1UZAA

Crystallographic structure of a feruloyl esterase from aspergillus niger
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
259
structure length
259
Chain Sequence
STQGISEDLYNRLVEMATISQAAYADLCNIPSTIIKGEKIYNAQTDINGWILRDDTSKEIITVFRGTGSDTNLQLDTNYTLTPFDTLPQCNDCEVHGGYYIGWISVQDQVESLVKQQASQYPDYALTVTGHSLGASMAALTAAQLSATYDNVRLYTFGEPRSGNQAFASYMNDAFQVSSPETTQYFRVTHSNDGIPNLPPAEQGYAHGGVEYWSVDPYSAQNTFVCTGDEVQCCEAQGGQGVNDAHTTYFGMTSGACTW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords FERULOYL ESTERASE A
publication title Structure of a Feruloyl Esterase from Aspergillus Niger
pubmed doi rcsb
source organism Aspergillus niger
total genus 100
structure length 259
sequence length 259
chains with identical sequence B
ec nomenclature ec 3.1.1.73: Feruloyl esterase.
pdb deposition date 2004-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01764 Lipase_3 Lipase (class 3)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1uzaA00
1L7QA 1EB9A 2B20A 1GQRA 2PX6A 1AX9A 3O4JA 3PUHA 2BJHA 3GZJA 1YA8A 2JEZA 4OCZA 3AILA 4XX1A 4I3FA 2WM2A 2V96A 3F97A 3FBWA 4L72A 3IUJA 2O7VA 5AOCA 4D9JA 1UK7A 2X5XA 3DLTA 3G8YA 2RHWA 1U2EA 3S8YA 4NVRA 3RLIA 4JEIA 5HQ3B 4B83A 3D2AA 2WUFA 1QIGA 1NX9A 1XQVA 2BFNA 4QDUA 4Q34A 5ALLA 5JASA 5ALFA 5DWDA 4BZZA 2XMGA 3I2GA 5CT9A 3ESCA 4DIUA 2GBFA 4QLAA 3N2ZB 2VQ6A 3L1HA 4PSUA 2VJBA 3G0CA 4N5IX 2WIKA 3WJ1A 3L1IA 5LP1A 2XQKA 4U2FA 5AKKA 1QFSA 2XI4A 3FOBA 1JU4A 2OGTA 1J06A 3D4LA 4OU5A 5E2IA 5CW2A 1CVLA 3O4GA 2GBCA 5ALZA 4G1FA 2DHEA 2HA7A 3G02A 1J1IA 4BB0A 2ZYSA 3HJUA 4YASA 1Q0RA 4UHDA 4JUIA 1QIDA 1XZAA 4OUKX 1ZGCA 4QWWA 2PBLA 3DKRA 5AKIA 3STVA 3LLCA 5A7GA 3BIWA 4UHHA 3DS8A 4X95A 4AMYA 4W9RA 1H2YA 1EHYA 1LPAB 2I03A 1THTA 4AO7A 3FAKA 3IUNA 4HS9A 4BCCA 2HIHA 3IDAA 1N1MA 1ISPA 5C81A 5ESRA 5AIAA 4H0CA 3I6ZA 1GT6A 4N5HX 3G0DA 1MAAA 4QWMA 5HFAA 4EB0A 2ZSHA 4U2CA 4GI1A 4NZZA 3C43A 4UFOA 2WFMA 4F60A 2K2QB 2XDWA 4BP8A 1W1IA 3WL8A 2OCLA 3C5WP 2ZYRA 3Q8WA 1LNSA 4ZRDA 3C70A 2XLCA 3FCYA 4KAAA 5K3EA 2HU8A 4JYMA 2R11A 1T4MA 3H2KA 4WY5A 4X85A 2CEKA 2BUCA 4Y2JA 1XZLA 1DT5A 4E14A 1DTEA 5CXUA 2J4FA 2WUGA 3HACA 1QIIA 2WJ3A 3AJAA 4H7DA 4KJXA 1F6WA 2XT0A 2WG0A 4HTAA 5D3KA 3W9UA 3IULA 4BVLA 2X8BA 3C8DA 5AK6A 5ALDA 2JIDA 4G8DA 3F8SA 4LXGA 4CIAA 1H2WA 5JD5A 1U65A 4FLFA 2QUBA 2CKMA 5AO9A 1UOOA 2XE4A 1H22A 1ODTC 2RAUA 1C4XA 3FWHA 4KR0A 4C4XA 4P9NA 3H1AA 4AMZA 2JGFA 3AUKA 3E1GA 1XQXA 3B12A 4GEGA 4DSZA 3ESBA 1QZ3A 1HBJA 1UKCA 2VA9A 4K6KA 3WIBA 2QS9A 3CN7A 5ALJA 4XVCA 5JD6A 1GQSA 2Y6UA 1AC5A 3HEAA 3Q0TA 1AQLA 1QIEA 2DCMA 3AINA 2R8BA 4RPCA 4V2IA 5JALA 4NS4A 1E3QA 4CI9A 5ALEA 2X76A 3FSGA 3O4HA 4FHZA 2OCKA 1HPLA 5IVIA 2CZQA 1ORVA 3M3DA 4AZ0A 5FPQA 3R41A 3DL4A 4DYHA 4J0IA 2XQGA 4J0JA 4QDTA 4UBNA 1PV1A 3A2LA 3ZV7A 5C8ZA 1E5TA 3GELA 1EX9A 2ZYIA 3UUEA 1SC9A 1CUYA 1QLWA 1KU6A 5AM1A 5ALXA 3A70A 4NMWA 3STUA 5K3DA 4EHBA 5JANA 4L0CA 3IUMA 3QYJA 1CUBA 1BEEA 4KE7A 2PSEA 4J0DA 2XMRA 4OB6A 4IH1A 2WQZA 4Q82A 5LLSA 3ICVA 3ILSA 5EIEA 1KEZA 2IX9A 3I6MA 1BEZA 5AI8A 1O6GA 3GROA 4RNCA 2VT7A 4C4ZA 2I78A 4A23A 5HKAA 2QT9A 5LIPA 3STXA 4A5SA 2PU7A 1ZICA 1YASA 2OQIA 5FV4A 3WK5A 3HSSA 4ARAA 3QBJA 5T4EA 1YB6A 3OC0A 5JATA 4Y2TA 4E11A 4UFNA 4CCYB 3G9ZA 2HADA 4H7FA 1IMJA 3R3XA 3O95A 5IKXA 5KBYA 3BDVA 2YH2A 4OB7A 4FWBA 3F98A 2CB9A 2RGUA 1ACLA 5DNWA 4KAFA 3E0XA 5T4HA 2HA5A 1XKLA 3DQZA 4BE9A 2C7BA 2H7YA 5BOVA 4FTWA 4Y2XA 1X70A 3T4UA 4MEBA 4EY7A 1ZIYA 2VJAA 4GBGA 5EHNA 2DHDA 3WK9A 2O7RA 4B82A 4OB8A 4CCYA 1XZKA 4DMFA 5IVHA 2DQYA 4J0GA 4Y2YA 2B61A 4BZWA 4DNFA 5IVDA 4KYVA 3WWPA 5AKGA 4QA9A 5SYNA 4ZGBA 3KXPA 2VAVA 4EY6A 2XMZA 4E15A 1JMKC 3PDCA 3ZPXA 4C89A 3WMRA 1DQYA 3C6ZA 4P93A 2EDAA 3VKFA 2ECFA 3BDIA 3M83A 4B80A 4W1QA 3IA2A 1GXSA 1VOTA 4XIIA 3SX4A 1VE7A 1F8UA 3VISA 4J3JA 4N8DA 4Q1VA 4G4GA 5CMLA 3WYNA 4C6HA 1CUXA 1H2ZA 4J0CA 5HF8A 1CUVA 1BS9A 4PW0A 5DNVA 4Q3LA 5KWIA 3V1NA 1WOMA 3WQHA 3F9CA 5AJHA 1EDBA 1AMNA 1JJIA 5HK9A 2AJBA 3R40A 3C6YA 5EIHA 1JI3A 3PICA 3FSGD 5DTIA 3H17A 3D5EA 2AJLI 4YX9A 1WB6A 1VA5A 3DOIA 1LPMA 4KEAA 3WKEA 4MWTA 2EEPA 3C87A 1NU8A 5ALSA 2PUJA 5I9IA 2DHCA 4GW3A 4DMCA 2VTVA 4I4CA 4BAUA 7YASA 4G8BA 3JWEA 4FFWA 2OQVA 5ALWA 2WLSA 5AI5A 2JGEA 4ZI5A 5CBKA 1C7IA 4I19A 1ZD3A 2OCIA 3AZOA 5CH3A 3CXUA 2GYUA 5CH8A 4CG2A 1XRLA 4QEKA 5CTAA 6YASA 4BRZA 2J3DA 3PUIA 3ESAA 4FLEA 3D2CA 4UHFA 4K5QA 3R0VA 4LIPD 3ANSA 3FLEA 2WJ4A 3QVMA 4BDSA 3I6YA 3EIOA 4PSDA 1A8SA 2J3QA 5AM0A 4ZREA 4QDXA 1TAHA 3BJMA 4Y2VA 3RKSA 4DLNA 4J7AA 3H19A 4W63A 4W1PA 1THGA 1MT3A 3IB3A 2HRQA 1A7UA 1F0PA 2I3DA 5DLPA 4HRXA 2CMFA 4EY4A 3BIXA 1MN6A 2QVBA 1GPNA 4BC0A 4ROTA 4FBMA 4PO3X 5ALRA 2AJCA 4W1RA 5AI9A 4H7IA 1HKHA 2QZPA 1W52X 1H23A 5EHQA 1YS2X 1WHSA 5K3BA 4AXBA 3H18A 2YYSA 3WK8A 5JD4A 5J3JA 3STYA 3V1MA 2GBIA 2PU5A 1D07A 1JJBA 2ONCA 5HQ3A 3B3QA 5E4JA 4KE6A 1OXMA 1VXOA 4MYSA 2G5TA 4UBKA 4UBOA 5AI0A 3WL6A 4O08A 5AM4A 3W05A 1HQDA 3BE8A 1A88A 5CT4A 5ALPA 3AZPA 2WIDA 1LZLA 2GYWA 2OXEA 2CBGA 4C88A 3W9BA 4DNOA 3BJRA 3HYSA 4Y7DA 4DMHA 1XZCA 2CJPA 4GHWA 3C6XA 1G66A 1BCRA 4L3WA 3UMJA 3WLAA 3C45A 2PM8A 3PF8A 2FUKA 4UBJA 4DMKA 4MJ3A 3FLBA 4AO6A 4KE9A 3OPMA 4ZWNA 5BV7A 3PI6A 5JAUA 