5CJ2A

Ran gdp y39a mutant triclinic crystal form
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
197
structure length
197
Chain Sequence
QVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKAVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPALAAQYEHDLEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords GTP-binding nuclear protein Ran
publication title Catalysis of GTP Hydrolysis by Small GTPases at Atomic Detail by Integration of X-ray Crystallography, Experimental, and Theoretical IR Spectroscopy.
pubmed doi rcsb
source organism Homo sapiens
total genus 68
structure length 197
sequence length 197
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2015-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5cj2A00
2WIAA 5EZ6B 4D81A 1WF3A 1VG0B 4GFDA 2FG5A 4OQLA 4MUAA 2CNWA 1KO4A 1WXQA 3CLVA 1NMXA 1QHHA 2H8KA 3AVQA 5AJVB 5GJCA 5JWOA 4BPBA 3T34A 4KLZA 4NU0A 3ND8A 3B85A 4TL9A 1VECA 2PEZA 2QM7A 4TL8A 4EJSC 4KAXA 2GWHA 2D2FA 3I5XA 5G40A 3UANA 2CLCX 4YMTA 3VR5A 1G41A 3Q5DA 4RZUA 4WXRA 2QQEA 2J1LA 1VG1A 2J5XA 3B1ZA 4RFSA 4DCUA 1TU4A 1H8ED 4HAYA 2ORIA 1L7VC 4HATA 3GLIA 2W2TA 4G5OA 5DO9A 3F8TA 3SFZA 5C18A 1YVDA 3I8SA 1DARA 3DO6A 3NVAA 5C4MA 4LYJA 1IONA 1NVVR 2J41A 1CKEA 2F6RA 3IKJA 721PA 1PVOA 3MJHA 2RH5A 5FUVA 2D62A 4JT4A 4A9AA 2OESA 3ASYA 3QKUA 3W34A 3AH8A 3EXAA 1IAQA 1K6MA 4Q9JA 4KO8A 5HCIA 1D2EA 1MABA 5FBVB 3FGNA 3TSZA 4A0RA 4P0TA 5DIFA 1RYHA 1G20E 4NHOA 5AJYA 1LS6A 4CEJA 4BEJA 2GAOA 1ZU5A 3W6PA 1DAMA 4IRUB 1XF9A 1CLUA 2VH5R 3SDZA 1CR0A 3UMSA 1Z0AA 4A8JA 1IY2A 1N5KA 4AYXA 2OCPA 2V7QA 1MT0A 4TQUS 2CNWD 4PZYA 3QXHA 1FL9A 4G5GA 4TTQA 4FD2A 4LRWA 5A0FA 1F3OA 4BASA 4A82A 2Q3FA 3PG5A 4I1SA 1RKBA 2XAUA 3RC3A 3EZ6A 2P5TB 4YMUA 3H84A 2ZRFA 4DCVA 1G5TA 2CCJA 3TQCA 4FWTA 2JLRA 4QXAA 3RRYA 4HLCA 4G01B 1E6CA 3EC1A 4YMSA 4HB0A 3VMFA 3HDTA 1Z0JA 5CIQA 4KBGA 3IO5A 3LO5A 2GJ9A 3CWQA 2HXYA 2RGDA 3GLFE 4R98A 3LNCA 2ODWA 4M1WA 5EUMA 3VR3A 2DFLA 3SNHA 5EE1A 4I1VA 4BFUA 5KU1A 1T0JB 4TTPA 2H7VA 3K09A 4B43A 4TMWA 4UNPA 1G7TA 4NYIQ 4Z8YA 2OLKA 2XEXA 2R62A 1NVUQ 4UQOA 2ZUBA 1N6IA 1Z6GA 1AZTA 3O8RA 4JJZA 5J40A 4JBWA 1FOEB 5BXQC 2H1LA 1SHZA 3WXMA 2A3RA 3PEUA 4R9UC 4BLQA 2OV2A 2WBLC 1L4YA 8OHMA 5TDHA 5FOWA 1N6HA 2GESA 4BGDA 2PT5A 2WAYA 2JIZA 2WMOB 1OFTA 4KVAA 2CCGA 4KJZA 4TLEA 1VCMA 2QG6A 4QNMA 2V7QD 3I73A 3X1WA 1YZQA 2B21A 1DAEA 4WOPA 3EZ2A 4CEIA 2DBYA 3CH5A 3D7MA 2H92A 4PPGA 2ZI3A 2YNMA 4JMPA 4GDFA 1E9EA 4V0LA 3K70B 1I4TD 1GRNA 1R2QA 3TLXA 1RRPA 3KDSE 3VKWA 1JPNA 2Z83A 3EWSA 3GFPA 1YJ5A 4O2LA 2AKYA 2C03A 2VTKA 1HUQA 4UNSA 1OB2A 4IOKA 1OH7A 5JJKA 3U7GA 1G8YA 4KFRA 3EASA 4TYYA 2DPXA 1E9BA 1G9XA 2AN9A 4C9BA 2GETA 4C7OB 2ZAOA 4Q47A 3DPUA 2FGKA 2GEUA 3H86A 4JSTA 4PC6A 1P73A 2ZJZA 2VEDA 1YZNA 2WSSA 2XTNA 4KI0A 3ONWA 5GJVC 2PJRA 3OE7A 4MRNA 4Q19A 2BJWA 1UKEA 4P4SA 1D2NA 1YRAA 5JECA 3QY0A 4GZMA 1P9RA 2PZEA 1BO6A 4OQMA 2BCJQ 4LY6A 4PAOA 4DZZA 3CZPA 1PLLA 2GBLC 4V03A 1W48A 4KU4A 3LLMA 5FOTA 1FNMA 4GP6A 4LJ6A 4LJ9A 1VHLA 2RGAA 3GMTA 3UATA 1UJ2A 3SHFA 1FMLA 5CM8B 3MLEA 5J4YA 5EP1A 2DCUA 3B6EA 5FOXA 4DXAA 2NO6A 2GJ8A 1II0A 1SXJB 1Z6TA 4B33A 4QBIA 1ZAKA 3C16C 2PJZA 1TEXA 5F2EA 2VYFA 4UKDA 3ZZUA 4DRZA 1P60A 2VBCA 2G9NA 3TGPA 4W5HA 1Z63A 4ILEA 4KFUA 5CJ2A 1QHIA 3JZAA 1XWIA 1W7AA 3VR1A 1JR6A 1VYVA 3CIOA 1OFHA 1Q3HA 3WYAA 221PA 4UJ3A 1JQLB 2BBTA 4WVFA 3QEJA 1RRFA 4P32A 1XMVA 4JJKA 2WSSD 2VP9A 4IOMA 3I4LA 3OE7D 1N25A 1XJQA 5BN4A 1V5WA 4MGIR 2CBZA 1IQPA 2WWYA 2QMHA 5HE8A 2C2HA 3HYTA 4TLBA 4OHYA 3IBGA 3W9YA 5JI2E 2IX3A 2JLXA 5HCNA 1E69A 1DE0A 2G3YA 4HSEA 2WSMA 5LPNA 2HYDA 3H1TA 4HAWA 4JLAA 1EFHA 3HU1A 2ZM5A 1X6VA 4DUGA 1J2JA 2NPFA 4RVCA 4B2PA 4Y0AA 3CM0A 3MJRA 4F7WA 1BYUA 4TMXA 4S35A 1A2KC 4NP6A 1E9DA 1H65A 1FQJA 2BEJA 3IHWA 4EDHA 2P2LA 2ZS9A 3K0CA 3ZJYA 1KJZA 4DB2A 5EE0A 2ZTSA 4AKEA 1G16A 1UFQA 5TY0A 3QXSA 1MR3F 3EZ9A 4CT4B 3MUFA 3D6TB 1M8PA 1KJWA 1G18A 4IW3B 1M74A 4DLTA 3B1VA 4PFSA 1VTKA 3KZ1E 4CT5A 4F92B 2ZU6A 3R8CA 3THYA 1TF5A 3AVOA 3NEJA 2O8BB 2P0EA 1RYFA 4JVMA 4U02A 4HUTA 1GVNB 3U3KA 2XB4A 1CU1A 4TYPA 3VQTA 2FFQA 1VG9B 4NYMQ 1TPZA 2IYZA 2XNSA 3AKDA 3HPQA 1W36B 1QG2A 1E4VA 1IN7A 5CB8A 5F9HA 3KJEA 4B75A 3K9LA 4URYR 4Q4LA 1R7RA 1Q1EA 4RZ3A 1VYTA 2ZRGA 1U81A 2HCJB 1FPMA 4Z8XA 3VFDA 1XEXA 2X1VA 1I2DA 3K8YA 4I1UA 4A36A 1KTVA 2DYKA 2QA5A 4K81B 4MA4A 5SZKB 2DFKB 4CYMA 3AVWA 4LGMA 1RJ9B 1XZPA 1ZD8A 1E79A 4RY2A 2H18A 4O25A 1E2KA 3SE0A 3LVRE 1ZM9A 3WRYC 2BCGY 5AJZA 3U3OA 1KO8A 4IOJA 4BLPA 2ZI4A 2IUUA 1E2JA 3K9GA 3EIQA 2P6RA 1G3MA 1DELA 1E4YA 1Q21A 1TQ6A 1XXHE 1AZSC 1JXOA 2R6GA 3PFIA 4TWZA 2V1UA 1OT3A 1NP6A 2ZRIA 4W7SA 4L4UA 1L2TA 4PPNA 4TSFA 3Q9LA 1KMQA 4BQSA 2IK8A 3FKQA 1ZP6A 4OKSA 3WBKA 1GKUB 1F48A 2CLSA 4L8GA 1M6NA 4E22A 3T15A 2DB3A 2QT0A 3PEVA 2A30A 2HXSA 2J7PA 1Z0IA 3FHOA 4HAUA 2ZANA 2FH5B 2GKSA 3NHBA 3JVUA 1IXRC 2X8AA 2IYTA 1ZIPA 1NG9A 5DI3A 4Q7MB 2FFBA 2WJVA 1DS6A 1NMZA 1UDXA 2QAGA 5FTKA 2FMXA 2BWJA 3FMIA 4DHEA 3TH5A 3C4JA 4WIAA 2RGXA 3K0AB 2CK3D 5CJPA 1G3RA 3THYB 4Q5IA 2IW3A 1E99A 1E79D 1GZSA 1NKSA 5CIWA 2YJTD 3LH5A 2JGNA 1YHNA 3EAQA 2NZ8A 4ZV4A 5L3QB 2ANBA 2ZE6A 2OFOA 4FCWA 3HJNA 