1I14A

Analysis of an invariant aspartic acid in hprts-glutamic acid mutant
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
187
structure length
187
Chain Sequence
b'YEFAEKILFTEEEIRTRIKEVAKRIADDYKGKGLRPYVNPLVLISVLKGSFMFTADLCRALCDFNVPVRMEFICVSSYGEGLTSSGQVRMLLDTRHSIEGHHVLIVEDIVETALTLNYLYHMYFTRRPASLKTVVLLDKREGRRVPFSADYVVANIPNAFVIGYGLDYDDTYRELRDIVVLRPEVYA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOXANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE
publication title The role for an invariant aspartic acid in hypoxanthine phosphoribosyltransferases is examined using saturation mutagenesis, functional analysis, and X-ray crystallography.
pubmed doi rcsb
source organism Trypanosoma cruzi
molecule tags Transferase
total genus 56
structure length 187
sequence length 187
chains with identical sequence B
ec nomenclature ec 2.4.2.8: Hypoxanthine phosphoribosyltransferase.
pdb deposition date 2001-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1i14A00
1I13A 1ECJA 1A95A 3M3HA 1QCCA 3DAHA 1G2QA 4P83A 1TC2A 1ZN7A 1L1RA 2PS1A 1W30A 1DBRA 1STOA 5EUCA 1YFZA 1DKUA 2VFAA 2GEBA 1I0IA 1XTVA 4WN3A 5BSKA 3GGJA 1UPUA 5JSQA 3O7MA 1OPRA 3OZGA 1U9YA 3DEZA 1DQNA 3QW4B 1BD4A 2WNSA 1A98A 3OZFA 1VSTA 4P80A 2YZKA 3GGCA 4M0KA 1VDMA 4RQBA 2JKYA 1P19A 5HIAA 1I14A 3N2LA 3G6WA 3OHPA 1QCDA 5IAOA 2PRZA 1ECGA 1ECCA 1QK3A 3NAGA 4PFQA 2FXVA 4RAQA 3DMPA 1BZYA 4LYGA 5KAMA 3KB8A 4F8EA 4RACA 5BQOA 1XZ8A 1IBSA 1PZMA 1UPFA 1XTUA 2XBUA 4RADA 1V9SA 1ECFA 4RAOA 4X44A 1HMPA 4P3KA 4KN6A 1A96A 3EFHA 4LZNA 4S2UA 1NULA 3S5JA 5HKLA 4M0PA 1I0LA 3ACCA 1P17A 1ZN8A 5K51A 1JLSA 1TC1A 1QK5A 2P1ZA 4P84A 1LH0A 1GPH1 1QK4A 1D6NA 4LZOA 4WMLA 4P86A 3HVUA 4X45A 4TWBA 1J7JA 1VCHA 4RANA 1FSGA 4RQAA 1L1QA 1MZVA 4OHCA 1CJBA 3MJDA 4MB6A 1G2PA 2DY0A 4QYIB 4M0UA 4RV4A 4QYIA 3LPNA 1BD3A 4P81A 1ECBA 4JITA 1O5OA 2HCRA 2AEEA 4PAWA 1U9ZA 2IGBA 1QB7A 2H06A 5JV5A 1Y0BA 4Z1OA 2JI4A 3MBIA 4RABA 1NONA 4IJQA 1O57A 5BQPA 1OROA 5KAPA 3ACDA 4LZAA 2C4KA 1ZN9A 3H83A 1A3CA 1I5EA 1XTTA 5IPFA 2JBHA 4RHTA 1P4AA 4LYYA 1JLRA 2JKZA 3GEPA 1Z7GA 2H07A 4FYMA 1R3UA 1XZNA 1HGXA 4RHUA 5ESWA 1AO0A 1A97A 5BRNA 4QRIA 1WD5A 1UFRA 4JLSA 1A4XA 1G9SA 1GRVA 5E38A 5ESXA 4RHXA 1DKRA 3ACBA 4P82A 2E55A 2EHJA 2PRYA 1QB8A 1OREA 2H08A 1DQPA 4ZFNA 4RHYA 3LRTA 1P18A 1G9TA
chains in the Genus database with same CATH superfamily
3AC0A 3SY8A 3SZGA 2G07A 3WGGA 4V1CA 1WDMA 4NBUA 3H3JA 1T6NA 4ER6A 4ZTUB 3G9UA 1TDJA 4AP6A 5AJTA 4TTQA 1H2RS 1KFKB 1ABFA 3TBFA 1HBJA 3GJZA 4EJMA 2YHBA 1NQVA 2P30A 1N3BA 3K7EA 3LUDA 4JQOA 2OWEA 4RETA 3H16A 1CULC 1DQNA 2B3TA 2H59A 1D1QA 2QI9F 3HU3A 4WADA 1NA5A 5B58C 3I9MA 5KBYA 5K0ZA 1FYFA 2QGNA 3UKDA 1SWVA 3ON5A 1EE9A 1PN3A 5AKIA 4D9EA 4FT2A 1H42A 1ULTA 1YZVA 4JL5A 1FFEA 1KIMA 4GI2A 2VSNA 5AVRA 1VDZA 3PNYA 1GPUA 2R97A 1ESEA 3OOSA 1UZAA 4F1WA 3EFBA 1WHTB 2YWXA 4GC9A 3FBTA 2FF5A 1GTJ1 3MWDA 3DLHA 3I2FA 2JK1A 1SZCA 5LPNA 3I76A 3DMPA 4PEVA 3ZWDA 1NZDA 4JP8A 3ROPA 2FE1A 4KQKA 3TR5A 1EXVA 5CMLA 3AM1A 3OCXA 3TKYA 5BP7A 4V0NA 1DWOA 1XCBA 2V6GA 3H8WA 3JD2A 1RIIA 1E63A 2Y1LA 4Q24A 2WG0A 4EZBA 221PA 1BWRA 3ZU4A 3BULA 4H7IA 5TF0A 1N6RA 4FT4A 4DILA 2OK7A 2ZLBA 1LC0A 3F6CA 3O9MA 5F21A 3QXGA 2AR9A 3TQTA 3KYDA 4HVCA 4QT4A 5A4FS 1KI4A 1WUYA 1M3SA 2XVZA 2X3UA 4G24A 3PYMA 3G3EA 4DLSA 4O4LA 2QDXA 4QGAA 4NKRA 5H83A 3NI2A 1G8AA 1E0AA 1T35A 5KYYB 4AX4A 1NMZA 1QAQA 4Q66C 3VZBA 1MVOA 2P9JA 2ST1A 1B1AA 1I7PA 1N2HA 4LJ5A 4PC2A 1JIIA 2HMVA 4H7PA 2AFIA 2OQ2A 3UUWA 2CK3A 1WLYA 2ICAA 2QX9A 3S4YA 3OCWA 3P96A 3DEHA 3GJTA 3DZIA 5IRCD 4XSVA 2QTZA 3U3MA 1WR8A 4M0EA 4NS4A 4KWCA 4I08A 1IK4A 1QF9A 1YHNA 1YIAA 2UUAB 1YVPA 2VP4A 3LLVA 4D44A 5BNWA 5JDIC 3PJFA 1LVGA 2ONJA 2OGTA 1U6KA 1YZFA 2GCPA 3ISJA 4ZVLA 1TEHA 4BC0A 2J9GA 3KTOA 4MXDA 3LUFA 5CA0B 1NW8A 2YY7A 3HKDB 1V48A 1E79A 4Y2YA 5FKJA 1YU9A 3X2FA 5JSZA 1SA0A 4G84A 1KDVA 4EW1A 4WJLA 2AHOA 2RK3A 2TRSB 4O4HA 4OGKA 2BGRA 3GLIB 4KH0A 1VA5A 1F48A 3WYEA 2IZ5A 3UWMA 3BGDA 3EXHA 3I52A 3PL1A 4J0DA 1KDYA 3WGTA 1IQPA 4K9QA 2QPLA 3FUTA 3W90A 1QTNA 1TZ2A 2HN9A 3LG2A 1R8SA 5A9TA 3LT4A 5K3OA 1ZD2P 4TTAA 3CPEA 3EE6A 1R5NA 3MGAA 4L74A 3VPGA 2MYUA 2QL6A 2Q5IA 3DHEA 2MR6A 4BFZA 3EGXB 3BE4A 3KEGA 2H3HA 4AZVA 5AW3A 2VNJA 4YBRA 3RVQA 5A3QA 1E69A 2C3MA 5CBPB 2OZEA 1FLDA 4WPGA 4AQDA 1YAJA 4WZBA 5JDCA 2I3GA 3U7HB 3BG5A 1TLFA 4HX2A 4UD2A 4I5GA 2LCQA 4D4HA 3CWZA 3ICOA 5AM5A 1JQ5A 3ZUGA 5KU7A 3FTCA 5B2ZA 3RC8A 3AVTA 1XMXA 1H65A 4BZZA 4MW4A 3K0FA 2MSWA 2QAGA 5AJHA 3TBHA 5SICE 1WPGA 1FUKA 3IUPA 2HSJA 4LK3A 3V55A 1V3VA 3I6BA 2Z9DA 4IVQA 4JC0A 4DEXA 5C5DA 3EAQA 5CYGA 3ZOKA 2F3TA 4HGNA 4QNRA 1XCPA 1M34A 2G9RA 4PZEA 1E0JA 5JWHA 4NG4A 3N58A 3I83A 1ZNZA 3RS0A 2AW3A 4L16A 1Q0UA 2GKOA 3GDFA 2RHRA 5B1SA 3VPXA 5IKMA 5LZ4A 2WJHA 2JFBA 4BJ3A 3E9CA 5C1IA 1R0LA 1JL3A 1T2FA 2V7UA 4JOBA 1UINA 1CVRA 1MN6A 1PQUA 2JZOA 4UCXA 5LL6P 2BFCA 2JJ1A 3U5ZB 1CUEA 1UIRA 4OXXA 1U2RA 3CB4A 1Z4MA 2MR5A 3FNGA 5DIZA 2QLJA 5E2AA 3SD7A 2ZIWB 2V1XA 1JMVA 4LE1A 4N5LA 5A4JA 4AW9A 2B21A 2AF3C 3PRYA 3EGDA 5LLSA 1OI3A 4RPLA 4D4GA 3MTQA 3O1LA 3JVUA 2O8DA 4MHTA 2F3PA 1RM4A 2PK3A 3H17A 1NRIA 1QYRA 4TKMA 1QS0B 1V8ZA 