5CJ2A

Ran gdp y39a mutant triclinic crystal form
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
197
structure length
197
Chain Sequence
b'QVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKAVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPALAAQYEHDLEVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding nuclear protein Ran
publication title Catalysis of GTP Hydrolysis by Small GTPases at Atomic Detail by Integration of X-ray Crystallography, Experimental, and Theoretical IR Spectroscopy.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 68
structure length 197
sequence length 197
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2015-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5cj2A00
1E79D 1M1YE 4JL8A 2VSFA 2YWFA 2FH5B 5EE9A 3U61B 4KO8A 2OCAA 2NQ2C 4ON9A 4XD7D 1SKYB 4YMWA 3QEOA 2WKRA 4L9SA 4V0LA 4QJ3A 1Z63A 1G8GA 2OBLA 4HAXA 4CW7A 3KQUA 3FMIA 2WJGA 4QBIA 3KUCA 5G41A 2XX3A 1WF3A 1TUEA 4S35A 4D4JA 3W34A 2QBYB 3H1TA 4NMMA 3GP8A 1XU4A 2OE2A 3QKRB 2QN6A 4Q1AA 4E5UA 3GLGB 1Z6GA 2JLUA 1ZNXA 4GOKA 3H84A 221PA 1P2TA 4K81B 4P3YA 2VL7A 5A5GA 1X8LA 2GZDA 2O0JA 4BFZA 4YMUA 3EZ9A 3QXJA 5SZKB 2HYDA 4TQ9A 2QMEA 1XZPA 1Q1BA 3D8BA 1KAOA 3GJ5A 5KSOA 1U99A 5FUYA 2A9KA 4HB2A 4EQ6B 3BBPA 3CPEA 2E9SA 5E95A 821PA 1JR6A 1JR3A 1GZSA 4QJ4A 4LPSA 2OCBA 2GJ8A 4HLQB 4B2LA 1XEWY 1Z0AA 3BAFA 1OH7A 4XSHA 1Z0FA 4JZKA 4LOAA 5HZKA 1B0UA 4TMTA 4C0BA 4D25A 1C4OA 1HT2E 2HF8A 1M7BA 5GJVC 3LNCA 1N6LA 3AV0B 2G88A 3S1AA 1H65A 2H7VA 4B44A 1FTNA 4HI0E 4W5JA 2VF8A 4GL2A 1JR3E 3WHLA 1NI3A 4B3CA 4NDZA 3FWYA 2XB2A 3CBQA 2W6JD 3MG9A 3OEEA 4A2WA 3GEEA 4TYYA 3MAAC 1J90A 4DKXA 1ZIPA 3R7WA 4JLPA 4F4JA 1R0XA 3UWKA 3DZDA 3CRMA 4QGAA 4CRWB 2N46A 3RSLA 1ZP6A 3IILA 1Z5ZA 4A15A 1QBKC 1T0HB 4GI7A 4Q7MB 2ZM5A 2QRZA 4OKSA 1EK0A 2PMDA 2AWNA 4RKEA 3PEUA 3Q7PA 3KTAA 1HQCA 1QHHB 1IOZA 1U90A 4EDHA 3ASYA 3B1ZA 1ZM7A 2BDTA 4U5XA 2FPMA 1MV5A 1N6NA 4TQUS 5KO2A 5DN6D 3TAUA 1HE1C 1COWA 4GOJA 1ODFA 3SFZA 3C5CA 2DB3A 3PQCA 4A0FA 5AJWA 4DLUA 1GL6A 5KNBA 2WIBA 4RZ3A 4QNRA 2J3EA 3A1WA 1OKKA 4POAA 4D2IA 1KY3A 3A58B 3AKYA 4H9GA 3ADCA 4MA4A 3DOFA 4L9WA 3PJRA 2GCOA 4M9SA 4C7OA 4NYMQ 1HTWA 3IBYA 2QM8A 2DBYA 2ZYUX 1R8SA 3O8CA 2DWQA 2CDNA 2O8DB 2BVNA 4JIMA 4Z8XA 2J7PA 5FOWA 3Q5DA 4HLDA 3QNUA 1CLUA 2ONKA 2RHDA 4M4SA 4N0DA 1E9FA 3B1VA 5H68A 3KB1A 2ZVPX 3EPJA 2X2FA 3AVQA 3C14C 2Q3MA 4C2TA 2G1KA 4URYR 2DWPA 1UAAA 4BFSA 1P5ZB 4EAQA 4TZ0A 4M9QA 2JJ2D 2BBTA 4Q4JB 2JAQA 4KBFA 3NBFA 2QE7D 2WHXA 1K6MA 1T9HA 3AUYA 4KLZA 3SS8A 1GNRA 4BLQA 1F60A 1M7HA 4ZKDA 3IIKA 4QNMA 1N2CE 2I4IA 4R7ZA 4NPHA 3IBGA 3KKNA 1VCOA 2HV8A 4MRRA 3EIQA 2IYUA 721PA 1W0JA 4OHWA 3SQXA 3RRMA 3E2IA 4US2R 3BB3A 4IOKA 1H8EA 4WBSA 3VHXA 4IFEA 4GMDA 4LSGA 3FYHA 2B92A 4BE7B 3KKMA 1TU3A 4RY2A 4BFXA 4Q01A 1ZCAA 5CYPA 3PUZA 1ZRHA 4JBXA 2FEMA 3NBYC 3OESA 2XTMA 1XXHB 1KHTA 1H8HA 4PC3A 1XD2A 2VP5A 3HU1A 2A78A 3M0EA 2IYYA 4LWZA 1OF1A 1GL7A 5DSZA 4E03A 5LPNA 1OXSC 1ZM9A 4CEIB 1SVWA 3EXAA 4MYHA 1EFUA 3T34A 2BEJA 2D7CA 3TW8B 1G3RA 3ZD7A 1KI6A 1GOTA 4AG6A 1QRAA 3LLMA 1ZNYA 3QF4A 5EP2A 3UANA 1RRPA 2XJ4A 4DUGD 5HTKA 4P0TA 4QL3A 2ZYVX 5BXQC 5LB2A 1ZNWA 2G77B 1RIFA 4DEXA 3AM1A 1DO2A 3CKLA 4RD1A 1A5TA 2QY9A 3AVWA 1GAJA 2V55B 2WWWA 3C16C 1ONBA 1SXJA 3W9YA 2V7QD 2XGJA 2OEPA 3ZZTA 3K0FA 5G53C 5KOYA 2CCKA 4TTPA 4Q9LA 5EP1A 4CEJB 2RH5A 3ND9A 4QBFA 3FB4A 3B1XA 5E7IA 3X1WA 1F2UA 2UKDA 2I1VB 3QXHA 4I1OA 4ZDKA 1Q0UA 3IIMA 4O25A 2E87A 1LFDB 4LC0A 1EFRD 1OFUX 3P4YA 3QSYA 3A1TA 1ANKA 4HAYA 3U44B 1SXJE 1F3OA 4DSUA 2WWXA 4M1TA 4PQRA 2H92A 1UF9A 3P26A 5CLLA 5DIFA 3FHTA 1CEEA 3RNLA 3T5DA 2ZI3A 1NJFA 2D74A 2CNWA 3BS4A 4Q9JA 2GJKA 2KJQA 4LYFA 4PXAA 3TQFA 4IXNA 3DDCA 1D2NA 3CX8A 1TADA 4JJZA 5AJZA 1E2KA 2DWOA 1G20E 4MKIA 2QU8A 2GHIA 2P0EA 2ZI9A 3THOA 1UEJA 3WRYC 4K8OA 3UXMA 4HEJA 2Q3FA 5FTKA 1P9NA 4HSEA 1E94E 3F0TA 1Z6YA 4R2IA 4M9ZA 3MWJA 1HUQA 2EFGA 4EPTA 2GAAA 4N0EA 1XJ0A 4P4SA 3PG5A 1DAMA 4JMPA 2IS2A 3X1YA 1QHSA 4Q1FA 3X1DA 2FX3A 1XTRA 2ZU0C 1VHTA 3P32A 4BLSA 4YQFA 4GPTA 3U6KA 1WE2A 1AGRA 4NHOA 2VEDA 1GILA 2W2XA 3FHCB 5CJPA 2F1RA 3T1VA 4A8JA 4B3FX 2BMJA 3GD7A 1IN7A 1E0KA 1OE0A 2R6FA 3LX5A 5FBRB 3VR5A 4LJ7A 2IXGA 1N6IA 3HDTA 2A3RA 1NN5A 1GM5A 4NYIQ 4ZPXA 3HYRA 5FL3A 2QENA 2ZUDA 3U6BA 1JPNA 2NO6A 2D7DA 4G5QA 3RS5A 4Q47A 5EP4A 1NBMD 1K8RA 2GA8A 3I92A 3QKUA 1ZJ6A 3HYTA 2GNOA 3KUDA 4N1AA 1XCGB 4PTLA 4GNKA 3RSOA 5JJLA 3WYAA 3EC2A 4TYNA 4OL0A 3RWMB 2D06A 5EJEA 1EWQA 2P2LA 2AKYA 3NTUA 4D0NA 1YZGA 3IIJA 2F43B 2C04A 4LYJA 4CDGA 1I2MA 4GMXA 2VYFA 2R44A 2WV9A 2QBYA 1KYIA 3RYTC 1T4GA 2V3CC 1W1WA 3ND8A 2XB4A 1WBBA 3GLGA 3RS2A 3FGNA 4BQSA 4MRNA 2VA8A 3UMSA 1ZD9A 4L8GA 2OLKA 1XEXB 4MYUA 3GLFB 2P5SA 1Q20A 1SKYE 4TMVA 2JLWA 4B2IA 1N0WA 5FPKA 1CU1A 1IN5A 1NIJA 1RJ9B 4DIDA 3NKVA 2JIZA 3CRVA 4OHXA 2IT1A 2ZIAA 3K9GA 2WWHA 1SVKA 2O8FA 5DYGA 1U8YA 5BQ5A 4LJYA 4B3DA 4KXFB 2RGEA 2IUSA 4EQ6A 4LJ5A 2BOVA 2JJ8A 2ZRPA 3QXCA 3GLGE 4XWKA 1QZXA 2ZREA 4QGHA 2ZE5A 2WKQA 1OSNA 5KDLA 1T3LA 3VFDA 3TQCA 3BIFA 3BK7A 3IQWA 3CX7A 5JI3E 4HLUA 2YINC 1L2TA 2OUKA 3T1QA 5FBVB 3EA0A 2C77A 1T5LA 3GMTA 4KAXA 1ZD1A 2A7QA 3O8RA 