4N0QA

Crystal structure of an abc transporter, substrate-binding protein from brucella melitensis 16m in complex with l-leucine using a crystal grown in a crystal former (microlytic)
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
344
structure length
344
Chain Sequence
DITIGVIAPLTGPVAAFGDQVKKGAETAVEVINKAGGIKGEKVVLKFADDAGEPKQGVSAANQIVGDGIKFVVGLVTTGVAVPVSDVLSENGVLMVTPTATGPDLTARGLENVFRTCGRDGQQAEVMADYVLKNMKDKKVAVIHDKGAYGKGLADAFKAAINKGGITEVHYDSVTPGDKDFSALVTKLKSAGAEVVYFGGYHAEGGLLSRQLHDAGMQALVLGGEGLSNTEYWAIGGTNAQGTLFTNAKDATKNPAAKDAIQALKAKNIPAEAFTMNAYAAVEVIKAGIERAGSTDDSAAVAKALHDGKPIETAIGTLTYSETGDLSSPSFDIFKWDDGKIVGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of an ABC transporter, substrate-binding protein from Brucella melitensis 16M in complex with L-Leucine using a crystal grown in a Crystal Former (Microlytic)
rcsb
source organism Brucella melitensis
molecule tags Transport protein
molecule keywords Leu/Ile/Val-binding protein homolog 3
total genus 122
structure length 344
sequence length 344
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13458 Peripla_BP_6 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4n0qA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4n0qA01
4L4UA 5TQJA 2FXIA 2GX6A 2IPNA 3N0RA 4OTZA 2OENG 4M88A 3GT7A 1E6MA 1JLKA 1JFTA 4TLMB 1RZRA 1RXEA 1MB3A 2CD7A 4YCSA 1QO0A 2R48A 4LZLA 5IUKC 2E4ZA 3BILA 5BRJA 1LJLA 4QYWA 4D74A 2L19A 2FMIA 2IPAB 2PAFA 4TLLB 4ZPJA 2WRZA 3CNBA 3EAFA 2FN8A 1PHRA 3IDOA 2WB4A 3F6CA 1U2QA 4IILA 2FW0A 2H0AA 1ISRA 3E3MA 1TM2A 3HS3A 3KSMA 4UHJA 3EDCA 3I45A 3Q9SA 4MRMA 1YTUA 2L2QA 3A10A 4RK1A 3HUTA 1USKA 3ILHA 5IUNC 5PNTA 1YMUA 1WETA 4DN6A 1ZITA 3OM1A 3C3KA 4B09A 1Z16A 3I09A 2IDMA 1GUBA 4D6YA 5HSGA 4UHKA 2PUDA 1JF8A 4NCBA 3HO1A 2RGYA 1E2BA 3NBMA 2ZWMA 3Q7RA 4W5NA 1APBA 1VRVA 1W9HA 4HNSA 5KC8A 4Z4EA 1DBPA 4MR7B 3F6PA 2OQRA 1RNLA 5BQ3A 1EWVA 1MB0A 3QX8A 3K4HA 4DADA 2W42A 2J48A 1DC8A 2QU7A 4KREA 1DCMA 3Q15C 3FGZA 4G0ZA 1C4WA 1ZESA 3M6MD 5IUJC 1YIOA 1A0OA 3RH0A 5B3JC 1NXOA 1SXHA 3OMXA 4OBBA 3QLTA 4MS1A 4RY0A 3H6GA 1B00A 1DZ3A 4JB0A 2JVKA 3KYIB 5GQSA 6ABPA 2VK2A 3T38A 2YHAA 4MR8B 1KRWA 3N0XA 2ID9A 4LE1A 4RK7A 2M1ZA 3UKJA 4YGXB 4YV7A 5JNSA 1D1QA 3DGFC 1ISSA 3CZ5A 1U2PA 4RY8A 3HVRA 4W5OA 5FWXA 1TVMA 5CHYA 2MYPA 1S8NA 1QQAA 3LMKA 4PEVA 1EFAA 4OATA 1M5TA 2QZJA 3QX9A 4G86A 4MR9A 3SAJA 3DLBA 2FMKA 1JL3A 1Z13A 4YP9A 5GOTA 2DRIA 4CBVA 4F8JA 4N03A 2HQRA 4RXTA 2F8TA 3NHZA 4F3TA 4MQEA 5JNUA 1KGSA 2E4XA 5C5CA 3RVPA 3OO1A 1M2EA 1YVUA 1HEYA 1SXIA 3H1EA 4W5RA 2VUIB 4G0QA 1L5ZA 3D8UA 5DLEA 2L17A 4FE4A 2L18A 3A3KA 3O1JC 5KQGA 1Z25A 3QELB 2IOYA 4MS1B 5DCLA 3NHMA 2FN9A 1ZN2A 3FFXA 1QMPA 2VYCA 3ROTA 4TN5A 2I6FA 3LUKA 1QKKA 2FSPA 9ABPA 1VPWA 1ZGZA 5FBKA 4PICA 2MYTA 4W5TA 2FMFA 4LE0A 4N0PA 2MSKA 2WJWA 4KVFA 3MMNA 1LK0A 3QLVA 5TQ0A 2PUCA 3CS3A 2CWDA 5JNTA 4RKRA 5IBQA 4N47A 3KG2A 6CHYA 4O1HA 1M2FA 5HKOA 1XHFA 4MS3B 4QYMA 2GI4A 4RY9A 3URMA 5BR1A 1JFSA 1CEYA 3O21A 3DBIA 4E7PA 1Z2EA 4IRXA 3H5OA 3H6HA 5F64A 4YS6A 1PUXA 3HV2A 3Q7TA 5CNJA 1MIHA 4JA2A 5ED4A 2R4QA 4NCAA 4RKQA 4P98A 2NT4A 3O2QB 3EJWA 3JVDA 2JK1A 3GL9A 1KMIY 1FFWA 2PL9A 3RVSA 4MGEA 1ZH4A 3KYJB 3C3MA 3EGCA 4Z9AA 3C3WA 4G0MA 3CU5A 1OXBB 3HXMA 1JFVA 4HNRA 1QP4A 3BRQA 1PNTA 3NNSA 2FQYA 2A9RA 3CHYA 3S99A 3HSYA 1LBHA 3IP6A 3O2JA 5TQ2A 3CG0A 1LBIA 1DP4A 1QNLA 3MA0A 1P6QA 3QLUA 4G0XA 4G0OA 4S05A 4LDZA 1USIA 2LBPA 1D1PA 5IULC 5T7BA 3HDGA 1JWLA 1QP7A 2HSGA 1DJMA 4RSMA 4GNRA 5BRAA 4RXMA 2A9PA 3O1HB 4XARA 4WXEA 1TLFA 1FFSA 1JDPA 1VKRA 4Z99A 5DTEA 2WWVD 2QSJA 2YHBA 2HJ9A 3GA5A 5D2CA 3T6KA 3KCNA 5CNIA 3FMVA 4KK4A 4Q6WA 3OLXA 3ROFA 3QEKA 2X7XA 4P1ZA 4YRZA 1UDRA 1DBWA 1Z2DA 1GCGA 3A0UA 1ABFA 3LUGA 3O75A 3RVOA 2KYRA 4WWHA 3MYYA 4WUTA 1NXTA 4MR9B 2IKSA 3FFTA 1D2AA 3H1GA 4RV5A 1NXVA 3TD9A 2PKXA 4FE7A 3H5VA 3JTEA 5JS1A 2V0NA 2PUFA 3RVKA 4XASA 4F06A 4F11A 3SNKA 3HDVA 3A0RB 4IGAA 5HM6A 1SXGA 4MYRA 2PMCA 1QQBA 5FBHA 2B4AA 1A04A 3OO0A 1MAVA 4KV7A 1JYEA 2R47A 2JVJA 3CFYA 3H75A 1FQWA 3HK2A 3RQIA 1U0SY 2MYUA 5KI6A 5ABPA 2VUHB 3CLKA 1DC7A 4KK3A 2BGGA 3SG0A 3BRSA 3RVQA 2LUOA 3BBLA 3EQZA 1DG9A 1K68A 3DGEC 5TE9A 3JPWA 2NZUG 3W9SA 4PE5B 4RXUA 2GBPA 2FLWA 1YS7A 4H3HB 3OLYA 3TB6A 1RZRD 1CHNA 3EODA 1ZDMA 4OLBA 2M98A 3IP7A 2RDMA 4D6XA 1J56A 3O1IC 3N8IA 4WZZA 1F4VA 2A9OA 3LUDA 1QPZA 4ML3A 4FB4A 3EQ2A 2E4VA 2ID7A 4G97A 5JNRA 3GBPA 4Z4IA 1FSPA 1W25A 1DRJA 1VLZA 5KQPA 3ILYA 1NXWA 4ETMA 4YLEA 3IPCA 2P4UA 4DQDA 4W5QA 3HUUA 3M9XA 2Q5CA 4Z9BA 4RZSA 3JY6A 3OLWA 1T34A 2QVGA 3I5AA 1NXSA 3JS5A 3N75A 1JBEA 5HQJA 3KLNA 4WT7A 1ZHHA 4XLTA 1Z15A 3HZHA 4MLCA 4NV3A 2QVCA 1AB6A 3QEMB 3QK7A 3CG4A 5EWLB 5TPZA 4EVSA 4EYKA 1IIBA 1NTRA 4RU1A 5C5EA 5JNWA 1OXKB 4Z0NA 4O5AA 2FVYA 3L49A 4JASB 1L5YA 3MF4A 4NICA 4Y9TA 3GYBA 4O1IA 5T3YA 4ETIA 3HM9A 1E6KA 3SY8A 5EWLA 4KNYA 1TMYA 4Z4FA 1D5WA 1QP0A 3QLVC 5EWJB 7ABPA 2PUBA 4LE2A 2QW1A 2H3HA 4S04A 2PUEA 4RS3A 1GUDA 1Z17A 3SM9A 4NQRA 3D02A 2JRLA 3LUCA 3RVJA 3H5IA 2PL1A 2R25B 3C97A 3OQNA 3JVIA 4LRQA 1RPJA 4Z4HA 1A2OA 3Q7SA 3OQMA 4XAQA 4L85A 5KQMA 1KRXA 3LUAA 2JB9A 1JH9A 3HEBA 3GBVA 4MS4A 2XDYA 3Q41A 2NZVG 3LUHA 4H60A 2FQWA 1R8JA 3F7NA 5EWMA 3RVLA 