3D6JA 1MCZA 2YZ2A 4HNVA 3HGTA 4GKAA 5CBKA 4R2KA 1XPOA 4FS8A 1M8JA 1N8SA 1ZOIA 2AOVA 3LYUA 4ZT4A 5EZ5A 1H2WA 1XI2A 1U28A 2WF5A 4CV3A 4TMWA 5B6PA 1LH0A 1X1DA 1EA7A 2BFPA 3F6BX 2Q4DA 3NHPA 5FA6A 1UJCA 4IDPA 4BIMA 3EMKA 2OCAA 2OESA 2X9LA 4ZAZA 1DXYA 2IY9A 3L84A 1CHNA 4HGPA 3W9BA 1POWA 4LDAA 4TLBA 4E07A 1OSNA 1U8TA 3ELDA 1GJRA 1QWSA 3DE0X 5CHEA 1IY8A 4OHRA 2XT0A 4OYHA 4FCVA 1XNJA 2FGJA 2Y66A 3MTJA 3V8QA 1WCV1 4OHMA 1UAGA 2OXFA 1OMOA 1RFLA 3WLQA 4BBZA 3ZDXB 5CCXA 1FXWF 2J7KA 2C5FA 2ORVA 5A1TA 3PI7A 5JW6A 3W78A 5LQJA 2QYOA 3ZU5A 1RRFA 2NSHA 3ZHVA 4D7AA 4KIJA 5DBHX 2IGBA 3RG2A 3R9XB 4HPWA 2UYCA 4JQZA 1U0NA 4YMHA 1TNDA 2JHGA 4ZD6A 4FE7A 5ILOA 4BY9E 2CD7A 5LSAA 4IIJF 1UQRA 1RJGA 2IU4A 2O23A 2ZRIA 4PYIA 5F2EA 2D00A 5JXIA 2GN9A 4UQLA 2QK4A 2AOTA 1CJKC 3MCWA 1U04A 2EFDB 4JKYA 1KE2A 5IXYA 3JQAB 1TLTA 1U2GA 3B36A 4UC0A 1ZM2A 5CCDA 5HCUA 2DG2A 3C8HA 3HWSA 4C78A 3FY4A 4TQ9A 5IXJA 4QT0A 3L7MA 1HGXA 4JMLA 4KB5A 3SF0A 4F0JA 1HT3A 2JGDB 4JWKA 4RS3A 2YN0A 4C3UA 2X76A 3M7IA 5A9SB 1NIJA 3ZV4A 2BFDB 4MV9A 3VPBA 4OX9Y 2GCGA 1DAIA 1U3GA 1YE3A 2AWOA 2PAAA 3GLGA 3NHMA 5A4MS 2ZB4A 1Z5VA 2Q49A 1URPA 3CUKA 4ZT7A 3I2YX 4F4JA 3PLRA 1VPLA 2MDTA 2WMYA 5DW0A 4ZI7F 4C29A 4W5OA 2XUAA 1NSTA 3ZWMA 4OOFA 2WUVA 1XL0A 2VBFA 5H9WA 3RDPA 1BWQA 1B0PA 1YAHA 2PL5A 1NJSA 3I12A 4LI3X 1DC3A 3CRRA 2EEZA 3JRWA 3KXDA 4GM1A 1R5OA 1EVEA 5DNWA 3KWLA 2GEFA 4PNPA 1ODLA 3TSWA 1EBFA 2WWHA 4Y30A 2HUPA 3PSAA 4RVUA 4LE2A 3CG4A 4KVFA 5KJFA 1VJ0A 2FPWA 1G0OA 2ZYRA 3M49A 4YALA 4DN6A 2PUBA 2FUG1 4M7RA 4RK6A 3LDUA 1XGKA 3OQIB 1IAQA 2AG6A 1FNSA 4FNAA 3RC9A 2WU0A 4DLUA 5GZ3A 1E4YA 1R16A 4FLEA 4GOKA 4QDKA 4AG3A 3ZJ4A 4BRUA 1JYSA 4E3ZA 2JIPA 3ZU2A 5GTDA 1VA4A 2XYRA 5LZ2A 3D4BA 1RXWA 2PSFA 2PV0A 3F3SA 3U4QA 2IX3A 3QVGB 4WH0A 1AGNA 2G08A 4OATA 1Q77A 2M6SA 4B8YA 2BEJA 2Y1DA 5MF6A 4U6NA 2XUGA 4AXXA 3U1BA 1YS1X 3RUFA 2AG1A 3MB8A 3UT5A 3UGQA 3O8CA 3DYVA 1DBWA 3R09A 5KX5F 2VHEA 4HDAA 1JHRA 3V4VB 4EPTA 2AJCA 3TIFA 2XADA 3ITEA 1PZGA 3RADC 2QUBA 4OLAA 2CLSA 4H7KA 1J2RA 2P4EA 2JA2A 1RJFA 1TU3A 3BH0A 4XYEA 5E1MA 3EA4A 5KU1A 1M8KA 4OSOA 1QO0D 2KB0A 3BXEA 5J4YA 4ZA2A 1OTXA 2C7BA 3FKQA 1U5BB 5TQ0B 3VO1A 3PUZA 1TLLA 4WY5A 1OVMA 4A6EA 1T6YA 4MK4A 2G70A 4CN9A 1W85B 3PZRA 4MO9A 5F9FA 1E66A 1WP4A 4OEHA 2QLTA 4L22A 1Z17A 4GX2A 5CB4B 2PX0A 1CQIA 4KQ9A 2RE8A 4UTOA 1GL3A 3CBQA 3SHOA 5CLGA 1NWCA 2BLNA 3LSYA 3RFFA 3N28A 3WO1A 3KETA 5IT4A 5EPEA 4RZIA 1EWTA 1MB4A 2HK8A 5FT9A 4OQXA 1CVIA 2YHIB 3COJA 2G4LA 1YU6A 2JAPA 1NZFA 1VKRA 1YC2A 3K72B 3NJRA 4ZDKA 1AC5A 3WA7A 4LDRA 4B8WA 3ROMA 1XMIA 3IEKA 4M1WA 4G86A 4R8KA 3OP4A 3PQ5A 1G8FA 3I6IA 1THTA 5IJXA 1W48A 4DRYA 3WFIA 2R8YA 2GCNA 1LTKA 5AT1A 3ZW9A 4BVAA 3CLSD 4HQNA 2XWSA 1F4LA 4KGZA 5EPUA 3V2GA 5D6NA 4CHGA 1VLLA 5C1DA 1W5SA 4UBNA 3M2PA 4ILKA 2ZUCA 4NDZA 1TTQB 3K5WA 4D82A 1LPSA 1DV2A 2EOAA 2OXIA 2DUUA 2ZPUA 1CUAA 2QIOA 2VF8A 4KNWA 4DQVA 1XROA 2KS6A 2C5LA 3CSSA 3AOEC 3HM2A 3CLTC 3WLOA 4MA5A 4HG2A 1F0KA 3F4LA 4G89A 4HN4B 5HJ2A 4RKFA 1MXFA 3R4VA 2VH2A 1ZIYA 2R4UA 3HY4A 3T0FA 3AF6A 1W35A 2X58A 1SCJA 4CMEA 2RI6A 1Z4OA 3V80A 5DI9A 1P5RA 2WUFA 3AIIA 2IOYA 3OM9A 4QFMA 4TL9A 4YJFB 3FUWA 5FWYB 1CG6A 3U3ZA 1U3VA 1KQOA 1SAYA 2DQYA 1PNQA 4TZTA 5HEKA 5G0WA 1OWNA 3RSQA 1XZAA 3I5YA 3IEVA 3SFZA 4G0ZA 4OM8A 4O4IA 3ROTA 4EYKA 2WF7A 1T5TA 4TS4A 2JI6A 5BWNA 3C8DA 2FQWA 3A3YA 3W4JA 2JI9A 3GFVA 4NMWA 9GPBA 5GMOA 2Z2KA 5CU7A 5KNBH 2C5SA 2XMRA 1A9SA 1L1RA 3ROZA 3Q5GA 2HD4A 5C18A 5H8WA 1LI4A 2IHZA 3W77A 1V47A 3GGPA 4C3OB 3NMUF 4ISCA 1ZIPA 3DOOA 1VHDA 4H08A 4ND3A 1Z4IA 4DV0B 4FW9A 5IARA 3CZ4A 5JVDB 4M8IA 3HVKA 4FWTA 2XH8A 1RVV1 2GO1A 1AXRA 5J5AA 3FOZA 4RDIA 3HYLA 3N53A 4XI9A 4ARZB 1IWOA 2QRLA 3A9RA 2X0NA 4UHJA 1ORRA 4R1NA 2C58A 3FMIA 3WWCA 1APBA 3EDOA 4NZNA 3WNVA 2DTXA 4MA4A 4UEOA 4YROA 1JHUA 4F06A 3NBZC 3THOA 1IXZA 4M54A 1SY7A 4P2GA 1YRAA 3RVRA 2J7PA 3DBHB 1PZXA 3ZDBA 4FE4A 4JOQA 1O9HA 1ID1A 3HFGA 4QG7A 3DDSA 4A16A 1V7PC 2CDAA 4YRLA 5B7NA 3SS9X 5CDTA 3WLPA 5CDYA 2H17A 5EE0A 5EUBA 1YBHA 2P9ZA 3ASZA 5IKEA 3Q40A 4RF5A 1UZMA 4YP0A 5JAOA 1MHTA 2JPDA 1FP1D 1RR6A 1SK9A 2H1VA 3KTFA 3QVWA 1BHSA 1PAUA 2ACWA 2ZDGA 3MOIA 3PR1A 4PFSA 5EMHA 3ZD8A 4LJRA 1N9GA 4IHKA 1XQXA 2ZSJA 1CB0A 4URUR 1U11A 1BDBA 4WSOA 1GGJA 2D1FA 3MF4A 1YCHA 1P77A 4IKPA 4OUDB 1K97A 1U9JA 5TNXA 3GEIA 1Q14A 1V9LA 4KQIA 5BOVA 4JI2B 1NQUA 4LHYA 2FSSA 1OT3A 4HWSA 1J2YA 4DJTA 2ZXFA 1IFXA 2X9QA 3QKUA 4PYRA 4RO0A 4QXMA 1EFTA 4UVHA 3G85A 1QVAA 5IH7A 4H6PA 1UQTA 2PBZA 3ICEA 3KJNA 4NIMA 4J2TA 4ESEA 4YCSA 5F33A 2I34A 1N0UA 3NC4A 4UE6A 4TZKA 2AVNA 3WIVA 4M7PA 5KYTA 3DV0B 1V4NA 4PPNA 1FXSA 5EE5B 1NQWA 3SIRA 4JENA 1ZD9A 4JHXA 4J0EA 5B1IA 2WM9B 3LH5A 2W0MA 4CLXA 2XNDA 1WHSA 1YZTA 1YBMA 2C4KA 3JYPA 5A03A 3RIMA 1PR1A 2B9VA 2D7JA 2PWYA 5HGXA 1GUDA 3NIFB 3VX4A 4F85A 4L8WB 1QP8A 4MWEA 4ZCPA 2PM8A 1FX0B 5EJEA 3H5RA 121PA 1NYLA 3PV0A 5AHWA 3L8HA 4PYKA 1YZHA 5TGTA 3AHFA 5HCNA 1YL5A 3EOZA 3QTTA 1CNFA 3VPDA 2YJZA 4BPBA 1Z7EA 3NUQA 5ALOA 3NB0A 3DV2A 3ZGVA 3D8HA 3SVTA 1JEQA 2J87A 3PE4A 3DLTA 1JHDA 1K8ZB 5K3AA 5ENVA 3TD6A 3UY4A 1KIAA 1LDGA 1SUFA 3COZA 5LKRA 2YOHA 4A0HA 4KMRA 3RUDA 2PRIA 3TXAA 1VKJA 1ZM3A 2GSDA 1XTSA 3NVDA 1CVLA 3ODPA 