1I14A

Analysis of an invariant aspartic acid in hprts-glutamic acid mutant
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
187
structure length
187
Chain Sequence
YEFAEKILFTEEEIRTRIKEVAKRIADDYKGKGLRPYVNPLVLISVLKGSFMFTADLCRALCDFNVPVRMEFICVSSYGEGLTSSGQVRMLLDTRHSIEGHHVLIVEDIVETALTLNYLYHMYFTRRPASLKTVVLLDKREGRRVPFSADYVVANIPNAFVIGYGLDYDDTYRELRDIVVLRPEVYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOXANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE
publication title The role for an invariant aspartic acid in hypoxanthine phosphoribosyltransferases is examined using saturation mutagenesis, functional analysis, and X-ray crystallography.
pubmed doi rcsb
source organism Trypanosoma cruzi
molecule tags Transferase
total genus 56
structure length 187
sequence length 187
chains with identical sequence B
ec nomenclature ec 2.4.2.8: Hypoxanthine phosphoribosyltransferase.
pdb deposition date 2001-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1i14A00
4RACA 4Z1OA 1XTUA 4P3KA 4RADA 3MBIA 4MB6A 1TC2A 1XTTA 3S5JA 3ACBA 4F8EA 1UPFA 4PFQA 3N2LA 2PS1A 2DY0A 3LRTA 5KAMA 1UFRA 4QYIA 1MZVA 1LH0A 2JBHA 4RAOA 2XBUA 1TC1A 5KAPA 1VDMA 1XTVA 3EFHA 4FYMA 3MJDA 2PRYA 1P17A 1STOA 4RABA 1U9YA 4RHUA 1AO0A 4PAWA 4LZOA 1OROA 1GRVA 5IPFA 2C4KA 4P84A 1ZN9A 1ZN8A 1QK5A 2H08A 1I13A 3O7MA 3QW4B 4LYYA 1G9TA 5HIAA 1PZMA 2GEBA 1A97A 1L1RA 1DQPA 1P4AA 1BD3A 2JKZA 1ECFA 2WNSA 1QK3A 4RHYA 4WN3A 1I0IA 1JLSA 2JKYA 4LZNA 1BD4A 1G2PA 1VSTA 4S2UA 1A98A 1U9ZA 4P81A 1DQNA 1D6NA 1ECBA 1G9SA 4IJQA 1QK4A 4RHXA 4P82A 5IAOA 1ECGA 4KN6A 2YZKA 1I14A 2PRZA 1A4XA 4RQAA 2E55A 1VCHA 4ZFNA 2P1ZA 3ACDA 1ECCA 1O57A 1Z7GA 2VFAA 3GGJA 3OHPA 1QCDA 4M0UA 3GEPA 1DBRA 3GGCA 1L1QA 4RHTA 5ESWA 5ESXA 1J7JA 1Y0BA 4JITA 1P18A 3LPNA 4JLSA 5E38A 1V9SA 5BQPA 2H07A 4LYGA 3H83A 4RV4A 5BQOA 1OPRA 1A96A 2JI4A 4OHCA 4P80A 4QRIA 4RANA 1JLRA 4M0KA 1W30A 5EUCA 1I0LA 1NULA 3HVUA 2FXVA 1I5EA 4M0PA 4X45A 1YFZA 5BSKA 5JV5A 1HMPA 4TWBA 1P19A 4WMLA 3ACCA 1UPUA 4RQBA 2AEEA 1IBSA 1G2QA 1CJBA 3DEZA 4P83A 4QYIB 2H06A 1ZN7A 2HCRA 4X44A 1HGXA 1QCCA 3OZFA 3DMPA 3G6WA 1WD5A 1QB7A 3KB8A 1O5OA 2IGBA 1DKUA 1XZ8A 1GPH1 1BZYA 1ECJA 5K51A 1XZNA 4LZAA 1R3UA 1QB8A 1A95A 3NAGA 5BRNA 1DKRA 4P86A 2EHJA 1A3CA 3DAHA 5HKLA 3M3HA 5JSQA 1FSGA 4RAQA 1NONA 3OZGA 1OREA
chains in the Genus database with same CATH superfamily
2PFSA 1H8EA 4I55B 4AQ7A 1L8QA 4WIAA 4BNNA 4DMFA 3N3BC 3VC1A 5MN4A 2Y1GA 1MAHA 1JLLB 1KI6A 1YZHA 2AEMA 4KRYA 4BNLA 2IOYA 4AMZA 4PXAA 1VKZA 5TPWB 1NU8A 1DAEA 2AFRA 4FEEA 4CL0A 4DCVA 3FNGA 1FIUA 1UFRA 1JHDA 1XZAA 2IVZA 2QXYA 3I0MA 1HG0A 2DY1A 5B1SA 3NIFB 3ZQ6A 2CCJA 5FP0A 1D2RA 5A6SA 3VM6A 3P9RA 1G6HA 2R6GA 3GA0A 4HNGA 4HUQB 3WYGA 2J9FA 3DOCA 1B93A 3LYUA 4N3CA 5FAXA 1YFLA 1O95C 5JZSA 3RBAA 2FWNA 3DBLB 4IV8A 2C92A 2PIAA 3BDIA 3DL4A 3FSRA 4H7HA 4QXQA 4PGGA 4X1YA 1NVFA 2HRZA 1ICEA 2NQ8A 3HY4A 3L43A 4PAWA 1QQTA 3R0XA 2I99A 3SZUA 2ID8A 2HMVA 3B60A 1BJRE 4R81A 2V58A 5F3DA 3UF0A 1X8LA 4EB0A 4CIVA 4BQEA 3JAKB 2CWDA 1BVRA 4E2FA 4NPHA 2WWGA 3BXEA 4I5DA 4GZ5A 5EERA 4B3IA 2MWMA 1F9EA 2W6ID 4NCKA 1YZ3A 1C1XA 4OHKA 5U1PA 4QLBA 1SOAA 1KIMA 1TU0A 1KEUA 5IKMA 1T1RA 2VDRB 2I6XA 3IURA 1EK2A 4CETA 1ADBA 2XTNA 2XBLA 3FPFA 2LKCA 3N7AA 1KMHB 4BY9E 1FFHA 4DDMA 1HBJA 4S35A 4ZVSA 4AF8A 1C9NA 2NUPB 4A10A 3FVVA 1W36C 1MX3A 1SEPA 4QRDA 4YT4A 5JH7B 3VO1A 3WSVA 3H42B 4PS0A 2Z98A 2YTZA 3F6PA 4V0ME 1C8VB 3QKRA 4YQEA 1URPA 1HZJA 4F91B 3PXUA 1A5ZA 1CJKC 3ZHTA 3KAQA 2PAFA 3IJRA 4HAUA 4C20A 3IBYA 1ISFA 1R27A 3KUDA 5GP1A 3RJ5A 4JAVC 4CQMB 1P33A 2PGIA 3K53A 4QODA 3OX4A 2I3DA 4BB6A 3CKLA 5T4FA 4OGGA 1BW9B 3RIHA 5FI0B 3L40A 1QIEA 2HJWA 2QRVB 2WZQA 1QG4A 2Y1CA 3DL7A 1UP4A 3F97A 4IJKA 1V3UA 3ZLBA 2MMCA 4OBXA 2H2AA 5KCZA 5CCBA 3NT4A 2VEDA 4L5AA 1G42A 2JCVA 4G24A 2VTBA 3KQTA 4BKRA 1V2GA 4Y30A 3TVDA 3CVXA 1LV7A 1RMQA 3STYA 2EVWX 5LU9A 3GV0A 1YFZA 3I2HA 1YJCA 2B82A 2P9YA 3OLQA 4G1UC 4Q9IA 4IDCA 5TC4A 3RRFA 2AKAB 3CN9A 3EHDA 4TWBA 4LF5B 3E9NA 4HWGA 2CMKA 1Q3HA 5D01A 5C1DA 1PEKE 3HBLA 4G0NA 4LJ6A 7MDHA 1ZMBA 2AWNA 5EEGA 3REQB 5KQMA 3LT4A 1C1DA 4K05A 1S3GA 1Y89A 1EVIA 4Z0HO 2VCHA 1DRWA 3OLCX 2E7ZA 4PYKA 5TVGA 3H8SA 1EFHA 1XZMA 3E58A 3RODA 3X1MA 2JIMA 2WU4A 2QNBA 1Q7CA 2VDJA 2GN0A 3MJRA 1OX4A 3EMVA 1JTFA 2WWVD 1FMFA 3ORRA 3RK4A 1ESCA 1MDBA 1NQXA 5IBCA 3EPLA 1IM2A 1YCFA 4OREX 2G1PA 4M8NE 1VBNA 4P35A 5EZYA 4N3AA 5CD9A 2DFDA 3VNRA 3FUWA 3NBKA 4KVFA 4J03A 4LGMA 1QUEA 4AMUA 1S1MA 3CKKA 2HEIA 1HDXA 1PTJA 2YRWA 3F49S 3GGSA 3L7BA 4HWOA 4C0KA 3TGLA 4JI4B 3B1YA 2HA6A 1JIJA 3CRRA 4JZKA 4RY0A 4Q9KA 4EG1A 3MW8A 4DZRA 3LWNA 3R4CA 4XJSA 4DDKA 4DPKA 1A77A 1LLUA 1N2GA 3GFBA 3O4HA 1LDNA 3C14C 3EH2A 3NDIA 1WXEA 2ZUTA 1FB5A 1G8SA 4PX3A 5CG1A 4YJGA 3ZNNA 4D97A 4DMGA 3M4JA 5KHLB 1KP2A 3ZZ1A 1PNOA 4ISCA 4WXPA 2PZKA 3MTIA 4P9NA 1Y9JA 3OCYA 5LZ4A 3U44A 3NEAA 5EWMB 1DDIA 1R6VA 2R9VA 2VP6A 2E48A 1L4GA 5LYJB 2CLIB 2SNIE 3U1BA 1OXXK 1U9YA 4HZGA 3TNJA 2PLFA 2W6PA 1ONSA 2OFOA 5KJCA 1I2MA 5AVOA 1K2WA 4UHJA 4YMWA 4LZOA 3LCRA 4XLLA 3SG0A 3VGJA 2LE0A 2ENUA 5JDCC 1G7SA 4QYWA 4U39A 3G2IA 1GZ6A 3E8MA 1U0HC 3SJAA 3GUZA 4G0OA 2GAFA 4S24A 1ZKDA 