1UZAA

Crystallographic structure of a feruloyl esterase from aspergillus niger
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
259
structure length
259
Chain Sequence
STQGISEDLYNRLVEMATISQAAYADLCNIPSTIIKGEKIYNAQTDINGWILRDDTSKEIITVFRGTGSDTNLQLDTNYTLTPFDTLPQCNDCEVHGGYYIGWISVQDQVESLVKQQASQYPDYALTVTGHSLGASMAALTAAQLSATYDNVRLYTFGEPRSGNQAFASYMNDAFQVSSPETTQYFRVTHSNDGIPNLPPAEQGYAHGGVEYWSVDPYSAQNTFVCTGDEVQCCEAQGGQGVNDAHTTYFGMTSGACTW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a Feruloyl Esterase from Aspergillus Niger
pubmed doi rcsb
source organism Aspergillus niger
molecule tags Hydrolase
molecule keywords FERULOYL ESTERASE A
total genus 100
structure length 259
sequence length 259
chains with identical sequence B
ec nomenclature ec 3.1.1.73: Feruloyl esterase.
pdb deposition date 2004-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01764 Lipase_3 Lipase (class 3)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1uzaA00
3QH4A 3AJAA 5LKRA 1ODTC 4UHHA 1IZ7A 4F0JA 1E8MA 4GW3A 5YASA 3QBJA 3O4HA 4W1QA 3WIOA 5IVDA 3WWEA 4QDOA 5JD4A 4GBGA 2PKYX 1W6RA 5H3HA 1R9NA 2WLSA 5AP9A 3PF8A 4EY6A 3RLIA 1CPYA 3PF9A 5LYYA 4MWTA 1KU6A 2OCKA 1ZI9A 1QIKA 5AHXA 1DU4A 1EDBA 1GPLA 2NW6A 2CZQA 1N5RA 1C7JA 1L7RA 1MN6A 1LZLA 1ACJA 5BOVA 1QIJA 4OUKX 1R88A 3FLAA 4LYDA 2J3QA 3R3UA 4DNPA 4OD0A 1UK8A 1U65A 4W1SA 2WIFA 2GYVA 2RIPA 5IVIA 3FYUA 4AB1A 4ITVA 4BRZA 2XMGA 1XZIA 2XQGA 2ZVDA 4C01A 2WSLA 3CCBA 5ALRA 1JMYA 2GBIA 5FUMA 5KREA 3WKDA 1R1DA 3WI7A 4J0HA 2RONA 3PICA 1UOQA 1UFOA 5DTIA 2GZRA 2VAXA 4LKOA 3M83A 3EQ7A 4FLFA 3R3XA 4G9EA 2DFPA 4G4GA 1WB6A 1U8EA 2VAVA 2D5LA 4TGLA 1IUNA 4WY5A 4U2FA 2WJ4A 1UZAA 4UHCA 5ALYA 4PF1A 1AC5A 1OILA 4BCDA 4XJVA 4FHZA 1N5MA 1G5FA 2OGTA 2PUHA 3C8HA 4DYHA 4X97A 4X71A 1UKCA 4FLEA 1QTRA 3WZLA 3H2GA 2Q0XA 3LCRA 2J3DA 2G5PA 3AFIA 1GKKA 4TVKA 4G8DA 4N8SA 1ZD4A 4GI1A 4X94A 5JATA 1H2YA 1MO2A 3EQ8A 3NGMA 2Z3ZA 4C4XA 1CUGA 5K3DA 3C5VA 4Y2QA 3G0GA 4BAUA 2JBWA 1K6EA 3VISA 5CT9A 3ESDA 2QKYA 1CLEA 4HZGA 1QIDA 2QS9A 4OB6A 1AKNA 5ALXA 1LPBB 4AXBA 4QEKA 5T4BA 1ODSA 3A2MA 3WZMA 5CH3A 1GZ7A 1YSCA 4Y2JA 2RGUA 5HQ3B 3WK7A 4BVJA 4PV7A 3T52A 3C8DA 2Z8ZA 3ICVA 4Q3LA 1E8NA 4DNFA 3GZJA 3GBSA 5BV7A 5F4ZA 2O2IA 3B12A 1EK1A 4KE7A 1J06A 1XLVA 3WL5A 3AZQA 5ALNA 4H77A 1ORWA 4KE9A 5BWCA 2HA4A 3VDXA 4BRSA 3M82A 3UUFA 5FDFA 4OB8A 3WKEA 1E5TA 2OGSA 2QT9A 4W63A 2G5TA 4BZWA 4X91A 1R4ZA 2GBFA 5D6OA 5LLSA 2OGZA 3L1JA 4Y2RA 4E15A 4UBOA 5EHQA 3FYUC 4IHAA 4OYLA 4G4JA 5EIHA 4Z49A 4C87A 2XUOA 1LPSA 1XRPA 5LKAA 3N2ZB 5CTAA 5ALEA 1XZLA 3FYTA 3I1IA 3OC0A 4B9AA 2JEZA 2WUGA 2XUKA 2WJ3A 4BDSA 1VE7A 1BCSA 4BP9A 4GHWA 1UOOA 2VJDA 3H2HA 5CXUA 4U2EA 1XKLA 3AILA 4Y2YA 3EIOA 1XFDA 4X95A 3VJLA 2C0QA 1LBTA 1G66A 3TJMA 1Y37A 4C6HA 1H23A 2FUKA 3R41A 2QZPA 3ILSA 5ALLA 1AUOA 1H22A 3DYIA 1USWA 1XQXA 3D59A 3LS2A 3DS8A 2WIDA 3FCYA 3WYDA 4QDZA 1UK7A 3SX4A 3H1BA 1P0MA 5JALA 4S0XA 4CG3A 3E3AA 4OU4A 1GQRA 2UZ0A 1O6FA 2VSQA 5I9IA 1THGA 1K4YA 5EIAA 2VT6A 5ALSA 1QFSA 2XI4A 4PNZA 4H7JA 2CEKA 2O2GA 3DQZA 1EVQA 2RHTA 4MJ3A 1P0PA 4X85A 4A16A 5T4HA 5LZ2A 3G0IA 3STUA 3QITA 3B3QA 4MQLA 4P92A 3I2FA 3F98A 1VLQA 1LPPA 2PVSA 4QZVA 3WQHA 3A2LA 4HS9A 1C7IA 3DNMA 3IIIA 4XWGA 5IKXA 2ACEA 2H7XA 4JYPA 3O4GA 3HSSA 5K3FB 3N0TA 4F5ZA 1G42A 4BYMA 1TRHA 3BIWA 3KWFA 5KBYA 4M0MA 1MAAA 5AH0A 4KE8A 2H1IA 2ORYA 5ALGA 1QIFA 1X2BA 2RHWA 1QO9A 3F67A 4MEAA 5CH5A 1CUCA 2VF2A 3B5EA 5AM5A 1F0NA 1MAHA 4ETWA 3C6BA 1CUBA 1BROA 2JGEA 4B85A 5DYTA 2FX5A 2AJ8A 1CR6A 4K6HA 1Q83A 1THTA 2QM0A 5AM3A 1VXRA 3WYNA 2HA3A 1EB9A 3A2NA 1CUDA 5ALZA 5ALPA 4LIPD 1ZI8A 1CUUA 1Q84A 3R3YA 1UT6A 3STXA 3U1TA 4FTWA 4BDTA 3RARA 1WB5A 2XLCA 5AK3A 2V98A 1XLWA 4K2AA 4FKBA 4DMCA 4DNOA 1EDDA 1RYYA 1LGYA 1SFRA 3DJYA 2HADA 1AURA 4FDMA 4JYMA 1XQVA 3QMWA 4ARAA 2PSEA 3FNBA 4HVTA 2VEOA 5EHZA 2XMBA 4LXHA 4AMZA 2J4CA 2I78A 4UBMA 1P0IA 4B6GA 2OG1A 4H7HA 3TEJA 3ZPXA 2HU5A 4BP8A 4YASA 2R11A 3VVLA 2XUJA 4CCYA 3ESAA 1AQLA 5CURA 1DQZA 4LYEA 1XZFA 4AZ3A 2PU5A 4B82A 3BDVA 1UKAA 3ANTA 2WM2A 5LIPA 5EGNA 4FLMA 3I2GA 1BU8A 3VXKA 4HXFB 4H7EA 2VATA 1H2WA 1VZ2A 4B0PA 2HU7A 1ORVA 3FVTA 2QR5A 2X5XA 5FPQA 3CXUA 4B80A 5KWIA 5HKAA 5HFAA 1A8UA 2XUDA 2DHEA 2J4FA 4KAJA 1MNQA 1QFMA 1AGYA 2ECFA 3FOBA 2BCEA 2ZYRA 5JIBA 4YX9A 2HFJA 1NU8A 3G9UA 3H17A 5AM4A 3F97A 2JGJA 1QIMA 3WK9A 1YR2A 1BN7A 2QJRA 2XUHA 4BE9A 5I8PA 2QUAA 5ALTA 1CRLA 5ALOA 4PW0A 4AX4A 2Z8XA 1PFQA 3QM1A 3CN7A 3HZOA 4X93A 3QYJA 4OU5A 1HQDA 3V1NA 3P2MA 2HFKA 4CI9A 2CKMA 5AI6A 4E11A 1X2EA 1W75A 2XQKA 2BAGA 3C43A 1N1MA 5IH7A 4W9RA 1HDEA 4LXGA 5FLKA 4HRYA 3WMRA 4HXEB 5AKEA 5C8ZA 1LPAB 1FFEA 1XKTA 4U2GA 3WJ2A 1XZAA 3VVMA 4DTCA 3L1HA 5SYMA 3KOOA 3H2IA 3FLBA 1ZIYA 3D2CA 4KR0A 3K6KA 3WA6A 1XRNA 5FP0A 5FV4A 4UHFA 3HJUA 5AM2A 1VKHA 2WIJA 1TAHA 1FFAA 4UBNA 4WCVA 3I1YA 3O95A 2I3ZA 4B7ZA 3AIMA 4BAZA 3DDUA 1ZGBA 2WTNA 4MQMA 2B9VA 1GPKA 2ZYSA 3BJRA 1CUJA 3BF7A 1SCQA 4CIBA 5EHNA 2V96A 3IVMA 2GYWA 4BTVA 3EQ9A 4H35A 5JAOA 3S8YA 3IBTA 4L3WA 1JJBA 2YYSA 4QDUA 2JIDA 2XUFA 4Q34A 4X6UA 2PBLA 1PJAA 2WQZA 2GBCA 4C88A 1DWQA 1EXWA 4J7AA 4EBBA 2EDCA 1XZJA 2G63A 4QA9A 3FBWA 4H7FA 3STYA 5CXXA 3W05A 1CFJA 