5CJ2A

Ran gdp y39a mutant triclinic crystal form
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
197
structure length
197
Chain Sequence
QVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKAVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPALAAQYEHDLEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Catalysis of GTP Hydrolysis by Small GTPases at Atomic Detail by Integration of X-ray Crystallography, Experimental, and Theoretical IR Spectroscopy.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords GTP-binding nuclear protein Ran
total genus 68
structure length 197
sequence length 197
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2015-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5cj2A00
4A92A 2CL7X 4TMKA 2D62A 2KJQA 2IWRA 3SYLA 2IYLD 3R8CA 3QF4B 4B75A 3KB2A 3CZQA 3WNBA 1CULC 4P33A 4GNKA 4HUTA 1CEEA 1SZPA 1P4SA 2ZITA 2C98A 3UMSA 5J47A 5L3RA 3H4MA 1GNQA 5KU1A 5SZHB 3A1VA 2DY1A 1T0HB 3IQWA 2HT1A 4TT3A 2ODBA 5C4MA 4C9BA 1UDWA 5SZJA 2GVZC 2L0XA 2JJ2A 5C4GB 2WJGA 4D82A 2RGNC 1AN0A 2QY9A 3KTAB 3MJHA 2E9SA 2PJZA 4V02A 4NP6A 1S96A 3IIKA 2JAQA 3SI7A 1IN4A 2Q3MA 3QXSA 4I4LA 1R8SA 5AUPB 2QRZA 1ZIOA 2QM7A 1DVRA 1B0UA 2Z83A 3TQFA 2WWXA 1I2MA 2D74A 2MMGA 3AQ4A 2ERXA 4GFDA 1E2DA 3GJ5A 4JBWA 1DAFA 1QHIA 4MRPA 1DADA 3I61A 3K0AA 5BYJA 4FXPA 5JSZA 4GDFA 2VQSA 4NH0A 2F7SA 1L4UA 1T8TA 3WXMA 2GJKA 4QJ5A 2CXXA 1LF5A 4PR0A 3SNHA 1G16A 4IXNA 1GL6A 5KPDA 1XX6A 4A9AA 4MH0R 4E09A 1G8HA 4PTLA 1L4YA 1TF5A 4WZ6A 1ZMXA 3U2QA 3RAPR 2FV8A 1OW3B 3TSWA 3TVDA 3CO5A 2HJVA 5HZHA 4DLYA 1P6XA 1E1RD 1G7SA 1R10A 3OEED 4DLZA 2V7QD 4MRSA 2QBYB 4UKDA 4JVNA 4MUAA 2IK8A 3GJXC 5JI3E 4B48A 5EJEA 3P20A 3P4XA 1P9RA 4PHGA 3T1OA 1LFDB 1NLYA 3Q5DA 4QHTA 4B6EA 1A2KC 4UNNA 5B30A 4NCJA 2KE5A 1OXTA 3TMKA 1KK3A 3U3OA 4ZV4A 4WBSA 3CRVA 1HQYE 4FW9A 1WRBA 4QBHA 4X8HA 3DM5A 5C18A 4QOSA 4Z1MD 4IFEA 4URVR 2XZOA 1OT3A 4QKQA 3WMFA 3TAHA 1D9ZA 2RGAA 2BV3A 5E7IA 5GVRA 2R6CA 2MSCB 1SVMA 4G0NA 1II9A 3HWSA 4QM7A 2QPTA 1OH7A 3ADCA 3Q8XB 1X6VA 4LDJA 3IO5A 2F43A 1WMSA 1GITA 2J0VA 4TTQA 2DHRA 2OBMA 1XF9A 1E98A 1N6OA 1QVAA 1A82A 2ZSEA 3CR8A 4AG5A 5DN6A 4CEIA 3AVQA 2A2ZA 4LC0A 1SXJD 4WIAA 3THYB 1XJQA 1CJTC 1VIYA 3AVPA 5B57C 4EJSB 3ZZ0A 3P32A 2ZE8A 4HZUA 2WICA 4C7OB 5B58C 1SVOA 1NMXA 1Z3IX 3A4NA 3LBNA 2QSYA 3LD9A 3EZ6A 5EUQB 4XWOA 4BGDA 2QAGC 3GLFE 1N25A 1OXVA 1X8LA 4C3ZA 3THWA 2JLVA 4AD8A 3RRZA 4DSOA 4LJYA 1BKDR 3KJEA 4DDUA 2CLCX 2OE2A 3NDBB 1K5DA 2REOA 1CJMA 3NBYC 2JIZD 2BJWA 5K8TA 1IN8A 2HJGA 5CYPA 5G3ZA 3EA5A 3QXCA 1N0WA 4PQFA 3QXHA 4M1KA 2W0SA 3PUWA 3BFKA 4FWIB 1JPJA 1VG0B 2RHMA 2XZLA 2VTKA 4BEJA 4D80A 5HCIA 3AP2A 3QKSB 2NQ2C 2W58A 2BKUA 2NGRA 1O3YA 4JT4A 1P5ZB 4X8OA 5M04A 5EZ6B 2J87A 5DI9A 3GMTA 1DAEA 2ZRPA 3QG1A 2OXCA 2JLWA 1NVXQ 2ZRAA 2HCBA 1TQ2A 3LX8A 3NDPA 4F4JA 1J99A 1G6HA 1W48A 4B73A 4OI4A 2H1LA 4MA4A 4OI1A 2FA9A 3BFXA 4Q9KA 2E87A 2J41A 1U8AA 4JZKA 3OF5A 2XTNA 1KKLA 2F9LA 1GP2A 2ZXUA 4Q00A 2JA1A 3EX7C 1DAHA 4A0GA 2VBCA 2DFLA 2GNOA 1E2JA 1GIAA 1SULA 1XTIA 2CE2X 4L9WA 1E4VA 3EG5A 3LV8A 3ZZUA 2FF7A 1UBCA 2GAOA 3R9IA 2ZI7A 3DDCA 4JKIA 1UPTA 2AXNA 2ZRLA 2ZJAA 3EA0A 1IONA 1CR0A 1SVLA 4LJ4A 4WZAE 2PX0A 3ASYA 2CK3D 3PG5A 1W0KA 4B33A 1Q21A 4ESHA 2JCSA 4TTPA 3WHLA 4NONA 4RJLA 3SE0A 2OLKA 3ETLA 2A3RA 1COWA 2DCUA 2J1LA 3KTAA 2QA5A 4G01B 4Q7JB 3KXIA 5TMPA 4QC2A 2AX4A 4IDOA 1J8MF 5JHGB 3F3YA 1VKJA 5G40A 1DE0A 3REGA 3NHBA 1G7CA 4CIDA 2V55B 3PEWA 1DEKA 4DLRA 1QHHA 1AA9A 2FMXA 3D3QA 1Z29A 2BCJQ 5FPKA 2O52A 2RAPA 3N2IA 1MABB 2AKAB 4C0HA 1M7GA 3NVAA 1VHTA 2CLSA 2ANCA 4KFUA 3H84A 1Q20A 1IJFA 1CJKC 4MKIA 1IY0A 2BJVA 5BW8A 5TARA 4D25A 3BJIC 1N6HA 2JLYA 3IEVA 1IN7A 4KODA 1LF0A 4OQLA 2FEOA 2FFQA 3UWOA 3CX8A 5BWMA 3ZVMA 621PA 1J2JA 3R9WA 3OEHD 1DAGA 4KFSA 5FL3A 4B32A 1VIAA 4LY6A 3LQRA 3LX5A 3ICQB 3CRMA 3CNNA 1CJUC 5UKDA 1TADA 2GEVA 5KTYA 3QF4A 1NLZA 3IUYA 2JLQA 1W0KD 4RSGA 1OB5A 2Z0MA 2WJJA 4FCWA 5AJXA 3A4MA 3QJYA 4EFLA 2CNWD 4N0DA 4LYHA 2WWYA 3AVVA 1JXOA 2REBA 1PVOA 1CLUA 3ND9A 1N5IA 1RJ9B 2PMKA 2FPLA 5GJWC 1NI3A 5EXPA 2ZE6A 1Z0IA 5TVKA 5FBVB 2DYKA 5AUOB 4JBXA 4MITA 2NPIA 3WNCA 4KFTA 4A8JA 1YR9A 4V0KA 2FFBA 3U44A 1NSFA 1Q3HA 2GK6A 4NDZA 4NCIA 5EP2A 2ZUBA 2WJHA 1LY1A 2Z43A 2OSBA 2GTPA 1Z83A 1NVVR 1XMIA 3LRPA 3PEYA 1VTKA 4BFWA 1GL9B 3BD9A 1HT1E 4X8MA 3SS8A 1T6NA 1C4OA 1OFUX 3A8TA 3D7MA 4I1UA 1V43A 3W8NA 5HZKA 3ADBA 1RPZA 2IT1A 2VP2A 3AKEA 1S1MA 5TXGA 3BOSA 3RSLA 4J0QA 5A5GA 1E9DA 3PV0A 5AJZA 3VKWA 2Z4SA 3K9NA 3VR1A 1US8A 4D0GA 3RS4A 4JLKA 1YZLA 4D0LB 3IGFA 1AS3A 4AKGA 4C0QC 2GA8A 3A1SA 4WXRA 3VU9B 1OH8A 4C7OA 1A4RA 2BEKA 2IX3A 1OHHD 2GJ9A 1KY3A 3W90A 4KU4A 3EPJA 1OXXK 1OV4A 4FN5A 4GP6A 1SQ5A 3CF0A 5L3VA 5FH9A 3K1JA 4CF7A 2IYRA 3I32A 1P3JA 4RFVA 1XCMA 1XD9A 3K70B 4W7SA 4PX9A 5IHPA 2R2AA 4FWTA 3DOEA 1KNQA 1U99A 1VCNA 3PIRA 4TYPA 1U0HC 5F9FA 1OSNA 2FJUA 3RRNA 2LCFA 3EAQA 1CXZA 1ZM4A 2R65A 1QHNA 3R20A 4IEEA 2KBEA 5FTLA 1C1YA 5FBRB 4TL6A 3P26A 5HR5A 1E9FA 2O8DA 1JR6A 4HB2A 5AWFC 4AKHA 1XBTA 4CEHA 2IYYA 2F3TA 4TYWA 1ZINA 1WA5A 3DO6A 2JLUA 3OZXA 2PEYA 2P5TB 3HR7A 4GBMA 4MYUA 5J4VA 1NJFA 3TW4A 5KSPA 1Z22A 4URWR 2ZJ5A 