4MS3A 2WMYA 4KMRA 1I3CA 2B1JA 1ZH2A 3LKBA 1BA2A 5KWSA 3H5WA 1D4ZA 5FWXB 3N6VA 4ZYLA 3QLUC 3O2SB 1Y1LA 1Z26A 2MYNA 1YS6A 3G1WA 3R0JA 3TMYA 2QV0A 8ABPA 5CNKA 4EY3A 3HCWA 5JNVA 4MQFB 3H1FA 3MIZA 2GWRA 1YMVA 3LOPA 3C6QA 4LX8A 4N0QA 3CRNA 1BDIA 1PNRA 4EUKA 1EWTA 2FLKA 3B2NA 3FDFA 5DKFA 2PJUA 1BDJA 5TPWA 3IPAA 5EWJA 3RVRA 3F73A 3OLZA 2LIVA 1XHEA 2JBAA 4MQFA 3OQOA 4QICA 4JAVC 3RVNA 2LPMA 1JHZA 2FMHA 1PEYA 1RXIA 2FTKE 3LTEA 4RK5A 2P9HA 3JPYA 1YK1A 1P6UA 3OMWA 2PUGA 1BAPA 3KKEA 4LDAA 3H5LA 3RVMA 4EVQA 2CHFA 1JYFA 4YO7A 4IMJB 1TJYA 1Z18A 5EWMB 1F51E 4ZJPA 3UK0A 2TMYA 5IEBA 3CTPA 3LUJA 3MM4A 4XXHA 5CNMA 5B3JA 3BREA 3N0WA 4RK0A 3OLVA 3QEMA 2PUAA 1DCKA 1ZY2A 3KLOA 5IC5A 3K9CA 1YK0A 3DZDA 4HNQA 3KTOA 1P8AA 3EULA 4MAAA 5I4CA 4Z4GA 3L6UA 1BVHA 4KQCA 4MRMB 3VNBA 1DRKA 4EYQA 1USGA 3P9YA 3TO5A 4N76A 2ZAYA 2O20A 3IP9A 2QR3A 2FQXA 5TPWB 5E3JA 1XWWA 2A9QA 2NT3A 1ZVVA 4RK4A 2IPLA 1M5UA 2IYNA 3FFWA 2WJAA 3CZCA 3T95A 4PYRA 4JB2A 1NXPA 4ZMSA 3E61A 2JVIA 4KQ9A 4F12A 1Z12A 1BDHA 1PEAA 1EWKA 4YWHA 1NY5A 2FEWB 4EYGA 1U04A 3G85A 4MPTA 4ETNA 4EYOA 5JS2A 2FEPA 1LJUA 4G0YA 1H9CA 2MSWA 2MSLA 3KJXA 1EAYA 1FFGA 4XFKA 4MS4B 2QXYA 4EVRA 3LKVA 4E7OA 5FWYA 3DLHA 2E4YA 4RWEA 2RJOA 3MQ4A 3N53A 4RDCA 4GPAA 2HQOA 3KS9A 2JCGA 4WXMA 1CYEA 1JDNA 1DBQA 3H5TA 3IP5A 3OM0A 1E6LA 4MR7A 4YR7A 4G0PA 2FKAA 3T8YA 4MR8A 1MVOA 2NUBA 4JOQA 5TPZD 1GLGA 1P2FA 3UUGA 4IF4A 2CHEA 3QELA 3SQNA 1JX6A 4TMYA 5DGCA 2WY2D 3NNNA 4HYEA 4Z4CA 2IPMA 3GRCA 4QPJC 4KPYA 1ABEA 3GWGA 3M9WA 4H3KB 5FWYB 2FEKA 3TX6A 4Q6BA 2GKGA 4OLAA 1K66A 2PLNA 4MQEB 4KRFA 4PZ0A 2LP4Y 3VNAA 3KHTA 2HPHA 2N9UA 3LFTA 4IMIB 4EGSA 3GV0A 4JP1A 5KQLA 3O74A 1DCFA 2PE5A 4KFCA 4N41A 5TQ2B 2AYXA 4KZKA 2E4WA 1ZAYA 1AB5A 5IEJA 2AYZA 1SD5A 1U8TA 2E4UA 1NATA 3LUFA 4Q7EA 5TQ0B 1QO0D 3CKMA 4ZMRA 2F8SA 4OG2A 2RJNA 2HQBA 5KC9A 3I42A 1C0EA 1SRRA 3HJFA 1ZGGA 5IX8A 1NXXA 2JBAB 4MLDA 1EHCA 1GCAA 3NNDA 1URPA 4RK6A
chains in the Genus database with same CATH superfamily
4P92A 2QD2A 2PLAA 3S2FA 3PT9A 3C48A 3C41J 2P75A 2FX2A 4TV8A 3V1NA 1SHLA 2NO4A 1U02A 4M99A 4R1OA 4X6UA 3V8RA 4F45A 5LN1A 5G0UA 1T3GA 1Y4SA 4TLMB 4ZCIA 3A9WA 3QF4A 4MGZR 2W43A 4YCSA 2AWNA 5DB4A 1CIVA 1X7WA 2R96A 5BRJA 2ZWAA 3BCSA 1RM4A 2GRJA 4U2BA 2BRUA 3TTWA 3OX1A 4KNVA 4LMAA 3TECE 3D4NA 3MUFA 5REQA 4ALNA 4DJAA 3AIMA 3FVQA 2Q3MA 1IN1A 2EL7A 4LDJA 3TLKA 1PJBA 5A4MS 4B3RB 2E1RA 2VHEA 1EKXA 2DFKB 4Y6LA 4JUCA 1YL5A 4JI3B 4O4IF 2OHGA 3T35A 4UHJA 1NP7A 3I45A 4PQYA 3UV7A 1POXA 4JH0A 1E2PA 1I7PA 5FQNA 4E31A 1UXOA 3QMPA 2HYDA 1MABB 1NRIA 3ETEA 1U0NA 4RK1A 4DUGA 1F8GA 4IFEA 4K9RA 4J1TA 5PNTA 1YMUA 2AG5A 3H11A 2ZVQX 1OYOA 3QW4B 4FC7A 4IVPA 3OM1A 2XF8A 1SU7A 3C3KA 3P0HA 4F91B 3H84A 1SH7A 5K99A 2BH9A 4DLKA 4TMKA 2BZ1A 4D6YA 3LXXA 2VTBB 5I9LA 5EIAA 2OHXA 2QLMA 3ZW7A 5JLJA 5JC1A 1QGOA 3PQ2A 3HO1A 4EPYA 3OLQA 4V02A 3DEAA 1ZVJA 4DJFC 1UJNA 3F46A 4GX5A 3JZAA 3LHIA 3HG7A 3SYMA 3GJ5A 3MGBA 5F21A 3ZS9A 4L3OA 1CP2A 4U7PB 4UCWA 2FPMA 3BGSA 1GGFA 2J48A 1P7PA 3N2ZB 4L73A 4EO9A 1DRVA 3JD3A 4OLJA 4ZIRA 1JKJA 4J0EA 2DQZA 1Q1BA 1GAWA 1SELA 5YASA 2O0KA 2ZRMA 3CNOA 3TEFA 4MOWA 1FP2A 1TGYA 1ZSYA 3DTTA 5EJMA 3BJRA 5C8YB 4YMGA 4JYMA 5FBLB 2FZKA 4RDHA 4TWJA 4XM1A 1DZ3A 3WGUA 3T5PA 3TVYA 1YBFA 4NYIQ 3QBJA 1GKUB 3S2SA 3FKJA 1DKOA 3AFIA 1U8XX 2A88A 4KQFA 5AHWA 3FTPA 4C0LA 4RTSA 3BMOA 1WEHA 1T8TA 4MO9A 2JIQA 4UPEA 2CE2X 5LIPA 1RQGA 5EY5B 1GFWA 3DC2A 4NYMR 4EKEA 5B55A 2B6HA 4D9IA 4UFOA 1NSYA 3D9QX 4DXHA 4EMTA 3WAJA 2Q2OA 1EPUA 2JAHA 3HKBA 4EQZA 3AI1A 1MG5A 3A6HA 1X0VA 3TUZC 1I7NA 5LJIA 1DKQA 1J8VA 3CLUC 3EG9A 1F4PA 2HK8A 3C7AA 5AO9A 1XPJA 4MR9A 2H2AA 1U65A 1Q1AA 2PZJA 2QPTA 4XW2A 5EUCA 4IRUB 1FFHA 1JNYA 1YZYA 2DRIA 2C4KA 3FSJX 1ZJWA 1X94A 4UUMA 1T8RA 1ONOA 4JBLA 3P9ZA 5G1NA 3THOA 1BCRB 2PBZA 3JW8A 4NI5A 5K3AA 1N6OA 4EP1A 2GQ0A 4NK5A 4DEYA 5JATA 3JZDA 1DEHA 4GAEA 4K6HA 5K9ZA 2HJVA 1L5ZA 2VKTA 3D8UA 2WOOA 4A73A 1QYCA 4TQAA 5IDVA 4OREX 4XSHA 1LC0A 3V80A 3GFGA 5K0FA 4MJ7A 3RG2A 3V8MA 2OORA 4K9MA 3PTLA 2ZT5A 3NHMA 1UJ4A 3RTGA 1CDOA 5FWNA 4X1KB 4DLUA 3RDPA 1US8B 2Z2YA 5HQ3A 1SVUA 1QUFA 4GD3Q 5IT0A 3U61B 1VHJA 2NTJA 3LBHA 3FVRA 3W8RA 1OHHD 4BNZA 5IZ4A 1ZA2A 2VNHA 4CKWB 4ZXFA 3ONFA 3WWYA 1USVA 4ACBA 2YXLA 3QFTA 3TPFA 1PQYA 1UL1X 4HEA6 1V9LA 2XQKA 1TO6A 1GAEO 3PI7A 2REXB 4JBXA 4CRWB 2AHOA 3TSAA 4DLXA 1XHFA 3NHKA 3PD7A 2BI7A 4W82A 2PPLA 3T9AA 3ZVMA 3GLKA 4FSXA 2BV3A 4DT1A 1NNLA 2R8EA 3G7NA 3EFEA 1C1DB 1UBRS 1DWPA 1P1JA 1JZSA 1QCYA 3W3AD 2RGBA 1V3UA 3AVUA 1QORA 2R4QA 3KE8A 3NBZC 2BFAA 1H2EA 3EJWA 3L41A 1VHDA 1EJ2A 4KL8S 3K3PA 2Q6VA 4EPRA 1X80A 1Z6PA 4F7WA 1MA0A 5DYGA 5EE9A 3FDXA 5KQRA 1JAHA 3A1EA 4J4BA 1QIEA 3B12A 2XJ9A 1KJNA 1OXBB 3Q6MA 5JRZA 2EZ8A 3CRVA 3NCHA 3AF3A 3DP7A 2RBEA 1K3TA 1XNJA 2PNJA 3RNLA 1RYNA 3KZCA 4QASA 1R4NA 1YCFA 2FDCA 4S05A 3N39C 2Y2VA 3PSHA 3BKXA 5IVPA 1S2NA 4U7FA 1AQJA 5J40A 2E0IA 1GG2A 4QE3A 5LNK6 4JUAA 3RFUA 4XKJA 1CUSA 4ZCMA 4BKQA 4CF7A 4RXMA 1M54A 3EEBA 5KVQA 1E2FA 1YULA 3GRPA 3ANNA 4LDPA 2IIBA 4DC9A 4AZSA 3FNRA 2QSJA 5TLSA 4CIVA 2EHDA 3COWA 1GTL1 3K9QO 3KCNA 1ODCA 4WCDA 5IMSA 2WIDA 4KK4A 3DDHA 1CTQA 2X2PA 3LBNA 1D1SA 1H05A 1KIAA 4IOMA 2J6IA 5J2UB 3GVHA 2CLHB 2HPAA 5CVTA 4YAKA 3UAWA 3EDYA 