5CJ2A

Ran gdp y39a mutant triclinic crystal form
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
197
structure length
197
Chain Sequence
b'QVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKAVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPALAAQYEHDLEVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding nuclear protein Ran
publication title Catalysis of GTP Hydrolysis by Small GTPases at Atomic Detail by Integration of X-ray Crystallography, Experimental, and Theoretical IR Spectroscopy.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 68
structure length 197
sequence length 197
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2015-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5cj2A00
1CTQA 2OG2A 3PEVA 4A6XA 4BGDA 3LLUA 3CZQA 1QHIA 2WPDD 3GJ5A 3LVQE 5JWOA 2ERYA 2V6JA 2F43B 3LNCA 1TPZA 3AVTA 5P21A 4NCKA 5UKDA 4HEJA 2B7BA 4LSGA 4PO9A 1JB1A 4ITRC 4TMKA 3SOPA 4Q9IA 1Q3HA 4OQFA 2AR7A 1J7KA 3VQTA 3U6BA 2QAGB 5DI9A 3UK6A 4YMTA 3TUIC 1KOFA 1E9BA 3UWOA 4KFRA 1SXJB 4LYHA 2OCAA 4NZYA 1ZM4A 3KUDA 4AKIA 5KPDA 1OYYA 2FX3A 4BUJA 1E1RD 1Q1BA 2W6JD 2DFTA 1KY3A 2V1XA 4D82A 1CF4A 1S1MA 4W5HA 2GDJA 3WYFA 2Q6TA 2CVHA 3T12A 4HUQA 3EZ6A 5B2ZA 3IHLA 1ODFA 2CBZA 3E1SA 2ZUDA 5FBVB 2CJWB 1P5ZB 3UXMA 5DIFA 3A1SA 2D74A 2QI9C 2D62A 2BC9A 1LS1A 2NZ8A 3ZVRA 2OFOA 2G88A 3B1YA 2UZIR 2WJIA 4P4SB 3L0SA 4Q4JB 1C1YA 4HLDA 2QMHA 1W2HA 1XX6A 2JAQA 3ZYCA 1E96A 1ZBDA 3AF0A 1P9WA 3CWQA 2WKRA 5G53C 5SZHB 4A4DA 2O8DA 1P9NA 1SVIA 1ZNZA 5HE9A 3PR1A 4UNSA 2V7QD 3VAAA 4OJKA 5EE3A 5IK2D 5GVRA 5JSZA 5GJBA 3GFOA 4HDCA 2ZSDA 3W8NA 3JZAA 5JI3E 4URWR 2XTMA 2C9CA 2W0SA 3U61B 3B5JA 1FUKA 2B6HA 4WZ6A 3RS4A 1Z6XA 1GUAA 2ZE5A 2OLKA 2XJ4A 3LLMA 4NKRA 2XNDD 2C5LA 2CE7A 2CL7X 2QM7A 1ZUNB 1KJZA 2ZI3A 5BQ5A 3ICQB 5M04A 2WSSD 2ZRFA 4KVAA 1ZC3A 3EZ2A 4GSYA 1W5TA 1YZKA 3CRQA 4B35A 4PANA 2QORA 4ASUD 2OESA 4RD3A 1J8YF 4TMWA 2RHMA 3CO5A 1QHGA 4GP6A 3KQNA 4M21A 1SZPA 2E87A 4I1UA 3RABA 4Q1EA 5GJVC 1N2CE 4B34A 1VYUA 2CCJA 4MQBA 4IEIA 3QKUA 5JCPA 3QSYA 2GF9A 1YR7A 4CT4B 1OFUX 1CS4C 2MSEB 2BCJQ 1UBEA 1LV7A 5CIQA 3X1DA 2IYTA 1ZU4A 5IF9A 4B3DA 1T8UA 1R5NA 1E32A 5C2JB 2NG1A 3QF4B 3RS5A 3QQ5A 4AYXA 1OXXK 3OFNA 4HAYA 2LCFA 1M7BA 1XMJA 1TADA 4XD7A 5F2EA 4KAXA 5C4GB 4Q9HA 3MD0A 4EIWA 1SXJE 3PUWA 4I1SA 1CLUA 3NKVA 1AGPA 1VIAA 2J46A 1Z5ZA 1N0UA 2WJYA 1IJFA 1SULA 2G6BA 2ZETA 2ZJYA 2IYVA 4JLNA 1L4YA 4L9WA 2QSZA 2DR3A 5FFMA 1CU1A 2A9KA 1PV4A 3GJ6A 4G1UC 1G3RA 4URZR 5HPYB 2BCGY 4MGYR 3KJHA 4Q4HA 5J4VA 5JJIA 2EWWA 3J81k 3EX7C 2AKAB 2LKCA 1N6HA 1DADA 4MYUA 5LD2C 1JXMA 1EWQA 1E0AA 3FWYA 1W7AA 1KK0A 4IDPA 1Z2CA 3RYTC 3RRZA 3KQKA 1GZSA 2P5TB 1DAKA 5FTLA 4AKGA 3OZXA 1I4LD 1NMXA 3LXRA 5JZVA 5JJLA 2GEUA 4HB2A 3Q85A 1MRSA 1XTKA 4EQ6A 4GOJA 4QBHA 5K8IA 1G6HA 2V1UA 2RGEA 4AK9A 3AF4A 1DE0A 1ZP6A 4DDWA 2FWRA 2ZYWX 4V0KA 3GCGA 3LW7A 2X2FA 3PUVA 1UBCA 2QA5A 4TYYA 5JEEA 2FE4A 4QGFA 3R7WA 3OIWA 1OB2A 1HQCA 5C18A 2ANBA 4F4CA 4B73A 1G3IA 2JIZA 1P61B 1W4RA 4WZBE 1II8A 2KWIA 3L0IB 4EPRA 4K81B 4ZDIA 1OXSC 2VP5A 1YJ5A 3IPXA 1MABB 2QGNA 2Y8EA 3UATA 3OEED 1LNZA 2IA5A 4BEBA 1GNQA 2ZI4A 4AG5A 1E69A 2F1HA 2FA9A 5E7IA 2A3RA 4A36A 1KMHA 1G6OA 3BD9A 4EPXA 1N6OA 1GL9B 5BWMA 1HURA 3NH9A 1JEEA 821PA 3PEUA 4C7OB 3BK7A 2MSDB 2A5DA 5DE3A 1NVWQ 2IYSA 1E2QA 4OI2A 4URVR 2QQ0A 1NNEA 4FW9A 4D4LA 5FH9A 4MGKR 2HCBA 3TSWA 4ZV4A 2HT6A 1GKUB 2EVWX 4D80A 2YNMA 2G77B 2ZEJA 4IXMA 1DAFA 1KI8A 4QHSA 1J2JA 4LY6A 5EP2A 5C4MA 5DH9A 2ZRLA 4QJ4A 1G7CA 1G4AE 3VR6A 4GL2A 4JKYA 2QAGC 4Q48A 2MSCB 5G3ZA 1YU9A 4PQFA 5DSZA 3SC3A 1U9IC 1PJRA 2BEJA 3IDQA 1FP6A 2WPDA 2ZR9A 1OFIA 1BMFD 2WKQA 3WHKA 2W0MA 3SFZA 1NL3A 1E3MA 3K9HA 2JLQA 4CGZA 1Z28A 4D0NA 1CRPA 1NBMD 1HTWA 4NHOA 3RS3A 3TW4A 1G20E 1UEIA 2VYFA 4B2IA 1E4VA 1LS6A 1XCMA 2Q3HA 2VP6A 5FTKA 3GJ7A 4BZXA 3K70B 1G9XA 1MO6A 2AFIE 5C46F 3W3ZB 2IYYA 2O8FB 2D2EA 1E1RA 4TLBA 2W6JA 1IXSB 1T6NA 4GZLA 3SJAA 2J5XA 2ONKA 3WMEA 3RS2A 3P27A 4KBFA 3ADDA 2NZJA 3THWA 2MMCA 5CM9C 5HCNA 1XXHB 3NBYC 4CEHA 1Z29A 3MUFA 1W44A 4C0SA 1E79D 5K8TA 5EUMA 3DKPA 4HDQB 2A30A 3R9IA 3H84A 1P75A 2ZRNA 3FMFA 2QZ4A 2ZYVX 3AVOA 3RSLA 2FV8A 1O3YA 3B1XA 2ZAOA 4MGIR 4JS0A 2P65A 4G0NA 1OPXA 3HYRA 1XD2B 2CHGA 1XEWY 4IKEA 3ZD7A 1UDXA 4B32A 5KSZA 2N42A 4Q47A 2XSZD 1JXOA 2VPPA 3KKPA 2V7QA 4RKFA 3CUEF 3KB2A 5IK2A 4A2PA 4PZZA 1P2TA 3U3JA 4HAZA 4DB2A 4HSEA 4BLTA 5JWHA 4C0AC 1AZTA 1XD9A 3UMFA 1T9HA 2J0UB 2V4ZA 3MSXA 3V00A 2ZU0C 1IN6A 3C5CA 2XNDA 5FUYA 4C0JA 3WHLA 4QBIA 1KO5A 2W2XA 4M1SA 2WSSA 2EU8A 4B43A 2BHRA 1MO4A 1FZQA 4QNRA 1NVVR 2HDNB 4RD2A 4ASUA 1IN7A 3GJ4A 4G5OA 1VCOA 1HE1C 3FGNA 3IGFA 3EA5A 3UKDA 3UWKA 3D31A 5D3MA 1WXQA 5L3RA 1EFUA 4IDQA 5C1BA 1AJEA 1W0KD 4Q1BA 5JECA 4KU4A 1HY3A 2VL7A 3U7FB 3CONA 1KZGB 3PVSA 1F2UA 5TVKA 3E2IA 2CK3D 5BW8A 2ZI5A 5L3QA 3U3MA 4ZKEA 1GRNA 3Q5EA 5EXXA 2XXAA 2JJ2D 2JATA 1RZ3A 2DFKB 3TW8B 5JHGB 3EPJA 3UPUA 1UKVY 4UNNA 2QRNA 4P3YA 3E70C 4B3FX 1XMSA 4L4UA 3DZDA 4O25A 1KSGA 2G9NA 3K0AB 4Z8XA 1IXZA 2ZYTX 4BFUA 4OI0A 1MR3F 4M2LA 4HUQB 2J9RA 4OQNA 1OIWA 3QKRB 4TL6A 3UMRA 4LHYA 4EJSA 3CBQA 1P6XA 1NY6A 1U0LA 2HT1A 1DAEA 3WBJA 1K8RA 2GXUA 