1YCDA 2C58A 5LZ9A 4N8SA 4AN1A 2QKYA 3V48A 3WK7A 3I1IA 3ESDA 4OD0A 1IVYA 4BC1A 3WIOA 3TEJA 1BRTA 1R3DA 3VVMA 4BRSA 1CUSA 1K5PA 1MNQA 3V9AA 1TCAA 2DSNA 4G5XA 2FJPA 1CUEA 1ODSA 1FFAA 1GPKA 2ZYHA 2O2GA 5AICA 3V1KA 5AK4A 1BU8A 4AQDA 4BBZA 3WKDA 5LZ5A 2XUHA 4UHEA 4H7KA 4HAIA 4F0JA 3S2ZA 2LIPA 4M0EA 3G0IA 1YR2A 2G5PA 5JAHA 4OPMA 1WM1A 1GKKA 1GZ7A 2BAGA 4E46A 4EZIA 2HL6A 1YAJA 3BXPA 4KAJA 4BCBA 4X00A 5EHZA 2QM0A 1K63A 2WIJA 3O4IA 2WU4A 1MTZA 2E3JA 4LKOA 4WCVA 5HCUA 2XMDA 1K8QA 4WFJA 4GDMA 2JGIA 3WKCA 1P0PA 3H2IA 1QO7A 1VZ3A 2JGLA 1E89A 5K3FB 2QXUA 3R3UA 1MX9A 2AXEA 2W6CX 2RI6A 5T4BA 1EVQA 2ORYA 3SC2A 3DJYA 1TKRA 4QDZA 2WKWA 1DWPA 5C8VA 2BKLA 5JZ9A 2WTNA 2AJDA 2XUPA 3N0TA 2XUJA 4QDOA 4FBLA 2WILA 4RE6A 1DWQA 3EQ8A 2OPHA 3W04A 1EA5A 3AIMA 1XLWA 3B5EA 2ACKA 5K3FA 2ZJ6A 3EF3A 4C01A 4BATA 2HU7A 2XUIA 1B41A 3I2JA 4PV7A 5HK8A 1QGED 1R4ZA 2GZSA 2DQZA 2IIVA 1FSSA 5AI4A 4ZXFA 5D7BA 4H35A 3QMVA 3QH4A 2HFJA 2XUKA 3PF9A 3GFFA 1CLEA 3MUNA 3WK4A 1CUAA 4C87A 1CUCA 4IHAA 3VVLA 1ZGBA 2D5LA 4DTCA 1JT2A 1LLFA 1QONA 3NUZA 5C8XA 4K2AA 1ACJA 4B85A 5ALHA 3K9BA 4EY5A 5ALQA 4S0XA 2Z8XA 3H2GA 4G4JA 4M0MA 2FX5A 1DX4A 3EQ9A 5JIBA 2OGZA 5AOAA 1EI9A 2HRRA 3QPCA 4MEAA 3ZWQA 4MWSA 4UFPA 1QFMA 3M81A 1CUIA 1VLQA 1CQZA 5IVKA 4TGLA 1U8EA 1XRMA 2HA2A 4DNPA 2GBGA 1E66A 2VSQA 4U2DA 4UPDA 2B4KA 5A2GA 1A8QA 3DOHA 3WK6A 3NOXA 3BF8A 3NGMA 2XMQA 3EBLA 2H7XA 1TK3A 1HDEA 1PFQA 5K5EA 3FNBA 1CV2A 4MYDA 2VJCA 1TQHA 2JGJA 4KACA 2XMBA 5HF9A 1JKMA 1PJAA 3WKBA 4X94A 3KSRA 2ACEA 3KDAA 4U2EA 1R9NA 4IQ4A 3TGLA 1SCQA 5LKAA 3V1LA 4BDTA 3WJ2A 1RP1A 1GPLA 5D6OA 3G9XA 4GXNA 3D7RA 4UBIA 4OYYA 2WIGA 4FNMA 5A6VA 2XUOA 4P08A 1CR6A 2C5GA 4UBMA 3T52A 5ALYA 2ZJFA 4IH4A 4BTLA 3LS2A 3CN9A 2PSFA 2G4LA 1P0IA 4UHCA 2P8SA 1TIBA 5AKJA 2XMSA 3WA7A 1QE3A 5BWCA 1YB7A 3BF7A 4B9AA 1IZ7A 1L7AA 1WB4A 1XKTA 3R3YA 4ZV7A 3AIKA 4HVTA 5A71A 1CUWA 2WG1A 3WWOA 4M0FA 3FYUB 1MNAA 2PPLA 4IH9A 4RGYA 4UBLA 4MQLA 1Q84A 2HA0A 4A16A 1ORWA 2JBWA 1Z68A 4DSAA 3BL8A 3H2HA 1XQYA 1ZIXA 4B0OA 1TRHA 3VDXA 4BAZA 1R9MA 1CIJA 3WL7A 2WG2A 1XRNA 1XZDA 5LZ4A 3L1JA 5IH7A 3A2NA 1JFRA 3OOSA 1T2NA 1W75A 5CXXA 4TVKA 5A7HA 4Y2UA 4Y2QA 2HA4A 4XWGA 5AK5A 3NWOA 2QJRA 3HABA 5HF6A 1CPYA 3FYUA 2PSHA 1ZD4A 1JJFA 4GWLA 1RYYA 1BN6A 1P0MA 4WY8A 3HC7A 5CT8A 1Y7IA 5FUMA 1N8SA 4ZV9A 2FJ0A 2Y2VA 1HL7A 2OLEA 3AZQA 3G9UA 3DYVA 2JGMA 5AM5A 4HXEB 5FKJA 1E8MA 3HZOA 4X92A 5JADA 3DDUA 3BWXA 2Z3ZA 5JYCA 1OILA 3SK0A 3F96A 1ZI6A 4BAGA 1XZBA 5ALUA 5FRDA 4H77A 1FJ2A 1CRLA 2XUGA 1F0NA 2Y2UA 4X6XA 1R88A 3DEAA 1FFDA 3I2HA 4X97A 4Q3KA 3O0DA 5CT6A 3TRDA 5FPPA 5HFNA 3LP5A 2C0PA 2Q0XA 2YXPX 5ALOA 1UWCA 2QR5A 1YS1X 3UUFA 5HKBA 2C0QA 3WZLA 1QIKA 5KREA 2HFKA 1FFEA 1ZD5A 1NU6A 3LIPA 5ALTA 5EGNA 3C5VA 3FCXA 1GKLA 1FFBA 4EY8A 1MAHA 3HXKA 1XRQA 1LPBB 2G63A 3D3NA 1K6EA 4CIBA 4PF1A 2I3ZA 5EI5A 3R3WA 3HRHA 4EA6A 1VE6A 1QO9A 2HHAA 1QIJA 5FOQA 2QUAA 2Z3WA 1CUFA 3E4DA 1ZI9A 5H3HA 1JU3A 4BCDA 4ETWA 1BN7A 4RE5A 5HF5A 1IUPA 4Y2RA 5AI6A 3OURA 2J4CA 2RIPA 5FXMA 1ZJ5A 4K6HA 4X91A 2XUQA 1OCEA 1WPXA 3RM3A 4Y2SA 4K6GA 3G9TA 4B7ZA 2W22A 1LGYA 5C7YA 1XRPA 3RK4A 3H1BA 5DTJA 5AM3A 5CURA 3WWDA 4OYLA 4FKBA 1MJ5A 5KWJA 4CG3A 3MVEA 4BTVA 1R50A 1QJ4A 2AJ8A 1UT6A 2XQJA 1CUDA 1UK8A 2QTBA 4H7HA 4LYDA 2RHTA 2BUAA 4HRYA 1CUGA 2XMCA 1XZEA 3I2KA 1R1DA 3PE6A 2QOEA 4WDQA 4J0HA 1XZGA 4BVJA 4XJVA 1QTIA 3QITA 2IITA 4EBBA 5T4FA 3W06A 5DJ5A 1ZD2P 4X7BA 3O9VA 3D2BA 4FNGA 4DM7A 2JGKA 3I2IA 1AURA 4JNCA 1Y7HA 4H7EA 3DD5A 4X6UA 5EIAA 1W4LA 2WU3A 5EFZA 2XB6A 2C4HA 3DL7A 3YASA 2DR0A 2XQIA 5F4ZA 1EH5A 3DNMA 4PSCA 1EB8A 4FMPA 1LBTA 1UXOA 1YAHA 2VEOA 3ICWA 5AKXA 1VA4A 4BYMA 4JH0A 2JF0A 1SCKA 4BE4A 3I1YA 3EQ7A 5AM2A 2O2IA 2RONA 5A7FA 3HLKA 1TCBA 1LZKA 5ALKA 4X93A 1K4YA 1UK6A 3X3HA 2OG1A 3IUQA 2XLBA 2WTMA 1Y37A 2PVSA 1WHTA 4OSEA 3OTQA 4KE8A 1X2EA 4B81A 5BWBA 1J07A 5E4TA 4B6GA 4U2BA 1J2EA 1IZ8A 4IO0A 1UKBA 1EDEA 1XZMA 1EDDA 2WUEA 3TJMA 1EVEA 4C4YA 5DYYA 5ISMA 4FDMA 1LPNA 2GZRA 1A8UA 1G5FA 1DWOA 1L7RA 3I2FA 3VJMA 3KOOA 4G4IA 1DU4A 1IUNA 4Q3OA 1MU0A 1VXRA 4PNZA 5FP0A 3DYIA 1XZHA 1EINA 1MO2A 3FVTA 3C8HA 3QPAA 5ALVA 4X3CA 5CT5A 4FOLA 1B6GA 3A2MA 3D0KA 3GBSA 1UK9A 4CFSA 1LPSA 5K3CA 4TPKA 1ZI8A 5AHXA 1XRRA 1EK1A 2WJ6A 4P92A 2V98A 4LXHA 2HDWA 1VKHA 3K6KA 5JAOA 3A6ZA 1WCYA 2ZSIA 4AB1A 4B9EA 5LZ2A 2OGSA 3DKKA 1BCSA 5K3AA 2ZVDA 4J0KA 3I28A 1LBSA 2ES4A 4AN0A 1YA4A 4LHEA 4X90A 3IIIA 5I8PA 3WA6A 2H1IA 4Q05A 3QPDA 4U2GA 1LPPA 3G7NA 4EUSA 3MGAA 4B0PA 1RWQA 2NW6A 4Y9SA 1AZWA 2WUDA 3QM1A 4X71A 1XZFA 2O2HA 4WDRA 4F5ZA 5AKYA 4GECA 3ZI7A 2OAEA 1QIHA 2XUFA 3U0VA 2CUTA 5JZBA 1N5MA 4CG1A 4G8CA 3KWFA 1BROA 4CCWA 3KD2A 3LIIA 3LCRA 4HXGA 1JMYA 1ZOIA 1TCCA 1UFOA 1AUOA 4UUQA 3FYTA 2DFPA 4GLBA 4DGQA 3QMMA 2EDCA 2JEYA 4QE3A 1MPXA 3H0CA 4UHBA 1XZJA 4QLOA 2BCEA 4ARBA 2GYVA 3CCBA 2OCGA 3KWJA 1LPOA 1MX5A 1WPRA 3WWCA 3E3AA 3MUOA 4LYEA 5JAPA 2WSLA 3WL5A 4G9EA 1AKNA 1Q83A 2VAXA 3GA7A 4BP9A 1E8DA 2HA6A 5ALMA 2HU5A 4W1SA 3ANTA 3H04A 1DQZA 4KRXA 3SWWA 2V97A 2WFZA 5AKLA 5HZGA 5JZSA 2WHPB 2WFLB 1DX6A 3FVRA 5E4YA 1XLVA 5AKZA 1W6RA 5ALGA 1X2BA 4HZGA 3R3ZA 4G9GA 4N8EA 2WIFA 1SOMA 5I7UA 3P2MA 2VF2A 4AX4A 1VJ5A 4B84A 3AIOA 4OU4A 2PKYX 