4LPKA 2JASA 5J40A 1NVUQ 3ZVNA 3WMEA 2IF2A 1W47A 2VLIA 2WAYA 4QFMA 1GNQA 1XMVA 3MRSA 1C9KA 1N0UA 1G7TA 3MD0A 4OK6A 4TTRA 4HZUA 2R6GA 4UQOA 5FFMA 4PR0A 4OHVA 2N42A 1NRJB 3C5HA 1S3SA 2WICA 2BIFA 2ZRFA 1VIYA 3CF0A 4HLCA 2EQBA 2GEUA 3VR2A 5E3HA 4C4PA 2YHSA 1WCV1 3PXGA 2YZ2A 3MFYA 3AF2A 2FNAA 3IO5A 4QM7A 2EW1A 3FE2A 4TT3D 4KFTA 2BBWA 1SKQA 1QHHA 4IDQA 4JSTA 4AKEA 3G0HA 5SZHB 5FBWB 4HDOB 1ZM3A 5KSPA 1C1YA 2QPOA 2OO7A 4EIWA 1Q3HA 2NMVA 5K8UA 4PO8A 4Y0AA 3EIHA 2ZRNA 4ASUD 5BN4A 3H0KA 1FMLA 3BB4A 3OEHD 1JB1A 1KGDA 1ZYUA 2F1IA 2WJVA 3ZVRA 2XZOA 1II8B 1E32A 3SHFA 1LF5A 4LJ4A 2G1JA 1KOFA 2JJ1D 3CONA 5IK2D 5FOUA 2GXSA 4FMDF 3DPUA 1IONA 4PPNA 3I5XA 2IHYA 1IN4A 3CX6A 4EKDA 3PEYA 4H1VA 4CVNA 1JI0A 4CGZA 1KKLA 1TAGA 4DCNA 1I4TD 4B2PA 4AD8A 3NEYA 4LRWA 1E69A 5HZHA 2GCPA 2RGNA 1JJVA 3DKPA 3ICEA 4Q9KA 1R4AA 1P4SA 2F6RA 1E79A 4W7SA 3SYKA 1GFIA 4IEEA 3SOPA 4PAMA 5C18A 1IJEA 1E2HA 4MYCA 3PVSA 1JXMA 4JLBA 1DS6A 4A4DA 4DB2A 4MUBA 2R6DA 1KO1A 1NN0A 1CP2A 3UWOA 3WXMA 3AVYA 2ZETA 2C96A 1GRQA 4M21A 4PZLA 3CZPA 3RRNA 3W6NA 3RLFA 5F9FA 2DYKA 4Q4JA 3ZQ6A 1KK2A 1R0WA 1YRBA 4Q9HA 4BPBA 4DJTA 2Q6TA 4M1YA 2RGAA 2ORIA 4TZ6A 2J5XA 1GKYA 1ZVQA 1AGPA 2R8RA 2ZAMA 4AKGA 1D9ZA 1OT3A 2WWIA 5L3SB 2W6ID 4NH0A 3RWOA 3TRFA 1UKEA 2VHTA 3GJ0A 4PAQA 4KSBA 3G5UA 4PHTA 2X1VA 1NVVR 3PUWA 2W83A 4QC2A 1US8B 2H8KA 3QKSB 1KMHA 5TARA 3AVPA 2G0NA 2P65A 4AYXA 4HATA 4QGGA 521PA 3AVVA 1JEEA 3P4XA 1ZW6A 4QHSA 3VKGA 1KO4A 4XJXA 4OI4A 1RE0A 2D4HA 4UXIA 5JEEA 2PH1A 2J59A 2AL7A 3BJIC 5EP3A 5AR1A 5EE1A 2ZYWX 2PZFA 1DARA 1XXHA 1PVOA 4A36A 2ZQ5A 3BOSA 2VF7A 3A1UA 1UEIA 3RDPA 4CEIA 2QGZA 4UNNA 2XJ9A 3TGPA 2B7CA 3ZS9A 3WNDA 2OBMA 3CF6R 3U2QA 4AG5A 2GZHA 4D4LA 4OI2A 4GOXA 5EE5B 4D4MA 4KI0A 2JLSA 3WRXC 4C0LA 2W6JA 4I99A 3CPHA 4GP6A 2V54A 1R2QA 4GZLA 1G3MA 1R8QA 3GFOA 3GCGA 5M04A 4A82A 2OCPA 4L5BA 2YNMA 4AK9A 2WVJA 2B8TA 1ZC4A 1QVRA 1XJQA 1XTQA 4DVGA 2MMGA 2IW3A 1UPTA 1GIAA 4Z1MA 5FTLA 2O8EB 1G64A 1JALA 4OJKA 4BLRA 2XTZA 3BH0A 3EC1A 1Q57A 2AXPA 5J4HA 2F3TA 1X86B 1Z28A 2Q9AA 2CMKA 2RMKA 2PEYA 1NY5A 1Y3AA 1TL7C 3D3QA 5IF9A 5DN6A 1P2SA 1KTVA 1PUIA 4DLTA 3WNCA 3EAQA 1DTSA 1OLOA 2AHOA 2FZ4A 2QAJA 2QP4A 4MUAA 3U44A 2XXAB 1NVWQ 1WXQA 2ODBA 3T35A 2QG6A 4RD4A 1J7KA 3CIOA 4A6PA 1ZUIA 1WMSA 2JEOA 2EU8A 3K9LA 2FF7A 1KJWA 2PEZA 3OE7D 1BYIA 2WMOB 5C4MA 1GKUB 3GLHA 4C0QC 3R9XA 3BD9A 4FCVA 2ZS9A 1YRAA 1AIPA 1PJRA 2D3WA 4QM6A 2CHVA 2QTVB 4OHZA 1XMJA 2G3YA 1VG8A 3FPAA 1ZAKA 2ERYA 4Q03A 5H70A 1VCMA 5DLQC 2Z6VA 5E4FA 3K0AB 2JATA 4OQLA 5LDDC 3VU9B 1F2TB 2GF9A 3K0CC 4MKGA 3RANA 2JJ2A 2ATVA 2QPTA 3GLHE 4IW3B 5DI3A 3I62A 3IHLA 3OFND 4R2HA 3D31A 3ZLJA 1Q44A 2W2TA 3FFAA 4OQMA 2QE7A 2BEKA 4OI0A 4M1SA 2LCFA 1UDXA 2P67A 4LX0A 4WAUA 3TBKA 3EPKA 3GJXC 2ORVA 4NCIA 3K09C 4BZPA 4RD2A 1YVDA 1DAFA 2WIAA 4GT1A 3GJ4A 1VECA 4N3NA 5FTMA 3GJ8A 1ZBDA 4JYBA 1AM4D 3C7KA 4XVRA 2GXAA 3DVLA 5BWMA 5KPJA 4MITA 1V5WA 3TLXA 3ZS8A 3AH8A 3MGCA 4PPGA 2F43A 5AUPB 3SNHA 3CW2A 2XZLA 1EFHA 1KKMA 3NXSA 5F3WB 4PSKA 3ZIAD 2A5FA 5FPSA 4R9UC 1T91A 2VHQA 3REGA 2AR7A 3CR8A 3NG1A 2WTUA 3T5GA 1JEDA 3IHWA 4P4TA 1XEXA 1QHXA 2ZR9A 4DSOA 3TW4A 2NTYC 3VMFA 3WYFA 1W36C 1RJ9A 2QGNA 3DM9B 3SBEA 2RKOA 4NYMR 4TLAA 5AWFC 2JLVA 2OV2A 3AB3A 4HDCA 4DUGA 1OXTA 2ZPTX 1AZTA 4II7A 1E99A 4HZIA 1E4YA 4BLPA 1OPXA 2CBZA 2GBLA 3FKQA 4BWYA 1Z0KA 3VR3A 4Q1EA 2BWJA 1ESNA 3Q5EA 3HR8A 3UG6A 3CO5A 1P3JA 1QHIA 4I1VA 4US1R 3WY9A 4MYTA 1R7RA 2V7QA 1J99A 1DEKA 3EA5A 1S8FA 3CZQA 2FV8A 1RZ3A 4B71A 1XTIA 4KFUA 3KZ1E 4Q7LA 5CB6A 5ELXA 4OHYA 4DCSA 1YZTA 4OQFA 5KSZA 5AJVB 4Q9IA 3DL0A 3EPHA 1DOAA 1MR3F 3TSOA 1Z0JA 4B33A 5EXPA 5FR2A 2J0UB 4DDUA 5KNCA 1L4UA 4KVGA 1KI4A 1HYQA 1G7CA 3C15C 1EFRA 2HT1A 3TSZA 2GTPA 4KSCA 4V03A 3VR4A 5JS8A 3KXKA 3GLIB 3SJCA 2C9CA 2J41A 2ZEJA 2J87A 1NN1A 1W4AA 2VPPA 3THXA 1PLJA 4A9AA 2O52A 3VAAA 1U9IA 2IYWA 4JKYA 3AF1A 3OZXA 1LVGA 3A36A 4OK3A 3KKQA 2BBSA 3BERA 2RCNA 4ZDWA 4URZR 1GRNA 2GXQA 4TN1A 3RC8A 2GILA 1U2RA 1DPFA 2J9RA 2QPAA 1P2UA 2WWFA 3ADDA 1Q1QA 3AVXA 2X2EA 4Q4AB 1SQ5A 3KFXA 3B60A 3CLVA 5EE0A 1AS3A 3KDSE 3ADBA 1RRFA 4ILEA 4LYAA 4URUR 4O2LA 3UPUA 5TY0A 4E09A 4PSAA 1N5JA 1WA5A 1G8YA 4EPWA 2ODEA 5B30A 1G6HA 5K8LA 3RRYA 4IXMA 3B7GA 4Q19A 2GETA 1BS1A 2RB4A 2WJYA 3X1ZA 1OIVA 3VHLB 2O8BA 2XZPA 4PC6A 1XF9A 5FOVA 4BFYA 4EFMA 3VNVA 5EQTA 4EJSB 3SJBA 1F48A 1QDEA 1XPRA 1XTKA 2ZVQX 4Q1DA 4WIAA 1N5IA 1PLKA 3OIUA 5LD2B 1TF5A 1NBMA 3KKOA 2H1LA 4G5GA 3HP1A 2FJUA 1W7AA 2WJIA 1P61B 3NDPA 3QUSA 1LV7A 3NBZC 2E1RA 2IC5A 3DKVA 3T1OA 3TNFA 1OYYA 4AIIA 4DIEA 5GVSA 5JBQA 3VQTA 5B58C 5JWHA 4XIGS 5TXGA 2W2VA 2GJAA 5DYIA 3HR7A 4TLCA 3ZZ0A 2BKEA 4UNQA 1W4BA 3I1FA 4X8MA 1E2EA 2G9NA 5FPYA 2VHJA 5J4VA 8OHMA 2LKCA 4B34A 4CEHB 1Z08A 5GVRA 3SI7A 3VX3A 3TH5A 2WJJA 3NBXX 4IVPA 4LV6A 4B3GA 2GXUA 4JSYA 4EJSC 2AX4A 1IHUA 3HPRA 2QROA 3L0IB 5G3ZA 3KQHA 1MH1A 1RRGA 1Z6XA 2QMUA 5LD2C 3U4QA 1W5SA 4RD3A 5L3SA 1AKEA 3FMFA 4TLEA 1TQ4A 5FOXA 3ZVLA 2ZYTX 3PEWA 4KFSA 2QORA 4LJ8A 4J0QA 4AYTA 2O5VA 2BBOA 1W48A 1US8A 1W2GA 1XJCA 1D8TA 1YHNA 2AXNA 1Z06A 1NNEA 3J81k 2FGJA 2EFEB 3CRRA 4C2UA 2UZIR 3KXLA 4C0AC 3I73A 1CJVC 1M6NA 2X77A 2C98A 1YZQA 3W8NA 3WNBA 