4A1FA 2IEZA 2QSYA 5HE8A 1X3SA 2GESA 2JLYA 3MWYW 3NEJA 3RRYA 4PC7A 4Q5IA 4D25A 1XXHE 1US8A 3WBKA 2VSFA 2WHXA 2OHFA 3K53A 2G83A 5J47A 4Q21A 2CNWD 2OAP1 4A0RA 5FPKA 3C8UA 3NVAA 4FMBB 1XTQA 4OI4A 3SHFA 1F60A 1CJVC 1KI7A 4G5SA 1RYFA 1QG4A 4O2RA 1SHKA 1SVSA 4DCNA 3LW8A 4URYR 3W34A 4GOKA 4EPYA 2CLSA 4OHYA 1TU3A 1HT1E 5JSZB 1RC8A 5A4JA 4DSOA 1FOEB 1EFHA 1EG7A 1XEXA 5KYKA 5TARA 2VHQA 2ZRHA 3ONWA 4YXWD 3QF7A 4TL7A 4CEJA 3C15C 2JLVA 1GRRA 2YWGA 2B7CA 4D4MA 1ZW6A 5BYJA 1JPJA 4ON9A 4EPTA 3QY0A 2WWWA 4F4JA 3C5HA 5H8WA 3NG1A 4D26A 2P3SA 3TIFA 4DCTA 1ZIOA 1MKYA 4JVNA 1N5IA 5CB8A 3K9LA 2Q3FA 3OEEA 4N3NA 1A7JA 1IQPA 2GXQA 2FSHA 3CM0A 5FOSA 1AS2A 3FKQA 1JEDA 3BFVA 1ETUA 1E6CA 1VCIA 3QOFA 1KI1A 3IQWA 1KNQA 3UG6A 3BB3A 5LDDC 3ZDQA 4MUBA 3B7GA 1VIYA 3K1JA 1UBGA 1X1RA 3RNLA 2FPKA 3EARA 5JWRA 1GAJA 2ZRKA 1BOFA 4EDHA 1U0JA 3Q7QA 2VTKA 3NHBA 4MDEA 4FMCF 2X19A 3O8BA 2DWPA 4M1WA 3R9WA 3K0FA 1FFHA 4UJ3A 4OHZA 3D3QA 5EZ5A 5LB2A 3A58B 4C0LA 1P73A 4U5XA 5FUWA 4ESVA 2H16A 2CLCX 2X8AA 3RANA 2C9YA 3GQBA 4V0NA 4DXAA 2ZR0A 2O0KA 1Z08A 1P3JA 4DB4A 4MYTA 3ZIAD 2AD1A 2W6ID 3ZS9A 3PEWA 2IF2A 1VPLA 2IYQA 1XPRA 1TUEA 4JLJA 5AJVB 3FFBA 4W7SA 4B6FA 2WTUA 4Q7MB 2JJ1D 3HR7A 1YQTA 4PC3A 1IY1A 2ZJAA 3TE6A 1BMFA 1OH5A 1WCV1 4A92A 5FTMA 1KAGA 1G18A 2D7CA 1N6IA 2Q21A 2G0TA 3LO5A 2R6AA 3KB1A 2NPIA 1NBMA 5CLLA 4ILEA 1NRJB 5FR1A 4MITA 5H70A 3T1QA 3PIRA 4B76A 1E9FA 4EQ6B 4O2LA 5CYPA 4DWJA 2AWOA 5CDFA 3K0SA 3AKDA 3BBPA 2AFHE 1GITA 1N0VC 3GFTA 4Q7JB 3ZVNA 1XJQA 1WBBA 1S1CA 3U7GA 4HAXA 2GCPA 1K6MA 2J7KA 3LFUA 3SI7A 3SJBA 1CJTC 2V9PA 2ZRGA 3NEYA 4KHZA 1NVUQ 5BN5A 3AVXA 1XZPA 2O8CB 4DUGD 1E79A 3TH5A 3EIQA 2REOA 3AH8A 4UQOA 1G3MA 4GMXA 5CIWA 4ZCMA 4XJXA 3AP1A 4I81A 1ZAKA 2PH1A 1CJMA 1WB9A 2J0VA 4TLCA 4FCVA 2W83A 4AD8A 5J4KA 4FMDF 2R6DA 3RVBA 4MH0R 1OF1A 4CEIB 1F3OA 4G5RA 3AKEA 4HLCA 1JBKA 1N6LA 1YR6A 3BJIC 1E2FA 2ZJ5A 4C3ZA 4JBWA 2GKSA 2XSZA 5EE9A 5L3SA 4KVGA 1Z0KA 1TQDA 4L8GA 1Z06A 2GF0A 3VNUA 4YONB 1L7VC 4FIDA 3R8CA 3TMKA 1G5TA 2WICA 1KKMA 2VHTA 4HI0E 2ZM5A 5JJKA 1XTIA 2ZS9A 1ZD1A 1SVMA 2YC2C 4DLUA 4F7WA 4DDTA 3CNNA 4RD4A 2YINC 3IHWA 4FXPA 1XD8A 5FBLB 5ANRB 3FFAA 1NN0A 3A36A 4HUTA 3CB4A 4V0ME 2IT1A 4V02A 4A6PA 3IO3A 4LRWA 2O8EB 3BH6A 4LV5B 3OIUA 1R6BX 5E3HA 1IN8A 4XVQA 1VYTA 2ECKA 3RDPA 1FP7A 4ARZB 2V54A 3IEVA 3RS7A 4HAVA 2ZREA 4MKFA 4PSVA 1OIXA 2F1IA 4M0LA 4RJLA 4BZPA 1JAIA 1DS6A 2PZEA 4MRNA 4UNQA 1KI9A 1XU4A 4Q4AA 2ZSEA 5CM8B 3MJHA 1GRQA 4JVSB 4BFSA 2XAUA 1W0KA 1V5WA 4EFLA 5KHOC 1Z8FA 2QPOA 2ZUCA 4LBYA 1KI3A 3HJNA 1IONA 4DDVA 4HLQB 1AQUA 4TQAA 2CK3A 3VKWA 4IW3B 3GJ0A 2BMJA 5DGXA 3CR7A 4LYJA 4LPSA 1DEKA 1PVOA 1OJLA 2J0SA 2JJ2A 5DI3A 3K09A 3K9NA 3B60A 4A0GA 1HUQA 2GXAA 1Y3AA 2YC4C 2GHIA 3Q8XB 3KKQA 4AI6A 3CPEA 1JR3D 3GLHA 2R9VA 5KU1A 5TMPA 3TRFA 3VHXA 2GCOA 5JS8A 2O8BB 4PC6A 1OSNA 4O0MA 1A5TA 4OL0A 3W3AA 3FYHA 3TSOA 4ZPXA 2KSQA 4Q7KA 5AUNB 1R0WA 2Z6VA 3TK1A 4NMMA 4EKDA 4JT4A 1H65A 2I3BA 2R65A 3PXGA 5AJXA 4ZDKA 1JJ7A 2C77A 1KO7A 3KFVA 5EUQB 4MRVA 1FNMA 1IN4A 4BFYA 3QBTA 4DSNA 4TTPA 1GSIA 1MO3A 1NJFA 1SQ5A 2WSMA 1KDTA 2CNWA 3QG5A 3F3YA 2WWFA 1N5KA 2FOLA 3SYNA 4AKHA 3X1YA 2NQ2C 2V55B 2BVNA 3F8TA 2NPFA 2RB4A 4Q1AA 4P0TA 3A37A 2GEVA 4PSKA 1K5DA 4IDHA 2ZROA 1TQ4A 3CRRA 5FR2A 3LDAA 3QEJA 1KMQA 1Q1ZA 4MA4A 3ZZ0A 3ICEA 2QP9X 2ODEA 4XSHA 3BFKA 4QHYA 4NYJR 4S35A 3B1ZA 3AUYA 4YXWA 2XJ9A 2C8VA 3DOEA 1DBSA 3THYA 3SYLA 2Q3MA 4IVRA 1WE2A 3MGCA 2VF7A 3DVLA 2WJJA 3BRWD 3R9XA 1ELOA 5G3YA 2J87A 5LPNA 1UKEA 3CPHA 1X6VA 3KTAA 4B71A 1BYUA 4XSGA 4TQUS 3LRPA 5K8UA 4KJZA 1TQ6A 4BLRA 2EWVA 2Z83A 1P7CA 1E2PA 4JJKA 1N3BA 3PUXA 2ZSBA 2RCNA 4HLUC 1ZNWA 4QFMA 4KO8A 2IL1A 2I1QA 2QMUA 4NYJQ 4Q00A 4WIAA 3EIHA 3WYAA 2FJUA 4M8NE 5FOUA 5L3QB 2NMVA 2O52A 1RJ9A 2WOOA 2XZLA 4PHHA 2JEOA 1GP2A 1T0HB 3AKCA 4NP6A 2OT3B 4TMXA 3MRSA 421PA 2ZIAA 2WKPA 4WA7A 4RSGA 3MCAA 3EA0A 1HEIA 1XMIA 4IFEA 3IO5A 1KZ7B 2BJWA 5BYKA 1TMKA 2DFLA 1KI6B 3KQHA 1CBUA 2QT0A 3OESA 2OCBA 3EZ7A 4GNKA 1C9KA 4BFTA 2KJQA 3THXA 4RKEA 1R5BA 3RRNA 3EWAA 3ZIAA 2W6IA 4NCJA 2JLSA 2NO0A 3B9PA 3P1JA 3M6AA 1MOZA 5B57C 4IFBA 2P6RA 5CB6A 2J1LA 2JJ1A 1VTKA 4OK5A 3P20A 4DLTA 1R8QA 1EGAA 1OXUA 2WM9B 4RCYA 2GK7A 4KFTA 2YWEA 4F91B 2JLRA 3MG9A 1EWRA 3ASZA 1ZUHA 3AVQA 4M1KA 1Z0FA 2H92A 4YMWA 3QPUA 1LF0A 4BE7B 2QENA 4K8OA 4L5BA 2IBMA 3SN6A 5KNBA 1ZVQA 1JNYA 2ZVPX 3A1VA 3T5GA 1ZRHA 3FOZA 3LX5A 1Q44A 1Q12A 4HZUB 4MYCA 4OHVA 1W36D 3MMPA 2NO9A 3WRYC 1DAGA 2WWGA 3B82A 4LJ7A 1Z0DA 2Q9BA 5F9FA 4LHXA 2QBYB 4PAQA 4LYFA 2RMKA 1VHLA 3A4LA 5EXTA 4E07A 2A5FA 2R6FA 4JLDA 3IEUA 2UKDA 3SBDA 4QG7A 1UBFA 1SXJD 5E7JA 3T06B 4AC9A 3WY9A 4DUGA 1AA9A 2RGNA 4GRAA 4LHZA 1KO4A 521PA 3ECCA 1VKJA 2KB0A 3D8BA 4EFMA 4M4SA 1KKLA 4JSTA 1EESA 2XTNA 3U4QA 1N6KA 3Q72A 3JVVA 4Z8YA 1ZCBA 2ZU6A 1GTVA 1TF7A 5KSYA 2P5SA 1IXRC 2ZI6A 3TVTA 4UXHA 2ATXA 4OHWA 1AZSC 2AXPA 1BYIA 2B8TA 1N6PA 5DISB 2OLJA 2IUTA 4ZIRA 2WIAA 3QXSA 5E4FA 4MYHA 1G291 4IXNA 3R8FA 1IN5A 3GLFA 3K0FB 1OHHA 1R2QA 4D0GA 3PUYA 2AXNA 3A1TA 1N6RA 2AL7A 2C78A 3L82B 3KFXA 1ESMA 3X1WA 2DWOA 4DDUA 3UG7A 4OJQA 5SZIA 2OV2A 3L43A 1YRBA 1IHUA 1XP8A 5F3WB 2BM1A 3GLGA 1NVXQ 1II0A 4RFSA 4TTRA 