5CJ2A

Ran gdp y39a mutant triclinic crystal form
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
197
structure length
197
Chain Sequence
QVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKAVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPALAAQYEHDLEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding nuclear protein Ran
publication title Catalysis of GTP Hydrolysis by Small GTPases at Atomic Detail by Integration of X-ray Crystallography, Experimental, and Theoretical IR Spectroscopy.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 68
structure length 197
sequence length 197
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2015-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5cj2A00
2V7QA 5ELXA 1DAHA 1SGWA 4FINA 3FOZA 1KI2A 4PC2A 4X8OA 3X1WA 5J4LA 2ZJBA 5K8IA 5G3YA 3OE7A 4MUBA 4WA7A 5FTJA 4M1TA 2WWYA 3NTUA 2DY1A 2QPAA 4HAXA 1W0JD 4LZZA 3VNUA 3EAQA 5HCNA 4US0R 1EK0A 1GITA 4JSYA 1EXMA 2QP4A 1R0XA 1FX0B 2EW1A 2GZHA 4HDCA 2CCKA 4OQNA 1X8JA 2ZJ5A 3BAFA 2DHRA 2J7KA 1IN5A 2BM0A 3X1XA 1FQJA 2ZPTX 4QJ3A 2CVHA 1W4CA 3HWSA 3IPYA 3EZ2A 1OKKA 2ZTSA 5JFGA 4URWR 1HV8A 2ERYA 3CONA 2QMUA 4QJ4A 2KB0A 5CB6A 5DHAA 3A4LA 1Q22A 1NLYA 3B85A 3F3YA 4A6PA 5FTLA 1Z22A 1X86B 2H1LA 1R0YA 3HYTA 3IEUA 4B3DA 1OH6A 4C9BA 1XD9A 2W2TA 4Q66C 2GEVA 4D4KA 4MUAA 4QG7A 2A5DA 4CRWB 4EQ6A 2XJ4A 4D0LB 1JR6A 1GRQA 1XU4A 2GJKA 1Z28A 4Z54A 3GLFB 3D31A 2RGAA 3RWMB 2LCFA 2IS6A 1Z0AA 3LRPA 2WMOB 3PUXA 3H2YA 5JS7A 4HI0E 3KXIA 4I1SA 4C0JA 3PV0A 4XWKA 2CL0X 2ZJZA 2J0QA 2V6JA 1SZPA 2HLDD 5DI3A 1NBME 3RRYA 2E87A 5GVRA 2A3RA 1KO4A 1QG2A 1UKEA 2VIIA 1XTSA 2VP9A 5J4VA 2XZOA 1JB1A 1S3SA 1JALA 2GAAA 3AP3A 3D3QA 4OI4A 2QG6A 5BWMA 1A2BA 2SHKA 1AKYA 4OQFA 1W7AA 4MDEA 1OPXA 3FKSA 3CX8A 4KI0A 2XXAA 1WRBA 1XMVA 4YQFA 1KOFA 2C77A 5AK0A 1SHZA 5AJYA 1AZSC 4LOAA 2W0SA 4PC3A 4XTCS 2VYFA 4ASUA 5TV2A 5E3HA 1M1YE 1D2EA 1X8LA 1TPZA 4NCIA 5CJ2A 3J81k 4PR0A 4ZDJA 3THXA 1KSGA 3ZVLA 1X1SA 3R8FA 1EFRA 2VP6A 1CJKC 1DBSA 1ZBDA 3B1YA 4B3FX 3A8TA 1XX6A 2PX3A 3CR7A 3UXMA 4EPYA 1Q20A 4OQXA 5AR1A 5JBQA 4NONA 1VG1A 4WXRA 4AKIA 3TNFA 2FPMA 2AHOA 4TMWA 3V9PA 5HE9A 4DT1A 1W48A 3K70D 1JR3A 1KMHA 4ZPXA 3MSXA 1ZMXA 1VYVA 3GJ5A 1HH4A 1FNNA 2REBA 4L9WA 2AK2A 1MO4A 2CK3D 3QY0A 5EP1A 1NVVQ 3C5HA 4W9MC 1MRNA 4FCVA 2A5FA 3RS7A 4DHEA 1CU1A 1E2PA 3KQNA 2XB4A 1W36C 3TAUA 4QBIA 2HDNB 4KLNA 4JS0A 2GA8A 2HF8A 3E70C 5J4KA 3K0CC 1ZM7A 4YXWA 3WMFA 2IBMA 4P4SA 4JLVA 3BJIC 4FMCB 4Q4JA 3VFDA 1G8GA 3TKLA 3QPVA 5EXPA 4A0GA 1F2UA 1NN0A 4EIWA 1A1VA 1GWNA 2ZYUX 4PZZA 1ZM9A 3QI2A 4EFNA 2QTFA 1N5IA 2W6ID 3PVSA 4U5XA 5HR5A 2XNSA 2A2ZA 2BV3A 2WKRA 3UPUA 4Q48A 4DDTA 1E2JA 3QEJA 4RFVA 4LRWA 1Q1EA 3FDIA 3W5JA 3MJRA 2R62A 3AF2A 2BBSA 2F7SA 2ZSAA 3TVDA 2WPDA 3K0FB 2F1IA 4NYJQ 1BYUA 3R9WA 2O52A 3ICQB 4PPNA 4CT4B 1XP8A 3AF1A 4JL6A 1P75A 1G8HA 2WV9A 3ECCA 3U44A 4TL8A 1OW3B 2FE4A 2ODNA 2OFOA 1CULC 1NL3A 5J4HA 4DC9A 1CP2A 2Z4SA 4ACAA 3ASZA 2O8DA 4XVUA 4I1OA 5KPDA 1NMXA 2FMXA 3CR8A 4PHTA 3UG7A 2XXAB 2FZ4A 3BH7A 1W36B 1E9RA 3B8HA 1D2NA 3FFBA 4D0GA 1PV4A 5BYKA 1Z8FA 4UXIA 3A37A 5FR1A 2C95A 2DR3A 4C7OA 3KKQA 1E2KA 3WHKA 3THXB 3CM0A 4C2UA 3AVXA 2IYSA 1F2TB 3CNLA 2DCUA 1TEXA 3G0HA 4PANA 4IFEA 2ONJA 1P62B 3LV8A 2QT1A 3P27A 1EX6A 3HYRA 4NHOA 3GLFE 4JL8A 5E95A 4DIEA 1KI3A 2X8AA 3MUFA 3A1VA 1OYWA 2W6JD 4DT1B 1NN1A 4QC2A 1KMHB 4HAWA 5BN4A 4YMWA 5IK2D 2PZEA 1E3MA 3PUYA 2NO1A 4P0TA 4C4PA 1ZD1A 3BFXA 2FGKA 4JVLA 4IRUB 3D6TB 3MCAA 2XEXA 3LLMA 2PJRA 1T8UA 2IYUA 2CVFA 3BH0A 4PSAA 2XSZD 5DLQC 4I81A 1R10A 3IQXA 3RYTC 1WP9A 5FI0B 1OXTA 2AXPA 4IFBA 1VYTA 3PEYA 1XMJA 4OHZA 2EWVA 4M2LA 1Q3TA 2L0XA 2WM9B 4H1VA 1G3UA 2GVZC 5EZ6B 1ESNA 5HE8A 1GM5A 3SS8A 4A82A 2OBNA 3WYAA 1C1YA 5JJIA 2KBEA 4JL5A 3LW7A 2OBMA 3C7KA 2ODBA 3PQCA 1Z47A 1DO0A 3CPEA 2ZVPX 1BKDR 2ZEJA 4Q9KA 2V6IA 2RH5A 2ZS8A 1KIMA 3R7WB 1MH1A 5C4MA 2GJ8A 2QQ0A 3L8ZA 3SEAA 5L8VA 4F4CA 1H8HD 2RMKA 1YR9A 3UANA 2QENA 4AKGA 2ODEA 1UBCA 1Z0DA 2D2EA 4JIMA 1P73A 5E7MA 3OAAD 2RGCA 3RS2A 1XTKA 1N6HA 4HAZA 1FUKA 2WWXA 3F8TA 2WICA 1U9IA 1MR3F 1DADA 1U81A 1BS1A 1CBUA 1IBRA 1P2VA 3A58B 4B43A 4EAQA 1QHXA 5EE1A 1R4AA 4F4IA 2X2FA 4DWJA 3CPJB 1KDPA 1KO8A 2O8CA 3A1UA 1GP2A 2BVNA 1TUIA 2HV8A 2WHXA 4BWYA 1TQDA 4K81B 4PPFA 4Q00A 1E9BA 1MO3A 1VCNA 4NH0A 2YOGA 4C7OB 3AKEA 1OXSC 1OH8A 4XSHA 2FJUA 2ZVQX 2D4HA 5LPNA 2UVQA 1IY2A 4WXPA 2A5JA 3TUJC 3LNCA 5CIWA 1Q57A 2GBLA 2Q3FA 1ZC4A 4KJZA 2ZAMA 4OI2A 1RKBA 4JLJA 4JKIA 2QY9A 1YZKA 1KAGA 2OLJA 4LC1A 2IHBA 1K6MA 5B58C 4V0LA 4ZKDA 5D3QA 4GZMA 2BIFA 2CHGA 2WZQA 2HT1A 1I4DD 3GFOA 5FTMA 5BYJA 4L4UA 3AVUA 5BXQC 1L2TA 4CIDA 4QOSA 4AYXA 4URUR 5UKDA 2Q3MA 1W44A 4O3MA 5FL7D 3K70C 2H17A 4U00A 4ESVA 4BFTA 1UDWA 3IBYA 4C3ZA 5LDDC 3UIEA 1LB1B 1XEFA 4UJ5A 2PBRA 1Z6AA 1T0JB 4QRHA 4IDQA 4B73A 2JLRA 3ICEA 3C4JA 4FD2A 1PZNA 2ZRIA 4Q1BA 5JWHA 3EC2A 1IAQA 4MGZR 1G18A 2OE2A 3KJEA 5G41A 4TSFD 3VKGA 2IEYA 4XOIA 3CO5A 4OJKA 2DWQA 2EFDB 1Z3IX 1N6NA 1Z6XA 1ZW6A 1W0KD 5E7JA 2PCJA 5J40A 2NO0A 4TYQA 1FTNA 1PUIA 1QVRA 4MA4A 4F91B 1GRRA 4QM6A 3EZ7A 1KGDA 4WVFA 1T3HA 5JEEA 1TMKA 1UDXA 5FBRB 4C0KA 2G77B 1JR3E 1SVLA 3TUZC 