4N0QA

Crystal structure of an abc transporter, substrate-binding protein from brucella melitensis 16m in complex with l-leucine using a crystal grown in a crystal former (microlytic)
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
344
structure length
344
Chain Sequence
b'DITIGVIAPLTGPVAAFGDQVKKGAETAVEVINKAGGIKGEKVVLKFADDAGEPKQGVSAANQIVGDGIKFVVGLVTTGVAVPVSDVLSENGVLMVTPTATGPDLTARGLENVFRTCGRDGQQAEVMADYVLKNMKDKKVAVIHDKGAYGKGLADAFKAAINKGGITEVHYDSVTPGDKDFSALVTKLKSAGAEVVYFGGYHAEGGLLSRQLHDAGMQALVLGGEGLSNTEYWAIGGTNAQGTLFTNAKDATKNPAAKDAIQALKAKNIPAEAFTMNAYAAVEVIKAGIERAGSTDDSAAVAKALHDGKPIETAIGTLTYSETGDLSSPSFDIFKWDDGKIVGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Leu/Ile/Val-binding protein homolog 3
publication title Crystal Structure of an ABC transporter, substrate-binding protein from Brucella melitensis 16M in complex with L-Leucine using a crystal grown in a Crystal Former (Microlytic)
rcsb
source organism Brucella melitensis
molecule tags Transport protein
total genus 122
structure length 344
sequence length 344
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13458 Peripla_BP_6 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4n0qA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4n0qA01
4NQRA 3VNBA 2NT4A 4YLEA 4G0QA 3JVIA 3OM1A 4QICA 4WZZA 2GI4A 4TLLB 3JPWA 1B00A 4LRQA 1LJUA 1MIHA 4ZMRA 2WJAA 3HXMA 1QP4A 1ZGZA 4RK1A 4MGEA 1DRJA 1JYEA 3E3MA 4Z0NA 3OMWA 4RV5A 2XDYA 1P6UA 4RXTA 5JNSA 1DP4A 3NHMA 4NCAA 2HQOA 4OLBA 1DC8A 3N0XA 2QVGA 3LOPA 2LUOA 4M88A 3F73A 1QO0A 3G1WA 1HEYA 1ZVVA 1JL3A 3ILYA 1M2EA 3CRNA 2O20A 4WT7A 1RPJA 2FN9A 3C97A 4RSMA 3RVJA 1E6KA 1LK0A 2M1ZA 3O21A 1YS6A 3TB6A 2FVYA 5KI6A 1YMVA 3EDCA 3N8IA 2FN8A 5T7BA 4FE7A 4YCSA 4F11A 1Z13A 3QLVC 3EAFA 1DBPA 3O1HB 4P98A 1FSPA 2PAFA 1U2QA 3KKEA 3H5TA 4MR9A 3GBPA 3F6CA 3LTEA 5ED4A 2E4YA 3CS3A 1MB3A 3OLWA 4KZKA 4HNSA 4E7OA 3C3WA 1BAPA 2IYNA 3TX6A 1JLKA 1ZY2A 5TPZA 3RVLA 5JS1A 4W5NA 1LBHA 3C6QA 3IPAA 1MAVA 3BREA 1C4WA 3EGCA 2J48A 4RDCA 2RDMA 3A10A 2CD7A 3I09A 1YS7A 1TLFA 5CNIA 1BDIA 3BILA 4KMRA 2QXYA 1TM2A 1E6LA 1Y1LA 3SY8A 5EWMA 2QVCA 1KGSA 4RWEA 2QU7A 3OM0A 3HDVA 2MYPA 4RXUA 4KV7A 2JVKA 4EVQA 1QPZA 5BRJA 1ZH4A 3K9CA 2B4AA 3MYYA 1DCKA 3A3KA 2MSKA 1JF8A 4RK6A 1JDPA 4RZSA 2FTKE 1R8JA 2F8SA 3RVMA 2IPLA 4N0PA 3FFXA 3HCWA 4EVRA 2M98A 1DBQA 3TMYA 2RGYA 1ABEA 2PE5A 4H3KB 2PLNA 4ETNA 4EYOA 3KSMA 3TD9A 1LBIA 2FLWA 2E4WA 4KK4A 2E4XA 2R25B 4DQDA 4KRFA 4RK7A 1JFSA 2ID9A 3H1EA 5EWMB 3CHYA 4EUKA 2FQXA 4MLDA 1ZH2A 2MSWA 5I4CA 4N41A 4XLTA 1MB0A 1NY5A 3L49A 2GBPA 1Z16A 4RK5A 4YP9A 2NZVG 3CLKA 3EULA 4O1IA 4YRZA 3I45A 5JNWA 3I42A 1DRKA 4IRXA 1DBWA 5ABPA 4KQCA 4NV3A 3KYIB 5T3YA 5IULC 5EWLA 4N47A 1D2AA 1QNLA 1TJYA 1URPA 4RY9A 5HM6A 1E2BA 2H0AA 5IX8A 4EYQA 4XXHA 1APBA 3NNDA 3OQOA 2VUHB 2DRIA 1USGA 3OLYA 1NXOA 4KFCA 1P6QA 3HK2A 2IPNA 1FFSA 5GQSA 3GV0A 1PNTA 4YO7A 4YV7A 4XARA 1EFAA 3CG4A 4OATA 3T95A 3H6HA 3OLXA 4IF4A 4ZJPA 1ZITA 2I6FA 2PUCA 1M5TA 4ZYLA 2QSJA 3DZDA 1YTUA 1A0OA 4UHKA 8ABPA 3LUAA 3C3MA 1NXSA 3LMKA 2FKAA 3E61A 3FFTA 4JASB 3QX9A 5EWLB 3URMA 3CG0A 4WXMA 3O1JC 5KQLA 4MS3A 4NCBA 1P8AA 2GKGA 3K4HA 3N53A 3GYBA 2GWRA 3CU5A 4G0PA 3LKBA 4Z4FA 1U04A 4MQEA 4W5RA 3QX8A 1K66A 4GPAA 2JB9A 1ZGGA 3LUCA 4MS1A 5FBHA 2RJOA 2QV0A 3LUFA 5B3JA 4F06A 2A9RA 3IP5A 4RXMA 4KREA 3QELA 3O1IC 4G0ZA 5EWJA 3CNBA 4DADA 3S99A 3BRSA 5IEJA 4ETMA 1U0SY 2LBPA 4WWHA 3Q9SA 3O2SB 1Z17A 4IGAA 3QEMA 5FWYA 4IMJB 4D6XA 1USKA 3JY6A 2JVJA 1CYEA 2CWDA 4MS4A 2VK2A 2H3HA 3LUKA 3D8UA 3KLOA 2FEWB 3UUGA 4CBVA 5JNUA 1FQWA 1OXBB 2MYUA 5IUKC 3OQNA 4KNYA 2IOYA 4QYWA 3FGZA 3EQZA 5IBQA 4G86A 4JB0A 5JNRA 4OBBA 1SXHA 2PUGA 3EODA 3O75A 3KTOA 4UHJA 3BBLA 5EWJB 1YK1A 2LP4Y 3CKMA 3KG2A 3F6PA 2WB4A 4YGXB 6ABPA 2FEPA 2JCGA 2E4UA 3QEMB 3QK7A 1E6MA 1SXGA 2JVIA 4XAQA 4RY0A 4MS4B 1QKKA 3LUDA 3SM9A 4IMIB 3GA5A 3JS5A 5HSGA 3IP6A 4F3TA 1F51E 1GUBA 3N0WA 4OG2A 3QLUA 3RVKA 4KK3A 4NICA 1OXKB 3HSYA 5JNVA 4PZ0A 4N0QA 5KC9A 1QP7A 1RXIA 2JBAA 3Q7RA 2KYRA 3LFTA 4LZLA 4E7PA 1GCAA 2N9UA 4TMYA 2L2QA 1NXVA 4MR9B 1FFWA 3ROTA 3KLNA 2WWVD 3HUUA 1P2FA 2IPAB 3IP9A 2W42A 3HO1A 5DKFA 3SAJA 2E4ZA 2HQRA 4B09A 5DLEA 2LIVA 4O5AA 4TLMB 5HQJA 2L18A 2MSLA 3MF4A 3RVRA 2IDMA 4KVFA 2WY2D 3QEKA 3T38A 3NHZA 1SXIA 4H3HB 3OLZA 3OMXA 1WETA 2A9QA 4PICA 2A9PA 3JVDA 7ABPA 5KC8A 3IPCA 4YR7A 2FW0A 2JBAB 5DGCA 2B1JA 2FXIA 2PL1A 3SG0A 3L6UA 1NTRA 1KRWA 2CHEA 1D5WA 2P9HA 4MPTA 1ZN2A 4DN6A 5KQGA 3GT7A 3DBIA 4XFKA 4EYGA 1RZRD 3CFYA 3KYJB 1TVMA 1TMYA 1EWKA 3DLHA 3GBVA 1JX6A 4MQFA 5TQ2A 3D02A 4Z4CA 1L5ZA 1XWWA 2V0NA 3UK0A 5BR1A 4FB4A 3KJXA 1Z18A 3HS3A 3N75A 1U8TA 3H5VA 2PJUA 3Q41A 4L85A 3LUHA 3TO5A 3H6GA 1U2PA 4Q6BA 2FSPA 3NBMA 4PYRA 2HQBA 4D74A 3FMVA 3ROFA 2NT3A 1BVHA 3LUGA 1Z15A 4LX8A 4EVSA 5BRAA 2FMIA 1D1PA 2MYTA 4Y9TA 5TPWA 4S05A 5FBKA 3C3KA 4W5OA 2LPMA 3H75A 1NXXA 2FMHA 4MQFB 5GOTA 3DGEC 3RQIA 4KQ9A 2TMYA 4JA2A 3FFWA 4XASA 3T6KA 1I3CA 3RVQA 4P1ZA 4YWHA 2R4QA 1Z12A 2FQYA 2FEKA 2X7XA 5CNKA 3A0RB 4N03A 1EWTA 4RY8A 3OO1A 4LE1A 3JTEA 1JDNA 2IPMA 5CNJA 4F12A 1USIA 3BRQA 3H5LA 3NNSA 5TQ0A 4W5QA 1EAYA 3P9YA 4N76A 4PE5B 1PNRA 4F8JA 4EGSA 2JK1A 3G85A 1AB5A 4GNRA 2HJ9A 4EYKA 