2BJVA 2J0QA 1U8YA 2AN9A 1GDDA 1Z0AA 5ELXA 1DOAA 4YQFA 4TTQA 2ZJ2A 4TYNA 1I4TD 3BB4A 4LV6A 4DT1A 2HV8A 3DMNA 2SHKA 3MLEA 4Q9LA 3G5UA 3ZZUA 2REBA 3QKSA 4LPKA 1T0JB 4FN5A 1GM5A 1GWNA 2OXRA 3GEEA 4C0QC 4TMTA 3Q3JB 4RY2A 4PZLA 4PAOA 4C9BA 1CEEA 4QXAA 1DVRA 2HCJB 1N0WA 4U00A 1M34E 4E5UA 5CJ2A 4MGZR 3VU9B 1HYQA 3W5IA 1G5RA 4RFVA 4NYMR 3THOA 1E2HA 3VR4A 4JZKA 3MFYA 2QG6A 2VP0A 4HYYA 4JSYA 1J8MF 3T34A 2VSXA 2EFDB 4L16A 1JR3A 2RHDA 1Q1QA 5EP1A 3SJZA 1ZYUA 2ZI7A 1VCMA 2WJHA 3AKYA 2J45A 3W90A 2LKDA 3PEYA 4B6EA 4I1OA 4EPVA 1LF5A 2BKUA 1KY2A 2WBLC 4XWOA 2RAPA 5FPHA 3LAWA 4PPFA 2GBLC 2QL6A 3G0HA 4G5QA 2PMDA 2RGGA 1EK0A 1VECA 3GP8A 3C7KA 5J40A 1WDTA 2F9MA 4LHVA 2C98A 4JBYA 4BFZA 2RH5A 4Z1MD 1XWIA 1FMLA 4LX0A 2GJ9A 5LBIA 2J59A 1P2VA 4I4LA 2GETA 4PAMA 4LJYA 1E2GA 3QKTA 2VIIA 4X8HA 2FMXA 3O8RA 2X77A 1TF5A 2Q9AA 4Z54A 1D9ZA 3DMDA 1E2NA 1X86B 3B1VA 2H5EA 3DM5A 3CX6A 5J5CA 1KYIA 1XDBA 2J7PD 2KI5A 2PCLA 3GLIB 3TAHA 3DOFA 3QXJA 3ND9A 2GJAA 1GG2A 5CK5A 5EJEA 3TUJC 1KNXA 2BBSA 3A1WA 5FTNA 1G7TA 2BV3A 3FMPB 1UEJA 4LOAA 1R0ZA 2DPXA 4QBGB 4M9ZA 5L8VA 4ERNA 2RKOA 3HDTA 1G4UR 2BBTA 3T15A 1W4AA 1E2MA 4LJ8A 1NN5A 1OE0A 1W1WA 3CRVA 1T3HA 4PO8A 2OSBA 4JVLA 4NPHA 1QHSA 4I1VA 3PFIA 4MRSA 1V43A 1DARA 1E9EA 1F48A 3CW2A 3VR3A 2X1VA 1QHHA 2DYKA 1OH7A 1G8GA 1RYHA 3Q9LA 3S1AA 2G1KA 2QTVB 4H1UA 1G8YA 5DI3B 2QP4A 2CCGA 2XB2A 4UXIA 1E0SA 1J99A 1XTJA 2OEPA 2P0EA 3NIBA 3NH6A 5AJZA 1M74A 1W4BA 2CVFA 2VP2A 1C4OA 4NBSA 4BLOA 4M1YA 4NCHA 3U44B 2P6UA 1R4AA 1CR2A 3L8YA 3E5HA 1GL6A 1DG1G 4M22A 4C0BA 3TUZC 4G3XA 3IKJA 1NIPA 2NIPA 3OAAD 2WOJA 4LC0A 3X1XA 1NSFA 2CL6X 4CDGA 5H68A 1M2OB 4TLEA 3PITA 2KBEA 2PLRA 4M9QA 1OFHA 4DLZA 1FX0A 3K0CC 4XH9B 4PR0A 5JMTA 2REXB 1OB5A 2IS6A 5EE5B 4QGAA 4XIGS 4CW7A 3F5FA 1KSFX 2GJSA 2ZSFA 3FKSD 1U8ZA 1BH2A 3C4JA 2ZRIA 2NO1A 2F43A 1BS1A 3EASA 3VX3A 4B33A 3JVUA 4BECA 3SQWA 3SYKA 1M7GA 4Q9JA 2QU8A 3B85A 3H86A 3LVRE 2ZITA 1ZCAA 1H8HD 2W2VA 1L8QA 4A15A 5F9HA 2QEQA 4Q1CA 1EFRD 1SVKA 2C9OA 2MMGA 1U9IA 4B3XA 1SXJA 4DEXA 1WRBA 4CT5A 1Q3TA 3K70D 3TNFA 3I3SR 4Y0VA 3I5YA 4PXAA 1AGRA 4JJZA 2HJVA 4JYBA 3NBZC 3AVWA 3GLIE 2XZOA 1R7RA 3KKMA 1TEVA 2ODBA 3BC1A 3PG5A 4PSAA 3ZLJA 4OBEA 1NVVQ 2XITA 3RC8A 2ZRMA 3AB3A 5FUVA 2FNAA 3G82C 4KLNA 1Y63A 4XVRA 1UPTA 3PJRA 5F98A 4KLZA 4B2LA 1NP6A 2EW1A 1FTSA 4LBVA 4Q1DA 1S2MA 1OLOA 4F92B 2VH5R 3NC1C 2VO1A 1U94A 3KKOA 2FU5C 2RGDA 3H2YA 3EPLA 4KFUA 4P4SA 4Q4JA 1MH1A 3AGQA 3U7EB 5LB4A 1T91A 4HB0A 1VG1A 4UNPA 3C41J 4FMDB 5EQTA 5JCZA 1DPFA 2F1JA 3B2EA 3ZQ6A 1ZNYA 3GJ8A 2AK3A 2O8DB 3BS4A 2IW3A 1CXZA 4M9XA 3AVVA 2GILA 3LV8A 1P9RA 3RRMA 1TU4A 1PUIA 1N5JA 4ZCLA 2IX3A 5D3QA 1RFLA 1NN3A 1YR8A 4IHQA 2JLUA 3BWDD 1G21E 1WF3A 3P26A 1EXMA 3U3OA 1JQJC 3ZQJA 1A4RA 3LY5A 1KGDA 4WXRA 3U5ZB 2ZYUX 1XRJA 4POAA 5TB5A 1E4YA 2IXFA 4ZO4A 1NJGA 1QZXA 1HH4A 1OKKD 2H17A 2OE2A 3IIJA 3R20A 4KXFB 4JIMA 4MRPA 3DKVA 2C99A 5FUXA 2AWNA 3HPQA 2VRWA 5KPJA 3LQRA 4JLBA 2WWIA 2CMKA 2QROA 2PJZA 3UIEA 4AURA 4QKQA 2PZFA 3NXSA 4OK6A 1EFTA 1XBTA 2ZPTX 3BIFA 5G41A 5DYGA 1KK2A 4ESHA 3EWSA 3D7MA 3RLFA 1W4CA 2A5GA 2FSGA 5A5GA 4QHTA 2UVQA 3QNUA 2N46A 4B44A 1UADA 3AF1A 3SNHA 4M1TA 3KXLA 4JMPA 2YOFA 4Y0AA 3M1IA 4UKDA 1KTVA 2HJGA 4WXPA 4A2QA 1ZIPA 3FB4A 3NDPA 1MV5A 2ZS8A 1GILA 4GMDA 2FFBA 1Q20A 2OBLA 1XMVA 4LUCA 2YZ2A 1DAHA 5E95A 3SBEA 4ZDJA 4DLSA 5TDHA 2BIFA 3BERA 5HKKD 1F2TA 2IHYA 1QDEA 2WVJA 4Z1MA 4OQMA 4XTRA 4CYMA 4LJ4A 4P31A 4P32A 2YVUA 3VR5A 2ZQ5A 1TNDA 2IS1A 2ZRAA 1W48A 3NDBB 1JJVA 1IJEA 1E99A 1G17A 2GZHA 1RKBA 2VA8A 3DZ8A 4MKIA 4TWZA 4WAUA 1OH6A 4DLYA 1VG8A 4Q4HB 1G1MA 4WOPA 3GMTA 4X8LA 4BASA 4P33A 3KKNA 5FBQB 3HWSA 1E9SA 1XFAA 4JLMA 2J7PA 3SE0A 1Q0UA 3VTKA 2HF8A 5GADl 1W0JD 4L15A 1X8KA 1YZUA 1B0UA 3CF2A 5FL7D 3GLGB 5CLQA 1G3QA 4RFSB 1P2SA 4QGHA 1RPZA 1KI2A 1E98A 2ASEA 5SZKB 4JL6A 3M4YA 1YR9A 1RRFA 2AKYA 3K09C 3PQCA 3RSOA 3ZVMA 4DT1B 4BPBA 2IK8A 3AP3A 4IRUB 4TL8A 4EUNA 3QKSB 1ZD8A 1R5OA 2QP3A 2QRZA 3R7WB 2RGAA 4DJTA 2PMKA 3DO6A 1II8B 4CRWB 4JLKA 4RZ2A 4D2IA 1XCPA 1MO5A 1MABA 1KJYA 2V8OA 4N1AA 1NMYA 1O87A 1T8TA 3VR1A 1CIPA 5EZ6B 4AY2A 1CKEA 2FEOA 2R44A 3SJCA 1KMHB 2BMEA 5GVSA 1WP9A 4S2EA 3A6PC 4C7OA 4W5WA 3P4XA 1UDWA 4H9GA 4XWAA 4FWIB 3NWJA 4A8JA 1DG3A 1K5GA 1T5LA 5KDDA 1YZTA 3N2IA 1CR1A 5JLJA 1JECA 4LC1A 3MWKA 2QPAA 4IOKA 3KL4A 3K8YA 2OZEA 2C03A 2JASA 5FPSA 1PLJA 5KSOA 1IOZA 3OAAA 5EE1A 2PT5A 1LVGA 4DHEA 2JGNA 3QI2A 4LYAA 2FFAA 3NTUA 4YMVA 2WJGA 4U7DA 4MDFA 3I32A 4TMVA 4TMZA 3VMFA 1U98A 3BOSA 1SVWA 1G64A 1S4QA 2CL0X 2FZ4A 3GEIA 4HZIA 1OXTA 1P62B 3IIMA 1SKYB 1GNPA 4JVMA 1L2TA 3TLXA 3VX4A 4PTLA 2ZJZA 3FKSA 3I8SA 1W5SA 1G3UA 4NONA 1DELA 2BOVA 3QUSA 5JRJA 2IWHA 3CR8A 4KI0A 4NCIA 5KO2A 4IJMA 3QXHA 1E2KA 3U3KA 1H8HA 2BKEA 1NF3A 3T1OA 2QUZA 1H8ED 2YWHA 2CHVA 3B1WA 2HXYA 2DBYA 3TKLA 1EFRA 3HP1A 4N0EA 2WV9A 1E9RA 4RZXA 4HAWA 3MWLA 2GAAA 4KITB 3D6TB 1UAAA 2O8FA 3QEOA 1XNJA 1U2RA 3PV0A 4R71A 621PA 2FH5B 3HYTA 1CJUC 1IBRA 1XXHA 2HEIA 3THWB 4RCZA 4AG6A 1HV8A 1KK3A 1GKYA 2YKGA 1RRPA 5AWFC 4CEHB 2FSIA 1G8HA 4F93B 2GK6A 6Q21A 3CH4B 2ZR7A 5FI1B 2VSOA 3EAQA 3QVUA 5HZKA 1D2MA 1YRAA 3CF6R 4FCWA 4GT1A 2H57A 2EFCB 3MJRA 1ZNXA 