1AGYA 1BE0A 1N5RA 3QMWA 4DNQA 4BVKA 1QTRA 5LKRA 2Y6VA 1Q0ZA 1KU0A 4WFIA 3WI7A 2BGNA 2ZJ7A 2WHPA 5A62A 2WFLA 2XQFA 5LYYA 4FLMA 1G42A 2B9VA 2HM7A 5AH0A 3CCCA 3VJLA 1IUOA 3AFIA 4LXIA 1GGVA 4H7JA 3ZLVA 2BUBA 3PFBA 3C6BA 2VATA 4FFVA 1QOZA 4MXDA 5DNUA 1QIFA 2Z8ZA 3ZLUA 3H2JA 3WYDA 5AK3A 3JYHA 1XROA 2V9ZA 5AKHA 2WHRA 2QXTA 1U4NA 2QMQA 4QNNA 1I6WA 4MQMA 1E8NA 1USWA 5EHXA 4WFKA 1CFJA 2HA3A 3ZLTA 3O9MA 2WHQA 3W2TA 2UZ0A 3IURA 3JW8A 3GUUA 1M33A 3IVMA 5YASA 1CUZA 1EXWA 1ETHA 1SCIA 2PSDA 4Z49A 5DYTA 5AKEA 1YSCA 5LZ8A 4PQEA 5D3ZA 3R3VA 1EK2A 1XFDA 1O6FA 2BGRA 3RARA 1CUUA 2QRUA 4J03A 3M82A 2XUAA 5CH5A 2VJDA 3VJKA 5DYWA 3G0GA 5ALNA 2PUHA 3HI4A 2H7CA 4QZVA 3WWEA 3FLAA 5JARA 5AOBA 4KRYA 1G4HA 1W76A 3PFCA 1HLGA 2VT6A 3STWA 3FYUC 1MX1A 1CQWA 3F67A 3IBTA 1C7JA 4YPVA 1CEXA 4L9AA 2Z5GA 1UKAA 2ROQA 1CUHA 5FDFA 1UOPA 2YASA 4F21A 1XLUA 3STTA 1ODCA 1DT3A 1WB5A 4HXFB 1CUJA 3D59A 1UZAA 3G0BA 4INZA 3WZMA 3OM8A 3U1TA 4AZ3A 3QZUA 3VXKA 1DINA 3OG9A 3K2IA 2C5FA 5CRIA 5AIBA 1ZJ4A 1VZ2A 2PSJA 1QIMA 2XUDA 5FLKA 4ITVA 2QJWA 2D0DA 4AO8A 1FFCA 3DCNA 3ED1A 4Y2PA 1SFRA 1UOQA 4H18A 1XQWA 1P0QA 5ALIA 4X6YA 5AP9A 3WKAA 2H9YA 5LZ7A 1XZIA 1S8OA 2PL5A 1H2XA 2OAGA 4YK7A 2Y1KA 4WJLA 5SYMA 4JYPA
chains in the Genus database with same CATH superfamily
3BH7A 3E9MA 4O29A 2B4RO 1JB9A 5BV0A 2ZTMA 3KQQA 3H7IA 4ECAA 4Q7JB 4GP6A 1EB9A 3DVAB 4RVDA 2B20A 3ZGVA 4J2TA 2PX6A 1AX9A 3TCXB 3GZJA 3EODA 3ABIA 4H4CA 1A7AA 1K1EA 1VL8A 1X8JA 2BI8A 4I3FA 1JQ3A 4LNAA 4XX1A 1TKCA 3RSHA 4XD2A 3TQRA 4GSLA 1EVYA 3KOZA 1H2BA 2RBGA 4MPJA 4U2KA 2NXEA 1NHGA 1RLTA 3TLJA 4LYJA 4IQGA 4U7TB 4L72A 1J9EA 1WBBA 1BX0A 3AWIA 4BFUA 3A1DA 3UHPA 2J9XB 1KS2A 1YWGO 1YJCA 4TZKA 5AOCA 2SNIE 3W5HA 4D9JA 2XTZA 1UK7A 2X5XA 1EE1A 3TQQA 3VO1A 1E60A 3QPBA 2C9DA 2HWYA 4RK5A 4I9UA 1FCJA 3JQBC 4WLOA 1R0LA 3V4PB 2O8BA 4N5LA 4X1IB 3IO5A 2B94A 3A6DA 4BN4A 1S3FA 3S8YA 1NVVR 1V3TA 3DJFA 4GI7A 1D4AA 1U0FA 3P96A 4B83A 3JYQA 4LTNA 3OQ6A 3M2PA 4I14A 4MYCA 3GRKA 3RS9A 4AM8A 3IDFA 4L15A 4MR9B 2MHCA 4RHUA 4AJKA 4EEZA 5L95A 1VMIA 4QDUA 2JLCA 2Q3BA 1PG2A 3FRIA 3OPYB 4OFWA 2OXCA 1PJ2A 3DV0B 2FF7A 1UEXC 3HEBA 3OMWA 4M1ZA 3PNVA 1X74A 5L3SA 3WG9A 2IC5A 3J81A 3F9IA 2GBFA 5BNTA 1Z82A 3DTVD 4W7IA 1JHAA 1QGDA 3I12A 2QBYA 1PEYA 3HDVA 1BVRA 1JL3A 4M8NE 2QHXA 5J1TB 1GARA 3DHEA 3TSZA 2REOA 3IUPA 4GLJA 3I9OA 4PGHA 3WJ1A 1KJWA 2GPTA 5BSRA 4E2XA 3CKYA 2O5EA 4D81A 4F3YA 4CPDA 4M9ZA 1KMHA 4F97A 3C5HA 3Q87B 1QANA 4PCAA 4QD3A 1A2KC 1QFSA 3WFJA 1HL3A 1XJWA 1VI5A 2GCOB 1U28C 2K87A 3FWPA 4Y98A 5B64A 2GHRA 2Z6VA 1SBZA 1FP6A 1ZXBA 1EMDA 3ENKA 3QTLA 4HPXB 2JBHA 3SC3A 4HB4A 4A36A 4IUBS 3LP8A 2AN9A 3KYIB 2JAWA 1AGPA 3CLTD 3BE5A 3F4LA 2JBAB 2DWCA 3G5TA 2C5AA 2EL9A 1KP9A 4JBGA 2ON6A 4R6XA 1HDOA 4L85A 5ALZA 3ZQ6A 4YWJA 4IOMA 3HRKA 4NI5A 4Y6RA 3RS7A 2DHEA 1QFYA 3VVCA 3I5MA 3LHFA 5ITZB 4TRJA 4PCUA 4A6XA 1YQTA 4DQKA 3IKTA 2ZYSA 3O47A 3JASB 1J2TA 1NBWB 4UHDA 3GOQA 2IU0A 4F92B 2CVHA 1YQQA 3GIWA 5JG7A 1RIFA 1QIDA 4UXIA 4OHKA 4KPYA 1XNQB 2W4QA 4OUKX 2WKQA 3GMTA 5EN4A 3DKRA 3EF1A 2BM1A 4EQ6A 5B58C 3STVA 2FEOA 3LLCA 4IYJA 3HKDA 4AJEA 3BIWA 3A06A 4QUAA 4PLYA 4UHHA 4YRRA 1BVUA 4WBNA 3T9BA 2PK3A 2JZNA 1ITZA 1EHYA 4NJMB 2FUG6 4UEKA 4ZRMA 1CF4A 4PC2A 1IK4A 3LNTA 1GRQA 2X2FA 5DYIA 2VPXA 5A4MS 4HVLA 3M6MD 3ZGNA 2WEKA 1Z36A 2YHAA 2I03A 3IBSA 1WW3A 3G6WA 3JYNA 4G1EB 2AMYA 2Y9PB 1BKYA 1THTA 2J9ZB 4GU5A 5J4HA 4B87A 2B98A 4AO7A 3L8ZA 3MZ0A 1L5OA 4R01A 3NTLA 3BGDA 3FAKA 3I01A 4XWWA 2ZAIA 1MAVA 3ZE0B 2HIHA 1Z38A 4FU0A 5J9FA 3A9CA 4EHDA 3IDAA 2DPGA 3PS9A 4GKBA 2X19A 3GEPA 5G2OA 5MHTA 1FU4A 2QM8A 4JLPA 2FZ5A 5DP2A 5DLDA 1C7RA 4H0CA 4RKQA 3SQDA 3BC1A 4HDSA 3TLYA 4W7HA 1MGPA 3U39A 4LQ4A 4GZMA 1HE1C 1QHGA 5IC6A 1NMZA 1G0OA 1NJ5A 1PUXA 1CQIA 1N7JA 4YCSA 3AH8A 5EC8A 4JJ4A 1WZEA 4DEVA 3NYWA 4YT5A 1R64A 1O54A 4L9WA 1VIDA 4WBXC 3ZY4A 2VP4A 1CNFA 4RIFA 4U7JA 1G63A 3E7FA 3SKVA 5K0JA 4EW3A 3VR1A 4GPIB 2EFEB 2AK2A 3VR4A 4F60A 1G6OA 2QL5A 2XDWA 5T6MA 3K20A 3D3QA 2Q2VA 1DMRA 3IIJA 5ILQA 1QQ6A 2Z8YM 1Y1PA 5KWEA 3WL8A 2OCLA 3GLQA 5ABPA 2A9OA 1K0FA 1YI8A 2IOFA 2YCLA 3Q8WA 4WNAA 4P8RA 4TT8A 3AFOA 4AX8A 2HQSA 1PWYE 2QMEA 4TV8F 3PFFA 3FCYA 2RC6A 1JZTA 1RKQA 5JT1A 3OOHA 3LFHA 5MGNA 2CC2A 4U1RA 3NTXA 4OKIA 3TNJA 1S2GA 1IQRA 2AH5A 2O54A 4X85A 4CF6A 1J0CA 2NUPB 1GUBA 4TYQA 4QJBA 2X1LA 5H5JA 4AUNA 4GUAA 5BSFA 1O96B 1PJTA 1GTVA 1FXWF 3DEJA 3WIUA 4HX9A 4EI2A 1SUDA 1RXIA 1V25A 4LNUB 1K0UA 1XTUA 2AVNA 2C95A 4PCVA 4ENPA 3I23A 3FXAA 3H2SA 4WKNA 5CVJA 5CXUA 1A4RA 4J9VA 1F1BA 1KP3A 2WUGA 2DQ4A 3HACA 1A98A 3O8NA 2XF2A 2ZYGA 4RU1A 3RF6A 2EJTA 4Q9NA 4BMZA 3GFTA 3HUFA 5JTUA 3HJNA 3U44A 1Q6YA 3PWTA 4LZPA 3DBLB 3AJAA 2B4QA 4E5DA 4HTFA 4IJKA 1LBIA 1L5SA 3AC0A 2VT3A 4PC1A 4ZJYA 2GUGA 2GHQA 2PQMA 2PV7A 3H5TA 3IJEB 2P41A 4OHVA 1UFVA 3LSTA 3GLHA 4G0OA 5JLJA 3O2SB 4FMDF 5EGSA 4KJXA 1F6WA 1R6UA 2XT0A 4D45A 5LBIA 3ZJTA 4TXJA 2GTPA 2I80A 5JSKA 5TPWB 2NUTA 2YS7A 1IBRA 2J6BA 3BXZA 1XA4A 1JHUA 4M8IA 4R9RA 4RH0A 4R71A 2AI3A 2EBWA 1RPJA 5BOSA 5LSAA 1LH0A 2C97A 3U3XA 5LPNA 2PUFA 1U8XX 1P1CA 1R6XA 2CKMA 5AO9A 1UOOA 2AMLA 2R3SA 2XE4A 1CULC 1Z0ZA 1BMFA 2OVFA 2Y0PA 4RKYA 1TK2A 2NUBA 4XSVA 2RHRA 1FSFA 2DTEA 