4N0QA

Crystal structure of an abc transporter, substrate-binding protein from brucella melitensis 16m in complex with l-leucine using a crystal grown in a crystal former (microlytic)
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
344
structure length
344
Chain Sequence
DITIGVIAPLTGPVAAFGDQVKKGAETAVEVINKAGGIKGEKVVLKFADDAGEPKQGVSAANQIVGDGIKFVVGLVTTGVAVPVSDVLSENGVLMVTPTATGPDLTARGLENVFRTCGRDGQQAEVMADYVLKNMKDKKVAVIHDKGAYGKGLADAFKAAINKGGITEVHYDSVTPGDKDFSALVTKLKSAGAEVVYFGGYHAEGGLLSRQLHDAGMQALVLGGEGLSNTEYWAIGGTNAQGTLFTNAKDATKNPAAKDAIQALKAKNIPAEAFTMNAYAAVEVIKAGIERAGSTDDSAAVAKALHDGKPIETAIGTLTYSETGDLSSPSFDIFKWDDGKIVGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of an ABC transporter, substrate-binding protein from Brucella melitensis 16M in complex with L-Leucine using a crystal grown in a Crystal Former (Microlytic)
rcsb
source organism Brucella melitensis
molecule tags Transport protein
molecule keywords Leu/Ile/Val-binding protein homolog 3
total genus 122
structure length 344
sequence length 344
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13458 Peripla_BP_6 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4n0qA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4n0qA01
4PZ0A 2TMYA 3IDOA 3URMA 2PUGA 3BBLA 1DCFA 4FE4A 4PYRA 2I6FA 1E6MA 2P4UA 3O21A 2OENG 1JBEA 4XLTA 2HPHA 5BRAA 2IOYA 5KC8A 1FFGA 3UKJA 1NATA 2DRIA 1CYEA 4EUKA 1NY5A 3C3WA 3KJXA 4IILA 3EDCA 1BA2A 1GCGA 4RY8A 2NT4A 4IMIB 4IRXA 4H60A 3OM0A 1D5WA 1YS7A 4RKQA 4JA2A 4EYGA 3KYIB 1PNTA 4L85A 1JLKA 3R0JA 2FMFA 1GLGA 2MYPA 3E3MA 3N0XA 4ML3A 2FVYA 4MS1B 4Z99A 5CNJA 5JS2A 1BDHA 3OMXA 2MYTA 2L19A 1MB0A 3F7NA 1Z16A 2H0AA 2M98A 4S05A 2PAFA 2CWDA 3ILHA 2JCGA 2QXYA 3C6QA 3H5OA 4QYWA 2FQWA 2QVCA 4G0QA 1EWKA 1LJLA 2GWRA 2WJWA 3Q15C 4M88A 3RVSA 3HJFA 4WXEA 1A2OA 1A0OA 4G0XA 5EWLA 4RZSA 5BRJA 4OG2A 3G85A 3O1JC 4IMJB 4RXUA 4OATA 4Z4EA 3SG0A 1DJMA 4N76A 1B00A 3KKEA 5IX8A 3GRCA 3I45A 2HJ9A 5IUKC 1FFSA 4OLAA 3IP6A 2RGYA 1OXBB 3L6UA 1QQAA 3UK0A 3QLVA 1YTUA 1GUDA 1GCAA 5JNRA 3H5TA 1JDNA 5EWMB 2FQYA 1Z18A 4MLDA 1ZY2A 2NZUG 2CHEA 3RVKA 3ROFA 4F12A 4W5QA 4WZZA 5KWSA 5HKOA 3GWGA 5JNUA 4KFCA 2QV0A 4MR8B 1NXWA 4RWEA 1JHZA 2X7XA 4RK7A 2FTKE 4D6XA 1E6KA 1LJUA 3JVIA 4ZPJA 5TQ2B 4RK1A 2FEWB 3TB6A 4NV3A 2FMIA 3HCWA 3I42A 4NICA 3N0RA 1QNLA 1BDJA 3O2QB 4MYRA 1Z12A 1RZRD 1YK1A 3CZ5A 4F06A 3K4HA 3LUJA 3RVNA 1PUXA 3H6GA 1UDRA 4GPAA 4YWHA 1SXIA 4NQRA 4EY3A 2IPAB 3LKBA 2JVIA 3O2SB 1USKA 5TPZD 5TPWA 4QICA 2MSLA 2MSWA 3QLVC 3IP5A 4YP9A 4RK5A 2JVKA 1R8JA 1YMVA 3DGEC 1DCMA 4G0OA 1I3CA 1NXXA 4WUTA 3OMWA 5TPWB 3KHTA 3TO5A 1ZESA 1D2AA 3RVMA 2J48A 1OXKB 1SD5A 3P9YA 2ZAYA 3DZDA 3H5VA 1JFVA 3MYYA 3HEBA 4LDAA 2NUBA 4MS1A 1U8TA 1SXGA 3KCNA 3O1IC 3K9CA 2IPMA 3A3KA 4DADA 4DN6A 4RV5A 3OQMA 1JWLA 1U04A 1J56A 2OQRA 3QK7A 3CU5A 4L4UA 4ZMSA 1D1QA 3LUDA 3D02A 2A9RA 4WXMA 1XWWA 5JS1A 3BILA 3EGCA 4KRFA 1Z26A 4RS3A 2R47A 3GT7A 4MS4A 1DP4A 4KK4A 2LUOA 4OBBA 5KQMA 1LK0A 4EYQA 2QVGA 4G97A 4HYEA 1NXVA 4LZLA 3QELB 3OQOA 2FMKA 4KPYA 5DTEA 2RJOA 5TQ0A 3MMNA 1EWTA 3O75A 3N53A 3VNBA 3CLKA 5HSGA 1TJYA 4S04A 3BRQA 1DC8A 1YIOA 4XXHA 1AB6A 2JB9A 4G0PA 4Z4FA 1A04A 1EFAA 1PEAA 5I4CA 5IEBA 4G0MA 5FWYB 2PL9A 3C97A 2MYNA 1DC7A 1DG9A 2IPNA 4MAAA 1ZN2A 4F11A 5DGCA 3GV0A 3HS3A 1DBWA 2IPLA 1T34A 2FMHA 2IDMA 1Y1LA 2V0NA 3F6CA 1W9HA 2MYUA 5JNSA 1ZDMA 5KQGA 2NZVG 4LX8A 5C5CA 3KS9A 5JNTA 1NXTA 3MA0A 2L17A 4MS3B 5EWJB 3GBVA 4O5AA 3RVRA 3JVDA 2QSJA 1BVHA 1M5TA 3O2JA 2E4UA 5ED4A 2F8TA 5FWXB 4QPJC 3FFXA 1VLZA 4P98A 5FWXA 2M1ZA 2FEPA 5T7BA 3SAJA 3RH0A 1QP0A 4Q6WA 3HM9A 5EWMA 4QYMA 1M2EA 2PUAA 3QEKA 1MVOA 3HVRA 4EVSA 4RK6A 3QEMB 5TPZA 5DLEA 2CHFA 1C4WA 1Z2EA 3GYBA 2FLWA 3LUHA 4D6YA 3EJWA 4ETMA 3OQNA 3IPCA 4JOQA 4MRMA 4NCBA 3H5LA 1Z2DA 5JNWA 1TMYA 5FBHA 4MR9A 5FWYA 4W5NA 4MPTA 1GUBA 4KNYA 5HQJA 3CHYA 4Q7EA 4ZYLA 1ZVVA 2GX6A 1U2QA 3CKMA 5IBQA 4TMYA 5DCLA 3QELA 1JF8A 1KGSA 4H3KB 1Z25A 2E4YA 3IPAA 3M9XA 3VNAA 4B09A 4WT7A 8ABPA 2R25B 3CNBA 4JP1A 1NXSA 1H9CA 3HDGA 1TVMA 9ABPA 2FXIA 3QX8A 4YV7A 2FEKA 3A0RB 1QP4A 2R4QA 3JS5A 1HEYA 3C3MA 3N0WA 3A10A 1XHEA 3Q7SA 5D2CA 4TLMB 4DQDA 4TN5A 3DLBA 3SM9A 4PICA 1APBA 1P2FA 2A9PA 5KC9A 4E7PA 1Z15A 5TQJA 1LBIA 3EULA 3FMVA 3MIZA 1ISSA 3NNNA 5T3YA 4KREA 4GNRA 4N03A 2QW1A 2L18A 4RDCA 4Z4IA 5TQ0B 1USGA 2VYCA 1KRWA 3H75A 3TD9A 3KSMA 4MQFA 1RPJA 2A9OA 1K66A 2FSPA 1ZAYA 3C3KA 3T8YA 4P1ZA 3KLOA 3QLTA 4XFKA 2QZJA 2P9HA 4MS4B 5IULC 2XDYA 1QKKA 5DKFA 2PUDA 2E4VA 4Z9BA 2RJNA 3JPWA 4JB0A 1MIHA 3T6KA 2IYNA 4LE0A 3T95A 1KMIY 3B2NA 2YHBA 3H5IA 2JBAB 4F3TA 1QO0D 1VRVA 3RVOA 1P8AA 3DGFC 3RQIA 4MRMB 2FN8A 3QEMA 2BGGA 2ID9A 2RDMA 1JYEA 1ZGZA 3BREA 4HNRA 1F51E 4RKRA 1TM2A 3S99A 2NT3A 3ILYA 6CHYA 3SNKA 1EWVA 3CFYA 2E4XA 3HDVA 1AB5A 3HV2A 1JX6A 2VK2A 4Z4GA 1JFTA 4PEVA 5KI6A 1DBPA 1PHRA 1C0EA 1NXOA 4O1HA 4O1IA 5EWLB 5PNTA 4Z4HA 4TLLB 5C5EA 5GOTA 2FLKA 2PMCA 4RU1A 4F8JA 1PNRA 4LE2A 2PL1A 4E7OA 5ABPA 3MM4A 4MLCA 5F64A 5IUJC 3HK2A 3GA5A 4MS3A 2FQXA 2WWVD 4JASB 1ABFA 4MR7A 2HQOA 3W9SA 2WB4A 1F4VA 1XHFA 2N9UA 4EGSA 3O1HB 4ETNA 6ABPA 1ZH4A 4Y9TA 3LUFA 4KMRA 4WWHA 4YCSA 4MGEA 3OLYA 2PUCA 3MQ4A 4YGXB 1LBHA 5TQ2A 7ABPA 2VUIB 