2BGGA 1ZHHA 2ZWMA 3HJFA 3W9SA 1C0EA 1MVOA 1D4ZA 1YVUA 3F7NA 4LE2A 1BDJA 5TPWB 4S04A 4RKRA 4LDAA 1CEYA 5KQMA 4MRMA 3B2NA 3MA0A 1Z2EA 4QYMA 1PEAA 3CZCA 3HDGA 3M9XA 4MS3B 3KHTA 4Z9AA 3Q7SA 5C5CA 5KQPA 3VNAA 1AB6A 1EWVA 1JFTA 4HYEA 4ML3A 3H5OA 3QLVA 2QR3A 3LKVA 3O2QB 3DLBA 5TQ0B 2PUBA 5C5EA 1H9CA 1GUDA 4MQEB 1F4VA 4WUTA 3DGFC 4G0MA 1QO0D 4G97A 4HNRA 1K68A 4QPJC 4TN5A 4MS1B 1D1QA 2WRZA 4HNQA 1NATA 5TE9A 4ZPJA 3SQNA 5B3JC 1W9HA 3QELB 2PUEA 5FWXA 5KWSA 2YHBA 3QLTA 2PUAA 3MMNA 5BQ3A 4JB2A 4OTZA 3Q15C 3KCNA 4MRMB 5FWYB 1RNLA 3RVOA 1Z2DA 1VKRA 4OLAA 5DTEA 3N6VA 2YHAA 4ETIA 5E3JA 4G0YA 3T8YA 4Z4IA 4FE4A 1JYFA 1BDHA 1PUXA 4Q7EA 4MR8A 1DCMA 2WJWA 2IKSA 5TPZD 2Q5CA 1L5YA 1DC7A 2L19A 2MYNA 3M6MD 4LE0A 1ZAYA 4RK4A 2F8TA 1NXWA 1YK0A 2R47A 2OENG 3HZHA 2FQWA 3IP7A 2AYXA 4PEVA 5FWXB 1A04A 2NUBA 5IUJC 1QQAA 4WXEA 1QQBA 4L4UA 2PMCA 2VYCA 2FMKA 3I5AA 1Z25A 1ISRA 3HM9A 1W25A 1XHFA 4W5TA 3CTPA 5IEBA 3N0RA 4D6YA 3H5IA 1YMUA 5TQJA 1J56A 5DCLA 4Z4HA 1VRVA 4RS3A 4MR8B 4Z99A 3QLUC 1IIBA 1PEYA 2CHFA 1JHZA 2HPHA 4YS6A 1FFGA 1QP0A 3FDFA 1NXTA 4Z4GA 1GCGA 1ABFA 3IDOA 3RVPA 4H60A 3RH0A 1ISSA 1DJMA 4JP1A 5JNTA 3CZ5A 4RK0A 2PL9A 9ABPA 2VUIB 1RZRA 2OQRA 1BA2A 2ID7A 2RJNA 2ZAYA 1VPWA 1A2OA 4G0OA 1M5UA 1ZESA 5D2CA 3UKJA 3MM4A 5IC5A 2JRLA 3OO0A 2FMFA 2P4UA 4MAAA 3RVSA 5HKOA 3LUJA 3HEBA 2E4VA 4LDZA 3O2JA 5JS2A 3H1GA 4JOQA 4ZMSA 2L17A 3R0JA 1RXEA 1JFVA 1NXPA 3H5WA 4MR7A 3GL9A 1Z26A 1DCFA 3OQMA 3GRCA 2R48A 1S8NA 1SRRA 3HUTA 4Z9BA 6CHYA 3MIZA 5CNMA 5TQ2B 4MLCA 1GLGA 3O74A 3KS9A 3HVRA 2QZJA 3M9WA 1EHCA 2PKXA 3RVNA 1QMPA 4O1HA 1XHEA 1CHNA 2HSGA 3EQ2A 1T34A 5CHYA 4IILA 4EY3A 1SD5A 4MYRA 2GX6A 2WMYA 3JPYA 5IUNC 3A0UA 1JWLA 2PUFA 3EJWA 1PHRA 3H1FA 2PUDA 2A9OA 3MQ4A 1UDRA 2AYZA 4MR7B 5PNTA 4RKQA 1YIOA 3OLVA 3SNKA 1ZDMA 1LJLA 3GWGA 4G0XA 3ILHA 2FLKA 4Q6WA 5F64A 2NZUG 1DG9A 1JBEA 1KMIY 1JH9A 1M2FA 3Q7TA 2QW1A 4JAVC 4Z4EA 1KRXA 4RU1A 3NNNA 4KPYA 1VLZA 3HV2A 1DZ3A
chains in the Genus database with same CATH superfamily
3ZGOA 4OBWA 1EVKA 5BSHA 1CT9A 1YULA 3OZVA 3OM1A 1RTTA 4PTZA 1CYDA 3GEPA 3L0IB 1ZL2A 1CUHA 1DARA 2C9MA 2GB4A 3ES9A 3H9GA 3OQJA 3ZWKA 4DYHA 5CA0F 4J1SA 3BFVA 5BR8B 1DEAA 3WIBA 5KDLA 4AFNA 1SOUA 5BVHA 4E5PA 4QRDA 3R41A 2W6CX 3LOPA 4GICA 3ECAA 5I4BA 1LTHR 1H05A 3WRYA 4TL7A 4XWYA 1CEXA 4G09A 5DPMA 3PG5A 3Q98A 4CNBA 4CW7A 4F04A 1LK0A 2AG1A 1B14A 2ZWAA 4UUAA 3JQGB 3AI1A 3DCNA 1ZD2P 4GKVA 3WMGA 3HP1A 3EHEA 2B4YA 2BMVA 2D0PB 3HYTA 1M6VB 3PUKA 4LJLA 5DEOA 4CG0A 1EP9A 3JWHA 5DX1A 1SEPA 1X6VA 4DGQA 1J24A 2EBFX 1L7BA 1RAHA 1JR6A 1PO7A 1ECLA 1U2QA 4UU8A 1OQAA 4MXDA 2BF4A 4QPZA 1S7GA 2FPMA 1UPAA 2XUQA 4ONEA 4Q1EA 4HNSA 2X6QA 1VE9A 2A92A 5BO5A 3RVLA 5ITVA 1DELA 1TQDA 2XCUA 4BGEA 1C4WA 4LQLA 5LFAA 1KZ7B 3EGCA 2VYQA 4KW7A 1DEKA 4NBTA 2GHTA 4BMVA 2BH2A 4DCSA 3A6JA 2PNFA 2XOXA 4FJ1A 3O47A 3ZNOA 1E1DA 5TARA 4RKYA 4UCWA 3PGMA 3DXYA 3TLGB 2QXYA 3NANA 3PR2B 1XQWA 1IEQA 3FYDA 4AJJA 4O0MA 1E1CA 2HNAA 2QU7A 2X2PA 3R0ZA 2O8DA 2HSWA 2A33A 1S3FA 2PUVA 4AMGA 2P9GA 3RE1A 5CXXA 3FWPA 1GKYA 3OP1A 4KR3A 4OVKA 4ZAXA 2IGTA 3B78A 1ZNWA 4G5FA 3REFA 2A14A 2W6ID 1PT5A 2O2HA 1XD9A 4M9ZA 4RW0A 2XKBA 1A8SA 3P0JA 4MDFA 2ODPA 1XO1A 4ZV9A 4F6LA 3HJNA 4FILA 3NHWA 5F51A 4B3CA 2XA2A 1V8BA 1HEUA 4ZZ0A 3DAFA 3JQ7B 4EYOA 4FJ2A 5K8CA 4LTMA 4KR2A 5EPOA 4XTRA 1GCUA 1RHUA 3OEEA 4XX1A 2Z5FA 1X7GA 1Y8RA 3U44A 2QLLA 2XWBF 1JFSA 3EEYA 5KOYA 1I3KA 5AJZA 1ZIOA 4D25A 3CHYA 5CFRA 3HXPA 1YDHA 3TX2A 4QO8A 4E03A 2ZVDA 5ECGC 2GBPA 2NYUA 4IGIA 3CVWA 3U4HA 3CR7A 1F3OA 5LDHA 2W2KB 2GZSA 3HXLA 1RR6A 1CVRA 1XALA 2O3SA 4TS4A 4LV8B 4IRXA 2ZRFA 4DVJA 2QLMA 2VR1A 4B48A 1E1QD 1FCJA 1Y3BE 2RAUA 1L1EA 3WJ2A 2LXNA 2YX1A 4RHXA 2D0OB 3ZPXA 3PX7A 4CGYA 1ZBQA 3EG9B 1JDVA 4M4SA 4NFLA 3RIMA 1E61A 1TJYA 3VQTA 3KJZA 3KLPX 3HY6A 2UZAA 1SCUB 1B1CA 3C45A 3UGKA 4CF7A 4P38A 1IY9A 4RTOA 1X7DA 4XUEA 2CFCA 1YGYA 3JALA 4RQBA 5I4KA 3Q5GA 2WIAA 4NCJA 2UZ1A 2Z2KA 4GYKA 2UYHA 5CYGA 1UXKA 1D5CA 1JHMA 3KJHA 4RA6B 1JMVA 1NWHA 1TK2A 3O03A 1A50B 3GGPA 4FKMA 1G2PA 1P62B 4TRRA 5LMCA 1FVXA 3M33A 2O2EA 4ARSA 3IURA 4P08A 1N7GA 2V4UA 1VL0A 4IHAA 3U62A 2DFLA 5A6SB 5TY0A 4PNEA 3WHIA 3ZZ0A 3SXUA 3ND5A 2QRQA 2QM0A 4GP7A 3V6MA 5G4KA 2I1LA 2I7CA 5FAKA 4HCJA 3K1AB 2I2AA 1N2XA 3DV0A 3FFTA 4UZFA 3LQFA 3WLLA 5C18A 3PSAA 4IR7A 2QRPA 2QL9A 3FLEA 5AICA 4ALNA 5SYMA 2YQ5A 4L0MA 3AIIA 1GL9B 1YB5A 1FYEA 1CUDA 1H0SA 1OAOC 3CN9A 2ZJ6A 1LK5A 2IYAA 4P3PA 5G3ZA 2EL7A 1EYZA 1ZPDA 3ILSA 3WZMA 1HTBA 5I5EA 2RHJA 1HT0A 1U28A 2A9RA 2GEJA 2XUAA 2BGJA 2BKUA 4YP0A 5FF9A 3H65A 2XXBA 5I9TA 4JKYA 5DXFA 4ZYWA 1C0PA 3A9SA 4P0QB 4AKIA 3S99A 2GF2A 4Q05A 5EMKA 3AR8A 1NA5A 1SD2A 3F4BA 3F5MA 2EFDB 3NRBA 4F7WA 4X6XA 1YZNA 2WHPA 4S2UA 5ALGA 3ND6A 5AVXA 2HWWA 1W87A 1Z39A 3ORHA 1VLJA 3VTAA 3H0KA 3KLOA 1QYWA 3C85A 4X1IA 1JECA 5IUKC 3ONWA 3P1JA 2V97A 5E1MA 4LZPA 5LZ7A 2VUTA 5FCDA 3WL3A 5JQWA 3O3MB 4KNYA 4M8IA 1DADA 3FGZA 3N2GB 3OE5A 3NZEA 5KHLB 4QDUA 1P5ZB 3PR3A 3OECA 2CHVA 3GP5A 1K7CA 1ZK2A 2I71A 2J9ZB 2OV6A 1NBWB 4M1SA 4RD1A 5H3HA 3DVQX 1N2JA 2PWYA 2AVDA 4JDPA 3UHOA 3DMNA 1JIQA 2ROQA 4YRBA 3K53A 3F6PA 1F5SA 5LLSA 4FSHA 1S02A 1I6KA 1VBMA 2E37A 2E4UA 4ZV4A 2EKLA 4LXHA 3THRA 1FMFA 4RY0A 3JARB 5SV2A 4ENSA 