1CUAA 4PSCA 1A88A 5AICA 5C81A 2PM8A 3DYVA 1EB8A 1ODCA 5DYWA 2XUPA 5AKKA 1QZ3A 4J0KA 4F60A 3H2KA 2XE4A 3WLAA 1J1IA 3BF8A 5ALJA 2Y6VA 1XZEA 2JGLA 1ZD5A 3W9BA 2BUBA 4BTLA 1FFBA 3OPMA 1YASA 2XUIA 1HKHA 2WJ6A 2CB9A 4LXIA 1SC9A 3WWOA 1YB7A 2HA5A 5HF5A 1QONA 3KD2A 1QLWA 1K8QA 5EHXA 4UBJA 3PFCA 5FKJA 3WL8A 1YB6A 2OCGA 1JJFA 4ZI5A 3R40A 1EA5A 5HCUA 4B84A 3IULA 4J3JA 3WK5A 5AKYA 3DKRA 3QPDA 3L1IA 1YAHA 4X7BA 1LPOA 1LZKA 1UWCA 2WHPA 3C6YA 5HK8A 4G8CA 4J03A 5CMLA 4MYDA 1YS1X 3G9ZA 2HHAA 2RAUA 4NZZA 4ZWNA 5K3EA 5AKZA 3AINA 5HZGA 4EY4A 1CVLA 4N8DA 2DR0A 2LIPA 3SC2A 3D3NA 4DMHA 2FJPA 3C6ZA 3R3VA 2WIKA 5C7YA 1TCBA 1MNAA 5AKHA 1XQYA 2IX9A 5E4JA 4NMWA 1MPXA 2HA2A 3MVEA 5CH8A 3GFFA 4AN1A 1KEZA 2BJHA 1DX4A 1ZOIA 3C6XA 1RWQA 3KXPA 3PFBA 4B81A 1ZIXA 4IH4A 5LZ9A 3HEAA 3R0VA 2QTBA 4FNGA 1YAJA 4XIIA 5AJHA 3LP5A 2O2HA 3WK6A 1W1IA 3VKFA 3WKAA 3K2IA 1DT3A 2QRUA 5AI0A 1TK3A 3ICWA 1XQWA 4QLOA 1JU4A 2XT0A 5FRDA 2O7VA 2WU4A 1WHSA 2ZYHA 4WY8A 4BBZA 1VE6A 4JH0A 1W76A 5T4FA 4DLNA 3V1MA 1A8QA 2H7YA 4K6KA 2JGIA 1UK6A 4JNCA 1XZHA 2PSJA 5E4TA 2ZSIA 3WA7A 3D2AA 3JW8A 3ZLUA 1GXSA 1U2EA 1FFDA 4AQDA 1WHTA 1MTZA 5AKJA 3VJMA 2Y1KA 3IURA 4J0IA 5JZBA 4BC0A 2AJLI 4QWWA 5CT6A 3K9BA 4UUQA 4OSEA 4Q3OA 3W9UA 1KU0A 2FJ0A 4YPVA 4BC1A 4UFNA 2XMCA 3ZV7A 1XZBA 4ZGBA 4MWSA 1DWPA 2WIGA 5K3AA 1CUIA 3D2BA 5LP1A 4CCYB 3WK8A 4BVKA 3PDCA 2CJPA 5ALQA 1JMKC 2OAEA 5DNVA 3RK4A 4J0DA 4AN0A 4G9GA 1XROA 1XZCA 5K3BA 4E46A 4OPMA 1E8DA 3Q0TA 5DYYA 4N5IX 1DQYA 2OQIA 4FMPA 2Y2VA 2D0DA 1BE0A 2ZJFA 4QDXA 5AK6A 1SCIA 4A5SA 4BCBA 4F21A 4Y2TA 2HU8A 5A62A 4EUSA 3QPCA 2XQFA 2ZJ6A 3FLEA 4Y2VA 3NUZA 1Z68A 4I19A 3FCXA 1MX1A 2BGRA 2C58A 5LZ7A 1R3DA 2XMZA 4IO0A 2DQYA 2OCIA 2Z3WA 3U0VA 4DM7A 2B4KA 1E66A 1EINA 5CW2A 5C8VA 4K5QA 4IQ4A 2I3DA 4KAAA 1CUYA 4I3FA 1DX6A 5AI4A 4HTAA 3I2KA 4EB0A 2V9ZA 4QLAA 4RE5A 1ZI6A 3STWA 1Q0ZA 1EHYA 5A7FA 3ZI7A 5JZ9A 3E4DA 2EDAA 1LNSA 2WG1A 3MUOA 5AKLA 4GECA 4OB7A 5FOQA 1ZD3A 1CUEA 1SCKA 1TQHA 3R3ZA 5ALWA 1A8SA 3KDAA 4CFSA 5EFZA 5AI8A 3JWEA 2DQZA 4B9EA 1XRLA 7YASA 3BDIA 5I7UA 2PPLA 2VA9A 1EK2A 3ANSA 4G5XA 3V9AA 1BEZA 5JARA 4BVLA 1QIGA 4AZ0A 2GZSA 1BN6A 2P8SA 3O9VA 2BFNA 3CN9A 5KWJA 5DJ5A 3C87A 4FBMA 3BJMA 5CT8A 1GGVA 4UHEA 1R50A 5FXMA 1VA5A 3HACA 5HFNA 1XRRA 1FSSA 2PSDA 3HI4A 4XX1A 1QO7A 1BRTA 1EVEA 4WDQA 2Y2UA 2PU7A 1GQSA 3AZPA 4AO7A 4QNNA 3HXKA 3GROA 3UUEA 4EY8A 2V97A 5AI9A 2CMFA 5JASA 3W2TA 2JF0A 4PSUA 2YXPX 1H2XA 4Y2XA 3SWWA 2GYUA 3FWHA 2HA6A 3BE8A 3WL6A 2AJBA 1UOPA 5K3CA 1O6GA 2XMRA 4HRXA 4DSZA 1ETHA 2ONCA 3HYSA 3VJKA 2WFLB 2XUQA 3QMVA 1VXOA 4GLBA 2QUBA 1EX9A 4ZV7A 2WUEA 1JI3A 3FAKA 1C4XA 5AM0A 1XLUA 4P9NA 1J2EA 4EZIA 4Q82A 5DNUA 4KRYA 1ZICA 4C89A 5DLPA 3V1LA 4P93A 3DL7A 5JAPA 3G9XA 5ESRA 3NOXA 4HAIA 3IUMA 1HL7A 1CUZA 2WHRA 1UKBA 2OXEA 3RKSA 2IITA 4PQEA 4W1RA 5AIBA 5JD5A 2ZSHA 1K63A 3ZLVA 3BIXA 3D4LA 2BKLA 3I2IA 2OLEA 1UXOA 4W1PA 1ISPA 3MGAA 3ZWQA 1QIHA 4L9AA 2WU3A 3GELA 1MT3A 1F6WA 5HKBA 3W04A 1E89A 1CUHA 1W4LA 1RP1A 4Y2SA 4J0JA 1WM1A 1A7UA 3HRHA 3DCNA 3I6MA 4JUIA 4O08A 1XRMA 1WPRA 2WILA 1TCCA 2ZJ7A 1B41A 3BWXA 2VJCA 2E3JA 2WUFA 1UK9A 4PSDA 1M33A 5BWBA 4CIAA 3QZUA 4G4IA 4BZZA 2DHCA 2PSFA 2VJBA 1GPNA 4FFVA 4RE6A 2EEPA 5K3FA 4AO8A 2H7CA 4L0CA 4UBKA 4WFJA 2QMQA 4DMFA 4X6YA 1ZJ5A 4NVRA 2HRRA 2XMDA 1L7QA 3FYUB 2WUDA 4JEIA 2BGNA 3ESBA 1L7AA 4BE4A 1SOMA 3I6YA 2DHDA 4E14A 5C8XA 2WHPB 1AZWA 3AIKA 3UMJA 1IMJA 3BXPA 3WL7A 4BATA 3LIIA 3IA2A 1K5PA 2C7BA 1QIIA 4KYVA 3WKBA 4FBLA 1VA4A 4GDMA 2OQVA 3D5EA 5ALMA 3DKKA 2PL5A 4J0CA 4J0GA 4HXGA 4BCCA 1EH5A 3F8SA 3M81A 2QXTA 1ZJ4A 4IH1A 1MX9A 1HBJA 1GT6A 1CUFA 4UFOA 1F0PA 3WKCA 3OG9A 4UFPA 3DOIA 1P0QA 5CBKA 2H9YA 1VOTA 5LZ4A 1NX9A 2RI6A 4FWBA 4Y9SA 4EY5A 3I2JA 4C4ZA 4OYYA 4U2CA 2AXEA 1Q0RA 5LZ5A 4EY7A 1YCDA 4DIUA 5AM1A 2BUCA 2B20A 5JANA 5D3KA 4UPDA 1LLFA 2WFZA 2DCMA 5FPPA 5D3ZA 4ZV9A 1X70A 4FOLA 3HLKA 1CUVA 2QXUA 3X3HA 1XZKA 3O0DA 4DGQA 2HIHA 1IUPA 4FFWA 4KJXA 2HA7A 2GBGA 1CEXA 2XMQA 3AZOA 3PE6A 4DSAA 3D0KA 5ALIA 5DNWA 1FFCA 3OM8A 4QWMA 3TGLA 3V48A 1YA4A 4U2DA 1JKMA 3M3DA 1Y7HA 3R3WA 4Q3KA 4UBIA 4H7KA 5JD6A 2HL6A 3RM3A 1S8OA 3H19A 3O4JA 4X92A 3H04A 4UHDA 1ZGCA 5CRIA 1AX9A 4X6XA 1T4MA 4Y2UA 4H7DA 2QOEA 1WB4A 3IUJA 2CUTA 1N8SA 3IB3A 4LHEA 5ALFA 3G9TA 2AJDA 5ALVA 2QJWA 4TPKA 2WHQA 2Y6UA 5CT5A 3KWJA 5HF6A 3DEAA 1NU6A 4N8EA 1CUWA 3PI6A 2AJCA 1YA8A 4FNMA 3I28A 1QGED 1IUOA 3W06A 3V1KA 5HQ3A 4CG2A 3DOHA 2PX6A 1EI9A 2OAGA 3DL4A 1G4HA 1H2ZA 5AK4A 2ES4A 5DTJA 2OPHA 4GXNA 4H7IA 1CUXA 3D7RA 3OURA 3IUQA 5AOBA 1XZDA 4PO3X 5AIAA 5A6VA 4A23A 3ED1A 3S2ZA 1LPNA 5T4EA 2X8BA 3SK0A 1QTIA 1DINA 4XVCA 1BS9A 4UHBA 3PUIA 3LLCA 1QIEA 1QOZA 3EF3A 4DMKA 2HA0A 3EBLA 4C4YA 2BUAA 2XMSA 1J07A 2ROQA 4NS4A 4AMYA 1JU3A 1DWOA 4WDRA 4ZRDA 1HLGA 3AUKA 3F96A 2Z5GA 1MU0A 4MXDA 5DWDA 2WKWA 4ZREA 3QMMA 2XB6A 4K6GA 4ARBA 5HK9A 3YASA 1TCAA 1IZ8A 3JYHA 5ALDA 4AO6A 1WCYA 6YASA 5ALKA 4B0OA 4L72A 2G4LA 3FSGD 4WFIA 2JEYA 1CUSA 5JZSA 4YK7A 4RNCA 4N5HX 3ESCA 4D9JA 1LBSA 5D7BA 4I4CA 4KEAA 3WWCA 1HPLA 3TRDA 1WOMA 3C45A 1CIJA 3O9MA 2O7RA 4Q1VA 4X90A 4ROTA 1XRQA 2B61A 3H2JA 1XZGA 3C5WP 5AO9A 1JT2A 2QVBA 4IH9A 4GEGA 1QJ4A 5JYCA 1B6GA 3IDAA 5AOAA 3G02A 3WIBA 