3CPEA 3VR5A 1U81A 1YJ5A 4PAMA 4Q1EA 2OFXA 4Z1MA 5L8VA 4US1R 2CMKA 1F60A 4GRAA 2V1UA 1HTWA 1XXHE 1SKYE 2ZJBA 4PHHA 3NBZC 2HCJB 3U6BA 4XSGA 1E6CA 1M1YE 4HYYA 1KI3A 2P2LA 3GP8A 2SHKA 4Q21A 4DVGA 1A7JA 1EK0A 4QHSA 1E1RA 2BBOA 5IK2D 3GFOA 1BOFA 1W36C 1W46A 3L8YA 1G291 5TY0A 1HQCA 3KKOA 3ZD6A 1AK2A 4HLUA 2R44A 5KDOA 3SR0A 4P4SB 4LGMA 3CBQA 3UWKA 2GXUA 1IOZA 1IQPA 1DAIA 2PCJA 4RCYA 1TF2A 3GLIB 4EFMA 3AGQA 4PZZA 1JNYA 3HU3A 2O8BB 1Z0AA 4NYIQ 4KV9A 2C9CA 4YMVA 2F1HA 1E2NA 2GXQA 2P67A 3K70D 4EUNA 1S3GA 2BKEA 4KSCA 1GNPA 1P2TA 2VHUA 3OAAD 4KBGA 4CT4B 1NBMA 1NKSA 4ERNA 3TUIC 3L0OA 1Z06A 5HPYB 3PUZA 4AKIA 4HAXA 1PV4A 3LW7A 2Q21A 3QOFA 1MKYA 2AN9A 3BFVA 2J46A 1XTQA 2XZPA 3K0FB 2RHDA 4MYCA 4F93B 2MMCA 5IF9A 1B23P 4GPTA 3VFDA 2C8VA 4DCSA 2V8OA 1P9WA 2JJ2D 4ESVA 1IHUA 3AUYA 4RZUA 2HYDA 3DL0A 2H18A 2O8FB 3RS7A 3SYKA 4UXHA 5LD2B 4LYAA 2F1RA 4O0MA 3QI2A 2J7PA 3HR8A 4IOLA 3DMNA 3TE6A 4RD0A 2KI5A 4LK2A 4DXAA 2OM2A 4GMXA 5KYKA 2HYIC 4HDCA 3LBHA 3LFUA 3I5YA 4V0OA 1W4CA 4IOJA 4UJ3A 1N6RA 2BBSA 1MT0A 3UKDA 5EQTA 3DM9B 4ASUD 4B3DA 3C4JA 2WMOB 2DWOA 3I5XA 2BEJA 1ZD8A 2GCNA 2ZETA 3VKGA 4W5HA 1KI6B 4X8LA 2OFOA 2CEAA 1RRGA 4S35A 1Z8FA 2A78A 3GJ4A 3MGCA 1HT2E 1CIPA 2WV9A 2W2TA 5FR2A 4JLMA 3GEIA 4XJXA 2BOVA 1QHGA 5FR1A 3CH4B 3A1WA 4JSTA 3VR3A 4EPWA 4KLZA 4CEJA 1XCPA 4LPSA 2UZ3A 3DMDA 3DOFA 2HV8A 5EE9A 4JKYA 2J0UA 2JASA 1ZD9A 5J4YA 4AG6A 1NF3A 1EGAA 3B9PA 1ZBDA 1QZXA 1KZ7B 5P21A 1UKZA 1J7KA 2VHTA 1G1MA 1HH4A 4TMTA 5JRZA 1ANKA 1NIJA 3BAFA 1TU3A 3IHLA 4D4JA 4DKXA 4R2IA 1JJVA 1W47A 3X2SA 1Z6GA 3CONA 3QF7A 3CLVA 1PLLA 1G3IA 3W9YA 1AJEA 1YE8A 1M2OB 2CCGA 1I4LD 1XFAA 3LXRA 2GBLA 3NBXX 4LYFA 4L15A 3GQBA 4V0LA 2EFDB 4DSUA 2ZRFA 3CF6R 5FPTA 1EFHA 2W6JD 4DCVA 2IYVA 4IVRA 1PUJA 1RYFA 3VR4A 3ND8A 3RS2A 2FX3A 2PCLA 2FNAA 4RZ3A 4Q9IA 1FUUA 1XJ0A 2IHYA 2F1JA 4CT5A 1KI8A 3QXJA 4B35A 2CLDX 1ZCAA 1VYVA 1KDPA 2OO7A 1OFTA 3E70C 4GP7A 3D8BA 3RWMB 5BN3A 1WDTA 3A4LA 4Q9HA 5ELXA 1T91A 3UK6A 2VRWA 3FGNA 2OILA 2IL1A 3I8SA 4NTZA 1NVUQ 3LY5A 4LOAA 4RD4A 1SGWA 2IYTA 1A1VA 3EPHA 3ZQ6A 1OE0A 1IY1A 1AGPA 2GETA 5K8IA 2H57A 2QG6A 1M7HA 1W4AA 2V6JA 2GAAA 2GEUA 1P2UA 1D5CA 1W4BA 1E1QA 2GF9A 4DDTA 2NO6A 1EFRD 2C9YA 3NKVA 1T3SA 4DSTA 3UATA 3VTKA 1T9HA 5JCPA 2ZJYA 1E32A 4ZCLA 3B1YA 2VSXA 1JQLB 3KDSE 4QHYA 5CYOA 521PA 1DELA 1UADA 1N6IA 3L0SA 3B60A 2B8WA 2OUKA 3BXZA 4MGZR 3HYRA 5J4KA 1E2KA 5EP1A 1D2NA 2QP4A 4GSYA 1GDDA 2BM1A 1FX0B 1KGDA 2BC9A 5DYIA 3R9XA 4ZCIA 1XEWX 4DLVA 3F0TA 1FTSA 2WZQA 1KO7A 1MOZA 3CH5A 4G3XA 4OJQA 1JB1A 2QT1A 3B13B 4LCBA 1UFQA 5FI1B 3T06B 2ZRDA 2VIIA 3AH8A 1EX6A 1W4RA 3FFBA 5FOVA 2YWFA 5DNYB 3A1TA 4KCGA 2ZRBA 1T3HA 1OIWA 1UKYA 3MLEA 2O8DB 2ZI6A 2OAP1 2HF9A 2BMJA 3AB3A 1YQTA 3U3KA 4EPTA 2J7PD 3BH7A 4TMWA 1XJCA 4AURA 1NJGA 3ZVLA 3QKUA 1D2EA 4DRZA 2VL7A 1G20E 1QBKC 1W2HA 2B6HA 4PO8A 3KKQA 3HU2A 5JSZB 5A4JA 5KNDA 3FVQA 1XEWY 3WRXC 3X1DA 4XVUA 5FOXA 1JPNA 3A36A 3SHFA 4ZCMA 4FMDB 4OQXA 4OHYA 3WY9A 4DJTA 1NVWQ 2VSOA 3DKPA 1P61B 5IRCD 1F6BA 1ZNWA 2PMDA 3Q5EA 4RCZA 4GT1A 3WNDA 4AIIA 3C5HA 3LDAA 1QDEA 1YVDA 3I8XA 4IXMA 3EPLA 5C2JB 3QEJA 2OZEA 5CIQA 3ICEA 1GFIA 1ZC4A 2FSFA 2ZYWX 1NG9A 3WP1B 3U7GA 1E2GA 1PLKA 1V5WA 3TW8B 1NNEA 1Y3AA 2F6RA 5JEDA 3LQQA 1OLOA 1RFLA 3CNOA 5D3QA 2QEQA 4F38A 1ETUA 2G1KA 2ZRMA 4ZDWA 4DZZA 3TK1A 2RGNA 2ZRNA 1U94A 3B5JA 4WZBE 1E0JA 4Q1AA 3WYFA 3CPHA 4URZR 2PZEA 1X86B 1GAJA 2W00A 1FQJA 3LW8A 2CL0X 2WPDD 3FMPB 2QRNA 2RGEA 2ODWA 4XWAA 1QF9A 4WW0A 1R7RA 2NO7A 1NG1A 1OKKD 2OCPA 1X1SA 5G41A 5FOUA 5G3YA 1E2IA 4FMCF 1A2BA 1KK0A 3L43A 2JLSA 3PEUA 1UAAA 1LV7A 3FHOA 1OYWA 2X8AA 3LBIA 3QUSA 3W3ZB 3QNUA 1K6MA 3QPWA 1FFHA 3P1JA 3SYNA 4ZDKA 2OLJA 5FTNA 3CR7A 4OK6A 3IBYA 1VG8A 3V9PA 4ACBA 4ZDJA 2QORA 1BMFA 3N70A 1GG2A 4URYR 2C03A 1SVIA 2EFHB 2VP9A 1Q44A 1P62B 2ZUCA 3KJIA 3SC3A 1W0JD 3EC1A 4EAQA 2NOAA 3O47A 1GZSA 2N1BA 5EP3A 4A4DA 2XITA 2X2FA 2BIFA 3KX2A 2JGNA 2QE7A 3GFTA 4AKEA 1YR8A 2WWHA 2OBLA 2HT6A 1IJEA 1YRBA 5CJ2A 1N2CE 4GOXA 1F2UB 3CUEF 4RFSB 4LC1A 2Q3FA 2OCYC 2W2VA 3CKLA 2D2FA 3B8HA 5FUYA 1KO8A 3RRYA 5J4LA 1U9IC 2OBNA 2IEZA 2REXB 1XEFA 3PUYA 2RH5A 5FPHA 2QAGB 3NBFA 4IDQA 1KI7A 4URXR 3K8YA 3TQCA 3GLIE 4JL8A 1M74A 2QTVB 1ZRHA 1L2TA 2XB2A 4MRRA 1UM8A 4KSBA 1KYIA 1U0JA 2J0QA 5GJBA 3ZDQA 2CVFA 3KQHA 2J0SA 2QP9X 3QQ5A 1N0VC 4LHWA 3J81k 1ESMA 2X19A 3QKRB 1H65A 1JQJC 4US2R 3GJ3A 5JS8A 2H5EA 1OHHA 4P4TA 2D7CA 1Z6TA 2V4ZA 3MRSA 1XXHA 5H8WA 2AK2A 1WBBA 1N3BA 1UDXA 1XZQA 3FKSD 2ZS9A 2JJ1D 5DH9A 4BPBA 1XMSA 1SKYB 5JMTA 4DLUA 1P2VA 3I73A 3SZRA 4EQ6B 1SXJB 2XGJA 5CB6A 1GRNA 2I4IA 4C0LA 2PH1A 4AY2A 4DLWA 5JBQA 2I1VB 1JEEA 1W1WA 4LV5B 2C77A 1VG1A 1OB2A 1FX0A 4JIMA 2YV5A 3GLGE 4OKSA 1XU4A 2AR7A 3NC0C 2ZJ8A 4ZI3A 721PA 4B3GA 2DBYA 3AKDA 4TMZA 4B3FX 1E9SA 5DGXA 1ZM7A 3FTQA 3FKSA 4QG7A 4KYIB 4LBWA 2ZR9A 1W7AA 3RS0A 2YNMA 2A5YB 1Q12A 2ZJ2A 4O25A 3SDZA 1G64A 4TYNA 2VPPA 1MH1A 3SN6A 1M7BA 2IYQA 1LS6A 4NYJR 1Y63A 5CK4A 4S2EA 4WAUA 1QVRA 5J40A 4L8GA 1ZW6A 2CNWA 3E5HA 4UNQA 2WKPA 2ZUDA 2R6AA 3PR1A 3U61B 4A1FA 3QBTA 3SFZA 1NL3A 2FSGA 2ZU0C 3QPUA 4HAWA 4LZZA 1HA3A 4V03A 2MSDB 1KZGB 1H8EA 1UF9A 2A5DA 2VEDA 3CX7A 1T4GA 4HLCA 4Q1CA 