3TSZA 1UFQA 2ZUBA 3S1AB 3FHTA 1XD2A 2PX0A 1DTSA 3CPJB 4F4IA 1E1QD 2WAXA 1Z0JA 1P72A 4D4JA 3TR5A 2Q9CA 1AS0A 1ZM7A 5EXPA 3U7HB 4TLAA 1G7SA 3BH7A 4JYCA 2RGXA 4JKIA 2YYZA 2NO7A 4OK3A 1ANKA 4LDJA 3HU1A 3LQQA 1TF2A 2YHSA 1LFDB 2QQEA 4BLQA 4B75A 2W58A 2J0UA 2IYWA 1CR0A 5J4LA 5KDLA 5FOXA 1QHXA 4ACAA 4BQSA 1OT3A 2HLDD 4Q66C 2GXSA 2VBCA 3IILA 3TQFA 1AQYA 2CLDX 3DDCA 4PPGA 1OKKA 1BO6A 3KX2A 3EPKA 3FTQA 1E2DA 2GVDC 1W47A 4BFWA 4TZ0A 1KO8A 2RGNC 3OEHD 4W9MC 4D0LB 2FGJA 3FPAA 4NE2A 2Z5FA 5D3MB 3AQ4A 1W36B 5FBRB 3FMIA 1Q1EA 4ZI3A 2UZ3A 2G3YA 4E22A 5HR5A 3HU2A 3W9YA 1SKYE 4DSUA 1YZNA 4PPQA 3ADBA 5B58C 5DNYB 1F2UB 3IIKA 4TYWA 1YZQA 5FOWA 1CR4A 2P2LA 2QE7D 3GJXC 4DC9A 2QY9A 2XXAB 2EFEB 2QAJA 1TL7C 1IY2A 2C2HA 2DHRA 1XB2A 2ZVQX 3ND8A 4JLPA 3W8RA 4JBXA 2ZI9A 4DRZA 1G8PA 4Q19A 4R7ZA 3UMSA 3K0AA 4BWYA 5FOTA 1QVRA 4IOJA 4BLSA 1NLYA 1Q22A 2BBOA 1AN0A 1XTRA 2O5VA 3QKRA 221PA 1ZJ6A 4CVNA 3B78A 2YOHA 5HKKA 1LW7A 4RD0A 4OHXA 3V9PA 2J3EA 2H8KA 2TMKA 4B47A 4EJSB 1AKYA 4LJAA 3LH5A 4IDNA 3ZZTA 3I72A 2H7VA 2XZPA 4JT2A 4TN1A 4A0FA 4QNMA 2D06A 2JCSA 2K5UA 5IT5A 1N6NA 1L4UA 2ZE6A 1DAMA 4CIDA 1US8B 4RD1A 4LBWA 2D4HA 4FCTA 4D81A 3AM1A 3NHAA 3KJGA 1E9AA 2IYUA 2PEZA 3VR2A 1VYVA 1W0JA 4ABYA 5FL7A 3AVUA 4LBZA 4YLGA 1CULC 2GA8A 3H4MA 2NGRA 1P2UA 2GAOA 3L0PA 1XEXB 2A2ZA 2ONJA 4DKXA 4LZZA 4P4TA 3QJYA 2XTZA 1SGWA 2WAYA 2R8RA 4Q01A 2ODWA 4CEJB 2BM0A 2PBRA 1UM8A 2EFHB 2GVZC 1SKQA 5AK0A 3OHMA 1U90A 3VKHA 1GFIA 5E7MA 3CRW1 5DLQC 1KSJA 2OCPA 2H1LA 4IOLA 5DN6D 1E9DA 2PT7A 2VEDA 4BRWA 4NCNA 4NL4H 3NC0C 5AUPB 3EPHA 3WP0A 1YZGA 2JA1A 2RGBA 3I8XA 2VQSA 2ZJ8A 1QHNA 3I1FA 4IOMA 1HT2E 2KBFA 2QNRA 1A2BA 2ORIA 4OI1A 3SR0A 2F9LA 1HA3A 4R2HA 5G40A 5BN3A 4AKEA 3TQCA 3V4RA 4LHWA 4V0MA 3M0EA 4QJ5A 1GNRA 5JS7A 1U81A 4IVPA 5IDVA 1M8PA 4U02A 4DBLC 2HUPA 4EAQA 4C4PA 4OQXA 1WMSA 3SQXA 2D7DA 1UKZA 2GJ8A 3ZD6A 1DO0A 5AUOB 4HLUA 4QOSA 721PA 2D2FA 3O8DA 2WMNB 1X8JA 2IYXA 1KHTA 4QL3A 5JEDA 2DB3A 3L8ZA 4A82A 1Z6AA 1JAHA 2JDID 1QHYA 1NKSA 1F2TB 1YZLA 2Z0MA 3ZS8A 5J4HA 1XPOA 3O8CA 4DCVA 4RD6A 4W5JA 2JLXA 3WRXC 1OYWA 2CHQA 4Q03A 3U3RA 3QXXA 3FHCB 1E0KA 1AM4D 1XCGB 1BKDR 5HCIA 3ZH9B 2V6IA 3T1TA 5AJYA 3SEAA 4K46A 4RVCA 2ERXA 2DWQA 2QTHA 4UXJA 2G1JA 4H1VA 3VFDA 4NTZA 4EFNA 1DAIA 1H8EA 1E2IA 3P4YA 4D6PA 5A0FA 2F55A 4QM7A 4FINA 1KO1A 1M6NA 2RGCA 1E2JA 1XEWX 3GEHA 3CX8A 1YHNA 4PPNA 1ZM3A 4R9UC 4X8MA 2IEYA 4TLDA 2NTYC 4A0HA 2Z4RA 4DVGA 4DLWA 2DY1A 2PZGA 3F0TA 2HYIC 2O8CA 1Z83A 2ZANA 3I4LA 1W49A 1WBDA 2QTFA 4B48A 1IY0A 1XZQA 2WZQA 1NIJA 4J0QA 2OILA 3DL0A 2WWHA 2G0NA 4II7A 1RW4A 1QVAA 1FW6A 3ASYA 4C2UA 1G16A 4DLVA 1JPNA 3LD9A 4KV9A 1AK2A 4DLRA 4KSCA 3LA6A 5CITA 5TV2A 1E1QA 4Q1FA 4PQYA 4NYMQ 5EE0A 1AS3A 2PEYA 3CKLA 4AYTA 3U60B 4CEIA 4Q9KA 4DIDA 2FDCA 2FEMA 1EFCA 1W46A 3W6OA 1I2DA 1RRGA 2PJRA 1MT0A 2GNOA 4A8JB 5L3SB 5AJWA 3KDSE 1RIFA 4WVFA 1ZM2A 3QENA 5KSPA 1TAGA 1JR6A 5EXSA 1VG9B 2ZRBA 2IYLD 2R62A 3B8HA 4JL5A 4DSTA 1COWD 1NG1A 5TXGA 1KJWA 3N70A 4PQRA 4US0R 5FPYA 3PUZA 3WNBA 5JRZA 1W36C 1HE8B 2HLDA 4ZDWA 2FG5A 2W00A 2O8EA 1IM2A 2YWFA 2ZRDA 3N5CA 3JZMA 3RHFA 4UJ5A 2FF7A 1XJCA 2HXSA 3UANA 1TX4B 1U8AA 4KFSA 3I5XA 3FMOB 1P60A 3LWNA 3BGWA 3MAAC 5EP3A 4ARZA 3W6NA 3QPWA 2QN6A 2PL3A 1SXJC 2OFWA 1KSHA 4B2PA 4WBSA 1NI3A 3OEHA 2FPMA 4BEJA 3CNOA 3AGPA 4Q4AB 3T35A 3RAPR 3EZ9A 3A8TA 1J90A 1CJKC 4QBFA 3T5DA 4LCBA 3FHOA 2ZTSA 4MKHA 1S9DA 2YV5A 5B64A 3QBVA 5KNCA 5AUQA 2B21A 4EJSC 1OIVA 2IXEA 5HZHA 2QE7A 2D3WA 1N25A 4V0OA 4URUR 1ZUIA 5DHAA 1T4GA 3BB1A 3KXKA 4QRHA 1FNNA 1PLKA 3AUXA 3NBFA 3EIEA 2Z43A 3LBNA 1I4DD 3I92A 1R8SA 1NBME 5SZJA 3H1TA 2ZE7A 2NO6A 3GLHB 1A1VA 4PX9A 3V4FA 4QM6A 121PA 2IS2A 2ZJOA 4TQ9A 2GCOB 4GZMA 1LTQA 2O8BA 1G41A 2GEDA 1RVDA 4KYUA 2XX3A 5KTYA 2BMDA 5CDFE 4DIEA 3GJ3A 4FMCB 4C0KA 2IWRA 2C95A 1EX6A 4TT3D 4GDFA 3TGPA 1QBKC 5DHFA 1KK1A 1PZNA 2ODNA 2VLIA 2CCKA 3OF5A 4I99A 3ZJYA 1NSTA 5EP4A 2ZSAA 4LV8B 4D4KA 4LI0A 1WA5A 3B13B 3WMFA 1OXVA 4FI3C 2ATVA 2O0JA 5BN4A 4HAUA 2PCJA 4DCUA 4JL8A 3REFA 1XF9A 1ZD9A 2X2EA 3SZRA 4UNRA 2IC5A 1A2KC 1E2LA 2GJKA 5FPTA 2OFXA 2VHJA 3AV0B 4BRUA 2GBLA 2BBWA 4HDOB 2EYQA 3AF2A 1R0YA 2J41A 3WYGA 3B6EA 1QG2A 4P4UA 3HR8A 1KI4A 4YC7A 3CX7A 4M1MA 1DO2A 3THYB 1X1SA 5IRCD 2EFGA 1NY5A 1NN1A 1XEFA 2QAGA 3B9QA 4KYIB 5KDOA 3HPRA 1Z0IA 4MKGA 1D6JA 2VF8A 3BAFA 4O3MA 4JLVA 4TSFD 1RE0A 3TR0A 4XVUA 3KJIA 4LJ5A 4E03A 2C04A 1NG9A 1ZINA 4NH0A 5DN6A 3KTAB 4XOIA 5TY0A 2E1RA 3C16C 3AVYA 2ZS7A 3K9GA 3TBKA 1T3SA 4OQLA 2XEXA 4BZQA 5J4YA 4WZAE 1D5CA 2NOAA 1Z3IX 1TEXA 1SVOA 1BIFA 2CJWA 3CIOA 3ZVLA 4PHTA 5GJWC 3CH5A 4QC2A 3RC3A 4B3CA 4CF7A 1YKSA 5CYOA 3WMGA 1FMJA 1GIAA 1M1YE 1RJ9B 2AHOA 2GWHA 3LX8A 3OE7D 4E09A 5JHHB 4KSBA 5KUTA 4C0HA 2GZDA 5IHPA 1G5PA 1QRAA 1U99A 2F3RA 3P32A 3KQUA 2XGJA 4GFDA 4YMSA 4Q7LA 3X2SA 1KI6A 4B74A 3I62A 2VHCA 2R6CA 4FWTA 2WWXA 3A4MA 4HB3A 5FBWB 2JDIA 1KDRA 1KAOA 3THXB 3NBXX 3SU8A 2AX4A 2V3CC 1UKYA 4US2R 1KDPA 1R0XA 3RWOA 4URXR 2PLFA 1LY1A 1SHZA 1FPMA 3KUCA 2FFHA 3GLHE 1JALA 4DLXA 2XOKD 5B30A 2FGKA 1EX7A 3BFXA 1FL9A 3L0OA 4IEEA 3EG5A 1FUUA 3ADKA 3IQXA 3Q5DA 4HB4A 1G8FA 3FVQA 4F38A 4GPTA 2QPTA 4N0DA 1VCNA 1D2NA 1U0HC 4OYHA 