1F2TA 2Z3ZA 4PCVA 1GGKA 4XQGA 2Q4DA 3AKYA 1T2DA 4L8FA 4KLNA 5CMLA 4Z86A 1E3DA 4LSGA 3VNRA 1A9QA 2F64A 4AJNA 2OCKA 5KO2A 4BXOB 2IKSA 4CL2A 4I1SA 3L0SA 2O0LA 5AWFC 3P9SA 1WDLA 3TZLA 1F6BA 4XUDA 4CUJA 1S9DA 3ZCTA 1AN9A 5ENDA 4C4YA 2PUFA 3OQ6A 3KAKA 2RHJA 1N1DA 2P4SA 3KTFA 4NBSA 2JCYA 1OW3B 2HA7A 5CTAA 3OUTA 4A91A 3B7WA 3D3QA 1RI4A 4P4LA 4OGGA 1U8AA 4W8GA 1Y1SA 3BRWD 3CKYA 3UAZA 2AG6A 2PT9A 5H68A 1M0TA 1KVUA 1F8FA 4TKLA 1R1DA 4OK6A 1P4RA 3OCYA 3MJHA 2DULA 3FPFA 3PG5A 4OU4A 7MDHA 5L7TA 3EA4A 1PLLA 2W6NA 3OOEA 4AMGA 2WDZA 2XLBA 3HDJA 5HBGA 1FU4A 1C1DA 1OV4A 1Z6TA 2VJAA 4JX8A 3NX4A 4MRPA 3EQZA 4NJMB 1SB9A 1Y9DA 4PRLA 1R15A 1ULTA 1E0DA 5AJVB 2QR5A 4YJ2B 3PUYA 1L7EA 4RSRA 5H7XA 4DJ5X 3V4FA 3IHWA 3WHPA 1BRTA 2LXNA 2NVBA 3OA0A 2YVUA 1Y63A 2XTNA 4N5IX 2GYUA 4V0ME 5J63A 3GP8A 5AIAA 1M0WA 1XIVA 4REOA 3NBQA 2O14A 4ZU6X 4A36A 3UANA 4L6AA 1KIMA 1D2MA 1I2BA 2R7AA 5JO9A 4TROA 1PFUA 4GOKA 4BBAA 3V8BA 4RZSA 4F4UA 1QE5A 3QPUA 3A6DA 2A35A 4BTLA 1AK1A 1GGVA 2JGJA 3R3JA 4GPBA 2Z6UA 4BNVA 2GCOA 2JA2A 1JQDA 2Q27A 4IFBA 2BFDB 3QOWA 4OHRA 4OI4A 4C1NA 2P3QA 2Y1EA 1IUOA 3F74A 1AV6A 5TPZA 4EVSA 4HLDA 1WP9A 3OZSA 4A8TA 1GR0A 4XZ3A 1K8YB 3AFMA 4NHEA 4NMMA 4NYMQ 4PBSA 3RIMA 4DFDA 2XDAA 3OE7D 1E6CA 3SFZA 2WJ3A 3MF4A 3U48A 5BNFA 4KLAA 4HAYA 4EGAA 2HPVA 4YV2A 4G5FA 2H11A 2IU0A 4KGXA 4JMLA 4RACA 2WTAA 2AV6A 4NC9A 1N77A 1IHOA 4NYIR 2QMOA 3H7AA 1MDBA 2RGAA 3GRFA 1YRYE 4RFSB 5A2GA 5AESA 1EK0A 2IHZA 3WAKA 1XCPA 3M81A 3MLBA 3PPIA 2ZPTX 4I81A 4CJXA 3SX2A 1IY8A 3CJRA 1WCWA 3D5TA 2OG1A 3TLYA 4LF5B 2JRLA 4IZ6A 3OJCA 3QZUA 5CYOA 1WXXA 5CFLA 1RSZA 2PH7A 3LP6A 2QQEA 1AHIA 1AQNA 4CIXA 2V1XA 3FA2A 3HYLA 4HPJB 2XZLA 2X9VA 1ADFA 3LT2A 4XAQA 3IDZA 2GA9A 1IM2A 2PD6A 3OAAD 1C14A 1E7YA 3GBVA 3RSHA 3QU5A 3VH2A 4PPNA 4AO6A 2GJ9A 3HU5A 4EFDA 1E2MA 4Q00A 4GSLA 4OQYA 2WMYA 1K8RA 1OLOA 2UVPB 2BGTA 4YECA 3SYRA 4LKRA 3I04M 4AJIA 3DQPA 3NHRA 3HDHA 4KKXB 4KLRA 4AG5A 5D8DA 1MX9A 5DYYA 3ECSA 3R5TA 3VU0A 3U6BA 2AR7A 3BQMB 1P4HA 3B2EA 4OXQA 4L5YA 4CF5A 1KTIA 2J0SA 4QO7A 3A1WA 3WNDA 1TECE 4BZPA 4E5KA 2HB6A 2PA3A 4EM6A 1DIHA 1SD2A 2HUPA 3HCDA 3DMPA 4YTEA 1FUIA 2ZUVA 3ZCRA 1JKXA 1SD1A 3RJZA 4N0QA 1NBAA 1E94E 2XB8A 3TBKA 1PNRA 2IP1A 2YY6A 2JHFA 3OT1B 1T2FA 2VDQB 4XDHA 5HF8A 1ATIA 4K6MA 4D9EA 2H59A 4LOKA 4E07A 1N2HA 1G5HA 2WUGA 3D6AA 2ZGVA 4D26A 4TUYB 2OYCA 4JVNA 1SCQA 4OQMA 2C58A 4AKIA 1C9NA 1ZLXA 1JHZA 4B82A 1RXIA 1MO3A 1N0WA 1O6ZA 1SNYA 1YDEA 1ZXLA 2P9HA 3E5RA 4P84A 2H6EA 4G89A 4JLDA 5AH0A 5K0NA 5TS2A 3MGGA 4CMCA 2W8BA 5KSYA 3EIEA 4ZYUA 4C0KA 1QG0A 3R5XA 3RROA 1QBKC 1TO2E 1E1NA 3U39A 1P77A 1ODSA 1TJYA 2FW6A 2IYWA 1L7XA 3LFUA 2C04A 1HSOA 5CX4A 1PR1A 1TRHA 2QRNA 1K08A 2F7SA 2JIZD 2X9NA 3MCUA 2WOJA 5KVSA 4P86A 1Z6AA 2NUTA 3L8CA 1Q7BA 2B9EA 5D6OA 1TU0A 5ELMA 2PUAA 1DCKA 3TYXA 2DH5A 1DPGA 4ARAA 4ZJYA 2JEOA 4I8IA 5JASA 1IVNA 2QWXA 1CY1A 1SKMA 3EULA 3KXPA 3NYIA 4OAQA 1RHMA 1MMFB 3NDPA 1P45A 1PFYA 1SY7A 2D2VA 5KYWB 1Z8NA 4RD4A 2EGHA 3O4VA 3ID6C 5KNLA 4B0PA 2HMVA 2ZRKA 4B4DA 3QWBA 3TSWA 4CM5A 2A78A 3WKAA 2GRUA 4V0SA 3TR6A 3ZWVA 3VR5H 1JR4A 1U9IA 1V6AA 3BZWA 4RWZA 3JQCA 4L4SA 3BIXA 3QVUA 3ZQKA 2D62A 4JB2A 3BE6A 2BEVA 1ZHFA 1MHTA 4INZA 4A26A 1KEZA 4YUXA 2RHHA 2Y3IA 1UR5A 3IILA 3IR5A 5BR4A 2VVTA 4KXUA 1U04A 1MTOA 4GZ3A 2PSJA 5DGHA 3IXQA 5H70A 4YXWD 2BHNA 1ZKMA 1ZJJA 4M76B 5EE1A 3DMRA 3COZA 3GUCA 3RABA 1MAHA 1HTWA 1R6TA 2C3MA 3PGKA 4W6ZA 3OKCA 3OZUA 4D7AA 1IBSA 1C50A 4MS4B 2WPDA 1RR6A 3AIIA 3K70D 2GFQA 5KOIA 1WSDA 3FMPB 1KSFX 4D9HA 3LK6A 4HC4A 3THWB 1KJQA 1D09A 2PGAA 2YFYA 4FR5A 3OM0A 1NU6A 2J0UB 4YR7A 4LSWA 3DZCA 3EQ9A 3N1UA 5CLFA 4HBGA 5MGNA 1O9GA 3OZEA 2ZJZA 1OX5A 1IN5A 3SQNA 3EQ8A 3LC0A 1JDZA 5T64A 2RGRA 5AVKA 3T4XA 4FFBA 3IBGA 4K86A 5BYAA 1UC5B 4OK3A 4LC9A 1N1MA 4J6EA 4M6WB 4IINA 3WP1B 1UAYA 5IVIA 3HYCA 1V37A 2X7HA 3A36A 1VG0B 4PZ0A 5ELXA 2C4MA 5ETJA 5IN4A 4L95C 3KHTA 3G2QA 5FOUA 3V3TA 6LDHA 4JROA 3L7DA 1O87A 3N8KA 5I9TA 2OSVA 3TWOA 1V5EA 3VNVA 4ZJZA 4B17A 2HSEA 1FTQA 2XZPA 2YC2C 4KDFA 1T0JB 3ESZA 2J3DA 2E89A 1PZXA 2O3TA 2AFHE 2QX9A 2ZIUB 2DJIA 3QFHA 2JGLA 4JP2A 3AW8A 2XEDA 4H1HA 4BBJA 3E8MA 2G67A 4L5BA 1YR7A 4BV3A 4ZIRB 1L5HB 3BB4A 3NOVA 3WB1A 4PG7A 5KYWA 3IERA 2B3DA 1Z4LA 2HQBA 5JPDA 3TLAA 3EMDA 1Y5NA 3LXMA 4RS4A 2O2IA 2ORWA 3JARB 3AIKA 3X44A 5BW5A 4C4RA 4MVJE 1NMQA 2FFBA 5JCJA 4LTDA 4F6RA 2H3EA 2OBFA 4JU9A 4ZDJA 4Y8VA 2FZEA 3OIWA 2CHGA 1UKEA 1WU7A 5JH7B 1CJKC 1JLKA 5KDLA 5HJ2A 1VQ1A 4M1WA 3G2HA 5F51A 2RAFA 3ZIAA 5BV1A 3HU3A 3SXJA 1QO0A 3UJHA 2JF0A 4X1YB 1TUBA 2EP8A 4GUAA 1CK4A 5CLHA 4D2IA 1J8DA 3H8JA 4TXNA 4Q9JA 5B7GA 2PAFA 4V2UA 3C0KA 2JIRA 1NAHA 4IDGA 3SSNA 4D3DA 3K0KA 5IHPA 1NYRA 4RSHA 1M3SA 3IUYA 4J8PA 4N5HX 1J5EB 1XR3A 4PX3A 4LJ4A 3DEFA 3OX4A 1EX6A 2N47A 3WIOA 1XBTA 2WB4A 3G02A 4G4SP 2W2PA 5DSTA 1L7NA 1M2OA 1T9AA 4R1UA 4MMXB 4PN7A 3ENKA 4XGRA 1UM9A 1PWYE 3ZEAA 1NLYA 1WCYA 3DF7A 3ICWA 1X2BA 5C1OA 3LX4A 1FPMA 1JZQA 1L7OA 4PLZA 4QU5A 4XSVA 5AQEA 5D01A 4ZN6A 4LF6B 1N78A 2CNNA 1HT3A 1PAUA 1XEFA 4AFNA 4HVCA 2XEXA 1NC3A 2EBHX 4CM9D 4X7MA 4HDMA 3I09A 3P9CA 3KKQA 4PG6A 3OX2A 2DCUA 1R0SA 4O29A 3ROPA 4KX3A 2PUDA 1JF8A 3U1BA 3D7KA 4NCBA 1UT8A 2HHJA 2RGYA 4DNFA 1NWCA 1ZCJA 4W5NA 1G291 2OE2A 