2JGKA 3NWOA 5AKXA 2W22A 4H18A 2CBGA 4EA6A 3O4IA 1T2NA 3HABA 1YS2X 1R9MA 2XDWA 1U4NA 2WG0A 5SYNA 1D07A 1QE3A 1VJ5A 1ACLA 4DNQA 1VZ3A 5ISMA 3WK4A 3HC7A 5AOCA 2C0PA 4CCWA 4M0EA 4QDTA 2HDWA 4QE3A 2W6CX 2R8BA 1OXMA 4MEBA 3LIPA 1E3QA 2PUJA 4Q05A 5IVHA 3F9CA 2YH2A 4M0FA 5JAHA 3BL8A 1W52X 3I2HA 5JAUA 2I03A 5ALHA 4WJLA 5AKGA 2ACKA 2ZYIA 4KAFA 2XQIA 3QPAA 4V2IA 1WPXA 3E0XA 1AMNA 3STTA 2WFLA 3GA7A 3T4UA 5A7HA 5ALUA 4H0CA 1ZD2P 1EDEA 2WTMA 1JJIA 4KE6A 4GWLA 4UBLA 3KSRA 2WG2A 3WWDA 2HRQA 3FVRA 2VT7A 5A71A 4BB0A 1DTEA 1CQZA 4P08A 1FJ2A 3G0BA 3WJ1A 3OTQA 1IVYA 5AKIA 2C5FA 1MX5A 5CT4A 2IIVA 1PV1A 4U2BA 1I6WA 2K2QB 2C4HA 5EI5A 4X3CA 2JGMA 1CV2A 2XQJA 3C70A 3PUHA 3E1GA 5A2GA 3MUNA 5K5EA 4ZXFA 1OCEA 3G7NA 5AK5A 2DSNA 1XZMA 5JADA 5J3JA 4KRXA 2VQ6A 3WWPA 5IVKA 3G8YA 3FSGA 3QVMA 3GUUA 3IUNA 4INZA 3H1AA 5A7GA 3STVA 2XUAA 3Q8WA 2XLBA 3G0CA 4B83A 2JGFA 1LPMA 4EHBA 1GKLA 1TIBA 2VTVA 4WFKA 4RPCA 1BEEA 2C5GA 3G0DA 5LZ8A 4G1FA 3I6ZA 5HF9A 3AIOA 5E2IA 2OCLA 1Y7IA 1DT5A 1CQWA 3DD5A 1BCRA 1JFRA 5E4YA 4Y7DA 2X76A 4X00A 4Y2PA 3DLTA 3CCCA 3ZLTA 3OOSA 1F8UA 4MYSA 4KACA 3A6ZA 1TKRA 3H0CA 5EIEA 2VJAA 5AI5A 4BAGA 3A70A 2XUGA 2PSHA 2YASA 3H18A 5HF8A 1MJ5A 4CG1A 4RGYA 4G8BA 4OCZA 2HM7A 2WFMA
chains in the Genus database with same CATH superfamily
13PKA 3HL0A 2GCIA 2ASVA 1AKTA 5A04A 3O8OB 4GMDA 4X3PA 5M7EA 1E2JA 3LL4A 4D26A 1EXVA 1NW8A 1MVOA 1LS1A 2JI9A 9MHTA 4FILA 3GRFA 1OV4A 2ZYVX 2IS6A 4MIYA 4W1QA 3O4HA 3VM6A 1X15A 2VPIA 3HVJA 1K98A 1XTKA 1MXHA 3EAFA 5HKLA 1JYFA 3F1KA 2ZI5A 3SOPA 4PGGA 5K9ZA 1AB5A 1KQFA 1BDMA 3CYFA 2KYRA 4OK5A 5H3HA 4AP9A 5IAEA 1R9NA 1J2UA 2GZ3A 3L7BA 4TMFA 3TIIA 1UJMA 4B79A 3ROKA 1IH8A 3MMXA 2A5LA 1NHGA 1Z07A 2D06A 4KBFA 4QHTA 5SZKB 3KOMA 2HSZA 2ZUBA 3QVSA 5JG7A 3RRBA 3S2YA 1M1UA 2C3OA 5GPBA 1B4DA 1RVV1 4PSAA 5AHWA 1QS0A 3NYQA 1A0OA 4P2GA 1Z0UA 3EVNA 2NSDA 5G4LA 5I9LA 3VJRA 1DU4A 2CLHB 1KYTA 2C1ZA 3UMFA 3ZXUB 5LBIA 1ITZA 2IZ6A 4P4UA 1ADFA 2O8FA 1UKZA 4XQGA 4AF6A 4CRWB 1J42A 1Q91A 4NENA 1YJAA 2OHVA 1I7LA 3FNIA 3H0KA 2WQ7A 2GJKA 1LZLA 4KQHA 1ZK4A 3NH9A 1QIJA 3ZWXA 9GPBA 3MUEA 1FDTA 1AGNA 4JLOA 3E5HA 1R88A 4OUKX 4DLLA 4LYDA 4LOJA 1P39A 4NV3A 4GI3A 1YZGA 3NPAA 3UPDA 3WYFA 2W4IA 3KFLA 1YI1A 2D54A 4WXHA 1VHLA 4F1JA 4YRAA 5B58C 5JSFA 4R8RA 4JI7B 1XAIA 1L4NA 2ACWA 3L06A 4DLSA 2HRZA 2QEQA 1D09A 2XZOA 1UK8A 5BUSA 2ZM5A 4RPLA 1WBDA 3B6KA 4WASA 2EGGA 4W1SA 5KSOA 2M6RA 2WIFA 3MS2A 2BC9A 2UZIR 2DBZA 3BMQB 2W6PA 3FYUA 3G49A 3FM9A 1F8GA 1PL7A 3MWDB 5EJAA 2JD1A 3GLIE 4EVRA 3A9CA 4QOEA 5GZ3A 3CWQA 2WSLA 2FVXA 2BEUB 3OZAA 1T13A 3L07A 2FPGA 3QA9A 3CCBA 4JVLA 2AC7A 5ICFA 4D4MA 1CF9A 5ALRA 2GBIA 4CIYA 1ZU4A 3SBXA 3KOYA 1R1DA 1VJ0A 1VL1A 5KREA 3IDSA 1SOWA 2REOA 2IXGA 1I4EB 4YONB 1BXGA 5FOSA 4MWBA 4F97A 4ZCTA 1N5JA 1MMFB 1T5IA 4DDKA 1VTKA 4IP0A 3ZNQA 5KNCD 3HY6A 1PNRA 1NXPA 2UU9B 3IPXA 4UNSA 5ENDA 3DEIA 3H5AA 4UZEA 3TS1A 4NULA 3T1OA 4LKOA 1W19A 5DBOA 4FLFA 4C08A 3R3XA 1OZFA 2BEWA 4FP9A 1Y3FE 4LJ9A 1I80A 4UAUA 3U17A 3EMDA 3D8NA 3D81A 3LE8A 4ZZ0A 3Q0EA 2E1RA 4TGLA 1WVMA 4K9KA 1X8JA 4U2FA 1T2EA 5JNUA 2A5YB 2X5KO 3FCAA 3EGIA 2P4EA 1DC3A 1ODFA 5L3ZA 1S0UA 2FW6A 4JASB 5IHPA 4CLXA 4ZAYA 4MZDA 4E21A 1KHHA 4GDFA 4AK9A 2F6RA 3AETB 1TUIA 1SRRA 1WUKS 2JVJA 4PF1A 3TLGA 3WB9A 1HDYA 1OILA 3F1LA 4DHWA 5LQUA 3JV7A 1EM6A 3C8HA 1G5FA 2OGTA 2ZTUA 3CWZA 4X97A 3FFWA 4KI0A 4E4TA 2DFDA 3U7GA 3WZLA 4IWNA 2ZI3A 4RD6A 1NQAO 1A9XA 1EFHA 2P6MA 2PS9A 1ZWLA 3KEGA 3BXHA 3TQIA 4ALLA 1SOAA 2Q0XA 4N3BA 4PS0A 5LBTA 1PQ4A 2J3DA 1UUFA 3DFFA 3E5RA 3NIDB 4IYRA 4RY0A 1TCVA 4G0MA 3QUAA 1AOXA 1QYVA 4UE3S 3AFIA 1QRRA 3D0QA 2XOKD 4JYZA 3OTOB 2ZJ5A 1K89A 4M6WA 4X7MA 2AVDA 4GWGA 4G8DA 1TU0A 4Q9DA 1WCWA 3DWGA 3IMKA 4FYHA 4P8RA 1YVRA 2GDJA 2NNWB 3IPCA 1YQUA 1JIUA 4LRQA 3AVTA 5HRAA 2RHJA 3PNVA 4G5FA 1WVIA 2A1IA 2IYQA 4PS1A 3RYCA 1U0BB 1BDJA 3B7GA 1CUGA 3DFKA 3OQNA 3JSXA 3DL0A 4RY9A 4BXOA 1AY0A 2QTWB 3AR5A 3G0GA 4IEFB 4Y2QA 2JBWA 2I2AA 2AC2A 3SJAA 3ROGA 4BAUA 4A8HA 1LRLA 2B8TA 1OXVA 3PEEA 2ODNA 3EFBA 4IDEA 1SQ0A 1NVGA 3EOAI 1II8B 1E1RA 1GGNA 1R5JA 1Z0ZA 2QKYA 3CGGA 3I9MA 3Q6MA 4JOBA 3C8ZA 3ZE9A 3U7HB 3GCZA 2ZB4A 1ZNZA 4ZO6A 2F00A 3WLRA 4UVGA 3JAWB 2AG6A 1PUXA 3MG9A 4LK2A 4OKIA 3E70C 1WQ3A 3ISTA 3A28A 4MGZR 2VCYA 3R7NA 3KFVA 4TSKA 3AFHA 4HVLA 2V59A 3ZI4A 3LY7A 4IIFA 5KJEA 3S81A 3ZVRA 2EEZA 3IJ5A 4PPYA 4FFMA 1ZCZA 3HJBA 4D9CA 1ODSA 2RKBA 4PBRA 2XZDA 3KTFA 2Q1TA 2ZRFA 3PB3A 3NDJA 1QR2A 4EHDA 5JCOC 2P6UA 1PEAA 1YSCA 3V55A 1TQ2A 3GD5A 4D8TA 3IILA 1H4VB 4Y2JA 1HE1C 2RGUA 5HMLA 1L7MA 4BV8A 4W5JA 3RVQA 4D3YA 2OBLA 3Q8MA 4LI0A 3O8NA 1E63A 3ND9A 3PPWA 4NH4A 5FA6A 4ES6A 3ICVA 2HXGA 4KKVA 1JAYA 3QLUC 1KVUA 1O9HA 2GOYA 1PV2A 3TBFA 4KO3S 4WW0A 5IYZB 4C2BA 2GK7A 3EMBA 3NDPA 2BTEA 2HBZA 2I62A 4HD8A 3E9ZA 3GZJA 3HGQA 3GBSA 3OT5A 5CNJA 2NU7A 4QU8A 2PRZA 2XR1A 1UMCB 4JXJA 1AKVA 4U1RA 3N6XA 1RRPA 3EJ6A 3N8GA 3U7FB 3AOEC 3PHGA 1J06A 1E61A 1G0OA 1R4NB 1OAOA 2R00C 2IKSA 3BWDD 4P3NA 5CVEA 5IJXA 1SURA 3IP6A 3BHJA 4LJ5A 1GPMA 2E9SA 1IHPA 1DEAA 4LOIA 1X19A 1QH1A 3KLNA 2UYGA 5EVCA 5ALNA 1RQ2A 1U04A 3AVOA 4DV0B 3H4MA 2FMIA 1JVBA 3LUFA 1FVHA 3LTNC 3EEYA 4LJRA 3HDGA 1EXDA 1YDFA 3QQPA 2HA4A 3NTOA 4PHFA 