 3O2SB 3JTEA 3K4HA 1DCKA 1BA2A 3NNDA 1JH9A 1QP7A 2HPHA 1SD5A 2WB4A 2CD7A 1RNLA 3NNSA 3GRCA 4JP1A 2IPMA 4EVRA 2RJOA 1ZHHA 1BVHA 1U04A 1M5TA 3MQ4A 2PE5A 4MS1A 3D02A 4YS6A 3A10A 4KNYA 3QLVC 3HM9A 2R48A 1QO0D 3O74A 4F3TA 3F7NA 3RVPA 5HKOA 2AYXA 4W5TA 2ID9A 3B2NA 3OLXA 4NCBA 4OATA 1A04A 3RVQA 4EUKA 2FMHA 1GCAA 4MS1B 2QV0A 4EYGA 1EWTA 4JB2A 2FQYA 4KQCA 1NXVA 5BRJA 5KQPA 3KTOA 2PUGA 4RKRA 2JK1A 5TE9A 1D2AA 2PAFA 3N0RA 3JS5A 3KS9A 3N53A 4FE4A 4NICA 4WWHA 5CNMA 3HVRA 5DTEA 4MS4A 4KQ9A 1GCGA 2ID7A 3KCNA 4IRXA 1KMIY 3QX9A 1JWLA 1XHEA 5FWXA 1GLGA 3DGFC 5KI6A 4KVFA 4LZLA 1ZY2A 3LOPA 4O1HA 3HCWA 2L2QA 3BRQA 5C5EA 4MS4B 1PEAA 3VNBA 3BILA 3FFXA 3H5OA 1LK0A 5FWXB 4RY9A 2MYTA 2FKAA 4PICA 3CLKA 4KMRA 5FBHA 5C5CA 1TJYA 1ZITA 2QW1A 3BREA 4MQFB 3CKMA 3RVMA 3H75A 3HK2A 5CHYA 2NT3A 4IMJB 1YS6A 2A9PA 5B3JA 2E4ZA 3NNNA 1U2PA 3QLUA 5KWSA 3H5WA 3QELA 2FQXA 4L85A 4PEVA 3TD9A 2R25B 5IUJC 4RU1A 3TB6A 3KKEA 2MSKA 3GWGA 3MYYA 4N76A 1QMPA 5IUNC 3RH0A 4MR7A 1D1PA 6CHYA 3CZCA 3EAFA 2OENG 3JVIA 2MYNA 1FFSA 3Q9SA 3QELB 4Z4CA 3SY8A 4N41A 2FVYA 4IILA 3T8YA 2W42A 1YMUA 1M2FA 4YLEA 4XAQA 3H5TA 1NXXA 2FLWA 2OQRA 2H0AA 3IPAA 2QR3A 3O2JA 4F06A 2QU7A 5I4CA 1E2BA 4MR7B 3HUUA 2GBPA 5EWLA 3OLWA 4QPJC 1VPWA 3SAJA 3C3KA 3URMA 1D4ZA 1Z15A 3HV2A 2WWVD 2F8TA 1EWKA 4EVQA 1ZGGA 1YS7A 2HSGA 4G0YA 3M9WA 1QQBA 3DLHA 2E4UA 4LX8A 4RWEA 1ABEA 3TO5A 4W5OA 3IPCA 3K9CA 3N75A 1JF8A 4G86A 3M6MD 4ETIA 5EWLB 1JFTA 5B3JC 1SXIA 1S8NA 3GT7A 4RK6A 1JBEA 2WRZA 4KRFA 5F64A 1KRXA 1ABFA 5IC5A 2ZAYA 3NBMA 3I45A 3LUJA 4TMYA 2PUAA 1J56A 4MYRA 3HDVA 1NXWA
chains in the Genus database with same CATH superfamily
4NHEA 3OJEA 4JL5A 1YBAA 3NWEA 1KI8A 3WLAA 1IOVA 1JIVA 2QN7A 3EUFA 5DGCA 5CA0F 1YU6A 2H4FA 1BE0A 2GPBA 5TNXA 5IYZA 1ISGA 5BSRA 1IOWA 3LUHA 3P9ZA 4FR5A 3GFFA 4AN0A 4BQEA 5K03A 1AKEA 1JSLA 1UFOA 1ZIYA 3HXLA 4QXPA 3RSZA 4EFDA 2WPDA 2PU5A 1GO2A 1KJQA 1PN3A 1T4CA 2BJWA 1IBCA 2B0CA 2HSDA 2OXRA 3C7TA 1FNNA 5FHQA 5GGYA 3WYDA 2B7CA 5FI1B 1VSTA 4TYMA 4JLKA 3DTVA 4LRSB 2RD2A 1R4AA 2JZNA 4RF4A 3ORHA 2YRWA 3RRZA 5J40A 4UAJA 3AMVA 4WT7A 2HHJA 4DA7A 1P6QA 3G6KA 4EGFA 1M74A 3ELDA 5FO0A 4TTTS 1E5VA 3DOFA 5H3LA 1JHRA 1AKWA 3PKZA 4R8KA 4MQBA 1WPQA 4B6RA 4BLPA 1NMZA 3PPWA 3DZFA 4YAIA 3VGPA 1PR2A 1ZU4A 1NP7A 1FDUA 3BMNB 3DDOA 3FZEA 2ZUFA 1AURA 2ECFA 5EUQB 2NG1A 2NPIA 4ZWNA 4TL6A 1NWHA 1TYDE 2CLMB 2XKJE 2PL1A 5CT9A 2IEGA 3NOQA 4RHFA 4XIYA 3ZUPA 4HXGA 1CR6A 1PV2A 1KQ3A 1OA0A 1T5HX 2IZ5A 3LLSA 1F0KA 3OO1A 1U98A 1CZHA 2HXSA 3DBLB 1EIWA 3VHRA 1BS2A 1P2GA 2A4MA 3F96A 2CHEA 1Z08A 3GRZA 5JZSA 4YR7A 1KPGA 1W8DA 4TROA 4UQLA 1KC3A 3ZBPA 5JO9A 2OLJA 4H2DA 1PR9A 3RWMB 5KNLA 3G2OA 2E4WA 1YDMA 1I33A 2OLEA 2R8EA 4N6GA 4PLPA 2XRFA 5K3FB 3T5GA 4D9EA 3DJYA 1I1QB 1KY2A 2OHJA 3AETB 3QWFA 5AUOB 1M1ZA 3DPSA 4L9RA 2YQ4A 1N5DA 1LWNA 5F35A 2YYYA 2ZVPX 1L8XA 2JA1A 2XUOA 2X7HA 2R00C 5EUBA 4D3ZA 3LT2A 1EWQA 2UZ3A 1Z2EA 2LD4A 4Q24A 2K5UA 1ESEA 3IAS1 1VIMA 3D8HA 3M2PA 4MI9A 1U7DA 1GVHA 1GPDG 3EYWA 4AJPA 1QG0A 1R6DA 2HU7A 3TLYA 1EVZA 4MKFA 2BDTA 1C9DB 1UF9A 3SS9X 4BBAA 2BI7A 1WXQA 3H5NA 2PSFA 1E4VA 2ZOSA 1XKQA 2BFWA 3C8ZA 4G9BA 4LXGA 5HKBA 5JFTA 2ZIXA 1M1NA 2DTXA 1G20B 2PGOA 2VXBA 4LISA 2PZEA 3E5HA 1P3Y1 3I4CA 3QXCA 1GQ2A 3KHUA 2BZ1A 4JXXA 5K2OA 2FAXA 3EXAA 3TG8A 2EARA 1UK7A 5ICGA 4L72A 1I7PA 3CRRA 4JI6B 1Z7WA 1AA9A 1QS0B 3ESBA 3O83A 2A5YB 3NIWA 2E5WA 5A03A 2FWBA 4ARUA 3W8RA 2JKVA 2PX6A 4LRXA 4TXHA 1RYNA 1EE9A 2ONYA 3G9QA 4KKXB 2X8JB 1RJEA 2F64A 4NJMA 3HC7A 5DYTA 3UJ9A 2B34A 3BBLA 5D3MA 2I34A 1W7AA 2FOIA 1FDRA 1SXJD 3CFYA 3NDIA 4HGRA 4KLCA 4RM3A 3D6TB 2QLFA 4EHFA 1PW5A 2IYEA 4JGBA 1N2GA 1JBKA 1M73E 1W25A 3IAUA 4UU8A 3K09A 1R4NB 1LDNA 3MWGA 4IVNA 1U8EA 4M0PA 2GN6A 3WP0A 4RA9A 4RJKA 1CX9B 3UOGA 5K0EA 2VTBA 1VI2A 1YULA 2MOKA 3CF6R 4CM3A 2TECE 4Y6RA 2POQX 4US0R 3H2HA 1QK5A 2WF7A 3T41A 3RTCA 3KOYA 4ZCTA 3FLMA 3U44B 4CIVA 3MT0A 3L01A 4YQFA 1WWKA 1RABA 1CRWG 4I81A 3OZEA 4ITVA 1NRXA 1XU7A 1YQGA 4NI5A 4PGMA 3C3WA 1XMIA 5HBRA 3UJ6A 4C05A 4HBZA 2H2DA 3V8VA 4I1SA 5CDGA 1COZA 5JADA 1J00A 3UHOA 3UWSA 1COWD 2C98A 2GZRA 5FJJA 3EODA 3GPCA 4NIMA 3D6JA 4RIIA 4UBJA 1ZISA 4YGXB 2I71A 2X5KO 2XF8A 1G17A 3LIIA 3HXMA 1PIWA 2C3UA 3WKCA 1A5AB 1YVDA 4LSGA 4KFTA 2JD1A 3Q5GA 3WTCA 3EF1A 2OTCA 2ZRAA 1I80A 4IKEA 3DAGA 4LXIA 4OREX 1XLUA 2F90A 4D57A 2OGTA 2VBGA 5FEMA 3UKDA 1N57A 2ZBUA 2V5VA 5B4VA 1QE0A 2G1KA 4LHEA 1PZMA 4XM2A 1KO1A 2EW2A 3L05A 1Z7EA 4M3NA 4D4JA 1MIOA 1BXZA 4DLKA 2BCJQ 3BIJA 3I6ZA 1X7XB 3QKSA 3SQDA 2AN5A 3BM5A 