2UVPA 2Y1FA 3EZ2A 4FYVA 1QF9A 2J9FA 2B8TA 2GJSA 1GTSA 3EPHA 1RNLA 4A10A 5BQ3A 3FSEA 4TXMA 5KPJA 3GPCA 3PC8C 2FWPA 4LHYA 4TWRA 1KI2A 2OKGA 2VJQA 4J1SA 3VR0A 4EFMA 1H5NA 1DCMA 3E3NA 3OTGA 4HWGA 3GUYA 1T2UA 4PNZA 1HKHA 1RAGA 1SCJA 4G5GA 4RVGA 5LUAA 3WL5A 5F3RA 2GAOA 2GBIA 3L4BA 5IUJC 1QE0A 3DZHA 1YIOA 3OTOB 5B3JC 2HCBA 2G5GX 1E4EB 3PTAA 3E2PA 2IV7A 3CT6A 2C9DA 1ND6A 1RHRA 3F6EX 4C4ZA 5GQSA 4ERXA 4JL6A 5EP2A 3QVXA 4Q1AA 4BCDA 1E8MA 1N57A 1I32A 4JGGA 4X66B 1ZNQO 4IIBA 4CKEA 1OH6A 3W5BA 1M74A 1PTJC 2ID9A 2QZZA 2G08A 1PTJA 5IYZB 5A03A 1UPCA 1AA9A 1JSXA 1A88A 1P73A 2I3GA 2VUTA 2Z2ZA 4ZOEA 1F12A 1LI5A 1IVYA 3VC2A 3W9BA 4RVSA 3WNQA 1U2PA 4K2HA 4NH0A 1XG5A 2G9VA 1QWOA 2YHIA 3DE0X 1QTQA 4HNGA 2MYPA 4G6ZA 3K30A 5JEEA 4RH0A 1A8QA 2D8AA 5LIRA 1PL6A 3CLTC 3ZI0A 4D8YA 1P3DA 3DBVO 4UDOA 3UJBA 3RS8A 4PSKA 5M2QA 1FJGB 2GXSA 3OJFA 1JLHA 2FMKA 1CUGA 3G9ZA 2YMLA 1JL3A 3OBBA 3BD8A 5TMEA 3ZIDA 4MEAA 4C88A 1IQPA 3L1UA 4F84A 4RXTA 3C1OA 2QTRA 5DIFA 4BIMA 1IJKA 2X0NA 1E3WA 1GCIA 4LWOA 4IFTA 4EX7A 1KZ9A 1R8SA 3I4CA 4DV1B 1X7ZA 3EVZA 3LVBA 3H1EA 3E4DA 2HK9A 4F0JA 2BFMA 2I4LA 4I1PA 2FUG1 4WX2B 2JD2A 2GYWA 4JOCA 4UNQA 1KO1A 2OBYA 3W90A 1GIAA 1TM4E 5BN3B 3EZXA 5AXCA 4URFA 1WCV1 2O2JA 4R9RA 4K1LA 1X8JA 4MS1B 1EVJA 2QPAA 2VSNA 5ALHA 1PV1A 1QMPA 1QV9A 2P6PA 2H4XA 1KWKA 1AK9A 2I8CA 2O1WA 2UYQA 5LMCA 1TD1A 4PQFA 1SHJA 2E55A 2QL5A 2YXBA 1WUTA 1T29A 2HNBA 3WJAA 2GHRA 3STUA 3DZ8A 1I0ZA 2MYTA 3AVTA 2VAXA 3FNEA 2ESRA 4KUHA 4MA4A 2JS7A 4J0GA 5BVGB 4XIIA 2K6GA 3GZNA 2GM4A 1DL5A 2GJAA 2PIDA 3DM5A 4G5RA 4QLOA 3PEVA 3S5JA 2I03A 3H16A 3KG2A 4MJ3A 4TUYF 5H3HA 3TMKA 2ZSUA 3D6TB 5SY9A 4IUCS 2AI3A 2FPUA 3QVWA 1E9EA 2I62A 1UPTA 2PWYA 2WV7A 4ZYZA 1G21B 1MGPA 2NO7A 3S6JA 4ZZIA 2C5BA 3GA0A 3P2KA 3FDZB 4TYMA 4NCAA 1JKFA 2W6IA 4YASA 1QK4A 4MI9A 1KP3A 1RCUA 3CVWA 1RCTE 1ISPA 3I39X 1DOAA 4GF5A 2JZCA 2P2LA 2RSLA 3TTTA 4HLCA 3ZDBA 2I2XB 3U09A 1G8JA 4M1ZA 3GLIA 4M54A 2DPGA 1KQFA 5A4AA 3JYLA 1Q0QA 1NUSA 3NHSA 1EP1B 1CZOA 5FBQB 2WZBA 3O8DA 1KTVA 5LA6B 7ABPA 2OCPA 1TZBA 4N12A 3S99A 2QSYA 1DFIA 3O2JA 4XX1A 3AETA 2QQGA 5AW8A 2XKKA 1I2ZA 1W0JD 1OR8A 2B1RA 3F4BA 1R9GA 2VK4A 3A7DA 5IULC 4H7DA 4GRAA 1M72A 2A92A 3RO7A 2JFNA 4GVLA 1E5TA 1FP1D 3IALA 1AS0A 1WVMA 4JYBA 4YO8A 4WXEA 4YJHB 1T8PA 2WSLA 4Z99A 3KQLA 4DV2B 2VPIA 2E3JA 1ZINA 3GEGA 1GTJ1 2AK2A 2Z6VA 3W6PA 3MOGA 2YDYA 3W3ZB 1AX9A 3C3PA 5JWHA 3STXA 4DCGA 4URVR 1WO8A 3SXUA 3C5CA 3EPKA 1Q0SA 2I0FA 1T10A 2YL2A 3A3NA 2FG5A 4OQPA 3SS9X 4NH4A 2Z6QA 1II8A 1W5AA 3EZ6A 3GLFA 1GG5A 1NMXA 1OXSC 4RH1A 1XDDA 4HB3A 5KMGA 5JALA 1NLFA 4IV0A 4R1SA 5BPFA 1QOPB 4B6PA 4UXHA 1WU8A 3RSZA 1FFEA 2TRSB 3CCFA 5IDXA 1EWYA 1KI3A 1YO6A 3F90A 2X5OA 4RHEA 4WACA 1PT6A 5ILGA 4AULA 5IK2A 3N0TA 3PKZA 4ZVOA 3P2IA 1L5VA 2ZTVA 3K0FA 2I65A 3PU6A 4J2OA 4ECEA 3U44B 5HRCA 2AVDA 3V4VB 4DRXA 4XVUA 1N2BA 4HWOA 2BY4A 3OZWA 2B4AA 4PO9A 1KP2A 3INNA 4R7TA 4ZQCB 2UXDB 4F9TA 2O8NA 1GCOA 2NLOA 4WE3A 3UOGA 4BC1A 3WV5A 4Q4CA 4MUIA 1JLMA 1V8BA 3RHZA 2PGJA 1GGNA 1UIRA 4ZA2A 1P5HA 1HGXA 1SWVA 4XIGS 1ZIPA 3EVFA 4KK3A 1EXNA 2LUOA 2FFHA 3D31A 4BFLA 4E08A 4QJIA 5JAZA 4EG6A 2GYVA 2GFHA 4ZCPA 4PAQA 2X0KA 4KN8A 4M9SA 1YS7A 2ZYSA 3RFXA 3ABOB 3PR2B 4C08A 1W0KA 3GARA 1OI3A 4D6XA 2GZMA 3KR9A 4UQLA 2QX7A 3KPJA 1VJ1A 2H57A 1BXRB 2A9OA 3HE3A 3OICA 4FB4A 3DE6X 4FNAA 4HFRA 3WISA 2DERA 1RJDA 1ZNZA 1AMOA 1R6BX 3NTQA 1JS1X 4ZVTA 3B1YA 1G41A 3C4JA 1HLFA 1HG1A 1TEHA 5KQPA 1RJWA 5K3OA 3ETGA 1ULBA 3HUUA 3HB9A 1N4DA 4ZC8A 3COJA 4DKJA 1XMVA 1KYXA 5F76A 1MD9A 3KLNA 4NATA 1KORA 3IOCA 4B9AA 4GT1A 4MVYA 4CDNA 5KYXA 4QKQA 3FCYA 1UJBA 2NU8B 3C6ZA 4J29A 1BH2A 4DXAA 4A0QA 4PZ9A 1UPUA 2RAUA 2B92A 2PQ0A 3OU7A 1U2DA 2ZBUA 1X39A 2WNSA 4MWDA 4PHTA 3VMFA 5AVYA 3IRVA 2KMLA 2BGUA 3GRZA 3HKEB 2EQBA 4WADA 4L9AA 3ESXA 2BFCA 1UBNA 3QUTA 4I1OA 4Y9TA 5D51S 1TTTA 3L6OO 2IWHA 3UMSA 1W35A 3ICPA 2GRAA 4QNMA 3R77A 4J91A 4ZKDA 3IIEA 1V2GA 1WEKA 2O2SA 2OK8A 4FZ3A 4JJ7A 4R3NA 1FX0B 3X1YA 3QQ5A 4TSFA 1E7SA 3BGIA 3CE6A 3PPYA 4NCJA 2ZBEA 3C1UA 4W1SA 4WZAA 4EJSC 1WQ3A 1UPFA 4G85A 3DXFA 1K4KA 4KE9A 1X9HA 3D1JA 4QYIA 4R3WA 3RWMB 1FYXA 4XIFA 5IANA 1HDOA 2PMWB 4D82A 1JJVA 3QVTA 5TARA 3SX0A 5I7HA 1JR3E 1LFAA 3UNXA 3OCVA 5JDIC 1YR2A 3KQUA 4ROSA 3C7TA 3F7OA 3PYXA 4I4TA 1Q22A 1RRVA 1XLVA 4ZAZA 3ZW8A 5KQMA 1SU4A 1O4VA 3LUAA 1FDUA 1OT3A 3DVLA 1GZHB 4RABA 3UIEA 3VKVA 2YFKA 1OWNA 1ZJZA 3Q41A 1M73E 3H7IA 2C8VA 3OF5A 4CDMA 4D0NA 1NKVA 1QXSA 1QKIA 2PTGA 3KQPA 1C7FA 3F6RA 1ZUWA 3I9OA 4E6PA 1C9YA 4WK2B 1VHQA 3O9MA 1Q7CA 5HJ7A 5DX1A 4CM6A 4YR9A 2UUAB 4PLFA 2PJRA 2ZB4A 4PYMA 1VCMA 1NUAA 4KPUB 5L51A 4DNQA 4YRAA 4XDGA 3P52A 5BYJA 4TTPA 1E3WB 1PFWA 2GZDA 3UWSA 1P80A 4MK4A 3VPXA 1XWFA 3THYA 3ROXA 3SP1A 3PFCA 4KMOA 5FNVA 4YMTA 3TPCA 5A5FA 1BVYF 4HNTA 3K32A 2WUVA 1P1CA 1GT91 2DWCA 3C6QA 4TLEA 3MJTA 3K9NA 1S2OA 1EK6A 1YWGO 2EZ4A 5TPWA 1ZM9A 2VQ6A 4UMVA 5GM1A 4X60A 1CUEA 1EVLA 1RHJA 1UBHS 1Z2NX 2LIVA 3E8SA 4U9HS 4AF7A 1XQXA 1P0CA 1PJ2A 2E87A 2PM8A 2GZHA 1LI7A 5JI2E 2VHQA 1PEYA 3KEOA 4JN6B 2DLNA 1S2IA 3OPXA 5B1EA 5J47A 5KU1A 2YWCA 4EUFA 1CY6A 2ZYAA 5IVHA 3I9KA 3JYNA 5CYFA 1M1UA 4ZI7A 1JYFA 5A9RA 4GDFA 2BWJA 4M8IA 1YUNA 5FA8A 1J0DA 1L7QA 2BBTA 3PXBA 4MKIA 1ZLYA 2HA4A 3ZZTA 