1I14A

Analysis of an invariant aspartic acid in hprts-glutamic acid mutant
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
187
structure length
187
Chain Sequence
YEFAEKILFTEEEIRTRIKEVAKRIADDYKGKGLRPYVNPLVLISVLKGSFMFTADLCRALCDFNVPVRMEFICVSSYGEGLTSSGQVRMLLDTRHSIEGHHVLIVEDIVETALTLNYLYHMYFTRRPASLKTVVLLDKREGRRVPFSADYVVANIPNAFVIGYGLDYDDTYRELRDIVVLRPEVYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords HYPOXANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE
publication title The role for an invariant aspartic acid in hypoxanthine phosphoribosyltransferases is examined using saturation mutagenesis, functional analysis, and X-ray crystallography.
pubmed doi rcsb
source organism Trypanosoma cruzi
total genus 56
structure length 187
sequence length 187
chains with identical sequence B
ec nomenclature ec 2.4.2.8: Hypoxanthine phosphoribosyltransferase.
pdb deposition date 2001-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1i14A00
4FYMA 2AEEA 3O7MA 4LZNA 1DQPA 1BZYA 1G2PA 1A3CA 1G9TA 1P17A 4RV4A 1XZNA 2YZKA 1ZN8A 2H07A 3H83A 4RADA 4RABA 1DKUA 4S2UA 1Y0BA 2P1ZA 1OROA 2H06A 3DMPA 1QB7A 1QCCA 1I14A 4QYIA 4TWBA 4M0KA 4P84A 1OPRA 2DY0A 3OHPA 1G2QA 4JLSA 4PFQA 1TC2A 2PRZA 2E55A 1ECGA 3MBIA 4JITA 1L1QA 5K51A 4RQBA 2H08A 4P83A 1J7JA 1UPFA 1VSTA 4QYIB 2JKYA 5EUCA 4P86A 5KAPA 1XTVA 4Z1OA 3GGCA 1NONA 4P81A 1ECFA 4RHUA 4M0PA 4X44A 3GEPA 4P82A 1JLRA 2JKZA 1L1RA 1DBRA 1U9ZA 4M0UA 1AO0A 2C4KA 3MJDA 2EHJA 3QW4B 2WNSA 3GGJA 1XTTA 1VDMA 1I13A 1CJBA 1OREA 5E38A 1P19A 3N2LA 1JLSA 1W30A 4LZOA 3LRTA 1QB8A 4X45A 5BSKA 1I0IA 1A95A 4RACA 1I0LA 3M3HA 4RAQA 2JBHA 1YFZA 4KN6A 1FSGA 1QK3A 5ESXA 3OZFA 1BD4A 4RHTA 3EFHA 1IBSA 1DKRA 2IGBA 3OZGA 4LYYA 2PRYA 1GRVA 1ZN9A 4P3KA 3S5JA 3ACCA 1Z7GA 1A97A 1A98A 1D6NA 1ECJA 1PZMA 4RHYA 5JV5A 2HCRA 1NULA 3G6WA 1ZN7A 1V9SA 4P80A 1P4AA 1R3UA 1LH0A 1G9SA 4ZFNA 1HGXA 5ESWA 1XTUA 3ACDA 4LYGA 2VFAA 1A4XA 5BQOA 3HVUA 3LPNA 1ECCA 1BD3A 2FXVA 1UFRA 1TC1A 4PAWA 1I5EA 1MZVA 2JI4A 5HIAA 5KAMA 1VCHA 2GEBA 4OHCA 4WN3A 4F8EA 5BQPA 4RHXA 1XZ8A 1QCDA 3DAHA 4RQAA 3ACBA 3DEZA 4RAOA 5HKLA 1GPH1 1O57A 1STOA 1QK4A 1U9YA 3KB8A 1P18A 3NAGA 4LZAA 1UPUA 5BRNA 1QK5A 1O5OA 2XBUA 4MB6A 5JSQA 1WD5A 5IAOA 1ECBA 4WMLA 4IJQA 1HMPA 1A96A 4RANA 5IPFA 1DQNA 4QRIA 2PS1A
chains in the Genus database with same CATH superfamily
1X1DA 2D13A 4KIUA 1KKUA 5KI6A 2YRFA 4UXHA 4AYXA 4FSXA 3WIEA 3VR3A 4PBRA 4CCAA 5HJEA 4TKMA 4MH0R 3V9PA 2PX5A 1MO3A 1NJSA 2BKEA 3OAAA 5IM4A 4Q37A 3AQIA 3HDQA 3ASYA 4OMCA 4BN0A 1DX6A 4S2UA 4QAQA 3PQ5A 4JGBA 2RKWA 4AI6A 3MSXA 2JDID 4I9UA 3EWNA 1Y5IA 4MUGA 4UBLA 3JPWA 1O94D 4D5GA 1KI1A 4DLNA 5A6VA 3L7CA 4FLMA 3RTBA 2XYGA 1ADJA 3RBVA 1ODCA 3DD1A 3TDKA 4NMLA 2SKEA 4BB9A 4NLLA 2RB4A 4IDAA 4C6SA 5LP1A 4KVAA 4Y67A 1DWOA 1S6YA 4U0JA 3VPBA 3SQOA 4XWYA 2C54A 5HW0A 3LVQE 1UMDB 5G0VA 4PC1A 4WXRA 3ODGA 2HHLA 1LSSA 4QBKA 1NXOA 1FC0A 1U4OA 2OE2A 3PWZA 2I9KA 4Y98A 1UC8A 2PVSA 3GBSA 3NQ41 1M6NA 3GGJA 1PFQA 1UDBA 3N28A 3NBAA 3RPEA 3TOXA 2GZMA 2XT6A 3PLAE 3CWZA 4E5VA 4LOLA 2D2EA 5F64A 4BUZA 2E4UA 1Q1AA 3QVMA 1H9BA 4NH0A 4CTJA 5KSWB 1NVWQ 1JW9B 3U1TA 3G2MA 1OV6A 4NCHA 2FWIA 2JHGA 2GERA 1P8JA 1ESNA 2DE0X 5IANA 3LKBA 1L7QA 3VH1A 1Y6GA 3BAZA 2NO0A 4GOKA 1G98A 1TB4A 3OZFA 4KL8S 2ZQ5A 2QMEA 1ISMA 4JODA 3FZEA 4TX1A 3IP6A 3TLEA 1GCAA 3DE7X 1G38A 2JFNA 5CX4A 3BH0A 2X86A 4OXQA 1GRVA 2FZKA 1W59A 4E5YA 5TV2A 3G2OA 1MX3A 3DAFA 4MV1A 5JS2A 4H2DA 3RC8A 4H17A 1US8A 1U7OA 2PWZA 4OSEA 4B35A 1XHLA 2UVQA 5AOBA 4IWNA 3ZKWA 3ZQ6A 3D8UA 2ZZNA 1TM7E 4OB7A 4L76A 3OQMA 4XD7A 2XKBA 2OENG 3CZRA 5H3HA 1D0IA 1C8BA 2JEYA 2HMAA 3LUGA 1KJYA 1U4NA 3LLMA 5E0KB 2WJZB 3G8BA 3KKPA 2J9ZB 3R5TA 3U3DA 3UXMA 2ZRFA 1RRPA 1V11A 1I5EA 3C5CA 4PO3X 4YDSA 1N7JA 3PFNA 5JYBA 4DR3B 1AC5A 1G8HA 3PUYA 4WKNA 4HS9A 1R5JA 3GUVA 4LYEA 3OKFA 1BMQA 5ITVA 1ODFA 4D6YA 5AK6A 5SY9A 3AWIA 4A2CA 2DKOA 4D41A 2WHEA 1NV8A 2EEZA 3ASVA 3UWSA 4AP5A 1JDNA 2BSAA 1V0JA 1EM8A 4AZVA 4AZSA 1QYXA 1PVVA 3JXEA 5DZSA 3GRUA 3KJEA 2R11A 4HTFA 2CF6A 4LJ6A 4Y9DA 4G8JA 1P6UA 2A9FA 1VDZA 2GJSA 4ZOAA 3DKPA 1ZNXA 2B1JA 4J9VA 2TECE 3QPCA 3AUFA 3P9KA 1RLJA 4EVSA 4G65A 4YMLA 2AFIA 1AGNA 1W48A 1X7WA 2X2PA 5F35A 3RVQA 2EATA 2GBGA 1U1GA 3W3AD 2QL7A 1G7TA 2QAGC 1JQLB 2BMJA 4RV4A 5D85A 1XZNA 1Q74A 3N2GB 1KDYA 3AB7A 3MOSA 4KO4S 4YLEA 3EAFA 4CL0A 1C9KA 4R2LA 3O9VA 1T4CB 3DC2A 4N9WA 4Q5IA 3SHQA 1UMCB 1NP6A 3CN9A 3CRNA 4UQPA 2DT8A 1IUKA 2DY0A 1OYOA 4IQGA 3EG9B 1SG0A 3BJEA 4HK4A 4JZKA 4YJ2B 5B58C 2C5BA 3PIIA 5LLTA 2DU8A 5K51A 1JR3A 4B4VA 2ONJA 3B6MA 2JLWA 1HORA 3KD3A 3Q3EA 3S0JA 4O4JF 1ZITA 3VNQA 4F11A 3IDQA 4D3FA 1OA1A 1XTVA 1SXJD 4BBPA 3AXSA 4G4JA 1E8DA 1DIAA 2H0AA 4HTFB 5TVKA 2VHTA 1NYRA 2XEXA 1E3DA 4L73A 4DFDA 5U1PA 2GNAA 2XCIA 1U8FO 4LDJA 2IKSA 1JZSA 4QOSA 1FL9A 2GKOA 3A58B 3K35A 2IGTA 5F2KA 4EJMA 3H8WA 5EIXA 2GDJA 1Y9EA 1E8NA 1U98A 4QSHA 1E1QA 2YMQA 4CMEC 1WS6A 2B99A 3EUWA 2O9JA 3RH0A 1WZEA 5CU7A 1U2DA 2CHGA 3KJGA 4OL9A 1XXHA 3HGQA 2SCUB 3F6SA 4YRKA 1X0VA 1E3TA 1U02A 2EJCA 5D7NA 5CB4F 4H0FA 3NM5A 5JMTA 3FOBA 3JRNA 3P7MA 2QVYX 4KLNA 2EFCB 4NCAA 5L53A 4CIYA 4QYMA 4BVBA 1QSGA 1NVFA 4CUKA 