1UZAA

Crystallographic structure of a feruloyl esterase from aspergillus niger
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
259
structure length
259
Chain Sequence
b'STQGISEDLYNRLVEMATISQAAYADLCNIPSTIIKGEKIYNAQTDINGWILRDDTSKEIITVFRGTGSDTNLQLDTNYTLTPFDTLPQCNDCEVHGGYYIGWISVQDQVESLVKQQASQYPDYALTVTGHSLGASMAALTAAQLSATYDNVRLYTFGEPRSGNQAFASYMNDAFQVSSPETTQYFRVTHSNDGIPNLPPAEQGYAHGGVEYWSVDPYSAQNTFVCTGDEVQCCEAQGGQGVNDAHTTYFGMTSGACTW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERULOYL ESTERASE A
molecule tags Hydrolase
source organism Aspergillus niger
publication title Structure of a Feruloyl Esterase from Aspergillus Niger
pubmed doi rcsb
total genus 100
structure length 259
sequence length 259
chains with identical sequence B
ec nomenclature ec 3.1.1.73: Feruloyl esterase.
pdb deposition date 2004-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01764 Lipase_3 Lipase (class 3)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1uzaA00
4IH9A 3SX4A 3H18A 5FRDA 3VVMA 5KWJA 3I2FA 1JJFA 5JZBA 1J07A 1QLWA 1GQRA 1MO2A 1ZD4A 3WJ2A 2QUBA 2XE4A 2OQVA 3W2TA 4DNQA 2HM7A 4G5XA 1LPBB 2VTVA 1EDDA 2W6CX 3D2BA 1S8OA 4B84A 3GELA 4YPVA 4X92A 1XRNA 1UWCA 3ZPXA 1ODSA 3AZQA 1UFOA 2J4CA 4KEAA 1C7JA 4QWMA 1YA8A 2B9VA 2YXPX 1MNQA 1E3QA 5JD5A 3WIOA 3IUJA 3Q8WA 2C0PA 4AO8A 4GBGA 5SYMA 3ZLUA 4I4CA 5DNWA 2OGTA 1JMYA 3W06A 3AZPA 2JGJA 4UHEA 3A2NA 1G5FA 1R88A 4BCDA 1IUPA 1MTZA 2XMRA 3I6YA 3DDUA 1THTA 1UKAA 1SFRA 5DNUA 3A2LA 3FVTA 3K6KA 3IULA 3FLAA 3QM1A 4M0MA 1CUYA 4DGQA 3FAKA 2OXEA 5AK5A 1IUNA 1CR6A 2WHRA 3C43A 3LP5A 3IVMA 5ALSA 2PUHA 1K5PA 4JYPA 4X94A 2C7BA 1AKNA 5ALTA 3QPCA 4W1QA 5K3FA 1MN6A 5EIAA 4Y2TA 1W52X 3DKKA 1UOQA 2HU8A 5AKIA 2I78A 3O9VA 4TPKA 5FLKA 2IITA 1CUGA 1THGA 3I2JA 2PSFA 3QBJA 1HLGA 5FDFA 2Y1KA 2H1IA 4EHBA 1QIDA 1WPRA 4H0CA 2PU5A 1E5TA 2O2GA 4GLBA 2R8BA 1Q0RA 3JWEA 4PSUA 3S8YA 3WK5A 2QXUA 2GBCA 1FFAA 4JUIA 3HRHA 2FJPA 4C01A 1HL7A 2VQ6A 4Q1VA 1XZDA 5HKAA 2BUCA 4DTCA 1QIKA 2XQIA 2WQZA 2QZPA 1AURA 5JARA 4J3JA 1XZMA 3WL5A 4FMPA 4GHWA 1YB6A 2AJ8A 4BRSA 3SC2A 1WHTA 1H23A 4UBJA 3H2IA 5EGNA 1CUCA 3D7RA 2PM8A 1P0QA 3WI7A 3WWEA 3AILA 1JKMA 2HA0A 1QIIA 1F8UA 3STXA 5JADA 1EDEA 1ZI6A 1HDEA 4CG1A 2ZSHA 5EHQA 1Q84A 5AIBA 3QYJA 3RK4A 3G9ZA 2XUOA 5JATA 4UPDA 2CZQA 5ALXA 3G9XA 5JAPA 2GBIA 1SCIA 4L9AA 3ESDA 3EQ7A 3DNMA 4E46A 4J0CA 1QO7A 3VXKA 4OUKX 3X3HA 3E1GA 3C8HA 5AP9A 2JGFA 2NW6A 3GFFA 5AI0A 1XZJA 3H19A 1XZHA 2HA7A 4ITVA 2WG0A 1QIFA 4DSZA 4EZIA 5D7BA 5CT5A 1JJIA 4UFNA 1IMJA 2CBGA 2ES4A 4P9NA 2CKMA 3BDIA 3ZLTA 4G4IA 4HXFB 4G8BA 1LLFA 4BZZA 2WUFA 1N8SA 1EDBA 1XZCA 3CN9A 2BGNA 3G0BA 2QXTA 3MGAA 2R11A 3AIMA 3PFBA 4JEIA 3WKBA 3OURA 3BIXA 5AO9A 3M83A 1AC5A 4WCVA 3ZLVA 1EH5A 4BVLA 4Y2JA 1XRRA 5AK6A 3KWJA 3TJMA 1R3DA 2RI6A 2C0QA 3O4JA 4MJ3A 1QFSA 1ZOIA 1YS1X 3WL8A 1PV1A 4Y2XA 4KE6A 4AXBA 