4N0QA

Crystal structure of an abc transporter, substrate-binding protein from brucella melitensis 16m in complex with l-leucine using a crystal grown in a crystal former (microlytic)
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
344
structure length
344
Chain Sequence
DITIGVIAPLTGPVAAFGDQVKKGAETAVEVINKAGGIKGEKVVLKFADDAGEPKQGVSAANQIVGDGIKFVVGLVTTGVAVPVSDVLSENGVLMVTPTATGPDLTARGLENVFRTCGRDGQQAEVMADYVLKNMKDKKVAVIHDKGAYGKGLADAFKAAINKGGITEVHYDSVTPGDKDFSALVTKLKSAGAEVVYFGGYHAEGGLLSRQLHDAGMQALVLGGEGLSNTEYWAIGGTNAQGTLFTNAKDATKNPAAKDAIQALKAKNIPAEAFTMNAYAAVEVIKAGIERAGSTDDSAAVAKALHDGKPIETAIGTLTYSETGDLSSPSFDIFKWDDGKIVGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of an ABC transporter, substrate-binding protein from Brucella melitensis 16M in complex with L-Leucine using a crystal grown in a Crystal Former (Microlytic)
rcsb
source organism Brucella melitensis
molecule tags Transport protein
molecule keywords Leu/Ile/Val-binding protein homolog 3
total genus 122
structure length 344
sequence length 344
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13458 Peripla_BP_6 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4n0qA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4n0qA01
2FMFA 1ZN2A 5TQJA 3CHYA 5EWLB 1PUXA 4XARA 2E4VA 3KYIB 3QEMA 3A10A 4YWHA 3QX9A 5CNKA 1YMUA 1U2PA 3HEBA 5FBKA 3F73A 1DBWA 2XDYA 2GI4A 2P9HA 4Z4CA 4Z4EA 1DCMA 3GV0A 4YCSA 4MS1A 1D1QA 2B1JA 4Q6WA 3HJFA 4YV7A 1TVMA 3C3KA 1YTUA 1FFSA 3A0UA 3LUAA 5D2CA 4Q7EA 3FMVA 1DJMA 1QO0D 2JRLA 2V0NA 3UKJA 4RZSA 5KQMA 2I6FA 3JPWA 4IMJB 2CHEA 3O21A 4EYGA 4M88A 3SNKA 4N76A 4RK1A 3CU5A 4PZ0A 1TLFA 1ZVVA 4KQ9A 3N8IA 3RQIA 4EY3A 4DQDA 3MIZA 3CNBA 1BDHA 3ILHA 1MIHA 3OQMA 3O74A 4HNRA 2HQRA 5FBHA 4EYQA 1ZHHA 1D1PA 2A9OA 2CHFA 1NXTA 1BA2A 3QLVA 2HSGA 4RK5A 4WWHA 5IX8A 2FMHA 1Z12A 1NY5A 1SXHA 3I5AA 4KV7A 4EYKA 5I4CA 4NQRA 3C6QA 5BRJA 3MMNA 3OMWA 1PNTA 4RS3A 4Z0NA 1C4WA 1URPA 3K4HA 2RJOA 3BRQA 2CD7A 2JBAA 1QPZA 3DGFC 2PUAA 2QSJA 1SXGA 4IILA 4LE1A 3MQ4A 1RZRA 2A9RA 2E4ZA 4YLEA 2YHAA 5TPZA 3DLHA 1QMPA 1VRVA 2B4AA 3DZDA 3IP5A 2FTKE 3OLVA 1ZH2A 5FWXA 1A04A 1FFGA 3HO1A 1DRKA 3QELB 1Z16A 5EWLA 1BAPA 1PHRA 3QEMB 3OLZA 4MLCA 1Y1LA 3F7NA 2ID9A 2QZJA 1PEAA 2JB9A 1BVHA 4RK4A 1JDNA 1XHFA 4RKRA 2E4YA 4UHKA 3H5VA 5TPWA 2PUEA 1MB3A 1USIA 4XFKA 3H5LA 1JHZA 2LIVA 3M9XA 4MS1B 2PL1A 3GA5A 5CNJA 5JNRA 1M5TA 5JNWA 3LUGA 4NCBA 4KK3A 1D2AA 3LUDA 3UUGA 4HNQA 1NTRA 4YRZA 4XLTA 4ZPJA 4WZZA 1QQAA 1ISRA 4RDCA 1P2FA 5DTEA 1NXPA 4O1IA 2FKAA 4WUTA 3L49A 5FWYA 1M2EA 3O1IC 1ZGGA 1E6MA 4CBVA 3LUFA 4TN5A 2GWRA 3IPCA 4OLBA 1ZAYA 3HDGA 4F3TA 4ZJPA 3HK2A 1KRWA 2J48A 4DADA 3FFTA 4G0QA 1QP4A 3QLTA 3GYBA 1NXWA 4RXUA 2QVCA 3EDCA 1GUDA 2ID7A 4MR8B 1IIBA 4EVSA 3I09A 3NBMA 4Y9TA 1M5UA 2PUCA 4JB0A 4Z4GA 5IEJA 3NHZA 5KQGA 2W42A 3EAFA 3SY8A 2QXYA 4MRMA 1OXBB 4YS6A 4W5RA 4G0MA 1B00A 2RGYA 4ETNA 2WJAA 4EVRA 1EAYA 4IRXA 4L4UA 2F8SA 1ZY2A 2KYRA 4Z99A 4JASB 2JVIA 2L2QA 3F6PA 4MAAA 2FEPA 3JVIA 2PAFA 4NV3A 4WXMA 5JS1A 1A0OA 2QR3A 4B09A 5CNIA 2F8TA 4RKQA 1D5WA 1Z2EA 1LBHA 3JPYA 3QLUA 2P4UA 4H3HB 3OM0A 3NNDA 4PE5B 4P1ZA 3E3MA 4P98A 1DBPA 3B2NA 5IBQA 1BDIA 1QNLA 3K9CA 1W9HA 1XHEA 1YS7A 4NICA 4KMRA 5DGCA 3KLOA 3HUTA 3M9WA 4ETIA 5IUJC 3GRCA 4LE0A 3H1GA 2IPNA 3BRSA 2WMYA 3N6VA 1RPJA 2PKXA 4ML3A 1CHNA 3HZHA 4G0ZA 1KMIY 1LK0A 4Z9BA 4LZLA 4ETMA 1VPWA 1YIOA 1J56A 4KK4A 3H75A 3OLXA 2OQRA 3T8YA 1NXXA 4LRQA 5C5CA 3A3KA 1HEYA 4F06A 4KRFA 3MM4A 3RVRA 3SQNA 9ABPA 2E4XA 4MR8A 4ZMSA 1W25A 2MSWA 2M1ZA 3O1JC 4RU1A 3DLBA 2H0AA 2NZVG 4MS3B 5TQ0B 1JL3A 4W5TA 3EGCA 1NATA 3N0RA 2BGGA 1DRJA 4IMIB 5TQ2A 1MB0A 3CFYA 3OQOA 1BDJA 2FQWA 2GBPA 4PEVA 5EWJA 1FQWA 2FXIA 3QK7A 1L5YA 4QPJC 4XXHA 1EFAA 1AB5A 4QICA 3H5IA 2FLWA 3HXMA 3MF4A 4JAVC 1M2FA 4F11A 4RY0A 3N0XA 1UDRA 3OLYA 4OTZA 4MR7A 5JS2A 3EODA 4F12A 2PE5A 5BRAA 3TO5A 4G0PA 3O2QB 3QEKA 2M98A 5TQ2B 3RVMA 4HYEA 3TMYA 3LKVA 5HQJA 5DLEA 3ROFA 4S05A 1P6QA 2MSKA 3CRNA 2DRIA 1AB6A 4G97A 1TM2A 4RK7A 3KG2A 3FFXA 2LUOA 2ZAYA 2Q5CA 5JNTA 3RVQA 3LUCA 4Z4IA 2A9QA 2PUBA 4YO7A 3T95A 3NNSA 2NZUG 5HSGA 4G0YA 4E7PA 2IOYA 5CHYA 1PNRA 5EWJB 1DCFA 1SRRA 2TMYA 1E6LA 4EUKA 3GL9A 4W5QA 3O2JA 2WWVD 3CTPA 5GQSA 1Z26A 4MR9B 4RSMA 3E61A 3NHMA 1DG9A 3DBIA 3P9YA 4TLMB 3W9SA 4W5OA 4YGXB 4O5AA 3G1WA 4RV5A 5TPZD 4JA2A 4XASA 3KHTA 2RDMA 3RVPA 2PL9A 4MS3A 2L18A 1USGA 5KI6A 1JX6A 4YR7A 1DP4A 1YK1A 1Z18A 2AYZA 2MSLA 3EQZA 1JFTA 3UK0A 2VYCA 2IDMA 5IEBA 1YMVA 4MR9A 4MS4B 2WY2D 1K66A 4UHJA 2A9PA 1RXEA 4TMYA 3N0WA 1I3CA 2IYNA 4KREA 2RJNA 1DCKA 2HQOA 1QP7A 3LFTA 3KCNA 1LJLA 1K68A 3TB6A 2FQYA 3D8UA 5KWSA 1QP0A 2R4QA 2X7XA 4RWEA 5IULC 5KQLA 4ZYLA 4GPAA 4QYMA 1NXOA 3H1FA 4RY8A 5T3YA 2LPMA 1H9CA 2PLNA 1ABEA 1JWLA 1LJUA 3L6UA 1DBQA 4MRMB 1JYEA 2JK1A 4QYWA 4MLDA 4Z4FA 3Q7RA 4WT7A 2VUIB 3ILYA 4MS4A 3EQ2A 4N0QA 1OXKB 1E2BA 4D6YA 2FEKA 2HPHA 3FGZA 5IC5A 4EYOA 1TMYA 4MR7B 1FSPA 3Q41A 4Z4HA 4OLAA 2CWDA 1JBEA 1F51E 1USKA 4FE4A 4LX8A 3CG4A 2QVGA 2H3HA 2MYNA 2PUDA 3I45A 1KGSA 4N03A 1L5ZA 3KKEA 4PICA 4OG2A 2NT4A 1JF8A 3HV2A 4PYRA 4D6XA 1Z25A 1NXSA 3FFWA 4H3KB 4LDZA 3Q7TA 4N47A 4O1HA 4KFCA 1DC7A 3BBLA 4G86A 1EWVA 3CS3A 5HKOA 1YS6A 8ABPA 1JYFA 