1SZJG 4BZWA 5HZMA 5CB8A 4G8CA 5CPBA 1ZR2A 4FFLA 4GOXA 2ZVPX 1Z2CA 4DLYA 4KG7A 2HIGA 1NXTA 3B85A 3IODA 3D2AA 5EGSA 3TW4A 3W3AD 2OZKA 2QU8A 4YP7A 4CPDA 5LXTB 3I0NA 1GNQA 1VIDA 2W4QA 4FFVA 2F17A 3AERA 3U7GA 2BRUC 5KPJA 2JLXA 4JVNA 5LUBA 4BV2A 1IPEA 1XC7A 1CIJA 1ZMOA 3G82C 2O5CA 2CVOA 1TD9A 3QPVA 1BWSA 1XRSB 1MEOA 2HA6A 2XLCA 4MH0R 4OQZA 1A98A 4DWJA 1R6AA 4IJKA 4OM7A 1K66A 3IE0A 1KMIY 4JU9A 3LDAA 4JYBA 3FF1A 1DJLA 4TWZA 4WUTA 5DXAA 2HCBA 2HXSA 2WJGA 1PS0A 3A6KA 3K9GA 3EZNA 4YWHA 4BRZA 1RAAA 3N2LA 5JHGB 1S7CA 4I6EA 6YASA 2ZITA 1S2OA 1ZUNA 5I9IA 3HCFA 1JIKA 1T1IA 4Q3AA 3IAM6 2Q3JA 4FDMA 3W5AA 4EX7A 2RI0A 1ZESA 1N6NA 2D06A 2ZETA 2MSNA 4YHBA 2SKEA 4HDQB 2ZQZA 3BS4A 4CEIB 5GM2A 1EUYA 2PVCA 4AF7A 3WISA 5BVGB 3EHDA 5CT5A 4QUJA 5JTTA 5BV7A 2JEOA 3OUZA 1KJYA 2A9KA 2HBZA 3N2EA 3UHAA 2R6DA 1X7DA 3Q7TA 3ZGXA 2CXSA 2Q0QA 3EXEA 4GLFA 3RVSA 3PE3A 4TMFA 4JBWA 4FWBA 3TIVA 5IM5A 1FTNA 3DEAA 1IHPA 1JNXX 3PFGA 2CMDA 3OU6A 5ED0A 3WL3A 2BFMA 3WB2A 4K81B 2IZ6A 1KPIA 5BQFA 5JZSA 4OL9A 1NDUA 4IXWA 3CG0A 1OXKB 3HP4A 2ZI6A 1IVYA 4K6CA 1WTCA 2PT9A 3HI6A 2QVBA 1KFEB 2JI8A 3AR4A 3LCCA 1Y8RB 5I51A 3PG5A 4Q34A 3R23A 4XE5A 2E3JA 1MBZA 1MA3A 5CVUA 1SG9A 3EFOA 4M0DA 1V8DA 4QLOA 1LLQA 9LDBA 3VPCA 1MH1A 4DR7B 4X41A 4MEAA 4DDMA 4HVLA 3D6FA 4LTNA 5IFLA 1OD6A 5LMUB 4DUGD 2LZ0A 1SUAA 1VKOA 2I6SA 5B58T 4UD6A 3M9LA 4ZXPA 1MF7A 2Z95A 3OQNA 5TMDA 3ME5A 1GQRA 5TQ2B 3OF5A 2O14A 3RWMB 1JB9A 2Y3IA 1A76A 2VDUE 3PZBA 3ETHA 3RKRA 2H16A 1P4AA 1O6FA 1TYZA 2FW8A 3L7JA 4JL8A 4Y1EA 4Y8VA 3GRAA 3PXAA 3I2GA 1G6KA 1DV1A 1NX6A 1TKBA 4FXOA 3FIJA 1CY0A 4OAQA 2X0DA 1XT6A 4C06A 2PUFA 4XDHA 1OLXB 4DM3A 3Q5DA 4UM9B 2QE7A 3CKKA 4IUDS 4NMHA 3REFA 3OPYA 4Y0NA 2FUG6 4AXBA 1XXHE 4YMVA 2GERA 3FOCA 4WWHA 3MS7A 3STTA 4I36A 2UYOA 4ENSA 2OAEA 5CT8A 3CN7A 4YJ2F 1S2MA 1Z7WA 1H2FA 4D99A 5BOSB 1WV0A 2ZQYA 4HXFB 3ZIAD 1TAUA 3MUFA 4B79A 3OFND 5LR6A 3R0ZA 4RMNA 3KLOA 3V2HA 2OYRA 1YVRA 1QIEA 4W8HA 4JC5A 4NJOA 3RLIA 2YQ5A 3VR6A 2JLBA 3W6ZA 3BHJA 1EVJA 1IHOA 3KZNA 1O87A 3ISTA 2JGNA 1NT4A 2XDWA 2XQKA 3EQ6A 1Z38A 1EHCA 4C4SA 1KVSA 4ND8A 1YSCA 4WN3A 4UTRA 5ITVA 2CZCA 2ODWA 4L28A 1AKTA 1TYDE 2RGEA 1FU7A 3EUEA 1IK6A 2FWJA 4GI1A 3HCBA 3PUIA 4HYEA 4JVOA 3B1WA 3U9TA 4DCVA 3NLLA 1R74A 1JWAB 2QMOA 4KPUB 4CLHA 1PYDA 3TLMA 1R8XA 1JSCA 1X8KA 3C3XA 3L4BA 4B7ZA 5J47A 1RXEA 3WGIA 5AUOB 1SCDA 2GM4A 2E4VA 3F7MA 3UCFA 1DAMA 2C2MA 2J0SA 3Q0TA 5ICMA 3JAKB 3WY9A 4ETWA 3ZJ5A 1NI4B 2P5SA 1U94A 1DZIA 2BZSA 3EULA 3OIDA 4MVJA 2JB9A 4DCOA 5K0FA 4C14A 2D62A 4WBXC 3WWYA 5J2TA 1T4CA 3USZA 5HKAA 2HDNB 4Y1FA 4QTYA 3I32A 1O54A 3DKKA 5ED4A 2JAWA 5AKZA 3U0VA 2SKCA 1Z75A 1Z36A 3BMCA 3FKSA 1P80A 3D6AA 3PGMA 1YH3A 3NHZA 1XLWA 3SEZA 4IPTA 3JSAA 3AJRA 4XQGA 3HLYA 5DHSA 5TPWA 4BO4A 4BWGA 1QRSA 2ZUBA 1TC1A 3TOZA 3ZE2B 4BE4A 821PA 1P4JA 3THWB 3CO5A 4QPPA 3CQ9A 2PU5A 3TINA 2ILTA 2PLFA 1MJGA 1KJZA 1XX6A 4CL2A 2AOWA 2VAXA 4YRKA 1SXIA 3PHIA 5B7QA 2PMCA 4P98A 3WK6A 3ZDYB 3LHIA 2AMFA 3MJCA 3DUWA 4I9FA 2RB4A 3QOWA 1RQ7A 4LRXA 2IKQA 4OP3A 2P8JA 4YJ3A 5DTRA 3WZLA 5IT9A 1PNTA 4M7WA 5B57C 2H1IA 3PX3A 1KO1A 4G1UC 4A8JB 5GIPE 1MAUA 2EYUA 5KYNA 3CX7A 3E3LA 3NBQA 2ORIA 2UV8A 1FPQA 4K3VA 5KNLA 1XKTA 1ZH0A 2Z2ZA 3K6SA 2R1UA 2YV4A 4QOIA 3SJBA 2CJPA 1XK6A 4L2IA 4QA9A 2XTJA 1SUSA 3P19A 5CDFA 2AKYA 1ZOOA 3V9PA 5KREA 1RP7A 1O7JA 3AY0A 1N2CB 1IU9A 5ECGC 5HK9A 4WFIA 3BGIA 5AM0A 1LTQA 4HTFB 3VH1A 2AOXA 2NU9B 4HNSA 4M1MA 1Z45A 2CVHA 1VL0A 2R1VA 4M1KA 1GNLA 1HA3A 5A6SB 3R9WA 3NS7A 5ARBA 1FUUA 3AESA 4CF7A 3GRKA 2NSJA 2V0CA 3GMIA 3MZ0A 3R8XA 1LD3A 3CINA 3JARB 4AMGA 1UMDB 3CX8A 1X70A 3WOVA 2JASA 2PHZA 3KL4A 2LPMA 3VR4A 1TO1E 1AQIA 3BH6A 3Q7IA 4XM0A 4ZVPA 3UJ8A 5BWMA 5I7UA 5KYXB 3LF2A 5G1NA 5JCOA 3VZSA 1JPNA 4X92A 2ENWA 2OHXA 1WDLA 3FYSA 3K2BA 1EU1A 2DEUA 5KO2A 4GSYA 1H2XA 1P44A 1OZAA 4GZ5A 2XXAA 4AKIA 1V25A 2I2WA 1NLUA 3A26A 3DC2A 2F43A 2P9BA 2NNLD 4JJ7A 4AP5A 4FYKA 4HD8A 5JO0A 3EZYA 5AVUA 3V3KA 2QT0A 4MULA 3U44B 3KYBA 3QKRA 3TGLA 2M2IA 1GDDA 3NHAA 1F6DA 5AI5A 1F8UA 1STOA 2WV9A 4CEJA 3EZ9A 2VJBA 2J3LA 2YVQA 5EPOA 3MT9A 2B25A 4R0NA 4XIGS 4OQDA 3TCNA 1BJRE 3NKVA 1CZKA 1AKMA 1GGNA 1K27A 1JEDA 4YP5A 3TNFA 3VKUA 1Y6FA 1Z6AA 2PRSA 2PSDA 4AN1A 2FK7A 3RS7A 3IKTA 1GQYA 4G5FA 5BVHA 1MIHA 1UBEA 2PJRA 3URMA 1D8TA 1L7AA 4YX9A 4PGGA 4QJ5A 1UT5A 4JLBA 3D4NA 1Q1NA 4GP6A 4DLPA 4D98A 4AY2A 1AQUA 3CHYA 2FW6A 1FS5A 3OOEA 4BB5A 3B1VA 3WV5A 1CJSA 3V6LA 4RAQA 3WLNA 2BFWA 3ZIDA 3GELA 4N01A 2BF4A 4ZOLF 1VSQA 3UMMA 3AB7A 4PSUA 1KP3A 3TW6A 3OCYA 3ZHZA 3UF0A 1XE3A 4O25A 4PTZA 2GH1A 1V9SA 1RAIA 2X86A 5DGTA 1VMIA 2PT6A 3SX2A 5IF3A 3O4RA 2AMLA 2O8CB 5EG5A 3VKHA 1O0BA 1EJ2A 2OFXA 5CFQA 4OA5A 3VR0A 3ZNQA 4MGYR 3F49S 1GN8A 2XYHA 3GLKA 3UEOA 4GXRA 4Z4IA 4WZZA 3REQA 5I8PA 2I4MA 4P7JA 3SC6A 4ETIA 1BCRB 1ZOPA 3M4XA 4BV8A 3EJ6A 4ENVA 4E32A 1GYPA 3AM3A 4EDHA 1FW8A 1MD9A 3Q9UA 4RM3A 3RVMA 5IC4A 4DANA 1Q22A 3DWIA 1CJTC 1ZMTA 1LPOA 4EKYA 4KGDA 3PBKA 4AQYB 3UHPA 3SDZA 3UK6A 4ZZ3A 1AA6A 1FJHA 2G0NA 5C5IA 3GJ7A 1Q0PA 3OZ7A 3N5CA 3EEOA 2IH4A 1Z37A 1OI4A 4EGSA 5B36A 3E5NA 1NVTA 1OXVA 1S6YA 2XUPA 3GJSA 3MWJA 4TRRA 2ID8A 4UTZA 5M5BA 1AUQA 3NWBA 4PM4A 4QKQA 2QJRA 2AKAB 1H6BA 3AUSA 3GLSA 