3LV8A 4M0LA 3VKHA 3QOFA 2REOA 3EZ2A 1NSTA 3QG1A 2ZSBA 1KI7A 1QHYA 2YV5A 2FOLA 3GJ6A 2RGCA 3PUXA 4MGIR 3UATA 5HR5A 2WWYA 5D3MA 4JVSB 5BYJA 2KBEA 4FWTA 1KNXA 2WSMA 2X8AA 5L8VA 3R9IA 1AQUA 2GVZC 2P5TB 4FMDB 3CNNA 1U0JA 4JLKA 1T0JB 3IPXA 5JRZA 2Z83A 1EGAA 5EZ5A 3PENA 3ECCA 2GKSA 4A1FA 4DCTA 4D26A 4BFUA 2IK8A 3IEUA 1PZNA 1FUKA 1TF2A 4EPRA 3MMPA 4F38A 5SZJA 1FW6A 2QQ0A 4A2QA 4XWOA 2WSSD 2ZAOA 3NH9A 4LI0A 4TT3A 2ZI6A 2VH5R 4B75A 2O8EA 4D81A 2ECKA 2H18A 3EARA 1GWNA 3MWLA 1CIPA 3DMDA 2BKUA 5FUWA 2HLDD 4MKHA 2IYVA 2HJGA 5J5CA 3Q3JB 2QAGA 3B6EA 5HCNA 4ASUA 4PAOA 1ZU5A 1U0HC 3OEHA 3X2SA 1YR7A 1X3SA 1G1MA 4W5WA 1RPZA 3ASZA 1WQ1R 2ANCA 2XXAA 1E1RD 5IK2A 2ZI4A 2JJ1A 1IN6A 3WBJA 1X8JA 1Y63A 2KWIA 2QM7A 2V4ZA 2ZJ8A 4UNSA 4P4UA 1MO4A 3BXZA 4KHZA 1U81A 1P60A 3DEFA 3LWNA 3LXRA 2NIPA 1FQJA 4GSYA 3L8YA 4GZMA 2HCBA 3LFUA 4YLGA 1GNPA 1MKYA 3KL4A 1BMFD 4X8HA 2ZJOA 1E0SA 3LVQE 5LBIA 4YC7A 3W6OA 4DLRA 1UJ2A 1MO3A 5IHPA 1IM2A 4Z51A 4FW9A 3QF7A 5J47A 2OAQ1 2V9PA 3AGQA 3K0AA 1ZM2A 4FIDA 4FMCB 4PFSA 2YOGA 2ZTSA 4Q1BA 3P1JA 3TK1A 1F2TA 3VU9A 4BECA 2VP9A 5TDHA 4HUTA 2R65A 4RZUA 3AEZA 5JSZB 1CJUC 2IXFA 3LBNA 4JJKA 1G8HA 3EWAA 1YJ5A 5CM9C 1XNJA 2QMHA 1GTVA 1OV4A 2C2HA 2IX3A 4E22A 3FDIA 4DLZA 5DHAA 3M1IA 1CR0A 3X1XA 4FD2A 3Q85A 5HKKD 4IDHA 4PHGA 2W6IA 4DCVA 3ZVMA 2RHMA 3SQWA 3LQRA 1W46A 2QA5A 3B2EA 2WWGA 2QP3A 2JLQA 4OBEA 1SHZA 5J4KA 4GRAA 1UKZA 1VDZA 1HV8A 4C9BA 1D2EA 1MOZA 4G5SA 1NLZA 3NC0C 5CIQA 1OFTA 3EIEA 2IA5A 4ACAA 1LS6A 4CZ2A 2GESA 1R6BX 2CHGA 4RCYA 4DHEA 2NPIA 4DZZA 3FMPB 1NVXQ 2CEAA 1YZUA 2VP4A 3AGPA 2NO9A 3RRZA 1AKYA 1FP7A 1CJTC 1FX0B 1YR6A 2P3SA 2YYZA 3OEED 1KDRA 2BC9A 4B6FA 1T8UA 3LRPA 4Q5IA 2AFHE 3B78A 1S1MA 4HB3A 2W0SA 2ZJ2A 3R20A 2PMKA 1KSGA 4F7WA 3R9WA 4JBWA 2J46A 1P9WA 2ZI5A 2WOJA 1IXRC 4F4CA 2MSCB 2ZE7A 3U60B 2C03A 3LW8A 1G19A 1KK3A 1II0A 3F5FA 4RFSB 3QPUA 1VYVA 3AVTA 3PEVA 3ZDQA 6Q21A 3QKRA 3MSXA 1YZKA 5FBQB 4LCBA 3QXXA 3LX8A 1RYFA 1DAGA 2BMEA 4PHFA 4V02A 5DI9A 3VTKA 1RFLA 4BZQA 1RVDA 4ZDJA 1IY0A 1OKKD 4EFNA 2NOAA 4ARZB 2J0UA 2ERXA 5KTYA 2VP2A 3ZYCA 1E6CA 4A0HA 1E9EA 4RD6A 2B6HA 1JQJC 1YZLA 2XITA 3M4YA 4NCNA 1Z2CA 4MKFA 1LW7A 1QF9A 3T61A 1MRNA 4ESVA 3THWB 3TKLA 5FI1B 4TL9A 4D0LB 2EYQA 2J7KA 4QJ5A 1S96A 3OE7A 4JL6A 2BMFA 3MCAA 5J4YA 3AVOA 5B64A 2ZSAA 2YOHA 4A0RA 4JLVA 3IGFA 1Z6TA 3QY0A 2WZQA 1U8AA 4Q4AA 1E2LA 4PPFA 4QKQA 4TL7A 4LUCA 2GEDA 1N6HA 2IWHA 3O8DA 2RAPA 2Z4RA 4RVCA 2ZI7A 1AN0A 1QVAA 4URWR 4B47A 1VG0B 1X6VA 1KDTA 2R2AA 2WKPA 5E7MA 4KITB 3OAAD 3AUXA 1IBRA 2OSBA 4JL5A 2IWRA 4DB4A 1LTQA 3OFNA 1FNNA 4DT1B 4WW0A 2C78A 1E2PA 4JVMA 2OM2A 4ESHA 4KYUA 4TSFD 1DAEA 1OFIA 2HYIC 121PA 4EJSA 5SZIA 1T3SA 1G7SA 2ZRCA 4EPVA 1G5PA 4Y0VA 5TVKA 3TSWA 3CR7A 1N5LA 421PA 1WB9A 1TQ2A 3ZH9B 1DO0A 1UM8A 2Z5FA 3SU8A 4NTZA 4LBVA 3U3JA 1KI3A 2PX0A 1L8QA 2QEQA 1XBTA 1U8ZA 3L82B 2JGNA 5A4JA 4M1KA 2MMCA 2PLRA 3LVRE 4RD0A 1N3BA 3TVTA 1P6XA 5AK0A 1JXOA 4Q7JB 2DY1A 3S1AB 2RGXA 3K53A 1A7JA 3AKEA 4HAVA 2OG2A 2FGKA 2O8CB 5CLQA 1LF0A 3ZIAA 1CR1A 1KK1A 2HXSA 4CEHA 1NL3A 3KXIA 2QUZA 3TR0A 4V0KA 2DFTA 4JT4A 5B2ZA 1W5TA 3THYB 2O8DA 5EXSA 2NPFA 5JZVA 2AFIE 3H86A 1T6NA 3AF0A 2JDID 5JS7A 2F9LA 3VR1A 4XD7A 3K9NA 1E2NA 1ZU4A 1G17A 2AD1A 4TYPA 4G3XA 1U98A 3TUJC 2EFDB 1S2MA 1SXJD 4YONB 2JLXA 2F3RA 3K1JA 3N70A 4GP7A 1X1SA 3JZMA 4WZ6A 4V0NA 4MGZR 2YOFA 1Z2AA 1TF7A 2C9OA 4PZZA 2JLYA 5CK5A 1VIAA 1N6PA 3L8ZA 3G82C 1Q1EA 5JEDA 4C0JA 1XD8A 5BW8A 2OXCA 2J1LA 1CRQA 5KYKA 1K5GA 1N6KA 2QRNA 1FTSA 1IY2A 3GQBA 3K0EA 1W36D 1R0ZA 3I5YA 1YU9A 5EXXA 1GL9B 2Q21A 5B57C 3KFVA 2GCOB 1FQKA 3L2OB 2CNWD 4DLVA 2NZ8A 4PZYA 3BB1A 3UG7A 1VYTA 4MDFA 3WP1B 1TEXA 2IYRA 5C1BA 2W00A 4HDQB 3K70C 1EG7A 5AUOB 1FPMA 1S3GA 1D9XA 2ZJAA 3LAWA 3LY5A 4W5HA 3W5IA 4D4KA 3KJEA 4TLDA 4FMCF 2FSHA 2V1UA 1AA9A 1KJZA 2P6RA 1X1RA 1KIMA 2FZLA 3L0PA 4ZV4A 3BGWA 1FNMA 5DE3A 2MSEB 3LO5A 2J0QA 1AJEA 2HT6A 1RYHA 3U5ZB 2ZE6A 1MO5A 4D6PA 3UMRA 3Q8XB 1JQLB 1HY3A 1SVLA 4NBSA 4TYQA 1OB5A 4HUQB 3K8YA 3RS7A 2X19A 4JLAA 2KSQA 2AN9A 1XXHE 2XOKD 2ZS8A 4M2LA 3QQ5A 4WZAE 1PV4A 1N25A 4I4LA 1XMIA 3O47A 3M6AA 1CF4A 1GP2A 3DHWC 3KJHA 3EWSA 4O3MA 1ZNZA 1OYWA 2CK3D 3DOEA 2CLSA 3I8XA 4CEJA 3N2IA 1J8MF 4JT2A 2QSYA 1JPJA 4Q66C 4W9MC 1N6OA 3LLUA 2AKAB 1VMAA 3SE0A 4AYWA 4I1UA 4IJMA 2OZEA 4WA7A 4B43A 1G21E 3FHOA 5EUMA 4DDVA 1Z0IA 1G3QA 1LNZA 3QKTA 4IOMA 3QBTA 5JJKA 5TB5A 1GSIA 1CR4A 5FTJA 3R8FA 4EFLA 1Z22A 3ZGXA 3L0OA 4WXRA 2ZSFA 4D0GA 2D62A 1MO6A 1CRPA 1R5NA 4PSVA 3B1WA 1TPZA 4TMKA 2ZR0A 4HAUA 3LQQA 4BLOA 5F2EA 5BN5A 4RCZA 1ZUHA 4M1MA 3EZ6A 4KVAA 2YC4C 1SXJB 2IS1A 5FUVA 2QQEA 3CPJB 3QVUA 4RKFA 1ZC3A 2V6IA 1AS0A 2GVDC 1D5CA 2HUPA 3EZFA 3P27A 2PX3A 2ZJBA 3KJGA 4GDFA 1JBKA 1SZPA 1VG9B 4LK2A 1KI9A 4LV8B 2CCJA 2A5YB 3VR6A 3UKDA 3CH4B 1FOEB 2REBA 1JJ7A 1G18A 2PT7A 4YMSA 2FPLA 3IPYA 4OK5A 1G16A 2BCGY 3SC3A 2EVWX 4YMTA 1Q22A 2REXB 3PUYA 1W36B 2XTNA 2CL0X 2DFNA 3FTQA 1XEWX 5FUXA 1E2JA 1FX0A 5FR1A 1EWRA 1XPOA 4ZIRB 2ZRHA 1E9SA 2VIIA 1NVVQ 1SXJC 2EFHB 2KI5A 4P32A 1XX6A 2AWOA 1ZD8A 2GDJA 2F7SA 2OLJA 3ZZUA 4MDEA 2QZ4A 1G3IA 2ZRMA 1EFTA 1E9AA 4WVFA 2OXRA 4RFSA 1VPLA 4DBLC 1FP6A 1CKEA 2FE4A 1G9XA 2D2EA 