1GKYA 1VYUA 4IVRA 3U4QA 1COWA 2CJWB 5CK4A 3V00A 4GP6A 3LBHA 3KX2A 4LPKA 1L8QA 1XTQA 1SVKA 1L4YA 2G83A 1DARA 1T91A 3RAPR 1Q0UA 1Z0FA 2GZDA 2W2VA 3L0IB 4ABYA 2YINC 3ETLA 1U8YA 5FFMA 5JZVA 2O8CB 2F43A 3TW8B 1KY3A 4IDPA 4EPVA 2CDNA 4HLUA 3CB4A 4CYMA 2RGDA 1G21E 1QHSA 4Q19A 5GVSA 2REOA 2QAGA 3K09C 3DPUA 2FDCA 2GF0A 2GZAA 2JJ1D 4TMXA 2H7VA 4Q1EA 2PX0A 3W5IA 2GXUA 5JJLA 4FWIB 2UKDA 3GEEA 2NO9A 2GCOA 1QZXA 4M1MA 3AB3A 5KNDA 1Z5ZA 4PO8A 2PEYA 1G5PA 4DLTA 3T5DA 4IDNA 2IYLD 2P6UA 4P4TA 4DUGD 4DLSA 4HDQB 1XCGB 5E7IA 2VHJA 2C2HA 2WAXA 4LYHA 2BM1A 2CCJA 2KBFA 1PLKA 4A2PA 2XOKD 3KB2A 3RS0A 1W5SA 1P2TA 2O0JA 1XMSA 2I4IA 4V03A 1G5TA 2GRJA 1Z2AA 1PLLA 2QAGC 4C2TA 2ZU0C 3D8BA 4OJQA 1LTQA 2P6NA 2Z83A 3RRMA 5J47A 2AWNA 4A0HA 3T35A 2GVDC 1HTWA 2B8TA 3GLIA 2CL7X 4BFWA 4Q18A 4B76A 1KI9A 1QF9A 4Q4AA 2ONKA 4AIIA 2A78A 2QSZA 2O8BB 3I32A 1N6OA 4TTPA 1Z06A 3N2IA 1XB2A 5TB5A 1N5LA 3OIYA 3IEVA 1E2NA 1T3LA 2ZRFA 1KMQA 1KI1A 5FPYA 3WRXC 3RABA 4EJSA 2PMKA 4M8NE 3KXKA 5DI9A 3FVQA 1G20E 2P6RA 5IT5A 4WIAA 2JIZA 1XEXA 3P32A 4V0MA 3B13B 1N6KA 3X2SA 3SI7A 3L2OB 2P0EA 3CRQA 1Z63A 4L15A 4EFMA 2VH5R 3GD7A 2EFGA 4FMBB 4FMCF 4N1AA 3T12A 4DDWA 1XPUA 4TL9A 1XJQA 2W00A 4RCZA 2FFAA 2FA9A 2ZI4A 2QAGB 3D7MA 1PJRA 5KSPA 4XD7A 5AUPB 1KI4A 5B64A 2OFWA 2C03A 3QXXA 5EP2A 5TMPA 2GXAA 5AUNB 521PA 4Z8YA 2C5LA 2KJQA 1T5LA 2VEDA 3I72A 4FCWA 4DJTA 4EJSC 2BEKA 2HLDA 5KDLA 3TW4A 2ERXA 3RRNA 4LJ8A 2QPOA 3ZD7A 1BMFA 1XCMA 1ZD8A 3TUIC 3CZPA 1ZU5A 4BUJA 3GP8A 1TL7C 2RHMA 3IIKA 5JRZA 1WB9A 4UXJA 4B75A 2V4ZA 1Z6YA 721PA 3HR8A 3O8CA 1RYFA 1PLJA 4MYTA 4JLMA 4C0AC 2HYIC 2KSQA 2ZS9A 1CR0A 4KBFA 5KNBA 2GETA 1AJEA 2R6FA 4FMDB 4JLBA 5IHPA 4IDOA 3WYGA 1HT2E 1Z29A 2GNOA 4OI1A 3T15A 1KNXA 3KDSE 5B30A 5J5CA 4HATA 1ZUHA 1N5JA 2AD1A 2C99A 3GLIB 4IVQA 4M9ZA 1JQJC 1VKJA 2IYQA 4FW9A 5FOVA 4CDGA 1U8AA 5K8UA 1L7VC 3WY9A 5JHHB 3TJZA 2OBLA 1W1WA 3B6EA 4MGYR 3O8DA 2CNWD 4OBEA 2PJZA 2BJWA 2OSBA 4H9GA 1E98A 1NNEA 4A6XA 4TLAA 3H1TA 3LAWA 4BFSA 1EGAA 1RJ9A 3QXSA 4EJSB 4G1UC 2BKEA 4U02A 4CEHA 1XTRA 5DSZA 3FMOB 2CE2X 4DVGA 1EWQA 2WJIA 2NQ2C 1N0VC 2AX4A 4HSEA 1R2QA 3IBGA 4PHHA 1UBGA 3EW9A 4DCUA 1AS0A 4JLDA 4AKHA 4YDSA 1T8TA 1J99A 1OJLA 5L3SB 3UWKA 2V1UA 2KWIA 1E9SA 3OESA 1U98A 1LVGA 1E6CA 4BPBA 2BOVA 2QN6A 3REFA 2G0TA 3L43A 4M22A 3QG5A 2D7CA 1NY5A 1F60A 1G8FA 3GPLA 4LJ7A 4M21A 3NDBB 4C0HA 3O8BA 1FQKA 2K5UA 4G5RA 3TQCA 3FMPB 2UZ3A 5KSZA 1VTKA 4GDFA 1FUUA 3BH6A 4QHSA 3TK1A 4IOMA 1KYIA 1NG9A 2VO1A 3CX7A 4GSYA 4CEIA 2JDIA 3NBXX 1QHNA 1T9HA 5F9FA 3WMGA 4PPGA 3AF3A 3GJ3A 2XJ9A 1QDEA 2XAUA 5FPKA 3SYLA 1XEWY 2QPTA 1YR7A 2AL7A 5EE0A 1UADA 1Z0KA 4IXMA 2GEUA 5CLQA 2ZSBA 3AM1A 4Z1MA 1WQ1R 3GEIA 4J0QA 3SJCA 1KTVA 2JLSA 5HKKA 2ZRCA 1N6PA 1GL7A 1E69A 4HUQA 4EPWA 4TT3D 4BEJA 3EC1A 1JEEA 1CLUA 2KI5A 4ZIRA 4LBWA 3UWOA 1G6OA 1LFDB 4W5HA 5CDFE 4BEBA 3K9HA 3MWYW 3M1IA 4LYAA 4UNRA 2IXFA 2QP3A 3GMTA 4EUNA 1M74A 5SZHB 1KSHA 3TLXA 4LX0A 4RCYA 2DFTA 4YC7A 5FPSA 1V5WA 3A6PC 1AM4D 1RFLA 2XZPA 3N5CA 4OHVA 3VR1A 2A5YB 3GQBA 1ZVQA 3K0SA 4G5OA 5JECA 3TIFA 2ZI6A 5JI2E 4TTRA 4FXPA 4FIDA 3DKPA 4NYIR 1KSJA 4PSVA 4X8HA 5EQTA 4YMTA 5FR2A 1RJ9B 4NU0A 2BC9A 1UJ2A 4CEHB 3SR0A 3ZVMA 3ADBA 1GFIA 2IK8A 4HZIA 2HEIA 3SHFA 1NIJA 2OILA 1OLOA 3O47A 3SOPA 3FYHA 4M4SA 3RLFA 1R5OA 4FN5A 4CVNA 1J8MF 1UEJA 1R5BA 1SXJD 3SBDA 2O0HA 5IRCD 4O2RA 4AI6A 2ZYWX 3K1JA 3AUXA 3NEJA 4I1UA 5EJEA 3Q7QA 1I4LD 1TEVA 4JJKA 3EWSA 3QOFA 1MRSA 5P21A 5HCIA 4LJ4A 5FPTA 3BC1A 3AQ4A 2IW3A 5FUWA 5G3ZA 2IS2A 3P4XA 4DCVA 4TQ9A 3VU9A 1E4VA 5DN6D 2H5EA 1SVIA 2WJHA 1QHGA 2IHYA 1S9DA 4MKGA 2IYXA 5KOYA 4CGZA 3EPHA 3BERA 1VECA 5JWOA 1TF2A 1H8ED 3KKPA 2QEQA 2VP0A 1M8PA 4JT4A 1U99A 3PCRB 3Q8XB 2N1BA 3CRW1 3WXMA 4JSTA 3EIQA 4B2PA 4E09A 3EA5A 2J9RA 3WBKA 2B6HA 2YOHA 1P2SA 2YWHA 5FPHA 2G3YA 1NVWQ 1N6RA 2WWGA 2MSCB 3FKQA 1EESA 1KZ7B 5CB8A 2FF7A 1S0UA 1TF7A 3THWB 4AYWA 1CJMA 4UQOA 1ZNWA 2ZRPA 2ZJ8A 2IYZA 4LYFA 1SKYB 5D3MB 1ZM3A 4IW3B 2QNRA 2PEZA 4WOPA 4GNKA 2CL6X 3CIOA 4RKFA 2WSSA 1RVDA 1S9HA 2D74A 1TQ6A 4G3XA 1YU9A 2JJ8A 1OFTA 1XEWX 3ZD6A 2O8FA 1WBBA 3PENA 4TQAA 2V8OA 4Q7KA 4H1UA 3X1YA 1CR2A 1DG1G 5H70A 4JLPA 2QT0A 4PC6A 2YVUA 2Q6TA 1II8B 4S35A 2J0SA 4HB3A 2ZYTX 4OI0A 3RWOA 3NWJA 1ZNXA 3GLGE 4Q7MB 1JI0A 3UK6A 3WHLA 1DAIA 2ZRNA 2IL1A 2QORA 4ZDKA 3CW2A 1P5ZB 1NBMD 5FOTA 5B2ZA 2FSGA 1KAOA 4MKFA 4PFSA 1QHIA 2GJ9A 1VG9B 2WBLC 1HA3A 2OEPA 2RAPA 3KFVA 2BBWA 4G5QA 2R44A 1HY3A 4DDUA 3RS3A 5FBWB 5IF9A 2GEDA 4Q7JB 3BWDD 2WIAA 2NPIA 3DZDA 3Q9LA 3IIMA 3DDCA 3T06B 1DG3A 3A1WA 4ZCLA 2VHUA 2ZRHA 3QKRA 1Z0JA 4QGAA 2DYKA 1WA5A 4BLTA 2OAP1 4LJ6A 3VU9B 1YQTA 2BWJA 4Q4HA 4DSUA 1E0JA 2NOAA 5C18A 3DOFA 2D3WA 1EX7A 1OFIA 2OCAA 4TZ6A 2R6CA 3K53A 5DNYB 4XH9B 4XWAA 1KK1A 2XTNA 1NKTA 1MABA 1KK3A 3I5YA 4AK9A 4Q01A 4V02A 2JLUA 2J46A 3LBNA 1GIAA 4POAA 1K8RA 3HDTA 3L82B 2VF8A 4Q5IA 3BIFA 4TMVA 4PC1A 3SYNA 1JNYA 2GKSA 1U0LA 4C0LA 1JEDA 2FSFA 4IOKA 3KL4A 2JLQA 1KI7A 1JBKA 3RSOA 3C14C 3VAAA 2JJ2A 2HJGA 1UBFA 2XTZA 4EQ6B 4HLDA 4B3BA 2C04A 2X19A 1MO6A 1HE8B 2BMJA 3VNVA 3I4LA 1II0A 4D2IA 2YJTD 2C9CA 1N0UA 4OYHA 3LBIA 2QBYA 2O8FB 3IHLA 3THYA 1NLZA 2N46A 2BDTA 2OUKA 3GJ8A 3LVRE 