4PGGA 1C1DA 4PTLA 1SMKA 3HVIA 3HMKA 3OEED 5EUCA 4DAEA 1P9WA 1XU7A 1YMUA 2W9XA 4YQFA 4ZDJA 1X7HA 2FVYA 3EG5A 4GRIA 4P9NA 5EJAA 3V9PA 5EZ6B 421PA 3CRZA 2NYAA 4FYVA 1YOBA 4Y7CA 2QL9A 5TLSA 4MX8A 5AVXA 1SCUA 3AUKA 5IFLA 2QAGC 3RSLA 2AEJA 4LCJA 3COJA 3ZHQA 2BW0A 2NVOA 4G97A 3UG6A 1YHZA 3SZRA 5BR8B 1KZHA 2Q3FA 3WYAA 1AV6A 3LDHA 1ELOA 5EL0A 5T57A 4CTJA 3ESBA 4MZDA 4NV0A 3T61A 2PH1A 2BBOA 2FQWA 1UKCA 2PCJA 4HH0A 4GZLA 2VA9A 4OP1A 4DA9A 2BWJA 1IIBA 3WIBA 4BKUA 5LN1A 3UK1A 4FGUA 2FN7A 3O8DA 2PL3A 4B3XA 5ICEA 2YICA 5ALJA 1H1LB 2JDIA 4ARIA 1XMSA 3OQPA 3KELA 1V5IA 2CHUA 1IEWA 2WIAA 4IZIA 1TLTA 4BKPA 1E0DA 3NJ8A 1N6NA 5JD6A 2A1TR 2HNKA 6Q21A 1H42A 1X1DA 4CLOB 1QR6A 4E33A 1B00A 3EFEA 3TZEA 2QORA 2G04A 2QRQA 2H7VA 2R96A 4GZ3A 3CR3C 3T9FA 1YUMA 4ZYTA 1TF7A 3DBHB 1XWFA 1ZMXA 4WCDA 2V7EA 4WKGA 5KQMA 1QIEA 3NCTA 3TAXA 2DFNA 2R8BA 3OEHA 4LJRA 2NNWB 4QVKA 1LD3A 1SOAA 2V7TA 4ZGWA 4DF3A 4S3MA 1ZIPA 1E3QA 5T5QA 4CI9A 2FPLA 3HCPA 3ICPA 4GPTA 5ERYA 4M9CA 1NQOA 2D54A 3QP9A 4HQNA 4E4TA 4Z3KA 1QQ5A 1QX4A 1GHTA 3GBPA 3SVLA 4JJEA 5KDOA 4K9SA 4WKBA 5HJ7A 2HKIA 3B2EA 4R8KA 2ZUCA 1CJUC 2W2KA 3JWJA 4GRDA 5LJLA 2OZEA 4XYMA 3ZGYA 1B1CA 3MJCA 1ZLYA 2NZWA 2ATEA 2QN6A 3L4EA 3S2SA 2O8CB 4BNDB 2YY5A 3AHEA 3ON5A 5IEJA 2YY6A 4TMVA 3QOWA 3AL2A 5JHHB 3A3OA 1JQAA 2VZLA 5AT1A 1Z6GA 3VHQA 4ZOLB 2WKPA 1Z6YA 5HS6A 1NDQA 3UOWA 4DYHA 3CLHA 5J63A 4YY3B 2XQGA 3HCAA 3NIDB 1RYNA 4J0JA 5H7XA 2QRGA 5K0ZA 2AG1A 3PEFA 4MMYB 4AJLA 3IBYA 4LMAA 4D5EA 3K0FA 5FPKA 4W5RA 2ZM6B 2HSJA 3O92A 4D99A 5JMTA 2PH7A 4I3HA 1O4VA 1HE8B 3EDMA 2BKXA 4K81B 2CLFB 4YR7A 2Y4NA 1HYEA 4L8VA 4P81A 2C2XA 5L9AA 1XPRA 3OJEA 1RIIA 5DXAA 1JEDA 1W2WB 4QM6A 3GELA 5IC5A 4B45A 4C7JA 4QJ4A 2JH9A 2HV8A 3UUEA 1ZU5A 3DZBA 4RA6B 1CUYA 4QSMA 3PGKA 1W4BA 2JHAA 2NU6A 1I33A 1MABA 1QLWA 5E6UA 5AM1A 5IHXA 2XAUA 4LBZA 2LCQA 3WYGA 3ZW9A 1K97A 2RGRA 2X0RA 4KFUA 1U2RA 5C7LO 1J0XO 1OAOA 2HMUA 1USVA 2W2XA 1JSRA 5KUTA 1Z16A 4HL6A 1W46A 1ZITA 1UXIA 2G07A 2P9TA 2QLFA 2WZDA 4KSYA 4L0CA 5KOHB 4A1FA 5JNUA 3H86A 1K5GA 2O50A 5LB4A 3KL4A 4G5HA 2FPGA 2VRNA 3D31A 3QVGB 1CUBA 4HLUC 2CNWD 4IIDA 4OV6B 1BEEA 1IVSA 4E5NA 1RWVA 2X7HA 4KE7A 5D5PA 1W36B 4U7WA 121PA 1X7WA 2EWVA 2PSEA 3VMMA 2GARA 4J0DA 2IOHA 4EGAA 2V58A 2YWHA 1GAWA 3M5PA 4NX2A 2VRWA 1BDJA 4QNRA 5FHRA 2QYSA 3L7MA 3LCCA 1Y8QB 4N0DA 4YB8A 1N2BA 3LZCA 2JCXA 2PA3A 1V11B 5EIEA 4Z9YA 5CDUA 1RWPA 1NOKA 4ZCPA 1K8ZB 2WT9A 1BEZA 2IHTA 1F4LA 2OB2A 3EVDA 2XYVA 3GZNA 4M22A 1O6GA 3T4PA 1PBNA 4G0UA 1GR0A 2XW6A 2IY7A 1ZZEA 5JRZA 3DOJA 1USUA 3B1VA 4RNCA 4C7XA 5IULC 2QYTA 1FFYA 5EZYB 1YD7A 3NPAA 3AY6A 1J22A 2IU4A 3C7AA 4FS3A 1KJZA 1MOPA 1AXRA 2GEUA 3ZTYA 5H9WA 4KRFA 1MA3A 4YJHB 4B6EA 4ZHQB 5K3DA 4F3TA 4D8YA 1FMLA 3E48A 5LIPA 1Z7GA 2R7LA 5HZKA 1MG0A 4QGGA 4F45A 2CDBA 2CNOA 1RLIA 1WCWA 2C1EA 2C9ZA 2Q6VA 2ZR0A 1UPXA 2X4LA 2PU7A 3HLTA 1YASA 2OQIA 4PVDA 1J99A 1BXKA 4I66A 3UB3A 4LDAA 2QRVA 4EH1A 5FV4A 4IQFA 3PFIA 4FVTA 3SYRA 3MWDB 5I45A 1SOUA 3SVTA 3AVYA 4ARAA 1IQPA 4FZ3A 1YMQA 2VYNA 1LBHA 3DEFA 3FOCA 3ZLJA 4AP5A 3OPNA 3RC7A 3I83A 5TQJA 9LDTA 1QYVA 3EFHA 3OC0A 3TW8A 4JR1A 2HY7A 3T3GA 2J5BA 4CCYB 1TQ2A 1ZK0A 2HADA 3G9ZA 3MERA 1V95A 5CEEA 3TYXA 5EIFA 2IX3A 5TVKA 3EOZA 1UXHA 3GH3A 2X2OA 2XH8A 3W77A 5IKXA 1BHO1 1C0IA 1PDOA 3KR0A 4LQCA 4E2ZA 4YJFA 1WV1A 3MCUA 1NPDA 4MWZA 2JH3A 1IRXA 2LDXA 4XYGA 4FWBA 5F52A 3F98A 3LM8A 1ONPA 2EFCB 4YRMA 1ZINA 1ACLA 5DNWA 3WVNA 2R8EA 1E3SA 1EXDA 3ZV4A 1L5KA 3E0XA 3Q3IA 4XM2A 4B09A 3QHPA 3KT8A 2FRDC 2IVFA 1BDBA 4LZAA 2W90A 5EXPA 3OE4A 2C7BA 3IL2A 1H4SA 2ZI9A 2OCBA 5DNEA 4PC6A 3L6EA 2I66A 3RUAA 5HKLA 3THOA 1R6DA 4FTWA 4Y2XA 4Z4FA 2JAHA 3ND9A 1UC4B 3W1WA 4RVUA 4OY3A 1DS6A 4QODA 5L40A 5JU6A 3E9CA 2E5LB 1Q0HA 1PNOA 2XITA 2AZMA 5CBPB 4M1KA 3IV7A 5IJ0B 1X0XA 1IQ0A 3K8QA 1GO2A 4KXXA 4N54A 5IVHA 4GBED 3UWDA 1M83A 2NG1A 3GD7A 1Z8FA 3KEMA 5EE5B 4IDFA 1SG6A 4B43A 2REQA 3I64A 4BZWA 3IEPA 2AFIA 5GJVC 2FUEA 3IOYA 1IG3A 4ND7A 5LBTA 2Q5HA 3H97A 1GNRA 4J75A 3VTZA 3ZUGA 2TSYB 5ICGA 1YJ5A 5KQPA 2B6HA 2GX6A 3K8ZA 3KYBA 5SY9A 4QTZA 1X42A 3T38A 1JQJC 3JWHA 9MHTA 4E15A 4CDGA 4PC3A 2F3RA 3PDCA 4KN9S 4ZOAA 4C89A 3MTIA 2P4UA 3A04A 1RXUA 4FMCB 3WMRA 4F96A 4JLUA 4ALNA 3OETA 4MW9A 4ZJUA 2FRVA 2NWQA 5JY6A 5K03A 3VKHA 3D8BA 2PS1A 5AW2A 4M1QA 2PKEA 5JNSA 3B1XA 3M83A 4RIGA 4B3DA 2A33A 1V71A 2FGJA 3E6AA 1E0JA 3ZNOA 1RWBA 4ZD6A 4RD4A 4W1QA 5FTJA 4E5KA 2HJGA 2ZJBA 1E2JA 4NOKA 4ZVVA 4HNHA 1U7PA 3WC4A 5LOVA 1T8SA 1OWNA 2VG8A 1PS8A 1FTYA 1MPTA 1V4VA 2O4CA 4J3JA 5B3LA 4G4GA 5F78A 1W73A 4LYGA 2AEFA 4LXTA 5JSYA 5BN4A 4HGQA 3B82A 3AV3A 3PSAA 3I61A 3INRA 1JZSA 2A7QA 4J0CA 5HF8A 3G2IA 2N0SA 3K32A 3P2KA 3NATA 3VFDA 2ODTX 3ANYB 4EM6A 2HN9A 1RBMA 4CL3A 2ODQA 4UM8B 1HZJA 1R4MA 3F9CA 4DJAA 3RW9A 3PTLA 1KY2A 4IDPA 5AHWA 5B4VA 1REQA 1EDBA 1AMNA 5HK9A 4BN0A 3GK3A 1E3IA 1P4AA 1QUFA 3NEJA 1R2QA 5EIHA 4O8CA 5FLEX 1KAEA 1W88B 3IHWA 3PICA 4KBGA 4QXQA 1V26A 4Y9TA 4CHTA 2KHZA 2MYNA 3G2NA 5DTIA 2E1PA 1QPGA 3H17A 2HO4A 4PFKA 2Q4RA 3EFOB 4PEVA 2PD6A 3V80A 3CR7A 3GAMA 3JQ7B 5KTNA 4PLVA 3KZXA 3G2MA 2B78A 3COSA 3K31A 4JJFA 1VA5A 1AF7A 2Z2JA 5KX5B 4JODA 1EAMA 3MAAC 4G2NA 1J9GA 4B7AA 1Q20A 2IPMA 3DNPA 2WNHA 