4G89A 4CR6A 1DMRA 5DI3A 4DCPA 3DHYA 1CQJB 4KN8A 3C6XA 3ZWKA 5T3YA 4H16A 4JIGA 1Y8RA 3GH3A 5BYKA 1DC6A 5F7JA 1BS9A 4NNOA 5FI5A 1CFJA 1P62B 4CT4B 1EU1A 1E2JA 3L84A 2CHGA 2HDOA 1GNQA 2XDAA 3MXTA 3PFGA 3EVCA 4GU5A 4KV9A 6ABPA 3TE6A 2ZWAA 4NCIA 4E1AA 1GU1A 2EWMA 1N4DA 4UKDA 1DADA 1F8GA 1ISSA 3TRJA 4RMNA 3R7WA 4CLRA 3EC1A 1OBHA 1E60A 1U8XX 3AHEA 1PVDA 1NUPA 1G5IA 2A1UA 3F2IA 3H4MA 3L5KA 3PI7A 3UJDA 3TZQA 1EFKA 4XLLA 5L6LB 1MO6A 3CUVA 3R41A 4ZKEA 3RQSA 4XGRA 2JIZA 3QX7A 4Y6QA 4UHKA 3PT9A 4FMCB 5I9SA 3C8HA 4PIMA 2BGWA 4HEJA 1ZVVA 2W93A 5DK6A 3MMZA 4YJFA 2Q0XA 1ZD4A 5LZ4A 3I30X 1YU9A 4HEA1 3NHSA 3ZQ4A 4CV0A 1ADCA 3UQZA 4CG2A 4LQLA 5HQJA 4P0PB 1SVMA 1YQ9A 3FVTA 1E98A 2NAPA 3ABRB 1T0HB 3LMKA 3PNBA 5DCLA 3S40A 4AJNA 1IOZA 2FR8A 4MLDA 5ALFA 1SZPA 4RVGA 3TDMA 3DE0X 1UC8A 4LXXA 5BVGB 1NVUQ 2C2OA 5AVKA 1P8JA 3LZDA 4UUOA 5FOWA 2HMUA 3EXIB 5IT5A 3GFOA 1GG5A 1JQEA 2C3MA 3B5JA 4KE7A 4ZQBA 4EQ6A 1YJ5A 3OF2A 1N1EA 4PWZA 5G53C 1LSOA 3C48A 3AO0B 3D3WB 3RR2A 2HHCA 4FXOA 1EX9A 4BMDA 1DC3A 1PR0A 2XWBF 1IHDA 4HDMA 4U9HS 4EB6B 3M4JA 4DPKA 2VJNA 2J5BA 3H87A 2GWHA 3HYCA 4YRRA 3B6KA 4PBTA 5AK4A 3S2EA 3X1DA 5EHIA 4C0JA 4F4CA 4AY6A 1Z6XA 3G9XA 3VSDA 4IGAA 4CKXA 4DTIA 3FWNA 1E0JA 1LFDB 4UBOA 3M5PA 3IB6A 4NYJR 1R8JA 4J94A 2XUPA 1A97A 3CLRD 4BQNA 2C9BA 2WIBA 4HVAA 1OIVA 2W4IA 5JVDB 5JANA 1N92A 4FNOA 1JT9A 1S8AA 4Y2RA 3TQRA 4AF8A 1RIFA 1PD0A 2QL5A 3KKKA 2LCQA 3LDHA 3WB0A 2BFPA 4PC3A 5L6MB 4B3TB 3TDKA 2QX6A 4FTWA 3NYWA 4PQRA 5FPYA 2NU6A 5T4FA 3RYIA 1G38A 1U7OA 2NUBA 5D51S 3FGZA 3RYHA 2PLNA 4FBMA 4FSHA 4G0OA 2OCAA 2ST1A 2XCOA 1PDWA 2WG0A 4X1YA 3PQ2A 4TWBA 3NCHA 5BQ5A 4PLGA 4JUAA 1QCDA 1EGMB 1HE2A 1X15A 2O8FA 3HSKA 3FZQA 1KS9A 5AK3A 5DOZA 1S9DA 4QUEA 2WM8A 3T9FA 3TLBA 5HIKA 1J49A 2JIQA 4IIXA 5HKLA 4MYTA 3M33A 2CD9A 5BN3A 4N7RA 3QF4B 1VL8A 2XNDD 5CDHA 4R54A 1FUKA 1QZ3A 4MVJF 5DFAA 4FOPA 3WHIA 5C9ZA 4E70A 1MGPA 1X94A 2N0SA 1GOTA 4GXRA 2GD1O 4LF8B 5IM5A 1I9GA 2QM3A 2HJSA 1OE0A 3FAKA 3OEHA 4DOMA 1GNPA 4PCLA 3RTDA 2N1MA 1G8YA 3U09A 4BIIA 4MZXA 3JVUA 4DHEA 3PTAA 4UUNA 4F2DA 3Q3GE 2G83A 3K9QO 3DZDA 4WA7A 1V0JA 1UFRA 2Q5JA 4FM9A 3SP1A 3TWOA 2P9BA 2V1UA 4RZIA 4AX8A 2JBAB 1BGXT 2BUCA 5ENVA 3UANA 4Z1MD 3PPVA 4C5BA 4FW9A 2GGSA 4G97A 2Q3MA 4J43A 1TU3A 4NCAA 5FX2A 1N8KA 1YZUA 1H05A 1Y6ZA 1II8B 1YT5A 2P3LA 4CR8A 1X1AA 4J2HA 2H17A 3FNGA 4R8LA 1A82A 2A9QA 4HYQA 4OYRA 3ZKWA 4OXQA 2JFQA 3IQGX 4PX5A 1H2AS 2YNMA 3B3AA 3RUAA 1AGRA 1LLQA 2GZ1A 5B58T 3MSCA 3O3NB 3W1WA 4ECAA 1S0UA 3CF4G 2ZUBA 4MUMA 4TXNA 5DM60 4B6GA 1VPDA 2QJTA 2PUFA 5GADl 3MD0A 4XVCA 2WQ6A 1EGAA 2VJPA 3BJZA 3KYIB 3RIMA 4B2IA 3MMNA 1W2WB 4TLEA 1Q3KA 3CNOA 1M2GA 1NZFA 2C5BA 1NT2A 3THYB 1AUQA 5EIOA 1UT6A 4K9DA 3W3ZB 1KJ8A 4MR9A 4LV5B 4D42A 4DYVA 2Y9MB 1K98A 1GKIA 2N9UA 4URZR 3JXEA 1ECJA 2BZ0A 3DEAA 3MINA 3ONWA 4B17A 1JECA 2KW5A 1G20E 3NQ41 1ZR2A 1QVWA 4ND1A 1RRPA 5FA8A 3RNLA 2PEZA 3OX3A 4OGWA 2ZT6A 1TTPB 1D1SA 5EJFA 1SBNE 5THKA 4BNIA 1GZ4A 3MIZA 4NXNB 4YECA 1RRGA 1E2LA 5IU6A 2JLUA 1GR1A 3O0DA 2ZXUA 3O8OA 3N2KB 2C7OA 1Z88A 3NHMA 2W2PA 4FJ0A 1ZUWA 2D6FA 1KO5A 4U6SA 4FDTA 4UVIA 4OHPA 5HCUA 1L7XA 2CNWA 2PKCA 1I2ZA 1YONA 4OY3A 3ZKAA 1I5OA 1XEWY 5FR2A 1KI3A 3LSYA 2GUWA 5CJPA 4UULA 1OI2A 1U1IA 1ZUNA 5ILGA 4MS1A 2NXJA 2ENWA 2OLKA 3R9KA 3R7NA 1KZHA 4EI9A 3ZDCA 3G9ZA 4KNYA 3IQDB 4TZ6A 2NLOA 1MDBA 5E95A 5HF9A 4C87A 5TMDA 4FX2A 4JR0A 5BQFA 2XI4A 1Q50A 4INZA 3KLMX 2DC1A 3L7AA 1QHHA 2YVQA 3EVBA 2PV7A 4Q3CA 4ZN6A 2HYDA 4CEHA 2EFGA 2WINI 2BFDA 3SYKA 3ESDA 3IUSA 5DNWA 3DKRA 1LA2A 3D7KA 2WR8A 5C34B 3KD3A 2EJUA 1WM1A 4WXPA 5IS2A 3EDOA 1OGJA 2HXYA 2COUA 4BB6A 5JJKA 1Q77A 1L7QA 3T7TA 3W9YA 3BHNA 1A27A 5E1DA 4D9FA 5CR9A 1EXDA 2IX9A 2GCGA 4KU4A 4LZJA 1E1RD 2Y27A 4CPDA 4D81A 3KK0A 1ZWKA 4QBFA 3LOPA 3BKWA 4MUYA 2NSJA 1Q74A 2UYQA 3ICWA 1O8BA 4MUGA 2FZWA 1G6KA 2R8ZA 1XALA 1J6UA 4ZANA 5H5JA 3F5QA 1FSGA 1UMDA 4M8KA 3II6X 1RLTA 2J6BA 3ZYZA 2FKAA 2PBFA 4UHCA 4F3RA 3KZVA 1YF3A 1ZD2P 2EFHB 1WHSA 4CYMA 1SHUX 1N2CA 2AK3A 1SXJB 3KSBC 4MQFB 5DM70 1W85B 4EAQA 2PA0A 5CHEA 1N2ZA 2O7QA 5CHYA 1CIVA 3RM3A 1EFVA 3ENVA 1BRMA 5JC1A 4H27A 5CYPA 2C78A 4C2BA 2GO1A 3F6RA 4BAZA 1W36C 2G1AA 1DTSA 4Q3NA 2KLHA 2JFNA 2NM0A 1PF7E 4F72A 4ITRC 5EKXA 3NT4A 5ESXA 2P6PA 3K96A 5EZ6B 2B6HA 2VC2B 3UTCA 4FBLA 2ZIUB 4QYIA 5EZYA 5CDFE 2IXGA 4C3OB 1JILA 4FHDA 3UAVA 4EGAA 1XA3A 3NALA 4RQUA 3DT6A 4B6SA 1NJSA 5C37A 4R31A 4R2WA 3ZV4A 4MRSA 1UP7A 1Y8QB 4FE3A 3W8DA 1UKVY 2VYFA 1YBVA 2YJNA 4MNTA 7AT1A 3PC2A 4N41A 4WXRA 3GLHB 4YJKA 3FUWA 2W6PA 