2XMBA 2G63A 2RGUA 4N5HX 5DYWA 4GDMA 2E3JA 1DT5A 1BN6A 5F4ZA 3WZMA 3DOIA 4B0OA 2WTNA 1CUFA 4ZGBA 5JAUA 1VA4A 4C4ZA 4S0XA 1F6WA 1K63A 2WFLB 4CIAA 4H77A 3A2MA 3CCCA 1SCKA 3FCXA 3WK6A 2JIDA 4LXGA 4AN1A 1G4HA 4B0PA 2XLCA 2UZ0A 1WPXA 1XKLA 3NWOA 2QM0A 1VJ5A 4ZXFA 2XUKA 5CURA 3FLBA 4J0JA 3A6ZA 2WFMA 2WG1A 3W9BA 2ORYA 4N8SA 5DTJA 4INZA 4X6UA 1ODTC 1VXOA 1JU3A 4WY8A 2WJ6A 1ZJ5A 3AZOA 3QMVA 1U2EA 3VJKA 3C70A 4LXIA 2X76A 1XLUA 4FTWA 3FNBA 4BATA 4FKBA 4ZV7A 3C6YA 2PBLA 3D3NA 4NMWA 2WSLA 1MX5A 3H1AA 1I6WA 2XI4A 5D3ZA 4BCCA 1XZKA 4BB0A 3W05A 3ICWA 5H3HA 2Y2VA 3R3XA 3V48A 1UK8A 2BAGA 1EB8A 3KSRA 4FLMA 1QIMA 5KREA 1BCSA 4FNGA 3QITA 3HI4A 2XUQA 3Q0TA 4BDSA 2GZRA 4NZZA 4BDTA 1TCBA 2WIJA 1WHSA 2WIGA 2XUFA 1VE6A 3BL8A 4N8EA 2WJ4A 5AK3A 5FXMA 2HL6A 2I3DA 3ZI7A 5HF9A 5FUMA 4O08A 1VA5A 1EA5A 5ALFA 1XRMA 5LZ9A 4BVKA 4EY5A 3IB3A 2HA2A 4P92A 1VZ2A 5FV4A 3BWXA 3EQ8A 4X3CA 4BE4A 1N1MA 5J3JA 4BCBA 4QDTA 3IDAA 5JAHA 4BTVA 1YS2X 2QT9A 4H18A 3HXKA 4BTLA 5ALYA 2BGRA 2LIPA 1NX9A 1LPSA 3DL4A 2C58A 3FSGD 4Q34A 3WYNA 3OG9A 2JGIA 2FJ0A 1CUSA 2Z8ZA 1YAJA 2C5GA 1LGYA 4ETWA 1TRHA 3KDAA 4FWBA 1MT3A 2QUAA 4XIIA 1IUOA 5AM1A 5AOCA 1LBTA 1G66A 3I2IA 3DYIA 3U1TA 1XLWA 4PO3X 4U2EA 3M3DA 3MUOA 4BZWA 1GPKA 1HPLA 5A6VA 4NS4A 1JFRA 2WUDA 3DEAA 3WWCA 4TGLA 3VISA 1EVEA 3G7NA 2WLSA 3C5VA 4GWLA 1VKHA 4CG3A 2P8SA 2JF0A 2XDWA 4F60A 1UK7A 1IVYA 1X70A 1BS9A 2EDAA 4TVKA 2PPLA 3WJ1A 1DINA 4QEKA 3IUMA 3D4LA 4MWTA 5AKXA 2DCMA 3F67A 5EHZA 4OB8A 3ZWQA 1DWOA 4UBNA 4I3FA 4U2FA 5LKAA 3WKEA 4QZVA 2ONCA 1CUZA 3MUNA 1CUXA 4G8DA 4XJVA 3RM3A 4DNFA 1WB4A 4UBMA 4BC1A 1F0PA 4MEBA 1QE3A 2QJWA 2Y2UA 4BP8A 1DWQA 3GA7A 4OB7A 3FYUA 4WDRA 1YAHA 5CT8A 5LKRA 2HRRA 4CIBA 5LZ8A 1VLQA 1JU4A 3TRDA 2PUJA 1O6FA 1M33A 1RWQA 3G8YA 5IKXA 3WIBA 3FYUC 2VT6A 3WQHA 2BCEA 5K3EA 2XMZA 4X97A 5JANA 3WLAA 2ACEA 2XUGA 4BE9A 4PQEA 1R9MA 3LLCA 4HXGA 3FYTA 1C7IA 1FFCA 5ALUA 1FFDA 3QH4A 2ZJ6A 1ACJA 3N2ZB 3U0VA 1VZ3A 1OILA 2PL5A 2PSEA 1UXOA 2WU4A 4LIPD 1E89A 2WKWA 1GQSA 1W1IA 1ZD5A 1QO9A 3G9UA 5T4FA 4DMHA 1XROA 5ALMA 4AMYA 2RAUA 5C8XA 3OTQA 3VJLA 5ALZA 4UBLA 3WA7A 4H7IA 4AO6A 5AK4A 5A7HA 3DOHA 1TCAA 2FX5A 2EEPA 3UUFA 5ALVA 3H1BA 2RIPA 5FPQA 1XRPA 1CQZA 1XZAA 4GI1A 4K6HA 4PNZA 1EX9A 3VJMA 4DNPA 1BEZA 1AUOA 5K3FB 2WIFA 4X7BA 1YSCA 3DS8A 3CCBA 2OGZA 4ROTA 5AKHA 4X6YA 5AM2A 2OCGA 3BXPA 5ALWA 3WKDA 2JGEA 1WB6A 4PW0A 5ALRA 1R1DA 1SOMA 4QDUA 1MAHA 2HFKA 1E8NA 1UK9A 3DQZA 4Y9SA 3LIIA 5CH5A 5EIHA 5EIEA 1W76A 3D0KA 5ALHA 3I1IA 4YK7A 5ALJA 4QLOA 5AI8A 2JGLA 3ANSA 1GKKA 4B9AA 3WWDA 1OCEA 2XQKA 4C4XA 4B81A 3E4DA 5A62A 1LPPA 2ROQA 3HABA 2G5TA 3FWHA 3SK0A 4C88A 4BAZA 1MX9A 5CRIA 3SWWA 5I8PA 2HADA 3WK7A 2WFLA 4MWSA 3BF8A 4OB6A 2PU7A 4A16A 1CVLA 1QONA 1MU0A 3IURA 2CEKA 4N5IX 4C89A 2WFZA 3C45A 3L1HA 4BAUA 4GECA 1XQXA 5D3KA 4EA6A 3IUNA 4UBOA 5ALEA 5LLSA 4HRXA 1XZIA 4IHAA 2PSHA 5HKBA 1MPXA 