4ZKDA 5JBQA 1OV4A 2E9SA 3LBIA 4RZUA 1FTNA 3AP2A 2ANCA 3T61A 1UF9A 4HZUA 4YMUA 1RRCA 2L0XA 4B3GA 2GTPA 5BXQC 2QMEA 1S3SA 3KJEA 5L3VA 4V03A 3K0CA 1A82A 1GVNB 2XB4A 2DFNA 1D8TA 1Q21A 1TQ2A 2QBYA 2FFQA 3VHLB 1F6BA 5AR1A 1J70A 2GRJA 5KOYA 2YOGA 2IYRA 1MRNA 2W2TA 1OH8A 3U6KA 4A8JC 1T3LA 2FZLA 4ACBA 2JLWA 2LWIA 3QF4A 2BWJA 5JI2E 8OHMA 2AD5A 2OBMA 4LJ6A 3SHWA 2ZJBA 2OM2A 3A1UA 1II9A 3U4QB 2QGZA 3CF0A 4NDZA 4A9AA 3DEFA 4HATA 3TAUA 2GZAA 3KQLA 1F5NA 3EC2A 2PX3A 1Z2AA 4Q4LA 1ONBA 4PC2A 4ZCIA 1AIPA 1Z6TA 1QF9A 1N5LA 4ZIRB 3OIVA 3I73A 1VG0B 3IBGA 3LXXA 3CRMA 3FE2A 2A7QA 4FD2A 4R98A 3ETLA 3IBYA 3GLFB 1COWA 4MUAA 2FSFA 2IUSA 5CJPA 3CZPA 2P67A 4JLOA 1VMAA 4V0LA 3CWZA 1S96A 1S9HA 4PHGA 3WNDA 2P6NA 4ZI2A 3DHWC 4IDOA 1CP2A 3U2QA 1PLLA 4IVQA 3OIYA 4JLAA 2CXXA 3BE4A 1AKEA 3Q7PA 3K70C 2ORVA 1PUJA 3HU3A 4TL9A 1B23P 4QJ3A 4TYQA 2ZRJA 1GOTA 3QVVA 2KE5A 1XTSA 4US1R 5K8LA 1HQYE 3AVPA 2ZAMA 2IYZA 3KXIA 1E2EA 4AWXA 1D2EA 1Z63A 2ZXUA 2JJ8A 2CE2X 3CNLA 3VU9A 2CDNA 2DCUA 3BORA 4GP7A 4A2WA 2VHUA 4LJ9A 5HTKA 3EZFA 1G7RA 3DPUA 4DZZA 1Q57A 4LK2A 2WMOB 2OUKA 3K0EA 2A5JA 2GCNA 1YE8A 2QM8A 3CLVA 3SFVA 1OW3B 2OBNA 4GOXA 4DEYA 1Z6GA 2EYUA 2ORWA 2VP9A 2EQBA 2O0HA 2OCYC 2HF9A 2IS4A 2WIBA 2OO7A 4GI7A 1ZMXA 2AK2A 1UJ2A 5H1YA 3QPVA 2BDTA 2B8WA 1NKTA 1CRQA 1KDOA 3OFND 4C30A 4AIIA 2R6GA 2JLZA 4TT3A 4XD7D 3GD7A 5GJCA 2N1BA 3QXCA 3DM9B 1XJ0A 4GBMA 3RS0A 3N2EA 4L9SA 3W6PA 5FL3A 1VDZA 4NU0A 2BEKA 1GKIA 3EW9A 2Q0HA 4TZ6A 2IUUA 3X1ZA 4BFVA 1FQKA 1P4SA 4DCSA 1Z47A 1TUIA 2ZE8A 1ZU5A 4R2IA 4Z51A 3BH0A 2A5YB 1TTTA 1JI0A 2QT1A 5FOVA 1E0JA 1FQJA 1OHHD 2YJTD 4OKSA 4PHFA 3IUYA 1Z07A 4B3BA 4YDSA 2R2AA 3PCRB 2IF0A 3SS8A 5DO9A 2OAQ1 1S3GA 1IAQA 1SVLA 2XNSA 3GLIA 4G01B 4QGGA 2VP4A 1XPUA 2FPLA 3GLFE 4TSFA 3FDIA 3H0KA 2I1VB 1M7HA 1S0UA 4KCGA 4MRRA 3WNCA 2FN4A 4M9SA 2WJVA 4NYIR 4PO1A 3A4NA 4X8OA 3L2OB 4WW0A 3ZGXA 2A78A 4BLPA 3QE0A 5LD2B 3AEZA 3TJZA 3LBHA 2C96A 3AF3A 4Q18A 4EPWA 2H18A 3GLGE 3QG1A 2OXCA 4KODA 2ZRPA 2F1RA 2IHBA 2BMFA 1E9CA 1ZM9A 2CEAA 2JIZD 3IPYA 1ESNA 5FTJA 3VNVA 3MWJA 4KBGA 1G19A 1QHHB 1YVDA 1E94E 3VKGA 3OE7A 1R10A 1LB1B 2ZRCA 4M1OA 2IXGA 3GPLA 2QMOA 3REGA 3W5JA 1GL7A 1S8FA 3RWMB 1VHTA 4PZYA 4TYPA 1W2GA 4NYIQ 1Z22A 1NLFA 3C14C 4Q02A 3SDZA 3WP1B 3ADCA 4M53A 4XTCS 4BFXA 2WWYA 2F6RA 1Z6YA 3U44A 4YDHB 4C2TA 3EC1A 1T5IA 4LGMA 4PFSA 1ZC4A 5CK4A 4RZ3A 2HYDA 5FI0B 3BXZA 4CZ2A 3GFPA 1I2MA 1X8LA 1JQLB 4AYWA 2B92A 2F7SA 1JR3E 3QIAA 1NLZA 2XOKA 5KNDA 5JFGA 1WQ1R 3WXMA 3KZ1E 1KIMA 2F3TA 4PC1A 4G5GA 3O47A 3PENA 4XWKA 5DYIA 4LWZA 1D9XA 2Z4SA 3I61A 1NMZA 1FX0B 3TVDA 3T1VA 2I4IA 3EXAA 1OFTA
chains in the Genus database with same CATH superfamily
4DUPA 2OG2A 4B3IA 1I36A 5TPZD 4XLLA 2C9DA 4AZ3A 4DV2B 4A6XA 1U3GA 1U0NA 3LLUA 4GI3A 4BQEA 1BS9A 1SZCA 3GJ5A 3U4DA 4GKKB 4M0PA 1X9IA 5JT1A 2BFEA 4YAOA 5I5EA 2TMDA 3H1PA 3LKDA 1X14A 5JWOA 1VSBA 4I5FA 4IQGA 1WM1A 4ECAA 2DSNA 4WACA 2F43B 3HGTA 3I64A 3OTOB 1YDGA 3NYIA 5P21A 3LTNC 4JZYA 2KPOA 4LSGA 5J58A 2ACEA 1JB1A 4O5OA 1VKOA 2GM5A 3QUQA 3TM5A 2AR7A 3CUWA 2IUYA 1NR1A 3L05A 2UU9B 4RF3A 1Q5PA 1YACA 4J0CA 10MHA 2D0DA 3UK6A 4YMTA 1KOFA 3H0EA 1E9BA 4JJ4A 3PYMA 4X00A 2C2YA 4AFNA 4I1RA 1ZM4A 5IKXA 4IS2A 5JAIA 2H2AA 4OVKA 3C97A 5CFLA 5KPDA 1NI4A 1XLUA 2FX3A 4BUJA 1E1RD 1XQVA 1SG9A 4Q93A 2V1XA 2ZPUA 4D82A 1ETHA 1UQTA 3ZHQA 3WYFA 2X5KO 4XCVA 1M75A 4XB6B 2AH5A 1YR3A 2A9QA 3ANYB 1YCGA 2XUKA 3K1ZA 4IFIA 1Y8AA 4XLZA 5ISMA 3D4NA 2Y0BA 4K87A 3EY9A 4UVHA 5K2MA 4EMUA 3N0TA 2YQZA 1H23A 3UXMA 3V5NA 4EH1A 5JUWA 1Q0QA 3ZCPA 3KU1A 4PN3A 3EEFA 2ZK7A 2QI9C 1EXDA 2WD8A 3L49A 3UPTA 1BD4A 4R0MA 3DLHA 1B3BA 1GY8A 1YBHA 2OV1A 2OFOA 4HH0A 4L6IA 3RVPA 2EG9A 3ZVRA 4CE6A 1CZHA 2Z2XA 4CM1A 2G6TA 1BXKA 3COZA 4P4SB 2JAUA 3L0SA 1RQNA 5C81A 1Y8RB 2A0WA 2QMHA 3GRPA 4EA6A 1SXPA 3GEMA 2C61A 4IZ6A 4F1WA 3NIWA 2Q5EA 4P53A 2JGLA 5REQB 3ZYCA 1ZBDA 4ZQBA 4D79A 1V9SA 4UMEA 5SZHB 2QL7A 4XGIA 4A4DA 3GEPA 4KQ6A 4R1NA 2O8DA 1UIMA 4UNSA 3VAAA 5JNSA 3L0BA 5GVRA 2E4XA 2Q9UA 4XX0A 4DCUA 1J2RA 2HBYA 5CAEB 1AXRA 1UXOA 2CY0A 2UUCB 2BHSA 1I0IA 1KBQA 4WCDA 3IJ5A 2C9CA 2V0CA 4WHMA 1ZCZA 5FORA 1BGWA 2W0SA 4S0ZA 4D8YA 2CV0A 3U61B 4WERA 3IP5A 4JWTA 3GDWA 4IF4A 2FR8A 2EGHA 3O73A 1L5KA 5FO1A 3RS4A 1YVRA 1RACA 3AESA 1DJQA 2ZE5A 4NENB 4P4NA 4GMGA 2VWHA 2RFLA 1FFCA 3IEKA 2AG6A 4NKRA 1IJBA 3OZDA 3OFJA 1E1CB 1DEAA 3RFFA 5KNLA 2CL7X 1KJZA 1GLGA 1NQXA 4X9XA 3WOHA 5CA0F 2ZRFA 1PGNA 4WASA 1CZNA 1I3LA 1Z5GA 1EWVA 2DZDA 3EZ2A 3FPGA 3G88A 3LA8A 4GSYA 4KVAA 5H83A 3WJ2A 4DLLA 3GT7A 4FR5A 4ASUD 4BNMA 1XZIA 1JDPA 4RD3A 1QGZA 1TM5E 2RHMA 2ZT8A 1YFKA 4GP6A 1QHGA 3KQNA 2BEVB 4L9RA 3ILYA 2BGIA 1SZPA 3EH2A 4I1UA 3WGZA 2BCEA 1Q83A 5EINA 2HM7A 3IJPA 5GJVC 2XF2A 1LTHR 1KZ6A 1P9LA 2G4LA 2WB4A 3QOWA 5C31A 4B31A 2GM4A 3LF2A 3EK2A 3I2IA 1IWBB 2E48A 5I51A 4LXHA 2GF9A 3HWRA 4XXHA 4YI5A 5B53A 3HB7A 5MFZA 2RSLA 4MVJA 5FHRA 1U7ZA 1AHPA 3W4JA 5CIQA 3VSEA 1DHTA 3RU9A 4H17A 3ZGVA 2H63A 5HCUA 3F4LA 3OFNA 2ZCVA 5F2EA 1XMJA 1TADA 4XD7A 2Y68A 5HIKA 1WCIB 5BOSA 3CZ9A 2QVBA 4NV0A 5JSFA 1PGJA 3I42A 5C4GB 1JA1A 2AZ4A 3SC2B 3RC9A 2XQGA 1SXJE 4EIWA 1RWOA 3VPBA 3PQDA 2K87A 3PF8A 2PGJA 2D5CA 