3QE9Y 2OB1A 4JVSB 1K6EA 3H2IA 1U9YA 1E2EA 2EXXA 5H1YA 2I9PA 5C7OO 2O2GA 4PYOA 3H87A 5DYTA 2H9IA 5B12A 2C7RA 2KB0A 3QXXA 1IUPA 2NZYA 2UUOA 3UUWA 4MP8A 3KTOA 2FSGA 2W70A 1KAEA 1O0SA 2GAJA 1AM4D 2QGNA 2W2LD 2ZBPA 3E2MA 1PJSA 4MAAA 4YQZA 1BVHA 4LRXA 4MRMB 3WP0A 2Z9BA 1DRKA 4FX5A 4ZOLB 4HQNA 3CBQA 4RNDB 4D3XA 1CIPA 1TZJA 2IHJA 3O8NA 4MUJA 1PWZA 5HFNA 4GS5A 3RIEA 1YRWA 1V41E 1Z6GA 5E3JA 1XWWA 3DAFA 1QH1A 4QVKA 4BO6A 1HG0A 4G07A 2NYUA 2AUNA 4YRRA 1OB5A 1CHDA 4GOJA 3K0AB 4RTNA 1SQ5A 4RK4A 1K6MA 3W79A 4B7UA 2R84A 3Q72A 4FSHA 4Q9NA 3ADKA 3VKHA 1H2ZA 4W1PA 3AVYA 5JMOA 2D0IA 1CUYA 1KI7A 1VMIA 2P4HX 5HVNA 5FPQA 4KQ9A 2WD8A 3I2IA 3DTYA 1LD3A 1H2RS 1PEAA 3LKZA 3QRWA 2ZZNA 3FGOA 3EDQA 1YDFA 3WZ2A 5J4HA 4JEIA 3DKRA 2FWNA 3ND8A 1DAHA 2YDXA 3WKCA 4CF3A 2YH2A 3EWNA 3OTIA 1XTBA 4DL9A 2GD2A 2GM5A 4CI9A 4RV4A 5JPCA 1D2HA 4HAXA 5DNAA 4DMKA 4QQFA 4XFKA 1IFXA 4RQUA 1TQ8A 2E4YA 4KPUA 1N5OX 4CMEC 3GRYA 4I3GA 4OGFA 1ZXBA 1ODKA 4UHHA 2IZ1A 1E6LA 1ONSA 2BW0A 4H4CA 1GGJA 2NVOA 1FYVA 3N0VA 1P2FA 2XODA 2ZS8A 4HVTA 5AVTA 4DLPA 4G1EB 1K3UB 2D8MA 2ID4A 3HCPA 3NNNA 2IPMA 4FCVA 4QPJC 2FW9A 2OP0A 4P7JA 5KWIA 3PL1A 4H3KB 3EGVA 1T5TA 3A05A 2EIHA 2Q5HA 5AW2A 2WUWE 3H86A 4AZ3A 3E70C 3IOBA 2CMKA 3KVNA 1TKAA 2CY0A 4PC3A 5AI6A 5TX7A 2V8BA 4WAUA 5LR6A 4CEIA 2HPHA 3NBXX 2Y1DA 2ECPA 4BNKA 5JAUA 1VECA 2EBWA 3PHLA 1SUSA 3CRMA 1OIVA 3AM1A 1U8TA 1OGJA 3FI0A 4WOBA 3TOXA 3B82A 5JVDA 4HKTA 1DEAA 2ZJ6A 1TO1E 4YJFB 2J0VA 3GAFA 1YVEI 4M1QA 4ER6A 1J0CA 4FQ8A 4ZOLA 2JJ1A 4OG2A 1NWHA 4R98A 1N34B 1KAOA 2H00A 2C77A 1NBME 5AOVA 3W5UA 5JU6A 2VWPA 1QHGA 5A4JA 1Z7WA 1J2JA 1GFSA 3WL6A 4IMRA 2B4QA 5EFOA 3T1OA 3HBAA 2VDRB 3B6ZA 4GR5A 3V8VA 1R16A 1G20A 3WJ2A 5FUXA 4CMAA 2EFJA 1KBOA 1M2NA 3GZTB 3MJVA 1ENPA 1K63A 4MJXA 3OHPA 1W73A 5EESA 1O57A 3TMAA 3SNHA 3ORYA 1GAQA 3PDIB 4QEDA 2Q28A 2QRVA 4M0KA 4KODA 1N3IA 1SPBS 3WIVA 1FB5A 3PYMA 3B52X 3DR3A 3BG5A 1U3FA 1OFUA 1HEUA 3LWZA 5BQFA 3LF1A 3FUCA 2POCA 4IO0A 2VSYA 4F4CA 3NT5A 4Y2QA 2VDUE 1LSUA 1GYPA 2C4TA 2W2TA 3GA7A 3ZI4A 1U2QA 3MMZA 1CEXA 4D45A 5K4GA 3P94A 5EKUA 3FZGA 1Q12A 3ZDAA 4EHKA 1SXJB 4KWCA 2W6CX 1MOZA 3GJTA 4R3UC 1P31A 5EJ4A 4BO8A 2EVWX 3KPUA 3Q5EA 2PGLA 1VIVA 1ESZA 4S24A 4XWKA 2CJPA 4HO1X 1FUEA 4I50B 1U7ZA 1HF3A 3ZQ4A 1ZZEA 5JHHB 1ZITA 2OC4A 1QHHB 4R9NA 2ZAOA 3V34A 4L4ZA 4OUKX 4U2KA 2E18A 2GXQA 2J6BA 4R8SA 5B37A 4DYDA 3GAAA 4Y7DA 5CIWA 5CP8A 3NEAA 1KK2A 2H1IA 4LA4A 4UHCA 1H2YA 4FYYA 3D43A 2ZQ5A 4C01A 5J4YA 5HFJA 4HNSA 4F5ZA 3ZHXA 2O0HA 4NBNA 2WQ6A 1Y5MA 4Y2YA 2OQRA 3TFQA 621PA 3QEBZ 5KTSA 2XVAA 4R2MA 5FA5A 1V2HE 2YBDA 1H5UA 4DADA 1Q1NA 2QX8A 5IJ0A 2QU7A 2O8BB 2A1TS 3O4GA 2GZSA 2KBEA 1Q83A 1ZESA 1E0KA 2CFSA 4KRYA 3IJEB 4R2HA 2O59A 5F1OA 4LQ4A 1KXZA 2WA2A 3AT1A 4AK9A 4IH1A 4ZGBA 2MT9A 4UEKA 2JGDA 4R2JA 4XOIA 3TDMA 1Q0HA 3B2QA 4XD7D 3IVAA 4ENUA 1NW4A 5KSWB 1K2WA 2UYCA 1MCZA 1JXMA 4C0QC 5DW3A 3ET5A 1OXMA 1MABA 4LVUA 4E51A 4BNDB 5JNSA 3DGFC 2WILA 2F4VB 3H9GA 2IIVA 2ZTMA 4UMFA 3UXEA 4URZR 3Q8WA 2W2NA 4BNLA 5KMGB 5D3MA 5FWXA 1DJQA 2XW6A 2H08A 3H2YA 2X4LA 4JVMA 2DPXA 4UKDA 2EQ5A 2Q46A 2X1MA 1G8FA 5ITVA 4L72A 4OATA 1NBMD 2FHSA 3BB3A 3E9ZA 1Z13A 2YRXA 3DWIA 4Y67A 3N8GA 2DBYA 4N03A 3IESA 4BZZA 3QTTA 2Q0SA 4Q1EA 4MQEA 3V2HA 4OYRA 2I7CA 1O95D 1YDGA 1ULUA 2RH5A 5AW3A 3P45A 2XNDA 4PFKA 5AUQA 3OZBA 1QU3A 1YZUA 3R3WA 3MWJA 1GNTA 5EFZA 2P2DA 3A3KA 3KL4A 2G0NA 3TX2A 6PFKA 1OWMA 4TXHA 3EGXB 3OP1A 2VZ9A 1ITZA 5CK4A 2BGLA 2YC4C 1XZHA 3D6NB 3S5UA 4MVCA 3ZU2A 5BW6B 2DFDA 2H8GA 2VF7A 4R0NA 1JTVA 1W1IA 2PRJA 4QTXA 3CH4B 2IHBA 2G9UA 1IUNA 3HFSA 2COKA 4HGQA 3K5WA 5DHAA 3ZV3A 1N5DA 3DZBA 3PP8A 2JLRA 5I8ZA 4YIKA 5GOZA 4OV6B 3LPCA 3ZXUB 3ZY6A 3WYGA 2MJLA 4UDYX 5TQ0A 1XZNA 2ZRLA 5EZYF 4I4LA 1T1SA 2QLJA 3UCFA 4A23A 1RRPA 5HKOA 2I78A 3FIJA 3FYSA 3GJYA 4KXWA 4Q03A 1WB5A 4QYMA 2Q2NA 1GCUA 4YCBA 1Z56C 4TMVA 4F3YA 4IRXA 4D80A 5JZ9A 2DMRA 4OQQA 3H6HA 3TQIA 1F3LA 2BM1A 3WTBA 4CIAA 4HRXA 4JA2A 2YWHA 3DYBA 1N3LA 1KS9A 2MDTA 1WHSA 2BMWA 3C14C 3JVDA 4R8KA 3QP9A 2X6QA 2E5LB 4UCFA 1HE5A 4R84A 3MJFA 3KU4A 4IIEA 2IYRA 3OQIA 4WY2A 2NG1A 2P62A 1XNHA 3HLYA 2RD2A 3HRHA 2AFIE 2C7VA 3OJWA 1T25A 2C7BA 2CDBA 3HWWA 4X7BA 5L3RA 3Q88A 4K40A 2PFKA 3PJDA 4R9UC 3TI9A 5JROA 3QU4A 3ZD8A 4ZDIA 2VRCA 3KAQA 1UBKS 1IRIA 3EVTA 3BZBA 2J0UA 1QHNA 1DRWA 1XKLA 4S1NA 2XCQA 3FGPA 2DR3A 3Q1LA 2HTFA 1YFJA 3KXDA 5HMMA 3BXZA 5BSFA 1QP7A 3LWNA 4D9GA 3O1HB 1Q19A 4WBXC 1A5BB 1TLFA 3K1AB 2JKVA 1R5OA 2IUTA 4B6OA 1EUDA 2WU1A 5A06A 2HJ9A 3T6KA 4CI0B 3PT5A 4BMXA 1ISMA 3GVCA 1L5MA 4DWJA 1PZMA 2PZKA 3ROFA 3TB4A 1COWD 1ZGHA 2VAWA 4CE6A 1HH4A 2HWUA 2Y76A 1MRZA 3GFSA 3WIDA 4BRSA 3UY4A 2FUG6 2H4HA 2JJYA 4WUTA 3RUDA 2BBSA 4OVKA 5J4VA 3D4BA 3O26A 2PV0A 4P83A 1K5PA 3P96A 1B8VA 3I9NA 4UEWA 4V3BA 4NBUA 1Q0LA 4MW9A 2HF7A 3FAKA 3J7TA 5AOBA 5HF9A 4DSAA 3RC7A 2PZGA 3TXXA 4ZRMA 3X1WA 3L7CA 1QYXA 1W6RA 1JHAA 1E8DA 4ZVUA 4Q34A 4DNXA 4NOMA 3PPWA 1T3SA 2QI9C 4I5IA 1CDZA 4QWMA 3PIDA 1XQ6A 2QJWA 3AWDA 1RYFA 1MAVA 4YRMA 2ZROA 5JBNA 4EEZA 3U7HB 4M8KA 5E7JA 3RQIA 4I19A 2YN2A 3NVKI 1CWUA 4ANFA 1R4MA 1PHPA 2C98A 4N65A 6AT1A 2IITA 2JGIA 5G0TA 3TOCA 4WZBA 3N2YA 3LY5A 3BD9A 5AR1A 4TV9F 4CQNA 1OTXA 2J07A 1CV2A 3H1BA 5DTMA 4PE5B 3K16A 4CM1A 