3HI6A 1EX6A 2BI4A 1UWVA 1KL7A 3KR1A 1GITA 1TMOA 2DLNA 4I1SA 4L73A 4OFZA 5KOIA 1AHHA 4PG7A 2W0SA 3C87A 4ZOLF 5HDQA 2V45A 3D6JA 3QLVA 1ZMRA 3FGNA 5AJWA 1BVHA 2XDQA 2B2XA 3ABRB 4C7KA 4RQTA 1KO1A 3FNFA 4YCDA 2Y1WA 4ZOBA 1RBQA 1JR4A 1PFUA 3B7GA 4GW3A 4WOCA 4CKEA 2OLKA 3ELBA 1COZA 2I71A 4E51A 3K96A 5ECYA 1HFKA 4CV1A 3ITEA 3TL6A 4BAUA 4EG4A 4G8BA 4GR4A 4KQEA 5DHRA 1NTOA 1HDZA 3G2OA 1Z8DA 2QUKA 1N6IA 3DMYA 1Y9DA 4JD5A 3ZD9A 3QOXA 5FWDA 1O5OA 5DBFA 1TAQA 4DSNA 4FFWA 2WYUA 3W5CA 2PZMA 1MV8A 1I5RA 1SPXA 2XNJA 2I7XA 4JLAA 5K8TA 2DQKA 4BFSA 3MCZA 4EG6A 3O2JA 4JI4B 1BJTA 4XGQA 1VLMA 3BQNB 3I9V1 2OD9A 4RAQA 6CHYA 4YJKA 2OCIA 2WY2D 1V8OA 4R40A 5CH3A 2DWQA 4G09A 4TKUB 4LSWA 5CH8A 4YJDA 1UZMA 4IO1A 1IJEA 5H82A 4WUTA 4X8MA 1SUIA 1HT0A 5CAEA 4F9FA 4I4LA 3I30X 4ETNA 2VJKA 3LFUA 3Q2IA 5TSDA 1L7VC 3EWIA 3DAYA 4RPIA 4YRNA 5CTAA 5BN3A 4N4AA 3C39A 1B3BA 4ZHSA 5BW6B 3O0TA 2B8NA 1X8KA 3CLVA 3LQKA 4BRZA 4CM9A 1FYWA 4ZCTA 2Q41A 4RF3A 3FIUA 3Q9SA 2PQ6A 3OHPA 4MJXA 5CA0B 4UHFA 1Z0JA 1PTKA 2WWHA 3IQWA 1EPUA 3S1SA 3DB1A 5DTMA 4GOKA 1H8HD 1U8AA 3NTQA 4Z51A 4OXRA 4NQRA 5MDHA 4PGFA 5LQMA 4F9EA 4NKRA 5C52B 2QSZA 2IQIA 1VP3A 2Q6IA 3ESQA 3B5IA 1L7PA 2WJ4A 3OP4A 3MWFA 1DFIA 4BO6A 1TVCA 4DVGA 2OHXA 3I6YA 4PAQA 5C4GB 3VSCA 4FSHA 3EDCA 2C1ZA 5IAGA 3ZKWA 1MB3A 3ZDCA 4OG2A 3ZY2A 3S3TA 1TMKA 3G85A 3DP7A 4CM8B 1V6AA 3CY6A 3H8JA 1RJDA 1ZP6A 3HN2A 3QY0A 4FSXA 4BO0A 3BJMA 4TYPA 1TZ2A 4S04A 1QFZA 1GVNB 4M7OA 4NE2A 4ZHQF 1DIBA 1OXKB 3RWMB 1HTBA 4QTTB 2OWEA 3AR2A 2NO0A 2V6BA 4NEQA 3SX0A 3FYHA 3RV4A 3GVHA 3D6VA 3GWZA 4N3AA 3KAPA 5LQUA 2XB2A 4W63A 4W1PA 2YOFA 5NLLA 1THGA 4XFDA 1TKAA 1UWLA 4R68A 1M1NA 1XA0A 3F3YA 3WMEA 1TFRA 2OCYC 3LQQA 1NJ8A 3TL3A 4LBVA 1E1RA 2ZPUA 1MT3A 4KBYA 1KOJA 3MGCA 3IP3A 4R2IA 4UE3S 5EMLA 5AW6A 1EVIA 3IB3A 4M4SA 4YRZA 2OM6A 1YKGA 1PQPA 2XY4A 2NO9A 3CR8A 4XWAA 3TUZC 3GYBA 4MW6A 1X7XA 5DLPA 5AW0A 3F6BX 1GUDA 2D5IA 2F3SA 2OXTA 3BXHA 1OOEA 1J49A 4EY4A 3BIXA 2VP0A 3WIEA 2L69A 2M32A 1GUFA 2QVBA 3L3BA 4I1UA 4INJA 4Z1MD 2RHDA 3E05A 1NNSA 4M0CA 1NJ2A 4ZT5A 4P1ZA 4PO3X 2HJWA 2JA2A 5ALRA 1ZWLA 2WI8A 1ZHOA 2VO1A 5JECA 1RJFA 1HKHA 1NVVQ 5ANRB 4CM5A 4FR5A 2HQOA 2Q5IA 1HTWA 3Q7TA 4EJFA 5JJKA 3PUYA 4WCFB 1CVRA 3R77A 4JY7A 5EHQA 3WRXC 4OQYA 3T1OA 4BIMA 4RVSA 1YS2X 2E18A 3W90A 4LF4B 1DJPA 1ZWKA 4R69A 2UZ4A 1WHSA 2IEYA 2IYSA 4BFLA 1LS1A 1YQXA 1WUIS 4PO8A 3HB1A 3V1TC 5GM1A 1T10A 5JFGA 1KQ3A 3BIJA 2OSVA 3PR2B 3WK8A 4ZMRA 4TWJA 1RSZA 4LRQA 5B6IA 5JSHA 1US8A 4FJ0A 2RI1A 2INGX 5MN4A 4JX8A 4ZQBA 4TN5A 5HKOA 4PZPA 1D07A 1RFLA 3KYCB 4IGEA 5EEGA 1WP4A 2ONCA 1JFSA 2GN1A 4JSRA 3UF0A 3NDPA 5E4JA 5HQ3A 1JYSA 2SKDA 2QX4A 1I01A 1IHUA 1XEWY 1Z5WA 1Z22A 3QJGA 4ND2A 4UBKA 4NYIR 5FV7A 4EO7A 3O3OB 5ICSA 1IBLB 4Y1RA 2TMYA 4IX9A 5HHTA 5AM4A 2A9JA 1U4OA 1IZ0A 1NUUA 3LFTA 3NV9A 2E9SA 3LX6A 1ML3A 4L2IA 3V3TA 2OOSA 3C15C 3PGJA 2IJGX 4P0QB 2CWDA 4IY1A 3F8WA 4MP3A 5DISB 4E08A 3FUWA 3PYXA 3NTRA 2WICA 1O9BA 2WIDA 2GYWA 2OXEA 2CHFA 4UUNA 4Z7NB 5B55A 3P0EA 2F17A 3W9BA 1SQGA 2QTTA 3Q1LA 3Q3CA 1CCWA 2QRKA 4HX5A 4MRAA 4DNOA 4FMCF 1CQJB 1T3GA 4WI1A 4JJ8A 5AUQA 5CPFA 1CHDA 2H5EA 4YRDA 2R2GA 3ZTTA 4B5KA 4N0QA 2YJ5A 2WRZA 4R9UC 2C2OA 1DBWA 5LQCA 1W48A 1G6KA 4LYYA 2VP2A 1OROA 3WLAA 4FS8A 5JXHA 1KPIA 2P6OA 1W93A 1R5NA 5IN5A 3U0BA 2FPIA 2JL1A 4RAOA 4DEYA 3P9QA 3PF8A 2DYKA 2FUKA 2VVTA 2ID4A 3NAGA 4OREX 4I55B 5C8YB 5KTOA 4L22A 2MSNA 1A76A 1COWD 1ES9A 3IV6A 1P19A 1PDWA 2QRNA 5JS8A 2OORC 2HHCA 1T9HA 2WV9A 1H2HA 2ZBGA 3K30A 4LY6A 2P9QA 5BV7A 2AXQA 4WA8A 1GEEA 5HNKA 5JAUA 5ADUS 1RABA 4HLQB 5EWMB 4HB2A 3GYGA 3KJNA 4AN1A 4OAPA 4X63A 3WK7A 4YUYA 2R66A 3I1IA 4OD0A 2BHRA 1IVYA 4AJOA 1Y3IA 3GEEA 1X19A 3SVZA 3A9RA 4CZ2A 4DLZA 2OENG 3MMXA 4XUGB 4BC1A 1BG6A 2IBTA 4IMJB 1W2GA 1AD2A 4M8LA 5KYYA 2PGOA 1WETA 3VVMA 5HMLA 4N5NA 1NVKA 4DCNA 1MIOB 3DBRB 2OHHA 2R47A 3BGOS 4LJAA 4EJ6A 2OAQ1 3WYCA 1MNQA 5U4QA 1NYLA 3RVBA 4E94A 3RYIB 4WCFC 1NKVA 4FCCA 2ZR8A 4CM6A 3DUFA 4P3OA 5IXSA 1CUEA 1ODSA 4OMDA 3RS3A 5KX5F 1Q44A 1SHZA 2G36A 2ZPTX 1RW4A 2MR5A 1NPTO 2Y3IA 3CRW1 1PR9A 5CDHA 2WV7A 5AK4A 3N76A 3W9YA 4KGDA 2ERXA 2GZAA 1U5BA 1ZGGA 2H2FA 4G63A 4OUDA 3S44A 3MK31 4I0WB 4BFWA 8MHTA 1AGXA 1JIUA 1ZEJA 3Q5EA 3KKNA 4XDHA 5L4LA 1DHRA 1A71A 3RTAA 2XUHA 1BO6A 3FVQA 4Y6OA 5IT9A 2G9UA 3S2ZA 1QG6A 2IUSA 2ZT7A 3OZIA 4GFDA 4OA5A 1E7QA 5LFAA 2F90A 3U4MA 3O8LA 3KJFA 4MQFB 5J40A 2EG9A 3F6EX 5CG2A 1GKKA 3VPFA 5B53A 4E46A 1H4VB 2OP1A 4YLEA 3CEJA 3RREA 5TS2A 4CUZA 5JCJD 3U16A 2AZXA 1EIZA 4MRSA 1PYOA 5AD1A 1GN8A 5BW8A 5HQTA 2YMMA 1MB4A 1XEWX 2XTMA 3E61A 3NETA 1R6BX 3UWOA 2HHHB 1YCFA 2NTJA 3BXPA 4FDLA 4IIYA 4KAJA 5EP2A 2PXCA 1GZ4A 2GO7A 1LDEA 1IZYA 4B6PA 3H1EA 4O63O 5DGTA 1R0ZA 1OV6A 3HJCA 3NVDA 5ETJA 1P1RA 3QE0A 1HYGA 1MLDA 1PYGA 4Q02A 4EFDA 2OZKA 2QM0A 3O4IA 4BNZA 5C8DA 1Z9BA 1UDRA 4Y67A 1UMDB 2FPPA 3FPHA 2OECA 3EN0A 3P9IA 3AMVA 4WCVA 2UZ1B 3Q9NA 4PZLA 2IDZA 4I2NA 4IDNA 4MJ7A 3GCZA 4V3BA 3O8QB 2Q2OA 4DKXA 1JR3E 1X9HA 2QV0A 1P0PA 3NIBA 3HXQA 3PKJA 1RC1A 4KN5A 1K8YB 4EG8A 2EFHB 5CA0F 4EHIA 1VL6A 2FPXA 1M2VA 2IV2X 3D02A 1ADCA 3CEAA 1TIKA 1JA9A 3L5KA 4NHOA 1TVKB 5JV5A 1JNYA 1KHTA 1P8AA 2SECE 3MQ4A 1HFEL 2WZQA 3DBOB 3PBKA 