2XUPA 3V9AA 4G1FA 3P2MA 4CI9A 3WK8A 1LZKA 2H7CA 3ED1A 1T4MA 1BE0A 4YASA 4JYMA 5ALGA 1FFEA 3FVRA 4HTAA 2B4KA 5ALQA 2GYVA 3LIPA 2V9ZA 4QDXA 3AUKA 4LYEA 2HIHA 2DQYA 1H2XA 5CT6A 1NU6A 4BVJA 3AFIA 3F8SA 2QVBA 3C6ZA 2XMCA 4N8DA 4KAFA 4PF1A 2X5XA 1ODCA 3BE8A 1H2ZA 5FPPA 5AJHA 3BJRA 5AM4A 1CFJA 1YCDA 2XMDA 4FBMA 5BV7A 4LXHA 2AJCA 3S2ZA 5IVIA 1CEXA 3R0VA 4W1PA 7YASA 2OCIA 2DQZA 1L7RA 4Z49A 3R3WA 5HK8A 4B7ZA 4AMZA 4Q05A 4J0GA 2HHAA 5K3CA 4AQDA 4RNCA 4Q3LA 2O2IA 4DIUA 3F98A 4P93A 2AJBA 3QPDA 6YASA 4QE3A 5AKKA 4OU4A 1UKBA 4L0CA 3K9BA 4OYLA 1Z68A 4XX1A 3HJUA 2QRUA 2BUBA 4F0JA 4UBIA 2IIVA 3NOXA 2QKYA 5FP0A 4M0FA 3D5EA 5DYTA 4RPCA 5LZ7A 1ZI8A 4Y2RA 5AICA 5CW2A 3R3UA 4ARAA 3GROA 3NUZA 2D0DA 2D5LA 2GBFA 1CUHA 4J7AA 2DHEA 2CUTA 2DR0A 5JD4A 2VAXA 5ALPA 1CUJA 4P08A 3RARA 3PICA 2DHDA 4XWGA 1E8MA 2GBGA 2RHWA 2AJLI 2YYSA 5ESRA 3GBSA 4G9EA 1J1IA 5CH3A 2ZJ7A 1EI9A 4UHDA 4L72A 4B82A 1SCQA 2XUIA 2HA6A 1TQHA 3G9TA 3DCNA 1N5MA 4FDMA 4JH0A 2VJBA 5AKJA 4BAGA 4HVTA 5JASA 4QDOA 3BIWA 3EF3A 3I2KA 1DU4A 2O2HA 4UHFA 2XUAA 5LYYA 1UKCA 1DWPA 1QFMA 3C6XA 3D59A 4FLFA 5AH0A 4AN0A 4HZGA 1W4LA 4Q3OA 1MX1A 5AKEA 4E14A 5K3AA 5BWBA 2C4HA 3PUIA 2IX9A 1P0PA 5JD6A 3WKAA 4U2DA 3W04A 2XUHA 4LHEA 2JGKA 1ACLA 2OLEA 4H7HA 3AIOA 2V98A 2QJRA 4IO0A 1DTEA 1BN7A 1TK3A 1VXRA 3G0GA 4X91A 1QTIA 2WUEA 2XMGA 1ZJ4A 3WL6A 5HK9A 5I7UA 5JALA 2V96A 4WJLA 1ZI9A 4IH1A 2WILA 5CMLA 1A8SA 4Y2YA 3JW8A 2AJDA 1ZIYA 5LZ2A 1CIJA 3OM8A 4WFIA 1RP1A 5K5EA 4Y2QA 1QGED 4X6XA 3IBTA 1LBSA 4IH4A 4LKOA 3DLTA 4Q3KA 1N5RA 4CFSA 1TCCA 4OPMA 3I1YA 2WHPB 1FSSA 2HA3A 4DM7A 4X95A 2CB9A 2J4FA 4OSEA 5AHXA 1A8UA 1WM1A 1IZ7A 1CUBA 2YASA 1HKHA 3PF9A 2Y6UA 1U65A 2BUAA 2I3ZA 2Z3ZA 3D2AA 5C81A 2QMQA 5ALIA 5CBKA 4K6GA 2RONA 1BRTA 4A23A 2OAGA 1UOPA 4WY5A 3V1KA 3C6BA 1AGYA 4BC0A 3VDXA 5FKJA 2VAVA 2WHPA 3C8DA 3G0IA 1KEZA 1W6RA 4UHCA 2X8BA 5K3DA 4B6GA 5E4JA 2VEOA 1B6GA 3NGMA 1B41A 4RE6A 1AMNA 2V97A 1ZICA 1EK1A 3G02A 5LIPA 4MQLA 1DX6A 1JMKC 1CPYA 1K4YA 3M81A 2HDWA 1YB7A 4J0KA 3ICVA 4KRXA 4H7DA 2XMQA 4CCYB 4FBLA 1J06A 1UK6A 2ZVDA 1LNSA 1JT2A 4FHZA 3STWA 4EY7A 4RE5A 4DLNA 1F0NA 4RGYA 1EINA 2WUGA 5LP1A 5ISMA 2WJ3A 4JNCA 4ZV9A 1QJ4A 3WK4A 4J0HA 1XFDA 4AB1A 5EFZA 4QA9A 2XB6A 2DHCA 1BU8A 4G9GA 3WWPA 3E3AA 1BEEA 1LZLA 4X85A 1KU0A 1XZBA 2AXEA 4H7FA 3YASA 4CCYA 3R3VA 1CUIA 3N0TA 4UUQA 5AI6A 4UFOA 2CMFA 3ESCA 4UHBA 2XMSA 4MYSA 1USWA 4BBZA 4E15A 3HEAA 1T2NA 5A7FA 1QZ3A 3C87A 1JI3A 3PFCA 2JGMA 5DTIA 3AINA 4MQMA 2ECFA 2JBWA 2Z8XA 2DSNA 4UBKA 4BP9A 1TAHA 4QNNA 5JYCA 3EBLA 1CQWA 4LYDA 1XZGA 2FUKA 2XQFA 3QMWA 3IA2A 5C8ZA 4ZREA 3CN7A 4W1RA 1MJ5A 4X90A 5DLPA 1MAAA 5LZ5A 4DYHA 4MEAA 5JAOA 3O4GA 1P0IA 5LZ4A 2VJAA 3IIIA 4HS9A 4XVCA 1GGVA 2Z3WA 3DJYA 3VVLA 1O6GA 1U4NA 5HF5A 3KWFA 1A8QA 5E4YA 3H0CA 5A71A 5AM3A 2ACKA 3DKRA 4Q82A 1ZGBA 4G4JA 2H7YA 1EB9A 1YASA 3HZOA 2ZYHA 1ZD3A 1UT6A 1E8DA 4Y2UA 