1NG1A 3LCUA 2FLWA 4XDHA 1JG3A 2L0XA 5CPBA 2B8JA 4X1KA 5EJ6A 3N86A 2IEDA 3TSOA 3ZR4B 5EI5A 4B7AA 5EJ5A 5EWLA 1WHTA 4YP6A 5LSAA 1VPWA 1JPJA 3G0BA 5LL6P 3UGKA 3IUPA 1K6XA 2D2IA 1YA8A 3SLRA 1Z07A 4FEEA 1T9AA 1XQWA 3OI7A 4YJHB 3ZQKA 2BP7B 3JQGB 4MWDA 4XYBA 4F0JA 2VTEA 4DSAA 3DOOA 3G9UA 2QY6A 2ZSDA 4KI7A 2J85A 4QPPA 1X7HA 4L5YA 4OM7A 1JTEA 3JX9A 1FW8A 4ZHQA 5BQOA 3DZIA 1Z3IX 2CXQA 1HMYA 1S8NA 2WDZA 2FP4B 3ZEIA 2IDKA 3EEYA 3KJHA 2AEMA 3RS3A 1ISJA 9ABPA 5IC5A 1TEVA 3UK6A 2HXGA 5JSYA 4RJJA 3MD9A 4EW6A 1PDVA 4GW3A 5KJ6A 1OLSA 3IVCA 3AIMA 2CXOA 4Q66C 1H8ED 4NBVA 1EHIA 4X0EA 2WJ3A 1HC7A 2ALJA 1XHFA 2H2WA 3BH6A 3S8YA 3IKVA 5T7BA 1TO1E 2GM9A 3OWHA 1P75A 1VE3A 3KU1A 3KLPX 1GA1A 1ZC4A 3T1OA 5KDDA 2AUNA 1FP2A 1YXMA 4LHYA 1YBFA 4QFBA 4M36A 4BNJA 2I6QA 3U0BA 2XUFA 2ZIFA 4KXXA 4OQMA 3IVMA 3VPXA 2AXNA 1GKYA 3LUKA 4AZ3B 5JDIA 2YHSA 1YC5A 1IHOA 2YVLA 1N1GA 1EESA 1FFWA 2Q4DA 4QVIA 1N7IA 4MVJD 4S05A 1ZM2A 4EUHA 2CCJA 4K2HA 4NYIQ 1SG9A 3OMWA 5IARA 2IA5A 1I94B 8ABPA 2VXOA 1P2TA 1G8JA 1GL7A 2GZMA 3NDPA 3G88A 4P3OA 3QTBA 4TRJA 5EQFA 2P91A 2QQFA 5CYOA 5T4BA 4DMKA 1VRWA 1YZKA 1KPIA 2Q3FA 1GZSA 1VLZA 1LEHA 2GILA 2YJTD 4DWJA 4X61A 4FB4A 5JC8A 2JLVA 4F5DA 1H42A 3IO3A 3LK7A 4GECA 5EHZA 3H1EA 1ORRA 3ONFA 2LTAA 5DHRA 1A1SA 2A4KA 4EVSA 5JSQA 1UCFA 1W4BA 2Q0SA 5JNRA 4ZT6A 4TLAA 2UYOA 3T52A 3N9IA 1K68A 4EKGA 5C81A 4YJ3A 1WLYA 2RGGA 3V2IA 4EA8A 1D1TA 4DMHA 2ILTA 5L4LA 2ZITA 4LDAA 3DVLA 1DS6A 2BGRA 2QMQA 5LLSA 1D4AA 5I6DA 1MAHA 1Z4JA 5ALPA 4MRAA 3C97A 5CA0B 4M22A 2Q3DA 1T35A 2QLBA 4UU1A 3SU8A 1CW2B 1EPUA 1GL6A 2W98A 1C0LA 1CC1S 3R0JA 4C4YA 3RVNA 3WICA 1KY3A 3R3HA 1UR5A 1PNTA 2NAFA 2R1TB 1L7RA 4AJ4A 1FDOA 3DV2A 4FS8A 1B14A 2V7BA 2VYND 3CW2A 3PL5A 1ZC3A 5CFNA 3IBFA 4BX2A 1A7UA 1RXYA 3PJEA 3ZS9A 3OPXA 2H11A 1OI7A 3R09A 4EYKA 3ZGZA 4IGIA 4HNRA 4JFRA 5HPYB 5B1SA 5LLDA 2Z2ZA 3MBIA 3H04A 4RAQA 2O54A 3RS7A 4WERA 4ZXPA 1FP4B 3MA0A 3LHIA 3UPDA 4YT4A 2JFUA 3DZBA 1G21B 2JVIA 5CM9C 5JCOA 4YMGA 2P90A 2QL6A 3TB4A 2VAWA 1CP2A 3GI1A 1IZ0A 2QU8A 3D7MA 1OF1A 4KDRA 5KQLA 3IJEB 3U39A 1FW6A 5F2NA 3ZZ0A 4TN1A 2OBNA 2VP6A 5FLYA 1YOVB 3U62A 4DIBA 3WJAA 3QLTA 5K8TA 1DKMA 3W2TA 1A8PA 3QXSA 3ZX4A 3JQAD 1RQ2A 3KJGA 3KR1A 5KTSA 4BHTA 4PX3A 1LBEA 5BOVA 1UJ2A 3CR3C 2ONJA 3HJTA 3VNUA 1P3DA 1QP0A 1V37A 2GHRA 3GA0A 1FLVA 4OL9A 5FOXA 3BF7A 2H2HA 1AS3A 2ZRMA 1U6KA 2BMEA 1QRRA 2VJOA 3FKJA 3FNRA 3PD7A 4RSRA 3VNAA 2XWPA 4UAVA 4NMLA 3VR2D 3AUUA 3GUUA 4KFSA 1W5FA 2D0OB 4DZTA 4U6NA 1E18A 1ZGHA 2VWPA 2ZRJA 2O2YA 4W82A 3OQMA 3VKGA 1Z33A 3L1HA 1J1IA 1L8OA 5HR5A 2RARA 3O0TA 1IAQA 1KNQA 1T5OA 3KCQA 1RXEA 1M75A 1P5ZB 1J5EB 4WKPA 3OOEA 2JATA 2JZCA 5L3QB 1JEYA 2PK3A 4KMOA 4G6ZA 5DBGA 1YDHA 3F8TA 3TW8B 3EVGA 1K5HA 4R8MA 1R8XA 3UZUA 4MI3A 3HKBB 1NBMD 3DCIA 2R6FA 4JVOA 1CUGA 2CY0A 3NV9A 3PWSA 4RM2A 4F5EA 4P84A 1AHHA 2O57A 2GPTA 3ZE8A 3HDYA 4ESVA 1W5BA 3JASB 1H3FA 2P78A 2PSDA 2WF8A 4NXMB 4OGGA 1ZK3A 3ZNPA 2QRQA 1Z12A 1Q7GA 1REQB 3GJYA 4GYWA 3D8SA 1J25A 4PC6A 1YO6A 5DLDA 1T5BA 3G2PA 5JXWA 3QQ5A 1VI5A 3MS2A 3L5OA 3GC6A 3HRHA 5DHAA 1JFRA 4R5MA 3IKMB 1FRNA 2GVDC 2R60A 2MU1A 2A88A 2YH2A 1WKCA 1V71A 3HN6A 4PZUA 4W1SA 2O2EA 4K9PA 1I3LA 3L4JA 4JJEA 1BNCA 2WVHA 2ZJ3A 4BJ1A 1GT6A 5I3CA 4YMIA 3F5MA 2BSQA 1I2CA 3SHFA 3SF8B 4E4YA 2M6RA 2WAXA 2AZDA 3CKLA 5C52B 3GDOA 5A4KA 2E85A 4KE9A 8ADHA 1DRKA 1SHLA 2G36A 4DA4A 5CFRA 2I3BA 3EXHB 3RC1A 1A4RA 5M3BA 5HS4A 2ZYAA 4OLJA 1VE5A 2C8JA 2W9XA 3FTQA 3LWDA 2QTLA 3EG5A 4LE0A 1RPAA 1SXJE 1FLAA 1ONPA 2FUG1 1U2DC 3NATA 1KYVA 5EXTA 5YASA 7REQB 1KJYA 1MAVA 1PL8A 1SWVA 1JKIA 4JJIA 1MZPA 4UXHA 2Z1NA 1T9GS 1GPUA 4FU0A 1U0JA 3UHAA 3KQYA 4MV0A 3KD2A 4W9NA 5E1OA 4WK6A 3F4KA 3FI0A 3L4SO 3T5TA 4D0GA 4CM7A 5HXAA 4X20B 2BFEA 4I4TF 3HUTA 2WKSA 2OV3A 2I3DA 1Y1KE 1MLDA 1RKQA 2H29A 2MYUA 2M1XA 4B4OA 1KK3A 4MAFA 4J4BA 1T1JA 3AUKA 3HWSA 1MOPA 3QPCA 2AVDA 5AKIA 4DUGA 3O8RA 3GPDG 3FHJA 4UEQA 3RYFB 1T2UA 3PQCA 5KKCA 3RHZA 1UKEA 3B8EA 2H4HA 1EHYA 3SEZA 5ITWA 1U4OA 1N6NA 1EUCB 1SBZA 3AX6A 4OFXA 5B7QA 2L69A 3VHXB 4ZQEA 4EHAA 1AMNA 3GLRA 2KJQA 3HZZA 3KKLA 1IPEA 4X6LA 2F9LA 3O8LA 3DQQA 2C2HA 3DTNA 3E1GA 3W05A 5K3CA 1PNRA 1JHOA 3HCEA 3GRPA 1TQ2A 4V0SA 4EBBA 4MV6A 4B35A 2E1PA 3IAXA 3P45A 4M7PA 3AEKA 1ECGA 5AOAA 5IEBA 4JR1A 1ZBQA 3PC3A 5LDGA 1LBHA 1KI2A 3ZH2A 2NSYA 1SZCA 4ZEWA 4BNYA 2QXYA 1PR5A 3CG4A 3IRVA 2HEIA 5H83A 5CB4A 3WQRA 5E6SA 1LU9A 3JWIA 2AOTA 1J07A 1YRBA 1V48A 3QY0A 3A0RB 4ZRNA 4JVMA 5F78A 3THYA 1U28C 3A1TA 4IAOA 2WA1A 4PQFA 3WK9A 4EITA 1YRHA 4YMHA 4Z51A 