1ISSA 3I42A 1Z15A 3H1EA 3QX8A 1T34A 3IPAA 1SXIA 4LE2A 3F6CA 3RVJA 3H6HA 4XAQA 4E7OA 2FVYA 1EHCA 1EWKA 3IP6A 4Q6BA 3QELA 4KNYA 4KQCA 2PMCA 3EJWA 3IP9A 1P8AA 1NXVA 3O75A 1ZESA 3RVKA 2JVKA 1RZRD 4TLLB 1WETA 1DZ3A 2FQXA 5KC8A 3JY6A 3LUKA 3OO0A 4JB2A 4RY9A 3IP7A 3M6MD 1ABFA 3O2SB 3HCWA 1EWTA 1E6KA 3BREA 3C3WA 3LTEA 2O20A 3MYYA 3N53A 3Q7SA 3RVLA 3RVSA 5TQ0A 1D4ZA 5B3JA 2JVJA 3CKMA 4H60A 1CYEA 2VUHB 1Z2DA 2NUBA 4F8JA 1PEYA 2GX6A 3H5WA 5DKFA 5FWXB 5HM6A 5JNUA 3KTOA 3HM9A 3C97A 4JOQA 2WRZA 3KJXA 3N75A 1RNLA 3KLNA 4IF4A 5TE9A 1FFWA 5DCLA 3VNAA 4G0OA 2FMKA 2ZWMA 4RK6A 1VKRA 3H6GA 2PJUA 4NCAA 3RH0A 4EGSA 2GKGA 2R47A 4JP1A 4N0PA 1C0EA 4MQFB 2PUFA 2R48A 2HJ9A 5IUKC 5B3JC 1GLGA 1APBA 3Q9SA 1U2QA 4S04A 1GUBA 4EVQA 2IPAB 2L19A 3HSYA 3KSMA 4FB4A 4MQEA 5CNMA 1YK0A 1JFVA 4KVFA 4MGEA 4Z9AA 5ED4A 4MQEB 3GT7A 2OENG 2JBAB 1ZH4A 2IPMA 2R25B 1JFSA 3CG0A 1A2OA 1RXIA 2FW0A 4OBBA 3RVNA 2MYPA 4KPYA 2FN9A 4IGAA 2FMIA 3S99A 5KC9A 2N9UA 2MYTA 3GWGA 6CHYA 1S8NA 2E4UA 3JS5A 4HNSA 3OO1A 3HVRA 1Z17A 3LUJA 3JVDA 2HQBA 3D02A 5ABPA 5PNTA 3A0RB 4WXEA 3ROTA 1VLZA 3OMXA 3H5OA 2JCGA 5BR1A 2LBPA 2E4WA 1P6UA 3IDOA 3URMA 1GCAA 3GBVA 3H5TA 1JLKA 2QU7A 1Z13A 1GCGA 1MVOA 1ZGZA 2FN8A 2QV0A 3CZCA 1QO0A 5GOTA 3OQNA 3BILA 1YVUA 2IPLA 3LOPA 4DN6A 4W5NA 2LP4Y 1JDPA 3O1HB 3CZ5A 2MYUA 5BQ3A 4ZMRA 1KRXA 3T38A 3SG0A 4MPTA 5JNVA 3LMKA 3OLWA 3FDFA 4MQFA 1U8TA 1SD5A 2L17A 3HDVA 3DGEC 5IUNC 3C3MA 1MAVA 3SM9A 5C5EA 1JH9A 1ZDMA 1LBIA 1CEYA 2WJWA 3LUHA 4RXTA 3T6KA 3NNNA 1F4VA 3TX6A 5EWMB 1QQBA 3JTEA 5EWMA 2FEWB 5JNSA 4LDAA 5TPWB 3RVOA 3CLKA 3QLUC 3HS3A 5FWYB 4KZKA 1U04A 3SAJA 4YP9A 2IKSA 3VNBA 6ABPA 1XWWA 3OM1A 4RXMA 1U0SY 5T7BA 2FSPA 4OATA 2NT3A 3QLVC 2QW1A 2WB4A 3GBPA 3KYJB 1DC8A 4RK0A 4D74A 2PUGA 4N41A 3R0JA 4MYRA 7ABPA 3LKBA 3Q15C 5F64A 4L85A 4GNRA 2AYXA 3KS9A 4G0XA 2YHBA 1QKKA 3EULA 3MA0A 3TD9A 5KQPA 2VK2A 5E3JA 4FE7A 1ZITA 1R8JA 1TJYA 3HUUA 2FLKA 3G85A
chains in the Genus database with same CATH superfamily
3HUFA 4JC5A 3W4IA 2QTNA 4NKRA 4EHNA 1PSZA 3LA6A 2YV4A 3TUZC 3WMEA 4F2WA 2LRHA 4L9SA 3WR5A 5M34A 5AW0A 3E1KA 1B23P 1GDTA 2PSEA 2VDPB 1N5JA 1PL7A 1ZIOA 2JJYA 1EUDA 1YC5A 3E8SA 3EZXA 2VPPA 3H4IA 2BGNA 1IY0A 4MS1A 3S4YA 3V33A 1C7JA 3EC2A 3O7MA 4I5IA 3BGDA 4Q6WA 3WO0A 3ZJ4A 3KPYA 4S12A 4Q4CA 2PZFA 1Q22A 1F38A 5DTIA 2JDIA 2F17A 1AXGA 3AJRA 4KO1S 4D99A 2BM9A 2XHZA 1M74A 3QWFA 5KYNA 3P32A 4YJ3F 4EF5A 1VL5A 4EEXA 2IUEA 4Z3DA 5CB4B 3QVWA 4AN0A 5I47A 3VJKA 2W37A 4HMPA 4MB0A 4PZ0A 2QEQA 3L4BC 5DHUA 3TSYA 2FFBA 2WF7A 2BFDB 3N8IA 1JMVA 4PPGA 4GX5A 4KH1A 3HCCA 3HLTA 1E77A 1EK5A 5KWVA 1LRJA 1YHZA 2D1YA 4R01A 3R7NA 1SKMA 1E2PA 4MVJE 4MUIA 1X14A 4YUWA 3T1QA 5A4DA 4TKVB 3NEAA 3CRVA 3T4EA 4ZXFA 3PEYA 2CDAA 2O07A 3RHSA 1E5DA 4AMYA 4K6KA 1OXUA 3RDPA 1LTKA 1Z83A 4F1JA 2V58A 3NQ41 4C9BA 4EFLA 5HRUA 1BRMA 3LZDA 1VJRA 2BZSA 4R2WA 3I83A 2PT9A 2QMEA 4TRRA 1H0SA 1S3FA 2FZ5A 4M1YA 5DM4A 5DHQA 3VDQA 1JDZA 2RJOA 2Q8PA 3L2OB 4RL4A 1IXRC 4YCDA 3RFCA 3U7IA 3U7RA 3QOXA 2PUAA 3L41A 4R1LA 4N9WA 4IZ6A 4IR7A 1JSCA 1JHAA 4B1FA 3Q7PA 3GHYA 4N54A 4CQNA 3HA7A 4YLEA 2C04A 3B85A 3ZGOA 3TIGA 2P40A 1ZH2A 2O3RA 1UL1X 4OGLA 4F60A 1D5CA 3DMFA 2BBWA 1Z16A 1HE1C 1I1OA 3ZK8A 2FWMX 2QVXX 4N3CA 2A3RA 3CLVA 4DMHA 4DL9A 3LQ4A 1ADGA 4QU9A 3R8FA 2FEOA 1W2HA 4QECA 1FDTA 1M1NA 2XT9A 5DXAA 2DCUA 5EEHA 4Q00A 3TI9A 2PUHA 3B5JA 1Y6JA 3MC1A 1CVLA 2YXBA 1R27A 3OHMA 3PXAA 4GRDA 2CLDX 2Q62A 3K92A 4KTVE 4E1VA 3V7WA 5BV1A 2LDBA 3P2EA 2H2HA 1T8PA 3P4UA 4KXLA 3CLHA 4MO2A 1T6NA 4KK3A 3W9BA 4RETA 5TARA 4WZAB 3VU8A 2ZDQA 3ADPA 4UHEA 5EPUA 5M5BA 4WZAA 2Q1WA 3MJCA 3RREA 2J85A 3CO5A 3F9RA 3SNHA 1S4QA 3HFRA 3U48A 1E2JA 3QX7A 4KQGA 2P9GA 1XTBA 1QOQB 3OTHA 4UW9A 1IG3A 4D1YA 2HMYB 4NS1A 4DY4A 1E18A 1P0IA 5K0EA 3VR0A 2JLUA 4QUAA 1ECGA 1H42A 4DEYA 5K2OA 2DBVO 4CEHA 2QLBA 3TW8A 3IPCA 4YJ3B 4G0NA 3MRSA 3WLAA 4GI3A 2G83A 4QNMA 1E6EA 5CEFA 2AW5A 4CDNA 3PJEA 1C1XA 2J48A 3G3EA 3OQIA 3LLUA 4G0QA 2BY4A 1CULC 1W1IA 2ZUDA 3L84A 4Q1FA 4C3VA 1KI6A 2ANBA 1QTQA 3IVXA 4D82A 2OKGA 1QYIA 4OJQA 1MT3A 3THOA 3SXJA 1BX1A 2YNMD 2DT5A 2IEGA 5CA0A 4CLEA 4QJBA 3PCTA 3WFIA 3GXBA 2X19A 1JZQA 1EEXB 4V1CI 1ND6A 2O6LA 3A1WA 2H1LA 3HCRA 2QT1A 4FN4A 1MAHA 2MSCB 4G5RA 4JU8A 1KDYA 3SIRA 1U3WA 3TTWA 2O59A 2FZWA 3PXUA 3N74A 2DUJA 5ERXA 3NBZC 3EXIB 1CQJA 2OY0A 3QVMA 3D6HA 1M2GA 2BMVA 1Y4ZA 2BE9A 2AFHB 1MJGM 3ITNA 2XADA 1VGVA 4TKZA 1IZ0A 2VPZA 2D7JA 2YFYA 3NOVA 3FOWA 3KPJA 1QFYA 4HWPA 1VG1A 4MV0A 3CX7A 5AQEA 1FUEA 5CGQB 4B09A 4BNYA 4S1PA 4LNHA 1EFRD 4PNPA 1OTHA 1XQWA 4LXQA 1DMRA 1GXSB 2VBGA 2VHVA 2XHEA 1KDPA 5SZJA 2WSSD 1UQUA 5T57A 4DC0A 2CXRA 1ULSA 4ICIA 1SO8A 2ILTA 4IZHA 4X1IA 4ZO7A 3S1LA 2FPMA 3FUCA 2CV0A 4DIKA 5KX5B 3LYUA 5A9TA 4UBIA 3VNUA 4JIMA 1X2BA 3OE1A 4M9RA 3HUTA 3AEKA 1PJTA 1SQ5A 3R7BA 3DAOA 1WLSA 4AMGA 2X15A 1E2LA 3TINA 1A9YA 2QZ9A 4LQ4A 3WOVA 5IAAA 2A1UB 1CHNA 2X0DA 4AM8A 2QTWB 3OOWA 3MWJA 3P2KA 3QVKA 1XZPA 1C4OA 5GAJA 3X1JA 2Z30A 1OFGA 4OKNA 1YACA 5KNDH 4HP8A 2PMBA 4S35A 3DBHB 3WJ7A 4XSHA 4G09A 2G06A 2QPTA 1XJ5A 2JGAA 2A0FA 3ONWA 4DDMA 5C5CA 3ZVNA 3UWMA 3TOZA 4WA7A 1L5FA 3HM2A 4K9OA 3SQNA 2ZTMA 3O4HA 9ABPA 4Y1RA 1ETUA 4JKYA 1EGVB 1Z4MA 1JQLB 4BO8A 1AM4D 2A2ZA 2CNOA 1N0HA 