2P2YA 2HGZA 3MTQA 1QNLA 3BGWA 2NNLD 3RPEA 4B31A 2XRZA 4XTRA 4M9QA 1YV9A 1E5DA 2QXUA 2FA9A 3R3UA 5FQNA 2UYCA 4K1XA 2QX6A 2VWPA 1ZJZA 3AU8A 3VA7A 4A8JB 2ORYA 1SD5A 3FNQA 2H17A 3SC2A 1U1FA 4BVFA 2IHJA 1TKRA 1A0OA 1U7XA 2OXFA 3EPPA 1BX1A 1Y48E 2BGKA 2OV8A 3EZ2A 2O0HA 3AKZA 1E4VA 1JDTA 4MKRA 1DWPA 1H93A 3WGKA 5C8VA 3HM9A 5IF9A 2ABWA 1SUEA 3M7IA 2HWWA 5BO5A 1VBNA 1Z0DA 2PX4A 3F3MA 2WJZB 3KQUA 3NHUA 2XUPA 1BWQA 4PZYA 2QP9X 3DHWC 4C4OA 3THWB 1LNZA 2XUJA 4CQMD 3C7KA 2QT0A 1L7XA 2DBYA 4RE6A 4Y0AA 5DOVA 1LX7A 2A6PA 3JALA 1JEAA 5TMPA 3A4MA 4NJEA 4BLTA 3UXHA 1GDHA 5B7NA 1XJ0A 1EA5A 3N8GA 4GC5A 4NZPA 4OHRA 4DR4B 1YZUA 2LTAA 3O5AA 3OJXA 5LNK6 5E6SA 2BT4A 3P5BA 2ACKA 4X1KB 2ZBUA 3N2YA 3CLRD 1WMBA 2QG4A 3BSWA 3FBGA 1SKYB 13PKA 1DNPA 4UEWA 5K4HA 2QZZA 2HU7A 4NBTA 1RM3A 2FJUA 2FSSA 2XXBA 2JIMA 3QYPA 2WTUA 2W93A 2P68A 5DI9A 2ID7A 1KEEB 3GJ5A 4AF8A 4RULA 1B1AA 1VSTA 4NATA 2B4AA 3RU9A 4DNXA 1Q1AA 1VCIA 1QGED 4S12A 4YP9A 2I22A 1NKSA 3IE1A 4PNPA 1QP0A 1N2IA 2DQZA 2P8JA 3LC0A 2IZ1A 4EATA 1IXSB 3U7IA 4O4LA 3RUPA 5DM60 4AS2A 1QZXA 3G7SA 4LI3X 1P2UA 3TCKA 3ETHA 2W6JD 3RUEA 2C0CA 1LQUA 3LHIA 4UMFA 4A03A 3IJ5A 4OK3A 3WLNA 3T1HB 3COPA 3GG2A 2FB9A 4JUDX 1EVKA 3U7EB 3C3MA 4U6NA 3WK4A 5BMOA 1EG7A 1SD2A 3AUAA 1ZFNA 1OYYA 4UUBA 1GL7A 1XXHB 2HMWA 2QA5A 3USZA 1Q77A 1CUCA 3TPCA 2A4KA 1DJNA 1RXEA 2RARA 1VJ1A 3PQ7A 3GRAA 1SVNA 2JB9A 5BQXA 4BY9E 4OXKA 1JW9B 2W6OA 4H4DA 3RDPA 4XB2A 1I3LA 1K7EB 4QFMA 5CB4F 1MFZA 3PA6A 1UBNA 2RH8A 1LC3A 4HGNA 4FQ5A 3N9IA 3H1PA 5ALHA 5IWCA 1EFVB 2OBMA 2WVHA 1KQNA 5A05A 3FCCA 1NI5A 2DPYA 4TMKA 2ZR9A 3UQYS 2X0DA 3CEHA 5ALQA 3L6OO 4S0XA 3EDYA 3A9VA 4M0MA 2FX5A 4MUGA 1NASA 3WFZA 1GGFA 3I09A 4JI7B 1K3FA 4JLNA 5CLJA 4EPTA 5IT0A 1B23P 1BRMA 2HRRA 3QPCA 4MEAA 3AJEA 3HPQA 3DFFA 4LGYA 1XB2A 2RG7A 1ESCA 2Y0EA 2F3QA 4I55F 2XWBF 2CJXA 2BD0A 1E63A 1RS0A 1W34A 1H6CA 3JYOA 3PC2A 3ZU5A 5B5SA 1R15A 4PXYA 2OCXA 4ZI2A 4QVGA 2CK3D 3RYTC 3OQOA 4TGLA 1FTGA 2EYQA 5HMMA 3V5NA 2COUA 1B14A 2FR1A 2ONZA 2VJLA 2O7NA 2ZZKA 2YVKA 4MK4A 4BRWA 1SVKA 2YHIB 1E1LA 3M4NA 2ZANA 1KSGA 3PNLA 5DHTA 3KSBC 2I54A 3N0RA 1VKOA 2PH5A 3BERA 3BF8A 3UJNA 2PMBA 2PMWB 1GZHB 3NGMA 4DPMA 3MG9A 5DT9A 2NU7A 2XGJA 2Y1LA 4GMHA 5I7EA 4DGSA 3D3JA 3G2KA 1ZW1A 1O9HA 5FOXA 4D0NA 2Z8YA 1M5UA 1T26A 4TRRA 2V7QD 5HUHA 1WD7A 3DWFA 3FNBA 2VJCA 2J0SA 5K0EA 2JCBA 3VAZA 4GEKA 1GNVA 3VBCA 5EIBC 3N6VA 5HF9A 3ZHUA 2JI7A 1OLUB 4WY2A 4ZICA 2IPXA 5F3DA 4BMCA 4EGSA 3QA3E 2ARKA 1TEZA 4HAOA 4C3UA 2VTEA 1E3JA 3DVSX 5DOZA 1FDUA 4TSRA 3SQWA 1G8GA 2R4QA 5AW4A 2VBGA 3HSYA 2QE7A 4AW9A 3HXPA 1SCQA 1SHJA 1XD8A 4FEGA 1B76A 3G0HA 1GRNA 1GPLA 3DLBA 1E2BA 5GGYA 2VF8A 5D6OA 2PR2A 3PXXA 1WZNA 1WDKA 3FFXA 1WEHA 1OUMA 2G7MC 2IP1A 3G9XA 1JGTA 1FTQA 3K0HA 5EIWA 3UAZA 2BTEA 4RA9B 3BIOA 1ISJA 1P4SA 1C2TA 5HA5A 1QC5B 4FNMA 5JXGA 4YMGA 2AK3A 3C1OA 3HY4A 3M4ZA 4G89A 3DO6A 4FNAA 4NE9A 4P6VF 5A4IS 1U3WA 1RLJA 4N7RA 4BQNA 2L2QA 1QRRA 4A0FA 3TTVA 3CE6A 4Z7OB 2Y71A 2C5GA 2PD4A 2M1ZA 4H7PA 3FYDA 5DMHA 4O2RA 2CXTA 5IJZA 1SZCA 1GL6A 5BYAA 4IH4A 2V5VA 3KTAB 1C9NA 4HUQB 1DIRA 1HURA 3L82B 1GFSA 2G4LA 1SAYA 4Z4HA 1TYBE 3DDCA 3DZFA 1BVYF 1P0IA 2FP4A 1VECA 2JVIA 1W0KD 4HF7A 4JXJA 4TLDA 2CJYA 2P8SA 5A6SB 5CYPA 2G76A 1GNQA 1D4OA 1U9JA 2GNOA 2UAGA 3Q5GA 4GSKA 4IVNA 1KJ9A 2QTMA 1N2CB 1Z0UA 1MCZA 1N92A 2GD6A 5SY6A 1RRMA 2POCA 4ISCA 3WWZA 4ETIA 1IZ7A 3T9AA 1WIWA 3S0JA 5DLYA 4YAIA 5JS6A 1GL3A 1IEQA 1O4WA 3AIKA 1ICEA 1KC3A 2BEWA 2WG1A 2FZ4A 2AEEA 1W30A 3UMMA 1MNAA 3FROA 3JZFA 2P5TB 3HY3A 4ENSA 2MYPA 2Q2NA 4GI5A 4NFLA 1NUTA 1OKKD 1QGOA 5LWQA 2QTVA 3COWA 2Z04A 1E59A 4MQLA 5FI3A 1OLOA 4X7PA 1M0WA 1JR3D 2VYVA 1QHYA 2FLKA 3LX8A 3SC4A 2R8YA 1TADA 2PANA 2RG1A 4RGQA 4F4FA 4TM8A 2BFWA 4D43A 5JH7B 1R9MA 3BFKA 1XK7A 4P80A 5LIRA 1W9HA 4LNHA 1XRNA 5HE8A 1K6MA 3UBMA 1UOEA 3BAZA 1HYBA 4KRGA 3WSWA 3RC2A 3A2NA 4ILEA 4A2QA 4CYMA 5DN6D 2NPIA 1SVOA 5JDIC 5KNDA 4TX1A 1L7EA 2FW7A 3KLBA 3KKLA 4MEJA 1ZL0A 3TQSA 2J9YB 4NTZA 4CTKA 1L5RA 3QKRB 3MOSA 4TWBA 5A7HA 2MTBA 4OHBA 1PZGA 4PLZA 1ONBA 2BGIA 4I6JA 2RGYA 4L28A 2VQEB 3L41A 3W5JA 5E7MA 5IK2A 3KAJA 3AHHA 5AK5A 5IABA 3R7WB 2X4GA 3PFNA 4R84A 5KJ1A 3HABA 1CPYA 2OBBA 3CNEA 3SIWA 4QTXA 3P9PA 5AW8A 4QO7A 3ZJVA 2I29A 4ETMA 3PNOA 1E1MA 3O9ZA 2JS7A 2WINI 3TLGA 1L4KA 3DLAA 4TT3A 1T1GA 3CRMA 4DG8A 2RHMA 4ZDIA 1BN6A 5AR1A 1A5ZA 2I4MA 3VH4A 4QG3A 5B1YA 3PXBA 4IVRA 3HO1A 2ORWA 1TTQB 1Y7IA 1ZRNA 2XVXA 4C4SA 2GVZC 4O5OA 2BDUA 1U1GA 4U0JA 1SU7A 4ZV9A 2Y2VA 3ZDYB 5JSUA 2YOGA 4FZVA 3QKSA 2OVBA 3CC8A 3MGBA 1HSOA 1Z6AA 5DGDA 5LUAA 2F9MA 2COKA 1OAAA 4OSPA 4EUEA 5CDFE 2O8DB 1OBHA 3V4SA 2BELA 4MW5A 4AZWA 1AOXA 4GXRA 2J5KA 4X44A 1E8MA 5FKJA 1KVTA 3FPEA 3GU3A 4XQCA 3QF4A 5B7PA 1B15A 1KYZA 3GGCA 3TTUA 3UVEA 3DFZA 2WR8A 4NPCA 3ESXA 1W96A 4RSMA 3RCBA 4D82A 2I5PO 2Q3LA 1N1EA 2JKZA 4IEEA 1N0VC 3OSZA 3RJMA 1EWVA 2I1WA 2GCGA 3S55A 2PEZA 1JMVA 5CJPA 2Q4TA 1ZI6A 4OQQA 2VOJA 3AFGA 3UJ6A 3MJ4A 4C4PA 4UU0A 5AXAA 1MXHA 2CD7A 1ADBA 1N9GA 3GJXC 3FKSD 4EW1A 1OB5A 3QEJA 2WIBA 1T5DX 4AZ3B 4XGNA 3JQCA 4L0MA 1U31A 2IIBA 4JYCA 5CA1B 4I6EA 1CQPA 1FFDA 2YIVX 2AN4A 4RQBA 2F4NA 1Q57A 4ND6A 1CKEA 5ADVA 3O0DA 3BHJA 4IMRA 3UT0A 5CT6A 3TRDA 