1F12A 2JLBA 3EMKA 5H5JA 5GONB 4OYRA 3ZV5A 1D4OA 5IK2A 5HRCA 5DX8A 5JJKA 1P5JA 3P9ZA 5E1DA 3FNEA 1KF0A 4KDRA 5G0TA 1GRNA 5FDFA 3SYKA 5IWCA 4JT8A 1L9KA 2OP1A 2IUEA 3THXA 2BGGA 3V1TC 2VZ0A 2YS7A 3F8WA 4CCSA 4ZHQA 1JEEA 4M6WB 2JHPA 4M8SA 4Q4HB 4ZVVA 3RI3A 2HJSA 2QT9A 4IRMA 4TTIA 3G79A 3HDTA 5FPHA 1PK9A 1TZ2A 4HQKA 3AKZA 1FMFA 2G5TA 3KYBA 2GBFA 1JR2A 1R4ZA 2ID8A 2Z08A 2GUWA 4HNSA 4LOAA 1A9TA 1KZ4A 1M83A 5LQDA 3HCWA 4K9LA 5TEWA 3LZ6A 4BO2A 5IXJA 5KVAA 4C20A 1PW7A 1R5NA 4Y2RA 1GTG1 5CVTA 5B57C 4KR2A 1U5CA 4AY2A 1T10A 3SQWA 4QO8A 2J6IA 3FDZA 5JS8A 3FYUC 4IHAA 3HL4A 4GSLA 4Z1MD 4G4JA 1QHHA 1N2HA 4EITA 3I5XA 3GMIA 2HD4A 2XUOA 3AUSA 2CDAA 2DHRA 1ABEA 1PR3A 2BFEB 3M1LA 4B1FA 1BMFD 5JQGA 1GTSA 5LKAA 4G1EB 4YMLA 3N2ZB 1GCUA 3ISVA 4JUDX 3CRW1 3MF4A 1KDPA 1YQWA 2PRKA 1DCTA 3FYTA 4FWIB 4M9QA 1Q0QA 2GRUA 5TPWA 2RH5A 2X0RA 3FF1A 3NYIA 3GLGE 1JEYA 1TTQB 2UVPB 1NVAA 4E03A 1EFAA 2JEZA 2XUKA 3THOA 1TM1E 2WJ3A 3CRMA 5KPDA 1CERA 1NR5A 3G88A 4BP9A 4P0QB 5FX2A 3PQFA 2VJDA 4NV0A 2R2GA 2W8BA 3AILA 4JLKA 5DM4A 2B4TO 3ZCSA 4F56A 4HN4B 4DC1A 3UN1A 1XXHA 2PL3A 3DF9A 3DONA 2G6TA 3VJLA 1THZA 2OECA 3JQ6A 2IELA 3KELA 3DZJA 4ZCSA 1VIAA 2W2LA 4UEWA 5K0TA 1Z35A 2NZWA 4AXXA 2R48A 2PBZA 4GRAA 3GPLA 3H3XA 3NBYC 4BNUA 4CVNA 5ED4A 4PVDA 1R5OA 1N9KA 4FHGA 3Q8XB 1JVSA 4I1YA 2L82A 3AQIA 5FA5A 1Y37A 3B9QA 5H4HA 3WY9A 3C16C 4C6HA 4BEWA 4QT4A 2WQ6A 3CE6A 1OI4A 3ZDAA 2XMPA 2P2CA 3TZ6A 2OV8A 2QZPA 2YMLA 4I55F 5I4KA 3ESXA 2XXJA 3SYRA 2ZR9A 3RT1A 2FB9A 4KPYA 2GN8A 5K0ZA 1Z38A 3BWVA 1FS4A 2F9FA 3OMWA 4K81B 4F5EA 2C95A 1HNZB 2CHUA 3W5BA 4H60A 3P9NA 1NNLA 2WYUA 4ZYZA 3DLCA 3PL5A 1ORIA 2NN3C 2WINI 5EG5A 1Q74A 4KNYA 4MUAA 3ZWAA 1Q0UA 3JATA 3CHYA 1W96A 3DS8A 3OQIB 1JV2B 4QBFA 1OIWA 1GQQA 3FCYA 3A1CA 1TI7A 1YCFA 4C06A 4CTOA 4DJJA 5DLEA 2FX2A 3H1BA 4IF6A 4ABYA 4G3XA 3EE6A 5JALA 2VHYA 3IOCA 4ZALA 1GZVA 2NVUA 3L8MA 1R66A 5BY2A 3UHAA 2DT8A 4QXQA 3AI3A 3A3NA 1POWA 2O8DA 3LP8A 5H81A 3RTCA 1UAYA 1QQTA 2ZYDA 3L7AA 3PKZA 4JJIA 5T57A 3KVRA 4RKRA 3AEYA 2C4WA 4JDPA 5EIAA 1P18A 4Q4JA 1NSFA 5HW0A 3EXIA 5C46F 3DFIA 1O57A 1OA0A 3FUCA 3K31A 1SHKA 5DTRA 3KOXA 3MJRA 4PNZA 5D6OA 1RHJA 4B76A 2O8BB 4H7JA 4GL4A 2AMYA 3N0XA 2AFHA 4MHSA 4D4LA 4QPNA 4GMFA 3PUKA 5KQPA 1A96A 1GCAA 3P45A 2WK1A 1U02A 3LYLA 4EZBA 3E61A 1Y8QB 3KJGA 3SP1A 1E79D 2IGBA 4CFYA 1G3UA 3FOFC 2RARA 1M2JA 1XWWA 2JCSA 1BX1A 2DFNA 3COWA 3OKFA 4A16A 3LHSA 2P65A 3P27A 1U8XX 2BOVA 3I8OA 3G0IA 4BTLA 4TMWA 4JKIA 1H5QA 1YQEA 4HZUB 2GTHA 4J7CA 1NZFA 3QITA 4II7A 4QAJA 3TGWA 4BKOA 4CKBB 4ZGGA 1BMDA 1Q11A 4JMPA 1TVCA 3LUGA 5J40A 3SIWA 3COJA 3WICA 4YLYA 3WZ2A 1TMKA 2GPYA 2UXDB 2BHRA 5B7PA 3VC3A 3PV0A 4NF2A 3WDKA 1J1UA 4HDCA 4C05A 4HSEA 5IF9A 2G1PA 4B7AA 2Q1WA 1X7YA 2GVZC 3CVJA 3PR1A 1UODA 2FQWA 3HR7A 3IIIA 2ORVA 3QVUA 2ACEA 2YJNA 4XWGA 4C7XA 1RXWA 3RUHA 4ABTA 2FW8A 4PRKA 3ASVA 4YP7A 1DJPA 1BKDR 2LBPA 1R10A 3P71T 1Z9BA 4GBED 3K9WA 4OHOA 1NI3A 2QBYB 3TOXA 3JTEA 2NYVA 1VHWA 3ND8A 4JYPA 3LQ4A 3T35A 4CU2A 4R1MA 4TKVA 4YJGA 3CT6A 3HSSA 1W44A 1C9DB 3EWAA 3N0TA 1G42A 3JWHA 1TRHA 3BIWA 2X9GA 4M0MA 1DKNA 2TS1A 4M1WA 1MAAA 3UICA 4AY6A 3RASA 3QHPA 3RSHA 2QQFA 4R6WA 3HCBA 3NWPA 3TL3A 2E85A 1YULA 4KQEA 5ALGA 3OEED 3BB4A 2Y8EA 1Q0TA 3FFAA 2CUNA 1RHRA 4GLFA 3U3OA 1YJQA 3KDPA 2RHWA 4ENSA 3O3CA 3JARA 5A4FS 1SPBS 5IXYA 3F67A 5MN5A 5H59A 2WBLC 4QVIA 3ICEA 1SOUA 3B5EA 3F5QA 2W2MA 3I8SA 3C7AA 1Z0KA 4FSDA 4IUYA 1MAHA 1NP6A 4LF9B 4G07A 3EDYA 2P9ZA 1P73A 3A32A 4HZIA 3W1EA 4FQ5A 4EVSA 2VQDA 4O2RA 4AYWA 1DQPA 1E0JA 3CLTD 4E3ZA 5LOVF 2QN8A 3ID6C 1CUBA 4MR9A 4XD7A 3BH6A 3CJTA 3K1JA 4I50B 1G59A 4F4DA 4AJNA 5TV2A 4BBJA 3F3SA 4EFLA 3GP8A 2ZUVA 4U5XA 1KK3A 1L4BA 1KFBB 4O4LA 3E5NA 4QNMA 3LXUX 3C3EA 4K9QA 1TLLA 4RHCA 1UDWA 4B35A 1J0CA 1CUDA 1EUDB 4HYTA 4AJ1A 3BE4A 2WJJA 4LIPD 3W0LB 3UB4A 2RGWA 1HV8A 3R3YA 3L40A 5IJWA 1D6SA 4DB2A 2CJXA 1JYSA 1PG2A 1T2AA 1U94A 2RH4A 5JCZA 4H3HB 2BGJA 5DDIP 5KTTA 2JLAA 2GAFA 2XVAA 1BFUA 2ZTHA 3JQCA 1XPJA 2W58A 3A1NA 3KB2A 5FFFA 4DKXA 2DEUA 1VCHA 2BGKA 2ZBEA 3K1AB 3L7OA 4Z99A 1E7MA 1GYQA 2XWBF 3ROEA 4BKQA 1UT8A 3GLIB 3OSZA 3JQBA 4DNOA 4XWYA 4RCZA 1QK4A 3FWNA 4TUYF 1GLNA 3AJRA 3KRTA 1AURA 5KNDH 1XJWA 1UBHS 3MTQA 5IUKC 3GRAA 2X1LA 1XD8A 3IMCA 4ARAA 4CKBA 2PSEA 3I9V6 3NP7A 4C14A 1T3TA 4FDVA 3B1XA 4B6RA 2BGWA 5CYGA 3OCYA 1ZBDA 2W5UA 4X64B 1RADA 2RJ3A 4S24A 2IW1A 4EMTA 5EUCA 2I66A 3BFJA 1RCUA 2FFBA 2EOAA 2P77A 3GAFA 4HPXB 5EMLA 3LFUA 3VVCA 1P0IA 3EZGA 2ZT7A 4DQKA 2IE0A 1X14A 1W1WA 2CDBA 2W2OA 1FDUA 3U1BA 2VJKA 3P96A 2HIAA 3L46A 3EEOA 1OV6A 2HU5A 4R71A 3U7QA 4MWGA 2XUJA 4CCYA 5I9BA 3AY3A 1F7VA 2DERA 3ET5A 3Q2KA 1I3LA 4FQ7A 4OFBA 3NT5A 5LB4A 3U61B 3OZBA 1Y63A 3K0CA 2JH3A 2D5IA 2Y67A 1RWMA 4O4IB 4PLFA 5CM9C 4O1HA 1C3OB 1PNOA 4S1NA 3TIFA 3TLEA 3UBMA 2XITA 3AOGA 4DN6A 1MIOB 3DE0X 1JLHA 2VRWA 1CD5A 1JEQA 1P72A 3FNQA 3OM1A 2BEJA 3PI7A 4LHWA 4MVJI 4XWTA 3ADOA 3BDVA 4U6QA 2BWJA 2CWWA 2HBRA 1U2PA 4R1PA 3LUAA 3WWZA 4RHYA 4QTUB 4RPHA 1OB5A 5TJHA 3CFYA 2WM2A 1DC7A 3VUEA 4ZAXA 4PCUA 5EGNA 4FLMA 2EHDA 3JWPA 5JMOA 4MDFA 3NALA 4HXFB 3ZUGA 2HCFA 3O4VA 5TDHA 1J8DA 5TJ9A 3WX0A 1JTVA 4F1WA 1TQ6A 1ZIDA 3OUZA 2D74A 4XH9B 4B40A 4KLCA 5DTQA 