1JAIA 1M34B 2C4NA 2CLOB 3ZU3A 3W7BA 3CT4A 4BJHB 4TMZA 2OOKA 3R3VA 2Q6TA 4GOND 4QUGA 3RC9A 5JD6A 1BDIA 1RM0A 1W30A 2FN7A 4WN9A 1SVSA 1DKPA 3RK1A 3N1UA 4DCJA 1SUSA 1U3VA 3QJYA 4LG1A 1K88A 4L5IA 3AJDA 4QL3A 1G8GA 3EBLA 2Q6VA 1T9GR 2VT2A 3AVQA 4QQRA 1LV8A 3BF8A 2Q41A 2V7QD 4DQ0A 2J7PA 3O4RA 3LZ6A 5CA1B 1Y1PA 2FFRA 3N0XA 2P0YA 4M88A 2XDWA 4PFKA 5D5PA 5EFZA 2IYSA 2Q5OA 4Y1EA 3UWDA 4GRIA 5DXFA 1NI3A 1C1DB 2OCDA 1MQ9A 3LO5A 2PH3A 3MUFA 1VLJA 2ZTHA 3PC4A 4GR4A 4CCYA 4D3YA 2QM8A 1YAJA 1KBQA 1IWBB 3BSYA 1KQPA 3LNCA 3PEUA 4LY0A 4YDRA 1ORVA 4IUYA 3D6VA 4OHWA 3VAYA 3W4IA 3V7FA 1RLIA 1SHTX 3FKSD 1WOMA 2NUPB 2RI0A 1IG0A 5B3LA 4K6OA 4PR0A 5KMGA 1OXTA 2Q1TA 4NESA 4N7BA 1QB8A 1RCUA 4X9XA 4X92A 3PQ3A 1AZLA 3TNDA 4L76A 3WJ1A 2AEEA 2EZ9A 4R0NA 4ZQGA 3VQTA 2PDAA 2WZCA 3RAGA 4P33A 2HK8A 4F5YA 1WB6A 4XYMA 1XU4A 4RD0A 2D8MA 2R7NA 4I08A 3G3EA 4I46A 4J1TC 4ZAGA 1RPTA 3CIOA 3OUTA 3ZQJA 5EIFA 1DP4A 3OZ7A 1Z22A 4RENA 3WYFA 1WEKA 3UJPA 2YY7A 3AKCA 4MDYA 1NBAA 1P5FA 4CUJA 1H4VB 2GF9A 1E4YA 5ELXA 1K7XB 3LQFA 1E2MA 2XYPA 4ZQHA 4X94A 4G0XA 2P65A 2WV7A 2V6JA 2Y1CA 4NF2A 2A0UA 1YVRA 1WUTA 3K73O 1JAXA 3D2LA 3H5AA 1CE8A 2QD1A 3ZOZA 1FDVA 1F4LA 4OJQA 1N9ZA 2AZMA 3DT8A 3O73A 3D81A 2O6HA 1JAZA 3K7EA 4LNHA 4UASA 3DTYA 4UUPA 1ULTA 5FPQA 2CXRA 1E64A 3PNPA 1ZRHA 4PHHA 3VR4H 3SS7X 3WK7A 3ZGYA 3KWJA 2QQEA 3EQ8A 3DKPA 3VKFA 1AU9A 3X1ZA 3RANA 4W63A 1TECE 4JB0A 4QX6A 2QN9A 4ZVTA 1D8AA 2I6GA 1G21E 5BSKA 4S0ZA 2O1XA 3LA8A 1FRQA 3M9XA 5C31A 3TLAA 5B64A 1DFIA 2PQMA 2NO5A 2IUFA 2NYVA 3Q2KA 2WU4A 3WIBA 3FA2A 4QTTB 3EFOA 3ZJYA 2AIRA 1HYHA 4NFYA 4XM0A 3UENA 3WXBA 4D97A 2PKWA 2BGLA 3R20A 3U56A 5EKDA 4A6EA 2QD5A 2WU3A 1ONOA 1D8TA 1BA2A 2EBUA 4K0RA 4P53A 2R6CA 2IS4A 4B7UA 3JQRA 1HZZC 1HDCA 3WGQA 1KFJB 4ARAA 1BQEA 2F8LA 4O08A 5GV8A 2G08A 1KEWA 4HN4B 4E22A 4L4SA 2ZDGA 3QE3A 3TFQA 3EGXA 4TTAA 5IJWA 3W5VA 2OZLA 1QYRA 1QC5A 5ADHA 5K8CA 3KZCA 4F3TA 2R6AA 4OQEA 1UPUA 5LU9A 1QIFA 1BEEA 3Q72A 1JXOA 5AHWA 1NVTA 3LIPA 4FBGA 3KLBA 5I45A 5CH5A 4R1UA 1NXVA 5KQPA 3THWB 3ONNA 4NFLA 2X9GA 1C7EA 2QR5A 2X5OA 4OK6A 3LHSA 3O47A 1IULA 1SZJG 3N53A 4MMXB 1LNQA 3C39A 2FJPA 2EJVA 3E5NA 3TLGA 1NI5A 2Q28A 4YA6A 1XQ6A 2ZAMA 5JYBA 1ZG3A 4YRZA 5FNVB 1XHEA 1GLGA 3TM5A 1QIIA 4JL8A 3TVYA 4XCVA 1TB4A 1WA5A 2JF0A 5KHLB 3DFUA 1DJPA 4MS4B 1DHTA 2WSIA 1V7ZA 1XC7A 3Q3VA 4OB7A 3VNBA 1VKJA 3H5OA 3K92A 4P22A 1SKBA 3JQAB 1MA0A 1CJSA 4B2LA 4GSLA 3F47A 3THRA 2XXJA 3CLKA 3PHIA 3M6WA 4RF5A 4KACA 5B3AA 2Z6VA 1DX4A 4EUEA 3QOXA 1SHJA 1BJTA 3FUVA 2BKUA 1E4EB 4UQOA 4BNWA 2QP4A 2HNAA 4EX6A 3M70A 4JKIA 3EA4A 4TTVA 3JARB 2FVXA 3HMKA 3B1FA 4G24A 1V5WA 3G0IA 3SX2A 4AUNA 3OCWA 5B3JA 1NR1A 3TGWA 3JW8A 4OP2A 2BGNA 4N4AA 1WY5A 2JDID 2NXCA 1AX9A 3WKAA 5EIWA 1WXFA 1I0LA 1GPKA 4MO2A 4JJKA 1MEJA 2D4HA 3MYYA 3F6EX 4D0SA 2ESRA 4NCJA 1Y0BA 5J43A 5ALEA 3GYGA 1T36A 4GI2A 1D1PA 3RRMA 3FBGA 4QGAA 4YCJA 3CE6A 1J70A 2Q9AA 2W42A 3AG5A 1Q0LA 5CCEA 4PZDA 3INTA 4WNCA 1JIJA 3RFVA 3FYUB 4ZVOA 4O63O 2C2XA 2QU7A 3HPQA 3RKUA 3NDJA 4GYKA 1IB0A 2OV4A 3MJHA 4HUJA 4TSRA 1BKYA 2UZ0A 1TYBE 1OBFO 1QQ7A 4XEUA 5FBWB 4BO7A 1Y8ZA 2F8TA 2QRJA 3FW1A 5AM2A 5DN6D 4BO3A 1YBHA 1QU2A 1LPMA 4QNNA 4JYMA 6REQB 2G70A 3NBAA 3PZRA 3JR3A 1YZLA 3KB6A 4LX8A 5HEKA 3OFND 4BGIA 4X65B 1PGJA 1JB9A 3BGWA 5KWVA 2C94A 1M76A 3ZXUB 2H1SA 1C9JA 1P0MA 2ZI9A 4WLUA 4B82A 4BMVA 3KPYA 2HRDA 1A8UA 4G4JA 4H7PA 1JW9B 4NYMR 2V9PA 1U99A 1XMQB 1NYTA 4LJ7A 1LRLA 4R9RA 2AG1A 3DVSX 4XW2A 2IFTA 2FF5A 1MX1A 4IXNA 1NXWA 4RPKA 4C0SA 5GMOA 1JT2A 3DXYA 3AQIA 3OIGA 3TW0A 3SYRA 3UEOA 5EG5A 3H7AA 3FSRA 5CU7A 3RS0A 5C1OA 5JZVA 3EAQA 2KI5A 4M9ZA 1Z6GA 1RJ9B 2VCEA 3NVMB 1OVMA 1XPUA 1RVV1 2I7TA 2ZTUA 2ADOA 4LC1A 1LSSA 1PWXA 1VCHA 2FRXA 2G7MC 2L42A 4GOKA 1E69A 4OOFA 3SBEA 1OLUA 6AT1A 3C1TA 5IAKA 3PVSA 1ST3A 4TVBA 4EVIA 1FVFA 3BMNA 4FEYA 2IYNA 4YCSA 2XUIA 3HXPA 4MEJA 2YS6A 5I7AA 1X1EA 1PE0A 1NDHA 1RAAA 1SQ5A 4G8CA 3T0FA 1M34E 4DR4B 3H0KA 4RZ2A 4K9KA 2JS7A 3HCNA 4M7OA 2HHLA 4LXQA 2AWOA 2HDHA 4R51A 2PUTA 4LEIA 3DBLA 4R69A 2XQKA 1NTOA 2NZYA 2LR0A 3HWRA 4M1KA 1IXKA 1GUDA 1AT1A 1UT5A 2ZIZA 2R1UA 2ZRDA 3BMXA 3HL4A 4RVOA 3WADA 4BYMA 2ZVQX 3O95A 5B12A 2YRXA 4M49A 3K4QA 4W5HA 2H1HA 4BLQA 2RHOA 2A9KA 1U7HA 4IF4A 4AYWA 5KU1A 1UZLA 3AETA 4YK7A 1XN1A 1AO3A 3LTNC 2GRAA 4GMKA 4D1YA 1D4FA 2IC5A 2RBEA 5ALDA 3U4DA 2ZJ4A 4NMHA 3W79A 3JD4A 2CVQA 1PZGA 3Q3HA 4KG7A 3DNFA 1P2BA 5BSMA 4GWGA 1LX6A 5JBQA 4S1PA 1DC4A 3T9BA 3U5ZB 2I3GA 4MWCA 1VXOA 5JBNA 3IMFA 4IG9A 2DKFA 2QN1A 4D9GA 1QKJA 3D64A 5TQJA 4N03A 