4FGLA 3TM4A 3EFHA 4B4UA 4C7XA 1VB5A 5JJCA 1FP6A 1HKUA 1ZH4A 2FX2A 1DTWB 3D0QA 5EKTA 2ZZMA 1MRNA 4W5QA 2FPWA 1IBLB 3U0BA 1G5TA 3PK0A 4CQLA 2F8LA 3BUSA 4KQKA 3IERA 5C37A 2GN2A 2EV9A 1U3DA 2LDXA 4MJLA 5EHIA 3OMLA 5IAGA 5CD1A 1H8EA 1M54A 1N5JA 1VLHA 1EYZA 1C4XA 2HCRA 2JBAB 1G8YA 2NU7A 2ZS9A 3D3KA 2ZULA 4MVJA 3RC3A 3O26A 1NUPA 5AM3A 3P8ZA 3EF3A 4R1MA 8GPBA 3M34A 5K3EA 1RPJA 4V2UA 2B21A 1YU9A 5J23A 3DBOB 4UU1A 1PU2A 2QVZX 2R65A 3UZUA 1V2HE 3EMBA 4MYDA 3O8NA 3GVCA 3QG5A 4RK0A 4RCZA 1GZ6A 1Y98A 2FJ0A 2BVNA 4X1IA 5EQTA 3ESYA 1JA9A 1XROA 5BNFA 3EH1A 4UVEA 5AW6A 1TIPA 5BNWA 1A69A 1MC8A 4P7JA 3WFZA 3EARA 1JT9A 2NMVA 1SQ5A 3NASA 1LD3A 1QG0A 5K0ZA 1JH9A 2H1SA 1K3FA 3ZQ4A 3I76A 3KE8A 5KQGA 1GKLA 2F2TA 1KY2A 1Y7IA 2NTEA 3IQEA 3QXGA 5JASA 1NY6A 1VKOA 3R74A 1JKJA 3L5KA 4G9GA 4QZVA 1KTIA 2GJAA 3BMNB 2C7VA 2FETA 4K6KA 4JJAA 1GGVA 1QRTA 2RGRA 3QF7A 1U2SA 1V9CA 3KVNA 5GVRA 1I51A 1NW7A 3IPXA 3JZDA 4QTUB 3Q2OA 3IIEA 1SUDA 4R2HA 4WT7A 1UKBA 2FUCA 4HGZA 1EFLA 1LW7A 3CUEF 3FHOA 1N2OA 3CPHA 4MAFA 3D1VA 4ZCPA 3DYVA 1T9AA 3KZXA 5HK9A 3E03A 3NOXA 1DEXA 4K9LA 3W8RA 3CVYA 1A4RA 1GFSA 3SS8A 4KMMA 5SYMA 3T5DA 3ZVMA 1UDWA 2PGOA 3OE7A 3C48A 4QUDA 2EJTA 3ZI0A 2VBCA 4Q0MA 5LB4A 2LR0A 4UEJA 1Q7CA 3C5VA 3AOEC 4WCFA 4RPIA 5ILOA 4YRTA 2DFLA 1GEEA 3G59A 2VHJA 3VJLA 1YRQA 1KEUA 3VU3A 1N2CA 2JDIA 3B1JA 2VDNB 4TMXA 5E6RA 1BO6A 5FOTA 4BNUA 2CV0A 3DL7A 5KVVA 2QN2A 1GCIA 4UTVA 3GGPA 1U2TA 2XGGA 1BJTA 3IGFA 2F48A 1FNMA 2B82A 2HHCA 2ZR0A 4P83A 4I55A 1QVRA 3HZRA 4QXPA 5FO1A 3VFDA 2GNPA 4JV5B 1EWYA 1S9HA 2VTVA 3DWFA 1PG0A 2GPWA 1FS4A 3NNNA 3UM9A 5KAPA 2W6JD 2IY8A 1JI3A 2J41A 1ULAA 2V59A 1GPMA 3I9JA 3PC8A 3RYFB 3PXBA 1SHTX 2C7OA 1I6WA 3IUEA 3A6JA 1DARA 1ETUA 4LVNA 2C2XA 1FNDA 1TAGA 2R6HA 3P0IA 4BECA 4U2CA 3K70C 4KFCA 3LPMA 5EQJB 1XKQA 2GSDA 3G2LA 4FJ2A 1QAOA 4XDZA 4MPRA 1NUTA 1QXSA 1TW2A 4ZOLA 2NSLA 3L7KA 2OYSA 1WDLA 1T0BA 1Z4OA 2A33A 3ZZ0A 4IZIA 4TMFA 1NLUA 5E9WA 4RSGA 5ARCA 4G56A 2OO7A 5JHGB 1Z6PA 2NPFA 4QTTB 5K0CA 5LWHA 5TSDA 3WK6A 3ZS9A 5IT0A 3HUTA 1B6TA 2BTEA 4BRZA 3ND8A 2WJPA 4RIIA 3UH0A 1JA0A 2JF0A 3B3GA 3DP7A 1JDSA 1W1UA 1Z13A 3RWMB 5LQAA 4C2AA 2E1PA 2VRWA 2I66A 5IJWA 1Y6QA 4HG2A 2A30A 3COVA 3WP0A 2Y2VA 4QPJC 2HQ1A 2GKSA 3VKVA 2IZZA 1IB0A 4GDFA 1G55A 4LYYA 1R8SA 3EZ9A 4PZ9A 1TZJA 1X77A 3AEYA 5AO9A 3NXKA 3RVJA 3ZV6A 3BL6A 4QNRA 4UNNA 4F84A 1WXGA 3MEQA 2XCTB 3CLUD 5KYXA 3ZI4A 3T9AA 1EUDB 3ORHA 1JJIA 2PR2A 3DZIA 3CNNA 3HDYA 4WNAB 3X0DA 4YR7A 5JRJA 3AESB 1BEZA 3DNFA 1JSCA 2FPOA 2RGNC 3M6WA 1GTL1 2GBFA 1OE0A 1E5XA 1U0JA 1YAJA 2N42A 1POWA 1MXHA 2XVXA 3EASA 4AUKA 3KXIA 3X43A 3RC7A 4A9AA 2H1WA 1PUXA 2DPYA 4J4HA 1RHMA 4OJYA 4AX4A 4DLRA 1Q0PA 1N3BA 3UMMA 3KZNA 3ZLVA 1PSWA 2NWQA 3IJRA 3QKWA 4UHCA 1W52X 3RT7A 4B9EA 4WK0B 2BT4A 3L4BC 4GE3A 4V0NA 1PK8A 5EE3A 1UOEA 4N1AA 4QOEA 1RM4A 3MWDA 4KPGA 3KR2A 5GWXA 1VL1A 2YXNA 3OESA 4IILA 1ZUD1 1DC3A 3NAMA 4QT0A 4UVIA 4ER7A 4JEUA 2FVYA 1QQBA 1GGFA 1U2GA 3O75A 3WSVA 2VSOA 1WB4A 3TLKA 4Q66C 1HI9A 1G8PA 2R6R1 1TM3E 2NPOA 5AUNB 3WAKA 2H0QA 3CM0A 3HSYA 1SU6A 3NIWA 1X2EA 3IKMB 4NBUA 3KD2A 1J2UA 2V03A 3BGIA 4G6ZA 2NTVA 3LZ6A 2HSZA 2ZBVA 2IP2A 2ZBGA 2BL4A 2OHOA 4L95C 3DE4X 1XTSA 3W3AA 4GI7A 4JBLA 3AEXA 4IAOA 5CFRA 1Z7BA 3M6IA 2GZHA 3OIUA 4WD3A 3V8VA 3FOAA 3OKAA 3AVUA 2ECPA 2G04A 2NSYA 3BWBA 1GL7A 2H06A 3WK5A 4ZCIA 2YWRA 3A27A 2QJRA 1L4FA 5FBQB 1TLTA 3GFQA 1Z45A 2G4CA 3F49S 3RS7A 1IEWA 2HJHA 4PFQA 4PWZA 5C8VA 4RPGA 3JVIA 5BYAA 3AKZA 2XEDA 1FDIA 2GK7A 1JG6A 1B8PA 3E22A 4RESA 3LG2A 3DH0A 3DHYA 3FTCA 5FYQA 3ZCTA 5BN5A 2BGJA 3CZCA 2C2KA 5T3UA 5CA0F 3EZGA 3PQ2A 4HAUA 2OAP1 5I7UA 5EIWA 5AI8A 2QW8A 4B3GA 1JMVA 1J8MF 4XUDA 5FUYA 2K87A 4DKJA 1R4ZA 1ODKA 1ZIOA 3TOCA 3CGWA 3I8XA 5DYWA 4CMBA 5LXTA 2CBGA 4HWRA 3UAXA 1V3UA 1BS2A 1GKIA 4E3WA 4B31A 5CMLA 3OURA 5HCNA 4OQ4A 3OCCA 1LK7A 3GRZA 3OJWA 4AWAA 1DQRA 4ZYXA 2CC2A 1YDGA 2EHJA 2I2XB 2RGWA 2W6NA 4YONB 1UAAA 2R6ZA 1V7QA 4AIRA 3MMXA 1O9BA 5LCXA 2O2CA 1WBJB 3KLBA 1CDEA 3RDPA 1JQ3A 4NCBA 2YVLA 1W29A 2WVAA 2HF9A 3F47A 3FCEA 2HK8A 5DK4A 1R9NA 4P31A 1GILA 1HFKA 2OV6A 5THQA 4DYVA 5KINB 1ZM2A 2EARA 2ODWA 1OUMA 4CLXA 2OAQ1 3PNLA 2ZJAA 4BC0A 4ECEA 4BQIA 2POCA 2ORYA 1XRJA 1JFRA 5F1YA 1E4EA 2OLJA 2ZSEA 3NFRA 5KVQA 3H5NA 2DPHA 4ZO8A 3LQ2A 5EIBC 4V0LA 3QITA 5JEEA 3RRFA 3D2CA 1Z17A 1M7BA 3DEYX 4HDRA 4XYGA 1KJJA 5EHNA 2BMAA 3OTQA 3PPIA 3JALA 4MGKR 4IIDA 4R83A 1UFQA 3LC1O 3QMVA 2FOIA 1SXJB 1X1BA 3I04M 1YL7A 4KR0A 4XOIA 5KNDH 2VH2A 2GD0A 4IRXA 3QI2A 4J3FA 1B7GO 1M2EA 1MQ9A 1NKTA 5LXTB 2NLOA 4PCLA 1VZ2A 1PJAA 1R5NA 4I4CA 2AI2A 4GRDA 2MSEB 3DMTC 4KXWA 2QU7A 2AW3A 3P96A 2PXCA 5DI9A 2GFQA 1QFXA 3GLSA 1RAGA 3NT5A 4RH3A 1N8TA 2VKTA 2IU6A 3FOCA 4UM8B 1BX1A 1SELA 4Q1DA 1CETA 4XJVA 3T52A 4DLTA 1TXGA 5BUCA 3CVJA 3RJTA 4YP6A 2I3DA 1M1NA 1A8HA 1T8TA 5KNBD 3EYAA 4RHXA 1FDVA 3ZEIA 5ELXA 3RVOA 1I8TA 4QBHA 1XVLA 2M6SA 1W5FA 3U4QB 1F2VA 1NVTA 3FWNA 3W77A 4BMZA 3OQIA 4DJAA 2Y76A 3MCAA 4KX3A 5B37A 4TVKA 1Z29A 4TWJA 2RGBA 3ME5A 2YJ6A 3JYNA 3ZYZA 3NUZA 3WGUA 1OLXB 3O38A 3OSZA 3L7JA 3QKIA 3IILA 1VL6A 4M1MA 4FMDB 4JLDA 4RZIA 5J4KA 3UXEA 3E8SA 2ATIA 2CJXA 5K6AA 4KWCA 2H4XA 3V8RA 2FKAA 2CJPA 1KMMA 3FYHA 3SP1A 