3HSYA 3O74A 1ABEA 3RVJA 4D74A 1Z17A 1E2BA 3H1EA 1DCKA 3OLZA 1D1PA 1DZ3A 2QU7A 4MR8A 4UHKA 4CBVA 3RVPA 3QLUA 4ZMRA 4UHJA 2GKGA 1YVUA 4YO7A 2IKSA 3NHZA 1E6LA 3LKVA 1K68A 1ZH2A 3OM1A 3IP9A 2LPMA 3HO1A 4OLBA 5JNVA 1D4ZA 1SRRA 4IF4A 3CG4A 3MF4A 4XARA 1FSPA 3GL9A 3BRSA 3OO0A 2PKXA 2E4ZA 4LRQA 4MQEB 3DLHA 3KG2A 2R48A 3DBIA 1MB3A 4YLEA 2PJUA 4RY0A 2HQBA 4Z0NA 1NXPA 5FBKA 1U2PA 2VUHB 4KV7A 4H3HB 3UUGA 1M2FA 3CG0A 3FDFA 4EYKA 1L5YA 3NHMA 2MSKA 2FW0A 3CRNA 3NBMA 3M9WA 1DBQA 5E3JA 4HNSA 1RZRA 3CTPA 4KZKA 2Q5CA 4KVFA 3CZCA 3H1GA 1CEYA 2FN9A 4RK0A 1JL3A 4N0PA 1FFWA 1FQWA 1EAYA 1QO0A 2LP4Y 2B1JA 1YS6A 3D8UA 4RSMA 2YHAA 3KLNA 5EWJA 3EQ2A 4G86A 3QLUC 3LUAA 1U0SY 4FE7A 1RXIA 2HQRA 1QQBA 4N41A 4ZJPA 1PEYA 1YK0A 2E4WA 3NNDA 4PE5B 3LUGA 2PLNA 5KQPA 3JPYA 1SXHA 3H5WA 3N8IA 1Z13A 3HUUA 3NNSA 4Z9AA 4JAVC 1QP7A 2QR3A 3HUTA 4EVRA 3HXMA 1QPZA 3CS3A 2AYZA 4G0YA 1DRKA 4KQCA 5B3JC 3N75A 4RXMA 1TLFA 3F6PA 4Q6BA 1MAVA 5CNKA 1JDPA 4MR7B 5IEJA 2F8SA 5TE9A 3LUKA 4YRZA 3T38A 4IGAA 3LMKA 3OLVA 5IC5A 2WY2D 1L5ZA 1NTRA 1RNLA 3QX9A 4RY9A 5CNIA 3TMYA 3Q41A 5KQLA 3FFTA 2KYRA 3JY6A 1ZITA 4YR7A 3SQNA 3JTEA 5GQSA 3OLWA 1VKRA 2PUEA 3KYJB 3H1FA 3FFWA 3SY8A 2GI4A 2WJAA 1W25A 4LE1A 4EYOA 1BAPA 1P6UA 4MR9B 1URPA 1YMUA 1JH9A 3Q7RA 1BDIA 3TX6A 4KQ9A 4KK3A 1P6QA 2ZWMA 2H3HA 3L49A 4W5RA 3EQZA 3RVLA 4W5TA 1M5UA 3I09A 2WRZA 3FGZA 4JB2A 4N47A 4W5OA 3F73A 3LFTA 3IP7A 1CHNA 1DRJA 4NCAA 2JBAA 2AYXA 1ISRA 1USIA 4MQEA 1KRXA 2PUBA 3KTOA 1RXEA 1VPWA 2L2QA 3G1WA 2LIVA 3LOPA 5B3JA 2FKAA 3HZHA 4Z4CA 3EODA 2B4AA 4FB4A 1EHCA 4HNQA 4YS6A 1ZHHA 1IIBA 1JYFA 3OLXA 3Q9SA 4MQFB 5CHYA 2CD7A 3E61A 2A9QA 4RXTA 3H6HA 2ID7A 2W42A 2O20A 5BR1A 2HSGA 4OTZA 2GBPA 4N0QA 2JRLA 4EVQA 5HM6A 1WETA 3A0UA 3LTEA 3GBPA 5IUNC 5CNMA 2LBPA 2JK1A 4LDZA 3M6MD 2PUFA 3RVQA 4XAQA 4XASA 2JVJA 1S8NA 3N6VA 2WMYA 4ETIA 2PE5A 1ZGGA 1JFSA 3I5AA 3Q7TA 5BQ3A 3ROTA 3OO1A 4G0ZA 3LUCA 4RK4A 3EAFA 1QMPA
chains in the Genus database with same CATH superfamily
3RS9A 1NOIA 5JQGA 3CWZA 5K0SA 2Z2YA 3JATA 1C0PA 3K0HA 1ZI8A 5JYEA 5K3BA 3G2MA 3GEBA 1O57A 2JLVA 2P5UA 5EHIA 4J0GA 5E4JA 4EQ6B 4JHLA 3JQ8A 5CVEA 1NRIA 2F9LA 4MQLA 2PGJA 3CR8A 4F8YA 2PLFA 4DSUA 5CFOA 3MCUA 4JBNA 5HCUA 4DZZA 5I4CA 4B4KA 6ADHA 1ANKA 2A1IA 3OTWA 3L8DA 3R3YA 5D3ZA 3PJFA 1ZJ6A 2O48X 3VO2A 4WBNA 1L7EA 2QYOA 4Y1GA 3Q85A 2F55A 4IPTA 3P0HA 4PC3A 3H2GA 1YQTA 3K9WA 3KQQA 4GG1A 3NRCA 3SBDA 4MGHA 3OETA 3SEAA 5A4MS 5CDGA 2E87A 4MICA 4EITA 2FVYA 2QSZA 5SZJA 1RC8A 1MB0A 3DG9A 2I78A 3C3XA 5T57A 4R01A 3FIJA 3VFDA 4LFAB 4TMTA 1IB0A 3T0GA 2NXJA 2F43B 3FPBA 3R7SA 1BXZA 1NW8A 3UWDA 4KCGA 1H1DA 4BLRA 5A3QA 3THYB 2HT1A 2J09A 1HF3A 4JWTA 4RD0A 1FDVA 2H92A 1XCBA 4HDRB 3LY8A 3LCJA 3R3WA 1QV7A 3G85A 5JCOC 3VSDA 3UAXA 2ZJ6A 4YQZA 3O1JC 3WNZA 1OJ7A 1KSGA 1P1JA 4DMFA 5HQ3A 1LEHA 1B00A 1G2IA 1N0UA 2FR8A 4O29A 3ZQ6A 2Q21A 4EJFA 5EXEA 3TLEA 1OFVA 3HE3A 1AUXA 1I5EA 3PC8A 5BSWA 2HWYA 4P3YA 4DFDA 2X86A 2ZWVA 5GJCA 5AHRA 1H8EA 3N8DA 4LJ8A 4D4IA 2VHXA 1KK0A 3B52X 4HPJB 4XDHA 5AW0A 2O19A 3ZWNA 3QE3A 4EI9A 3MBOA 4ERNA 1B0UA 5DHSA 2QM7A 2QPOA 1IRIA 2B7BA 2E7ZA 1L7VC 3VU9A 4NARA 1ESZA 1N1MA 4HWOA 4NU0A 1NASA 3D8NA 3DVAA 2J6HA 1WTAA 3DH0A 1FFAA 1X7ZA 2BYTA 3S27A 3MB5A 4BLUA 3OU6A 2ES4A 2XWPA 2CLLB 1U2GA 3WAJA 5DO9A 3BTUA 4O4JF 5CD9A 1GGEA 4K6KA 1P0FA 2REOA 3DULA 1FU8A 1SQ5A 3N0RA 2CEAA 1K6IA 1T5OA 3LP5A 2XCUA 2H6EA 4YLYA 5F2OA 1F48A 4EJMA 4ZO7A 3L8FA 4PLPA 5IC4A 5KNDA 4BFVA 4Q1VA 1R7RA 1KP3A 1EBUA 1LVGA 4C7KA 4BQSA 5J2UF 4O6VA 5IJ0A 3RTBA 1PDWA 4TS1A 3DTNA 3IVAA 2UYOA 3TR5A 1WSAA 2C96A 2FP4B 2IY8A 2XZPA 3FYUC 3JTMA 2AH5A 4OM8A 4A8JB 4G8BA 4EY3A 1KC1A 3O8CA 1W36B 1DOZA 1FSSA 2D5AA 4R6WA 3SFVA 3HCPA 4OY3A 2NNLD 3L40A 3QVKA 3ZIAD 2O2EA 1OSNA 4E2YA 3IP5A 5AW1A 1R0BA 2WUVA 1KEEB 1WLYA 1XPUA 5AXAA 2G9VA 3OQ1A 4RORA 1MZVA 1NXXA 2SHKA 3OZVA 4CQMB 1T6NA 4LOLA 1T4CB 3Q3CA 2QD2A 2CB9A 4BBAA 4J3FA 1KK3A 1AMOA 2IBSA 3JQ9C 3EIXA 3H5VA 1J90A 2H2WA 2DBZA 3KCNA 3HXOA 1DO2A 2KE5A 3NH6A 3A6GA 4RV5A 3TL3A 4HDSB 1SCUA 2OQRA 4Y0NA 4A5SA 1UPAA 2ZCVA 5DJ5A 3E7DA 2B20A 3U81A 2EX1A 3UPTA 2PRIA 2M2IA 4L2IA 1XWWA 5TMBA 3ET4A 1CDOA 1HT2E 2FX5A 421PA 1H0HA 2OQ2A 3WHLA 4CT5A 2EYQA 4U7TB 2J3MA 1PT7A 2E85A 3Q0EA 1WB6A 2IXTA 2QRJA 4ZDJA 1QPBA 4KDRA 5CB4B 3QELB 4YP7A 3HKBB 2HBYA 1WSDA 2ZSIA 1SULA 1CUVA 5TQ0A 4KQXA 1LDGA 5BVHB 4IIGA 4C5CA 2I9KA 2JFUA 1Y4SA 4RMJA 4Y2JA 3BYZA 2PTGA 1AB6A 1E6CA 1XZLA 3Q9UA 3QWFA 4LJAA 4JNCA 3UEOA 1KQGA 1ZCBA 1N2HA 1DS6A 2HI0A 2XF8A 3OWHA 4U4AA 1AO3A 2MINA 5FQOA 4YJHA 1X3LA 4IGIA 4HDSA 1GZ4A 1SVOA 2NNWB 3C97A 3VTFA 3K0SA 3U5ZB 1K5GA 3DC7A 4BLTA 1N5IA 4YT5A 3FUVA 3J81A 3LZ6A 4A82A 3H9CA 3RHFA 4K28A 1GPJA 2EZ4A 1A1SA 5CGZA 1YB4A 1JHAA 3CA8A 4F56A 1PP4A 1XZIA 5AW6A 4YCBA 1ZZEA 4BNMA 1HG0A 3OSZA 1V6CA 3VC1A 4TKMA 2ZUFA 5CVVA 5A4FS 1CV2A 3AG5A 3HL4A 2DGDA 2LD4A 1P1HA 2Z3WA 1O5TA 3BFXA 2PBZA 5KNBH 1DC3A 1XEFA 3KAJA 3DZHA 4ZV7A 5E1DA 1WPGA 5EJ7A 4WERA 3T9AA 1ZNXA 1IEWA 2VDVE 1E7RA 3PKJA 4HWKA 4L6AA 3RSOA 3S29A 4ZI5A 2NO0A 4BZZA 2ODNA 4RCZA 1JQBA 1P29A 2K87A 4JKIA 4BV3A 1YACA 3VHXA 2NYAA 4EI8A 1OH6A 2WEKA 3CLSC 4EKNB 4HVCA 4JOQA 4AZ0A 3KYCA 5LOVA 2J8ZA 2OGUA 2D2XA 2IHBA 2HJSA 3ETGA 2NVBA 1V45E 1XF9A 2WU8A 