1RHQA 3RPEA 5PNTA 2VIIA 4C7MA 3M5DA 4NZYA 3IOCA 2I91A 4GMHA 2P5YA 4ZYVA 1QBGA 1K0UA 1QR2A 2VDJA 3L41A 2FPMA 1LC3A 3ADCA 5IVIA 1QK3A 2C7BA 1DZ3A 2P0AA 5A0FA 3PQ8A 2B20A 3KUKA 1U6JA 1UKCA 2J3MA 4C7BA 3TOZA 3O84A 1G20A 5ED0A 4HNUA 3VC2A 1EP2B 1UMCB 2Z8XA 2OOSA 2P4UA 1VHTA 2EX1A 4BRZA 1JVSA 5C1DA 1QS0A 4P6VF 4DMGA 1KEEB 1RWKA 3GHHA 5IP5A 3WLPA 3F6SA 4I0WB 1M2HA 1PU2A 2PUVA 4FOSA 1M1YB 1B1AA 4NCKA 2X8JA 1Y1QA 2IHYA 1NLMA 4J49A 2QSJA 2WJPA 2X22A 5T57A 3ZJUA 2NUTB 4C0QC 1A5SB 1GKUB 1RLOA 1TW3A 1E0KA 3OJWA 2VDRB 4QOIA 1IAVA 4XE5A 3KAKA 1H2YA 3K2QA 1J42A 2AX3A 3I52A 4GWKA 4RPJA 4BZXA 4B80A 3TGPA 3E1KA 2V3WA 2VPYA 1R4NA 1RQXA 2CJYA 4Z3OA 1SA0B 3UAYA 1I3OA 2N42A 3FVQA 1B8OA 3A28A 4L5CA 3R3WA 1E61A 4XIGS 5JNVA 3CEHA 3ISTA 5FFFA 3T3OA 1E77A 4L4ZA 3ROFA 1XV5A 3U44A 1Z83A 2A5JA 2IXTA 4IUCS 4GP6A 3WK6A 4AMZA 4B43A 1U9YA 2QG9A 1VA5A 2Y66A 2ZRGA 4LOHA 1U2SA 1WUYA 3K53A 3ZDQA 4DSTA 4MVJI 3AFMA 3IEKA 1WS6A 2EGUA 4OO3A 3L8EA 1YSCA 4YCBA 1PK9A 4EYSA 4H7KA 3EQZA 3I0ZA 4HEHA 3PF8A 1UXIA 3UUGA 2WKWA 4JBNA 1QLHA 4LE2A 3A1WA 4U2FA 4BDSA 1R0RE 2Z9DA 3ONVA 5B2EA 5IANA 3NANA 3NTLA 4CDMA 4A2WA 4HX9A 1EWVA 2QRMA 2HQRA 3HR8A 3T3HA 4GPAA 2B4RO 2C04A 3Q5DA 3AU9A 5IUKC 4D74A 4OXIA 4EDHA 3AM4A 1DXYA 1TJNA 4L3WA 1EGQA 2Q9BA 1XDGA 4P1ZA 4K40A 4OH1A 4O3MA 1X7XA 2YOFA 3D8BA 1XTQA 3ETHA 3FNIA 3KAJA 1Z82A 3QXGA 5AW2A 4AI6A 1UJCA 1K7FB 4PXSA 1CQJA 3B6ZA 1JFLA 1XMPA 4A0HA 4GKKB 1KZ6A 4YAGA 3E7FA 2FFBA 2JFGA 4X6XA 1E7RA 3ANLA 3VTFA 1XIVA 5TR9A 1UWVA 2NTNA 3OQJA 4G5QA 2OO7A 2HH9A 4HXEB 4P58A 4G36A 1T2CA 5L7YA 3OQOA 1E2GA 2PUJA 3C7CB 3WS7A 4EO7A 5K7SA 5JQWA 1UODA 3AUSA 2O0LA 4DN6A 5T64A 2BYTA 2NACA 5DXAA 3FVWA 3SF0A 2I80A 2BZGA 2FPOA 3RODA 2W2XA 2DCUA 3WG9A 4X3OA 1RADA 2H1FA 1CIJA 1CUFA 1X9IA 5CDFA 2AI2A 3KFVA 2X7JA 4QLOA 4TS9A 3UQYS 1ZCAA 5MGNA 3GLGB 4M87A 1L4BA 4DIMA 4QYMA 1GL3A 4NZPA 2ZXFA 3H2SA 3S55A 1AS2A 3TF5A 5EWJB 1GL9B 4OAPA 1ZH6A 2PNFA 2CLFB 3A6DA 3B48A 3MWDB 1G9SA 4KGZA 4KMMA 4URFA 4Y7DA 3VO8A 3WL8A 1ADYA 3VUFA 4C7KA 4LNUB 1X9HA 3CVJA 3V2GA 4ND6A 2BKXA 4RZXA 1HLDA 1MB4A 3CNLA 4OIMA 1QV7A 1ZGBA 1OGYA 3HBJA 2PAAA 3SJZA 5F98A 4M0MA 5AYVA 1NDUA 3QYJA 1KS2A 2NU9A 2YHUA 3FMGA 4JBLA 2GHTA 5BVGA 2VTKA 1XD9A 3EXIA 3PQ5A 3WI7A 4NU6A 4FR0A 4FCWA 3RU7A 3WB2A 2JHPA 3L6EA 3D3WA 1JJFA 1P73A 1WUHS 3CF0A 1W75A 1NR5A 4LOLA 2BMFA 2OCBA 3U4QB 1GYRA 3CEPB 4EB6A 3RAJA 1IHYA 3I9LA 5JH7B 1CVIA 1HXHA 1MABA 1ZDMA 2QI9F 2WNSA 3B3GA 1NBME 3B1XA 1HQKA 5D3QA 5J9FA 4JI0B 3KTFA 2P1ZA 2Q8NA 4E33A 1ZD8A 5SZJA 3WLQA 1NLFA 2JCXA 3F8SA 1FUUA 1U2GA 2OCKA 4PHCA 4D9IA 3PFHA 4GDFA 1IZ7A 3NFYA 1IBMB 1ZNZA 4ZCLA 1Q0UA 2AQKA 5JVDA 1F5NA 1A50B 3IDFA 1M67A 4LZOA 1P77A 3HA2A 1C3VA 5FWAA 3ORFA 1T9HA 3I6QA 2BE7A 4K9LA 5I9IA 4KO4S 3GFPA 4RKFA 1E6LA 1Q1EA 4RD6A 1CUHA 3H16A 5JCXA 2C9ZA 1U2RA 3AHHA 3WC4A 2C29D 2Q2VA 3MWEB 1DQPA 4J0CA 3ELWA 5FTNA 4CRWB 4E31A 1XA4A 3NHPA 4L4XA 5C8YA 3WDMA 5DGHA 2OV6A 2XY4A 4QGFA 2NV2B 5K6AC 1HEIA 1YZNA 5LZ8A 3S44A 5C8VA 2FDCA 2FX2A 2V7WA 4PLFA 2P4HX 3PEEA 1W87A 1KMMA 4JN6B 5HF5A 3ZTTA 4S3MA 2WHEA 2YJ4A 3QF4A 2RHGB 1LW7A 1N5IA 2OKGA 3CYFA 3F9IA 4REQB 5FTMA 4HK4A 3RS5A 4DQDA 2HT6A 4KSCA 1Z0KA 4YCLA 3A1DA 2IQ5A 1PT7A 3E7DA 3GHYA 1AKUA 1DAIA 1MC8A 4IHKA 4MYUA 2BT4A 4XSGA 5DPMA 4E5VA 2ZRPA 3G89A 4PE5B 1EP1B 2HGSA 2I7CA 1VG0B 3BE6A 4I4TB 4Y0AA 1IC6A 4OLHA 3VOAA 1A76A 3EZFA 4DR6B 3FYSA 4F91B 1YRLA 3K8OE 2FWMX 3M6UA 1KK0A 1MB2A 1PJ2A 2O8BB 1GGKA 3IULA 1VSVA 4NABA 3EPHA 1RZVA 5LQJA 3V4PB 4O1MA 4RPLA 3AHFA 3DMHA 1Q7TA 4EJ6A 3TQQA 5TX7A 5ALVA 2JBAA 2CXUA 3DLAA 4WINA 4EJSB 1X0XA 2F7SA 2H31A 2QYSA 1AXRA 2HBQA 3OE1A 3OPYB 4J0EA 2IY9A 1QRTA 3ETDA 1U65A 3GLKA 4HSGA 1ND6A 4OL0A 4Y2TA 1TPZA 2JHAA 4ZVSA 5F3RA 4HFJA 1HG0A 3SG0A 4BAUA 3TW6A 1II8A 3T38A 1JHAA 2I6TA 3OAAA 3LT0A 5E9AA 2ERXA 1C0PA 3BICA 4HAOA 3U9LA 1N3LA 1NQOA 3EGIA 3LW8A 2NZJA 3P5SA 1Z68A 2D06A 1CY0A 3M1YA 1P9RA 1G19A 2XVMA 1KOFA 2PKXA 3HR7A 1QQAA 2NMVA 2EVWX 3E9ZA 3C45A 1SIUA 4WV3A 4G9GA 3VTZA 4UHJA 2D5LA 1WDMA 4FD3A 4CWAA 4NONA 4L15A 2OMEA 2Q3LA 3RTAA 2HD4A 3COPA 4IWXA 2PVCA 3ZCVA 4BE4A 4W5RA 2HGZA 3Q88A 2W8BB 3F97A 4IGKA 3T1TA 1P33A 2OHXA 4ERXA 5IF3A 4MHSA 3A6ZA 5ICSA 2Z56A 3RVJA 3V33A 4A27A 1QH8B 3ILVA 1EH5A 3NHZA 3OZGA 4NBWA 4RF3A 2C1XA 3A3KA 2E3JA 1GUZA 3ADKA 3E0XA 5FEUA 1U0RA 1Z6YA 2YHAA 4HAUA 4WJKB 3KB8A 2JCBA 1F4PA 4MLPA 4BWYA 4OTZA 4J0JA 4B3GA 3BMQB 3CJQA 4W5WA 1EFTA 3BUSA 3EW7A 3IIMA 1XDSA 1AF4A 2ZJBA 2EQ5A 3NBKA 2D4AA 3WLHA 1CUBA 4G3XA 1BMQA 1JFVA 1PTKA 3N2KA 3H0EA 4GNKA 