3AIKA 5C8VA 1CUEA 3G0CA 2ZYRA 3PF8A 1R4ZA 2XQJA 1NU8A 4C6HA 4F21A 5DYYA 4AX4A 4DMCA 3B5EA 4U2GA 4A5SA 4UFPA 5AM0A 3ESAA 2BKLA 4Y2PA 5IVKA 2QS9A 1Y7IA 5HF8A 4KE8A 3QZUA 4X93A 2GYUA 3JYHA 5AI4A 1LPNA 4DSAA 4EBBA 4K6KA 1D07A 1GPNA 1WCYA 2ZSIA 3FCYA 4WFJA 3TEJA 4KJXA 1VOTA 3ZV7A 1PJAA 2BFNA 1AZWA 1UZAA 5BWCA 4HRYA 3R41A 1QIEA 2VA9A 2J3QA 1K6EA 3RKSA 4G4GA 3I28A 3STYA 3QMMA 3AJAA 1QTRA 4ZRDA 2J3DA 1Y7HA 4OU5A 2BJHA 2DFPA 2JEZA 4H7KA 1A88A 1IZ8A 1L7QA 2HA4A 3PI6A 3HLKA 1XQWA 4X71A 3FSGA 1QIHA 3DYVA 4Y7DA 3GZJA 3H2HA 2XLBA 2VJCA 2W22A 5AKZA 3O4IA 2VSQA 4W63A 3WZLA 3WK9A 4B9EA 1EVQA 1FJ2A 1RYYA 3V1MA 2WM2A 3WMRA 4C87A 1W75A 1HQDA 2RHTA 1ZD2P 5T4EA 2EDCA 3V1LA 3IUQA 3W9UA 2OCLA 4WDQA 3UUEA 1XRLA 3WWOA 1CV2A 3RLIA 1GZ7A 5HQ3A 4Y2SA 1CUWA 1X2BA 2ZYIA 1GT6A 5AKLA 1AQLA 2PVSA 1QIGA 1Q0ZA 2VJDA 1WOMA 3M82A 4W9RA 1HBJA 5HFNA 2O7RA 4FFVA 2VATA 2H7XA 2PSDA 5BOVA 4GXNA 3H04A 5AKYA 3BDVA 5IH7A 2Z5GA 3G0DA 5ALKA 5HF6A 5JZ9A 2PX6A 4C4YA 2ZJFA 4B85A 3OOSA 5EHNA 5AM5A 2WIKA 1JJBA 4EY4A 2O7VA 3I6MA 5AI5A 4FLEA 3WKCA 2ZYSA 1PFQA 2OCKA 4AZ0A 3H2KA 5E4TA 5HCUA 5AI9A 1XLVA 4AZ3A 5IVHA 1G42A 3I2GA 1GXSA 1L7AA 3B12A 5CTAA 5AOAA 3A70A 1QIJA 3STTA 4WFKA 2XQGA 1H2YA 2HU5A 2HA5A 2PSJA 5KWIA 3WL7A 3F97A 5ALOA 4K2AA 4BYMA 4QLAA 3WA6A 3FYUB 3HSSA 4H7EA 2I03A 1R9NA 1SC9A 1K8QA 4EY8A 3PE6A 4MXDA 5IVDA 4OD0A 3T4UA 3BF7A 2JEYA 2Y6VA 4I19A 1CRLA 4MYDA 1DT3A 3R40A 5CXUA 2YH2A 4J03A 1C4XA 1A7UA 4KYVA 4CCWA 1CUVA 5HQ3B 3WYDA 1KU6A 1BCRA 5CXXA 5A2GA 4IQ4A 5CH8A 4K5QA 4FFWA 3PUHA 1LPOA 3F96A 5A7GA 1J2EA 4H35A 3O4HA 1EHYA 1XKTA 1P0MA 3HC7A 4YX9A 5DJ5A 2GYWA 3OPMA 1AX9A 4HXEB 4M0EA 4ZI5A 5KBYA 2WG2A 1XRQA 2QOEA 3O95A 1QOZA 3EIOA 5K3BA 3K2IA 5T4BA 3V1NA 2WU3A 4F5ZA 3KXPA 2OGSA 4ZWNA 4OCZA 3CXUA 4CG2A 4DNOA 3LCRA 1Y37A 4J0IA 1XZLA 1ZIXA 5CT4A 3KOOA 4Y2VA 3DD5A 1EXWA 5YASA 4L3WA 4PSCA 4J0DA 2OQIA 3FOBA 5FOQA 2C5FA 1ORVA 2WTMA 4D9JA 1TIBA 1XZFA 3I2HA 1CLEA 5EI5A 2OAEA 5EHXA 3LS2A 4PSDA 1ETHA 3FBWA 5CT9A 5DWDA 3R3YA 1XQVA 2H9YA 4U2CA 4E11A 5ALDA 4AO7A 4QDZA 2B61A 4KACA 2WIDA 3O9MA 1OXMA 3T52A 2HFJA 3R3ZA 2Q0XA 3D2CA 2G5PA 4G8CA 1LPMA 3PDCA 4HAIA 2OPHA 3QVMA 5HFAA 2QR5A 4H7JA 2HU7A 3STVA 5HZGA 2PKYX 1LPAB 1CUUA 3DL7A 1E66A 1YA4A 1UOOA 3ILSA 4EB0A 5I9IA 3STUA 1GPLA 1WB5A 1ORWA 5AIAA 3B3QA 3E0XA 4OYYA 5AKGA 4V2IA 2WHQA 1BROA 2VF2A 3L1IA 4ARBA 4KE7A 4W1SA 4DMFA 4KAAA 1XQYA 1X2EA 3UMJA 5DNVA 3OC0A 1CUAA 3FLEA 2XT0A 4B80A 5ALLA 3O0DA 1Q83A 4KE9A 1DQYA 2OG1A 3H17A 4X00A 3ESBA 2VT7A 2CJPA 4FNMA 4QWWA 4GEGA 1MNAA 1GKLA 4DMKA 3HYSA 1FFBA 5JIBA 1TKRA 1R50A 1XZEA 4PV7A 1H2WA 3KD2A 1ISPA 2XUJA 2GZSA 4EY6A 5D6OA 1H22A 3H2GA 1EK2A 1ZGCA 3GUUA 3HACA 5T4HA 3F9CA 3QPAA 1U8EA 3L1JA 4NVRA 3ANTA 4BRZA 3TGLA 1YR2A 4GW3A 5SYNA 2G4LA 1DQZA 1DX4A 1VE7A 5JZSA 2B20A 2HRQA 5C7YA 3BJMA 3C5WP 3EQ9A 3I6ZA 2XUDA 5AOBA 4EUSA 1CUDA 5E2IA 5ALNA 3MVEA 4KRYA 3H2JA 4U2BA 2K2QB 4B83A 4KR0A 4UHHA 2QTBA 4KAJA 4FOLA 3VKFA