4HDKA 1IPFA 4M86A 4Q1DA 4QDKA 4JVLA 4NX2A 2XZTA 4LYFA 5TGDA 1WRBA 2M98A 1WF6A 4AY2A 3O1IC 3PVZA 5CT8A 1JSLA 5AT1A 4MVJA 3OQIB 1BEUB 1DJPA 3E84A 3AXTA 4WY5A 5FEMA 2MR6A 2GUWA 4FOTA 3QGMA 4BQSA 4CR8A 3WA6A 3NP9A 3KJFA 3AERA 4L1KA 4MB0A 3SSMA 1E5QA 2ZETA 3ILYA 1LPPA 4D8TA 3KKOA 3IPCA 5J5VA 3ZD9A 4KN5A 2XNCA 4ZPXA 2N1MA 5A0VA 4PZLA 4X64B 10MHA 4KIGA 1NPYA 1WP4A 3ZXIA 3ADDA 2V4UA 1R0RE 2WYVA 2Z5VA 2X7JA 3ABIA 3TLXA 4EAAA 2QVCA 2B99A 1S01A 3QHQA 3B9BA 5EWLB 4R5MA 4YC7A 1IEXA 2VSFA 3AHFA 3GLRA 4JQYA 4E3WA 1S7GA 1VMAA 2FVYA 2OILA 1VFNA 4IV8A 3HEMA 2ZXUA 3U6KA 1K6IA 3O0DA 1ZHOA 2PKEA 2J9FB 4Q4AB 1ZJYA 2VHUA 5E1OA 4ZVRA 3TCNA 3M4JA 2VSOA 3TH5A 1GRCA 1UWCA 3U44A 1E61A 4QUKA 3SQDA 1MNQA 1K7EB 4L3VA 2OT3B 5CA1A 3GIDA 5J2TA 2PUEA 3UHAA 5EHIA 3OPYI 1J1UA 5A7HA 1VYHA 2ZBQA 2X1HA 3ONEA 4U2EA 4N3NA 3W2HA 2IX9A 4BFXA 4YV0A 2MINB 1EUCA 2R25B 3MTAA 5CCXA 1FW8A 2AYYA 2DFNA 1ONNA 3QNUA 1KAGA 4HDSB 4BPRA 2OORC 3KO8A 1FNBA 1IK6A 1YQEA 4S1PA 1K7XB 4DHWA 3VR3A 3OOYA 2W11A 3RCBA 5K8CA 2I4MA 3FYCA 4FYHA 3FBTA 4L57A 4MLZA 5BSHA 1DBVO 3O4JA 2ZRPA 4GECA 1EB8A 1E32A 2ZRQA 1R9NA 2V7QA 1HT1E 1O6CA 1QB7A 1RYYA 2Q29A 1BJRE 2HO4A 5EJGA 3BCUA 1BC5A 2ZRAA 5DGXA 5ALMA 5B6JA 4YXFA 2PSSA 4RD1A 1G38A 1HQDA 2FN7A 3OSUA 4ZV4A 4DLTA 2FUEA 1T91A 1EJBA 4YP7A 2ZU6A 3T3OA 4EJ2A 1DVRA 3E9QA 1I80A 1TM7E 3H6KA 1LK7A 1XX6A 3PHIA 5K3DA 3V1LA 3RBZA 3I6QA 1JQEA 1MORA 2F00A 2QG6A 3AEUA 3H1FA 3R3ZA 4R8MA 4UHFA 5TT0A 3VHXB 4PYJA 2DUWA 2XMSA 3KQNA 1BDIA 2DUJA 4FT4A 2H1RA 4GZMA 3ML1A 5DKFA 2W42A 3RKRA 1B8UA 2JIBA 2EJBA 2W7TA 3IPAA 4N8EA 1TQHA 1V7ZA 2AQIA 5ELLA 1T9BA 3FY4A 4EA9A 1E4OA 2AW3A 3R3XA 3KR0A 2BEJA 1KAQA 2YWXA 1GU1A 4QICA 5LDGA 4X8OA 1B2LA 4WJKB 4QAQA 4PTYA 5EMLA 3ZHSA 2FTKE 2FV8A 2YQZA 2ZBFA 3SBEA 1P6UA 3IQEA 3ANMA 5HGXA 2B4TO 3UHJA 3OG9A 3GUVA 4OLHA 2WWFA 3U81A 2QTWB 1W34A 2APJA 3M34A 2CHFA 4YV1A 4FHFA 1Q11A 2WFAA 1NVMB 1Z18A 3OFND 3ICOA 4OXXA 5FUBA 1A8SA 5CLQA 4D46A 3EC7A 3OCZA 3L8FA 3UK0A 1BXKA 1E3TA 3IT2A 1X1CA 1T6BY 3LAWA 5DM2A 5EMNA 3ZV6A 2BZSA 3WGIA 2IYTA 2FW8A 1NN3A 5BVGA 2F3TA 3HXKA 5FJJA 5H9VA 1UBSB 3QYFA 1SU6A 1X2EA 2H48A 3IO3A 4QXMA 1R0BA 3RS3A 4FMBB 3UYLA 4HEHA 2GK4A 4NCKA 2ZI7A 5DTRA 4N3AA 4MI3A 2Y8EA 1J23A 5ALIA 4C0BA 5JY6A 3KEFA 1TW3A 5HNKA 2PX6A 1Y1RA 5KYVA 4EYQA 1LBSA 3BD6A 2LCQA 3P9YA 4YRNA 1Z45A 3GELA 1BG6A 3K2BA 2QR3A 4LVOA 3B60A 5JLAA 1YF3A 1T1IA 3TKAA 1XD9A 1KY5A 1IRXA 1GR1A 1JLLB 1TTHA 1V96A 2QYTA 2Y4OA 3GT0A 3EGDB 2C2OA 4HPWA 4O4JA 5GVRA 3MFQA 1NM5C 3V1TC 4AJJA 3I5YA 2VRBA 3IPYA 4MEBA 2WJAA 5L8VA 2VPTA 1OE0A 1FZTA 3DOUA 2C2GA 1DU4A 1FDRA 1DEXA 1I4DD 2BKVA 3CLHA 2BZ0A 3PK0A 4JJEA 4JUFA 4S1VA 3DE5X 2GR9A 3TLCA 4G8JA 4ENVA 5LJLA 3PKIA 2GSDA 5JJLA 2J7KA 2RKWA 3TW4A 3ZK8A 1P29A 4FFDA 1WBBA 2BEUA 2NSDA 2GN0A 3FOWA 3ZYZA 2HZBA 4A2CA 1A8UA 1Z0DA 4D02A 4F4HA 4ENRA 1H9CA 4Q4HB 2LRHA 5DM1A 5CT5A 2HIHA 3P9XA 2IXEA 3CC8A 4IEEA 1RWVA 2CZCA 3I52A 4L0CA 3WDSA 3WMWA 3WDLA 2HHHB 1K5DA 4K6OA 4KBGA 1FVXA 3VPCA 4BNTA 4C29A 5AK6A 1LI4A 3MQ2A 1JHVA 3AL3A 3QVVA 4GH5A 5B1YA 1YCGA 1B3BA 1N2OA 3F96A 1AOXA 3EE6A 3TRIA 4DUYB 2QL7A 3OF2A 4HLUC 3ZWMA 3U4QA 1CDDA 1P72A 1XZBA 2JZOA 4WN9B 1KVTA 4TRMA 3BGWA 4BRZA 2IBMA 3HB4X 1TYDE 2DPLA 1NBMA 3LO5A 4PNHA 3T7TA 4HYEA 4EARA 4FDAA 5JPIA 2GNOA 3K73O 3HWRA 4JLWA 2WVJA 3DMGA 3GWGA 4F3KA 1RRGA 1D4OA 4RTPA 2FEKA 1AZWA 5HFAA 2DCMA 3BF7A 2QLLA 4PG4A 1HQKA 4JC0A 4LK2A 2JLZA 3FTDA 2GN8A 4ZVMA 4BWVA 4AMVA 1C9EA 2A4MA 3NBAA 4NECA 3W5AA 1W0CA 4KN6A 1ZP6A 3O3CA 5B1IA 1FTGA 4POOA 4RJIA 1DT5A 4ZAGA 3LUFA 1IBMB 1DWUA 1I1NA 2FA9A 4L8WB 1EG7A 3RE1A 1EZZA 5CM8B 2PX8A 3ACCA 5A5DA 4IQ0A 1Z2PX 1N5IA 1OD6A 3MD9A 5H5JA 3RRFA 2I54A 1RM0A 1TJNA 3PC3A 2B78A 2WJJA 3I42A 4DJEC 1PV2A 4QXPA 3U4IA 3RUCA 1S8OA 3NNDA 3EXEB 4UEOA 2AUMA 3E7XA 3M2TA 2V7BA 4PG5A 3RYFB 4DSZA 1PFQA 5GINE 1SXQA 4K2AA 4D4JA 3KB6A 2GX6A 2IPNA 3SDBA 1MH9A 2O5CA 1IZ8A 1PYGA 2NTEA 4ZFNA 3LPNA 5DRYA 1UKAA 4GM1A 1XEWY 3T4EA 3WB2A 3RRMA 2FPSA 4ZEMA 1YZTA 2ZKLA 3S81A 4BY9E 4H6VA 2CBGA 4Z7NB 9LDBA 4RTJA 2FN3A 1VJ0A 3DVRX 4B2PA 2YXPX 3QE0A 3W0LB 4DBZA 1ZEMA 2D2IA 2ZR7A 3FKSD 3AK4A 1TEXA 4NU0A 4DRYA 4F3RA 1E2JA 4MQ6A 3VHLB 4U0KA 2WWRA 3JR7A 2KLBA 2WNIA 3GLQA 4P32A 5E0OA 3SQWA 3MRXA 2WF9A 4LYJA 5M34A 2P5TB 2DUUA 3NORA 4HFNA 4MVJI 2JGEA 1DKMA 6NULA 2BM8A 4MV4A 1EK2A 4EG5A 1PFVA 2J3QA 3EEFA 4DLWA 1P2DA 2VQ3A 4PZCA 4HAUA 4P7KA 2CVHA 4ER3A 3KUDA 1LQ2A 4UE3S 4HX9A 5AI9A 3PUHA 3WE7A 3QM1A 4XR9A 5IH7A 1QF7A 2XCIA 3WYDA 2NYAA 4KE6A 4O63O 1BN6A 2J31A 3IVGA 4JCCA 4XWGA 1U2GC 2PX0A 4WH0A 2MINA 3SYLA 2TYSB 3I9V1 1BXZA 1XLTC 2QMHA 1HT2E 2R5NA 1OBOA 3KU1A 1M8JA 2EZ9A 4KQGA 1L5KA 3T61A 1MLDA 1YCDA 3I73A 2H18A 1TXGA 3PUVA 1PG5A 3AWIA 4EBFA 1VKNA 2NPOA 4LXTA 4XYMA 5K4HA 3AOGA 3VM6A 2Z5FA 3E53A 3SYNA 4NDNE 4C14A 1G59A 3BAZA 4TSRA 3D8BA 3UG7A 2QVZX 4DMLA 1O6GA 2VF5X 1L7MA 3X1ZA 2B83A 2HLNA 1F8XA 3AYZB 3HA5A 3K4HA 1UBGA 2LCFA 4MPDA 5TRTA 4Z0PA 1IHXA 4NCHA 5BSGA 3IIIA 2J41A 4HYQA 3ROGA 4YX9A 3QKSA 3RWOA 3MXOA 3CH7A 4D79A 5J4KA 3DZGA 3KUUA 1GUAA 1I5RA 5L3VA 5AM0A 3LIIA 1J07A 1E3LA 3LL4A 4FDLA 3DBHB 2QNIA 3UV3A 3HA7A 3IH5A 3H6GA 1JU9A 5ALYA 3ASVA 1GYQA 4YP1A 1SIOA 5AKHA 1KRWA 1J1IA 3CWQA 2F43A 4PFQA 3BMCA 4HEQA 1DRUA 