1I14A

Analysis of an invariant aspartic acid in hprts-glutamic acid mutant
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
187
structure length
187
Chain Sequence
YEFAEKILFTEEEIRTRIKEVAKRIADDYKGKGLRPYVNPLVLISVLKGSFMFTADLCRALCDFNVPVRMEFICVSSYGEGLTSSGQVRMLLDTRHSIEGHHVLIVEDIVETALTLNYLYHMYFTRRPASLKTVVLLDKREGRRVPFSADYVVANIPNAFVIGYGLDYDDTYRELRDIVVLRPEVYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The role for an invariant aspartic acid in hypoxanthine phosphoribosyltransferases is examined using saturation mutagenesis, functional analysis, and X-ray crystallography.
pubmed doi rcsb
source organism Trypanosoma cruzi
molecule tags Transferase
molecule keywords HYPOXANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE
total genus 56
structure length 187
sequence length 187
chains with identical sequence B
ec nomenclature ec 2.4.2.8: Hypoxanthine phosphoribosyltransferase.
pdb deposition date 2001-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1i14A00
4RHTA 1XZ8A 1O57A 1I14A 1QCDA 3LRTA 1OROA 2PRYA 1I0LA 1U9ZA 4M0UA 4TWBA 2FXVA 4M0PA 4ZFNA 1DQPA 1BD3A 1I5EA 1XTVA 1O5OA 3HVUA 4OHCA 4WMLA 4RQAA 3ACBA 4P80A 1ECCA 1VCHA 5K51A 2PRZA 4LZAA 2H07A 1FSGA 1NONA 1UPFA 2HCRA 5IPFA 4JITA 1P19A 4X45A 1OREA 3M3HA 1ZN7A 1STOA 1JLSA 5BQOA 2DY0A 3DEZA 1GRVA 1GPH1 1ECBA 3O7MA 5HIAA 1VDMA 3OZFA 4FYMA 4KN6A 4P3KA 1A4XA 1NULA 1MZVA 1WD5A 1P4AA 1TC2A 1P18A 1BD4A 4IJQA 1L1QA 3LPNA 3ACCA 4WN3A 3S5JA 1L1RA 1A97A 5JV5A 2YZKA 3DAHA 1J7JA 1DQNA 1G9SA 1UPUA 3N2LA 1BZYA 1AO0A 3OZGA 1U9YA 4RAQA 2P1ZA 1R3UA 4LZNA 1DKRA 4LZOA 2E55A 4P86A 4Z1OA 5JSQA 1QB7A 1DKUA 1ECJA 1Z7GA 5ESWA 1G9TA 4RV4A 4P81A 1VSTA 4LYGA 4RHUA 5BRNA 5BSKA 1QB8A 5BQPA 1QK5A 4QYIA 5E38A 1QK4A 1YFZA 4RABA 1UFRA 1V9SA 4JLSA 3GGJA 1IBSA 1G2PA 4RHYA 1D6NA 5HKLA 1PZMA 1ECGA 3KB8A 1OPRA 4RADA 2GEBA 1ECFA 5IAOA 1XZNA 1P17A 1XTTA 3DMPA 1TC1A 3GGCA 4LYYA 2H08A 2XBUA 5KAMA 3G6WA 4RQBA 3GEPA 3EFHA 4RHXA 4P82A 1QK3A 4MB6A 2JKYA 3MJDA 3H83A 1I0IA 2PS1A 1LH0A 2C4KA 4RACA 3MBIA 4RAOA 2JI4A 3OHPA 1G2QA 4P83A 1Y0BA 5KAPA 1A98A 3QW4B 1HGXA 4PAWA 1XTUA 3ACDA 4RANA 4M0KA 4S2UA 1JLRA 2JKZA 2JBHA 5ESXA 4PFQA 1ZN8A 1A3CA 2VFAA 4X44A 1HMPA 2WNSA 5EUCA 4QYIB 4QRIA 2H06A 4F8EA 3NAGA 1A95A 2AEEA 2EHJA 4P84A 1I13A 1W30A 1DBRA 1QCCA 2IGBA 1A96A 1CJBA 1ZN9A
chains in the Genus database with same CATH superfamily
4HFRA 2GYUA 3OE4A 1V48A 2JAWA 3EGEA 4DCPA 3RJ5A 2CFTA 2NSYA 3TNFA 1OROA 2QTVB 3C97A 2B4KA 3AY3A 2QEQA 1EXWA 2V5VA 2ZCVA 3KB1A 1Y1TA 4DMLA 3GAFA 1LDNA 3LOUA 3WRXC 4OI4A 2VTBB 3IQFA 1N4AA 1XCPA 5C46F 5HOQA 4R8RA 2EDAA 2C3UA 4HEA6 1B0AA 2GB4A 3KALA 3ST7A 4ISBA 1UT8A 1FSGA 4I14A 1M1ZA 1EP9A 3EY9A 5DNUA 4XLZA 4N6GA 1QPBA 1TO6A 1XUOA 2VP9A 4H0CA 4BZZA 1XNGA 4B73A 1C0EA 2OV2A 1Y4DE 1TZKA 1E79D 3ZY6A 3H17A 4FOOA 2EP8A 3Q6NA 1BCRB 4QUDA 3VPCA 3TUIC 4MROA 1QVWA 4JENA 1C3EA 3L18A 4CFYA 5FPHA 4F45A 5E0KB 3ZHOA 2YS6A 3GAZA 4LC0A 2EWMA 2AOUB 1JDVA 3JRNA 3PFGA 3AVYA 3DW3X 4EVIA 4D80A 4HHEA 1L5YA 4HVCA 5CNIA 1USVA 2VLBA 4Q1CA 4WN3A 4B09A 3OPVA 1VKJA 1C29B 4P7KA 4B4OA 3M1LA 1TU3A 4ARIA 2EKDA 1JKMA 1N2JA 2HLNA 3ILYA 1FLAA 2JGKA 3H5AA 3RRBA 4OL9A 1U0OC 1DZ3A 4IXWA 2VT6A 2P1ZA 1DG1G 1KPIA 2D5IA 2O2DA 4LZNA 4E31A 3B6EA 5JY1A 4JI7B 3OU6A 4BLVA 5JAMA 1ICIA 3UWDA 1F8FA 1UBKS 1MH9A 2R65A 5ICEA 4BZQA 1O3YA 3RIXA 5EIBC 2PQMA 3BFXA 3M82A 2H0QA 3DAFA 4XIGS 3GP3A 4HL6A 4J9VA 2CFCA 2WM3A 3I5YA 1Y5RA 3NH9A 2X7XA 3V80A 2E4VA 3L0OA 1FVOA 3MLEA 1BHQ1 1S01A 2RGBA 3C39A 4L95C 3EOBI 3FW1A 5DSZA 3UV3A 2YFQA 3CLKA 1O6GA 4NBWA 4OLBA 1KIMA 1FL9A 3CN7A 3DE3X 5FRDA 5FTJA 2WA1A 4PHHA 2FW9A 3IT0A 4G86A 3ZC3A 1G5HA 1G6OA 2WYUA 3I2FA 5JPIA 4NZNA 4PZCA 2XB9A 4FI3F 5KOJA 4JBGA 2JKYA 4KO2S 4MITA 4WK6A 4LPKA 3U9TA 5K2MA 4D9CA 5F9FA 3KX2A 2Y4OA 2Q4EA 3NV7A 1Q6ZA 4REMA 2BOVA 2FDXA 3ROKA 2PV7A 3RBAA 3SQLA 4J4BA 1QYVA 3DCNA 4HYQA 3E27A 1M2NA 3N2GB 5D3ZA 4A5SA 3MOGA 5H4HA 3VZRA 4WA8A 1CRWG 4O4IA 1UJ6A 5TQJA 3STXA 3VVMA 3N6RA 1NY6A 1FJXA 2XQGA 3GJ6A 1DP4A 2HHJA 1OZ0A 3AM3A 4NH4A 2H06A 4WZBA 2NSJA 4GUAA 5CT8A 2PMEA 4CF3A 4RTKA 1Q6YA 2Z09A 5DW0A 3GP5A 4IFIA 3D5EA 5A3JA 3W5BA 3ZQKA 4FW9A 3K9NA 4YRPA 2ACEA 3VR6H 4HAVA 3GEMA 5HE9A 2GI4A 3NG1A 3DL0A 2YOFA 1EBBA 4ND2A 4Z86A 4ZVUA 3N8KA 1RC0A 1AB6A 1K5DA 2QGNA 3EEOA 4QJIA 1LVUA 3NW9A 1LTHR 1YZLA 5HQTA 3PDIB 2R00C 2HQSA 1PG5A 4HJXA 5D6OA 3RU9A 3VH3A 3S68A 1FDVA 3AWIA 5B6IA 5GZ6A 4EZEA 1DXHA 1I1NA 1JR6A 4JKYA 1T5HX 4C06A 4JC5A 1SU7A 1BEUB 3LTNC 1XZPA 1M0WA 2VATA 3IOEA 3O84A 5EWMB 4B76A 5F3RA 4I66A 1X1TA 2G9NA 3ZGZA 1LS1A 3P52A 4KPFC 1HOXA 4X95A 5H83A 1GSHA 3DF9A 4X1IA 1L8XA 1QFMA 2ZBPA 3KL2A 3C3XA 4RKRA 3R9KA 5A02A 4JLUA 5ENDA 1R5JA 3WO1A 1Q0LA 4X6XA 3VHLB 1FRNA 4WA7A 3UMGA 3KVVA 1P62B 3O38A 4K05A 3D6MA 4MVJD 1PX0A 4QUHA 3WXMA 4DHEA 1G3UA 2GRJA 4ETIA 2WIKA 1EIZA 3MUFA 2BHSA 3P9YA 5JLAA 1EWRA 3BN3A 4ARAA 1A97A 1OBHA 2JAHA 4C5CA 4J0JA 1N5RA 3R0VA 1MTZA 1UANA 4N0DA 5HSGA 2FPOA 2FZLA 3ON5A 4GZ3A 4A8JC 1U9YA 3TL2A 4YAFA 3S8MA 3I8OA 3WGHA 3MWLA 5A3QA 1B73A 4TQAA 2RD2A 1H1TA 2PZLA 3OP1A 5AW9A 1M8FA 4DXHA 3C1UA 3C3EA 3L0SA 2RGDA 4YRCA 2HPHA 5L3SB 1DAKA 2OQ2A 3A9RA 4BECA 2CMGA 