5FL7D 2CLCX 2VTKA 3SN6A 1N6RA 3WMGA 4BASA 3FKSD 3QE0A 1RRCA 3EASA 3TAHA 3GLFA 4FCWA 1EX7A 1LB1B 1LY1A 1NG1A 5UKDA 4M53A 4FCTA 4PC1A 4BGDA 2XNDD 5G3YA 2WPDD 2HLDA 1D2MA 1G5TA 1OXVA 2IEZA 3O8BA 2PCJA 5CIWA 4PX9A 2CL7X 1L4YA 1S4QA 3FFBA 2OILA 5EE3A 3RC3A 3WHKA 1NLYA 2RGGA 4NYJQ 1ZIOA 3PITA 3GEIA 4G5OA 4NP6A 1G7RA 4YXWD 5AUNB 1Z83A 3B85A 3AF3A 2FMXA 3GLFE 3THWA 5KNDA 3N5CA 1GRRA 1OH6A 4ZKEA 3H2YA 5ANRB 4UXJA 4MRPA 1BOFA 3E1SA 1CS4C 4LZZA 4A8JC 4B74A 1BMFA 2RGBA 2ZJZA 4S2EA 2GJSA 5C46F 2IYTA 1G291 2BJWA 1KY2A 2C9YA 2OESA 3B13B 4AY2A 3CWQA 2IBMA 4YMVA 2ZXUA 2UVQA 2GJ9A 4IOLA 3KQLA 4JS0A 1W2HA 3C41J 4ZCLA 1N0VC 3BWDD 3Q72A 1NMZA 4DT1A 3UIEA 2PJZA 4NZYA 5HE9A 2O8FB 1S9DA 4EPYA 3RHFA 3L43A 5HKKA 3LA6A 1ZUNB 2MSDB 3V4FA 3BRWD 3IO3A 4AC9A 4KBGA 4LC1A 1E2MA 2OFWA 4U02A 5HCIA 4YDHB 4ABYA 4JLMA 4C30A 1UFQA 1E1QD 1W0KD 2LKDA 4CT4B 1OIXA 5P21A 1ZMXA 3UMFA 3SYNA 1QHNA 1UBFA 2FDCA 4GBMA 3RS0A 1II8A 2H5EA 2WAXA 3ICQB 1JAIA 4JBYA 5IDVA 5JJIA 1IQPA 1E4VA 2XAUA 3JVVA 3OHMA 2IUUA 4UJ3A 4MRSA 2BHRA 2O8CA 4RFVA 1P73A 1W4RA 2KB0A 2GK7A 1WP9A 5D3QA 4HZUB 3THYA 1F5NA 2IS6A 1HH4A 1O3YA 1TQ6A 3AP1A 2VQSA 4IDNA 2ZJ5A 2ANBA 2PBRA 4KODA 3A6PC 5GJWC 1YE8A 4KLNA 4V0OA 1A2BA 4B3BA 2FSGA 5DNYB 4UXHA 4HB4A 5CB8A 3BC1A 4PHHA 2DHRA 1DG3A 3B9PA 4WOPA 3I8SA 4HLUC 4HB0A 4XWAA 2QSZA 5AJXA 4Z1MD 3BH6A 4G1UC 2D2FA 2NGRA 3RS3A 4IEIA 1VHLA 4TMZA 3REFA 1NBME 1NMXA 3CM0A 2VO1A 1TUIA 4U7DA 1WDTA 1XTJA 4IDOA 4FXPA 4ITRC 4F91B 1M34E 2OCYC 3HPQA 3SBDA 3A37A 5TMPA 1KAGA 4H1UA 1NKSA 2YWHA 2PJRA 2NO1A 5L3QB 4QG7A 4US0R 2O0KA 2CJWB 3LBHA 2IS4A 2QTFA 3IUYA 1G41A 2G0TA 3QKSA 4IDPA 3SFVA 5TV2A 4P31A 1KO5A 4AKIA 1R5BA 1IN8A 1EX6A 3LD9A 3QEJA 1KI8A 3BH7A 4MGKR 1AK2A 4DWJA 3F3YA 1ESMA 1OXXK 4BEBA 2ZSDA 1RW4A 2UZ3A 4QBGB 1T3HA 3W5JA 2C99A 1E2QA 1G4AE 4NCKA 4QRHA 2WJHA 1E9RA 5DISB 1SHKA 1BIFA 2FN4A 1GKIA 3CF2A 2XSZD 2ZRGA 4PO1A 2XEXA 1DAKA 1KSFX 5EXTA 4NCJA 4NL4H 4QXAA 4BLTA 1EESA 5FH9A 2FFAA 2JLRA 1OXUA 3K9HA 1A82A 4RSGA 3TMKA 3QVVA 4MGYR 4NYIR 3SDZA 2ZRJA 3WP0A 4OJQA 3KJIA 1IJFA 4PPQA 4HUQA 3P20A 2ZRLA 1PLLA 5JHHB 2FA9A 4FWIB 3DM5A 3OAAA 1QG2A 3I4LA 4LYHA 2CL6X 4UNRA 2I1QA 4KYIB 3LW7A 2Q9BA 3B82A 3A1SA 3D6TB 3QBVA 1I4DD 2RGNC 5CM8B 4TSFA 2ZU6A 3QPWA 1OH8A 5K8TA 2P6UA 1F6BA 1U0LA 1KMHB 3I72A 3WBKA 2YKGA 1D6JA 3PUVA 1UDWA 2HF9A 1TX4B 4Q00A 4PO9A 4NU0A 4GFDA 1OHHD 2IL1A 3TJZA 4TWZA 4HAWA 2BCJQ 1T5IA 1KZGB 4LHVA 3AF4A 3K0CA 2W0MA 4FI3C 3HU2A 3MLEA 1J8YF 1FUUA 5LB4A 3UK6A 3W90A 1SVMA 2ODWA 2XNSA 1S9HA 4F92B 1W49A 3B9QA 3BORA 2A30A 2BV3A 2ZE8A 3MWKA 3QI2A 4BRUA 2FG5A 4Z54A 2NO7A 1R10A 3OIVA 1P62B 2Z0MA 1RKBA 4PQYA 3K09A 4LBZA 3HWSA 2A2ZA 3T06B 3IKJA 4DLSA 1NP6A 4CT5A 2JDIA 4IFBA 4FINA 3B5JA 4FMBB 4F4IA 4PQFA 4PANA 1NMYA 2OBNA 3FMOB 5FPHA 3MJRA 1DG1G 2HXYA 3L0SA 4TL8A 5C4GB 4XSGA 3RAPR 3C4JA 4QHYA 1CXZA 1E2DA 2F1HA 2CE7A 2ONJA 5JRJA 5KPDA 2VRWA 2CLDX 5H1YA 3VKWA 4DDWA 2ZJYA 1VCIA 4NKRA 4LJ9A 4X8LA 5JECA 2L0XA 4QBHA 3SZRA 4DLXA 3T1TA 3VNUA 1JR3D 2ZROA 1KO8A 2AD5A 1NLFA 2VSXA 2ZANA 3BE4A 3R8CA 3TUZC 4RZXA 2O0HA 2YWEA 4LJ6A 5JCPA 2WOOA 4Q7KA 2ZS7A 1MRSA 4XVUA 1YQTA 2FFQA 2OFXA 3V4RA 4ZIRA 4KFRA 3GLHB 4Q4HB 5IT5A 1KI2A 4DSTA 3KB2A 4TLBA 4XVQA 3W6PA 4WZBE 3DZ8A 4LV5B 2F55A 4C0SA 4TYWA 2ORWA 3SJAA 4ZCMA 4XTCS 3CB4A 4P33A 1XCPA 3SJZA 1DAHA 2QI9C 1MABB 4NCHA 5KDDA 4TTQA 2JA1A 3ADKA 1IXSB 3AQ4A 1CULC 3TUIC 4B6EA 1DE0A 3GPLA 1A4RA 1IY1A 4G0NA 2YWGA 2QMOA 2GF0A 4L16A 4NE2A 5DI3B 4B32A 5DGXA 4ZI2A 2HEIA 2DFKB 2I3BA 2IUTA 3QPVA 2HCJB 1A1VA 1S0UA 4LBYA 2BMDA 2HJVA 3OF5A 1NY6A 2YC2C 3PR1A 4ERNA 4PC2A 4DLWA 3K70D 4DEYA 1XP8A 3KKPA 5FPTA 2XOKA 4DRZA 5EUQB 3GEHA 4X8OA 4CF7A 3ZD6A 2A5DA 2R9VA 2WBLC 3FOZA 4V0MA 1G4UR 4OYHA 1E98A 1DADA 1VCNA 2CK3A 4D80A 3QIAA 5J4LA 3U7HB 1FMJA 2JLZA 4G01B 5F98A 3NH6A 3AVUA 1COWD 5JCZA 2FPKA 3U3RA 4HAZA 2Q0HA 3DMNA 2BM1A 3I3SR 3TR5A 1E0AA 1KDOA 2IEYA 3IQXA 2GCNA 1IAQA 4C0KA 1O87A 4UNPA 2C95A 2CVFA 4JVNA 2ZRAA 1Z47A 4V0ME 1HA3A 3T15A 3EG5A 1WBDA 1J2JA 5DHFA 1HQYE 4JVLA 4WXPA 5A0FA 3A1VA 1BYUA 2J7PD 3GLIA 3K0SA 4Q1CA 2R62A 2YJTD 4UJ5A 2C5LA 1KSJA 2H17A 2EYUA 3PV0A 2ZRDA 3NVAA 1XTSA 1VTKA 3ZJYA 4BRWA 2VBCA 5JWRA 1YZNA 1CJKC 3PFIA 3C8UA 5KHOC 1JAHA 2R6AA 1YR8A 4Q48A 1XD9A 3Q7QA 1XRJA 1GDDA 2NZJA 1BO6A 1CR2A 4M22A 2IYZA 4KJZA 4LHZA 1BH2A 1L7VC 3GFTA 3QG5A 5K8IA 3NHAA 5KUTA 3GLIE 3IEVA 1M74A 3EZ7A 1UBGA 2H16A 5KU1A 2CXXA 1KSHA 2FFHA 4JLDA 2DCUA 1E2FA 1NSFA 4F93B 4RZ2A 4BFWA 2ZUBA 4M1OA 2EWVA 3ONWA 1E9CA 2FWRA 1W0JD 1NF3A 2JCSA 4DCUA 3MUFA 5DO9A 3B8HA 2C8VA 1H8ED 2IF0A 3U7EB 4CYMA 1CJMA 1X8KA 2GBLC 5JWOA 3THXB 5FBLB 1KNQA 1GUAA 1KO7A 1HT1E 5JHGB 3PIRA 4JYCA 1KI1A 1H8HD 1DELA 1P7CA 2OFOA 1JNYA 1PUJA 4MQBA 1DBSA 1Q12A 4DDTA 2QNRA 1ELOA 2F9MA 4K46A 4A6XA 2VP0A 1I4LD 1LS1A 4G5RA 4I1SA 3ZQJA 3HU3A 4BEJA 5CK4A 2KBFA 1ETUA 4TQAA 4ZDIA 3QENA 3SHWA 1AS2A 4C0HA 1SGWA 2DPXA 5FL7A 1E9BA 2ZUCA 3W3AA 5HE8A 1XDBA 3FKSA 3R7WB 3U3MA 4AKHA 3ETLA 3KX2A 3RVBA 1EXMA 2PZGA 1E2IA 1KZ7B 3DO6A 1OIWA 3AKCA 4IVQA 1TU4A 2XNDA 2O8BB 2J45A 2WPDA 4BFVA 5L3QA 3WMFA 2GWHA 4IOJA 2CJWA 2AK2A 5L3VA 3K70B 1V43A 2J0VA 2HDNB 1KK0A 1UADA 1U9IC 1GG2A 2FSIA 