2NZJA 2C96A 1PJRA 2EFCB 3OEHA 4YMUA 1X3SA 3LA6A 2O0KA 2PZFA 4Z8YA 5EUMA 2H92A 1S3SA 3AF2A 5CK5A 2QN6A 4PO1A 4TWZA 5HCNA 2BDTA 4QGGA 5CDFE 1BS1A 3V00A 2PZGA 3EWAA 1TUEA 4OJKA 2GESA 3UIEA 1W0JA 4Q01A 4BLSA 4BE7B 2RGCA 1A5TA 1KMQA 3X1YA 1KDOA 3PVSA 3M0EA 3U3RA 8OHMA 1XTJA 4C30A 1LS1A 1KDRA 1DPFA 1Z0JA 2RGXA 4NCKA 4FIDA 2VHCA 3U4QA 2FG5A 3U44B 1JAIA 2ODNA 2C04A 4Q4AA 5LB4A 5HTKA 1RC8A 4LBVA 4M9QA 3BB4A 2CBZA 4D4MA 1E94E 1R0WA 1BH2A 4WOPA 3VAAA 1T8UA 1N6KA 4K81B 2CJWA 3IDQA 4DSNA 1OKKA 4B76A 4JBYA 3VX3A 2YC4C 4TN1A 2PLFA 1NMZA 3C7KA 4D26A 3OE7D 3NEYA 4PC3A 1JR3E 3CZPA 2R6FA 1CR1A 1WCV1 1YZNA 5JRJA 2F55A 1QG4A 1IXZA 2ZU6A 2ORWA 1JJ7A 1NN1A 3PQCA 1E9BA 4QXAA 1NBME 3LWNA 4JLOA 4MKHA 4H1VA 1KHTA 5FI0B 4KBFA 4OL0A 1US8B 3EWSA 2YHSA 1NY5A 2ZI3A 4FI3C 5FPSA 3TR0A 3VHLB 4A15A 2JLRA 3VU9A 4YMWA 5HKKD 2FSIA 3F8TA 4I99A 1RE0A 4YXWD 2C9OA 2CL6X 1GKIA 1ZNXA 3DPUA 3LH5A 1U8YA 4TLBA 2D2EA 4JLVA 4G5OA 2WKRA 1ODFA 4DHEA 2EFEB 4KVGA 3TH5A 3EZ2A 3UG7A 2ZTSA 3KUDA 2Z6VA 1W2GA 2W2XA 4DLTA 3B85A 2QAJA 3HU1A 1Z6YA 1ZM3A 4PSKA 2QU8A 1R2QA 2BBTA 1YZGA 4HSEA 4OHWA 5FTJA 4XTCS 2A5GA 2C2HA 1VYTA 3AEZA 2WKQA 1KTVA 3GD7A 4I1OA 1TNDA 1E4YA 1VPLA 2ZYUX 3GLGA 4UQOA 3K0SA 4NMMA 1NY6A 2O8CA 4HDQB 4YDHB 4CVNA 3PJRA 4Y0AA 1FQKA 2C95A 5BN4A 3HJNA 2E1RA 3KKMA 3PFIA 1OF1A 5EE3A 3ZYCA 4Q4JB 4B6FA 2EYQA 1Z6AA 4KFRA 1J90A 3THOA 4GZMA 4PC7A 2IW3A 1E0SA 2G6BA 2C99A 3BB1A 3LVRE 4QFMA 2QQ0A 5CLLA 3UMFA 4E5UA 5KNBA 4HLQB 2WJYA 1IXSB 3EARA 2WHXA 4L9SA 3IBGA 4JVMA 1UBGA 2ATVA 3T1QA 2A5FA 2ZSFA 4QL3A 4F4IA 3NHAA 1J8YF 4BFZA 5E3HA 1H8HD 1SXJA 2ZRCA 4QRHA 3QEOA 3JZAA 4GMDA 3U3JA 5EE1A 2GCPA 1DO0A 2WJIA 1XWIA 5EE0A 1XEXA 4XD7D 1RIFA 1T5IA 4C0SA 4DBLC 1WXQA 3EZ9A 3ONWA 5JECA 3U60B 5DHAA 2BCGY 1KDTA 5F2EA 1FL9A 1YR6A 4IVQA 4XVQA 3GPLA 2H16A 1AZTA 1UBEA 4EPYA 3QY0A 2FN4A 2FPKA 3K53A 1G6OA 1VCMA 2AD5A 1E1QD 3ECCA 4LJ9A 5LBIA 3TGPA 2XXAA 1IN6A 3ASZA 4A2PA 4PC2A 4HDOB 1D2MA 1N6PA 3R7WA 1E3MA 3HPQA 3W6PA 5DIFA 1HUQA 4BECA 3GLIA 2KSQA 4UXIA 2Q3HA 2O8BA 4QBIA 1HE8B 2V7QA 3B9QA 3FYHA 1XTSA 2I3BA 4BEBA 3NH9A 2QP3A 5DI3A 5C46F 2NMVA 2IS1A 2KB0A 1TQDA 1HY3A 2QSZA 4TLAA 3I4LA 4JVSB 3I1FA 4LPKA 4PSAA 4NKRA 4ZI2A 4LUCA 3EXAA 3UANA 2W6JA 5HE8A 4LRWA 2QTFA 4ZDIA 2GZDA 3AF0A 5E95A 3A1UA 3C5CA 1G21E 3B1XA 1BO6A 3R8FA 2GXAA 1WP9A 3FMOB 3B78A 1D9XA 1ZC3A 4FMDF 1IBRA 5FUVA 2Z4RA 1GUAA 5F98A 2OCBA 2ECKA 5TV2A 4R98A 3B6EA 3IHWA 3ZLJA 2BWJA 1DAMA 2NPFA 1Z47A 2OT3B 3GEHA 3QPVA 4DT1B 4MKGA 3AF4A 1GKYA 1Z07A 1G18A 1NIPA 3FWYA 3KXKA 1KMHA 5JZVA 1TEVA 1AIPA 4Q1FA 4RY2A 4UNRA 2G77B 3GJ6A 4HI0E 4M1MA 3Q7PA 1TTTA 3T61A 2CJWB 4NU0A 1R4AA 1KNXA 4HAZA 1GILA 2QTHA 4TT3D 2QZ4A 2WOJA 3TNFA 2GF0A 1WQ1R 5CB8A 2XJ9A 4CEIB 1TMKA 4RZXA 4QGAA 5LD2C 1DG3A 2HLDA 2XOKA 4ASUA 4YQFA 3AM1A 1NMYA 2O8EB 1E79A 2GZAA 4LHXA 4B2LA 3JVVA 4CEJB 4MRVA 2B7CA 2WAYA 4EJSA 3AUXA 4RD2A 2CCKA 2EU8A 3ZD7A 1Z0KA 2DFTA 5EE5B 5SZKB 2W0MA 2XOKD 2FFHA 2HLDD 2R6DA 3ZZTA 4IOKA 4O3MA 1IY2A 2QM8A 2P6UA 2WSMA 2XTZA 4OBEA 4Q1DA 5KOYA 1UEJA 3MUFA 5H70A 1SHKA 4HUQA 4NZYA 4HATA 1Z28A 3OIVA 2DR3A 4A82A 3IIMA 2QBYA 2QL6A 2CHVA 3TUJC 2LKDA 4HAUA 2AHOA 2BMEA 3IILA 4MRNA 5EXSA 1Z63A 4AYXA 4WXPA 3V4FA 2P6NA 3RNLA 2J3EA 1TPZA 3FE2A 4NHOA 1I4TD 2F9MA 3QKTA 2ZI9A 4W5JA 5L3QA 3GLGB 4XVRA 2G83A 4TL7A 5E7JA 4DDWA 3KQNA 3OAAA 5CM9C 3ZVNA 5DLQC 1X1RA 2IC5A 2K5UA 3T1VA 3MJRA 2GWHA 4QGFA 4B3CA 1CP2A 2CE7A 4M21A 1ZVQA 4DIDA 4MGYR 3AF1A 4M0LA 4MUBA 4M9XA 1QG2A 4LHVA 5JWOA 3THXA 1VCIA 1GM5A 5D3MB 2KBFA 3K9HA 2WAXA 1D6JA 1E9CA 3EIEA 2ERYA 2P6RA 4R2HA 4PO9A 4PQRA 1HEIA 4FCTA 2IYZA 3GLHE 1R5OA 4P4UA 2QGNA 4US0R 1L7VC 3AP1A 4QNMA 5EZ5A 2FSHA 3DZ8A 3WBKA 5IK2A 2AKYA 2IA5A 4M9SA 1AM4D 1P72A 4F7WA 2AK3A 2RCNA 1CTQA 1GOTA 2IBMA 5F3WB 1KSFX 4IOMA 4IDPA 1JI0A 1PZNA 2ZAMA 4LYJA 4M22A 1YU9A 5BXQC 1K8RA 5J5CA 3IEUA 1E9AA 4TLDA 1XNJA 3RS5A 2J5XA 1DOAA 1F3OA 3BERA 1G8YA 3LVQE 3BBPA 1GRRA 1YZQA 5FUWA 2F1IA 1UKVY 2GJ8A 3ZIAD 5FTKA 1E2EA 3U7HB 3LLUA 3FFAA 1ZNZA 4IHQA 4OHXA 3I92A 1XB2A 2QGZA 4IFBA 4Q9LA 1OFHA 4LBZA 1MO6A 3QKSA 2ZI5A 2P5SA 3CIOA 4JVLA 3WYGA 3VR2A 3RDPA 5IDVA 2XX3A 2VH5R 2ZIAA 4NE2A 4AK9A 121PA 2ZSAA 2YWEA 2R62A 4XD7A 2TMKA 1NP6A 4JLBA 5DI3B 2VP5A 3GJ8A 4EPRA 4HLUC 2RKOA 1YZKA 2FU5C 2O0JA 1UKEA 4ON9A 2LKCA 2ZANA 1H8HA 3AVYA 4DUGA 4E22A 2EWWA 2CHQA 4B71A 1NN3A 1ZM2A 3T15A 3LO5A 1FP6A 4OQNA 2D4HA 3OHMA 5A0FA 1MV5A 1ZNYA 3RVBA 1IXRC 3WHKA 4BASA 5JS7A 1CF4A 2W6IA 3VR6A 4TQUS 1KOFA 1DAKA 3W5IA 1G4UR 1Z0FA 2F3RA 5JWRA 4Q19A 1CU1A 4QNRA 3DEFA 2HXYA 2I1QA 2ZSDA 3M1IA 3ZVRA 3FMIA 4N1AA 4A8JC 1XEXB 4NBSA 2B8TA 4PHTA 4DB2A 2QUZA 3QE0A 1G5TA 2V3CC 1SVWA 1W44A 2IUSA 4A8JB 3H2YA 1P2SA 3L82B 4Q4HB 3K70C 1FZQA 1VDZA 2ZAOA 1F48A 2W6ID 3QENA 3WMGA 2Q9AA 4PZLA 1SXJC 2ZQ5A 1P9NA 1KK2A 1WF3A 4E03A 3VQTA 1DTSA 1EFTA 2XTMA 3Q72A 2UKDA 3TSOA 3ZGXA 1EG7A 2OAQ1 5DO9A 3SQWA 5JFGA 5H68A 3R7WB 4F92B 2OESA 4DEXA 1GKUB 2OFWA 1DG1G 4R7ZA 4BRUA 4HB4A 2PBRA 1TX4B 1JR3A 2PT5A 4A0HA 4DWJA 2QQEA 4DEYA 1GTVA 1W36D 3MSXA 3RS3A 1GRQA 1I2DA 1X8KA 1XZPA 4HB0A 5J4HA 2O8EA 4TZ0A 4HZIA 3WP0A 1NSTA 4YLGA 4RD6A 4NCHA 4DIEA 2FFAA 2B21A 1Z5ZA 2G0TA 1Q1ZA 