4L5BA 1KKLA 3F0TA 2CLSA 4PHGA 1KDOA 5DI3B 1QHYA 1N3BA 1J8YF 1JAIA 4KSCA 1ZIOA 2ZE7A 4JJZA 2IUUA 4DB2A 1VHLA 4EPTA 2QTVB 1E0KA 4D81A 4HZUA 3T1OA 3DO6A 2V9PA 4DLUA 1G7CA 4LBVA 2ZE5A 1Z6GA 4ACBA 2YZ2A 3V4RA 1G9XA 4QGGA 4N0EA 2KE5A 2VBCA 1OHHD 2JLYA 2FG5A 2ZRKA 3P1JA 5F3WB 1ZP6A 4W5WA 3ZVRA 2XGJA 3IUYA 2DBYA 4FMDF 2C78A 2GK7A 1Q1BA 4MRRA 5HPYB 1SKYE 3QXHA 2QAJA 3OEHA 1G8YA 1KZGB 3TE6A 1XWIA 3QKRB 3L0SA 4TTQA 4A4DA 1OIWA 3TGPA 1IN7A 4W7SA 2G9NA 3FFAA 4D4LA 1OIXA 3B2EA 3IDQA 5EE3A 1KO5A 2GTPA 1XXHA 4E5UA 3FHTA 2RGXA 4LWZA 3NKVA 2AFHE 5JCPA 5F98A 5JEDA 1DAEA 2ZIAA 4HUTA 4ZI2A 2HF9A 3AEZA 3MRSA 4TL6A 4QBHA 1X8KA 2IYVA 4C0BA 4G5SA 4PQRA 1IXSB 1TU4A 4B2IA 3LY5A 3KQUA 4JLNA 5JWRA 3SJZA 4MRNA 2D2FA 3ZIAA 1IM2A 1G3IA 4QBGB 4P4SB 4Q4JB 1P6XA 1OB2A 1KK2A 1OH7A 2RB4A 1US8A 1CJUC 3LXXA 2CLDX 2VF7A 2IXEA 1F2UB 4TLEA 4NCJA 5CM9C 2ZRJA 3OEED 3VKWA 2VTKA 1P7CA 1KI6A 2JATA 4TN1A 3ZZ0A 4AURA 2D62A 4II7A 4WW0A 2Q3HA 2V7QD 5AJZA 4TYNA 3THYB 2QBYB 1E0AA 2B7BA 5KPJA 4XVRA 2ZJ2A 3S1AA 1TX4B 3MGCA 4TLBA 4DSNA 1M7BA 3X1ZA 3IIJA 5TY0A 5DGXA 3RANA 2ZREA 3CUEF 3B9PA 3CLVA 3OE7D 1GL9B 2LKCA 3NBZC 3CF6R 1TUEA 4JYBA 3LDAA 2VSOA 3U44B 3NHAA 4MRPA 8OHMA 1YHNA 1Y63A 3CH4B 3EIHA 3W6OA 3KZ1E 2ZE6A 4NL4H 1MT0A 1NG1A 3QG1A 2O8DB 1FP6A 2QL6A 1AS3A 1RRFA 4MYCA 2BMFA 3LX8A 1KHTA 5EE5B 4RD4A 4RVCA 3BB3A 4EKDA 1OKKD 3AF0A 3IPXA 5KSOA 4GL2A 3KKMA 4RZUA 4QNRA 2GXQA 3VX4A 2YKGA 5AUOB 2YOFA 3VR6A 3SDZA 1XFAA 2J7PA 3WRYC 1IXZA 5KDDA 2QA5A 4N3NA 3C15C 4D26A 1NJFA 3FTQA 1Z0IA 3I92A 4QM7A 1U9IC 2WJGA 3OIVA 3EZ9A 2N42A 4F7WA 2ZXUA 4NMMA 4M9SA 2IXGA 1ESMA 4R9UC 3SHWA 1X1RA 3U3OA 4I99A 2WJJA 4UXHA 1JPJA 4M1OA 4GP7A 4MGIR 4PQFA 1OB5A 4LBYA 1RZ3A 2HCJB 2Q0HA 1DAMA 3IILA 1IHUA 1WDTA 1AS2A 3QBVA 2I1VB 2O8EA 2PT5A 2TMKA 2CE7A 3MG9A 3M4YA 4A1FA 3K9LA 1BIFA 1M2OB 3BXZA 3GJXC 3ND9A 1S1MA 2ZI7A 1X6VA 2CMKA 3EZ6A 5FBLB 4DEYA 3OFNA 4BZQA 2GBLC 4N0DA 2JEOA 4B3XA 2P2LA 2IYTA 3FKSD 2XITA 3U2QA 4CF7A 4B32A 4LK2A 4C0QC 2ORWA 1W36D 3KKOA 4ZCMA 2F3RA 3S1AB 3NDPA 4ASUD 1E2GA 5JJKA 4Z51A 5L3VA 4CEJA 1GVNB 821PA 4LHXA 1E9DA 1NP6A 4NE2A 1EFRD 2EFEB 2J41A 3SQXA 1NVUQ 5H8WA 4KV9A 1NI3A 1C4OA 2G88A 3ADCA 3WNCA 3OZXA 3PEWA 3KUDA 4JVSB 4RZ2A 2ANCA 3RHFA 3CRRA 1CR4A 1JR3D 1KJYA 2R8RA 3QPWA 2QGZA 3H86A 4GPTA 4QXAA 4BLQA 5KUTA 3I5XA 2FFQA 5H68A 1NN5A 2PH1A 2WMNB 3VR2A 1LS1A 4R2IA 4AYTA 3TMKA 4M9QA 1G5RA 3U5ZB 4BE7B 3BD9A 1AQUA 1FFHA 4W5JA 4WBSA 3DMNA 1P60A 4BRWA 2HXYA 1P72A 1OH5A 3BB4A 4ZDIA 1G41A 1EG7A 4QL3A 1IONA 3O8RA 4YXWD 4CT5A 3RC8A 1E1RD 1UPTA 4HB2A 1CRPA 4LV8B 1UKVY 3U7EB 1OT3A 4OQLA 4GBMA 4URXR 1Q44A 2AN9A 1DAGA 3DOEA 3SE0A 4Y0VA 2F55A 1T3SA 5JCZA 1N25A 5C4GB 3LLUA 2ZU6A 2FSIA 4LC0A 5EXXA 1B23P 3KQKA 1XZQA 3I8XA 3KTAA 3AGPA 2F3TA 3Q3JB 4KO8A 5CITA 5KTYA 4HLUC 1SXJA 3QPUA 4KBGA 2RGNA 1XPRA 2WPDD 4QBFA 3UG6A 4Q03A 1E9FA 1YRBA 2O8EB 2YNMA 3G5UA 5KDOA 1UBEA 3U60B 1E1QD 5C2JB 1N0WA 2WWFA 5L3QA 1W0JA 4F92B 6Q21A 1CR1A 1Z6TA 2XB2A 1IJEA 1E2IA 1EFCA 1RRGA 4NKRA 5BN3A 5JLJA 1A2KC 3HJNA 4JBWA 2OV2A 3LD9A 2Z43A 3QSYA 2XX3A 3NIBA 3SZRA 4R71A 4JKYA 2HJVA 1KO7A 3WNDA 2ODWA 3BBPA 1OYYA 4QGFA 1G19A 1GZSA 4I1VA 3C16C 2R6GA 2B7CA 4LJAA 2VPPA 4Y0AA 1X3SA 3GJ7A 5TVKA 4CEJB 2X1VA 4GZLA 4JMPA 3ZQJA 3SQWA 1ZM2A 1TTTA 2GCNA 1YZQA 3U4QB 3P26A 3EARA 2IC5A 5LB4A 4DCNA 3HP1A 1OXVA 3SFVA 1Z2CA 2RGNC 4AKEA 1YZNA 2ZE8A 2QTHA 3SN6A 4IHQA 5EP3A 3U3KA 2UZIR 4PAMA 5G53C 3RNLA 2VSFA 1E96A 1P9WA 1NKSA 1XF9A 1RE0A 1KDRA 2F43B 1KY2A 2IEZA 3RSLA 5GJVC 3LW8A 1TQ2A 3ZLJA 3BK7A 3RS5A 1H65A 4PAQA 1VCIA 4QHYA 4YDHB 1G16A 1DTSA 2ZQ5A 3WYFA 1E4YA 4LCBA 1GSIA 4PXAA 3HU2A 4DB4A 4Q47A 1G3MA 5KHOC 2RCNA 4GFDA 1D8TA 2GCOB 4TLDA 1EFHA 5AJWA 1XTJA 4M1YA 1KKMA 2FV8A 3A4MA 1GNQA 3DHWC 4A0RA 2MSEB 2YC4C 5DH9A 2QQEA 4B47A 1T4GA 2NZ8A 3LH5A 2JASA 3P4YA 3GJ4A 5A5GA 3MWKA 1BOFA 2MSDB 4IEEA 2ATXA 1NBMA 3T61A 3EWAA 5F9HA 4ESHA 3BS4A 1G7SA 3K0AA 3SU8A 1CJTC 3DVLA 3U7HB 1XCPA 1HEIA 5E4FA 4O25A 4R2HA 1ZM4A 3FWYA 3LQRA 1SQ5A 3K8YA 3NH9A 1YE8A 2FFHA 3MAAC 3AKDA 4HLQB 3SBEA 4D0NA 3I61A 3VX3A 3M0EA 5EZ5A 4CW7A 5CM8B 2WJYA 1Z08A 1ZD9A 1G6HA 3WP1B 1Z07A 2ZR9A 5L3QB 1NSTA 1IN8A 4BFYA 2D7DA 2VP4A 3I73A 4Q4AB 3AVWA 2QM8A 1EFTA 2CHQA 1PVOA 1A7JA 2JA1A 1MV5A 4PO1A 3NXSA 4ZCIA 4PZYA 4NCKA 1ZYUA 2GILA 4DRZA 2XTMA 3B9QA 2VQSA 3IKJA 4R98A 3VHLB 2BCGY 1HUQA 3THOA 2YWEA 4LI0A 2BHRA 2CK3A 2G6BA 1Z83A 4XWOA 1OF1A 4P33A 1FW6A 5CYPA 3JZMA 5JS8A 4TYPA 1E9AA 1S96A 3P20A 2G1JA 2FSHA 4MRSA 1XEXB 4WZAE 4KITB 1XZPA 1AZTA 1GKUB 1NVXQ 4HB4A 4ZV4A 3FMFA 4BLSA 1U2RA 3WMEA 2P65A 4EPXA 3HU3A 1G1MA 3KQHA 5FTKA 2P67A 4OQMA 1DS6A 4KSBA 2ZJOA 4A8JA 1R8QA 2QUZA 2FEOA 2ZS7A 5M04A 3T5GA 1QVAA 2IF0A 2W6IA 2YWFA 3I8SA 4NBSA 3ONWA 4MDFA 5EXTA 2PLFA 4GMXA 3ND8A 3L8YA 2C98A 1ZRHA 3HR7A 4DLVA 5JMTA 2Q9AA 1QHHA 4G0NA 5FUYA 3KJHA 1ONBA 1YZLA 1R5NA 3QNUA 3LFUA 4YONB 2FPLA 2EWWA 3L0PA 4XVQA 4BFUA 1JAHA 1KJZA 3ZGXA 4HYYA 1HQYE 3SFZA 3OIUA 5FL3A 1S8FA 3TSOA 2F1JA 3QUSA 3R9XA 4D4MA 3ZYCA 4DSOA 3HU1A 5BQ5A 3MWLA 1FX0A 1CKEA 3CBQA 4X8LA 2W58A 4HDOB 5HZHA 3EIEA 4RD2A 2A30A 1O3YA 2YYZA 1OHHA 1N6IA 1F6BA 2ZETA 2FWRA 2OFXA 3B1VA 3AGQA 3EZFA 3TBKA 2J87A 