2GZAA 3KTAB 4ZI3A 3CRQA 3E70C 4IHQA 4BUJA 2OHFA 3V00A 4LGMA 5AUQA 2V6JA 4C3ZA 1N5KA 4YXWA 2IYLD 2ZITA 4AWXA 4IVRA 3GJ3A 2AK3A 3OIYA 1TNDA 5H8WA 4YDSA 1Q21A 1XEFA 2A5JA 4A2PA 3U7FB 1XCMA 4B73A 4XOIA 1P2VA 2Q9CA 4LDJA 5FTNA 2K5UA 2B7BA 4M9XA 5JMTA 1A2KC 4C7OB 1G3UA 2Z4SA 1G8PA 1NJGA 4Q02A 4Q21A 2R6CA 4RJLA 3BFKA 2QT0A 3AP3A 3RABA 1XPUA 3EW9A 5KDOA 2EFCB 3B1YA 3LH5A 3OIWA 4CIDA 2ZRIA 2F1JA 3E5HA 1K5DA 1P72A 2CVHA 3F8TA 4JLJA 4B76A 1FZQA 3U4QB 5G40A 1M7GA 1SVIA 3NEJA 1Q1ZA 2OAP1 1DAIA 1E96A 3U3KA 4FN5A 3PCRB 1KMQA 3A8TA 1HEIA 1G6OA 1OFHA 4URVR 1FFHA 1OB2A 3NHBA 1E2GA 4OQNA 5CITA 1CBUA 2A5GA 1Z8FA 5CYOA 3TE6A 2KE5A 4EUNA 4KCGA 3GJ7A 4XTRA 2PT5A 1SVSA 4BZXA 1T8TA 1E1QA 1W0KA 1CTQA 2ZR7A 3I32A 3QJYA 5GJBA 3NDBB 4R98A 3I61A 1SVOA 3IDQA 3A4NA 1Z0DA 4Q4LA 1E9DA 4U00A 2ZRBA 5GADl 1UBCA 1WRBA 3BFVA 3D7MA 5L3RA 1HURA 2QTHA 3TVDA 1G8FA 4OI1A 4URXR 2CHQA 5CJ2A 4AI6A 3SR0A 4LHYA 4TMXA 5D3MB 2SHKA 2IHBA 5AJYA 1NG9A 4Q18A 3CNLA 1FL9A 2NG1A 4M1WA 1GVNB 4A92A 4DLYA 1NKTA 3JVUA 3EX7C 1ZCBA 3CH5A 1Z6AA 3W3ZB 2GEVA 4QGFA 1YR9A 5FOSA 3WYGA 3U7GA 1TTTA 3T12A 1IXZA 2V1XA 3A4LA 1ZM4A 3MWYW 3BFXA 3CNOA 3N2EA 2FEOA 4NYJR 2QL6A 5EZ6B 5CDFA 2YVUA 3SEAA 1Q3TA 3AKDA 3LXXA 3V9PA 5IRCD 2Z43A 2VHUA 3AP2A 1QG4A 2VSOA 2OT3B 1AZSC 1XD2B 4DC9A 4DXAA 5BN3A 4TL6A 4LY6A 1AQYA 3TIFA 1P75A 1W4CA 2GAOA 3U3OA 5JLJA 1MT0A 1KDPA 1KI6B 1XMSA 2CE2X 5JSZA 2IYSA 1RC8A 2P6NA 1TQDA 3QF4B 2JIZD 4OQXA 4PC7A 4TMWA 2WM9B 1GITA 4O2RA 4QOSA 5CDFE 1J70A 1XWIA 2QAGB 2ZRKA 4KV9A 4UKDA 4DSNA 3NC1C 2Y8EA 2ASEA 4I81A 2EWWA 1OW3B 2VHCA 3GFPA 3MJHA 4IKEA 2PCLA 4MRVA 3Q9LA 1UKVY 4KU4A 2B21A 1OH5A 2B8WA 1ZINA 1VKJA 3CWZA 4JLOA 4XH9B 4IRUB 1E3MA 1XZQA 5DH9A 3K0FB 4D82A 1VYUA 4JKIA 1R5OA 5F9HA 2BM0A 4LHWA 2FSFA 2PZEA 4BFTA 2BJVA 1JECA 1QHGA 3A4MA 3NWJA 3NIBA 5E7JA 5GJCA 4Q4HA 1R0YA 1F2UB 3LDAA 4B3XA 4Z8YA 2DFLA 3CRW1 4R71A 5BYKA 5C2JB 1SULA 1BKDR 1TEVA 2ZSEA 5KSYA 2LWIA 2GK6A 3H4MA 3KQNA 2DR3A 3FVQA 2Q3HA 1TMKA 5JFGA 2XSZA 2G6BA 1UKYA 1M2OB 1MABA 3EPLA 2QAGC 2TMKA 4O0MA 1II9A 1E0JA 3KQKA 1Z3IX 2W58A 3LBIA 4AURA 1KJYA 1OJLA 2ATXA 1U94A 2IYQA 3SYLA 1W44A 1VG1A 4ACBA 4L4UA 621PA 2ODNA 1NIPA 4QHTA 2CCGA 4LHXA 4LBWA 4LJAA 2G83A 2RGDA 4ZO4A 5HPYB 1YKSA 2VP6A 5FOTA 4P4SB 4A0GA 2WMNB 1B23P 3RS4A 2WSSA 3HJNA 3QXSA 4ZCIA 1I2DA 1XFAA 2V8OA 2N1BA 4A8JB 1UBEA 4E07A 2NO0A 2QT1A 2J0SA 1M8PA 3CUEF 4NONA 2IYXA 2IXEA 2QP9X 3W8RA 4EPXA 1XB2A 1NN3A 2FFBA 1Z29A 4HYYA 4B35A 2FU5C 1DVRA 1OHHA 1S1CA 1EFCA 1Z07A 2GRJA 5JI2E 4ARZA 4L15A 3VX4A 1HE8B 1P9RA 4B48A 2PLFA 4M8NE 4MH0R 4JLNA 5FI0B 2H57A 1E1RA 3JZAA 1G5RA 2PL3A
chains in the Genus database with same CATH superfamily
1I32A 2ZIWB 1P2GA 2JEYA 3H1AA 2ENUA 4BEVA 4DABA 4I1PA 4DR7B 3NVKI 2OCAA 4XD7D 1JFLA 1G6KA 1RWPA 3KJXA 4K7JA 1ZN2A 2HHJA 4V0LA 1PR5A 4F2PA 4F9EA 2C9ZA 4H1HA 4R69A 3YASA 1SURA 3WDKA 4CW7A 2WJGA 1RVV1 3L7MA 1QFJA 1T24A 4QBIA 4DUPA 3GDHA 4BMXA 2TYSB 1HDGO 1DRVA 1KOGA 1DKPA 3AUTA 3AHDA 4NMMA 2AQIA 3CVWA 4ZMBA 1P1CA 3N2NA 2QRVB 4EW3A 2B1QA 5C52B 1XU4A 1OGIA 2EWMA 1DI0A 3QKRB 2QN6A 4Q1AA 3N2GA 4CR7A 3OZRA 1UFVA 2YZ7A 3OKFA 2JLUA 4GOKA 4BNLA 3U4IA 1SQGA 1KWKA 3LT4A 4F5YA 2R4TA 2SCUB 2VZ8A 3IQIX 3SC6A 3WKAA 4D4GA 1EUCA 3V4ZA 2GZDA 2V9CA 2O0JA 5HGJA 5FKJA 1Y80A 1SCBA 5HK8A 4YMUA 3D5QA 4TQ9A 2UYOA 1PJBA 2QMEA 3RTEA 4BJ6A 2W6PA 5JDIA 1DG9A 4TT8A 5D6OA 3LWBA 1KAOA 3BGIA 2WB4A 2O57A 4P8RA 4TS4A 3TOZA 1E4OA 5EGSA 5KSOA 3S81A 4A7PA 5YASA 5TPZD 2X6QA 5CIYA 3WNQA 2TS1A 4YCCA 3CC8A 4NESA 2IKSA 1NRIA 1RAGA 1YCGA 4JA2A 5FNVF 821PA 1JR3A 5I7VA 5AVSA 2RHJA 1VL6A 4HDNA 4WXYB 1NP7A 2JGMA 3FUCA 3PJDA 4B2LA 3ITNA 1OH7A 1UFOA 1PHPA 2HA0A 4XSHA 4ND8A 3NYIA 1X80A 4LOAA 4Y0NA 1IXYA 1B0UA 1C4OA 1Q16A 2Q3BA 5GJVC 1HE4A 3ABOB 3I9KA 3VNQA 2I0FA 4CM8B 2ODPA 1XYYA 2DUWA 3AV0B 4JC0A 1U3VA 5D6NA 2CXOA 2I8LA 1AQ6A 2GZ1A 3E7WA 2H7VA 3S1AA 1V26A 5DTEA 3WWOA 2IH2A 3MTGA 4OGKA 1JPVA 1RQNA 4ZYLA 3V9AA 5F2NA 1RJFA 4G89A 1JR3E 1SBYA 2HRZA 3FDJA 2FW7A 4HL6A 1DX4A 3IYLW 4CU2A 3ERCA 2ACVA 1WXEA 2X5OA 4P7KA 4YIKA 1V4NA 2OZLA 3FWYA 4JC8A 4DM3A 2AG1A 1SCAA 1WLSA 3HXLA 3PR3A 4QFCA 4A2WA 3GEEA 5KVVA 3BQ9A 2MDTA 3R7WA 4HYEA 3HEMA 2RHBA 3DZDA 1PQ4A 1NU8A 3GO4A 5AK5A 2ISSD 1CY2A 1ZP6A 5CVEA 5ALTA 3SR3A 2NVBA 4BO5A 2CV0A 3WLSA 4A15A 3RYCB 1V25A 4DOMA 2YZNA 3ANTA 3JD0A 2ZM5A 2QRZA 1HYGA 1EK0A 4OKSA 2G1PA 1ABFA 3D3WB 4OLFA 5FHQA 4RKEA 3LYHA 4K9SA 4HDMA 4LCJA 1QHHB 3KVYA 2WKWA 1ZH4A 1A4XA 1IOZA 2J3DA 3OPQA 3ZWYA 4QAJA 5IZCA 2BDTA 2EKZA 4R0VA 4U5XA 3VJKA 3ZLVA 4OP2A 5C8ZA 3OTGA 3WWEA 2Q8QA 3T3GA 4E3WA 2FKNA 2Y4OA 3AKZA 5DN6D 3OPYI 4Y6RA 5TC4A 3R5KA 3ADOA 2HREA 4D9BA 2IEAA 2PH7A 5JXWA 1KEPA 1WIWA 2A1UA 4JI1B 2YFYA 1NUUA 2BFBA 2WIBA 3FTCA 3F7TA 4QNRA 4CCYB 1ECGA 2J3EA 4POAA 4FMPA 2ZSIA 4BUZA 1NJ1A 1BXRB 2UVPA 2ECPA 2PSHA 1N5RA 2QD4A 3OQVA 4H9GA 5JSYA 4MA4A 1HRKA 2XUFA 2X1HA 3UK1A 4CLHA 4YAKA 3NDJA 4R8KA 3FCXA 3Q9UA 3IBYA 1HZZA 4U9HS 2X0JA 4WOJA 1PGJA 2HPVA 4FKZA 2O8DB 3HCOA 1PNVA 4JIMA 4CL2A 3NP9A 1TTQB 3Q5DA 5FV4A 4HWPA 5KWEA 3GIWA 3CXRA 3RJMA 1QJCA 2ONKA 4IMIB 3NM4A 4IGEA 4M4SA 4JI2B 3DPSA 3WK8A 2ENWA 4MUYA 2XDQA 3V4OA 3WO0A 3FJYA 4EGAA 