1V3QE 4TV8F 5A05A 3I37X 4E2FA 2R7LA 3EW9A 1B73A 4UXHA 3OFND 1KHTA 3GFPA 4YJ2A 4QVGA 3DHYA 4HXFB 2GPJA 1U0HC 4X0EA 3RLFA 4BQIA 1M1YB 1P1KA 2WWRA 3QEJA 2XZLA 4OI2A 3AJ9A 1XMOB 1P81A 1PF7E 3QPUA 5DF1A 1JQDA 2EATA 1NLZA 3I6MA 4ZICA 2IT1A 3VR4H 3GDGA 4B3TB 2YJ4A 1PKXA 1V9CA 5K5EA 3RFUA 5CG2A 1FDTA 1Z0DA 1KO5A 1TVMA 3OG9A 4N7MA 2OQVA 2PKRA 3R75A 4EB3A 2GHRA 2BFFA 4LTMA 4OQYA 3UATA 3GCXA 2HRDA 3H8JA 4IUYA 4XCXA 4MTCA 3ZVLA 2V9ZA 4IHJA 4PICA 4J8PA 2HU2A 5EE1A 5LB2A 3HA2A 1P2FA 1QANA 4MGIR 2IZ1A 1Z15A 5LQRA 4ALIA 4ENUA 1G20A 1JXQA 3ZDEA 3EULA 4Y2GA 2FUG1 4IHKA 3WHIA 1XTZA 2YQ5A 3DXYA 2NU8B 5I7UA 2P5YA 4YYEA 2WPNA 2VTVA 1PEDA 1FJHA 2VA9A 4D8XA 4EG7A 5LLDA 2X9GA 1YAHA 1N8SA 4D3FA 1WPRA 2BFEA 3IAM1 5ITZA 5MF6A 2UXDB 3B1FA 2J9XB 1UXGA 1K8RA 4BQOA 2PMDA 3UO8B 4ENVA 1Y0BA 4NNJA 4A8PA 4XFKA 5AIBA 4MS4B 1IY0A 2BM0A 2EFYA 4FOOA 3S1AA 5C2JB 5ES4B 4OK6A 5A5EA 3WL8A 3VPSA 4HLQB 3CH5A 1TVKB 1ZHFA 3P1JA 3AR7A 4KAJA 4Z9BA 1HNXB 3TQSA 1PZNA 2RCNA 4FEEA 4LE0A 4CEHA 1JSLA 2HA5A 2WUDA 3A1UA 2QL9A 4KSBA 4F4IA 5IVHA 4KNYA 1LXCA 1E2DA 3P2OA 1EJ2A 3QE4A 4CUKA 2VT2A 3AJRA 5ALEA 2YHUA 3AKZA 5B6PA 1JYEA 3IHTA 4ZKEA 1FNNA 3BULA 2CXTA 3T4EA 3DEYX 5L6MB 2GEFA 5LQMA 4HCJA 1NQAO 4PC6A 4H1HA 5LDGA 2HCJB 4NIMA 1KJWA 5AOBA 2J3EA 4CNQA 1IAQA 3A1FA 3R9IA 2EU8A 4GM1A 4O1IA 3WLMA 1E18A 4HZUA 1ZJ4A 2TSYB 1R6DA 3PI6A 4D96A 4DXAA 1LLFA 4JL6A 4B6JA 2R11A 1ZRHA 3F4LA 3KOUA 2IXDA 3QVUA 3RC9A 4ENPA 5B7QA 2IZZA 4GUAA 3OUZA 2XXAB 3VAYA 5AVUA 4FDMA 5IF9A 4JLWA 4XGQA 3ZD7A 4MOWA 2GN2A 4N5MA 1UANA 2G80A 2NV0A 2NYRA 4KW7A 4MJ3A 2NVUB 4EIWA 4YAIA 4WZ6A 3IMKA 4GUDA 2R8RA 3QE2A 4MS3A 3HI4A 2I66A 4BO6A 3U13A 1R4AA 2J6BA 1C30A 2CDNA 3WYCA 3WK4A 4DAOA 2NO4A 4WLVA 1MIOA 5HGXA 2DX7A 1LX6A 3ZK9A 1R0WA 2VXCA 2ZE8A 3BMQA 5ICFA 4RM2A 5TQ2A 2VUIB 1GAWA 2BFBB 2PFKA 2VCYA 4IO1A 1FLVA 4QJ5A 4CCSA 4AP9A 1D1PA 1DZ3A 4KDFA 4UHKA 5DN6D 3O8LA 3C6YA 4W6ZA 1KXZA 4QLOA 4HDMB 4ONEA 3SHQA 3KQNA 3D54D 5CA1F 5KTPA 4NC9A 1P39A 4LWPA 2GM5A 1E6LA 2YVUA 1IEVA 4ZGBA 4YJ2B 1L3IA 2XDQA 3AQIA 4KLCA 1M1YA 1O54A 3IRVA 3LVQE 2CW5A 2A58A 2ATEA 2C8KA 2PZKA 2E4ZA 3QVGA 1RS0A 1J23A 4AZ3A 5CCEA 1J1ZA 5IPFA 3SNHA 4IXMA 1Z33A 4CE6A 4GXNA 2AR9A 3OE5A 5AW7A 1GT6A 2IYRA 2JI8A 2PD4A 4OLFA 4PLZA 1QO7A 4YMVA 5D84A 4KLZA 1L5SA 1YQ9A 1N9GA 2AOVA 4KV7A 2AEJA 5CD1A 3STVA 3KZ1E 4UU0A 3GFGA 2PGNA 4KXNA 5IJWA 2HNBA 1JECA 3DNMA 1X1AA 2JLUA 3C1OA 3WISA 2GGSA 1DO0A 1LI4A 2HF2A 4YRJA 1OZFA 3PE4A 2JI4A 2TYSB 2NSHA 2Y27A 3GGOA 1W2WB 3RSFA 5AVQA 5A2QA 4GOJA 1WUJS 4IJWA 2PMFA 2FHPA 5CH8A 1ORVA 5CJ2A 3UJDA 1EP3B 4L22A 1J7KA 1ACJA 1VL1A 4Q34A 4REQB 2ZBPA 3RFTA 3SMQA 4PHFA 3DDCA 5EWJA 2HLHA 3NIWA 3AONB 2YS6A 3I12A 3R3HA 5K0NA 1Y1PA 2HBRA 3CO5A 4G37A 4PHHA 4ZZ1A 3QU7A 5HM8A 2Z5VA 3QGMA 2XAUA 4KU4A 3HB4X 5HGJA 1YK0A 3DAYA 4PE5B 3UWPA 2XHEA 4ZYXA 3JPYA 4HQ0A 3AJDA 4HDCA 1E1KA 4JAVC 4OCZA 1O97C 4G89A 1E2LA 4A8JC 2H7XA 2RK3A 4ABYA 1T2NA 3GUUA 4NMWA 3JVUA 5T6MA 4ND3A 1JHRA 3LXUX 4ZVUA 1ZC4A 3DPIA 5LN1A 2QI9F 3QVOA 1WHSB 1H05A 3C7TA 3QVTA 2ZBRA 3BWYA 4I1UA 5REQA 4MVJE 1DQSA 3FSGA 1Q74A 3A2LA 4DGSA 1E4OA 2J5RA 3GP3A 3GY0A 5CNIA 3F3KA 4IDFA 5CK4A 3TPCA 3I6IA 3VU9B 2HXGA 3UGKA 2JG3A 2O2DA 2Q3HA 2GN6A 5CT4A 2Q4OA 2GAAA 1GNRA 4S0XA 4WPGA 1QONA 2VJPA 3CLUC 2EZ8A 3CZAA 1VKRA 1G8HA 2FSSA 2OC4A 1HR0B 3K3PA 4HZUB 3NH9A 2AX3A 2IOHA 3JD0A 4R0MA 3P2IA 1D8AA 4LE1A 2D5CA 4QO7A 1WXDA 1URPA 1RZUA 4DPKA 3E53A 1XVTA 2DFNA 1A69A 1P91A 2HRQA 4W5RA 3UAYA 3G6KA 1CY1A 4C7JA 3PVCA 2FRDA 2CWWA 3O4HA 4YAJA 3TOCA 5IU6A 2V0GA 1T26A 3LT5A 3ZWPA 4MWSA 2CHVA 5K03A 3BXGA 3F6BX 2JGKA 4EF6A 3VDXA 4MZXA 3KSRA 1ODIA 3NEYA 4P33A 4AWAA 1E66A 1ZIYA 4WFQA 1ISRA 3S8EA 1F8YA 3BFVA 5EP3A 2HIAA 2FWAA 2DZDA 4TTRA 3WNVA 1PS9A 2Y66A 1UFVA 1RQRA 2ZYHA 3GDFA 4UDNA 5B3JA 3SK0A 2IHYA 2JC3A 4YJGA 2JDID 3GRVA 3F2IA 3GIWA 3E18A 3U39A 4CU5A 4DBLE 1B8NA 3SGLA 2J33A 1TJPB 3K1ZA 2OMKA 5FL7A 3A06A 2CLEB 4HLUC 4Z7QB 3ICQB 5CHYA 5JD3A 1EA7A 3M6FA 1LB1B 3KPUA 1OA1A 4BAZA 2FY8A 2O20A 1H5UA 2D0DA 1N7GA 4IDNA 4A0HA 1OZ0A 2GPTA 3UMBA 4EVQA 5CVTA 2GBPA 1LRLA 4HFJA 4L3VA 3A0UA 1W19A 3TLXA 3V46A 5JAPA 1PR0A 4ARZB 4DRXA 1NJ8A 4OHCA 1J9ZA 4UXJA 3ZI4A 1EDEA 5KSPA 5A4AA 3HKDA 4DWJA 1P2TA 2OHHA 2YOFA 2QIPA 2Z6VA 1CBUA 3OU2A 4HDOB 4I4TB 5BV7A 1WP4A 4UBNA 3KNZA 3MC1A 4NPAA 3PZRA 3RNLA 3F3YA 5KOJA 1A77A 5FV4A 1A7JA 3ZD6A 3ELWA 4M0DA 4UOZA 3N3AC 4F3YA 2VDLB 1AK1A 3LUCA 4IOLA 3U3MA 4F8EA 4QOJA 1QMPA 4Q3BA 3MCWA 1OGJA 2TMYA 1HE8B 2PUGA 1SIWA 2YWJA 1IY1A 4YCJA 4K86A 2XZTA 3P5SA 2OBYA 1BX0A 3D6UA 4KPUB 5FOVA 3ZU4A 2LCQA 1VZ2A 3HB9A 3ED1A 1GFSA 3ETNA 1GA4A 4Y2HA 1TD9A 4DSAA 1VRCA 5UKDA 2BMFA 1R9MA 2I55A 2QD4A 1XDSA 3U6BA 2FMTA 5GM1A 1SIOA 1BWSA 2EYUA 2Q3MA 3ZDQA 2WWTA 3MPOA 1YZKA 1P9LA 3HDJA 1KJQA 3R8CA 1TIPA 3U4GA 4QLBA 5CCXA 2XUFA 4ENSA 1YH3A 4JR1A 4KKVA 3RTGA 1O6GA 1I2CA 4DV3B 1DG3A 3G9QA 2B34A 4R8SA 2VNJA 4A1FA 3SYNA 4BGVA 2ZJFA 2F17A 2PLRA 4PCLA 2O2IA 1QYRA 5CNJA 3LLSA 5EJ9A 3A1EA 4GM0A 4FQ8A 4A10A 5CGQB 4EEZA 4Z53A 2R84A 3HDTA 4IH9A 2XKKA 2WUWE 2WJZB 3FUCA 3K8ZA 5BNZA 1STOA 5JFTA 4S05A 5FLEX 1FYFA 2JJ8A 4M1YA 4AT1A 4BNZA 4MW1A 3CLUD 1NSTA 2GPSA 1S1CA 1A4XA 2GWRA 2OAGA 4JVOA 4QLAA 1QHHB 1R0RE 4BQRA 1DOAA 2OZPA 5C0OE 