2G5TA 1IPEA 1MIOB 1MQAA 4LJ4A 3RG8A 5B4VA 4IKEA 2XB6A 1II8B 4TV9F 5B7QA 5I8PA 5IKEA 1RM3A 3PXCX 1ZJWA 1Q1EA 3P2MA 4UNNA 4FMCB 3L6CA 4Q7QA 4WKOA 2QTWB 2G67A 3LVBA 3CLUC 1G41A 4QECA 2M6KA 4V2UA 5HZKA 2O8EB 2JJ2D 3FWYA 2XUJA 3IQEA 3VJLA 3HM2A 1FTSA 1RXSA 1ECGA 3SHQA 2FLKA 3K32A 4PXSA 5TQ0B 3SZOA 5KDOA 4XD2A 2CFOA 1L5VA 2W58A 5PGMA 1T15A 4HSGA 3ZE6A 1K7CA 1OZHA 2ZE7A 3T3OA 5LZ5A 4M53A 2O0MA 3A58B 2CL5A 4FS8A 4PNPA 4BQOA 3VAYA 4EHBA 4F6RA 2YWDA 1NE2A 1WXQA 2B0JA 3HJHA 1JW9B 1ZD2P 3I6BA 4LVCA 4L51A 1V5WA 3NWJA 1XEXA 5SY4A 3TGWA 4ZJZA 2B4KA 3UC9A 1E1CA 1RWMA 2YDXA 1EGVB 4UBMA 1BRMA 4DY4A 4NATA 1K8XB 2XXAA 1IM5A 2PMKA 3R3WA 4TMFA 3C8HA 3R75A 2O7SA 2HFKA 3PDJA 4PAGA 1KKUA 3GMDA 4B31A 4PBTA 3CSUA 2C1EA 3OI7A 4QC2A 1YZGA 2FWRA 2B34A 3A05A 4NF2A 2X5NA 2BZGA 4X94A 4MA4A 3H4TA 3HL0A 3OQVA 1EWYA 3KLBA 3IMCA 1T8RA 1O94D 4YRTA 4AWAA 4JEIA 4U4AA 5H1YA 1EBFA 5KVQA 4EKIA 1F60A 3HN2A 3KKPA 3GEIA 4LFCB 1MOPA 1R8XA 3NHMA 2C2BA 1WCWA 3OJLA 5BO5A 1YDEA 2I54A 1H5NA 4BMZA 4LZZA 3P1JA 2MSLA 3F8WA 3JTMA 3AXTA 8ADHA 4A92A 1U0JA 4BVEA 1EFVB 3ZK9A 3ITDA 3JZMA 4RA9B 1FQKA 2P9QA 4QU9A 3UWPA 2GESA 4F60A 5L3SB 2QD4A 1OX6A 4B5KA 4Q1CA 3I6IA 5CH5A 1JQBA 4RNCA 5KQPA 4ND6A 1U1FA 1I33A 4MW5A 1Q77A 3H5TA 4TSKA 2VXOA 2BMEA 2YNMA 4ER6A 3AM1A 1A7JA 3GBPA 4HX5A 3MUOA 4X9XA 2IWHA 3LGXA 4A9AA 4GVPA 5KNBD 1QHFA 1GAXA 2FDXA 2V6MA 4ND4A 5M2QA 4TLBA 3CONA 2REOA 4IDGA 2D0PB 2AF4C 1EE1A 3B1ZA 3IODA 3D1LA 2F48A 4O8ZA 1S4MA 5CCDA 1GSHA 4D81A 3QUBA 4GE3A 1ZQ1A 1NIJA 2BLNA 1GTRA 4BNMA 1COZA 3MYRA 5F76A 4H1UA 4OK5A 2V7TA 4KWIA 4GQIA 5L4LA 4JBWA 1O1YA 3I9OA 4D79A 3Q3IA 1YQQA 4WNAB 1BWPA 2D5LA 3O7WA 3WY9A 2HBZA 2Z1DA 3JASA 4GX2A 4N5DA 5BVGA 3ND6A 5JS1A 3IIJA 4DPLA 3WWYA 5FBWB 3IQGX 5BSUA 5FWXA 2HU8A 1U6JA 3BYZA 3HJAA 3WLTA 1XAGA 2OAGA 4B8YA 4BEJA 4MVJM 3OCJA 4P4TA 5A4AA 5K20A 3VHQA 1EQAA 1NDUA 3TKAA 4DV1B 4LF7B 4YRDA 3DVRX 4WH0A 2BONA 4XFDA 1RI5A 3Q7PA 3U81A 1TUBA 4Q3EA 4QXPA 2KWIA 4AB1A 3A3PA 2WFLA 2ZYAA 3OAAD 3RJZA 1YU6A 2Z6AA 4IZHA 3V7WA 4DYDA 3GJYA 1KI3A 4FDMA 4K88A 3E3MA 1XLWA 4Y6PA 2J46A 5BRAA 2HA7A 3H5WA 2V7UA 3HLTA 3HNPA 2EV9A 5DM0A 3NOXA 1KE1A 1SKYB 4IJQA 2PL1A 3INTA 3OO0A 2HA3A 3P4UA 2CD9A 3TFQA 5H68A 2QLTA 3G5UA 4BNYA 1XLVA 1JDNA 2D3WA 4IIJB 4BC0A 4XOIA 2GF0A 1MMFB 2LRHA 3BMNA 1L8XA 4K40A 5HF9A 3V3TA 1M9NA 1YACA 1G5TA 1I3KA 1P39A 1JZQA 2BGJA 4AW9A 2PD6A 3PUVA 4MR9B 4P38A 3SC2B 3A1VA 1UMCB 4EB3A 2IDZA 2WTEA 1Y6JA 4FLMA 3TQOA 4DRZA 3USZA 3ZE1B 1MHPA 5KTKA 3T5GA 2C9CA 3RDPA 5BOSB 4JITA 5HX7A 4OMCA 1GG8A 3N6RA 1V9SA 2HNKA 3JQ8B 3Q15C 3LK6A 1FSSA 2I6GA 2P8SA 5L3VA 4KQFA 4U2FA 1UBKS 1P73A 4XEHA 1T0IA 4PC6A 3G0DA 1HOTA 2EJUA 4NENB 1UZMA 5KINB 1N1DA 2O5EA 4M8SA 2BI4A 2Q49A 1UJNA 2OXFA 3BKXA 1KAGA 1JHPA 4OI2A 1P2UA 2P7IA 1VYTA 2YC4C 2P2GA 2PPLA 5EVCA 3UAXA 1E1RD 4K9KA 4JQYA 4AMYA 1EVKA 1HE2A 3VR3D 4ASUA 2YVUA 5H4HA 1ZM4A 1QHSA 4CKZA 3CPEA 5K0GA 3H9BA 4HYTA 3VDMA 1WMFA 4NE7A 3Q8LA 2W0MA 2VYNA 3EVFA 3NEYA 2ZVQX 2J7PD 3TMKA 5LR6A 1S3SA 2AX4A 4HH4A 2WQ6A 3QLJA 2NT3A 1U7XA 5J5AA 1AD2A 2ORVA 3R0IA 4BVLA 1EA5A 2FB9A 3QUCA 2IITA 2Y1XA 4QPCA 1DTEA 2HWYA 2AG6A 5AJXA 4N47A 4AURA 4J7AA 4PO3X 4R9UC 3NBXX 4FOPA 4HOYA 4IWXA 3UB3A 1OTXA 1XZJA 2IZZA 2VUTA 4G0UA 5CPFA 2BBOA 3QU9A 3KQSA 4MQEA 3TQSA 1CY7A 1EVQA 1RVDA 3WMWA 5BYJA 3BREA 3DP7A 3ZTYA 4PG5A 1I32A 1XTKA 3ZNPA 1H0RA 1I36A 2BEVA 2PZJA 2R8YA 4Z3DA 5FR2A 2GETA 1UH5A 2L17A 1AGYA 1EGQA 4LTMA 3U09A 4EH1A 4UVHA 3E2PA 3LOQA 3W2HA 2GPAA 5EL0A 3AF6A 3BICA 4OK3A 3FI0A 1UBLS 4HQLA 1WQ4A 4UDOA 5AI4A 5I8WA 2OP0A 1NVUQ 2KSQA 4AROA 4DR4B 3DDOA 3DLCA 4DILA 2J32A 3JVIA 1W85B 2FDRA 3QWAA 3V6LA 1GDTA 5AOVA 3EB9A 3C85A 3Q88A 1DOAA 4W7SA 2XODA 2IUFA 1NBHA 1WLYA 4ZPJA 4JLPA 1O5IA 1DOHA 5KREA 1CZUA 5AM5A 2CDNA 5B12A 2JFFA 2OBFA 3O4GA 1O77A 4L95C 4ANFA 4TVBA 1XYVA 4IXDA 1JPJA 4MQLA 1ODFA 3E70C 2Z57A 3T41A 2IU4A 1AS0A 1ECFA 1NBEA 2ZP1A 3TLXA 4CM3A 2Y3IA 3VZBA 2H7CA 2HXSA 4XYLA 4FXPA 3OEWA 5AM4A 4Z7OB 3F3MA 3W6OA 3ZLJA 1VXRA 3UCXA 4O4HA 2E4YA 2XXBA 3CLHA 1ZK0A 8ATCA 5ESDA 3QA3E 3KZNA 2EDAA 4L0DA 2FQYA 3RFTA 1PU2A 3Q5EA 4PIPA 2G36A 4TKUB 1Q0UA 2C1XA 2KQUA 2REQB 3P0IA 3BWMA 3GFSA 3ONVA 4HDSB 4YJKA 3EVGA 1JQDA 4CTMA 5CAEB 4L5JA 1TECE 3PC7A 4EENA 4GWLA 5JUWA 4DEVA 3DE5X 3O95A 4MHOA 4DJAA 2AQIA 3FSGA 1E9BA 1JRLA 1PJ3A 3BB4A 3QFSA 3H6GA 3QIAA 4LOIA 4BQSA 2PUBA 1SXJD 4OGFA 1XSEA 2F8SA 4OHVA 3MERA 4TTJA 5EUQB 1KEEB 1V8ZA 2F43A 3H2SA 4NMHA 3GJ6A 4NV0A 4F84A 4V1CA 2K6GA 4JVLA 3GJZA 2Q5OA 4H0FA 3ZWCA 3AGPA 2PSEA 3WP1B 1JR3A 4FN4A 1C0PA 4DTCA 5BP7A 3EJ6A 1ECLA 4HGZA 4DIKA 1M2OA 2QR3A 2CFIA 2W8ZA 3AZPA 2EKZA 1UC8A 1XA0A 3GI1A 3OE5A 2XY4A 4ND1A 3TXXA 3GIDA 1U3DA 4INOA 4ZOBA 4YCDA 4MVWA 3IKLA 5JV5A 1T13A 2JFZA 2FP4B 5B30A 1IOZA 4PQEA 5CYOA 2QYSA 4FZ3A 3CRZA 5B1IA 2OLJA 3I6MA 1BX3A 4K87A 3WYBA 2V3WA 3OEHA 1C1HA 2W4QA 5SZIA 3OZIA 3L2OB 2OYRA 5CIYA 16PKA 1U5BA 3DQQA 1C9JA 1R3DA 1ZJ5A 2QP3A 3CF0A 2XKBA 3IALA 3PC8A 1WD5A 4YDHB 4ETNA 4AJLA 3ZXIA 3D7SA 3AESB 3QXJA 2G70A 3IIIA 5JRDS 3Q10A 4W9NC 2PSJA 2VPXA 5ED0A 3U4CA 5H7XA 3OD5A 3WDKA 4NK5A 1F0YA 1UC4B 3QOFA 4XWAA 5IAKA 1KJIA 1J5EB 2BFEA 2JFUA 3EEIA 2C7GA 1L7OA 3R8FA 3PXDA 1RI1A 1W49A 4QPJC 3NAQA 