3P7MA 5SY4A 4FFPA 4TL7A 3VNVA 3D8BA 3SE0A 1IWBB 3NP9A 4LF8B 4MTLA 3U17A 5ADWA 4G8DA 3GVPA 3G17A 2WPDA 2ADMA 4Y2VA 3DZIA 1E1DA 1XBTA 2WRZA 4EUHA 4Y2SA 1E69A 2BCEA 1RYDA 2X13A 2YRWA 1ZINA 1J8FA 5AKJA 4HRYA 5EWLB 3SD7A 5LN1A 3DOFA 3QKWA 3VR6A 1JTFA 1ZONA 2W2OA 1QIIA 4RVNA 1PV4A 2LZ0A 1NIJA 4P4NA 4QZVA 4MHSA 3I0MA 3NFYA 5ERYA 2ZYTX 4BQOA 1ULAA 1WUYA 1DIAA 2BTOA 2IU6A 1IXRC 4MVJI 1AKUA 4BWFB 4X65B 3W77A 1JKIA 4ZAFA 1G19A 3BMOB 4GICA 2CWWA 3N8GA 4TX1A 4UM8B 3WQSB 3HKCA 5A6VA 3ASYA 3FCAA 4FZRA 4M89A 4O5AA 3W6PA 5K4HA 2DWUA 3ZLJA 1FMFA 3TRJA 1YDMA 4WE3A 1EDBA 1RS0A 1SVMA 1PK9A 2DLNA 2W6CX 1JNXX 2QTNA 4BFUA 4GI5A 5B3KA 3ZBQA 1FFCA 1EGAA 2V6MA 4YUXA 4EG4A 4II3A 4M0KA 3Q1LA 5DULA 1ACMA 2G6BA 1N5OX 1EFCA 2B34A 4L7QA 1ZN8A 2C1XA 3M4YA 4YAWA 3QLVC 3W78A 1P72A 1KI1A 4EHBA 4TXLA 1ZICA 2Q8NA 1VJ1A 3P0EA 3G0BA 3K15A 1QDUA 1NJFA 3DEAA 1EFPA 4Y6RA 3D4LA 4A5OA 5JYCA 2CE2X 1NSTA 1Z5ZA 4ZVTA 1V9LA 3NATA 1D2MA 2Y0CA 3MCWA 1NFQA 1KMHB 1KVUA 1P74A 2NVWA 3UMCA 4CKWA 1J1UA 2HPAA 4E5UA 3CH4B 1ZCBA 3B5IA 4RD3A 1N3LA 3SOPA 1IK4A 4IXTA 4EW6A 3SG0A 4ZO4A 1XF1A 2P6PA 3T3HA 3WRYA 3WMRA 1RW4A 3LHSA 4TXJA 5LNK6 1G21E 4LCBA 1IRXA 2Y1CA 1PGQA 2OOKA 3AFMA 3KNZA 2CVOA 2POQX 2X8LA 4ZDWA 4QUKA 5SYNA 3B9RA 1P1KA 3NBKA 2HMUA 1FS5A 1Z6YA 2H1CA 4MW6A 4C2TA 4MUYA 1I2AA 2K7ZA 1YHNA 3HRHA 4GMFA 3WGGA 4D9EA 3A25A 1QRRA 4DTIA 1AQUA 1H65A 3HB4X 1P1FA 4W5RA 1Z2DA 4X3PA 4B8ZA 1H0HA 2FWIA 3OVMA 1FYVA 4LJ4A 3VSBA 5K0JA 3CMCO 3BMOA 4JK3A 4DRXB 3JALA 1W0JD 3KYDA 1YRWA 2OXEA 3C3BA 4TOIA 5FBZA 3A9CA 1JB9A 4MKGA 2B2CA 3RTEA 4G9GA 4F1WA 5LU8A 1I94B 1QU3A 1W581 4KGVA 1K6IA 1B26A 2QVGA 4N3GA 2QRHA 4WBXC 4Z53A 1V7CA 3HUEA 4IG4A 1CDDA 1P1BA 4PGMA 2YY5A 1VZ2A 4RD0A 5TT0A 4DADA 3LWBA 4MWDA 3L8CA 1KI8A 1U28C 3PPYA 2NV6A 3T4PA 4CUZA 4D42A 3A9UA 5CDSA 3IXMA 2QBYA 3VNQA 1F2VA 2X2PA 2VZ9A 3DZKA 5K99A 2O4UX 3VR2A 3CUEF 4CU5A 4X61A 3P26A 1JFLA 4YO7A 4G4IA 5BSKA 2CFSA 3L7BA 5LYJB 4QYIA 3H9QA 1YFZA 4KEAA 2CT8A 3U4MA 2XNDD 1H6CA 3LIPA 3PZRA 3WZ2A 3CX6A 1BXZA 1Q16A 2FX5A 5CURA 2CVZA 3TQCA 4LXTA 2ID7A 1TFUA 1NJSA 4O2AA 4QXOA 2I54A 5F4BA 4F9TA 1QIMA 2ZS8A 4ZTZB 2FZKA 2VK1A 3EXG1 3LVFO 4RK7A 4RJIA 3LPAA 5JJKA 3IEPA 4Y6SA 2RHDA 1VG0B 2GBCA 1EFTA 3PUHA 3THWB 3SKVA 4O08A 3A4VA 1LC0A 4DNXA 1F38A 2IZ6A 4BL5A 1DWOA 3G0IA 1GAWA 2GZSA 1P6QA 2J3KA 3JR7A 2Q6VA 4D92A 4H1UA 3ETEA 3BM5A 1IRIA 2FGJA 3FKJA 5DLQC 5HWSA 2PGOA 1GRQA 2XMZA 4KWHA 3IBFA 5EIHA 4J0DA 4YRTA 4Y9UA 4EMBA 2HH9A 1Z5VA 2AQIA 3AUUA 4QEKA 1DHTA 5TQ2A 1Q1ZA 3W9BA 5DYGA 4BY9E 4WOBA 2D4AA 1HA3A 3UW1A 1D07A 1P61B 5IKOA 2WYOA 1GNQA 3L8GA 4DUGD 4RKWA 7ADHA 5EHNA 3IQWA 3UA4A 1JEDA 4YIHA 5H68A 2AXNA 1PYGA 3TDNA 3DR5A 4ILKA 1H5UA 2EZ9A 1BDMA 4AP9A 2P2CA 3L07A 3UT6A 1P0QA 4IJWA 3ROTA 3USCS 4GEKA 3EUAA 3IQGX 1BHO1 1LLFA 5ER9A 4ENSA 5IVPA 3LA6A 1SUWA 3G5AA 3R3HA 1CJBA 5FUVA 4NBLA 2UXDB 1K9VF 1TJPB 3NHZA 3EQ2A 1TF5A 3EFEA 3Q11A 2M32A 2VUSA 4RGYA 1G5RA 2QTBA 3EF1A 4K86A 1N32B 2I2FA 4IDNA 5F2EA 3N6XA 1VJDA 5BMVA 5JSZA 5JVDF 4CFZA 3CLSD 3SF0A 1AMNA 3PX2A 4GMKA 3RUDA 4OEHA 4OUDB 2EVWX 3KTAB 4N5IX 1LA2A 3DQZA 4X5OA 3ACBA 3T3MB 5JMTA 1KI2A 1WUHS 4BRUA 1K2WA 4F1JA 2Q7XA 3MJ4A 1EUDA 3Q7QA 1E2HA 2ZDGA 2BP7A 5IX8A 3WLHA 3IEXA 3KFLA 1MX3A 3ANYB 3PIRA 3QGMA 3MBKA 4XUGB 1ZNXA 1AHIA 2B92A 1AUQA 3OMLA 1NVUQ 4RVOA 2IH2A 5EZYA 4WPGA 3HK2A 4HLUC 1T6ZA 4B6GA 5AJTA 4K46A 3ZXSA 1TCCA 3SEZA 4TPKA 5HKKA 2V7GA 1P4AA 1QNLA 1SK8A 4JAVC 2H9AA 2QE7A 1JYSA 3DZCA 5AI6A 1V96A 2PVCA 4QYXA 1ZU4A 2R6CA 4NATA 5EN4A 3L8HA 4KMMA 6ABPA 5CD9A 5ELXA 3CRW1 1X94A 3DAHA 3FX2A 4O3FA 4B2PA 1USWA 1UPUA 1UP6A 1UOPA 4ARSA 5CFQA 3VKGA 3QF4A 4BNTA 1UJ4A 1MU0A 1SPXA 4HDOB 1LI4A 1WQ1R 3GPBA 2GD1O 3W2GA 3FCYA 4IL5A 2C4UA 4KUEA 1Q0TA 1PWYE 5CD1A 3UM9A 2CXQA 2BM0A 3D9QX 5FH9A 3L40A 1WXEA 1E7WA 2W4IA 4X9XA 1C3OB 1TD9A 4ZHQF 3IIEA 4CTOA 4DMKA 1G6HA 1DJMA 1T0UA 2G1JA 5HKLA 3ONFA 4G4JA 4FCVA 3NP7A 4C3UA 2GH1A 1VJ5A 1NVWQ 1OAOA 3GZNA 3G2IA 5JRZA 1J09A 3A6JA 3I9FA 5KYUA 5B1HA 1TKRA 3X2FA 2F43A 2ZE5A 4JASB 4I3HA 1XQ1A 1ZNYA 1AKYA 3WK6A 4DJTA 2HNAA 3L1HA 4ETMA 2Q9BA 3CTMA 3OEEA 3SXPA 2PWZA 3KUKA 3K1JA 3NO4A 1SM4A 3G5UA 4C6HA 4M54A 4EG3A 1B42A 2QHXA 2JGIA 1ESDA 4MB6A 2QW1A 2NVUB 2B7BA 1Y98A 4FN4A 4MQ6A 2VHCA 1RM5A 2C4KA 3H16A 1VYUA 3FYHA 4HSEA 5D00A 3ZPXA 2VSNA 3GDHA 1FSPA 3B1XA 4L75A 5HX7A 4Z0TA 3FPLA 3H2GA 4LXIA 1H2WA 1I51A 1SVSA 5FBVB 3U2QA 3U9LA 1L4MA 4MQBA 1VKNA 4YUAA 1KMIY 3REOA 3T6KA 4I5IA 1U0RA 1A82A 5DHAA 2G70A 3IUMA 1GL9B 4NE9A 4D4MA 4YPOA 1ZA2A 1HZZA 3TL3A 2N42A 1A7JA 3E3OA 1KTVA 4FE4A 1PFKA 2WWHA 4Z5XA 2ORVA 1AVTA 3OPMA 4DDMA 2OFPA 4D5GA 3KXIA 1LJLA 3HVHA 3RFCA 1C3VA 1JIVA 1W4ZA 2IZZA 1HZZC 3TEFA 2BLLA 3EG9B 3ZI4A 4RMIA 5EJ6A 1JIQA 1MENA 2P79A 3CW8X 3DPIA 1JX6A 4UZEA 5KJEA 3RK0A 4U0JA 4ZWNA 2V7QA 4OFXA 3RNLA 5JEEA 3GLKA 3ET4A 2ZM6B 2QT0A 3PUJA 3C3WA 5EJ2A 3U3KA 2DE0X 4KR6A 1RQNA 4IIBA 5I9SA 5CA1B 1V6CA 4WLNA 4WY5A 3MWEA 2WD7A 1G60A 2HIMA 4PIMA 3C5EA 3MS7A 1DAPA 1ZGJA 3NBMA 4I1VA 4MW0A 3T35A 2VP2A 2YKGA 2JNWA 3CT6A 3M5CA 3C3AA 3SMVA 1Q7EA 2E2WA 2WUEA 4QYMA 5KSOA 2BRUC 4NYJQ 4BNLA 2PPLA 2V7UA 1NVKA 2WQZA 2X3YA 4IVQA 4TMXA 3STHA 1TZBA 2E4ZA 2ZI6A 3UOAB 3V7NA 2R6ZA 4JYZA 5K2OA 