3VU1A 1FW6A 3EVZA 1L5HB 1U11A 3L7KA 1GUBA 4OG2A 4F92B 1UODA 4URZR 3EFBA 4KK3A 5ANRB 1XLUA 4A0QA 3VNQA 3WKAA 4C21A 7REQA 2VBIA 1RXIA 1SAYA 2JGAA 1IEXA 2WG2A 3LFTA 1VMEA 4NE7A 5CJPA 1ZIDA 2DP4E 3QRWA 2Q3JA 3T3OA 2FWBA 5I7VA 5TDHA 1HMPA 3COJA 1Q7CA 2FW9A 3IP9A 4PBSA 2AXPA 3KVNA 5AP9A 3R0VA 3V34A 2GETA 1OWOA 2IOHA 4HV4A 1NQOA 4AI6A 5JXGA 2LIVA 1YAJA 1U3DA 2F9MA 4C5BA 2ZLBA 2GEVA 1CF2O 2XE8A 1J4AA 4WLNA 2WY2D 5LKAA 5JPDA 3R44A 3MHPA 2GCNA 4GSKA 5CX1B 1TM4E 5CDFE 1S2MA 1XTJA 2H2HA 1UFQA 1WXIA 5P21A 4D9BA 1CUFA 4S12A 4RLHA 1I4DD 1II0A 3DZKA 1C7QA 3DFFA 1TJPB 3KR1A 3WGGA 3NHRA 5EJEA 5BW5A 2JBHA 5FBRB 2D2FA 4TT3A 3AH8A 2GERA 4UPDA 4GBMA 3G2JA 3WLRA 2XZLA 1MZVA 3DLHA 4UW9A 1UM9A 2BUCA 3K2QA 1J2TA 5BNZA 4CEIB 1FNCA 1VE3A 4HYYA 4XQ9A 3NWPA 4LHEA 3K8YA 1E7MA 3G2KA 2Q9AA 4XB6B 3Q41A 5KTMA 4BVEA 8ATCA 1QIFA 4OU4A 4B1FA 3OFND 3EQ7A 4D2IA 1NFFA 5D7NA 1U8UA 2XZTA 1QOPB 2VRCD 3MFQA 3GT4A 2CL7X 4PPQA 3IRUA 1QTNA 1Z08A 3ZW9A 4KDRA 4KUHA 4P93A 4G24A 1Z15A 2I99A 2BT4A 4J0KA 3COSA 1Q5PA 3KUUA 4V0RA 1RSZA 2XSZA 2O05A 4DSOA 1P81A 3EIUA 2PG3A 4AS3A 3EYAA 3VR4A 1PL6A 2YYAA 3RUAA 4FI3C 4JA2A 5K0NA 5AI9A 2AFIB 3KQPA 3U3MA 2IUEA 4M0KA 1J8YF 4P1ZA 2NTNA 5HUJA 2FQYA 2ZZKA 3DEJA 4RZ3A 1JJIA 5C1DA 4ZU1X 2QIPA 2VYFA 3OO1A 3SFVA 3O92A 1Y1PA 5CNJA 1I80A 1XROA 1USIA 3E9QA 3H5LA 1DWPA 1M1YB 2PUWA 4DZZA 1R9GA 1V9SA 4ND6A 1JKXA 4PX2A 2HMYB 5DK6A 4N76A 2WYIA 3FNGA 4JI1B 3UOAB 1CJCA 1COZA 1ZHHA 2Y68A 4HPWA 4RWZA 2ZWMA 5IW8A 3QVOA 1EFRD 5GONA 2MHCA 1X0VA 2E5WA 3FCXA 3HGMA 4HUQA 3GCZA 4JCOA 3UENA 5LZ2A 4NI5A 4F5DA 3HA7A 2P9CA 1V26A 1XVLA 2FFBA 1QFZA 1EI9A 2JA2A 4I5GA 1RIIA 2KJQA 2QAIA 4HPXB 2ODAA 1XRMA 3BM5A 4JJGA 2CFSA 1HE8B 5H81A 1SBQA 4WGFA 4XUDA 4PC2A 1JFTA 2GEBA 4ZAGA 3NV7A 1HKHA 1RS0A 4NZMA 1IVYA 2PX3A 3A37A 1X2BA 3TR6A 3GJ6A 1GT6A 3MYRA 3RQSA 2G04A 1CS0B 5I8WA 4BLSA 1IWPB 2O7QA 1LV8A 1UP7A 1R4NB 3QX3A 2DTEA 1BTOA 1KARA 2DWPA 3K15A 2IIVA 2ZREA 4DIOA 4NS1A 4NZZA 1X1TA 1ZZEA 4X8HA 4DTCA 3PEFA 4KI0A 5FWXA 2LDXA 1QR2A 2JBWA 1P1JA 5KYWA 3LX8A 4AKTA 1CPYA 3Q15C 1LDNA 1NU8A 3NTRA 5FPSA 3DEIA 3AEKA 3H9JA 3HU2A 3SHWA 3GXBA 1NM5A 5EHQA 2FPGA 1DRVA 5B2ZA 4ARZA 5BSGA 4YAUA 1NW9B 5KNBD 5EE9A 2HSJA 1LRKA 2YN2A 3QHQA 4RTNA 1V0JA 3JWJA 3LQYA 1JE0A 3I3OA 3EZYA 1HE2A 1LVUA 4J2OA 2AIRA 3LNTA 2R5FA 3FUWA 1DEOA 5DZSA 1JDBB 3QKRA 5KS2A 2O4UX 1V7ZA 2VAPA 3CF2A 4HAWA 4U2CA 421PA 3SS9X 2QSZA 1FQOA 2H1WA 3H7AA 3IVAA 4FNOA 4HX9A 4KX3A 4D4IA 1S8FA 4XVUA 5ITSA 3U4GA 4UHBA 4EJMA 2ZXEA 3I1IA 2WAYA 3NTVA 2AYXA 2WD9A 3EYWA 1P3Y1 5GWXA 3V2HA 3ZHBA 3JR3A 3K5IA 4YJ2B 2RB5A 3V3KA 1MU0A 1GA6A 2GCOB 1U63A 2ZSFA 2CHQA 2OLKA 3RCBA 3BJRA 2ZJ4A 5CP8A 3I23A 1PJ4A 1W5SA 1DUVG 1Y1RA 3CTPA 4LF9B 2GTIA 3GYGA 5IK2A 4M9RA 1P4HA 1KAMA 2WIGA 4V03A 1YMUA 1NMSA 4PY2A 5TQJA 3FOEC 2BKEA 3HU3A 5ESXA 1BQ4A 4Z4HA 4C7OB 3R76A 4WKOA 4UPEA 3U7GA 3F1LA 3N2EA 1IEWA 3IDZA 4YACA 3KKMA 4GU5A 4JI8B 3QTBA 1P2UA 4BCBA 5JI2E 1XNHA 1DAMA 3RWOA 5D1NA 5LOVB 1QP0A 2HKIA 2GPAA 3P7MA 1H65A 2ZBPA 4FPXA 3V1KA 2Q7DA 5ALOA 3NWJA 4HWPA 2Q21A 3E84A 4MKHA 5ALQA 4BS9A 2PH3A 3V32A 5EMHA 4GUAA 3HL0A 1NI4B 2G4LA 4TSFA 2V03A 1FFBA 3B6JA 1WPRA 2NNWB 1GOTA 2VKQA 3SEAA 2UZIR 4L76A 5DNWA 4MB2A 2QVLA 2MCFA 1CLEA 1T2DA 2XDQA 3LHDA 1M2JA 1YA6A 1CY6A 1W36C 1SRQA 1ZESA 1YRLA 3UGQA 2IUUA 1S89A 4AP5A 1EVJA 1H94A 1OV4A 1RYDA 1B16A 3D43A 3ZW8A 4KJXA 5IVIA 4RZQA 4DIEA 3RVSA 3SJ7A 2GRJA 3EFHA 1H3FA 2E4VA 2F90A 3DT6A 3LLMA 4G3XA 4GE3A 4BPBA 4GEKA 2CYCA 4EI7A 1UBSB 1HNXB 1EESA 1SBCA 3ROZA 3KSAC 3ZS8A 5IPFA 1G3MA 3NRJA 4XDZA 1L4GA 1V7PC 3P9ZA 1PX0A 2Y1DA 4P0TA 4BX0A 4MVJA 1TTTA 2QZ9A 1T6YA 5EOVA 4D7AA 3AI7A 3GIDA 1QV7A 4EJFA 1S5PA 3KQWA 3WY9A 2FX2A 3L7CA 4EUNA 3BB4A 3RFFA 2YY7A 4LWOA 2FSGA 2FZ4A 4EWLA 1IPEA 5KQSA 2QZ4A 2W90A 1SZDA 4C0WA 4DBVO 3F6RA 1M1UA 2VRWA 2Z04A 2JI9A 4MYDA 4ZIRB 1QH0A 4YMUA 1GSHA 1NFQA 2Q1XA 1BA3A 2ODEA 1AMNA 1SXJD 5BORA 4P7BA 1ZWKA 3JZAA 2CKDA 2DR3A 4HLUA 1VCIA 3PIIA 1EP1B 2Z4TA 1J8QA 2Q0SA 3C8DA 1D4FA 2C98A 2WAOA 3PNQA 2AKAB 2GFQA 1U80A 5B53A 1VBNA 5IDYA 2DY1A 1ZCJA 4CN9A 4RD0A 4QL3A 3T7RA 5IT9A 5MHTA 2QBYB 1DLJA 1O77A 1Z5PA 4NE2A 3ANTA 4GLLA 1UOEA 3JQGA 4N65A 4AP6A 3NNNA 2IZOA 3WLHA 3IOBA 2P62A 4DN6A 1M6VA 2JNWA 1SKAA 1ZM7A 2H5EA 2R87A 1QPBA 3HJGA 2JATA 4MHOA 5CUQA 3VNBA 3COWA 1HFJA 1V71A 4DIFA 3O8QB 4DILA 4QICA 4LHZA 5C4GB 3DLCA 3U5ZB 1FXSA 2R62A 3AO0B 1V2HE 3AERA 1VIAA 2WJAA 4R1OA 5JW6A 1RJDA 2REXB 4BMCA 2DFDA 3J7AC 3I37X 1IVNA 5A0FA 2OQ2A 2HMSA 2HHLA 3FHLA 3V46A 1J22A 1WE2A 1TCBA 1Z37A 2OBLA 3D6VA 1DT3A 4U02A 3D64A 2WJGA 4MO9A 3ZBQA 2VXCA 4X1YB 3ZE7A 4MUBA 2R5NA 1ZCFA 2XD4A 1XVAA 2ZI3A 4F0JA 3KLMX 3L07A 4GMXA 1SBNE 3TLGA 3ROQA 1WQ3A 1FTQA 1YMVA 2YHSA 3HCCA 4GSLA 5C53B 3LZCA 2H4YA 3LRPA 3ZV6A 5B6IA 4EFLA 1U5AA 2LKDA 1RJ9A 1Z13A 2GJSA 2ZBVA 4M7PA 3C3CA 2VAXA 1CP3A 3QEJA 3B3AA 1F8YA 1T2CA 4TROA 5BQOA 1CIPA 3LGXA 1SG9A 4LHYA 3TTWA 1ZU4A 3CF6R 4TYPA 3ZNQA 4DRXB 1N7IA 3NGLA 3R7AA 3HEMA 1BS1A 2WM9B 1CX9B 2GBFA 4E7OA 3BIXA 3KEQA 3Q3VA 2AMYA 4FS8A 4PPYA 1XJ0A 4FFPA 5AFSA 1UBFA 4RD4A 3BRWD 3C6QA 1QE3A 1PR4A 4HAVA 2UYCA 4ZJZA 1KOFA 1E7RA 1YE8A 4M0UA 1P31A 1REQB 1CY0A 3JQ7A 4MV0A 621PA 1JIXA 1VG0B 4XR9A 2YWJA 1BJKA 2V9PA 3C4QA 1E0AA 1W4CA 