3V4FA 3FMIA 1W2HA 2H92A 3IHWA 1OXUA 2OZEA 2X2EA 2H16A 4K8OA 2FEMA 4LJ9A 4C0SA 4E22A 1DELA 4LHZA 4RY2A 2EFCB 1FNMA 4NTZA 3TSZA 1JJVA 1FPMA 2O5VA 3U3MA 2FNAA 4TZ0A 1OSNA 2WKPA 1KO1A 2Z4RA 1GTVA 2W6JA 3ADKA 4Q1CA 5EUQB 2IUSA 2REXB 3AP2A 2AR7A 2YC2C 1UM8A 1E9EA 4WAUA 2ZRMA 4Q9JA 5IK2A 1GOTA 4HAUA 4F38A 3W8RA 1XNJA 5CJPA 2XZLA 3QKUA 1QRAA 3LX5A 2R9VA 4AG6A 1IJFA 1DE0A 1SHKA 1IOZA 1OIVA 3QBTA 1SULA 1WCV1 2XSZA 4A0FA 1T6NA 4Q21A 4QHTA 1U0JA 2ZUCA 4JLAA 1TQ4A 2Q21A 1MO5A 3SYKA 4UJ3A 4ON9A 1ZUIA 3DZ8A 5DO9A 3N70A 4PO9A 4JVMA 2GF9A 4GOKA 4B2LA 1T0HB 2NPFA 2IA5A 3AV0B 4X8MA 1R8SA 3BFKA 1LV7A 3AVTA 2J3EA 2QI9C 4MH0R 5G40A 2QGNA 2Z5FA 3AKYA 5F2EA 5A4JA 2FX3A 2I1QA 3MMPA 4JYCA 4QFMA 1VIYA 2OHFA 3U7FB 4IOJA 2OCYC 1H8HA 4UNPA 3GLIE 421PA 4CEIB 1BYIA 2LWIA 1E99A 1GL6A 1QHHB 5DIFA 3OAAA 3SC3A 1K5DA 3LA6A 4E03A 2CLCX 4KFTA 2OCBA 3LXRA 1I2MA 2FH5B 4NPHA 1S4QA 2J1LA 2GHIA 1HE1C 1E79D 3PG5A 4GI7A 4ILEA 1V43A 2OXCA 221PA 5LB2A 3EPKA 1AK2A 1S3GA 4HUQB 1LF0A 3A1TA 3H4MA 4BFVA 4V0ME 4LUCA 3QIAA 4DKXA 1ZIPA 4ZIRB 1E0SA 2FN4A 2J5XA 2PLRA 1EFUA 1DAKA 1KI8A 5K8TA 3FE2A 5K8LA 1CXZA 2JIZD 3WBJA 4UNQA 2H8KA 2RHDA 1HQCA 4BQSA 2NO6A 4E07A 2GCPA 1JPNA 4JBYA 1RPZA 2NZJA 2O0KA 2DWOA 4QNMA 1S1CA 4WZBE 3DMDA 4LHYA 1UKYA 3TSWA 5B57C 3QVUA 2A5GA 2GK6A 3CKLA 3U3JA 1YZTA 4LBZA 5KNCA 4DLZA 1ZNZA 2QMOA 1I2DA 1UEIA 1FMJA 1KSFX 1NRJB 4ZKEA 5HTKA 1T5IA 2WWIA 2YHSA 3ZZTA 3B1WA 2AWOA 4HB0A 4XD7D 1VG0B 3WP0A 5FL7A 2AXNA 2Q9BA 4JBXA 2ANBA 1CEEA 2A9KA 2D06A 3AVVA 3K0FA 3NC0C 4GT1A 1DAFA 5EUMA 1OE0A 3TRFA 5FOWA 3AP1A 4BASA 2WWHA 1N2CE 4BFZA 2J45A 1N5KA 2V3CC 2DB3A 3KJIA 2WWWA 2VL7A 1BMFD 1II9A 2FGJA 2FZLA 4TWZA 1CIPA 4B48A 2ZI3A 1VMAA 1ELOA 4TSFA 3B78A 4MRVA 3PR1A 1G3QA 2ZJAA 3IQWA 3EXAA 4Q9HA 1M7GA 1U90A 1W0KA 4HEJA 5FI1B 1TADA 4ZI3A 4RD1A 3OHMA 3K0CA 1IXRC 2DWPA 2EVWX 1DEKA 2ZRDA 3DM9B 1LY1A 3C41J 1F2TA 4DCSA 5TARA 2VHQA 1EWRA 1F48A 4TMTA 4V0NA 2OT3B 2G1KA 1QG4A 4EFLA 2ZSEA 2QU8A 1U0HC 3AF4A 4OK3A 2IUTA 4L16A 2OXRA 4RFSA 4C30A 1YR6A 2F1HA 1SVMA 4R7ZA 2OG2A 4JLOA 4ARZA 3ZJYA 1P2UA 1UF9A 3U6KA 4MKHA 2BBOA 2IYWA 2JJ1A 2IYYA 3LQQA 5GJCA 3ZDQA 4NYMR 4BRUA 4D4JA 1YRAA 1GNPA 3QKSA 2J0VA 5AWFC 3QF7A 4TQUS 4URVR 2PCLA 4LSGA 4QJ5A 1YZUA 5BN5A 2NG1A 2GDJA 1E1RA 4TMZA 3RC3A 1A5TA 2EYQA 3KB1A 4PTLA 4KU4A 4LPSA 3QJYA 3B5JA 4RD3A 1E2HA 4DUGA 1W4BA 3BORA 4AY2A 2P5SA 2BMDA 5AJXA 3B1ZA 4Q4LA 1ETUA 5JI3E 2BCJQ 2W0MA 3R7WA 2XOKA 3R8CA 2ZAOA 2ZRBA 2MMCA 4P32A 5FUXA 4TYWA 2JDID 3DL0A 2Y8EA 4DXAA 4Z8XA 3KUCA 4P31A 1R0ZA 1SVOA 2XNDD 4KFRA 1E1QA 3NBYC 3UATA 4JVNA 3SNHA 5KO2A 2RGGA 3ZS9A 3GFTA 1RYHA 2W83A 3UMFA 3VR4A 4A2QA 2QE7D 2QSYA 4PPQA 5LD2C 4Z1MD 2NIPA 4D25A 5GJWC 3VMFA 3UMSA 5HKKD 2LKDA 5FBVB 2JLVA 3K0EA 2PZFA 5FOUA 2EQBA 3A4NA 5CK5A 5C46F 1Q21A 2P3SA 1TNDA 5FH9A 3VHXA 2ZR0A 1U94A 4Q4HB 2OAQ1 1GILA 2W2XA 4HAYA 4V0KA 4IXNA 3CZQA 4FCTA 4NDZA 3PUZA 5SZJA 1Q12A 1XTIA 3ZVNA 5DISB 1L4UA 4IDHA 1NJGA 5H1YA 1MABB 3JVVA 4YMVA 1ZNYA 2B21A 2BMEA 2NTYC 2PZGA 2H18A 1FZQA 4PSKA 1GKIA 4B33A 3QXJA 3H84A 4PZLA 4MYHA 4UNSA 3EX7C 1F3OA 1J70A 1XJCA 4RFSB 3BGWA 4L9SA 4RKEA 3E1SA 1Y3AA 1HT1E 2IT1A 3U7GA 2ZUDA 2ZJYA 2ZSFA 4ARZB 2QRNA 1CRQA 3QF4A 3QQ5A 1IY1A 4AG5A 1MKYA 1M6NA 2YWGA 1XD2A 3RDPA 2Q9CA 2IS1A 3QKSB 3B82A 4OHXA 5LD2B 1AKEA 1ZC3A 4D82A 3PFIA 3NVAA 5AUQA 1NLFA 3K9NA 2DFNA 4NYIQ 4U7DA 1ZUNB 4KVAA 1O87A 2CEAA 1XPOA 1G17A 3EPLA 2IWHA 3KJGA 3VR3A 1Q1ZA 2ZM5A 3AUYA 2Z0MA 5DYGA 3NC1C 4GMDA 4HZUB 3CNOA 3F5FA 3CRMA 4Q1FA 4BZPA 3PIRA 3R20A 3Q7PA 4DZZA 4YLGA 5CIQA 4BECA 1GG2A 3I1FA 2PT7A 2VLIA 4XJXA 3W6PA 4PHFA 3TR5A 1B0UA 3U6BA 3EASA 4K46A 5CYOA 1CS4C 4BZXA 3IO5A 2CJWA 4NP6A 3HPRA 2IWRA 1LW7A 1R0WA 4WZ6A 5ANRB 1E2MA 3MFYA 1D9ZA 1C9KA 2CNWA 1YJ5A 4EDHA 2GJSA 2ZANA 4NZYA 3DKVA 4UNNA 3W3ZB 2B92A 2VRWA 3PEVA 4B3GA 3C5CA 4LJ5A 2VSXA 3N2EA 2JAQA 2OLKA 3TQFA 1ANKA 1LNZA 1XXHB 2QM7A 2H57A 2VP5A 4URYR 3K9GA 3Q5DA 2WSSD 2QRZA 3VR5A 4ERNA 2HYDA 2V54A 2VP2A 4IEIA 3VKHA 3C8UA 1OXXK 2QMEA 4KFUA 3ZQ6A 2R6AA 3Q85A 3AH8A 1NY6A 621PA 4EPRA 4B44A 3Q72A 3MLEA 3H0KA 3GFPA 4D80A 5FOSA 4QGHA 5DHFA 1UAAA 3FHCB 2ZYVX 5SZIA 4YMSA 3NH6A 2JGNA 3AVPA 1US8B 4RZXA 3M6AA 4M9XA 4M0LA 4KHZA 3QF4B 4A2WA 2WSMA 4RJLA 1P3JA 4OHWA 2X77A 2F9LA 1FOEB 4M53A 1KI6B 2GXSA 3E5HA 2AK3A 5FOXA 3KKNA 4B74A 1XD2B 3QEOA 4GRAA 4RD6A 1NIPA 4A36A 4D6PA 1MOZA 121PA 4GOXA 4MYUA 2ZITA 1XDBA 1SKQA 2C8VA 1KDTA 3CWQA 2P5TB 4B71A 1E9CA 2QP9X 3EA0A 3AVYA 2DFKB 1YVDA 2R2AA 4A92A 4Q1DA 4NCHA 4CZ2A 2O8BA 3FPAA 4DBLC 3K09A 1HURA 3OF5A 1R6BX 2C9YA 1AN0A 3KXLA 4JZKA 3T1TA 4TT3A 2FPKA 1JQLB 3GCGA 2J59A 4KYUA 1NSFA 1DO2A 2BEJA 3EPJA 3PUWA 3QE0A 4M1WA 1TF5A 1G8PA 3AVQA 3MJHA 4KYIB 4HLCA 4DCTA 3I3SR 5GJBA 1G7TA 1A82A 5CDFA 2NGRA 3LWNA 3U3RA 5DYIA 3ZZUA 1JECA 1W49A 5FTNA 1N6LA 2GJAA 3G82C 2JJ2D 3GJ0A 1Q1QA 2ZROA 4PX9A 2ECKA 3T1QA 2HUPA 1G4UR 5DE3A 3REGA 3ZS8A 1NMYA 3NBFA 1GDDA 2OCPA 1E2LA 3BB1A 2WKQA 4IKEA 3W8NA 3JVUA 4JT2A 4B34A 1W2GA 2ZRAA 5KSYA 2JCSA 5TDHA 2WJVA 2B8WA 2ORIA 1IY0A 4P4UA 2VHCA 1S2MA 5J4YA 3GLHA 3BRWD 2WVJA 3CRVA 2AD5A 1LS6A 3GEHA 4JLKA 4KAXA 4LHVA 4BGDA 1W4AA 1G3RA 2IF2A 3FGNA 1GRNA 2EYUA 1OFHA 5LBIA 