1EFAA 1LV7A 3SZ3A 3WGTA 4ME6A 4YMSA 4BO5A 4C1NA 1HYHA 2OBYA 3R3UA 1LS6A 4BEBA 2EBFX 4BTVA 3AI1A 2CJXA 4GPIB 3DKPA 3UK7A 1UM9A 3K6SB 3CF6R 2PCLA 3QELB 1RIFA 2P9GA 3D7SA 4DWVA 2J0VA 1SUPA 4JUDX 1ACLA 3U7QB 3VC3A 1LC3A 2JI6A 1KFKB 3GZ4A 3FOCA 3H19A 4MAMA 1IHPA 5LMNB 3EVEA 2WAMA 5ALXA 3H04A 4XYBA 2OO5A 3GMTA 3OQPA 5TPZD 1HRDA 2XVZA 1GDHA 3QMWA 2PUCA 5LXTA 5L51A 3C7CB 3HFJA 2JFHA 4XWGA 3IHLA 4UW9A 3V4PB 1ODTC 3G8DA 5HILA 3SVLA 1T6XA 3I05A 4GDMA 3CZMA 2VJMA 4RY2A 2FQXA 3TE6A 5C8YB 3LUKA 1GZSA 4EB0A 1U7PA 4BBJA 1AQLA 1JJAA 3NUQA 1YQTA 2P0AA 1QE5A 5LZ4A 4EQZA 1G3IA 4IV5A 1RJGA 3HZOA 1P7PA 2CFIA 1G2PA 4KXMA 4V0ME 5J2TF 2XYGA 3C2QA 3SP1A 4DR5B 1U7TA 1WBBA 1GPJA 3NS7A 3HLYA 2PKQP 4IH1A 2GJ9A 1KO4A 1B6GA 1L7OA 1U65A 3A3NA 4X93A 4D3SA 3SMQA 2WHRA 4RXTA 4DNFA 4BYMA 2AXEA 5JCOC 3SZMA 5KWSA 3U9SA 2FEXA 4B31A 4PLZA 4PN7A 5HQ3A 3PHJA 1RWVA 2CNDA 5ALHA 2J9RA 4D6YA 3OZRA 3FJ1A 3ZKWB 1M5UA 1VC2A 1VYHA 1CZNA 2NPOA 1QRUA 1E9DA 4KOEC 3ZDDA 1Q7CA 5D01A 5EWLA 4XFJA 3WQBA 2Q50A 3QHPA 3VVCA 1OZGA 1G3RA 2QPTA 3GNQA 2YMQA 3GVIA 3MQ2A 1RRCA 2ZBUA 4W9RA 1RIIA 1Z2CA 3WB2A 3PNQA 4JMPA 4GKJB 1NUAA 1A7KA 3P20A 3LK6A 2K5UA 4MQEA 2P6RA 1B43A 3L92A 2AC2A 4JUIA 2D13A 4REOA 1EFVB 1QGDA 2EFCB 2H57A 4PFQA 1HSZA 2YW9A 3BL5A 4BX9A 4EHJA 2G8LA 4BFZA 4LJSA 5GGYA 3O0TA 2HEGA 3HB0A 3R3SA 3JYLA 2VDWB 2O8DA 1CBUA 1M34E 1RPAA 1VJTA 2IU4A 4I46A 3WB9A 1NL3A 1FDTA 3LC7O 1ICEA 4U2DA 2FQ1A 4P31A 3EULA 1JKXA 4N54A 3QPDA 1JBKA 4KNVA 4F6RB 2EC5A 2PS3A 4H17A 1SZPA 4L0CA 1Y8AA 1Q95A 1Z0JA 1CS0A 1SRRA 3EWSA 1DJPA 1HFEL 3KXLA 1YONA 1DNPA 3C3PA 3LFTA 4INZA 4IUDS 4WASA 3UICA 1SR8A 1VHQA 3KVOA 3O91A 2W90A 2CLFB 4MGKR 3GJXC 4QXMA 4YUVA 5KYKA 4KLNA 1FVHA 3Q3HA 1D8TA 3L6CA 4PQFA 1J42A 3R3XA 4M21A 1XMJA 1SHZA 2QAJA 4RTLA 4MA0A 5CT5A 4ZANA 4DDWA 3CVUA 4ERXA 4GNRA 4LZAA 1HV8A 3D3QA 1A69A 4NDZA 3V00A 1VE1A 5ES4B 3I1JA 2XCQA 3ROQA 4XYGA 1UXIA 1ADGA 1P7CA 3GA5A 4BNXA 3EXHC 1XAIA 3TTWA 4OCZA 3TCNA 3VH1A 2IA5A 2C9CA 4FLEA 4BX3A 2FF5A 1RC8A 2O52A 1IHXA 4W9NC 1HRKA 4YI3A 3U4CA 3JQFC 2WK1A 1K9SA 2QT9A 1C9YA 3BGVA 3JY6A 4LTMA 1E4YA 1IIBA 1HNZB 2ZBEA 3P0JA 3IELA 3PQFA 1RYNA 3KVYA 3T8YA 3EWNA 4HLUA 1EBFA 1ZOPA 2ZUFA 3CCCA 3AIKA 3EARA 1GGFA 3HWWA 2OXFA 3U7FB 1RYZA 2R87A 3IVRA 1KSJA 4XYEA 4YWHA 3RSQA 3LQRA 2WB2A 4K28A 3QOYA 4YP9A 3F8TA 5KQLA 4TUYF 4DTCA 1VGVA 3QPAA 3KD3A 1OT5A 2I91A 2CKDA 3EZYA 2OGZA 3FR7A 2J4DA 2NU9B 3EGXA 5AW7A 1NVEA 2OOSA 4LE1A 1EEXB 3FYUA 1DC8A 4NEHB 1M1YA 1QXSA 2V45A 4GR9A 4J29A 4TTAA 3HCCA 3DFIA 3HKCB 3SYNA 1V2GA 2ZXEA 1Y3HA 1ZZGA 3JS5A 3KJNA 3I62A 4WJZA 1HE4A 1IB6A 5ILQA 3RUPA 3NAZA 2EX0A 1VG9B 5JEDA 4JODA 4F86A 1DOAA 4YONB 1JILA 3B6IA 4E22A 4ZAXA 1ONPA 1AXGA 4WZZA 3BB1A 1O1YA 2UYQA 1QAOA 1LDBA 2HQ1A 4PLGA 4XLLA 1ZIOA 5K3EA 1R9NA 2MSCB 3QLJA 4D3XA 1YE8A 4NNPA 4PG6A 3H5WA 4KQEA 2NTEA 5CR9A 4C08A 1R8JA 1DOZA 5EINA 3KTDA 1FYEA 1MA0A 2WHEA 3GLHA 4FONA 3I04A 2R1TA 4UBNA 4AJJA 1OWLA 4RE6A 3U4QA 3OM8A 3RPEA 1CIPA 4FBGA 2I6TA 4L0DA 4I4IA 5D87A 2AC4A 3N9IA 4YAOA 2W6ID 3JAWB 3ESZA 3VSDA 3NTLA 3PS9A 5EE0A 4FVTA 1G59A 3NBQA 4UNIA 1Z2OX 2I2BA 4JFAA 4YYZA 1UOEA 2X15A 2Q6OA 5IJ0B 1NKVA 3FGZA 4OB8A 3KKQA 2H0AA 1X77A 5REQA 3S2GA 2X0KA 4TWIA 1XN1A 3B2EA 4GE0A 4OXQA 4ND3A 1YQQA 4OAOA 2JVKA 3DKVA 1CEYA 2VNAA 1WCIB 5B4UA 3QFSA 3AH8A 4MSUA 4G09A 3AB3A 1JA9A 1NT2A 3D6HA 5CH5A 1DAEA 1K8ZB 3IQXA 2P9BA 3HCEA 4NOMA 1WHTB 3BZUA 2XPCA 3ANTA 4KX3A 2E21A 2O0MA 1W0CA 4MI9A 2XUZA 4FNGA 4Y2GA 4L51A 4WZAB 4RGBA 1I5EA 1H2XA 1GRNA 2HR1A 2O3QA 1Z12A 5HFNA 3W7BA 1F2TA 3ORFA 1PJQA 2PSEA 2J6CA 1Z33A 4K1XA 2ZFUA 4ND8B 3TRKA 5I7EA 1B3RA 3LLCA 4QREA 1FRFS 3E7DA 3L7YA 3WRXA 1XCBA 4AKEA 3DO5A 1VSVA 3LPDA 1QLHA 4I55F 4A6EA 4LV8B 4EPTA 5DM70 4U7DA 2C9BA 4LQCA 2C78A 5IBQA 1ECPA 4AO7A 1XZBA 1C9MA 3RDPA 3GJZA 4MR9B 5BT8A 4OUDA 5BT9A 4E51A 5CLJA 3WL4A 1WPQA 2A0WA 4RC9A 4RKEA 3ZWNA 4HTFB 3H87A 3ZS9A 1JHVA 1FYFA 3FKSA 5MFPA 3P9PA 3UK2A 1Q22A 4LZPA 3RTDA 4OXIA 4YTEA 2D74A 3P9SA 3WYBA 1C4XA 1DJOA 3DMYA 1YK0A 2EFDB 1YIOA 2GF2A 5DBHX 2JH9A 3W9YA 5KOHA 3FNQA 1EGMB 1TUIA 2IQIA 2VHUA 4FR0A 4RK1A 1L7EA 3WA6A 4EA8A 2RDMA 1GYPA 4FFWA 3EMVA 3WMEA 5A7GA 4HS4A 3JRWA 1PI3A 3CWQA 3P32A 4N3NA 2PZGA 1BKYA 2KMLA 1SURA 2VBCA 1TK2A 3BREA 3UIEA 1QB7A 4CODB 2L42A 1GTJ1 3OQ6A 3PFWO 3WHIA 4OG2A 2AYXA 1C0IA 2EF1A 1W73A 2EFHB 1A71A 1JLLA 2LE0A 1JQJC 2PSSA 1UAYA 2VOJA 1G7TA 3FDZB 3LF2A 4ZO6A 2QTFA 3PNMA 1P3JA 1YB6A 4W9NA 2Y0DA 3TH5A 3FTEA 1K4YA 4RTNA 1U5BB 5C1DA 1C50A 2ZIGA 4CM3A 4MP8A 4OX9Y 3F3KA 4LY9A 3ZDBA 1KA9H 2WHXA 2QZPA 4FKMA 4WSOA 2F64A 4A0QA 1G42A 2YY6A 2ZBFA 4MKRA 1CR2A 3UTCA 1NBEA 1ZSVA 1IG0A 2GZRA 4A2PA 2PUHA 3TJMA 2D0IA 3LX5A 4NMMA 1XCGB 4W6ZA 2YV4A 1YAJA 3MMXA 2WFMA 1ZL2A 3IDZA 3FBTA 1UPTA 4CF5A 3Q3JB 3MJDA 4BVEA 1Y89A 4RF2A 3N2NA 4PZAA 1F06A 3KJXA 2ARKA 4TTSA 1NMZA 3NFRA 3O83A 4FJ2A 1CP3A 5DCYA 5HIMA 2X0RA 4D8YA 1K8XB 1DARA 3ITDA 3PI6A 1R6AA 2BFBB 5EJ8A 5I3ZA 3GHYA 1G3QA 5AHRA 3L02A 1TMKA 2JZNA 3R6GA 4N3CA 2QG4A 5B3JC 1UKZA 2WTAA 4FJ1A 1HYEA 2J6IA 2Y1LA 3DE4X 4K9RA 1VLLA 4P36A 1I4OA 4XRRA 2KJQA 4YAKA 4ZXFA 2TMYA 4N7BA 1WB5A 4EI2A 4LDRA 1GPYA 1YI1A 2GHRA 2VPPA 2Y1OA 3L8EA 3P27A 1KS2A 1KE1A 4BMZA 1GGEA 5IC5A 