4W8HA 2WQ7A 1CDOA 3E15A 4Z1MA 3L93A 1D7AA 3RYTC 1E5QA 2RI6A 1TKRA 5GPBA 1F0YA 1KDTA 1G5HA 2IYRA 3RASA 1ZVMA 5HTKA 3WBKA 3GFSA 1NQUA 2VDMB 1ARZA 4X8OA 3JQPA 2ZIAA 3OKPA 4KXMA 5BRJA 2WAAA 1IN8A 1D8TA 1V8OA 2XHZA 4YLGA 1RCUA 3WGVA 1VHWA 2W2KA 2MWMA 3WJAA 1FS4A 1TQ8A 1G7RA 1HLDA 2J6IA 2KSQA 4LWPA 2C1XA 2CEAA 4B84A 1P9NA 4EVRA 1R5BA 1X70A 4RSHA 4NH4A 5AKKA 1ABEA 2HPAA 2X9GA 2PN1A 4MAFA 1UC4B 4MPJA 4MWZA 3RSQA 1MX9A 1UPFA 3D6FA 3S1AB 4I19A 2R84A 1ODJA 4MRPA 1SCUA 2JDIA 3R7WB 4FYHA 1QVZA 2CBGA 4V38A 3B52X 4ZO4A 4ZALA 4CI0B 3A6ZA 1OXUA 3ND9A 1XR3A 1Z82A 4IIVA 1HT3A 4HGQA 4M37A 2Y2VA 5B3AA 3WK4A 3WYEA 5KTRA 4RA6A 2QX7A 4D8XA 5CD9A 2AS0A 3V55A 5GZ1A 2XB2A 2C5EA 3GPBA 4GD3Q 2ZAMA 4IHKA 2OBBA 4ILEA 3X2FA 4EZIA 3L0OA 4R51A 2IOFA 3PC8C 5C8VA 5A6SA 5HEKA 3UK7A 1H9BA 1PFVA 1RXSA 1RZ3A 1N8NA 3I9FA 3L01A 5K05A 3DD1A 1K1EA 1RPZA 2ZE6A 1P9RA 3HNRA 3RADC 3K1AA 3KOXA 1MBZA 3VM6A 1D2AA 2IZ7A 5AVVA 2F67A 2H0AA 4G5GA 3DLIA 3UJNA 3U1VA 4I4TF 3BMNA 1ENYA 1U6JA 1OD6A 4OL0A 4CGZA 1ZMXA 4TUYB 4PNHA 3R3HA 2X5XA 3MTQA 3EQ6A 1HNWB 1X8KA 2GVDC 2XITA 3GUYA 4UDNA 3TQTA 3HTXA 1DXYA 1KFJB 3CA8A 4Y2JA 1UXJA 3V42A 3KWMA 2BFCB 3TZCA 2BBTA 5E0OA 5B58C 2FR8A 1NNUA 2LW7A 5KVQA 1PZHA 5BWNA 1F20A 4JBXA 3DMTC 2ZW9A 4G8BA 1TC1A 2FZLA 4TS1A 3VR2A 2G88A 2V58A 2JANA 4LCJA 4YDRA 4LYJA 1SY7A 4ACAA 2B8EA 2IYEA 2JIDA 2QYHA 3AP3A 4PAQA 4RKFA 4JHXA 3D54D 4ZQIA 5E2AA 3SJUA 3UPDA 1D0SA 1C3XA 2OUKA 3C3MA 1NXSA 1YZVA 3G8YA 5ESRA 4IFEA 4BB5A 2NO1A 3CG0A 4BC1A 2JAPA 4DQUA 1CLUA 2FZGA 1NFRA 4GOLD 2B8TA 4QT0A 1YBAA 3OCCA 3RNLA 4CODB 4GECA 1QLJA 3LU1A 4Y2HA 1U0HC 4YP6A 2AOUA 3FPAA 4UU7A 2C4HA 3LZDA 1N9ZA 3CKKA 5CM8B 3N2GA 1EX6A 3E7DA 2NVBA 5FBHA 5JE8A 3SHQA 2ZRBA 3UICA 1BDBA 4RENA 5B3JA 4OLHA 2X0RA 4MGIR 5IJ9B 4X44A 4HWOA 5DN6D 1ZRSA 1QZXA 2J41A 4OFWA 4PLHA 3BTSA 5BQ5A 1Z73A 3ZLTA 1TW3A 5CB0A 2GZMA 2QUBA 4EG4A 4ZI2A 5IEJA 5A9RA 1Q16A 3CXRA 2E87A 2EF1A 2YDXA 1PJLA 2E49A 4D6XA 1BE8A 3SX4A 1XLTA 3P0RA 3B12A 1BX1A 1ILWA 2JGJA 3F6BX 3R3YA 4MW4A 4P5PA 3VR5D 3WSTA 3ELBA 3ADKA 3CT4A 4LGCA 4TYWA 2FEWB 4IV0A 3KP1A 2ZROA 4KYIB 1C3EA 1R0YA 1VCHA 2FPUA 4WXYB 3SIPA 3ZXYA 1L7RA 1Q6YA 2QSYA 4YEDA 1TQ4A 2VK4A 1AGYA 3I04A 5E2IA 4B5KA 4DR5B 1DHRA 3FNFA 4PYMA 4JP3A 3IAM6 4JV5B 4WCVA 4XSGA 3ONVA 1IY2A 1UBLS 2YOGA 3I1YA 1G8YA 4D42A 3ZQJA 121PA 2FK7A 3LUBA 4RCYA 3TCNA 4JS0A 3P2EA 5JY1A 1E4OA 3R9XA 3AEZA 1YZ3A 3O4JA 3ULKA 5I7OA 4R1QA 1OC4A 4YH1A 5DHPA 3JS5A 2JS7A 1KJNA 4I0WB 1EPUA 4EJ6A 1Z6XA 1LTKA 1EBFA 3QLUA 4JOBA 3RVKA 2ZTUA 3UCEA 4LJRA 3EC1A 4OFXA 1ZSYA 4IRUB 3M2PA 1QP7A 1R6TA 2WM3A 3WOVA 2NSHA 4IBOA 5ERYA 5H1YA 5A5FA 4LZLA 2BEWB 1MQAA 3I9LA 5CVCA 3I0NA 2YFKA 1RI5A 1Y9EA 5FJIA 1TU4A 3UAVA 3V7FA 3JRWA 3WLQA 1CY2A 1FFWA 4UVHA 4ENUA 1X3SA 3HUUA 3BXPA 3HO1A 2MTBA 1E7SA 4YPFA 4KAXA 4MUAA 4W9NA 5CGQB 1LDMA 4NDNE 5LMZA 2CF5A 1I7DA 5FUBA 4EB8A 1XFDA 2WKPA 4HDKA 2XDWA 3P94A 2D2IA 4JU9A 3L4KA 4CEIA 1OKKA 1KYZA 1HRKA 1U7XA 2VPIA 3AFOA 3UJPA 3WKBA 2TRSB 3OLZA 4O8ZA 3EDRA 1S96A 1IAVA 2O2SA 4MQUA 4D0RA 1I0ZA 1VYUA 2WB2A 1WETA 2Q1SA 2VHJA 4I2NA 2JI8A 1JRLA 3C1OA 3S5UA 5DWVA 3TQFA 4ZYVA 2JJ2A 4Q9NA 1Y3IA 3W1EA 4QFBA 2J9XB 1FS5A 2VTEA 4RYLA 4HH0A 3HVUA 3KEGA 4EW6A 3WMWA 2L69A 3ZY3A 1J99A 3R0IA 4O25A 4E3WA 5KEIA 1R50A 1MH1A 3QE3A 3DV9A 3CVJA 3Q7PA 2D8MA 5CA1F 3T9CA 3U9SA 2Q4TA 5FPQA 4CJXA 3R6TA 2J6CA 4F2WA 5CCEA 2AFIA 2VT6A 2QDXA 1R9JA 3P71T 1SKYE 4U7HA 3TLYA 3CLVA 1LNQA 4DCNA 2CXXA 4N49A 4Y2VA 2HZBA 3SIWA 3Q3CA 5JMPA 4DDMA 1P5RA 1XE3A 3ITNA 4GQBA 3KFVA 3V8PA 1EA7A 2FX5A 3DL4A 1M1YA 3B1FA 5CG1A 3D3QA 2DERA 4PYRA 4G4SP 5KJEA 1NQTA 1QFXA 1Y8QA 2R751 3FMVA 4G0NA 4PRYA 4QPCA 1EM6A 2WIFA 4WZBB 2UUBB 2XY4A 4Y30A 3C7AA 3W5JA 3ABZA 3NFYA 1G41A 2BFBA 3IQFA 4UUPA 5IH3A 4CQNA 5LVAA 2JAHA 1HQCA 3PENA 2UDPA 2GF9A 4JJEA 4WXRA 2FWRA 5EE3A 1T4BA 3P0IA 5F4BA 3H1TA 1JEDA 4R7TA 2FX3A 4K40A 3KZCA 2H7CA 2XXAB 5J59A 1SH7A 2FEKA 1T3HA 2H0QA 3I8OA 2H59A 4LX0A 3EC2A 5DGHA 2X5NA 3EASA 4B4WA 4EGAA 5HQ3B 3ZH9B 3DBHB 3LA6A 1P77A 2Q4OA 1BE1A 1PJ3A 1JDNA 4C3VA 5K7SA 4W5QA 4A6DA 1FRVA 1DPGA 1KH2A 1KJ8A 3NAGA 4H4CA 4NU0A 4EGSA 4MYTA 1CS0A 2RG1A 1JZSA 3SPXA 1EDEA 2Q3LA 1C1YA 2JAQA 1R4NA 4MIYA 3KXIA 3FOZA 3WLEA 3W9SA 2YDYA 4RV4A 4UHFA 4X84A 4XX0A 5CH3A 3HEAA 1Y3FE 3NH6A 2HIAA 2P6PA 1UKVY 3BL5A 3HY4A 4N0DA 5TPWB 4S04A 1TCVA 2Y0DA 3I8XA 5DHQA 4JWTA 4FMDB 1CEYA 2GM9A 4EJSB 3EPKA 1RM0A 1UWLA 2JFXA 5ENZA 2C8LA 2ZULA 4GI1A 3K09A 3X0DA 3C6YA 4DSUA 3UH1A 5IKMA 5KNDH 1JVNA 1FVFA 1TUBB 4F12A 1WMDA 1U3GA 2YZ2A 2Q28A 5LYJF 2VP3A 3PNSA 2ZIEA 4K9NA 4M1ZA 4B8ZA 3A6DA 3LQ4A 2RHTA 3COVA 1A3CA 3N8NA 3UUWA 1UT5A 5D86A 5C5EA 1WDKA 4V3BA 3A9WA 4P36A 1GUDA 3EIEA 4KGDA 1G8SA 3TFQA 1LDGA 2V7UA 1E2FA 3MLBA 4IW3B 4URYR 3WV4A 4D9JA 2OXIA 4UBLA 1RWQA 3QELB 1ONOA 4ZI7F 3ZWVA 5EJ5A 3SVZA 5JXIA 4YJ2A 1NN3A 1Z3IX 2GCOA 1WUKS 2N75A 2ZI4A 3AGQA 3Q12A 4G1UC 4P33A 3ZG6A 3L7NA 3NBQA 2VSXA 5JRZA 3TVYA 4IZOA 3N6VA 3E1SA 1VKHA 4R05A 1ESZA 4HJXA 2OCPA 3TKAA 1LEHA 1YR8A 2C83A 2CKMA 3FVRA 1GUFA 2JKYA 4C7OA 4PS0A 4RTMA 1GG9A 2WYHA 2W43A 4WCFB 1L5YA 2BBWA 4ZYTA 3I8SA 3MWEB 2MYNA 3PQDA 3OICA 4MUJA 5ELLA 5LOVA 4GI5A 4BLTA 1Z2OX 3DJFA 2OENG 3EGWA 1SZPA 2H4FA 3RS4A 1OU4A 4DDTA 2SKEA 2DSTA 3DE4X 