2PCLA 3ZDXB 4FD3A 2CHGA 3BL8A 2FMIA 2GHQA 3N07A 3OZGA 1F1JA 3HRIA 1KE2A 4PFSA 2WNHA 2VLBA 5AK0A 1BYIA 2AHOA 1Z62A 2PY6A 3CPSA 4KMRA 4F71A 2L42A 1CR0A 4JLOA 4ZDIA 4HRVA 1ZUHA 3PP8A 3IDOA 5CCXA 1FY2A 1VBMA 3EVCA 3L4BC 5EE5B 5A5DA 3P9QA 3IKTA 4L07A 3PFCA 3RV3A 3AUXA 1RQLA 4LCEA 1H6DA 1GTZA 2NACA 3UHAA 4CTKA 1NRWA 4BFSA 5EP4A 1DWPA 2QJTA 4C3ZA 4X7MA 1FF9A 3MQFA 1XEWX 4L50A 2OM2A 4AS2A 2CXXA 1IHXA 1GIAA 1UR5A 4I9UA 3OFJA 1Z18A 3VR1A 3IDAA 3LV8A 1VE5A 3KXLA 2ZUCA 4OLFA 3F6BX 1V8DA 3JQAA 4JX9A 5FWYB 3I61A 4UASA 1T1GA 1R9GA 1W6UA 3IMEA 1ULUA 1US8A 3LM8A 2UVPB 3H3XA 4FSXA 4ZOLB 3REOA 2PR2A 5E95A 2XT0A 3I8SA 3I6YA 4CLEA 3TMYA 5I9LA 1ODJA 3DHWC 4JWTA 3OZSA 1EZ1A 1WZ2A 4DCOA 3Q4GA 4ZYLA 1AS2A 5K6TA 2JLZA 3AU8A 1C8KA 2I4LA 2XH8A 2XWSA 5CG2A 1XMSA 2WWYA 2O14A 4R05A 3M6VA 3RH0A 2Q2VA 3W2EA 1Z9BA 3VHLB 5E6RB 5ALRA 4LCBA 4AICA 2HC9A 5I7RA 2WPNA 1JBEA 3HV2A 5JCOC 2C8JA 5EZQA 1QF6A 2YFQA 3IT0A 4ZOQI 4JX8A 3FMGA 1RYEA 2WIKA 1YB2A 1JWBB 1WX1A 2CVHA 2GCPA 3TXYA 2XE8A 3MGGA 3WRXA 1C9EA 3ZHOA 2XGOA 4FWBA 3TOSA 1K88A 1BSVA 1U0TA 2A58A 5GV7A 5M3BA 2R1ZA 4FYHA 3DAYA 2Q9BA 4HXEB 1VCNA 2QUIA 4M0UA 3D3WA 3BN3A 3PJDA 1O58A 3ZV6A 2EBHX 2OSVA 3OD1A 5BQFA 2C8LA 2JZOA 4OXKA 4R1QA 1XL1A 3PRJA 3EBOA 5C32A 3WO1A 2QRNA 4R5MA 3DMGA 3EPRA 4YUZA 2V9ZA 1AH2A 2Q6IA 2A2ZA 4LJSA 3TJMA 3BHJA 4RJLA 1Y6FA 2XT6A 3PGA1 3I83A 3ILYA 1XXHE 5JZMA 2FQ1A 3EEBA 3RYCB 1UBFA 1A9PA 4IIEA 4NR0A 1IQPA 2HDHA 1FXSA 5EEHA 4ZODA 3BAZA 4CMIA 1ND5A 1EQ2A 4JLUA 5DO9A 3D8HA 1OXUA 1CV2A 2QXUA 3LAWA 4HP8A 3T4EA 1HLGA 1KZ7B 2ZAYA 2BKVA 2WC1A 1OTYA 1XDSA 3JPWA 3DMPA 1QYVA 1YMUA 4YRFA 4J16A 1UKVY 3ECCA 5FL7A 1TUGA 1SQFA 4DG8A 1TVEA 4HLCA 3X1ZA 4R8LA 3D3EA 1E59A 5DM2A 5JFOA 2W6CX 4IOKA 4CN8A 5JY6A 3S68A 4FYIA 5KYWA 4O1HA 2HZBA 3ZK8A 4OQZA 5F52A 3EVNA 4WJZA 2BMDA 5B2FA 5AM3A 2WE7A 4YC7A 3VSBA 1JBQA 4UU7A 1F8GA 4JQZA 1OREA 1RAFA 4NNOA 1VIVA 1PBTA 2X86A 2XDQB 4GNRA 4BGEA 5C8YB 4PQYA 1JEDA 2QRKA 1GITA 4V0RA 2ZUVA 3GHYA 3HP4A 4R1TA 3C3PA 1EK5A 2BGTA 4H3SA 2WDZA 4EHFA 1PR5A 1LNQA 2Q4DA 3H8VA 3GQVA 4H0CA 4HPJB 3SQWA 5JFGA 3DC2A 4HMOA 1XNHA 4EABA 2IV3A 4HVCA 2Y05A 5IM4A 2EHDA 1LBTA 3JQCA 1ZNYA 1LD3A 4QYIA 2WWHA 4DXHA 3G2KA 4O2LA 4AL4A 4X8MA 1SOWA 2OGSA 3IJEB 3WMGA 3ZJYA 1BE6A 1HPLA 2V5UA 3E03A 1TJYA 4ZDJA 1LB1B 2HLDA 3BRCA 5MN6A 3IVMA 2X8WA 2XUHA 3BSYA 3MWJA 3UJNA 3WDSA 4LF9B 1QV6A 4AP9A 4C22A 2AJTA 3ZGVA 2ISSD 1C3JA 2XYRA 1DAOA 2X0NA 1JYEA 3LKVA 4NQZA 2IV7A 3KEGA 3WLLA 4BMNA 5LA6A 5K3EA 1FJXA 5C5DA 5J1SB 5ALXA 4F2WA 4OP3A 1YDFA 1RYYA 4E13A 3PCRB 1NAIA 3TNDA 5FOXA 1LPPA 1QGED 1L6IA 2Y1WA 4IVPA 4KLRA 4GGPA 4BDSA 3M3PA 2YJ3A 3IAFA 4UE3S 5DRTA 3BRWA 3TN7A 1QMPA 1EFPA 2Q3BA 2V1XA 1KJYA 1ESZA 4FJ1A 1E0DA 1P74A 5F1PA 3V2UA 1O97C 3D8NA 2IHZA 4OB6A 4WT7A 2NXCA 4INPA 1DQNA 3DZCA 4HQRA 2VPQA 4KZKA 1U2SA 3C3AA 3ZDBA 1V37A 4FU0A 2IC5A 2XMZA 3ZWAA 2PMWB 1Z7EA 1K89A 2V9PA 3O4VA 5FNVF 4C29A 4R40A 1IOVA 4RQAA 4L27A 1VYHA 1MG5A 4A0HA 4FKZA 3U7QA 3BFXA 2H59A 2OY0A 3GGJA 4R16A 4WOKA 2J3DA 2GJ8A 4RKEA 3D4IA 3I2FA 4AC9A 3IQIX 2GKOA 3W2IA 5CU7A 3EZ7A 5H16A 3CE9A 4YRGA 2OVFA 4O02B 4RFSA 2HPVA 2GA8A 3D54D 3KOXA 4M86A 1HSOA 5K0JA 1GZ3A 3HVIA 1ZD9A 3PX3A 1IY9A 1J0CA 2ZI3A 3HKCA 2ATIA 4P0PB 4KE8A 4K6HA 2VP4A 3GA5A 3L4SO 2AE2A 5AJYA 3F7NA 3SJ7A 3WZMA 3K8QA 2WYIA 3W5CA 1XB2A 2NO6A 4Z9FA 3C6ZA 2Z09A 3LXMA 3GMIA 1KFEB 1ZA2A 2IYNA 4DMLA 3G8AA 1J06A 2QN6A 2P6RA 2H5EA 5D8DA 4UXJA 1Q7GA 3RAFC 3OBBA 3BK2A 1JS1X 2MT9A 2QZJA 1JMKC 4GP9A 3LX4A 3PV0A 2CE7A 1XVAA 2I33A 1R0XA 1J5PA 3GLKA 1EB9A 3BB1A 3RYHA 2FSVC 1YK0A 2IPXA 1ADGA 3KEOA 1LDBA 1BFKA 3KJZA 2CJPA 4HVTA 3X1YA 2OM6A 3TW8A 3TLGB 4UU8A 3WK8A 4GL2A 4V0LA 3FZYA 3MSXA 4KBFA 3RFXA 3V1LA 1HXHA 1U80A 5FFFA 3QY9A 4C4YA 5JWRA 4G5GA 4MPDA 3TOXA 2NUTB 5B7PA 2W2KA 3A3YA 3UC5A 4IV5A 4EOGA 4NBVA 2CLSA 3SNHA 4Y67A 4D02A 1B6RA 2Q7XA 3WLRA 5LIPA 1LXCA 1JJVA 2CLLB 3M81A 4ZCIA 2D1RA 4XVRA 4X84A 5TJHA 2EX4A 2X2EA 5EIAA 1IZ9A 1G20A 1KA9H 2XUFA 4Z51A 1A9OA 2FSIA 4BO5A 4DAEA 5LP1A 4R1MA 4ZARA 3T3HA 2CDAA 1EXDA 3E1SA 1E58A 1VFPA 4U3JB 1OBOA 1JGTA 3K20A 4FZ5A 2O3JA 1PNQA 3VPHA 4CCYA 2Q5QA 3WTCA 1Q12A 5EIHA 4IIVA 4WNCA 5GZ3A 2TSYB 3P32A 3S2ZA 1EU1A 2A5LA 4DNQA 5L9AA 4X3PA 3TAHA 3CLTC 3QKWA 2DOKA 4ZYXA 2V4MA 3S1SA 4M9ZA 4FFMA 1NVEA 1N3IA 2BBTA 4PY2A 4LKOA 3B82A 3AH8A 3P97A 5IVIA 3TSWA 4CE6A 1A9XB 1HORA 2CSUA 3DFFA 3HKBB 3DDNA 2JAPA 1ESEA 1OYYA 3LX5A 4R7TA 4WFJA 4YHBA 5KCMA 3ENKA 2AN4A 4KXMA 4MV6A 3OU2A 4DPMA 4YP7A 5DYNA 1NYTA 1R6XA 1XTIA 3QLEA 1KU6A 3TBKA 2Q2WA 5CTJA 2H4XA 4PZYA 2IXAA 3MTJA 5CB4B 2O7RA 4OYHA 2C4UA 1RWWA 1EX6A 2GPYA 1PJTA 1ZVJA 3KBBA 3VU8A 3C5VA 2AUNA 3PNVA 4HWKA 4PFKA 2EBUA 1TCUA 1ZZGA 2WV7A 3DDHA 1TA4A 4JK3A 2M98A 5FLYA 1SHUX 1E3TA 1T8WA 1EXNA 2I55A 4IFEA 1Y8QA 3RFVA 2Q3HA 4MV1A 3TRJA 4M36A 5FUBA 1QKKA 4PINA 5IW8A 2PBFA 2WP8J 3KVYA 5B1HA 4IHJB 5HZHA 3UGKA 3K0CC 3FCXA 1YA4A 1NXOA 3U4IA 4NH4A 3TQTA 1P61B 2YV4A 1XUOA 2YJNA 4GR9A 5DSXA 2HSEA 3DM9B 4Q4DA 1SBQA 2XWQA 5KBYA 3IFSA 2GVNA 4JLSA 4R1NA 4R2MA 2W6JA 1JMVA 3HXQA 2C9ZA 3L82B 2VHWA 5BVHB 3N2YA 5JLJA 1DEOA 4CTOA 3P9XA 2RGRA 3GPBA 1C9KA 4N6OA 4R0MA 3AETA 1LLDA 1Y3IA 4UEJA 5IT0A 5TQVA 2Q0XA 4UM5A 3S1AB 1XMIA 