chains in the Genus database with same CATH superfamily
4TUYA 3HUUA 4N12A 1TYAE 1YBVA 2NZVG 4IH9A 4Z86A 2XQVA 1TVCA 1ZNXA 1EM8B 1OI3A 2HCFA 1ELOA 2Q5JA 3VUFA 3ECSA 4MINA 1JIVA 3QFHA 5F5NA 3ET5A 5BVHA 4CTJA 3FFXA 3PNMA 4NJEB 4OV6B 4H1TA 1KH3A 5CLIA 5KWJA 1KZ4A 1JJFA 1TL7C 1XEXB 5EJ5A 1JA9A 2AOUB 3BRCA 4RUKA 4IDDA 3OLXA 1MO2A 3A1WA 3P32A 3ZCRA 5AHRA 5G0TA 2X0FA 2QN6A 4R2MA 1HMPA 3W2TA 1J7KA 5FPSA 1Q91A 2QJOA 2YV5A 4UOQA 3ZDEA 4K26A 3R9XB 2HM7A 1QRRA 2J3IA 4F8EA 3HEBA 1NBAA 5C4MA 4Z4QA 3LGAA 4NOMA 3WIVA 2TECE 2P9TA 3PFKA 4YPVA 2OVBA 4DPLA 1GUAA 1Y98A 5TX7A 4DIOA 1IRIA 4ISCA 4OQQA 2ZANA 1KJWA 1K8ZB 2AS0A 4G56A 3ITEA 3PRJA 4IZHA 1U1IA 1USUA 2AZDA 2J4CA 3FFTA 3OQVA 4PPNA 1XEWY 1YA8A 1X1EA 1NVUQ 2ZTMA 4OJKA 1HG0A 4K8RB 1M75A 5FOUA 3VYWA 1SVUA 3PQDA 2ZJYA 4D0GA 4CT0A 4L95C 5B3AA 1GFIA 3HJHA 4FXOA 5F1PA 4JR0A 3CNOA 3TEMA 2A2ZA 2FMFA 3QPBA 3QF4A 2QSJA 4FDTA 4JI2B 1ESZA 3L43A 4MW0A 2CEAA 2CNDA 3CCFA 3WIOA 2C0PA 2ZRIA 3OOHA 2DJIA 2IYNA 1PQWA 3D3QA 1JR4A 3L8GA 4TQUS 2RH5A 1YE8A 3PHIA 1P33A 3UWKA 4AO8A 1ODIA 1YZHA 3KXDA 3FZQA 4PPQA 5SYMA 1F0YA 3EOZA 2FQXA 1RD4A 4JUCA 3FTEA 2O7NA 3C1OA 1X8JA 2W2KB 1XDSA 4MS3A 1M8KA 2B2NA 3BT7A 3W06A 4ZZ1A 2Y0DA 4ZOLA 3WGOA 4AKTA 4S05A 2B1GA 1GUBA 1QHIA 4JJAA 1DJOA 3EDMA 5JH7F 1KQGA 3U56A 4BGDA 4NOJA 4HMQA 1R88A 2PLNA 3HA5A 4CEIB 2Z58A 5JXGA 1AS2A 2AA3A 1OTHA 1MTZA 2KBEA 2LWIA 3IOCA 5EVCA 3B2QA 4ZC8A 3OM1A 2XMRA 3QUBA 3V2HA 4CTOA 3IOBA 2XYVA 2Z0MA 5IEBA 1O97C 1VI6A 1GPYA 2O8NA 2EX1A 3DDUA 1THTA 3KUUA 4FU0A 1RZVA 3EGOA 4S1TA 4YMVA 2JGRA 5LQMA 2NO7A 2PL1A 2W6PA 3K05A 2OORC 4JR1A 1OAAA 4U0KA 3T34A 2FOXA 2P4EA 1GD1O 3E3LA 2P0YA 3MMPA 5L40A 5CVEA 3IULA 4OAOA 3K0KA 3WMGA 3CQ9A 5CB6A 4LSZA 1X6VA 4YNBA 5HA5A 3HJBA 5C9ZA 1UXGA 1A9TA 3FAKA 3OPNA 4WERA 5AK5A 5TQ2A 1AG9A 2VIIA 2HIGA 2FA9A 1OXBB 1N0HA 4F6LA 1KI2A 1MVNA 3GT3A 4FDVA 3IVMA 3T0IA 5KYYA 4Z53A 1SD5A 2WYOA 1O87A 3R5FA 1DFGA 1Y9DA 1TQDA 3HYNA 3L5OA 2QZZA 1DOZA 3OZEA 2XY4A 4PIMA 4RETA 2QG6A 3NFYA 3AETA 4NQRA 1YZTA 3IBSA 3SMVA 3GLSA 3UFXB 3WGVA 3OKPA 2HCRA 1V25A 4MP3A 4ID3A 4OHWA 4QREA 4AY3A 3TGWA 4BO4A 2OCYC 5B12A 5ALTA 4KSYA 1PP4A 4KIWA 4W1QA 4RPHA 4EB6B 4ZHQB 1GZDA 4BX2A 3I61A 3ZD8A 1OXXK 1V37A 3LT4A 2OCAA 4UCWA 5FWNA 2JHFA 4JSRA 2EW2A 4MA5A 3SS7X 3KOXA 3F3MA 2HCBA 2P4SA 1UOQA 2HU8A 3JXEA 4HLDA 3Q7PA 2CHGA 3O9VA 4PR0A 3B20A 3Q3EA 5JLAA 1GFWA 1B1AA 2O8CA 1EE1A 5IMSA 2O2CA 1MB3A 2ISCA 3G3EA 3NOVA 3RD5A 2MYUA 3IIMA 4DKXA 3QE0A 2BFFB 5IKOA 1TZCA 1VL0A 3WLQA 2XGJA 3DTVD 3FWZA 5FDFA 3CLRD 2ZDQA 1I4EB 1XNJA 4PXSA 2V7EA 1WPRA 1PJTA 2FR8C 4H0CA 5CIYA 3MPOA 5F2NA 3O8NA 2DBVO 2QNBA 4OQDA 2CXNA 3PK0A 2O2GA 1VCOA 4G9BA 4MW4A 2OTCA 4QGFA 5I9NA 1WD7A 2JIOA 4LV6A 5LQCA 4HLCA 1L5RA 2JD2A 2RHMA 1Q0RA 4YDSA 1Y80A 5DEIA 3PQ5A 4PSUA 1W7AA 3NIBA 1JQEA 5KX5B 