3VNBA 5B1EA 3LOUA 1A2QA 4FFLA 1KZ6A 4JFAA 2C9CA 1IQUA 2P6MA 3AV0B 3KR9A 2OKGA 3LP5A 4D9FA 5B57C 4WK4B 1GKYA 4W4TA 4A0HA 5KO2A 1UWCA 5KNDH 4KKVA 1FX0B 1K2VN 1OWPA 4CKWA 4KYTA 3O8RA 2PD3A 1NZJA 2EZ4A 3GCDA 1NRJB 2QRLA 1J25A 3WZLA 1PUIA 1QIKA 2QMOA 2BM8A 1FFEA 3FUUA 4LVNA 5AFSA 3H42B 1NU6A 4J4BA 1WBJB 1Q7CA 2AG0A 2BF4A 5ALTA 3PHJA 3C5VA 5MFPA 1KXZA 4LOKA 3GL9A 3EXIA 3K4PA 5I7FA 2FN8A 4IV8A 4LY0A 4MVYA 4C0SA 2FFHA 2QSUA 2BFFB 5TPZD 1QU2A 1NZFA 2EC5A 4N47A 5DV9A 1SH7A 5JRDS 3KJHA 1KOFA 4HBGA 1HDYA 1UUFA 2IHKA 2IS1A 3HCNA 5JC1A 4KKXB 4NPHA 5E4FA 4WLNA 1LPBB 1RHUA 1M6EX 1XFAA 1U1EA 2DG2A 2G63A 3D3NA 3KLMX 2NZVG 2R0QC 1V8DA 1WY5A 2J0EA 3EEFA 2JJ2A 4TLEA 5BQOA 3HB5X 1T2AA 2X2PA 1YNOA 4UREA 1VLJA 3ZVNA 4FBGA 3I2YX 3UANA 2EZ9A 1HORA 1P2SA 3WB1A 1FDTA 1Z0FA 1F3LA 3HRHA 2ONJA 2UUOA 3DOCA 4UXHA 2BCGY 4YN3A 1QAQA 2NVWA 3FHLA 1QO9A 2VNSA 3LBNA 4XVQA 5DO9A 3RR2A 3WGOA 5I9BA 2AR9A 2IW1A 3I76A 2PMEA 4LEIA 1L4GA 3QNMA 4PYLA 3RT9A 5FOQA 2Q2WA 4M54A 8ATCA 1O0SA 1CUFA 3E4DA 5FUYA 1ZI9A 3UJBA 1T5HX 3LWZA 1C9YA 1JFLA 2XGMA 3ZZNA 1E99A 4JITA 1GA4A 3TKAA 3LBHA 2VJPA 3T7KA 1JU3A 1KH2A 3FMVA 4ZKEA 4BCDA 1JR6A 2NX2A 5B37A 2V3VA 4ZQIA 1IFXA 3BEDA 3AI2A 5HF5A 3QPVA 1XCJA 2GCEA 1K6JA 1IUPA 2WJYA 4G0YA 4IJMA 1OR8A 4Y2RA 1KYXA 5AI6A 2MR6A 3P97A 3ZY5A 2GEKA 1W36D 4LJ7A 3TR5A 3K3PA 4PPQA 1PF7E 1ZVMA 2EP5A 2V3CC 3ZWWA 3B1KA 2PX8A 2Z56A 5F98A 2XZOA 1QS0B 3N2GB 3O73A 3RM3A 4MCJA 4K8OA 4Y2SA 4K6GA 1SPBS 2XXAA 4MTLA 3HUEA 4OMUA 1KK0A 5GV8A 4D9HA 2J59A 1PG0A 3EZNA 3QBTA 4ZI7A 4ES6A 4EPWA 1YK0A 3E9NA 3PEUA 4HDKA 4R2LA 5CURA 1MEJA 1Y5NA 3C3AA 3EXEA 2J32A 4R1UA 5D84A 4F2GA 3VPXA 4MLPA 5B12A 2O2YA 4OYLA 1YL6A 1F20A 3NRJA 5KWJA 3P9KA 3KT6A 3NM4A 4CG3A 2VBIA 3K1AB 3MPOA 4BTVA 2HRBA 2WSBA 1J24A 2Y27A 3KQWA 3O3CA 4ZALA 2LWIA 3CEPB 4HY3A 5T6BA 3F73A 4LV8B 2CUNA 2C4VA 3E58A 2PWYA 3PSHA 2OBNA 2XQJA 3KXIA 1NP6A 2P90A 2HH9A 1NAIA 2GK3A 2UUPA 1ZJ6A 4UNRA 1WO8A 4IQ0A 4Q48A 3KYDB 4LMBA 2R44A 2QTBA 1NNEA 4RTNA 1TZBA 3CLSC 2EJVA 2AOUB 1IDOA 4LYDA 2RHTA 4U3JB 5J4KA 3TK1A 1URPA 1XZEA 1E3WB 5DRYA 3DLCA 4BE7B 1DLJA 1EM8A 1R1DA 3EYAA 3PE6A 3LKZA 1IBMB 3CH4B 4EFLA 3JVIA 3JQAD 4J0HA 1XZGA 2WOJA 2VTBA 3RAFC 3AL0C 2A0UA 1IHYA 2HT6A 4YQYA 4OQNA 2VYFA 4UVGA 1SCBA 3K1JA 3HA7A 4HAVA 4KMMA 5JH7F 1IN5A 4NF2A 2J0QA 1U7HA 2E55A 3OMXA 3U7QA 4CMKA 3I04A 2ZTHA 2WKSA 4C29A 2WNSA 2G1PA 2QRPA 4Z2YA 3I5XA 2OZLA 1NVGA 3K4QA 3EZ9A 4QKQA 4KIJA 2ZRIA 3W06A 1OJLA 1Y4SA 3BWCA 5LDHA 4F6LA 4ZQEA 2C78A 3PK0A 4NYIQ 4QYXA 4BKRA 4KGZA 3M4JA 2Y4OA 2QVLA 2BTQA 3O9VA 4LY3A 4AJ9A 5CITA 5HDBB 1OZAA 4DM7A 2JJ8A 5GADl 2ZIGA 3OM9A 3CZCA 3LT2A 3TWOA 1DPFA 1OX5A 5EPEA 4JASB 4NBVA 2BMJA 3PHCA 4EJMA 1RQNA 3RG2A 4HFRA 2DBQA 4H7EA 4EL5A 1FNNA 1DG3A 2JIZA 2EARA 4X6UA 2BE9A 1NVMB 5EIAA 3PNMA 5JCZA 4JT2A 5EFZA 2J9FA 1R5JA 3ZWNA 4G37A 5BUQA 1EJBA 1M2OA 3X1XA 5I8WA 1CDZA 2I7TA 4XZ3A 3OJLA 4K86A 1MTOA 3FUTA 2DR0A 1G17A 2XQIA 5CVUA 1XDUA 5FX2A 1O95C 2EIHA 1GLVA 1TA4A 1Z8NA 4DCUA 3OY2A 1JG7A 3A1NA 4F9TA 1DADA 3DNMA 1PS9A 4PSCA 3KPVA 4K46A 1CR1A 2VPZA 3SZGA 3L6CA 3I9KA 3WB0A 4KVFA 1LBTA 3R0XA 4ZZ0A 1YAHA 4LCBA 1QCCA 4WH0A 3LUKA 1YZ3A 3A1TA 2PLRA 5LDDC 4DV6B 1XLTA 3IP5A 4LE1A 1HFJA 1BMTA 4HN9A 1WAMA 4LBYA 4WZZA 3RBAA 4BYMA 3NOOA 5JD5A 2R87A 2GK7A 3COVA 1HSZA 3GLFA 3IQZA 3FCUB 3NX4A 3SHOA 2G7ZA 3I1YA 4YTEA 3NC4A 3GDGA 4YYEA 2RHCA 4JSYA 1KY4A 1U2TA 3CGWA 3OE7D 4OBWA 1AQ6A 1N57A 2RONA 4UZEA 5KYWA 2RGXA 5A4JA 2P0EA 1UT8A 2W6PA 3EZFA 3HLKA 3UJ3X 1IN4A 3W8FA 5ALKA 4ODIA 4WECA 1L4UA 2F8LA 4MS3B 5I01A 1A9XA 3SD7A 1K4YA 1GCOA 2YWFA 1QFJA 4R7ZA 1P77A 2H07A 2N42A 2OG1A 1OREA 3HBFA 5CA1F 4IIGA 1PR1A 2XLBA 3IUQA 5CW1A 1YR6A 3BD9A 4J0FA 1T9GR 4B76A 3NNNA 2LGJA 2ZXUA 2BKUA 3BS4A 4NARA 3NM6B 1QP8A 3EPLA 2PVSA 2ICAA 4IINA 4OSEA 3OTQA 1WXDA 3BXGA 4RVHA 2YVAA 1FJXA 4FDTA 5FHQA 5DF1A 3SQOA 5BWBA 3O75A 1J07A 1R4AA 4DR1B 3KSDO 4L51A 2BFOA 5D5HA 3GO4A 3DMDA 4MVJF 3VNAA 5FNVF 4BJ5A 2GM3A 2A0YA 3D4IA 4HWOA 4KXVA 5D85A 3PNBA 2WK1A 4R1PA 5GZ6A 4KOEC 3UPDA 4Q7QA 1E92A 1LLQA 1F38A 1QYCA 2NACA 1J2EA 8AT1A 1JWLA 4C14A 3P52A 3MN1A 1JKFA 1PTJA 4DB4A 2VAMA 4M98A 3VZSA 5JCOC 4M0KA 3L5OA 1QP7A 5EZSA 4KUHA 3RYCA 3I4CA 4AWXA 4BMSA 2CHGA 1C50A 1IY2A 1NMEA 1EDDA 1XZMA 1WSDA 3L43A 4GPEA 2EJWA 4MW1A 4OI2A 2WABA 3E3OA 2XGGA 3FDZB 4OH7A 4TV9B 4B4VA 1OHHD 1SKQA 4AYTA 1Q11A 1S3SA 1CJMA 2FW8A 3IFSA 3G3EA 3LK7A 1DKOA 2GI4A 1NBAA 4WZAA 5DM0A 4QTUB 1BXRB 1XP8A 3ANMA 1AK1A 4XXHA 3OT4A 4X9XA 1RJ9A 4K1LA 4QGFA 3ICQB 1VPEA 4P22A 2CDAA 3DMTA 4TYNA 3W7BA 2VPQA 4H6PA 1DWOA 1L7RA 2DFKB 2FWBA 2QAGA 1Z2CA 4WGFA 5CLGA 5E1MA 5IMBA 3EZ6A 3KJXA 2ECQA 4G23A 5FWXA 1DU4A 4LA4A 3LBYA 1VXRA 4MCIA 1H3EA 3PHLA 2DULA 5BVHA 2DFDA 2HXSA 3BZWA 2FV8A 3KWLA 1JS1X 4K2HA 4YRTA 1QTQA 4AY2A 1FDSA 3F6SA 4LW8A 2RAVA 1MO2A 4IG4A 4YAUA 3FVTA 2DR2A 3ZDEA 2X42A 4C1NA 3C8HA 1RAEA 1I14A 4EI7A 5IAOA 1FJGB 1P1FA 3CSUA 2GJKA 2D1FA 1FQJA 3KZOA 4IJVA 1C3EA 4K6MA 3RYHB 2PLNA 9ATCA 3P2JA 4PQFA 5HIIA 3B1JA 5FOSA 4NZMA 3TRIA 2GFIA 3Q8XB 2HJHA 3VU3A 1MO5A 4XEHA 1B6GA 5C32A 5I7SA 2UXDB 6LDHA 4P2GA 3LVBA 1I1QB 1G3UA 1PGJA 2YYYA 5IT5A 2FSVC 1GGKA 3RD5A 1UK9A 5CHEA 4CFSA 1K3TA 4K03A 5K3CA 1S8AA 