1YV9A 1XTQA 3JD1A 2DERA 5LPNA 4Q3EA 3RU7A 1PAUA 1ZIXA 2NTJA 2QW0X 3S4YA 1UIRA 4CL2A 3T5CA 3QBVA 4UHKA 3VR5H 3F5SA 1CR2A 2OBLA 4XYMA 5EMNA 2O2SA 5EESA 4U3JB 1UXHA 1XTBA 5LYJA 4GKBA 3V7FA 2B35A 4OA5A 3TXYA 1DWUA 3QENA 2WHXA 3QXXA 2NZUG 4A6PA 1R74A 1T3TA 4DSAA 1UPXA 1TQ8A 1U90A 4EPXA 5BW4A 1DVRA 1HZJA 3LSYA 1QKIA 1G20A 2C58A 2ZDQA 5EWMB 3GLIE 4DR1B 1USIA 2GAOA 3DE1X 3J81A 2GN0A 2YICA 2BMFA 4B3HA 2W6JA 1YH3A 3DYIA 4W9RA 2MMGA 4ZV4A 3F8TA 3BGDA 1ZMOA 3KOZA 2C20A 5C8ZA 4Q9LA 5E7JA 4Z0HO 1ZOLA 2C84A 4P08A 3JWIA 4C6RA 2J9GA 4RNDB 4I08A 1E7YA 2A2ZA 4WLUA 3G9XA 4PPGA 3LX8A 4P3PA 3GLHB 2X0IA 1DKOA 3GEDA 4BLSA 2X2EA 3DONA 2QLMA 3N6XA 5EIAA 1WLYA 5F7JA 1K6MA 2HH9A 2KLBA 3A6GA 3I2YX 1GPKA 3IBTA 1BMTA 3QYJA 2O8CA 2AC7A 3QUSA 4KBYA 4K9PA 4NS4A 4PYKA 1VXOA 2XAAA 4H7HA 3TTWA 3V1YA 3I3OA 3ZHTA 3O84A 2ONYA 2DBYA 6REQB 3CN7A 1YQTA 5K01A 1Q0TA 1OH5A 4B80A 3NBUA 3RF6A 3E70C 3IP8A 3N2IA 1UKAA 3ISTA 2WFLB 3HHEA 1IDOA 4K2HA 4K9SA 3RVNA 3RT1A 3UIEA 3ZY6A 3WGJA 4DXAA 4F8YA 4PSKA 4DQUA 3OZGA 4MQMA 5EZYF 3WDMA 1JDBC 3D4OA 3TDMA 1Y1PA 4P3KA 4GYYA 3RAFC 4OSPA 4HQLA 3FPKA 1Z5WA 4WVFA 5JV5A 4KLCA 2Y9MB 2H5EA 2HGSA 3H2SA 2PX2A 2YIMA 5TT1A 3AF4A 1T1IA 1U63A 1W96A 4R6XA 1HE5A 2ZWOA 3UJ6A 1UK9A 2WWVD 2FGKA 2IYFA 4J4BA 3FF4A 1MIOA 2DY1A 3R9IA 4DIOA 4FGSA 3RJ5A 4YV7A 1LCIA 2DPGA 4W1QA 1DPFA 3K0EA 2JGJA 1V71A 2VYCA 3NIGB 5HFAA 3WJ1A 3CC8A 2ZIXB 3CUWA 4BVHA 1JPVA 4AMGA 2J0EA 1QVWA 4XE5A 1WDWB 5TEWA 1TM1E 3DZBA 3C3CA 4BP9A 1OI2A 3JATA 3G1TA 2WM9B 5CK5A 4CM9D 5C7OO 4D43A 2G08A 3A1SA 2ZE5A 4QM7A 2QNBA 3BMCB 4ZMBA 5F33A 2ODEA 1ML4A 4ROSA 5KC8A 1DIOB 3LLSA 1CNMA 1MP0A 2H4JA 4G0OA 2WJYA 1NT2A 1QHHA 2F64A 3KEFA 1CLEA 4JNCA 3QPBA 3SHOA 2ZBPA 4J3JA 4B4KA 2HJWA 4RJLA 3BORA 3Q7QA 4QARA 4WZBE 3WNZA 4YMWA 4ZDIA 1N9GA 4RFSA 1SXGA 4UAUA 3DEAA 4E32A 5IK2D 1QP4A 2P4HX 1A8QA 1BHJA 5BWBA 1YR2A 2IYLD 1SBYA 3MUEA 3QBTA 4MS4B 1G5FA 2CHEA 3O4RA 3GAZA 5FB3A 3U39A 2PQMA 2C3YA 1DRVA 1ZCAA 3QHAA 4E31A 1EESA 3ORQA 1QZ3A 1MQ8B 3TSYA 1Q0HA 1ZH0A 8ABPA 1ES9A 1XZAA 3G6KA 2FEMA 1N7GA 3R8FA 1X1SA 1FU7A 4HFNA 4R1OA 4XQCA 4ZP1A 4JEMA 4RM2A 4MWGA 5JG7A 4KU4A 3AJ8A 3PKJA 1JBEA 4CEJA 3KEGA 3NAQA 3WLNA 1E5LA 1VYUA 4DZTA 1F12A 2PN1A 5DRYA 3MTAA 4JI4B 5DLYA 2EDCA 1OU4A 4GPBA 3TLCA 4Z1OA 4DBVO 1UZAA 3NKFA 2UZ0A 3GA0A 1A2KC 3VPHA 4BVLA 4ITRC 4ML3A 2BE9A 3AEKA 4ZGBA 1Z0KA 1KYZA 4QX6A 1FDSA 1FYDA 4KIWA 1XDSA 4OI1A 4OG2A 3LP8A 1QFSA 5FXMA 2IHNA 4MRNA 3NBFA 5D3QA 3HDTA 1ND5A 4Q12A 2XDYA 5BSWA 1JJBA 3C3BA 1M10A 1Q15A 2VHWA 1NI4B 4TGLA 1QQ5A 1LDEA 5KYYA 2GI4A 1Y4DE 1U99A 2FRVA 1YFZA 2PHZA 1Q0UA 1XCLA 3HB4X 5TNXA 3PE3A 3GLGA 4CCWA 4U8GA 5CLLA 2YXEA 4QE3A 3ZY5A 1YZLA 4CMIA 2WV9A 4RA6B 2H18A 1PG2A 3S2FA 3HFJA 2C04A 5JDCC 2Q1TA 4ZVQA 5L3SB 4JDPA 1U7PA 5KWEA 1E96A 3EEIA 1H4SA 2J6HA 4UFNA 3HR8A 3REQB 4UUNA 2H52A 5EJ5A 4EW3A 3QE2A 3BWDD 3T4XA 5AVTA 2Q9BA 1AGYA 1Z4IA 4OHKA 1JHMA 4P5DA 3UWDA 1OBFO 4CM8A 2F8TA 4WNCA 1KVQA 3ZU5A 3RUAA 1PFWA 2AOUB 3CEMA 1KQNA 1A76A 1GN9A 1OV4A 1U11A 1E3LA 3KT0A 3RVRA 4GZ3A 3P2EA 4W5HA 3S29A 3R5XA 5M5BA 2UYYA 4PPNA 4CMAA 1MO4A 4PYIA 1MPXA 1NSYA 4ARCA 5JS1A 1YZYA 3NHSA 5KNBA 1AMNA 5BSTA 1UT8A 4GNRA 5J2UA 3FRIA 4FI3F 3CURA 1F8XA 2QQ5A 3FZNA 4XCVA 5EFOA 5P21A 3VU0A 1ZX1A 3ZI7A 5JH7A 2V74B 1WXIA 3CUVA 4B34A 4XA8A 1CS0B 2V1XA 2OXFA 3FB1A 2GN9A 3MS4A 4I1YA 2OV3A 2AZMA 3U4HA 2B9EA 3WTBA 5L3VA 3EPLA 2FQ1A 4O2AB 3SM3A 5I7WA 5H16A 1LBTA 3RIMA 1ZM7A 4JBXA 4DMUB 4ZK6A 4BCBA 4M1YA 1T8SA 3JR7A 3PFHA 5ADVA 1IRXA 5JD6A 3UMFA 4IFEA 3F5QA 3ADOA 1NBMD 2B0JA 3CZPA 1RQGA 2HWXA 3NYQA 2ZR7A 4XR9A 2XMBA 4YCJA 3MNFA 5EP2A 4CCSA 1QLJA 2Y77A 5DFAA 1GG9A 5FADA 1RXVA 1M5RA 4P3XA 1RYNA 2UXDB 4RD6A 4TRNA 4FMCB 1UXGA 1TM2A 5J43A 1WOYA 5M34A 3VTFA 4F4JA 2WTBA 3NVMB 3CRZA 4DRXA 3TDNA 2X5NA 2MHCA 1DHRA 2BZ1A 1L8AA 3GV0A 4O4HA 1RYFA 1E2GA 2JIBA 4GBJA 1RT9A 4GXNA 1HNNA 4IINA 2FMHA 1G2QA 2UU9B 1UBJS 1P74A 1VGRA 2E85A 3C6ZA 2W83A 2C5EA 5J2UB 3SDZA 1BCSB 3SYTA 1L7PA 1KQFA 5A7GA 1N6RA 1X19A 3H6GA 2O7SA 5LBIA 1OC2A 3COSA 3WIBA 3TMYA 4JB8A 4AKGA 1H4QA 2VUUA 3M7IA 5DTEA 3KLNA 3AUSA 3GJ4A 4NCIA 1OXTA 3FKJA 1R6AA 1JNXX 2IS6A 2ADFA 1ZSYA 3D7MA 1ZUWA 2GTIA 2PTGA 1ECFA 3DUFB 3L8DA 5LN1A 1B26A 2TYSB 4URZR 4BX9A 1VHDA 2HUPA 5HSGA 1OH7A 3QWBA 1Z7WA 2F1OA 4FQ8A 4BQEA 1APBA 2HJGA 2RIPA 3S2EA 1GDTA 1A9XA 4M54A 1BVYF 3PQDA 1UQUA 1EX9A 2ZFUA 5EWJA 1I33A 3OZAA 2YCLA 4U5QA 3T5PA 3RTDA 3EFBA 4MO9A 3TGLA 1WPQA 3VR4D 1TYBE 4EYEA 3OZWA 2WUDA 3KTAA 1TFRA 1YMVA 4MYSA 5HG0A 5LOVF 4OHYA 1WF6A 3TD2A 4OXKA 4C4SA 4CDNA 1QB8A 1RM5A 2AR7A 3FIUA 3AHDA 1NN5A 1YJAA 3FPHA 1I0LA 1UQRA 3EMVA 3I45A 4MR8A 1Y3IA 5E6UA 4FKZA 2QN3A 5BSGA 5FLXA 1ZD3A 2AX4A 3GHYA 2FPPB 2HA7A 2XDQA 4TLLB 1K63A 4UFOA 3GP3A 4WESB 1BS9A 1X3SA 2C4WA 1O6FA 1AKVA 1ESDA 1YQ9A 2QTMA 3OX1A 4GR4A 5KJEA 1GZ7A 2BCEA 2YMPA 4DIKA 5CFQA 3MQ2A 1EGHA 3MPUA 1XZCA 1V1RB 3HYNA 4I1IA 5FWXA 1TUEA 1U8ZA 2OGSA 2P4QA 3FPLA 1WXDA 3SQLA 2XUJA 4LCBA 4NVRA 5AESA 4N7BA 2IIVA 1X7GA 1TVKB 4J7CA 1WOMA 1QYVA 2AN9A 2HGZA 3DTTA 5CHEA 5BOVA 4ZI2A 3GJ5A 3RVSA 2R1ZA 5BMVB 1KI7A 2ECQA 1YFLA 3RS2A 2PJUA 2QR2A 1E1CB 3CKLA 5AK4A 5K2OA 4FTWA 4TMKA 2YZ2A 2ID4A 4M86A 4LXGA 5FX2A 4Q7MB 2KBEA 4X6XA 