3V7WA 1I5OA 3GPLA 3I61A 3TTXA 1P5HA 4YRZA 1S2DA 4U39A 3VU8A 1GFSA 5IVIA 3KYJB 5L95A 2GASA 1H1LA 4BDTA 4JLJA 1QVZA 1JLRA 3I5MA 4TTIA 4EG1A 4XYMA 1YDMA 2B9EA 2ZWAA 5A5FA 5BUZA 1HX7A 4CIWA 1X14A 4CG2A 3BGSA 3I6MA 4D97A 5EJ4A 1NXQA 5DTIA 1KO8A 4YC7A 1PFQA 2XMDA 2BEWA 4QRIA 3U37A 4D41A 4EENA 1GPWB 3DW3X 4L6CA 1W2HA 4B0PA 2F64A 1Z9BA 1WU8A 2CHGA 1XD2A 3DFIA 4FOPA 4JB3A 3UOGA 4EO7A 3NVKI 3IHTA 3HG7A 2XCLA 4CV2A 3JQ7B 4PXSA 2O0KA 3OPXA 4PGMA 5HUJA 4S05A 1MPTA 2Z9CA 2DVMA 2C99A 3FUUA 1X7XA 2QTTA 3ET4A 5FBKA 3PDUA 4GUAA 2VPZA 3BMOA 1I9CA 2R62A 3HL4A 1VRVA 3DBLA 4HDKA 4AQ7A 1SD5A 2ODTX 1DO0A 1JHAA 2COEA 4F5DA 4URVR 1EYZA 2Q0SA 5E4TA 3W2HA 3HP1A 3WIOA 4NNJA 2YXDA 2ZKLA 4G9EA 4ZQGA 5F7XA 4ZP1A 2M9MA 4PCLA 4K9NA 4UM9D 1FYDA 4PY2A 3USES 1ZCZA 2Q3DA 1L9KA 3T5DA 1YRHA 5BMVA 3COYA 2UUOA 3OEED 3TIGA 3GGJA 3UAOA 4QFBA 5CNMA 2FPIB 4BNUA 4GPBA 3MJRA 1T25A 3BDVA 3MNFA 4MKHA 3MM4A 3OE5A 4MUEA 2WNSA 2R25B 1ZBQA 3FZQA 2IZ0A 1KMCA 1AS0A 5IF9A 1ZI6A 1JFSA 4PNEA 3M5DA 4HAVA 5KVQA 4WBNF 4QUHA 4RY0A 5CGQB 4H1WA 2G1PA 2EZTA 3EEQA 2RONA 2VYND 1EWVA 3OHPA 4XUGB 5DV9A 5HFNA 1E2PA 4KLAA 2O8EB 3CRMA 4PPGA 1WUIS 4CF3A 5AP9A 1S8AA 1CR4A 4PC7A 4I4LA 1HZZC 4FZ5A 5JASA 3EZ2A 1KAGA 2EV9A 3G23A 2JBWA 1P5JA 5DYYA 1UT6A 3ABIA 2EZUA 3FFWA 2Q9CA 4IF6A 3EF3A 4LZNA 5IK2A 4C7MA 4PBRA 4RJKA 4G1CA 3P20A 3E2MA 5CX4A 2IE0A 3EBLA 3QF4B 3M0EA 4GIBA 4HXEB 2G71A 1NFRA 3MLEA 1E4EB 4PFKA 2AF4C 1RWMA 1W0JD 1A9QA 4YMIA 1NXWA 1DXHA 1UH5A 3L0SA 4OI1A 4N65A 2GGSA 3AEKB 3NWJA 4MP3A 4EELA 2W5UA 4AJ2A 5B4UA 2AC2A 2NVUA 1IBRA 1PO7A 1ZW6A 4R2MA 1IWBB 3PQ2A 3Q9NA 3RK1A 2DLCX 1CFZA 3IA2A 2FRVA 3A1NA 1IBCA 2WSIA 4CM6A 1NNSA 4GC5A 3TE6A 1A9RA 1TCUA 3O75A 4Q39A 3JQBC 3N74A 4JP5A 4NCNA 3W4KA 3LKVA 5AW1A 3W06A 2P65A 5H4HA 2WHQA 4POAA 4DMCA 5IBCA 5ALSA 2QVZX 5JSZB 3R76A 3ZEIA 2H4JA 4BX8A 1YTUA 1J8VA 2Z1NA 1ELOA 2NSLA 3RQIA 4RD4A 3V34A 1QRDA 3D7KA 4YXWD 4M6WA 2G9NA 2O0JA 4MYRA 4NC9A 3QYJA 4C5CA 1OROA 4MICA 4PZDA 2LR0A 4Y6QA 1UDRA 2IH2A 4LY0A 1I4EB 5LM3A 2B2NA 3RIHA 4ISBA 1J23A 3HXQA 3GJXC 1V16A 2FWPA 1EFRD 2YMQA 3SNKA 1BS9A 4ROSA 4FCTA 4BVLA 3O2NA 3BJIC 3VSEA 1HNWB 2K6GA 3DR5A 3UN1A 2GJ9A 5B64A 2W6JD 3F9CA 5JWRA 4H7EA 2D2XA 3MJEA 4Y2JA 1Q0LA 1W6RA 4M0MA 6REQA 1Y4DE 3IIIA 3ZDFA 3HBJA 3QMVA 2RGXA 5IJ9A 2C94A 4WZBB 5J58A 2M6RA 3P5SA 2VWPA 2NG1A 1ZVVA 3FDFA 3TS1A 1ICIA 3VBCA 3RS3A 2GWRA 1BGWA 2QJWA 2CKMA 1ESZA 2V8OA 2GPJA 1C3OA 1XDGA 3FNFA 4DCCA 4KXYA 3K0FB 4ZOCA 3IHLA 3N0XA 3AEZA 3KDPA 4B3GA 5IU6A 4LA4A 4OHYA 1A9PA 2R6JA 4OGGA 1TMKA 2PSSA 2OE2A 3Q6MA 1YT5A 4CG3A 1P4GA 1JR3D 3N2KA 2Y1EA 1SOAA 1JHPA 4C5BA 1S8FA 3NNNA 1A7UA 1JQBA 3GAZA 2B1IA 2CNWA 1HYEA 2DULA 4L5BA 4TSFD 5CR9A 4BU1A 5B2EA 1TEZA 3ASVA 2QZZA 1IN6A 4YUZA 4BEVA 1WSAA 4M8KA 3D0KA 4W9RA 4Y98A 3UGJA 2AFVA 1LPAB 2QNIA 4MLCA 1P0QA 5ALMA 2RKOA 3FTNA 4UHCA 1R5JA 1N6PA 1IOLA 1U1IA 3C6MA 2ZPAA 4L72A 3R6DA 4WOJA 2I78A 5FPSA 5JNVA 3ZCVA 4DC9A 4LNAA 4LYJA 4F56A 4XTRA 5HQ3A 4BRWA 4R1PA 4LXTA 2IHNA 1X7YB 2BRUA 4N41A 1SQ6A 2OM2A 2YIJA 1TKAA 3EGDB 2E49A 4JP3A 3IQIX 5C8YA 2HWWA 2Y2VA 5DRYA 4A0SA 2PWAA 4DV7B 3I1JA 3BYZA 2GLXA 5KS2A 3WQSB 4TT3D 3T7DA 2ZWIA 2WJYA 3U3KA 1T13A 1ISIA 5JLJA 5AK0A 2AG8A 1YDFA 3M1LA 4B3FX 3C3EA 4NR0A 2V7TA 5HKLA 1WDTA 3PI6A 2PA0A 2P6PA 3GVHA 4Z9BA 4Q93A 2ORYA 1RCTE 2VAWA 5GONA 3U6BA 2VKQA 2JK0A 3NHRA 4DT1B 3BWCA 3UJNA 2M32A 1K68A 3JZAA 1G7SA 4ZTZB 1H9AA 2F3SA 3C70A 3JQGB 1VLHA 2OG1A 1T2NA 4REQA 4TOIA 2EKBA 2HRDA 3FDZB 2B8NA 3B3FA 3LBYA 3QYPA 5IM4F 3SXJA 4M21A 4E09A 3LMKA 4K1LA 4E0BA 1UDAA 4ZZ0A 3T5CA 2HCFA 1J7KA 2VHZA 3LP8A 4Y9UA 2N1BA 2UKDA 2DERA 1M8PA 3S27A 4WZAB 4EFLA 3ANTA 3E4DA 2P40A 2QEQA 3DL7A 3LPNA 3RRZA 1PKEA 1V3QE 2SICE 4NLLA 5TY0A 2BN4A 1TVKA 1DBQA 2VN8A 4ZQFA 2I1VB 4YRRA 1KGSA 3P26A 3DPIA 4KUEA 5J2UF 4XWYA 4CYMA 4O3MA 2IV7A 3EVDA 1UBCA 2HMYB 3DAFA 4IMJB 4OO3A 5B5SA 5EJIA 4NNPA 3VYVA 3QKSB 1DJMA 4QO8A 2XB9A 4I3GA 4TL6A 5JH7A 3IAS6 3N05A 2FZKA 4WINA 3SYLA 3ZW8A 3SQNA 3Q8XB 2L19A 2GAFA 3OX4A 1CR2A 4QYMA 3B38A 4PHFA 4WY8A 4O4JF 4FX5A 5F3WB 3AR3A 4I9GA 4U7WA 3VSBA 4AZ0A 5L6MB 1YRLA 1SXPA 1GEEA 1EFLA 4IR7A 2Z2XA 1DX4A 4QYSA 3T8YA 1XNQB 4BZQA 1NVEA 2I4NA 3QWFA 1PNVA 1GGKA 2O1SA 2XCOA 1YOBA 1NY5A 1DDGA 4UUMA 1XELA 3JWGA 3DE7X 1BMFD 2NUAA 5EJ7A 1HURA 1NF2A 1Q1QA 4H7HA 3W4IA 1XPUA 4NOJA 2CE7A 2R66A 2OA0A 3FNEA 1U7XA 2BMAA 2PJDA 5IYZF 3KT6A 1PQYA 2BFFB 5EJ2A 4DCMA 3GU3A 1VLVA 5KSWB 2FP4A 2GT1A 2VZLA 2YXPX 1E1DA 3LBHA 4B6OA 3MUNA 4U2BA 3OX3A 1GZHB 4EJ0A 4PIVA 3KVOA 1B6RA 2Q6IA 1ISJA 3G02A 1C1XA 2YINC 3DMNA 3NETA 3SBOA 2YWJA 3ET5A 3JAMA 3WLLA 1N78A 1FNCA 2NO0A 2RHMA 4PTYA 1TAGA 2BR4A 2EQAA 1QF7A 1YD7A 3OZGA 3IERA 1PBTA 5IP5A 2O7VA 4OBWA 1H5QA 1O3YA 1CQZA 3WXMA 5LKAA 1UOPA 4HAWA 1XSEA 3AF4A 3GFBA 4HLNA 4JT2A 3R7FA 1NVUQ 2GCOA 1E5TA 2A5FA 2R1ZA 1TCAA 3FN4A 3GGSA 3IUNA 3GUHA 2W4IA 4LYDA 3RS9A 1OX6A 3O03A 1ESDA 1Z39A 4I81A 1NGSA 1QH9A 4DNXA 2Y92A 2NXEA 3QQPA 3NAGA 5AR1A 3NT4A 1KEEB 1MAAA 4H9GA 4JR0A 2GUWA 2H2GA 3A0UA 2B4TO 2JH3A 3N8NA 2G36A 5DBEX 5EZ6B 4ZV9A 3SMQA 4URFA 5F4BA 3UMFA 1CEYA 5JQGA 1UL1X 1LCIA 2AXEA 5ADVA 2W2KA 5CURA 1NULA 1YGYA 1DBPA 1MB0A 2NQ2C 2VUTA 3BK7A 3Q0EA 4MVJH 3CXRA 4BQSA 2BMVA 