2QJRA 1XCOA 3WV4A 4RVGA 2Z2ZA 1GY8A 3EIXA 5FYDA 2X5KO 3L4EA 3A9RA 3KOYA 1E7SA 4PQRA 1W52X 3CF2A 4Y2HA 3CB2A 1Q57A 2C2WA 2C7VA 4MW4A 3EMKA 5ANRB 4KXVA 3VHXB 4GLJA 5AHKA 1IJKA 4J3FA 4N0PA 1EXMA 1VMKA 4WZZA 1RWPA 2JGKA 1Q1NA 1FDUA 3TOZA 1ZC4A 2POCA 1GWNA 2AJCA 4N9QA 5H9WA 3B5EA 2GARA 1TUIA 1DC3A 4EZEA 4G9EA 3LVRE 3DGFC 4CLOB 2CK3A 3KVNA 2B5WA 1EAMA 2F59A 3LDGA 4FC7A 2HTFA 4XUCA 4YAJA 5MN5A 3KTFA 3TRDA 1E1QD 4NH0A 4WV3A 1KAMA 3U7IA 3X44A 4EARA 1KXJA 5EJ6A 1BS2A 2WWRA 4WZAE 5CFMA 4FE7A 4E1VA 1T2NA 3B48A 1LVUA 1SG0A 2XOEA 5TGZA 1VKHA 4E0BA 3DT9A 1Q6YA 1ZGBA 1OGJA 1RT9A 2ADFA 2CN1A 2PHZA 3ZQJA 4HNTA 4C0SA 1F2TA 2ZSHA 1E20A 1WV0A 2WK1A 4KJZA 1OPXA 4OGWA 5AM1A 2RGBA 3AGQA 1N6OA 3OU6A 1CLEA 1XDBA 3PIDA 1LJ8A 3T3GA 2C5AA 2XE4A 4GPTA 2DEUA 4DQVA 2ST1A 1WUTA 1YKFA 1GT6A 1H2RS 1IHPA 3ZVLA 1D0SA 2WAMA 4YT5A 3H2GA 5GJCA 1PW5A 1DQRA 1KEWA 3RABA 2WIAA 2ABWA 3K09A 1IN7A 1TKBA 1U8AA 4BBZA 4LYHA 4CFSA 1PJSA 1G7RA 1PL0A 2DX7A 2G04A 2FWMX 4HAOA 4I4IA 1A04A 2DUMA 2FJPA 5LBUA 2QVLA 1XVUA 1HX7A 5EN4A 2POQX 3ESDA 4ZJUA 1R50A 4NBSA 1SZPA 3M1LA 5BV8A 1YOBA 3OCVA 4FDUA 4U7TB 1JA0A 3ZW8A 3PUHA 4C04A 3MRTA 2BEJA 3ZJUA 5FPQA 4V0MA 4DIFA 1WW3A 1JKFA 1HURA 2CLOB 1YBFA 2GJAA 1YJBA 4WSOA 2BGGA 2LBPA 3AIKA 1MABA 4Z4IA 2JKYA 2ARKA 2PSFA 2I2WA 3H1BA 1H66A 1GGKA 1VPLA 1GPLA 4B4WA 2PSHA 3OKCA 3VMFA 1TM7E 4MV8A 4ZANA 4OHOA 5IASA 1XQXA 4N7RA 1UJMA 3NIBA 4FQ8A 3UPTA 2BMFA 1X8XA 1DIOB 2VOJA 3TWOA 1GILA 1B8VA 1GUDA 1WB5A 1DTWA 2MSWA 1P1HA 4BB9A 3A9TA 3GGPA 4MUIA 1DBSA 2JGNA 4MCHA 5BR8B 4EI2A 4KAAA 5KO2A 5HQTA 4DLBA 1QG0A 4G1VA 5H80A 2X77A 3W79A 5L3RA 3R9WA 2XGSA 3EX7C 4GIBA 4TMVA 1V1JA 1ZZEA 3JATB 4A6XA 2OYSA 1XVLA 4I5EA 2ISCA 4ZVMA 3ANXA 2B2CA 2AK3A 1RXIA 2OK7A 2BM0A 1MO3A 4MB0A 3SNKA 5FHQA 2IHBA 4RETA 3ZCTA 1N9GA 3DOUA 3ZYCA 3NFRA 3WRYC 2ZYIA 1H85A 5A4DA 2A9OA 4B7UA 3BFVA 5GINE 5LB4A 1GLNA 4ZAYA 5KYTA 4ME6A 5CGZA 3Q7IA 4YJHB 2DSNA 3OVMA 2OBBA 2XRMA 4TUYB 2OMEA 2WWXA 1VE1A 1ZN7A 2B8NA 3DD1A 1SQSA 5G4KB 2UZAA 2AN1A 3SEQA 1QQ7A 4YCSA 3WWPA 3ASVA 3B1JA 2C4TA 2R4UA 3CW2A 3LZCA 4RVCA 5DHPA 3VU0A 3W2GA 3AI1A 5HPYB 1R5BA 1GPNA 4BV2A 4OMUA 4AY3A 5E7IA 4D7AA 5ARBA 3PSAA 1CZHA 1T25A 2GZ3A 3CZRA 3U39A 3UWKA 4DJ5X 2FZEA 3SM9A 2LIVA 2QL6A 1IY1A 1UQUA 2A33A 4IIGA 3C15C 3CWZA 3VUFA 1QIMA 2DJ5A 2QUKA 3I2KA 1AN0A 1JLMA 4BAZA 4N41A 4OI0A 3MQ2A 4RD6A 3RV4A 1SHLA 2W00A 4NI5A 4REQB 1Q0ZA 4UC0A 5YASA 1H5UA 4EPRA 2O7VA 5AQEA 4D9KA 1SZDA 3N2LA 2R1TA 4MS4A 1QAOA 3E1GA 5EJ8A 1VIMA 4MS1B 4PCLA 3PGVA 3ROPA 4EJSC 5B64A 3O3MB 1DRVA 3O1JC 2B4RO 5DM4A 2N9UA 4FHGA 5L40A 1ZRHA 1NUTA 2E37A 3KS9A 4MXDA 3OZCA 2CGEA 4WBSA 2O3QA 4PF1A 1KDRA 3C3CA 3QVXA 4WXHA 1ND6A 5FBRB 1TMOA 4DMKA 4B6EA 1CEYA 1KF0A 3JARA 1JSLA 3D43A 3ZKWA 2KMLA 1EGAA 2O0KA 4LXHA 2A6PA 5JI3E 4B7CA 3KYDB 5CP8A 2Q6OA 1HV8A 1FK8A 1KH1A 2D4HA 4GOND 3DFUA 5AIBA 3DMDA 3K1ZA 1KQFA 5IPFA 4IF4A 4IFTA 6NULA 2EZ9A 2UYCA 3OJ0A 3NVKI 4D9IA 3RARA 4AO6A 5CT9A 3LDUA 1XALA 3IQXA 1QZ3A 2ZRIA 4PYNA 5EUBA 3LYAA 4CCWA 1G5QA 1JB1A 2CVPA 3FM9A 4CCSA 3THSA 4ZMBA 4HAWA 2X3YA 4OGLA 5K3AA 3MWDA 5CNKA 1UANA 2ZAOA 2BFFA 4X60A 3CG0A 4WCVA 4IOLA 3D7LA 3SJBA 5FPPA 1OHHD 5IYZF 1GAQA 3F3KA 1T9GS 2Y0EA 3A1NA 4NAHA 4S0XA 1H4SA 3GRUA 5ALKA 5EJMA 3AFNA 1M66A 3Q2KA 4HBZA 4EEKA 4G0YA 2XAAA 3K6SA 1EFRA 4BUZA 1WAMA 5JHGB 3FNIA 5IAJA 2RGEA 5EHIA 2HU5A 5EHQA 2DUNA 1JXMA 3DFIA 1UPXA 4MVYA 3T5AA 3AVYA 4MR8B 3ZHSA 4GO1A 2Y92A 3CSDA 3M6AA 4FW9A 1JTVA 3SZ3A 1HF3A 4A2QA 5CB6A 5JBNA 4NY1A 1COWA 3G6KA 5ITSA 1E4EA 3FYUA 1ZK1A 1UBOS 2I65A 3FNBA 1U0LA 4I9FA 4PAMA 4ZV7A 2J4CA 4JJKA 3V4OA 4DSZA 4BUCA 2ODEA 2PKQP 2CL6X 4ARUA 3FCCA 5KUTA 1M67A 2E18A 1U8XX 3U3DA 2PXXA 4OOEA 3W7AA 3PGXA 1EDBA 4L0CA 2VQFB 5DRYA 3PEEA 2VF4X 4URXR 2R68A 2X19A 4RELA 1CZNA 2ZB4A 4YCNA 3N53A 3EC7A 3EDYA 1M6NA 2JLAA 4UZFA 2OT3B 3GZNB 4QTYA 1F20A 4CIBA 4J6FA 5CDFE 5D87A 1P0CA 1WUHS 2CDRA 3G5TA 3T4UA 4CV0A 3P96A 3DCYA 1JDBB 5JIBA 1UT8A 1OCEA 3FGPA 4UQOA 3OWOA 3AW9A 3SCZA 1NJ2A 3SVZA 5KOYA 4W5TA 3K15A 4F5DA 1I3LA 3WWCA 3ZUPA 3KXKA 1C7JA 6YASA 4WKBA 2A0WA 3HEMA 4QYMA 5HDBB 3RSQA 3RVRA 2ZB7A 1GU7A 5DULA 2R8RA 2O50A 3BK1A 2YXDA 2CXRA 2EJCA 4KFTA 1H3EA 2RARA 5C7LO 2V4ZA 3F0TA 3HJBA 4MR7A 5HKKA 2OKGA 1WM1A 4PYQA 1KI6B 2DWUA 3L41A 1YVPA 4N54A 3ET5A 3ZU2A 3M5CA 3W05A 3U6BA 2Q2NA 2X14A 4BNTA 4MDHA 1EGMB 1WHSA 3H87A 4BTEA 1FNNA 1MN6A 2I7DA 2HSWA 2P6PA 2PH5A 2PX5A 2GO7A 5HR5A 3B3GA 3F7MA 5KYVA 3IPLA 1OZ0A 5JHHB 4O29A 1E99A 2J9FB 2ZEJA 4C4SA 4YPVA 1UFVA 4U00A 3GRKA 4X1YB 1KDTA 1K06A 1GVNB 3Q3VA 2JFNA 2DPYA 2JIPA 3PGLA 1JALA 3GZJA 3Q6NA 3QBVA 4RF4A 3VVCA 3U9SA 1M2EA 4Q7EA 2PEYA 3QLVA 4EW1A 1FDVA 4B6JA 1O94C 2G06A 4FNMA 1D2HA 4HJXA 2GSDA 1JFRA 3OX1A 4TKMA 4AULA 1PK8A 3ICQB 5AK6A 1RCUA 2I67A 3K5WA 4TRRA 2XT9A 7AT1A 2F8LA 4C4ZA 1EVLA 3D4OA 1QNLA 2WUDA 4R1SA 4D6PA 5DCYA 2PFKA 2JAOA 4MSUA 4G5OA 4N65A 4BX0A 1YBAA 1O8BA 2XKJE 3V1MA 4XEUA 4PSKA 4LYAA 3O3CA 1WBJB 4BTVA 2JGMA 1N2ZA 3JD0A 1QGUA 2XE7A 1TGYA 5A0TA 4MWTA 4MGKR 1A9QA 2P4HX 4OAPA 4F85A 5LQMA 2VHJA 2CFCA 2O8BA 5IC4A 2Q2OA 1JQAA 4O08A 2Q8QA 4D6YA 3FOZA 2C5FA 5ALEA 2A5DA 1LF0A 5IX8A 3D8UA 1OZFA 1PEDA 3ZBPA 3TB4A 1QHNA 2ZPTX 4XQ0A 3WYCA 1X39A 3PDCA 