2XAUA 1RT9A 4XVCA 2YN4A 2WLSA 4IFIA 1NI4A 5BRNA 4D56A 4UHDA 3ESRA 4RM3A 1SU7A 4W5TA 1SMKA 1QIMA 1FDRA 3DHWC 1NAHA 2W6JA 3FLBA 1VSVA 3GT0A 3NEPX 4B74A 4D74A 1L8OA 2W2PA 2MU1A 4J43A 2YQ4A 3GK3A 3L6BA 2GTHA 4UBKA 5BYAA 1OT3A 1PJZA 2QD3A 1G21E 3VR0A 3KKNA 3L8MA 3ZLUA 4L0DA 2HPHA 1HGXA 1RYNA 1HX7A 1IXRC 1JGTA 1D2HA 1XCOA 2AUTA 3IUPA 3LDUA 4TKVB 4HNGA 3FRIA 5G0VA 4UE6A 1XEXA 1JEAA 2BZSA 3N0VA 4I4IA 4LS3A 4QGHA 4ZGBA 3KD3A 4H0NA 4D0GA 4DCVA 2C8VA 3FCSB 2DR0A 4F5WA 2EGGA 1DAGA 1SVIA 3AKDA 4UTZA 3G7SA 4JEHA 4PZAA 3IIJA 1GILA 1DG1G 1NN1A 1ISSA 3CUEF 1MJNA 3JQCA 3KKKA 4GXNA 4JSTA 4GL4A 1JUDA 5COAA 3GRFA 5F52A 3EBPA 5CDHA 5FOSA 3SYNA 1XTRA 2P1ZA 2IEYA 2CXNA 3B6IA 4X7MA 4O29A 5KYVA 5IVPA 4G0OA 1ULZA 1DJNA 3QF4A 4NG5A 2YH2A 2YICA 3UFXB 4DCOA 1J9EA 2XPCA 3HWRA 3FWKA 3G59A 1C30B 1CF9A 4G26A 2OAP1 5D51S 4BKPA 4FEGA 3TLEA 2WFZA 2ZRCA 4J3JA 3USES 3LNCA 2X4IA 4COOA 4QTYA 3ROXA 3T9FA 3BOSA 5K0CA 4RIGA 4TKMA 1HFEL 1TTPB 5F7ZA 5C5DA 2R48A 1HQDA 1BX0A 3WLJA 2QE6A 4Q9JA 1O95C 1L8LA 1GPJA 3DDZX 2ONJA 2OC4A 1V25A 4CMBA 2EZ9A 1NZJA 1WUHS 4CLOB 1GYQA 3Q3HA 4O2RA 4EF5A 3OSZA 5ALNA 3B38A 3AI3A 5BMOA 1XTSA 1Z74A 5KJCA 2AEEA 4ND8B 1MVLA 2HWKA 3ZXSA 1E2DA 5FH9A 2F3SA 1P74A 3NBFA 3NBKA 4QSMA 4ACBA 5B6PA 3I6BA 2C7PA 4LF8B 3AJ9A 1PLLA 2O2XA 1I3LA 1N1GA 1T2EA 3WL6A 3ZBPA 3RS8A 3ET5A 4I4NA 4YMSA 4B7XA 2QRJA 2EZ8A 1R4MA 1SQ0A 4J03A 4L02A 4DV0B 2W2VA 3DDUA 2ZRDA 1AKTA 3OPNA 1YS1X 3OTIA 3WICA 3ZWWA 1NUHA 5MGBA 1LJLA 4JJIA 3HQ4O 4G0XA 1JP7A 2JJQA 2FLKA 2O2CA 3A28A 2NZUG 2VAMA 2W6NA 4K28A 4ZT5A 3RRXA 5IZCC 3PA6A 4YRFA 3SEQA 4HY3A 1F3LA 1I7QB 1GNTA 2YXPX 4OHPA 4ZEWA 1ZG3A 1PZNA 2YHUA 4PWZA 1CY4A 5K5EA 1G5QA 4I14A 4WK2B 4R0NA 2X6RA 4EHDA 5KYNA 1B00A 1LUAA 1OA0A 1QGYA 1T8UA 2G0TA 2R6GA 2YFYA 4I5FA 4D5GA 4DRXA 1QVWA 2G6TA 3DBOB 2Y99A 5ECYA 1CUEA 1JYEA 1NJ6A 3E3MA 3L3BA 3OMWA 4BCCA 1DP4A 4IUCS 3G2IA 3QUQA 3QKWA 1R5OA 2H0RA 1JPJA 3HI4A 3N0XA 4RD6A 2BEJA 2IH5A 5SZIA 4NXNB 2XADA 1QO0A 4QLAA 1GNPA 3EQ9A 1BVUA 3R0QA 4M0FA 3U3ZA 1HQKA 3F90A 1EFDN 3G1UA 5JISA 1JJ7A 1GRNA 2AYYA 2FN9A 1L7OA 2O7NA 3DZHA 3H2SA 3KPJA 2PT7A 4WOBA 3VJKA 3JYQA 3LCVB 1U7OA 4QQ8A 1FLAA 1NQXA 2FVYA 4GOJA 2H5IA 5AJXA 2BW0A 1COWA 1O6CA 1W4AA 2OYSA 1KIAA 1RPAA 1Q0LA 1CRLA 1Y6RA 1Y42X 2PIDA 3OZIA 4U3JA 2BGTA 1QCZA 3A1TA 4X65B 1H9AA 3F49S 1QUFA 5BMVB 1MAHA 2HMWA 1T5HX 4JUDX 2DJIA 4PSVA 2X1VA 3D6NB 2FMXA 4MQ4A 3P2KA 3RBVA 4MDEA 3KFLA 1RYBA 2RE8A 2J32A 4LXXA 1O94C 3OESA 1QHEA 4PQEA 4UUNA 5GJCA 5HMLA 3VZSA 4L73A 3GRYA 3BMQB 5TPZA 4F2DA 3QVMA 1XRPA 4MV3A 5NLLA 4DZRA 3DNFA 4E6EA 3PHCA 1NC3A 4DWWA 1E3QA 4OSPA 4RDCA 4RFLA 1L5RA 4D3DA 5BT9A 2I2BA 3STVA 2H9IA 4DNOA 5CXUA 1IHUA 4I7EA 2CNNA 1NV8A 2RH5A 4L28A 4EQ6B 4BLRA 3VPFA 3I53A 3IVCA 1TC2A 1WS6A 2RJ3A 2E0IA 5FBLB 4K6KA 1DTEA 4HAXA 1AVTA 3E22A 2HRDA 4RXUA 5FBWB 3CNNA 3U3JA 3ZOZA 3N76A 1T2UA 3FMPB 4RETA 5KPJA 4X85A 1WHSB 4H7HA 1N6IA 2P8SA 3BWEA 3WRXA 4LF5B 4LFBB 2XYQA 3U1BA 3DZ8A 1XB2A 4YYZA 3OX3A 3D1LA 3EXFB 3NORA 4DABA 1TU3A 3HCWA 2YWBA 3KB6A 5AVSA 1R1DA 1V11B 1GZ7A 1NBMA 3SZOA 3GXOA 1IHOA 4XOIA 1GUAA 4DXHA 4EAQA 3KSMA 5IRCD 2CSUA 3QTLA 1C7EA 4GYYA 1PUJA 3CNLA 5JAPA 3NI2A 4DY6A 4YALA 3BWYA 3GUVA 3P27A 4KK4A 1I4TD 4OYLA 3MS4A 3PFKA 4N01A 4QFCA 5AVTA 3NV9A 1AQYA 2GUWA 3GMTA 2GILA 3H5RA 2ZIGA 1FL9A 3OQHA 4EUKA 2F1RA 3MD0A 1G6HA 1ZD3A 4TZ0A 4ES6A 2J59A 1Z7WA 3K73O 2PWAA 5AI6A 5JH7F 1RHQA 3F5SA 4DR7B 4N41A 2F1JA 1FP4B 1MX1A 5HKBA 2NZVG 1KK3A 2NU7B 2PA3A 1WZEA 1R10A 2W2OA 4IKPA 4RF2A 4Y2TA 4F4DA 2IP1A 4A91A 1P2SA 2IHKA 3I4LA 3OZUA 1A9ZA 4NYMQ 5EERA 2HCFA 1VJDA 4PPGA 5COBA 3VVBA 2WSMA 2XTNA 2PT6A 3D6MA 4IHJA 4WCDA 5BUCA 5L9AA 3UJDA 2ERYA 3D6UA 1XCBA 5DO9A 4KFSA 6NULA 5D85A 1T5OA 2OCLA 4N0EA 1CW2B 4L72A 2WUFA 1U0JA 2EIHA 2B1GA 1F8UA 3OEWA 3TTSA 3V8QA 2BMAA 3GY0A 4FYVA 3TSYA 1R0RE 1QB8A 2PX5A 3JWEA 3DMDA 1N5LA 3W4KA 5JAHA 1Y5IA 2A9VA 4EP1A 2V4ZA 5IJ9A 2FRDC 4MGZR 1M5TA 1KOGA 2C2YA 4M38A 3PDHA 3Q1KA 2PPVA 5F9MA 3UK2A 3X1JA 3E81A 4GT1A 4TZKA 1P0IA 1TJ3A 5K3EA 3LUAA 2P2LA 2CJXA 3D6HA 5AXAA 3RG2A 4O4HF 5LXTA 2CFOA 4BBAA 1E3JA 5FUXA 3E7XA 1ORVA 3URMA 4NECA 4TV9A 3AYZB 2VXOA 4K0KB 3A7EA 1MPXA 1WJGA 3PHHA 4CIDA 2R1VB 1D4AA 1WPQA 4HI0E 4G07A 1VA5A 4UQLA 3DTVD 3GYBA 1ST3A 5D00A 3W5IA 4PN3A 4MVCA 3UMFA 3HCRA 4KE7A 3QX8A 3M0EA 3NIBA 1H9CA 4HMPA 1KYQA 2HK6A 3EPPA 1WXGA 2NXWA 4AULA 1TF7A 2E1PA 4DBLC 4KQMA 4QARA 4P22A 2B6HA 3PFNA 3OOEA 2OL4A 2QMEA 3OQBA 4IIFA 2AKYA 2FQQA 3ELWA 3B70A 1SUAA 4Q1AA 5IS2A 1ZC4A 3CVYA 3STYA 3HHPA 1HDYA 1RXYA 3CIFA 4GW3A 3HU5A 5DB4A 1L1FA 1DV1A 2CE2X 4AS2A 2JLVA 3AVUA 1OX5A 1Z06A 4IIHA 5HIMA 4Q3NA 4PX3A 1XCPA 3GFFA 1T8SA 1VHDA 3IMGA 3HDJA 4YC7A 5JNUA 2P6UA 1E9FA 4E94A 5ICFA 1AHPA 3WGNA 1YFZA 4R83A 4L6CA 2XKKA 2EIXA 4DVGA 4PGFA 1WKBA 2LZ0A 4PW0A 3IUMA 3RDPA 1TZJA 2ORWA 4UVIA 1ZOSA 1XKXA 5JV5A 1KKLA 4IEIA 2B37A 2B3DA 3I5MA 2BKAA 5IKEA 3DMRA 3KG2A 1ZA2A 3B9BA 4RE5A 3WO1A 5BY2A 4DEVA 3CZ9A 1T2VA 1H8HA 1SVOA 1VJCA 2WV9A 1IQPA 4GPD1 1RWOA 3OPYB 2P5UA 1PW5A 5EMLA 1K5HA 2XRYA 1KQ3A 2I7VA 3DOUA 3H11B 2NV0A 1WZUA 3LF1A 5EHZA 1W52X 1W5TA 4IKEA 4JK3A 4KMMA 3T5PA 2R8ZA 1NBHA 5AK0A 3W2HA 4DPKA 4BX9A 1KO1A 4MKZA 1NUAA 4KNVA 2W00A 2ZKLA 4QQNA 3K9FC 1Z68A 5JSYA 5I9IA 