4P4SB 4ZZIA 5I01A 2HL6A 1M1YE 3OU7A 4RLFA 3RSLA 1U8TA 3P4XA 1BMFD 1GCIA 4E6PA 4B3MB 3RSCA 3FD8A 1CP3A 2BDEA 4B6PA 4UOEA 4H3SA 3G8BA 2PUDA 1GFIA 1PFUA 2H7VA 1OI4A 2LV8A 4R1NA 4TPKA 1G3IA 3IIJA 3NNDA 4B47A 3Q0IA 5KJFA 1WCYA 2YN2A 4CN8A 4GX5A 2KSQA 1D7OA 1TE2A 1FNMA 3NPMA 4MV1A 2WHQA 4Q16A 1OX5A 5I4KA 5KYNA 3IKTA 1Y82A 1ODSA 4O4JB 3CO5A 1M5TA 3E22B 3L07A 3M81A 4QREA 4Y1RA 2Q5IA 4OP3A 4WFQA 1P0FA 2COEA 1SJ9A 4MQMA 2WE8A 3UOAB 5BMOA 2NSDA 3O74A 4MGKR 5F7XA 1EXNA 2AYXA 1M6YA 3HU1A 4HB2A 2V6BA 1V8ZA 1UPAA 3E05A 4MAMA 5IAOA 3A6LA 3BEDA 1EFPB 1RWVA 4MV7A 1SUEA 3P2JA 1CDZA 2ERYA 1MOSA 2P4EA 3VM6A 3WLFA 5HZMA 2BR5A 1JI0A 1L7EA 2O19A 3UM9A 3DZKA 2PEYA 3KTOA 2IRWA 2K87A 3C87A 3HUEA 3P0IA 2DFTA 4Y9UA 5JIBA 1YH3A 5EPOA 1NVMB 2CVHA 2X42A 5EXEA 1Z4KA 2YQ5A 5KKNB 3RG8A 3GQBB 2PS1A 3EE6A 1GCGA 1DUVG 2BJHA 2QRVA 2YXPX 2D0PB 2W58A 2WYWA 2HQSA 2P7IA 3DEZA 5H0IA 1JNYA 3CN7A 3EEQA 3DGFC 3OCZA 4TYQA 1S02A 3FOCA 4C43A 5KHOC 3GCGA 2QX7A 4WKOA 4HFNA 3L7IA 3IBYA 2PMWB 4EFLA 1ZK4A 3GUVA 3SCZA 4LK2A 5TSDA 1SXJA 1U7ZA 2HCRA 4AXBA 2B82A 3LM8A 1W85A 1CQPA 4R0VA 3R0IA 4DY4A 5FWXB 2HDNB 1KARA 3QPDA 2MYTA 4P36A 1WRBA 4I50F 2NSHA 4OHMA 4BRSA 4DJJA 3UAZA 1WZCA 4L6AA 3IURA 2DUNA 3ADOA 1UADA 1Z7BA 3M6VA 2AE1A 3CB2A 3AF0A 1JR3D 1EWYA 1ULHA 5JSUA 4ER7A 4ZT4A 3RLFA 3SM3A 2ZETA 1M6WA 4G25A 2AQIA 2YMPA 3M2TA 5KOHB 3ERCA 3BA6A 2XEDA 3HO6A 4W8OA 5LBUA 3W5SA 4UFPA 3GLGE 1YWGO 1G3UA 1LI4A 2HO4A 3HHPA 4KWTA 2R6GA 5D6NA 4TGLA 3M83A 1Y8QA 4K2AA 1MO2A 3UYLA 4WRRA 2FQXA 5LD2C 2V9ZA 1COWA 2ZYHA 4F8EA 1N6LA 1ZJZA 2DR3A 4UC0A 2V4MA 4P35A 2OFWA 3OOSA 2O2GA 1QFMA 3SIRA 3BEOA 2H85A 2VDWB 2Z43A 4MV8A 4QQNA 2GPYA 2MYNA 1RMTA 2QG6A 4GOOD 2G04A 1DIGA 5DBEX 4YJHA 3JALB 3SBDA 3VPBA 2AZXA 2BP7A 2H06A 3JQGA 2V98A 3KZ1E 2QR3A 1P1JA 3R75A 3SJ7A 2VHJA 2Z09A 4DVGA 2BFAA 4EYEA 3G2JA 4K6MA 4MR7B 3HUUA 1EUQA 4NKRA 1PT8A 4NG4A 2AKAB 4JCOA 3U1BA 3C3KA 2FR0A 5TT1A 5AO9A 4C6TA 2Z5VA 2O8CB 4L73A 2WWVD 1DIHA 3QU2A 5CVVA 4GE3A 4RYLA 1SVLA 1XAHA 2F6RA 2XH8A 3A1FA 4HDKB 4IIHA 2AMLA 3HFGA 4NOLA 4OFZA 3UAWA 4MWEA 3BTUA 1X14A 1ZJJA 2HMWA 3FMPB 1JFTA 3TE7A 1M1XB 2YWXA 4E0BA 4V38A 5IM4F 3A9TA 2EV9A 2FW6A 4Y3UA 1ODIA 3DLPX 2P11A 4DSNA 1ELOA 1E8NA 1RJDA 2J5RA 3MQ2A 4JT2A 3REQB 2XKKA 4R1MA 2FPRA 3WGHA 4CMJA 2WICA 3PZBA 2HCJB 4YRNA 2WHPB 3GEEA 2GEKA 4JLJA 1M8PA 4KXLA 4AXXA 1ZM7A 3H1BA 5DBIA 1Y4SA 4Z0TA 1L5VA 4Q4DA 3HNPA 1J2YA 4F85A 1MX5A 4AZ3A 3EUWA 1EBBA 5A6SA 4BJ5A 1K3TA 1V2HE 3KJEA 4M89A 5FOUA 1P4RA 2Z1MA 4RFSB 4UMEA 1UMKA 2ZI6A 1R9GA 3HXKA 4WKBA 3E9MA 3U4CA 5L8VA 2BUAA 1BHJA 3QHAA 5SY4A 3CO0S 1E6UA 5AVTA 4LWZA 1A8IA 4L0CA 1HY3A 1BHO1 2WJIA 1KAGA 5JD3A 2WVGA 3CF2A 4IDOA 5CXUA 3PXEA 3C6MA 3VOTA 1XPRA 3LW7A 1LBQA 1OTYA 1X3SA 2XZPA 3C7AA 4BEBA 4YRQA 2CNNA 3K8QA 4DT1A 3RNOA 3BDVA 3T7AA 2OWDA 1CY8A 2DLCX 2D7JA 5KKAA 3HYTA 1HYBA 3QBEA 4U2EA 1KBZA 2TMDA 3LDUA 4M98A 2G88A 2XV1A 4O5AA 5ALNA 3MPUA 5T4HA 4ZIRB 4EEXA 1WY7A 1QAMA 3T3EA 4EG4A 2DYKA 1AGPA 5CA0A 3L6OO 1FJXA 3IPRA 4OJKA 1KAEA 2XNCA 4EHIA 1W4AA 4R1TA 2B2CA 1JJVA 2J3LA 3NOVA 4I1IA 2FRDA 4Q6WA 5GOTA 1DNPA 3QKWA 3PEWA 2JVKA 4A0FA 2RB5A 3D5TA 3H1TA 3NWPA 3QF7A 2PUCA 1CXZA 3OY7A 2QT1A 4GT1A 1JZQA 2Q2NA 1FXSA 3ABZA 3CLTC 1K8ZB 2R6R1 4GYYA 2F67A 3ZK9A 4ENQA 1HLPA 1O95C 4JZKA 4BWFB 4BZPA 1B3BA 1ZSVA 1PFYA 1P6XA 5JT1A 2GASA 2CNLA 3R8XA 3ASVA 1B15A 1FP4A 1MXHA 2Q2OA 5B6JA 1PFQA 2LRHA 4LDZA 1G21A 3AINA 4PYRA 2WM3A 3ITNA 3OEWA 4MYDA 1OAOC 2YWJA 4RTMA 5G0VA 2O3RA 3HB0A 4QAQA 4D9NA 4ZDIA 2XUAA 4RK4A 1TM5E 4UFOA 5HIIA 2CXTA 3F1LA 3IH5A 1THZA 4U7WA 4RDCA 1KGSA 1WP9A 4Y2YA 5HHTA 2EDAA 5JXGA 3TZEA 5KNDH 3TG2A 3L6RA 4Q39A 3ZJ4A 3JQCA 1CV2A 4WFKA 1GEEA 3ZNOA 4AQ7A 4QT0A 1JXMA 1SVIA 4GM4A 1QHXA 2VJMB 1Q16A 2FZKA 4QE3A 4TTPA 3TRHA 3WGYA 4MOWA 3DXZA 4QUDA 3WRWA 3ZBTA 3QFCA 3OPQA 3LRXA 4Q9DA 2YV5A 4ED9A 4FLEA 3HLKA 5AD1A 2IHBA 1L7VC 4GZ6A 4XH9B 1YASA 2YN4A 1V6CA 2OM6A 4FZVA 1ZM4A 2MSNA 4MO9A 4TT3D 2KX7A 5H80A 4Z1MA 1YUMA 4F4DA 2XCUA 2EFDB 1PG0A 2REQB 5JD5A 2WJHA 2XMDA 2G4VA 2QQ5A 3BB1A 3NS7A 3WVNA 4EARA 3EBPA 5L3QA 4HOYA 3JQBC 3LKVA 2X14A 5FI0B 3O2QB 3U7RA 4MK4A 4RH3A 3ZU5A 4BFZA 1FYEA 1KL7A 5FBQB 3DKVA 1AQLA 4HRYA 1PJZA 4HDSB 3EXG2 3HKBA 4HFMA 2XE6A 3EZGA 3BQMB 3MQFA 4C06A 2QTWB 2I8LA 4LVNA 5GQSA 4DLVA 1BZYA 3JASA 2HBZA 4L8WB 1Q84A 4B46A 2QUIA 1T91A 3ZCTA 1WQ3A 1A77A 4RVNA 3TN7A 2UXCB 1CB0A 1XQVA 3C6ZA 5DGDA 3SBXA 5BSFA 3GT3A 1RC8A 1M8FA 1DAGA 1MEEA 1FXWF 3TD2A 4LPKA 2FLVA 4RY2A 3ZU4A 4JV5B 4UE6A 1ID8A 1S2LA 2NXEA 1F5SA 2AG8A 