2TMKA 3DEIA 2GF9A 4GZLA 3W5SA 3S7ZA 1PR1A 4JYCA 2Q3CA 4MJ3A 2HMYB 4C3OB 1N1EA 4JKYA 1CY6A 1OWPA 2P0YA 1XLVA 1MB3A 4BBAA 2ZWAA 4EBBA 2QE7D 1NFQA 4FZRA 5A2QA 2ATVA 3ZUGA 3Q9UA 1P81A 4LJ9A 4TMWA 4AJOA 2ATXA 4KR6A 4PQEA 1OFGA 3QYFA 4CM9A 2OVBA 4OH1A 2IHKA 5F73A 2UYHA 2NT3A 2RHDA 4NG4A 4ZALA 4Y6LA 1KZYC 4R8MA 2HQSA 1IVYA 2FQQA 4RKEA 2Z4RA 1TM4E 2WF9A 3PEUA 4EM6A 3SBOA 1XMJA 1XPJA 4BKOA 5B1YA 5DTIA 4GG1A 3QLJA 1BVRA 3I4CA 4DY6A 1RJ9A 2A3NA 3EVCA 3IEXA 3JWHA 2AEEA 3C7KA 4NZZA 4C21A 3FNGA 5IK2A 5BYKA 3P9PA 3G02A 1EVLA 1FSPA 3DOFA 3QLUC 1ZGZA 2FH5B 3KRTA 3P9NA 1Z6XA 2A86A 3I64A 1KMQA 3CG0A 4EWLA 5JD5A 2WIJA 1GR1A 4RZQA 4JAVC 3P9XA 4GP7A 3SE0A 1XZJA 2AEJA 1SUBA 5GZ1A 4WBNB 3O1JC 5TQVA 3QXSA 3K4PA 4Y9UA 4DV0B 2ODNA 4IVQA 2X8BA 4YMUA 1A5BB 1JILA 1J7JA 1OXMA 4K28A 4QJ3A 2R84A 3BD8A 4RPJA 4B17A 3ZUPA 3A2KA 3LHDA 3OE4A 3T12A 1ORDA 3RU9A 1N9KA 1ZA1A 3O9MA 3ZK7A 1ZU5A 3HNOA 3BH7A 3RROA 1F3LA 1ZK2A 3O83A 4Z7NB 2P9EA 4QXOA 4MP6A 3PE6A 1VRVA 4PIVA 3TD6A 4AUMA 1DBRA 1QOPB 2FR0A 2WD7A 4FFBA 4L0QA 4LQDA 5H5JA 3RLIA 5ES4B 1OTYA 2AFHB 2XOKA 2HV8A 4AMYA 3IP5A 1P0QA 3FNBA 4RVFA 3DMDA 4RD0A 4D8YA 1Y6FA 1NXTA 1LPSA 3THOA 4W99A 1FEZA 5BYJA 3UPDA 5IXJA 4AJLA 1KF0A 2RG1A 4P35A 2YQZA 1ZOSA 2WTAA 2B5VA 1MH9A 4EG3A 5KTNA 3CRW1 1ZFNA 2J9FA 4YRDA 4DV7B 1LBQA 4GP9A 1J0EA 3U49A 5K6RA 4YJ3B 1PG5A 3HXLA 3HZHA 4K6MA 1YB4A 4GGMX 3E1KA 2IPAB 4XX0B 4QUEA 3CJTA 4NEHB 4OGGA 3ZDFA 2RJ3A 1L7VC 1I1HA 3FVTA 2WUFA 5C0OE 3U3MA 2BMWA 2PGLA 2XF8A 1PR4A 5CM9C 1P5RA 4RFLA 3T3MB 4PW0A 4ZFNA 2CE7A 3A10A 2RH5A 1XDWA 4J9UE 5G0SA 5ARBA 3Q3CA 2H5LA 4LXHA 1JJFA 1QPBA 4KFRA 3W0LB 1KAQA 2FF5A 2YRXA 5EE9A 3LDAA 3LFUA 2QB5A 5D6NA 1FFAA 2AT1A 1JR6A 2Z56A 5EJGA 1RKXA 2CXNA 3HWSA 3ZX4A 4LFBB 2H9YA 1U2PA 3D0OA 2F9MA 4P36A 4F96A 2ZIVB 3BK2A 4DLXA 1CZKA 2DZDA 4IYRA 4F5YA 2VP2A 2VT3A 4WOJA 5EIEA 1HT3A 1OIWA 1UJBA 4OQZA 1MC1A 2WRZA 4HXGA 2HYIC 1UZNA 2E82A 2ZUVA 2HNAA 4C0HA 1YZ3A 1RBMA 2XYPA 3NHAA 2YY7A 4H18A 1EX7A 2CF5A 2H2HA 4F04A 1Z2OX 1ABBA 3WLKX 2XXBA 4C7VA 2C0CA 2XGOA 3N0RA 1XQ6A 2AJCA 2PM8A 3N86A 3LHSA 1EG2A 2IEYA 4M0DA 3KJHA 4BP1A 2ZU6A 4NK5A 1JLKA 1VZ3A 3VMFA 3G2PA 2QK4A 2WEKA 4N0MA 4BFZA 3I2JA 3CRVA 2WSIA 1Z63A 2D7DA 1UKYA 4AT1A 2WWHA 1LDMA 1UBRS 2MSLA 2XE4A 1TEZA 1KI2A 1P2TA 1P44A 1XRPA 4KHZA 2VP6A 4FOLA 3S70A 4FB5A 5TC4A 5MN5A 3PXCX 4MULA 4PRYA 3GPIA 3DF7A 1PT8A 3VTZA 3IAXA 2PH1A 4MHSA 4JB3A 3AI1A 4P86A 2QJTA 2D0PB 4PG7A 2I2FA 3R3YA 3R0ZA 1TO6A 1V8FA 4JJIA 3UN1A 1Y8AA 3GFBA 3W6ZA 1Z4PX 3ZGYA 1KJ9A 1NI3A 2IU3A 3EWSA 3DV0A 3HXTA 1CBUA 3P0FA 2GK4A 5C18A 2BW0A 5F3WB 2DTDA 1SB9A 4K2AA 2AK2A 4ZTUB 3OM0A 1K4MA 3TZHA 1DCTA 2YWHA 3DL2A 3Q88A 1BXRB 4R81A 2NXCA 2HWWA 1PDWA 2VK2A 4KPFC 5H9WA 3DDWA 4KRFA 5FP0A 1HXHA 1I80A 1YS4A 2UUBB 3CE9A 1BTOA 1U8CB 3HB7A 3LT1A 2HSJA 4K0RA 3Q5DA 1W5TA 2VDVE 4LECA 3VR4A 3VA7A 3WLOA 3SLRA 3G0DA 1DRUA 3BJRA 4CM7A 3OQNA 4NSNA 4UJ5A 1NZDA 3BWXA 4QULA 4KN6A 3BVPA 3V55A 2OFFA 2JASA 4QD3A 3LAWA 5TMBA 3WLAA 3AFOA 1XLWA 4MPJA 4NATA 3VYVA 3PGKA 2I03A 3MHTA 4GQIA 4YT4A 3ACCA 1HETA 2CUTA 1XWWA 4TV8A 2FWJA 2QSYA 2QGFA 2R66A 5LKAA 1RQXA 3C3WA 2R44A 5BN4B 3ZDZB 5BNTA 1BJRE 3TJRA 5COAA 4TYPA 3C8ZA 5KYWB 3EPJA 1HT0A 1LVGA 1TKAA 2XADA 4OGFA 4KOAA 4AROA 5GIOE 3JAMA 3C8DA 4GX0A 4Q02A 5AKYA 3U26A 1L5OA 1S8AA 1SA0B 4A6EA 3S2YA 5ALMA 3L9XA 3C87A 1K7SN 3E7DA 1JEJA 3ZJVA 4U2GA 1UZLA 1V1JA 2CT8A 4JVNA 1JQEA 4CF6A 4JC5A 2O8EA 3ID6C 3JYQA 1U7DA 2RB5A 5T41A 4B84A 4HBZA 3DAHA 1F9AA 2Q9CA 3KJQA 2B8NA 1U2DC 4QRHA 3NWJA 3OBIA 4MQFA 4QGGA 3C8UA 2EWWA 3I5UA 2BR4A 2KQUA 3OOEA 4ISCA 4WADA 5TPZD 1Q1NA 3KXLA 5CEJA 3A3OA 5EMJA 2MR6A 4PGHA 2LIPA 1AXGA 4TWZA 2F3SA 3A9VA 4E3ZA 4L4RA 2C2YA 4MB6A 2FYTA 1TZCA 1ECBA 3G1UA 4XGIA 1BA2A 1U9IA 2IHJA 1LLDA 2A9QA 1NP7A 2HREA 2OO5A 1UFVA 3IQIX 1TKRA 2IPLA 4GWGA 1AK9A 4LY0A 4Q9AA 4QDZA 5BWOA 3W9BA 2ZJZA 4GSKA 4D9IA 1LFAA 4CLOA 2N3ZA 3TMKA 2DFNA 3UMBA 4CKXA 2D4AA 2WUWE 2CMFA 5JWHA 1TK9A 1PJQA 2B5OA 4R69A 1QTQA 2IE8A 2QTZA 1PI3A 3VKGA 1NXXA 3EXHB 3PDWA 4DQLA 3DF9A 1FX0B 2YMLA 4F2HA 3FBGA 2DMRA 1OWLA 3VO8A 2B7LA 2P1RA 3DPUA 4C6HA 1NE2A 2DFKB 2Y3IA 3N59A 1T43A 3ZBPA 2O14A 3DO5A 2E2WA 3LX4A 4IR7A 1HWYA 4X1KA 2O8EB 1QYCA 4IZHA 3QUTA 4AG5A 5M04A 4RTJA 4HD8A 1ID1A 2GA8A 2XCLA 2C98A 2WHQA 3H18A 4ZOCA 4KZPA 1FUEA 3GDWA 3VC7A 4A26A 1YDMA 5IC4A 4L4UA 2NX2A 4XFJA 4PM4A 5ENDA 2BIFA 2PU7A 4KO1S 4WKPA 4HUTA 2ISSD 3NHKA 5JCJA 3CH6A 4YJFB 2P91A 5HCUA 4PBTA 2YIDA 3VOBA 3WY9A 1EUCA 3B8HA 3KQLA 2IE0A 3IMFA 3M81A 3PJEA 5JSUA 2ZJOA 3CR8A 1B0PA 1UJ4A 1QBKC 3RC1A 1OXXK 4L0DA 3MXTA 3VBEA 4ZJYA 5EFZA 1H05A 1KP3A 1MVLA 3CRRA 1YOVB 2HL6A 2MWMA 2R1TB 3C74A 5FPHA 3LDHA 3T9DA 2XMQA 2XB8A 4N6NA 2FPGB 2ZIUB 3LLCA 3MLBA 4ZVTA 3A1TA 3PD0A 4IIJA 2NADA 2O3TA 3BMQA 3Q15C 2D1YA 4RGYA 1OLSA 5AJXA 2DJ5A 4WCFC 3KWLA 4BKUA 3VC2A 4BEWA 1MX5A 2OUKA 1IG0A 3QBJA 1HDGO 2LTAA 1SRRA 2WAOA 3E9ZA 5D5PA 3RFXA 3ZTYA 2X1HA 5C5EA 4Z54A 2X5OA 3OD5A 1Y1LA 2Q49A 3W5UA 3PQCA 1O94C 3O2SB 1XCBA 2G8NA 3LY9A 1VYHA 1HSOA 4GXRA 1D1PA 1QYRA 2VOJA 2QN6A 3Q85A 1NULA 4B2LA 3G6WA 2NIPA 1U5CA 4P1ZA 2B6HA 1P4AA 3E9NA 3NCTA 5D87A 2JFFA 1PS0A 1TEVA 1Y33E 3Q7SA 2PBZA 4Q9JA 2IS1A 2BGTA 1YZGA 2O0JA 