4IDQA 4ZEOA 1PKEA 3C6MA 3OMWA 3G13A 3FROA 4DM7A 3JQ9A 2FMXA 1MOQA 1Y4ZA 2ZQYA 4OIFA 3UUWA 3DYIA 3LWBA 3PF8A 1M2HA 4BVHA 1YU9A 5K6AC 1SXQA 4Y2JA 3RUDA 4FB4A 4I1IA 1XNJA 1E5QA 1BCRB 5BSWA 5LZ8A 4KH0A 2G0NA 1PGOA 3ET4A 2I6UA 3F90A 1FDIA 3CMMA 3H83A 5TEWA 1FU7A 4BIIA 1TF5A 3BXOA 2FAXA 2OZEA 1FTNA 3QJYA 5CTAA 1CULC 4OYRA 1F7UA 1ORTA 3EQ7A 2D2IA 3IPRA 1CK4A 2EG9A 4FFBB 5B37A 2FMUA 4PQFA 2GXAA 1FJ2A 2HF2A 1R8QA 2X42A 3VBEA 2VDNB 4S05A 3KFXA 3ADDA 2GN4A 3CQ9A 1T29A 3B13B 4YWJA 3HCBA 4DJTA 2AEJA 9LDBA 2PNFA 1CE8A 2OBMA 3Q87B 4I36A 2H16A 4IRUB 1LPAB 3R5HA 5D5HA 4QBIA 1DQZA 4RTNA 1O0CA 2AEFA 3G23A 3IQWA 3PEVA 3H5IA 1L7XA 5AHRA 1OBFO 4F45A 3QSYA 4KITB 4AI6A 2QAIA 1EUCB 4KDFA 1ZIOA 4C4TA 3RE1A 4LCJA 2QWXA 3ZV4A 2G80A 4P3YA 2OO5C 1XROA 1KK2A 2XF2A 2A1UA 1QYDA 4EBBA 4MYTA 2GK4A 4KX3A 3UUFA 3IA2A 4QWWA 2WJHA 4WX2B 3USES 3TSCA 1MRZA 3ZKAA 4D8YA 2HJRA 5COBA 1GUZA 1UOQA 4IYJA 1WB9A 1M0WA 3FOAA 4YJGB 3N3AC 5TMEA 5D00A 3L7KA 3RB8A 4MV3A 4F2PA 1I94B 3WKCA 4EBFA 4F21A 4RLSA 1RRKA 3JQBC 4XH9B 2AOXA 4D4MA 3U44B 3ZBQA 3NH6A 3E35A 2FR1A 4Y1EA 5AVTA 4AKGA 5IUJC 4LSGA 3Q6IA 1PCXA 5FBKA 5SICE 4S04A 5LQJA 4TT3D 5KTOA 1F8FA 1U2DC 3GC6A 4U9UA 2R84A 4UUQA 8MHTA 4Y1FA 4RTOA 1E2IA 1YR7A 2X6TA 4EHAA 2CCKA 1W0CA 5FLXA 2D2EA 3IJ5A 3AVOA 1AMNA 1CF4A 3CWQA 4M7OA 3AVTA 4XR4A 1IH8A 1D1PA 4AWBA 3V7UA 4C1NA 2HL6A 3F96A 4KN8A 5G3YA 3O8OB 1NLFA 1WCYA 3AEYA 5LYYA 1QZZA 5B3AA 1HFEL 4FGUA 1V6AA 3O3OB 3HXOA 5JS8A 3UMMA 4LECA 4M9CA 4I3HA 2RKOA 1LLCA 3GCGA 4KVAA 5GGYA 2J0SA 1PUXA 5CCEA 5LP6A 1PUIA 4RNDB 1EIWA 4F11A 2YHIA 4GD3Q 3HFGA 3U1TA 1RABA 1NJ5A 1RAHA 2P9EA 1TCCA 2JRCA 1GGJA 3D7KA 1IXRC 1C3OA 1E9DA 1HLPA 1PL8A 2OORA 1I6WA 1YONA 3A7EA 3GX1A 2RCNA 4FDTA 3QHAA 3SYRA 2DERA 3QYPA 4CJXA 2ID9A 4YGYA 1OFUX 3HL4A 4KN6A 4UM9B 1KO8A 4CYMA 3VDQA 1T3GA 3HSYA 5L53A 4CT0A 4EY4A 3QH4A 4NU5A 3V7FA 2C9DA 1VE9A 1GNQA 4OJYA 4E7OA 4NOLA 5ALUA 5GZ6A 3H1FA 1WW2A 2IIQA 4L6IA 4WN9B 4OVKA 4A8HA 3MOIA 4L5BA 2WR8A 3UHOA 2XXAB 4ZVNA 3WYEA 4KODA 2VDVE 1MLDA 1XDUA 2HADA 2HYDA 2JB9A 4GM1A 3EIOA 4D3YA 2PLRA 1G3QA 3OQ6A 3P9NA 4RESA 1O6ZA 4JFRA 3EZYA 1A27A 5TS3A 5HS6A 2YN2A 4MROA 1M6EX 5C35A 1F12A 2X0IA 5F2NA 2XZTA 1E7RA 1NULA 3AM3A 2C5LA 1EA7A 2GTHA 3SICE 1ZGZA 3JVVA 3DHEA 1WXFA 3T3DA 3K5PA 1RPNA 4NL4H 5TVKA 3OF5A 4C7XA 4DGSA 8GPBA 4TWIA 5KNBH 3MT9A 4W99A 2HGSA 3HDVA 4J1NA 4NJEA 4DR6B 2DR2A 2WAXA 4N7BA 4WY5A 3BRQA 3NXKA 4JL8A 3RWMB 4IRXA 3G6WA 1GYRA 1C2YA 3CEPB 3QPUA 4LHZA 1ACMA 1VXOA 3F3SA 2V6BA 1E6LA 1NM5A 5KTNA 3HXPA 3GJRA 1M2KA 4TYQA 4WK6A 3I3SR 3A27A 5IKPA 1T4GA 2KX7A 3WMEA 2HU2A 4B8ZA 4QUIA 5I9IA 2QD5A 3PWSA 1C80A 1FFYA 1SD5A 2A9VA 3IUQA 4UAGA 2R8PA 2NVWA 2YWFA 3EAFA 1SURA 2NUAB 3RRZA 4BGVA 5J4HA 5JSQA 2GEDA 5JCJD 3UT5A 2XVYA 2W98A 4Z1OA 1XTUA 5B3JA 4MK4A 1AMOA 3FUUA 4Q4CA 1U7WA 4OAQA 1O7JA 4A73A 1BMFD 3U56A 1QOZA 1RP7A 1SBYA 3TRKA 4JJAA 4QSHA 1YR8A 3LUFA 4MUNA 2ECKA 3M0EA 3JD3A 3VDXA 2LIPA 3C5WP 3DLBA 4Y0VA 2NU6A 2V4UA 3E8XA 5FNZA 2DWQA 3AK4A 2AN3A 4MWZA 4D99A 2WF5A 4TM7A 5DWVA 4TVOA 1CXZA 3BZWA 4LC0A 3KZMA 2QQ5A 1SPXA 1IEVA 4ZCMA 3TOVA 2GVDC 5ADVA 4N7JA 1UAYA 3FHCB 4LDPA 2WKPA 4ZT5A 4MRSA 4UAJA 5B2EA 4YV7A 4HDOB 3VQTA 1TUBB 2JI8A 1Y6RA 5DBOA 2VIIA 2IV2X 1YIAA 4P84A 1WCIA 4DQ0A 1I3CA 4FZVA 2A1TS 4LGCA 2AD1A 2GYVA 4TWZA 2QRLA 4E08A 3EIUA 4A15A 2P5TB 5KQRA 1BGXT 2MSDB 2QNRA 4MV9A 2ONZA 3AR2A 3LIIA 4C9BA 5CEJA 5HM8A 1J56A 1OLXA 2V96A 3NIDB 4MW9A 4Q9NA 1FP1D 3KTDA 3V32A 3VZRA 3KSAC 2JZCA 3BMNB 4YFVA 2GXQA 1K7XB 4JSTA 1H2HA 2C58A 2NV2B 5FTJA 3IKJA 3KLMX 1A4UA 3IILA 4RZXA 1L8AA 2X15A 1E3WA 4R2JA 2FZLA 1FNDA 4H15A 1Q44A 1VCHA 4DLZA 3JYHA 1GZUA 5ESRA 1DG3A 3KCQA 1PEYA 2I3AA 2D06A 1I7SB 3VPCA 3MBOA 1YULA 2OV1A 3CNNA 4DRXA 4GRDA 3C3BA 3AYZB 4U7WA 1U0OC 3H4VA 3NASA 3WJAA 2HK6A 4ENPA 1QDUA 2FW7A 3TE7A 4CEHB 3HEBA 1KP9A 3COSA 1RKQA 3OFVA 1XTRA 1EK6A 1JEJA 3C16C 4G0XA 4FYYA 4YP0A 5TARA 3ZJ5A 1CZKA 3AIMA 3ZX4A 5ED4A 1P1FA 2CJWA 3HFSA 3TEJA 2KHZA 2ZBEA 1VJRA 1OLUA 2E5WA 4M1EA 4ZK6A 5JD6A 4KHPB 1X80A 3IVAA 5EMMA 3HB4X 4KFCA 4FD2A 3P19A 4QQKA 4XW2A 3T5PA 1MP0A 1VBKA 2NTJA 3VZQA 1CJBA 1YA6A 4HDKA 1DEAA 2ZR7A 1DC4A 2R5WA 3CRNA 1PFVA 2OCGA 3FYHA 3MLAA 3MJSA 4I4CA 4LWZA 3N0VA 4PGAA 4QU5A 4QUBA 5AJZA 5C4GB 3W9SA 8AT1A 5I48A 1ID8A 3I5XA 4ECEA 3N1UA 4ID9A 3C7DB 3CZ5A 4QBTA 2PCJA 3L6UA 4FC6A 4FONA 5K3SA 4HNAB 2ZCJA 2UXCB 2PQ2A 3JD2A 5HJEA 3A1TA 3TAUA 1K92A 4MQEB 3ZZNA 4L7VA 3CPHA 3S81A 1GAWA 2PXHA 1IUNA 4EGFA 1BXGB 2O1SA 1WVMA 3ZZMA 3WADA 1K5PA 3OOEA 3B78A 3O26A 4H59A 4F3YA 3AEUB 4K1XA 5F7OA 3OM9A 5HUJA 3UXYA 2VSNA 1I7LA 3HB7A 3GLFB 1NG9A 1ZA1A 2FVYA 1JFSA 3VOTA 4J7CA 3PQ6A 3W8FA 3RT1A 4R9SA 4JI7B 4OFZA 3CWCA 4TXLA 4L78A 5CRIA 4LDRA 2RBGA 4C88A 2JBHA 4L5CA 2GEFA 4N48A 4C2BA 4RTSA 3Q5GA 4BLSA 2V6JA 1R88A 3S55A 1AUVA 4I8DA 4M3NA 4PZCA 3E9RA 3SJUA 1KGDA 2WF7A 1JDZA 2J3LA 3MJCA 3LFUA 3EXHB 4TYWA 1EWQA 2YJGA 1EWTA 4FYPA 1JB9A 1RQXA 2A9JA 2UUOA 3W5VA 1P2DA 4A8JC 1PR6A 3LPLA 1DIAA 2CVFA 1NBMD 4QYTA 4KMMA 1Z5PA 2ZYUX 1Z5VA 2P9ZA 3NIGB 3H84A 4O4HB 4OQFA 3C43A 4DJEC 1OH5A 3VR0A 2ZVPX 3C1OA 3KUUA 1FYXA 4UMDA 3D8RA 5AOCA 4M49A 4GWKA 4J3NA 3LX8A 1ZHFA 4FYVA 4MULA 3FB4A 4IR7A 2TMDA 3WI7A 1E9EA 