1LF5A 4UKDA 1FMLA 2GESA 4NYMQ 3LO5A 1Q3HA 4QKQA 1YKSA 4Q02A 4Q9LA 3R9IA 3B60A 5DN6A 3W34A 3W9YA 2YV5A 5KYKA 1UKZA 2ASEA 1IN6A 1BO6A 1CTQA 1H8EA 3T1VA 2HCBA 3IO3A 3T34A 3W90A 2RGBA 1GAJA 2MMGA 3NEYA 4DLRA 4LYJA 1P4SA 2R6DA 4URZR 3B7GA 3NG1A 2WOOA 4BLPA 1XXHE 3IGFA 4Q7LA 3OEHD 3VQTA 3Q5EA 1E79A 1SXJC 2ZR7A 3ZH9B 4DSTA 2JLXA 2QMHA 3DM5A 4G01B 3PUVA 3AKCA 4B35A 2F9MA 4KCGA 2FOLA 4A9AA 1TU3A 1RC8A 1WMSA 1CJVC 4ITRC 4OK6A 3CH5A 3MD0A 1ZU4A 2PL3A 1G4AE 1W46A 4XTRA 5AJVB 1AIPA 1IN4A 2F1RA 1M7HA 1D6JA 3TAHA 1WXQA 1FP7A 1YZGA 2ORVA 4XSGA 2BKUA 5L3SA 1J90A 2ZRLA 5GADl 1VDZA 4IVPA 4RD0A 5A0FA 3ZIAD 3KFXA 3KQLA 3PITA 3SJBA 4LGMA 3A36A 1D5CA 1G64A 2RGEA 1ZCAA 3QKTA 1WBDA 3FB4A 5SZKB 4TMKA 2ZRGA 3PEUA 1BH2A 1M34E 5HZKA 3ASYA 4TL7A 2CHVA 3GLGA 3GLHB 4IOLA 3KTAB 5BW8A 3CWZA 1FL9A 1SXJB 4I4LA 2BBTA 4FWTA 1W47A 4O2LA 1E2FA 1SVWA 1OFUX 1E2QA 3CF2A 4FI3C 1ZAKA 1JXMA 1A4RA 2DFLA 3B1XA 1J2JA 1NVVR 3JZAA 2IS4A 4KFSA 1FTSA 1GUAA 1QBKC 3E2IA 4S2EA 1DOAA 1G7RA 1AGPA 5JSZA 2CXXA 3LVQE 2J0UA 3UMRA 4OHYA 3PXGA 2A7QA 5KU1A 4MITA 2WIBA 1P9NA 3CF0A 3NHBA 3UKDA 2IYRA 2DPXA 1E32A 3TVTA 2BJVA 4L8GA 5IDVA 1RRPA 1VHTA 4F93B 2V1XA 2E9SA 3EG5A 1WF3A 1ZINA 1U8ZA 2ZI5A 2J7PD 1F5NA 4LHWA 4ZO4A 4M1KA 4TYYA 4DDVA 2EU8A 4AWXA 1D2MA 4US2R 4DIDA 3ADDA 2IX3A 1W4RA 2EFHB 3SJAA 5TXGA 3MWJA 1XRJA 4NYJR 1SVSA 3PJRA 1VG8A 2ATVA 2FFBA 5CLLA 4P3YA 3I62A 2WOJA 2GAOA 3A1SA 3L0OA 4RZ3A 2PMDA 4G5GA 4OL0A 4AD8A 1VCOA 4MQBA 4TLCA 2AKYA 2VA8A 4OKSA 4DLWA 1G291 4US1R 1R7RA 1J7KA 2C9OA 2E1RA 2NO7A 4KVGA 3BE4A 1HYQA 1XMIA 1RW4A 1AQYA 1NMZA 2QROA 3OIWA 2VHTA 3BFVA 3BOSA 4KODA 3VTKA 2ZSDA 1AA9A 3RS4A 4DEXA 5JRJA 1W5TA 2OM2A 4Q1AA 1RIFA 5FBQB 3RVBA 3X1DA 3WNBA 1ODFA 1E94E 3W6NA 1PUJA 3OFND 1IQPA 2R65A 3FHOA 3QENA 5EP4A 4LV6A 3RRZA 2OO7A 4KLZA 2RKOA 3CX6A 3QVVA 3K0AB 2AFIE 1NN3A 4DLYA 1XBTA 3TR0A 4BLRA 5FUVA 3GLGB 2WTUA 1D9XA 4HAVA 4A8JC 2AKAB 1OV4A 1VCMA 4LJYA 1KJWA 5C1BA 1XD8A 2G0NA 2V55B 2XNDA 2WAYA 4ZDWA 2QE7A 4AC9A 1COWD 3CNNA 4DLXA 1JJ7A 3W3AA 2CCGA 4BFXA 4MKIA 1JXOA 1YR8A 2HT6A 1NF3A 4PC7A 4MGKR 2JLZA 3THWA 5JSZB 3TH5A 2J0UB 4LV5B 3K70B 4OK5A 1ZJ6A 5D3MA 5JHGB 2FU5C 1E2DA 1UFQA 1TAGA 2OESA 3GLFA 4IJMA 1K5GA 1ZCBA 2GWHA 2ZI9A 2HXSA 3GJ6A 4LDJA 1P9RA 1GNRA 3AVOA 4GOJA 4KXFB 1CF4A 4F4JA 2I3BA 1KK0A 5EXSA 2QZ4A 1VPLA 2JLWA 4B3CA 4M1SA 4Q9IA 1RRCA 4XIGS 1XJ0A 4YMUA 1II8A 4A15A 1WE2A 2Z6VA 4B6EA 3CPHA 4V0OA 1VIAA 3QXCA 4RSGA 1E2EA 4B6FA 4LY6A 2NMVA 1KNQA 4NCNA 2C96A 3GLHE 5EE9A 4PAOA 4A8JB 1SXJE 3HPQA 1DPFA 1P61B 2CBZA 2F6RA 4PQYA 4O0MA 1DVRA 3OEEA 3DEFA 5L3RA 4BLOA 3U61B 2ZUBA 1AGRA 1I4TD
chains in the Genus database with same CATH superfamily
4RVFA 4I0WB 2DR0A 3ITDA 4LIPD 1UOOA 3MAGA 1KI2A 1ADJA 1EDDA 2FSVC 3CZCA 2Y0CA 5J4LA 3N9IA 5HIKA 2PX5A 3O9MA 3ZV7A 5DOVA 3TGLA 3ZHUA 3CSSA 3OE7A 1NUTA 2YNMD 1HZZA 2VRBA 4YMHA 4PCAA 3WLFA 4GMFA 5JADA 2O8FB 1R6XA 4GECA 4LZZA 3I28A 5TEWA 3I5AA 3LF1A 5CCEA 2QW8A 1V7CA 4Y2HA 1EK0A 1GITA 4JSYA 5GOZA 3GDWA 3NX4A 4MS1B 1T9BA 1FX0B 4X6YA 2EW1A 1JTFA 1G5IA 1TUBA 3R3VA 4H08A 4TROA 4UUNA 2GZHA 4F7DA 5AVTA 1M66A 2CCKA 5F21A 1X8JA 2BMAA 2FW8A 1OWLA 2ZJ5A 3CGGA 1R9JA 3A11A 1FQJA 2ZPTX 4RS4A 4UATA 4IX1A 3CNBA 1W4CA 3Q7SA 4YJHB 1QZUA 4CKEB 3JZIA 1ZGHA 5DYWA 1VM6A 5B37A 1TGVA 2X1HA 4Z4IA 3Q8WA 4FFVA 4JYAB 3PNYA 2A88A 3PB3A 3R74A 5DHAA 4BCBA 4RV5A 4ZAVA 2O5CA 3H04A 4X20A 1JA0A 4A6PA 2IRWA 3F98A 1X86B 2H1LA 2R1TB 4HS4A 3SBOA 2I22A 4B3DA 5HRAA 3CVUA 5I7EA 4Q66C 3Q3VA 4TTJA 2GEVA 4MUAA 5IBRA 3HA5A 4F72A 2A5DA 5I4CA 3GMIA 4EQ6A 3O0TA 1ZAYA 2YZKA 2XJ4A 1K7FB 4D0LB 3B7WA 4EBFA 5B3JA 2C7GA 3CNQS 5H70A 4AN1A 1GLVA 1R0KA 1V1RB 1GRQA 1IC6A 4FYHA 4Z54A 4CKZA 1E62A 3Q3GE 3D31A 1WW2A 2RGAA 3PQEA 2IS6A 2AN5A 3RB8A 2ACWA 2RJNA 3L01A 1YRQA 3EODA 3DDSA 1A2OA 4IJ6A 2HK6A 2FDRA 3AEKA 2XT9A 3USES 3OOYA 4XWKA 4GE3A 2J0QA 3H65A 3QHQA 3DMGA 2D1SA 4J6EA 5CFMA 1HE4A 4RV4A 4RSMA 4J94A 1BDHA 2E4WA 5AXAA 2HLDD 2JLCA 1NBME 4NARA 3RRYA 4BYGA 4F6CA 4JAVC 2E87A 1UBLS 5GVRA 1KFEB 1KO4A 1QG2A 2VP9A 1XTSA 4X9XA 3FVVA 5F4BA 3EQ2A 1I7QB 3AP3A 3NHJA 1EE2A 1TJNA 4WEQA 5BWMA 4QWMA 1W7AA 1OQAA 3DBVO 1P91A 2G5TA 2VJAA 3H9BA 4ER6A 2PKCA 5EL0A 2NUPA 1XMVA 5AH0A 5C5EA 1L4GA 4CI9A 3AKZA 1B1CA 1U0RA 1Z9BA 1YQDA 3VPGA 4IY1A 3FUUA 4UHJA 4JI8B 1XQ6A 5AJYA 3SXJA 1AZSC 1H3NA 1TRHA 4LOAA 1AXGA 1C29B 2O0MA 2B0JA 1MGPA 4YT2A 5ALGA 2R7MA 5ITVA 3J81k 3THXA 4PR0A 4ZDJA 1XVAA 3KSRA 5LQKA 3LIIA 4M60A 3ZVLA 1ORIA 2BI8A 2LXNA 3WRWA 3B1YA 3R8FA 1CJKC 5IVKA 2B94A 1XX6A 5FBKA 3U17A 3UXMA 1M9NA 4EPYA 1HL7A 5J2UB 1WP4A 1J56A 1RJGA 3BUSA 1P6UA 4DIOA 3E3LA 1X2BA 1VG1A 3UVEA 3CEHA 1F8YA 4YRQA 4YPVA 2C8JA 3EDRA 3MTEA 4JP3A 5HE9A 3V1YA 1H5QA 2CFSA 1JR3A 2GB4A 2HBRA 1VL8A 3EXFB 1ZMXA 2H8GA 4MINA 4MUNA 3GJ5A 4KPUA 3D3EA 4P08A 4H4EA 1H23A 3VR0A 3ZBPA 2XCUA 4L5JA 2AK2A 1MO4A 5KINB 4DR6B 1DCFA 5D5PA 1IDN1 2IOFK 3PHIA 2AFRA 4LS3A 1RPAA 1X1BA 3RS7A 5KCMA 1TT7A 4MWEA 5I9MA 1Q2UA 2BCEA 2FPSA 3DLAA 2AA3A 3UICA 3TAUA 2PUGA 5B4UA 1AF7A 3X1MA 4RE5A 1AGYA 3C3AA 3WJAA 1MB4A 4XM0A 4IIBA 3ZZMA 1R4NA 4KNWA 2I5PO 2QG9A 3RH0A 3WMFA 5J4KA 3O38A 2R0QC 3BJIC 3IQDB 4FMCB 2YR0A 1AT1A 2R97A 