3EDQA 4JCOA 4YRAA 4ESHA 2JHFA 1P1FA 2A86A 4WQMA 1R2QA 4O4LB 1AZLA 4BC0A 4PLHA 1FJ2A 1SVKA 3I4LA 1H2XA 2TMGA 1AQNA 2D5LA 3ZIUA 4UMFA 2VAXA 4RQTA 1YVPA 2Y1XA 4EELA 2ZJFA 1B73A 3Q3GE 5FUBA 3PFBA 3CFYA 3EPLA 3OQOA 3DOIA 1YFLA 4LVNA 5DHAA 4BFTA 4E22A 2AOXA 1WVMA 2J4FA 2QN8A 1PHPA 2WILA 3ELDA 3AOEA 3AXTA 1JDVA 3MPUA 4DUYB 2OG2A 1EFAA 3ZZMA 5CCEA 3HYNA 3OA2A 4IFEA 4H59A 2BN4A 4M1ZA 4ZFNA 1SCKA 5JFOA 4FYVA 2J08A 3QH4A 5LQAA 1I7DA 2YWCA 1Z62A 2WV9A 3G49A 4C4SA 2FZGA 4IRUB 3KQUA 4BXOA 2EDCA 3WYFA 4N0MA 5ITVA 2N46A 1RZUA 1SVNA 2C5EA 2BTQA 4KXQA 2B94A 1VC2A 3N86A 1U0TA 3NEPX 4C7OB 1CVRA 1HTWA 2XOKD 4LSZA 4UE3S 4G97A 2J5XA 4LZPA 4JLWA 3WZLA 4AO8A 3EDRA 4WCFC 2GZMA 3KXLA 4UPEA 5K0CA 2R6R1 1AIPA 1LBTA 2ZSAA 4NE2A 5DWVA 5FI0B 3LH5A 2FF5A 4C88A 5HSGA 3F8WA 5KYTA 4QBHA 4GWGA 3M5CA 3PNQA 3ER9A 4O4HA 2Y1OA 2WJZB 5CYPA 2C8VA 5FI3A 3M9LA 5H68A 3RSLA 5CK5A 5DGIA 1NPTO 3BMNA 4UTZA 3R6TA 3CVYA 1ZGJA 4ND8B 5E9WA 3SC2A 1QZXA 2QNBA 2VG8A 3WL3A 4KWCA 4GMXA 2VIIA 3JZMA 4GLJA 2YZNA 4P2GA 5KVQA 1YDHA 2EGHA 4XASA 2YX1A 1P39A 2KJQA 3Q6IA 4TXMA 4TQ9A 2KI5A 3QKSA 2B30A 1Y8AA 3OBIA 1YCGA 1DIHA 2XGMA 1PU2A 3Q11A 4GZ6A 3KXDA 5DYTA 2C4TA 2HBRA 5IEBA 3NAZA 4XYMA 2QAGC 4E07A 2APJA 5DNYB 2X8WA 3FNHA 2Y1DA 2QTCA 1YE3A 5GONF 1W6UA 2VYVA 1Z06A 2D13A 3L6CA 1UKAA 3TB6A 4D0SA 2CCKA 2DAPA 2J9GA 1LDYA 3EDOA 3LBYA 5B1YA 2VF7A 1EH5A 4LYHA 2O8DB 4GPAA 4P3KA 1EUZA 3S81A 3U1BA 5AHRA 3DR3A 3P9KA 4O2LA 4RENA 3R7FA 1JWLA 1QHNA 1XEWY 4Y3UA 2Q0QA 1E5XA 5F5XA 5AI6A 3RF7A 2O19A 1PR1A 1Z6GA 3ER8A 1B2LA 1R5BA 3EC7A 3H2KA 1WCXA 1GPAA 3H42B 2YBEA 3MD0A 1QHFA 1EI9A 3CSDA 1G4UR 3EE6A 4PGAA 1EXDA 3G2JA 1M73E 4NCJA 1WZ2A 3PEUA 5BR4A 2ZIXB 3RJ5A 4I2NA 1Z4JA 2CWDA 3QUQA 1KVSA 1VA5A 2GEFA 3LDHA 4FE4A 4TMKA 4JI4B 3ETNA 1KGSA 1WXHA 2BMAA 3TB4A 5B55A 3GMSA 1H2FA 2QRPA 3P0FA 2BR3A 1JU4A 5H59A 4HQOA 1Y5NA 3V32A 4BOYA 5AW6A 3Q7TA 2GYUA 4BFVA 4Q9DA 4BRUA 4X0EA 2FW7A 3AC0A 2YHIB 3T12A 3BJEA 4Q4JB 3ZJYA 5LU9A 5TMEA 4HEA1 5IAEA 2PN1A 1ISSA 4CTJA 1DIGA 1L5HB 1NMYA 3BQ9A 3DMDA 3AETA 3K6SB 2RBGA 3F6CA 4P4UA 5CX1B 4YT8A 1GP2A 2Q3CA 5J59A 1BCRA 2HZ7A 4KE6A 1Z0DA 1JGTA 2EFYA 3HXTA 4ZT5A 1E0AA 1JDJA 1G8MA 4U3JB 5A4MS 1TQ8A 2W70A 4X9XA 1QAOA 1XAHA 3IUYA 5B1EA 3E15A 5C3MA 3C14C 4FEYA 1WIWA 4A82A 5FOQA 3QNWA 1ZD4A 4KJZA 4E21A 2FQXA 4FYPA 1I24A 2ZQZA 2XUFA 4C7XA 1Z6ZA 1DLIA 1JPVA 1E6KA 2VJMA 3GA7A 4WK0B 3PGLA 1JDSA 4KHPB 3DM5A 3REQA 1MFPA 3HYRA 1KMHA 3WQRA 4L07A 4R8RA 4EHKA 1X19A 1P18A 4GI7A 4UVDA 3LBIA 3K6JA 5AI5A 4IDAA 3D4OA 2GRAA 4XX1A 2ZI5A 1K2VN 1CY8A 1VJGA 3W6NA 3FKJA 3PNOA 5H3LA 4D98A 4ZV7A 1BH2A 5CDUA 4OYLA 5EVJA 2DJ5A 1XMQB 4U2BA 3C1AA 4BLSA 4WK6A 3CNEA 2I67A 5LD2B 1PZXA 2O7SA 3DHWC 3AHHA 3IVMA 4NZZA 1KY2A 4WDRA 3RIEA 3W04A 4Z3KA 1B8VA 5KPJA 1FU8A 5F35A 4J6FA 1ULZA 2FPKA 3X3HA 5IM4A 2WZDA 4D8YA 3WISA 2OBFA 4DDUA 3JQBC 1FNNA 5BN4B 4ND5A 1JA0A 3LHIA 5HJ5A 1BX0A 2WU1A 4H7HA 1ESDA 5DI3A 2HA7A 1DTSA 4G4SP 4M8LA 3MLEA 3W3AD 1LRKA 4DYHA 3DAHA 2DG2A 1H2RS 2PJRA 1UAYA 3CJQA 1Y8RA 4KVFA 4LGYA 4F1KA 4UULA 1ZBQA 1ZU5A 3QFCA 3UBTA 3CW9A 5I8WA 1GPLA 3LV8A 3PT5A 3ZNPA 2G28A 2O54A 2GESA 4WBNA 1DKPA 2O7VA 3LL4A 1GG5A 4Y9DA 3SEZA 3Q1LA 4N7RA 1QLHA 4IDDA 1Q0SA 1X3SA 2ID4A 4PZAA 3HC7A 1FDOA 5TS3A 3BGVA 5E6UB 1Z38A 1ICEA 2QRJA 3KSUA 5ABPA 3H18A 4PLTA 4YHBA 3AEUA 2GCPA 4M38A 4NYIQ 1OASA 3H5OA 1A8SA 2DPMA 2LBPA 4IDHA 1Q1QA 5CFLA 3PK0A 5LOVB 4HNTA 2JCYA 4B5LA 5BWMA 3BGOS 3EZ6A 2X5OA 4J0HA 5JCZA 4ZRNA 4CIDA 4BVAA 3PDWA 2W6JA 2X6RA 3D8RA 1C30B 4CNBA 1A9QA 1WDWB 1XXLA 2E2WA 2IHZA 3LPMA 4A6EA 4URVR 2H6EA 3SG0A 1CUWA 3WG9A 3WLJA 4CIVA 5BW8A 3HJUA 5JECA 2AFHA 2R1TB 1QGED 4BVLA 1QHHB 3L46A 3H11B 4QDZA 4BQFA 5D3QA 3TX6A 3AFIA 3FUTA 3SX2A 4ZZ3A 4RULA 1YU6A 2PG3A 2ZWOA 1T8YA 2ZCVA 3HSKA 3G82C 3LPCA 4E2WA 5A3QA 1CUVA 2DB3A 4IUCS 2ZRIA 5DYGA 4CCAA 3ESBA 1IEWA 1O77A 3G2HA 3K15A 1XQ6A 2YJTD 3HR7A 1WP9A 5DEOA 5DH9A 5ALUA 2ZYWX 5KAMA 1J24A 1LDBA 4NG5A 5T7BA 1GKLA 3DTNA 3VR6D 4IQ4A 1B3BA 3EPPA 5ECWA 5KTMA 1OFUX 1SQSA 5F9FA 3K9LA 3K70B 3CNHA 4XLLA 5C1IA 4ZI2A 4I46A 1BXRB 3B13B 1T0IA 2B98A 2H1FA 3NEJA 1U02A 1J20A 4CU5A 1KI2A 3DV0A 4JLKA 1W4LA 1UR5A 4BNJA 2HMUA 2GVZC 4EL0A 2FAXA 1BA3A 2YHBA 4MP6A 4WIAA 4CV0A 1JR3E 3G2MA 4TGLA 3ZZNA 1QCDA 4RM2A 4LIPD 5EQJB 4NAUA 4PC7A 3TQRA 2L69A 4NBKA 2J9ZB 1XMIA 1KE2A 3VR2D 4CETA 2J3IA 4BFUA 1P5HA 1OYWA 3S5UA 4JLSA 1WF6A 2IOHA 4D5GA 1N8SA 5BSKA 1QPGA 1TO6A 4HJRA 3SS9X 4QLBA 3MT8A 1D04A 3PYXA 3OJXA 1JDTA 5K1ZA 2BTEA 4ZA2A 3SHOA 2R1VA 1G5HA 1U2PA 2F48A 5KNCA 4L8VA 1DBWA 5IAGA 4RGYA 1FP1D 4QYSA 3KELA 1OWOA 3P71T 4G67A 2HSZA 5E1MA 2C5GA 1PBTA 3IUJA 1PS9A 8AT1A 4Z1MD 1DO2A 4EAAA 2CUNA 3PS9A 1Z34A 1R88A 5ES4B 2AB0A 4C5BA 3TFOA 4G5FA 2FSFA 3HKDB 3GVXA 4RZ2A 3TTUA 1PFUA 1KYTA 1Y7HA 2V0NA 2VDNB 4BDSA 1E8DA 4RZSA 3VPGA 3B9PA 2RHRA 3ROQA 4XWKA 5E2AA 2AC2A 3ISJA 5F2NA 1S2GA 4M88A 2HF8A 3SNKA 4KI0A 1J2TA 3R7AA 3CRW1 1Z4LA 3AVXA 2P68A 1PJ4A 1QPBA 4UM8B 3WL4A 2F3RA 5L7TA 1Q57A 3W6PA 1KMCA 3L6RA 1U80A 2GN2A 3CNBA 3TCXB 4CM7A 1CUHA 3PITA 3DXZA 1IHPA 1N3IA 3FHLA 4RYDA 5FI1B 4TL6A 5L8VA 2IHBA 4C4PA 1NYTA 3UJDA 5IAKA 4DJTA 1MUUA 1BG6A 1X7HA 1P7CA 3GCGA 4RK5A 3KFXA 3D0KA 3RRZA 1HMYA 2FMHA 3A9WA 4B74A 5LQRA 1X1BA 3ZV6A 