1E2NA 4EMTA 2G5CA 4MR7A 2O5RA 4KMMA 4C76A 4M87A 5C31A 4OKIA 1EEHA 3AU9A 4RDXA 3E22A 5DCYA 5IASA 4CTMA 3G0DA 2A5LA 2I6FA 3NRBA 5F35A 5DGHA 4CKBA 1CQIB 1SIOA 3IVCA 1PK7A 3MPOA 3WRWA 4O5AA 3O5AA 1YB4A 3QF7A 4KIWA 5KHAA 1DARA 4HMQA 1QOPB 5F4ZA 4OQYA 4Q3BA 5SYMA 1A2QA 2DWUA 1V3TA 1WB6A 4JUFA 2ZYAA 2CHUA 4M88A 2XQIA 3WLAA 4XPZA 2QUAA 1UC8A 1SHZA 1NMEA 3GHHA 4G56A 4V0LA 1T8PA 2D5IA 4X00A 1XHEA 3F9IA 1E32A 1UADA 3EQ9A 4I4TA 3TLGB 4QJ3A 2P4UA 5JQWA 5F78A 3Q8WA 2ES4A 4WLEA 3BCRA 1WDKA 1HDXA 3AWDA 5ARCA 1KOLA 1YWGO 3UFXA 1YDHA 1RMQA 3AW8A 1W8DA 4WJKB 3K73O 2ODNA 1WPQA 2WUGA 4MGEA 5EFZA 3QBDA 2Z2IA 2WU8A 4IICA 3RPEA 2PYDA 4LISA 3M6AA 4B84A 1CNMA 2JIBA 4F3KA 1UXHA 5CNKA 2H5EA 3DZ8A 2JFGA 2HEIA 3A9CA 2HJHA 4NU8X 1W25A 2A3NA 1M7BA 3B9BA 5JEDA 4MARA 4EQZA 3ZWCA 1DT3A 3UCXA 1K75A 5C3UA 3D2BA 2YY6A 3Q8LA 3MIIA 3RC3A 2QZ4A 1XALA 4RA6B 1U81A 5DHTA 1GRVA 1Q1GA 2IDKA 2QD4A 1R0RE 5KDOA 2WTAA 4NEQA 3UIEA 4JC4A 1W94A 4N40A 1Y6GA 2EQ5A 1DAFA 3NASA 1KI1A 1U5AA 3THYA 3S2YA 3DBRB 1VGQA 3RT1A 2OKGA 3GK3A 4BQRA 1E18A 1OIVA 3FGPA 4JXJA 1Z0DA 1OHHA 2FWRA 3G2NA 4FMCB 4HL6A 3VR4H 1COWD 5EQTA 2Q4OA 5ES3A 2H4WA 2PZJA 2Y76A 4ZI2A 1NWHA 1VL6A 2NO9A 3AF0A 3IOEA 1ZVKA 3OZSA 4JOCA 1Q2UA 1RM3A 1YQWA 5FNVB 3PX2A 3GMTA 3RUPA 4XD2A 3ZWAA 2RBEA 3IAUA 3OCJA 4QSHA 5FBQB 1AIPA 1F3LA 2AFRA 1Z0AA 4FFBA 3GAAA 4MCHA 1S3IA 5JNLA 4RVNA 1OXBB 3CVXA 3W1WA 4YDQA 3IAHA 3LL7A 4XARA 3HB1A 3N7UA 3LP6A 2EF1A 3K16A 2H2FA 4XDGA 4F4UA 2EERA 1CF4A 4H59A 3DFMA 2IYWA 3CF4A 3GD5A 2F1IA 4CI9A 1KMHA 2GM3A 4QD3A 1N2ZA 2VNHA 2WC1A 2YL2A 4HQ6A 5AJXA 2J3KA 4ZTBA 1ILEA 1EPUA 4UVIA 2B37A 1P1IA 3W79A 3TD9A 1XWFA 4G3XA 4Y2PA 3MYRA 1WPXA 4R8RA 2GO7A 4GH5A 2G83A 4B3CA 1GU7A 1AF4A 2BELA 4FYXA 4IDAA 4L8YA 3KTAA 5AHXA 2NYUA 4MJ3A 1GGFA 2J31A 3S2IA 1QU3A 2OGSA 4JJIA 4LXIA 4BDSA 2GNAA 3MWEA 1HNZB 5DBOA 2PGDA 4NZMA 4DV2B 2I03A 3C7DB 3ZLVA 4HP8A 4TTVA 5BR8B 2WE8A 3HACA 2FEOA 4PG7A 5DX1A 1M8FA 2R7NA 4DIDA 1H4TA 1JE0A 4TL7A 4EITA 1R64A 1PJRA 3FJ1A 4IHJA 2EP7A 3IVXA 4J0GA 4P4TA 1GGHA 2Q2QA 1WZIA 2PZFA 2XUJA 3C3BA 5EWJA 3C3KA 4CKEB 5BNFA 4EB0A 3KSBC 3HTXA 1FQKA 4RC9A 2O07A 1VCHA 4WW0A 5JZBA 3KJFA 1OFUA 2ZAIA 3BSYA 2VEDA 5C8DA 5I9LA 4GNRA 4OKSA 2DSTA 5TMBA 2D59A 4D8YA 2GK7A 5FX2A 5L4SA 1WCYA 2CZGA 5DASA 4RULA 2FH5B 5K4GA 2MTBA 2XWJI 2AN1A 4GAEA 4AWBA 2XTMA 3PFBA 4PSAA 2WB2A 1CLUA 5LMNB 3DXXA 1GNVA 2QF7A 3ANLA 4EY7A 2LV8A 8ADHA 5U9CA 3UJCA 2XKAA 3HKBA 3ND6A 3LHFA 1T4DA 3V46A 3W6OA 3IDZA 4QJ4A 2W2LD 1RXUA 3C87A 5K09A 1A71A 1LQUA 4NYMR 4B4OA 3ZDQA 4A5OA 2PXHA 1WKBA 4INPA 4NENB 4CL3A 1G59A 3D4PA 1VJTA 3VYSB 1SZDA 2RH9B 3VBEA 4FILA 1HLDA 1EWRA 1G5RA 3E2IA 3FYTA 4LZAA 4BX0A 2XF2A 1A69A 4BYGA 4YPVA 4ZCMA 4XB6B 4XWTA 3FUCA 4DQLA 4LF9B 3B6JA 1U7TA 5BN5B 1TF2A 3C6XA 3FMPB 3QWAA 4IS3A 2Y67A 3HJBA 4QUAA 2IYTA 3NW9A 2GK4A 3OCVA 4Q01A 3ESCA 5ECDA 3SS7X 3WR5A 2F4VB 1N57A 3GLRA 3VPSA 1XZJA 3QA3E 1N4DA 1U7PA 4XEHA 1EEXB 1UDBA 4MV1A 5CEEA 3ADBA 1MC8A 3UPUA 1JEQB 2DF8A 1DBIA 3WG9A 6LDHA 1YZQA 2R8ZA 1EVKA 2DHDA 4MUBA 3MINB 2EKQA 1K86A 3Q7RA 2XTZA 1IEWA 1VCOA 4MEBA 2C2GA 2C3OA 1TT5A 1D6SA 3T3OA 4JI0B 2I6TA 5JJKA 1YL6A 3IUYA 4OLHA 3ER9A 3ICVA 3FPAA 4Z9FA 3TNDA 4EYGA 5LP6F 2KE5A 2W42A 5A2QA 2I7VA 1IE3A 5CBPA 5HNKA 2G6TA 4HLUC 4OMUA 3SHVA 3GDOA 3WKCA 1ZSYA 4IWNA 1SHKA 3UXEA 4DZTA 2VZEA 5JT1A 5HWSA 2Q4EA 4S1NA 3A1WA 4F45A 2E4YA 2PS9A 1SEVA 2OECA 5KMGB 3B1ZA 5EMKA 2XPCA 2F6RA 3EC1A 3GUUA 4EYEA 1OXTA 2WHRA 4Q4HA 2LKDA 3CZMA 3OE4A 2B8EA 4I50A 3V8EA 1U2ZA 4KIUA 3W5SA 3MTIA 3CKLA 1DXOA 3UGTA 3JPYA 4YJKA 4RPKA 3IQXA 3IUBA 3K35A 2VAPA 3W2TA 3TSOA 5A0VA 1EVYA 4L5JA 3MJHA 4HWRA 4CIVA 1ZUNB 2C3UA 4BKOA 2WD9A 3HN7A 4FU0A 2X6QA 1N1GA 1EVIA 1FFXA 3VJMA 2QUHA 1R10A 1BNCA 2VXOA 3C98A 3FFAA 1S9HA 2I67A 4ENPA 5CLFA 4Q3DA 1U7WA 2KSQA 3DNPA 3O8OA 4LOJA 5TQJA 4RZXA 1GKLA 1J97A 2GLUA 3AETA 4DCGA 1QGZA 4FZJA 4CQLA 4E51A 3LL4A 5M34A 2CNBA 2WOJA 5SZIA 1OFGA 1RC8A 3QVTA 3BCSA 4C04A 1IHXA 2XR1A 4ENTA 3AQIA 4DJFC 5JARA 1DKPA 4TMTA 4YASA 1TAHA 3IESA 3RSFA 4YAKA 1TQDA 1JLLA 2X13A 3KIPA 2AW5A 1Z28A 4L75A 5IBQA 3I04A 2C77A 4NABA 3DFKA 4DDKA 3UMSA 5IUNC 1IHDA 3IOCA 4IHAA 4D96A 5BORA 3NT5A 4IDGA 2QMHA 1PFVA 4BB9A 3ZXSA 4EOGA 2ZSFA 4N3GA 2A5GA 4LRQA 2B94A 4FHEA 4M1ZA 3KDSE 3KUXA 4ZPJA 3FNBA 5AI9A 3BKWA 2Q8NA 5A5VA 3U3OA 1UXGA 3G0OA 2H92A 4F2GA 4HGZA 1DC8A 2P9FA 1WW3A 3INYA 1SVMA 3EFOB 2C78A 1KSJA 3WAJA 3VJKA 3RT9A 3SQXA 4HDSB 4RSGA 1A8IA 1HLFA 3TEFA 2X2PA 1KZGB 3VR5A 1UOOA 1DAOA 4TM7A 4W5WA 4GOJA 1K5GA 4DADA 1QLWA 4LNUA 1Z56C 2CV2A 2OMEA 1ITZA 1S2LA 4E2YA 4RE5A 1E8NA 3A2NA 5FNZA 5E3HA 3J7TA 6ABPA 2YIMA 5IPFA 5LWQA 4UW9A 4QFCA 5KHOC 4P2BA 2X40A 5IW8A 5TT1A 2GBPA 3OQMA 3GCGA 4LF5B 3OD1A 3C48A 4UEQA 3B7GA 1G6OA 2V65A 2HBYA 4AF6A 3C3DA 2PD4A 5F12A 2ZRMA 1VYVA 1IJEA 2XRFA 1N7HA 2D1TA 5A7GA 2BH2A 3KYCA 1F2VA 3PYXA 3KL2A 3R0VA 4PRLA 4CMJA 2QVGA 3L0ZA 3OZIA 4JFAA 1S3FA 1OLSA 4KWEA 1QLHA 5ALQA 1CY1A 4C6TA 9MHTA 3SBDA 2I22A 4BVFA 1WCIA 4KDRA 2Z2JA 4KLNA 3W8NA 4B3SB 2NSYA 3ZLJA 3QE9Y 1J8DA 2OAQ1 2XTAA 4QBKA 1TUEA 2X8JA 1QFYA 4LYAA 3R9IA 3IMEA 3G9QA 2BJVA 2PLWA 1XQVA 4KK3A 3H1GA 3OOHA 4U9HS 3MRXA 1OBHA 3SX0A 3ZQ6A 3WRYA 1AK9A 4LJLA 1KMNA 4MPDA 