4HPJB 2AN5A 5BPFA 1K0UA 3GJ6A 1KJNA 2ZYGA 3DPSA 4LQDA 2WF6A 2VUUA 2X2OA 2X5XA 1KKMA 2MDTA 4ANFA 4AKIA 3ADBA 2O52A 5L45A 3CXUA 2E7ZA 5KWIA 1NUQA 2FPOA 2ZRGA 1LSSA 3W7AA 2WVJA 4DCOA 1DEHA 3CZCA 3UCEA 4KLZA 2M9MA 4TUYA 5HFAA 3VGPA 3KJNA 1A8UA 5FNVF 2O3JA 2DHEA 1UP6A 1WUHS 3X2EA 1K2VN 2ERYA 1BE1A 5IWAB 3IJEB 2ZWIA 1ICIA 2P11A 3UC9A 5CU7A 4DCJA 2VYNA 4BV9A 4DDHA 2BCEA 2MSEB 4RQUA 5JIBA 1T8UA 1JPNA 3VNSA 4MPRA 3UM9A 3TSOA 4IOLA 4EUEA 1SKQA 2EX1A 2EBHX 3H17A 1ENZA 4Q9HA 1W8DA 2JGJA 3SHTA 1U8CB 1GPWB 1PBNA 2M6KA 3P2KA 2Y05A 2X9NA 3LQQA 2AEFA 4GPBA 4XQ0A 4NWIA 2E55A 3CNBA 3A6EA 3E0QA 4ZU6X 1BN7A 2QJRA 4X1IA 5I8PA 4FNOA 3N05A 4HH0A 1K8XB 2JVKA 1X7HA 3D4PA 3D3QA 4ZDWA 2Q7DA 3VZDA 5INTA 2NSLA 2C98A 5DNEA 3K0EA 3DHWC 1E5LA 1DIOB 1F0KA 3EQ6A 2QTAA 4IHKA 4AX4A 4B45A 4AZ0B 3WRYA 5EXSA 3KTAA 1PFQA 3SG0A 4WK2B 1E6UA 3W3AA 4MA4A 3QYJA 4OU5A 2HB6A 1OTXA 2DUMA 1J8MF 2WU8A 3SE7A 2HFKA 3J80A 1E2EA 3NKVA 5AI6A 2W2QA 4QQ8A 4EX6A 1E5DA 2YMQA 1G0NA 2HK6A 2PZJA 1ZW6A 1A2KC 3QFHA 5LA6A 1W75A 2XQKA 4JSRA 4XB6B 1XQ6A 2GR9A 5BSGA 3SF8B 1N1MA 3KHTA 4TYNA 1GRRA 1KY4A 1E3SA 1QH9A 3EN0A 3AERA 4LCJA 4WE3A 5BSUA 3UMGA 4YRJA 3V4PB 3UPTA 2BZ0A 1HDEA 5EJ7A 2XXAB 4G1CA 3AR3A 4TKLA 1Z8NA 2I6GA 2D7DA 3FRJA 4HDRB 2PMCA 5BSMA 2E2WA 5HIIA 1A5BB 4UMVA 3NTXA 1J00A 1XC7A 4RF2A 4FCTA 5C8ZA 1T5LA 3RGGA 1DTWB 3R9IA 5SZJA 2GGSA 2SKDA 2GEBA 2QLBA 1LPAB 5FB3A 1FFEA 1R0YA 1XKTA 1GITA 2C7PA 1HQCA 2VK8A 3IQIX 3V4RA 3CW2A 1G5TA 1MIOA 3PLNA 4WLOA 2B9EA 1SD1A 2IXAA 1T9ZA 3W5DA 2AWNA 4P3XA 1R6XA 3TOSA 1Z16A 2R1UA 3IXLA 4ZAFA 4C9BA 1T2CA 2GD2A 3GIWA 3H2IA 1E4VA 4HFJA 3JX9A 4FYKA 4K1LA 3BMNA 2IHTA 2WWWA 2EKBA 1C0KA 3JQ9A 3MSXA 4GI7A 1YK1A 4C4SA 3WLMA 4YHBA 4YO8A 5G0WA 2VP6A 3ME5A 2EQAA 3BULA 2DBVO 4P3OA 1PUIA 3D2CA 4QSMA 4UDOA 3C7KA 4BMVA 1E2MA 4OOEA 3K6KA 4FEEA 4NAVA 3TR0A 1XRNA 2D1SA 3ENVA 2D2XA 4DV1B 1X7WA 4DJAA 4OMUA 1O4VA 3OOEA 5FP0A 5EWLB 5KMGA 1R9JA 3IAS1 1TGYA 4WBXC 4F91B 4UHFA 1QR6A 4GMGA 4JLNA 5AM2A 5SY6A 4DA7A 4S3MA 1B73A 1QKJA 2LR0A 1H5UA 4PBTA 5B53A 4PBSA 4BFYA 4DOMA 4LTDA 4UBNA 4D9GA 3V4ZA 4EFKA 3H8WA 4Y9TA 1ZKDA 3U13A 4BFSA 2ODWA 2BL4A 2J7PA 4KFUA 4BEBA 4WEQA 4F2DA 1Z6ZA 5JPDA 5LSAA 1ZNXA 4HDMB 5J47A 2RHOA 3T61A 1IEVA 4BAZA 2O57A 2Z2JA 4ZVTA 4CDMA 3RAGA 4G0WA 3ORFA 1WV0A 5HCIA 1IN7A 3B6EA 1GPKA 3U44A 1DQRA 1SCQA 3KBBA 1NYQA 4LBVA 4RDXA 3T3GA 4IMJB 2X5OA 3ZXXA 1KVRA 3DXFA 2W98A 4A0HA 3DEHA 2E1PA 3SOZA 3QF4B 1D03A 5FI1B 3SIPA 3VR1A 1MRNA 4LA4A 4RXUA 2GZAA 3ECCA 4ETIA 1PS8A 1DHRA 4G0UA 3R5KA 1ULSA 2IUSA 3CNNA 4YA6A 4QULA 4MQ5A 1UL1X 4H35A 1S7GA 2FZWA 4EO4A 1WB9A 4PYLA 3ZQ6A 1CDOA 1P31A 3FB1A 5JMPA 1R00A 4PXAA 1QRTA 1RRCA 1HM5A 1K6XA 1DIBA 1H05A 1T15A 3IBTA 4ZI7B 2IS4A 4BMZA 1Z13A 2CYAA 5H3CA 5GWXA 2JIDA 1AKRA 1FMLA 1UDRA 3DMRA 4MPTA 1WABA 5BQ5A 4Q34A 4F8YA 1P2DA 4Y30A 4OJMX 4X6UA 2PBLA 2JLCA 5BMVA 3QU5A 4AZTA 3IDZA 4PZCA 3SVLA 3SSNA 2GBCA 2Z8YM 1XN4A 2D4AA 4XYBA 2REQB 3ZX4A 4J7AA 4C5CA 2C2XA 5EL0A 1P4RA 1U0RA 2CMHA 3Q7IA 4LXUA 1C3LA 4TT8A 1QMGA 1C9MA 1ES9A 3DOCA 1WMDA 4KLNA 3DHYA 1CFJA 1CUAA 3M1AA 4PSCA 3AEUB 5TMPA 1U2DA 4G84A 3UMVA 5FTMA 4HJRA 2RGGA 4KMRA 3NV7A 4D9NA 3U49A 4OHCA 1IRXA 3PX3A 1ODCA 2WFAA 4BLOA 2M1ZA 3N2IA 2VNAA 2JZOA 2NLOA 1BE8A 1VHQA 3HHPA 1PJ2A 4JLSA 4U7PB 1B23P 5AKKA 3U0BA 1XL1A 1ZMBA 3H8VA 1QZ3A 5FBKA 4F60A 9LDBA 1VPWA 2CFCA 4F4IA 4GC9A 4CMJA 2EP7A 4XA8A 3ZCRA 4C0HA 4RLHA 2F3UA 2GRAA 3E1SA 1SR8A 2Z43A 1JDVA 1P1JA 2IUYA 5ALJA 1CY8A 1AXEA 1HEUA 3N5KA 2V4ZA 5CHYA 4YMHA 4LV5B 2GXSA 1KH2A 1O94C 1QKIA 2FEMA 3DVAB 3NHYA 4TLEA 1WP9A 2A9OA 2JGLA 1ZD5A 2X3YA 3HJRA 2VHCA 2V3CC 1N33B 4PAWA 3W9BA 2BKEA 1PFKA 1A1VA 1RLIA 2Q8QA 5ICCA 4MUNA 4OUDB 2FE1A 3HUEA 3ZW8A 1GG5A 2QX8A 5THQA 2KJQA 1V4BA 1JPJA 2GH1A 4Q1EA 5TPWB 3RBAA 2QAGA 2FRXA 2RHDA 2WPNA 1IOVA 1C9NA 1JQKA 4RAOA 3S1LA 4DBLE 3K9FC 5EWLA 2DECA 5ECYA 4O2BF 3GXBA 3G2JA 4ARIA 4TRJA 4LXIA 2NSYA 5JEDA 1Z7GA 2GNAA 1G8MA 5CXQA 1L5OA 4Q00A 5CJJA 3M9LA 4L9SA 1S96A 3FWYA 4PIPA 1JHAA 3KKPA 4HWGA 3RIXA 2BE7A 3IEMA 2WWIA 3B2QA 2HJGA 4M9XA 1QGYA 2HA5A 2R1ZA 2C2HA 3KD2A 1IVNA 3DCYA 5BOSA 1K8QA 2I67A 2O5RA 3V8MA 5LVAA 4ZCMA 4NZPA 5KNBA 4Q4AB 4OQ4A 4OHPA 2B2NA 4IJKA 2QD2A 5FKJA 4UD6A 4LOHA 1KJZA 1JG4A 2OQRA 4MQFA 3RS0A 3UMSA 1NI4A 4D6XA 3RREA 5TGTA 2X23A 4ZI5A 3E7PA 3R40A 2Y1LA 1IBKB 1GN9A 2QNIA 4BLPA 5KX5F 4F38A 3EX7C 4W4TA 4J3JA 1S02A 1ZH2A 2HI0A 1TW3A 1YMUA 4H7PA 3OCUA 5HIJA 2HZBA 1J5PA 1MO6A 1UJ5A 4FDAA 1QH1B 3Q7RA 1W2GA 1HDXA 1R8XA 1EHCA 1ZRMA 2YN4A 3L1IA 4P33A 2C20A 3LT5A 1JILA 4HWPA 1NLMA 2POQX 5LPNA 2UXCB 1LXCA 1W5FA 1P2SA 3BXGA 4QYIA 5DEOA 4IQ8A 5TGZA 1LZKA 1KFJB 1M66A 2FPPA 3CUVA 3OZCA 4CM4B 1Z4PX 3SEFA 5HM6A 1UWCA 2I87A 2WHPA 3OUTA 5HK8A 3BTOA 3TGPA 5CMLA 5KDOA 1ISRA 1YS1X 2PNFA 4DCSA 1YB1A 1RWPA 3G9ZA 1EFKA 4TQAA 4EX7A 2H63A 3NW9A 2A33A 1YC5A 2WIBA 2JFHA 3H5IA 2V74B 2RAUA 3GQBB 4NZZA 4CIXA 4YLEA 4UTPA 2CNNA 1MJGM 3CEPB 4AYXA 4RMJA 3AINA 4OLAA 1V71A 3OZWA 3P2OA 4E3WA 4ZOEA 3H3FA 4DT1B 3DTVA 2L0XA 1A9SA 3MXTA 4F84A 3DV0A 3LYHA 1FS6A 3HZRA 2FSSA 3BE5A 4WINA 3UT5A 3R0JA 1SBZA 2J9YB 1EE9A 1FP1D 1Z33A 3DZIA 4RLFA 1G1AA 2DR0A 3T7IA 2LIPA 4OFWA 3UC5A 2Z4RA 3JVDA 2H16A 3NJ4A 2HLDA 