2CT8A 3AVQA 5F33A 1DBIA 3CLKA 4M0EA 1AHPA 3C3BA 4P2GA 1MG5A 4M9QA 4LK3A 2JJ2D 2VAVA 4X1KB 3TTSA 5BXYA 1HNWB 2E49A 2J48A 2XDAA 4X6YA 1DEHA 1L5KA 3TNJA 4DNOA 3QVXA 2GOYA 4MVCA 5EFZA 2VC2B 5JIBA 2QE7D 4JCCA 4BBAA 3RJ5A 4QX6A 3WZMA 4HNVA 3AUYA 4KLZA 3SS8A 1QAMA 1QH8A 1E7SA 3GMIA 3WLAA 5I7OA 3IIKA 4R7ZA 2W90A 3FD8A 4J0EA 4NPHA 4FX2A 1KFBB 4KAFA 2ZYRA 1YVEI 1H2FA 4DXHA 3W5BA 1JTFA 4NV3A 2ZTLA 3ZQ4A 1C3LA 5IANA 2P35A 4O2BF 1BFKA 5E2IA 3TAXA 4ZJYA 2XGMA 5HRAA 2HQBA 3SQXA 3RRMA 2JZNA 4HWOA 3N9IA 2FP4B 3M4ZA 2ODQA 3K05A 3QEMB 5DNWA 3T5AA 1ATIA 4ZQEA 4AROA 1T25A 2JD0A 3QHQA 4QREA 4RY2A 1IXKA 2GMWA 1ZN9A 1L3CA 1ZCAA 4P83A 1DFIA 1V1MB 2QVLA 4Q01A 5BN1A 3FDZB 2FK7A 1NW7A 2FEMA 3P9RA 2VYVD 1OQAA 2FN7A 4YP9A 4LVCA 1PVDA 1QH9A 2XODA 4FFBA 1NAHA 4CU5A 1XD2A 4GG1A 3HU1A 2PGJA 2IYYA 4CUJA 4ZI7F 3WL8A 5DSZA 1YQGA 1ZM9A 2IZ0A 4GGMX 1NRWA 4IQFA 3T34A 1EFUA 1U11A 3TW8B 1G3RA 3ZD7A 4Z5XA 3GGSA 3OCJA 2PDAA 2WM3A 2YS7A 3QU7A 7MHTA 5HIMA 1KH2A 1ZNYA 3LLMA 1ATZA 3QF4A 4JJ6A 3LVFO 2YVAA 4WKNA 2XTJA 5EP2A 3TE7A 3UANA 2XJ4A 2A58A 5IBQA 4YGYA 4P0TA 4K05A 4QL3A 4R9RA 3SNKA 5LB2A 2G77B 4JDPA 1XQWA 1YS6A 3IMEA 3AM1A 3IUEA 2E1PA 3CKLA 4DR3B 4RD1A 4B0OA 2Z2JA 2WZCA 2CF5A 3C16C 2V55B 3KK0A 1SOWA 2W42A 1RXSA 3A9UA 1PQUA 5FFNA 4V2IA 1M1ZA 1ONBA 1RYDA 1TA9A 3W9YA 4KUHA 2OEPA 1KAHA 4CFSA 4K6FA 5EEGA 1W5EA 4AN4A 1QANA 3RUPA 4NU6A 4UDNA 2RH5A 4TKVA 3MMZA 5F1PA 4UD6A 5JDCC 2P7IA 2J8ZA 5HKBA 1V48A 5E7IA 3R2JA 1F2UA 3I5AA 1J23A 4ZDKA 1K9SA 1Q0UA 5IF3A 1EP9A 4NG4A 4O25A 4P3XA 1P7PA 5KNCD 1IEWA 3RFTA 3E35A 4EI9A 1CUHA 1OWMA 5JT1A 1KBOA 2P2SA 3NI2A 1Y3FE 3A1TA 3KT0A 1JFVA 3OKAA 3E4CA 2PSFA 5JQGB 2YDXA 4M1TA 2ET6A 2ZWOA 1CEEA 1UF9A 2PYZA 5DIFA 1K06A 4YRLA 3HCFA 4HDRB 1V7ZA 1NJFA 2ZI3A 1E7MA 2CNWA 4KX5A 3W0LB 4R81A 2Y71A 1GZ6A 4MS4A 1A8PA 4CCAA 3IKTA 3KWFA 3CX8A 1T9DA 4X1IB 1TADA 2VH1A 3R9XB 3GVHA 1E2KA 5T6MA 2DHQA 3C7TA 4MKIA 1RNLA 2AV6A 2P0EA 1HDCA 1UEJA 5ALHA 2GZ2A 3WRYC 4B46A 4K8OA 1O9HA 4FC7A 1GZHB 1SD1A 1VI5A 1ORWA 1E94E 4MV3A 1Z6YA 3Q7TA 3B70A 3EMKA 3L01A 4RSMA 1HUQA 4F8JA 4MAAA 3KT3A 4WN3A 1DAMA 3CGWA 3X1YA 1QHSA 5IXJA 2ZU0C 3P32A 3Q8MA 1CRLA 3CVOA 1JVBA 2H3EA 4AZ0B 1XCBA 3U6KA 1ODTC 1OAAA 1AGRA 2PR7A 2X86A 2VEDA 3CVUA 2W2XA 5FBKA 2QR2A 3H11B 2BMJA 3GD7A 4DV6B 1IN7A 1OE0A 5FBRB 1NUPA 3BXEA 4KQIA 2I22A 2H7CA 3NBKA 3BBLA 3VISA 3ZWXA 1ZVMA 2BHTA 2BFCA 4B5KA 4BBPA 1BEUB 3HYRA 2QENA 1CJBA 2YIDA 3WLFA 4NZMA 2FMHA 4JODA 5D84A 3ETHA 3RS5A 4HEQA 1NGSA 5EP4A 1NA5A 4M54A 2Q4EA 3TD9A 1TC2A 1ZJ6A 4D8TA 2CVZA 3HYTA 2WDZA 4MVJF 4U0JA 5H02A 1FTGA 1PDVA 3QLVC 2FE1A 4PTLA 1DLJA 1PQYA 2H08A 3ME5A 3RSOA 2VBIA 4BNHA 4QUBA 3IP8A 4C6RA 4TYNA 5LP6A 4LWOA 1EWQA 1GGHA 1CDDA 4G5FA 1XHLA 1YZGA 2WTXA 2QB5A 3SBXA 2JEZA 2F43B 2XUIA 4LYJA 5D86A 4CDGA 5HQTA 1TECE 3DUFB 5DT2A 2VYFA 2L19A 1FBNA 2R44A 1VJTA 3D02A 2P78A 2R6R1 2W37A 4EITA 3RYTC 4P7FA 1B2LA 1O89A 4FYHA 2QBYA 2X41A 3IODA 4G8BA 4TLMB 3ESXA 4Y1RB 5M34A 3ND8A 3AVYA 1T2FA 3NHPA 4JC5A 3RUAA 3GLGA 4K03A 4DADA 2JAHA 2M32A 3P2IA 5AT1A 3UMSA 3NP7A 1ZD9A 1PZXA 4BCBA 4R40A 5ER9A 1JG7A 1XEXB 2HCTA 2P5SA 3PVZA 1SKYE 2JH8A 4MYUA 3NDRA 1N0WA 4QOHA 2W5UA 4YVFA 1RSZA 2PUTA 1IN5A 1NIJA 2YMQA 1FVHA 4K6MA 2Q8PA 5AI8A 1KZ1A 2JIZA 3PL5A 3QVMA 3ZDDA 2EBWA 5DMXA 4OHXA 1BTOA 1ISIA 2CNNA 1OVGA 2O8FA 3O8LA 5DYGA 1U0GA 1U8YA 3EVFA 5BQ5A 1YASA 4KXYA 2QUHA 2FUCA 1Z17A 2RGEA 1ZUNA 1RAFA 1F38A 1F6DA 3CEHA 4LJ5A 1JHMA 3GLGE 5I5GA 2JFNA 2QRUA 2ZREA 4BLVA 1JKIA 1O58A 1WO8A 1R88A 2B4KA 2C83A 4MEBA 3VTAA 2NYUA 3KPVA 5DW3A 4YT8A 2YS6A 3BIFA 3TQCA 5BMVB 3CX7A 4AJHA 1TKAA 2JIMA 2YINC 3GK3A 3ZWKA 3EQ2A 2DKOA 1R1DA 4DBZA 1U1FA 1Z6ZA 2Q0XA 3BGDA 3OO0A 5CA1F 2QX7A 1WPXA 1T5LA 1NX6A 4BUCA 2LVBA 3ZI7A 2P1RA 1VPVA 2A7QA 4LPKA 4RAQA 2GPYA 3IQZA 5KYWB 1BJKA 4FEYA 4TKZA 3RVRA 5JO0A 1YI8A 3P8ZA 1I9CA 2W4IA 4MICA 2WSYB 2QTAA 1VZ2A 3HMKA 4E14A 1R18A 2ZCVA 4BMYA 2DPHA 3GEBA 5FFMA 4KNVA 3GFFA 1DL5A 4OHVA 1AK1A 3T9FA 5H5JA 1P18A 3C5HA 3IUBA 5I4BA 2WICA 1QWOA 1YH3A 5EHNA 3C39A 2IJGX 4E4RA 3JZIA 1XZDA 3GP3A 3T5CA 1PFWA 4Q34A 3CF0A 5A3VA 2EQBA 2G36A 3ODGA 2B9VA 4G0ZA 4DCMA 2GEUA 2OM6A 3QLTA 1IVNA 1WCV1 3DBIA 3G79A 4MP3A 1QH1B 2Y1XA 3S2ZA 3FWNA 1NBOA 4AULA 4KPYA 3FE2A 4KFTA 2BBWA 1CY0A 1SKQA 4CXMA 3HO6A 3P9QA 2JD2A 4IDQA 1KQNA 4AKEA 2DR2A 3M6IA 1ZOLA 2EATA 4HDOB 4HZGA 3PNMA 3DEAA 1NXWA 4IM7A 1C1YA 3C3WA 1PCXA 5DWQA 4MINA 4H4EA 5K8UA 4W9RA 1Y1QA 2XLCA 2AC2A 3LF2A 3VU1A 4B2YA 3EIHA 3PFGA 2GBFA 1R6DA 2AFIA 3AG6A 3T7TA 3WDSA 4BBJA 3JQ8A 4C03A 1ZYUA 2AGVA 4DQVA 1UMBB 2UVDA 2VTVA 5LN1A 3SHFA 1E32A 3E5MA 4NRDA 5SICE 2ZZMA 3REQA 1ZICA 2VEOA 1E5XA 3ELUA 2FPIA 2GXSA 3MCUA 4R9SA 3SSNA 2ZB3A 2NV6A 3NTXA 2E4XA 1Y9ZA 2J0EA 2P2NA 3GA7A 3TRDA 4EYSA 1J8DA 3A7EA 4EKDA 5CDGA 3E7PA 4CVNA 1JI0A 2VNJA 4AD8A 4JK3A 4J1QA 1G2PA 3UMJA 3ISJA 1K1EA 2BONA 2GCPA 3GA0A 1IRXA 3ZCTA 4ZT6A 4E2WA 3DKPA 4OF4A 1QTNA 2O6LA 3RRFA 1P4SA 2F6RA 1E79A 3HSYA 3SYKA 1GFIA 4NEHB 4IEEA 1XDDA 4PG6A 5CB4A 5JPDA 3D7RA 1MTOA 3MBIA 1A76A 4M9RA 4MYCA 1JXMA 1M1NA 2P9YA 4KO2S 3H2GA 4LSWA 1GQOA 4MUBA 2ZDQA 3NHJA 1NN0A 3ETEA 4DJJA 3DMRA 1CP2A 2F17A 3DHVA 3UWOA 4M21A 2C96A 3WXMA 3IAHA 