3FSEA 5BW6B 3FDJA 5SZJA 1PEYA 1QYIA 1X1RA 1T8WA 1ZIDA 4RCZA 1U63A 4F38A 1ZXBA 1NBMA 1KYYA 1OPRA 1XLTC 1OOEA 1ZC3A 2ZJAA 4F92B 3H65A 2ACVA 3SR3A 1HLGA 3FTDA 2DR2A 4RLSA 1UZNA 3M1YA 1IB6A 3LIIA 3T35A 2Y93A 3F3MA 1DC4A 4BNWA 1AKEA 1KAMA 1GTG1 2IIBA 2O6HA 5ITWA 3M4YA 1W1UA 5EKXA 4URYR 2QTRA 2C7VA 3IDSA 3PQCA 4RPJA 4J4BA 1Z6TA 1X8LA 1DIGA 2EBUA 3PT5A 3WIEA 5T3YA 3ZHCA 5LQMA 2VP9A 1D1PA 2OORC 2G9QA 3K09C 1D2MA 1KR2A 3BMCB 3D3NA 4LFCB 1Y8CA 4UTNA 5JHHB 1XXLA 4HR7A 1CZOA 2JD0A 2GEKA 1XTUA 3KKPA 4K6KA 3TTYA 1UWCA 1N6HA 1QV7A 2XBLA 1L5HB 1QZZA 3E5RA 3H4IA 3MWYW 5HILA 3T12A 2W2TA 3OWHA 1KK1A 4RWZA 1JLHA 4P84A 4L7VA 2E1PA 3VR2A 2A9FA 2G4VA 3H99A 1QRUA 2QTVA 5H7XA 6Q21A 4CCAA 2GB4A 1RKVA 1PFGA 4JB2A 4YH1A 2FW9A 3BTSA 3AVPA 1E4OA 1WTAA 3FVQA 3G0CA 3H13A 3WKBA 1RFGE 3DNFA 3WXBA 1WCXA 5MFZA 1UBUS 4NJEA 1JN0A 1QC5B 1WMDA 2YFKA 1C7FA 4IW3B 4G1BA 2QN2A 3RM3A 3EGEA 1R8QA 3I58A 1DC7A 2BI4A 3FCOA 2W6MA 3UWPA 2HADA 1JG3A 5C5EA 1GSAA 2I3DA 2KWIA 1VPWA 1AV7A 4MTCA 3MCZA 4W63A 4LV5B 4YR9A 1CQJA 1CUFA 1GGVA 2R6FA 4GQIA 3K6SB 1MPXA 3U16A 4L2IB 3A05A 5K0JA 1LLDA 1JU3A 1OXUA 2W6NA 2X23A 7YASA 3UWSA 1KSHA 1CUJA 1JQLB 3KR1A 4IX1A 1NBOA 3FRHA 4LTMA 4NCHA 2PMBA 4PVCA 2X8WA 3DLCA 5EMNA 5HTKA 2UU9B 2J6IA 1AB6A 3TIXB 4EAAA 3FTQA 5EE1A 1BXGA 1PSDA 5CLQA 4EZIA 8AT1A 1ONNA 1J1IA 2JC3A 2V45A 3M4NA 4MTLA 4O4IF 4E5DA 4LJYA 4EGJA 2O2DA 1M7GA 2W98A 1G19A 2PO5A 3RUEA 2PUGA 1UKCA 3K5PA 4WIAA 2DWOA 3UYLA 1W9MA 1ML4A 1E60A 4M1YA 1BXZA 3EQ8A 4WAUA 1H2YA 5B3KA 2BMJA 2JD2A 2QI9C 1N5IA 1CUGA 4RY9A 2PLAA 5KOYA 4FDTA 1TXGA 4LS3A 4D9NA 5LIPA 3RIEA 1B76A 5EINA 3R7AA 4EW6A 4R2LA 4B81A 1GKYA 3BK1A 1CY4A 1NUQA 3M6IA 4EP1A 4ZJYA 3I8OA 3TWOA 1XYVA 4DMKA 4AKEA 3RV4A 4C7XA 2F48A 5JYDA 1A9XB 1N5MA 2FPKA 2RD2A 5LDGA 2GNOA 1AURA 4BRSA 2HIAA 1LSJA 1GQQA 2E0IA 2EKPA 3B6EA 4LRTB 4NEHB 4KQCA 4CEJB 3OFKA 4NRDA 4JDPA 4X1YB 3QPDA 3FXAA 3H4TA 3U39A 1PEAA 3H4VA 1VOTA 3CZCA 2NOAA 3CRZA 4MB2A 4EY3A 1W76A 1IZ7A 4A3SA 5CYFA 4AN4A 4RK0A 3IELA 2HJVA 3FCCA 4R4JA 2XIQA 1KAHA 3H87A 2FEMA 4R1TA 4XCVA 4D42A 2XB6A 4L73A 1AKYA 1CY8A 1W5BA 4DBVO 5BVHB 4D46A 3A10A 1HSZA 2X6RA 2V58A 3D8TA 4YJDA 1YR3A 2HMUA 2WHYA 4B4WA 4TRNA 3PENA 4YN3A 1P29A 2ZSKA 1EXDA 3ZHXA 4RTRA 3TZLA 3WHIA 3ZI4A 3ZD7A 4UFOA 4IOMA 3H7AA 2EDCA 3UTDA 2EFGA 2GA8A 3WBBA 3L7BA 3IUSA 3CNLA 3MWGA 5DLDA 3H7IA 3VNVA 2Q1XA 1JQAA 5DX8A 4Z0NA 3LPMA 4Y2QA 1KDOA 3OPQA 3NTXA 5FL3A 1SVIA 4NCIA 4CKCA 3GNLA 4TVSA 2AEFA 4JFRA 1HNNA 1VB5A 2I6GA 4M0PA 4J03A 5HIKA 1NF3A 2JLRA 3IAXA 4Y6LA 3PFCA 2RK4A 5IDQA 3REQB 2IQ5A 4KITB 1U65A 1WO8A 1J2UA 1VPEA 4W99A 1W4CA 1SM4A 2P9TA 4UM7A 2JLWA 1T9DA 3E81A 1O58A 4KR7A 1Q3TA 3W1EA 4D4KA 4NCJA 2AUNA 4BN5A 1YI0A 4JLKA 4OL0A 4URWR 4CMIA 1MO2A 3PFIA 1Y89A 1RZUA 1GZ7A 1L7BA 3CZPA 2V55B 3G2HA 2AUTA 4IH4A 3D8NA 5KC9A 1CUCA 1HZJA 2YWDA 3DFFA 4RELA 2GXAA 4I4IA 1QOQB 2NXWA 2G7MC 3PGA1 4L5AA 2W00A 4BL5A 3OCZA 4RVCA 4KJXA 3IDOA 4S0XA 4EA7A 7GPBA 3EMVA 1LWNA 2O3UA 3DMYA 3JX9A 2H7XA 4CKWB 3LE8A 2VZ0A 1TJNA 1B1CA 1E96A 1FY2A 2FX5A 2AZXA 3FPKA 2ASEA 1D2NA 3LT2A 5BN3B 3VFDA 3H83A 2ZRJA 3W8RA 5HQTA 2V7QD 1H1LB 5G40A 1LDNA 4YMLA 1DRUA 1BXRA 1SRQA 2Q1SA 5LUAA 4B7UA 1L3BA 4ND1A 4RPGA 4TXNA 2B35A 3UJPA 4OJKA 3WGUA 3ZVKA 2BEWB 3CIFA 1R9NA 1HTWA 4B71A 4D92A 1RYDA 3CIOA 3M6XA 5JNUA 2C9BA 2AMYA 2QU7A 3HSSA 4I1RA 4MWBA 4P7FA 4Q1FA 2BTOA 1QKIA 1W4LA 3BIOA 2OHVA 5CIYA 2NMVA 1ZKDA 1V41E 4EKNB 1SULA 4JUDX 2XVYA 2FE4A 1US8A 3CWQA 1VCMA 4NF2A 1U3DA 4CTNA 3KPJA 1JNYA 4CM1A 3WSVA 3CX4A 3RYCA 5F7ZA 2VJYA 1K7XB 4TXMA 4CM4A 1HQYE 1GFWA 4BFWA 3H5OA 1R88A 2CF6A 3INRA 4PLPA 1RBMA 2I6QA 4DMGA 4QECA 2UUPA 4RTLA 3FWKA 5G41A 2QX8A 2AT1A 3BE5A 1JDSA 1QAOA 2CWDA 2GPAA 3GARA 1N2IA 4BAUA 4EPYA 5CA1B 1A7JA 5KDDA 3B1JA 1JX6A 2K7ZA 3QLVC 3O1IC 2WJVA 2COKA 5CD9A 5D87A 1GN9A 3LUJA 2C4TA 3ZX5A 4KYIB 4IQFA 3WWPA 1NM5A 5CIWA 3USCS 4MKRA 3HR4A 4PRKA 4GXQA 2JFWA 2LBPA 2PG3A 4IZIA 2IXEA 4KQ6A 3M89A 4FX2A 4KRYA 3MWFA 4EHAA 4JK3A 4U00A 3F73A 4ZQEA 2JF0A 2M98A 3NTVA 3STHA 2IW3A 3X1JA 2YYYA 1VJDA 2C96A 2B4RO 3EZLA 4LDQA 4CV0A 2OHHA 1V8PA 3RF6A 2AXQA 2AGVA 2X7XA 4Q0MA 3GEBA 4QPCA 1GRQA 2A14A 3RS5A 2NTVA 5JIBA 1ZD4A 1I3MA 2A86A 3BL6A 4OJMX 1S2IA 2Q7DA 2QLFA 5G4KA 2XNCA 4DR2B 1M75A 4D9FA 2W6ID 4RHCA 3EVGA 4D79A 4Q7JB 2BHSA 5MN4A 4EF4A 1SOVA 2Q5LA 2F62A 2G5TA 1RYBA 3K1JA 4P3KA 2BGKA 2GZHA 4DC0A 2VNSA 4ALMA 2XOXA 3ZZ1A 4V24A 1U90A 3KPVA 4CMGA 3ACCA 1FFCA 4MUYA 4P5PA 3NZEA 4B3DA 1WBDA 1IBMB 3A28A 4BBPA 1QHHA 5IABA 3BQ9A 2NADA 3MYYA 4OHPA 4P86A 1RZRA 1GPAA 2GKSA 3BMXA 3O8QA 1G8YA 4CV1A 2IYRA 3NPAA 2NVUB 2OWDA 5D85A 3GFSA 2VJNA 3FAKA 3B2QA 3DYBA 3OH8A 5IMSA 4C2BA 2Q50A 3WTCA 2QTGA 4OQEA 4YJHB 2GARA 3G8DA 4H4DA 1XVTA 4P81A 3AKYA 4ZCIA 1TADA 2JIOA 2O5VA 2WAAA 3QJYA 4L6AA 1EP2B 1TIBA 3BORA 1VBFA 1XMPA 3AZOA 3IOYA 4ARBA 3QOXA 5AVYA 4YEDA 3IP9A 1H4SA 1SO8A 4X3PA 2HZ7A 1K1EA 3RFTA 4R1OA 3C1AA 1SKYE 4B75A 2ZW9A 2XUDA 1EUZA 2IXTA 3TW8B 4PXYA 1GUZA 3Q1KA 2WYVA 4L4XA 1DDIA 4K05A 4MVJM 4Q4AB 4XX0B 4KVAA 2UZIR 3H9EO 5CH3A 2G67A 4NE7A 2Y05A 4DDTA 1DO2A 1P60A 2ZB3A 4GMDA 3QHQA 5D5QA 5AVOA 4EFDA 2CBGA 5B7PA 1Z7GA 2UXBB 1R00A 5IAEA 5J4KA 3HB7A 3QPBA 1F8YA 2WU3A 5KTOA 2WB4A 