5IARA 4UCXA 3GAAA 2Z6VA 4GI3A 2Q4BA 3RJTA 1C3XA 4Y1RB 1FL9A 1Z8NA 4C01A 1YHZA 1Y1LA 1HNZB 3LKDA 4BMXA 3L6RA 4GU5A 4E5KA 3BQ9A 1E3WB 1K88A 4NCNA 2EKDA 4QTTB 4Q1VA 2FRVA 3ZJ5A 5HKAA 3T38A 4R84A 2XQIA 3EIQA 2QZPA 4I36A 1OUMA 3C15C 1U8AA 3KSBC 1U8UA 3H5NA 4FMPA 5C34B 5JSQA 4N3NA 3TZBA 5F9HA 4PQFA 2NYAA 2CMDA 3SZLA 1M2OB 3M1LA 2XMPA 4DJAA 1Y9ZA 1KDOA 2VRNA 1QTQA 3NIFB 4UBJA 4CM9A 1XCLA 5FA5A 4XJSA 1WUKS 2ZS7A 1PI3A 4PRKA 3WI7A 1Z4JA 3AILA 2HA0A 2XA9A 3ULKA 5IXJA 1W9HA 2YOGA 3K0AB 4MGEA 5REQB 3RF7A 4KWEA 1Z16A 2RKBA 3STXA 3F90A 2M98A 5TGTA 3CNHA 3CVYA 5EKSA 2A7XA 1SA0A 2QP9X 4JBYA 1GRRA 1IDOA 1QFXA 1LX7A 3AP2A 3HKEB 4PCLA 3UHPA 3RYHB 2PAAA 1M2HA 1M8GA 4G1EB 2IHKA 1LTQA 4O3FA 4JYAB 3L6UA 3ZX5A 2C2YA 1Q84A 3AONB 1PGPA 2IEGA 1YO6A 2GZ3A 5J4HA 1SQ0A 3BTOA 5IANA 2ZM5A 3G9ZA 4K05A 5LA6B 5F33A 1KL7A 1VHLA 1UP6A 1VI5A 1P60A 1V8BA 2XUOA 3PUJA 4K9NA 3FNEA 4FHEA 1S2DA 4LE0A 5G1OA 1O4WA 1OXKB 3ZXSA 4F4FA 4LRQA 3LRTA 3N2GB 1K3TA 2IXEA 2OWDA 2QXYA 1Z4LA 4HWKA 2XRYA 3G9XA 1NNI1 2MOKA 2VCYA 3N8GA 2XGSA 4G67A 3ZQ6A 3ZQ4A 1VCNA 2GHIA 4RAOA 2R6AA 3AV0B 4URFA 2GBIA 2FU5C 3B6ZA 1EYZA 1E1RD 4M1ZA 4XRGA 3N5CA 1H0HA 3EQ7A 4K86A 4JUFA 3T9DA 3WLTA 4HH3C 3VO9A 4G09A 5DMHA 3MWKA 4DXHA 1E63A 4C7KA 1TW2A 2R48A 2H16A 4ENQA 1I7PA 1PVDA 4P4TA 3U6KA 4Z3OA 3CVVA 2VP9A 3Q85A 1E6EA 1QKIA 3RYHA 1E1CB 3WYCA 4TN1A 1RYZA 3E1GA 3BZWA 3NFRA 2ZJ2A 4RGBA 2JGFA 1E9SA 1VBFA 2R00A 1REQB 3HY3A 3TL3A 1YVEI 4YAIA 3RC8A 1DXHA 3ZY4A 3PKIA 1U3GA 1XZHA 4BX3A 4KVZA 5IXSA 1HI9A 1KRWA 2QENA 5IAAA 1FA9A 3KQMA 4WN9B 1V5EA 1XKXA 4BX9A 1KY2A 3TN7A 2DBRA 4RX1A 3VR4A 1D0VA 2OLKA 5ESDA 1G5IA 1KC3A 2AFHB 4DSZA 2BEVA 4PEVA 3VDNB 1GL7A 1WULS 4BQOA 1JZTA 1UBFA 2QTNA 3ND9A 4XVRA 1QB7A 4BBPA 2Q5OA 3AR4A 4DUYB 1YFLA 3EBOA 1IMJA 4KXYA 2CKMA 2JATA 3B9QA 3Q0EA 4EA9A 3B52X 1A9SA 1DRJA 1B8OA 3G2IA 2G83A 5EKXA 2LCQA 1ADJA 1QO0A 3AUAA 3IMKA 1MQ8B 4JC8A 4L5YA 3WVNA 4B43A 4BUJA 4EQZA 3KQNA 4RHXA 1LLFA 3I83A 1NBMD 1PRYA 1WZUA 2WUFA 4KU4A 4MZDA 4WLOA 3FYSA 3V4OA 1TTTA 1OQAA 2UVPA 4WSOA 2BGNA 1Z33A 2OV8A 2LP4Y 3BWVA 3GLRA 3TNLA 4ASUD 2C2XA 3P45A 5CP8A 3CRVA 4WTOA 3PFBA 1GKUB 5LOVF 5DM60 3CVOA 1E9DA 4L2IB 4BFYA 5B7NA 3GRKA 1J0XO 3L0IB 4G36A 2NP7A 3OURA 3D7SA 5BV2P 1NMEA 1P2VA 1KY4A 1AC5A 2GVZC 3PIRA 4AP6A 1Q0SA 1XYGA 1WMAA 4QDKA 4FIZA 1Z83A 5EYPA 3RIEA 5HJ7A 3HU2A 2UUAB 3AFOA 2AV6A 3T0GA 2SKDA 4KMSA 1U7TA 2PY6A 3LBFA 2C0QA 4I2VA 1U3WA 1M6YA 1RXCA 1BX0A 4LI0A 3AG6A 1P4JA 5KINB 1SCJA 3OJXA 4DR7B 4NNPA 3QJ5A 2WF6A 4CRWB 1T2EA 1ZIOA 1RS0A 4YR9A 4DUGA 1ADYA 3BHIA 5FLEX 1LW7A 4KQFA 8GPBA 2XMBA 1YI8A 3FBGA 2NO0A 2RGUA 5BQXA 3DAOA 1L4UA 2P7IA 3ORFA 4HR7A 4N5HX 4GDMA 5AVRA 5JNVA 2E3JA 4WNAB 4QPNA 1RHKA 1QHYA 4UM5A 5F4ZA 3CUYA 1ZUWA 2E21A 5LU8A 3DOIA 1KFKB 3DB1A 4X61A 4B7UA 1CUFA 3A6KA 5J4VA 3P2EA 1NUUA 5T7BA 4ZGBA 5CDUA 5JAUA 5F9MA 4JP1A 1IEXA 1M34A 2JDID 3ECAA 