2CLOB 2NU6B 2J3LA 1CEQA 2OAEA 3AEUA 3G2OA 4EUEA 3LFUA 3L6BA 4BFTA 1QOQB 2VCEA 3M3DA 4PCUA 1QZ3A 1G38A 3TKYA 1CXZA 3L7YA 4AZ0B 3W9BA 3ONWA 1QF9A 3KKEA 1XOIA 3PRJA 4MKGA 4V39A 1S2NA 2I5PO 1C4XA 3FTQA 3AHGA 3ZLJA 2HJ9A 4AY2A 4NJEA 3E4CA 1OBCA 3FHLA 2QW8A 3OY2A 3OJEA 2WMNB 2ZTMA 2FP3A 2Q2OA 4KP7A 5LIRA 2NVWA 3GWZA 2I03A 4JUAA 1E7MA 5BUSA 3NPMA 4G26A 2QJWA 4D26A 2FQYA 1ZY2A 1E20A 2NZUG 2WWGA 3ROFA 5IAKA 3X44A 4JCOA 2CV1A 2D4HA 5HIKA 1AKEA 3EF0A 4JI0B 4L28A 1UBSB 1BOOA 3VPDA 1ZRMA 3E9RA 3VQTA 4QC2A 4ESVA 1UJMA 3CUYA 1LJUA 4AS2A 4D46A 3D6VA 3GHHA 1SG9A 5CXUA 2FR8C 2QN6A 3W7AA 2D2VA 1E8NA 5TDHA 3T35A 1GLNA 1ZXLA 2FB9A 4UVGA 2VQ3A 4ER3A 1PJZA 1JHOA 4R1QA 3TGLA 1KR5A 2Z3ZA 1JHMA 2WJHA 2Y1DA 4R7TA 3ZS9A 2X5KO 1AF4A 5JCOA 2WAMA 1A50B 2W4IA 1E0SA 2XTNA 4LWQA 4MLZA 3CJRA 4TXJA 4YY3B 2PGOA 4RKFA 3NHKA 1YNSA 2G5PA 1SKYB 3EXEB 4XYLA 4WFKA 4HDNA 1K3UB 3O03A 1M1NA 1OLSB 4FBMA 5FLKA 1KK2A 2H65A 3ND9A 1SBZA 2DHCA 3D4OA 1ORTA 1T6ZA 5GIOE 5TRTA 1IN4A 3ND8A 4RK5A 2AMYA 1X7HA 4BWFB 2B3TA 1B6RA 4RV9A 1PNVA 3LDGA 5HKLA 1G6OA 2WAXA 1G59A 3TO5A 3KZMA 1FJ2A 1EDZA 1TI7A 4US1R 2VO1A 1OX4A 1MABB 2GERA 2QY6A 2HH9A 3I8XA 4MGKR 4H59A 4TV9A 4AY6A 1KF0A 3L6EA 2Z5GA 1N9KA 5JZOA 1TL7C 1QSGA 2AOTB 3G0CA 1GTZA 3H17A 4X20A 5TJ9A 1NLYA 2WIGA 4F3CA 1EM8B 1WCWA 1I3MA 2O3TA 3LDUA 1D1QA 1V2GA 2R60A 4L4UA 4X97A 2C9ZA 2M6RA 3BILA 3P0JA 1EQ2A 3O47A 1PTJA 4LG1A 4RS3A 5E7QA 5HF8A 3T9FA 1MX1A 2NXEA 3VPHA 2H4HA 1LK0A 1S8OA 1Z4PX 5FQNA 2P3QA 1FFXB 3SZMA 1L9XA 1DKLA 3V8MA 4FIDA 3ZNQA 1KVTA 2O3RA 1ONNA 1OB5A 1FBNA 2ALJA 1C9DB 2HX1A 3L8EA 2A6PA 3O75A 4CN8A 5HSGA 3V4SA 1TJYA 1Q1QA 1U7HA 3IV6A 3OKPA 4D99A 2JD0A 1HDXA 4Z4FA 1U7DA 1P19A 2AIRA 5A0VA 1NVDA 1OBFO 3GPDG 5D85A 1RXYA 1D5CA 3HR7A 1B15A 3HXQA 5A02A 3WBKA 4BFUA 1PQWA 5FPQA 5J3JA 1JYSA 5ILGA 3THSA 5HDQA 3UC5A 2PLWA 3N58A 4GZMA 4U2BA 2R8PA 2FMHA 2TMKA 2D1RA 5JCZA 5BO5A 1IE3A 4AC9A 1J20A 1SFRA 3I1JA 4F6CA 1B42A 2VJDA 3GF4A 1MDFA 2YICA 3TW8B 3NBQA 3QPCA 2A30A 3E23A 3MA0A 5EWJB 4K40A 4TQAA 3WADA 3GBVA 2BR3A 4XTRA 1XVIA 1DHRA 3PFFA 4O3FA 3L1JA 2AWNA 1XNRB 3EHDA 3WBFA 4GKAA 2F8TA 4P08A 4P98A 2BKVA 2C3OA 3ZQJA 4FFLA 4UDOA 4BB9A 4YASA 3RGWS 2GAFA 1DT3A 2CSUA 4N3AA 2IF0A 3C4QA 2XMRA 3KQVA 3L06A 1Q2XA 1TXGA 1KY2A 4O2BB 4WRRA 4KGDA 5HKAA 1C8LA 4QUAA 1Z2EA 3U4QB 4Q12A 4B8YA 5U9CA 1MN6A 3JAKB 4HFNA 2XODA 2V3WA 1FRQA 4LFBB 5BQ5A 1H94A 2QZPA 3BH6A 4GICA 3O91A 2WD7A 4XJTA 1K5PA 1JE0A 3D8TA 1NV9A 4X7PA 3V80A 3B2QA 5B58T 1J1IA 1G7SA 1W49A 1XTTA 2O2JA 3OECA 3ROPA 2JGJA 3VYTB 7YASA 2YZNA 3L93A 3K70C 5ES3A 1R4MA 4FHDA 1NPDA 2IIBA 1N7JA 4QU5A 4XA8A 3E1KA 1K3FA 2W6NA 4A4DA 1H6AA 2H1SA 1U2QA 2IYQA 2MDTA 3MRVA 3R7NA 2BCGY 1DAKA 2Q1UA 2R65A 2A3NA 3S2ZA 1PN3A 1GPLA 3M9XA 3VNAA 1CEXA 1U31A 4B09A 1Q14A 3NGLA 4UEKA 5EIEA 4PM4A 3TUZC 1Y3CE 2A0WA 1Z0IA 2V96A 3HJUA 3AG6A 4ALNA 4DPLA 5JAMA 4Q18A 5M04A 2J6IA 2VQSA 1NAHA 5B58C 3W06A 1CP3A 1R4ZA 3C7CB 4ZEVA 2O8EB 1GNPA 1J8VA 2WD7B 3HJAA 3P71T 3V7YA 4ARUA 4DQDA 2BEUA 2PZMA 3FHCB 3A2MA 4FHGA 4MV7A 2VSXA 3OJOA 3ZWVA 4YRAA 5AQ1A 1VI5A 2A9PA 4I4NA 1AQJA 3HO8A 3HWRA 3NT4A 1DAMA 2IEBA 3G2LA 1ONSA 3OPMA 4QREA 5TQJA 3NNNA 4B85A 2FSVA 2C42A 2VPIA 4EHLA 5BPHA 4KREA 2EIHA 2VWHA 3B5EA 3ZGVA 2H4ZA 3G5UA 4G63A 4HQOA 3TLBA 1WRBA 1BMFA 2QS9A 3H2HA 1QDLB 1R10A 1K4YA 2PXXA 4OYLA 4IWNA 1FFXA 2A9OA 4OAQA 3NTUA 1UIMA 2OYCA 5C53B 1CSEE 1E3SA 3C3KA 1PGJA 2JHFA 2X7HA 1FTSA 1T15A 4DANA 1PL7A 3T1QA 3C3CA 1QG6A 3DCIA 2O2SA 1A27A 3DCJA 3FA2A 4BZWA 2GK7A 3O8NA 2GZ2A 5DKFA 3SC4A 2W6JD 4F6RA 1KIAA 2HADA 4IDCA 2BTOA 1JZTA 3O3CA 4EZIA 3NYQA 4FN5A 5IDVA 3MINB 3BTSA 4JGIA 5F7JA 5M34A 3EK2A 2I2WA 4J76A 4Z3KA 3KD3A 1VHDA 5EIBC 4LYDA 3RHZA 1FTQA 1HNNA 1T4MA 1F38A 5EMKA 4P93A 4EW6A 5BWLA 3RQIA 3TTUA 2I62A 2DHEA 5HX7A 1F51E 1WS6A 1TW2A 5AKGA 5E7MA 4CL8A 2CLFB 1L7RA 3ZLVA 3K0FA 4HMQA 2D54A 4BX2A 4DNQA 1JMYA 5ADVA 5HJ7A 1P2GA 3OPYA 4R8VA 4OQNA 2O7SA 1I1QB 2D0IA 1QHHA 4O1HA 4YR9A 3PQ3A 3L6CA 4II3A 1YBAA 4P4GA 2O6HA 1A9YA 2XYRA 3C5EA 4TMKA 4TLLB 1ZU5A 4AF7A 4JJ7A 4TUYB 2JW5A 3RYFA 1GPYA 5GOTA 1E3DA 1Z4LA 2FLKA 1KNXA 4R3WA 4HNUA 4C4PA 3DMPA 3M7IA 5L9AA 1YQUA 6YASA 1E1MA 2H4YA 1TCBA 1DPFA 4ZO6A 3PIIA 1NV8A 3OJ0A 3OZEA 1NSFA 5CDTA 4FM9A 1P4HA 2P1ZA 4YBRA 2FSFA 4BUJA 5EUQB 4CMGA 3DM5A 1PG0A 3LSTA 3CN7A 3W9SA 1BHSA 1GVNB 3B3AA 3O1HB 1ENZA 4HEQA 4QUBA 1ECFA 2Y76A 3OIFA 2ACVA 4JLNA 5IWAB 2RHWA 4FFMA 1X74A 5AJUA 5F35A 1BE1A 2J3DA 2KLBA 1W34A 2CGEA 4OXXA 4JU9A 1DXYA 3ZWKA 4OUDB 4BU1A 4TTPA 5T4HA 1E3IA 2B1IA 2YL2A 4DM3A 5FDFA 5JT1A 3H1EA 2C4HA 1D7AA 1PU2A 1QIFA 2ENWA 2ZLBA 3L7IA 4TUYA 4ZMRA 1T3LA 3WWYA 3V8BA 4G36A 2OKCA 2ZUDA 2ZDHA 1RACA 1NW4A 1OPXA 2YTZA 4PG5A 3U31A 1U0NA 3HXLA 4JH0A 1P7CA 3CG4A 3ESBA 3HMKA 2H06A 4QNRA 4OQMA 2D62A 4WZBB 1TO1E 1IHXA 4KBGA 3AWDA 4M6WB 2ZXUA 3IKVA 3KP1A 5G0TA 2RAPA 3KYCB 2R48A 5F98A 1ULHA 2PX4A 1JG1A 2OHXA 3JRNA 3N2ZB 4ZTZB 4AMYA 1WZ2A 2CBXA 5K01A 1TF2A 5IXJA 1NXPA 5FL3A 1U0RA 2YY7A 2BHTA 3QENA 3VAAA 1N0IA 1H2RS 4PSKA 3AFGA 2QMHA 3W7VA 4Z1OA 1V47A 4FD2A 3N6XA 4XYEA 4KMOA 2XT9A 2ICAA 5M3BA 4Q66C 4QODA 3VSCA 2QN7A 3C8HA 4RJ2A 1FYVA 2WIFA 5DEOA 4K7JA 4GC5A 1Q17A 4LY0A 4DLLA 5KVAA 2YVAA 2AZTA 2ISSD 3FPHA 3NGMA 3WBBA 1WDMA 1JILA 