3TJRA 3A27A 3B36A 4B73A 2RHWA 5E38A 4MAFA 4A0GA 5PGMA 1P4JA 4BQQA 1C30A 5KI6A 4IQFA 1V1MA 4PZZA 4V39A 3T7CA 4EFNA 1SG6A 2C5GA 4JB8A 4IILA 4HUJA 2W6ID 4I08A 4KDEA 2OHOA 2YW2A 4U5XA 3ZNOA 3ZZNA 4RAOA 3T5MA 4E14A 4KBYA 5IJXA 4RFVA 2YYYA 1Q1EA 1JUDA 1UOPA 1TYDE 2GHTA 2R62A 3DV0A 2ZSAA 1XZLA 2WPDA 2ISSD 5I9BA 3UMCA 3NTLA 2F1IA 4NYJQ 2GYYA 1PBTA 2QVBA 4G2TA 5GV7A 2WIKA 4CT4B 3WWDA 2XXBA 5C7OO 2NV6A 2J85A 1XAGA 3HKCA 3RSGA 2FE4A 2ODNA 4E1BA 3UJBA 3A9UA 4EGCB 3PA8A 4EHNA 5JD5A 4BN0A 5ALWA 4ACAA 3ASZA 1CE8B 4I1OA 4I4TB 4N7BA 1NMXA 2NSDA 2IXTA 2PXCA 4ZC8A 3BH7A 2JAUA 1DJLA 1W36B 1E9RA 1V3UA 1CFZA 1BEZA 1D2NA 3FFBA 3U4GA 3OCYA 5EMJA 4RLQA 4BV9A 1I01A 3T7DA 5GWXA 5DYNA 4ZAGA 1PAUA 2IODA 1JJFA 3OPXA 3UMYA 3THXB 4KZKA 1F2TB 3CNLA 1L5GB 2B82A 1TEXA 3G0HA 4MXDA 1H2RS 4PANA 4I4CA 2YWJA 4IDEA 1OWPA 1EX6A 3GJRA 2X6TA 4EEKA 2FQQA 1EK6A 4DIEA 1A4UA 1JIJA 1BCRB 2X8WA 1WY7A 2RG1A 1FJGB 1RI4A 4QC2A 4A1OA 3NONA 1E3MA 4KPUB 4RVDA 1OAKA 2WM2A 3F90A 3QLUA 4RHYA 1C0IA 3AT1A 2OHVA 4QO7A 3FSGD 2DKFA 4C4PA 5BSRA 5B6PA 4JJ7A 1I1NA 4IJKA 3L0BA 3MCAA 5KS2A 1OXBB 4PSAA 3KZNA 5DU2A 2IPOA 2YIMA 4DLAA 1CERA 4I81A 1GTJ1 1OWOA 2HWKA 2C2GA 2G9VA 3D8HA 3IQXA 4ND1A 2YIDA 2AXPA 3AF5A 3LQYA 2XHEA 4IFBA 4FI3F 4W82A 1XMJA 2H3HA 4CMJA 1JHZA 5CFLA 2WM9B 3HMKA 4HWGA 1DKRA 2QOEA 1B15A 1R4NB 3O9VA 5KC8A 2GVZC 5EZ6B 5CD1A 5C53B 1IIBA 3ZJVA 3NOOA 1GM5A 1RFGE 4GKKB 1IVNA 3SS8A 4LYYA 1E1CB 3KYCA 2KBEA 3CZ4A 1YF3A 4R40A 2EFYA 4GSKA 2PMBA 1LBQA 2ODBA 3GR6A 5C1IA 1XRNA 2A4KA 3UCEA 4DNOA 2EZ4A 4C3OB 3NUGA 2FPWA 4Q9KA 2G5PA 3TOVA 1MORA 3D4LA 1QIEA 2B8EA 4PG4A 5HDQA 2GJ8A 3SEAA 1QIHA 2W6QA 4M7RA 3F97A 4F4CA 2RMKA 3UANA 4XQ0A 2Q5QA 3DV0B 4RIGA 1UBCA 1Z0DA 3IULA 5E7MA 1P73A 2DT5A 4WDRA 4RACA 4HAZA 2WIGA 3F8WA 2C0CA 3KTDA 2AZDA 1GRVA 1OTXA 2D00A 2WWXA 1FRZA 1U9IA 3F8TA 3H5IA 4UMDA 1DADA 3G9TA 4AO7A 2KQUA 2I62A 4RVUA 1F17A 3OOWA 2OD2A 2XT6A 3A58B 2FJ0A 3LCMA 2I2AA 3ER9A 1WDLA 3OMLA 1YBHA 1R4AA 4M7WA 2X2FA 3RU2A 4LKOA 4MHOA 2LW7A 2R4TA 4Q34A 5JU6A 3CPJB 4IO1A 3AQIA 3L7OA 4RL4A 4WNAB 2R1UA 1KDPA 4KWTA 3C45A 3AWIA 3BPSA 3HBNA 4N5MA 2AUMA 1GP2A 4ZVNA 5KVAA 4LVCA 2WHXA 3PGA1 3TZEA 2P4EA 1CZRA 2CYAA 2B0CA 2PX4A 1VCNA 3QPCA 4NV1A 5FYQA 3S2UA 1CNEA 3AKEA 2C84A 2ZATA 4DBVO 5ALZA 1M6VA 3WDLA 4FBGA 3NJ8A 4AL4A 2QRGA 2OV3A 1G5HA 1LI7A 3BXEA 3OPYA 4G23A 5G1PA 2A5JA 2IEIA 3H87A 1QSGA 2ZWIA 1J5PA 2GBLA 2D0IA 2Q3FA 4FK8A 1ZC4A 3VR4H 4MVJM 4IXWA 2ZAMA 4KJZA 1G20B 3I01A 3TEJA 1H3EA 1C7IA 1L5WA 1NUUA 1YR1A 2X1MA 2QY9A 1YZKA 3ABQB 1KAGA 3C1OA 3OY2A 4JLJA 4IIHA 1K6MA 5B58C 2X0JA 2BIFA 4GZMA 2HK7A 4MUEA 1I4DD 2X9GA 1RM0A 4IDAA 5HS6A 1N0HA 2VK2A 3E1KA 5BYJA 3W2GA 2YMLA 3AVUA 4WY2A 4CIDA 5K51A 4ETWA 1TJYA 4WBXC 1B0PA 1RVV1 2Q3MA 3T7RA 5DHSA 1X1CA 1RRMA 4JR1A 4B6GA 3UGJA 1IXYA 4U00A 2FETA 3ZD9A 2C7RA 1KRXA 3IBYA 1R64A 4BNTA 5I7SA 2B2NA 5DNUA 5KYXA 1XA3A 4P34A 5LDDC 1PX2A 5KOJB 2H11A 1LB1B 1MG5A 4UJ5A 3TD2A 1C3EA 4YCNA 2D1RA 5IM5A 1T0JB 4QRHA 3LYHA 3NJRA 4N3GA 2UUAB 1Z0ZA 4JBHA 3ICEA 3C4JA 2GYUA 3HGTA 1PZNA 2D5LA 6GPBA 1MEOA 4F0JA 2EG9A 2VNSA 3R0ZA 4MGZR 3A14A 3QHAA 1DX4A 1WCYA 5G41A 4MV4A 3BIXA 4N40A 5EKXA 2W93A 2RDMA 2P9EA 2F4NA 1JSZA 3K2EA 4XOIA 4UEOA 2O7VA 1IUKA 2WF5A 4YMGA 1Y80A 3R44A 4IHKA 2OXIA 1Z6XA 2JGDA 5KTRA 2ARKA 3V7YA 1W0KD 3I1IA 5E7JA 4HMOA 3KJQA 3AZPA 4TYQA 3W2FA 1WCXA 1FTNA 3H8WA 3SIXA 3DD5A 3UMVA 2UVPA 4JK3A 4B9EA 5CFZA 3HGMA 3RIYA 4F91B 4QM6A 2ON6A 1KGDA 4UM7A 1T3HA 5JEEA 1TMKA 2FR8C 3NMUF 1UDXA 4EHJA 4QWWA 4NABA 1JR3E 2PR7A 1GKYA 4IVRA 5C8XA 3U4QA 4XD2A 3A6EA 3KPUA 3BK1A 4Y2XA 5TF0A 1F0YA 2Q3BA 4H59A 5HX7A 2Q29A 3OC0A 3RKSA 3RT9A 3A6KA 3VGPA 2DUUA 1ZJZA 1XTQA 1SVKA 1XVVA 3OG9A 1RI5A 2BTEA 2IYOA 3RAPR 1DARA 2R79A 4EO7A 1K63A 2AQ8A 1E7MA 1A8IA 2E21A 4DZRA 1C80A 1JG4A 4X62B 2J5BA 2F43A 4FNGA 1V4BA 2CDNA 3QH4A 3VYRB 1YJXA 3EOBI 4QNNA 4NU6A 5DBIA 2BHNA 5A3SA 4HDKA 4LFAB 4DWWA 2GOYA 4D9GA 4IBOA 2D0OB 3EQ7A 3BWMA 4B7CA 2WYHA 3I2KA 4BL5A 2H7VA 4N8EA 4E13A 4IVNA 2GXUA 2D1FA 3QV2A 5IG2A 3P9RA 4RSHA 4U5QA 5LQUA 3RVNA 1SCNE 2KX7A 4J91A 1Z5ZA 3K9BA 4PO8A 3ULKA 3SXUB 4MW2A 4DLTA 3T5DA 3IA7A 3E61A 2IYLD 4P4TA 5HRUA 3O4IA 3KIPA 1KGSA 1ZJWA 1OVMA 1JFRA 4MLZA 2VHJA 1W75A 2C2HA 2XMBA 3LXUX 2WAXA 2H3EA 1DQNA 1YFJA 3LT0A 2CCJA 2J0EA 1IEXA 1WDWB 4KXNA 3EFEA 2Q2OA 2GNPA 2XOKD 4MR9A 3RS0A 1PNVA 1IQ0A 1P2TA 5IVPA 3USZA 1M6WA 4AICA 1Z2AA 3SQNA 3ZE7A 1SQ0A 1U4SA 2RFLA 1X9GA 4A16A 3D8BA 4DQXA 4B4OA 10MHA 2P6NA 2R2GA 3QFRA 2AWNA 3AL2A 4LNUB 3WGYA 3RSZA 1OI3A 2GVDC 3GJTA 4OLFA 3WFJA 3GLIA 3E5MA 3OSUA 2R6ZA 3GA7A 4Q18A 5JG7A 4AIIA 2ONKA 5ERYA 4BFWA 5HKOA 5ICFA 1DUVG 3I32A 2N3ZA 3EW7A 3S1LA 5BVGB 1HBJA 5J2UF 2LZ0A 3CLRD 5TB5A 2P75A 1A8HA 1E2NA 5EKDA 1K4MA 2PT9A 1C7QA 2VF2A 3GVXA 4ZVLA 1TCAA 3H5OA 1M76A 1M2VB 1L4LA 2QG4A 1JHQA 4M8KA 2OO5C 5I7OA 4GQAA 5DLDA 4NU5A 3RYFB 1ITZA 1QX3A 2UVPB 4RDHA 3FVQA 4HNSA 3UJ6A 1G20E 3IAAA 3CHYA 3GCXA 4R01A 4JUAA 2MYPA 2OYSA 2DECA 3EBOA 2ZUFA 2JIZA 1XEXA 4OAOA 3P32A 3DXFA 1K1EA 1QH0A 5CVUA 1V8BA 1PK9A 1N6KA 5EY5B 5HUJA 1OI2A 2O6LA 4UTOA 4WFJA 3SI7A 4WADA 2G6TA 3M82A 2R8EA 2OFPA 4X24A 4U6SA 1K3FA 2YDXA 3AHIA 3HP4A 1L1RA 1SXGA 