3U39A 4HX9A 5CVVA 2BR4A 2IUYA 3A8TA 2YN4A 3EFOA 3SCZA 4G3XA 5KQGA 3A2MA 1GARA 1COZA 4FEGA 3E6AA 1UC4B 1KBQA 2CE7A 3L4EA 4LXGA 3DVLA 4TKZA 2C00A 2PVCA 3FPSA 3U3KA 1G2PA 4R40A 5DGIA 3DLPX 5ICMA 3BMNB 5BSUA 4AN1A 3HA7A 4R9RA 3SG0A 1B0ZA 1TQ2A 4YJ3B 1PX2A 1E1YA 1G4HA 2H2HA 2PR7A 4B0PA 1XXLA 2HSWA 1PT9A 3KPYA 4LISA 1DS6A 3WP1B 1AZTA 2FPPA 4ZO6A 2XUKA 4QJ5A 5CURA 1ANKA 1TB4A 4A0HA 5CLLA 4JQSA 3UANA 4ZI7A 4IPTA 2QMOA 2RGCA 2YN0A 3AC0A 3EY4A 5GZ3A 3D9QX 2WFMA 4QAJA 3W9BA 1J6UA 3VAAA 2HLDA 2G88A 4A5OA 4XUDA 3FOCA 3IFSA 1D1SA 2HPAA 1FXWA 2MMGA 4WPGA 2WYVA 5EKTA 2WSSA 3UAOA 1O97D 5DI3A 1DTWB 4EUEA 1SUWA 3TZKA 2PKWA 1ZJ5A 3DEYX 4UM9D 1QCZA 5JFTA 2ZZNA 1GEGA 1W0KA 1OXVA 3HFJA 1UDWA 2JFUA 1X7WA 1IXKA 5FLXA 2XRZA 3VJKA 2IV2X 1T5OA 3EFOB 1ZX1A 3EXEB 3KOUA 2B92A 4TZTA 5DHSA 5FL7A 4NX2A 5HGJA 3C70A 1VHDA 4YRZA 4M83A 5BR8B 3SOPA 3RT7A 1MABB 3GJRA 4TV9A 3FNBA 2NLOA 4BATA 2H85A 2BDTA 2PBLA 2B82A 4URZR 1QX3A 4YCDA 3V4ZA 4A2WA 2BF4A 4ZQBA 4RJ2A 5JXWA 1XGKA 1YQQA 1HYBA 3DBHA 3VVBA 1JAZA 4DA4A 1RYBA 5AMXA 5FWAA 5HTKA 4FUTA 1XYVA 1VE3A 1U31A 5AVWA 3DV2A 1I6WA 4B3RB 2BM1A 4LKRA 2XI4A 4OLHA 2PS9A 3VKHA 4A27A 4C3VA 5JNRA 1XZKA 2O1WA 3DEJA 3JWGA 3ICWA 5H3HA 2Y2VA 4ND8B 5LXTF 3U3DA 3DWIA 1FUKA 3L1UA 3P8ZA 1EB8A 2WPNA 4CG0A 1EFHA 1P0FA 4MV4A 4AJ1A 2YMLA 3TKAA 2HEIA 3OPVA 2WRZA 3WGZA 2OHGA 1EUYA 1W34A 3MF4A 3A6PC 1W2WB 5BWNA 3O1HB 3BK2A 3V4LA 1SR8A 2IYUA 5F5XA 1OYWA 3QITA 1XCMA 3PIIA 3HI4A 1KK3A 1R16A 4NFSA 4ZEOA 1XTQA 1T34A 3IQXA 3Q0TA 5BY2A 4JMLA 3O2QB 4ARUA 3UPTA 4BDSA 2IH4A 2GZRA 3AHDA 3KT6A 4E22A 4BDTA 1BA3A 3IAEA 2XTMA 4P86A 3Q9SA 1S1MA 2GD2A 2E49A 3HN7A 3THRA 2WIGA 4LW8A 4N8EA 4RLQA 3L0YA 1BIFA 4BMDA 5T8KA 1MO3A 4EFMA 3ZDCA 1NYTA 3HSYA 1E3LA 1GILA 1Y8CA 5AK3A 5FXMA 1RAFA 1W2HA 3M1IA 4UZFA 5SY6A 3CX4A 4D4MA 4AU1A 5IDXA 1I4TD 1V3UA 2BP7B 2XGGA 3E82A 4JBGA 3EULA 2N9UA 3KSZO 4UEWA 1V9CA 4PCUA 2FY8A 3RAPR 3U49A 2D5CA 2BBTA 2J9XB 3T1NA 3TI9A 1L1RA 3ZU4A 4DLYA 4O08A 1XD9A 1S8FA 4NPAA 4MMYB 4MUKA 1JLSA 1P7PA 1VA5A 1T2UA 2ECPA 4C4RA 1AN0A 4OHRA 2QK4A 4LZNA 3BXXA 1CVRA 4RKRA 3ZHSA 1EVLA 2A88A 2QX7A 1RHJA 5H3LA 5LZ9A 3JZMA 4EY5A 4C0SA 2CFRA 5AW3A 3HMKA 1KVRA 2HA2A 1O58A 5FV4A 4M1OA 1BVUA 4LCEA 4X3CA 3RUAA 4BE4A 4M60A 4BCBA 1BVYF 4BU1A 2IRWA 2G09A 4I81A 1PUXA 2X8JA 3IDAA 5CVTA 4BQSA 3DL0A 1JEOA 4EUFA 1YS2X 2QT9A 1TJ3A 1USKA 2H1OA 4DV5B 3FHTA 5EEHA 2H31A 3HXKA 4BTLA 3PGMA 2LIPA 4IX1A 1NX9A 2I1LA 3PCRB 3RIXA 4R83A 3EA5A 3SC3A 3I92A 3H05A 1YU9A 3W5HA 2XV1A 2BYTA 1BZYA 4Q34A 4TVOA 3QJYA 1USIA 5DTQA 3IAAA 2CYCA 2D4HA 1Z8DA 2E7ZA 1NV8A 3FWKA 2Z8ZA 4OQYA 1RYEA 2AHRA 2DFLA 4XDGA 1ZM7A 4KVAA 3PGJA 5F2EA 3HM9A 1ULSA 4JJEA 4URHA 5TF0A 1E5DA 4LBYA 4RPIA 1BXGB 4FWBA 5D3MA 2EATA 1S8AA 3ETLA 4XIIA 2XXAB 2UZ1B 3R76A 3H8JA 4DLLA 2C2MA 2IPMA 1BDBA 2D1RA 3K35A 1LBTA 4J4TA 1G66A 4ZVPA 5B6PA 5KTOA 1W0JA 1H4QA 3AV3A 4UUMA 