3DV0A 4RK7A 3LPLA 5CA1F 4GKKB 4W5JA 1Q0PA 1Z7GA 4PYNA 3AERB 1M75A 1D1QA 1JA9A 3UQZA 3EPJA 1V1JA 5NULA 4N5LA 5AXAA 3NTLA 1W5SA 1BXRA 5A9SB 2NN3C 2ECOA 2BSXA 1I7SB 5AKIA 3EA5A 1A9YA 3IE0A 5IHXA 3PIRA 1E2NA 5EXSA 5FT9A 3CZQA 4PEVA 3EXHA 1DNPA 2C0QA 4FOSA 1B42A 2YFQA 1UMCA 2E5WA 1Z5PA 2HY7A 2JGMA 1OHHA 4KXYA 2VPXA 1LLUA 1QH8A 5EIWA 2IVFA 1KOGA 1KP9A 2J67A 3ASZA 3LDHA 4EYEA 4ZOBA 3T7EA 3WRWA 8LDHA 3EF1A 1PG0A 3MT7A 3AR6A 4E94A 2ZCJA 1M2VB 3NASA 3OO1A 4M0EA 4W9NC 5G3YA 5GONA 1KY3A 4AF6A 1CR6A 1ZM7A 4W5RA 2MWMA 3DR5A 1AGPA 3LCMA 3DUWA 3KKPA 1ZD2P 4H31A 1C29B 1AE1A 2Y68A 4GGPA 4JR0A 4QFBA 1KZGB 2KPOA 4P81A 4ALJA 4CWAA 5FA6A 3ZZUA 3T5DA 5TC4A 1W5BA 4BYGA 3A3OA 1U5AA 3GQBA 4LQDA 3WXMA 1D8AA 1H9AA 1UEJA 4KO8A 4ZI2A 1QTRA 2A0XA 1DDIA 1WM1A 1RRKA 4WKCA 2B69A 4H16A 1O7JA 3C8MA 1LUAA 1RTKA 2VZEA 3IE1A 3R75A 4YCCA 3Q7QA 5FX2A 1NF3A 1RLJA 1S3FA 2AFIA 3G0IA 3OHSX 4BU0A 4C0AC 4N7BA 3AB8A 3H5AA 4F7DA 2VQSA 1BH6A 1E7WA 1Q1EA 2YINC 3DE1X 3TLGB 2CWDA 2HIAA 3BL5A 3D81A 3JATB 4WOCA 3EA0A 5DSXA 5IBQA 5ES3A 1F6WA 1NI4B 3L8GA 4IDNA 4O1HA 3USCS 2GI4A 1R66A 1ULAA 4DR6B 1P9NA 2AI2A 3EVDA 3ER6A 3B5IA 4FHEA 4L15A 4DNPA 2X8WA 1NVGA 2YNMA 1V6CA 3ENWA 3LA8A 1U80A 3TK1A 4DILA 4GLOA 2MIIA 3GY0A 4E4TA 1J7KA 3UAVA 1W36D 1EINA 1RACA 4MCIA 3V2UA 2HC9A 4LY9A 1XDUA 3JALB 4R2KA 1ZH4A 1SUAA 1LB1B 3AR5A 3VU3A 4Z1OA 2DWPA 2WKQA 2ZK7A 3CT4A 3O92A 3Q7EA 4WIAA 2CUZA 1PZGA 1GGEA 2B34A 2CL5A 4ND1A 5FADA 1SHKA 3DMYA 2CLFB 4EF6A 3KQSA 2FQYA 3VZCA 2VSXA 4ZP1A 2C61A 1FRFS 4GW3A 3B48A 3M5CA 1WPGA 1W0KD 3QKRB 2D1QA 3MTEA 5DGDA 4R71A 2L42A 4G0XA 1DP4A 2N46A 3OM9A 3QLUA 3BIOA 2VDMB 3NTOA 1HE2A 4LDZA 1USIA 4YJKA 3EOZA 3OETA 2GN2A 2WIKA 1ACMA 4AZWA 3H13A 2XMDA 1TCCA 2WKRA 1HKUA 3FRJA 4XARA 4BV9A 3PQ8A 3PA8A 1YRLA 2VJKA 4PIMA 3ZWWA 2B36A 2AMFA 3NWPA 4MEJA 2PLRA 3P9KA 4NFHA 2YYZA 3IUJA 4Q3BA 5DBFA 1HWYA 2D0DA 5ESXA 3EGIA 3K0FB 1JTEA 5BOVA 4BYMA 2ONZA 2V7GA 4GX0A 5CG2A 3AZQA 3ZU5A 1BDMA 1DBSA 1JAYA 1PQUA 3U4DA 1M2JA 4WZBE 2GFIA 4RJLA 4IUDS 4PINA 2DP4E 1L5RA 1QZXA 1P5JA 2KYRA 1XZPA 2PYDA 4FJ1A 4X92A 4XX0B 2GZAA 1N6IA 3FETA 1DOHA 3RK4A 2V97A 3FPBA 1RYZA 3O7WA 3R6WA 1GU7A 4LKOA 1WCIA 5FHQA 1SBTA 3ZHYA 2VC2B 1NF2A 3T7KA 2R1ZA 1ATZA 1N25A 4FK8A 1QV6A 3RVKA 3STYA 3W3AA 1WMEA 1EEXB 5EERA 4FB5A 4XEUA 4KWIA 2O7RA 2HJRA 3ITNA 4F85A 5HM6A 4GBMA 4H0CA 5CA0A 5LQMA 3BICA 4RLQA 1RRFA 4AY5A 1E5LA 1R6XA 2R47A 5BT8A 3AL2A 3A06A 1A2BA 4KYIB 3KKLA 3ZLVA 1U0SY 3PUWA 1G7TA 3H3XA 3HPQA 4JI6B 4WLVA 3GH3A 5JXWA 4Q9LA 2R11A 2BVNA 3ELBA 4KE8A 2I2DA 1M1NA 1N6RA 1T6NA 1XLUA 2XTAA 1K68A 4JBGA 4EJ0A 2LTAA 3A32A 2FX3A 4D96A 4RXUA 2P1DA 1GPJA 2GBPA 4NENB 4WASA 4UVHA 1R8YA 4NEGA 1NI4A 2HEGA 1CHNA 2C1XA 3REQB 1RZRD 2GXUA 2H2FA 4EG3A 2XDQA 5FV7A 3NHFA 5LPNA 4KR7A 2XRYA 4HEJA 4KO2S 1SR8A 1KK1A 3MWFA 3G9XA 2AOTB 1OC2A 3EQ2A 3K6SB 2E4VA 2JLVA 3JYOA 4RE5A 1WB6A 1B93A 3RUHA 1OA0A 4KWHA 5C34B 4Z2YA 4AD8A 1U7HA 1DKNA 3U60B 2P4UA 9ABPA 4AUKA 1E9SA 3E9YA 1HPLA 5CUQA 5EJ8A 3BF8A 3MAGA 3AHJA 1RYDA 5CCEA 2OKCA 4P4GA 1MB2A 3CUVA 3J7AC 5EE0A 3KIPA 1F17A 2CFIA 1KFCB 2QUJA 4PRKA 3KB2A 3G8AA 3BMQA 3IMGA 5FTKA 3K0HA 2E4AA 5EIHA 3DEKA 3WX0A 2PWZA 3TR0A 1GKLA 3I3OA 4QDOA 3LZ6A 3LPAA 5J2UA 2Y1KA 2CNLA 3HM9A 4EF5A 4POAA 1R27A 1XQ1A 1J0EA 5JXJA 3UMYA 1CDEA 3QLVC 5HK8A 1W52X 4M9RA 2G3YA 1NVDA 3LNTA 4M9CA 2QW1A 2H3HA 2QN2A 3PDUA 4JLMA 3FIUA 2O3JA 4DE5A 3IQHX 3NP7A 4B83A 2AKEA 3OCWA 3FHOA 4X9XA 4L0DA 7REQB 2X5JO 2ZUTA 1RLOA 1FNCA 4I55A 2QD5A 1I2AA 3P2JA 4D3SA 2HPZA 1SZCA 1AK2A 2D5BA 3TSCA 1W59A 3WK8A 5BY2A 4M83A 3JQ6A 3HO6A 4JBIA 1ZISA 2B37A 2H4YA 3TSYA 1R5NA 3DOHA 1C80A 3LQYA 2IZ6A 3R0ZA 3RUFA 1CZLA 2XJ4A 1I3CA 3CEJA 3EXHB 2QE7A 1VHLA 5AVUA 2YZ7A 3C8HA 4R1QA 5BWNA 5JAIA 1G8KA 1UDAA 5KWSA 5A1TA 1CQJA 2BM9A 2X14A 1E3MA 4LMBA 3IUPA 3DH0A 3O2SB 3O4IA 2V6GA 4BDTA 1PT7A 4OHKA 3MGCA 4YI3A 2JLWA 5D86A 1W88B 2ANCA 3M6WA 5A4FS 3KSBC 4AKEA 4O2BB 4XPIB 1KE1A 2R5FA 1GZ4A 2H07A 2ZCUA 3PDIA 4EY3A 1JEJA 1DLJA 1U1DA 2B5WA 4QBKA 4C78A 1FS4A 5I6DA 3LOPA 2QUZA 4CV0A 1YC5A 1F7UA 2WWXA 1D2CA 2ZYTX 3B2NA 1YUBA 1T2NA 1OLSA 1NRWA 1CRWG 3EW9A 3RU9A 2IXBA 3LBAA 4P7BA 5ADUS 3EDMA 3KYCB 4JBYA 1D3AA 1PUJA 3GFRA 4QGBA 5EVJA 1H69A 3S2UA 4JAVC 4AJ2A 2JDID 1XPUA 3G0BA 4Q3NA 1IQ0A 4J7CA 1T36A 4F2HA 1I2DA 2PMDA 2M32A 4MVJF 1A9SA 4RZ3A 5H16A 4BGUA 2HREA 2X8LA 1SKYE 4H7EA 3TEJA 1GPKA 3GW8A 4O8ZA 2CVFA 2VHYA 3FOAA 4CDGA 4ZODA 2CJYA 3ZIUA 4NZPA 5EWMB 1F51E 3ZOZA 4ZJPA 1HORA 3UT0A 3NIBA 5I9MA 3WWZA 3GLUA 1OWOA 1LLDA 3L04A 5AVOA 1LZKA 3ES9A 2QTNA 3PENA 1XLWA 2V74B 3LPMA 1I3LA 4XSGA 4MQUA 1DTSA 3V8QA 3OIYA 4AZ3B 1XEXB 1X0XA 3WQRA 4GX1A 1XCBA 1Z5WA 3I2YX 3KQOA 2FRVA 4PQGA 4UBOA 4BLOA 4AG6A 1NN5A 5SYAA 2YZ2A 5SZIA 4G67A 4E33A 5MN6A 3KLMX 1T4CA 2I3AA 4YRPA 1M0EA 1NKSA 1KFKB 1USGA 1YV9A 2R8PA 1EH5A 1TA0A 1G8AA 4TOIA 3S70A 5JYBA 3VGPA 1Y7TA 4HXYA 4G0WA 3WZMA 4RPKA 4KHZA 5K7SA 4H0NA 3IT0A 4YUAA 1HRDA 1ZK2A 4LFCB 2ZB7A 1ANKA 1RBQA 1W4CA 1EJ6A 5BMVB 2XRMA 2CK3D 5G1OA 5KSPA 4DQKA 2IYNA 4FBMA 3BWYA 4F92B 4H3SA 4UVEA 3UC9A 3DG9A 4H59A 4H6XA 4KW7A 4CFSA 2ORED 5CVDA 1WVGA 4KO1S 4LJLA 3D4OA 5CB0A 2CL7X 1E3SA 3G2KA 3WYNA 2XD9A 4BFSA 2W0SA 3F5MA 3G0CA 4MUHA 5JMWA 4HH4A 1CQPA 1Y8ZA 2R5WA 