3V1KA 3M6LA 4HL6A 4LY3A 4G1VA 2C97A 4U2GA 2VJKA 2IEDA 4G5SA 3VHXB 1OU4A 1QTRA 1QZTA 2OO7A 3NAMA 3QKWA 4U9UA 5EHNA 4LF6B 3E9DA 4C4TA 1LVGA 1C4WA 5IVKA 1U81A 5K8IA 3OVMA 2HIAA 1IHYA 2XKJE 3BH7A 4KOAA 3LUBA 2G4CA 5EE0A 3MQ4A 2VRCA 1YA8A 3A1SA 4HT3B 1X13A 4YUYA 1VMDA 1ZK2A 3ANTA 1QIFA 5KNBD 1L7XA 2VYNA 2ZBUA 3E9RA 1DRKA 3BXEA 4QTTB 4L4XA 2O5RA 4TSKA 4U7TB 5C4IA 3EZGA 3KXPA 4FCCA 3QPWA 5EQFA 2BEUA 4MVJG 1E1KA 3AVWA 4X41A 1XL0A 1QS0B 4LHYA 2J67A 2ZRQA 3QVXA 4YP7A 5CCDA 2ZT8A 4ED9A 5A5GA 4BLVA 4C20A 1OA1A 5GINE 1I4DD 2BELA 4HC4A 1DU4A 1E8NA 4MS1B 1M83A 4TXJA 2PL1A 3FNBA 1J2UA 3BJIC 3JQCA 4TTIA 5DBIA 1KR5A 3UWDA 1O95C 1JIJA 3UICA 1M0WA 1M7BA 4OLFA 2IWHA 2XYRA 1UBEA 4PGFA 4KUEA 1FTGA 4NFHA 1VP9A 3LQQA 3UT5A 4PR0A 4CCYA 3TH5A 3P1JA 3KSDO 4ZPJA 1S8AA 2JEZA 2QIPA 1T1IA 4WZZA 1OB5A 5KYGA 1JB9A 2Z8YM 5JEEA 5K8TA 2FW9A 3EGXB 2WSBA 3L7LA 2QJTA 4K5QA 5TC4A 3D31A 1KHTA 1DQYA 2EHDA 1KQ3A 3FB4A 1PT9A 3JATB 4M1TA 1ZEJA 4OFWA 4EG6A 1E6MA 4DR5B 5JEDA 3TBKA 2BR4A 1FS4A 2G08A 4KWHA 5A7FA 2YQZA 1ULUA 5JNWA 2WU0A 1RYZA 2W6MA 1IHOA 3DDZX 4QAJA 1BN6A 5K3FB 3SDZA 1XO1A 4U7GA 2ORIA 3NIFB 1XK6A 2O0KA 1FYEA 3TLGB 3U0VA 3GLIE 3ZE0B 2BGMA 2FG5A 2GKOA 2X2EA 1AKMA 3AVPA 4WKGA 4LVUA 4MR8B 4OSOA 5HUHA 2NU7B 1JTVA 4Y9TA 3FMOB 5ECDA 1IC6A 1N78A 2OAQ1 3V2GA 3RUDA 2I33A 2OYRA 4KP7A 4OHVA 3VO8A 3O90A 3OWOA 3E5MA 4GUAA 2V3CC 1VKNA 1K8XB 1G19A 1RHQA 2FE1A 3MWEB 4GOMD 3IDZA 1M5RA 4JEMA 2BH9A 4LWOA 1P7YA 1OVMA 4LZAA 3VR5D 4BE9A 2PS1A 1EAYA 1SCJA 4MAFA 1T2FA 4MV1A 2EZUA 2V65A 2R6CA 3UZUA 4Y2HA 5CA0F 1KI4A 2G70A 5BUQA 3F6PA 5LR6A 4INOA 2VT6A 5JS1A 5JMTA 2OZLA 3DDCA 5B64A 3DMPA 3E18A 3IRVA 4L4SA 4LTMA 5CM9C 3SVTA 1LF0A 1E6UA 2PU7A 3JPYA 3TLJA 3F3SA 5LQCA 3BVPA 1RKXA 4E5PA 1O94D 2L0XA 4PE5B 3CQ9A 3V97A 1JXQA 3B2NA 4RD3A 4ZPXA 3BEOA 5CFZA 1QNLA 2DPLA 3U7EB 4MQUA 4JDPA 5C8YB 1IHXA 3MWLA 4D8WA 2R6GA 2RHDA 4LYJA 1NONA 2EIXA 3UA3A 4IIHA 1R0ZA 5IUJC 1WKVA 2I7VA 1MJHA 4JX9A 4RTNA 2HA5A 1DRWA 1GNTA 1Z7BA 2JKYA 3F5FA 3UJHA 3CPHA 5JPCA 3PRYA 2WUEA 4ETMA 1ONPA 4K2AA 1T9GS 4N3GA 1N6PA 1FQOA 1J90A 2J9RA 3VVLA 4URUR 1U5BB 1E2FA 5T6BA 1U7PA 3MWKA 2ZZNA 4NCNA 1I01A 2PXXA 4LRQA 1H5NA 2QWXA 3G2KA 2AKAB 2WM8A 5B4UA 1Z9BA 3GUHA 4OREX 5EVCA 3AWDA 5IKOA 4O4LF 4CFZA 3COYA 3EOZA 4KWEA 4HZGA 4JLVA 4UTNA 4PYNA 4DR1B 1ACLA 2XB8A 1HFKA 4LFCB 3T3OA 1U28C 2EJWA 3UN1A 2PZEA 1VHJA 2H5EA 1OLOA 2K87A 1NR7A 3BAFA 3OECA 3AY6A 1A96A 2R8YA 1ZD9A 3V2HA 1U65A 3ESAA 2IIPA 1ZUNB 3CSSA 1VHQA 4ONEA 2FNAA 3RASA 3WLPA 1XZIA 1SCAA 2I9PA 3L9WA 4EJ0A 1JUDA 3EGDA 3G2PA 2KBEA 1NLZA 3LC2O 2ZVPX 2PVSA 5FA6A 3IX7A 5HBGA 2D8MA 5EP4A 1THGA 2C07A 1X42A 1RI5A 1DEXA 1RI3A 4GSKA 4B6PA 3DXXA 5KWEA 3FETA 2C57A 3QGMA 4BP8A 2I76A 1T4CA 2V4UA 5IN5A 1G5PA 2G9RA 2Q41A 4MNTA 4HOYA 3ZV5A 1VI2A 3HKCB 3M6WA 3PUVA 2A4KA 3LX8A 4PFKA 5DX8A 1RW4A 2Z3VA 3PYMA 1H1DA 1UP6A 4HNGA 3HLKA 4ZO9A 3K1TA 2I6SA 3HJGA 4I5FA 2BGTA 2HJGA 4M7WA 1SKAA 3T35A 1Z29A 1P6QA 1U7UA 4MPPA 2GFIA 5JZOA 1AB6A 4LY9A 1RXWA 2C98A 2PWPA 1MJGA 1CEEA 3HDYA 2I4MA 2LUOA 4W1SA 4C5CA 5LXTA 2OBBA 2OCLA 2WPNA 2O8DA 2HWYA 3K2BA 3T95A 1OIVA 2XITA 1MGOA 3ND7A 1IUKA 3NCHA 5DFAA 3KOZA 3I9MA 2ZYUX 5C8DA 1P45A 2Q1UA 5AVQA 1GQFA 3UGKA 4N6GA 1FDVA 5ARCA 1G8PA 2VN8A 3E5NA 4BAZA 1MORA 2QP3A 1ZLYA 3LG2A 1N36B 2XJ4A 1CRWG 2Q5JA 3R4CA 4J94A 3E61A 13PKA 4RSMA 3D4LA 3NGMA 1WR8A 1N33B 4PAWA 1Z2AA 2ZYHA 2FR8A 4GI1A 4R54A 1IZ8A 2IU0A 3WBKA 4DLXA 4XD7A 1DX6A 2J9FB 4XQ9A 2PTHA 3I6ZA 2H2WA 3K09A 2RI1A 4HH4A 5TR9A 4R05A 4CI9A 3NTQA 5CCXA 1SM4A 2WE7A 1NFFA 4B3IA 2NYAA 3T9CA 5A6SB 1YQWA 3MWDA 3ODGA 3UK0A 2XBMA 2JHAA 3NLLA 3H9UA 2PPLA 3D3WA 5FNVA 4R9NA 3GJ6A 2DLDA 5KTKA 5FPQA 3QPVA 1L5QA 4C0HA 4LXXA 1RAEA 2Y71A 2ADOA 3SJBA 2HMWA 3KCNA 2JIBA 2O8CB 1YDMA 3H84A 3EUWA 1QIMA 3RO7A 3ZWXA 5JFTA 2C96A 2OZLB 1BVRA 1FRFS 1GQQA 2AN4A 1AA9A 3F1KA 4BATA 4YQEA 4BCCA 3BKWA 2A78A 3RNLA 3I2HA 1WXQA 4BMSA 1N4DA 3Q3VA 4TYPA 2NPIA 2AQKA 2W2KB 2AZ4A 2VHWA 3HZOA 1N3YA 3Q9NA 4IV8A 2UZ3A 3KPVA 3DOJA 1G20E 4MP3A 4CL2A 1MO3A 3THXB 1WNFA 2C88A 3N2GB 1HYEA 3AVYA 3NHRA 4C14A 4WY8A 2G0AA 4MR7B 2OBMA 3E53A 4Z4HA 1RDFA 1Z6XA 3JVEA 3PC7A 4LX8A 1C3VA 3CG4A 3CW2A 1TTPB 4PZDA 2P9FA 2O8FB 1J0DA 4PLZA 2QN7A 3HB9A 4ZCSA 3ZHYA 3ZZ0A 5HYVA 2IY9A 1FNDA 2I91A 1CG6A 4YJDA 5GZ1A 3BWVA 1Z25A 5HTKA 1UQTA 2ZLBA 1XNQB 2BMWA 2GF9A 4ZEMA 2DETA 3PNYA 4RA9A 3S2UA 1RRVA 2JLBA 2BEVB 4EY5A 3HRHA 1F8GA 1P91A 4CVNA 4D3SA 1VJ5A 4H7JA 2VEOA 3U81A 2FPIB 4I5GA 3S29A 3QTTA 5C32A 3PG5A 4TXHA 1QVWA 2BP7B 2V6GA 3DB2A 5EKSA 1T1EA 5KSWB 3U60B 3DUFA 1N2GA 4YRBA 1Y6ZA 1QQTA 1JJBA 4HGYA 3WKAA 1VM6A 4GSLA 3C8ZA 4WHMA 2R4UA 4DANA 2M6KA 2V8BA 2VPTA 3BFXA 4WACA 2XA2A 4UREA 5KQRA 3BMXA 2ZI4A 4PLCA 5ER9A 1JP7A 5KZMB 2D1QA 3GVHA 2QMQA 1UBUS 5CYGA 5CVEA 4TLLB 1FXWF 2J3QA 3TK1A 4RM3A 4NBWA 5A5FA 4JB2A 3OEHA 3Q2KA 4J76A 2QVLA 3FPEA 3BZBA 4C0XA 2SICE 5GIOE 2IUSA 4YHHB 4KR6A 1I3KA 1NUHA 1RLUA 5D00A 4AXXA 3WBJA 4L7QA 4UJ5A 5G53C 4OF4A 2PX6A 3SBOA 3KSBC 3THWB 1GPNA 3GLQA 3ZD7A 5HM6A 1DAHA 2VLBA 2AF3C 4OK3A 4E2YA 1JA1A 2NV2B 1Y5RA 3FFBA 2R85A 1XU7A 2ZSIA 3LDAA 4FR5A 2AHOA 4ER5A 1RXCA 3FGPA 5ARBA 2BDTA 1MZPA 2O0MA 1QYVA 2X8JB 4UASA 4Q9AA 5EN4A 4MQMA 2BRUA 2EW1A 2FZCA 2LXNA 3B3QA 3ILSA 