2D54A 1GTL1 1SULA 2Y71A 2ZETA 1PJSA 3KSRA 3M6IA 3DEJA 4KNVA 4C6SA 4L9WA 3N8HA 4X3OA 4OP1A 3Q9NA 1DNPA 3T1YB 1J21A 1MLDA 1G6KA 1QWOA 2FMIA 3O4JA 3PI7A 1CU1A 1WHSA 2A9KA 4CM9D 5ICMA 1PV4A 3FYSA 4O2AA 3GJ6A 5HPYB 1G3RA 4Q4HA 3L7AA 4BNUA 4HX5A 2JRLA 3B2NA 4YCSA 3N2YA 2AKAB 3R2JA 4DSAA 9GPBA 4QXPA 2PRZA 2YW2A 1ADBA 2COUA 4NBUA 1EWQA 3W0LB 1PZMA 3FWYA 3FUCA 3KZOA 4IDPA 2WTAA 3RIYA 1W7AA 3RRZA 1GZSA 1ZMBA 1ARZA 3STVA 5FTLA 2Y93A 4PG8A 3IODA 4QYIB 1IFXA 2DT8A 3LXRA 1A96A 5JSYA 1USKA 3CVUA 4IIVA 2ZWOA 2QD5A 3Q85A 3GZ4A 3BWMA 3AILA 3M82A 4GOJA 4LMAA 1DWPA 3DONA 5ALWA 3UQZA 4MHSA 2XWPA 3TDNA 2H59A 4P7FA 4CMIA 3AFIA 5K8IA 2RGRA 4YCCA 4FFLA 1K6JA 1ZP6A 4JKOA 2FWRA 5K0JA 2YJ5A 2CUTA 4M0DA 3HCFA 2O4CA 3U31A 5HG0A 3R0XA 4TM8A 3D6FA 4QGFA 3A4TA 4U4AA 2ANBA 1YK0A 4G81A 4AX8A 5JBNA 4P5EA 3KV1A 3T3MB 2KWIA 3ZNOA 3I9OA 4OREX 4IGEA 3ITDA 2O23A 1YJ5A 3UAXA 1MABB 1KMMA 1LZKA 1RAFA 1WSDA 4QU0A 1GNQA 1YI1A 1LLDA 4Z0NA 2XCOA 1T26A 1E69A 1XI2A 2FA9A 4X91A 2E5LB 4A36A 1KMHA 1P81A 3IUJA 2PUWA 3OLQA 4AZTA 4JI2B 5FADA 1V6AA 5FJJA 3G59A 4MINA 2ZBEA 3RJMA 3BA6A 1AGXA 4HCJA 2Z3VA 1AA6A 3AR3A 1JEEA 1TGVA 1CUIA 4AJ2A 3M9LA 4F21A 3OEYA 2IYSA 1E2QA 5EAIA 5LMUB 2IIPA 4KTTE 4URVR 3PNKA 5K3DA 4DA8A 3LUAA 3C4VA 2Q6IA 4IKPA 2VSNA 4FW9A 1ECCA 4HH3C 1X7YB 3CJTA 5LDGA 5FH9A 1JSRA 1Y82A 5B1SA 2YJ6A 1RT9A 4P35A 2H1CA 1HDZA 1KYWA 1UAYA 1A0OA 4MO9A 4ZVSA 4O29A 4D80A 2UV8A 3T4UA 2PX5A 2ZEJA 3X0DA 1DAFA 5LQKA 4AMUA 2FR1A 5EP2A 5AM4A 5C4MA 4FE3A 5C37A 2ZRLA 4QJ4A 2VJLA 4JEIA 1GPUA 1K7YA 5EY5B 1G4AE 3QE4A 5EIBD 4GL2A 1F0NA 3QKIA 2WB2A 1U8UA 2CDBA 1FIUA 1YU9A 1DHRA 2GO1A 4XRRA 5TPZA 1KQ3A 3SEZA 2HSGA 1M33A 1P31A 4M0CA 2R97A 1L5FA 1U0OC 5C5CA 3IDQA 1ZIYA 5LUAA 1GZUA 1Z4PX 2ZR9A 1AKRA 5K4AA 2I3ZA 3WHKA 2W0MA 3FF4A 4K9PA 5BY2A 4TV8A 5JS1A 4LZJA 4JR2A 2PTGA 4F6LA 1NV9A 2OXFA 1P8AA 1QRDA 2QJOA 3K2BA 3D02A 4CGZA 1W6UA 1W6RA 1CRPA 3WK8A 2JCBA 4ZYYA 4C89A 3F7MA 1IXKA 1IUNA 1XCMA 4ZQHA 9MHTA 3AOEC 4D4HA 1PJZA 1SR8A 3GJ7A 4IJ5A 5IH7A 4BZXA 4L9AA 5AFSA 1JT2A 5C46F 5JQWA 2IYYA 3MRVA 1EGHA 1E1RA 3GJRA 2MJLA 2C3OA 3NUQA 3T0FA 3OI7A 2ONKA 3FWKA 5DHUA 2IUEA 4DAEA 4DGSA 1CG6A 1A9YA 1PSWA 1ID1A 3H2IA 4KBFA 5TQVA 3TFQA 3TN7A 1BQ4A 1UBKS 4AZSA 3JYOA 2D7JA 4O1MA 5C0OE 4EDFA 1DIOB 2Q3LA 2NUPB 3OMLA 4OIMA 3RGGA 4CEHA 4WINA 1GHTA 1LI5A 1SH7A 2PRIA 2XR1A 3NEPX 3CZAA 5K8TA 1P7YA 4AJOA 2RE8A 2V9ZA 3VRHA 3NMUF 1T5BA 2L18A 3FPJA 1T9ZA 2ZJ6A 4FJ2A 4Z9FA 5AHXA 3RD5A 4PONA 2GS9A 1YVEI 1E5TA 3AVOA 3KQSA 4NE9A 5COAA 3ZKAA 1IG3A 4GICA 4MGIR 4YY3B 1MO2A 1RADA 1YS6A 1SBYA 1UT6A 1ZJYA 2P65A 4MAFA 4QULA 4EB6B 1AK1A 2Q8NA 2CHGA 1T8YA 2BLNA 3P45A 3LWZA 4B74A 3ILHA 1GA6A 1Y6GA 3RJTA 3ZD7A 3BRCA 3CEAA 1MU0A 4R31A 3V7NA 1NW3A 3CLUC 5GOZA 2N42A 4Q47A 3SHTA 3QSGA 3SDBA 3G1WA 1XVUA 3M89A 1UC8A 4LSWA 3EA4A 3KB2A 4RKFA 4ZCSA 4PZZA 1NJ8A 1P2TA 4PW0A 2IITA 2P2NA 4LXGA 1UP6A 3W2IA 4WLFA 1JQEA 4NECA 1N9KA 4N3AA 4URHA 4BMSA 2IXBA 2P0YA 1Y4SA 1XD9A 5CDGA 3KCNA 2J0UB 3BMCB 3IOYA 4F4FA 2R8ZA 3A27A 3DHYA 1IN6A 4FBMA 2HWYA 5A4AA 1HDXA 1BEEA 1NR7A 3JPWA 4PX3A 1GPLA 1L3CA 1MP0A 3EF0A 2YUTA 5IC4A 2FZCA 1BGVA 5JW6A 4PZ9A 2ZBFA 1NWHA 3RIGA 4D9KA 2EU8A 3EOAI 3UGKA 1FZQA 4QNRA 1NVVR 4ASUA 3D43A 4AJKA 3W9UA 3ESQA 4HXYA 5CLIA 4G5OA 2DC1A 1HE1C 3FGNA 3IGFA 4L76A 3ZQUA 1Z75A 4QATA 5D3MA 3CYFA 2TMYA 1EFVA 1YAJA 5T8KC 3RF7A 2DU8A 3RTDA 2BFCA 2G0AA 4H60A 3TIGA 4KU4A 2OYRA 4CBVA 1Y0BA 2VL7A 3ET4A 3KPUA 2W5UA 3CONA 4CL2A 3PVSA 4O4HF 1F2UA 1V41E 4L8YA 5TVKA 3EMVA 1N2OA 3U3MA 3HABA 2QLBA 2B1JA 3IS3A 3RIEA 5FAXA 2B4KA 4ZJZA 5DHQA 2XXAA 4Q1VA 2MYUA 4YI3A 1DDOA 2A84A 2OENG 3Q0IA 1FJXA 5FNVA 2WI8A 4P3YA 3N86A 3CXRA 1KSGA 4O25A 2G9NA 1I01A 5DX0A 5CBPA 1NMSA 3C3WA 1J5EB 2JH9A 3IR5A 4RMHA 1A71A 3FETA 4FFMA 3GT3A 1PWXA 3ENNA 2VRNA 3CG0A 4L02A 4LHYA 4KJXA 3T0GA 4EJSA 5J2TF 4W82A 4P98A 1G8AA 1P6XA 4CXMA 3W3AD 4MRMB 1ECFA 1U0LA 3GRRA 3T94A 5JZOA 1GYPA 3NPMA 1K8RA 3RE1A 3VNBA 4PLVA 4CM9A 1V5EA 4N8EA 2JLYA 3D8RA 4QDXA 4PC7A 1JIUA 4EFDA 1WUYA 4FFBB 4IIFA 2UAGA 3FDXA 5IJXA 3K53A 3JSXA 4NJEA 4P3KA 4PINA 3RQSA 2CNWD 2OAP1 2HQBA 3ZN2A 4N0PA 4A0RA 4H18A 5CEFA 4FMBB 5IANA 4P58A 4I08A 4OI4A 2XTJA 4G5SA 3GRZA 1QG4A 5KEIA 3A3YA 3I12A 1SHKA 1SVSA 3UW1A 5KKNB 1Y4ZA 2ZIVB 4DCOA 5G2OA 3W34A 1XK7A 2CLSA 2Z9CA 3SCZA 1KP3A 1TU3A 4OEHA 2AE2A 3T6KA 5ILGA 4J3NA 5A4JA 3FCOA 2QD3A 3B1KA 2HPVA 1EFHA 2GD6A 3DSRA 5KYKA 1V3QE 1OVMA 3ONWA 4D7AA 2QTAA 4BWFB 2Y77A 5T57A 4RSHA 3WLKX 3H1GA 1QFJA 2B7CA 1LGYA 3GP5A 4GKVA 4Z4IA 5H82A 5KTNA 1S2LA 3R09A 5IMBA 4BVLA 3QFCA 2H8GA 4ZYTA 1HL3A 3EC7A 3JYLA 4EPTA 4KR7A 3ZHZA 2WWWA 4D26A 3CKMA 3JD2A 2I99A 5KNBH 1T0BA 5CB8A 1N5IA 5JSUA 4ZVUA 3TRJA 8LDHA 4KXLA 1PSDA 3P0IA 1H2HA 3HNOA 1VL0A 1IQPA 1J0CA 2FZGA 2QV0A 2RCYA 5AXAA 1GCOA 5FOSA 1S8OA 1E6CA 1VCIA 2VNSA 3QOFA 4N6OA 3TLMA 4EEKA 4CKWA 3A11A 4ZVVA 3UG6A 2WHPB 3BB3A 2XVAA 3ZDQA 1G2QA 1AKWA 3K1JA 2DUWA 1UBGA 2DBQA 3E84A 4UBIA 1STOA 1V2HE 2PSHA 4YBZA 4Z9AA 3UKJA 2ZRKA 1CYDA 2QLJA 2BZGA 3WA6A 1MH9A 4FMCF 3CLRC 4M1WA 2DWPA 5ARDA 1OAKA 1G5FA 2BP7B 2AEJA 3K6JA 4JX9A 5EZ5A 5T4BA 3Q9SA 2VQEB 1XRNA 2XNJA 4LOJA 3UENA 1I1OA 3SYMA 4EK9A 1EZ4A 2YIMA 