3SC2A 4DUGD 3RRZA 2VXCA 5C9ZA 1CY2A 3EDRA 3V6LA 3R3VA 1CRWG 2X0JA 3VI4B 1L6IA 1E94E 3DVAA 2QY6A 1MNAA 2H0QA 1M72A 1U1IA 3DMPA 1WUTA 2I4TA 3WQBA 1Y6FA 2FZLA 2IX9A 2P3LA 1J0AA 3ROMA 3NAQA 5E4JA 1ZA2A 3ZGXA 3IP7A 4PZUA 1L5QA 3QOYA 3QVLA 1MPXA 4U7GA 1MW9X 2JFFA 3JQ7A 4JT2A 4EKNB 5MGBA 2P78A 3I34X 1RJWA 5GQSA 5KKAA 3WGNA 4RMGA 1LW6E 2BJHA 4IFEA 4KB5A 2XD9A 5J4YA 2EJVA 2W48A 3OO0A 3NFYA 4TMVA 5I9SA 4JB3A 1XDGA 1ZOIA 2D62A 4B4VA 3C6XA 4QJ3A 5KO2A 4TKVB 3G5TA 3PFBA 1ZGJA 2OOKA 5HJ2A 1RI5A 4JQOA 1X80B 1ZQ9A 3IP1A 1YVUA 3HYNA 3N86A 5B1HA 5SV2A 3U4QA 1B1CA 1H4QA 2NU6B 2GZ2A 2IPAB 3FUWA 1N9ZA 3IL2A 4M7WA 4FMCF 3WO0A 1DOZA 1VMIA 4RU1A 4Q4AA 3RAEC 2YWGA 2PS1A 1FX0B 4FNGA 1JHVA 1YAJA 2IXEA 2QRQA 4KP7A 4D8UA 3O93A 5TLSA 1E1NA 3LP5A 2PR2A 3MFYA 2ZSBA 3LO8A 1XMOB 3WK6A 1L0BA 3MCAA 5TVKA 3T7SA 5CPFA 1U1FA 3VKFA 5HJEA 1PU2A 3SVZA 4YYEA 3K2IA 3Q15C 1CK4A 4HRAA 4GXTA 2QTGA 2DPGA 3VYTB 1R6DA 1MABB 4CF5A 5AI0A 1XQWA 4GOLD 4QLOA 4D43A 3W5SA 3FIUA 3W90A 3OJOA 4MR9B 2O7VA 1R4MA 1F17A 3QWBA 1GZ4A 4YRDA 1NUTA 4ZARA 4C21A 5LQCA 1X3SA 2WSMA 1NX6A 4LRUA 1MDFA 1Z6TA 4QYIB 3QXJA 1VE6A 2VZEA 4WZAA 4OF4A 3G7SA 3B13B 4AWXA 1G8HA 2QSZA 2J5XA 3DG9A 2IGTA 4PQFA 3P9IA 3L1UA 3PS9A 2H2HA 3ZXIA 3V1MA 1ISSA 2GZHA 2YXDA 4ZVRA 6AT1A 3SNHA 4E2YA 2H7YA 3J81A 1H66A 3KYJB 2F8MA 4ID3A 3HSKA 3EA5A 1XZHA 2QP9X 1MFZA 4TYMA 5E4TA 3OE7A 2JAWA 4IRXA 2ZWMA 5ARBA 4YPFA 2GB4A 3WGZA 4DGSA 1YR8A 1OBVA 4HEQA 5AVOA 1SIUA 5FQNA 4QXPA 4AYTA 3AP3A 3LLUA 2YICA 1Y4AE 4ZYYA 2W70A 5FBZA 4AURA 5LP6B 1I3OA 4OQDA 2COEA 2R8EA 3NTUA 3RC7A 5BSVA 1INLA 1MTZA 1O95C 3M3HA 5ADUS 1KMHA 2ZJ3A 2FPLA 2GO7A 2PEYA 4C0LA 2JC3A 2OB2A 4HGYA 3GJRA 4PNEA 4IIDA 1UC4B 4F5YA 2J46A 1NF3A 3ZXSA 5JZBA 4GICA 1N4AA 1GTMA 5I4IA 2XIJA 2YWRA 5NULA 4OP3A 3HHEA 4JLPA 3O1JC 4PFQA 1XYVA 4RM3A 4TXMA 2B30A 3I58A 3Q3GE 1LDMA 2ZETA 1Q50A 3WLQA 4GR9A 2HEIA 5IAGA 2LZ0A 4MW0A 4OSEA 5BPHA 2IXBA 2WDPA 1MGPA 3X1JA 4AMBA 4ZQCB 4Q3OA 3EIEA 2X5NA 3VOSA 4JXXA 4YPVA 1LBEA 4UFNA 1DDIA 4JFRA 5KUTA 2QGZA 1C2TA 3FXAA 4W5NA 3ITKA 3VNAA 5ITVA 4JITA 1DWPA 2WIGA 5K3AA 2P68A 4ZO7A 3WSWA 1U2DC 4OQMA 2DSTA 2YQ5A 4TT3D 1VECA 3KFXA 3V4LA 3U7QB 4FZ5A 2JCYA 4CCYB 4O5OA 3VU0A 4ZYTA 3RTAA 5F7XA 4US2R 2VHXA 4Z0PA 2OXTA 2DAPA 4MAAA 5TS3A 1LC0A 5ITZB 3ASUA 3UMCA 4LF7B 2HNBA 2DGDA 4KFTA 2DFKB 4G9GA 1XROA 3B8EA 5AVKA 2IYEA 5CTJA 4TKUA 3WMGA 4E46A 1WSDA 5AVTA 1E6LA 4WOKA 2CF5A 2RAFA 3FHTA 1AKMA 1D6NA 1E8DA 2Q5EA 4L9WA 1WD7A 5JAIA 1LW7A 1BVRA 2B25A 2BM9A 5KNLA 1RIFA 2DKNA 3ETNA 5LXTA 1RQGA 4HEA6 3NHUA 3UK0A 4URVR 3ZD6A 3A9TA 1VHDA 4P4LA 3TKAA 2W2TA 4YAKA 5K0JA 3GJSA 5FNVA 3TXAA 4WKGA 1NW3A 4CQNA 3K72B 1BE0A 2J7PD 2ZJFA 3QW2A 4QDXA 1Z6YA 1XNQB 4HQNA 1A4UA 4BCBA 4B3SB 3KWLA 1NPYA 2P2SA 2HU8A 3PIIA 4B7XA 5KJ1A 4DUPA 4HLDA 1JP7A 2GPSA 1X39A 3NB0A 1W2WB 5JCOA 1C1DA 4GOOD 1ISIA 2ZDQA 2QORA 4PM4A 4ZCRA 4DBZA 1V8BA 4PPNA 1JDBC 4EA9A 2V5UA 5E9WA 4RDHA 3FCXA 3QFCA 1Z4IA 2JDID 2D0OB 4A8JA 1MC1A 2Q46A 3ADCA 2FWAA 4K8RB 4BQIA 3QTBA 5MHTA 1NQOA 1VYVA 2G5CA 3F6BX 3EPLA 4IO0A 4ZICA 5E7QA 1G4AE 4RY2A 3H84A 1GNRA 2ENUA 1BHQ1 3K9NA 1P61B 1C4KA 5K4HA 2B4KA 4AJLA 1E66A 1GQ2A 3NYWA 2IODA 4OGLA 1F9EA 4RK7A 3TD9A 1VB3A 4Z7NB 5LMUB 4HDSA 3K0FA 3WGLA 4YRGA 3ONWA 3TFOA 2VPQA 2FMKA 1CUYA 2J45A 1NRIA 3N75A 3V8NA 3A4IA 4EARA 3QXSA 4KR6A 4MW7A 3CVVA 1JWLA 3TNYA 1VE1A 1J5XA 2H06A 5AR1A 5CA0A 3H99A 5BV0A 5A2QA 5C5DA 1WUJS 1ODJA 1LF0A 3TLXA 5B1EA 1ZI6A 3KTAB 1Q0ZA 2I65A 2NYUA 4MX8A 4I1OA 4KXMA 1Z47A 4KMMA 4XLZA 5JZ9A 2ABWA 5KQLA 1ZCAA 4DCVA 1IXSB 3AF5A 1LNSA 4WV3A 5FCDA 3UGTA 4CEJB 3UCXA 4PPGA 4YWJA 4PYOA 2Z04A 2ZB2A 3HNOA 3HWWA 3LQYA 4EK9A 4ZJPA 4GECA 3KZCA 3RAJA 2WY2D 4OB7A 5F76A 3GFOA 4JC5A 4MHOA 1SCKA 3HB7A 4QJIA 2Q7XA 1E4EA 4LE2A 4B3HA 3THYB 5J5VA 2FCAA 3IV9A 3NEPX 2B2XA 4J0QA 1E58A 3E3NA 4PICA 4EEZA 3KDAA 4OHRA 2WWYA 4BY9E 3NVAA 1MR3F 1ODLA 1Q1AA 3H05A 4HDRA 4PZAA 4RZ2A 5CB4F 1YFKA 1N2ZA 4QOFA 4EO9A 2DQZA 3CUTA 1NSTA 3A4VA 5JHHB 1XFAA 4Y1FA 3H75A 5CYOA 4B9EA 1D8AA 2ZUDA 4JKYA 2ZBUA 1CQIA 1Q7EA 2BF7A 3S2IA 5CB0A 2FDCA 1H0SA 3TR6A 4DPKA 2Q2WA 1PZEA 3HB5X 4GQBA 2VA9A 2DG2A 2BFMA 221PA 2WHEA 3V9AA 2PA0A 3CF6R 4FIZA 2PT5A 1IZYA 2Z5LA 3X2SA 1XBTA 2XNHA 4H1WA 2QLFA 2R7LA 3W5AA 2YVUA 3KV1A 3CM0A 3T3NA 3OY7A 1YL5A 5SYAA 1QCZA 4EVIA 3OE7D 2BKUA 3A4LA 4WY2A 1BWPA 4K9OA 3RSFA 3H5OA 2QYSA 1HK7A 2AOWA 2BFNA 4LZNA 1FBTA 3FROA 1CYDA 2C9MA 5FNVB 2ZAGA 5HGXA 3IT2A 4MWZA 4FBMA 3BJMA 3CX7A 4UHEA 3EPKA 3PYLA 2Z4SA 3SZUA 2CK3A 2FW7A 1ST2A 4UAVA 3TECE 3ZHVA 1HX7A 2B6HA 4WXYB 4D9BA 1KQPA 1YOBA 4QUBA 3EHEA 4GKKB 4QOIA 2PSDA 3PBKA 5KTOA 1EKXA 1QO7A 5E9JA 4YIHA 1EVEA 1Q14A 2VDRB 2ATCA 2PUFA 1C1DB 2PU7A 3QFSA 2C96A 4K1XA 1ICEA 1U2TA 4F2GA 2DRIA 4C3VA 4PRZA 3AZPA 3HV2A 1M8FA 1ZCJA 4H0NA 1LU9A 4QNNA 4JYAB 1J33A 3KTDA 3HXKA 1Z4MA 1ZK1A 1DLIA 3O3OB 3PA6A 4MUGA 3TX2A 1E2LA 3UUEA 2WD8A 2DY1A 2IV7A 4EY8A 2V97A 1DV1A 1R5BA 1XHEA 3NG1A 2GLUA 2YQZA 4KSCA 4JI8B 1NBOA 4IINA 4LZLA 2PHZA 2R1VA 3H65A 2YVAA 5LDHA 4ZYUA 4RKEA 1BXRB 3UAZA 1T24A 1H2XA 2UKDA 3L5OA 2QSJA 4GOJA 3I3SR 3AGQA 2P9HA 5KYKA 2HA6A 4FYXA 2JATA 5E8RA 3WL6A 2AJBA 3RYIB 1EVZA 4TX1A 3L77A 4FGJA 4BNDA 2NPFA 3RC2A 2ARKA 3PC2A 