1AO0A 1SUCA 3ZGVA 3ZHVA 2GAOA 2P91A 5EL0A 1L4LA 2ZUBA 3MJRA 4GC5A 4J7XA 2F00A 3KJIA 4BCDA 4PHGA 2WV7A 4O5AA 3SSAA 1USWA 2BSQA 5JJIA 3PHGA 3D4LA 2G5TA 4Z6KA 1SXIA 1RE0A 1A9QA 4DLNA 5IABA 2JLWA 1KEEB 1MRNA 4ME6A 4LV5B 3VDXA 3TXYA 1A8HA 1E1RD 2HWXA 4MV1A 1DOHA 1XA3A 2WICA 3F7MA 4L15A 3VR6A 3ZUGA 2VT7A 5E9JA 3U37A 2YVQA 5FI5A 4A4DA 1JHAA 1EK5A 2FXIA 2WFLB 4ZVLA 5LJLA 1S4QA 4YPOA 2XXJA 4TYQA 1IY8A 1JTFA 1B1AA 4WZBA 2NW6A 4JLAA 4IGKA 2PV7A 2XBLA 3WWEA 2QROA 5FAXA 4CL0A 1M3SA 1ZOOA 2WU0A 5CLFA 1CUXA 1NURA 1MOSA 3TOCA 2H17A 3H1AA 1M2OA 3QHAA 1CZUA 5LB4A 4I4CA 4BNKA 4JELA 3ZQKA 5ENDA 5TQ2A 1KZGB 2WU3A 2BM8A 2O1EA 2W4QA 4FOSA 2H85A 4LRYA 4IICA 3TTTA 5KTTA 1LX6A 3Q7EA 4G84A 4LY0A 1XMIA 4QBTA 4WDRA 3U31A 2O8EA 3DBHA 4S24A 4TQUS 3Q40A 2C9BA 3S8EA 3RPEA 2R4TA 4KH1A 3GJ7A 1TZCA 4PQGA 4P3KA 5KVCA 2Q3BA 2PZEA 2HQBA 4RJ2A 5HGJA 4GZLA 2C61A 3AK4A 1KO4A 3G6WA 2EKPA 1XCGB 4GGOA 4XGKA 1ZR2A 2Q62A 1VLLA 1TPZA 2Q3HA 1AKUA 1OTHA 2AF4C 2AFHE 4W99A 2JCBA 2MYTA 3AFGA 5TPWA 2YWCA 5IMSA 4QHTA 3R5HA 2XVXA 2FMHA 4TMXA 2EKZA 1KDZA 4QEKA 2H1SA 2ZPTX 3V33A 3FCEA 1CXZA 1U4OA 2WD8A 1TUBA 4CCYB 1KAQA 2H2GA 4OJMX 2C9YA 2QA5A 3B5IA 1JLLB 4NULA 1V3QE 4N03A 4X24A 1RQ7A 4KR9A 3RK4A 4BX3A 5KYGA 3Q9LA 3FVQA 2FCRA 2FETA 2IS1A 5LDGA 1JAHA 3JQ9A 1OILA 2GBLA 2OSBA 1P5FA 5DYGA 5KMGB 1P1CA 3B1WA 1Q22A 1GGEA 2NTVA 1OLSB 1A1VA 4RQTA 4HRVA 1KSHA 4UVGA 3ZTYA 3PR1A 5ICEA 3H4TA 2EGHA 3UXEA 4CYMA 1ADCA 3L8GA 5DM4A 3WA7A 3M81A 2SECE 3U3OA 4ZDIA 1CETA 2WA1A 4HDSB 5FUVA 1KMMA 3K1YA 3NX4A 2OV2A 5BSTA 1H66A 1LKZA 4GYJA 3SFTA 5AKYA 3ND8A 5IH7A 4ZPXA 4QYTA 1JLRA 4RNCA 4B4OA 3RJMA 4MQMA 2OFXA 1SBYA 4MUMA 4ASUD 1E2KA 1E6WA 2TMDA 3DPSA 3LAWA 1PBNA 3WLPA 5EHXA 1V3TA 1EUZA 3DEZA 3DW1X 5FFNA 1ISMA 1GQQA 1T5LA 1BVRA 1EJ6A 3GJTA 2FJ0A 4UNSA 3VHXB 3GX1A 4RPGA 2DPXA 4KQ1A 4WUTA 4G0MA 2POCA 4YQYA 1L6RA 5JMOA 3DDHA 4M1EA 4GZMA 1E2UA 4RIEA 3VTFA 3K94A 4DG9A 3DTNA 5ITZB 1QRUA 2JH3A 3N2KB 3CRW1 5BWMA 5AQ1A 5IWAB 4P6VF 4RSRA 1GCIA 2WHRA 1B8VA 1F17A 1IG3A 1PZXA 3CZAA 4Y1FA 2AG6A 4IRMA 3R6WA 4MWCA 4XM2A 4XM1A 3PK0A 4F2PA 3LO8A 5JS7A 5KINB 3MZ0A 4W4TA 5FWYB 5A2GA 4M53A 2A0XA 3NAMA 4F60A 1A7UA 4Q18A 1L4BA 1SWWA 4I08A 3ZHSA 1ZICA 4G0YA 4RAOA 2CCKA 3E2PA 3C3DA 4JBIA 4FE4A 5DBHX 1PUXA 3G89A 3HHEA 4TWJA 1TGYA 1ZD5A 3W04A 3T1QA 3W2EA 4Q4AA 1N5IA 2Q5CA 5EESA 5CMLA 4F46A 3SD7A 5CK4A 1JDTA 1ZAYA 1ZIXA 5JAOA 1EMDA 2J9RA 2QGNA 1U6IA 3G0DA 1P7WA 4PAOA 2HU5A 1JA9A 1PI3A 1YJAA 3GG2A 4LUCA 1N2GA 3WLOA 2BGUA 4BB0A 2ANBA 5IUJC 2A4MA 2ADOA 3IFSA 4NK4A 5CJ2A 1I01A 4MMYB 5AJTA 1J1ZA 4O2AB 4N5IX 1L2TA 2EZ4A 2VYCA 3MJVA 4PHTA 3SKYA 2IL1A 2DG2A 2WJ3A 5IEBA 3CISA 5L4LA 1XLVA 2UUCB 2AMFA 4AMVA 3STTA 2CJWB 3IAAA 4BO2A 2EJTA 1FDSA 5DCLA 3H05A 1E99A 1KH3A 2DJ5A 3OY2A 1LFAA 4Z99A 2PKWA 3IERA 3UFXA 4H16A 2HXYA 2WMDA 4COKA 4NABA 3N3AC 2EP8A 3FOBA 3RU2A 1C30A 1L5OA 2QJWA 3FPGA 5IKPA 1AQJA 3THWB 2JJ1A 1RPTA 3EIXA 2I7XA 2PZMA 2WILA 4OMCA 2GD2A 4IDAA 4L27A 5BSKA 1EM8B 4UPVA 4IXNA 1HLFA 2NTJA 3H9EO 3QXJA 3UWPA 4NJMB 4EKEA 5ICMA 4FZVA 3WGUA 4JNCA 4CLRB 2AA3A 4ZVKA 1QNFA 4KN6A 4KN8A 2XOKA 3QX7A 2R1UA 1BRMA 4AVYA 3SSOA 1FP1D 1WW3A 1YZYA 1YCDA 1J42A 3H0CA 1YC5A 3PCRB 4CLOA 4GRDA 1T9AA 1DO0A 4L5YA 3ENNA 3RANA 3WKEA 2Q9BA 1Z2NX 4XB1A 3V8EA 1A4RA 3EIQA 2QTLA 1BD4A 1YVEI 3PQ6A 4XRRA 4YI3A 1EFLA 4K88A 2RBEA 5HKOA 3IA2A 2YTZA 4PBRA 2HRRA 4LDZA 4FHDA 4YPVA 1MP0A 1QRDA 1CRZA 1P1KA 2H92A 4M0EA 3FUUA 1RXEA 4QATA 2R8XA 4WFIA 5K3CA 2IV2X 3TEFA 3EXHA 2CLKB 2IZ6A 3WLSA 2BJWA 2JFNA 5AO9A 3BL6A 5IP5A 1P1FA 1T1IA 3PYMA 3EXEB 5CX4A 1ZOLA 4UJ5A 1HG0A 3PYLA 3VVMA 5T6BA 4YUXA 5IT4A 1B23P 1JKIA 4KN5A 3SF0A 4RL6A 1IBMB 4R2JA 4FNGA 3OPVA 5EHIA 3WWDA 2BGRA 2PA0A 4UATA 1BQEA 4J0EA 2BSAA 3PDJA 4UXJA 5HHTA 1SCIA 1CHNA 2PRSA 4RULA 3C14C 3VSAA 4BB6A 3DPIA 1QHSA 2WHYA 3H83A 3LT4A 1MXFA 4ZHSA 3PL5A 1TIBA 1G18A 2OV1A 1RXCA 3C0KA 3LX4A 1Z5VA 2Y92A 4QRIA 5EFOA 3K6SB 2D4HA 2EJCA 2IELA 4OXRA 3MJEA 3KSZO 1MJFA 1MX3A 2GZDA 2LRHA 2RHHA 2Y6VA 1QS0A 5A4FS 2IDJA 3PFBA 1GD1O 2C00A 2VDKB 4WASA 3V4LA 2RHGB 1EXVA 3EZ9A 4F4UA 4V24A 3GEDA 4EW1A 2R5WA 1ZEMA 4B82A 3FUVA 5THKA 3TM4A 5CDFA 4FJ0A 2WP8J 2B4TO 4Z4EA 2ZWVA 4I9GA 1EGAA 3PDIB 5KNCA 3ROPA 1VLZA 2X7JA 1N2SA 1RIFA 3BKXA 4AUMA 1JJAA 4K9OA 4WERA 4BC0A 5B4VA 4TKUA 4XCQA 3VSDA 2GK4A 2JZNA 4P7KA 2OZEA 3RUCA 5BMVA 2GI4A 2X0KA 3TTUA 2G5GX 2FN7A 1X9IA 4GX1A 4BIMA 1WHTB 4EX7A 4TWAA 4HH4A 3CNOA 3NDIA 1NPDA 1ISJA 1UMCB 3D2AA 3K0HA 1KIFA 3PHLA 3BMQA 1QTQA 4O4JF 3KC2A 4LRWA 3EVCA 4XIGS 4M9UA 1NNEA 4PHFA 4B3GA 2YW9A 1Q19A 3P2YA 5DASA 4WT7A 4F1KA 2FSVA 1WY7A 1J0XO 4EQ6A 3RHZA 2K2QB 2VNHA 4IKOA 3UXMA 4O8CA 2OGUA 4XYGA 4H08A 2LD4A 4JKIA 4DTIA 3GGDA 1NVTA 3O8OA 3QLVC 4OGWA 2DUUA 4HO1X 2DBRA 2VJPA 3AG6A 1HA3A 1YS9A 4NC9A 1BEZA 3GBPA 1OTYA 1K0FA 3O0TA 4XYBA 2HLHA 1PGPA 5EMMA 5F2KA 1WHSA 3DF7A 3QLJA 2CVQA 1JA1A 2F9FA 1KDPA 3V48A 3EXFA 4XDHA 2GAFA 1VP9A 3LBYA 4X7PA 4Z54A 1V11A 3S55A 4CXMA 5EMNA 5BVGB 1O6FA 1AGRA 1X1CA 2OGTA 2WYOA 3C1TA 1U1CA 3QXXA 1GLNA 3LC7O 4D3YA 3GQBA 1DXQA 5CVDA 3I09A 2RBKA 1GUZA 1ZMTA 2RHRA 4W8GA 5CNIA 4UFNA 4WPGA 1MB9A 4BWGA 1Y1QA 2BL4A 4YRNA 1GPMA 2QVYX 1RC1A 3JAKB 3CBQA 3RTEA 3AEXA 1GWNA 4FGUA 3TDMA 1KGSA 1V5GA 1Z7GA 3B1YA 