3NBZC 1W1WA 5DH9A 4BFVA 2ZRNA 3GLFA 3E5HA 1ZM4A 2W0MA 2YHSA 1XTRA 4BFZA 4D2IA 4II7A 5KYKA 4Q00A 2A5JA 1RZ3A 4F4CA 2IUTA 2PX3A 1BS1A 1BKDR 1M2OB 1F2TA 1UKYA 4PZZA 1KDOA 4MYCA 1QHGA 2QPTA 5AWFC 4ZCIA 3CNOA 2XITA 3E70C 2Z4SA 4RD6A 3UWKA 3VU9B 3C14C 1KKMA 4C0KA 1OV4A 4NE2A 2REBA 1T8UA 5B64A 1TMKA 1XD9A 3Q3JB 4DLZA 5FUWA 2PCLA 1XX6A 4OK5A 2NTYC 2WV9A 3FHCB 2W0SA 1ZMXA 1N0WA 2QM8A 4DDVA 4JVLA 4LC0A 1T3LA 2ZAMA 1J7KA 4FCVA 3CONA 3RYTC 2CXXA 3IBYA 3IEUA 3BFVA 1U90A 5FPTA 1P75A 3M0EA 4C0QC 2ZRKA 1Z28A 1WDTA 5HE9A 2ZJAA 4PO8A 3R9IA 2QAJA 4D82A 2OAP1 1NLFA 2O5VA 1XPOA 2RGCA 4B3XA 4G3XA 1XEWY 1NSFA 1DG1G 4CRWB 1RRCA 5KDDA 1TNDA 4LPSA 1Q3TA 1JI0A 4AKHA 2EQBA 4OI2A 2WMNB 1DAHA 1E0JA 2CE2X 2ZVPX 4XOIA 4XVQA 5SZJA 2KSQA 3OEHA 4Q9KA 4DLWA 4CEHA 1M1YE 4P31A 5H70A 1D9ZA 3K0FB 1GITA 1XD8A 2IUSA 1R10A 2BM0A 3HWSA 4R2IA 3ZDQA 1HQCA 2RAPA 4C0JA 2W58A 2ZSAA 3IPYA 5K8TA 2VHCA 3ZQ6A 2VSFA 5KNBA 2PZFA 4WAUA 2HLDA 4LYHA 2QAGB 1ELOA 2IS1A 2C9OA 1GNQA 3T1VA 3BFXA 4BZQA 3HYRA 3ZZ0A 2ZSDA 4B3GA 3KKNA 1DVRA 4IKEA 2A5DA 2EYUA 4D0LB 1Z0DA 2Z6VA 4P33A 3CR8A 2D7CA 1WRBA 1HQYE 4TYQA 4Z54A 3NDBB 3AUYA 2IYWA 1R0YA 2EFHB 2WWIA 4RCZA 5GJWC 1G8FA 1ZRHA 2ANCA 2XZOA 3LDAA 1HEIA 1S3GA 2HJGA 1FTSA 1CULC 3QKSB 1CXZA 2LWIA 3GLGE 2UZ3A 4URWR 2RGNA 2QBYB 2KBFA 1IM2A 1ETUA 1GRRA 4TQ9A 2OFXA 1N6NA 1F2TB 1A2BA 4LYFA 4DCNA 3GQBA 1Z07A 1U94A 2WICA 3OESA 4CW7A 3NKVA 3TR0A 2O0JA 2NGRA 3AUXA 2PEYA 1IOZA 2ZE5A 121PA 5FPSA 4RD3A 1KK1A 3OEHD 4HLDA 1LVGA 1SKYB 1G8PA 2YV5A 1ZM3A 2ASEA 3L0SA 2JLUA 2R65A 1CRPA 2WM9B 1MOZA 1OIXA 2FPMA 2X19A 1LTQA 2NG1A 5JLJA 4JLMA 1ZYUA 5LB2A 2W00A 5FPYA 4D4LA 3AVVA 2W2XA 2WPDA 4RZ2A 4HLUA 2JLZA 3MCAA 4HDOB 2IS4A 3VTKA 5CYOA 5LBIA 4ESHA 5EP3A 3B1YA 3NC0C 1N6PA 1TUIA 4JLPA 4KFSA 1GTVA 1W2GA 4E5UA 4B47A 2ZI6A 1J90A 1GL7A 2QSZA 4TN1A 1FUUA 1YU9A 1B0UA 3BB4A 1VKJA 1F2UB 2PLRA 3GJ5A 1OYWA 2AWNA 4AY2A 2GJSA 5DHAA 1ZJ6A 5TMPA 3DZDA 2D74A 2YC4C 1IY1A 2ECKA 4LOAA 3SU8A 4EPVA 3J81k 4BLTA 3R9WA 2WVJA 3B60A 3PQCA 2OCYC 4Q01A 4TTRA 4W5JA 2ZPTX 1E2FA 3GD7A 4AYWA 1KYIA 4BRWA 4Q1BA 5KO2A 3CRW1 1Q20A 3BFKA 1N0UA 4LC1A 1GKYA 3QJYA 2BV3A 4KSBA 2IF0A 1N6LA 1VG8A 5G41A 3C5CA 1TL7C 2C9CA 1SHKA 4OHZA 4Q1FA 3OIVA 4DEXA 4MGKR 4C2TA 4GOKA 2ZVQX 2J0UA 3A6PC 3BE4A 2L0XA 2ZJ8A 5GVRA 1XD2A 1BH2A 1P7CA 1JEEA 1LW7A 1XTIA 2VHUA 4M9ZA 5DN6A 2WPDD 1TF2A 5FBLB 1Z2AA 1CJKC 1OXUA 4J0QA 2EFEB 1IN8A 2OHFA 4EJSA 4ACAA 1Q44A 1EESA 1W46A 3TE6A 3BD9A 3X1XA 3BS4A 4A1FA 2PLFA 2HCBA 3BIFA 2OCAA 1YZLA 4M1YA 4QGHA 4JSYA 2ZYVX 3CX7A 1TQDA 2ZRBA 4KCGA 3AVUA 2ZQ5A 1AK2A 4ZCMA 3NBYC 1A7JA 4EAQA 1H8EA 1LF0A 1DTSA 1E0KA 4PSVA 2B7BA 4Q1CA 4DT1B 1E2NA 3QF4A 5UKDA 3B1XA 3CF0A 3W8NA 2BMEA 2EWVA 4OQFA 3KQLA 2H17A 5DE3A 1OH8A 1E9AA 1W2HA 1X86B 1PJRA 1ZUIA 2X2EA 2IBMA 4TMZA 4ZDWA 1K8RA 2F7SA 3ADKA 2V6IA 3K0SA 4JLKA 5FTLA 1XXHA 3CWZA 4PXAA 2GJKA 2ZEJA 1TQ2A 4WBSA 2I4IA 2YOGA 5B2ZA 4C4PA 2IXFA 4YXWD 4O0MA 3X1ZA 3LBHA 2GRJA 2XX3A 3MWYW 1CBUA 1OB5A 1FP6A 1OE0A 2V3CC 2CCKA 4M4SA 1KGDA 4A0FA 5EE9A 2VHJA 3LW8A 1G4UR 5HZHA 2Y8EA 2BJVA 5FTMA 5DN6D 1CR4A 1T5IA 3WNDA 1E2QA 2B8TA 2ZJ5A 3CPEA 3SC3A 5JJIA 2CL7X 4ARZB 3A1UA 4QJ3A 4TMTA 3IDQA 2IHYA 2AFIE 4IDPA 5IK2A 4FMBB 2Q6TA 3AVPA 2FDCA 1HY3A 2DFNA 2ODBA 5DLQC 4NL4H 4TL7A 1SKQA 3D8BA 2FE4A 2G0TA 2JDID 5KSYA 3SYKA 4LUCA 1XMIA 2Q9CA 4L15A 1AS3A 3I5YA 2EW1A 2C99A 2ERYA 2GEDA 2IWRA 2O8CB 2J0UB 3F0TA 3W8RA 3PUXA 2AHOA 4U5XA 2KI5A 3EG5A 2ODNA 3BH7A 1QHSA 2IF2A 4UXIA 6Q21A 3C5HA 3WHKA 5JHHB 4BFXA 1KY2A 3ZVRA 1T8TA 5F9FA 2R6DA 2WOOA 1OW3B 521PA 4XD7A 4XJXA 4QFMA 4M21A 1LY1A 2ZYWX 2GZDA 4LX0A 2O8EB 3LLUA 2JJ1A 3UMRA 4NZYA 4RD4A 5BN3A 3VHLB 3C7KA 1W44A 2I1QA 4Q66C 1KI1A 2REOA 2C96A 2FZ4A 3MRSA 3H0KA 2RGBA 1WP9A 1KO5A 1E9FA 2XTMA 2IYSA 1N5JA 2A78A 2UKDA 4DJTA 3RS2A 1W49A 3P27A 5FPKA 3U6KA 3VHXA 2OXRA 3QF4B 1G8HA 1KZ7B 1KOFA 5CB6A 4Q1AA 3N70A 3LX8A 3PVSA 3AF2A 1DO0A 5G53C 5IK2D 1KMHB 1US8A 1X8KA 1Z6XA 2EFDB 3I62A 3IUYA 3W5JA 2C95A 4R2HA 5CK4A 3CPHA 1XXHB 3LXXA 4PANA 3EARA 4V0OA 5TVKA 4D26A 4TZ0A 3KQKA 1COWA 4DLYA 1UAAA 3QE0A 2QU8A 4AYTA 2O8DA 4URVR 5JRJA 3LD9A 4B35A 4Q9LA 1E9SA 4TLAA 2GAAA 1EX7A 4Q7LA 1AS0A 3P26A 4EFLA 5A5GA 3RDPA 3U4QA 1VCIA 4DLXA 4JL5A 2IYXA 2JCSA 2Q21A 4F93B 3LRPA 2G1KA 1D8TA 2Q0HA 1QHHB 1T91A 1XMJA 1NVVQ 4LJYA 2JLWA 4WA7A 4XD7D 1JALA 3T5DA 4MRRA 1AKYA 1XMSA 2JJ1D 4PQFA 4BRUA 4B44A 2H5EA 1G21E 4XWOA 3AEZA 3RWOA 3PJRA 3C15C 2CEAA 2JEOA 4RFSB 3U44A 1P2SA 3T1QA 2X2FA 3GLIB 2GCPA 2D7DA 3A1WA 4NCKA 4GNKA 3ZZTA 3QEOA 4AK9A 1WBDA 3BGWA 3GLHE 3UKDA 3UMFA 2GK7A 3I8XA 2O8FA 1TF7A 4M1MA 3GLGA 4X8MA 1MABB 2C5LA 2ZSEA 3K70C 4LWZA 4PAQA 3QVUA 4H9GA 1XP8A 3B2EA 1XEWX 1YQTA 1COWD 4CEJB 2ZUDA 2GCNA 3LY5A 2XNDD 4GP7A 3CW2A 1GILA 2PT7A 2CVFA 2WZQA 3ZIAA 1QDEA 2FZLA 4IOLA 1N3BA 1E2GA 1SVIA 4PSAA 2ZRCA 1U8AA 4YONB 3CRQA 1IXSB 1TX4B 3U7EB 4A8JB 5JEDA 2WKQA 2NOAA 4WW0A 2YWFA 4M0LA 5CM9C 1T5LA 4M9SA 4XTRA 1TADA 1CJUC 4HZUA 3QIAA 2G0NA 3NXSA 5DYGA 1VMAA 5JWHA 2ZITA 4MDFA 5DHFA 3RSLA 3GCGA 5FL7A 1P2TA 4M1TA 4X8LA 4GOJA 5TARA 1T9HA 2F1IA 3D31A 3RHFA 5JZVA 2YOHA 3A4NA 4W5WA 4OK6A 2XZLA 3Q5EA 4HDCA 2XB2A 3CPJB 3IIMA 3FFAA 4P3YA 