4LY0A 3AWIA 3ORRA 4CMCA 4DDWA 4RJTA 4AICA 3HE3A 3NVMB 2BMJA 2XMRA 1MJFA 5DVZA 5LL6P 4DLAA 3GLGB 1EEXB 4I4NA 2LDXA 2X3FA 3VJKA 3OTIA 1PR9A 4OJTA 2WFLB 1Q7TA 1ORRA 1YJ5A 1E6KA 1SQSA 3LRPA 4GLBA 2C4NA 4RKQA 3ZVKA 5A4MS 3Q5DA 2ENWA 4L15A 2OYSA 2X14A 1HE4A 1GCOA 3HG7A 4TWRA 1HURA 3LV8A 3ZZUA 1PZGA 3CO0S 3FAKA 2GCOA 3FI9A 3K6SA 4CEJA 2DQ4A 2IOFA 4TSFA 5BQFA 2SNIE 1SCBA 4I5IA 4KV7A 1B2RA 1L4HA 2EP8A 1XLUA 3QLJA 5AM0A 4BNHA 3AX6A 2IP1A 1W5BA 4I7EA 4P9NA 4KIJA 1SQFA 3S2UA 2WZCA 1OT3A 4G4SP 5CB4A 5KHLB 3N2LA 1SOVA 5DNCA 3V1LA 4OM8A 1SM4A 3RJ5A 2J3IA 3DR5A 3LC7O 3PTZA 3QG5A 3G9XA 3PGJA 1VL2A 1J0BA 4N9WA 4DA6A 3I2YX 5C8YF 1MPTA 5MDHA 2R0QC 1O0CA 3GPIA 3MRSA 3DE3X 1ZUWA 1CUZA 3W2IA 3HVRA 1TDJA 3O5AA 2O3SA 2C5BA 3IV7A 1UKBA 4PNPA 1L3CA 5IN5A 1VCOA 3N0WA 4CGZA 4O3MA 3RKSA 2IITA 5J4HA 3T5CA 4LDPA 1RRKA 3V2GA 2P6PA 1U8UA 2EERA 2NSJA 4IIYA 2GZ1A 2QAIA 3OOWA 5GGYA 2QNRA 3IAAA 4YT2A 1GU7A 3L8FA 4MQ4A 1L7VC 4HWKA 2ZZKA 4KZKA 2JH8A 1RS0A 1FUUA 1N9GA 4ZMRA 4N0DA 2VRNA 1M3SA 3BWEA 2CL5A 3D4LA 4EHAA 2EQ5A 4ERNA 3NWBA 2BKLA 4RVGA 1TEXA 2NXNA 4A03A 4EYEA 2OLEA 3U6KA 3QKWA 4Q1BA 2WIAA 4E2WA 1UEJA 4D4IA 3NJ8A 3TTVA 1KKLA 1H8HA 1TAGA 4RMHA 5B3AA 3RJTA 2E0IA 3C97A 4L9AA 3GELA 3P0EA 5E9QA 4LRTB 4I6GA 3TN7A 2AD5A 4EYSA 5L3QB 4MKHA 4EF5A 5KJ6A 5TT1A 5HKBA 3I64A 1OBOA 4AM8A 4WA7A 3SJUA 2QQGA 1WV1A 1E89A 1CUHA 5I4CA 1DDGA 4IX1A 4Q66C 3BJIC 5IANA 3HCEA 1W4LA 1NRWA 3OKAA 4MR8A 2X4LA 1II9A 1YKSA 1T3SA 4HKTA 1HZJA 1OAKA 5DV9A 3K16A 1WUIS 2W2KB 1EJBA 1T5DX 1OZGA 2YV4A 2XXBA 3H5NA 4O02B 1UJ2A 4RGVA 5K09A 2EATA 4HK4A 4DEYA 3ZX5A 4BQFA 3KCNA 1Z5VA 1P7CA 1N5LA 4RDCA 5KSWB 1CDDA 1T2UA 3HZHA 2ZSFA 1A7UA 1KJJA 1WMFA 2J3JA 3S27A 5FEUA 3HRHA 4QFMA 3W1WA 4O08A 4LF4B 2V7TA 1XRMA 1WPRA 1NI4B 1XZ8A 1TCCA 2GHTA 2ZJ7A 3BMCB 3QEJA 4ZQBA 4BEVA 4EGSA 3MMNA 4OLHA 2CL7X 4CLDA 4L4XA 4NAHA 5FLEX 1TU3A 1T2VA 2VJCA 4LCEA 5B55A 2FLWA 1M76A 2SBTA 1OFIA 1ZL2A 3AKDA 1B3RA 3DHNA 2WUFA 4CL0A 1UK9A 4EECA 4UZFA 1D7OA 3AETA 1ZH8A 4NYJR 5KYVA 4UE2A 3I04M 4ZOLB 5LDDC 4BZZA 3OX1A 2PSFA 1VYUA 1OQAA 1EUCA 1SA0B 4ALKA 3HY4A 5KOIA 5A5FA 3TZQA 3D7LA 5DGHA 5DZSA 3G6WA 3AWDA 3L5KA 4ILKA 3GLRA 4FZJA 3FHCB 4IOKA 3W4KA 2CFIA 3AB3A 4ZVMA 3RRMA 4AO8A 3HVIA 3I92A 4U02A 1FTGA 3H83A 2PJRA 4KN5A 1OROA 4PWZA 2W6MA 4IW3B 2GPBA 1T8SA 4L57A 2CD7A 3LX8A 1B8OA 1EAMA 1B8PA 3HBMA 4KV9A 2H7CA 5EC8A 3VPHA 2FSPA 3T41A 2OL4A 4ESOA 3KVOA 1YDGA 3HKEB 3TEFA 2CVHA 2ZAYA 2R7NA 2QMQA 1HT1E 3GC6A 1A2OA 3O84A 2QLNA 3SCZA 5BNWA 3HKDB 4B6PA 1BRMA 4G1MB 2V9CA 4MV1A 4OJQA 5JV5A 1Y4SA 3ES9A 4OHMA 2HRRA 1GZUA 2A4KA 4B4KA 4EUHA 3DV0B 3H16A 3W5IA 1UAAA 4PG6A 1Q0PA 4JEIA 1J8FA 3TK1A 1J2TA 2Q6LA 1SXHA 2QQ5A 4MYHA 2OO5C 3ESBA 1DBVO 1VC2A 1SVIA 1MVNA 4UU0A 4BE4A 4LSMA 4WGFA 2JG3A 4BEJA 3FVQA 1RWKA 2FZGA 1O97D 5L3SB 4N49A 4EAQA 1C3VA 4LY3A 4BNZA 1PO7A 3NETA 4D0RA 1C9JA 4MH0R 3WIUA 3SICE 5C8XA 4L51A 4MTCA 1T36B 4ESHA 3AIKA 5JWOA 4TZ0A 1W4CA 4DMLA 1M5RA 5D01A 1SBCA 3T4XA 1KJ8A 3M89A 2FWBA 4JHXA 5C8YB 3PHBE 3IA2A 3N2NA 2G36A 3HBAA 1QIIA 1NZDA 4KYVA 4LPKA 4TKMA 4E4YA 3WKBA 3L4BA 4JOSA 2W4QA 3L6DA 2NQ2C 3ABQB 4O1MA 1M73E 2XDYA 2AFIA 4FE3A 3RC9A 2FWRA 3H1TA 3MWJA 2QG4A 4GDMA 5LYJA 4EI9A 1RU3A 5BUQA 2FPIB 3ZJ4A 3QV1A 3GCXA 5DSZA 1E9AA 4WNIA 3LX5A 4GIBA 5B6IA 4HXGA 1LNZA 4ZO9A 2ATVA 2ID7A 5LUAA 5F33A 3T1QA 1HOTA 4Q3CA 5ADWA 4CEIA 4YUVA 2QRPA 2ETXA 4HAZA 3HA2A 5TMEA 3RS8A 1I01A 4MQFB 1GZSA 1ZJ4A 3WGJA 3R9KA 4DIDA 5KCZA 4D92A 4RFLA 2E4YA 1HBJA 2LKDA 4B3GA 7MHTA 4PN7A 3KPVA 1EDZA 3NNSA 3D7SA 2RMKA 3DOIA 1C2YA 4MRAA 2SKCA 3ZHTA 1QZTA 3R77A 5DCYA 2H9YA 4E1BA 5LZ4A 4DYDA 2OGUA 3R3HA 4AECA 2RI6A 4CHTA 5DGXA 2XDQA 4FJ2A 3VR5H 3CINA 3SBEA 3KEQA 1R4NA 1Z6GA 2O1XA 2RHCA 4FWBA 4TL9A 1T8YA 1FDVA 1TYBE 3V33A 1C8BA 3FCUB 3TSAA 5JT1A 5K8UA 4NFSA 4MV7A 3VV3A 3I2JA 3NRJA 4I0WB 4OYYA 4YRFA 2YRFA 2YFYA 5CAEB 1AA6A 1EUCB 1SA0A 5MN4A 4TTJA 1CZHA 3CC8A 3N3AC 3ZHYA 3EGWA 4ZT5A 4HWRA 2G1UA 3DTNA 3QXHA 2WM3A 3WB0A 4BVEA 4DIUA 3QSYA 1A9OA 1D0IA 1QYDA 5AM1A 3DXZA 3IIMA 4N7RA 2OZEA 1Z5GA 1ETUA 1R9GA 3GN2A 1PJ4A 3LOPA 1Z2NX 3LC1O 3VO8A 3I3OA 4GVLA 2ZK7A 5D3KA 4AKTA 3T5AA 1E1QD 2Q3DA 3TAXA 3WQQA 5L51A 4BJHB 4BLUA 4JVOA 3WTCA 5L4NA 2CVPA 4LZAA 3I4FA 4Q4HA 1TF2A 1VG9B 1FL9A 2C07A 4H4DA 1EX7A 4P31A 4A10A 4WESB 2C54A 1IJFA 2JBAA 3IHLA 4YTEA 1FLAA 4I4LA 1JG6A 1NMYA 1A5TA 3LQFA 2GFHA 1HTTA 3WRXC 1RRGA 4AVYA 3S4YA 3R7FA 2BV3A 1KMHB 2DOKA 4TXLA 3W3ZB 4F2HA 5A5VA 3LKBA 2P5UA 3FVVA 4NZYA 5B1IA 1Q44A 3HZZA 3E8MA 3LO5A 4ZPXA 4UQLA 1M6VB 1Y89A 2GERA 3HH8A 3EXG2 3LUBA 1UBNA 4KXQA 2Q3CA 4RGQA 4KPGA 5DM60 1XWIA 4DEVA 2XMQA 1UBCA 1SU4A 2O0MA 2YZMA 2Y1XA 4N47A 3HKCA 3TZHA 1RW4A 3WYCA 3EVZA 3D0KA 3OZGA 4QRHA 4YYZA 1TEVA 4QQRA 1FFCA 1UJNA 3R7LA 5K0SA 1SBTA 2IBTA 1T36A 2OO7A 2ONKA 1T26A 1VDMA 2HBYA 2Q6VA 2JD2A 4ARSA 2VDNB 1VBNA 3GNLA 5C8YA 2BSQA 1Y7HA 1QQBA 2FFQA 4OFXA 4HTFA 2XE8A 5JLAA 4Q3KA 1E6CA 1U2GA 1DO8A 4R54A 5SY4A 3UVEA 2HL6A 3G6KA 1L1RA 2DPHA 2R84A 3MOIA 4G97A 5GVSA 2QG6A 4L28A 1BTOA 3QX7A 1ZVQA 3CZ5A 4G41A 3HP7A 4J1QA 4IIJF 4XM0A 1ZGCA 4Z4GA 2H29A 3DW1X 4X6XA 5HMMA 4UHKA 2I4NA 3WGGA 2I5PO 1XCGB 1TJ4A 1X1CA 2QJFA 4MRMB 5I5GA 3PNPA 5B4UA 2NO4A 4JR0A 2CXUA 