3VNAA 4D3FA 1PSDA 3B53X 1NQUA 4GD3Q 4YJ2A 3C3AA 2FRXA 1T36B 3NJRA 4X45A 5JC8A 1WUHS 4Q1CA 4KN6A 4QYTA 5D86A 3UV6A 2A1UA 2Q6LA 4QGHA 4MGKR 2OV6A 3FOCA 1J1ZA 3P2IA 3WB0A 3ZDEA 1AKUA 1Q2UA 2YOFA 4TMTA 3U9LA 2NYVA 1GZDA 3BWDD 9LDBA 2DM6A 3EIHA 4WNIA 2Z04A 5BRNA 4HWKA 3VPCA 1UJBA 2GPWA 1YULA 3A1TA 4L9RA 4X6UA 2MDTA 4ZZ1A 1R0XA 1QDUA 3KZCA 2C4NA 4F5EA 3WQQA 4N5NA 2WWHA 3KJHA 4AJ4A 1SUFA 2A58A 1BX3A 2BUBA 2H85A 2PSDA 3L1KA 4QRHA 4BDTA 4UDXX 2B7CA 5L9AA 3ENKA 1CQWA 1O6CA 4H31A 5C8YF 1C9YA 4HAWA 1L5KA 3WMFA 2G1JA 2X9NA 3CUVA 3LUJA 5SZKB 1SZJG 3FSRA 5B2EA 5JXIA 2YXLA 2G4LA 3DZBA 5DULA 4URFA 3KV3O 4WX2B 2N42A 4RHCA 1AN9A 5PNTA 1JXOA 2UYCA 2V97A 4WN9A 4ALIA 4BCDA 5BR1A 1BQ3A 3I53A 1WLYA 3II6X 4M0UA 1IG0A 3GBVA 3ZH9B 1KMQA 1NIJA 4B3GA 2REQB 3LFHA 5A4JA 2C9CA 1GJRA 2IP4A 1JDPA 1L5NA 3ZU4A 1FMCA 2ECPA 1MP0A 2ZU6A 2HQ1A 2WVAA 3SXPA 3L02A 1X2EA 1P8JA 1QGYA 3D4IA 1G1AA 4TZ6A 5CR9A 2OD2A 3SM9A 4YAIA 4DY6A 4EO9A 1SH7A 2CVHA 4FWBA 3A28A 3QNUA 1MG5A 2WSSA 5CITA 1CEYA 1E0JA 1UJNA 4GHWA 1ZW6A 1KJ8A 2FW6A 2IX3A 5EXSA 2JFWA 4MMXB 2ADMA 3C5WP 4RH3A 3SF0A 4C3UA 4DA7A 2N3ZA 4NJMB 4D8XA 1KZ7B 4Y6SA 2BEKA 4KXYA 2BT4A 4GIBA 4M1QA 5IC4A 2HNKA 5AHWA 3UAYA 3A6PC 1M1YA 1CR6A 3ABRB 3USES 4CEIB 5LBUA 3NC1C 1L8LA 3A9UA 4F6CA 3MJVA 4OATA 1XD8A 3WTCA 4ZGWA 3AR9A 1O3YA 4RKFA 2V03A 4EYEA 4I8DA 2BJWA 2N47A 2PD4A 3A4LA 5H7XA 3RS9A 3TSCA 4BO3A 3Q15C 4MWSA 1XVLA 4JJ6A 3ABQB 3HJHA 3NM6B 2G5TA 3CIOA 3TD9A 3GUCA 3QXHA 1LPOA 2BFAA 1XMSA 4LOIA 1PEKE 4PFJA 3S5JA 3BJZA 1M6HA 4PQFA 5LMUB 4PBTA 2HUNA 4ZQBA 1MTOA 3LK6A 2OA0A 4O4JB 3ROEA 3WIBA 5LDGA 1BHJA 1ZD1A 3D6FA 1FS6A 1T3GA 3OBBA 1M8PA 4IGKA 2H63A 4Q15A 2CBXA 3PNMA 3HA3A 3NEYA 1CUCA 5HZGA 1COWD 1XMXA 2IYUA 2R00C 4R16A 4JGBA 5FL7A 2XE6A 2C9OA 2JEOA 2QN3A 4G4GA 5TMBA 5KDDA 3AF0A 3CZ9A 3PU6A 3RYCA 1F2DA 5KOJB 1T1GA 4HXFB 1U2TA 3HJFA 1L5VA 4GOND 4YQZA 1ULBA 4Q7EA 1XZHA 1DPGA 3CUUA 2YWGA 3QFSA 1IEVA 1UEXC 2WHYA 4QOGA 3KLMX 1V71A 3UG6A 3ROMA 1D7AA 4EMSA 4Y0VA 1YE5A 1UKYA 3PKZA 2VHQA 3SOZA 1WMSA 1KDOA 4N76A 4CMKA 2RK6A 4LGVA 5DF1A 5EIOA 3VQTA 4WKOA 3MT9A 5BR7A 1HSOA 2EGUA 1DT3A 1F9EA 1BNCA 3K32A 3LECA 5FD8A 4N3AA 2VKTA 1YBVA 1ZVKA 4RF2A 5C37A 1UPAA 5K4GA 5EJIA 3K0FB 3TLYA 1A8UA 5K45A 2FPPA 4Q4DA 1BDHA 3AR4A 4MA0A 4JI8B 1Y89A 3V6LA 2VYVD 2YS6A 3UJAA 4IIUA 1ETHA 2D5AA 5H81A 1OXTA 3E1SA 1NQAO 1A5AB 3R0IA 4NU8X 4PW0A 4XOIA 2EFCB 3QU5A 1YS9A 4V3BA 5T8KC 2ZYSA 2Q0SA 1FK8A 1G9XA 3PEWA 1QMGA 1H6CA 4XSVA 4YCMA 4Z0NA 1IQPA 2IPOA 4KPYA 4MV6A 1PJBA 2QRKA 4Q48A 1O9BA 3I30X 3UW1A 1UMCB 2FMUA 2QSJA 3JQQA 1NW6A 2FJUA 1DJLA 1JECA 4KLCA 1QMPA 5E2IA 2HHJA 2O7NA 3BMCA 1T4DA 4PYJA 1TECE 1EDZA 3C3EA 4KE8A 1KI6B 1TA0A 4KEAA 1JXMA 3W5CA 2FN7A 1FYXA 4CCSA 2QE7A 3SN6A 1JT9A 2OLJA 3B1JA 1C0PA 2WJ4A 3KR2A 3SYNA 1RC8A 4C06A 4F4JA 1M8FA 3O95A 3ABSB 4DLSA 1Q7EA 4RAOA 3VU9B 3PX7A 1QYDA 4KPEC 1XXHA 3H4MA 4P5EA 2BFCB 2IUTA 5AW2A 3U6KA 4O4IF 1FPQA 4JU9A 3JWEA 4K3UA 1U8CB 5EXEA 2EZTA 2ZRHA 4KC0A 3ZKAA 2QD2A 2A7QA 2I2CA 2W2MA 1W36B 2UXBB 3C43A 3QU2A 3D0QA 3HXPA 4ANFA 1ISRA 2AR0A 2C1XA 2WUVA 5H8WA 5A0TA 5ALHA 2EQAA 2GHRA 4NPCA 3M89A 1UKBA 5KYYB 1PFGA 1W49A 2PIAA 5JSYA 4P5PA 3RLFA 1J6UA 2JKVA 3F4BA 4NJMA 4KQFA 1EG7A 1EX6A 3A3YA 4CBVA 4X7RA 5K6AC 3W8EA 4XB2A 3OTOB 1NZJA 1U9JA 4CZ2A 1QQ6A 1N5DA 1TLLA 2DWPA 3FPSA 4K3VA 1Q1ZA 1RQGA 2WJPA 1EFCA 3E7PA 2JGRA 5IYZF 3ZK9A 4HYTA 3GO4A 4B40A 3EDCA 2Y8EA 4UUMA 1MHTA 1ZGAA 1XDDA 3MFYA 1QU3A 4NXNB 5KKCA 1WVGA 2P3QA 1E3WB 4KGXA 5BWBA 1MN6A 2Q07A 5J1SB 4KYUA 4V0QA 2Z2ZA 3AR3A 1V3UA 2FYTA 3CLRC 4I3HA 4E70A 1GUZA 2B3TA 2ZAOA 3MWYW 4CR7A 1OUMA 4V2UA 3FTPA 3NGLA 1UKEA 4IRXA 4L4UA 4CDMA 3A58B 4LISA 1XJWA 1Y3AA 4O4HF 2NN3C 3NP7A 1I1NA 1KF0A 2ODBA 1XRQA 2PAFA 3DBLA 2JHCA 3DHYA 3H2GA 3CCBA 4NV3A 4RO0A 3BFPA 3BE8A 4AUEA 1W93A 6AT1A 1B8NA 4H3HB 2ONZA 4TTAA 2IEYA 5C8YA 1JLLA 3IKMB 4HUQB 2NO9A 3IJRA 4P1ZA 3ADDA 3EZYA 3GGJA 3M81A 1DBPA 4FKZA 5JO9A 3DH0A 2YKGA 4YMUA 3A37A 3OTGA 3JZDA 2P75A 5JHGB 3PQCA 4JJIA 3TNDA 1XQ9A 5SZIA 5BWNA 4GPTA 1G3MA 1VZ3A 5EGSA 1XVIA 4LE0A 2IPNA 5A0VA 4JJZA 1QE3A 3PENA 3WJAA 3EGEA 1AE1A 1SUWA 2J46A 3EUEA 1RS0A 3VUEA 3RC3A 3HCAA 1Y1RA 5EFOA 2PNFA 3MEQA 4K28A 4NYJR 4YEDA 2C7OA 5DLPA 1DC5A 3DE2X 2RGRA 5JZ9A 1YRYE 2B1IA 3OCUA 1L9XA 2Y9MB 5K4HA 4DBLC 3IOYA 3DF9A 3ZVMA 3DCNA 4E31A 4AX8A 1R7RA 2O57A 5FUMA 3VNVA 5C5IA 1FMJA 1EE1A 5FIUA 5JOQA 2BGRA 3MCUA 1K4MA 1U0NA 5JQWA 1Y4UA 2MSWA 4C0SA 1GG9A 1VMAA 2Q1YA 1RZ3A 2QX4A 4HAZA 3PX3A 4RU1A 5CVCA 1UZAA 2H2GA 5T67A 4O6VA 2G0TA 2W0MA 2ZBDA 3UOWA 4C87A 4EQ6B 2KLBA 4W5TA 3TQFA 4CTOA 1L3CA 2ZSEA 1I5RA 3V80A 4PC2A 1Y3HA 4AY3A 2C2WA 2C3MA 3QVGA 5T4BA 2BGGA 2O8NA 2WHXA 4PRYA 1EESA 3GLHA 3FH0A 2Y6UA 3UNXA 2CCGA 1JEQA 4NONA 3R3SA 4UNQA 2F8MA 4V39A 4XGNA 5ICFA 3RROA 2NWQA 2WIDA 3F74A 4WASA 1QS0A 1YU9A 4PG8A 4J9UE 3FPFA 1OZGA 4JP8A 1C3OB 1FX0B 1R9NA 1VYHA 2L82A 4R1PA 1VDMA 4YI3A 5C4GB 5IKEA 2RCNA 1O58A 4UHHA 1D2EA 2VAWA 3G5UA 4YBRA 4MA4A 1IQUA 4X3CA 5A4KA 4ZC8A 2IDJA 3NWJA 3WZMA 1RKQA 5LZ7A 4G0PA 2Q50A 1IB6A 1ZHFA 3DAPA 4R3WA 3O3OB 4PVCA 2GR9A 1FUIA 1H8HD 2A5DA 2BUCA 2ASVA 2HBZA 2X1MA 4QREA 3RVMA 4CMIB 1XTPA 1I2MA 4DJ5X 4C4AA 1PKEA 1TUIA 1UT5A 4EI8A 2AE2A 2RC5A 1H2YA 3CRNA 4NLLA 