3FDZB 4G07A 1VHJA 3D2CA 1E5LA 1YHYA 3GLFA 4B8WA 4IFBA 5G0SA 1OUMA 3KLNA 1WCYA 2VUUA 5BYAA 1JVSA 1U0SY 2OILA 1T43A 2BAGA 4V3BA 4RMGA 4H0NA 4JLVA 1RRMA 2P6NA 1X7XB 3BIOA 3I32A 2ZCJA 3UMMA 1H3NA 2VTKA 3A3NA 3I53A 1E9CA 2J3JA 3LUGA 3DJFA 3O7WA 2AW3A 1YC2A 2APJA 4KJXA 1QVZA 5LUBA 1XL0A 4EVRA 1Z34A 1JAIA 3D5TA 4P36A 2AZMA 4E5VA 1QHEA 2G8LA 4WGFA 5B3JC 2ODPA 1CUYA 4FEAA 1SOAA 4JQSA 3R9KA 2BE9A 1LBQA 2O6LA 2A94A 1SBYA 3NHUA 4RF4A 3IR7A 5I51A 4F1JA 3P4XA 1W4RA 2CV2A 4URVR 1H6BA 4OD0A 1FMCA 2MMCA 4LJ5A 2FR0A 3JQCA 4NF2A 1KS2A 2HSWA 4FGJA 5HF5A 3QX9A 3A37A 3VXKA 3GFFA 3HWSA 1BKDR 3CNNA 2MU1A 5DM70 2P78A 4R9SA 4TVOA 4MDHA 3JY6A 3W2TA 4RYDA 1JJ7A 4DVJA 4TL6A 4FSXA 2PUJA 2H1VA 3JTEA 3SXUB 1KWGA 4KN5A 5K3DA 4DIKA 1Z36A 1Z6ZA 2OV4A 4M7OA 1BN7A 4NYJR 2JLYA 1P77A 3Q5GA 1UC8A 4J1QA 2JAUA 2OT3B 4QGAA 3PDCA 1ZGBA 1N6NA 3Q7RA 4JJ8A 4EFDA 1XU4A 3WV4A 5AUPB 5A03A 3N59A 1SJ9A 2DKOA 5A5DA 5EJEA 4BGDA 4D5EA 1RWMA 3I09A 4M0UA 3TQTA 1Q1NA 2AV6A 1GGVA 4R7GA 1Z4QA 4FMPA 2GKOA 2BRUA 4NFSA 4Q3KA 3W5VA 1D4FA 2Y2UA 1ACLA 3A4IA 3DKPA 4FDVA 1EINA 3I2YX 4EDFA 2ZIXA 3MS4A 1I7DA 3UJ6A 5LU8A 1Q15A 2RC6A 4D9GA 3G1WA 4R8LA 2XSZA 3KHSA 1XJWA 5EUMA 1U0TA 2B4AA 4E4TA 2JK0A 5F52A 3C0KA 4NVRA 3GN1A 4HN9A 4YS6A 4Z4QA 4RGVA 3DW3X 4OHKA 1X87A 5KYNA 2QUKA 4HUQB 1B2RA 2FPKA 2IIPA 4QUGA 1GU1A 3IH5A 3EZNA 1XRJA 5AHKA 4CU2A 4MA0A 2EEZA 3ANMA 2P1RA 1EH5A 4I4TA 1N2CA 1TM5E 1VYVA 2CNWD 2ZYRA 3DTTA 5ENVA 4B3CA 3O38A 5FA6A 3UNXA 2PUFA 1YFZA 2K2QB 3IIKA 2D2EA 4LX0A 3PL5A 5T8KC 4U02A 4M8IA 4ARSA 1AU9A 3W8RA 1SXJA 1E9BA 3EXIB 4EJSB 4YJFB 4E51A 2ZVPX 3PI7A 5KYTA 5DNDA 1G0OA 1RHQA 2W11A 3AHFA 3IAM6 3KK0A 3ROTA 3CVXA 2IODA 4H60A 2WJVA 5K8CA 2C7OA 1QFZA 2W7TA 2PT6A 2TECE 3D8HA 4RHUA 1HNZB 5AVYA 1ZC3A 3LAWA 1IRXA 4IJMA 5EUCA 1VE6A 2JEYA 3ORYA 5F21A 4ZODA 2VHZA 2FZ4A 2P4UA 2Y6VA 3D6JA 3MGBA 4QBHA 4U6QA 4DLTA 3OHMA 3OX2A 4NU5A 2ID4A 5BSGA 3OJXA 3UXEA 1ZQ9A 1VRWA 1G20E 1C29B 2ABWA 3LOQA 2D5IA 2BFBA 1H65A 1W48A 3B9QA 5B1IA 5H82A 1NY5A 2IE0A 4ESOA 5LOVF 4Z7JA 3KOXA 3PICA 2BBWA 1VLMA 2ZWOA 1U2ZA 4TVKA 4UATA 5C81A 4K05A 3BG5A 4HGPA 2CXUA 3GVXA 1QWSA 4RKQA 1E5QA 1N5RA 1M2OA 1U28A 3ECAA 4JA2A 4R1MA 1XNQB 1OWPA 4KMMA 3EXHA 3CCFA 3BC1A 1MT3A 3GH3A 1V95A 4HNGA 3TBFA 4DLBA 4QX6A 1NW3A 1GLGA 2K2WA 4HN2A 4MHOA 3K2EA 3KAKA 4C7XA 4J1NA 3JARB 1BDHA 5FTJA 2OUKA 4DYDA 1EFTA 3OJFA 1OVGA 2RGAA 4ZVLA 1K08A 5BT9A 4TXLA 2JF0A 3CNLA 1OXMA 1EFVB 2KW5A 3JALB 1GGFA 1XQ9A 3NONA 3V00A 3KFVA 3EIEA 3FWKA 4G0QA 1LV8A 4LRUA 2EXXA 1TQ2A 4RFSA 4WEQA 3PKZA 1EK2A 1XZHA 4OG2A 4ZVVA 5REQB 5KTTA 2FUEA 2QRVB 5EHXA 3QF4B 1I7SB 1FX0B 3P2KA 3AUTA 4RXUA 3W3AH 2B6HA 2G4VA 4XGKA 1F5SA 2VSOA 2N42A 1K6JA 1BE0A 2Q0SA 3CLTC 1YJ5A 3LTNC 3CF6R 4E15A 1TZBA 1G2PA 5E0KB 4DC9A 4BKMA 1RMTA 3SYMA 3EQ7A 5FOXA 1VCNA 1PNOA 1XKQA 3BIFA 3E7WA 2IHKA 3UZUA 1Z0SA 3GQVA 4ZANA 3LP8A 3MGCA 2JKYA 3HRIA 2RFLA 2XUGA 4X8MA 5FI0B 2CKMA 3U7JA 1EK5A 5EWMB 1Q44A 1QQ6A 1NVXQ 1Z18A 2Y1WA 2ZRBA 4M87A 1N3IA 4KR3A 3Q7IA 3HV0A 3H9BA 5DNAA 2OUIA 1W2HA 3H9EO 1PD0A 2EIXA 5FJJA 3T3OA 1NONA 4QARA 4C7BA 3CO0S 3IRUA 3IUBA 4WECA 5SZKB 1U7PA 2FLVA 2BHNA 1EVJA 2OCAA 4PGFA 2ZAGA 3DE0X 3EN0A 1A82A 1OLXB 4IXDA 4C9BA 2Y67A 1EZ4A 4OHPA 4ER0A 4FX5A 1ML3A 4XUCA 1W4LA 4NU8X 4C6TA 1EVEA 2ST1A 2ZUUA 5KVSA 2R8ZA 2VPTA 2EFCB 2ZJ0A 1ULTA 4OP1A 4XWWA 3RAEC 3DZFA 3HB5X 4MUYA 3RT9A 4F4DA 1Q91A 2XJ9A 3KC2A 3L77A 1HFKA 3H6GA 1L4FA 2AN3A 3ZV6A 4NECA 5L7YA 1TEHA 1VHWA 4REMA 3BH0A 3HXKA 2X41A 1U3FA 1MRZA 2Y77A 4MWBA 3MIIA 3OI7A 2JHGA 4H16A 3BZBA 4BUCA 3BGWA 6AT1A 3C3AA 3L46A 2C7PA 3BXFA 2MSLA 1DEAA 3AJAA 3CX8A 3DO6A 1S9DA 1T9BA 3PYMA 4JLDA 4COOA 1HE2A 3F8TA 1JMVA 3OPQA 3SFZA 4M4SA 5DN6A 3I9V6 2O8FA 1NVTA 1D7OA 4JC4A 3FVVA 5CMLA 4QQRA 5EZYB 1E1QA 4MVJP 4IS2A 2X0FA 3PGA1 1GKKA 1ZH6A 4XZ3A 1Q1BA 1SB8A 1NC3A 1G20B 2I2XB 1EQUA 1A8QA 1N5DA 2YMPA 3KSUA 4PGGA 2LRHA 4YALA 1E7SA 4IW3B 5JCJD 5FOQA 3SEQA 5KSZA 2ZJ7A 3TRKA 4EKYA 4L07A 1L7QA 1JJIA 2JIRA 1NBMD 3QHAA 4QHTA 1YU9A 1U63A 2PGDA 3HCBA 4TWZA 4ZMSA 1EP2B 4JR2A 4N3GA 1GARA 5E9QA 3QF7A 1JI0A 4H6XA 4HMOA 1V26A 3ZE8A 4W9NA 1G7TA 1XU7A 4EPWA 5LFAA 1JKXA 1TLLA 1QIIA 3RYFB 1JXMA 2HFJA 1TFUA 4HTAA 3AXTA 1CJBA 3NS7A 4N8DA 4ZEOA 4JSRA 4Y7CA 2PJDA 1AKNA 2SKEA 2PIDA 4E14A 3FKQA 4YDSA 3WY9A 4G1UC 5IJ9B 1TQHA 1SUWA 3LC1O 4XCQA 2HWWA 2WF6A 3AF3A 5FTNA 3S2YA 4CLHA 4UVHA 1QU2A 3TQCA 4UBMA 2V0CA 1QRRA 4OKNA 2OBMA 4LDJA 2BI8A 4B5LA 5DV9A 1ZHOA 1CULC 2QT0A 1CFZA 4E32A 5K8TA 4W82A 2FPPA 1P2SA 1BYIA 4RZUA 5KQSA 4WKPA 1O58A 4JMLA 5ESWA 1KDVA 4QZVA 2OZVA 3DSRA 3CX7A 5JASA 1AKTA 5EYPA 1I01A 2V6JA 2UZAA 2JAOA 3FVTA 4YJKA 5DX0A 2F4NA 4L16A 3HEAA 4A2WA 5JNSA 4HATA 4GEGA 1M2HA 3DFZA 4F72A 1V1JA 4MITA 4F2DA 1BROA 5LZ2A 2B30A 4MO9A 5B3KA 1RWOA 3QE0A 4F3RA 2ZJZA 1UDCA 3NC4A 1Y1TA 2DC1A 2D59A 3EZ6A 3GLRA 3QXHA 2EGUA 1VSBA 5J63A 4Q6WA 1ISHA 3HM9A 5EWMA 2RKBA 4UW9A 2PH1A 1XP5A 3CRVA 3IP3A 2C54A 1G3IA 4ZAYA 1XMPA 1LZKA 5DXJA 4EVSA 4LF8B 3VJRA 1C14A 2C84A 3ACDA 1P4JA 1VKJA 2FQQA 4ZIRA 1NP7A 3GQBB 2GJ9A 2ZBUA 1ZWLA 1DUSA 3HYCA 4AKIA 4LPSA 2ZDGA 1GFZA 4WADA 4C30A 3BL6A 3K6SB 1CY0A 5KOIA 3U4AA 2CKDA 1HGXA 1QH1B 3BE4A 1DBVO 4WACA 1TQ6A 4YJHB 4D2IA 3KETA 4EHKA 2RGBA 2Z2IA 1QRAA 2X58A 