1XEFA 1A5TA 1FMJA 2FNAA 1OXXK 2QMUA 3VX3A 3U5ZB 2ORVA 3CF6R 3QI2A 3GJ4A 3THXA 3U4QB 1P9NA 2GXQA 2YOFA 2GILA 3BWDD 3DKPA 4LV6A 4PHGA 1FX0A 5C46F 1A1VA 3G82C 4BEBA 1X8JA 1BIFA 1KY3A 3SYNA 4ASUA 1SXJC 4B71A 3B1WA 3SHWA 2P5SA 3ZIAD 2QPOA 5FBWB 2YZ2A 3UK6A 4EIWA 1E9RA 3AQ4A 4EPTA 2QTFA 5L3RA 3U44B 4JBYA 1XTKA 1ZD9A 4XVUA 4V0ME 3KQHA 3KX2A 1W0JD 5D3QA 4MYUA 4OK3A 2VP4A 2GEVA 3GJ6A 2JAQA 4I1OA 5H8WA 2OSBA 2R44A 1UDWA 2VP0A 4C2UA 3TUZC 1U9IA 3KKQA 4CEIB 3OZXA 2O8FB 2HF9A 1JR3E 4QBGB 5FL7D 1U8YA 1XPRA 4KYUA 1UKVY 3TVDA 1Z47A 1UF9A 5CDFE 2NMVA 1J8MF 3X1YA 4IFBA 3LQRA 3H2YA 5FBRB 4QRHA 4QNRA 2DWQA 5EE3A 5JSZA 4CGZA 2LKDA 2H16A 3WMEA 3CNNA 2N42A 3BC1A 2CHQA 1WMSA 2IYVA 2HUPA 5FI1B 1A82A 2J87A 4PQYA 4QHYA 4WZBE 2ZR7A 2ONKA 3FYHA 4OQXA 4ZI3A 1SVWA 1HH4A 4G5SA 3R7WA 4JLDA 1KK0A 1YZKA 4AC9A 1JECA 5DGXA 2UZIR 3T35A 3ZH9B 1C1YA 1E32A 4QHTA 2OEPA 4MYHA 4N0EA 3AKYA 3DEFA 1JJ7A 1OH6A 4ASUD 2UVQA 2VHTA 4GL2A 2MMCA 4IVPA 3RNLA 4OJQA 2A5GA 4BUJA 1E2EA 2QE7A 3B82A 4LDJA 4P4SB 2YWEA 5JFGA 1QG4A 2HF8A 3UXMA 4QKQA 3EX7C 4DLVA 1T0HB 5EQTA 2BM1A 2W6JD 4A2PA 1BOFA 2OE2A 1UADA 2C8VA 1JQJC 5EXSA 1GDDA 4ZDIA 3REGA 1HTWA 4MGZR 2AD5A 2GCOA 3CNLA 4QHSA 3THXB 3SZRA 1IJEA 1Q57A 2ZRDA 4ERNA 1R6BX 1JEDA 3MG9A 3RS0A 1FW6A 2IXGA 3OIWA 3Q8XB 4GI7A 4BWYA 2O0HA 4LV5B 1DEKA 1W36C 4URZR 1AQYA 2V6JA 1DAGA 1ZM2A 2RHDA 2QROA 2QGZA 1GUAA 4IFEA 1EX6A 1XRJA 1CEEA 5AUOB 1OFUX 2PH1A 3KQNA 2G6BA 1IBRA 1G8GA 5ELXA 4EFMA 5CK5A 2ZRMA 2CK3A 1S0UA 3PEWA 1EFUA 3E2IA 3U2QA 4Z51A 3MD0A 5JCPA 5KPJA 4GPTA 3O8DA 1NJGA 4MKFA 1GNRA 1U8ZA 3RRNA 2EVWX 1E96A 3RRMA 3KTAA 2GVZC 4GRAA 3SYLA 1WA5A 5TB5A 4BFYA 4MDEA 5AUQA 3W90A 3QQ5A 4JLOA 1PLKA 2QZ4A 2QE7D 4FCTA 3GEHA 3SJCA 3VR2A 5E3HA 3VKGA 2XSZA 4BLOA 4Q1DA 5EE5B 4MRSA 4BFWA 3BORA 1ZNXA 2EFGA 1YRBA 2FSHA 1E2LA 1U99A 2QMEA 2WIBA 1E2MA 2P67A 3TSWA 2J45A 3WP0A 2JLVA 2GF0A 4Q02A 3Q72A 1SVSA 3QSYA 3QXCA 3RAPR 4TT3D 2QP9X 1U0LA 4FWIB 5L3VA 5IDVA 1GL6A 2QRZA 2VL7A 3CX6A 5L3SA 1XNJA 1R0WA 4Q7JB 1OKKA 2LKCA 2J9RA 4Q9IA 4IVQA 3I61A 1LFDB 4LJ4A 4RFVA 2WOJA 4YDSA 2WKRA 4IDNA 3WNCA 4XWAA 3G5UA 5E95A 4Q48A 3UWOA 1MH1A 1K5DA 3VX4A 1NIJA 1E2IA 2ZRHA 1G17A 2GCOB 3L8YA 3BJIC 4PC3A 1GIAA 1JB1A 4V02A 2BC9A 3K1JA 3DHWC 4ESVA 1G4AE 1WCV1 2YINC 3AB3A 1DOAA 1NBMD 1SGWA 1B23P 3BOSA 2XSZD 1KK2A 2RHMA 4DKXA 1LB1B 5GADl 1QBKC 1XJCA 4KXFB 3RS7A 2CE7A 3KL4A 5FPHA 3F3YA 4B3DA 3AP3A 3TW4A 1EXMA 4PC2A 3S1AA 4RD2A 1XEXB 2WJGA 4KYIB 4X8OA 4PQRA 3AP1A 3GFOA 4K8OA 4MKGA 4PHFA 3MSXA 2CJWA 1CP2A 2VLIA 3HPRA 1NLZA 1NN0A 4M22A 5HPYB 4DLUA 5ANRB 5EZ5A 2FU5C 1G3UA 2J0VA 2FSFA 4LHVA 5J5CA 4D4KA 4ZIRA 3KTAB 1VDZA 2AWOA 1XTQA 4LYAA 3PIRA 3GLHA 2Q9BA 1OKKD 4N0DA 2RMKA 4NONA 1ESMA 2GZAA 2A9KA 4GBMA 3CRRA 3T5GA 1DADA 2G88A 2LCFA 1VIYA 2QT1A 2QUZA 1JPJA 2NO0A 3B78A 5C4GB 421PA 4AWXA 3QPUA 4KITB 2V55B 3CH4B 4FMDF 4G5QA 4TMVA 5DNYB 2ZRJA 1KSFX 4PSKA 3VR4A 4LK2A 3EPKA 1GG2A 3ZQJA 4QBHA 3A36A 4OBEA 4C3ZA 4F38A 1N5LA 5JWRA 4Q03A 3EPHA 4QM7A 4CZ2A 4PPQA 4KVGA 2F43A 3FTQA 5TXGA 3H4MA 3QUSA 4U7DA 1XCPA 5DI3B 2QAGC 1YR6A 2KB0A 2G77B 5HTKA 3MGCA 3LFUA 3EC2A 2ATXA 3W6NA 1WB9A 5JRZA 3BXZA 2R9VA 3NEYA 4TMKA 4AG6A 1QZXA 2QMOA 3PEYA 1AKEA 1QF9A 3B9QA 3BERA 3ZYCA 1P62B 2Z4RA 1KZGB 4TYWA 1QVRA 1RRGA 1S4QA 2VF7A 4HLQB 4JKYA 3TNFA 4URUR 1KI4A 3AKCA 4JIMA 1Y63A 2CL6X 2F9MA 2PL3A 3IGFA 3WYGA 1AIPA 1V43A 4I81A 2BVNA 2ZYUX 1FQKA 3GLFB 4H1UA 1JNYA 2C04A 1IN6A 4IHQA 2B92A 5AUNB 1SXJE 5A4JA 1ZNYA 5BQ5A 3LV8A 2WWWA 1HV8A 1NN3A 4ON9A 1P4SA 4JLBA 5FOVA 3CKLA 1TAGA 2NPIA 1O3YA 4GMXA 1FTNA 1BYIA 1OSNA 3VAAA 1Y3AA 4JLJA 4IEEA 2ZJ2A 5AK0A 4Q4JA 4JL8A 3TAHA 4TL6A 3SFVA 3FMOB 3KKMA 4V0MA 1VCOA 3T61A 4QBFA 1IHUA 2FPLA 3MWKA 3N5CA 2ZS8A 2OCBA 3W5IA 3THWA 4LPKA 5EJEA 2RGEA 5JMTA 3U60B 2RCNA 2JLSA 1NI3A 4NYJR 1JR3A 2BBOA 3KFVA 1CR1A 5CDFA 1T3HA 2FEMA 2J0SA 3DMNA 3GJ3A 4URXR 3EPJA 5G3ZA 1G5PA 1I2MA 1MKYA 4L16A 5SZIA 4D80A 5FH9A 3NG1A 3KJIA 5KPDA 4IJMA 3P20A 1LV7A 4PHHA 4RSGA 3RS4A 4A2QA 2QPAA 4KODA 1G3IA 3PUWA 3RRZA 2NQ2C 1F5NA 2J59A 2V4ZA 2W6IA 3FE2A 4B34A 4B3FX 4CEHB 4OHWA 4IDOA 4WZAE 3AGQA 2MSDB 4TYNA 5FBQB 3A1VA 4W9MC 1ZC3A 2FN4A 1UBFA 2W2VA 1KDPA 1KO7A 3ASZA 5IF9A 3NC1C 2QQ0A 3T1TA 5EUQB 1OH5A 1XPUA 2FV8A 4IVRA 2WWHA 3WY9A 4PX9A 1ODFA 3KUDA 2QGNA 4JLVA 2WJIA 3OIUA 1MO5A 5EXPA 3L82B 4DCSA 5AR1A 3DM5A 4YXWA 1NN5A 2MSCB 4G5RA 2ZRLA 2IS2A 3SS8A 2F3RA 4L9SA 1E0AA 2JA1A 1G6HA 2P65A 3L0OA 4LHZA 5KDOA 1CJMA 2OM2A 5E7MA 3ZD6A 1JR3D 2BKUA 4A0GA 3SBEA 3KXLA 2CHGA 4MQBA 2HT1A 1ESNA 1GL9B 1KAGA 1W5TA 1G5RA 2ZJYA 1ZBDA 1R8SA 3HP1A 2YYZA 1E2DA 3U3RA 5JHGB 4MKIA 2BBSA 4Z1MD 1R5BA 4JKIA 1D5CA 1UBCA 4AD8A 4Q4JB 1ZIOA 1Z8FA 1P6XA 3P32A 2W6ID 3LQQA 2JDIA 4HUQA 1YZTA 1G7SA 2E1RA 4M8NE 1MV5A 5LB4A 2KBEA 3EPLA 2ZR9A 1Z3IX 5JS7A 4N3NA 2Z5FA 2BMDA 1PUJA 1T6NA 1MRNA 4B48A 2VF8A 1KI9A 3GJ8A 2ZS7A 4HLUC 5DISB 3K9HA 1EK0A 3C41J 4G1UC 1XCGB 1N6KA 4ACBA 4A6PA 3KKPA 4MRVA 1VIAA 3GFTA 1WE2A 3Q7QA 4NCIA 4RD1A 1S1CA 2ZI7A 4DSNA 1U0HC 1W4AA 1HA3A 1W0KA 4YC7A 4B32A 2W83A 4WZ6A 4C0LA 4EPXA 4LJ5A 3PITA 3WRXC 3QXJA 2DR3A 3UIEA 3SQXA 3DOFA 1DPFA 1HT2E 1S9HA 2DWOA 2GXSA 1UBEA 3WP1B 2Q9AA 4DC9A 4FMDB 