5FWDA 3F74A 4WE3A 4B33A 4S2UA 5FORA 4KR9A 3KWJA 1IHDA 1L7AA 2FWBA 1CDDA 4C7OA 1VGVA 2G76A 2WYOA 1X0VA 2PX6A 3ODGA 4N5NA 3KP1A 1VGRA 4MWBA 4QD3A 1UBNA 3WXBA 4JROA 3IKVA 4DQXA 2WG1A 4UHDA 4V1CB 1T0JB 3HDGA 2VA9A 1NQOA 2OV3A 5E0KB 3FRIA 4JHLA 1NN1A 2G1JA 3GZ4A 3UVEA 3B7GA 4UNRA 4ZN6A 4YYEA 1CY2A 3MS4A 1L5NA 1NURA 1SPBS 1DXYA 3EWIA 1JU3A 2WVGA 4P4SA 1OA1A 1PGQA 1Y0BA 3CF6R 5G0VA 5KX5F 4E88A 4DNPA 4Q4HA 5BR4A 4K26A 1OI4A 2IPOA 3EPJA 4H7EA 2Q4TA 2OVBA 2B35A 2BFNA 1KDYA 1F4LA 1GNRA 5DHTA 3EXIB 3OTIA 3N8DA 3SR0A 2YY6A 1NNI1 3B8EA 4ZZ0A 1LA2A 1UCFA 2ZT5A 2VJNA 5F21A 2JARA 2PGLA 2GILA 3ECAA 4KQKA 2OFPA 4HLUA 2AHRA 3IVGA 4JUIA 1LU9A 4QE3A 3ZHUA 2ACWA 5T3UA 4U7PB 4DE5A 3I53A 1AKQA 2Q27A 1DV1A 1P19A 4DFDA 4CFZA 5BSEA 2DHRA 1G60A 1JIXA 1S2OA 2I22A 3A2LA 1V5FA 2EFEB 4LJ5A 3B9RA 3CFYA 2FJUA 4WCDA 2X0EA 3HFRA 4RKYA 5HKOA 4XUEA 1T36A 2RAUA 4JODA 2BFEB 1TAHA 3F98A 4ZZ1A 3QE9Y 1C0IA 1RZ3A 2ID7A 4M89A 3HRHA 4OV6B 5I9TA 3R7WB 3HPQA 1L2TA 2QMYA 3JV7A 1SUPA 3OO1A 1AUPA 3RU3A 3U1VA 1E3LA 1A2OA 2WU8A 4RDHA 5I3CA 4GLBA 4BLPA 2AFHA 2H7YA 3ITNA 3CRW1 2HWUA 1DZIA 5L7TA 6ABPA 1GRNA 2O5RA 3NR2A 1XP8A 2I1VB 3FTNA 1Q0PA 1UPCA 4QDZA 3AY0A 4WLEA 3U0VA 1GR1A 1U3UA 3PITA 4MI3A 1T9AA 3ZE0B 3ESBA 1HR0B 3DBHA 1OWPA 3Q9NA 4UHFA 4CMBA 1A9TA 2DWPA 1LW7A 3PUYA 5BN4A 2WSSD 2QUJA 3K1JA 1NJ6A 2JK0A 2XADA 4RZQA 2DECA 2VPPA 4JN6B 4UBNA 5JASA 2A30A 4A3SA 2FGKA 3ELBA 4A82A 4R2KA 1P29A 1RR6A 4GDFA 2PX3A 3EXEA 4AJJA 3QM1A 4J90A 1SIUA 3B6MA 3PDUA 3ZWMA 5K2MA 1MC8A 3L46A 1Z75A 1N4AA 2GEKA 2OZLA 3V4PB 1DLIA 1NVBA 2HT6A 2OD2A 2HQSA 2VT3A 1J2TA 3EISA 3L7DA 1O2DA 4GOOD 3WG9A 2PT9A 1N1MA 4WOCA 5EP2A 421PA 5AW4A 2KBEA 1N75A 1J2YA 3VH3A 3P5SA 2FN9A 4OXNA 5DP2A 3UPDA 3GRRA 3PNBA 4Q16A 5ITZA 1WY5A 1OE0A 1LI4A 1P9NA 3T52A 1H2EA 4ND3A 2QRJA 4Q05A 1RZRA 2EKQA 2PAAA 4Q4JA 4R1OA 5CJPA 5J9FA 1UODA 4JP3A 1LRLA 1XJ5A 4TTPA 1D4OA 3OQNA 2W90A 3DMTA 4KPYA 1G6OA 1E9RA 1DC5A 5THQA 3DZIA 2Q3FA 2WJGA 2MSEB 4YJ2F 2E2WA 4LK3A 4A91A 4RY8A 3BZUA 3A3KA 4YYZA 1SELA 3NHUA 1UP6A 2G9QA 3LCJA 1TU3A 1Q7EA 4G0MA 3CVJA 4FGKA 4L9RA 2X1LA 1K4YA 4YJ3F 2ZSDA 4KQEA 1QCDA 2XTJA 2A9PA 4RHTA 4IIFA 4JEMA 5F78A 1GGHA 1V3TA 3WZ2A 3TQHA 1H6CA 5JNRA 2OGZA 1ZESA 1C5KA 3D5TA 3TJRA 5JYDA 4FHCA 1NXSA 3NI2A 5CUQA 4RV4A 4IIXA 1AV6A 1DIRA 2NZ8A 4CMIB 3C74A 3ZX5A 1DU4A 1QANA 3SF8A 1Y33E 2B25A 3C7AA 5JTUA 1KSFX 4PIVA 1D4AA 4JJFA 4TMKA 1QYIA 1N5IA 3ZXYA 3WGVA 2ZZNA 4UPVA 3CNOA 1H1TA 4ARZB 3CE6A 1YQUA 2J48A 1KPGA 4YAGA 5LMCA 2VK1A 4CT5A 2H9YA 5IAEA 4AZVA 1S89A 3T3IA 4QPNA 2CXPA 2IYEA 3WL6A 1UC5B 1JFFB 1RZUA 2YBEA 4MI6A 2HV8A 3KSZO 4RKFA 2I2FA 3IP3A 5SYNA 3DOFA 3VC7A 3H0EA 2IUUA 1QFYA 1AVTA 2J3MA 1AQLA 1QPGA 1XU4A 2FG5A 2C8VA 5I6DA 1H8ED 4GPZA 1SB8A 1UJ6A 2I2DA 2VAPA 3DTNA 3QFFA 4ZA2A 3TLCA 3TLJA 2H5LA 3QWHA 5JLAA 5BNIA 1XGKA 1PJCA 3K0FA 4K2AA 4AMVA 2E85A 1N2IA 3DLPX 5DM1A 3SXUB 5C53B 4GKJB 4HPXB 3CCCA 2IHTA 4BYMA 4I2VA 3TE6A 4DLKA 2RHCA 3UBMA 1SQGA 3TF5A 3NC0C 3PPYA 3ETLA 1GPMA 2HDWA 3QBEA 3VR4A 5KWVA 1WIWA 3B6IA 3ZY6A 3WLKX 3BTVA 3LOPA 2G7ZA 2IJGX 5LLDA 2XBUA 1NW3A 2XA2A 5LL6P 2B2NA 2C9OA 1JFVA 2G4LA 4YXWA 3B1VA 4NYMR 5LA6B 1DMSA 1ZIXA 1AF7A 1QS0B 4XR9A 1XA3A 3TM4A 4ZHQF 1M8GA 3SPXA 3SXPA 5K8LA 1HNWB 5M7EA 2FFRA 1S8AA 2B94A 1UXHA 2QYTA 3U4GA 2HJHA 1O03A 3BEOA 2IU6A 5CXQA 2GDZA 1JHYA 2A35A 3BGIA 3EZGA 3AFOA 4H08A 3R7NA 1I24A 1DUIA 1I9GA 4ZT2A 2AW3A 2CLKB 1K86A 3SYTA 4C5AA 1NKTA 3HV0A 3F71A 4EIWA 5A3JA 2H63A 4BN0A 3OF2A 3T1VA 4CI0B 1EDZA 2GKSA 2YOHA 4HCJA 1VJGA 1RJGA 4V24A 4F4DA 3I52A 1HK7A 1CQXA 1TAUA 1AO3A 3WB1A 3RCBA 5KJ1A 4TMTA 2ZT6A 4OJMX 2HI0A 3IP8A 1QK4A 3T1OA 3I58A 3U7QB 1THMA 5JSHA 1OV4A 3BH7A 4GI7A 3RC3A 1WD7A 2F3PA 1DDOA 4D74A 5K6RA 3OTWA 2VVTA 4NBUA 1EVZA 4RFSB 2QTHA 2XWPA 4E5DA 1Q14A 3H1GA 3NV9A 3NZEA 4Q7JB 2EFJA 5DN6D 4NOJA 4BO2A 4N76A 3ZG6A 2O2IA 1JAYA 1BE1A 1E5VA 1U6KA 3IAXA 5CEFA 4FBLA 3K5IA 4US2R 4LY9A 1BAPA 4RJKA 4URYR 5E8RA 1X13A 2RI0A 4JNKA 3FIUA 4Q5IA 3NJRA 5KYUA 1AK1A 1LQ2A 3DDZX 3T9FA 2FEKA 5ELXA 2V0CA 4N03A 1U1DA 3HR4A 1NVVQ 3ZHXA 3VX3A 2YC2C 4O4IF 5JDIC 5D5PA 4E4RA 2JANA 2P5SA 2ZCVA 1LSOA 3K7EA 2GAAA 5KC9A 3DEZA 1NZDA 4XX0A 2ZK7A 1AOXA 1XD8A 2QGZA 3WL8A 1PQWA 4FYJA 3UEOA 1GZDA 3ONWA 1TTQB 1HE1C 2PK3A 3K4HA 3EG9B 4Q24A 4B82A 2WT8A 3I6ZA 3PXEA 1MAVA 4H4EA 4MVJD 2IY7A 1N0IA 1KAOA 2HREA 3MFQA 3MJFA 4RKQA 5KWJA 2W4IA 3RIYA 3C97A 2FRDA 2QUZA 3R20A 4IUDS 4LNUA 5I4BA 4MDEA 1IBRA 1FW6A 4IG9A 3NHAA 2BN4A 2O3RA 3DUFA 2IP4A 3BH0A 2ECFA 1SWVA 2GEVA 1G20B 3L1VA 3I5UA 2H48A 3AG6A 5GTDA 3UJPA 2XZLA 2M32A 5CHEA 4QOFA 3QELB 5EKDA 1IE3A 1ULHA 3DHNA 4FOOA 4MDYA 5HA5A 2V0GA 5HQ3A 1VCMA 4XCXA 2HQOA 1MDFA 5H70A 1O6CA 3WLJA 3SZLA 2QD2A 4J2TA 2ODNA 1W1WA 3BSWA 4CVNA 1ZFNA 4MEBA 1A8UA 2FETA 4F46A 1JVNA 4X71A 3KHKA 1M2VB 1RYFA 2IF0A 2R6FA 2BY4A 1OGIA 5EY5B 4BECA 3BWXA 4OHUA 3U17A 1ANKA 1VIDA 3DNFA 1VMDA 5THKA 3CZQA 4HGRA 2H11A 3GLIB 1V6SA 3AONB 4IIHA 3UJHA 4WBNF 3GARA 1GG2A 3DM5A 4D3ZA 1SUFA 2G9UA 3K0BA 3N5CA 3TX6A 5A9RA 1V7PC 4PLYA 5IZCA 5DBGA 3GUYA 1KYYA 1GZSA 1JIKA 2ZB8A 1E4OA 3AUAA 4U8HA 1M6HA 4ALMA 4FNGA 5BY2A 1MB9A 1AURA 2NYVA 3HDQA 3PHBE 4UXIA 5FO1A 4EO7A 4YQFA 2AOWA 3M2PA 4B40A 13PKA 