4AIRA 2INGX 4GECA 2C4KA 1GO2A 4PZLA 3A6KA 5EKSA 3ORQA 5E1MA 1JDNA 2FMIA 2K4MA 3RLFA 4HXGA 4P0PB 2LZ0A 4CMGA 4R16A 4Q4JA 2ZTMA 4LMPA 5LR6A 4DIFA 1R0WA 1DBQA 1ESDA 2C5EA 4DJTA 3OSZA 3ZWQA 4TZ6A 1GKYA 3E53A 2G09A 4DARA 1IC6A 1X19A 5DGIA 3RWOA 4G2TA 1WXDA 3IEMA 2IPLA 1FXWF 2R8PA 5JASA 1PT9A 4LXXA 2GLTA 3DTVA 3FIUA 3G5UA 3KSDO 4MSUA 3JTEA 4ZO8A 1NVVR 2WT9A 3H99A 2W83A 2PUJA 3ORYA 3DMPA 3QKSB 3QUTA 3T3HA 1QVZA 1HL7A 5CPFA 4AX4A 3AVPA 1U5BB 3FUXA 2YN0A 2WG1A 2AJ8A 4AYXA 1UAGA 4Q15A 521PA 2BEWA 3OZFA 4TTTS 4L8FA 4QHSA 5ESRA 4E4TA 4XJXA 2D4HA 2VNKA 2Z3ZA 5ALRA 2IOYA 3PQ3A 1U0TA 2J59A 2AL7A 4LNHA 5EP3A 5AR1A 4CMIB 1P5HA 1BHQ1 3H17A 1QIJA 3AJ8A 3KG2A 1SK8A 1SBHA 3OP1A 4LYYA 1KY5A 1XZAA 3GGJA 2J30A 4PX5A 4DW8A 4DR6B 4A0QA 1T4MA 4D9HA 1T4CA 2XUQA 3A1UA 3HRKA 1UEXC 4NEGA 5C1OA 1UCFA 2EBUA 4CEIA 1EK6A 1CUFA 1PQWA 4G4GA 2B7CA 4CODB 4BP3A 3EGVA 3U2QA 1MJ5A 1J1IA 3W8DA 2JFHA 3L40A 4OI2A 2BLNA 4CF4A 1TM5E 4LKRA 3NHKA 4IINA 5IT0A 2N1MA 2QL5A 2V3VA 3P5SA 4WCVA 3CPHA 1U2EA 5DRTA 4DCOA 3MYYA 1OV6A 1R8QA 3G0GA 4HFJA 4ENRA 4D3FA 2ONZA 5F35A 5M04A 1KYXA 2JAPA 3VAZA 1JA9A 2WVJA 2CNBA 1ZC4A 4LXUA 4YBRA 1FS6A 3IQFA 1Q92A 5K6RA 2AF4C 3S0JA 1KEWA 2C5AA 4FNAA 3ZDRA 2HGSA 2VJMA 4OHBA 4QTUB 3RYFA 3MVEA 2E6UX 1HFKA 3C3PA 3EC1A 4X6LA 1Q57A 4N03A 3HV0A 5J4HA 2F3TA 3WLJA 3HCNA 2AMJA 4W5QA 2UZ0A 1NY5A 4YHBA 1MF7A 1TL7C 2X2OA 3D3QA 4YFVA 3U9TA 1PS9A 2VDVE 1KTVA 1P1JA 2Z95A 2QRJA 3CEMA 2WYHA 5LA6F 4LOHA 4PZEA 2XIQA 4ZJZA 1OLOA 3QBEA 2FZ4A 4NK4A 2QAJA 1S2OA 1P0CA 2QP4A 3AZQA 3BXFA 4MUAA 1N9ZA 3V5NA 3W7AA 2J5BA 3T35A 4W1SA 1O0SA 4HDAA 1J7KA 3OLYA 3CIOA 4CF5A 3X1JA 2WP8J 1QQ6A 4Q7QA 3F7NA 2AOUA 1W581 1W96A 2VJBA 3H5RA 2EU8A 4GKVA 3F3SA 4IJQA 4IMJB 1KJWA 2PEZA 4ND1A 2VPQA 3ESQA 5IBRA 3PGKA 1I3LA 1VBKA 4GKAA 1R0BA 1WUYA 4FCVA 2ZS9A 1U1GA 1YRAA 2HJRA 1E9VA 5JAQA 3V8QA 1LTKA 2D3WA 1P44A 2WU4A 3VH3A 4QM6A 3I9FA 2QTVB 4OHZA 3ZGOA 2G3YA 3U0VA 1BCSA 4DLKA 4AY5A 3FPAA 4A5SA 5KVAA 1ZAKA 2ERYA 2JW5A 4PHCA 3F97A 3R3XA 5H70A 3GRKA 4EUEA 1HFWA 5B12A 1NOJA 5E4FA 4ZVTA 3V97A 3K0AB 1JIJA 5LDDC 1Q77A 4K28A 3KLOA 4PLHA 1SUFA 3C3YA 3NRCA 4CQMA 5KYYA 2AMVA 3K0CC 5H4HA 2A33A 3EC7A 1O96A 4YR9A 1NDUA 3TRJA 4B6QA 5K5EA 3H1FA 4CI0B 1P0QA 4NAHA 2OVBA 3I62A 5DI3A 1ILWA 1FFCA 3B52X 3IHLA 3PT5A 2DHDA 1Q44A 1LBEA 3FFAA 3NEPX 5ES3A 4G0QA 1RRKA 4OI0A 4MUMA 4M1SA 1Z18A 2KS6A 4XYGA 1C50A 1JKMA 3K92A 1S2LA 2FSPA 3N8NA 1PWHA 1QIIA 4OMDA 4RPCA 2NTNA 4WAUA 3DZGA 1VBNA 4YRJA 2C1XA 4MLCA 2ORVA 3G2KA 3K09C 3PHLA 3T54A 5CDSA 1DAFA 4YCMA 1TIKA 1Y6GA 1FE8A 4EY3A 4E1VA 4JYBA 2Q46A 4XVRA 3GNSA 4Y98A 5EJ4A 2WUWE 3FVVA 2BISA 1CY7A 2WHEA 4HRXA 2FZVA 3ZS8A 2QX8A 4PPGA 1EDZA 3JZFA 1O08A 2I2XB 3KUKA 4WVLA 5AUPB 3N2YA 2WJPA 3W79A 1P74A 3NXSA 1SUAA 4EX7A 3F9IA 2GCIA 1TO1E 3VPXA 1I01A 2ZIFA 4DV2B 2WYWA 4K0RA 2FWAA 4RLQA 3NG1A 4AICA 3SKXA 3T52A 1UBSB 3L07A 1F9AA 1TT5A 2IZ1A 3HB5X 3ONFA 1FLDA 3T5GA 2QDXA 3UJ3X 5BWBA 2ZR9A 2CDCA 2NTYC 3TW4A 3VMFA 4OOFA 2YDYA 1WOYA 5CEFA 5AWFC 1MFZA 2KX7A 3D3NA 3EEOA 1UP4A 2FTKE 4RJIA 1OXTA 2WQ7A 4CFZA 5KTKA 4GMGA 4L27A 1E4YA 2X8JB 3LBFA 1JQ5A 1J00A 2V7TA 4P2BA 3FKQA 4BLPA 2TMYA 3CS3A 1DDOA 1DPGA 1UZLA 2RJ3A 4RYLA 4XPIB 4A23A 3OPVA 5A2QA 1Y7PA 1ESNA 2EBHX 4KBYA 5FPQA 1QTIA 1FYXA 1QHIA 1Q1NA 1NVGA 2NU6A 3MWDB 4RDXA 2V7QA 3L7AA 1SUCA 1I3KA 3EXHC 4N3BA 4FFLA 1RZ3A 4D1YA 3OY2A 2BI8A 5B1DA 1TM1E 3DTTA 4OQFA 4DCSA 5KSZA 1RZRA 3A4TA 3HS3A 4FWBA 1RHMA 1QU3A 4Q9IA 3HVUA 2JHPA 3DMYA 5EXPA 2I3AA 2QMYA 4DDUA 2C97A 3E7XA 1AXEA 1L4UA 4FR0A 2H0QA 3PS9A 1G7CA 1XVIA 4HO1X 4LNUA 2GRUA 1EFRA 4ZU1X 3BSWA 1MO2A 3VZBA 2ZUVA 1N8TA 4J0CA 3MLBA 1N7GA 4V03A 3VR4A 10MHA 4R9VA 1HI9A 2F90A 3CZRA 5A6SB 1IL0A 3FMGA 4J8PA 3T7SA 2IYPA 3PWZA 1Y4SA 2EXXA 2C9CA 2J41A 5JMOA 4ZHSA 3TZHA 1W4AA 1GUBA 3A4YA 3K2QA 3WX0A 4MR8A 3TRIA 3THXA 1ZQ1A 3MEQA 1HETA 3RFCA 3ZY4A 3U1VA 3O4HA 3KKQA 2BBSA 2XBUA 1FDSA 4K2HA 3Q7RA 2QYOA 4JWTA 4URZR 3HYCA 3FNEA 1U2RA 4J6EA 4XVHA 2OB1A 4AJ4A 2ZBUA 4EDFA 5IZ4A 3AVXA 4OSEA 4EHNA 4ZYVA 3DO8A 4G0MA 3KFXA 4PU0A 4ZAGA 1YBAA 2X22A 1AS3A 3TKYA 5ALQA 2FMFA 4FTWA 4REOA 4TV9A 5TY0A 4PG8A 3UPUA 3LDHA 5BT8A 2NUTA 1WA5A 3IV9A 2QY6A 4D9IA 2ZP1A 4MV1A 3Q3GE 4HQNA 3HSSA 1H42A 3B7GA 4Q12A 1ZHFA 2RB4A 1O94D 3CU5A 1NVFA 4JQSA 4Q19A 2IKQA 4CIVA 4JI4B 2WABA 1ULAA 3X1ZA 3VHLB 1LV8A 5FOVA 4I46A 4D3SA 4EFMA 3KB8A 3VNVA 4EJSB 2XCTB 2C00A 1H2XA 1QDEA 1ESEA 1R4MA 2XBLA 3KNZA 2B0JA 2ZB8A 3GLSA 3H2JA 3MTIA 4CG3A 2B5WA 2VXYA 3HV2A 1VMIA 5LD2B 4CE6A 1NM5A 4MJ7A 5A4IS 1NBMA 2UZAA 3KKOA 5JYBA 3H5LA 4G5GA 2X40A 3RV3A 4YJFA 2AFRA 2CFIA 4EGSA 2VYND 3PGMA 3NDPA 5BV2P 1GTG1 5AW1A 1LV7A 1JX6A 3F8WA 3NBZC 4OLHA 1ETHA 4DZTA 3FNHA 1T2DA 3T1OA 1OYYA 2BM8A 3TVYA 9ABPA 2FSUA 2I6XA 3H5AA 1HE3A 4JHXA 1D4OA 4XIGS 2W2VA 2GJAA 5DYIA 4RVUA 4EB6B 4KKVA 1YACA 4MWZA 3NHRA 4UNQA 5CCEA 3FOEC 5K6AC 3IB6A 4I4TA 2QN9A 4Q3EA 2G9NA 1E2EA 1U2DA 2ZIVB 1CUGA 3TZBA 4ZT7A 5J4VA 1BEEA 2BFDB 2LKCA 2VXOA 5AVVA 2H2FA 1PD1A 1E6WA 2RARA 5GVRA 5E9WA 4D3DA 1NE7A 5KNCH 1RYNA 3W2FA 3NBXX 5BNZA 1JFFA 2GXUA 1O7JA 4DAOA 2AX4A 4BPRA 2JCVA 4OQPA 3P9ZA 2PS1A 3ILVA 2CB9A 1BDBA 3C6KA 3SLRA 3UB3A 1MH1A 1RRGA 2P9HA 