3O8DA 4A2QA 4ZKDA 5L3SB 4HEJA 4EIWA 1YZUA 2XB4A 2A9KA 1XPUA 3PXGA 1XMJA 3OE7A 4ITRC 1CRQA 1O87A 2WVJA 3FHCB 4HUQB 4DCUA 2X77A 2QPAA 3MMPA 2XNSA 3ZQJA 2Q6TA 4HLDA 4KO8A 3IQXA 4GL2A 2VHJA 1P73A 2BVNA 1XDBA 2WSSD 1FMJA 3MG9A 1BIFA 1R0XA 3WYAA 4KITB 4LSGA 1KAGA 2IYSA 1FPMA 2P65A 4JLNA 3CM0A 5EXTA 1EWQA 1HURA 2IYXA 2ODEA 3RANA 3GEEA 3PUXA 4U5XA 3BWDD 1LTQA 4DT1A 3SJZA 5FL7A 3GLHA 5CM8B 3TR5A 4UJ5A 1R0YA 4BLRA 3L2OB 4QBGB 4Q7KA 1MRSA 2G1JA 2ZRJA 2QAGA 1KMHB 1KSJA 4GZLA 4UNPA 4JSYA 1G5PA 3SBEA 3T12A 1DARA 2YWHA 1KAOA 2ZRKA 2IHBA 4NYJQ 2XSZD 4DB4A 4NL4H 1Q1EA 3WMEA 1VG9B 221PA 4LJAA 3Q85A 5FBLB 3NG1A 3X1ZA 3CX6A 3TLXA 5D3MA 1OFIA 4BZPA 2EFGA 1QHYA 4AYWA 4DLSA 1VHLA 1R5NA 3SOPA 4BRWA 4MDFA 1XRJA 3U7EB 2GCOA 4EJSC 3AVXA 4OI2A 2CDNA 2DFKB 3C15C 1ZP6A 1XXHB 3UXMA 1COWD 5FFMA 5AJWA 3C8UA 4K8OA 2R9VA 1BYUA 2GDJA 2YOHA 3TVTA 2IUUA 1AQYA 4XWKA 2NG1A 2CK3A 4EQ6A 1S8FA 2BMFA 5KNCA 1R5BA 1YRAA 2HUPA 3RSOA 1CR4A 3TJZA 3D6TB 1U8ZA 4NCNA 4PXAA 1KIMA 3LXXA 2G88A 3RABA 2GXSA 1Q1QA 1ZUNB 3NXSA 4QBFA 2HEIA 1Q3TA 1LVGA 1N6NA 3FPAA 3HYTA 5LDDC 1TUIA 3E2IA 4OI0A 4XOIA 1Z6XA 1XP8A 4NPHA 1S2MA 5CDFA 3AVUA 3S1AB 4B2PA 3EW9A 4GOKA 4MQBA 1U9IA 1M8PA 4Q5IA 2IUTA 3VHXA 1E79D 3T5DA 3VMFA 5L3QB 1G8PA 2VF8A 2PJRA 2QROA 2WMNB 1QRAA 3AKCA 4IW3B 1W5SA 4P31A 1JECA 4ZO4A 2P0EA 1QHXA 4KVAA 3AF3A 4EPXA 3B1WA 3SJAA 1XD2B 4YMTA 3V4RA 5JLJA 1SVKA 3WRYC 1AS2A 1E2MA 5BN5A 1RRPA 1XD8A 3NIBA 4QJ4A 3W8RA 4LV6A 4ZIRA 2JJ1A 4C2UA 2ATXA 1FW6A 4DCNA 3KJGA 3K0FA 3SU8A 1Q22A 1WB9A 3K09A 1FOEB 4AWXA 2VYFA 3UPUA 2QPOA 3OIWA 3DKVA 3GCGA 3K0CA 2WWWA 1G8FA 1G3MA 3FHTA 2JIZA 2GBLC 1VECA 4A0FA 3MFYA 4OHZA 1AGRA 2ZREA 2ONKA 4LBYA 4AC9A 2PX3A 2V54A 4HAVA 1MR3F 2OEPA 1NLFA 2A7QA 4JLJA 2B92A 5KDDA 3AVWA 3BC1A 2H8KA 4Y0VA 5FUXA 1FMLA 5HE9A 1AZSC 3HP1A 3I62A 3EPKA 2VHQA 3MAAC 2AWOA 3CRW1 1ZUHA 1E9RA 3B7GA 5FBQB 5DN6D 1PLJA 1NRJB 1MRNA 4AI6A 4D6PA 4C4PA 3B1ZA 1VYUA 2NTYC 4TSFD 4TYYA 2QE7D 5FBWB 2LWIA 1R8QA 2GJAA 2AWNA 3K0AB 3G82C 4U7DA 1P60A 3K9LA 4QM6A 1TQ6A 2PEZA 4OYHA 1XTRA 2ZVPX 3A37A 4OQFA 1BMFD 1FNNA 3AKYA 1NN5A 1MO5A 3KXLA 1E96A 1II8B 3CF2A 5FOSA 1GWNA 5L3SA 4OQMA 2UVQA 2W83A 3W6NA 3CPJB 3PUVA 1KJYA 1EXMA 2PLRA 1AQUA 4PPQA 3BIFA 1GNRA 5AJYA 2O5VA 2ZRIA 4CW7A 1EWRA 5AUNB 4FMCB 5KSZA 2ZSBA 1XTKA 2O8FA 3OEEA 2WPDA 3KQLA 2Y8EA 3MWYW 4ABYA 3B1VA 3T35A 1Q1BA 4C0KA 1NN0A 3EIQA 3ZH9B 3ADDA 4D0NA 2WTUA 2A5JA 5SZIA 3TAUA 1C9KA 3TKLA 2X1VA 3OESA 1G8GA 3K9GA 1Z0DA 4LWZA 1U2RA 2ZPTX 4BFVA 4V0NA 2YYZA 5JHHB 2Z5FA 2IXFA 3OFND 2C78A 3AGPA 4BFUA 3D31A 4N0EA 4C2TA 1Q57A 1G9XA 4TL8A 5AJVB 2YVUA 3W5JA 2F43B 1E69A 1KI6A 1LB1B 1RRFA 1T3LA 4RVCA 3K0CC 2IS4A 3RHFA 4G5SA 1CJVC 1F5NA 1U0LA 3TSZA 1E2PA 4BZXA 4U00A 4PANA 1W5TA 1TEXA 2R6GA 4LHYA 2XEXA 4CGZA 2ANBA 2QMUA 3W34A 4EKDA 3IPXA 1CR2A 1YHNA 3E1SA 1XPOA 4TTRA 1MO3A 2J0UB 4HZUB 1ELOA 1F2TB 2D7DA 5DE3A 4Q47A 4FINA 1G3RA 4TLCA 3THWB 1FUKA 2VP6A 3FB4A 2IS2A 4DDVA 4GI7A 4Q02A 2ZM5A 2PT7A 2FZ4A 3QBVA 1UBFA 1X8JA 4BQSA 4MGKR 3U6KA 1RW4A 4A6PA 2WJVA 1KO1A 4M4SA 4PAQA 1RYHA 1RZ3A 4I1VA 1NKTA 4B3BA 2QNRA 4EPVA 2QMEA 2ZI4A 3N5CA 1OIXA 3OFNA 1GVNB 2CHGA 4YXWA 3IIJA 1KO4A 1E2FA 1CBUA 5HKKA 2NIPA 4YONB 2GK7A 3N2EA 1QHSA 1XMVA 3ADKA 3S1AA 4JYCA 1G3QA 3VKHA 3KKNA 4XTRA 2XXAB 2WWGA 1E2HA 4JJKA 1P75A 5EP4A 4JT2A 1EFUA 1VCOA 3GLHB 4QJ3A 3Q7QA 1N0UA 4TMXA 1JXMA 2AFHE 2BM0A 5KUTA 4M1WA 2DFNA 3M6AA 4M2LA 3C41J 4TMVA 3EASA 1L8QA 4ZKEA 3TUZC 4ACAA 1TQ4A 4MYTA 4Q7LA 2RMKA 1TL7C 1FNMA 4PSVA 5GJVC 3TRFA 4B47A 4ZIRB 4POAA 5TDHA 3SFVA 4TYQA 2ZYTX 4I1SA 4K46A 3H1TA 2ZR7A 1EFRA 2RGGA 4URUR 2VF7A 3UMRA 2GCOB 3KFXA 2GVDC 4U02A 4N3NA 1DBSA 4TZ6A 4DC9A 1EESA 4O2LA 2FWRA 3B82A 1BYIA 2OHFA 3BGWA 3DZDA 2EW1A 4LJ7A 4CYMA 5B64A 2FGJA 4PFSA 4RZ2A 3VX4A 5KDLA 1N5LA 3BH6A 3MWLA 6Q21A 4PPFA 3F5FA 2IEYA 3QSYA 1W49A 3BORA 4IDNA 3VNUA 1W36B 2ZJOA 3LNCA 4PAOA 5CITA 4BZQA 4B2IA 3CB4A 4TSFA 2BMDA 4XSHA 4B3XA 2XNDD 2ZR0A 3EZFA 2OV2A 3T34A 3DVLA 1D8TA 1KJZA 2D06A 2EYUA 5KPJA 1KJWA 1G7TA 5CLQA 2GZHA 1H8ED 2EQBA 1QHHB 3LLMA 3MCAA 1M6NA 4IDHA 4CZ2A 4LI0A 4M53A 2AXPA 4BLQA 1MABA 4LJ5A 2FE4A 2FPMA 1HE1C 3K0EA 3BE4A 2X2EA 2YOGA 4G5GA 5F9HA 5K8UA 1G5RA 1OYYA 1XD2A 4FD2A 4OHVA 4D4LA 4JJZA 3SHWA 1KO5A 2ZEJA 2HDNB 1DS6A 1PUIA 4O2RA 3QG5A 3K09C 5G53C 2HXSA 4BWYA 4IRUB 1GL7A 2FEMA 4RKEA 4M1SA 4M9ZA 4FCVA 2BBWA 3KZ1E 1G3UA 2IF0A 4JYBA 3QVVA 2IF2A 5TB5A 3ZS9A 3U7FB 2ZE7A 4BFTA 5CIWA 2JEOA 4KHZA 1ZUIA 1S4QA 2DWQA 4PC1A 1XPRA 1JEDA 4MDEA 3C16C 3RYTC 3G5UA 2Q9CA 4YMSA 2JJ8A 1RJ9A 1F2UA 5DSZA 1IN5A 4DLXA 2V1XA 1S0UA 2N42A 2IXGA 3SJCA 3O8RA 4YDSA 1ONBA 5H1YA 1S1CA 4E07A 2DB3A 2QMHA 1KSHA 4RD3A 4BLPA 3T5GA 3PCRB 5JCZA 5DYGA 1AKEA 4Q1BA 2IS6A 1JALA 3BK7A 1OH5A 2QT0A 4WA7A 1E2QA 1AS0A 3B2EA 2ASEA 3EC2A 3O8BA 2QENA 4IJMA 2YINC 4JL5A 2J7KA 5AR1A 1SXJE 1J70A 4ARZA 4B34A 1S9HA 4JLAA 4Q03A 2FH5B 3KL4A 1N5JA 3G0HA 4KYUA 2ZROA 1EX7A 4XH9B 3THXB 5LPNA 5JJIA 2VSFA 2NZ8A 4A0RA 4PC6A 1YR7A 3KQUA 2J9RA 1AKYA 1OIVA 3QXXA 3W3AA 1Z2AA 4F4CA 4PPNA 1II8A 4L16A 4A36A 5KHOC 1ESNA 2CVHA 4B43A 3IO3A 1Q0UA 3CRQA 3GJ7A 5AK0A 1NBMD 1TAGA 2YOFA 2J59A 1G19A 4JS0A 4KJZA 1N5KA 3W6OA 3AV0B 