3AOEC 4L3VA 3TB6A 5GWXA 1XZLA 3GFTA 2IFTA 1H8HA 3UK0A 4G2TA 2K4MA 1JBKA 1VL1A 1Y8QB 1S2NA 1HUQA 3WO0A 1Y42X 3FCEA 4Q3CA 1XRPA 2ZWIA 2HYIC 2AMVA 4YTEA 2UZ4A 5K2OA 1TKCA 1JIVA 4JC0A 5B1EA 4QXOA 4KSCA 3SHOA 3TEFA 4YUAA 4RTLA 3WFZA 5DYYA 2SECE 2XUOA 5D7NA 1DL5A 4DCTA 5JJBA 4P2GA 4UM9D 4Y1RB 1J21A 3F1KA 3W3AA 1YAJA 1DKLA 2JFXA 2ZKIA 3N2KB 3NYQA 5KYNA 4JMLA 3OMXA 4C7KA 5IHXA 4RZSA 3QRWA 7REQA 4UBIA 2VP0A 4PRZA 3MGCA 1SUCA 4CNBA 1NYRA 4D56A 5JEDA 1KDPA 3NORA 1UT6A 4KUEA 3RU7A 3VKFA 3FR8A 1SQ6A 3WICA 4EPXA 2WHRA 5CDFA 4D98A 4M6WB 4C07A 2LNDA 4OHXA 4LX8A 1PDWA 1EZ4A 2QJFA 1I2CA 2DFPA 3AG5A 1XCJA 3BD8A 2PS3A 4I1SA 1CZRA 2C2ZA 1LV8A 1NPYA 1QYWA 2B7CA 2V59A 3JQFA 4LAFA 4MPRA 4YCJA 1CQZA 1EVYA 3HB0A 3PT9A 5BQ5A 3N86A 1NF9A 4NCNA 4ZAGA 1Q7TA 1SHTX 3OJEA 1F0KA 4L4XA 4BLWA 1YR3A 3S7ZA 1UZLA 4PVDA 2AEEA 4UUOA 4YPOA 1G8FA 4XSGA 1RHQA 1YZFA 2YMMA 4JOBA 2NU9A 4ZO8A 1U28C 4JJEA 5EPEA 5HS4A 3NGMA 4F4HA 2NO1A 1LJUA 2QR5A 1EAYA 3I8XA 2AXPA 2QQ0A 3KZXA 1A7KA 3RQIA 4PYJA 4M99A 2KW5A 1F4PA 1Z0KA 2BMVA 3AERB 3RHTA 4TYPA 2ZSAA 1Y5MA 1ZW6A 4IXWA 5TR9A 3U2QA 3LP5A 4DOMA 4DDTA 4LZJA 4MICA 4R6WA 3UV7A 4OP2A 4BNFA 1VKNA 4AN1A 3KJGA 3GFQA 3TQRA 2WZCA 2AG1A 4JUDX 3AR6A 4C43A 1YQTA 1TX4B 2WJAA 5CVVA 3EUEA 5MGNA 3A1WA 4B48A 5LU8A 4I4NA 1LEHA 3JRXA 2WIJA 1F2TB 1K0FA 5I51A 3O9MA 4IGFA 3UFXA 4YAEA 1L4EA 1E5TA 2IWRA 3SHVA 1UBEA 4LVNA 5KSOA 1Q83A 2EZ8A 2GUGA 2J3HA 3LHDA 5AYVA 2RI1A 2NTEA 4AN4A 1P2FA 3FTDA 5BN3A 4I66A 2PMCA 1RCFA 2I7TA 2ZUWA 3DMYA 1O95A 1E0SA 1WMDA 4ETIA 5FOUA 2MSCB 2G5GX 2ZBGA 3UJDA 2PKWA 3CLRD 2OD7A 3FLAA 2BTQA 2QVXX 3I3OA 3PTLA 5C7YA 5IEJA 1JEQA 3E3OA 1XRRA 1A9RA 4IV0A 2HRRA 4UJ5A 3BG5A 1MFZA 4XSVA 2GZMA 2CXTA 4XLTA 3FOEC 4ER7A 1W9HA 2PO7A 4ZT7A 1C14A 2Z4SA 3C8DA 4EZBA 4M0EA 1NVTA 2RGXA 2V6FA 3KV1A 1FP2A 2FSUA 2H2DA 2ZROA 3H9JA 3PYMA 4GX1A 2J0UA 4D9NA 4L4ZA 1MHTA 4MVJG 4GUDA 1IBCA 2J8ZA 3C6XA 5HXAA 2WFAA 5GGXA 1MABB 1HYBA 1QX3A 3QFHA 4ROTA 2P9GA 1ATIA 4MGZR 2GEBA 3UO8B 2WWTA 2QMHA 2CUZA 5C2JB 3IEMA 1T9BA 1VYUA 2ALJA 3BRSA 1P0MA 1SCNE 1VPEA 3DXFA 4IDBA 4NBLA 1QBKC 2WJJA 3E53A 2BHRA 4OA8A 4OLBA 1I8TA 1NUHA 3QP9A 3WBFA 3O8RA 4Z54A 3JCZA 3PX2A 2XQJA 1Y4SA 4B76A 3DW3X 4S12A 1WBBA 1TA9A 3OZRA 3ZHBA 4ZEWA 3X43A 4DA4A 1R9NA 2I9PA 2WUVA 2IY9A 4MZDA 2VNAA 3MD9A 1P0PA 3BMQA 1YCGA 1CCWA 2B20A 4ZFNA 5CA1A 1JR6A 3AR8A 3STHA 3TR5A 3I5MA 3FLMA 2OWDA 1B00A 4YRQA 3IAM1 3TMAA 3MGAA 4QVKA 3S5UA 5LQDA 1W48A 1JZSA 2RGDA 4II3A 4P98A 3E4DA 4RU1A 4M1WA 4S1NA 2QR2A 5FLKA 1QAQA 1JQJC 1RQNA 1U1CA 3K6RA 3QXCA 5DISB 3KYCB 1A50B 1X14A 5DGTA 3U7HB 2H29A 1W35A 1TU4A 3OP4A 3U80A 2MSKA 1C30A 3C6YA 2DRIA 4XVHA 3GJ7A 3GT7A 1W88A 1M72A 4G23A 1USVA 4NECA 4W4TA 3D4BA 5HQJA 4EUHA 4FE4A 4XXHA 2JAWA 2J4FA 3N7TA 4X45A 4ASUD 4CI9A 2RBKA 3T1HB 1GJRA 2BR5A 2V7QD 4YCBA 4EMSA 2ZJYA 5TIIA 1OMOA 5E3IA 2OGTA 2NSDA 3OCWA 3AQIA 2J08A 3P26A 3PKIA 2XCRB 4UD6A 2VYND 2ZJ3A 3VU1A 3NH9A 4E32A 2OPHA 3CR8A 2BHLA 3D6HA 5HMLA 1W2WB 3IRVA 2Y66A 4NCAA 2QJWA 3EW7A 1CRPA 1W76A 2AOUB 1TM4E 4KO8A 1J2EA 4XGNA 2WV9A 4B6SA 5EMNA 5BV2P 3HGTA 3OIWA 2YV1A 2C82A 4XVUA 1SNYA 1CHNA 4M76B 4PICA 1IY8A 2XI4A 4RZIA 1MZPA 1A88A 1P2VA 2HV9A 4GX0A 5DT2A 2ZJ7A 5CEEA 3I8OA 3FTQA 3EQ8A 1QDLB 2B7BA 2GI4A 2DWCA 4MIOA 1ONOA 1QYXA 1UDCA 2CW5A 2PVCA 2R1TB 1FC0A 3BILA 3DNPA 3BGVA 3EQ2A 3H05A 3RSFA 4V0SA 2Z6UA 1WXDA 1QR2A 4TMZA 4B3FX 1A5TA 4FMCF 5BN5B 3GEGA 4J4BA 4MUAA 2UZ0A 1WETA 1JKMA 1I7QB 3S40A 3JARB 4DLSA 3RC2A 1D6MA 1QLJA 4RGVA 1Z08A 2WW8A 2JEZA 3OUUA 4N5IX 4TGLA 4U2GA 2MYTA 3URMA 4Y2XA 1MUUA 3PE6A 4FQ5A 5JDCA 1KZ1A 2X0DA 2F00A 2FPKA 1MGOA 3T7SA 5C51B 1CFJA 3G7UA 2OZVA 4MKIA 3TIFA 4RSRA 3ILHA 2FPRA 1J8DA 1QIHA 2G40A 3O94A 4CG2A 4NIMA 2VJCA 3INRA 4LY3A 4U9HS 5DNEA 1WTCA 1WKCA 4TSFA 2GXUA 2YV2A 3NHWA 1J00A 1JG3A 3ND9A 4RHCA 4EKNB 3I4CA 4FFRA 1G3UA 3IEIA 4ESOA 4H16A 2BFFB 1QVVA 4H4DA 3R5KA 2Z5FA 4RHYA 2F1KA 4C0BA 3CEAA 5EE0A 1DO0A 5LMUB 4MUFA 3QITA 4W82A 3ROXA 1C7ZA 3IBCA 3SDSA 4ZV4A 3TLMA 3K6SB 4FUQA 2P78A 4D41A 4RK5A 3IAUA 3FCOA 4FINA 5BWCA 2WWIA 4E5SA 5C80A 4WXEA 3THYA 4B7AA 3GAMA 1BIFA 2GRAA 4HRXA 2UUCB 4IEFB 4EW3A 1C9MA 1T1SA 5JMWA 3I39X 1WY7A 3U40A 3FYUB 3VNSA 2P3QA 4P8RA 5CLIA 4KE9A 2HLNA 4HSEA 2A9FA 4MP8A 2O19A 4R2IA 4QL3A 1Q0HA 4Q01A 2PBLA 3GK3A 3JZAA 1S2LA 1UL1X 1Q1ZA 2HMAA 3OZAA 4E11A 1OT3A 2PJZA 4DUGD 3P9PA 4PVCA 5DASA 4NOMA 4C7MA 3C3WA 1W4ZA 4JB0A 1MH1A 5KTYA 1JEYA 1XPOA 4I5IA 1OTHA 1AG9A 2IE8A 1MQ9A 4N0EA 4RQUA 4WY2A 3A9VA 3VYSB 4JLDA 5J4YA 1HZZC 2OHVA 3FZGA 1OXKB 3RYFB 3HCDA 3V00A 2ZBVA 1CNFA 4Q37A 3OEHD 3T7CA 3EWSA 4I81A 5DP1A 1AN9A 4KSBA 3ZIAA 1UM8A 3WSTA 3AIIA 1P0IA 3ZI7A 3C48A 5B1DA 3W90A 3WHPA 1QP7A 4UMFA 3LVFO 4Z1MA 5AKZA 4ITUA 1H9CA 2XRFA 2JLRA 3EZXA 3FPAA 4YACA 1XTPA 4RK4A 1E2BA 1MB4A 5B6IA 3ABSB 4C0HA 3LUCA 4AJKA 4UHKA 5L6MB 1P9RA 1YB6A 2PGNA 5JT1A 2PM8A 1O3YA 4MR7B 2DQ4A 1Y1RA 1JG6A 1NTOA 2FTKE 1IY2A 1SVMA 1Z07A 4BE7B 3BGWA 5ICGA 4HLQB 2HSGA 4PG4A 3FZNA 3ZPXA 1L5YA 1BH6A 1YL6A 1GNPA 1CUFA 4FMDB 4B4UA 2Z2JA 4ZTUB 4Q34A 5A5EA 1U8FO 2O57A 3TLEA 1JZTA 2AFIA 2EFCB 3UQYS 5IDXA 3ZXSA 1P60A 1Q0RA 2JIZA 1DRKA 1YA8A 3DC7A 5JJKA 2L82A 3LL7A 3P20A 5BSHA 4IGKA 5C37A 1HEYA 3AI3A 2OCDA 