3QJGA 3V1LA 4PLWA 2P35A 1P0CA 4EGJA 4X1YA 4V0NA 3E7FA 4DXAA 5HF8A 3C87A 1ISGA 1F9EA 2DLDA 3ETHA 5DHSA 1Z08A 4MYTA 2AD1A 2W6ID 4D43A 2IF2A 4S1TA 1QH0A 1GTG1 1NUQA 3GMIA 4JLJA 4MX8A 1RI2A 4G8BA 1U2DA 2P9YA 2CV2A 4Q7MB 1QC5A 3HR7A 4N9QA 5EMLA 5A62A 1YQTA 2JGFA 4MR7A 3ZLVA 3HKBB 1IY1A 2YV3A 2ZJAA 3Q3VA 4RVUA 1V25A 1RRVA 1O54A 1YJXA 3FVWA 3K9BA 3OZBA 4IHJF 4RGBA 2QJRA 3QVJA 4IQ4A 5JNRA 3DDWA 1WCV1 3MTEA 2PS0A 3GPDG 5AVJA 1G18A 5LP6C 2F64A 1A97A 4E2FA 4AVYA 3S2YA 3CZ5A 2G0TA 3LO5A 2R6AA 3U7QB 4TVBA 4BO4A 3L6DA 2PM8A 5CLLA 3ZW7A 4DJAA 5IT9A 3CS3A 3OPVA 4PZUA 4NDNE 1W52X 4MITA 5KNBD 3BFJA 3T1QA 1QDLB 1YHYA 2FEKA 4YRLA 3OSUA 2C00A 5KYXA 4EQ6B 1COZA 1E62A 2IPNA 4UHFA 3TRIA 1DFGA 2QZZA 3L46A 2AFHE 5DW0A 3GFTA 1WKBA 3BMNA 1WBBA 1BJKA 3BPSA 1ULHA 3P2JA 3W8EA 2PUAA 4KBYA 3LFUA 1BVRA 3SJBA 3WFZA 3NP7A 2VJPA 2O8CB 1Q16A 1XZPA 1SRRA 1UKAA 1DL5A 2RK6A 2XGGA 4L7VA 3D0QA 3OCCA 3LIIA 4XJXA 1JFVA 3AP1A 4WLVA 4BFCA 4COKA 3EISA 4Y2GA 1CJMA 3C39A 2GERA 4IX9A 4RHYA 4FCVA 1VA4A 1NURA 4MJ7A 1PEDA 1A9QA 1Y5IA 1KBOA 2JFBA 3FCAA 3CY6A 3M6LA 4GQAA 4MH0R 1OF1A 1AQNA 2VC2B 3KWLA 2ID4A 4C4YA 1BQEA 3BSFA 5TEVA 5F4BA 1N6LA 2E6UX 2X9VA 4GM1A 4C3ZA 4UD6A 4BMPB 5KX5A 4KVGA 4U2DA 1Z0KA 3PSAA 5HGJA 3EYWA 4XFDA 1Z06A 2GF0A 3BTVA 1N7IA 3TTSA 4U9IS 4R6XA 1L7VC 3DT6A 3MCUA 3PYXA 3JQDA 3OQBA 2ZM5A 4BX9A 1RWQA 1FLNA 2HY7A 4JUFA 2YC2C 1SVMA 1NXXA 4DLUA 3DP7A 3HK2A 3FUVA 3C8DA 5JH7A 2FFJA 3EXG1 1W35A 2H4HA 4FXPA 3FN4A 3PJEA 2GPYA 1P7PA 4V0ME 1C81A 2IT1A 4EUEA 1XCBA 3IO3A 2O8EB 2HF2A 2QTNA 4I36A 1TA4A 4V39A 1FFXB 2AW3A 2AZXA 4D9IA 3G9ZA 1EE9A 1U1EA 2CLIB 4MIOA 3OD5A 3PC8A 1TKCA 1IYZA 2R1UA 2V54A 4G9EA 1JFRA 3OQHA 4PSVA 3RS7A 4ARZB 3IEVA 2F1IA 3KCQA 4RJLA 3D8UA 4TKLA 3NW9A 4KO2S 4NY1A 2ZSEA 1L7MA 1GRQA 1ZQ1A 3MJHA 4BFSA 2I5PO 1UPFA 1E3WA 2XAUA 3E23A 3UGTA 3P19A 4Z99A 2QPOA 3GDFA 2HSZA 4N76A 4LBYA 3W5SA 1U4SA 2GI4A 4M98A 1AKTA 1KEEB 3IOCA 4WOJA 2R751 3TECE 1V35A 1X74A 4OB6A 4YP5A 1P7WA 5BR8B 2D5LA 2PLAA 5C1PA 1MB9A 3N05A 4DW8A 1LH0A 4LPSA 4EHIA 4G1MB 4CQLA 1X1TA 1GPMA 3UYLA 1FP4A 3NUGA 3B60A 3EJ6A 1YB5A 3D4IA 3ZY6A 4BO6A 4I5IA 3L6OO 3ZCUA 3A9SA 3HDQA 3IDFA 3ECAA 3Q8XB 1HYHA 3W78A 2V4MA 3MJSA 2DTDA 4J75A 1JR3D 3GLHA 2R9VA 3M6MD 5GZ6A 4GM4A 4JJIA 1TMYA 3NRBA 5LBTA 1JPUA 3FUWA 1NASA 3G17A 3BD7A 3VUEA 3DVRX 3W3AA 2NSLA 2KSQA 1R0WA 1EXVA 2FKNA 2AOUB 2RHWA 4LHSA 4EKDA 1H65A 4L78A 5AJXA 4LFAB 1XHFA 4MRVA 1FNMA 3QBTA 4DSNA 1NJ5A 1UXGA 1XT6A 4BMDA 1GSIA 1MO3A 1WLSA 2WSMA 3MJDA 4HGOA 3WR5A 1KDTA 3ETNA 2CNWA 3QG5A 1DOZA 2R11A 2WJ3A 3MWEB 2DEUA 4AKHA 4JC8A 4J6EA 3IXMA 3X1YA 3AETB 2NQ2C 2V55B 4QJBA 4NJMB 4UTXA 2QI9F 3F8TA 2CV1A 2NPFA 2RB4A 1MMFB 3ICCA 3A37A 2GEVA 3EGCA 3OTQA 4BQOA 3I5UA 4BQQA 4CMEA 2HQSA 4DS3A 2VJQA 4IDHA 1TQ4A 3FWZA 2Q5QA 2R8XA 3QEJA 2AFVA 1XTPA 3PYLA 5JPCA 3ZZ0A 3ICEA 1NDHA 2O2CA 4NBKA 4Y9DA 3BFKA 2J3IA 4QHYA 3KQTA 3B1ZA 2OHOA 4RZSA 2I4MA 1DDIA 4KH1A 3E9MA 2PT9A 3JR7A 2Q3MA 2BGKA 1ZJZA 4MW4A 3PHCA 5G02A 3AR9A 5ADHA 4DV7B 3ICWA 1X8XA 2R4QA 3T3DA 3GUUA 2WD9A 2ZT5A 2VJAA 2WJJA 3CH7A 1C4KA 2NVOA 2J87A 4GE3A 4GWKA 1UKEA 3MCVA 1L7EA 1X6VA 1VHQA 2OFPA 2PS9A 2Q5HA 3KWJA 4K6GA 5CX1B 4B71A 3D7KA 1N77A 3FRHA 2XUZA 1OOEA 3MJVA 4FMPA 1DEOA 5TT1A 3QWAA 5B7QA 1TQ6A 1JSZA 2QR3A 4OHMA 3FPBA 4AKSA 2EWVA 4B7CA 4BLRA 3L4BA 2Z83A 4INOA 2PUDA 4O4IB 2VK4A 2NUBA 1L7PA 3T5CA 4JJKA 1N3BA 3PUXA 4PYMA 5LOVA 2QMYA 3F6EX 3JWGA 5HUJA 4KO8A 4K9QA 3KKLA 1X19A 1QR2A 1BCRA 5C8YA 4RLHA 2OR3A 3USZA 2F3UA 2FJUA 1Z26A 4M8NE 2WOOA 5KYYA 3LRXA 3W7VA 2ZTLA 5DBHX 1BROA 1YSCA 2CSXA 1T0HB 4TMXA 3MBIA 3R5TA 3VNQA 421PA 4ZN6A 4Z4FA 2WKPA 2C59A 1Y1TA 3WGIA 2DT5A 3MCAA 5CDHA 3EA0A 1CYEA 3EQ7A 1KZ7B 5BYKA 2F4VB 4IH9A 1NAIA 4OB8A 1A5AB 2FWJA 1PTJA 5T6BA 2QT0A 3ELYA 3LBYA 2PNJA 2OCBA 3COJA 4YECA 4NATA 1G5HA 3RTCA 2Y4OA 4JNKA 3SSNA 2K4MA 2B5VA 3AR2A 2W6IA 3L8EA 2OMKA 4PEVA 1T9KA 3B9PA 3ZY4A 3L01A 5K7SA 1XZCA 1E8NA 1BU8A 2FETA 4Z4HA 5ALXA 3CVWA 4XR4A 3K1TA 4C4XA 1B0PA 2R1TA 1U9JA 1R8QA 3ZBPA 1OXUA 1F4VA 2Q7XA 2GK7A 2NU9A 3BTSA 5AVKA 4PR3A 3D8HA 2YWEA 3I8OA 4M8SA 3QOXA 4JUIA 4S1WA 4Y6PA 2JLRA 3PGJA 2P91A 1HYBA 2Z5LA 4F91B 5JJBA 4Z7OB 3AVQA 3BWCA 1JLSA 3HZHA 4M1KA 4YMWA 2QN2A 1OX4B 1T1GA 3JQCA 2JIQA 3OZRA 1GPKA 3K96A 2CNDA 3O91A 3QPUA 3UV3A 1XRSB 1EFDN 3SN6A 5KNBA 1H0KA 2ZVPX 3F6SA 4HRXA 3A1VA 1GA4A 2HU5A 3STXA 2VK1A 3K05A 1UOPA 1LLQA 2GLTA 1AMUA 1GZHB 1Q12A 1U65A 4HZUB 1KFJB 1WWKA 2A1IA 4PQEA 1SWVA 3WX0A 2BRUA 5C3MA 3B82A 3TTXA 3LCCA 4OPMA 5TS3A 2IDMA 2Q9BA 4QUAA 5AD1A 1G0OA 3A6HA 2GB4A 2PQMA 3V1MA 4R16A 5L9AA 4PAQA 3A4LA 4ND7A 1GT91 3MB8A 2A5FA 3V1TC 4DLBA 3SBDA 2R00C 1U7HA 2FG7C 3WY9A 5DFAA 2ZIWB 3T3EA 3WO1A 2ILVA 2AJTA 4GRAA 4LHZA 4FUQA 4QFCA 521PA 3FLMA 2KB0A 4D9HA 4M4SA 3CF4G 1H05A 4ZGWA 1PBTA 5H9VA 3U4QA 1EESA 1N6KA 5ADWA 3HJBA 5BV7A 4OHOA 3JVVA 2R1VB 5AW7A 1E0DA 2WF5A 1VDMA 1TF7A 4RJKA 3HL0A 1NQAO 1BN7A 2NLOA 2AG0A 2P5SA 3B36A 4KPUB 2ZI6A 3TVTA 2W9XA 1C3OA 4FFRA 5ALRA 1KYXA 4WKPA 2PX6A 3HMKA 4MP6A 3GPCA 3BF8A 3L7BA 4OHWA 1AZSC 2AN1A 3STWA 3LC0A 4BJ3A 5A7GA 1HC7A 3W7BA 1A9SA 3GZNA 3NQ41 5DISB 2XGOA 2OLJA 3PU6A 4XWGA 3H2BA 2WIAA 3VTZA 2JGDA 1F2DA 