2C2WA 3ANXA 3RC2A 2CFOA 4Y98A 3KTDA 2G0AA 2GF2A 1M83A 2VJCA 3LRPA 3EC1A 3I9V1 2VK8A 1FDUA 1FFBA 3Q8LA 3C3DA 4EHJA 2Y1XA 4NXNB 3JR7A 3FE2A 1HL3A 1WPXA 3TH5A 1V6AA 2YWFA 3GAZA 3JWPA 4MUGA 4O8ZA 4EZBA 2Q9BA 4BX8A 4XIFA 5CLQA 1L3BA 2XYPA 1PJ2A 5ALUA 2FOLA 4OB8A 4WN3A 1ODJA 3WGHA 1J6UA 3LY9A 4JQYA 5WRFA 3FH0A 4YXFA 1Y5RA 4JOSA 2AI1A 1TEVA 2N47A 4EKDA 3H4MA 2YWEA 4CL3A 3MAJA 5JS8A 4MEAA 1YKGA 4MW7A 1BSVA 3RUPA 1CR4A 3SI7A 4BL5A 4E2ZA 4MWCA 2K7FA 3NM6B 2JGMA 3KKOA 4RHTA 1G9SA 4ZAXA 5LC1A 4ALMA 3N5CA 2QW1A 1KGDA 1FNBA 5CTJA 4BFWA 3T1HB 3L9XA 1HKUA 3AEYA 4Y0AA 4Y2PA 1SU6A 5GONB 5KHLB 1RPJA 5LR6A 5MGNA 3WNBA 2GDJA 2EJWA 2WTAA 1BGWA 1GZ3A 4MI3A 1VL8A 4YT2A 5F73A 2ZSBA 1Q1AA 4NS4A 3EAGA 5AHOA 4KYUA 4V0MA 1RYDA 2YNMA 5CDFA 4B71A 4D42A 4DTIA 4DMKA 3EOZA 3NX4A 5SY6A 2GVZC 2ESRA 2RJNA 4JXJA 1D6JA 3IVXA 3GDHA 4BFYA 4K5QA 4DWOA 4MXDA 4HLCA 2NP6A 4CMBA 1ZEMA 1BHJA 1A5ZA 1D2CA 2FEAA 2XB9A 3Q3JB 2BEJA 2REXB 2YY6A 4FGUA 2CDCA 1ZK4A 4NY1A 4TL8A 5IVIA 3RVOA 4E31A 3DGFC 5CDUA 3MLBA 1V1RB 3LWNA 4AJ9A 1JT9A 1P7ZA 1T6BY 1KYXA 1Z06A 3AUXA 3P9PA 5B37A 1TM2A 4EEKA 2PRSA 4FVTA 4MUEA 3O2NA 1EWVA 1O1YA 2ZT7A 1CS4C 3GGDA 2E4XA 2BGUA 4ON9A 1J24A 4QRIA 5DHUA 2CK3D 3MWEB 1FFDA 3BGOS 2QQEA 3MT9A 4OXRA 1EZZA 3PNVA 1RSZA 4GMFA 5LQJA 5C52B 4DR6B 2MR5A 1OB2A 2AFRA 2ZR7A 3DHNA 1HQDA 5B4TA 1I13A 1FSFA 1VDMA 2AOXA 1GO2A 1JKIA 2ENUA 3K73O 3B53X 4KC0A 1GAJA 3T0IA 4D41A 4EJ6A 4BFZA 4KB5A 1JNYA 4MDEA 4IUDS 1Q92A 2Y0CA 5BSHA 3PUKA 1DAOA 1N4AA 5KJEA 5AUNB 3M83A 3SFTA 5IUJC 3B36A 3AR9A 4MCHA 4CM9D 4XPIB 8ATCA 2EFGA 3P9QA 4JASB 4RMHA 1S4MA 1KAOA 2XNKA 2PTHA 3HCAA 2I87A 4FD3A 4EGSA 2XNSA 1SN7A 1RWWA 3LHIA 3ER9A 3MHPA 4H0FA 1CX9B 3T9DA 5AJVB 4BVKA 4EJSC 1L8XA 3OLYA 5LP1A 3IO5A 3UAVA 4INOA 1WXIA 2ZSJA 2I1WA 2M32A 2X9QA 3UTCA 3W5CA 4UTXA 1CE8A 2CXQA 2ZYDA 4GPZA 3DJYA 3I5MA 1NN5A 2VPPA 4MGYR 1I9CA 3QIAA 4MR8A 4YACA 4RFSB 4ZU6X 3PE6A 4BYGA 2ZANA 1TTQB 3OE7A 3HABA 4AY4A 5JS7A 3NHZA 5ETJA 1SG6A 4CEJB 4B6OA 1Y1KE 3AF5A 2C03A 2P65A 2Y0EA 3WMXA 3ZV7A 4QVKA 4DVGA 4MV1A 1CRPA 5IC6A 1FSPA 3IQWA 5C1OA 1G98A 2CVZA 1OASA 2QZSA 3OO0A 4J16C 5HS6A 4XRGA 5CB4F 2PSDA 3W3AA 1LS6A 4I1IA 4AYXA 1WHTA 3DLHA 6PFKA 3E8SA 1KKMA 4ZVMA 1G21B 1R8QA 3RBXA 2GPAA 3DNPA 1GNQA 5CUQA 3TTVA 4U7HA 1WF3A 1AUVA 1XD2A 2EP8A 2JCVA 4GLFA 4RY0A 1YAJA 3NTXA 3SC2A 4UD6A 1UC4B 3GFQA 3KKNA 3VYRB 5E3HA 1RAFA 2P6UA 4LRSB 4WOCA 4L8WB 3ILVA 4QDXA 4JEHA 4BJ3A 2C88A 4YPOA 4BB0A 2IYLD 1XFAA 4MDFA 2VNAA 3GZTB 2I2BA 3OZIA 3FJ1A 1RBQA 5GGYA 4GGMX 4X64B 4AW9A 2P3SA 1H69A 4QNMA 5ALIA 4FCVA 4TRMA 3TEJA 1QO0A 1GPAA 1RWBA 3KBOA 4OGGA 3BWCA 4UXIA 2UV8A 1WSBA 5BWBA 3EVFA 1RBZA 1SC9A 3WLHA 4O0MA 1EP9A 5DBOA 4QDTA 5FUXA 1FYXA 2YJZA 3R23A 2GNOA 4YQEA 2PA3A 3NCHA 4YEDA 3LVBA 4N41A 4ZJPA 3FBTA 3FHTA 4L50A 1JEJA 4RVGA 1DTWB 4MEJA 4QECA 1RI5A 1ZNWA 3HBJA 1RRFA 1ESNA 5ALYA 5JBNA 3IUYA 3MTAA 3RVBA 4C76A 1W9MA 1IZ0A 4ZCPA 1AY0A 3LYHA 1VG8A 2SCUB 2ZPAA 3G1TA 3WDLA 1W7AA 4KIFA 1A4IA 1F6WA 2P4EA 4MCAA 3TI9A 4I4IA 4S1OA 5AVSA 2BEWA 1U9ZA 2F8SA 3DYVA 3FCUB 1E60A 5E6RA 3VDMA 1Z3CA 4JC8A 2BOVA 2P35A 3GW8A 1L7DA 1F2DA 1RI4A 1XMJA 4Q21A 3I5UA 4RLFA 3PV0A 1BH2A 1JSZA 1ODTC 2W6QA 4O2BF 1QGDA 2O7QA 3BKXA 3GDOA 3TPZA 4IXWA 5TGDA 3AM3A 2PSEA 3TQOA 1A4UA 2FQ1A 5HFNA 3SSOA 4DRYA 1WBDA 2GHTA 1M8KA 3STTA 4UNRA 1MQAA 4D44A 1IHYA 1U9IC 3WJ7A 2X14A 3LXXA 5CA0F 1EIWA 3K94A 2PZJA 1P44A 2Z1NA 3N8HA 4NJEB 5T4FA 5KDOA 3ADCA 4X3CA 5IAAA 3QUQA 1MO4A 3JQFA 1K8ZB 2W2KA 1M5UA 1H5QA 1Q0ZA 1TUEA 1XF1A 2DPHA 3E22A 4AU1A 2F1IA 1Z47A 1ETUA 5GJVC 3CW2A 4IG4A 2OAP1 3RRFA 3LFTA 1BGVA 3G7UA 2R00A 3L8HA 4B3GA 1PFUA 3D1LA 3QWIA 1WB9A 4IXTA 2JLRA 4BQEA 1MA0A 3O4GA 5D1NA 5KU1A 1CR0A 1VYHA 3MINA 3VYUB 4NFYA 1Z0FA 2XD9A 1VBKA 1YDWA 1EVLA 1KI6B 2XUOA 4E33A 4MKIA 3V2GA 2ZPTX 1J2TA 2NN3C 1EUDB 2BKXA 2ONYA 2WIKA 3CUTA 3FG9A 4KTTE 4CR7A 1W44A 4MVJI 1UZLA 4M1TA 5DH9A 5K0ZA 2ZM5A 5TVGA 3HJBA 5A04A 2PWBA 4RNCA 5J9FA 1QH8A 1SGWA 3MTBA 1VB3A 3DL4A 1UDXA 4XEHA 4RXTA 3G0OA 4LJ4A 3K0FB 1EB9A 1LRKA 3BD8A 3TQRA 1J39A 1UAGA 1VBFA 5CG1A 1QCYA 4NTZA 1HG1A 2CY0A 5EKTA 4BMZA 3K7EA 4EABA 3AR3A 1EFLA 2ZJ8A 2DTXA 2GBCA 3MCVA 1IJFA 1LSSA 1OTYA 3HZRA 3OEYA 3O8BA 5CBPB 2AS0A 3PWKA 3TBKA 3HVKA 2A0XA 2ANCA 3B1WA 5IZ4A 4U2KA 3UTDA 5JI3E 3H99A 4JQZA 3UOWA 1WDLA 5JY6A 4MIEA 1GOTA 4MQ5A 3P9KA 2UUBB 1FDIA 3LQFA 1P9WA 1B2LA 2WF9A 3G2KA 4TYPA 1XQWA 2ZK7A 3I28A 3MJTA 1NAIA 1MC1A 2Q49A 2Y8EA 1FX1A 3OT1B 3EPJA 5KCZA 2XUDA 1F12A 3TTYA 4YJGB 1LPPA 3FFBA 5BRAA 1Z83A 2OCXA 4U5XA 3BFKA 4U39A 3ISVA 2COKA 4WH0A 1OWMA 2GAOA 3MOIA 2A9VA 2QLBA 4YGYA 2OORC 4I4LA 4IMIB 3ES9A 4MNTA 2FZ5A 4HLNA 1MJHA 1V8DA 3P0EA 3OM0A 4JENA 2O54A 5F5LA 3FDIA 4EYGA 1LTHR 4V2IA 4FUQA 9MHTA 3INRA 1C7JA 2DUUA 2H07A 2IYSA 2X8WA 5KTYA 3W1VA 4ARZA 4KUGA 3AUFA 1B0ZA 1XTBA 3MT7A 4JWKA 4KVAA 3S2UA 3VBCA 3DEKA 2Q5LA 4HH4A 3FWZA 2A0UA 5EMHA 5LJLA 4O1MA 3OUUA 3I4CA 3OZWA 4E6PA 4CT0A 1PSDA 4C4AA 1YB7A 3GELA 2QSYA 2ZJ1A 3ULKA 1A2OA 2BT4A 5C34B 3LQQA 5FI1B 1MPXA 1SVLA 3PVZA 1UADA 1D3AA 1UKAA 1Z4KA 3E9NA 3M81A 5TEVA 4OB6A 4DE5A 4E5DA 1TT7A 2JARA 3DL2A 4F1WA 7ADHA 4C20A 1CY4A 1XEWX 2WYHA 2YYAA 3JYNA 1T2FA 4KHZA 5D1HA 5IH3A 1NQVA 1ZMTA 3UMFA 4TZTA 2CLHB 4CF6A 4MZDA 4RKEA 