1E7YA 3ETLA 3W2FA 4BQQA 1TM2A 1OWLA 2P11A 5LYJB 3Q0EA 2SBTA 3SVZA 5JNTA 1KR2A 3LF2A 3HBLA 4FZJA 3JD4A 2IE8A 3TPZA 4CLRA 1GA6A 1ODJA 4D80A 4DCCA 1NNUA 1QBKC 3RSFA 4OM8A 2UVPB 2JFZA 4IZOA 3VPDA 2H0RA 5EWJB 3U3JA 4D9EA 2C2OA 1DCFA 1GTMA 4XW2A 4DR3B 2IH4A 3LP5A 4TUYF 2COKA 4YACA 3AR6A 1Z26A 4MUKA 2BEVA 1Z82A 3NTOA 4ZOLF 3SHQA 3P9YA 3NHMA 2YHIA 3RRYA 1NAHA 4RX1A 3R9XB 3CWZA 1W34A 3S70A 3AUTA 4EFDA 2VRCD 1DLJA 4LRWA 4MJ7A 3DOUA 4PR3A 3ZLVA 1XF9A 2H4YA 4EJ6A 4HX2A 1I4OA 3IAXA 3IVCA 2Q0HA 1T2VA 3ZIAA 4Y6GB 1Z18A 2IXFA 1CXZA 3K53A 4XJSA 4BNVA 1BROA 1T0PA 3OIUA 1C2TA 5C7OO 2B61A 2GN6A 2Q3DA 1TVEA 4TS3A 5LNK1 3H1TA 1DIRA 3H4VA 3LXUX 1O94C 5HF9A 1ZMTA 4JLDA 4WNAA 1D0IA 1EUDB 1UC5B 3HHEA 3B52X 3N0WA 1CWUA 3PRKE 2JFYA 4MGIR 4Q1EA 4QT0A 5HMMA 4QTXA 5HW0A 2VOEA 1AHPA 4Y2GA 2PH1A 1BQ4A 2QLMA 5C31A 7REQA 4DCJA 5HM8A 2XPCA 5TDHA 1A2QA 4B17A 4OMDA 2VK8A 4M9UA 4PQRA 5JCJA 4ZYLA 5B36A 1J00A 3M3PA 1FSSA 1XSEA 3TUJC 1CERA 1VBNA 4B85A 1SA0A 4W99A 2W43A 1TJ4A 3LT5A 4XGQA 1SUDA 3U4IA 3ASYA 3A9CA 4DMFA 1MMFB 1XCLA 4U00A 3AW8A 1Y82A 3IUBA 3ADOA 2C2BA 3ILYA 2VDWA 5G4LA 4W63A 2NXWA 3IT3A 3HTXA 1UEIA 4F5WA 4FHCA 4M86A 1GGFA 1VCNA 1BC5A 1XCMA 4C1BA 2FQ1A 3GLIB 4DXHA 4O63O 4OU4A 1AZTA 1NN1A 5KNLA 4DWJA 1M8KA 3MOIA 3PIDA 2DQKA 5IASA 1P0FA 1F8YA 3QMPA 4GVLA 1DNPA 1SB9A 3C70A 3PNBA 2I2DA 4CIXA 2WKSA 1GA1A 4PYRA 5CD1A 2QAGA 4XTCS 2XYHA 3NW9A 4LC1A 1YFZA 4G5YA 1JLRA 2L42A 4IVQA 4FJ2A 4V0OA 2ASEA 3CPEA 1T15A 1KZ1A 3IAFA 3MS7A 4KBYA 2N0SA 3FLBA 1QGUA 2OMEA 4Q12A 1CJMA 2A57A 1I3LA 3GGOA 3I42A 5HBRA 3UAGA 4D8TA 1Z28A 4IJMA 5E9AA 1S4MA 3OOJA 4LE2A 1E66A 3H5NA 4MWBA 5JXWA 3PCRB 3L8EA 3M6XA 4A9AA 3DFZA 2GUWA 3L1IA 3ON5A 1SN7A 2FVYA 2I54A 3D6MA 1ADBA 1R0SA 2GCOA 2WICA 2QM7A 4XCVA 1I80A 3LQFA 3MINB 3SU8A 3WSTA 4B34A 4CM3A 3WVNA 5IK2D 4HFJA 4R84A 3OH8A 5CM2Z 3W5IA 3T7SA 3K9HA 2AJDA 4Y2JA 1E4EA 2HSWA 3U7JA 1DAFA 4J0IA 1IAQA 3OO0A 1I13A 1UAGA 4QUIA 4I6GA 5CVJA 2QE6A 2W90A 4C7VA 1GT6A 3AUUA 1N57A 2GAIA 4I1OA 3R0VA 1NRJB 2CL5A 9GPBA 3RVLA 3C5EA 1C4KA 1GNVA 2FRDC 3DKRA 4LRTB 4EHHA 4IGIA 4M1MA 1Y1TA 3ADKA 2I4TA 3JQFC 1LPAB 4S3MA 2BGUA 3I76A 1HKUA 4Z5XA 5INTA 1HZJA 1GNQA 4J2HA 2H5LA 3LLVA 4E6EA 1HXHA 2UZ1A 2P6UA 3GPBA 3OT4A 3Q4GA 2UXCB 3JQ8A 3AUSA 3JWJA 4ZAXA 4WN9B 1L7DA 3DL7A 1WWKA 2G9ZA 3IQFA 3QQ5A 2I0FA 1H4SA 4DSNA 2BGJA 1GRRA 2OO3A 1X7ZB 3VC1A 1EX9A 2GKGA 1FVHA 4YB8A 4X90A 1CY2A 4L57A 1BHQ1 4CM8A 5AVTA 3C3DA 1JQEA 1G98A 2PUFA 2PGJA 4L9WA 4AURA 4QXRA 1EQ2A 1KO7A 5LMNB 4NFYA 3BTSA 3Q9SA 1TF7A 2IS1A 1XDBA 1ID8A 4RTQA 2NSYA 1A9XB 1EQUA 3F8TA 5AVKA 1GFSA 3KTAB 3KSMA 4S0ZA 1L5GB 1ZUIA 3R3HA 3ZE6A 1XNHA 1P33A 2H31A 3V46A 4LC9A 2JANA 221PA 3P20A 2R25B 2GBLA 1JFSA 3ZWBA 3JYHA 3CSUA 2BFDA 3TUIC 2AOTB 1RYFA 1UK8A 1FNMA 4YJHA 4PG5A 1BE8A 1JR2A 1RQRA 4M36A 3DE3X 4MIEA 3VKGA 5DXJA 2R00A 3UK2A 1JJFA 2Q2OA 2P2LA 1F1BA 2CMDA 2Q5IA 2X2OA 3KSZO 3PR3A 4V1CA 1FNCA 2CLCX 3PGMA 1UZMA 1V47A 2Q5FA 4L72A 3IAAA 2VAMA 3DOHA 1RBQA 1XQ1A 4ZREA 4I66A 2PH7A 4KSCA 3DMNA 4J7UA 3HRIA 2JLXA 3H5TA 3B1XA 4MW7A 2G09A 3ZWVA 4D25A 3L1UA 1OT5A 1T5OA 1E4YA 2NPOA 1SBNE 2DX7A 3OQNA 3U4QA 3BILA 4MYSA 3KB2A 1NTOA 2ZGVA 3IUNA 4Q3OA 3Q9LA 4EPVA 1WA5A 2PZMA 1L1EA 5CXXA 5CB8A 2D5IA 2Q29A 2BAGA 3AB8A 3M3HA 3QVOA 3GJ5A 4X97A 5IUNC 1RXSA 1W4CA 1SQ0A 1ZL2A 5IAJA 1Y6FA 2WJWA 3LP6A 4IIDA 2OBYA 3FFAA 1PIWA 2C2KA 1NY6A 2WTBA 5EWMA 1Z08A 5EA2A 1G5QA 2B5VA 4LSMA 1IZYA 1U8EA 4QRIA 5KMGA 1TUBB 4IEEA 5A7HA 2J0UB 4NP6A 5LOVA 5MGBA 2Y0EA 3AY7A 1EUYA 2I2XB 5FTMA 2OO5A 5A05A 4C2BA 1IL0A 5K8LA 1IRIA 1XVVA 2NT3A 4M76B 1W75A 4QQRA 5KUTA 5J2UA 3A7DA 4IHQA 2J33A 3WLOA 5H70A 1MZVA 1A4RA 4PC6A 4UVEA 2V7GA 1WSBA 3CH7A 7ABPA 4MCIA 1QFXA 3L0YA 5DOVA 3A2MA 1E3JA 2MWMA 2KPOA 2Q6OA 4L85A 4GNRA 4FR2A 4AUMA 5EQDA 2J6HA 3TQSA 1ENPA 5A5EA 4G81A 4QOHA 3LA8A 2FMXA 3KR1A 2EHJA 2Y0DA 3HUUA 5EJ6A 2DEUA 1ZN2A 3SX0A 2P7HA 3IMEA 2ZWAA 3WRYC 4Q9HA 1JZTA 2P3SA 5KCMA 2PKYX 3MBKA 3QEMA 4M89A 2WHEA 3UB3A 2NM0A 1DINA 2LD4A 4JOCA 4OQLA 3UHPA 1A4IA 2GTPA 4L2IA 1YASA 1JU3A 2X6TA 4OXNA 3ZJTA 1E3MA 3QF7A 1NA5A 2OCKA 2P9HA 4B3JA 1OA0A 1MX9A 3TD6A 5EFZA 4X93A 4P7GA 2XQIA 4E08A 3H2IA 4P53A 1TZJA 3B9BA 2NSDA 3A0UA 1ZM7A 1WHSA 3W1EA 3ZKWB 4AU1A 2DQ4A 3SQDA 4CF6A 2HU2A 3CBQA 4EWLA 2J0SA 1CJVC 4G0WA 1OU0A 1VCMA 2BEUB 2F64A 1CDEA 3SXUA 1QH8A 3UKJA 2FGKA 2G6BA 1RM5A 3AERB 1UJMA 3EIUA 4F6RA 2GM4A 2IV2X 1Z8DA 2GK7A 3UUFA 1UBHS 4P7FA 4R2JA 4FQ5A 4YJ2B 1MH9A 1Z3CA 1OGYA 4UBLA 721PA 2P8JA 1QZZA 1ZVVA 4DMMA 4GZLA 4X7BA 4ZYZA 3AHDA 4NXMB 3D3NA 2QMUA 2VJNA 3UGTA 1N1DA 3MOSA 1PJCA 4IFBA 3WLRA 3O74A 4PG7A 3JQ9A 4BMCA 3NOOA 2BRUC 1ZHHA 3OZCA 4WLFA 1X1CA 2QYHA 3LGAA 2DP4E 5A3RA 3DD5A 2XQJA 3KYDB 2XTZA 2P0AA 3F7TA 2QN1A 4DE5A 4ECAA 1E58A 2QLNA 4NZOA 1N8KA 1DO0A 1TEVA 1O4VA 1V4NA 2AX3A 2ZZKA 3L7BA 4O02B 5FTKA 3RU9A 2YRFA 1AKYA 4WOCA 5KJFA 3I9LA 3VZRA 3D0RA 1XF1A 3AEZA 2V54A 3AI3A 2R4TA 3IUQA 3N0TA 4NARA 1NE2A 3FVTA 2X1VA 4Q7QA 4ECEA 2DBRA 1SHKA 1D2GA 3C7DB 3EIFA 3IESA 4CIYA 1NOJA 4H6WA 2CT8A 4KN8A 2QPLA 1AD2A 2O2XA 3WICA 2JZNA 2QD4A 1M2VB 1RLIA 1UM9A 4EI7A 2JB9A 5HOQA 5TPWA 1E62A 1C8VB 1G42A 3H5VA 3I05A 4HDMA 5LNK6 1RD4A 5HP4A 1XZ8A 5AM5A 2Q5EA 1JHZA 2XOKA 3ZWWA 3RODA 1V25A 121PA 3PHLA 