2VUSA 3PC8C 3SCZA 5JHHB 5A4FS 1EE1A 4W9NA 5FBHA 4LI3X 5GJWC 2CLDX 2J3JA 3QUQA 1ZLYA 3ZS8A 1EK2A 4DRZA 3ANLA 1ORTA 2Y27A 3D9QX 4OK5A 1BVHA 2XVMA 3RKSA 3H86A 1UZMA 1ZVJA 3CR3C 3QYPA 4M46A 3X2FA 1ZH6A 4KQ6A 3SZ3A 1XQWA 4B3XA 4Q9HA 5EXXA 4JJ4A 1B00A 2RHLA 1VIAA 2JFPA 3FUXA 4FD3A 4LHVA 4PXAA 4YCMA 1EB8A 1O08A 4HLQB 3V1TC 3ZW7A 1K4YA 2XQKA 1AV7A 2YFHA 4JBWA 4IJUA 1OTHA 4TTTS 4ZT6A 3H3FA 2Q4EA 3K9LA 4GC5A 4X62B 1ZM9A 3PKZA 4K6OA 5G3YA 4BKRA 1XJCA 2C5FA 2VZEA 4MQUA 3X2EA 5A1JA 3ENNA 3GRCA 1Q92A 3F4KA 3DDNA 5FOWA 4Z5XA 2X76A 3HE3A 4WGGA 2OC4A 5T8KA 3D2LA 3FLEA 4RETA 2IUFA 2X0EA 3U4IA 4N8SA 1HO3A 4WVLA 5ALVA 1QYWA 2HA5A 3LVBA 4FYMA 4IG9A 5EVCA 2IXTA 4IUCS 4V38A 2XNJA 1CUEA 2QPLA 3EZLA 2AX3A 2PRKA 3PCXA 1ZGGA 3KNZA 4YRLA 5FBKA 1PEAA 2J0UB 2HY7A 3THSA 5BWCA 5DKFA 1DTEA 1TVMA 3OP4A 4U2DA 2ADOA 1G7RA 5JLJA 2ODTX 1ZD5A 1UBMS 2X0KA 5KCMA 2IELA 3UJ7A 2YW2A 2AJBA 2I34A 5H0IA 5MDHA 4C7OB 4CV0A 3H8VA 3NANA 4L4YA 1UBNA 3O2QB 4BQNA 1J09A 2QXUA 1IHDA 1KMHB 1O0SA 3KR1A 5A3VA 3MHPA 1KO4A 3VKFA 3O8QA 4QQKA 3TQSA 1DEAA 3V7NA 2A0WA 1OHHD 2K6GA 3FBTA 3IOCA 4XSHA 5AI4A 3IUJA 1EJBA 2VQDA 3GLRA 4FHEA 4D3XA 2WG0A 1K88A 1U2GC 2BEUA 1MTZA 4RHUA 1VA4A 3CWQA 5A5FA 4BAUA 1VBKA 1MO2A 4UVHA 1PZXA 1UMKA 2G70A 3WMWA 2X0FA 1W25A 4Q93A 3PNYA 3ZDYB 5KO2A 1EFAA 4OTZA 3LCUA 4DA8A 5L7TA 4TN5A 4EGAA 2CGEA 1WCIB 1E77A 3I01A 2VZ9A 1MNQA 1OI7A 3NB0A 3QW4B 4KCGA 1RJDA 1T3HA 4JQSA 5ERXA 1XL0A 3CF4A 3PJGA 3OO1A 4J1TA 4ZARA 1ZVKA 4MS3B 5HVNA 3C5WP 4Z99A 5H83A 5C2JB 4AD8A 4D9HA 1XF9A 5DCYA 2I2BA 1PT9A 5JROA 2IDJA 2O7QA 4MUEA 4L1KA 1KVTA 2HDWA 5SY4A 1Y63A 4KQMA 1TK2A 4BXOA 2JLBA 3GRPA 1KS2A 3PDIB 5ALJA 1RFLA 3TCNA 4BTEA 2J3IA 3M5CA 3MWKA 1YJBA 4NZYA 5DT2A 3U4AA 1L4NA 1SCBA 5KSZA 3AK4A 1Z3CA 3TTTA 3EUEA 4HDNA 5FI5A 2W6ID 4HAVA 5JRDS 5CVEA 2XGMA 4RHFA 3RTCA 3QZUA 1R0BA 1O58A 4I3FA 3KLOA 2GD6A 5JBQA 3DOEA 3Q98A 1Z26A 1I2DA 1W73A 4KYVA 5AVKA 3SBEA 3WMRA 2AE2A 3P4XA 3NGMA 5KX5F 2HZBA 1SC9A 2OWDA 2QUHA 4CDRA 3G9ZA 5AOCA 5HP4A 4M9ZA 4V3BA 5CURA 1E3IA 1LB1B 4GEKA 2DH5A 1Y7HA 1WCV1 4EQ6B 3HYSA 1OLUA 2AZ4A 4HMOA 3DE3X 2DP4E 1NU8A 2BOVA 5H70A 2F3PA 1FQWA 2BFFA 4ILEA 5JD4A 4XRGA 2BEWA 4DB2A 3PUZA 5CYOA 1YWGO 3A1NA 4QXMA 3PUVA 2PSEA 1D7OA 3Q11A 4LNUA 1ZI9A 1VECA 4RAOA 4U5XA 2ZJ3A 3KUCA 3EQ9A 1S0UA 4P4TA 4O4JA 4I1PA 3RS4A 1X13A 2QTRA 3QKTA 4C06A 5CBPB 5TPZA 1YIOA 3JQPA 4TLAA 3FZGA 2I54A 1MF7A 4DLYA 1M8PA 3H9QA 2DR3A 2H2FA 3AI2A 1D03A 3F74A 3R0XA 4NQRA 2XW6A 1PJRA 1O3YA 3OFKA 3R0QA 5IDYA 2EIHA 2R2AA 3WIUA 3LUDA 3HM9A 2IBTA 2RGAA 4YAIA 2EG5A 2XUHA 1JIVA 5H8WA 1IH8A 3EXAA 2O8FB 4PYOA 1NPYA 1M33A 4L5AA 4EF5A 3G3EA 1FU4A 1E2HA 4Q47A 1SCAA 1K08A 4AC9A 2ZS7A 4FDVA 1FYEA 5AI9A 1PVOA 5AIBA 4Q3AA 5TB5A 3R7FA 2O59A 3OH8A 3SC2B 5CB4A 1RC0A 5JU6A 1L9XA 3M8KA 3GLTA 3I0NA 3K1JA 4PGMA 3KHTA 4QDKA 4OBWA 3ONFA 4LNUB 4MI1A 3ZXYA 1F2UA 1Y5RA 4DIFA 1M1YE 2CKMA 3SIWA 4O4JB 4WY5A 1UK6A 4E11A 3BSFA 3O4VA 4KIGA 4NCXA 4JI3B 1UBOS 1Q84A 3B48A 4J0QA 3L05A 4RZXA 5ESDA 6REQA 4IVPA 3P9ZA 4X3CA 2VH5R 3CCBA 4BJ6A 1DJLA 3BIJA 1NW3A 1RD4A 1L5GB 4ECAA 4F21A 2FMKA 3VVLA 5LNK1 1Z22A 5K8IA 3ANTA 4BZWA 3AR4A 5BOSA 3BRWA 1Q0RA 1Z74A 5E4TA 1CS4C 4AZ0A 2FPIB 3L7AA 1U0EA 3P9QA 2YV3A 4UNQA 2M9MA 2ZB4A 5JISA 4II3A 4Y2VA 4H16A 1EWKA 1Z73A 3KHUA 2OFOA 5DHFA 3TOVA 4EY6A 3VO2A 1X7HA 3QBDA 2J3MA 3OQJA 3P0EA 3C43A 3RHSA 1Q11A 3D59A 4YMGA 1YVPA 4OBEA 3HADA 1M75A 4PINA 5GJCA 3UHFA 3VKHA 4BWFB 4L9RA 4CEHA 1N6LA 2FW9A 4M0EA 4KJXA 1OIVA 2IGBA 3CU5A 4IJMA 5HF6A 4B85A 1A5TA 3GZ4A 4ME6A 4Z0NA 3ZGLA 4ETMA 2WKQA 4R1UA 2VRCD 1BQ4A 2OAGA 2Z8YM 4ZEMA 1ZXLA 2FFHA 1GP2A 1WDTA 2FXIA 3AKYA 1WU8A 2C4VA 4YTEA 4OXNA 3TR5A 3M2PA 4I46A 4RK6A 1WP4A 3GD7A 4IH4A 4IIGA 4N18A 1HYBA 2QY6A 3MTDA 4H3VA 5GJVC 5KSPA 3TL2A 2B1RA 1S1CA 2AYYA 3AKDA 5FEMA 4WK2B 2O20A 2P0EA 5PGMA 1VL8A 5AT1A 4FXOA 1SUSA 3R5JA 3L46A 3PTLA 3FBWA 3QU9A 2P69A 621PA 3SF8A 3EVZA 1Q0QA 3LZCA 1J2RA 2HU8A 3DGEC 4REMA 4RJIA 3RQSA 3RYIB 3W8NA 1FSZA 4BO6A 5CEEA 4GOXA 4IDDA 1U7ZA 1WCWA 3SKVA 4OHCA 3CLTD 2F43A 2GWHA 2G7MC 6CHYA 3U4MA 5BNIA 3L8ZA 1SKUA 5HQTA 4Q1VA 1E2MA 1DELA 1ZAKA 4LY6A 4EF6A 2YIJA 2GH1A 1AE1A 1K2WA 2WTEA 3NDJA 2PGNA 3GK3A 4NU5A 4Q3LA 3DFIA 3QU5A 1N5MA 3U3JA 2XUOA 1EXMA 1R4NB 3CH4B 3R5SA 4B4DA 1R6DA 3WZMA 2IF0A 2GXAA 5KTRA 4HB0A 4Q3BA 1E1KA 2V58A 4Z4GA 2J31A 2KS6A 2P3SA 1VSUA 1NR7A 2A1UB 3WGLA 4DCCA 1NPDA 2AG6A 4P98A 3I1JA 3AF5A 3MIIA 4TXMA 3H3JA 1KK3A 3OM9A 4X3PA 2FX3A 4CFZA 4IFBA 1D2HA 2QM3A 4F3KA 4FN4A 3ZD9A 2Q8NA 2FAXA 1A9QA 1TQDA 5DI3B 3RRZA 3JV7A 2XUAA 4JJEA 1AUQA 3JVDA 2QD2A 3EFOA 3QELB 5EMKA 3RF7A 4DEYA 1KU0A 3O9ZA 1L5LA 3CLUC 3VX3A 5G1OA 1BQEA 5D1HA 4RTQA 9LDTA 3FWHA 3A6FA 4CUZA 2GHIA 2VJPA 4KITB 1R0WA 4U7GA 1TTTA 1QTRA 3PC4A 1HT2E 3KKEA 2I6FA 2G0NA 3B6IA 3PA6A 1QCCA 1F4VA 4RQUA 5AJHA 2PKYX 4FEYA 2NNLD 1XEAA 4HRAA 3FGNA 4P84A 4Y1RA 1NDQA 3OT5A 4ZOBA 5JNRA 1CEYA 1GZ5A 3UICA 3TE6A 1DOAA 1GDDA 4H15A 5BMOA 3FLAA 1L1QA 2W2MA 3DBHA 3LCCA 4PYMA 4RTOA 2IH4A 1Z0SA 3ORRA 1OHHA 1KQ3A 1A27A 1N6HA 1C1DA 1KH1A 4R68A 3UA4A 1TW3A 2ZIFA 3OZ7A 2NNWB 4GWLA 4WUTA 2SNIE 2YQ4A 2GHTA 4QHTA 5FFMA 1RE1A 4BNDA 5E1BA 4OL0A 1RVV1 3EXG2 2YY6A 3HWX1 2P11A 4REQB 4WRRA 