2B20A 1A5TA 2AS0A 2JZCA 1XXHB 4Q4DA 5G40A 1Y3BE 2XGJA 2DQZA 1U80A 2IGBA 4AKHA 2XVXA 5KTRA 1P4RA 1LTQA 1ZN9A 3PVZA 3P0IA 5I4CA 3H9GA 5IFLA 3DLIA 3LO8A 1BCRA 4ZDKA 5DSXA 1EFDN 3CRZA 3U4HA 4L6CA 5ALYA 5KWJA 3WWDA 2H3HA 1IATA 1QH1A 4BO1A 5MF6A 3DSRA 3ADBA 4KRFA 1ZFNA 4GT1A 1AKRA 3LOQA 3PXDA 5D51S 1E9CA 4U7WA 3KZOA 2EL9A 2VDVE 3CPJB 2AG0A 1IZ8A 2VA9A 1CJMA 4KACA 1C7QA 2JFNA 2WVJA 1MW9X 3BBPA 1K8YB 2H7XA 2GBLA 5JAZA 1CIVA 5FV7A 1OCEA 4YRIA 2E9SA 4XIYA 2X2FA 3A2NA 4TMYA 2QRZA 1M76A 4H7HA 3RBVA 1OLUA 3R8XA 3ETJA 4PICA 2HU2A 1F1BA 5DVZA 3VNSA 2R6FA 4B81A 4E6PA 3AKEA 1XKLA 1COWD 4FFBB 3NKFA 5JAHA 4F4DA 2WW8A 1JR3A 3TS1A 5KQMA 5HKOA 2Y1EA 3IAFA 1SKMA 4ZT5A 4JLVA 5JSKA 1QTQA 4JJ4A 3B7PA 4JUAA 1EZ1A 4H9GA 3E9MA 5JD5A 5AW5A 1R4AA 3U44B 3STUA 1ZGGA 4PYKA 2UYOA 2AD1A 3HDGA 1AB5A 2QG9A 1XP8A 2FHSA 3ZLUA 3FOAA 2AEFA 3AUKA 4UTNA 3F3SA 3LPNA 3S5JA 4QICA 4RMJA 3Q88A 5SY6A 2IBSA 3HMQA 1ZAKA 5DNAA 2QX4A 1RVDA 2M9MA 4KQ6A 1G2OA 3W04A 3UJAA 4QBTA 2QRNA 3T3GA 3WSVA 1XELA 1Y9JA 3BQMB 4O2AB 3IYLW 1N9ZA 2QSYA 1U8XX 3I01A 5BNTA 1Y8ZA 2D5AA 4DMGA 1NSYA 2WIBA 1E6MA 1OLXB 2Y1GA 5F3DA 1A5ZA 2PUEA 3A1WA 3GWZA 3C8MA 2A57A 4FDVA 3PC4A 4O63O 1OLSB 5A04A 5JBIA 1KYYA 1PYOA 3QEOA 3HZZA 4PFSA 5BRJA 2P3LA 3NDPA 4A0RA 2AVDA 4NBRA 5CIWA 5I48A 3I28A 5JD4A 3UT5B 2GRAA 3RBXA 1GDTA 1WEHA 4EP1A 3RVMA 4WVFA 2YV5A 3AVOA 3G2QA 3OLVA 3ZVKA 3CA8A 3QTTA 3D2LA 2YY7A 4FCCA 2R6GA 4PRLA 2J0UA 4RETA 5IABA 3NT4A 1JFFA 1D03A 4AJHA 3KQOA 2GPYA 2OKGA 2D62A 4I5FA 4K9OA 3RRYA 2QZZA 3GG9A 2QT1A 1Q0ZA 4XQCA 4P92A 4CN8A 1KMCA 2FWBA 2NUTA 4C0WA 1HYGA 1Q3HA 1XEXB 1GJRA 3EAGA 4FLMA 4Y1EA 3RS2A 1SC6A 1YCHA 2XOXA 3DL7A 4M6WB 1X38A 3WLOA 1IOWA 2F4VB 1NQUA 1H2HA 3WNDA 5HXAA 4OAPA 3RU7A 1NW4A 2ZDQA 1IPHA 1QG6A 1SCUB 1K7XB 4FCTA 4FFRA 5AVOA 4CLRA 3ENNA 3HVKA 1IN5A 2VRCD 2JGDB 2OAQ1 2O8EB 2ZB8A 4JVMA 1L5QA 1XRMA 4R2IA 2QSJA 4MGEA 4P22A 4PNPA 3HTXA 3CR7A 4HDMB 2Z3VA 1EX6A 3E22A 1NT4A 5IEBA 3GGPA 4OI1A 5KOYA 4TSFA 4XJXA 1XTZA 4TT3D 3O8OB 4BO3A 3L0CA 3VR4A 1TAQA 1WCXA 2Z1MA 5EWJA 1Q19A 3ROFA 4ND5A 3IOMA 4MGIR 4DB4A 2V6BA 2YN2A 3IILA 4A2CA 2AR9A 4G37A 3VO2A 5JXIA 5B7NA 2OMEA 5B55A 4LRWA 3GBVA 4MP6A 3HJTA 4A6PA 1NW8A 4B7UA 5KYGA 2QPOA 1UC5B 4PQRA 2ORWA 1WUTA 3C7TA 2ONKA 2BJVA 2FDRA 1EFPB 3D3JA 3ZGLA 5FWDA 2DPHA 3I6YA 1FU7A 4DSTA 5JNSA 1OV4A 1SXGA 1VIMA 3AP3A 4BRWA 4BV2A 1PFUA 4FNOA 5EJIA 3R5HA 4UHBA 2QD1A 1NBME 4LYHA 2O1SA 5CP8A 2PIDA 1MW8X 2GVDC 4ZI3A 2B7CA 3A31A 3E2MA 2J09A 4G5RA 4KMOA 3NHWA 2DHCA 4R9VA 2J8ZA 3LH5A 1XLTC 2A5LA 4QECA 3RUEA 4BB6A 4G4GA 4RH0A 5CA0F 2H48A 4RVCA 1QYWA 5AMXA 3K0EA 1QYCA 4FBLA 1SD5A 2NXEA 4GZ6A 4M55A 4F9FA 4OM7A 2W22A 3ZIAD 4P33A 3MT7A 3OZFA 2X14A 4OHVA 1QO7A 4HGRA 4D9HA 2PYZA 2H00A 3IR7A 1H2FA 4QOIA 1W96A 3V8VA 3WL5A 1HQDA 2JEZA 1E63A 2Z2IA 1Z2EA 3ZY3A 3T7AA 2W6JA 1EE2A 1SBQA 1T1RA 3A3PA 2OD7A 3JQEA 4WY2A 2I1LA 2WF8A 3IRUA 1XQ6A 2GXAA 3CN9A 4C4SA 1X39A 3W8EA 1GZ3A 1A4RA 3AFNA 3P96A 3PGLA 1SAYA 3AHFA 2QLBA 3DEJA 1SG6A 2W43A 3HUUA 4BNFA 5IU6A 5LZ2A 5GADl 5DOVA 4U2BA 1G9TA 5LQDA 2X8BA 1ZVQA 2QU7A 3EXFA 1S3SA 3G9ZA 4L0QA 2Y9PB 4WDRA 4IDFA 2L69A 4MTCA 1CSEE 4KO3S 4TM7A 3MUEA 2CLMB 1Z6TA 4MYSA 2P9FA 1FA9A 5U1PA 3R9IA 3L5KA 1Z7YA 4E2XA 1S89A 1CJTC 1BXRA 4WD3A 2ZJ2A 4R8LA 5AXBA 1QHNA 3WYNA 4CDGA 5FA8A 1JDSA 2B37A 2FA9A 3SZUA 1J0DA 1AV7A 4I36A 4F72A 1NPTO 1OT3A 3GP8A 3USES 1F2UA 1KZYC 1AN0A 2C4WA 2CLCX 3A3KA 2W2LA 3HPQA 4JLJA 4ZEMA 5JIBA 4X1YB 3SC6A 1WIWA 2JIOA 3IVGA 3GGOA 1NQXA 1PBNA 2WAXA 3I3OA 4JSYA 2PWAA 4HNSA 1XDGA 3TLEA 4DLSA 3ISVA 3ISTA 2BH2A 2HGZA 1KL7A 3P9QA 4CTMA 2AWOA 3ETLA 3THXB 4ZT2A 5C8YA 4IEIA 4ZALA 4DLVA 2JFBA 1Z4MA 4C87A 2REOA 2H8KA 3B12A 4UU7A 5ITWA 3V4RA 2VP5A 2FWAA 3N86A 1BNCA 2ODWA 4PAWA 4C5BA 1QQTA 1KJQA 1R0XA 1YCDA 2Q5IA 2VJBA 4OVKA 4AIRA 3HADA 4KAAA 1QTRA 2BFWA 2PHZA 4OSOA 5A0VA 1TUBA 3DUWA 2NZVG 4HRAA 2XB4A 4YT5A 3BICA 5JC8A 3LF1A 2HLHA 3A6DA 3K2EA 3ZJ4A 3WGMA 2OQVA 9LDTA 6ADHA 3QQ5A 1B6SA 1A9OA 2YZGA 3I6IA 3KZNA 4YMVA 4XCVA 1CUIA 1ZEJA 1JIJA 1XI2A 4Q3OA 1YACA 4IFEA 3IKLA 4BC1A 2JAUA 4UHDA 4LJ9A 1L2TA 3GFQA 2WABA 1G7SA 3I01M 1XVAA 3OPNA 4DQVA 4HLNA 4XJSA 4BNJA 1ENOA 2PZEA 3NGXA 1GZ5A 2V8OA 3H99A 4FEYA 2IDZA 2BDTA 4QHSA 5ICCA 1S8NA 3BWMA 3QNWA 1U0TA 5CBPA 1UZUA 3AP2A 2XDAA 4GX2A 4X0EA 2C0QA 3V8PA 4Q1EA 1EJBA 4NE2A 4E46A 2JDID 3KQWA 1JTVA 1HDYA 1TVEA 2I22A 2ENWA 2JAQA 4KTVE 5JVDB 3A6GA 4A26A 3IE1A 1KJYA 1N1MA 1CERA 2HF2A 4MIKA 3KQYA 4R41A 2OK7A 3B3QA 4D0NA 3VHXA 1FLNA 1M2VA 5C4GB 2PJDA 3WE7A 1T43A 2EYQA 5KSWB 2OQRA 1NDUA 2VZ8A 3OA2A 4CR6A 1GUBA 3GNSA 3NTXA 4UE6A 4REQA 4B3IA 2GCOB 1H9CA 5T6MA 2QTVA 3CLUD 3DT8A 1VDMA 4AB1A 1RMYA 2JLRA 4R98A 3ZU5A 1FFWA 4F2GA 3PXGA 4JBHA 5C1PA 2J4CA 721PA 5CBPB 1WD5A 1A7AA 1RFLA 4MDYA 3A2LA 5I5GA 4M76B 1XJ5A 4INJA 3OZIA 3M6XA 3QA3E 3QBJA 4N0QA 4AZ0B 3FSEA 4QFCA 2FKAA 4HNQA 4TV8B 4FPXA 3G68A 2QGFA 3S2ZA 1CQXA 4YCBA 5C7LO 4H2DA 4NJMB 1CUZA 1W52X 5KHLB 3OIGA 1MDFA 4W1PA 1ZXBA 3PDCA 2P8SA 4QQFA 2JFXA 3TK1A 3TD2A 4JELA 3CVYA 2UZIR 3NHPA 4JOBA 3JZMA 3EOAI 4EHLA 1T5DX 3GJ5A 2ZTHA 3R7NA 1BCSA 4H16A 1MXFA 4HQLA 1J90A 1YB4A 5JAQA 2NO4A 3RTCA 3ZZTA 3KLOA 4ZTUB 5K8TA 4F11A 1T9BA 2FPMA 4TL9A 2Z2ZA 