3U4QA 5EINA 4NE9A 2GEFA 4KFSA 3RJ9A 3SS9X 3ILHA 3MJEA 1G0NA 4H3SA 2HO4A 3TLJA 3WMWA 4QDOA 4BC0A 1BXGA 3II6X 4XIFA 4C6TB 3TIVA 3SR4A 1EHCA 3JTMA 2VJQA 2UZIR 4OQQA 4XXHA 5EPEA 4KLAA 2C98A 4RJ2A 1UIRA 4ANFA 3PXUA 3JWJA 2I3DA 3LV8A 1PRYA 3QOFA 4JUDX 4TRJA 3UT0A 3EZ2A 4C4TA 3VKHA 4PTZA 3H9BA 2FW0A 1MMFB 2ZSBA 3UAVA 4J7AA 4KQGA 1QGED 3G2OA 1QHYA 3GJ6A 4P54A 1NQWA 2WWYA 4JVSB 4F3CA 2DPYA 3ESYA 4PLGA 1NDHA 3CH6A 2FAXA 3PKZA 5L8VA 4ZT3A 2AOTA 2ECOA 4ZVMA 2DU8A 3R9IA 3MCTA 1RDFA 2ACWA 4W5RA 1T0JB 2RCYA 3FZGA 3CG4A 1FSSA 5JRZA 1NWHA 3KKLA 3N2LA 3D6MA 4EVQA 4H6PA 1RCUA 2GKSA 3S2EA 3R0QA 1CY6A 2NP7A 2IK8A 2XOXA 1UC4B 3RTGA 3DH0A 3Q0TA 4NXMB 3OTWA 2A4MA 4FSXA 1B2RA 1UK7A 3T7DA 5C8YA 4J0HA 5TX7A 4DA8A 4TWBA 5SZJA 3L8HA 4YWHA 4B6OA 1RLOA 4BTLA 1FTQA 5EESA 1K2WA 2WSSD 2J9FB 2ZAOA 3FJOA 3I2FA 3QMWA 4PRLA 4BNZA 2Z98A 2PLWA 4TT3A 5K3AA 2CV1A 3C1TA 4B75A 2H1IA 5B2EA 2PMFA 3GUHA 2O8EA 2VJAA 1LBIA 1OZ0A 3ASUA 3MWLA 1CIPA 1QSGA 3DEKA 4A6DA 3E81A 4HWRA 3KT8A 2HLDD 2PLNA 2HJGA 2HMAA 5J5CA 3TOVA 2O2JA 4ASUA 2D8AA 3GNQA 5BYAA 1EXVA 1P4AA 4Q39A 4H08A 1NQXA 2ZAIA 4MCJA 1MD9A 4X41A 1RPZA 1G1MA 1SNYA 1G66A 1DQPA 3LKVA 1WQ1R 2JCYA 4LNAA 1EFDN 1QYRA 2JJ1A 2IYFA 2ZI4A 3R3VA 5IK2A 1X8JA 3DE6X 1JYEA 4Q82A 4R2MA 3WBJA 3WG9A 1W6RA 3L1UA 1EMDA 5HQJA 3O1IC 4BP8A 5MF6A 3T9AA 3QK7A 1J22A 1WLYA 2W2PA 3BXZA 2YJ3A 2BSQA 4BMZA 2OGUA 2CUTA 3PYXA 3LXRA 4GSYA 3DWIA 1AV6A 2PRYA 3RSFA 3IVMA 2CJYA 5HDBB 2Q3CA 4KRXA 3SKVA 1AHNA 1Y3HA 4YLGA 2Y1EA 3KEMA 5T8KC 2ZJOA 3U09A 3LVQE 3T5TA 4GPZA 1VPDA 1XQ6A 5LBIA 4BNUA 3W6OA 1KARA 2V0CA 1IG3A 4OH7A 3ZK9A 4PN3A 1H6BA 5IHPA 4Z4CA 2H1HA 2JKZA 1AC5A 1U3CA 4Z51A 1XRLA 2AR0A 2XA2A 2OAQ1 3AGQA 3TX2A 1N0IA 4Q1BA 2ZTSA 3VU9A 4HUTA 7REQA 3TK1A 3C74A 4BECA 2VP9A 5TDHA 3BDAA 1Y1SA 2OTCA 1CJUC 2IXFA 4IXWA 3NXKA 3WYBA 3WHIA 1WUKS 1XNJA 2PVCA 5F73A 2PXAA 1MG0A 1OV4A 3TIGA 3EXG2 4JBIA 5K20A 5L4LA 2IX3A 1BW9A 1PGQA 2VCYA 4PX2A 3TOXA 3CT4A 5JPIA 4NBWA 3BMQB 3CSSA 1Y37A 1L7EA 4IDHA 4J03A 1B76A 1VA4A 1U8CB 1Y81A 3ZVMA 2RHMA 2WT8A 4NZPA 2OCKA 4TS1A 4ZAZA 3T9EA 3KS9A 5ARCA 4ZYYA 1CWUA 2WWGA 1ZKMA 2JLQA 2G9UA 3HJUA 4FE4A 2ID8A 2BF4A 1S02A 2OZKA 4AJ1A 2WLSA 3LS2A 4I2VA 5E6UB 5H16A 1XQ1A 4REMA 4F45A 5AM3A 3G6KA 4PS1A 1TCCA 4NBUA 4WTOA 4WHMA 4CBVA 2IA5A 4RHUA 4ACAA 4EG0A 3CRNA 5IDWA 1R6BX 2CHGA 4F85A 5DCUA 3KDPA 4RCYA 3FMPB 3H7IA 3ZHOA 4OMFG 3ZHTA 4ZVOA 1O0BA 4JBLA 2FW6A 2CEAA 1ZGHA 3LPDA 1QCCA 4MULA 4XLLA 2VP4A 4GXTA 1T13A 4W6ZA 4DG8A 4UMFA 1SJ9A 4TX1A 3NR2A 1U6JA 1IUKA 1G5QA 3UMGA 1YR6A 2BC9A 3A9TA 4B6FA 1T8UA 4Q5IA 3H8SA 4YNBA 1S1MA 4ZO9A 4BKOA 4F7WA 4YCNA 4QLOA 4F4UA 3R9WA 4U2FA 1EXWA 5JYDA 4AT1A 3KQTA 1RXUA 2J46A 1P9WA 2QZ9A 1KVRA 2HK6A 1ORDA 2WOJA 3CLSD 5EWJB 4F4CA 2ZE7A 3COJA 1NJ8A 1F17A 2C03A 2GWRA 2AMFA 4IUBS 2Z6QA 1KK3A 4EG7A 1DBWA 1II0A 3F5FA 3SQOA 3QPUA 1VYVA 5KTRA 3AVTA 5BV0A 3T3IA 3PEVA 5TNXA 1SBCA 5I9IA 5DOZA 6Q21A 5TQ2A 1KMCA 3LTEA 1SXHA 2GKGA 2D1TA 1W9HA 4M6WB 5A7GA 4RULA 4ZHQF 1WD7A 3LX8A 1BVUA 3IR5A 4GOLD 4JXJA 1C30B 2BMEA 5JNLA 3CJTA 2R1ZA 4NU8X 5DI9A 3SBOA 4GVPA 3QRWA 1RFLA 2WJWA 4BMSA 3KTOA 2OKCA 4ARZB 3AJEA 4CMCA 2J0UA 4UMEA 1WY5A 1UZMA 3GJQA 4KB5A 4FDTA 1N36B 3R40A 3HBFA 4IHJF 2WHPA 5ALNA 4LEIA 3U1TA 3ZYCA 1GRCA 1B0ZA 2JGRA 3D6UA 3F74A 4IFTA 1XJWA 1NYTA 5HKLA 3GUVA 2YL2A 3I30X 3N59A 2FUG6 2XITA 4MS3B 5CFPA 1UL1X 2UXBB 3BTVA 3LUDA 1EINA 1XTBA 3JAKA 4UEJA 2XGSA 3U81A 1MRNA 1YC2A 3ET4A 3NM5A 5EJFA 4ARAA 4KDFA 1M6VB 1U5AA 2QLMA 1Y8CA 4AXBA 1GTSA 1HFJA 2WP0A 4QJ5A 4A16A 4CIWA 1I3OA 3BMOA 2E82A 3JQBA 2WKSA 4OGWA 2WNSA 5FP0A 3VOSA 4DS3A 1FNSA 2DX7A 3PFBA 4GX5A 3E18A 2O8NA 3AT1A 3F5SA 3A32A 1KJ8A 2HMUA 4RVHA 5ALEA 5G4KA 5L3ZA 5T7BA 4LZNA 4Y1FA 5TQJA 3J7TA 4WNAA 1W88B 1SCUB 2KQUA 1KETA 8LDHA 5D51S 5THQA 3INNA 4ALLA 4A26A 1HORA 2DY0A 1AN0A 4BMCA 3K20A 1PDOA 4URWR 2SKEA 4BGUA 4AZSA 2WYOA 1D6SA 4MRMB 5K3FA 1E20A 2CNDA 1IBRA 1TZKA 2OSBA 2F3QA 3IVGA 4M8IA 4HXFB 2LR0A 2HBRA 1ZWKA 4L5YA 4OBWA 3RM3A 2PUBA 3A6ZA 1V1RB 2ZKLA 1F5SA 4HDKA 4MPJA 4TSFD 5EJ9A 1DAEA 1EFPB 2QLTA 1G1AA 4U8HA 4E5DA 2VDRB 1N2JA 3X0DA 1T3SA 3FUVA 3RB8A 1G7SA 1UBMS 2C0PA 2ZRCA 3L06A 4NIMA 4Y2YA 1G5PA 3TSWA 5TVKA 3V1UA 4BQEA 1BCRA 3A06A 5BUZA 5K4HA 4YK7A 1E1CB 3SU8A 1TE2A 1JIQA 4YUAA 1XMOB 4QECA 2W6CX 2PX0A 1L8QA 2VDWA 3PDWA 4OLJA 1QLWA 3B20A 5AI4A 1WDWB 2QEQA 2Y27A 2GBCA 3RQIA 3OX3A 3UN1A 4EATA 3TF5A 4D79A 1IBMB 4AMYA 4JXXA 3HNRA 1C3OA 5K0SA 1GQQA 3THSA 1Q11A 2ACEA 4GWLA 1JXOA 3PDJA 3KOXA 1SQ0A 3EJWA 1TK3A 3K53A 1S3FA 2W2KB 3IXQA 3CJQA 3KUXA 1Y8AA 2UUPA 1ISSA 3IC5A 2FGKA 2M6RA 4KPUB 4OJMX 3ZY5A 4YCSA 1P33A 1LSOA 1LF0A 2IPOA 4WECA 3UGKA 4LQ4A 2O8CB 1CR1A 3B5EA 2GA9A 3A4VA 1E89A 2XKKA 5JDIC 1D0SA 4J1TA 4LRYA 3THYB 2CNLA 4EHFA 3GUCA 2OV8A 1TK2A 1Z26A 1MB2A 1L1FA 1YI1A 2NPFA 5JZVA 3H86A 2VWPA 2H5JA 2H1OA 2JDID 4E21A 3WBFA 1CS0A 3K9NA 1SU4A 4HBZA 3OA0A 4B47A 1G17A 2W2OA 1L7AA 1KMNA 3L41A 4A6EA 1PL0A 2V0GA 5M2QA 3K1JA 4QTZA 1GQ2A 4K6OA 4PG4A 4PLCA 1YU6A 4MP6A 1DIRA 1RAIA 3AEUB 3N87A 4WZ6A 3OD1A 5U1PA 3AFGA 2A59A 1WULS 1VIAA 1N6PA 5A71A 1NYRA 1T0PA 4R51A 2IGBA 1Q1EA 2AVDA 3UT6A 1XD8A 1ENYA 3V8VA 2PWAA 4R01A 1VB3A 1CRQA