1XAGA 7GPBA 2GI4A 1Y1SA 4PLYA 4YWJA 2FX3A 4G5FA 4GKVA 1XRMA 2WJWA 1M2OB 1XKLA 4G01B 4IIFA 1PHRA 2W2KA 4PFJA 1PGOA 1XZDA 3CR8A 2QI9C 3H2ZA 1OT3A 4OD0A 4XUCA 3FDIA 3WL4A 1YQDA 2XWJI 3AEUB 3ZLBA 4DL9A 2VHQA 2JLRA 2PRIA 1IN7A 4EX7A 1QOQB 2ZB2A 2RMKA 4F56A 1HNWB 3MHPA 3U4HA 2Q99A 2HMYB 4X62B 4KO8A 3EIHA 4MVJG 1M1UA 2HF9A 1Z6ZA 4RTSA 5BT9A 3M49A 3SF8A 3V4SA 1FFBA 1K6MA 1FMCA 2C5FA 1NRWA 1NM5A 1UQUA 3QGMA 4HH0A 4NULA 4UDNA 4BNGA 1G18A 1DKLA 3KDAA 3BE4A 4RTQA 3F3KA 3NTUA 4BLTA 4YO8A 5D7NA 1IQ0A 1GKKA 2ECOA 3EXHA 4L28A 2M6SA 4JYBA 4DXDA 1XTZA 1YB4A 2ZS7A 2HA7A 3KHKA 3NZEA 4MS3A 1NJ2A 3IT0A 1K9SA 1PJRA 4OLFA 3AI3A 3PGXA 1OLXA 3V32A 2FZVA 4ND7A 2O9JA 3KSAC 2H54A 3KAPA 4NNPA 5EJ7A 5JYDA 2NP6A 4BLSA 3DB1A 1P1RA 2BR3A 3EXFB 1Z0FA 3P9XA 1EVYA 4BNXA 4KE6A 5CFQA 3R6DA 4YQYA 3T9CA 4EI8A 1Z5NA 4ZDJA 3IEIA 3MG9A 5BWLA 1KDRA 2CT8A 4OXNA 2EJBA 1Z5UA 4GNRA 2FFAA 3F9CA 1NV9A 4LN1A 4X20A 1V26A 4F7DA 1CERA 2EFCB 3HNOA 4E2WA 1KEKA 2KMLA 2Z5LA 2FF7A 4EHKA 1ZKDA 1E8DA 3HB9A 2VKTA 5K8IA 3EULA 4Q1DA 3MCTA 4PF1A 3B2QA 5C5DA 4WLOA 4NZMA 3BHIA 4ZRDA 4TS1A 2DFDA 2C2ZA 2H1LA 4RA6B 2IXDA 1XYGA 2GAJA 3SLGA 1W6RA 2ZUCA 2R4TA 4UCWA 4L4YA 2ZULA 1EUCA 1LPNA 1P74A 2FHPA 1QFYA 2KPOA 3GAMA 1B93A 3CCCA 1C9YA 4ZAYA 3VHXA 4C0AC 4QDKA 3W1VA 1KIFA 1IRIA 3VZRA 3PDJA 1E1RA 3QFHA 4IDHA 4TRMA 3N74A 4WN3A 4YRMA 4AMVA 1P2DA 1R66A 1ZCBA 2WFLB 4MLCA 1QPBA 2ZU0C 2X1VA 5IJAA 4UMFA 2CCKA 2PZKA 4DDUA 1ZMRA 5CW2A 2EQAA 1G1MA 2QZZA 5HOEA 1IJKA 3F98A 2PBLA 1X38A 3AF4A 4TLCA 3RTBA 4EZIA 4EJ0A 1C14A 3UT0A 3OTGA 3I2JA 3OIWA 3AI2A 4K6GA 4K8OA 1F48A 2QTFA 3DHVA 1NXPA 1ML3A 4X00A 4AURA 5I7UA 2Z58A 3SK0A 1J97A 4HWRA 4JI1B 3UHJA 3F73A 1T8YA 3KVOA 1CJMA 2WSLA 3OHMA 1SUIA 3K16A 3ONDA 5AUQA 3QW4B 1G42A 3IAHA 2DHEA 1LD3A 3ZWNA 1FTWA 2LXNA 3WB9A 4IIYA 5IG2A 2QL7A 3EVDA 4FNMA 4GZMA 1A4UA 3P71T 5AIBA 1AUVA 3EXG1 4AKTA 1NOIA 1KHHA 2RHDA 4PSVA 4PHFA 1MH9A 3ILYA 3PUIA 3RKSA 3NAGA 1GA6A 4X8OA 2WLSA 5CA1A 3FJ1A 3QVVA 3CZ5A 3D8NA 3LFUA 3PRHA 3CVUA 4GMXA 1VIDA 2J7KA 4YRJA 4CT0A 3TUIC 2XUKA 1VE1A 4KIJA 4BVBA 4LCJA 1KFBB 5SYNA 1O3YA 3U61B 1Q1NA 1XLTC 2P68A 4E94A 2H1IA 2C7PA 3WL3A 2V3CC 5TS2A 3OCUA 3OD5A 3C14C 4AY2A 1ZXBA 2WVJA 3K9NA 2UVQA 3ANXA 4FLMA 4DNFA 4OX9Y 2NUPA 2B94A 2Y68A 1XQ9A 2DHRA 3PXXA 4MI6A 3ZIAD 3U7HB 1VMDA 1RWOA 1LTKA 3OQ6A 5I9BA 1FX0B 1W9MA 4RO0A 1GGHA 3SSNA 4XJSA 2XJ9A 1DDIA 2IOQA 4PPFA 4RESA 1CLEA 4ILEA 1E0SA 4ZICA 1WEHA 3LXRA 1RR6A 1CZRA 5EFOA 3AVPA 4J16A 2C9CA 5DLYA 4BVGA 4D6XA 5F77A 3RUHA 5K3OA 4TYNA 1R8QA 2Q3HA 5T5QA 1YZVA 2EAUA 2X3UA 4AS2A 3T0IA 1XVLA 4Z4EA 3BRWA 2CSUA 2MR5A 5TB5A 4JY7A 5DNCA 5J4KA 4RJIA 1BGVA 3PFCA 1QIJA 3AERA 3R6TA 4E2XA 3GNTA 3TNJA 3IIIA 1P6UA 1I4DD 2DHQA 1U1DA 3GZNB 5CVDA 4MQ5A 4CTNA 2H48A 5AW8A 2WU0A 3DMPA 1ZI9A 4Z4GA 3JAKA 5T67A 3X2SA 3K71B 2HIHA 3SSOA 2GLUA 4AFNA 3DPIA 5DM2A 4ZAZA 3U9TA 3FHTA 1BG6A 2ZJAA 5AJXA 3AJ9A 3ZVKA 2PMFA 2ZDHA 3AB8A 3BWMA 1UBGA 5HNKA 5B1DA 3HXOA 4EF5A 3C3CA 5JR3A 1J7KA 3L0SA 4C03A 3W5JA 4D0RA 2KYRA 1IH8A 3A6JA 5FKJA 5I9LA 1W1IA 4P4UA 3AFIA 3KO8A 2VNAA 2D62A 1V3TA 1T6XA 2C2KA 2JC3A 4EYOA 3WMRA 4QEZA 3HEMA 2H5JA 3EX7C 3KOXA 4BN0A 3ZE6A 4ER6A 3TI9A 3X1XA 2FSPA 2NYRA 5J23A 1EDBA 3KXLA 3ZGOA 4C7JA 4IZ6A 2UYCA 4G1EB 4OQQA 1OPXA 3GEMA 4ZREA 1SHKA 1GUYA 2PGNA 2J9FB 2VUSA 1AD2A 1E1DA 1F6WA 4MYHA 5LOVF 1NF8A 2HV9A 1NY5A 3S99A 4DPLA 1EB9A 4CKCB 3X43A 3EMDA 1JRLA 5IT0A 3UJ8A 2HEGA 2O50A 4R2KA 3IDQA 3DEYX 2NU8B 3VPGA 5K0CA 5K6RA 5LQRA 3E82A 4PC1A 4GF5A 3A2KA 4Y2UA 3PLNA 5EVJA 7MHTA 4TTIA 3ITEA 1G7CA 2MMGA 1XZJA 1NF3A 5G02A 4Z7OB 2N3ZA 4DIFA 1V8PA 3NNSA 3M4XA 3R8FA 1GAEO 5KX5A 3K15A 1QM5A 1AV7A 5HJ2A 5C3MA 3W5AA 1ECBA 2I2BA 3ESRA 3OJCA 4LWPA 5AK5A 3ZDZB 1BVHA 2VYNA 2WLTA 3HE3A 1OYWA 2AOXA 2GCEA 5EGNA 2ZRFA 3O9VA 4XYLA 3M9LA 1QHSA 4YRDA 1FSZA 3N59A 5DISB 4FILA 1CUAA 4LAFA 4YJDA 3PV0A 4D96A 1DO2A 1N36B 1DAFA 1D2MA 4CEIB 3A3PA 3MFQA 3OF5A 4EYGA 2CB0A 2CDAA 5FNVA 5DRTA 2YWCA 3PHLA 2Q5QA 4MUFA 3BS4A 1P0PA 4EL5A 2D0DA 4ZVMA 2JRCA 4OMFG 1W73A 3KS9A 3ZCQA 1DV1A 4MCHA 5EIEA 4C2UA 4QOFA 1CHDA 2BMAA 4MS4A 2XNHA 2FZ4A 2ID7A 5M5BA 1QH1B 3UC5A 4ZYZA 3WO1A 4BO8A 3JQAA 1TC2A 4XGNA 4ND2A 1P81A 3BXXA 4NAHA 5HM8A 5JEDA 2RBKA 1PZHA 3GLQA 4ZOLA 4TV8F 2X23A 2JHFA 1ZY2A 3DPUA 2EGHA 1Z5GA 1P9WA 3WQSB 1GP2A 2GXSA 2L2QA 2Y2UA 1L4YA 1LVGA 1E4EA 3WIDA 2HJVA 1D07A 4DIKA 5C46F 1F12A 2C2GA 3RTEA 5JFOA 4FQ8A 4JHLA 2ZJZA 4UATA 5F21A 3JARA 1C8KA 2QGNA 1XL0A 4JT4A 4LF6B 1L1RA 1O5OA 3ZDAA 2GLTA 2BFNA 1K8YB 2VOEA 3V4ZA 4DCVA 2FK7A 3CRVA 