1JEJA 1YBAA 3G0OA 3G5MA 1Q1QA 5T67A 2BHNA 3TZLA 1SD1A 1OLUB 3KB8A 4OQEA 4WXPA 5LA6B 1DFHA 5EMKA 4Z2AA 4LF4B 3V2IA 1UKEA 3VYUB 1Z35A 1XTBA 3BXGA 1OGIA 3K9CA 4MLCA 3UMMA 3EA5A 3E9YA 4UVGA 1C0PA 4HWSA 3RR2A 1OFVA 2ZBVA 5LMUB 2XITA 2I65A 2O8FB 3HVRA 1Z0KA 4GZMA 3H83A 2WB4A 2H4JA 1H2RS 3OSUA 2PS1A 3THWA 3QF7A 3AEYA 2VKQA 3FA2A 1HDRA 2TMDA 2FSVC 4GMDA 2WILA 1UJBA 4P5PA 1DAIA 4F2HA 1UCFA 3AR4A 3DE2X 1KP2A 1MOZA 3CGWA 3F3MA 3CG4A 1GQRA 3WY9A 3VYSB 3D8TA 1MHPA 1TMGE 1CQPA 2C7GA 2GBFA 3IQZA 1Z9BA 2AHRA 2PXCA 2QIPA 3L4BC 2GK3A 3EWAA 4IOJA 4OGKA 2VSXA 1WVIA 3OE5A 5TB5A 1GL6A 3NM6B 4O8CA 2PO5A 5FLYA 3L0YA 4YAJA 3QMMA 2RHLA 4JGGA 1LBHA 1L4UA 4F8EA 2IXTA 3WISA 2CC2A 4ITVA 4TYYA 2XTZA 1QH8B 4XM1A 2EX1A 3ZX4A 3RANA 4O0MA 4BX0A 3GFBA 4K5QA 1HXHA 3NUGA 4RTPA 2XKJE 1Y63A 2WQ6A 4WDQA 3LXMA 5AI8A 5DHQA 2ZCJA 2C82A 5K0ZA 4V0OA 1EE1A 3K9BA 5FBWB 5TNXA 4XSGA 1R6XA 2ZI5A 1LSOA 2PLFA 5F98A 4J94A 1EH5A 1HG1A 1YMUA 4OD0A 2H31A 4OHPA 4PLFA 4OFBA 5SYAA 4QPNA 4P0PB 4GP7A 5D3KA 3G88A 4Q9DA 2WJGA 4DLUA 2CK3D 2OCXA 2WM8A 4QBKA 3JD1A 3OPYI 4OP1A 1LGYA 5A4AA 5IKMA 2GR9A 3VOAA 1JHYA 4FHCA 4QVKA 1YHYA 1GQOA 1XTPA 3SJBA 4NHEA 3AQ4A 1DKMA 4D9JA 4OHFA 1F4PA 1NF2A 1UH5A 4V2UA 4EUFA 3WL6A 4J3JA 3SNHA 4R6XA 4UEQA 2GK7A 2QRMA 4COKA 3W9UA 1VHWA 3IP9A 4L57A 4URVR 5K09A 4YCJA 2BRUA 3BDAA 1JEQB 3DBVO 1J39A 5K8VA 2ZRKA 3ECSA 4JJFA 4EDFA 4S04A 1YASA 4FS3A 4EG1A 4RQTA 2W2QA 1KC3A 5JW6A 1AZWA 1XWFA 5K9ZA 3NIDB 3UJNA 4G56A 2WWYA 3EDQA 4Y1GA 1MEJA 1XZKA 4Y30A 2R5NA 3HYRA 2HJ9A 3RH0A 3I83A 5U4QA 1AUPA 1QH0A 3S2SA 4ZDJA 1M72A 2G9ZA 4PLWA 3EE6A 1B2LA 2G3YA 3MAJA 4QFBA 2XMQA 4RA9B 4UCFA 5EFOA 3DG9A 2PMFA 1XKTA 3UJ7A 1TEZA 5KYXA 1VKZA 2NO0A 1N5IA 1ZD9A 3I1YA 2OO5C 5FQNA 3RU3A 3W8DA 1M2JA 3RG8A 5LP1A 3PVCA 3GF4A 3TBFA 2FX2A 3E7FA 5K5EA 1A8QA 1V8DA 3D5QA 1HEUA 1II0A 4GYKA 4ASUD 3Q7SA 1G291 3K9FC 4N7JA 4B5LA 4QJBA 3L46A 2C5FA 4FYWA 3TRFA 2DM6A 1NVVR 5DI3B 1Y3DE 3A11A 3LPMA 4FYJA 4WOCA 3NIWA 1SO8A 2Y0PA 2AZXA 2OP0A 5ALJA 2CV1A 3P0HA 4PZDA 2SKCA 4YALA 2A59A 5DP2A 3D4BA 3UUGA 3B52X 1CEEA 3HCNA 1C1XB 1CDOA 1KYIA 2JH8A 3HCFA 3Q9SA 5AXAA 3TQOA 2V7VA 4CIYA 2ZIVB 3IPYA 3GK3A 2ZAIA 1KY2A 4UUAA 1B14A 2H1SA 2O0JA 3M9WA 1YB7A 4XYMA 1XEAA 3PNKA 3BWBA 3NKVA 2MSKA 2JIZD 4K9QA 4V2IA 4CF4A 4Q66C 5K1ZA 4PU0A 4PR0A 4RUKA 4XASA 4ZGBA 4L1KA 2QI9C 4GL4A 1UFOA 1PL0A 2JVIA 3CKLA 3ND6A 2O2XA 3G8BA 3GAMA 3KJEA 3NOOA 4OHRA 5H80A 3DONA 2VJNA 4U4AA 1TQ6A 3IKVA 2HA6A 4H15A 4UEWA 5A3RA 5B1IA 3M2TA 4B87A 1F4VA 2HI0A 2B1RA 1GIAA 5AK3A 1EIWA 2GNAA 3E61A 3FY4A 3I64A 4NLLA 2AEMA 4O4LB 1GNSA 2NT4A 5TIIA 1PR3A 4BNUA 4DLXA 5JPCA 1GCOA 1YRYE 2WU3A 3HXKA 3HR7A 4F5ZA 3EIUA 2ADFA 2EHJA 4GOOD 1RKVA 1E3TA 7MDHA 3GLGE 3S4YA 1DRVA 3U48A 4L5CA 1VB5A 5IRCD 4P5DA 5DBOA 1IN1A 2FV8A 2P2GA 5HGJA 4GOXA 2HRQA 3KKEA 2MYPA 4LISA 4BVBA 4AS3A 1V16A 8ADHA 3OOHA 3WSTA 4AW9A 3DXYA 4HEQA 1ST3A 3CX8A 1N2HA 4BN0A 5REQB 4B35A 4ESOA 4G89A 4JJAA 1JHXA 3BHIA 4MS4A 4K9LA 4EFNA 3L77A 5NLLA 4B33A 1UXKA 4G36A 3CZPA 1IN6A 1LU9A 1VCHA 4RIFA 3GLSA 4WERA 1U3GA 4K3UA 1YSCA 2QYTA 4R4JA 4B2YA 2KQUA 2ROQA 1IL0A 1NX9A 5KNDD 5CDGA 2GAJA 4JZKA 3LHDA 1PDVA 3UJ9A 1EQAA 1DINA 4ALKA 3U09A 3W5AA 2VUTA 3OKPA 1JVBA 4FFDA 3TQFA 4CIVA 1H8ED 1NNLA 2IF0A 3F74A 3LS2A 2YV1A 3V48A 2P0EA 1UEXC 3F3YA 5FNZA 3QU7A 4CLXA 5BNWA 2INGX 1E7YA 2RCYA 5ITSA 1XWWA 1M1YB 3OX1A 4KVFA 1ULTA 5BQXA 2XECA 1U9CA 3TSZA 1Z4QA 1T0BA 1XRRA 2P9JA 2SICE 4MR7B 2QRQA 1EQUA 1YR2A 2P4SA 3PFFA 3VO1A 5B7GA 5JSUA 4JA2A 3CNHA 1PRYA 1YQXA 2NU9A 2VK8A 2FRDA 3A14A 4JBXA 4BQIA 4ZYYA 2G5GX 2NXJA 4PZEA 3QWFA 5JCPA 4ZCIA 2C8VA 4B7AA 4PF1A 3N2LA 4M0LA 2CNBA 5CB0A 4PQEA 4YMIA 2JCGA 2W5UA 1ZK1A 2GTPA 2ILVA 3EG5A 3EK2A 3HDQA 2NU8A 3DNPA 2ZB7A 1ECJA 3DEFA 5EJFA 5DGIA 1VHTA 3IPLA 1NXWA 3T5DA 1T9GS 1ZISA 1KIFA 4QG7A 3R3ZA 1U0NA 1V5IA 3EAQA 3I2YX 1EX1A 1N1EA 1X1DA 3CRVA 4ZVVA 4K6KA 2YJZA 3N2KA 2I7DA 5JDCC 3WRVA 3O8CA 3HWRA 3NBAA 4JJZA 1IG3A 3K05A 3GWGA 1BROA 4XSVA 1EP1B 3L93A 1Z06A 1XRLA 2O4CA 1KKUA 1CR4A 1U4SA 4GM0A 1VECA 3LUFA 2IUSA 4N40A 3MUOA 5T4HA 4DWJA 3RVKA 4MCJA 1CHNA 3NHSA 2UZ1B 2XW6A 2C1EA 4KN8A 3EFHA 3O4JA 1QS0B 5CX1B 1ZOLA 3SDZA 4EKIA 3AF4A 4RACA 3WLQA 4EMUA 1WETA 3ZDRA 3FIUA 4LRSB 1XPOA 4CMKA 1DFGA 3MBIA 5JWOA 3G2NA 1SOMA 4G3XA 4BIIA 4CLHA 4PPYA 2ZSDA 1V8PA 3FPEA 3LBYA 3F2VA 2I2DA 4G01B 4C6TA 3L7DA 4CW7A 2X5XA 4D8XA 1BDBA 5DT2A 1TU0A 2P0YA 1R4NA 5DWQA 1T4MA 1QPZA 1R16A 3K8YA 3UVEA 3EA4A 1BJTA 2BTQB 2GM3A 3GW8A 4P38A 5AKHA 4NYIR 3TSAA 4AXBA 3A28A 4C7OB 1AOXA 4J3NA 3S1AA 3S2EA 4D9FA 1Q0UA 2WM2A 3IBTA 1PWEA 2C54A 4OLHA 2HB6A 1DAMA 1FUIA 3Q0TA 2MINA 3P4XA 5H70A 5IAJA 4IDBA 4L5BA 5KQGA 1RTKA 2VPXA 3I9JA 4LDQA 3Q2IA 4MV8A 2VBGA 3E3NA 4MQ5A 1XZGA 4QPZA 3GMIA 3R5JA 1OW3B 1WUKS 2AVNA 4GBED 1DIBA 1NV9A 3QBDA 3MZ0A 4AJLA 2FVYA 2A1TS 3HCWA 2YIJA 3RVDA 4ZGGA 4OQ4A 3WK7A 3Q3GE 1M2WA 2QJWA 5B2FA 4MUFA 1PEAA 4XH9B 5BUZA 2CXXA 2VYFA 3BRSA 4O2RA 4WINA 3OETA 1IJEA 1M8GA 1I1OA 3EQ7A 3GEHA 1HY3A 1TA4A 1V6AA 2ZYAA 1YTUA 1H22A 4F9EA 4DLLA 1WW8A 2ZI9A 2P4EA 1L3BA 4O33A 1RACA 2JARA 4EH1A 1GRVA 4K2HA 2WEKA 1ECBA 4E5VA 3K6JA 1TLFA 2XNKA 3R0XA 5D3MB 4B7ZA 4DCNA 1T9DA 4BZWA 5IULC 2G0NA 3X44A 4AYXA 4DA6A 