4R2MA 1ZS9A 1T24A 5IX8A 3GRCA 3TECE 2UYGA 3NDPA 2QW0X 4YRDA 5IUKC 1B43A 1PYGA 3HC7A 5A9SA 5HFAA 1PCXA 2HF8A 2MINB 4DJEC 5EA2A 2UUAB 3AW8A 4TV8B 1VE3A 3U61B 1NBME 1Z74A 3UK0A 5J43A 4CJXA 2VQ6A 2X40A 3MVEA 3DWEX 1WUYA 3IELA 4N39A 3SDBA 1R5NA 1EGMB 4M86A 4W5QA 5H5JA 1PK8A 5CU7A 4GPIB 5DWQA 5HKOA 1O96B 3HKBA 2AC4A 3GUHA 4I9UA 2C97A 4NJMB 4DLNA 5HOEA 2OK7A 3OZGA 1J2EA 4LSZA 7AT1A 1AK2A 3DDWA 1R0XA 1G5PA 5K0TA 4P2BA 2XEXA 1BRMA 3NWPA 2J08A 2J4FA 5FO1A 4I14A 5JANA 4LNUA 4CLOB 4CKBB 2ZAOA 4U2EA 2CJYA 2Q2NA 5ALPA 1TTHA 1U2EA 4CCWA 4DLVA 5HUHA 2WHXA 5KX5F 3I62A 2C83A 3Q5DA 3VPCA 3QVGB 2W6ID 1XTUA 2HK7A 2JVIA 6GPBA 4U2CA 4TS4A 2O14A 1JU4A 2GASA 4Z0HO 1U3GA 3FGOA 2FWIA 1H2HA 1U7XA 5TPWA 2HOQA 3WJ2A 3QTTA 3QLVC 1V8FA 3QBJA 1A9OA 4DLXA 5ECGC 4G8CA 4ZJZA 1KPIA 2ZQYA 5FOWA 5CT5A 4FQ7A 1WABA 4FHFA 4DC1A 3IIJA 3PJRA 3S8MA 4OVKA 1ZA2A 4AJPA 1BCRA 2AL7A 4I6GA 1D0VA 4Y2RA 4DQXA 1M1NB 3CT6A 1CR6A 3C41J 4ITVA 3TBHA 1F1JA 3UJ3X 3KB8A 2ERXA 2ZJAA 3ICVA 4JFAA 1XMXA 2D5BA 5IBCA 5KSOA 2MMGA 3RYCB 5FTWA 1SXGA 1X0VA 4DQLA 4M9SA 2ORIA 1TU4A 4DN6A 1BFDA 3GLHB 4YONB 3OQMA 2EZUA 1C8KA 2C3UA 4WNIA 1GA1A 3GN2A 4RFLA 1WMBA 3F6RA 3RM3A 4C07A 1MAHA 2EWWA 2PS3A 2ZIFA 1QDUA 2WTUA 4QXQA 5BSEA 3GT7A 4YCCA 1P73A 3BE8A 1QK5A 1Y8RA 4PG7A 1OI2A 1VPTA 4YMWA 5KQMA 2C4TA 3T5GA 1VLHA 2QVGA 3GAAA 1UBCA 5JLAA 3OQIB 2DR2A 3ENVA 5KTNA 2GJKA 1NVKA 3QXXA 4GFDA 4A2CA 3EDOA 3CPHA 2OPBA 3VKGA 1JPNA 1ONPA 1DKUA 3B1KA 4DCNA 5ALKA 3WIDA 4I5FA 4RYLA 2OV1A 3RKUA 1YIOA 2R44A 4KN6A 1ZUNB 3SLRA 5F3DA 4AMZA 5MGBA 2EP5A 1BU8A 1P0CA 1YE5A 2Z8XA 3LK7A 4CIAA 5LU9A 5CXSA 2IUTA 3DD5A 3H9JA 7REQB 1WXHA 2X4IA 1AF7A 3DS8A 3KDSE 3H2KA 2O3UA 2WMOB 4MI9A 3STXA 4DUGD 3B48A 1RBMA 2BMEA 1QP8A 1Y3AA 3F6CA 3TM4A 1MLDA 3UJAA 4HZGA 4FGWA 2TMDA 2Z57A 4B2PA 3A7EA 4LS3A 1CEEA 2WPDA 1AD2A 4UFNA 1NF2A 3JVDA 1EFCA 4UUBA 3TCXB 3JYHA 4FOLA 2CZCA 2YRXA 3BJRA 1T8YA 3FCSB 4QPJC 1DKOA 4LW8A 4XDZA 2QPLA 5LNK1 5K3CA 3AKCA 1FP2A 2LDBA 5FA5A 4LJ6A 2BFEB 4XWYA 3GJTA 4HSGA 2W8ZA 3M6IA 2JD2A 2H00A 1XU9A 3AHDA 3CUSA 3KLPX 4MMZB 4TGLA 4I1SA 3UWSA 3WKEA 1NG1A 4B84A 4YQFA 3PQ8A 4EG8A 4QDUA 2VHWA 3VTZA 3HHPA 3ADBA 1W8IA 2OESA 3QFTA 3B1YA 4PIMA 4DDTA 2PFGA 1YA4A 3IOBA 1KAMA 2I0FA 3EJWA 3HFSA 5H59A 5EFZA 2IV3A 1Y4UA 3NDJA 3QA3E 3TQIA 4GDFA 5LLSA 1O6BA 5C7OO 5AW3A 2YJ3A 1JAYA 5BN5B 2ZUSA 4DR3B 1OT3A 1BZYA 1WQ3A 2Q2QA 3KTAB 4MV4A 5FIUA 2PM8A 3MERA 1RLOA 2X77A 2C9DA 4X7RA 5C4MA 3E5RA 1KOJA 4Y2QA 4ZN6A 1T2EA 4BNDA 4PGAA 1EHYA 2NUAB 4HQRA 3UIEA 1IUNA 2VJMB 4YRPA 1NF3A 5G1OA 1I6KA 3SQOA 3P26A 1GPUA 2D3WA 8ABPA 3NP9A 1YZ3A 2MOKA 5GZ3A 2V7BA 3EVAA 3H2IA 3KJZA 4PAOA 1G6HA 2WLSA 3KDPA 1SCDA 4OI1A 3HDGA 2QRZA 3BMOB 3QX8A 4YV7A 3VR5D 2VLIA 3JS5A 1KY3A 3HR4A 1T8WA 4HQKA 4N6GA 4OUDA 2C9OA 4LFCB 4GPTA 3GMSA 2B82A 5EZYF 3TRFA 5K8UA 3NFYA 5JVDB 4QBIA 4NG5A 5EE3A 2WBLC 4CRWB 1APBA 2HJRA 4J6FA 1R6AA 1E98A 2I2FA 1UDAA 1X7WA 2JEOA 4LTNA 5FKJA 4DG5A 3VH3A 1P6XA 1T2UA 3OEEA 3GLVA 1TKRA 3NT2A 4TRNA 3UV6A 2DXIA 4TWIA 5FWAA 2BGWA 4H7HA 3SICE 1DKRA 1XXLA 3L92A 2XMSA 1UEXC 4LWOA 3T9BA 4LVCA 3TG2A 3QJYA 4KR0A 2R4TA 1Y8RB 2XMPA 3RBZA 1GRNA 1SQSA 4M0CA 5TY0A 2QROA 1U9CA 2ZXEA 4DCTA 1ZK3A 1RI2A 2HMSA 4DIMA 2VEOA 3VBEA 4CETA 1ZI9A 1IWPB 1KYQA 2RSLA 4OQZA 2OP0A 3ZX5A 3ELUA 2QRUA 3CT4A 3SIWA 3G5MA 1WEHA 2NSLA 4B33A 2VUSA 4IQ4A 4WMLA 2ZXFA 2A67A 4MPRA 2NT3A 3DCNA 5EZYA 4F6RB 5DNUA 1TM7E 3RYHB 3G0BA 3HDVA 1E2HA 3T5MA 4JVMA 2VK2A 2CV0A 3TRHA 5CJPA 1KE1A 3IXMA 5CJJA 2CMKA 4WZAE 1ADYA 2HMWA 3OY7A 4PQRA 4JZYA 4UMFA 2P9BA 1XA4A 2DMRA 4AJLA 3EIUA 1QG2A 3OE1A 2JH3A 3U7RA 4I1PA 1BS1A 4Y1RB 3KZNA 5CLIA 1D6SA 1OC2A 5BV1A 5I6DA 3U49A 5H3CA 3O31A 4RULA 4FINA 5LA6F 3AVYA 1OXSC 2C1XA 2J6CA 1IXRC 5F64A 2EKLA 2XTZA 4HRVA 4E4RA 5BXQC 1Q20A 1FMJA 2VXOA 1VXRA 2WF8A 4XUDA 3ZXUB 1VM6A 4FT4A 2DVMA 3DLCA 5C51B 1PR5A 3K0CC 3OZBA 4WOJA 4E11A 4BP1A 3FNEA 1KDPA 3N3BC 1W8DA 1ZH4A 2C5FA 3G2PA 4WWHA 4PTYA 4LXTA 3ZI7A 2IE8A 4MGEA 1DAGA 2IVZA 3NHPA 4Z86A 1FX0A 1RHJA 1KZYC 1M0TA 1QFJA 1RQGA 3JQDA 2A9JA 3ZS8A 5BWOA 1NW9B 4B3MB 3WHPA 2NAPA 1SHTX 3HU2A 5JG7A 2P2YA 4H4CA 4ADSG 3HCFA 4C4YA 5K6AA 2PMBA 1PG5A 1GY8A 4YO7A 1WW2A 4Q3LA 2P9JA 2C92A 5K8JB 3R5KA 4FFVA 4K88A 2IGTA 1QRDA 2E2WA 3EEFA 1H8ED 1AXRA 2WWHA 4JEIA 2I3ZA 5JNVA 2FXVA 1WU7A 3MLAA 3QY9A 2VUTA 1SU7A 1WQ1R 2R5NA 3RPEA 1FUEA 1AV7A 3HU1A 4YIKA 4M98A 3DVRX 1GAEO 1BCSB 3N2IA 3BMCA 3ODGA 5E38A 4EP1A 2V7QD 2ZYVX 3MCZA 2PX6A 4MDYA 3QEBZ 2NZXA 5CXQA 1CFJA 1SCBA 4GOLD 2J9ZB 4EUNA 3ANYB 3TF5A 2OHGA 1IOLA 1MQ9A 1FTWA 4L8GA 1KI8A 1IM5A 2YNMD 4GMHA 4BPRA 4EAAA 2WSIA 4W1RA 1SMKA 4LRXA 1YZTA 3M8KA 2NP7A 2F00A 4LRWA 4OHUA 1JB1A 2AA3A 3CZCA 1M8FA 3H1GA 3D7LA 4EVIA 4S2EA 1G9XA 3IERA 3K1YA 4PWZA 2VPZA 4IRUB 4QPDA 1I7QB 4A6EA 1PUJA 1ZICA 1A8SA 1M1UA 4N5DA 3S2GA 4YRLA 4LZJA 1GGKA 3IIIA 4ZAVA 1SURA 5C31A 2AXPA 1OXUA 3EXFB 4GVLA 3RROA 4EPTA 2H7YA 3T7RA 2PYDA 2CD9A 2XBUA 3VSAA 3QYAA 3DOHA 2H59A 4PVCA 4NL4H 4K1XA 1GQQA 5IFKA 2QNRA 4NZNA 4DQVA 2QR2A 3RC3A 3FOCA 4EJSA 1B0AA 4Z9AA 3M6UA 5EXSA 9ATCA 3EZ9A 4GP7A 1NUPA 5I3CA 5ED0A 3TVYA 3ONFA 1LNSA 3D8BA 5B6IA 4FOPA 1PAUA 3ND7A 1LZLA 1DRKA 3JZIA 2W8BA 4C2BA 1HE5A 4GI2A 4QYIB 4RXMA 1J8MF 3H97A 2QAIA 5CNKA 5I4IA 