3FMPB 1FNNA 3OIYA 5G3YA 4ZKDA 3OAAD 4TZ6A 2GNOA 2OAQ1 3DDCA 2NIPA 1RFLA 2FSIA 3B9PA 4MUBA 5CYPA 5FTJA 5AJXA 2AKAB 3JZMA 3NH9A 5B57C 1KK3A 2JASA 1NVXQ 5C2JB 5J4KA 5KOYA 2PMKA 2MMGA 2OO7A 4P4UA 3CRVA 2IWHA 1CF4A 1CJTC 1YZGA 2YKGA 3NDPA 2OG2A 2XZPA 4UXJA 2OFWA 1X8LA 3BB3A 1NN1A 1WQ1R 4D25A 4DDUA 4Q18A 2IEZA 4Q4AA 4BZXA 4KLNA 2ZJOA 1AN0A 4FN5A 1F6BA 4QM6A 1XD2B 2AK3A 1NSTA 1C4OA 1OPXA 1QHYA 1NBME 2WJJA 4KHZA 3TKLA 2O52A 1C9KA 1LNZA 3PR1A 3GJXC 4FIDA 4TQAA 4EJSB 1VPLA 2PBRA 3GPLA 3DM9B 2A2ZA 1PV4A 1XCMA 2IXEA 4QL3A 3TBKA 1W0KD 1GWNA 3ETLA 4DVGA 4B6EA 2YC2C 4PC7A 5BWMA 2Z43A 2AR7A 4HUQB 2V54A 1QRAA 1II9A 3BAFA 4NYIR 2IA5A 4BFTA 1MRSA 1CIPA 2NO1A 3KXIA 3WHLA 4CVNA 2C78A 3I1FA 3ADCA 2GJAA 4BZPA 2HYIC 1G7RA 1ONBA 2IYYA 4KBFA 4C0AC 1JBKA 3U7HB 3L0IB 2OLJA 2BDTA 4DSUA 5EXTA 4I4LA 2FFHA 4HB3A 2HT6A 5JCZA 5KDLA 1FUKA 4EQ6A 3TIFA 3PUVA 2VP5A 2VIIA 4UNRA 1AGPA 1KDTA 1QHNA 2KWIA 4Y0VA 5JJLA 1SZPA 2ZU0C 4OQNA 4LBZA 4HB2A 2QSYA 2XNDA 4PO9A 1OFIA 1W5SA 4NDZA 3ADDA 2AXNA 1W4BA 4A4DA 2VQSA 2QN6A 1RPZA 3RLFA 3O8CA 2AFHE 1EFTA 4D0NA 1Z29A 1RC8A 2FGJA 2VSXA 4QOSA 4DWJA 821PA 1HE8B 1NKTA 4JVNA 4C7OA 1IJFA 2QY9A 3A4LA 1ZNZA 2YWGA 1J8YF 1I4DD 2A5FA 3ICEA 2X77A 2OBNA 4NMMA 4JT2A 3AF0A 3DL0A 3T1OA 4DCTA 4LI0A 5BW8A 1KI2A 4C0BA 1NRJB 1S3SA 1CR2A 2ERXA 3RS3A 4EPYA 2DWPA 1KSJA 3LX5A 1N6OA 2GF9A 1HE1C 2ODEA 1N6RA 4B73A 5FOSA 1E0SA 3AVXA 3FFBA 2GBLA 3CF2A 3NBFA 2D06A 4HZIA 4Q4AB 1FZQA 3O47A 5KSPA 3QNUA 1Z5ZA 4F4IA 1TEVA 4US2R 5J4LA 4QGFA 4N1AA 1PUIA 3TUIC 3K70D 2PMDA 4OI0A 4BECA 4LBWA 2J46A 2BBWA 3HU2A 1SXJA 1AS2A 2DY1A 1N2CE 4DSTA 2REXB 3CZQA 4KV9A 5FI0B 3KB2A 1ZM7A 2VO1A 3M1IA 5DI9A 3FDIA 4RKEA 5BYJA 3NHAA 2FF7A 4RD0A 3IIKA 2IYRA 3UG6A 1NMYA 4ABYA 1SKYE 2F9LA 2CDNA 1M7GA 1ZINA 5K8LA 2FWRA 1GFIA 3TRFA 3EWAA 1CRQA 1SVLA 4A8JC 5HKKA 1Q22A 1A4RA 4MRPA 2N46A 1KSHA 1S96A 1OXVA 1P9WA 1W0JA 3LVQE 3L8ZA 1SVOA 1PLJA 4E03A 4LJ7A 3EZFA 4PHTA 4V0KA 2R6FA 3R8FA 3K53A 4Q1EA 2FJUA 5J47A 2BKEA 4JS0A 4DEYA 1R0XA 1SVMA 4OHVA 1US8B 2IYQA 4H1VA 4K46A 2QP3A 3P4YA 2PCJA 4AI6A 5SZHB 3LBIA 3CRMA 4EQ6B 4DDWA 1Q0UA 2WJHA 2F3TA 3N2IA 3A1TA 5B30A 5CLQA 4X8HA 3B13B 1W47A 1YR8A 1OJLA 2GVDC 2ZSFA 3SR0A 1BMFA 2WWGA 2BOVA 4M1OA 2O8DB 3CUEF 3M6AA 5AJWA 4HEJA 1KI3A 1X1RA 2JJ8A 2B8WA 1ZCBA 2F1JA 3VKHA 3SQWA 1SQ5A 2FOLA 5JEEA 5FOUA 5H1YA 2ZRPA 2TMKA 3K09C 1IN4A 1SXJD 1H8HA 4A6XA 2ZE8A 1ZW6A 4Q4HA 4PZLA 3LBNA 1NF3A 3B7GA 1ZCAA 3DZ8A 4LHYA 4EUNA 2OT3B 3ADBA 1NJFA 3K9NA 2IT1A 5L8VA 4M53A 2WTUA 2JIZD 2YVUA 5B58C 4M1SA 2PZGA 3AF4A 5JS8A 2XXAA 1UM8A 1ZU4A 1HURA 3FMFA 3I32A 2P6NA 5HKKD 1II8A 3IILA 4ZDJA 2ZXUA 2W6JA 2O8BA 2EYQA 4MITA 2I1VB 4KFTA 2ZR0A 4M9QA 5K8IA 3NBXX 3KXKA 4U00A 1Z0KA 3GJ7A 4ITRC 4PPFA 3U3JA 4F91B 1XU4A 2AL7A 2J7KA 4PAMA 4XWKA 1XJ0A 2J0QA 3GLGB 2IS6A 3P1JA 3LXRA 1ANKA 4XSGA 1KI6A 3MWJA 2P6UA 4MKHA 2IHBA 4FXPA 4C0SA 2EFCB 1GAJA 4OI1A 3TUJC 4JLNA 3WYFA 4A15A 1DBSA 2SHKA 5C1BA 1BMFD 4B2LA 1QVAA 2QEQA 1RJ9A 4GSYA 4XSHA 4NYMR 2ZE7A 3L0PA 3EIHA 3QPWA 4LBVA 2WWXA 3TQFA 4EFNA 4BLSA 4E07A 1ZNWA 2IYLD 1RE0A 1P61B 4D4JA 2VA8A 2VSOA 4CF7A 1P3JA 4WXPA 2QNRA 4HZUB 4OYHA 1H8HD 3MWLA 3UG7A 3TR5A 1KI8A 2BHRA 4NPHA 1EFRA 1M7BA 1TQ4A 3X1DA 3RC8A 1U2RA 1XTSA 1GNPA 2EWWA 3KKOA 3FPAA 2Q3HA 1EWRA 3FVQA 4MH0R 4NKRA 3NWJA 3DMDA 1M7HA 1UEJA 3QENA 4EPRA 1W4CA 3QKRA 2AXPA 2KJQA 3TMKA 5IT5A 2ZJBA 1E94E 1OIWA 2Q3MA 3KFXA 1AA9A 2GK6A 2V8OA 3CO5A 2Z0MA 3R9XA 4FINA 1ZUHA 3DVLA 1AJEA 4GT1A 4LHXA 4US1R 5KUTA 4TT3A 1DAIA 2GXUA 1W36D 2QP4A 5JI3E 1TTTA 1I4LD 1G1MA 1DAFA 2R6CA 3AGPA 1FX0B 4R71A 3ZS9A 4JL6A 1E1RA 3SJBA 3T06B 4LBYA 4Q4HB 3ZVNA 4BFSA 4LJ8A 4US0R 2WWFA 2ZI9A 3TAUA 2CMKA 1JXMA 2IL1A 1DG3A 3AV0B 3K0AA 4FMCF 4UNNA 3RSOA 2J3EA 2XXAB 4XH9B 3BBPA 4QGGA 2O0KA 3OF5A 1II8B 4NBSA 1KHTA 3Q85A 5EP4A 5H68A 5L3QA 5BN5A 1JJVA 4B3CA 4IXNA 1OXSC 4HI0E 2GA8A 3WNBA 1U9IC 1NY6A 2VRWA 1GOTA 5F98A 1R8QA 1RVDA 3FB4A 3QKTA 1EFRD 1P72A 4DSOA 1S1MA 2ONJA 3CX8A 1X3SA 1Q1BA 2FPKA 3LW7A 5CITA 1E1QA 4LZZA 4ZDKA 4IDQA 5KSZA 1NBMA 5FR1A 4EKDA 3D3QA 2R2AA 3U7FB 5JSZB 1KSGA 2BEKA 2FFAA 1KI6B 3VNUA 3VU9A 4OL0A 1Q1ZA 3N2EA 4AG5A 1YR7A 1OYYA 1EFCA 4EPWA 2G83A 1L8QA 3VR6A 4DUGD 1GP2A 4OI4A 3SI7A 1G291 4JBXA 1G7CA 5FUYA 3IQWA 1KI7A 4O2RA 1F60A 3R7WB 5HR5A 4IXMA 3REFA 3AKEA 2OZEA 3SBDA 2JLYA 3KUCA 3W6OA 1OHHA 2F1RA 3HU3A 1E1RD 3L43A 3W3AA 1T4GA 2XJ9A 3K0CC 2HJVA 3HR7A 5FL3A 3WMFA 4IDHA 3GP8A 4A2WA 2OXCA 2ZRAA 1LS1A 1X1SA 1Z2CA 2V9PA 4ZO4A 1P2UA 3QKRB 4HAZA 1YE8A 2IC5A 4B2IA 1SVKA 5FR2A 3THOA 5AUPB 3BH6A 3RS5A 2ZSBA 3K0FA 3SOPA 3EW9A 4UXHA 1GSIA 1T3SA 3EZ7A 1ZUNB 2N1BA 3CR7A 3TJZA 2XTZA 3U6BA 4AKIA 2QTVB 1NNEA 2GXAA 1E1QD 1NL3A 4QGAA 1E9CA 5E7IA 4CIDA 621PA 4BLRA 3V4RA 3PENA 2NZJA 2GDJA 1KJYA 3IHLA 4NCHA 4XVRA 1ZC4A 1EG7A 3GEIA 1SULA 4JZKA 4RZXA 1RIFA 1E98A 2V1XA 4JVSB 3GLIE 5IHPA 3PUYA 5LDDC 5DYIA 3IPXA 1XBTA 5KSOA 4XIGS 1XFAA 2NO9A 2HEIA 1S9DA 2I3BA 3QKSA 3R20A 2XOKA 3G0HA 1OHHD 1GKIA 3ND9A 2XJ4A 2QBYA 4YQFA 1W4RA 4HAXA 1EWQA 4TSFD 4UNQA 4A0HA 1Z06A 4V0NA 2IYUA 3TSOA 1P5ZB 4POAA 2DHRA 1MO4A 1JAIA 2GTPA 3EIEA 4Q9HA 3KB1A 4F4JA 3AVYA 4OJKA 5IRCD 5FTNA 1XDBA 2EU8A 1NG1A 2BMFA 