1T3ZA 5AKXA 4RPLA 1FFSA 3K0FB 4UDYX 3C45A 4M6WB 4PYNA 4RDCA 4JI5B 4D0GA 1NBEA 4G25A 2AXNA 1SY7A 1W85B 2BFBA 3DBHB 3H9CA 1HXHA 3R3UA 1WDLA 1BNCA 4YRDA 1CE8A 2O8NA 2I7DA 5HKLA 3WICA 4EX6A 5C4IA 3AZPA 2NU7B 3NNNA 4P36A 4J4TA 2DWOA 1XLWA 4X44A 1W9HA 1DKNA 2X4IA 5CX4A 2GWRA 4DILA 4C3VA 4UUQA 1PYOA 2B4QA 2OV2A 3SLGA 4MW9A 3WLQA 1BE1A 3R40A 1K27A 4AO8A 4IHAA 1J8FA 4EI9A 1UXJA 3TD6A 1TYCA 3I9JA 3CCCA 2QYOA 4OM8A 2UXBB 5EKXA 1XQ6A 1GDDA 1W88B 3UAOA 5KWIA 5ELXA 1DJMA 3AR7A 4XYMA 2WIJA 4F97A 1D6NA 1NW7A 2ZJ2A 2Z8YM 3HFJA 4LV6A 2JGMA 1ZGZA 2QVCA 3C85A 4C43A 4JFAA 3ZZUA 2SHKA 3MLEA 5JS2A 3VZDA 1Y6JA 2IP1A 4KDEA 4OU5A 3OZTA 4I50F 1KR5A 2O3RA 1DWOA 3E3OA 4RSMA 3SNKA 4DG5A 3WGUA 4NMWA 2I3GA 3GEEA 3VOTA 5JBIA 4RY2A 3H75A 1QFZA 4PAOA 4X1KA 2EHDA 3MAJA 4H7IA 3V4VB 1N0WA 4N7MA 4U00A 4DBVO 4GF5A 3FDJA 4U7WA 5FLKA 2RB5A 4EY8A 1PJLA 3WQSB 1HYQA 3NDIA 3W5IA 1G5RA 3IEIA 1V1RB 4G85A 4RFVA 3MTQA 5C8VA 2B82A 1QK3A 3QU5A 1H2AS 4B6PA 5CIYA 1P33A 1JYSA 4HP8A 5KREA 1X7WA 2X5NA 1BFDA 3NGLA 1BW9B 3T34A 3G8BA 4N5DA 5GOTA 1JR3A 3OJFA 3TMAA 4HYEA 1Q1QA 5H3CA 3RSGA 3MWDB 1ZONA 2AW5A 4I4TA 1FW8A 1VCMA 3R6GA 3D7LA 3M6VA 2LKDA 3IR7A 1FXWA 3H5IA 5FV4A 4H4DA 2IQIA 4I1OA 2GBCA 2YXDA 2J3JA 2I2BA 2KQUA 5J1SB 5KKCA 1NQTA 1UJBA 1NLUA 1R4NA 2H31A 3I4FA 4XZ3A 4IMJB 2AMYA 4U0JA 4DJFC 3LI2A 1QKKA 2QL6A 3PUJA 4N3GA 3EE6A 1EIZA 3Q11A 1FVHA 5GTDA 2F9MA 3LRTA 4OX9B 4EHKA 2C98A 1UMDB 3JQBA 4RA9A 4Z1MD 1TYBE 5DBIA 3HXPA 4G4SO 4LX0A 4LXIA 2GJ9A 3PPWA 4QO8A 4U9HS 4YJGB 3GRKA 2HJSA 1KC3A 3I9FA 4PAMA 4BLWA 3QKTA 3JAMA 2PBFA 1IULA 3SQMA 3IAM6 4YV1A 3M9WA 3ADOA 3C70A 1DJNA 1TF5A 5FWYB 1FDVA 2D8MA 1ABFA 1UQUA 3KPVA 1P6UA 4HGQA 4UTNA 4G37A 1X86B 1U0FA 2IU3A 2OCKA 4FFWA 2H5EA 1U7WA 5EJMA 3CX6A 1CZKA 5J5CA 4HWRA 2JZOA 1G6Q1 2QTBA 1NW6A 3QLUA 3QXJA 3TAHA 2AEFA 5AXBA 3SBOA 3KVOA 3NTLA 4I55A 5CK5A 5JFTA 3LHFA 4RL4A 2IOHA 3MELA 1KRXA 3NTOA 2XVYA 2BV3A 3SXUB 1QCYA 4DEVA 1UEJA 5BUQA 1R0ZA 2DPXA 3DEIA 4B8YA 1YQXA 4N39A 1Q0SA 1X1DA 3T15A 2I03A 2C9ZA 4PZEA 2XKJE 4Q16A 3CNEA 4H1TA 5F73A 1W1WA 1OE0A 4PO8A 4DPMA 4KE8A 1M1YB 1PNOA 3MVEA 4JVLA 3ZU2A 2W37A 1TCBA 4GVLA 2W2OA 3I6MA 2W7TA 1LK5A 1QMPA 4TTIA 1BX1A 4MRSA 3ZQKA 1HLPA 1QQ5A 1O57A 2MCFA 3ADPA 3OM1A 3LBFA 3PWZA 4FHFA 4GZ5A 4WA8A 4WQMA 3L0YA 1QHHA 1EQAA 1YNSA 2DYKA 3HA5A 4QOIA 1G8GA 1KERA 1MNQA 4DANA 4OXKA 1PI3A 4H1UA 4YTEA 2ZULA 3F9IA 3K1AB 3R4CA 4UMVA 2XB2A 1T6ZA 3R1IA 3Q10A 3WWYA 3KOYA 4L8WB 3NIBA 4UUBA 1QHEA 3KSMA 4O08A 5HDBB 3NH6A 3TQHA 3Q2OA 3ZGNA 4RQTA 1FLDA 1M74A 5GWXA 5FEMA 1RAGA 1W4BA 1J2YA 4L4RA 3FG9A 4NULA 4NBSA 1EUCB 1G21B 3AYXB 3PRKE 3SLRA 2IXTA 3LL7A 1USWA 1R4AA 1XP5A 3NVMB 4L0QA 4UARA 5ED0A 5EJ5A 1NU8A 3EEQA 4K88A 4R84A 4FB5A 4G3XA 1PFQA 3A2MA 1IXYA 3GFVA 2C9BA 4IH4A 2WOJA 3IVCA 3L04A 4WVLA 1THGA 3TG8A 2HPAA 4NSNA 2QR2A 4A26A 4A1OA 1Q17A 2NAFA 2QHXA 1B15A 2LCIA 3L5KA 4I7EA 2KBEA 1TZKA 1FF9A 3D3EA 4DLZA 1FX0A 5JMTA 4WBNF 2JFXA 3ES9A 3L9WA 3PDHA 5LQAA 3LC2O 1C3LA 5CD9A 2XYPA 1L8LA 1R37A 4CW7A 1HNZB 4AF6A 1WO8A 3WIDA 1KSFX 4LFCB 1Y1KE 3VH2A 3FKSD 2FYTA 1PJTA 3E5RA 3OC0A 1YS7A 1BH2A 2FMFA 1DDGA 3C6ZA 1WV1A 3WXBA 2ZRIA 4BX3A 3MPUA 2O2DA 1EU1A 1WAMA 2F43A 4RA6B 3TZLA 3HVRA 4M1QA 3GHYA 3GGDA 4BECA 1M8GA 3LVRE 4QUHA 5JC1A 3TL3A 2P4SA 2W2VA 4K6OA 3VSAA 3ZI7A 2OPBA 3L41A 4RY8A 1BXZA 3IVRA 3JTEA 4GPAA 4FHZA 1K4MA 2FAXA 4LZWA 3E61A 1JHDA 2P41A 3GDGA 1C3JA 1UWCA 5HEKA 3MS7A 5B1IA 2V5VA 3KOOA 3KK0A 4N5IX 3I3SR 5B12A 3HNPA 1HE3A 1VP9A 1VL1A 4PXAA 4ZJYA 4HDSA 1WZNA 4JYBA 2XT9A 4FSHA 5DHTA 3AVWA 3CZMA 4RHUA 1R7RA 3KKMA 1TEVA 4U2BA 3ZLJA 4U2EA 1KEVA 4ND8B 1NVVQ 1Z7YA 4EY4A 3RC8A 1J25A 4CM5A 3I2HA 4CM6A 3QU9A 4X3PA 4KR6A 1CFJA 1R88A 3MS2A 4KLNA 4XVRA 3CUUA 3PJRA 2HF7A 3WSVA 1S2MA 5GZ1A 3T38A 1UJNA 1L7QA 1RCTE 4F92B 1JKIA 1TJPB 5LWHA 3NC1C 2FQXA 3JZFA 2JLWA 3KKOA 2NU8B 2C20A 1L4NA 2RGDA 4B46A 3H2YA 2VNAA 3COVA 4FDTA 4P4SA 2XAAA 3CO0S 2O0LA 3QJ5A 3N07A 4MS1B 1Y8RA 2WE7A 3RUHA 2H48A 2EKLA 1RD4A 4K6HA 5LB4A 5BWOA 1P77A 5EQTA 4B4UA 3M4JA 4X20B 3ZCRA 1U2EA 5REQA 3H4IA 5TMDA 1ZN9A 3B2EA 3ZQ6A 1ZNYA 4GYWA 1L5SA 5DV9A 4M54A 4YRCA 2D1RA 5KZMB 3E9EA 1DRJA 2GAJA 2XCUA 2D5BA 2E0IA 4RKQA 4XM2A 3KSBC 1TJYA 1N9GB 1E4OA 1VJDA 4W7IA 3NV9A 4DQVA 3DC7A 1JQAA 2BE7A 4JP2A 1P9RA 4AP5A 5K0BA 3IPAA 3U3ZA 1ZXLA 3KQPA 3Q98A 4YROA 5JZ9A 5D3QA 1SMKA 1RFLA 2BI7A 4UC0A 1JHUA 2X76A 4IHQA 4X54A 2JLUA 3BWDD 1IE3A 4L73A 4X3CA 1WF3A 2CLOB 2Z1MA 4DADA 1E1CA 2PH7A 3ZQJA 5FBKA 1KGDA 2ZYUX 3E9QA 1QYXA 2PD6A 3DDZX 4POAA 5TB5A 4UDOA 5IF3A 2HRRA 1MEJA 1HG0A 3IIJA 3DHEA 4HFNA 4KXFB 4U0KA 4FNMA 4JIMA 3A2NA 2C99A 4Y2SA 4OXQA 4BNVA 1E2BA 2JVKA 2VATA 3FNQA 5TS2A 4AURA 2WWIA 2QROA 2QIOA 3GFFA 2AI2A 4YCBA 2BEVA 1PJ8A 2E4ZA 2OECA 4TKUA 5CUQA 3D8NA 5JTTA 3NBKA 1OTHA 1I3CA 2BDUA 2VYND 4N49A 4MRAA 5AI8A 4D5EA 1CY2A 1NVEA 1J39A 1SBNE 2HMTA 5JCXA 5JYDA 2GD0A 5LP6F 2A5GA 2FSGA 1T1IA 4LMPA 3QNUA 4JXKA 3G2HA 2YXNA 3BXOA 3I2KA 4GC9A 1YBAA 1VHJA 3RRJA 1VIDA 2I71A 2OV8A 3H83A 3SNHA 3GT0A 3GYBA 3EEBA 4JMPA 2YOFA 4BO3A 3M1IA 4UKDA 1XJWA 2H1FA 5IBQA 2ZAIA 2NXWA 1SWWA 1WCIA 5I48A 5IAKA 4U6SA 3HV2A 1YE3A 3G9QA 4B87A 4KFCA 4LSZA 1XMVA 2JS7A 1IZ0A