3PT5A 1XRJA 4TL8A 3QIAA 1V3UA 3DDZX 1B41A 4HQOA 2R66A 3CKMA 2PKQP 3GVHA 3A4NA 1MO4A 3MCZA 1KMQA 2J59A 4MUXA 1AN9A 1UQRA 1N5JA 2C7GA 3HI6A 4JJ4A 5G4KB 4BLVA 3MTBA 5BN4B 4EI2A 2VTDA 3NNNA 4RACA 2ODTX 2H4XA 4AKIA 1CRQA 3A9VA 3AFHA 3H2JA 4LDJA 1GGJA 1NBMA 4YXFA 4OHXA 2EZTA 3THOA 1EJ2A 3IRUA 3PA6A 3PR2B 3KVVA 2YHIB 4PEVA 4HNVA 3HVJA 4B7CA 1U9CA 2JH3A 3G7SA 3LWZA 4UZSA 1XAIA 3TB6A 5KNDD 1F0NA 2R6ZA 1R2QA 3FYUA 2W6ZA 4FKZA 4AS3A 3WWDA 1YFJA 4LZPA 3H18A 3SC4A 1ZGJA 3LBNA 3SMVA 2WTEA 1E2UA 4EKDA 3Q9SA 1X2BA 821PA 1EDOA 3L7KA 5DLPA 1NVKA 1IVSA 4NDZA 1M2FA 1C0KA 3ZQ6A 1SULA 6REQA 4F1WA 3KJFA 2VXCA 2PBZA 2VCYA 1NBWB 4G5GA 5F3WB 1UDAA 3DDHA 4GFDA 3QE2A 1H0RA 4IHJF 5D00A 3Q0EA 2BSAA 5IJXA 3R5TA 3HGQA 4WCVA 1J0DA 2O5CA 2EKZA 1J8QA 4K7JA 1T8UA 2DPXA 2QW8A 1LNSA 1YFZA 2ZBPA 5FL3A 1QQBA 3MTIA 3B2EA 3LNTA 4BQSA 1KO7A 2REBA 1MKYA 1SIOA 3ZIDA 1UOEA 2WF6A 1MX9A 3ITDA 4FYHA 2FW9A 2X9VA 3EFHA 2WAAA 5CVUA 1SVWA 4OHFA 4WZAB 3WSWA 3K9BA 3CV3A 1V5EA 1R0BA 4FQ7A 4RMGA 1SOVA 4DM4A 3W5DA 2VNHA 5E9QA 3GIDA 3WNVA 3PX2A 1TYZA 5C4GB 1RJ9A 3N8GA 2WIKA 1NN3A 3ZI7A 3R6GA 3LC0A 4QECA 5BN5B 4JC8A 2B1IA 3HDVA 4B8YA 2XB9A 2DH6A 4J16C 2A5DA 5I4BA 3S1SA 5FT9A 4IDGA 2Q50A 4I8DA 1KSJA 3LPDA 5IFKA 1T0IA 3DEJA 1QKKA 2AR7A 2XVYA 1W52X 3L04A 2R1VA 3SOZA 1LSUA 5AWFC 2P6MA 1A88A 3TLZA 3L0CA 3IBCA 1CULC 1JR3E 1PLKA 1QF7A 1Z4MA 1K9VF 2NNWB 2HMTA 1BTOA 3O26A 3O8DA 4EY4A 3B5EA 4ARVA 1IQPA 3DFIA 5JSZA 1ZW1A 4RUKA 2X4DA 4GMFA 4JLOA 4DV1B 2DUUA 2K6GA 5NLLA 3V2UA 3VI3B 1SUDA 1XDWA 2ZIAA 2CLCX 3PDUA 3C4VA 2HJRA 3NEAA 4YFYA 4QZVA 5L40A 2I87A 1X7YB 4KZKA 1TKRA 2I65A 2QLMA 3EH2A 1O6BA 3VJLA 4BPBA 4B3HA 1SC1A 2YXBA 4CM8A 5A0TA 2NUAB 1PFWA 2JD0A 3MERA 3ADDA 3U9SA 3FF1A 5CK4A 2BJVA 5GVSA 4DC1A 3TR5A 2O2JA 4BBPA 2VHZA 2WABA 3X44A 2GETA 4NFSA 3H9GA 2C61A 5KQGA 1CY2A 2LE0A 3HRIA 3LK6A 1J8DA 1TQ8A 5HRCA 2VDQB 2XX3A 2VATA 2XB8A 3BPSA 2CUNA 3VKUA 2QUHA 5HS6A 2QUBA 1QYWA 3E0QA 4EWLA 4MMZB 2WNIA 1I1NA 5A5GA 1JL3A 4BZQA 3CMCO 2IWRA 1KH3A 4IRUB 4X3CA 5JG7A 4BV9A 4JH0A 4U2GA 4ZGWA 4E5PA 4MEBA 2TSYB 3ABOB 3JWGA 1SUPA 4B4DA 2D1QA 1F3OA 2XTMA 3GMIA 4IJ6A 4P2BA 3C3MA 3CRNA 1WBBA 4EMTA 1G66A 1K8RA 1YL6A 3PKIA 1O57A 4XXHA 3WWOA 1UMCA 1JFSA 3GU3A 4MUAA 1MT0A 3MJSA 1NQ5A 3UVEA 4I9FA 4A4DA 3E58A 4JC4A 4KKVA 1RXVA 1EDDA 1O94C 3WNBA 1JQLB 2PPLA 4WH0A 1ZD5A 3B9PA 3F6CA 1NDQA 3BRCA 1G2PA 4ACAA 1KEEA 3B9QA 2IEZA 5COBA 2OXEA 4WXYB 1M1YA 3VC3A 1ZCJA 1WCV1 2O7VA 2V7QA 5DLEA 4LUCA 1NR7A 3QENA 1VBNA 2QBYB 4YRLA 4DR1B 3PXGA 2G40A 1XTPA 4L9AA 2EF1A 2EXXA 2X4IA 1K66A 4P7KA 3DG9A 1SZDA 5A05A 4HLQB 3U0VA 3SJUA 3QFFA 2NTEA 4ATNA 1GU0A 1L9KA 4O02B 1SA0A 4JWTA 1JJIA 4QKQA 3RT9A 2WHRA 5ALTA 2Y6UA 4DAEA 3TOCA 4PLCA 1PWHA 4PONA 5FF9A 3H8WA 2FV8A 2BPOA 3JZAA 3FKSA 2H1VA 3DH0A 2VSYA 3KZOA 2YJGA 4BU1A 2A0YA 3O9MA 1CQIA 2QVXX 2ZRKA 1BWQA 3NHKA 2QTCA 1VE6A 4QXQA 1JDZA 2FZEA 1JKFA 1C8BA 2HSEA 3L0OA 1BX3A 3ND6A 5KYYB 3O8CA 3VKHA 1K4KA 1ZNYA 1UJ6A 4C1BA 4DG5A 3L4BC 5G0SA 5AW0A 4TX1A 2OV2A 1NQVA 4AYXA 1RP1A 1XRRA 2G9QA 2Y0CA 4OYLA 4QT4A 2TMKA 2Y4OA 2G9VA 5F5LA 1E5TA 5KS2A 1L5SA 5ECWA 5CVTA 3K0HA 3G23A 5K0NA 4ZJZA 5JW6A 4ZFNA 4UNIA 4EMUA 4OKSA 3WNDA 3AP2A 2HWYA 4J03A 4RVSA 1PO7A 4LJAA 1PSWA 4KYIB 3DCNA 4FGUA 2R4UA 2H92A 4FW8A 4BVEA 5KVSA 1UWKA 5LA6B 1WSDA 1ZOLA 1LFAA 3PQ7A 2P2SA 1K0FA 4RJLA 2J48A 3N2NA 1KYIA 2RAVA 5H9VA 3G02A 3NU1A 2OVBA 4IJWA 3DWFA 2FN8A 4EPYA 2FQQA 2YZGA 4W7IA 4Z4QA 3KFLA 2GMWA 2X9QA 2ZTLA 3FNBA 3V4OA 5KQMA 3R0XA 3F4BA 3IOYA 2VDPB 2C31A 2HQBA 4OBWA 1U4NA 4ER0A 3E9EA 4IWYA 4QDOA 3RUDA 1L5QA 1SVKA 3OCXA 3GLGA 2Q2WA 1YTUA 3F2VA 1ZR4A 3MFYA 3JYHA 4HLDA 4IOKA 1ZAKA 4U2KA 4GVXA 2IYZA 4WCDA 5FP0A 2KWIA 5FUWA 4B1FA 4GDMA 3MWDA 4X7RA 4MB0A 1RWXA 1PT9A 1WXDA 4X1OA 5GGXA 1HFEL 4HP8A 4LJ6A 3DW1X 3EASA 4LNUA 4M54A 5EXSA 4Q4JB 4TMVA 3WOHA 5BY2A 3EPKA 1Q22A 4XWYA 1UPCA 1Q20A 2ONZA 1OXBB 4YLGA 4CVNA 5H81A 2QTVA 1I0IA 4HADA 5U4XA 2VF8A 3CZRA 1C41A 4BMCA 4UHEA 3DO8A 3QWHA 4C21A 4KFRA 1KDTA 2VP9A 5EWMB 1MDFA 4ZZ1A 1R1DA 2WM2A 2YTZA 4XR4A 1XKXA 1E9EA 3OLZA 4U3JA 3FTNA 2RCYA 2JARA 2ZCJA 5AHOA 1JDTA 5DYNA 3S2SA 3UJ7A 5AKHA 3U4QA 4J0GA 2IW1A 5JH7A 3TUZC 2ZRNA 2VHWA 3HCPA 2Y1LA 3P9CA 3ENWA 3JRWA 3RRYA 4NPAA 2H2GA 3L1UA 4K8RB 3MF4A 1TDJA 2IF0A 4C30A 1FBTA 1E2PA 1XJ0A 2PFGA 2QHXA 4OHYA 1BXGB 4BP1A 2IV7A 1NP3A 3VR6H 3T15A 3WAJA 1NQXA 1N2SA 4LF7B 2RH8A 3C8DA 4LGMA 2RH9B 2WJ4A 3VBEA 4DCTA 3UKJA 3E9QA 1NZJA 2FOXA 5JMWA 2HK7A 3EZ6A 4JHXA 3RVSA 1EUZA 1V43A 1TD9A 3DMNA 2QRHA 1NHGA 1WVIA 2AF4C 5KAMA