1D9XA 3TK1A 4RCYA 4YMWA 2J7PD 2ZUCA 2HDNB 2C98A 1E2HA 1CTQA 1HT1E 3BK7A 3LWNA 3AP2A 3ZD7A 2QRNA 2DFTA 1VYUA 1MO3A 3RABA 3PXGA 2D3WA 2WHXA 1NIPA 2ZI5A 3EA5A 3QPVA 1DO2A 5L3SB 3A1SA 4OHXA 3OFNA 3IQXA 3DKVA 4KSCA 4AKGA 1MO6A 4LCBA 4LV8B 3OHMA 4D6PA 3QVVA 2GHIA 3U3MA 5BYKA 3ZGXA 1Z08A 3JVVA 2VP2A 5TV2A 3GJ0A 3QG5A 5P21A 3A37A 4RJLA 2WJYA 4PC1A 1IXZA 5JBQA 4G0NA 4TLDA 3LA6A 4R7ZA 2JJ2A 5KNDA 1R5NA 4QG7A 4YDHB 4HDQB 3TVTA 1GM5A 1F2UA 1IY0A 2XOKD 3AM1A 3PCRB 3NTUA 2CVHA 1D6JA 1UKZA 3V00A 1Z6YA 1ZVQA 1Q1QA 1PZNA 3T12A 2CHVA 1YKSA 2FSGA 1OF1A 1R4AA 4HB4A 3VNVA 4AURA 2R6AA 1NY5A 4L5BA 1CJVC 3DOEA 4B3BA 1YR9A 5EP2A 4M2LA 1S2MA 2RKOA 4PTLA 3ZLJA 1ZD1A 1KIMA 4JYBA 4PR0A 3QBVA 4ZPXA 3S1AB 5LD2C 1Z0FA 2A5YB 1KNXA 4QC2A 5LD2B 1P2VA 3W3ZB 3GEEA 3UPUA 2CJWB 3Q7PA 1K5GA 4GMDA 5J4HA 4FMCB 2ZREA 3B8HA 1J70A 4PO1A 2ZIAA 3NIBA 2H57A 3OFND 3WBJA 3C8UA 1FP7A 4DLSA 4ZIRB 3U61B 2ORWA 1R5OA 3A4MA 3GLHB 2JATA 3FKSA 1M34E 1N0VC 2OUKA 3I72A 4FW9A 2VP6A 4YMVA 3ZVLA 2D4HA 3V4FA 2RB4A 2ATVA 3I3SR 1G19A 4O3MA 2JJ2D 3MFYA 4NH0A 4ZI2A 3KJGA 4Z1MA 5M04A 3BB1A 2G1JA 4I99A 1AGRA 2R8RA 2ZYTX 5EXXA 4DT1A 4B6FA 2WKPA 4QJ4A 4A92A 1E3MA 1KO1A 2QL6A 4FI3C 2HLDD 2F43B 5HZKA 3O8BA 3ECCA 4NTZA 5D3MA 3ZVMA 1KNQA 3F5FA 3QF7A 4DLRA 3K0EA 5GJBA 4ZKEA 3SEAA 2AX4A 4D0GA 4M1KA 3OEEA 2BIFA 1KDRA 3A58B 1J99A 1E2PA 4E09A 4DIDA 2F55A 4B76A 3M4YA 2XGJA 2A7QA 1KAOA 4JYCA 1Z83A 5KTYA 4HYYA 2GZHA 1RW4A 4Q21A 2QORA 4D4MA 5J4VA 4UJ5A 3ZS8A 4DB4A 4TLCA 2PX0A 3KJHA 1UPTA 3AVTA 1R0ZA 4ZCLA 1G3QA 4L9WA 1AQUA 2CLDX 2FEOA 2OBMA 1FFHA 4GOXA 1JAHA 4DIEA 2C9YA 2E87A 3A8TA 3RVBA 1OIVA 3FKSD 1L4UA 1CS4C 1Z22A 4ARZA 2RGNC 5FUXA 1NVWQ 2FX3A 3TW8B 4DDTA 4IEIA 3RWMB 5F3WB 3OAAA 2CL0X 4LJAA 3P4XA 5GVSA 2VPPA 2OBLA 3SJAA 3KQUA 4C0HA 5FFMA 4NYJQ 2VHQA 4S2EA 1Z6AA 1NLYA 2FA9A 3SN6A 3AF3A 1EGAA 3QOFA 2ZETA 2YWHA 5E4FA 2KE5A 2QENA 2JLQA 4P4TA 4YLGA 2O8CA 1G6OA 1O87A 4AIIA 2AD1A 3IEVA 1HYQA 2RGGA 4NCJA 3THWB 3EA0A 1XTJA 2B7CA 3FOZA 1KKLA 1XB2A 3L2OB 4B74A 2P3SA 3IIJA 3QBTA 3HR8A 5CLLA 3OEED 3IO3A 4BE7B 3AF1A 3ICQB 1U98A 2O8EA 4CDGA 3CBQA 1GRQA 4M9XA 1VHTA 4LHWA 1S8FA 3CB4A 4GZLA 4QJ5A 1U0JA 2E9SA 3FWYA 1D2MA 3QG1A 4Q7KA 1WBBA 3NH6A 1TU3A 3B5JA 1UEIA 1TUEA 1G64A 1QHXA 1UBGA 2ZROA 3LAWA 3WMGA 4DBLC 4C30A 4NCNA 1AM4D 1N5IA 2K5UA 3V9PA 4HAVA 1DAKA 3X2SA 1XZQA 4LSGA 1YZUA 2OILA 4XTCS 5D3MB 2NO7A 2BMJA 3SJZA 1KMHA 5DSZA 3MAAC 1LF5A 2HV8A 2QTHA 1Q12A 3RANA 2WAXA 3PV0A 1OXTA 2MSEB 5KNCA 2D2EA 5K8UA 2IEYA 3FHTA 3QXXA 2QI9C 3BH0A 1OLOA 4MYTA 4RKFA 1IN5A 3MMPA 5E7JA 2C77A 4MGYR 3BRWD 2AK2A 3E1SA 2F1HA 3PUZA 5KHOC 1VCNA 2B6HA 3I92A
chains in the Genus database with same CATH superfamily
4X65B 3ENKA 1UQTA 3IAFA 5AJTA 2Q6OA 3RJTA 2NTEA 5I9IA 5I4IA 1XZNA 3IVXA 3GP3A 3BCHA 4TOIA 3SQMA 4D81A 5B2EA 4RDHA 3R7BA 3ANMA 2NUPB 3VPCA 2NP7A 3AUTA 3NALA 3MINB 5AH0A 5HFNA 4UD2A 4D4GA 5BOVA 2ZBPA 5ETJA 5AW1A 1T0BA 1KO4A 1WXQA 1QB7A 2FWMX 2HK8A 2OHJA 3ESDA 3GNSA 4GX1A 5AP9A 1RQLA 4M7RA 3PIIA 3T34A 2W5UA 3OT1B 1IBSA 3K1YA 4NU0A 4OLHA 3ND8A 3LNTA 1NT2A 1VECA 1Q16A 3L02A 3OD1A 1MZPA 1TJNA 2CXNA 3AJEA 4TTIA 4FB4A 1KZHA 2DOKA 1QXSA 3M6LA 4FUQA 3TZCA 2WSYB 5ISMA 2OQRA 4RZUA 2FWBA 4WXRA 3B1ZA 3B89A 1FFEA 2W2QA 5DO9A 2VF2A 2FMTA 1YVDA 1RZVA 2L17A 2X8BA 3GAMA 1T8RA 3D02A 3JQPA 3K94A 4LYJA 4RK5A 2HHCA 2Q29A 1CKEA 1H22A 2F6RA 3HYSA 3IKJA 4H7KA 4F8EA 3O83A 4A9AA 2OESA 3W34A 5E0KB 4D8UA 1G6KA 4AROA 4BNTA 1VYHA 4KO8A 1ONOA 1H1TA 3AYXB 4GLBA 1D2EA 5HCIA 5FBVB 2DUJA 5BOSB 3TSZA 3VYVA 4A0RA 2UUAB 1L3BA 1L7MA 1QGUA 3LO8A 4OGLA 1G20E 2HZ7A 3FMVA 3K32A 4HH1A 4MW9A 4IH9A 2G06A 2M1ZA 3OI7A 2ECFA 3OOEA 5IH3A 5K3BA 3ZWYA 4ZYTA 4MHSA 3K5WA 2UXBB 1OAOA 4FSXA 1XF9A 3KSZO 4DUZB 1L7QA 1YS2X 4TWBA 3SDZA 3BE6A 3HUTA 4PNHA 2VJLA 4JJFA 4AZWA 2QXUA 3L4KA 4OIMA 4C7BA 3R0VA 2YQZA 4TQUS 4QX6A 1NX9A 3UQZA 5LA6F 1N1GA 3U56A 2W6NA 1RT9A 3QXHA 3A1DA 4G4SO 1XMOB 1P5HA 2LE0A 1HZJA 4EB6B 1JHDA 1JFVA 4W8HA 2XNJA 3NAMA 4ROSA 1WVMA 1ULZA 3I5UA 4TKVB 3EZ6A 2XVXA 1PQ4A 1F38A 1BCSB 1JILA 3DMTA 5F78A 3IL2A 1VLVA 1J8FA 3I3OA 4Q34A 4D45A 4V2UA 2CCJA 2WFLB 3L84A 4PYQA 3I2FA 5AVKA 2Q7OE 3WVNA 1UC4B 2CXTA 3W2GA 4G0MA 4HGRA 1W88B 4PZ0A 3UA3A 5I3ZA 3EEQA 3KQTA 3VMFA 4RK4A 1I8TA 4C2BA 3FUVA 1UJBA 1XYGA 1EK1A 1JHXA 2GCEA 3EISA 2GJ9A 1Y1TA 3P45A 5C81A 3GLFE 4KR2A 3KYJB 1KQPA 3ND6A 4M1WA 1JTFA 2HK9A 3GGSA 2BR3A 1K4KA 3FVWA 2EL7A 2XUDA 3UH0A 5KU1A 3V4LA 1E5QA 4FBGA 1T0JB 4HQKA 1LPBB 4R1OA 1RACA 2VXCA 1HDCA 2ZTUA 4R6WA 4B43A 4F6LA 4OGGA 3EZGA 4RELA 2W37A 4NYIQ 5K0NA 3O8RA 2R62A 3DUFB 1N6IA 3MFQA 1ZGGA 4IIDA 4YUXA 1AKRA 4EO9A 3OTGA 1YB7A 1NQTA 2CN1A 5JAHA 1SHZA 2J9ZB 4R9UC 4R2WA 3NGLA 1FDUA 5TDHA 5FOWA 3H1PA 2IEDA 4HTFB 2PT5A 2WAYA 5CPBA 2ZIXB 3PC8A 4EHFA 1OFTA 1WCIA 2CCGA 3BHNA 2QG6A 4LXHA 3AEUA 1DOZA 3FSRA 3EEYA 1DAEA 1ORWA 4WOPA 2ZB3A 3EZ2A 3FSGD 3CZRA 3I01A 4CEIA 5FADA 1YTUA 3BWCA 4IH4A 4MPPA 1IOWA 3HFJA 2XY4A 2HA0A 1TYCA 2AA3A 2YNMA 4G97A 4PCAA 1JMVA 2AJ8A 2I8CA 1W75A 2CHFA 3F67A 3DE2X 2IPLA 1E9EA 4GU5A 1M34A 4U63A 3G2PA 3S2ZA 2NWQA 1RRPA 3KDSE 3VKWA 2QRQA 2QJFA 4KQ9A 3STTA 1KEVA 3G02A 5CVTA 2YBDA 3GFPA 1YJ5A 4O2LA 2AKYA 4XCQA 