1G17A 2BHRA 4QGHA 3DHWC 3BH0A 4LJ8A 4V0MA 2IXEA 3GJ0A 4P32A 1G41A 2IYWA 2O0HA 1G4AE 4ILEA 2XSZA 1WBDA 1KKMA 4Q18A 1XCGB 2JDID 2EVWX 2AD1A 3VNVA 2Q9BA 4RFSA 5K8LA 2ZRGA 5FL7D 1UJ2A 3CW2A 1G7RA 2RGDA 2G9NA 3SJBA 5FOWA 4CEHB 1P7CA 1DO2A 1SHZA 4IVPA 2ZJZA 4V0ME 4W5WA 3Q3JB 2Q0HA 5IT5A 2WSSA 4C0AC 3ZJYA 3BRWD 3GLFB 4M1YA 4B44A 5E4FA 2AFIE 2WBLC 3I3SR 4PZYA 2GKSA 3NEJA 3AVOA 2YC2C 5KSYA 1ZD1A 1HYQA 1Z2CA 2ZS8A 1UEIA 2DPXA 2CCJA 2VO1A 4JLPA 3KKPA 3QKRA 3RLFA 5BYKA 1SKQA 2UZIR 5JWHA 5JEEA 2V9PA 4HB3A 5AUQA 2MSEB 3PITA 4BFSA 1OPXA 2D3WA 1NVVQ 2JDIA 1HV8A 5ANRB 1U98A 1F2TA 2GILA 4L4UA 1JBKA 1KI9A 1TU4A 4ZPXA 1E0AA 2GHIA 4UXJA 1ZU4A 4JL6A 1U90A 4BLOA 4D2IA 4LX0A 3AVTA 2H7VA 1JR3D 3RRMA 3NH6A 3O8CA 1ZJ6A 2ZS7A 1RKBA 5GJCA 4PPGA 3MD0A 3QIAA 2V6IA 1IAQA 4LHZA 1II0A 5JJKA 3X1WA 1JAHA 4RD1A 2RGBA 1FTNA 1KY2A 3KUCA 3OIYA 2XAUA 3FDIA 1T0JB 4Q4HA 3FOZA 2JLXA 5BQ5A 1Z08A 4Q4AB 5DHFA 4P4SA 4HAYA 1YZTA 1T5LA 4KAXA 2G0NA 3TBKA 3SBDA 5KSOA 3NWJA 4R9UC 5FTMA 2WWIA 2NO9A 1CS4C 1EFCA 2DWPA 2WIAA 3KB1A 3M4YA 3EIHA 3KFVA 2VLIA 2P3SA 4MGIR 2C5LA 1GSIA 1KSGA 2HF8A 2ZRHA 2ZYVX 3OIUA 5GADl 2OXRA 1YKSA 2OCAA 3AP3A 3MWJA 2JATA 4MKFA 4P0TA 1OXUA 5LB2A 3Q9LA 4A2WA 5C1BA 2ORIA 1OJLA 4PQYA 2YZ2A 4Z8XA 4FMBB 4OK3A 4M1TA 5DISB 1OXSC 4NYMR 1OH6A 2FDCA 3U5ZB 4P3YA 4DUGD 4TL9A 1WE2A 5KO2A 3FKQA 3I72A 4G5RA 2PL3A 1E0KA 2GEDA 4EFNA 3IPYA 2KWIA 4H9GA 5JJLA 3H86A 2N46A 4M8NE 4D4KA 1VMAA 4KLNA 4II7A 3SEAA 1E99A 1R0ZA 2WOOA 4Q66C 4Q48A 3JZMA 2FZLA 4TLEA 3ZS8A 1E2LA 1SVSA 3PENA 1ZIPA 4Q7MB 4D81A 1RRCA 2WWFA 3BS4A 5E7MA 1ZCBA 3JVUA 5FOTA 1LW7A 3IKJA 2R8RA 2ORVA 4A6XA 3H0KA 1S9DA 3A58B 1ZAKA 3U4QB 4GOJA 4KI0A 4Q9JA 3ZIAA 1M34E 4C0JA 1TF7A 4WVFA 2ONJA 3L8ZA 4F91B 3BB3A 3U3MA 3CWZA 3NTUA 3LAWA 3RWOA 1I4DD 3CRRA 3P4YA 4DCTA 4TQ9A 2G3YA 4RKFA 4AYTA 1IM2A 3C14C 4W9MC 2RB4A 4M1OA 1RVDA 3WBJA 4CRWB 1ZU5A 5CJPA 4Z51A 3RC8A 1CRPA 2WM9B 3A6PC 2GJSA 4OK5A 2ZE5A 4BUJA 2QMOA 4IEIA 1MO4A 3THYA 4TQAA 2XNDA 2OG2A 3X1XA 4L5BA 1KI2A 4KXFB 4MYHA 2FGKA 2AL7A 1CKEA 3MWKA 4NYIR 2QI9C 3KJHA 5FPYA 4YC7A 2FOLA 3GFPA 5B2ZA 3RC3A 2J45A 1ZYUA 4BFYA 2XJ4A 4LV8B 3HPRA 2GRJA 2ZVQX 4EDHA 1E9EA 1KI4A 2IYUA 2VP0A 2WIBA 2IWHA 3CNLA 3KQKA 4CDGA 4XIGS 4JLDA 2VA8A 3PEVA 4G1UC 5EXXA 3SQXA 1R6BX 3NC1C 3L0PA 4PHFA 3HDTA 3P27A 4B74A 5JI2E 3T1TA 4BFXA 3REFA 3TIFA 2JLZA 3GLFA 2H17A 4UNSA 1KK1A 1ZM9A 2VP4A 2B7BA 3QVUA 2YWGA 2O8CB 821PA 4H1UA 4ARZB 2NO0A 2YKGA 4IKEA 4Q4LA 1N6LA 2A30A 4G5QA 4Q4JA 421PA 4C0BA 2EWVA 3FMFA 4BLTA 1FP7A 3L0IB 3EZ7A 4R71A 1LNZA 4LJ6A 4JMPA 4Z54A 2NO1A 3UG6A 1K5GA 1KI1A 4I81A 2YJTD 3CWQA 5GVSA 4NYMQ
chains in the Genus database with same CATH superfamily
3DAYA 4K0RA 2KJQA 3Q3VA 1VRVA 1XVAA 1MD9A 5HBGA 1ZXBA 3W9BA 2GR9A 1MCZA 4G26A 3FW1A 1M0TA 1Y1RA 1CULC 3GOHA 3HUUA 4LVUA 4LC9A 1VHDA 1VE7A 1WVGA 1SZPA 2JZNA 1EB9A 3R3YA 3CBGA 4GXTA 4IYRA 3TD9A 5KU1A 3R75A 3H4MA 5E6RA 4KKXB 1H1TA 1HG0A 5SZHB 4D57A 2G5CA 3A1VA 3IP6A 2DY1A 5JS2A 2LIVA 1NWHA 2UZ0A 3QLVC 4TT3A 2J09A 1C3OA 2ODBA 5EEHA 4CG0A 3EVNA 3P7MA 2GVZC 5DNVA 5EIHA 3RIYA 1HX7A 4NIMA 5C4GB 2WJGA 4D82A 4FYIA 2RGNC 1AN0A 3W8FA 3LC7O 4V02A 1J21A 1S96A 4NP6A 3IIKA 4Z0HO 1EWYA 5B1SA 5BSMA 3SI7A 2Q3MA 5CT6A 1JAZA 5EEGA 4RGBA 2IQ5A 3OX1A 1OTXA 4ERXA 2QRZA 1ZIOA 1T10A 4PBSA 1UPXA 1SKAA 1DVRA 3N6XA 3RC7A 3TOXA 1ZH6A 2DJ5A 4YP5A 2D1FA 1IY8A 4LXUA 4CKBA 2HJHA 4GFDA 4F9FA 5FBZA 1QHIA 1AQIA 1RZVA 1WSAA 2ECQA 2FMUA 2OV8A 2P2CA 3FJOA 2QAIA 3ON5A 4HFMA 5FPQA 4BAUA 4WFIA 1T5BA 3K0AA 4ESOA 5JSZA 2H11A 5HRAA 2W9XA 3ZHRA 2OHJA 2VQSA 3P9XA 4WK6A 3S29A 3VH4A 4D9MA 1L7XA 4NH0A 1TGYA 4KQCA 2X1LA 2X22A 1T8TA 4DR7B 1USVA 2A59A 2MOKA 4MUXA 1C50A 2CXXA 4HL6A 1KYTA 1SUBA 1G16A 4PR0A 2J6HA 5HCUA 4MR8B 3SNHA 1T15A 2CB0A 5H5JA 4X44A 1TCAA 3IDSA 4MH0R 4BQEA 1LDNA 4M60A 4S1VA 2G04A 2X40A 3EFBA 1BE8A 1VPEA 3DAOA 4FFRA 3GBVA 4KRYA 1ACJA 4KWEA 1XQ1A 4ZVSA 2P8SA 4YRDA 2FG7C 2FV8A 1OW3B 3IVGA 2DSNA 2P40A 3TSWA 3TVDA 3AERA 4E88A 3U09A 2H48A 1G5QA 1JSXA 3OEED 2XCSB 1TJPB 4BNHA 1O2DA 1QIMA 2CYCA 3BA6A 4MRSA 2QBYB 4JVNA 1FW8A 2IK8A 4CF5A 5JI3E 1D2HA 3P20A 1AKWA 1H4TA 3N2ZB 1QCZA 1O77A 1LFDB 1RKQA 2JGEA 3OCZA 4FR0A 1QANA 1A2KC 4U7JA 2Y0BA 1Q92A 2XUDA 4ROTA 2KE5A 3RUPA 3ZNPA 3ODPA 1XZDA 2JHGA 2W8ZA 1K8XB 3FFXA 4XB1A 4X8HA 2OV4A 3EOBI 3DM5A 4KNWA 2ZQYA 2A8YA 1JV2B 1KXZA 3W06A 5I45A 4URVR 3KU1A 2EF0A 1OT3A 3WOVA 3ZXIA 2MYTA 1WQ4A 2OVFA 2RGAA 2YV4A 2BV3A 5IC4A 1FRVA 3SQDA 4J0IA 4TOIA 2GUGA 1SVMA 2GEFA 2H1HA 2ZR8A 3GNTA 1GEEA 4IX1A 1II9A 5EZYB 2WJAA 3QPCA 5IULC 2QPTA 1RACA 3S8YA 4TVSA 2C4UA 3ADCA 3PYMA 4RHYA 2C3UA 1ORVA 2J0VA 4GUAA 1P44A 4KO4S 5CBPB 3DKKA 1E98A 1TYBE 1HXHA 2ZSEA 3HA5A 1NOKA 1Q11A 1QAQA 1XO1A 2OWDA 2PRKA 3IAFA 2IV2X 3AVQA 5IEBA 4LC0A 1UC5B 3GJQA 1SXJD 3ZLVA 4DBVO 5IM4A 4RTNA 1DBIA 2ORYA 3A28A 4WEQA 2G9ZA 4L78A 1O95D 4FWBA 4EYKA 3FF1A 1ORTA 4WX2B 1DZIA 4EJSB 3ZZ0A 2AFIB 5JZOA 4BMVA 3FIJA 3IP9A 2R86A 4MB6A 4F5ZA 4C7OB 1DIHA 2G07A 1SVOA 1WM1A 3JRWA 5F12A 1E89A 1Z3IX 1E1LA 2P2ZA 5FNVA 3WGJA 4XWOA 2QAGC 4WOBA 1N25A 3GLFE 3KG2A 3GHHA 2TMGA 2A58A 4YCJA 1JN0A 1WXGA 3FTNA 3KJEA 4FYWA 3RKSA 3RROA 4AD8A 4D9BA 2OE2A 3MWEA 