1QYXA 3ROMA 3TKLA 5A5GA 3QA9A 4BWFB 4Q1VA 1GNVA 1GAJA 1P3JA 3LXXA 4LN1A 5LUAA 1QPZA 1G9SA 3FA2A 1ZH8A 5L6MB 2NU7A 5ADUS 1NJSA 2Z3ZA 1JF8A 1Z22A 3F74A 1HZZA 3GFVA 4R8VA 2JIZA 2C5HA 4BUJA 5EIXA 8MHTA 3FTPA 3VKFA 3DUFB 1IUKA 1N4DA 1ZS9A 1GFZA 5DEIA 4UM9B 3NAZA 2QMZA 3MOGA 1AQNA 2VN8A 1JSRA 4H3KB 3UXYA 2PLNA 4P3XA 1L0BA 1AS3A 2I1WA 4YJ3B 2EJUA 1UC5B 4O59O 2F3RA 1H22A 1P4RA 1TO1E 2H3EA 5JCJD 4Q4CA 4OYHA 1R5NA 1CSEE 5LMNB 3CF4G 2ZXFA 4EHAA 3I9V1 3ZXIA 3L43A 3AU9A 5JVDF 1JG6A 1LDYA 5HE8A 5CBKA 1D8AA 4O63O 3HE3A 2PZ8A 1O95D 3U3KA 3CZ4A 2Q7OE 3IVMA 3A1FA 4EK9A 3KKPA 4NZOA 4YP9A 2QAGC 4ZOBA 2VG8A 3A9CA 4KTVE 3FPJA 3DO5A 3FHOA 3I45A 2WSBA 1Y80A 3ZD8A 5JNWA 1RRFA 3U16A 2C4KA 4JLKA 1D1SA 2OHFA 3Q88A 4M76B 4PO9A 2C29D 3B1KA 1H4TA 1UC8A 2C3MA 5IULC 3W6OA 3QBJA 1EXMA 2H9AA 4RKWA 1QB7A 3GVIA 1AH2A 2CVPA 3DD5A 5DYTA 5IC4A 2XWSA 3FPEA 4AWBA 1JHOA 2WBLC 4KWEA 5EQTA 4PIMA 1OZGA 2IYYA 3GWZA 3AVTA 2R1VA 1RLIA 1SG0A 3EVNA 1M0TA 2PT5A 5LC1A 3RU3A 2CNWA 3MS7A 3F8WA 1C2TA 3IEXA 1P6QA 1A5ZA 2ZR9A 4PZZA 2W0SA 3TSWA 1F8FA 4WXPA 5D6OA 1KI2A 2HHCA 2W48A 2P9QA 4LF4B 4KO2S 1O2DA 4LJ8A 3PBKA 1PT9A 2PGDA 4JJZA 4Z9FA 2JASA 4R5HA 2HSEA 3FOAA 5CVJA 1DEHA 1NNLA 2OGZA 2X41A 1CFJA 4GM4A 3TL2A 2JGIA 2BF7A 1ENPA 4R2MA 3MT9A 3QUSA 4R6XA 1YDMA 3T0FA 4AJKA 4Z1OA 2BGIA 4TLAA 2FUG6 1XNQB 2VTDA 2CHUA 3L8YA 3QUCA 3WYFA 2IZ1A 3QH4A 3UK6A 3U56A 3WQBA 4GM0A 2GKGA 1NULA 3BULA 4OH1A 4OQDA 1JLSA 4RZUA 2JFWA 3QYFA 1QC5B 4UD2A 5FA5A 5GOZA 3BEOA 1ZSNA 2P3LA 3LKBA 1ZH0A 1I1NA 3S68A 2H07A 4ALKA 1GZ5A 1XZHA 4UAUA 2C7GA 4BRUA 1Z83A 4F72A 1M10A 4Q4HA 1K5DA 1XAGA 2Y9MB 3LUFA 4WFKA 1XZCA 4RTQA 1R0SA 3ZD6A 2SICE 5I7RA 4Y6RA 2GO1A 4HSGA 5E6SB 1T1RA 1EKXA 1UK9A 3GFGA 4J1NA 2X8LA 1P3DA 4D8TA 2FW6A 3EF0A 1XMPA 2IHUA 2NVOA 1MGOA 3TTYA 4M83A 1LPOA 1NBOA 2PX6A 4IGAA 4DLPA 3IEVA 1Z28A 1G21B 3DL7A 4A6EA 2H3HA 3WB0A 1LW7A 3H11A 1I7PA 4L6AA 1FQWA 1OXBB 2MYUA 3V6LA 4MPPA 4E4YA 5CVUA 2UXDB 1SBTA 1T3GA 2HCTA 2YMMA 3C87A 3T0GA 1C7ZA 1MAWA 5DNUA 3UBTA 1NYTA 2O8NA 2DY0A 4INOA 3O6VA 1DJPA 2HHAA 2WHEA 1Z0UA 4OFBA 4Q4LA 4UMDA 3RARA 3T3IA 1T43A 4I5IA 4BNLA 2P3QA 3HB9A 3K31A 5TF0A 4HGRA 4MW1A 2D00A 3IEUA 2Q5HA 4DCGA 1M6NA 4O4LA 3CH4B 2A67A 2EBHX 4EDFA 2FG7C 3N2ZB 5FNZA 2OECA 3SJCA 4A8PA 1R00A 2FEPA 2QPOA 3QXGA 4CDGA 1HTTA 1V6CA 3RUEA 3AU8A 4RDXA 2ECOA 4IMIB 2IT1A 1AUQA 3WRYC 4IDBA 1M5RA 2CB0A 3N0WA 3WK8A 2IY8A 3AXTA 4AZ3A 1KFEB 3IHTA 4RIHA 5GM1A 4IWYA 2CXQA 2IXEA 2BFEA 2BYTA 1I0LA 2P2GA 1FYVA 3IS3A 4PYOA 3OTGA 3Q7RA 5BWOA 5I3ZA 5FYQA 2Z0MA 1QV6A 1RTKA 2WFLA 5HUQA 1LI4A 4AUNA 3CSSA 2C2KA 3RV4A 5J5CA 3LFUA 4BRSA 2DHEA 1E63A 1T5BA 2ZRIA 1NOJA 4WNYA 4DRZA 1H6AA 2EX4A 1EG7A 2GPNA 1IZ9A 1P4AA 1PF7E 3PC4A 1RCTE 5C80A 1TRKA 3SAJA 4J0IA 1VL8A 2IF2A 1DIHA 3LOQA 3LPAA 4NH0A 5CPFA 2GTPA 3E9ZA 1BZYA 2IHTA 2V65A 1U8EA 2ZP1A 4ZO8A 3VI4B 4V1CB 3A26A 2SKDA 2HFJA 4ENPA 2NV6A 2Z58A 5AVZA 1WMAA 2VOEA 3P19A 3PX2A 2ODTX 4GVLA 3L6OO 4P2GA 4A82A 4BEJA 2WHQA 3E5HA 3OZDA 3BCHA 3DNPA 1T9CA 3GRVA 3SXPA 1FW8A 3RRZA 1I4WA 1QBKC 1XZBA 2GEUA 7ABPA 3TRDA 1W2WB 4O0LA 4OHOA 5G2OA 3RGWS 5EJ6A 3ZVMA 1R0BA 3ACCA 1ZN2A 2GVZC 2NU9A 1AZTA 4P3NA 1L1RA 4IV8A 4UVDA 1JDUA 2QTWB 3WRVA 5LMUB 1UC9A 3TOXA 3CFYA 3CRZA 3F47A 4B45A 3VKVA 1K8XB 4YREA 1Y48E 4QA9A 4POOA 4PLTA 1VI2A 3K3PA 3R6LA 2EYUA 4EKDA 4URVR 5B1DA 3PC7A 4WY2A 1UZAA 2HNBA 1JLLA 3DE3X 3RSCA 4RTSA 2QX8A 3H6GA 1K7XB 4L3OA 5AH0A 5G41A 4NU8X 5CB4B 2XCSB 3NUZA 4GM1A 2NSLA 1EWRA 1NP3A 4EZEA 1ECGA 5JD5A 4K1LA 3EZ7A 5KMGA 2GR9A 2ODBA 4FFBB 2WKQA 3BQ9A 3FUXA 1LY1A 3GROA 3VNUA 3PGKA 4LDRA 2ODWA 4GEGA 2NPOA 4DIUA 5HA5A 4ED9A 1MOPA 3PIDA 4D0LB 5CH8A 2FZEA 5FBKA 1BRTA 3R40A 1FX0B 4DGSA 2A5YB 2RKBA 3RC8A 3F3MA 5GOTA 2C84A 3VDQA 4KQ9A 1JXAA 5C1IA 1P4JA 1IXZA 2WJ4A 3CWZA 1N5KA 3T5MA 1T0HB 4I1UA 4QO7A 1N9KA 1OAOA 4IDQA 2PZJA 3VZCA 4UU0A 2I9PA 4EG6A 1LLCA 3OURA 2R6JA 3HGQA 1U2DA 2JLCA 5G4LA 4NJOA 1QANA 3VHXA 1BOOA 2ZIFA 4B2IA 3FHJA 4N6GA 1E3IA 4V0SA 3WVNA 1C3JA 2EX1A 3KL4A 3V5NA 3VU3A 4ABYA 2IU4A 1KY4A 2X9VA 1ZXLA 2FOLA 3OX4A 1SVMA 4L8WB 3F67A 3E35A 1EDOA 3LGAA 2FB9A 5KQMA 1WP4A 2JFZA 1TMGE 1I3NA 2ZRJA 3H2BA 3NKLA 4TKZA 4B3XA 1F0PA 2RC5A 3T5GA 4CR7A 4TMKA 1Z2EA 3KM0A 1Y82A 5CLLA 5T6MA 1OXMA 2TS1A 3T06B 4NFYA 4EGFA 4KPYA 1X74A 1LDBA 4UU1A 1H4VB 1FFDA 1XQYA 4ML3A 2ECFA 3D3WB 1OH7A 4GWKA 1XTKA 5E3HA 1DL5A 4H59A 4E31A 4CUKA 4II7A 4OA5A 4EQZA 2PQ0A 3C4JA 1JE1A 3QOWA 4X63A 2VO1A 1D1QA 2PVCA 4N5LA 3L9WA 2GQ0A 2IP2A 1BH2A 1CR1A 1ZUIA 2X1LA 2G63A 3CW9A 4X20A 5CGZA 3SYMA 2J5RA 3QP9A 1NVUQ 3MMNA 4DWOA 3KYDB 5BQ3A 1SVLA 1X7YB 3MG9A 2BZ0A 2GN9A 4HDNB 4O2AA 4NOLA 5SY4A 4MRMB 1L5VA 4M0PA 5KO2A 5A62A 5AHWA 3RVOA 4HD8A 1POXA 1XPOA 3CT6A 3E9RA 4OMDA 4KGZA 1JFFB 1SU6A 4MKFA 5E3JA 1M7GA 3UMGA 2CJWA 3T8YA 4DDKA 3AW8A 4QUDA 4DLXA 1ZXXA 5DBFA 5I5GA 5C0OE 5EXXA 1A8PA 4ALLA 4AWAA 5BR4A 3NCHA 4W5NA 4OBEA 2JIQA 5CW1A 3PFFA 5A9SB 1KAHA 3PTZA 3HYSA 4BLQA 2Y0CA 4JVNA 3CN7A 3QTTA 3D5QA 4PRLA 4TTTS 1CJMA 1NIPA 1NYRA 1EM8A 4RZHA 2VTKA 4D9GA 3MMXA 1A8IA 1VG1A 2DBQA 4WKGA 1QQBA 1AKQA 1W59A 4EYSA 4N5DA 5REQB 3VZRA 4YQEA 4ERNA 2O2DA 4RLSA 4EF6A 2PUFA 4YDHB 1G19A 4L8YA 2GD6A 2A86A 4AMZA 5JFOA 1M7HA 1WX1A 3FNBA 4YAKA 4BRZA 1YQ9A 2UYQA 2X42A 