4H6XA 4I7EA 5E1BA 3AVXA 5DNWA 5FNVB 1KBOA 4POOA 4BWVA 1TRHA 1A2KC 1RQLA 4TYNA 2F1JA 3MWJA 3HRIA 4JI3B 1DCMA 1S9HA 2MMGA 1XEFA 2NO7A 3GCWA 4IHJF 1XALA 5CVCA 3CUSA 5AW3A 5AVQA 2E87A 3ND8A 3DLCA 3H86A 2PDAA 1CZUA 4NE7A 3WAGA 5ESWA 2I7CA 1UJCA 2I80A 3PUVA 3QOWA 4HYTA 2HMSA 1UFRA 4BBPA 3L1KA 5CHYA 4BMDA 1RKBA 2X1VA 1E3IA 2B5VA 3OQMA 3P0FA 2C42A 3NHRA 2WWIA 1L8OA 1ODKA 2AR7A 2F00A 1KC1A 2YQZA 3DVLA 1LF0A 3N75A 1CUDA 2PU5A 4HAXA 1IC6A 4BKMA 4BMOB 5LD2B 3D4IA 1RMTA 2GGSA 4QU9A 1LQUA 3M1YA 1SCIA 4RZIA 2BM9A 4E5NA 2A0XA 4W5NA 1CV2A 1PTJC 1GCIA 3PGJA 4D02A 4NPCA 5JMOA 2ZVJA 4UMVA 3L6DA 1IBRA 4HSGA 4UD2A 3SOZA 1AIPA 4I5GA 2QVXX 4BFXA 1BMDA 3M9XA 1SH7A 3I9KA 3K1AB 4QBIA 5EKXA 4D97A 3N0VA 5AVSA 5K0BA 5AT1A 3L79A 4ZQGA 1SPBS 3EVFA 4JV5B 3CBGA 2G67A 3UPTA 5DYWA 1KZGB 3T1TA 2ERCA 4TKZA 3C4VA 4CTKA 3UMVA 4D8UA 2BEWA 4XTCS 1L1EA 3GV0A 2J67A 3GLHB 1A98A 3VR5A 5K4GA 1ZL0A 4I1IA 4JJGA 1MOPA 5G3YA 4X6YA 4BNNA 2EKQA 4DGQA 1KKMA 1B1AA 2XB8A 5HA5A 5KTSA 2G77B 1V1RA 3FWKA 4HKTA 3BMQA 3C3CA 4HP8A 1A9RA 1OFHA 1AJEA 4LOKA 2H1LA 3OU7A 3SSAA 3JAKA 3BMNB 1JI0A 1TFRA 4LV5B 3UUEA 5JCZA 3EXG2 2NYVA 1YFLA 1T0HB 2DBRA 4PSDA 3ZXYA 5CLQA 4LZJA 4CHGA 3D6TB 1ARZA 4HTFA 2XOKD 5DMXA 1YB1A 3TZEA 1R27A 1PLJA 1CDEA 3PXEA 3IOYA 1I0LA 1Z22A 3A6LA 3ANLA 4J1QA 1MLDA 1E1CB 2B21A 2BHLA 1E77A 3IBYA 1DEKA 1XTVA 3FI9A 3LT0A 1ZK0A 1GP2A 3P45A 4H7FA 1RMQA 1W85B 1D1SA 1JG4A 5HTOA 2AKEA 4KODA 3L9XA 5F52A 4GLJA 1JL3A 2FMHA 2OPHA 2BGWA 2HCJB 5F7OA 4Y7DA 5JSFA 1PR6A 5LZ5A 4P6VF 2EOAA 2P4QA 3MIIA 3VPAA 3QKIA 4IO1A 1JG2A 4KLZA 1W19A 1MRZA 5FOUA 1OREA 3BVPA 4QGSA 1I7SB 2V3CC 9MHTA 3CX3A 4HGQA 5UKDA 5KJ1A 3JVDA 3LYLA 1W36D 3T9AA 3HBNA 3ZXIA 2D1RA 5FLEX 3WV5A 2DTEA 1KI6A 1CRZA 2CBXA 2JJ2A 3C3YA 4KQFA 2W93A 3QSGA 3F46A 3UWMA 7YASA 1LI5A 2I3AA 4QDUA 2DHQA 2OG1A 3F5FA 4N12A 3DPSA 1U8ZA 4EF5A 4KGZA 1WUIS 2ZS7A 4RLQA 221PA 4BFVA 1VL1A 1G8KA 4ES6A 3TMYA 1YA6A 2PAAA 5IUNC 4I4TF 4OB6A 2NTYC 2Y9MB 4F4HA 5JAOA 1SWWA 2CNOA 1AQ6A 1Z0ZA 2E55A 3G7UA 1AXEA 1E3WA 1YIAA 3DKRA 4HDCA 1Z2AA 4AY5A 4RV4A 1ADFA 4OQDA 4QBHA 3INNA 4TTRA 1D7AA 1I6LA 5FUYA 4DQDA 3RSCA 2VHXA 5DN9A 2CZGA 4O2AF 4AZ3B 5ITZA 3DVRX 2LGJA 4YECA 5ADUS 1PEYA 1Z5OA 5F12A 1OB5A 3KCQA 3K0KA 5CPFA 3RIGA 1JG3A 4GBGA 4JZYA 1WMEA 2OD9A 3T5TA 3KB6A 5B53A 5FLXA 1ISRA 1M1UA 4L6IA 2FJ0A 2V59A 4IVPA 2GESA 5K3FA 1P7YA 5KJFA 2PXXA 1T5BA 1ODFA 4GH5A 4HQOA 2SNIE 1X74A 2AFVA 3AHHA 3RYIA 4CMCA 4L02A 5LQSA 3P8ZA 5DHRA 2J5BA 1PUXA 3CCBA 3DTTA 1AGPA 1GPKA 3FETA 3OO1A 4N7RA 1KR5A 2BFMA 2H1OA 3E5RA 2MYUA 4IJ5A 3HWSA 2FN4A 2QLNA 1WKVA 2ZRHA 1LK7A 3UT5A 1BDJA 3ZBUA 5AVYA 4KQIA 1TCUA 3QK7A 3KZVA 2RGAA 3EY4A 3D8RA 2WJ6A 4DB2A 3BBLA 3SBEA 3S55A 3WWCA 1JSRA 1ZUNB 1ZSNA 3CY6A 5ITZB 3VU0A 4UUMA 4CKBA 4AX4A 2BGTA 1I01A 1GGJA 3UJCA 5HOEA 1FNCA 1Y1KE 5FUMA 4PGGA 2WVHA 16PKA 1E3WB 1HYBA 3C1TA 3FMFA 2R48A 4JLWA 5CCEA 2JGNA 5CK4A 3W4KA 4TXHA 4RHCA 1L5HA 3NAQA 3VKUA 1IUKA 1T2FA 2OCKA 5EMMA 1XVVA 5TPWA 4DZRA 3FZGA 1KEWA 3BL6A 2Q4OA 5LM3A 5FORA 3UBTA 3KQLA 1QZTA 2C2BA 4X8OA 5K0CA 3OF3A 4ZJPA 1NRIA 2J9FB 1ESMA 2YUTA 1ZRHA 2BT4A 3UGKA 4ZZ3A 1Z8DA 4YJ3F 5HF6A 3AONB 4WY8A 2FPWA 5CA1F 2IXFA 2GZ1A 3W3AH 3I42A 2I76A 5TF0A 1ADCA 3MMZA 4OXRA 2DBZA 2O7QA 3HVIA 4RLFA 3UCXA 1REQB 1CE8A 2QP3A 3DVAB 4AMVA 2W48A 3O3MB 1K8RA 1R5OA 4C0JA 2O8VA 4HT3B 1EFRA 1FP4A 1NAIA 2F3RA 5A4JA 3NM5A 2WTMA 3HCPA 4RORA 4NZPA 2VR1A 2XQFA 2QZ4A 2YHUA 3CKYA 3AHCA 2VHTA 4RHFA 2QD3A 1NGSA 1WMDA 2LD4A 1RHJA 3LQKA 2V74B 4L2IA 5JS1A 5A5GA 5GONF 3OF2A 2O2SA 3D2CA 5GM2A 2XF2A 4DV4B 2FEWB 1YNSA 4LTDA 1Y8CA 4PZ9A 1L4HA 2V9PA 1IQRA 4N4AA 5ER6A 1E7RA 3RKUA 1BDIA 1U98A 1YUMA 5H16A 3AG5A 1HE2A 1ZMRA 2ECPA 3PTLA 3MELA 1DX6A 1OZFA 2C95A 2QR5A 3PHLA 4KSBA 2PGNA 4TRJA 4EATA 4QQKA 2RHTA 2DG2A 3LCRA 4CCYA 1CY7A 1D2HA 4HN9A 5BWOA 1QVAA 4GQIA 5ED4A 1XXHA 4L72A 2WFLA 2SKEA 1T1SA 3T15A 4CQMB 4JOQA 5LYYA 3VHQA 1RXWA 4OJYA 9ABPA 4MRRA 5EKUA 1OAKA 1GHTA 1XFAA 4Q47A 4K3VA 4BXOA 5CIQA 1NVXQ 3DFMA 4QLOA 5DI9A 5F2KA 1E58A 4A7PA 2AHOA 4XCQA 4DA0A 2QNRA 4DLYA 3ZYZA 1VPWA 5AUOB 5J1SB 1W88B 1E2IA 1CUSA 3PFBA 2IUYA 3V4OA 3DF7A 3QE2A 1QK4A 1Q74A 4D9MA 1HFKA 4MKXA 2H5IA 2DTDA 3PNVA 2FLKA 4B43A 3L1VA 1IXSB 1COZA 1BMFA 3M3PA 4MXDA 3LYHA 3TIFA 4AROA 3P9KA 2W58A 4IIDA 3TM5A 3VA7A 1QIKA 1M2GA 5MN4A 4ZEWA 2QRUA 3EF3A 1VL8A 1Z4IA 3JQ7B 3K4HA 4OOEA 2BBOA 1M73E 3A1EA 3PPWA 4Z3OA 2X86A 4GX0A 3DDZX 4BWYA 1LY1A 1IEQA 1S4MA 3GRFA 1FP4B 5PNTA 1B74A 1TCVA 1Z83A 2CF5A 4B17A 5B36A 4KITB 4TV8F 4JI1B 1A72A 3NASA 1L4NA 3NETA 1G64A 2BZSA 1NI5A 3T5BA 3BXHA 2J87A 1Z6GA 4FKBA 4NECA 1KU0A 3W79A 4OQNA 3R8CA 2R47A 1Y4AE 1KI3A 2BFFB 1Z73A 3ZGNA 2CD9A 4YMLA 2BFNA 4J76A 3GLHE 2O54A 3NT5A 3PKIA 2YDYA 3K70B 3D3NA 1L5ZA 2WSSA 1DXYA 3EVGA 3WIUA 2IXAA 1DTWB 1JQKA 2XTMA 3ZHRA 4JEIA 1M2OA 1F9AA 1U2PA 3M33A 3ZZUA 1BDHA 4IIUA 2R25B 2PY6A 2YMPA 3H5IA 5EXSA 5M04A 3L4KA 1ZI9A 5AKYA 5HYVA 4UU8A 1FSZA 4HDSB 3EZ2A 1CETA 4PFKA 4TV8A 2G9QA 2L0XA 1Z36A 4OMDA 3WMFA 4ER5A 4Z4FA 6NULA 2QG6A 3TN7A 4KR3A 1XE3A 1E5QA 1CQIB 1JR2A 3DMNA 1AKWA 4YREA 1FTNA 4HEJA 1ZRMA 1ITZA 2GXQA 2ZITA 3CSSA 1QOZA 3EGIA 3IEUA 4INOA 4H3SA 3W8FA 2W2VA 5LZ9A 1SC4A 4TS3A 3CZQA 4RQAA 1OKKD 