1H05A 1OB2A 4IOKA 3UK0A 2WJ3A 4YFVA 4R1QA 1SC1A 1CRLA 1ZQ9A 4XR9A 4G36A 1V11A 5K2OA 3QHPA 3HY3A 4IIJA 3VOTA 2KHZA 5FYQA 4C9BA 2ATEA 2D0IA 4GGOA 4O4JB 3IYLW 3KOWA 4OATA 3T0IA 3IT1A 1ULBA 3ZLTA 5IDXA 2NM0A 3VPGA 1RIIA 4JSTA 2JG3A 3EJWA 2C83A 4EG1A 1YZNA 3FHLA 3ONWA 3AUSA 4FYPA 1LA2A 4KWEA 2BJWA 5LQDA 1V37A 1JHRA 1Z5PA 1D2NA 5JECA 3QY0A 5AHRA 1P1JA 4D8XA 4OQMA 4BQRA 3W5AA 5J1SB 3FYDA 4PYMA 3WLTA 2PUVA 1PV2A 2DPMA 2Z9BA 3AT1A 3EQ7A 4V03A 2VZ9A 4KU4A 3K92A 3LLMA 4BS9A 4IJQA 1CZKA 1VJ0A 2JIBA 4TV8B 3RSZA 2C7PA 1TD1A 2P4QA 3KHTA 1NXSA 2CLHB 4E3WA 2APJA 3UFXA 3FTPA 2VSQA 2HGSA 1Y1RA 2AMFA 4ZWNA 3EXG2 4Q7QA 1FMLA 2J3HA 3UCXA 3M9WA 4FX2A 5J4YA 2DCUA 2P2GA 3DOHA 4HPXB 1JEQB 2QOEA 1QK5A 1TVEA 2CUNA 3GCZA 3UICA 4DXAA 4RADA 4NOLA 2FPRA 2GJ8A 3OE1A 3UHJA 1II0A 1JE0A 1USIA 4FW8A 5KQRA 4COKA 4QBIA 1ZAKA 3C16C 5DLYA 2Y1EA 2REQA 2G70A 1K7YA 1Y5IA 4WK4B 1VMIA 2FMFA 1LDYA 1KXJA 1XYVA 2HWWA 1VE1A 1Z63A 3TGPA 4W5HA 2X42A 5H4HA 4ILEA 5IM4F 1QRTA 3HRKA 1JSXA 1QHIA 2I0FA 2VG8A 4P53A 4ZPJA 5JS8A 1JR6A 1Z4MA 1VYVA 3LM8A 5EPUA 2BE9A 4J2TA 2XMBA 4LOLA 1V7PC 1V8DA 3PTLA 3E0QA 4UM9D 4MKXA 1LK7A 1RRFA 3DTNA 3EGXA 5EEHA 4JFAA 2YJ5A 4H6VA 5FRDA 2GFIA 1YI0A 1R12A 2WFMA 2WSSD 2YN4A 2VP9A 2ZG6A 4IOMA 1UJ6A 4W6ZA 4NXMB 4AAYA 3TECE 5BN4A 2XV1A 3EUEA 5EINA 3EVDA 1NC1A 3VBCA 4RULA 4B45A 4RBNA 1WPXA 5HE8A 3UK2A 1H4SA 1XCJA 3FCSB 1Y3FE 3AFMA 4MWTA 5CMLA 3A14A 1TYAE 4AJ2A 4FKBA 2Z5GA 4BPRA 1Y1SA 2LW7A 2GMWA 3W9YA 4UPEA 5JI2E 1KYVA 1DE0A 3IP8A 1G2OA 5LPNA 1Z2DA 4C43A 3OJWA 4JLAA 3HU1A 4MLCA 2HREA 3BWMA 5B1IA 4S2UA 4ETMA 1SBTA 1X6VA 2ZULA 1J2JA 2HU8A 4N8SA 3WGMA 4DUGA 3KZCA 4MWBA 1TRHA 3FZQA 3REQB 2OVFA 2FPOA 1XAIA 3A0UA 3ID6C 4QBKA 4B2PA 1HF3A 3CM0A 3QSGA 4M83A 2Y0CA 3OOJA 4F7WA 6REQB 4S35A 1A2KC 3AHFA 4NP6A 5EKTA 1JH9A 1A9XA 3DLBA 1FQJA 4BFLA 4A03A 4C6HA 4QYSA 4EDHA 4AQYB 3NATA 3EF3A 3L7YA 3ZJYA 1E1CB 3ZDBA 4ND7A 4LJRA 1Q0ZA 1UFQA 1JFLA 2V6MA 2Z2YA 3A9RA 4R5MA 5GJVC 1MR3F 2JI9A 3EZ9A 5LA6B 3MUFA 3G2KA 2CV1A 3D6TB 1GGNA 3QYAA 4ZT3A 1ZGBA 1B16A 3WRVA 1MAWA 5FYDA 4EBBA 4PFSA 2I9PA 1VTKA 4CT5A 4DSZA 4LQ4A 2EAUA 1TF5A 5U4QA 3AVOA 2HRBA 1F1JA 2O8BB 2P0EA 1YUBA 2YFHA 2QPLA 4JVMA 4U02A 1OFUA 1F0KA 4JUAA 3B2QA 2LIPA 3UBTA 3EGDA 4H4CA 4D43A 4CUJA 1JW9B 1I3KA 1TM4E 2DE0X 4NYMQ 4DC1A 3OCWA 4P5EA 1TPZA 2XNSA 2CT8A 3HPQA 5CH8A 4PRKA 2KPOA 3L7CA 1PWYE 5FBKA 4B75A 4WY5A 2Y9MB 3K9LA 2XVMA 1EM8B 3H9CA 2A86A 1YFLA 1Q1EA 4RZ3A 1VYTA 5MN6A 1MEEA 2B1QA 3RKRA 5I4KA 3F5SA 1EM6A 2RKWA 2G72A 3K8YA 3NJ8A 4G86A 4MRMA 3IOBA 4BQIA 3OPNA 2ZCJA 3N1UA 4MA4A 4ZOCA 1WP4A 2DFKB 3V2IA 2GSDA 4CYMA 1GR0A 5CG1A 3IP5A 1MX3A 1RLIA 5EHZA 5IHXA 5JY1A 2R84A 2H18A 3JQ9C 3O38A 4WADA 2Q46A 5AJZA 3WIBA 5EMJA 2XCSB 2JCYA 4IOJA 4MO9A 4W5RA 1BRMA 3EAGA 2BTOA 1XTZA 1YB1A 5AM5A 3TOVA 2CMFA 1XZJA 3L1JA 4AJKA 3D6HA 3K9GA 2BGIA 3CUWA 5AM0A 5CDYA 4ERXA 3K71B 1TQ6A 1DELA 2WIDA 2P6RA 3WSTA 1AZSC 3KZKA 2ETVA 4TWZA 3BUSA 1GGVA 1L2TA 1C7IA 2TMGA 1KMQA 1KEEB 2RSLA 3UK7A 2VZEA 3C6YA 1WB4A 1ZP6A 4OKSA 3WBKA 2OGWA 1UXKA 2OKCA 3W6ZA 2XMDA 3EGWA 4E5YA 3ZWWA 4B87A 2HDHA 2ZT8A 3EXIB 1YE3A 2DB3A 3FYSA 1YVEI 1F4VA 2X1LA 2QT0A 2HXSA 4PZPA 4NJMA 4XM2A 2ZANA 4Z9XA 5C37A 2FH5B 3R9XB 3OKPA 3HA3A 4ODIA 5F77A 1Z2PX 3KQVA 5AW9A 2CEKA 5KYWB 1GTSA 3ZNQA 5CD1A 3WIDA 3B38A 4JIGA 1W87A 1NV8A 3FMIA 3KAQA 2ID4A 2EKLA 3C4JA 2TMYA 4MWSA 1ZKMA 2W2OA 4YJKA 4DV4B 1TM1E 3E3OA 1C2TA 4OMCA 4QTYA 2PZ8A 4H1TA 3CZ5A 2XHEA 1QKKA 3C3MA 5DGCA 3RUFA 4Q5IA 1D6MA 1E79D 2W42A 3LH5A 3HDVA 1XZCA 4L0DA 1GUDA 2WF5A 4JQCA 2SCUB 3ZE0B 3IX7A 5KC9A 5L3QB 2ZE6A 1Z68A 2OLEA 3AI7A 3VPBA 3ZWCA 5DH9A 4AKTA 1LI5A 2I2BA 3E5HA 2WHPB 4GRDA 4TRJA 3GYGA 3PQ8A 1C9MA 4HS4A 4II7A 4D2IA 2V7PA 5IW8A 1VSBA 5AKIA 4B0OA 4XYEA 1BVYF 3HZRA 3DBLA 2OQVA 2XCUA 1BS1A 1BKDR 4EF4A 3R5FA 4CXMA 3G8DA 2H2FA 1KDOA 2HN9A 3ZDEA 4MYCA 2QPTA 3R74A 1RC1A 3OF2A 1XDSA 3GRCA 4P3OA 1I0LA 1U65A 3I5MA 1OV4A 4FOOA 5KTOA 2REBA 3G9XA 5D7NA 1YS9A 1TMKA 4RK0A 2Q1XA 1V1RA 4DLZA 3AESA 5FUWA 1DP4A 4KC0A 1CHNA 2WV9A 1ZK4A 3E22A 5JXIA 1MW8X 1T3LA 2AMVA 1PFVA 3CONA 3RYTC 1JDNA 2CXXA 4NV0A 4P2GA 1Z35A 3IBYA 3IEUA 3BFVA 3BRSA 4Q37A 4PGAA 1QPBA 3LSYA 2BFFA 2WZCA 5FPTA 4KUGA 1P75A 5FTWA 1JG7A 2ZM6B 4YRJA 4C0QC 5EFZA 3VZBA 1CE8B 2B20A 5CX4A 4D9EA 1P1BA 1AQJA 2P4SA 3R9IA 2D4AA 2K6GA 2QAJA 5BVGA 2OAP1 2FMHA 1SKAA 4B3XA 1XEWY 1AKMA 1WD7A 2XIQA 3G5TA 4RYLA 4D7AA 4DZTA 1NVAA 5KDDA 1E3EA 1JI0A 1Q3TA 3OO1A 1XVUA 3D3EA 4ZZ2A 2FKNA 5KTNA 4AKHA 1TT5A 3WDLA 3COWA 1DAHA 1B14A 1ISGA 5LIPA 2Y1XA 5SZJA 3SYRA 4CEHA 3KR0A 1M1YE 4XI9A 1VMDA 2FSSA 3I37X 5CHYA 1D9ZA 3VH1A 1GITA 1QF7A 1XD8A 3QK7A 4HDNA 4N40A 4PYLA 4R9RA 3U81A 3HWSA 4WCDA 2RAPA 4RM3A 3A6LA 4FX5A 2ZSAA 1PGQA 3MPUA 2VK1A 4P86A 2VAMA 2C9ZA 1V4VA 3HCRA 5AI8A 2C2WA 2WMYA 4Q9DA 2QAGB 2X0KA 2C9OA 1YMUA 2EZUA 3A70A 3WB0A 1K27A 3WL3A 3HYRA 4MV9A 4TWRA 3BMNA 2A9QA 4EMUA 3N7AA 2XQIA 1XU9A 2JK1A 2VT7A 1Z0DA 1D6NA 2PWYA 4RYDA 2J09A 2Z6VA 1OX4B 3CR8A 1JYEA 2QDKA 3EVZA 3JTMA 2YCLA 4CTKA 5AM2A 3BXFA 3AUYA 2J9GA 4C14A 1D4OA 3FPLA 3PHCA 3ZGNA 1SBZA 1RLMA 3CCFA 3IMGA 1K7SN 1ORDA 1X7GA 1R3DA 4WOCA 5B12A 4EEZA 1R15A 3JAWB 5HCUA 5EXDA 4XUDA 