1TUGA 1Y4DE 2EFGA 3K1AB 1GCGA 1RDFA 3LA8A 4FMBB 4FMCF 3A6HA 1CJBA 1Z6ZA 5AK4A 4I3HA 5A1JA 1XPUA 2FHSA 1KEKA 2PKRA 2E3JA 2QTZA 2C97A 2RI0A 3RWBA 2IZZA 1PJRA 4XD7A 2OFWA 3FDFA 2C03A 1ETHA 2D5IA 4J2OA 5IKXA 3RAFC 5EP2A 4IPTA 3NRCA 2B8JA 2D1QA 4QECA 3OLVA 3Q87B 2DSNA 2KJQA 2XMDA 4FCWA 1RD4A 3RTEA 4BVGA 2YZ7A 5LBUA 3NHSA 1U2TA 1NQWA 3HL0A 1Z2NX 3T4UA 4FWBA 4GLJA 2Y1DA 3ETHA 1BMFA 2YS7A 1E5DA 5AKIA 3U4AA 4ETMA 3U7FB 3OLYA 3BGDA 3PUJA 2FSPA 5NULA 4QSHA 3TAXA 4CETA 1VGVA 3E6AA 3JVIA 1RZRD 2X4IA 3WO0A 1ECCA 3QXGA 1S2IA 5AIAA 3TBFA 1YDMA 3IIKA 2XODA 4X1YA 3TDMA 1KP3A 4F9GA 1C8BA 4MR9B 1FFWA 5EPUA 4I4TF 1LSSA 3LHFA 1EIWA 1EAMA 2Q1XA 1YA8A 4JLMA 5SY4A 2ZS9A 3WADA 1SUPA 5CVDA 5A4DA 1MZVA 4AJHA 4FMDB 1NNSA 1UJ4A 2F00A 5IXJA 1SKMA 5IHPA 1PT6A 1HT2E 2GNOA 3BSYA 3R3SA 3T15A 1KNXA 2G8NA 3C24A 3KDSE 5TMDA 1QYRA 4QUEA 3VO1A 3WE7A 3WLLA 1ZUHA 1JYEA 2C99A 4EYKA 3GLIB 4IVQA 1Q1GA 3DQZA 3PQFA 1U8AA 4UPVA 2DE0X 1GQRA 2BSAA 3WY9A 3KSAC 2PN1A 2JGIA 5KTMA 2O57A 1UPXA 4MWZA 4DR7B 4RADA 5KX5F 3O8DA 2CNWD 2IKQA 5FO0A 3HUFA 5EHQA 5FQNA 2IOQA 2AEJA 3PNPA 4KPGA 2PNFA 3G0DA 4RF4A 4TLAA 4WGGA 1O0SA 1QK3A 1I6MA 3JYPA 1J8FA 1C4WA 2D1YA 4FQ8A 4U02A 4OB7A 5KU7A 4CEHA 1TU0A 2C3YA 2OWEA 3FNRA 4C3UA 4A8PA 1UC8A 4CQMA 2NQ2C 5JYBA 3IB3A 2AX4A 3L8EA 3CX4A 4XGIA 5K7SA 4XVHA 5JW6A 3GF4A 3D6UA 4HHEA 1LJUA 4JLDA 4XYMA 4IIVA 4AKHA 1UKCA 2V1UA 1YC5A 1FK8A 4U2EA 1DKOA 5JS6A 4UM9D 1QHEA 1U98A 1LVGA 3TRDA 4MX8A 2WG1A 4YA6A 4M22A 3L43A 3REFA 1PG0A 4XDYA 1AQIA 2A5LA 3MJEA 4RHXA 5CBPA 3QU5A 2UV8A 2C2MA 1B73A 4PLTA 4BRZA 2HA7A 1GZ6A 2OGUA 4D44A 1FUUA 1VLHA 2CL5A 6LDHA 1L9XA 4E70A 4IOMA 1AHIA 1NG9A 4HDRB 2VO1A 1Y8RA 2BUCA 4CR7A 3SD7A 1RZVA 1Y7TA 3AF3A 1PBNA 3PPIA 2QRPA 3UAYA 1EPUA 3RIEA 1HTBA 4ZODA 3S2GA 3Q3IA 4TX1A 3L79A 1YR7A 2AL7A 3ZHQA 1UADA 3DE5X 4IXMA 5HZGA 4Q3LA 1F38A 3HHPA 5CLQA 4JIGA 1WQ1R 2GAJA 3GEIA 4J0QA 1SCQA 5C1OA 2UYOA 1NF2A 4O5AA 2PSHA 3ORSA 4XDGA 1NW4A 2WUEA 3JQFA 2G67A 1R6DA 4LHSA 2XPCA 4TWIA 5LQJA 4X1YB 4KIUA 1P7PA 4PYNA 3VPDA 1CLUA 1IG3A 2P90A 3BRCA 3KKEA 1G6OA 1T5BA 4W5HA 5CDFE 1NNUA 4BEBA 3F6PA 1J7JA 3QUTA 5H83A 2BGLA 2ZSHA 3K92A 3IP7A 3NEAA 2A59A 5LYJF 2QP3A 3QW4B 1T9CA 4CHTA 1P0CA 2VYNA 5LLTA 3LPDA 3W04A 2DFTA 5FPSA 2RHJA 5T8KA 3A6PC 4MJXA 3TZ6A 1RFLA 1N92A 2AFHA 2BKLA 3VJLA 2X0EA 3K0SA 2OGTA 1FSPA 2Z58A 1T8YA 1CPYA 4EY4A 4RTJA 4ARAA 5ITZA 2EX1A 2ZI6A 3BCHA 3VZDA 4RC9A 3LQ4A 1RRKA 2C20A 3E9CA 4RKWA 4BN4A 4ZVUA 3Q6IA 5ALPA 1X7ZA 1C41A 4NYIR 3NVKI 4YMTA 5FR2A 4QFCA 1U1EA 3TOZA 4CEHB 2R6R1 3ADBA 1GFIA 1EWKA 3D2AA 3O3MB 3LUKA 1NIJA 2OILA 3ORYA 1GPKA 4KAJA 3O47A 3SOPA 2BISA 4F5WA 2WEKA 3FYHA 3B1KA 4GG1A 4S0ZA 4GIBA 4FN5A 1UEJA 2HIMA 3KEQA 4GX2A 2WRZA 2QJOA 4U4AA 1JFVA 4O2RA 5IRCD 1U7UA 1MB3A 3ORHA 4J3NA 4YO8A 4QOIA 3A25A 1TM5E 1EKXA 1ORVA 4I1UA 2FVYA 4HO1X 1I4LD 1Y42X 4M87A 4AP5A 3LQFA 4QOFA 1R0CA 3PD1A 4R68A 4EHLA 4BQIA 3MRTA 2VYQA 2XGGA 3AM5A 2AW5A 3PCXA 4FDAA 4BB6A 3RJTA 2EJUA 1J0CA 3L46A 3AQ4A 3E3NA 3JPWA 1V95A 3R5TA 1LDEA 4GR4A 5G3ZA 2QKYA 2OKGA 5I4BA 4DCVA 1C0EA 1D0VA 2JJQA 3VU9A 4MVYA 4YFYA 1Y4AE 2WJHA 4QRDA 1S9DA 2FMIA 4UMEA 4GR5A 4D41A 4CGZA 4X5OA 5DMHA 1VECA 1TF2A 5D86A 4F3RA 3RBZA 1H8ED 1KVUA 3FDJA 4P0QB 1FNDA 2ADMA 4PSDA 3SSNA 4GW3A 1L5YA 2P7IA 2YXDA 2V7EA 4X65B 2AI2A 3EIQA 1R88A 3L1JA 4QFBA 4OX9B 1FDRA 5B12A 1TTHA 3PDJA 2BZ1A 4PTYA 1BJTA 5TQVA 5FPHA 4QVIA 2Q6VA 4JI5B 1OVGA 1N6RA 4P4GA 5SV2A 3C6BA 2MSCB 4UDOA 1EESA 4TTSA 5AP9A 1Q19A 2R7NA 1S0UA 1HZZC 2VEOA 2X7JA 2WF7A 3THWB 1J97A 4UQOA 3HZHA 1ZNWA 1ULHA 2IYZA 5D3MB 5FHQA 3ZX5A 2I7DA 2IHUA 2VVTA 4WOPA 1D4AA 3NOXA 4TKVA 3JQ8B 3O8LA 4IMRA 3T0GA 3BKXA 2FPUA 4P3XA 1BVUA 3RRJA 1TQ6A 4JUDX 3TRHA 1YU9A 2PZKA 1MX3A 1GU7A 1FQOA 1F14A 2EBFX 5SY9A 3NNSA 4Q7KA 4H1UA 1PL8A 3X1YA 1CR2A 1CDEA 1RMTA 2DULA 4LWQA 4QGBA 4XM1A 2AFHB 4NZPA 5DRTA 3M6LA 1II8B 1WXIA 2ZTLA 2J0SA 5IMBA 3G5AA 3JQ6A 2GSDA 2NT3A 1ISMA 5ITZB 2DWCA 2DRIA 1PDWA 1EE9A 4JOQA 3NWJA 4LGCA 1U31A 1CS0A 2AV6A 4DM4A 5DGHA 4QU5A 2UYCA 1JAZA 4WY8A 1X7ZB 1JI0A 3UK6A 3WHLA 4V38A 1DAIA 1RKVA 1DSSG 4ZDKA 3CW2A 5EIFA 3M49A 1OBFO 1JYSA 3S2YA 1KAOA 1QZ3A 4DN6A 4PFSA 4UCQA 4B7UA 1K7CA 1ABBA 2OEPA 4FYWA 3ZDEA 3FNQA 1AKQA 2P69A 2RAPA 3KFVA 4YFVA 1B74A 5B3JC 1M2HA 4NK4A 1NBIA 3NB0A 4ND8A 2NACA 3ROTA 1C1DA 1JEJA 3RTBA 3RS3A 5JAPA 4EVSA 4IV5A 2OO3A 3O4GA 1YBMA 4AWBA 3TW0A 1Z8DA 3MWEB 5CLFA 3AFIA 5JRDS 2GEKA 3DZDA 1O9GA 2VJQA 1P4GA 3T06B 1CCWA 3BWBA 4QOEA 3QKRA 3X1KA 2FF5A 3NFRA 2JAWA 4QGAA 3C70A 5LMUB 1U0SY 1U1IA 3P9PA 2P9QA 5DXFA 4HVCA 1QANA 2JFGA 4LJ6A 3KNZA 4Q4HA 2BWJA 2JGKA 2QJWA 1E0JA 3OZ7A 3VU9B 3ZD8A 2EP5A 3T7TA 1QFSA 1EX7A 1KAQA 1CR6A 1UPUA 1RXVA 4J1TA 2I1WA 3EOZA 2B35A 2B36A 3UJ3X 3J7AC 3G49A 3DHEA 1GGEA 1C3LA 3FIUA 2FQWA 4MVJI 4ZOQI 5KKAA 4AK9A 2QR3A 3I5YA 3OQHA 2JLUA 4X93A 1K8RA 3DWGA 2HJSA 4UAJA 3FNEA 3I6QA 3MQFA 3UWSA 2VF8A 2Y1EA 4ZYUA 4Q5IA 3CLHA 4R3WA 1EU1A 4BGEA 2FUCA 4XIYA 4ZV9A 3N07A 2GPJA 4BVKA 3KL4A 1ZHHA 4IKPA 3SVLA 4GYWA 3ZY3A 2JJ2A 1ECJA 1UBFA 3JARA 4A03A 4HLDA 4JQZA 4HV4A 5ALYA 3SF8A 2Z5VA 1JR2A 1XWFA 4D7AA 2C04A 2Y68A 1RMYA 2ID7A 4RPCA 5A02A 2BMJA 2H7YA 5LA6A 4P22A 1MEJA 2DG2A 