5DMXA 5IASA 4ZAGA 1KIAA 2Y71A 3F78A 1PLLA 1HFEL 3P9YA 4MV9A 1PG0A 4I5FA 3A9UA 1TTTA 3EPJA 2E5FA 1JTFA 5B7QA 1KYQA 5BV1A 1AUXA 4LHEA 5TEVA 3V4SA 4KXXA 5ALFA 3U4MA 3G9TA 2OB1A 4ARVA 3LX6A 3HB9A 1GT91 1GQFA 4KXYA 1LRKA 4PXSA 2VHJA 3OZSA 4YT4A 3OU6A 1V7CA 2NV6A 4TPKA 2WHQA 3KZKA 4CKWB 5A4JA 1AQNA 1FCJA 1K8ZB 1ECFA 3PI6A 1Z5OA 5DNDA 4A6PA 1YA8A 3VPAA 3OCZA 4DRXB 2FHPA 4CQMB 4F72A 2AFIE 1PFVA 2CDCA 3GJZA 2WM8A 1AA9A 3IUSA 4WOCA 2XHZA 5TPZD 1U28C 3V1YA 1WO8A 2ZPTX 3ZWWA 4GGOA 5CLFA 2QZZA 3D8SA 3MWLA 1EFPA 3V80A 5F3RA 4RH3A 5KDDA 1D9XA 2BEVA 3DO8A 3B7PA 2OAGA 3DL4A 3G5UA 3FMPB 2Q0QA 3UA4A 4IXNA 1H2ZA 1OUMA 5AK4A 5DTJA 1PYDA 4DV3B 1I6KA 1NMZA 3VHLB 4QICA 4DUYB 4GXNA 2R4QA 5BNZA 3FSJX 3ZK9A 2KE5A 4H7IA 1KWKA 4JVNA 3JQGA 2O8BA 3OX3A 1RLTA 4PLZA 5AJTA 3OURA 4ALJA 1FZTA 3HCPA 2V9PA 3ICOA 1VI5A 1XB2A 2VJOA 4HYQA 3RK0A 3RVPA 3RABA 4JB8A 2FV8A 4IDAA 4WZBB 3DB1A 3NVKI 1AD2A 3ESRA 3UO8B 4D9KA 4V0RA 2WTAA 3MAJA 3S2ZA 5BRJA 3OICA 1S2IA 4KQ1A 4M0PA 5IJ9B 3A9SA 1AGXA 3DOOA 1ZN7A 3NBZC 5KU7A 3QHQA 5E7IA 3TDNA 4LVCA 4CV1A 1PJ3A 1QTIA 2X9VA 1DINA 2BRUA 3OOHA 1FBNA 3WLLA 4KHZA 3PUIA 1RWVA 5LLTA 3Q6IA 1JNXX 2PEZA 2FPUA 2OV4A 3PXXA 5I01A 1EZ4A 1UZLA 3TZEA 4Q1FA 2W93A 2AOTB 3CB2A 2HA0A 2YWEA 4L8VA 1FRQA 4M1ZA 4JWTA 1FS5A 3EBLA 3QWIA 4OI2A 4C0JA 3FGZA 2X15A 1J07A 1JKXA 2ROQA 4AMYA 2YS6A 2Y1GA 4JZKA 2PFSA 4COOA 1YQDA 1TAUA 1GEGA 3FETA 3LQ1A 5L40A 1HLGA 1YZKA 3AUKA 1GLVA 2Z5GA 2OUKA 3LMKA 1L5HA 4O4HB 1FPMA 2Q5FA 1OJLA 4ARZB 1FU7A 5FEMA 3C1AA 4F6RB 2WNIA 4MXDA 5K99A 2CHGA 5EJ9A 4FJ0A 5FL3A 1NR1A 1DUVG 4G01B 1HDOA 5EFOA 2HYIC 3BG5A 3JTMA 3QY9A 5MFPA 4K6GA 1MQAA 1V9SA 3YASA 2YIVX 1TJPB 4R83A 5KWVA 3V32A 3TLCA 2IU3A 3TI7A 4AO6A 3PGVA 1PN3A 3A14A 1XG5A 5J1TB 2EZTA 5EIBD 4UQPA 4ASUD 4B0OA 6Q21A 3LLVA 1RXCA 4EDFA 4PO1A 3L82B 4G5YA 1ECGA 3QOWA 1U5BB 2JEYA 2B7CA 3EA4A 3L6CA 4IDPA 4TN1A 1ZVVA 3O2SB 3VI3B 5KQGA 2GD6A 3OP1A 1RCFA 5H02A 1EWQA 4RZHA 2O2JA 1CUSA 2X3UA 4PRYA 1NUAA 4BP1A 5JZSA 3O73A 4INAA 4UM9B 1R0XA 5D7BA 1C0LA 3OEYA 5KQSA 3N87A 4D9FA 4NFLA 4K9MA 2NTJA 1AZLA 4KFSA 2PY6A 4G2TA 4I4CA 1T9HA 4ER5A 4L4YA 2BKXA 2YY5A 4C6RA 5I7HA 2AWOA 2VDQB 1L4KA 4RF3A 3FUXA 1AM4D 1HKUA 1WOMA 1V3QE 3C45A 3K35A 5BN5B 4YCNA 3RUEA 2ZWVA 16PKA 4KC0A 3LCCA 4EKGA 4MVJH 2Z56A 4RL6A 5DM70 2NP7A 2P69A 1VPLA 2A0WA 1D2EA 4ZTZB 1XRQA 1T1IA 2B61A 3O2QB 4M1EA 3LBNA 3RYHA 2HHHB 3OZDA 4LI3X 4PTYA 4FS8A 1WY5A 4LXYA 1BZYA 3KALA 1N78A 4PC6A 3RODA 3C5WP 5AO9A 1JT2A 1SC3A 1ZD1A 2QVBA 3FIJA 4GEGA 1ZM9A 4KX3A 2FUG6 2BFWA 2DVMA 4P54A 4R3WA 2ZIXA 3JQGB 3IDAA 4WBNF 3F8TA 1MC5A 1N2GA 1GKYA 2ZWPA 4IWXA 2L19A 4QG7A 4RD4A 2E4AA 3BAZA 3HMQA 3M6LA 4BVHA 3TKYA 2CSXA 1BCRB 1ZRNA 3HUUA 3LVFO 4M60A 4PYIA 3WIBA 5AKXA 1A95A 3INGA 4I1SA 4H18A 3QKSA 3QPBA 4DCMA 5TVGA 3IE2A 2BP7A 3JQFA 1AQIA 3H8JA 3QA3E 3O4IA 4GM1A 4TYPA 4RL4A 5G0SA 2FSFA 3RV3A 3U09A 5DF1A 4HNQA 2PD4A 1T2NA 1MFPA 1G18A 4M9UA 2PAFA 3RFUA 4QXOA 3NONA 3MJSA 1R9MA 5CJPA 2CVZA 1KDTA 1CLUA 3PQDA 3R0IA 4ZMBA 2R7MA 1GM5A 4DIKA 3NHBA 3Q2IA 1DC8A 1GL7A 4RD0A 4CE6A 4MJ7A 3D6HA 3EUEA 1D07A 4FOSA 4JGGA 4L4ZA 5CLJA 1QE3A 5J4VA 1FRVA 4ND2A 5AXDA 5IAOA 3W6PA 5KAMA 1BS2A 1VZ3A 5EUBA 3WJ7A 1ENOA 4YNBA 3KAQA 3THYA 4B6QA 2IIBA 5JBIA 1DI0A 2VCEA 3GUVA 4NESA 5DCLA 4EP1A 3B3FA 5AOCA 1U8FO 3Q3EA 3ZCPA 4S2EA 3RVBA 1J90A 4CCWA 4KYTA 1JALA 1SXIA 1NW5A 2GN4A 2BEKA 3LZDA 3KT0A 1O9BA 1V25A 2R8BA 4MEBA 3M6UA 1Z2CA 3LIPA 4F6RA 2JFXA 1YQQA 3H7AA 2GEJA 2WKRA 1PNVA 1JJAA 2DYKA 4M7RA 2DJ5A 3BILA 1GKIA 1N8KA 1OBFO 1GL6A 4R7ZA 3ZK7A 2YH2A 2CBZA 1J9GA 2DPMA 2ZJ0A 4TVOA 2C83A 1KZGB 5EE0A 3TINA 1GZ6A 3TZLA 2O1EA 4WJLA 5ITSA 1JZSA 3X0DA 1M1YE 5AKGA 3RUFA 4ZQEA 1EIZA 2OD2A 4MKZA 5WRFA 2NUAB 2ZYIA 2XQIA 3QPAA 4KN9S 1YJXA 1QYRA 3M6VA 4IVNA 1ELOA 2GLTA 3FBGA 2R8YA 2RJOA 1NJ2A 2EARA 2EZ4A 3TAHA 5HJ7A 1FTWA 1FVXA 2WV7A 5MFZA 2ZRKA 3GA7A 2MMCA 4H7HA 1KXZA 4UUNA 2Y66A 2EF1A 5ALUA 5AVVA 4H0CA 3C7DB 2QQEA 3ZY4A 5K45A 2C9OA 1XELA 3ZCTA 1EDEA 1KI8A 3PHHA 5DTMA 5CBPB 3CJQA 1SU8A 1XPUA 1JBQA 1S2GA 4UBLA 5KWSA 2H07A 4IHQA 5EUMA 3KVVA 2OO3A 4EI8A 2ZWOA 2HHLA 1CQZA 4IDGA 3T8YA 1R8SA 1T0IA 1N3YA 3CIOA 4KIUA 1Z15A 3L0PA 4LQLA 3WJ1A 2FEXA 1IVYA 3DXYA 5BN5A 1K7FB 2AW3A 4P22A 3EG5A 1ECBA 3M6WA 5AKIA 1SBHA 3H4TA 1N1GA 2H1VA 5HFJA 4IZ6A 4AAYA 3A31A 1I4TD 3SN6A 3LWBA 3PNLA 2XNDD 2HUNA 1A98A 3G13A 1P2FA 3KVNA 2ZSUA 2P90A 3R7DA 3L43A 1PV1A 3BCUA 3CNHA 4NPCA 2K2QB 4XCXA 2JFBA 1HE3A 3H5TA 4P6VF 3EZFA 2PZEA 4N6NA 5L53A 3Q98A 4J7XA 5I9MA 3WQRA 3DDOA 4KXVA 3EXAA 5JTUA 4K2HA 3K0HA 4FC7A 4N6GA 4QJBA 5DIFA 4WOJA 3B52X 1IU9A 5C0OE 2J0UB 3C70A 3PUHA 3SZGA 5JQWA 1PHRA 2YOFA 1P2VA 2YWJA 1X1BA 5TQVA 5K5EA 4JJ6A 3TR5A 4X1IB 5JDCA 2CLSA 5JJIA 3LHKA 4FR0A 2ODEA 5IZ4A 5JADA 4BNGA 1W29A 4EPYA 5FORA 2H5LA 1DG3A 1KJWA 1BXGB 3NTVA 3R6TA 2H5EA 2EYQA 4LGCA 5AQ1A 2HK9A 3D8UA 2CC2A 5ABPA 2MIIA 1AH2A 5C4GB 2YV5A 1XU7A 1CU1A 1RJDA 4RWZA 1QHYA 1L1QA 3PL1A 3AYXB 4JC0A 1UINA 4IXMA 5A7GA 4M37A 1I0IA 1WXDA 1OLXB 1FEZA 3OECA 3QLVC 2X9LA 3RJZA 1NP7A 3AHFA 3G0CA 4K40A 4QU0A 1UPFA 2OC9A 3MGCA 4Y6PA 5KHAA 1K6JA 3LDAA 4ZV4A 1LPMA 4BMNA 4UUOA 1WXFA 4ME6A 3OD5A 4AUKA 3FNGA 1GKLA 2AEEA 4BS9A 2P3QA 1YD7A 4HCJA