4PXYA 2V0CA 3TOZA 4D02A 5LMCA 1K5DA 1EUZA 3NDBB 1EEHA 4R69A 2BJWA 1FK8A 5LYYA 4DFDA 1JHDA 3PQEA 3EA5A 4AS2A 3UGKA 1JKFA 4NOMA 5TF4A 2NU9B 3R2JA 4ND1A 3G5LA 3UM9A 3CLKA 3WZMA 1XPOA 1DUVG 1SD5A 2W0SA 3DO8A 2LVBA 4W63A 4TKUB 1A7AA 5BV7A 3F5QA 2EZTA 3HKDB 1XKXA 1PVDA 3PP8A 2XZLA 3UK2A 1O94D 3IESA 2J85A 4X1IA 1M2JA 1O3YA 4FEEA 4G84A 1WUTA 1P5ZB 4R7TA 5AKXA 4AT1A 4ZVRA 4X8OA 1NVGA 3HKEB 3UAGA 4Q1VA 2AZTA 1T43A 1DAEA 2AOWA 2KM1A 1L7NA 3P9IA 3QG1A 4J49A 3X2FA 5G02A 2JLWA 2YMMA 3F74A 1M34A 3FWPA 2VNKA 1J99A 3TBHA 1IHOA 1VP9A 3FNBA 5EINA 4B73A 4D9CA 4L6AA 3VNAA 4XB6B 1N4AA 2ZKIA 1WX1A 4KUHA 2ZPAA 1JWBB 4QSHA 1TUBA 4ITUA 4Q9KA 4Y6PA 2UUPA 3N6RA 3WZ2A 1U8AA 4JZKA 1ECPA 2XTNA 1H85A 2YBDA 3OF5A 4D42A 5BWBA 1TC2A 1K7FB 2Y67A 3M6WA 3WLJA 3EX7C 2DFLA 3CUUA 3ZZUA 4LK3A 4O4JB 1E4VA 3EIWA 3ZX5A 1UBCA 4UM8B 3R9IA 4UM7A 1LPBB 2NSLA 3DDCA 4TTTS 5D5HA 1QO0D 3G2MA 2V7TA 3I6QA 5AO9A 2A1UB 2QDXA 5F23A 2WTXA 3VPCA 4LJ4A 4JBIA 3H3JA 3FCXA 1LSJA 3ASYA 3WKDA 5F33A 3A6GA 3MRXA 1W0KA 1Q21A 1F2DA 3WHLA 4RJLA 1PUXA 2OLKA 3L4KA 1L4EA 2YXNA 4Q7JB 1I5RA 2QA5A 4MIOA 4QTTB 5K1ZA 3EY9A 4PO3X 4FS8A 1M2GA 4QC2A 5ECYA 4QOHA 3JQQA 4IDOA 4KQEA 1ADYA 4DQVA 1E61A 1RHUA 4QOFA 4Y6RA 3WQSB 1VKJA 4FR2A 4D8UA 1K88A 1DE0A 2XUJA 3CLSD 3M1LA 2J3DA 5DEIA 5G40A 1KIFA 5IXJA 4JBLA 2VAVA 3PEWA 1MC1A 4F3NA 1AA9A 2GTIA 4PG7A 1X0VA 1K7SN 2G7ZA 4U63A 1NW7A 3OTQA 3NNNA 1EE1A 1MABB 2AKAB 2WWRA 3DXZA 3G2HA 3OTWA 3H5IA 3TQQA 4KO2S 3NVAA 5EIBC 4C0HA 4ZI7F 1ZCFA 4AIRA 2VDJA 4C4SA 1LC0A 5HMMA 4IO1A 5BW8A 3RV3A 1BX0A 4NULA 5A7HA 3PC8C 4P7JA 1LF0A 2FY8A 3C6KA 3STUA 3UWOA 3UJ3X 3JPYA 2P69A 4ENWA 3CX8A 4Z3OA 1A7KA 4C78A 2JC3A 4RNDB 3HZOA 1J2JA 2UYOA 5DNEA 4A3SA 3DONA 3R9WA 1F17A 5C1IA 2WK1A 3A1CA 3DNMA 3NAQA 2MDTA 2ZBGA 5FL3A 4LY6A 1DCKA 2R7LA 3GH3A 3N75A 4BZZA 3CRMA 1KFCB 5CNMA 1TADA 1F6WA 2D0IA 1NLZA 2R0QC 2JLQA 3E53A 3UHPA 2ZM6B 2P30A 2Z0MA 4FCWA 1NTOA 3LVBA 2XGMA 3QJYA 4N0DA 1WZIA 1TMYA 1ECBA 2REBA 3E3OA 2PV0A 1AMNA 2FPLA 5I3ZA 5EXPA 5U4QA 1UBOS 1Z0IA 2ZE6A 5FBVB 4MITA 1RCFA 2NPIA 1D3AA 2H1IA 3OIDA 1B15A 4LNUA 3A31A 3ZE2B 3P0RA 2FFBA 3U44A 3T9FA 3EGIA 1D4OA 4NCIA 2GK6A 5EP2A 3KEMA 3UWDA 1QFMA 1J5EB 2OKGA 4YI3A 2OSBA 1OC2A 1SCJA 1UINA 1V5IA 5TPWB 2BTQA 1OGYA 4E5VA 3BSYA 3OJLA 4G25A 3GLSA 2IP2A 5A7FA 3QLEA 4JEMA 1T6NA 3D7MA 4I1UA 3W8NA 1GPWB 1V43A 2G72A 3ONNA 3WLFA 1V11B 2DFPA 5DCUA 1WVMA 3G8DA 3F49S 3LBFA 3PFNA 1YQXA 2QY6A 3AKEA 1S1MA 2IU6A 2PQMA 1DIOB 3ACCA 3OC0A 4J0QA 4LYYA 3PV0A 5EUBA 2Z4SA 1L4FA 1E6WA 2EW2A 3K9NA 4R3NA 3VR1A 1WULS 3FYUC 3ZLUA 5ADVA 5KEIA 1PR6A 4QUKA 2J3MA 1SCAA 3OZCA 3P9QA 4MQ5A 4EYQA 2UAGA 1G42A 1AS3A 4K9MA 1ZDMA 3V8QA 1JQBA 3A1SA 1DXOA 5ALEA 3QWIA 1FDIA 1YT5A 3C3CA 2JCYA 1E3DA 4Q4CA 4KU4A 3DYBA 4IMIB 1CY2A 1SQ5A 1PFQA 4Z0PA 5FH9A 1JDZA 1X70A 4ZU3A 4CF7A 2VUIB 1C1DA 4G5FA 1HK7A 1P3JA 2FPPB 4TV9B 1W52X 1XCMA 4CHTA 4G4GA 1KH2A 1XD9A 3K70B 3K92A 3MCZA 4PX9A 3SOZA 4RIFA 3UN1A 1KNQA 1TI7A 1U99A 1UJ4A 4RWZA 1XQ6A 4R2JA 2M6SA 4L07A 2BZSA 2C7VA 3UUGA 2IHNA 1OSNA 3QLJA 3CKMA 2LCFA 4QPJC 1JQKA 2OB1A 2Q3JA 3EAQA 3PXAA 5K5EA 2K6GA 1CXZA 1ZM4A 3KC2A 1GTZA 3IUNA 4RIIA 1DCMA 1E3EA 1VLLA 3P26A 3QA3E 2QG9A 4O6VA 4CCYB 2O8DA 3DEYX 3FUUA 2Q5EA 4HB2A 1NW3A 2B99A 4AKHA 4REQA 1LPPA 4JLUA 4CEHA 3FSGD 2X0DA 4AX8A 1M1YA 1QRUA 1WA5A 1X74A 1VIVA 3R5FA 2JLUA 3NB0A 4EY7A 4EX7A 2PZJA 3CZMA 1PN3A 3JWJA 3PYXA 3LPAA 3WDMA 3VR5H 1PGPA 3U3DA 1L6IA 3IA7A 3C70A 3QLVA 3CPEA 2VDQB 3TRIA 1D2AA 3VR5A 1U81A 1ZJJA 4UATA 3MFQA 4C07A 1Q19A 4PAMA 3NHWA 3A3OA 4PN3A 1XJ5A 2OFXA 2WNIA 4JITA 4Z1MA 3DBRA 4RJKA 2Q1TA 2CMKA 5ERXA 4AY5A 5JZMA 2C0CA 5FAXA 3UMYA 4H4DA 2ZUFA 4CUKA 1F60A 2CFOA 2ON6A 1HTWA 1XXHE 3RTGA 2CD9A 2WLTA 2ZB8A 3KOOA 1DQSA 1ZZEA 2J31A 1DUSA 2V58A 5C8YA 3ESCA 4B0OA 4EB0A 2E1PA 2X6TA 5GGXA 3T7DA 3QUTA 1PGJA 1M1YE 1A95A 2C82A 4R8VA 2FOXA 3I2KA 2Q0QA 4KGDA 2HU5A 1MJHA 4EJFA 2SHKA 3GP8A 1EK0A 3O4VA 3OZAA 4BNZA 1RHJA 3NS7A 1T8PA 2ZSIA 3KTOA 5IK2D 3GFOA 1TZKA 1W36C 1W46A 3RVJA 2XHZA 4GC5A 3DP9A 5TY0A 4NWIA 1HQCA 2BFAA 1R16A 2JJYA 1QRTA 4HTFB 2Q2QA 2ZWVA 1QIJA 4B7XA 3OUUA 1DC5A 3EXHA 3ES9A 2FRDC 3PSAA 1RZUA 1SJ9A 4LHEA 4L22A 2XUQA 3IQFA 2DT5A 1XRMA 3CBQA 3UWKA 3G0OA 1IOZA 1EFAA 2DTDA 3AUUA 1IM8A 2ZJFA 5ILOA 4H18A 2YJ5A 1JDPA 5HKBA 5BV1A 1KP3A 2OP0A 2C2WA 2HF2A 2OM6A 2O8BB 3DYIA 2DRIA 4KV9A 5IM5A 2LNDA 2GPBA 1AH2A 1BKSB 3R3VA 3VNSA 4FD3A 4BJ6A 1GNPA 3ZI0A 4HXEB 3S0JA 1EM6A 1NBMA 3TE7A 1V16A 3IQGX 1GRCA 5AHXA 3P0IA 3PUZA 2IZZA 3V4PB 4HAXA 1PV4A 2TRSB 2Q21A 2AJ8A 4YJ2B 2XCUA 1XTQA 4HO1X 4MYCA 4F93B 5IF9A 4D3XA 3VFDA 1R9GA 3TQRA 3F6RA 3ZTYA 3NHUA 3DT6A 1TCBA 4LQLA 1RBMA 5CT9A 1L8XA 1EWVA 1PQ4A 2DAPA 2VYVD 2VZ9A 1X80B 2MSLA 2GPWA 2EOAA 4FEYA 2H85A 2HREA 1GY8A 2HPVA 1VJRA 2BDEA 2PMBA 2O5RA 2FW9A 4AVYA 4H6WA 2J0EA 3BE6A 1JDUA 1YJ8A 4BO9A 4EHLA 4IOLA 2VDWA 2L69A 3M4NA 4RD0A 1JH8A 1DFHA 1YJBA 4OHFA 2WB4A 3X1MA 3FCYA 5B1EA 1VB3A 5KWSA 1VL2A 1B6TA 1MRZA 3C4QA 3LBHA 3EVCA 4HDCA 3S2ZA 3V4SA 4V0OA 3I5YA 4DY4A 3O74A 4Y6LA 4O08A 2O05A 3LPCA 2AHRA 3VPXA 5IAOA 3ER8A 1MT0A 1U8FO 4U6NA 4PX5A 5AHOA 3UHFA 3DM9B 4EVSA 3W5CA 4LSZA 3B6IA 3TLZA 3Q2KA 3SC2B 2BEJA 1UDAA 