3KAPA 1KL7A 1TDJA 1NW5A 3HKCA 3ZDXB 4F5YA 5C1PA 3PE4A 5JFGA 3OF2A 2VYNA 4HAIA 1OR8A 4J7UA 1SQGA 2P2DA 1B74A 2ZYSA 3BJIC 4LMBA 5CJJA 2ZJ2A 3U9LA 3UTCA 3KOWA 3V4VB 4MIEA 4X00A 1AN0A 4ZRNA 1G2IA 1WOYA 2X0IA 2CSXA 1PKXA 5LD2C 5HP4A 2IX3A 5ALPA 1YO6A 1W0JA 3BPSA 3RTBA 3QQ5A 5DP1A 2N42A 2CF6A 4IIXA 4LJ5A 5HRAA 3PKIA 3EZLA 1Z45A 1QG0A 3OJWA 4E5UA 4X95A 3KZOA 5FL7A 4GO1A 3EXEA 4FEAA 1B0PA 1Z5NA 3DTTA 3L6DA 4JOCA 3TZLA 4ESVA 3UJHA 4RABA 4PGMA 4X54A 2I4LA 3GGJA 4XLLA 3ND7A 4DSAA 1MC5A 1JR3E 1PGNA 8LDHA 4K0RA 3E6AA 4X64B 4AICA 1AQUA 3FHTA 3D3KA 4DQ0A 1RQPA 2KWIA 2OGSA 4ZQGA 5ICCA 1XTQA 1WCV1 4JJAA 2CCGA 2FMFA 5CLHA 2ZI7A 4IOJA 1KORA 3MUOA 2CLMB 3H8JA 3K6SA 4O2BB 2A5LA 1XL1A 1CJKC 1FFXB 2QTAA 4H17A 5AW2A 4P8RA 4W9RA 4M1WA 4R0MA 1IJEA 1RWVA 4DIKA 4GOMD 3ML1A 2BCJQ 4GDMA 3OQMA 2AVNA 4H6WA 5EJFA 4TMFA 3I83A 2DU8A 2ABWA 2NOAA 3CJRA 3OFSA 4NP6A 1J9GA 3H9QA 1HSOA 1CZRA 3B5JA 3GJXC 3ZIUA 3DR3A 4KRYA 2E6KA 3EIFA 3PFGA 3BEDA 3ZJ4A 3OETA 1ML4A 2KMLA 1XRLA 4O1HA 1RLMA 4UDXX 2IY7A 4WAUA 4A7PA 3EFEA 2I3GA 4NEQA 3WB1A 3PJFA 2WSIA 4RMJA 3N5CA 4U9UA 3LG2A 5BYJA 4ZK2A 5IUNC 4ENVA 1P0MA 3EGDB 3KTDA 4DV1B 1N77A 1B0UA 5AUQA 3D7LA 3SE7A 2F1KA 1H2HA 2ZJOA 1JA0A 1JKJB 1TXGA 1UBJS 1ZMOA 2BD0A 3HDTA 2WZBA 1UBMS 4B47A 4PZCA 4DC1A 2XVMA 3FPBA 2XGMA 4ZP1A 4J0JA 4LXTA 4NXMB 4DV4B 3Q7TA 1DUIA 5EHNA 2WJHA 2VDRB 3GAFA 4A9AA 2PKYX 2XCTB 2NT4A 2HA4A 4YIKA 3KZVA 2QT0A 3G23A 3FYUB 3THOA 3TQOA 3X43A 1P7VA 3FJ1A 2NVUA 2ZRAA 1MIHA 3ICWA 5COQA 2BTEA 1N4AA 1DPFA 2W2QA 1XMOB 1JXMA 1P6UA 4BV9A 5ARDA 5JNSA 2XRMA 4TLBA 1BG6A 2HQOA 1CR6A 1DC8A 1PNQA 4AURA 2P9BA 2XRZA 5ELXA 4ROTA 3PQ7A 2Z4SA 1G8HA 2J4CA 3ZHTA 1AF7A 1E79D 5F76A 2G70A 3ASVA 2ONKA 3IOMA 1ORHA 1DWUA 1HY3A 1TAQA 2VWHA 2WOJA 3JAKA 2FN8A 1UR5A 4IZHA 4L8GA 4RMHA 5EPUA 2P75A 3LC0A 1YKGA 1GL7A 3GAMA 1IUPA 1GVNB 2DQZA 4R2HA 3WHKA 3I61A 3H5TA 2JFGA 3JX9A 3K92A 1VLMA 3LTNC 2ZS7A 2FJUA 1OF1A 2W93A 3FFBA 4A6XA 2PQMA 2YYSA 3WYAA 2DHDA 3KSBC 3TLAA 3TX6A 1U7WA 2AFRA 3DUFA 5JAIA 2FUG1 2QVZX 2BHRA 4ZEOA 2W71A 5FIUA 4PO8A 4W6ZA 3BREA 3P96A 3QY0A 5DT9A 1FSZA 4NIMA 2J48A 2YY6A 4YJ3A 2PMEA 1DX4A 3OIYA 2CUTA 4OB8A 1TLFA 3UZUA 3U19A 4FUQA 1EVZA 3AEQB 3WYCA 5AW5A 4CQMB 2X3YA 3P2OA 3GEGA 1NM5C 4EKYA 4LBZA 2HWUA 1KQNA 2QVCA 2UZ3A 3QE4A 1SWVA 1PJSA 4RWEA 4LFAB 1BFDA 4FWBA 4F3NA 1B7GO 4GWGA 3P9XA 3HDVA 4UEOA 3SJAA 4CN8A 3FTQA 3T7EA 1RRPA 3SLKA 3TSCA 2FPOA 4BRWA 3ANXA 2QN9A 1SUPA 3A3OA 5B4UA 5BQXA 2FTKE 2OV3A 3I2KA 2G83A 3KT3A 1BWPA 1C0IA 1GXSB 2WT9A 4TUYF 1VJTA 5DV9A 5CFLA 3IEIA 4AF8A 5E7IA 3O7WA 1NPTO 1U9CA 1B76A 4W1SA 3LCJA 2FWPA 4WKPA 1NX6A 1DBIA 2GBGA 4S1TA 1RMTA 3RIEA 3S3TA 1O0BA 3NOVA 2PCLA 2XUZA 4E2FA 2R25B 4Z3DA 4BVAA 3RVDA 4MB6A 4KQKA 2Q2WA 4RESA 3NRCA 1RHJA 1P39A 1WB4A 3GJ3A 4M1KA 9MHTA 2H7YA 4YRAA 4CMEC 3RR2A 1KP9A 5KSZA 1XN1A 2SCUB 3R0XA 4QQFA 1HM5A 2OCYC 4K2HA 5KJ6A 1E9SA 4DCPA 1QH8B 3FCUB 1RW4A 1VKOA 1JAXA 2EYQA 5CT5A 1P45A 2FGJA 3B2EA 1SB8A 4PR0A 3IAFA 4QU5A 4S1NA 4XOUA 1BROA 2PXHA 2GYWA 2Q3CA 3AUYA 3D6TB 4J0HA 4TS3A 3RABA 3BF8A 5HM6A 5D3MA 3WL4A 6Q21A 1K6MA 5ENVA 5IX8A 1NONA 1JEQA 2K2WA 2A58A 5FFFA 4Q48A 2IIBA 3UKDA 1JJFA 1QC5A 1YB7A 3BB1A 3E9NA 2EP7A 3F7OA 5LL6P 5M3BA 2C9OA 4KC0A 3HI6A 3EJ6A 5C32A 3GV0A 2C4VA 4K3VA 4YV1A 1MO6A 3BAFA 2HIGA 2ZI5A 3E4CA 3OCVA 2XGOA 2AW5A 1FYFA 2JGEA 1NVAA 5DHFA 5CCDA 1JXQA 4YAGA 2XVZA 4JYMA 2EQ5A 4PFJA 4BLUA 2D5BA 3VTKA 3ZDCA 4CL2A 5E6SA 1G16A 2Y1WA 4RGYA 4BNFA 2HA2A 1H2EA 1BN6A 4AO8A 1GV1A 3URKA 1CUJA 3T1TA 3HKDA 4YT4A 1N8SA 1L7VC 4FP9A 4Z7NB 4HQFA 2DBZA 3UT0A 2HN9A 1KP3A 4NCBA 4MX8A 4ID3A 4TQ9A 1G21A 1SIWA 4IWNA 1T9ZA 1UOPA 2F8LA 2G1UA 4QUBA 3WKDA 5HXAA 3IDAA 5LN1A 5TLSA 2GXAA 4LJYA 3PA8A 1NIJA 1VB3A 3SYLA 2OP0A 4HXGA 2QBYA 1C8KA 1X7XB 3FRJA 4PZUA 5T4EA 3TIGA 5KQRA 4MROA 2I03A 2QMHA 5BUZA 1VP3A 1U3WA 4GOKA 4G0ZA 1B15A 3OHSX 4GRIA 3WS7A 3ANLA 2RI0A 3BRSA 4GBJA 3UQZA 2OY0A 4DMGA 1W5AA 3CMMA 2B8NA 5C3MA 3HO8A 1SC1A 1X8LA 5I9LA 3EEQA 5JARA 2QP9X 4XTCS 3W5BA 1NUSA 1SFRA 2VZLA 3FAKA 1WNTA 1SKUA 3LLSA 3NOXA 4KB5A 2XNJA 5EUCA 3O8RA 2I9KA 3A1VA 4KBYA 5IBCA 4LC0A 4QXPA 5B1IA 4YRSA 2VSFA 4CV2A 1AUXA 2DC1A 2BI8A 3JD1A 2GK3A 3PTLA 5L8VA 3L46A 1U2SA 4AWXA 3NYIA 4MWBA 2X58A 3IVRA 2QN6A 2WG1A 3R5FA 5ICGA 4RCZA 1RWWA 2EJVA 1YE5A 3EAQA 2DETA 2XNSA 4B85A 1N0IA 2XQKA 2PFKA 2LWIA 3QFFA 2D3TA 3DVSX 1X1DA 2JGFA 2GYYA 2EF0A 3SOZA 1PFWA 3LHFA 4V1CA 1L5MA 2WYWA 3ER6A 2M6SA 3QEMB 1SZJG 1BWRA 3GZNA 5HZGA 2P0YA 2IW1A 2PBLA 3GVCA 4W63A 4YCCA 2NP7A 1Q14A 4CMCA 3AOGA 1U4NA 4YVFA 4DCCA 1E6EA 5C34B 3MINA 3MELA 4EIWA 3P52A 2R7MA 1M0SA 4XWAA 2WD7B 3HVHA 3L84A 4QYXA 3TPFA 1F1JA 5L3VA 3CINA 3DM5A 3FZEA 1NKVA 1T9BA 2DMRA 2FSUA 4AZ0B 5KAMA 1BOFA 2VEDA 4L4ZA 4PCVA 4BO0A 4QHSA 4GLFA 3FRHA 2P9JA 3WQSB 4QWMA 4LHWA 5DKFA 5C51B 1ZM3A 2QTNA 5K8LA 1DXOA 2AQKA 2VFAA 4IVPA 5CFOA 1GPYA 3GD5A 3OF3A 4MPRA 4KI7A 3VUEA 4BNGA 4EY5A 4INPA 1X39A 3BIFA 3BA1A 2WEKA 3MF4A 3MFYA 1NWCA 3RYHB 3IODA 4K9MA 4IOMA 4H3HB 5F23A 1WABA 1P80A 2XYHA 3P9QA 2YVUA 3V7WA 4BVJA 4JR2A 1L8AA 1M2GA 1RHRA 1MQ8B 1DHTA 2QZPA 2Y71A 1T0UA 2PR7A 2XTAA 3LIPA 4YAEA 1M1XB 5CB4A 3ZZMA 4CTMA 3K9LA 4OL9A 3M1AA 1HT1E 2I3DA 1GKUB 3FCCA 3K6RA 1MQSA 1ZNZA 1RJGA 1DLIA 2HF8A 1D5WA