4KAAA 4TT3D 4XTRA 4IOLA 4DM4A 5IJZA 1B4DA 1PWZA 1GPUA 4OUDA 1YJCA 4FGUA 4UXHA 5IH3A 2OKCA 4AI6A 3N9IA 4FI3C 2IEIA 2X5XA 4G2TA 5AVVA 1VYTA 2PA3A 5WRFA 3WWEA 5EP3A 5IZCC 4IO0A 1AC5A 3DDHA 1Y7IA 3IAHA 3B82A 3ME5A 1P2FA 1FA9A 2H1VA 4URXR 4UVGA 4AVYA 2FJ0A 3ASZA 3C6KA 4PHTA 4QXMA 4B45A 4CTMA 3V8BA 4NYIR 2H4XA 2GEVA 3RK1A 3BHJA 4PSKA 1IY8A 5DU2A 4OQYA 3MTJA 5L45A 3KOWA 4G41A 1TRKA 2BUAA 3W1VA 3MGAA 3UKOA 4B6EA 2E89A 2DTDA 2V7EA 1R3UA 2DY0A 3L6DA 2Q7OE 3GAZA 2C92A 1XJQA 2BONA 2UVQA 2Z98A 2IELA 3N7UA 4OGGA 5E6SA 4J4BA 2WWYA 1HEUA 1DX4A 2R7NA 1Q3HA 3R09A 1JHUA 2E18A 2NSLA 3PE4A 1VE3A 4XGKA 2J4DA 3ITDA 2DHCA 4ENVA 1EK1A 2ET6A 4DDVA 3PL5A 4QHTA 1E1RD 2F9MA 1N2OA 3RUEA 1P4RA 2DR0A 3T7JA 3IKTA 2FZ4A 2F55A 2ZM6B 1UFKA 1NJFA 4TT3A 5EMMA 3LY7A 2H29A 2P30A 4QHSA 2QX7A 3DE0X 2WJAA 4OJTA 1CR2A 2CVPA 1CLUA 3L8CA 1EPUA 2E48A 4P08A 1BDBA 1FFXB 2FEPA 3JVIA 1DXYA 3A9SA 1Q84A 1Z22A 3EVEA 3PFGA 1OI4A 2IYOA 3SHWA 2QL7A 4XOUA 2XUDA 1ZK4A 4AO6A 1W5AA 3L1HA 4PIVA 1XIVA 2P4UA 2X8LA 3HNOA 4IJ5A 3MCVA 4H2DA 2QX8A 4AJ1A 3L5OA 2ZANA 3L6OO 4F5DA 2HD4A 1A50B 2ZITA 5I45A 1H5UA 1IEQA 1XNRB 3WK6A 5BMVA 3AONB 1G8JA 3Q7IA 1VTKA 4JMPA 4X8LA 3W05A 1K6IA 2POCA 4IDPA 5DGCA 1VA4A 4MV5A 3SDSA 1PQ4A 4EMBA 4NDAA 3FMIA 4EGCB 4N5LA 3OT5A 1B41A 2AJTA 2YHUA 1QCCA 3UMCA 4BASA 4BNHA 4G0ZA 1NZFA 2JI9A 2C4UA 1ISIA 1KI9A 1W8DA 4FMCF 2DT8A 4I36A 4RCYA 3BB3A 5CXSA 1SOMA 1OGJA 1VYVA 2CDNA 3HY3A 4ILKA 1Z6AA 1M1XB 3PGVA 2WUWE 4NMWA 1NI4B 4P3YA 5CA1F 4AQYB 3WMWA 1PR9A 1T9BA 2YC2C 3CR7A 3FDZB 1G3IA 2BMFA 2Q5QA 1WB4A 1NI5A 2GPJA 4PLYA 4PTLA 4IUDS 1EGHA 4WD3A 4O8CA 1OKKA 4MR8A 4RTKA 3RVNA 2P9QA 5MN4A 1OFTA 5AH0A 2GH1A 3SJ7A 1PUJA 1MOZA 2WYOA 4LBZA 1KVQA 2NZVG 1OJLA 2VXOA 4QJ4A 1Z56C 2R1UA 3GZJA 3NH9A 3Q8WA 3EF1A 3K9WA 3L7AA 4P4LA 4EKEA 1SR8A 4PYLA 1NV8A 1TO1E 1L4UA 1GGMA 2OBXA 1PGJA 1N32B 5P21A 1CS0A 5D6NA 2EG5A 4R83A 1L3BA 4GXQA 2A0WA 1OXMA 2XVAA 2DFVA 1OI7A 5AI0A 4AC9A 4C2AA 3WLLA 4OQMA 4LJSA 1OBHA 3GQBA 3DTTA 3HCFA 4H27A 4BO9A 1A9PA 5LQDA 2PJDA 4H0CA 1YB5A 4OP1A 1MGPA 3U09A 3JQPA 1IM5A 1ZOSA 2O1EA 3PWTA 3LNCA 1NHGA 1E1CA 2ZSJA 4IQ8A 5DASA 1XB2A 2BHRA 4MB2A 1Y7LA 3F2IA 2FF7A 2VA8A 3GG9A 4WDQA 5FCDA 1TU4A 4IUYA 4BNKA 4O2BB 5FUWA 1Q1EA 2JZOA 1J5XA 3HMQA 4RHEA 4B48A 4IZIA 5HQ3B 4HYEA 2W8BB 2Z2JA 4KE7A 1P1CA 4L95C 5HFAA 2IQ5A 4YRTA 2OV1A 3NOXA 4MVJD 3X1KA 3ZY5A 4AG3A 1MQAA 1KY4A 1QFSA 2XLCA 1CEXA 1U7TA 2WI8A 3E27A 3VDRA 4UTVA 1AQJA 1SC4A 2EXXA 3JAKA 5KYXB 3KG2A 1AGPA 2Y3IA 3FYTA 2YZGA 3OIGA 2IHUA 4GP9A 3VTFA 3FKSD 3ELBA 1L9KA 4DLKA 1E6CA 3RHZA 3OHPA 2EV9A 3C7CB 3IKVA 4HPJB 3INTA 4MXDA 4OXKA 1JQ3A 3HHPA 4HN9A 5D3MA 4A2WA 1JAYA 2AS0A 4D43A 3OU7A 1PNRA 4NH4A 2XZOA 2FRVA 1R6BX 4NQZA 4WK4B 4F7WA 5B3KA 2QM3A 4EUKA 3EXEA 3N2GA 3NWPA 2YBDA 3UTCA 3ESRA 1GO2A 4B73A 3PV0A 2K4MA 2G72A 3O73A 5C1DA 1AS2A 2ICAA 2ZZMA 3QPAA 1FQJA 1M10A 2G88A 1U1GA 2XQGA 1PAUA 2QG4A 4IF6A 4IDQA 2ZRNA 5DHSA 1J07A 2IYVA 2JI8A 4UBJA 5AKZA 2PNJA 4PYIA 3SGLA 5ANRB 2NV6A 1WZEA 1MABB 1ACMA 1OYYA 5ENVA 5IAOA 2ZIFA 3A1NA 5K3SA 5JSQA 1M34A 4DEXA 4MJ3A 5IF9A 1SG6A 3WQHA 4I99A 2F3SA 1YCDA 4PQEA 1XKTA 3OQJA 1KVTA 3UM9A 1OX5A 2NXJA 2PBLA 3FPBA 4DA0A 3P0HA 1PG0A 3HEMA 3AVVA 4L3OA 4MS4B 1E2DA 3C87A 3W8NA 2GEUA 4KDCA 2BFBB 5KTSA 1MOQA 4OI1A 1R4MB 1XQXA 4LYAA 1BXGA 2RJNA 4PCVA 5IC6A 4HQ0A 5EJEA 1NQ5A 2A5YB 2QT9A 2Y76A 4JT4A 2IDZA 1FFYA 2NQ2C 1QP0A 4PPFA 5BQFA 3WQSB 1P60A 3OOHA 4WI1A 2H3EA 3ZDZB 3WLMA 2GMWA 4LYFA 2D2XA 4LXGA 4QNRA 3OZXA 3LIPA 4CXMA 2WIBA 3DEHA 1V45E 1G4AE 2LTAA 3S8MA 2RHLA 4L6IA 4X6LA 1RRPA 1A2BA 1GRVA 2RGDA 1NBEA 3LVBA 3KUDA 4X6YA 5KX5F 5G0TA 4LFBB 1UWVA 2BFMA 3DEYX 4ER7A 4GYJA 4MRSA 4R81A 4Y2XA 4KV9A 1YZFA 2ZJ1A 3EF3A 2QRVA 3EWNA 3K8ZA 3BZUA 5FUQA 5CBPA 1OAOC 3ZU5A 4OLAA 4TV9F 1JLSA 4UAUA 2DHDA 2QVGA 2FFAA 5AVWA 1K5DA 2A14A 5MN5A 5HX7A 1J7KA 3OPYI 3PFHA 1Z5WA 4I19A 5HUJA 5EZ6B 3HV2A 4ZO4A 4Q03A 1DSSG 4F91B 4N47A 4DRZA 3EEQA 4P82A 1XAJA 2RMKA 4HB3A 3P0EA 2ZSBA 3Q9UA 4WESA 1ENZA 2IH2A 2E7ZA 3FMPB 4OHBA 3WKDA 5L6MB 4IDNA 1PGPA 4IY1A 1JYFA 1KAQA 3PJGA 1Y9EA 4ZQEA 3IPAA 4AKTA 3LI2A 5IMSA 1IPHA 3WL7A 1NG9A 3N6XA 1UF9A 2HWXA 1KXJA 2VHJA 4I4CA 3TKYA 1SOVA 5JSZA 1MIOA 4YPOA 5KTOA 2DH5A 3AKDA 1KSHA 3VBEA 1Y8ZA 3M0EA 4MLPA 2IZ5A 3A6ZA 2V7BA 1YZTA 1CUGA 2WF9A 3N8GA 4JJKA 1OZFA 1TXGA 1YVEI 2WFAA 2VHTA 3DFKA 2REXB 3ICPA 3FTNA 4I4TB 4ABYA 4V3CA 3JYPA 2BC9A 2BL4A 4GSYA 2P77A 4BFSA 3GEPA 3KP1A 1PFYA 1OFHA 2RGXA 3EIOA 1EWTA 2O7QA 3C3WA 5ALZA 5TF4A 3TRDA 5HKKA 4KFSA 2YHSA 1WOMA 1NQOA 5DGXA 4ZI5A 3RVSA 4JXZA 4JOSA 4DIMA 3CUKA 3O8OA 1ZISA 4J07A 2VUHB 3HVKA 1S02A 4MYDA 3WRWA 3FWYA 5JBIA 2C9BA 4FKBA 2HA6A 3AR7A 3BTUA 2QTGA 1T6ZA 3KYBA 1RU3A 3THXA 1RNLA 2ALJA 4MUGA 1D2NA 1MJNA 4BLUA 1Y4AE 2HKIA 4MVXA 4UCFA 3ZDCA 4HEA6 2VSXA 3WGZA 2XSZD 4R2IA 1F0YA 3ED1A 3RH0A 2A0KA 1M1NB 1A9TA 1XEWX 4IS3A 4E2ZA 1V48A 1QCZA 2BI8A 1OYVA 3OE7D 1LDMA 3P26A 4C3ZA 4DB2A 1T3ZA 1WQ1R 3MLBA 5AHOA 1VI6A 3ISVA 4REQB 5U4QA 1APBA 3QSYA 4U4AA 2CLOB 3PHHA 3LHFA 3ZOKA 5DNVA 4BTVA 4EVQA 2IZ7A 3V7FA 1XR3A 4MYCA 1Q15A 1NSYA 3VKWA 1GILA 3H9EO 4HDNB 4AY5A 3PWKA 2Z9DA 2FW0A 1V96A 3L7DA 5IJXA 3S99A 4B2LA 3F1LA 3RWMB 4FFVA 1ZXLA 1ZIPA 1EBBA 1KXZA 4EPXA 1AG9A 4QDKA 2VF4X 