3KB8A 1ZD8A 2ZETA 3A6EA 5I9IA 2WFLA 2DGDA 3NJ8A 4S35A 1FTYA 1Z8FA 5IXSA 1JFTA 2NUPB 3GJ4A 3IQIX 1C2YA 1HT2E 3TRKA 2WV9A 3EQ6A 4JLMA 5IHXA 3GEIA 4XJXA 1ZK4A 1QHGA 2CZQA 2IRWA 4C7XA 4Z1OA 2B1RA 3UH0A 4EPWA 3LL7A 4YQZA 4CEJA 1URPA 1Y3IA 2V45A 3FLEA 3HRHA 3VGJA 3DOFA 3EZYA 4OLBA 2J0UA 3HB9A 3SZUA 5LQAA 3JPWA 1GTMA 4MIYA 1PVVA 5MFZA 3RVNA 1U1GA 3V1KA 1KZ7B 4PN7A 4PG4A 1GUZA 1J7KA 1G21A 1N9GA 2DUJA 3M2TA 3OG9A 2GGSA 1ANKA 3BAFA 3IMKA 3F3MA 5BW4A 1NM5C 1A76A 4R2IA 4JYAB 1W47A 1YS1X 1Z6GA 3X2SA 1U9CA 5CVUA 1BGWA 3CLVA 3ICWA 1CS0A 1I0IA 1ZITA 3JASB 3L41A 3QF7A 1FYDA 4HH3C 4A7PA 4DA9A 4AX4A 1AJEA 2BKLA 4TVKA 2Q07A 5TNXA 4FLMA 1VE3A 2FQXA 5CDSA 3OJFA 3LXRA 1W73A 1XVTA 1E1DA 1D8AA 1SBNE 2PGJA 2V9CA 3GQBA 4L15A 5F78A 4F21A 4D98A 4W9RA 3CF6R 3EGEA 4MZXA 4DCVA 4DV1B 3LT0A 3D2LA 1POXA 4FT4A 1TCUA 3A06A 3GJYA 3ND8A 1M5TA 3UICA 3VR4A 3I4FA 5JAMA 1GR1A 1MTZA 2R8XA 4O33A 3WZLA 1JAYA 4RZ3A 4CLRB 1MX9A 2HPHA 3LCJA 4CR7A 2IHYA 2QRGA 2QU7A 1Q0RA 1D2GA 1KI8A 2M1XA 3W7BA 4CT5A 1YOVA 4X7PA 2YXDA 1U2ZA 4RPGA 2W8BB 1G20A 3D8BA 5K0CA 3K94A 4D5GA 5H3CA 5ELXA 2ZIXB 1T36B 2PUEA 2I66A 4RK1A 3SE7A 1LI4A 1QRSA 5EJ8A 2GK4A 4II3A 3UK6A 1BCSB 5C5DA 2PVCA 1LLCA 4MR7A 4XX0A 2PL9A 1EXVA 4BDTA 4BL5A 2OILA 3I8SA 5K8VA 4Z2AA 1N92A 1NVUQ 3D8RA 3LY5A 1DIAA 2DJIA 4TN5A 1A7UA 1BEUB 1VSQA 3BDIA 4N5LA 4Q16A 1SEVA 4WCFB 1IY1A 3VJLA 3ZGYA 5DU2A 2O5EA 4PYIA 2NVWA 2H57A 2Z95A 3LHIA 2QG6A 1M7HA 1J9GA 1W4AA 2FDRA 2QTTA 2Y68A 4MA5A 1ICEA 3T1NA 4X62B 4X6XA 2DBQA 2GEBA 2O0LA 4DSTA 4DAOA 2X0IA 2Q4BA 5JCPA 3PRYA 1Z88A 3B1YA 3OC6A 1IPFA 1EE2A 1F1JA 4JJ7A 4M36A 3KDSE 2ZSKA 3R5TA 5CLGA 2WU0A 1JFFA 5T64A 1YB4A 5REQB 3FPSA 4DOMA 1DELA 3VR3D 1P77A 1UADA 2HMAA 2HEGA 4S1OA 3N8IA 2BL4A 3L0SA 5E4YA 3GBSA 4D4HA 1MGOA 3B60A 5L9AA 4JNCA 3HYRA 2GT1A 4FHGA 4MGZR 3U7JA 1WZCA 2X76A 1D2NA 1I13A 1PFYA 2BKAA 2ATIA 2QP4A 3G2IA 3MTJA 4HS4A 5GONF 1VA5A 2HIAA 4DCPA 1E5DA 4MS3A 2WDPA 2NYUA 3S3TA 2KS6A 4LOHA 2WZQA 1KO7A 1MOZA 2CFCA 4G3XA 1E5QA 1JB1A 3AHFA 3IP3A 4QODA 1GKLA 3AUTA 3B13B 4A2CA 2JLCA 1UFQA 4QA9A 4X92A 4HQFA 4PYOA 1EX6A 2ZJ6A 4QSMA 2XDAA 1H4VB 3A1TA 3BE5A 1LCIA 1T3HA 3GFRA 4P3NA 4CV3A 5IJ0A 2ZI6A 5JYBA 2HF9A 3ZXSA 5IZCC 1S01A 1T35A 2Q3DA 4M9UA 2WJPA 5ECWA 3T3MB 2XMSA 3MQ4A 4EPTA 3KVOA 4AURA 3GVHA 1POWA 3PJFA 1TLLA 2VQEB 4DV7B 1HM5A 3BSFA 3DMPA 3QMMA 1GTSA 3HBAA 1D2EA 3UAVA 3K9QO 5A3RA 1G20E 2C3PA 3TI9A 3I64A 2FN3A 1GPDG 3HU2A 3BGIA 3CJTA 1VA4A 3ZU5A 1GU7A 3KPJA 3SQOA 3VXKA 4XVUA 2YZ7A 4UE2A 4FC6A 1H4SA 2Y77A 1F7VA 4OQXA 4OHYA 1DRJA 3WY9A 4JFRA 1QGED 3OHSX 4DJTA 4LN1A 1KEVA 1MIHA 1AUVA 1XC7A 2CDAA 4FGSA 1HDIA 1TVMA 4R0VA 5KMGB 1ZEJA 4EKYA 3T0FA 5IRCD 4HLNA 4HXGA 2VAWA 2QN8A 5IH7A 2WIDA 3LKVA 3C5HA 2DBRA 3NRBA 4N9WA 3V8EA 1QDEA 4LXGA 1XVIA 1SK8A 4KQ1A 4KAAA 4BNJA 5BQOA 2RHLA 1R88A 2OZEA 2QQ5A 3ZWVA 3RADC 4GLOA 2ZYWX 1ZC4A 2FSFA 1FUEA 2JGLA 4ZVVA 3ICEA 1UPBA 3Q15C 1U8XX 3PGLA 4Q82A 1V5WA 4RXTA 5HIKA 4FBGA 4COOA 2C7RA 1BVRA 1E9VA 2PWBA 2HK8A 3OSUA 3W1EA 5JEDA 4H3VA 3UJBA 4DLPA 4JI4B 1YQWA 4HN4B 3HQ4O 4FE3A 1RFLA 2QEQA 2G1KA 2VXOA 2XE8A 2ZVDA 1CLEA 5BSEA 3TK1A 5DM2A 2RGNA 1AD2A 2JVIA 2ZRNA 1U94A 5F77A 2YN4A 4IMPA 1FQWA 1E0JA 4BXOB 1U5BB 3BL6A 1EVIA 1GSHA 1AXGA 1XF1A 3JQ7B 1T1EA 1QZZA 1Z8NA 3NTQA 4URZR 2MWMA 3TB4A 3VOBA 4ALKA 3DPIA 1Y5RA 2CL0X 2WPDD 4AXBA 3VDNB 2OHGA 3D7NA 4HS9A 1SAYA 2NO7A 4LMRA 1OKKD 1JG2A 1ZJ5A 2OCPA 4NI5A 2OUIA 2EERA 4FKBA 1E2IA 1P19A 5G3YA 4YRPA 3AJRA 5DX0A 2HK7A 1AVTA 3KZOA 3PEUA 2E6UX 3FHOA 4PYNA 2VHYA 4ZVPA 3U1TA 2ID7A 3EFOA 4D46A 3M70A 3LXMA 2GD6A 2OLJA 4R1NA 1L4GA 2L18A 3IBYA 4CFSA 2AYXA 9ABPA 2O57A 3QWHA 3TQSA 3ZZNA 1HFEL 2QORA 4RKWA 3NWBA 1GG2A 3MRVA 1NXVA 1Q44A 2ZUCA 4CG3A 1GA1A 5JSUA 3PRJA 3LKZA 3VU3A 1OQAA 5FQNA 4FOPA 5AHRA 5BWOA 3KX2A 4ARBA 2WD7B 2C8KA 2FI1A 1XELA 2BR3A 3LT2A 2XUHA 2OBLA 4DILA 1DWOA 4EK9A 1UBUS 3FR8A 4LRQA 1FDUA 4HDSB 3WK6A 1F2UB 3CUEF 2N75A 1QS0B 4LC1A 3F98A 1Q7CA 3ZU3A 5FUYA 4Z4QA 3Q87B 5FYQA 3AJAA 2AW5A 2OBNA 2AC4A 4UU0A 2X0RA 3UV6A 1UPAA 2REXB 3F6YA 2BISA 1XZ8A 1KI7A 3K8YA 4AP9A 2NQTA 1IZ7A 4QZVA 5IEJA 2L42A 3GLIE 2BH2A 4KTVE 2ILVA 2XD4A 4ALLA 4D3ZA 3IIIA 2QTVB 2B4QA 1U4OA 4QUJA 3E82A 3WLAA 4MRRA 2BUAA 1UM8A 2D54A 4IUCS 4P81A 2PKRA 4DC0A 2PUCA 1U0JA 3Q7SA 4G1CA 2IHTA 1YB2A 3ZDQA 3SFTA 4ZPJA 2QP9X 3ORFA 4UHFA 3K9BA 2I2XB 1N0VC 3DO5A 4GO1A 4IIHA 3SIRA 3WVNA 4K03A 4CL0A 2X23A 1UQRA 3HG7A 2W4MA 3M6FA 1R66A 2WNHA 4YQYA 3AG6A 4UCQA 3J81k 1SUCA 4FFNA 4NXMB 1FVOA 4J4BA 2CJFA 2CNBA 1UKBA 1QZ3A 4EYEA 4L85A 4P4TA 5F2NA 4BDSA 2YVLA 2JD2A 4HFJA 2V4ZA 1NLMA 1XXHA 1GT91 2FPXA 1SG0A 1K4MA 2NXEA 4JI2B 3M3HA 1VIDA 2ZS9A 4MW6A 2JJ1D 5DH9A 3QU5A 4ETMA 1NHGA 2HQBA 3I73A 4UTOA 3SZRA 2EF1A 3ZV5A 1QG6A 1SXJB 3ZWMA 2HPAA 2GM5A 4C0LA 2PH1A 4QE3A 4DLWA 4L2IB 3ESAA 2I1VB 1JEEA 3A6KA 2BRUA 5D2CA 2QLLA 1VG1A 5L7YA 1OB2A 2YV5A 1XU4A 2AR7A 2PLWA 2ZJ8A 1SCKA 1YVUA 3AB8A 3KR9A 3NC0C 4QNNA 3V7YA 1TM7E 2BR5A 1ONNA 1SZDA 1XE3A 3CZ5A 3FH0A 4TTSA 3SSNA 2QVGA 4PGAA 4Y2JA 4FZJA 4CLHA 1RKVA 4QG7A 4KYIB 1LDYA 5AJHA 5JXJA 3A1DA 1JIVA 2ZR9A 3I9OA 3LLVA 3CS3A 3BXEA 3LCRA 1B00A 2A5YB 2OOSA 3AI7A 4BO2A 1ODLA 3VJRA 4TKLA 5ESDA 