1II0A 3K31A 2G7ZA 2YJTD 4OQYA 1K75A 1PR4A 2QTAA 4OYHA 1SC9A 2YXEA 2N46A 1Y9AA 3BRWA 3GJ8A 3KHTA 4L5BA 1KKLA 4UE2A 2ZIEA 3F0TA 5D00A 3KQVA 2W6MA 1YBFA 1J8YF 3NHMA 4LSZA 4IJVA 3ZHBA 4ALKA 4PNEA 4CQNA 2BFNA 4FZ5A 1SOMA 1TO1E 2ZE7A 1GVHA 4DB2A 4ZOEA 4EPTA 3NRBA 5YASA 2GPTA 2QN1A 4G2NA 4YECA 1A98A 1MB9A 1FXWF 4DLUA 4YJKA 4JJEA 3VJRA 3CE9A 3OZIA 3WIDA 4I2NA 1Z6GA 5K3FA 4ACBA 2YZ2A 3ZLBA 3ZV5A 4L5AA 2KE5A 1Z88A 2A0XA 4L51A 3O0DA 4ND8B 4TVSA 2MSNA 2QD3A 3P1JA 1C1DB 3DTYA 4IWNA 4W5WA 4AX8A 3FYUA 1HQKA 3AFOA 4FMDF 3T5CA 1K7SN 2GK7A 3BXGA 4MWCA 4KK3A 5KYNA 1N75A 2QRUA 2BELA 4ZYTA 1M2KA 1GPNA 1QE3A 3OEHA 2AN1A 3TE6A 1NAIA 3C6KA 1VLQA 4ZQHA 2DUWA 1HLGA 3QKRB 1QIKA 2DQSA 3L0SA 4TTQA 4A4DA 3KEFA 4EFKA 1DRKA 4QPNA 2DBZA 4W7SA 2G9NA 4D4LA 3E8SA 4EITA 5HM6A 2HA5A 1OIXA 3B2EA 3KKZA 2GTPA 1MAHA 4FD3A 3E58A 4E5UA 3FHTA 2AOUB 5BURA 2YWCA 3NKVA 3T52A 2AFHE 4ABTA 4B6QA 1MW9X 3HUDA 4F6RA 4C04A 1PTKA 2C83A 3HWRA 2R7AA 2BDEA 5JEDA 1K98A 4ZI2A 2O1WA 1URPA 2HF9A 4LOIA 3AEZA 1MAAA 4TL6A 1I0LA 1X8KA 2VF4X 5GQSA 4QLOA 1KDVA 1XZCA 2OBYA 4C0BA 1LPSA 1ZITA 5AJHA 1JHDA 3EVBA 4G5SA 1M1XB 3MHPA 1CRLA 1IXSB 3QQPA 1XI2A 4B6OA 4DV2B 2QR5A 1L4MA 1BEUB 3UQZA 1K8YB 1EBFA 3NBAA 4MRNA 3KLNA 3SJZA 1KZ9A 3SC2A 1G3IA 4JNKA 4P4SB 4GICA 1P6XA 4JGBA 4DUYB 1OB2A 5H4HA 1IULA 1TZJA 1HPLA 3CU5A 5H3CA 2A6PA 1NVKA 1UJ6A 4YUWA 4QIHA 3OEED 2X9NA 4OO3A 1A97A 1DBQA 5KVCA 2Q2NA 1AA6A 2VJMA 2JATA 4AURA 3M5CA 3R24A 2D62A 4FC6A 1YJAA 2EKDA 2V7QD 3KSDO 3C3DA 3KDAA 2POCA 2ZZNA 1HRDA 3MGCA 3QEMA 1OC4A 1I4WA 1L7QA 1NDUA 4GWLA 3CUEF 5M7EA 4E11A 3B9PA 4GL4A 3UJ7A 1QR2A 3VKVA 2I4LA 4C7JA 1GL9B 2LKCA 3NBZC 3WIBA 3CF6R 1MVNA 1K3UB 1TUEA 2OMEA 1F6WA 2QQ5A 1UBMS 3PQ6A 4JYBA 4RYDA 4ZCSA 3MT8A 4A6EA 4MRPA 1CUVA 1ZVKA 3W6OA 1R5JA 2CUZA 3DZKA 3NTRA 4F5YA 2Q5FA 2ZE6A 1UJCA 4CNBA 1TFRA 2O8DB 3QE4A 4LXGA 2PKQO 1JW9B 5DW0A 5E0OA 4JCOA 4GUDA 3KEMA 1PNTA 3PYLA 1XLVA 1Z4LA 2XMQA 2AJLI 5IU6A 5AVRA 2HM7A 3OIDA 5G4KB 3LX8A 3NYIA 1C5KA 3MLBA 4NEQA 4R8VA 4EKDA 1PSWA 4EG7A 1OKKD 1JHPA 4DCJA 3FYUB 3KKMA 1K8QA 4MUIA 4F2PA 3TMYA 4K9QA 3VX4A 2YKGA 3DDWA 4INAA 1F6DA 1PTJC 1E64A 2GCEA 2YOFA 3OX1A 4GX1A 1XFAA 2J09A 4RPKA 5DYTA 3FH0A 2RCYA 3N8GA 1BDIA 3TRJA 2Q9UA 2N47A 2QA5A 5DTQA 4F5ZA 5KDDA 4MAAA 3OUTA 4S3MA 1EP9A 5CB4F 3FTQA 3KPVA 1Z0IA 5DTJA 4F9TA 1SWVA 2Q1WA 1U9IC 3AXSA 4NJOA 3EZ9A 1VJTA 4BP8A 2ZXUA 3HCAA 2A3NA 3VDNB 2I6TA 4DRYA 4Y1FA 4KSYA 1ESMA 1J8DA 3UT6A 2DFDA 2HA6A 3NPMA 1PSDA 3OZTA 3HYNA 5TMEA 3V4PB 2WJJA 4N5IX 4UXHA 5LR6A 4DQVA 4MGIR 4U39A 3TZQA 3ZXSA 4F4UA 3EVZA 1QRUA 1ZG3A 4PRLA 2QN9A 2C2XA 4EKEA 1RZ3A 2HCJB 3O8OB 4DJAA 4ID9A 1WDTA 3UK0A 2A0FA 4HRXA 2PT5A 2TMKA 4YCLA 2X2PA 1CVRA 2Y1GA 4EAAA 1T1EA 1BIFA 3KOWA 1IHOA 4UVHA 1M2OB 2P2GA 3ICPA 5I7UA 3D6HA 3HDVA 4FR5A 2RB5A 4DEYA 2O1EA 1I3OA 2ID8A 4KUEA 4X60A 2GBLC 3D5EA 1CZHA 4G65A 1Y4UA 1UBSB 3U2QA 2QZ9A 1D6NA 4LK2A 1N9GB 2NXWA 4QELA 4LRXA 3SLKA 1PG5A 4X3CA 4BVEA 1E60A 5JJKA 3DL7A 3F4BA 4CEJA 1GVNB 4ND2A 3JAKB 4YRPA 4Q24A 3JW8A 3S3TA 4QT4A 5KJ1A 1O96B 3ICWA 1H66A 2V9ZA 2Y1LA 4NE2A 2CW5A 3CUUA 1EFRD 2CXUA 3N2GB 3SQXA 2AC2A 4BMSA 1V4NA 4KV9A 4MR8A 1NI3A 3THRA 3U7QA 4O5OA 3UT5A 2D0PB 5FT9A 3PEWA 3AJ8A 2ANCA 5ECDA 3VYSB 5I47A 1GEEA 1KJYA 2PDAA 3QBEA 1J20A 3H86A 4D96A 3HCEA 5KKCA 3I5XA 4PLPA 2G9RA 3GCZA 4LVUA 4XCXA 2FAXA 5H68A 1T4MA 1S8AA 3LY7A 2Q5EA 2Q27A 3VR2A 1ORWA 3QKWA 3HK2A 1USKA 2SBTA 5LN1A 1X7WB 5A0TA 1UDCA 3BD9A 4BE7B 2HTEA 3H5WA 1VKZA 3OQIB 3VYVA 3R3UA 5LOVB 4FEEA 1EMDA 4EHKA 4LG1A 1OFUA 3R3JA 3PNVA 4R1PA 5CBKA 2HXYA 3DVAA 1C7RA 1VXOA 2XZTA 1VL1A 2AG8A 1U3FA 1Q11A 2EAUA 3PLRA 3O8RA 5CM2Z 1G41A 1OH5A 4QL3A 4YXWD 1G2PA 3AERA 4HB2A 5TJ9A 5ALVA 4LV8B 4NU8X 1KWKA 3T7IA 1WTAA 1JSCA 2O2ZA 2C7BA 1NVDA 2F9FA 1AUOA 1DAGA 1O1YA 1EX9A 3GD5A 3ROPA 5CX1B 4BEVA 2DLNA 1OI7A 1J9ZA 5JCZA 1HFJA 1I7NA 5KYTA 4UDYX 4EZEA 2PLNA 2X76A 2FSIA 2XE7A 4ZREA 5EXXA 4G1VA 3NIFB 3HVUA 4RQTA 3M1LA 1XZQA 4D9BA 3AGPA 4NZMA 1BHO1 1AD2A 1CRWG 3H2KA 1VKRA 3QPUA 4YRRA 5HIIA 1XPRA 2D7JA 4W5QA 4QGSA 1YB7A 1N4DA 1E9FA 2YNMA 4KW7A 3G5UA 3MELA 1TCVA 3KB8A 1KPGA 4NDAA 1E1QD 5A03A 3BMOA 3U60B 1L8AA 2YWDA 3ZDFA 1N0WA 5L3QA 2FQ1A 1CR1A 1E4EA 4MWGA 1IJEA 2REQA 4NKRA 2GMWA 1G4HA 2XRFA 3HJNA 1JP7A 4JBWA 1L5QA 1OYOA 1ZUWA 2H4JA 2FUEA 2FWAA 1DP4A 3QA3E 3QSYA 1YAJA 4E30A 4LDZA 4DMHA 2XCQA 5C8VA 2HJVA 2WB2A 2ORYA 7AT1A 3BBPA 3PLAE 3ZY4A 5COQA 1BX3A 1OYYA 4X97A 2EZUA 1G19A 2DM6A 3K2IA 4QT0A 3C16C 3LG2A 4LJAA 4W5NA 2PJUA 4S1TA 1R12A 1X3SA 2LIVA 2HWUA 4TTVA 4BQOA 1BZYA 1FXUA 2X1VA 4PZAA 1JFFA 4GZLA 3WTBA 3G9ZA 4CEJB 3L8CA 5KOHB 3H9QA 1G0NA 2EERA 1BEEA 1ZLXA 3ER8A 2WUVA 5EMKA 4J0DA 3P26A 3ZDAA 2XYGA 1I3NA 1YE3A 1E89A 1SPXA 4ANFA 5K05A 2QAIA 2GZ2A 4HGOA 4IHQA 3UJNA 3U3KA 1ODIA 2Q5JA 3RNLA 3UT5B 1PJLA 4BNUA 1WHSB 5AW4A 2UXBB 1KDRA 3AUKA 4WI1A 2Q0QA 2IPAB 1KY2A 5E4JA 2JFXA 3RSLA 4KR7A 2CV0A 3L92A 3U9SA 4D9JA 2XHZA 5CUQA 4HDNB 4WZBA 3SGLA 1LRKA 4OXXA 3RYIB 3UJ9A 4C89A 2QW0X 4QHYA 4UE6A 3ZWBA 1M2GA 1YAHA 2HGSA 5IM4F 2GK3A 1V41E 3RSFA 1E4YA 3U39A 1WMFA 3DVAB 1KYXA 4Q47A 2HN9A 1GGFA 5A4KA 4R16A 3T3NA 1MPXA 1WPQA 4GFDA 1M6YA 2GCOB 5ICCA 4RH3A 4MQ5A 2FV8A