1S4QA 3R9XB 4AY2A 3HA3A 5LYJF 3VM6A 4H08A 4KLAA 5HJ5A 1YFKA 1PJTA 5F78A 1UK7A 1PZGA 4F6LA 3G17A 3EVBA 3M2TA 3DZKA 5G0UA 4QEKA 1M6VA 3FFTA 1V8BA 3ESBA 4XSVA 5DSZA 4C7MA 3Q8KA 1Y9DA 2HR1A 4FOPA 3ZOKA 3R8CA 1IRIA 5IBRA 2CJWB 4BP3A 3L82B 4DS3A 5DV9A 3WRXA 2I6TA 2E48A 1P31A 2I2WA 3OQ6A 4CL3A 4UUOA 2FHPA 2XIQA 1FCJA 1TJ5A 3OM1A 3PGMA 4YUVA 4WK4B 2ZIZA 1CF4A 4FDMA 3HR7A 3X1DA 1YBHA 3KZCA 4QVKA 5BSFA 3BB4A 2FSSA 3DBLB 3O4HA 4G5SA 1KYQA 2DQSA 2DULA 1P3DA 2W2PA 3H5LA 3K2QA 5B7QA 3W7AA 2H54A 2Q07A 4YN3A 4DDHA 1P73A 5B55A 3COJA 5ITZA 4YV2A 1EVQA 1L7EA 3ZH9B 2X8AA 1LF0A 2HI0A 3BXGA 4CTOA 4N0DA 3O4GA 5DSTA 5C8YA 1E61A 3U9TA 1VA5A 1ZNQO 1QV9A 1WKBA 1XCPA 3EWIA 1I36A 5LU8A 2X40A 3RE1A 3T1OA 4EMUA 1QQ7A 5JAZA 1R6BX 3WLJA 3DBIA 1CERA 1YB1A 2J59A 4H7KA 5H4GA 3AY3A 1QO0A 2I8LA 3CKMA 1DBSA 3I6QA 3ITDA 3VX4A 2HKIA 4BN5A 2ECFA 3GCZA 4Y7CA 4AY4A 3GAFA 3KOMA 1MAUA 4Q4JA 3CE6A 1XZMA 3BWMA 1V3QE 4IHJF 1PKEA 1D1TA 4M1QA 4RGVA 5BQPA 4CNBA 2J46A 2V0NA 5TARA 1WB9A 4YDQA 1TA9A 3BFPA 2FPRA 4R4JA 4Y6RA 4LJ8A 4AL4A 5LQNA 3VKWA 4IEIA 1DAOA 3HDVA 1EZ1A 4JL5A 3ZZUA 2QMHA 3ZE0B 3UHJA 1ZW1A 3ROPA 3BGWA 3B20A 3QPVA 4L22A 5CA0A 1BYUA 4L72A 1XE3A 4NV3A 3S8MA 5L9AA 2HJVA 3AR5A 4MRMB 2ES4A 1XU9A 4ZKDA 4ERXA 3OIWA 5K7SA 4ZVNA 5AVWA 4L51A 4RLSA 5IF9A 4DLPA 3QVOA 4N3CA 5AYVA 3P9IA 1PS9A 4LX0A 2ZREA 2VQEB 5DHPA 3D02A 4GECA 2ZETA 2B8WA 3ANYB 2OK8A 4EL5A 1IBRA 3M3DA 3RFFA 1C4OA 1NVAA 4PAOA 1FW8A 1VE1A 3ETGA 4CLRB 5IX8A 1R0CA 1UH5A 1M0TA 5AJTA 2PNJA 1XELA 2YS6A 1JL3A 2J4DA 4JENA 3SXJA 3QSGA 3A31A 1UKEA 3NNSA 1WV0A 5DP1A 1Y48E 3CINA 1VJ1A 2QJWA 5LMZA 4H59A 2BTQA 1C1XB 4ZAYA 2ZRBA 4UUAA 2QD3A 5FQOA 2DBQA 5FQNA 3CLHA 1OD6A 2Y4NA 4ERNA 4M0KA 5MFZA 1SQGA 4X20B 3T4PA 5E7MA 3WTCA 4EUSA 4ZTZB 3HNPA 1N0VC 4O4IF 4QWMA 3BL8A 5DTRA 3IULA 3S99A 2B34A 1JEYB 3VPSA 5DCLA 2WJJA 4G23A 3F9IA 1M6YA 3LOQA 5DM0A 2Q29A 1WZUA 4XB1A 4RQTA 3V2HA 3MQFA 5C1BA 5IN4A 2EXXA 1YJQA 3K1ZA 3JTEA 3QUBA 4RA9B 1GRRA 3I37X 4KR9A 3T34A 5ECDA 3TLXA 5CA0B 1E59A 3DAGA 2Q2QA 3LBHA 3IOBA 4N7RA 5ECYA 2R25B 1PO7A 4DMKA 2BH9A 4I4TA 4ATNA 4L9WA 2BE7A 4M0PA 2NUAB 4HAXA 3FCYA 3G0CA 4POAA 3RUIA 2HIAA 1AZWA 5THXA 2VHCA 4NPAA 3TLGB 4Y6QA 4UBJA 4LGCA 1HNXB 3V4LA 3FDJA 3BXXA 3RO7A 1KI8A 4UDOA 2P4SA 4GEGA 2A0FA 2MOKA 4O63O 1RCFA 3GUYA 2DFPA 2GFHA 1HT1E 3DGFC 1AA9A 4MA0A 1XYYA 2OBYA 2EU8A 2W2KA 3WDLA 4MUHA 5KU7A 5JY6A 3CQ9A 3CCFA 4PIPA 3W06A 4W9MC 2VNIA 4QG7A 3N3BC 3K6SB 3PSAA 2B94A 2B98A 2DWPA 4OIFA 4PNZA 1JKMA 5HS4A 1A9PA 2CFIA 3OM8A 4DZRA 4FYVA 3A4IA 4OFXA 1AZLA 4UNPA 4C20A 4L0MA 2VRCA 5EZ5A 4ND1A 3EPHA 1XO1A 3R5FA 1A7KA 1G5QA 1USGA 3I5MA 4FT2A 3BF7A 5J9FA 3A1WA 2D2FA 2YJ3A 3A2NA 3CUTA 3H13A 4MVJI 4A8PA 1FPMA 8OHMA 2XUKA 3CKYA 3D43A 4A2PA 4FCCA 1S2GA 3OZXA 1JU9A 3IAEA 4LHEA 3T4UA 1ISSA 1GAWA 3BTUA 3CMMA 4LYGA 4MGYR 2FN4A 5LIRA 1YI8A 5C5CA 1V25A 3ZV3A 3S2SA 3EEFA 3N2ZB 1JECA 1WXEA 2ZR9A 1ZNZA 3N6RA 3QOFA 3UYKA 2GM4A 4CFSA 1P0IA 1L5HB 4D0GA 4C78A 4S3MA 3A25A 3KPVA 4I81A 2WJ4A 4D79A 5DNCA 1CYEA 4OHVA 3HG7A 3OTHA 4JASB 4CKEB 3R6WA 2W43A 7AT1A 2OAEA 5JFGA 1J1ZA 2A3RA 4B4OA 3THWB 4KMSA 2VJKA 2FN3A 1Q3HA 3M9XA 4HQFA 1J21A 3L06A 1IK4A 1ADFA 3STHA 2FWPA 1RMTA 1A96A 1DOZA 1O54A 3P4YA 3COWA 3GQBB 2PYDA 5GM1A 2D7CA 3PQ6A 2YUTA 3DV2A 2VATA 1W36C 1CQXA 3OBBA 3I9MA 3QOYA 3GLFA 3U7RA 3JASB 4V02A 16PKA 1MJGM 4HSGA 1OGIA 4G0WA 4JI6B 1U8YA 1E7WA 3O2JA 3PITA 4OJQA 3SG0A 3K9GA 1CNEA 2GK3A 4QIHA 2B61A 3EBPA 4RADA 2IOFK 3B1YA 3BEOA 2P1ZA 4RL6A 3RBZA 1WPXA 3QWFA 5IC5A 4WZAA 3V4OA 5J3JA 2ZEJA 3MTQA 3R0VA 4MR7A 3DL0A 4UUPA 1ZU4A 4MROA 4UE3S 1MGOA 5CM2Z 4GPEA 4ADSG 2JVJA 4CIDA 4WNYA 3WMEA 4R9VA 1CLUA 1S2IA 3EOAI 1F0YA 4IXTA 5IRCD 2VDQB 4EGQA 1IULA 2J32A 4R8KA 4C07A 5KZMB 1RI5A 1ZMTA 3JQFA 5ADHA 4XLZA 3KEOA 4L50A 3PD1A 2NV2B 2ZYWX 1LRJA 1G1AA 3V46A 3EXEB 4HKTA 2JI9A 3IAM6 5IKXA 5KWVA 3O1HB 4BPBA 2X3UA 2XA2A 4OFBA 1BMDA 1LI7A 3ZDAA 1LJUA 3KZVA 4F97A 2JKZA 5CG2A 1M83A 1BJKA 3AMVA 3EVDA 3T6KA 1X15A 2ONZA 3K5WA 4QXAA 2A5DA 5DHQA 1BFKA 4LJLA 4DTCA 1DLIA 2B3DA 3PT9A 1K5DA 3HJFA 3UK1A 1OX5A 3LGXA 3UT0A 2HHJA 4KVZA 2H4ZA 4AY6A 3V42A 2QWXA 5D3KA 4YXFA 1DO0A 1NRJB 3F46A 5I47A 1IE3A 1NMZA 1FTYA 1EFCA 4G1VA 4EG1A 1IAQA 1NXSA 4BASA 3HTXA 4BHTA 4I5DA 1NW6A 1ZDMA 4JR1A 1YUBA 3EX7C 2EGHA 1QS0A 2YVKA 4BJHB 3V1UA 3I6YA 1J70A 5ALEA 1JVSA 2XGSA 4GI5A 3QVTA 3WFIA 3L0YA 4BIIA 1GQFA 1T5DX 2OBFA 5DGIA 5EZYB 1KZHA 2H8GA 2IX3A 2QR3A 2BFDB 3RUCA 4XM2A 3I61A 2IJGX 3OJ0A 1L3IA 1F7UA 1X7ZB 1Y6ZA 4M0CA 4OPMA 4AJJA 2A6PA 2AB0A 2I7VA 1NRXA 3HCRA 3MUOA 2CL6X 3FX2A 4HZIA 3P2KA 2VLIA 5LWQA 2CB9A 2CVQA 1V8ZA 1AQIA 2ID9A 3IDOA 1AG9A 3ESCA 1RHRA 3LUKA 4NENA 2ZJYA 3TWOA 1UFRA 4F5DA 1SVWA 3UMYA 1DJOA 2XBMA 2Y0CA 1TYCA 3AEUB 1H0HA 3M6MD 3OY2A 3PF9A 4IGAA 4D2IA 4DQXA 4ABTA 3LBNA 1KAHA 4MKGA 4FWIB 5TR9A 4ZIRA 2ZQZA 4WJLA 1YR3A 5K8UA 4LXTA 1DXHA 1K7FB 2PQ0A 4L8YA 1VJTA 1AF4A 4RQAA 1AB6A 3NC4A 4RJJA 1E6EA 3OKPA 1T24A 4OKIA 4CR6A 1OB5A 4BLTA 1N2GA 1QORA 3UMRA 5LD2B 2QV0A 5HF5A 4QLAA 3U44A 1JIKA 3QKSA 4FNAA 3K1AA 2IYEA 4QLOA 3NG1A 5B30A 3MJRA 5K2MA 3HKBB 4ESVA 3BK1A 3MPOA 3N07A 2QL9A 3QU4A 4Q4HA 5TGDA 3F6RA 2NUPA 2PGIA 3FPGA 2W98A 3VQTA 1XZHA 1K7XB 1Y0BA 5ALZA 