4URWR 1KDYA 3SJUA 3VOSA 2BF4A 3PLAE 3T94A 2B3DA 2OFXA 4RSHA 3ENZA 3NHYA 1I51A 1KEPA 2BUBA 3NNSA 1Z07A 1U94A 4QXRA 3K2BA 5EUCA 3GJQA 5H16A 4H3VA 2Q50A 1LX6A 4GM0A 1XVVA 3ABZA 2JHFA 4HQ6A 5JNLA 3HFRA 4BN0A 1CDDA 4REQA 4YX9A 1EP1B 4J0CA 4KPUB 1A4XA 4CL2A 1N2XA 1JVSA 4BKOA 1JEYA 1UK8A 3V42A 5I7OA 3CNBA 4LHSA 4O5OA 4DGSA 1CZNA 1GVHA 1BVHA 2ASEA 5SICE 1CRPA 1I7NA 5U1PA 1IZZA 3TXAA 4R1SA 2WM9B 1OIXA 1YDMA 2FPMA 2OORC 2YW9A 1BXKA 3TRHA 3R6LA 5KNBD 3VSEA 2COKA 1ODCA 1QFXA 4JLMA 1MMFB 5MFZA 2W00A 3UW1A 2WPDA 2O07A 5AFSA 4AMVA 4EVIA 4JXZA 1RWPA 2HGZA 1ATIA 1LZKA 3VTKA 4BB0A 3AC0A 4DXDA 5C35A 1NHGA 4EHAA 5I4CA 1HM5A 3B1YA 5LP6C 3NC0C 1N6PA 1TUIA 4JLPA 3OHPA 4FP9A 3VHRA 3C1UA 2B7LA 3CG0A 4L4ZA 2B61A 2RI1A 4E5UA 3TFOA 2YY6A 2BKLA 3CKKA 3VDRA 3B12A 1GL7A 2QSZA 1U2ZA 1UIRA 3N0WA 3PDJA 4EJ6A 1V3TA 1VKJA 2G5TA 4KQ2A 5J2UF 3ZVKA 4IUYA 4CIAA 1B42A 4OHBA 5DHAA 5ICSA 1LSSA 2PAFA 5AI9A 3EXFB 3P9ZA 4M38A 1L5OA 4MPTA 4ZREA 3VZCA 2RC5A 3SBXA 1AB6A 1RYDA 3BGSA 5LQCA 4GYJA 1QRRA 4O4HF 4Q01A 2OCYC 4W5JA 4BWGA 4CMGA 1E2FA 3GD7A 3HACA 3KJZA 5F1PA 2YWRA 2WD7B 1KYIA 1XAGA 2R4TA 4FDLA 4MULA 3U4MA 4Q1BA 1TJPB 3HE3A 2MYNA 3BZUA 5CW1A 1VSVA 4MUIA 1N0UA 4QA9A 3IEMA 2PKCA 3QKWA 2BZSA 2P9QA 2BV3A 4KSBA 4N6NA 2C7VA 1N6LA 4GBGA 3C5CA 4M89A 1TL7C 3T5MA 2C9CA 1JRLA 3G6WA 4LRSB 1SHKA 2QVXX 3PKIA 3OIVA 1GPDG 3LGXA 5LUBA 3GVXA 3A6PC 2L0XA 4WLFA 5TS2A 1TECE 1R4NB 5DHRA 1MN6A 1NBAA 1X14A 1FDWA 2V3WA 4AUMA 1CJBA 2DTDA 4W5QA 1XTIA 2VHUA 3R0QA 4M9ZA 4UPDA 5ECDA 5LLTA 2QV7A 1Z2AA 1CPYA 5FD8A 1LXCA 4GE0A 3IVRA 1J9EA 1IN8A 2OHFA 2BHTA 4MVWA 3H19A 1Z4LA 3TJMA 3BD9A 3PD7A 1MW9X 3TQHA 3X1XA 1F8XA 3P5BA 4A1FA 2PLFA 4ZP1A 5HKOA 4X1IB 3V8BA 3PJFA 2RIPA 2OAEA 4UU1A 1V3VA 2O59A 1M2FA 4KCGA 3B6JA 2F64A 1EXVA 1CCWA 1T29A 2Y1DA 3VM6A 3V2GA 4L8VA 1VGVA 1DTSA 2C7GA 3LJKA 4Q1CA 1ODJA 4MJXA 1E2NA 4IM7A 4JI1B 4LIPD 3TOXA 3W8NA 2C9MA 4BGIA 5LNK1 1U7ZA 3H9JA 4ID9A 1DFHA 1E9AA 1W2HA 1WCXA 4HN9A 4TMZA 2X2EA 2IBMA 1XVIA 2JFBA 1SPBS 5FTLA 3T9EA 1AV7A 4P0QB 1HDEA 2GJKA 2VNSA 2ZEJA 2HSJA 4KXYA 2NXJA 2I4IA 2DY0A 1DSSG 2IXFA 3KCQA 4YXWD 4HOYA 1XZBA 4OXXA 2HNKA 3X1ZA 4GPEA 2DU8A 1BA2A 1CY0A 2XX3A 2FPXA 1Y3DE 1JPUA 1FXWF 2PV0A 5FA8A 2QM3A 1G4UR 4FEYA 5HZHA 1PVVA 5E8JA 1Y9AA 3S8MA 3GI1A 3I0NA 2KX7A 2MYTA 3KOXA 1B6GA 1N7GA 1CR4A 1PWHA 2Z08A 4QTTB 3UWSA 4BMCA 3SC3A 5BSTA 3RU3A 3CPEA 3TX6A 4DY4A 1DEAA 3A1UA 3TIIA 4M7PA 5BWOA 4E14A 2EQ5A 4IDPA 1SC9A 3CR3C 1EFDN 1RP1A 1Y8QA 1KPGA 4GI1A 4YPFA 4MYRA 4D9IA 1FJ2A 3IAHA 3NHUA 2XGGA 3CBGA 1D8AA 4UVHA 4YP5A 4NL4H 3CH7A 1OX6A 2ZUUA 5GOTA 5IDQA 1UC5B 1PG0A 1EXWA 1VHWA 2JDID 4PG5A 3ABIA 4PFKA 2XCRB 4N6OA 5A6SA 1ORHA 2PA3A 2J4CA 4HDMA 3WGIA 5B7QA 2AN5A 2AOUA 2EW1A 1PQWA 1XRPA 5KQGA 2PQMA 3IMEA 2O8CB 3A9VA 3ITDA 3LP5A 3W8RA 3V7FA 1XWWA 1YJAA 3O9VA 1SA0B 2EF1A 3FPSA 1NBEA 1QHSA 2IF2A 1JX6A 3CTPA 2YS7A 5CU7A 3RHZA 5JJBA 1QIKA 4JGBA 4W5NA 2VZLA 3FF1A 1ADYA 4IV8A 3TZKA 1BOOA 1T8TA 3MUEA 5JS2A 5F9FA 2WOOA 4UBLA 4FLFA 4XD7A 3QEMB 5EJFA 5CFZA 2AVNA 4KIFA 5DWQA 3L4BC 4LX0A 2ZYWX 5AIAA 4IIJF 3IAUA 2JJ1A 2P78A 1IQUA 3EGCA 3PIDA 4ZI5A 1T25A 3UMRA 3C7KA 1W44A 2Z2ZA 2YFYA 2REOA 2C96A 4FZVA 8GPBA 2FZ4A 2OXFA 5FI5A 1GTJ1 2JH9A 1NYQA 1WP9A 4XYGA 3ZCUA 4F85A 1ZHOA 1KYZA 1E92A 2E49A 3SR3A 1Y3IA 2EW2A 5K3FB 3M6UA 2A78A 2UKDA 3PQ6A 3TZHA 3LUPA 3UNXA 1QX3A 4NG4A 4QQ8A 5FIUA 2CJFA 3QF4B 5FPKA 2X14A 3QX3A 5ALQA 2P90A 5CB6A 1EE9A 3GLSA 2CF5A 1ZMRA 4G5HA 4P81A 3HGQA 4Q1AA 3VNAA 1R00A 1WSAA 4CMHA 3LX8A 1LWNA 3PVSA 5CEEA 4E7OA 1KYTA 4PS0A 1SIBE 3DKKA 2YW2A 5AVTA 4PTYA 1X8KA 1Z6XA 2EFDB 3L5KA 2N3ZA 1V5EA 4JB0A 4G1MB 1XZAA 2JAOA 4IV5A 5TPZD 1K06A 2FW8A 2QSJA 4JR1A 4U7TB 1XXHB 1WV0A 4OHRA 3ORYA 5D01A 3RPEA 5BNFA 4BKPA 4JB8A 4D26A 4TZ0A 2GLUA 3P2EA 3RRJA 1JA1A 2GK4A 3M1AA 3PICA 3W5SA 3C8DA 1PZXA 4DLYA 4ZYYA 4RTJA 1UAAA 4X71A 1Q2UA 3IE2A 2X8JB 4CCSA 4Z7NB 3L6OO 5JRJA 3AEKA 2IEAA 4QPDA 3VR6H 2GAAA 1MA0A 1MXHA 2ODTX 3SF0A 2GH1A 3P26A 2G7MC 2A8YA 4GX0A 5JAUA 4XWKA 3O8OA 4YT5A 4JL5A 2R48A 1QAOA 4EBFA 3IUQA 1M2JA 1I7DA 3RADC 3ET5A 1T91A 2JLWA 4BZZA 5AKEA 4WA7A 1CY6A 3HBMA 1JALA 1D7OA 4FDVA 5DULA 1AKYA 1FRVA 3TB6A 2G07A 5AI6A 1RBYA 1ZJZA 2A9RA 4JBNA 5J2UB 5AKHA 3KZXA 2Z5LA 4ZAWA 2JLBA 3A31A 1X92A 2FN3A 2FPUA 3DJYA 2P68A 2H5EA 4RK6A 2J67A 1PZMA 2QVBA 5ALKA 4XWOA 1RFGE 1NONA 2GHTA 3BMCA 5EQJB 5C1PA 4G4JA 3ND5A 3DQPA 2CVOA 1N4DA 1P2SA 4O4HB 2X2FA 1WZEA 3PGKA 5FQNA 4AY4A 2D7DA 4N41A 2C2ZA 2E48A 1KEWA 3A1WA 3OLZA 3U0BA 2O3QA 3G17A 4MW0A 4AK9A 4DJEC 1RPAA 1J9ZA 5BUSA 1MJFA 3IUPA 4W1RA 2ISCA 4Y2SA 3MTEA 1P5RA 3UKDA 3WGQA 4UTOA 3UJ6A 2EKPA 3LU1A 2C42A 3UT0A 1QGZA 1XYYA 2QR3A 3GLGA 3SZLA 4TWJA 1D5WA 3WHIA 3F90A 1GZHB 4K9LA 2C5LA 4QU8A 2ZSEA 3K70C 1ID1A 2CXHA 4PAQA 4R7TA 2IPXA 3GFGA 3B2EA 2CLEB 3ME5A 4WOBA 1JVNA 1XEWX 4E13A 4F72A 3K30A 4BPBA 3G5AA 1EFLA 3CW2A 4GKVA 3GB9A 2WZQA 2H07A 3NU1A 1CEQA 1E2GA 3H6HA 1LJLA 2ZRCA 3R0IA 3RI3A 1IXSB 1YDHA 1XRMA 3IP1A 5DZSA 5K0ZA 2NOAA 3GUYA 4JKOA 4WW0A 4M0LA 3DW1X 1JU9A 5FDFA 1Y7PA 2YBEA 3ANNA 3GRRA 4OUDB 1V1MB 4WBXC 4IS3A 1UPXA 2G0NA 3NXSA 1VMAA 1MTOA 1X9HA 2OB1A 2QTAA 4MDFA 4V39A 3RSLA 1EGMB 4F71A 3RBZA 1NQAO 4GOJA 