3H9CA 3WWZA 5CDFA 2HQBA 4DSUA 1YL6A 3ROTA 2YMQA 1FEZA 2DR2A 1ZNQO 1ZK0A 1L6RA 1C7EA 2IZ0A 3S40A 4IHKA 3ZVKA 3TAXA 3CVXA 4OFBA 1HNXB 4DEVA 1MVOA 3SYMA 5CLQA 2XEDA 4F4IA 4UM9B 1ONSA 5CA0B 3EAQA 3V7YA 2ANCA 1RYNA 4FFNA 2E49A 4FSDA 3ZWAA 4L5YA 1B6SA 1V7ZA 4UEJA 3SXUB 5ALOA 2IGBA 3BSSA 5FTJA 4RVUA 5A6VA 1TKBA 5IBCA 4GKKB 2H2AA 1SBQA 1W2WB 3VHQA 4FFBB 3NIGB 4M1KA 5LYYA 3LX6A 5DXFA 1FRQA 5I6DA 4KXXA 4C2UA 3TSOA 4G0UA 1LX7A 4IHJF 5TGTA 4KXUA 3ZGYA 1EE2A 3W2IA 5A1JA 3NHUA 5KDOA 3KVYA 2A9JA 4CKWA 3PPVA 2CBGA 4LCBA 4WLUA 1ITZA 1NKSA 4CPDA 1LRLA 1ZC4A 5AM1A 4OMFG 4D3DA 2H9IA 2AVDA 3SAJA 4Y18A 2VUUA 1RADA 4G6ZA 2C7RA 1UDWA 3O83A 1Z6YA 3U4MA 2YJ3A 3I1IA 3KWJA 1W46A 3PNSA 3AF5A 1TX4B 2HSDA 4ZOEA 2D62A 4RK0A 4I5DA 5K0ZA 2RHOA 1NVKA 2DLNA 2NUAB 1XZLA 4ITUA 4QXOA 2EX0A 1KBOA 2YJNA 2VP4A 3RYHA 2NP6A 3ZY3A 1QYCA 1GSHA 1WXFA 3BDAA 1NP7A 1F8FA 4IJWA 1P1HA 1W88B 1B6RA 4NESA 4QDJA 5LMCA 1N77A 2VTVA 1F5NA 2WP0A 5HGXA 5IKXA 4ZXPA 3U3DA 4G8CA 1DL5A 4BGDA 3IP3A 2EJTA 1T9GR 4F04A 3PXCX 4ON9A 1KOGA 1JKFA 1GU7A 2O2ZA 4OBWA 4QOJA 3U1VA 1QGOA 5IARA 1PSWA 5KOYA 4NVRA 1Q83A 2QVBA 5E95A 2PZGA 1PV2A 3DTVB 3OM9A 3KYCA 4IYJA 3HXQA 2OCBA 1RIIA 4DBZA 3D3JA 4EP1A 2IV3A 3K6SA 1N7IA 4UEQA 1THMA 3AEUB 2P4SA 5D2CA 1KSGA 9LDTA 3GH1A 4C0AC 1LW6E 5DNUA 3FMVA 4G56A 4KHZA 5J4VA 1IN5A 3H8VA 1BWPA 4YPVA 3D8HA 3DTYA 3KJGA 3K2EA 2O0HA 1XQVA 1J22A 3BA6A 3HP1A 5KVVA 2PO5A 2X77A 5FADA 1GZUA 5REQA 2O8CA 3SEAA 2EP5A 5ILOA 2DFDA 3O84A 2ZI6A 3UCEA 1N3BA 1LEHA 2GXSA 2WTMA 3D8BA 3QPDA 4FGZA 3R9IA 1WP4A 1JLLB 1CV2A 3E35A 2G80A 2QV7A 3FYDA 4J90A 2WFLB 4KDRA 4URZR 1E92A 1KVUA 3V1UA 5SYMA 3IYLW 1U2EA 4DMRA 5B6JA 3KWLA 3QBDA 4FPXA 1SIWA 5FHQA 4D02A 2ODWA 5B1HA 4M6WA 2FW8A 1T2NA 5DBGA 5JH7A 1WB9A 1CR0A 2DY1A 1DMSA 4MW0A 5CYFA 4A2QA 1XN4A 4E14A 1NNEA 3CY6A 3LXRA 1NX9A 2WYIA 1M2OA 2CMKA 4JYZA 4D9GA 2CD7A 3BWXA 1QH0A 2WTNA 4FINA 3K6KA 3VO9A 4LVOA 1TAUA 1TQ2A 2V6JA 2V1XA 5DM70 3R5TA 5F23A 4X66B 1G20B 2B4AA 3ASVA 4GKBA 4UFOA 5MFZA 3FTFA 2W9XA 1TT5A 4NE9A 2DFNA 2P2GA 3K9QO 3W3AH 2VH2A 4IWXA 4IH1A 5D3KA 3QEMB 5MFPA 5HF8A 1F12A 2ID9A 1I2ZA 2MHCA 2VH1A 4K1XA 1C3LA 1QIEA 2OE2A 2P0EA 2E4YA 5FTWA 1IN4A 2VQ3A 2WWTA 1IATA 4MARA 1PEDA 5TVKA 1IONA 1Z6TA 3T5CA 2WUDA 3OPXA 4NI5A 5JYBA 1OD6A 1FP7A 1XEXA 3VH1A 4BXOB 1C1YA 1M5TA 3H6KA 4AUNA 2P35A 3QP9A 1A9ZA 4PLGA 4QPZA 4UHFA 5FYDA 2G77B 4A92A 3I5YA 1GG2A 1MV8A 1RJGA 1ZMRA 4XD2A 1SURA 3GARA 4O4IB 5JJLA 5A06A 2P2YA 4O2AA 2ERCA 2PH5A 2WKWA 3CYFA 3DG9A 4INJA 3TJMA 3VFDA 2J5RA 2BGKA 4AJJA 4HLCA 4W7IA 2I1WA 1TAHA 2C54A 2R6DA 3ZZUA 4HV4A 4ZK6A 1H4QA 1MTZA 2XCLA 5JFGA 1SU4A 2OSVA 2GFHA 5JBNA 1W7AA 2GN9A 1G2IA 1X8LA 2JAXA 5JCOA 1XROA 4B44A 2GWRA 4M8IA 3HY4A 2GD1O 1Q1BA 2YS7A 1ZAYA 1Q12A 3U3ZA 2CFOA 2UUOA 1DQRA 5DBHX 4R0VA 1VIVA 2HK6A 4YCJA 3FVRA 1QP4A 1KPIA 4GVPA 7ADHA 4ZI7A 2W6ID 4R9SA 2G67A 2ID7A 1GV1A 1GFIA 4EVSA 4H4EA 3FUXA 1X80A 4FZ5A 4EGAA 3S2IA 2PRJA 2Z6VA 1E1QD 1A98A 3B3JA 4TMZA 5T41A 1S8OA 3RV3A 2XT6A 3T41A 5JISA 2GCNA 3NBYC 5F1KA 2B78A 2ZS7A 2EBUA 3O3MB 1YZQA 4DNFA 1DAPA 1U7DA 3A6FA 2FZVA 3OFJA 3SIXA 4G0MA 3ZWDA 5M04A 2IJGX 4MK4A 2O8BB 3I04A 2GXUA 2ZRMA 2C5SA 2JFGA 3VVCA 2JGMA 3N7TA 1K9SA 2XB9A 3F8SA 3VZSA 2Y1LA 2P6MA 3K1YA 1FSGA 2A92A 3AO0B 5CTJA 4BV8A 5L7WA 3BQMB 2FPUA 2RB4A 1GHTA 1E3IA 3PXBA 4DLTA 1XZMA 3RS8A 5KSOA 1RPZA 5ALEA 3V4OA 5BY2A 3KZOA 3ZLUA 1VBMA 1XLTA 3E9NA 1GOTA 3MZ0A 4HRAA 1B43A 1R4NB 1XU4A 2V74B 3PF9A 1JWAB 3R75A 1HRKA 4K8RB 2WQZA 2P2DA 3I01A 3QEOA 4L1KA 5AICA 1QO9A 3DD1A 3PXGA 4H3SA 1FLDA 3T1VA 1ONOA 4Y2PA 2SECE 2W2XA 1GUYA 4UZSA 4YI5A 2JIDA 2NV0A 3BE4A 5ICEA 1V8ZA 4ZQGA 4BFXA 4YASA 3H1PA 4BC1A 4BE7B 2M9MA 1FS5A 2VF8A 3IBFA 3A1UA 3JYOA 5KYVA 5JANA 2IY7A 4AG5A 4YMVA 4FOOA 2HHCA 4UTXA 3ONEA 5JROA 1JBQA 1HTBA 3MTBA 1EA5A 4NENB 4RCZA 1C9NA 4C1NA 1VE9A 1FUUA 2HHLA 3HVHA 2Q2WA 3IIKA 3JW8A 5DBEX 5EKTA 3GDOA 4LHZA 4AULA 1DBSA 3CLRD 3TDNA 4K88A 3L01A 2PZKA 1CRZA 1G8GA 4FYHA 4WLVA 3RC2A 1AF7A 5BUSA 1DKNA 4LYDA 1YH3A 4FN5A 4ZHSA 3FOFC 4O3MA 4BWFB 4GC5A 1XTUA 4LECA 1U1FA 4ZMSA 2E6UX 3LF1A 1NBME 4H1UA 4IG4A 1Y1PA 3HSSA 3NUZA 1WV1A 1C0KA 3CUSA 5HGJA 2HH9A 1XA4A 2Y2VA 5ALMA 4MHTA 1SBCA 3C6XA 2ZE8A 3HR4A 2R8ZA 3N0RA 5HFJA 2ZAMA 2X0FA 5LQMA 2JH3A 2IY8A 4GW3A 3DEAA 1W1UA 2ARKA 1U8AA 2H5JA 5DNCA 3NHAA 4PEVA 4B6JA 3B20A 4FYWA 3CW8X 1YQEA 3K1ZA 4P83A 4QPJC 2LGJA 3FWHA 2XZPA 3SC6A 3WMGA 4JAVC 4N5DA 1GZHB 1V9CA 2CLSA 2I2WA 3B6MA 3N0XA 4XGRA 2XF2A 4H35A 3AIMA 4Y2YA 3TMKA 1LKZA 3VH4A 2ZRFA 3MS2A 4JDUA 1JI3A 2IQIA 4DVGA 2OUKA 4XVHA 5C2JB 2VJYA 4DV7B 2HZBA 2DSNA 4PO9A 4URHA 1XEXB 1HM5A 2PANA 3D0OA 4MW2A 1MEJA 1Z68A 4H7PA 1KDZA 3SKYA 3TTSA 3WGLA 1RBZA 3ZX4A 2DRIA 3OPYB 2FW1A 4NPHA 1K89A 2NO5A 3OIFA 1J1UA 3TZEA 3FFXA 3O0TA 2BHLA 3KLPX 4BX2A 4HAYA 4OL0A 3RKUA 3V42A 2BISA 2YNMC 4G9GA 4HDSB 4JNCA 5LYJF 2VBIA 2GARA 4I55A 2C7BA 3OKAA 3CR3C 5J63A 3V8RA 4F2HA 4GQIA 3BFKA 1RHMA 2VNKA 1N1EA 4FW9A 4I3GA 4MVJH 1VXRA 5B6IA 1GT91 1PLLA 2XMRA 4GOJA 4EW3A 1GITA 4F21A 4CDGA 2G9QA 2VVTA 4GGPA 3M4XA 1V1JA 3G1WA 5GM2A 3WKCA 4CF7A 4B9AA 4E0BA 4RIFA 2OQIA 4HDAA 5AKYA 1JMYA 2VLIA 4TV8A 1P0CA 4FT4A 4K9DA 3UB2A 1V3VA 4PM4A 4EY8A 3VNSA 1GY8A 3FCSB 3GRZA 4M9QA 3V4FA 2RCYA 2ZQ5A 1TKCA