4PGHA 4RPCA 3R74A 3HI4A 3O8QB 4AJEA 4BVGA 2WHPA 5E1OA 3LSTA 2P9TA 2J6CA 4EI7A 1NXTA 2XVAA 2AW5A 4AUEA 4DL9A 4BXOA 3CRQA 1L4MA 1M8FA 2LVBA 2A3NA 3AHDA 4IIJF 5FR1A 5IFLA 1EHYA 1QO7A 4YAOA 1ZCAA 3C1UA 3V4SA 3R5SA 2MCFA 2HBRA 4F5EA 1SHJA 4TYYA 3MCVA 4QDTA 3IPAA 1MC1A 3GUVA 4EF6A 2NTNA 3I42A 3MZ0A 4MJXA 3L0OA 2HHCA 3KQKA 3G0HA 3LDAA 4G3XA 1OWLA 4OHBA 3TZQA 1EUZA 4MDFA 2WF9A 3ANYB 5T57A 2TMGA 1KARA 1VGQA 3ZHZA 1QGUB 1JHQA 1THGA 1XDWA 2CYBA 1QJCA 2RGAA 1TIBA 3QTTA 4QUHA 1ZEJA 2I3GA 3RASA 3QFRA 4OJTA 2O8BB 2YR0A 1Y37A 3NNDA 4D9CA 1D1SA 3ZV3A 1Z63A 5F9HA 4BNDA 1P91A 1LPOA 3HZZA 5F2OA 4FCVA 1YZQA 4MV7A 4XGKA 4IEIA 4E46A 5LOVA 3T9BA 3DL0A 4HG2A 4Y9RA 4ZI5A 3AVQA 3D2AA 1ZQ9A 2R6R1 4JKIA 2Q8PA 5GJWC 2F8MA 4ZVQA 4NCXA 1TYZA 1PWYE 2E5FA 1H9AA 3LFTA 2W4MA 3UH0A 4XIYA 3FCYA 3R3JA 1PD1A 1UBJS 1ZG3A 4TN5A 2BFOA 5BSGA 1LDEA 2QLFA 2Z2KA 4IDHA 1BDBA 1G5FA 2OBNA 5LDGA 3O6VA 4HH1A 2W83A 2JLVA 4I1YA 5JZVA 5H5JA 2JFPA 3ANTA 5C46F 1ORHA 1LVHA 1IULA 2G6TA 5CVCA 5KTTA 3OPQA 1T8PA 2B3TA 1JXQA 3U7JA 3CUYA 2V45A 4TXJA 4XDZA 2WTNA 4LYGA 1XPUA 5CNMA 1N2XA 4R51A 3JSXA 3IJPA 1QVRA 3NDJA 2FLVA 2C2HA 4C0LA 4O8CA 1DO8A 3GRCA 3UUEA 2YN0A 3DO5A 1CE8B 2JIOA 2DPXA 3AF2A 5AHWA 3ZVKA 1QDEA 1QYRA 1JI3A 1ZM3A 2B99A 3BJMA 4RVDA 5HUQA 5JNTA 4KOEC 3T1TA 1RADA 1N25A 3DT8A 1UMBA 3AXSA 2QI9C 3O4RA 4O2RA 4JGIA 3RSHA 3PRKE 5FL7D 3UMSA 4E5PA 4QJ3A 2FU5C 4KQIA 1WXHA 1VE3A 1AV7A 4ZRNA 1OQAA 5DM60 4NTZA 3MJ4A 1P72A 3HU3A 1ZISA 3UJAA 1FMTA 5K0NA 4NEQA 3LC1O 1CY8A 1JSXA 4LGVA 3PQ2A 4LJKA 2PL9A 3KR1A 1WZNA 2CBGA 4KWTA 5JAMA 4AYWA 3WLNA 4K03A 3DFKA 3K1AA 1W5BA 3O1IC 4NMXB 4PO9A 4MKFA 1YVRA 4M1SA 2GXSA 2AJLI 5KPJA 2AYZA 2ID4A 4QM7A 3EQ9A 2IYZA 1QIKA 3E7FA 3P27A 2HRQA 2VL7A 3HYTA 5P8WA 3BVPA 4OLAA 2AZTA 2V7GA 2VBIA 3DE2X 1OT5A 3ETJA 3FPGA 2OOSA 3L8GA 1XEAA 2BMJA 3ENNA 3I64A 3SHFA 3A9CA 4G0VA 1Z5OA 2FUKA 3NBAA 2KM1A 1V5GA 4AMGA 4AUKA 4UVDA 1GNLA 2F1IA 2VP5A 1Z0FA 3C5CA 5REQA 3VJKA 1PLKA 2JLSA 2XMGA 1V95A 3FN4A 4CT4B 3D7MA 5DX0A 5JPDA 3UFBA 1YC2A 4MYHA 3LZ6A 3KEQA 5AJTA 3WLAA 1FTYA 2MDTA 2ZSKA 2MMGA 4UARA 4ZAVA 5FXMA 3IO3A 2JCBA 3C87A 2RHRA 4G4GA 2D5CA 2HLDD 4GECA 2HJSA 3ODPA 4BMSA 2ZVJA 3FTCA 2Z2XA 2C78A 5LFAA 1AE1A 3TD2A 3V9AA 3KQUA 3LRPA 4JXZA 4MI9A 2FPWA 4Z86A 4L1KA 2ZE8A 5EHNA 4P34A 3H2IA 2XRYA 1NI4A 1KJ9A 3RS5A 3K70B 2IP1A 3GZTB 1T35A 5ALIA 4X66B 1FDTA 3ND7A 3MXTA 5BR7A 1UBSB 2YHIB 1T1EA 2HRCA 2OV2A 4TZKA 5K8TA 3QW4B 5FBVB 1XDDA 1ZM9A 3LWDA 4TXMA 1L5ZA 1AUOA 3IV7A 4YMTA 4JCOA 1U94A 2QBYA 1LDYA 2QSUA 3LT0A 4LDZA 3KFVA 4FFSA 2BFCA 2YWJA 4EATA 1D9ZA 4LOJA 3QOWA 2CHUA 1KEKA 1YB7A 2C4VA 2VNSA 3IVCA 5EWLB 5K7SA 3LBNA 4AZ3A 1E79A 3TUZC 3UGJA 1YS6A 1T5OA 2VOEA 3NYWA 5DNYB 4YR9A 1ZVKA 2VCYA 3PYLA 2FZGA 2JAUA 5AKIA 1XAHA 1AIPA 2LCFA 3MAGA 1Z2AA 4ZT6A 1GADO 3GGGA 4RVHA 4UBJA 4FNAA 2HIGA 3WE7A 2JA2A 1USIA 4R69A 5LN1A 1BU8A 1J9GA 2IGTA 4BNZA 2AC4A 2VYCA 4DNOA 2ZXUA 1VZ3A 2XYGA 2RAVA 1TGVA 2AYYA 4HQ0A 5SZHB 3WA7A 3GEMA 1UZUA 1UDWA 1MO2A 1ZICA 3QOXA 2ZIUB 4BP3A 1XD2A 2HLPA 5FOTA 2CZQA 3CZPA 5KNCH 3JZDA 1Z33A 3ZCXA 4E5YA 1IM8A 1I7PA 1K75A 1KJWA 1X7WA 2VR1A 3T5MA 3GLVA 4XIGS 1PJ4A 1V4NA 2LKDA 3PQCA 1PLLA 4LK2A 4TS4A 4F3NA 1YHYA 4Y2RA 3MINA 2C04A 1XXLA 1UPUA 1YVDA 2K2QB 2GZSA 3IBSA 4I1UA 1RI2A 4PC2A 1TFRA 2Z9CA 4MX8A 1JHOA 2GPBA 2DBZA 3DE4X 3WGLA 1M5RA 4RIIA 1U2ZA 2YZ7A 2F2TA 1B8UA 4O59O 4EVSA 3QEMA 4CTNA 1JT9A 1F3OA 4HR7A 4DSNA 4F5YA 2XQFA 1LTKA 4JQSA 3TCXB 4DSOA 4MJ7A 3VYVA 4DIEA 2YUIA 4HGPA 3K5HA 1A9ZA 4N4AA 1EKXA 1F0NA 3TSOA 2VWHA 2AZMA 4YXFA 2WF8A 1MW9X 1N5OX 2B6NA 3Q12A 4Q1FA 5FI3A 3TR6A 1E2JA 4D43A 2J87A 3E3AA 2YXPX 5G2OA 3A6HA 4INAA 2JKVA 2YZGA 2KYRA 2VKTA 4PBRA 5H3LA 1HRKA 3RRXA 4AG3A 3LTNC 4GKKB 1OF1A 4DW8A 4DS3A 4KH1A 1AHIA 4M8LA 1CD5A 1NR5A 4TWJA 1AK9A 2NU6B 4IJ5A 1TJNA 2BEWB 1UAAA 3CC8A 1JKJA 1SVUA 3ML1A 4J91A 1RWBA 3DSRA 2R87A 2UYYA 2C3UA 4G89A 1TAGA 5K05A 5JYEA 1N6KA 2ATVA 4UHHA 1KFBB 2FVXA 4M4SA 1CPYA 3S1LA 4RM2A 2AQHA 1NN0A 1FA9A 1PHRA 1XV5A 3GVHA 2RHGB 3DKVA 4EWLA 2OV6A 2H0QA 3BIOA 1DKMA 3HCEA 2MR5A 3ROEA 3C3DA 4KWCA 4WUVA 4U7HA 5EXEA 1X77A 3KHUA 1L7RA 1CUXA 1WCIB 1YCDA 2NGRA 5B6JA 2I5PO 1PV2A 1G17A 1CIVA 3FFXA 4LRXA 3WFJA 1DJNA 3QLUC 4RYLA 1DVRA 1PG2A 3CIFA 5CIWA 4K2HA 5K0SA 2YHSA 4OPMA 4OK6A 1QFSA 3DOEA 2ETVA 5JCOA 1V0JA 4RK6A 2WOOA 5TDHA 5A7HA 3KKQA 3R8CA 5ALYA 1A97A 1AKUA 1TEHA 2ZOSA 1A8SA 4MW2A 4UZEA 4K9PA 5ARDA 2UKDA 5KKNB 4L3WA 4L0MA 4LRQA 2FUEA 5G0SA 1E3WB 3RK1A 1BG6A 4BBAA 3WL3A 2QHXA 4DCNA 3RVMA 3TUIC 1V7CA 1YDGA 3VH2A 1JQLB 2YZNA 5FBHA 3U60B 3SEAA 3OX3A 4P82A 1XXHB 1OYWA 1UDBA 3M6IA 5ILGA 5A3SA 3RBXA 5IABA 2H5IA 2C7BA 4A2WA 5K99A 3PC4A 3AL2A 1IBMB 1L7PA 3A9SA 3VO8A 2F62A 3LHSA 3PYXA 3QXSA 2F3UA 4FHFA 5BT9A 2W6JD 5L6LB 1KMIY 3RRJA 3OPNA 4ILKA 3FPHA 3CLSD 1G5HA 1GUBA 4EO4A 5IU6A 1OOEA 3D6TB 4XWOA 1CR6A 5EKSA 5AXCA 2EDCA 3OCUA 1JI0A 3T94A 4F7WA 4O33A 4Z8YA 5EIWA 5C8YF 1MVOA 3OIVA 2PH3A 3HB9A 4FTWA 4CLHA 1QYCA 3A1UA 4HDKB 4U2BA 2O6HA 2I9KA 2HSJA 1EINA 1V96A 3SX4A 3K35A 4ARBA 2FUNB 1D7AA 4KO2S 2R8EA 4WLFA 4I4TA 2BWJA 2BHNA 2GLUA 3I1YA 1M54A 1FVHA 1WEHA 4P83A 3LP8A 3VFDA 3ZZ0A 5ARCA 4LG1A 5DIZA 3QTBA 1HGXA 2Q5EA 3OZFA 4EB6A 2CKDA 4YREA<