3T9CA 2B1QA 1YZKA 2HT1A 4DNQA 3DFFA 1Z4MA 4LWZA 4DQVA 3FVQA 2OG2A 4MZDA 5DTQA 3BQ9A 1KSFX 3OHPA 4PNPA 4U2FA 4QFDA 1NDHA 1MVNA 1RXCA 1KVRA 4IJVA 4XIIA 2PR7A 2BM1A 1KQGA 3HH8A 2IHYA 2WJ6A 3C6YA 2ZLBA 1JSXA 3VH4A 2HRRA 3OPYA 2QRJA 5EXPA 4F5WA 2PGAA 2ZYVX 3CWCA 2X0RA 3F3MA 4NARA 1Y5LA 3K73O 4I7EA 4RXTA 4Y2RA 1T2FA 1T4MA 3VVMA 3ZWCA 3ASUA 4RVSA 1AHHA 2BELA 1UZUA 3H0CA 4UAJA 5HBGA 1QH1A 4H27A 4MVWA 4ZVVA 3K1AB 5LQCA 4HADA 4JGIA 5ADWA 1IQRA 3GEGA 3HB0A 4RK5A 4J8PA 3SMVA 1BAPA 1NBAA 3TPCA 2PMEA 3N2YA 4JIMA 4Z1MD 1I13A 2P5SA 1W8IA 1R64A 1K0FA 2FSPA 1GZHB 1GVNB 2VBFA 3AR8A 2GD1O 1ZUNA 3K94A 3KEMA 1C0IA 4PCAA 2Y1DA 4RZSA 5CIQA 3RSCA 1QRRA 1WV1A 3IH5A 4C7KA 2BUBA 5JSZA 3UW3A 4IIHA 4NV0A 1Q6YA 4ON9A 2H2IA 5AKLA 2FNAA 4AQ7A 3LC0A 2GO7A 5C46F 3BSYA 4TMZA 5HMMA 3KVYA 4M0MA 3C7TA 4C03A 3GCGA 3QTLA 1UM9A 2JFZA 3DVLA 2MYTA 3URMA 3KT8A 1FJHA 2OTCA 1ZNWA 5JY1A 1IN5A 1N2IA 1OVMA 1TADA 3GPBA 3PNQA 3GW8A 3HBNA 3M6XA 5JAMA 3JAKB 3G82C 2WUVA 2HMSA 4QYTA 4BGVA 4ZJPA 3TZKA 1E92A 3ZDEA 3Q87B 2GPNA 3ND9A 1RDFA 3GMSA 4JFRA 4EPRA 1VPTA 4X85A 3VDQA 1BWPA 3HBAA 4J07A 4HCJA 4PSCA 5DBOA 5KSYA 2Q3MA 1RXIA 1XEWY 2NU6B 3D7RA 1KE1A 1Q21A 3A7DA 5BQOA 4IX1A 3PHLA 1CZRA 4H1WA 4Z3DA 3IVCA 3OVMA 3AGPA 2YCBA 1ISFA 1JLHA 4G8BA 3PJDA 2BAGA 4NBVA 3NJRA 3TTSA 3ONEA 4B5KA 2PH5A 2WKPA 2J9RA 4YRSA 1SHLA 2C1XA 1M8KA 1ZUNB 2ZWIA 1YNSA 1VTKA 2ZB7A 3DOCA 4MW2A 4S1PA 4GPTA 4WINA 1ECPA 4DMCA 1S9DA 2J7KA 4B40A 5JSZB 2VYND 4I2VA 1WMDA 1T34A 8ATCA 3VR6D 3DEZA 3R9WA 3GHHA 3GCDA 5DE3A 1WMSA 4DSOA 1IN7A 1VBNA 1TUGA 3OG9A 5HK8A 1IJBA 1DI0A 1LK5A 3D3NA 3D3WA 3QA9A 4FYHA 1A2BA 4UMVA 4YQEA 3WNQA 4DIEA 4EATA 2VDOB 3O8CA 4TXNA 1YUNA 3RQIA 3FHCB 3M4ZA 1L5QA 4JXKA 3DS8A 4JCCA 2YZMA 5K4HA 1IIRA 4G1EB 6GPBA 3DTVD 3SQNA 2OORA 2IUTA 1QP7A 1QPZA 4TKZA 4YGXB 4A92A 4RTMA 1NA5A 1U9CA 1DEKA 2A0XA 2AFVA 2QT1A 2WZBA 4S1WA 1DAHA 2LUOA 1KEZA 2P27A 3BFKA 3GVPA 3Q7TA 4C4YA 1WXFA 3PEWA 3OP1A 1NMQA 1F14A 5C8DA 2BKLA 1G18A 3ZGXA 1Z47A 1YR7A 3KAJA 1JBKA 2A9OA 3L8MA 4O5AA 3VI3B 3FMFA 5JARA 1J2JA 2ZUTA 2J5RA 2HAEA 1D2EA 4PHGA 5LOVA 2YW9A 4LXQA 4NNPA 2AC4A 2Q6LA 3PYLA 1P1FA 1T4DA 2VUIB 1B0AA 1OJ7A 1KWKA 3KSMA 3L0PA 1SC6A 4HYTA 1RAFA 1CY1A 1PDOA 3IBGA 4RDIA 3I6MA 4TRRA 4BNGA 2YVQA 1E3WA 3VH3A 2XLCA 1CE8B 4URUR 4BATA 4CKWA 2Y1EA 1SCUB 4JUAA 3VHXA 1TTPB 1G19A 4Q4DA 4KDCA 1PJ8A 3MCVA 2G5PA 2Z2KA 1RJWA 4DV4B 2OV8A 3D3WB 3H5TA 3IP1A 3SF0A 3L1KA 3QPUA 3NIDB 3ROMA 5JS6A 4GVLA 2FDRA 1F2TB 2PS3A 1BIFA 3KZ1E 5A1TA 2YXLA 4A3SA 3FYUA 1YI0A 4ZYWA 4NULA 2XE7A 5J2TF 5LR6A 4KB5A 3BIXA 3OI7A 5JNUA 1L1RA 2REQB 1L7AA 2Q1XA 4TZKA 2XY4A 5SZJA 4CEHB 2QJOA 2WHPA 3BL5A 1DGQA 2OO5C 1U9IC 4PLGA 4ND2A 1NJ1A 4WJKB 2Z3ZA 1LRKA 4X7RA 2I33A 4BV8A 2R8PA 3IPCA 3ZLJA 2IPOA 3Q3JB 4ZVOA 1L7NA 5EAIA 4CKCB 1Q1BA 4PTZA 4O02B 2ZTHA 3OSUA 5CCXA 3K0AB 1VCNA 4YAWA 5JNWA 2XVAA 1L4GA 1WY7A 1W93A 4OD0A 4BMOB 1TJ3A 2P9GA 2PH7A 1QGOA 4OVKA 5CFPA 4L9AA 3SIRA 5FI3A 1UBKS 1T0UA 2G9UA 2BSXA 3OT1A 4D02A 5F52A 1WB5A 1T8YA 4UVGA 2CKDA 5KMGB 3FYCA 3RUPA 1O95D 1F60A 1W8DA 3RG8A 4D9EA 3WB1A 2AUTA 3RR2A 3FYUB 2UUAB 4K46A 3TTVA 2G9QA 4KQJA 1KY3A 2X14A 3SYMA 4QEZA 1NUUA 1FLNA 2G0TA 2JGDA 1IXRC 1PD1A 1Y8RB 2O2JA 2DCMA 3BFJA 3O3NB 4FSHA 4GX1A 2FUKA 4IDCA 1P7VA 4EUFA 1A88A 4YMVA 2K2WA 1WXXA 3LPAA 3CZ5A 3LHIA 3B7WA 3ZQKA 2VP0A 2Y6UA 4BWYA 2QRGA 4MV9A 1LPPA 3KP1A 2PUFA 4TS3A 2XZPA 2UUOA 4TTIA 1XVVA 1SZDA 3QTTA 3SVLA 1QWSA 3WWPA 3X1MA 3ETDA 4GI3A 3MAGA 4MV7A 4AAYA 1SCNE 1GPH1 3KYDA 3LUAA 5DYNA 1PTJA 4ZVKA 4N41A 1XJQA 1VBMA 4RNCA 5KWSA 1K8XB 1Y3HA 3AONB 5DASA 4WE3A 2GHRA 4LC1A 1PJZA 2CXOA 5BSUA 1ZICA 3IODA 2C07A 1F1JA 1LPBB 4XIJA 1E9EA 3VVCA 1FDUA 3JPYA 4LRSB 1CB0A 1X70A 1BZYA 1K6JA 3NBZC 1CR6A 4KFTA 4IJ6A 2PS0A 2I7TA 1G8SA 2YYYA 1DOHA 4OQXA 4Z9FA 2Z98A 3M1YA 1KMNA 4PC3A 4DM4A 4F93B 3RANA 5JJKA 1H6AA 3L92A 1OI3A 4UPDA 1M34B 4QFCA 3TPFA 1SG6A 1FFYA 2Q3EA 4W9NC 1IYZA 2Q4DA 3EDYA 5TVGA 1N9ZA 4JI7B 5EIFA 1HMYA 2BFBB 4LCEA 5AJVB 1WY5A 2OWEA 4FCTA 3DNPA 2J7PA 1EFHA 2XQIA 3ZV7A 1M67A 2ZRDA 1EMDA 4BVFA 4IMJB 1Z0JA 3DMFA 5C9ZA 1I2CA 5F4BA 1M7GA 2PNFA 3AUTA 3NX4A 5K3FA 5G2OA 4CVNA 4EHIA 5GINE 1EP2B 2W93A 1XD2B 4GS5A 4B48A 1N0WA 5LM3A 3KYCB 4LHWA 3UFXA 3QOWA 5ICMA 4J7UA 5DGTA 2C3UA 1HFEL 2XECA 3PNVA 4N3AA 1EXVA 2IS4A 3U7JA 3HV2A 2P5YA 3DHVA 4LNHA 4G5OA 2RCNA 2GRAA 4HQOA 4A73A 4ZI7B 1D9ZA 5T8KC 1Q7GA 4ZD6A 3TBKA 1RM3A 1W88B 2JZOA 4JP3A 2QUBA 4RF2A 5CDSA 2RAVA 4Z1MA 2E4VA 2PKCA 2IYTA 1V39A 3EE6A 3SLKA 2CLHB 2JCGA 2D62A 1VC2A 3BRCA 1TPYA 5FJJA 5TJHA 2W2OA 1FP1D 4MUAA 4N6OA 2PDAA 4RELA 3O7WA 1IEQA 1I0IA 3O8LA 1P29A 4R98A 3C7AA 4HJRA 5DMHA 5BV1A 1N32B 1JV2B 4UU0A 3VZBA 3UUEA 4ZYLA 5KQSA 3R41A 4R9NA 5LIPA 1I7DA 2MTBA 4D25A 2B6NA 4ZQGA 3L40A 2AOVA 1Q7BA 4LAFA 4LXIA 4NZOA 5FULA 4DNPA 2BYTA 1QOZA 2IXGA 1YU6A 3SI7A 5E4YA 2OGUA 1UOQA 3M49A 4D9JA 4OQMA 4KQ2A 3GP8A 1TO2E 5TT0A 4KGZA 3KOXA 4P3YA 4KTTE 4IZOA 4AM8A 3WYNA 4ZHQA 3MG9A 4ZEWA 1A9TA 1S89A 3B53X 5BV8A 4X3OA 4FYYA 1J5PA 1QHIA 4ZJZA 2QX8A 5JT1A 3LA8A 1WUHS 3PXGA 2XA1A 5ESWA 1C30B 2XWQA 4I50B 1T9DA 3ZXXA 5B6IA 5LQKA 2Y71A 1G16A 4Y30A 3D4BA 1SCIA 2QLJA 5A5GA 2Y1CA 4DG9A 3T1VA 4NX2A 2BCGY 3K0FA 5K0GA 4N49A 