1X7WB 2IEIA 2JJYA 3VGPA 1I6MA 4QJIA 1P91A 3T34A 1IZYA 3NIWA 3OJLA 6REQB 1T1GA 5EKSA 5T4BA 4RLFA 4RESA 3FYCA 1I7QB 1KP9A 3GY0A 5DBGA 5KVSA 4KQEA 1NUTA 1J9ZA 4OXQA 4HZGA 1MJGM 2QLBA 3EH1A 4MQFA 1N2JA 4WUVA 4D0LB 1LPBB 3FPJA 2YR0A 4ZCTA 3KLPX 4R69A 4ZT3A 2UYQA 4DPMA 4LHSA 4JT4A 1NW4A 4ZZIA 1SVWA 5TS3A 3OY2A 2NX2A 2XT6A 2HLDA 3LQYA 1F7VA 1FSFA 1YQUA 1C3EA 1FLAA 2XSZA 3N2KB 3MJVA 3VR4D 2GAJA 3X2EA 4UDYX 2EBWA 4OB8A 4ZDWA 4PIPA 5ITZB 2PL9A 3SXUB 1AQYA 5AKKA 3BEDA 3WRVA 2IYUA 4L95C 1C2TA 5FL7D 1OZHA 1Z3IX 4O2BB 4O2AA 1OAOA 4FSXA 1VYHA 5HOQA 4YECA 1ZBDA 2ID7A 3F90A 1TZMA 3DBIA 2AB0A 1L5VA 1JQDA 2WD7B 3DOFA 3FCEA 4N5NA 2XW6A 1J2TA 4RMGA 4FDUA 2FFRA 4BN4A 4Y6SA 2IPNA 5B1YA 1FJ2A 3E9DA 3LM8A 3S99A 3GOQA 3T9CA 4XWKA 1TPYA 1PUJA 4MVJP 3NHUA 4L15A 2FQXA 3P94A 3ETJA 4DM4A 1ZK2A 2JBAB 1USVA 4KRXA 5C8YB 1YBAA 2OGZA 2IV3A 3VOBA 1F38A 3M83A 5E7MA 2CUNA 2JCYA 4GOLD 3RSSA 3VAZA 3A3KA 3A4MA 5D6OA 2XBUA 4HLDA 1VL5A 4R0VA 5J1TB 4J76A 4RF4A 4GPAA 2A84A 3L6DA 1TJ4A 5GONB 1RTTA 3N86A 3C41J 2DUWA 2HA7A 1RE1A 4NBNA 1BKDR 1PSZA 3KJGA 1B93A 2AL7A 1QK4A 1D6NA 3RYIA 5DHUA 2GETA 2J0UA 3QE4A 4LZOA 4EKEA 2AQIA 4QOJA 3TRKA 3GVXA 4BNTA 4Q1BA 1CHDA 3VX3A 2ODAA 2YCLA 3EVFA 2ZBVA 3PPXA 4U6SA 2IU0A 1GSOA 3K1TA 1NP7A 1XRNA 4KXFB 4ZC8A 1KZ7B 2DY0A 5A5GA 2QD5A 1TVKB 3LY5A 1U8CB 2DMRA 3NC1C 2ECKA 4U7JA 1DU4A 2FXIA 3T6KA 1Y5NA 4CFSA 1U1EA 1NXXA 1U80A 3E3MA 3OJFA 3OIGA 5F9MA 4EJFA 2F59A 5JLAA 3ILHA 4R3UC 2J9YB 2N1MA 4FZVA 3SZLA 2IWHA 3ZGNA 4EKIA 3IYLW 5EHXA 5TPZD 3TR0A 1HE2A 4ENWA 5T4HA 4EBFA 3PJDA 2CNDA 4HBGA 3HRIA 2WT8A 5HUHA 3UFBA 4C0AC 4C4PA 1QDUA 1CDOA 2Y1KA 2C9MA 1A3CA 2DOKA 1NAHA 2C8LA 1PT8A 2QSYA 2R3SA 1Z5OA 3UA3A 1EE1A 3STVA 4M9UA 5I47A 4MS4A 1H0HA 1DKQA 3UTCA 1X77A 3FMOB 4FJ1A 2UUBB 4C4XA 1E62A 3VR5H 4KR6A 1SD2A 1DT5A 2NUAB 1DEAA 5CB4F 3DE4X 5HX7A 5K20A 2OHOA 1P2TA 3R20A 5CVDA 1GZ3A 4Q9NA 1U1CA 2OCIA 3IEIA 4BNNA 1ECLA 1IY1A 3LYLA 3ST7A 2ZBFA 4ZDIA 4R81A 2ZUUA 3IVMA 1V1RB 4YCAA 4GRIA 1NHGA 3EIFA 3WKDA 3I42A 1II9A 1QRRA 4B8ZA 2P0AA 4ND2A 1QIGA 1DP4A 3CRW1 2NXNA 3K5IA 2O9JA 3FA2A 1QONA 5HCIA 5ABPA 1M5TA 2NT3A 2MINA 2OYSA 4F46A 4ZDJA 1H1DA 1LNSA 1NVDA 2Q5CA 4EG3A 1ZRSA 1KTIA 1O94A 2VFAA 2GN4A 2ZUFA 4AJJA 1L1FA 3ZLUA 2VDWA 3C39A 3D5QA 3NEJA 2JHFA 3QVVA 1U9YA 1CLEA 1H22A 3OSUA 2MCFA 2NTEA 1GZ4A 3CLTD 2R00C 3SQOA 2A9PA 3NUZA 1E6EA 3BFVA 4YDSA 4AFNA 3KHUA 4R9RA 1PG2A 4Q82A 4W8OA 4OHBA 3RU2A 4GHWA 4QUEA 4XVRA 2PDAA 4M53A 5FUWA 1QX3A 3WO0A 5DI3A 4I3HA 5DTJA 2EIHA 1SXGA 2WM8A 3A9UA 2ADMA 3O4HA 4QWWA 4RYLA 4DMMA 5JBIA 2OO5C 4GL4A 2HIHA 3CF0A 5AQ1A 3I01M 3DHYA 1I2ZA 1MVNA 3PJRA 2R8OA 4BNHA 1DELA 1TM5E 2Z8YA 1WABA 3TFOA 4MR7B 5EXPA 4QVKA 3UUEA 2P2NA 2BP7B 2YV5A 3COPA 1CUIA 2J4CA 4ZARA 5K51A 4WERA 4HYQA 1RPTA 4D8VA 1U8XX 1YQDA 3H0CA 4AJPA 2OLJA 3C2QA 4ZHQA 3PITA 2OORA 4FHCA 3MT0A 2WUDA 2IHKA 4PSDA 1YASA 2Q45A 4DMUB 5BPFA 4R0MA 2JD1A 3CUUA 4CF4A 1FSGA 4HRAA 4PINA 5FUXA 1TTTA 1TQ6A 3DZJA 2VJAA 3QU4A 1F6BA 1NFQA 3LWBA 1EGMB 1CJBA 1HQKA 1CKEA 3EA0A 3O7WA 3SXPA 4FGJA 1I01A 2CN1A 1K4KA 2YXLA 1N92A 3H2YA 5F1OA 3OG9A 3B6ZA 2XKJE 2Z1MA 3JQRA 4I4TB 2EIXA 4JHLA 4C4RA 1B8OA 2B4YA 4RVGA 5HZGA 2Z43A 2JCVA 3PJGA 1SN7A 1Y1PA 3NHBA 3PEEA 1Q7CA 4P3YA 1GPMA 1LDYA 4HNTA 4U2FA 2O06A 1QHIA 5EIAA 2BBTA 3JVDA 4C7VA 4KPEC 1T9GR 3ORQA 3PRHA 4OK5A 1HG1A 4HUQA 4U4AA 4ZCRA 3DMTC 2W8BA 3P45A 3P4UA 1T3ZA 4PZZA 1X2BA 1NR5A 4FMDF 4UVDA 1LF0A 2GD2A 3GEPA 2WYIA 4MB0A 4BYMA 5FFNA 1E2LA 2OOKA 4YTEA 1JFTA 1T36B 1NSYA 3EJWA 3PIDA 5D51S 1JRLA 2ECFA 1JSXA 1SBIA 3BXHA 3HGQA 1UDCA 1AO0A 2VCEA 2PTHA 1KTVA 1VMEA 2FW1A 1EXMA 1X19A 2ZRHA 4BMVA 3Q5EA 4RD6A 4HFJA 3ZK8A 3FCSB 3KZMA 3T9BA 2H29A 3TNYA 3HABA 4AYTA 4QM6A 5AM2A 3ADPA 4GX0A 5CG2A 3UMYA 4BGIA 3OZAA 3DBOB 2J3DA 1D6JA 2NUPA 2XE8A 3JRNA 4W9NA 4LJ7A 5E95A 2R9VA 2P67A 1XWIA 1JPVA 5BMVF 2CLHB 1DQPA 2J5RA 4RV9A 3TCKA 3TLBA 1QAMA 3ID6C 1EXNA 3U7QA 2DR3A 1V4BA 2R87A 2GA9A 2PGOA 1B8VA 1I13A 1WD7A 1S8OA 2P2DA 3ENNA 3GZTB 2P3QA 3PXBA 3DAHA 3K2IA 4P0TA 3RRBA 2HI0A 2Q28A 2I62A 3ANXA 4MEJA 2CHEA 4WEQA 3BWYA 5EHIA 4P7KA 2I3AA 3INNA 1KOGA 4H1VA 3FJYA 4EHDA 1F14A 3P2EA 5A06A 1EIZA 1MC1A 1UMBA 2GEBA 4YT8A 2IYQA 3HRHA 3NDJA 1W1WA 1QQTA 5BV0A 3TZHA 1Y1LA 3LWZA 1NQAO 3RFVA 1KMHB 4PLWA 2H5LA 3PUWA 1M2NA 2Z04A 1W5FA 2Z5GA 3IBCA 4DWVA 4GGOA 5KTMA 1QFMA 3SBXA 3Q8KA 2ZR0A 4HT3B 1L4GA 1CNEA 3V1MA 1UXJA 4U2EA 5F51A 2LVBA 3DOJA 3IL2A 4R3NA 1TYEB 1ZCFA 1PWEA 4DVJA 3EGCA 1J0CA 3KQWA 4KMOA 3EBOA 3I0MA 1XVVA 2GEVA 1A88A 4MKGA 4HN2A 3DFUA 3QLEA 4ZYLA 5IUJC 4NMLA 1U0FA 4G8DA 4OUKX 1T15A 4CMBA 2G1JA 2HGSA 3MWEB 3OY7A 2O2YA 1TJPB 3RBAA 2PJZA 1HOTA 4G0NA 5J4HA 1X1TA 2I65A 2R4TA 2ECPA 1BS2A 4NCXA 1Y1QA 2FN3A 3TQQA 1KPHA 3RWOA 1JXAA 1YDEA 3KWFA 3V4FA 3SMVA 1GYQA 1CE8B 1Q15A 3I0ZA 3WDMA 1GR0A 1EMDA 3ICCA 4GECA 2YMLA 4M9ZA 5AICA 4DQ0A 4NE9A 4DG9A 4UCFA 4A27A 2BGMA 4CUJA 1I7LA 1Y37A 2AMJA 2QZPA 2REBA 1H93A 3C15C 3AR8A 3GJ4A 1KVUA 4QE3A 4ERNA 2PVPA 4C08A 2SKDA 3ZEAA 5GOTA 3ZDAA 1OFHA 1DG9A 4D0SA 1PJQA 4IGEA 1P9LA 2BGUA 3DSRA 3DKPA 3R44A 4NONA 4DLVA 3C1OA 3L06A 2ZSAA 4OFZA 5TMPA 1PGNA 1K9SA 1O96B 2Q27A 4KBFA 1W9HA 4OXIA 2WJAA 3M3DA 3RUCA 4C0SA 2YN4A 3L4JA 5K3SA 5BWCA 