4TPKA 3T7JA 1Y4AE 2LKDA 4UATA 5EKDA 4N3CA 1JHZA 2WJ6A 3OFKA 4GLLA 2FKAA 1H4TA 4P92A 1P18A 1KI6A 3PQEA 5AJYA 4LXHA 1K92A 2I33A 3W6OA 3VU1A 2D7DA 3NT2A 3Q1KA 1SBHA 4DC1A 1H4QA 3ELYA 4HEA6 3A6ZA 2CSUA 4P33A 4OQDA 5FLYA 4D0LB 2ZSIA 4AB1A 3O3MB 4KO2S 5BYKA 4HDMA 3KSZO 2H54A 2XVZA 4NFSA 1UDCA 1TUBB 4RADA 1BCSA 4E1VA 4J0KA 3UWKA 3WAGA 4BLSA 4CL0A 4LOJA 2G67A 4MI9A 3TO5A 4BNYA 3WP0A 2ES4A 2P6NA 1BOFA 2VQDA 3NCHA 4EWLA 3USCS 2GZMA 5FUWA 1B7GO 3OPVA 4JL6A 5BMVB 2XCSB 4Q15A 3CUKA 1A77A 1Q2UA 3U5TA 1KTVA 3GJTA 4LHEA 3D8NA 4W82A 1X7GA 3ROTA 4L5YA 2RI0A 1CY1A 5LB2A 2BMVA 3IIIA 4HNVA 1M8PA 4Q05A 1C0KA 1NTRA 3QPDA 1V4BA 4IIJA 5I8ZA 2VHXA 4C2UA 3HYTA 3O21A 3Q10A 4FGSA 3X1WA 4IHQA 3ANNA 1O8BA 2A5FA 3HCWA 1TKBA 3AW8A 3L8DA 3MGAA 4AUMA 1KZ1A 4DL9A 1SKYE 1SU8A 4KSCA 3RO7A 4H4EA 3R7NA 1AZWA 2ZI7A 1QZUA 1F8FA 4YCBA 1PAUA 4BQEA 2R6GA 2Q9BA 1FNMA 4CLRB 4MB6A 3G1TA 1JHVA 2YDXA 4NK4A 3GP8A 5AVRA 2C83A 1FXSA 2QN2A 2BFBA 4RESA 3U0VA 2XUFA 3M6FA 1LS6A 2CXUA 3NNDA 1EFRD 2H9IA 4URWR 2VPTA 4PBSA 3SEZA 3VKVA 5BUZA 5JZBA 4JVOA 4CG1A 4R3NA 1BROA 3QJ5A 2M6RA 3JQGA 1S01A 4JYBA 4MKXA 2HF9A 2BC9A 4P34A 4X7MA 5BYJA 3L2OB 1U80A 1GNLA 3IPLA 2AF3C 4HXGA 3ED5A 1TCCA 4Y8VA 1RRCA 1UFOA 5DM2A 4HLUA 2XCQA 2JFUA 4A7PA 1WF6A 4FYKA 4GLBA 4FHGA 1ZDMA 3UBTA 3GAZA 1V1MA 4FZJA 4CU2A 3U7RA 1VBKA 1L3CA 2FW1A 1YCGA 2JEYA 2Q3MA 4QE3A 2D0IA 2OYRA 2NZ2A 4IXNA 1H9AA 1XZJA 2GEBA 4XUEA 2CDRA 4F4CA 1U02A 4EVRA 2GYVA 5CB6A 1A1SA 1XXHE 2HYIC 3MJRA 3U3MA 4Q7KA 1I1OA 5D3MB 1FUKA 4IJQA 1P6UA 2ODPA 3H9QA 3WWCA 3F4BA 1ZA1A 2IEIA 2V74B 3X0DA 4DA0A 2JFPA 5HTOA 1U0TA 1C4WA 3EPHA 3MS2A 2H4YA 4G9EA 5EHIA 4CEHA 5FR2A 1I4EB 1FW8A 3KPYA 3L0PA 4O2LA 3TW6A 3S5JA 3GGSA 2GFHA 1JKJB 2QZSA 2ZKIA 4RM3A 3ZXIA 4EEXA 1JIVA 1PI3A 3A3PA 4BMNA 2C8JA 2VCEA 4YBZA 1ZBQA 3FMPB 5ALMA 1I94B 4MPDA 1VJ0A 1WDTA 4YJ3A 1Y3BE 1R0RE 2VUTA 3CCFA 2ZJ5A 3IUSA 4RPGA 1C7ZA 2G4CA 3KPWA 2VH1A 4RSRA 4XR9A 3V8BA 3GJ0A 1XTQA 2Q5LA 2QTRA 1XWWA 3AXSA 4KRXA 4D7AA 2K7FA 5HZGA 3EC7A 4YQEA 5JZSA 2I2WA 2I3AA 2WHPB 2HHLA 3AR3A 1FQWA 3P9XA 4URZR 5IEBA 4EG7A 3N75A 3I39X 3K0AA 3GDOA 3NU1A 2G6BA 3CKKA 1G5HA 3RHFA 3ZWMA 5BRAA 4YREA 1FYDA 1KFBB 3T7IA 4WT7A 1W6RA 4JLDA 5ALGA 4MAMA 3AERA 1X2BA 2AMVA 4YMVA 1XAGA 1PSWA 4V0NA 5LXTA 3R5TA 1QYIA 3IDQA 2FU5C 2C2MA 4QGBA 3UMYA 2ZKLA 3CX8A 5LQNA 1N6HA 1R0CA 1E18A 1Y9ZA 2J8ZA 2VF2A 1UM8A 1XMVA 2CXPA 4J2HA 2PJRA 1JFFA 2PLFA 3FGPA 5DMXA 3H5NA 3C0KA 4H3VA 4IJUA 4O4JB 4BO3A 3TAHA 4Z6KA 1RRFA 2ZWOA 1AGYA 4Y1FA 5EAIA 2XYGA 1BHQ1 4RZQA 5GJCA 4DNQA 3V33A 3U60B 2GJ8A 3SYKA 3B53X 2HR1A 1QTRA 2C54A 2R62A 3RFFA 4URXR 3CINA 2HPAA 1ODFA 3EAGA 2Y6VA 4UTNA 1N2XA 5EWLB 1M72A 3UXMA 5K8CA 1Y63A 3QTBA 4KNWA 3LO8A 2FK8A 3WQBA 1P17A 5LD2B 2B8JA 4WGGA 2FRDA 1OU0A 1NOIA 3NP7A 4OHPA 4DY6A 1BMQA 2HJSA 3WMXA 1CD5A 1UBJS 2ONYA 3H8WA 3HDJA 3K8YA 2PGIA 3IXLA 3S8EA 4CEJB 1T43A 5LYYA 1WQ4A 3QWIA 2MIIA 5IMSA 3NGLA 1F2UB 1YH3A 2CY0A 4C08A 3LUGA 5J2TA 5CFZA 1ZUWA 1VHTA 1G42A 1Q3TA 3F0TA 3P26A 1S1CA 3SJZA 3QBEA 3T3NA 3MIZA 4OA8A 2FMHA 1QP4A 3LZDA 5DWVA 1INLA 2ASEA 3AL3A 2PT7A 4UU8A 2WM3A 1GQOA 1M6YA 1N0UA 4LXIA 1CY0A 3PITA 1Z13A 4TV9F 4IXDA 1RQ7A 3ZLVA 5K8JB 3U7HB 1QYRA 3C74A 4KVZA 1ECFA 4J16A 3PFBA 3C6BA 1P2DA 3K9NA 3F78A 3U61B 5ES4B 4FFVA 3EH1A 1KQGA 5FCDA 3N7TA 1UBLS 4ITUA 4ZN6A 5HR5A 4HFMA 3H0KA 1TW3A 5IAEA 3A0UA 4ABYA 3C1UA 1SK9A 2PBFA 2Y66A 2Z8ZA 1IB6A 2Q6TA 1Z2EA 4KH1A 1AZSC 1FYVA 3HA3A 4WV3A 1HYHA 3T0FA 1D8TA 4KXWA 1GY8A 4CMBA 2V9ZA 4IKPA 1Y80A 1T1EA 5FULA 1BDHA 3MTJA 3UM9A 3KQLA 4IIUA 3NW9A 4PTZA 3HMQA 1HLFA 2HSDA 3GPIA 1SXJC 3K0EA 4HDNA 4DLSA 1AN9A 4RJTA 1ZIOA 3R7AA 4BV9A 1FNBA 3EXFA 1N2CE 4CR7A 1ZCFA 4B4DA 2IP4A 3ZWXA 2M98A 3IQIX 3DTVA 1JLHA 1ISFA 3FGZA 3IRVA 3MWGA 4OAQA 3WXMA 5F2NA 5EHXA 3G5UA 4UVHA 1C9DB 1JLSA 2A5JA 4IEIA 3PWZA 1CFJA 2MYTA 3BREA 1TVMA 3I5AA 1J8DA 2GF0A 1Y8RB 3WRVA 4PYRA 3BL5A 4HXYA 5CLIA 3ZLTA 4EJSB 3O9MA 1NUAA 2WJVA 3UWPA 5IM4F 4U00A 3WO0A 2WF5A 1Z47A 3EZGA 4FB4A 2G25A 3GGOA 2AKAB 1EJ2A 3O1HB 1T25A 3CT4A 1Z39A 3EGWA 4PZCA 2CXQA 2FPUA 3AUSA 3S28A 3F6CA 5CVVA 1KWKA 4WLUA 4ZAFA 1RPTA 1ZIDA 2BLNA 2CMHA 2YHSA 3ECAA 2QV7A 5A3QA 2W4MA 1KVRA 3SU8A 5TMBA 3MJTA 2WYHA 5KOHA 1CUZA 2OWDA 4FE3A 3E7WA 3KZ1E 3NQ41 1U2GA 1EXWA 1ZGZA 3GRVA 4L27A 1JTFA 1ETHA 2Q1SA 3TQOA 1YZQA 5C1PA 1N34B 1L5WA 2H00A 4Q3EA 3FMGA 4JU8A 3AVPA 4F4IA 2BFCB 2OV6A 3FFAA 1NVFA 5REQA 5CK5A 1FVHA 3MAGA 3QJYA 3NBUA 5LD2C 2Y68A 3GLTA 3KX2A 7GPBA 1N7HA 1IXYA 1KI2A 1MC1A 5BMVF 4YCCA 4CQNA 4BNVA 1PLJA 3O1IC 3Q6MA 4RH3A 3SBDA 4JIMA 2GB4A 1VL0A 4RJJA 4XVHA 5FPSA 3RARA 1CUUA 1QVVA 1DTSA 2PZLA 3EVEA 3M82A 2G77B 2XUAA 2VJDA 1FXUA 2RD2A 2B34A 2VIIA 4W5WA 1NF8A 3ZE1B 5DYWA 3G0GA 2QTHA 2P3LA 5IKEA 1O77A 5G41A 3R5KA 1EX7A 4O1HA 3EISA 4DIKA 1G8HA 2VDUE 2ZUUA 2H0RA 3F6PA 3GEHA 5IDQA 4JOQA 1CZHA 1OJ7A 4LF5B 3DAFA 1YZLA 1UBGA 2FXVA 2GXUA 1JVBA 1HG0A 3O2QB 4TL8A 1B16A 5AOBA 2ZIUB 4R54A 4ZFNA 4YEDA 1M67A 1W76A 2IPLA 1H2FA 4ZQCB 1QZZA 2BKAA 2L18A 3D64A 3V6MA 5JDCC 4I1OA 1HLGA 1R66A 3ZI0A 1NDUA 3C4JA 4MITA 3QXXA 5DLEA 2NT4A 1HV8A 5IJ9A 3IBTA 3O03A 1O0CA 1Q0QA 5A9SB 4KO3S 4DLVA 1U8UA 1RTTA 3CBGA 1C7JA 3G59A 2QROA 3RAPR 1NW5A 4YPVA 5HJEA