4XWAA 5FTJA 3D64A 3DM9B 4G0YA 4ZHSA 1LBEA 2V9PA 1JH8A 4WXYB 4Y2SA 2Q7OE 4C0WA 2RK4A 1KJJA 2MSLA 4MH0R 2X5KO 1ZH6A 3A6PC 2Z43A 3QG5A 4YDQA 3JD1A 5GJVC 4XVRA 3OZGA 3BTUA 2C57A 3MS2A 3NUZA 4U7DA 2B35A 3CE9A 4QVIA 1FQOA 1BKSB 2FZVA 4GPAA 3UMVA 1IHYA 2JCGA 4BTEA 5JH7F 2B61A 1OFVA 2HM7A 1XLTA 2ZRCA 4US1R 4FINA 1T4GA 3SMQA 3I04A 4A0RA 1PJRA 1RQXA 4C4PA 4QUJA 1GLGA 4BLWA 2XCTB 1NVVQ 2VJNA 4LRTB 1TA4A 5BR7A 2GAIA 5DRTA 1O95C 1VYVA 2Q99A 4Y6RA 4Z4CA 3K09C 4B4VA 3GRCA 2CHUA 2Q6LA 4O6VA 3GMSA 4W63A 5KTPA 3AKZA 3ESAA 3F5QA 3M89A 5G0WA 5KNBD 2NQ8A 3BORA 2J5XA 5H02A 3OI7A 3JAWA 2KSQA 3VHQA 3U5ZB 2CXXA 3ME5A 1I9GA 4HGYA 3U7GA 3VVCA 1X1DA 1QNFA 2Y2UA 1AB5A 1GDHA 2C0CA 5AK5A 3KOOA 3KWMA 1HXHA 3F3YA 3B20A 4PXAA 1QO0D 2H51A 2ZSFA 4ZMRA 4ZZ0A 3GRRA 3T5MA 5DNYB 1GRRA 3SQOA 3UK2A 1AXEA 3UPUA 1VBKA 2X1VA 3FFBA 1T5LA 4JJ4A 4JP8A 5CDYA 1FUYB 4WKPA 1SGWA 3AIOA 4Q1BA 4H1UA 4YRQA 1GCAA 1FP4B 2QLFA 2WYUA 3R6DA 4B2LA 4QL3A 4MQLA 3W4JA 4OL0A 1COZA 2OCYC 2B8WA 3PDCA 4QFMA 1DKLA 1DQRA 3FCCA 3HVUA 4TL7A 3RAJA 1U3TA 1VIMA 1X3LA 2F1IA 2Q9BA 3GT7A 1QX4A 1R8QA 2C97A 1DG3A 2JGDB 3HN2A 3LYAA 1M6VA 2D3TA 3N74A 3QXHA 3PHCA 1KEWA 1E66A 4IGFA 1AGRA 2G4LA 2ZJ0A 3OIFA 4XCXA 1HMYA 2SCUB 4HPXB 3AQIA 4IQ4A 1MU0A 3HN7A 2I4IA 4MB6A 5AM4A 3AOEA 4P5DA 3AHGA 1D7OA 4CHGA 3OMLA 1HLPA 2AEMA 3BMXA 4TLLB 3D7NA 2FE1A 3I34X 1RS0A 2QOEA 3PGA1 4IHAA 4EQ6B 1HNZB 3AESB 1PHRA 1GPBA 2V59A 2CYAA 3I5MA 1JHOA 3OPNA 1HNXB 2EW2A 3IHTA 1FLAA 3RGGA 2V54A 1S2GA 2IEGA 1XDWA 4IBOA 1UXIA 5E9AA 5LUBA 4EGSA 2MSNA 1UFQA 5DU2A 1RMTA 3I2FA 2QTLA 3DFZA 2E37A 5IUNC 3D6HA 3MWEB 1WOYA 2FX5A 4ENTA 2NUAB 1B6TA 3D6VA 5LQKA 1FBTA 4NNOA 2PGIA 4YBRA 3W1EA 3UT6A 5FNVF 4Q4DA 4YLYA 1DLIA 3QY0A 4CTOA 5B57C 2Q7DA 3ZXXA 5BSVA 2G1KA 1E2BA 1GA4A 1Z33A 3IOEA 3NI2A 4JBHA 5TNXA 4C4XA 1PR4A 1U0OC 1VL2A 3EIQA 3S44A 5DTQA 3KJHA 4HGOA 1CC1S 3EYAA 4FMPA 1VCOA 4B3JA 3MWDA 4D8WA 1VG1A 3L01A 5G1PA 1UUFA 2Q2QA 3C5EA 3GB9A 4BVFA 2I7XA 1RMYA 2AC4A 3F78A 4OY3A 3AR7A 4U7HA 1Z28A 4G5HA 3H1PA 5F78A 4MHTA 3INYA 1FXSA 3HACA 4LF7B 1VOTA 3IEKA 1WQ1R 3WL3A 3TSZA 1GYRA 2VQEB 1PJAA 2CZQA 2RHRA 5F7ZA 4BQRA 5JCPA 1Z4JA 1LCIA 4MVXA 4ON9A 1SQGA 2EF0A 4MCJA 1H22A 5ALXA 1JEEA 2OV3A 2YHIB 1XWIA 1EGAA 4MYUA 5J43A 4CFYA 3F0TA 4YV7A 3MT0A 2V0GA 3TZQA 2IW3A 5BV0A 3F49S 1UBLS 4ILEA 4RY8A 2VPYA 4LCJA 4W5OA 5TV2A 1WKBA 2F17A 4TLBA 2DTDA 2VWGA 3RUEA 3L77A 1MKYA 1OY1A 2HU2A 3JQGA 3OHMA 2R7NA 4ZAFA 1Q7RA 2MMCA 2XY4A 2J5RA 3QX9A 1P2UA 4P53A 3SAJA 2UKDA 5JSZA 1TT5B 3ZCVA 1PL8A 3E6AA 5BOSB 1T2CA 1W48A 3LV8A 5AK3A 2IV3A 1BHSA 2YV3A 1JHPA 2Q5QA 4OGKA 3SOZA 1GDTA 3GGPA 2YASA 3F3SA 5CW1A 3GGJA 3UATA 1SOMA 2F1RA 1XSEA 4HAWA 2O0MA 3D0KA 4QPCA 3ZWNA 3DWGA 1JFLA 3HWX1 1CUHA 2BGWA 1CEEA 1JMVA 2I67A 4QQRA 4O1MA 1FU7A 1Z83A 3LBIA 4TTQA 1WPQA 4U7WA 5TB5A 3DMHA 1I3MA 1QIHA 4UJ3A 4XPZA 4DM4A 1EUDB 1PQWA 4OX9Y 1S0UA 1QMGA 2ZFUA 3DB2A 4RTRA 2IQIA 1TI7A 3MTQA 5M3BA 1S8AA 5E3IA 2QYHA 5AVZA 3S1SA 1DSSG 1EP9A 1KPIA 1LDMA 1MO4A 2JZNA 1ZBDA 4TMWA 2CGEA 1GLNA 4MWTA 4C22A 1RLTA 4NMWA 3VDQA 1WZEA 2WTBA 5LA6A 1U8YA 1YA8A 3DAPA 2HOQA 2V0CA 3EAGA 4GR9A 4JENA 2J3EA 4JGIA 3TD6A 3TQFA 4E70A 5L4SA 2FDRA 2QXTA 4B79A 2PUCA 4IJMA 4P2BA 2P9GA 2YWRA 4MGIR 2EZTA 3EZYA 3MNFA 1PLJA 4ZREA 5IBPA 2P7HA 4UZEA 4L5IA 1A71A 1IMJA 5T67A 4P3KA 4RY9A 5IWCA 1CEYA 1UDBA 3GRKA 3AVVA 3DBIA 1V4BA 4C89A 4PGGA 1TAGA 4YS6A 1LFDB 1XMXA 3HV2A 4BFTA 2NMVA 4E03A 3RLFA 1SVIA 1GRNA 5ALNA 1BMFA 4FZRA 2HL6A 2B21A 3WOHA 4CLXA 5BQXA 1CVIA 1SC3A 1GL9B 1PEDA 1TX4B 1T6YA 1QFYA 2ZUDA 3KYBA 4P08A 4AMUA 2EWMA 4CKCA 1B6RA 1O96B 4EEKA 3WR5A 4DCTA 4ARSA 4E2FA 4EUHA 5CB6A 1Q44A 1Y8RB 4FP9A 4ZTUB 3U4GA 4MWBA 3K70B 2BHSA 4DLAA 2WFLB 3H4MA 1MC4A 1U0LA 2PCJA 3AR3A 3TLMA 3CX3A 1ZOOA 3OKAA 5EOVA 1O9HA 1PDOA 2FPXA 3TIFA 2QKYA 3GJXC 1EE9A 3E22B 3O47A 5EPUA 4S35A 5TQ2A 1E60A 1VHWA 3I9V6 2IEYA 3GLFB 4BMSA 4CTJA 1M2VA 4BEWA 2BD0A 2O7QA 5E2BA 2X8AA 2PS3A 4NZNA 4JYAB 1Y7LA 5CFNA 3PWSA 3Q10A 5LWQA 2XZOA 3WL7A 4U2FA 5FLKA 1JDPA 1XKXA 4MTCA 1NSFA 4BNHA 2WWVD 5A4KA 3EX7C 2IUUA 1RIIA 1UANA 4FFVA 3H1AA 1RW4A 3KFVA 4OFXA 4QAJA 5CNIA 3ZNOA 1ESCA 2H1HA 4EG4A 3OLXA 4CMHA 5TS3A 3PHJA 3UMRA 1XA0A 1AZLA 2GEJA 3C85A 4LXYA 1E64A 4ZT3A 1E9AA 1E63A 1F2VA 1SUWA 3GDHA 4OIFA 4QBTA 3PC4A 5LBUA 1JE1A 1EVZA 2EFYA 1ABFA 2X58A 1NULA 3OFNA 3P20A 4OMCA 2OQVA 3RIYA 3HV0A 2AJBA 2D06A 3ICCA 3LPDA 2WM3A 1JQJC 2OXEA 1HK7A 5A3QA 3ZWKA 2OVFA 2GJ4A 1VLVA 4Q4JB 2XE8A 3GRUA 1FRVA 4XJXA 2NXJA 4F06A 4P0QB 2V98A 4MV0A 4E11A 5AW4A 4M8NE 4MYRA 1OB2A 2J87A 2O5VA 1SIWA 2RE8A 5LLTA 1H94A 2IEBA 1DTWA 3E15A 3HK2A 3QITA 4ETWA 3H75A 5IMBA 2HSZA 2ZIEA 3K6JA 5AW6A 1OAOA 1EESA 2R8XA 5HRAA 2IYQA 4D4MA 3CLKA 4I6JA 4EMUA 3THWA 4PAGA 5D3QA 4Q9IA 3PRJA 4J94A 4ENQA 1GQQA 2EERA 4QULA 1AKQA 1DG9A 2ZYWX 3DGEC 3OCUA 3JPWA 1JEDA 4KE7A 4QQ8A 1L3CA 4UASA 1ZWLA 2HDHA 2XYQA 4V1CA 5K8TA 4Z9FA 1G6KA 4F71A 4FM9A 2AQKA 1M1YA 1QRAA 1ZDMA 1DDGA 2OBMA 2PXHA 2WM8A 3AX6A 1TNDA 2R9VA 5A3VA 3WKDA 4IQ8A 2FUCA 4AICA 1A8HA 2G7ZA 3N28A 3LUDA 2V7QD 2VP4A 3EXHC 4Q7LA 4UAGA 4C3ZA 1LVUA 1TCBA 3IDAA 4TGLA 4BQPA 3BMNB 4TVOA 2VLBA 4KGVA 1USWA 3VPSA 5M5BA 5EKDA 1ZNXA 3O8LA 3E27A 3QUBA 1BEEA 2PBRA 4I6EA 3UA3A 2DOKA 1E4VA 4UBLA 3MT8A