2HCRA 2AOWA 3HACA 2I4IA 4R4JA 2C2GA 1OBOA 3SXJA 4EPRA 3G89A 5IC5A 2A9KA 4PS1A 1L5ZA 1NQ5A 3HBAA 4BKRA 2YV3A 1YS4A 4CDMA 4D97A 2OEPA 2WTBA 4JDPA 1KO4A 1L5WA 3UWOA 2P2CA 5DIZA 1NNSA 4YR7A 2FF7A 2UU9B 4ZKDA 1ECPA 3JWJA 1RLJA 2QQFA 3H1FA 5JMTA 2W4QA 1FU4A 1GQSA 1Q2UA 2WJAA 3HFGA 2YDXA 3SOPA 1F3LA 3M4YA 2I6TA 1P6UA 2JGLA 4HDKA 4FZVA 3TIGA 1V4BA 1V8PA 5DCYA 2GA8A 4DSTA 3K35A 3NEAA 3OLCX 5ALWA 4LZWA 5HBGA 1S8FA 4W5TA 3NMUF 4Q05A 1GWNA 1HRDA 3HNPA 1C1DA 1NJ6A 3FMIA 4LECA 2CFCA 2C2XA 3JAWA 4DJAA 1X39A 1NR5A 2XNHA 1Z0JA 3IE2A 1LCIA 5F1YA 1ONBA 3EW7A 4LIPD 2AYXA 4ZXPA 4HNHA 1B76A 3WLJA 2YYYA 3GLUA 4HV4A 4ZD6A 1ZVJA 3AEKB 1K7FB 2FKAA 2ZDQA 2VNKA 4M7WA 2Q4RA 4MQ4A 1MZPA 2HJWA 1XX6A 3HNRA 4U00A 1KK1A 3DZBA 1MJFA 4TL9A 1VGQA 2WKPA 1V7PC 1JYFA 2Y92A 5B1YA 1Y7PA 2E1RA 4OSEA 1K7YA 4DM7A 1E1DA 2Y1FA 3AXSA 2YJ5A 3AR8A 1H6DA 2B9VA 2ID7A 2WM3A 5DYGA 1T0JB 1UPFA 3N76A 1VSUA 1C9JA 3Q0TA 4IKPA 1SG0A 3GBPA 3PQ6A 2B36A 1IONA 2LBPA 2RGUA 5CNMA 4IINA 3DEHA 4UTRA 3RVQA 2IK8A 2RB5A 4BTLA 1U90A 4IVQA 3MGKA 3OE4A 1QLHA 3ZWBA 4FNAA 3GLIE 3PXBA 3CW9A 4JMPA 1X0XA 4NCXA 4XASA 5ITWA 5LL6P 3U1BA 1U7ZA 4PPGA 5JHGB 4DMCA 3KFXA 4B9EA 2BGIA 2AF4C 5JWRA 4J1TA 4IDDA 4X5OA 5D5QA 2BISA 2G0TA 4ZHQA 4CKWB 2QTTA 1KJJA 3EC2A 3JYLA 5YASA 1DFIA 2W93A 1IMOA 3BBLA 5JI2E 1UMBA 3G0HA 4BNLA 5ARDA 4WVLA 1JBEA 2DFPA 4LBYA 4BV8A 5TGTA 1ZJJA 1ZD2P 3TSZA 2XNDD 5B57C 2VJYA 5AM5A 1RCUA 1V16B 5TNXA 3ZPXA 3ELDA 1AQYA 3PZBA 1CZKA 3ZQKA 2W2QA 4R16A 2UUOA 5IM5A 1BA2A 4H15A 2F90A 1YA8A 3NKLA 4OXYA 5LD2B 2KSQA 4TRRA 5LZ7A 4WNYA 1L7BA 1ZUHA 4WLFA 1D6MA 2AG6A 1WE2A 3WYFA 1YS7A 4BO9A 5T5QA 4LJLA 1PWYE 3M5PA 5AJXA 2B5VA 5LOVB 1UBFA 5LQUA 1XRNA 2VYVD 3RRNA 5CDFE 2GK6A 3P9IA 3CZ4A 5LYYA 3E3MA 1JHUA 4O4IA 3BQMB 3KTFA 1I6WA 3DEAA 1XZQA 4KR9A 1UP7A 1EE1A 1R37A 2IYWA 4M36A 1BVUA 4LNAA 1I4EB 4MRSA 4F5DA 1F8XA 1VJGA 1YWGO 4JLJA 2CWDA 4ZOLA 4FYJA 5GV8A 4QHSA 3H5OA 3TXYA 3G82C 4NH4A 4F4JA 2GK4A 2DWUA 5DSXA 3I6BA 1ZUIA 4TV9F 3ST7A 5LQCA 5AK5A 2P6PA 5FOTA 2RAFA 3COJA 2KJQA 3CZPA 4EDHA 2ODAA 4OV6B 2CCKA 3TB4A 1J4AA 4ZZIA 1OROA 1DQZA 4M8LA 3ZGXA 2WM2A 5I7FA 3CEJA 4NJOA 4GP9A 3N7UA 3DZGA 3I5YA 2P6RA 1P9RA 3KT8A 4OU5A 2ONJA 3UAGA 1DAHA 5ALLA 5ALMA 2WAOA 1FFSA 1UBKS 2RBGA 1CHDA 1X9IA 2WK1A 5A6VA 2IHNA 4C87A 5KB3A 2V4MA 1SK9A 3C5HA 5G53C 3S2EA 1Z4IA 3CC8A 4UNQA 1T10A 4BIMA 5DSTA 5B36A 4R7ZA 4G25A 3P32A 3PUZA 2H52A 4YNBA 3DV2A 5G4LA 3H5TA 4GKJB 2D1QA 4OAPA 4YMUA 5EQDA 4ZC8A 2FR1A 1L5OA 5BSUA 2PJRA 1DEHA 3AINA 2OXTA 1RFLA 2PGIA 1ZG3A 1XROA 4BNHA 4JC5A 2VP5A 2XUAA 3D3EA 1P7VA 1X9HA 4NBTA 2YJ6A 2FN3A 3I42A 4M9ZA 5LP6B 5EE0A 2GFHA 1GUFA 2WFLA 2OZEA 3DZCA 4GLLA 2RONA 3HYSA 2ZIGA 3D59A 3GPBA 5I9TA 1O6CA 4UFOA 2QF7A 2B4TO 4LYYA 4J91A 1GNLA 3K4HA 2CJWA 5BYJA 5B2EA 1LFDB 1O9HA 3LUJA 4IH1A 4WI1A 4K9SA 1R5JA 2Q3LA 4E21A 5THXA 2DPMA 1NN3A 1NVMB 1S7GA 2QM0A 3C39A 1HE1C 4NQRA 4CG3A 4J0FA 2JJ2A 2QRVA 4FR0A 1QUEA 1QUFA 2CLMB 5TPZD 3H4TA 1T9GS 4KE7A 3V1YA 1G5RA 2IP1A 4CG0A 2V1XA 1MT0A 1XJ5A 3JYOA 2ZIUB 5ENDA 1ADFA 3MUNA 4AKSA 2W9XA 1HLFA 1Z6QA 3INGA 1GZHB 1TKCA 4PFJA 4BEJA 3OMWA 2X5JO 1SQGA 2Q9AA 3EDMA 5FA8A 1D2AA 1QZUA 2J3KA 4OYYA 3CTMA 2AEEA 3G2NA 3FPKA 3EXHC 2F48A 2BR5A 3LT1A 3TZBA 1TW3A 4LDAA 4DIBA 4MS1A 1OI7A 1SZCA 2BLNA 2P7IA 4RVFA 3UJPA 3WFJA 4AX4A 1EFKA 3G9TA 4G1MB 5I7HA 1VCIA 1U04A 3KV3O 3OP4A 3PF9A 3R0XA 2Q0XA 3PGXA 4M0KA 4Z0PA 2MSDB 2O9JA 4XWAA 3RRMA 3UUEA 3C24A 3ZJUA 4PYOA 1G21E 1JA1A 3WGVA 1V1MB 2OQIA 5DM2A 4P4LA 3ZXIA 1YDEA 1M74A 1P17A 2F1RA 2GRAA 4OBBA 3TMKA 5A06A 3V1TC 4MMXB 2A5YB 3AOEC 4K6HA 4EHNA 4PG8A 4GM4A 4PR0A 4XUEA 3QUAA 4FW8A 4JUIA 3DLPX 1M6VA 4HX2A 4KPEC 3OQOA 3T3NA 1ACMA 5AKYA 1H2ZA 3K8OE 9LDTA 2J7PD 4LKRA 1DEXA 3N2GA 1MD9A 5THQA 4A8HA 1LDYA 2OGWA 2WU4A 5I7AA 2RHHA 2PBRA 4FDAA 4BO1A 2B78A 4H7JA 5IZCC 1CVLA 4L5AA 3IYLW 1TYCA 1LLCA 2EBUA 3DFFA 3JV7A 4QRDA 2DBVO 1V4VA 3SC6A 1K5HA 4LC1A 1DG9A 3KSAC 1ZN2A 3OOWA 1FNCA 3AVTA 1IQPA 1QTIA 3HS3A 3L0DA 5HUQA 4DYHA 4D4JA 2WHPA 1V0JA 1N2CB 1I3NA 2G72A 1F2UA 2YWCA 5KKNB 3A6HA 2IHUA 1JR3A 5C5CA 1V6SA 2HSJA 3I2GA 5TT0A 1M66A 4B4WA 5CFPA 3N07A 3ZK8A 1KWKA 1E5VA 3SQXA 1JZSA 3IBSA 3PUIA 2PWAA 3FCXA 1HYQA 3DW1X 4W7IA 4RVOA 3ZUGA 5FWXA 4D4MA 1PT8A 4UJ5A 3CVYA 3ZDBA 4BV2A 3U4MA 3GLKA 1MH1A 4PAMA 4UBKA 2ASEA 1K6EA 4R1LA 3A70A 5AJZA 2QTVA 4GX2A 4QYTA 4TMFA 3TJMA 3DDHA 3M6LA 3HVRA 1JQLB 3A36A 1YB2A 1DRVA 3CNEA 4OHMA 2IZ0A 4YFYA 2R1TA 3JCZA 4JBLA 3WG9A 5A9SB 1ZSYA 2YZ2A 3GYBA 3KZOA 3T4UA 4RTKA 4QAQA 4R5HA 1NI4A 2R1VB 3HL0A 4KIWA 4MRMA 2PS1A 4GKVA 4EI2A 3IJPA 2A35A 2FZEA 4YJ3B 3RWOA 1KZ9A 5IDWA 2QBYB 1Y63A 3RSGA 4F3KA 1JLMA 3AFOA 1L4LA 1GUBA 2J9RA 2XMZA 3CX4A 5ESXA 5HJEA 3GG2A 2V8BA 3BDAA 1UQUA 3PF8A 3AFNA 3VU0A 3ZE9A 3KR1A 1GSAA 3W5DA 4PIVA 3ZZ1A 3C43A 4NJMA 3I6ZA 1GD1O 2QVXX 4TQUS 3BB1A 2IDJA 4K6MA 1IXSB 4O4IF 4YH1A 5E9JA 3T1OA 3TLZA 4PHTA 5TMEA 4TSFA 4P2GA 1TMKA 1AXEA 4AZWA 3E5HA 4F9TA 2PPVA 2J59A 2R6HA 2LGJA 3I6QA 2CXPA 2J07A 3RJTA 4I81A 3TIXB 3TTSA 2HK6A 5BN3B 3GGSA 1Z22A 1WMSA 5HHTA 4RKWA 4ZMBA 4DUYB 1GPBA 3MJRA 1XLWA 3PE3A 1S2MA 5LMCA 4GBGA 2ZRMA 1T3ZA 1A95A 3FWPA 3MRSA 2JIDA 5KC9A 3NP7A 4IDAA 2P9QA 1CUUA 1QFYA 1WMFA 10MHA 2EP7A 1V4NA 4C3ZA 2NU7A 3IUSA 4WW0A 4C0LA