3PNBA 3IBSA 1JW9B 5A2QA 4ID9A 4F2PA 3PBKA 3TQQA 4RULA 4MICA 1CRPA 2PFGA 2WP8J 3HABA 1N9KA 4ER6A 1KFEB 1JN0A 3K8ZA 5EHQA 4IH9A 2P78A 3TMAA 1MVLA 2F1RA 1GN9A 2FW7A 3ZV7A 4DAEA 3ADDA 2GBLC 4F91B 1YS6A 3UFXB 4KFTA 2RK6A 1OLSA 2VSFA 4IVNA 2COEA 1Y5IA 1MN6A 2BR3A 1AF7A 2P75A 2XCUA 3FKQA 2CDRA 2EFYA 3KJFA 4XWTA 4ZVMA 2J3IA 1IVNA 1D6MA 2SKDA 3U39A 3U4AA 3W2FA 1K4MA 3JR3A 3W4IA 1IZZA 1BAPA 2O1XA 2WF9A 4U3JB 2WG1A 3P5BA 5DEIA 4Z9FA 4D43A 2WIFA 5DP1A 2WJHA 2P41A 3DM9B 4JP3A 3TVDA 3NJ8A 2PUBA 2PLRA 2RK3A 4FYIA 5FIUA 4GU5A 2FN8A 3ZDYB 2QN6A 4U7PB 1FXUA 2OENG 1RXVA 3AERA 4ZREA 2ST1A 5ULLA 2IZ1A 2RGUA 4AC9A 1T8RA 1MGPA 2P5YA 1C1HA 1CHDA 1CUBA 2Z30A 3NEAA 2F7SA 4C6TB 3OHSX 3FGPA 3TZCA 3ICWA 5F76A 1EESA 2YH2A 1CUAA 3RM3A 3KB2A 3UHJA 4Y18A 4Q34A 2X4GA 3IIMA 3GVHA 4HDKB 3KLNA 5KHAA 4ENTA 4I9FA 1U7DA 3FN4A 3Q98A 1Y37A 2QX7A 1Q1GA 2ZIXA 1ZYUA 3OX3A 2VLIA 1O97C 2I34A 2PQ0A 1N6IA 4AG5A 3WKBA 5G1NA 3QVTA 1W5AA 5AM5A 1UDAA 3SC3A 3KR1A 3FNRA 4DJEC 5AHWA 5LIRA 1M6YA 4M1EA 4WFQA 1I0IA 2FSUA 3B1WA 1UKVY 3G7NA 3QVGA 4FGSA 3UJPA 2D3TA 1C9NA 5T4BA 1QOPB 1B0PA 3IPRA 3NQ41 4BLRA 1NXSA 3GIWA 1KJNA 1M2KA 1WSAA 3NYQA 3R1IA 1FU8A 2AIRA 4UM5A 4M8SA 3C6XA 4QDKA 2VZ0A 1EK2A 3PDIA 1UBOS 3W5CA 3JYHA 2Z2KA 4CMAA 4QD3A 1E3EA 1KJIA 2WHPB 3H8JA 1U02A 1KEUA 4IQGA 3WGNA 4KQKA 4WRRA 5AKEA 1UPAA 2DFPA 1TQ2A 2NSLA 2YZMA 1V5WA 2NLOA 3IUJA 3N76A 4J2OA 1SBNE 3CX4A 4LCJA 4D9GA 1YS1X 5K05A 1B8PA 4PXYA 2RHOA 4A8JB 3HU1A 3X2SA 2GX6A 4CU2A 1P1JA 1GZDA 3QNMA 4M1KA 1GPUA 1SNYA 3REGA 2PLWA 1JFTA 3LXUX 1BIFA 1OH5A 2R1UA 3EHEA 3AI3A 1Y80A 4JP8A 4HB4A 2FOXA 1M75A 3EISA 4M8LA 4B4VA 2BFBA 4ARBA 3K9QO 2BAGA 5BSHA 3TPCA 4ITRC 4UEOA 4KR9A 4EG0A 1KAEA 1VOTA 2H1FA 4TTIA 4F84A 4YRMA 4DLAA 1JVNA 4A9AA 5KOJB 1D7OA 4IILA 1UKCA 4KPUA 3VZSA 4G0WA 1ECCA 1E20A 4WJLA 1OVMA 3OD1A 5CGZA 3FM9A 2BMFA 2A88A 1LSUA 1VBMA 2PMKA 1EAYA 1HLGA 1ZRSA 2B82A 2QP9X 2A9VA 2EG9A 2QMQA 1ZH6A 3AC0A 5EIBD 1PT8A 4ZVKA 4EY6A 1QGZA 4DYDA 3WLNA 3RC1A 2VCEA 2I9PA 1YR1A 3DEZA 5C0OE 3TXXA 2NO1A 1YZUA 4ER7A 3KJZA 3WNCA 1VL5A 2Z1NA 2UUCB 1V16B 3GVCA 2UZ4A 4B45A 3PE4A 4AS1A 4JVNA 2P9ZA 4O2LA 4XVCA 2B1QA 4F4UA 3QEKA 4IRXA 2OBBA 3D31A 2PNJA 4W8OA 5I3CA 3QVMA 4Q9NA 2L82A 4WEOA 3E03A 4O2BB 1KQFA 1Q0RA 2Y1FA 3VPSA 3JQ9A 3IO3A 3DE0X 4MVJP 1G0NA 4UBJA 3ZZ1A 1BKSB 1LLCA 1UBHS 2M1XA 5GOTA 5CEJA 2P1DA 1E1QD 3I58A 3AB8A 4AIIA 3QKRB 1F6BA 2YASA 2X7HA 4BNYA 3BE8A 2VK2A 4H1TA 2R7MA 4TQ9A 2A3NA 4DR3B 1N8NA 4NAHA 1FMLA 5K8CA 4BPRA 1ULUA 2PKWA 4HB2A 1VE5A 1X80A 2PS0A 4A27A 2ODQA 2QZ9A 3AI2A 2R8XA 3HBFA 2GVNA 3HR8A 4DDTA 4OHYA 5LYJF 1BGXT 4LDPA 3GPIA 2GLXA 3VKVA 2O2IA 1WQ4A 3H0CA 4FWIB 5JU6A 5IH7A 1N0HA 3GJQA 3DBIA 5BSVA 1HX7A 3M4ZA 4AYTA 1X0VA 5FWXA 2ZW9A 3BGWA 5HCUA 2ZXUA 4NCNA 1BO6A 2F8TA 1SVUA 3U16A 4R5HA 2FEMA 4DQUA 3E2IA 3I9MA 4Q48A 5DIZA 5B3JA 2WF7A 4MV0A 3RROA 4EGJA 4UU1A 1E2BA 1ZVKA 3I6BA 3P2EA 2WU1A 5DRTA 3IEKA 4PNHA 5M29A 3OY7A 3H9EO 1R4MA 4G9EA 4AF7A 1DI0A 1E6KA 2Q3BA 3CO5A 4FFVA 1VLMA 4C5AA 1FXWA 4KQ2A 4MUJA 1ODIA 4G0YA 2Y3IA 5CM8B 2VJMB 1NE7A 2OVBA 1JE0A 2VP6A 3AUFA 3WWZA 4KR2A 3V33A 2HSGA 4G1FA 4IFTA 5GINE 1NNSA 1DXOA 1U8AA 1XDUA 2V7XA 1JS1X 4KUGA 5A7FA 5JJCA 3VTKA 1JR4A 2CSXA 1A0OA 1UK7A 4QODA 2GPSA 3NAGA 3PX7A 2G7ZA 2Q5EA 2QMYA 2ZGVA 4GSYA 5BNIA 5K6RA 5JY6A 3I2GA 2RHHA 3FDJA 3GMSA 4IIVA 3W5SA 4CKCB 1T6NA 2AC7A 3KG2A 3G8CA 1E2DA 4RHTA 3KEMA 1GUDA 3OFJA 4JBWA 3K8QA 4H6PA 3B60A 1W49A 3P9NA 4KZPA 3E4CA 2HSDA 3M6MD 1NDHA 1H1LA 2ZT7A 3PD0A 4IG9A 5H4GA 2NAPA 1Z47A 1R4NB 3AESA 3HG7A 1EK1A 2F8LA 4L9WA 4MWSA 4UASA 3ZK8A 1YL6A 1P9NA 3ES9A 3G2JA 3GUZA 2EKLA 2OB1A 1GD1O 4I4NA 5BV7A 5JD6A 2DAPA 2CJPA 4G8BA 3R4VA 1FQJA 1U28A 2V58A 1IUOA 2OT3B 4JQCA 1FZTA 5ALQA 3GA0A 3MSCA 3OTWA 1E9AA 1BEEA 1NW7A 5HF9A 3TTUA 2BFOA 4YCAA 1TA0A 3U81A 3P4YA 5K03A 5LLTA 4M7PA 5DBFA 4FZJA 3V7FA 1FRQA 1NBMA 1XZFA 1K6JA 3CVWA 5KYYB 2IWHA 3WVNA 3SFVA 2VHZA 2A9OA 1T4CB 4BNGA 1I7NA 4IDDA 4HFMA 3SC2B 1GQYA 1X8JA 4J0QA 5D1HA 5FL3A 1VKRA 4KV7A 6CHYA 2Z0MA 3Q15C 1EK0A 3UMFA 1JYEA 1EXVA 4HQRA 4C4ZA 2DEUA 2ZS9A 4KDFA 1J5PA 3AUYA 3BMCB 2GCPA 5AIAA 1TJNA 4OIFA 4DZZA 1T2AA 4WCVA 2HJWA 3C0KA 2NMVA 3WK8A 3D6UA 1WXGA 5EXEA 1LB1B 2WIGA 4RXUA 2HUPA 3HHPA 2ZTVA 1LDEA 2VHYA 1S2OA 2YZKA 2IU0A 1KOJA 2YWXA 3QVOA 3HRKA 4MV4A 5JARA 1SHKA 2XRFA 2HF9A 1M3SA 3MJHA 5IF3A 3GRZA 5C7OO 3RADC 3MT8A 1NQ5A 2AF3C 4BQQA 4Q9HA 4TS1A 3MFQA 5F9MA 2R8YA 1DKUA 5JNWA 1D4AA 4A91A 4DQKA 1GT91 1NRXA 2WSBA 1E0SA 5SV2A 3T7JA 5B1SA 2WYIA 3AVUA 2JJ1A 3T7SA 4H1VA 3K0SA 1HMYA 4XZ3A 3KSRA 7MHTA 3SKXA 4TYWA 1EVJA 3AF0A 5CLHA 1FMTA 3GU3A 3MIZA 1EXNA 4C0HA 4Q1VA 1KFJB 4ANFA 2IHVA 1S5PA 5DW3A 1UOOA 2EHDA 4LJYA 3LC2O 3X3HA 4PY2A 4NXMB 1P81A 3K1TA 1PR0A 4LZLA 2NTVA 4K8RB 1DWQA 3MRXA 3JATA 5FEMA 1DC6A 1TJ4A 5HUHA 4C0QC 1IMJA 4KXFB 1TTQB 2G9RA 4K6FA 3SZGA 5A9RA 4PHTA 5IDXA 5IEJA 1UM8A 4MWOA 1XKXA 1HETA 4TYQA 3HXTA 3VPGA 3Q9NA 5FXMA 4F21A 3ORRA 4EFKA 3MS4A 1QZXA 4A0HA 1HTWA 1V3VA 5CLGA 4Y3UA 1JSXA 1QAMA 3QBTA 4M0EA 1ZNWA 5KTMA 4LBWA 1SUCA 1F20A 1R0ZA 3EZ7A 1ONSA 3M5DA 5KMGA 1MABB 5EP1A 3BIJA 3ICQB 1Y6ZA 3R7SA 2X0IA 3G5LA 3NZEA 4MS4B 5E1DA 5HJ7A 5I7VA 4GPBA 3OY2A 2QMHA 2ZEJA 1VP3A 3Q7IA 4BP1A 