1M2VA 4G67A 1EK2A 1H9AA 4W5WA 2RD2A 3VVLA 2XZLA 3ZV7A 2HPHA 4ZD6A 2XB2A 4MMZB 2WK1A 3CPJB 1L6RA 2VT2A 4NXNB 3QFHA 1AUVA 3JQAA 2E4AA 5FLYA 5HA5A 1FMJA 4CGYA 3Q4GA 2PUDA 1MVOA 6ABPA 2ORVA 2VXYA 4IGEA 4IR7A 1XZGA 3FCEA 3IAS6 3N9IA 3PPWA 4ZXPA 2WU1A 3NYWA 3V33A 2O7QA 4WXHA 1U0OC 2PH7A 1HT0A 3A06A 1FS6A 3O6VA 4NCXA 4ALKA 4EG4A 2P1RA 3I2HA 2R6R1 4ED9A 2HLHA 4LV6A 5A5VA 3DKPA 3GPDG 3DCNA 3OQNA 5C46F 3K5HA 4OJYA 3S29A 2DQSA 4OGFA 3IMCA 5LJLA 5L9AA 1RCFA 1P1RA 3EUFA 3C24A 2P9GA 3HJRA 2EJVA 2QLFA 5T6BA 1SCQA 2JI6A 4LE2A 4TM7A 3FNEA 2YZ2A 1ISMA 1A9ZA 1E9RA 3KEFA 4NS4A 4NV3A 4S0ZA 4YPVA 3FF4A 4JP3A 2QTFA 4UU7A 3S28A 1VLHA 4B6PA 4JBYA 2I6SA 3CNHA 1ZD9A 2G76A 5DOZA 3OZCA 4MVXA 1M3SA 2FR8A 1ZRNA 4OK3A 1WMDA 1XZKA 3AEUB 5JMWA 5H8WA 2OSBA 1EVYA 1UDWA 2R44A 1DKUA 1HYHA 3IUEA 4Q05A 3VJKA 2DP4E 3KKQA 3QELA 3TUZC 5FWDA 3PX7A 4YCAA 2BFNA 4CEIB 2O8FB 3JWEA 4QBGB 4RAOA 1UKVY 4L78A 5ALJA 4RDXA 4HQNA 4ICIA 2W6CX 1J8MF 3I58A 3NBAA 4Q3KA 1VMEA 3BHMA 4IDFA 3LQRA 1M34B 2ZWOA 4CQJA 2B34A 1WY7A 3WMEA 2Y9PB 4YAJA 1NKVA 3BC1A 3DXXA 1SKMA 3VISA 2IYVA 2HJ9A 3Q11A 1EXDA 5FI1B 3RYCA 5ED0A 3IOMA 4WEOA 5F4ZA 5MGBA 1VIDA 1JI3A 1EFPB 2ONKA 2W7TA 3RT1A 4MAFA 1HH4A 3U7RA 3R7WA 1YS4A 1N7JA 4PYJA 5K2MA 1JAZA 1V11B 2YJZA 3FWNA 4AC9A 1JECA 4FFSA 3WRYA 4IIJB 3B7WA 2BFDB 1RKQA 1L8XA 5ICFA 4UVEA 1O94C 3C3PA 4U3JB 4MA5A 5BQ3A 2MMCA 1DB3A 4MV4A 4QGBA 3UV7A 3DB2A 1DRUA 2H29A 4ALNA 4FC6A 3F2VA 1DGQA 3L0YA 3TW0A 3QM1A 5DF1A 2YWEA 4L51A 2O2EA 4LYDA 4QKQA 1QFMA 2R1ZA 1FRZA 3R3HA 4XYLA 3A04A 1I1HA 2R8EA 3PDIB 2OE2A 1UADA 4RMIA 3QVKA 2OHVA 2JGDA 3C3KA 3EVAA 2I33A 3WGNA 5ITWA 1LDBA 3VPHA 1NDHA 1QANA 2J5BA 2PYZA 3QP9A 1U7XA 2GCOA 3I04M 4QHSA 4D9JA 3STHA 3SZRA 3THXB 5LDHA 1M1ZA 1IQ0A 2JAHA 2BZ0A 4ERNA 3I9V1 4YJHB 4MVJH 1FXSA 1T6XA 4NU8X 1JEDA 3UFXB 3VSCA 1OWOA 2WG1A 3DW3X 1U1CA 3VZQA 3NTQA 2W6ZA 5L7WA 3GX1A 4G8JA 2EHJA 3MLBA 2QE6A 4RWEA 3ZGLA 4WNAA 3ZHQA 5IXSA 4JVOA 1UQRA 3DTYA 2J3KA 2RHDA 3G0CA 2Q1YA 3A11A 1NSYA 1PWZA 1GUAA 3FI0A 3A3KA 1EX6A 2REQB 1CEEA 1GQSA 2AN4A 2JFWA 2QRGA 3ZV3A 3VC2A 5AUOB 3KQNA 1G8GA 1TC2A 2WV7A 5ELXA 1FMTA 2ID8A 2HMWA 1M1NA 2PKRA 2WF9A 1ENOA 1WWKA 5IJ9A 4P2BA 4BKQA 3B1JA 1EFUA 1NA5A 3B5IA 3BRQA 1U7OA 3U2QA 5JZOA 4L7VA 2OCXA 3PHLA 5KPJA 4GPTA 1NJGA 3DD5A 3RRNA 2PKXA 4DNQA 5EIAA 1W73A 3W5BA 3IRVA 2GVZC 1FYDA 4JJGA 2R8BA 1E8DA 3MXOA 4D9MA 1NP7A 1BROA 2GKGA 3PNKA 2PU5A 3T5TA 1PFKA 4BFYA 5DM70 3MBKA 3QQ5A 5NLLA 3SJCA 1BW9A 2AMYA 3GEHA 4EGFA 3OZSA 1IRXA 4TN5A 5IABA 5KTPA 3VKGA 1ACMA 5EE5B 1U1DA 1YAJA 1SOMA 1TK9A 2QQGA 3NP7A 4RABA 1CYEA 5AVWA 1ZNXA 5GZ1A 3ESQA 3SKXA 4DBVO 2C4TA 1E2LA 1U99A 2PY6A 3AG5A 3SLRA 2OXIA 1OQAA 4QDJA 1QMGA 2BM8A 3H5VA 3DAOA 5IF3A 1P2DA 4OP1A 2GR9A 2LVBA 2JLVA 1PDWA 4Q02A 3TE7A 4ZMRA 3F74A 4I5FA 5KSWB 2ZUVA 2A9FA 4D9BA 2NXEA 3CLKA 3HNRA 1PFWA 2D0OB 2FPGA 2I76A 2NO4A 3IKLA 4DMGA 4EAAA 1GL6A 2QRZA 5KNLA 3UYKA 2FF5A 2DETA 4W4TA 2WSIA 2Y2UA 1A9XB 1O8BA 2TECE 4OAQA 1OKKA 1Y37A 2J9RA 3AWIA 1QGOA 3ELUA 3JQRA 1LFDB 4GZ5A 4IVQA 4J2OA 3VU0A 2VAWA 4Z9FA 2QRVB 2WQ7A 1QP8A 1SQ6A 1KKUA 2RCYA 3ONEA 3WNCA 4IDNA 2CJPA 4PINA 1U5BA 3HNOA 8ADHA 1JEAA 2DHCA 3G5UA 5E95A 3UWOA 5AOAA 2X40A 3KR2A 2WUFA 3MWDB 2ON6A 2A58A 1G17A 5BUCA 4PC3A 3HJFA 1AVTA 1PCXA 4V02A 4ZXFA 1U6IA 3EGDB 1ZJYA 1I5RA 3DHWC 3G89A 3GEMA 5AVXA 1P0PA 2YINC 3AB3A 3G8YA 3U4AA 1NBMD 1F20A 1U7HA 1OZAA 5TQ2A 3CLRC 3GAAA 5GADl 2BAGA 3PS9A 4HNRA 1IXYA 2IKSA 3KL4A 5FPHA 4QOGA 1AKNA 3ESXA 2D5BA 1J0DA 3TLYA 2GF2A 3ENWA 1QX4A 3AP3A 1BWQA 5KQMA 4A8JC 1WD5A 4ZQCB 4O2BA 3ZZNA 3L4SO 2WJGA 2Q2NA 1G21A 2HPVA 4JQZA 1IJBA 1NASA 4JLWA 4X8OA 1E7MA 4Z9AA 2QY6A 3KPUA 3V48A 4CM1A 3MSXA 4L1KA 2VLIA 1S89A 1NLZA 2VK8A 3MXTA 3I9OA 4L28A 4PZCA 3UMBA 5K20A 2FU5C 1G3UA 4G8CA 4TPKA 4QT0A 3TTUA 5J5CA 4LHVA 5DTIA 3KTAB 1VDZA 2AWOA 1MQSA 4FYWA 4L0MA 3ZE1B 4N0DA 2Q9BA 2ACKA 2RMKA 3ZXUB 4AS1A 3RJ5A 4GBMA 4G8BA 1A95A 1DADA 4QU9A 4QNNA 5B1DA 3DE1X 3N76A 3WWPA 4DREA 2ZUWA 1SB8A 5CNIA 3NRBA 1O4VA 3PJDA 3F78A 4BNHA 2N1MA 3B78A 4WJZA 4BO2A 4PQGA 4RKQA 1ZGAA 2D3TA 1XSEA 2OQIA 4FGSA 4EA6A 1KSFX 1WTCA 4PSKA 3HBAA 3GL9A 4LK2A 3MB5A 3VR5H 3FPHA 4GBED 4N03A 3WLAA 3ZQJA 3KYCB 3A36A 2GQ0A 3RAEC 2HBZA 4Q03A 3CVUA 2RB5A 5LQKA 3GWGA 4NJMB 2W2KB 4X7PA 5B2FA 4IIFA 4MPDA 4ZVOA 2ZAGA 3FTQA 2FVYA 2H2WA 2CVZA 3H4MA 3QUSA 4QDOA 1BCRA 1RMTA 4RHXA 4H0CA 1XCPA 4QFDA 1DDIA 1FTQA 1C7FA 4K9PA 4EKEA 4MV8A 2G77B 3MGCA 5CM2Z 5F73A 1YOVA 2VTBB 3P9SA 1R74A 4K6CA 2ZIWB 4TMKA 1YRYE 3LC0A 3NEYA 4AG6A 3ZJUA 2ZYRA 5BOSA 1MORA 4DJDC 2WJWA 3BERA 3GRUA 1I24A 3VUEA 4Q9AA 3LIPA 2DRIA 1QVRA 1ZL0A 5LOVF 3EEIA 1VBNA 2VF7A 3ULKA 2ZTHA 4JKYA 1VGRA 3TNFA 5IT9A 3SS9X 4URUR 1YKGA 1QQ7A 2I62A 3D6VA 2BEUA 2PL3A 4BBAA 2C9BA 1Q0LA 1V43A 2WE8A 3ORHA 3ZGZA 5CP8A 1PJAA 5PGMA 4L7QA 3DE5X 5AHOA 1IN6A 2IQ5A 4N7BA 1JU3A 2YVKA 5AUNB 1SXJE 2QTRA 2R68A 3TD6A 1EEXB 1F0PA 4YYEA 1O5IA 3DBLB 2PYIA 5DNDA 1L1QA 4HC4A 3QLUC 2VHEA 1F51E 5CBPA 1XO1A 4MYSA 4YV7A 4R3UC 1WXFA 5A3SA 3E84A 4JLJA 3PPIA 4KUEA 3DE7X 2R00C 2O8CA 1IMOA 4Q4JA 1XA0A 4WLVA 4DIMA 5EVJA 2WU0A 1V1RB 3OMLA 4ZOAA 1J49A 2YZNA 3KKMA 1TYZA 3OT5A 2XUOA 3A9CA 4MI9A 4BIMA 4QBFA