1CW2B 3GFTA 4LPSA 1VRCA 1XTJA 5AP9A 3RNLA 1RXSA 1XVIA 5FT9A 5CDTA 3UUFA 2R4TA 2RGYA 3REGA 4B3CA 1YZTA 1WQ4A 4J1TC 1OTXA 3A36A 3UNXA 1DU4A 2C97A 3VR6A 1Y4SA 3BE8A 1TMYA 4KXYA 2OCKA 5HQ3B 2BI8A 4LQCA 1TZBA 1E58A 1GKUB 2OM2A 3B7GA 1C29B 3ZGOA 3ZCUA 1S96A 1DLJA 2GRUA 4KYTA 2EDAA 4NAUA 1E79D 4HNSA 4WN9B 3KXPA 1F6WA 4D3ZA 4G81A 1ACJA 4BZXA 2QYTA 4B2YA 1B4DA 3DTVA 2QRHA 3V32A 3S55A 1IEVA 4L3VA 2B8JA 3ADCA 2MMCA 3WNCA 2CVOA 3T0FA 1IHYA 5DM1A 1Y9AA 3MWGA 4K03A 1W9MA 4CIVA 2VWHA 2X8WA 4BO0A 1PHRA 2RHGB 3WWCA 1EIWA 3K2BA 1ST2A 1FNCA 4JC4A 3T7RA 4J1NA 4Z86A 1WVMA 4QOFA 2VCYA 1JNYA 1PSZA 2JB9A 2OL4A 2VT6A 1Y3FE 1X7YA 4BIMA 2COKA 2JFWA 3CA8A 5K45A 5E7QA 1LK0A 2V7QA 4HGPA 4M9CA 1IHXA 2FSIA 4TL7A 4JA0A 2ZAGA 5ABPA 1GUAA 5A4AA 1EWQA 2VHEA 2IRWA 3B6KA 4XIGS 3GEHA 5LA6A 4N47A 4NCNA 1JG2A 5GV8A 1E7QA 1L6IA 1L5VA 1GZ4A 2JHCA 4EB0A 4WKBA 2QRLA 1WTCA 3K9WA 5AJYA 3STVA 1HK7A 3EXFA 5L4NA 1XLTA 2QRMA 4DCJA 2IOHA 2Q6TA 3DOJA 4F1WA 1W4LA 3IAAA 4ILKA 3N7AA 5D86A 5PNTA 4AS1A 4IW3B 3EGEA 4RVNA 1NURA 4KQFA 5AKKA 1BE6A 4EY5A 3W6NA 3DO6A 1P9RA 1RYZA 4YJGB 3QRWA 4ARVA 4D9FA 3PFIA 5CR9A 1XB2A 3HEBA 4B3BA 1NF2A 3DE2X 3I5YA 1V4NA 4IUBS 3HUEA 2ROQA 1WRBA 2VDUE 5AI0A 1NSFA 2D59A 4R16A 2I4TA 5CA1B 4RPCA 3CT6A 1WO8A 3EA5A 1ENYA 3I42A 1YFJA 2ZPUA 3BB1A 2VI5A 3O90A 1QIEA 4IQ4A 1RQ2A 2X4GA 3LMKA 1PLJA 4AZ3B 3UHPA 1B6SA 3A3YA 4IOMA 4DCGA 2IU0A 4XTRA 3V8NA 3T5AA 4MUKA 4PX9A 3I9FA 2QYHA 1F8UA 3CT4A 1KFKB 5E0OA 3EG5A 2JLAA 2IZ6A 3KJNA 5I7OA 1O95A 1ECJA 1V48A 1JG1A 2NACA 4NYJQ 4Q3NA 1AKUA 2HBQA 3GFRA 3MN1A 4L5IA 3WV5A 1Y8ZA 3QNWA 3EXFB 4FMPA 5AVSA 3WL5A 4EA7A 3ODPA 1O4WA 3KR9A 1QM5A 3OJXA 4YHHB 3HHPA 2X1LA 1XC7A 1PL6A 2PWAA 4NYJR 3WHLA 2BBSA 2YR0A 3HZOA 4LDNA 4AVYA 2HCJB 1USKA 2ZJ6A 4IQ0A 4KE9A 4MEBA 3RSOA 4EI8A 4JVSB 2E3JA 1SKMA 3RRMA 4UOEA 1BGWA 2ERYA 3X2SA 3OUZA 2PEYA 2QNRA 4GOLD 5LNK6 1D2MA 4I9GA 1DP4A 2PZJA 1XZ8A 3AC0A 1CF9A 4ARAA 4ZAVA 3NU1A 1XRMA 1GSAA 5F3DA 4ZICA 3CNQS 3FVRA 5A9SB 1U9YA 1N78A 3INYA 3DVAB 1GR0A 5GMOA 3SJUA 1SIUA 3AIMA 2VAVA 1X2BA 1CJSA 3HUFA 1IQUA 1P9NA 4PHHA 4X0EA 5ALHA 3NHBA 4DV1B 4P2BA 1REQB 3ABIA 3FYSA 4CDMA 4R7ZA 3BK7A 4CM4A 4H1HA 4RANA 1J5XA 4UTNA 3HP1A 2HEGA 2VPWA 3TZCA 1DAGA 3LX6A 4CR8A 3RI3A 2QRKA 3LXMA 3D4LA 3KJZA 4JL6A 4FSDA 4QTXA 3VAZA 5D00A 3W2TA 5ICEA 3B1XA 5IZ4A 4I36A 2Y68A 2CHQA 2OCLA 5AHKA 1OA0A 2ZRLA 1NQUA 4RK7A 1ZC3A 3SZOA 2DHDA 4R5MA 1GL6A 2VF8A 1PFYA 2PXXA 2JFUA 1GG8A 2FLVA 3LPDA 2AJTA 3E53A 2Y1LA 3BJZA 3HYLA 4LKOA 5LQUA 3PEEA 3EW9A 1EHIA 4XAQA 4G36A 1KP9A 3ZBQA 1RU3A 2HLNA 3LT0A 3IP3A 1L7XA 1THGA 3NW9A 2NUBA 4PLTA 1DINA 3C45A 3HU3A 4AWBA 1H2FA 1TLFA 2Q9AA 4YIKA 3ZVRA 4EGFA 1YB7A 4Y18A 1AS2A 5K0FA 4PZYA 4NZ9A 1W94A 3HA2A 1THMA 4DCSA 4B76A 2EX0A 2R5WA 1W76A 3MUNA 3MT8A 4I55F 4IRMA 1VKJA 3BSSA 1XEFA 3U6BA 2OQIA 4NECA 6PFKA 1XF1A 2HLPA 2HZ7A 3Q9NA 5CDGA 2AS0A 1T35A 4IV8A 7ABPA 1EJ6A 3LUPA 5T3YA 3U4CA 4EUEA 2B20A 3F6YA 2NZXA 1DO2A 4ZOLF 1WDMA 1P3Y1 1WZIA 4WOCA 1YIAA 2PX4A 4UHDA 1TTQB 2CVPA 5U4XA 2P9HA 1CY4A 1NJGA 3FWYA 3THRA 1U3WA 4JH0A 4B73A 2Q2OA 2EFJA 3P45A 1UJ6A 4NBSA 1EUZA 2QQ0A 1SFRA 2VJQA 4R2WA 4BWVA 3VJRA 4E1BA 2Z83A 2F1KA 3M9LA 3K1YA 3M5PA 4BB5A 1JAXA 1SCJA 2ZVDA 4IKOA 2AJLI 3RYCA 4UE2A 1W5AA 4ZQBA 4X60A 2PUWA 3H17A 4HWGA 3OKCA 5JPIA 5F7XA 3AY0A 3K70D 1GAXA 5CP8A 2BF4A 3H7IA 3JQGB 1R2QA 1DADA 2GAAA 3OQPA 1DAEA 1VHWA 4A0RA 1A77A 4QGHA 1G9SA 2XMZA 4FIZA 4QT4A 2ACWA 5TX7A 2VQFB 2Q46A 4N5NA 2IEZA 1T8WA 2XQFA 1Z07A 2A0UA 3ENVA 3VR2D 2R8RA 2A84A 5HF9A 1TJPB 2OEPA 1N4DA 4WEQA 2QMZA 3D5EA 1D04A 1GYRA 4AG3A 4TYWA 5AM0A 2ZIWB 3G8AA 4UJ3A 3NEPX 4BX3A 5L3QA 4RGQA 3JARA 2JLSA 3DOHA 2IYZA 2PAAA 3H6HA 3HVIA 3W6UA 3DFMA 5E4FA 4YMHA 3LV8A 1XFDA 4AMZA 4CF4A 4NDNE 4PZUA 1YBFA 1II0A 4FR2A 3AO0B 3WRXC 4N5MA 1T5HX 3W9SA 1PWXA 1V16B 1YBVA 2I1LA 2I87A 4YEDA 2JGKA 1Z75A 3G2NA 1TUBB 1ENOA 3OFJA 2OXTA 1E79A 2WHRA 3U16A 2KX7A 1SXHA 1X7XA 4LYAA 2PA3A 4ZK2A 1FB5A 1U31A 4D96A 4LF5B 4Z4CA 4GPD1 1OKKD 2ESRA 4N76A 3LBAA 2WJVA 1E2QA 1P17A 2GPYA 2OHJA 2OXCA 3DA8A 2Q5CA 3MJHA 1RAIA 1Q44A 2EEPA 1KO5A 2X4DA 2Z43A 4KI7A 3BXPA 3S8EA 1T4GA 2XZOA 4IDPA 1FNSA 1R00A 1OYWA 3BA6A 4PF1A 5MFPA 5CRIA 4D81A 3PQ3A 2BP7A 2YJZA 3EUAA 3HI6A 4TSKA 3E9RA 1C8KA 3LFTA 3FMOB 5DN6D 2FZGA 2G40A 4KAXA 4BX8A 4MQEB 1PFVA 1FRQA 4IPTA 2I6GA 2P9FA 4QYIB 2EW2A 1JFFA 1BW9B 1CY8A 2I3BA 4PTLA 4N5HX 4RVOA 1HDEA 2X6RA 1JJ7A 1QH9A 4LZWA 3BM5A 3ESXA 5I4BA 1YF3A 2H1FA 2O23A 3M3PA 1K1EA 4DA9A 3T35A 4LKRA 4PX3A 1ISPA 1G21B 3D6MA 3JD3A 2WDPA 1NVXQ 3JQ9A 3LS2A 1SOAA 4K7JA 1B0UA 2KYRA 2YIVX 3QYAA 4JHLA 3T5TA 1R10A 4FX2A 1P9LA 2Q3LA 3A4NA 3HKDB 4MJXA 1PP4A 2W8BB 2YHIA 5ULLA 3O1LA 4BVJA 2R79A 2GCEA 1Q83A 3IA2A 4W6QA 8MHTA 1QANA 2VT2A 4JNKA 5K09A 4QU0A 4LIPD 1H94A 2FN9A 2K7FA 1AS0A 1YQQA 2O8NA 1DQSA 4ZPJA 2IWHA 4AP9A 3OF5A 1SBCA 3T99A 4YH1A 5BVGA 1UBSB 5DT9A 1KERA 1D2GA 1PBTA 3R7BA 1I2ZA 1C0LA 1U8UA 1MHPA 3A70A 3BIOA 3GPCA 3QWAA 4HI0E 1P45A 4K1LA 3V4PB 1K5PA 4BE7B 1VQ1A 2AXPA 4RHCA 2GUGA 5EG5A 5FLKA 2G07A 2MINB 4QJ4A 4I66A 3HJCA 3ROEA 3KVVA 3ZV5A 2JG3A 1BC5A 3E6AA 4Q7LA 2R2GA 1EBFA 2QENA 1Y7LA 1Y3BE 3D5QA 2WWYA 4X1YA 5KX5B 4TKVB 1MV8A 2M98A 2P4EA 2WZCA 4JQZA <