3NJ4A 5M34A 5ILQA 1WXIA 3ZG6A 3OZTA 2H4JA 3WMWA 4TXNA 3IAUA 1U7OA 3MJVA 5TC4A 4GH5A 1LS6A 1Y63A 5CK4A 2PAFA 4WAUA 2WP8J 2E89A 4XGQA 3E5HA 1R4NA 2D0DA 1GQOA 2ZUDA 3E4CA 4RDHA 5C8XA 2CLEB 4A1FA 3D4IA 3QPUA 2RDMA 2QR2A 4XI9A 5EXEA 5KYNA 4DV5B 4V03A 2MSDB 1OAAA 1UF9A 1AXEA 1CVIA 2VAMA 1T4GA 1CVRA 4Z9FA 1DAOA 4BCDA 2H0QA 4J3JA 4J1SA 1CNFA 2GEJA 1UODA 2O0KA 3HVKA 1VLZA 3KYDA 4I6JA 5IBRA 3T7JA 4AMVA 3T5PA 3DFMA 4GBED 1VJTA 4QECA 5FLXA 3FOFC 1ECJA 3D6MA 2E18A 1YDMA 3RI3A 4BATA 2DU8A 2P2NA 2QN6A 4PO1A 4XEUA 3K5HA 4JJFA 1BMTA 4QYTA 2BT4A 3KPVA 5FUQA 1JDBC 3UBTA 5ARBA 3TXXA 4ZYZA 3I01M 2LIPA 4UREA 1Q0SA 3DVAA 2R8PA 4Y8VA 3CN9A 1FUYB 1TA4A 1A5TA 3FGPA 1IFXA 5B7PA 3PVSA 4DCJA 5BSVA 4A23A 3ROEA 3OKPA 2XCOA 4B17A 3PNMA 2VH2A 2XT0A 1XTJA 1XPJA 1U6KA 3SC4A 1KDRA 3UOAB 4P35A 2O2YA 4M8KA 3EXEA 1RLIA 4AQDA 3EIOA 4R05A 4KE6A 4NBVA 2GD1O 1PR2A 4ZO9A 4DYDA 2C04A 3AONB 4JXZA 1BG6A 1B26A 2OAEA 2P4UA 2VBIA 3LT1A 3WAKA 1E94E 1OLSB 5I9SA 3QXGA 5CCEA 5TPWA 3KR1A 3QVLA 2PWAA 5K7SA 1SBHA 3DAPA 3IDQA 3O3CA 4XDGA 1SUAA 3TZLA 1A2QA 1CFZA 3I37X 4B76A 4JBYA 5AOVA 5DNUA 2HA0A 4TN1A 2JA2A 1V11A 4AKTA 3S99A 7GPBA 3NEYA 5KC9A 3CZPA 2R6FA 1CR1A 1F5SA 1WCV1 3CUTA 2VNHA 4ZMRA 2ORWA 3OSZA 3WR5A 5I6DA 5KX5F 1NBME 2O5CA 2QOEA 3ESXA 2CDRA 1RD4A 1JA0A 3R7DA 2HJRA 1VQ1A 2Y0EA 4KBFA 4OL0A 2C84A 5FPSA 3RD5A 1X9GA 4PCAA 5I47A 3D8SA 3VHLB 4A15A 2JLRA 1KYWA 2HFKA 5D7NA 1ISMA 4C06A 2FW8A 3E8MA 5JVDB 3VZQA 2C7QA 4I99A 2C9OA 4CG2A 5HXAA 1EA7A 3O9ZA 1DKPA 1ZNXA 1LJLA 3T3PB 5EWLA 4HEA6 3O73A 4HOYA 1U8YA 4YX9A 2TECE 3LQFA 5AVKA 1XA0A 3TX6A 4YUYA 1UJBA 1ZS9A 1H94A 1IJBA 1A69A 2W37A 3H0EA 3R1IA 3RQIA 2C8JA 1MB2A 1JDNA 1AU9A 3GVIA 3B85A 1K9VF 4PLYA 4YEDA 4JZYA 1C9EA 5GOTA 2X14A 1Y9ZA 1NMSA 1UWLA 1ZGGA 2HJ9A 4UEQA 5EPUA 4AF6A 2MJLA 5JARA 3IYLW 4AY4A 1O94A 5FTJA 4RDIA 3ZC3A 2Q0SA 5DCWA 1VYTA 2B4AA 2JAPA 2WKQA 5F9MA 3AW9A 3DE2X 1I6MA 5FWXA 1TNDA 4EB6A 4C6HA 1V9SA 1XK7A 1ZOSA 2XGGA 3KL2A 3OZIA 4XWYA 4NMMA 5F51A 3RVPA 2O8CA 3E9NA 2JLBA 3PJRA 3DV0A 4A10A 4YPOA 4EB8A 4TWBA 4C21A 2OBYA 5EE3A 2WSBA 4B6FA 3PC6A 3U7IA 3WWPA 4D44A 4KFRA 3INGA 2EKDA 1QJ4A 3OWOA 3BB1A 2FPGA 3PI6A 1ZCZA 4IR7A 3S81A 4QYSA 4RH3A 2ADOA 5CLLA 3ZWPA 2IZ5A 1F38A 1G55A 2YR0A 1T2CA 4Y6OA 2JFYA 4JI3B 4ALMA 5CURA 2ONZA 3SXJA 4FDLA 4MJ7A 2WJYA 3TXAA 3HABA 5KNBA 2BY4A 1VJDA 3BWCA 1T0PA 4Q12A 2WD8A 1YMUA 3T1QA 2ZSFA 2I3ZA 4MS4A 5E3HA 3P96A 1DV2A 1OASA 3BL8A 1H8HD 2Y1WA 3G5TA 4ZYYA 3OTOB 4N8EA 3ZZMA 1JW9B 4D96A 2QRVB 3JZAA 3U3JA 3VUFA 2ZYIA 1DO0A 3DBVO 5EE0A 1TGVA 3AZPA 1U31A 2FMFA 5H3HA 2Z5GA 1WXQA 3RVOA 4IG4A 4K2AA 4L9RA 3BCHA 2C58A 3UMVA 1CYEA 1VE9A 3GT4A 2AE2A 1XMQB 1WEHA 3EXG2 1H66A 1LKZA 4MWDA 1QIEA 2XNJA 1XU9A 1YU6A 2L82A 1ZK0A 3U9TA 2FVXA 3LIPA 1LK0A 3PXCX 2H9YA 4R41A 1FL9A 1YR6A 4ZALA 3GPLA 3HUDA 2H16A 4EPYA 1U0BB 2FN4A 1V3UA 2FPKA 1NVAA 1DJNA 1NVTA 2I71A 4Z4GA 3K9CA 5IBCA 3O83A 1XIVA 1QTNA 3DFFA 3LUCA 4KO1S 4P08A 3NI2A 4HKTA 1Q17A 4PC2A 2B4YA 1N6PA 1E1CB 1I30A 1E3MA 3RTEA 4FCCA 4RVSA 1HUQA 4BECA 2P1DA 2XBLA 1YJAA 3CSUA 2KSQA 4KRGA 4LWPA 2O0MA 2XBUA 1NUPA 1X0XA 1HKHA 4XIFA 4D9KA 2FKAA 3MGAA 1P18A 2CMGA 5AVVA 2RIRA 1PSZA 3ORYA 4FP9A 3KAPA 4IBOA 4LVOA 1K8YB 1OFUA 4CMJA 2NO4A 4ZRNA 3GHYA 2GASA 1E18A 4EY4A 2AJLI 3E2PA 4KWIA 4YT5A 4LPKA 3MA0A 4Y2PA 4WZBA 2WVGA 1J09A 2AX3A 4NFYA 4ZI2A 4YJ2A 1KU6A 3D3WA 2DMRA 2C94A 1K8QA 2PBZA 2W6JA 3GUHA 4HWSA 4IIJF 4LRWA 2QTFA 4N6NA 1IZ9A 1Y6ZA 4F3TA 5AW6A 5TQ0A 2COEA 4RZIA 1AUOA 4KLRA 1SU4A 1DWPA 1WP9A 4H59A 4ZU6X 1X80A 2O8VA 3OZDA 1QPGA 5B6IA 3HCOA 1D9XA 4KDCA 4BNWA 3R4CA 1VL8A 4C4RA 3AUAA 2IP1A 3NV7A 1JDSA 3S1LA 3VKUA 2VTBA 5FUVA 3NQ41 1GUAA 3KOYA 3QVMA 4L6CA 3UKOA 3UT5A 4R98A 1WTCA 2ODAA 1RWPA 3B6EA 4RDCA 5IKEA 3PRHA 1NT2A 5E7QA 5K3AA 2CV0A 2JEYA 3RASA 5CD1A 4HEHA 2J3IA 3C1TA 1XTTA 4JC5A 1GKYA 3NT4A 3FLBA 4FJ2A 1IWOA 3E2MA 3TKAA 1IB0A 2O2IA 2PZ8A 2Q4DA 1PGNA 3UJAA 4BC1A 4UNRA 3VNQA 1RMTA 4HI0E 5IN5A 5K8CA 4BNDA 4CL2A 2G4CA 1J1IA 4BBAA 4NU0A 2BZ1A 3WGNA 5TPZD 3ZXUB 1UWVA 4I4TF 4LE1A 3DCIA 1TEZA 2Y99A 2QZ4A 1A1SA 5BQ3A 5C1DA 2R751 5K03A 3AFIA 1P1BA 4RYLA 1XQWA 2HADA 4R3WA 4XPIB 2Z98A 2NUPA 3TL2A 5CB8A 3LGSA 2XJ9A 3MN1A 5BUSA 4RJIA 4I1IA 4QGAA 2WJWA 4RZXA 2VR1A 5LD2C 2HLDA 2YMPA 1NMYA 4BMZA 3H19A 2GZAA 5AH0A 1CUHA 5C7IO 1WV0A 3JVVA 6CHYA 4UFPA 2GYWA 3NM4A 3ZD7A 2DFTA 3FYUB 4OMFG 4RK7A 5AW2A 4GF5A 3RTAA 1MJ5A 2FFHA 3RVRA 4ZTUB 2R11A 4H17A 3EAFA 4XYMA 4IOKA 2W2KA 1AF7A 8AT1A 1MUUA 4PAGA 1IY2A 1QG0A 2QM8A 5D86A 2JIDA 1T6ZA 2HTFA 4U7TB 2X15A 1YO6A 5KOYA 4B4OA 2Q5OA 5FWDA 1NV8A 3MUFA 1B8NA 1P7YA 1SHKA 4HUQA 4KXXA 4HATA 4NZYA 3L6RA 2FSVC 4NPCA 5KNCD 2DR3A 4QXOA 4A82A 4CTOA 1PWZA 4TRMA 1GXSB 4EMBA 4CDNA 1J1ZA 2LKDA 4PV7A 5ALTA 2BMEA 3UHOA 3RVLA 2NTNA 1E6LA 4JJ8A 2VWGA 4MRNA 3T3OA 5EXSA 1QUEA 2B35A 1PTKA 2INGX 3BXFA 3V4FA 2P6NA 4LF8B 3PGVA 5FBHA 3BHNA 3FE2A 1T8SA 2F9MA 3D6JA 3PX3A 5HFJA 3RU7A 4E32A 1C8VB 3H2IA 3WJ2A 4MGEA 3EVEA 2JIMA 4N7RA 4B3CA 2ZIXA 4DIDA 3Q0IA 2BMVA 4F5YA 5JG7A 2BN4A 1QG2A 3LHSA 4BQPA 1M1ZA 4RY9A 3CLSC 4AMUA 3PZRA 2PZLA 3VSBA 4B2YA 4XXHA 1VLQA 4TWIA 3UGQA 3PNQA 4CLOB 4ED9A 1HTBA 3GDOA 4XKJA 4XGIA 4PO9A 3S68A