1ZHOA 5A9SA 4ISCA 1P2BA 1WKBA 3U5ZB 2QNIA 5EZSA 1A96A 1LPSA 3K4PA 4XDHA 3RHFA 2GF0A 5P8WA 3SLGA 4ENPA 2ZAMA 4PYJA 2P9EA 2ZYIA 3TLBA 3UJHA 3ZCPA 1C1YA 3JW8A 4MVXA 1LDGA 1R0WA 1S4QA 4A8HA 1QIGA 4CE6A 2I29A 3H9CA 2BR4A 1HOTA 4F92B 2IDKA 1T6BY 1UPBA 1XLTA 2NM0A 2YJTD 1GADO 3HDVA 5TPWB 1PNQA 1NSFA 4A8JA 1U6IA 2C5AA 2H07A 4OP3A 5B57C 1FW8A 2DCMA 3AJRA 4JT8A 4M53A 1CUYA 4MV6A 1QPGA 5AW4A 4QTTB 1G7CA 3CNNA 1N6HA 4UM7A 3WK4A 1NXOA 2YYZA 4HH3C 1DC3A 4LSWA 3MTIA 3ZWWA 5B12A 4YT8A 5DI3A 1OX4A 3QPWA 2GPJA 1X1AA 1WXFA 2YQ5A 4QUGA 1EJ6A 1JU3A 1NW3A 1CPYA 2AFIB 4YGYA 5BN4B 4DSOA 3F6SA 4R1SA 4DKJA 5I5EA 4UULA 5JDCA 1YZGA 4MQMA 2FOLA 1XTRA 3G0DA 4TYPA 1QOQB 3OC6A 4R8KA 4V0MA 4P93A 3RQIA 3ZCXA 4QVGA 2AX3A 3IULA 4WQMA 1RXEA 3SQWA 5TV2A 1A88A 5IUJC 2P2SA 2YNMD 3DNFA 3RUCA 2YOGA 8MHTA 3D7RA 3IXQA 3MT0A 3LL7A 5LXTB 1MO3A 3DZ8A 2R1VA 1EHCA 4M0MA 3RFTA 3FI0A 1QM5A 3CINA 1WO8A 3DDOA 1NR5A 1NQOA 5FKJA 5AM0A 3NI2A 4HADA 5HF5A 1QUEA 1WCV1 4O2BA 4Q3CA 2A0UA 4U8HA 1NOJA 5E4TA 2PT5A 2XB6A 3TX2A 2CLKB 3V4VB 1PLLA 1JXOA 2A1UA 2HMVA 2JGFA 1E9EA 4IX9A 4XR9A 5CAEB 5AM3A 1Q1NA 1P4SA 2WMOB 2ZYHA 3HA2A 2RHWA 4M9CA 3QKRA 3SJAA 2KWIA 1DIHA 4PTLA 4X7BA 5ALOA 3UMYA 5BWMA 1EVEA 1PCXA 3SWWA 3UAYA 4UATA 1BH6A 5LP6C 3KR9A 2ILTA 4G4SP 5JS8A 1Y1LA 2J6BA 4ZOLA 5J47A 1VPTA 2RFLA 2XY4A 2XH8A 2V4MA 1KARA 2XUDA 3ZV4A 1XA4A 4PAOA 2EKPA 2C7OA 4I5EA 1M34A 2AJTA 3X1YA 1P73A 4F4JA 5I01A 3S81A 1TTHA 4E30A 2GVZC 5LKAA 3CF4G 4DDKA 3M6IA 4L74A 3Q85A 4R1PA 3ZD6A 4F2DA 1VCMA 3P9RA 3WLMA 5FO0A 4LHEA 4C0XA 2RARA 2W83A 1V26A 4C43A 5HIJA 3U0VA 1B1CA 3DVSX 5CB8A 1RCUA 1YQEA 2R9VA 4MRMA 2DU8A 1JKJB 4J0FA 3TZKA 4KSCA 3SJCA 1G8MA 3H1TA 3LFUA 2QE6A 3FMGA 1SC3A 1OWOA 1Z5WA 1H1DA 4AECA 1J9GA 3KQMA 2QB5A 1PTKA 2HA2A 3AVQA 3S70A 3NNDA 1JT2A 1DVRA 1QRSA 4LJ8A 1XD9A 3V7UA 1KYTA 1I6MA 3LT4A 3ER9A 4E1VA 2VJKA 2QTTA 3MGAA 3H4VA 4OLJA 5DBEX 4I2VA 4L85A 1JV2B 1O03A 2QLTA 3FCOA 2EBWA 4TMWA 2WNHA 3C4JA 4BN5A 1EFUA 3QJGA 5K0FA 3TEJA 3H6GA 4CMBA 1FMCA 3KYIB 1GU7A 4TZTA 4CMGA 1H8HA 2CL0X 1BA3A 2VP4A 3IRVA 5F35A 4Q4JA 1W34A 4FGZA 1BYUA 2GTIA 1BOOA 1ODJA 2IIVA 3OFND 1GAQA 1ESCA 3PXUA 4Y2YA 4BHTA 5IT5A 4H35A 1V5EA 3OX4A 4RWZA 4Y7CA 2BMEA 3PA6A 5CTAA 5G4LA 4XKJA 2GZAA 3GZTB 4JR0A 3UK1A 2E4YA 1PZGA 2ORYA 5FUWA 4MK4A 5DLDA 4UOEA 4N82A 1D9XA 2RGXA 1H6AA 1P9OA 1IH8A 2HO4A 1LK5A 4TTPA 3BSYA 1U04A 3VKFA 4EB6B 3OQOA 4N7MA 1CY6A 1PR2A 4JGBA 3O4FA 5HPYB 2EQBA 1K68A 4EGCB 3S8YA 2CV0A 4MV1A 4NQRA 4TUYA 4WZBE 5GIPE 1ZM3A 1Y5MA 2AUNA 2AW5A 3O4HA 4PLCA 4TWJA 1TUEA 3C43A 4ZXPA 3CWZA 4TZKA 3KKPA 1CB0A 2FSPA 4BUJA 4DXAA 3WHKA 4IO0A 3BQNB 1NY5A 2Z2XA 3RKRA 2XCTB 3R77A 4OA5A 1T4CA 4HAWA 4QU0A 2ZQZA 1RWWA 4GC5A 3FPCA 1U0BB 4TN1A 2DJIA 3OQHA 3EZ9A 2B78A 1Y5NA 1LVHA 3CONA 1M5RA 3UHAA 5JXGA 2V3VA 2CLIB 3N5KA 4P4GA 3WDSA 3DLHA 4JQZA 2JGEA 3MILA 4IOLA 5COBA 3J7AC 1OFUX 1WU8A 2FQQA 3FG9A 2HYIC 3WWOA 2ZETA 3ROGA 2Q6IA 5LU9A 3PGXA 5CBKA 1J56A 1XMPA 2FHPA 2W2MA 3QWBA 3UEOA 2VAWA 3KQQA 4B3BA 5JJ5A 2IH4A 4EB3A 4BLUA 2XAAA 2XDQB 5TQVA 4AJIA 1E64A 2Z04A 1EEHA 1NN3A 2KSQA 2XLBA 2Z5LA 1U2EA 3VGPA 5ALPA 2AL7A 3SR4A 5C1OA 4W7SA 2HADA 1FC0A 4BP3A 2EFJA 4Y2TA 4HCJA 4TTTS 1NJ1A 4RNCA 1IDOA 3HXPA 2IHYA 4ZO7A 3K9WA 4EI8A 1A8SA 4EIWA 1JHUA 3OQJA 3B78A 4AJPA 4FTWA 4Z9XA 4Q5IA 3KKNA 1WZNA 3REQB 1N8TA 3GVXA 1S2DA 1Q7TA 3QYAA 3BF8A 5IT0A 3GJ3A 2JZOA 3TZQA 1W8DA 3FDFA 2YXBA 4NPHA 4ZMRA 1SFRA 5D3MA 3ZU6A 1T9ZA 3UPUA 2G17A 4EPRA 3Q7EA 1C8KA 2FP4A 2NZXA 1G63A 4F3NA 4RL6A 2CHEA 3LE8A 3N53A 4TRMA 3I2KA 1GA4A 3FMPB 2VJAA 3ZHBA 2JFZA 1M54A 4UXJA 4C04A 1QHGA 1TXGA 4G0QA 5TGDA 3UJ6A 3COSA 4MWBA 1MJHA 4R7GA 4F1KA 5CFZA 2V1UA 4CQNA 1G17A 1T8UA 1WDKA 2C2GA 4IV8A 1C4WA 1UMCB 5EYPA 2H9IA 2P30A 3NU1A 1KWKA 2FSFA 1IBKB 5G1PA 5CCDA 4AJ1A 4MB2A 2JJQA 1RWPA 2VA8A 4HK4A 4YP1A 3E1KA 1L7XA 2SCUB 2GM5A 2ZJ4A 4XB1A 2AEEA 1PS8A 3FPHA 2VN8A 1W30A 2B61A 1DBRA 2E5FA 3F47A 3HB9A 4I3FA 3UKJA 3UMJA 3WB0A 3BRWD 1OH6A 3L6OO 4IGAA 2BFFA 4KE9A 4ARUA 3GGSA 1C41A 4EMTA 1EVLA 2CEAA 2F8MA 3KK0A 3DJFA 3PZBA 4FZ5A 4C22A 4H60A 4XUDA 3B51X 4R05A 2FRDC 3WYEA 1MORA 3GLFA 3PG5A 1EZ4A 3T7TA 1F9EA 3EXIA 4A6DA 4C4PA 5A9SB 1HE1C 1IEVA 1AT1A 1ZH4A 1XTIA 4DA7A 5E4JA 4FD2A 4Q4CA 2PQ6A 5E6UA 3SSOA 3W0LB 4PVDA 1SKYB 1NONA 1YUBA 2Q0XA 3IVCA 2O07A 4LQDA 5B1DA 3WIOA 4E33A 5KVCA 4H59A 1I32A 4LRUA 3IVXA 4BEWA 3O31A 2FKNA 4PNEA 1TGYA 1PVOA 5BVHB 1DFIA 2G4CA 4LXUA 3T99A 1MIHA 3FCSB 4BQPA 2B0JA 2OWEA 4I55B 2HCFA 2PV0A 4NJEA 1PX2A 1YCGA 4DUPA 5JYEA 4B2IA 1PO7A 1O5TA 1VI2A 1F2UB 2P9QA 5CGQB 4RNDB 2QBYB 3PENA 1FNSA 2HAEA 4AJ9A 2XWBF 4G26A 4OBBA 3VAZA 5I9NA 3EPLA 1LLUA 3QUQA 4MO9A 4OGLA 4W82A 2QD2A 1WMAA 5I45A 4ZA2A 5E0OA 2OZEA 2EJWA 2NSHA 1U5AA 4XOIA 4YRQA 4GBJA 2D0OB 2KLBA 3DDHA 1FB5A 3QXGA 4I8XA 4MW9A 3ZE2B 1GPMA 3B1JA 1JQEA 5AW8A 3P9ZA 4TRNA 4DMMA 1CZLA 4XM0A 5KI6A 4UM9B 3MWEB 2O2JA 1T9GR 2V7WA 3NYIA 4JROA 4PSAA 3DZJA 3KQUA 1RC1A 2OBMA 4EVQA 1J9ZA 5MGNA 1N2GA 3L8DA 2DQ4A 2QKYA 3FFXA 3U4IA 4RU1A 3THYA 2W2LD 2FRVA 1G41A 5HTKA 3ZNQA 3CEMA 4RVHA 4IMJB 4IYRA 2IP1A 4KPYA 2PKYX 2OZLA 1N6PA 3L41A 2VH1A 3PQ6A 4EJ0A 3NWEA 4IINA 1HLFA 3NHMA 3WNQA 1TT7A 3HL0A 4XXHA 2HDOA 1AS3A 5AVJA 2FNAA 6REQA