3CPJB 4XXHA 1Y6JA 3WQQA 4HGRA 4BC1A 5JXGA 4MPJA 3P0FA 3LDFA 5EE9A 4BNKA 5LNK6 3P8ZA 1GKKA 2GXUA 2NZWA 1VFPA 3CGWA 3LT5A 4ILEA 3OU2A 5FI0B 1DDOA 2OR3A 3GPDG 1E3WA 4MI1A 5GP1A 1JEYA 2HU7A 1I5EA 2X7HA 3AGQA 1KRXA 4V0KA 2J4DA 3JQDA 3ONFA 3DL4A 1JAYA 1VIMA 2B2CA 1QIMA 2VTBB 4BLSA 1P0FA 3BRSA 3FB4A 5GVRA 4KXMA 4B83A 2JARA 1LY1A 4A82A 3MUEA 1M0TA 2VF7A 4LSZA 5EE3A 3E9RA 3RBVA 3QEMA 4HI0E 1AK1A 1AUXA 1XEAA 1SU7A 3I2KA 3NBAA 4UZEA 4X1KA 2R86A 1E7SA 5E38A 4GVLA 3RT7A 4IV0A 4DF3A 3RGWS 1KKMA 4DJEC 1BU5A 1T5BA 3EH2A 4XDZA 2WTNA 5CEJA 4AD8A 5J43A 5IBPA 2TMDA 1ZGBA 3PPYA 1Q0ZA 2VP2A 3AP2A 3TEJA 1U0GA 4AF8A 3KYIB 3ROGA 2BFOA 1FPMA 2PUTA 4U1RA 3OVMA 1G2PA 3TUZC 3BSSA 3QG1A 4UVEA 5FI3A 3D81A 4MRPA 1J99A 4EJ2A 1YOVA 3KSAC 4FEYA 2GAAA 4O02B 3SSOA 2OZPA 1U02A 5AK3A 1BXKA 2P9QA 4OA8A 4HS9A 5FTMA 1A4IA 4IOKA 1NU6A 4RF2A 4I50B 2XB2A 2L69A 1P7PA 1XHFA 4AG5A 2V7XA 1AXEA 1LSSA 3TTVA 1XKXA 1PGJA 3O4IA 2I99A 1NVVQ 1O95A 2XHEA 4H27A 1DTWB 4HFNA 4HB4A 4IGAA 3AR2A 4P4NA 4ZODA 3MBOA 4MCAA 5AXCA 3T1QA 4HZIA 1VL8A 3WNBA 4FHFA 4JI8B 1SJ9A 1XFDA 4Z8XA 5BMOA 1ZSVA 3MXTA 2I1LA 5CFMA 2ZIGA 1XF9A 5LOVB 2Q41A 2VQ3A 4LBVA 4QU5A 2ECQA 5LYYA 5CITA 5H02A 1X9IA 3O8OB 1EHIA 1AE1A 1W5EA 2F3QA 2A1TR 3EMDA 4P4LA 4WLOA 5FTLA 5AD1A 1O5TA 4HRVA 2WI8A 4Q6WA 1MO4A 2WWGA 5HVNA 3WLFA 2HR1A 3LPAA 4BUJA 1LQTA 1QOZA 4D56A 3D0OA 3M34A 4YAUA 1XDBA 1PJ3A 4HYTA 1MZPA 1Y9EA 4D02A 4FIDA 1G8JA 5IWCA 2BMEA 10MHA 1G20E 4LNHA 721PA 3VMFA 2ODBA 1JLLB 3WRXA 3DC7A 2B61A 1YIDA 3EFEA 4W7SA 4X6UA 4Y18A 1EZ1A 8LDHA 2AFHE 4O2LA 2Q3BA 3PTZA 1UBFA 1A77A 1KL7A 3IPXA 2H6EA 2WSYB 1E3MA 2IBTA 1UBKS 3B89A 5JH7F 3R6WA 3PRJA 4V39A 4CODB 2MSDB 1NN3A 1V2GA 1M7HA 1NNEA 3P0JA 3O74A 1S3SA 1MQ9A 1QIKA 4I7EA 4BNXA 4M9RA 4IIJA 4YCNA 3AM5A 1BDJA 2DHRA 2CCJA 2VYQA 3AG6A 3ZZUA 4WCFA 2REQA 4XFKA 4XPIB 2E21A 2VJOA 1KC3A 1NMXA 4N6NA 2HW8A 4OHWA 5L40A 1JLKA 2JANA 2VL7A 2IX9A 2PPVA 2QJOA 4CBVA 4E11A 2VYCA 3AIMA 3E8MA 3GLHE 4R8VA 4BU0A 4W6ZA 1FYWA 2WV7A 5G4LA 3FR8A 3TAUA 2XRZA 2K7FA 3IDFA 1UPBA 2COUA 3VA7A 3WK5A 5DXFA 3GZNA 3OIVA 5KYUA 2GSWA 4TV8B 3UMRA 4UARA 5BV1A 1VXOA 2P11A 5F1KA 5JADA 4LSWA 5E0OA 2E2WA 3L6CA 5I01A 4J1TA 2ROQA 2HF9A 1T9KA 3MOSA 4OK3A 4ARVA 1N0HA 5LYJB 4HV4A 4X5OA 1EP1B 2C20A 1QG2A 1R12A 2FTKE 3KYCB 3DT8A 1KZ1A 2Z8ZA 3EDQA 2I55A 5H59A 3FWHA 4C2UA 1EFCA 3F1LA 4L08A 2JEYA 1P33A 3ENWA 5LCXA 3BIXA 3GJYA 3TR6A 5FWXB 1Y6QA 4BP3A 1RCUA 2VPIA 4KOAA 5LZ7A 5CP8A 2X77A 4O0LA 2Q5HA 2O48X 2IPAB 2X8JB 3UJDA 1GL7A 1OVGA 2X14A 3B70A 2VS1A 4UEWA 4F1KA 2JRCA 4LZWA 1RQPA 3PVCA 4EL5A 4Q7QA 3C74A 3I92A 1Z6ZA 5EIHA 4M0FA 4XQ0A 2DBYA 4KYVA 1VQ1A 4ZIRA 1GPLA 5UKDA 4QATA 3FLBA 4B6FA 2O7NA 3ANSA 3KLBA 3O7MA 2R48A 3VTAA 1L4KA 3A32A 4IFEA 3O4VA 3O4GA 3RRFA 1BD4A 2UVPA 1Q74A 1IUNA 1OHHD 1S1CA 1W88A 2FWAA 2YZKA 4A6DA 4BGVA 1LF5A 3FNRA 1MJ5A 3TLCA 4OD0A 4KMSA 3UG6A 3HKEA 1TAQA 1ODKA 2B5WA 2VCHA 3GCDA 4CLOA 4MMYB 1P75A 2ZI3A 5EVCA 3GZJA 2DQ4A 4H17A 5FR1A 4OBXA 4R54A 4QLBA 2W2NA 3HDGA 2ET6A 5EJAA 3DVLA 3ZLTA 3R5HA 5EHGA 3E1GA 1SCIA 1U0HC 4M46A 3OOYA 2ZS7A 5DO9A 4DDUA 3D7RA 1Z3CA 4RFSA 5ICSA 3PEWA 4N03A 4LOLA 3P9KA 1J21A 4MLZA 1DAHA 2P6MA 2YC4C 1HYHA 3MT8A 5BNTA 1KYXA 1E61A 3U6KA 3B3AA 3DZKA 1E5LA 1XNHA 2IDMA 1RLMA 2QV0A 3ZWPA 2QVCA 5EL0A 2C00A 4DSAA 3A1SA 1YK0A 4CR8A 4GOOD 3E7XA 1Z0UA 3HCRA 4F4DA 3CONA 2XZLA 2O3TA 3JYOA 1HK7A 4Q48A 1L7XA 2V7GA 1JHQA 5PGMA 5SY4A 3GFGA 4MYDA 3ZV6A 2ZUSA 1E3JA 5K0SA 3QBVA 4K9LA 3WJ7A 4BEJA 4JLOA 3BREA 2ANCA 5I8ZA 2HJWA 3H5IA 3IT2A 3W5CA 1E0DA 2XWBF 5C80A 1VMAA 3RIGA 2Y9MB 3HO8A 4J7XA 4RQTA 1WLSA 4KSCA 3VAAA 4LDZA 1B73A 1U3CA 2ZIFA 2UZ1A 3KD3A 2ZTSA 4QQKA 4UZFA 2J67A 2WKSA 4WLFA 5CLIA 5BYKA 5A05A 5FV7A 1UZUA 2ZJ4A 1EVZA 3JWEA 2QN1A 3L7OA 3HWX1 3LA8A 4N0DA 1TB4A 4FFRA 4Y1RA 3ESDA 4LF8B 1FFYA 1QFJA 1C8VB 2CB9A 2WZBA 4WY2A 1G7CA 3UUGA 3ZXXA 2ZUDA 1BXGB 3LNCA 1DXQA 1K4MA 4G41A 3RKSA 3VZCA 2JAXA 1SIBE 3OAAA 1PV4A 3NDRA 5I9TA 4EQ6B 3LCUA 1QIHA 4O1IA 3FCUB 1CUWA 1MDFA 1Y6ZA 5TEWA 3ZK7A 3BJRA 1U3FA 1XTJA 2XDYA 2YMMA 3ZTWA 4RDHA 4FQ8A 1C9NA 1PTJA 2IEGA 3BWVA 2JGLA 3AKCA 1TFUA 3KQOA 3K0BA 3Q7SA 5GGXA 2Q46A 2FK8A 3Q3GE 3GCZA 1HFKA 1IEQA 1SXJE 4LFBB 2Z2YA 4MS3A 5U4XA 2FWNA 3L18A 2B1GA 1PEKE 4OJNA 3S2FA 4K9DA 1ZAYA 1Y9AA 2I2FA 2JLSA 3F1KA 3Q4GA 2D0OB 5EWMA 3ZZNA 2WTXA 3C0KA 1I1HA 3DTVA 2W43A 3MFQA 2HHJA 3AHJA 3EXG1 2KBEA 1NW5A 2EZ8A 2WPDD 4OPMA 1O6BA 4LF7B 3WNQA 4MRAA 4DIBA 1ES9A 3ELWA 3N76A 1DCTA 2BEKA 3R7WB 1L4BA 1PQWA 1RI5A 2DWPA 3PQ8A 4N82A 4AO7A 5IHXA 1NV9A 1E2MA 1UDXA 3QJ5A 4LHVA 5BQ5A 3M2TA 4UUAA 3F0TA 5KYWB 2GYYA 2VYVA 1E3SA 3F6RA 3IEUA 1MX5A 2ZJ8A 3V97A 3Q2KA 5JXJA 1UJBA 1L4LA 3QTLA 3BOSA 4L85A 5LN1A 1SD1A 2O54A 2QX4A 3GO4A 4R8MA 3ZZMA 3QI7A 3A11A 2V9ZA 4U6QA 3RG8A 5BR1A 3DVAA 4HAOA 2P9GA 5I7SA 3DOIA 1EAMA 3PHCA 1OGYA 1Q92A 4H7DA 1XVLA 1XTQA 2YJ6A 3B12A 5ALUA 4RJ2A 1XLVA 1KA9H 1D07A 3MTEA 4LQ4A 2FOXA 1WETA 1UK7A 4IHJF 2PRZA 2YN2A 3DAYA 4NOLA 4PLTA 3EYAA 2QVXX 4DXAA 1NQ5A 4ASUA 4Z6KA 5KNCD 4Z0TA 2G3YA 2IQIA 4N7BA 5AW7A 1T9ZA 1W0KD 1ZJ4A 3HKCA 5I4CA 1Z6QA 2I71A 5CM2Z 2JGRA 4RD0A 1QYWA 2J9RA 3WL8A 1USIA 1ONPA 5AK6A 3NO4A 2V7WA 5HIJA 1FSZA 1YVUA 4RZUA 4DLRA 1LKZA 5T67A 1O