4MKGA 1W47A 2ORIA 3G1UA 4PO3X 3U1TA 4U6NA 3M3DA 3X1DA 1B8UA 2KHZA 3EDQA 4D4GA 1L4KA 1QQ7A 5JJIA 3LUJA 4NS4A 1O9BA 1I36A 1ONSA 3AM5A 3NVAA 3PC8A 2O7QA 1K0FA 4UU0A 4GPAA 2IU0A 4LFBB 3T54A 2XITA 4MIYA 2CVPA 2JIQA 1NVTA 2G25A 3I9KA 1NVEA 4ILKA 3V8NA 4DFDA 1NF2A 4RSMA 3MA0A 4PZAA 1EVEA 2WYWA 2OO3A 2WLSA 5PGMA 1JDUA 2FMIA 1L3BA 4TM8A 4B3FX 3ZBQA 5FUWA 3LUDA 3MEQA 3QTTA 4YAGA 4LZOA 1QG6A 4AKGA 2AFIA 3EVCA 3BTSA 3SR4A 2J0VA 5EMKA 4BNJA 2JGDA 1VC2A 4DY6A 2IYOA 3ZV6A 2WB2A 4QSMA 4NQZA 5FPKA 2RG7A 2XDWA 3OF5A 4N6NA 1UK7A 1IVYA 3AH8A 4B76A 3G2LA 1BS9A 2LNDA 4ILEA 4CQMB 5BSFA 4EM6A 2VYND 2EDAA 3NWPA 1COWA 3R9WA 1GUDA 1Q2UA 1TK9A 3VZCA 1ESDA 3H3FA 3PNQA 3SSAA 3T7DA 3H16A 3U61B 3B2NA 3G1WA 1XKQA 4LDQA 4TXMA 4UM8B 3T3HA 4EI8A 1ZRNA 1SKUA 4MWTA 2PV7A 2DCMA 2QP4A 3Q87B 1EUCB 1SQSA 1FNBA 4NBTA 1W2GA 4P2BA 4CQNA 2Q3JA 4KHPB 2H0RA 3LVBA 1P73A 4O4LB 2EJUA 1X14A 2FZ5A 4O1IA 3IEIA 2CL5A 2HK9A 2FGJA 2CK3A 4UBNA 4QVIA 1NKVA 3IQEA 4E5NA 3F2VA 1KDTA 4HWPA 3U13A 3F5SA 1I32A 1CUZA 4D7AA 1BW9B 3U6BA 9LDTA 2V0CA 1OW3B 1O6CA 3KP1A 4IG9A 2VDPB 4XJVA 3QKUA 4UBMA 1SURA 2OBXA 3V00A 4MEBA 1AUQA 2EKBA 3NHBA 2QJWA 2XVZA 3O4FA 5FI5A 2WDPA 1YR6A 9GPBA 1CQIB 3OH8A 2REQA 3COJA 1PT6A 5JO9A 3DVSX 3RQIA 1EUZA 1UBRS 2ILTA 2PZJA 3CLKA 4HGQA 5FPYA 3C1UA 2VSXA 2CDRA 3SC2B 2C96A 4HNUA 1Q1ZA 5JH7A 2AOUA 1QG4A 5C4GB 2PMCA 1CR2A 3BMCB 3K0BA 1IIBA 1JAIA 1FC0A 1HL3A 4DV4B 4W5OA 1OZFA 2JJ8A 4UMVA 4LV8B 821PA 1K6MA 2YWDA 1YAHA 2Q1UA 3SLRA 1XDUA 5BYJA 4JEHA 3EISA 3KYCB 4C21A 5JAZA 4GE0A 1JDZA 4PYKA 3SYLA 3NJRA 4HEJA 3X1XA 2OP0A 1H69A 1E0KA 1QLJA 3LA8A 1VPDA 4HZIA 4EJFA 2PUJA 3NHUA 3FIJA 3PC4A 5KKCA 1KZ9A 4HPXB 4YCJA 1ULZA 1G9SA 1QOPB 2P6NA 2Y93A 4I0WB 1LK5A 1OJLA 4UTZA 5THXA 2CSXA 1ZOOA 4DR2B 2BGKA 1ADGA 4OLJA 3MCTA 2H08A 1APBA 1JDSA 1GN9A 4CHTA 4QTUB 3GNQA 4MAFA 1KMNA 3UK7A 1YCHA 3G6KA 2VT6A 3A28A 2ZK7A 3F3SA 3QVSA 3AQIA 3PC7A 2CD9A 5K4HA 1XPJA 4HVCA 3Q11A 2XDAA 1P1RA 4X97A 2AFHE 3TE7A 2P2DA 4EO7A 1L5MA 3B7WA 2ACEA 2JIMA 3R3SA 2E4AA 4PQEA 1UP4A 1R6AA 4HF7A 3G68A 1H8ED 3LLCA 3RVJA 3BXGA 3M6XA 4MRVA 4EVQA 4EL5A 2DH5A 2PXHA 5DGXA 3I23A 1T10A 3FVVA 1FFCA 1JWBB 3JVDA 3PXAA 4Q3AA 5CM8B 3Q8MA 4XPIA 1N1GA 4XR9A 1DAMA 4HDMA 2ZJ6A 1SWVA 2NTYC 4D42A 3NYWA 2QJTA 3D6UA 3BH6A 3N2ZB 2P0AA 4F2HA 4F2WA 1SC3A 2BSAA 3U0VA 4MDEA 1JECA 2H1RA 1OILA 1T9ZA 2XB9A 2L18A 4E88A 4YRMA 2WU4A 3BTUA 3D8HA 1CEYA 3LPDA 1UKYA 3EQ6A 1B0PA 1L7XA 3C24A 2VBCA 1X9GA 1FPQA 4BLQA 4UNQA 1XNHA 1UFRA 4EJ6A 1IJFA 1Y4AE 5JTUA 5A5EA 1MEEA 5TDHA 5I3ZA 4YPFA 1W1IA 1ZZEA 2AKAB 2ATIA 1VCMA 2V6BA 3VH2A 5BN4A 4UVEA 5CM9C 3QTBA 3QXGA 4QFMA 3UWDA 3OLYA 2IPXA 4AKIA 1XU9A 5TQVA 3D6FA 3U40A 3M9WA 3H4VA 3GIDA 1YJXA 3EQZA 3VJLA 3ZHUA 3GRAA 1ZCAA 1JWAB 4CMJA 1DGQA 3B3AA 4I14A 1IZ0A 1J97A 3DFFA 3KX2A 1ZG3A 3NUQA 4B71A 2NACA 1NSTA 4NRDA 3E4CA 3HJNA 1YS9A 4MTLA 1EUDA 4PE5B 2BEKA 4GYJA 1XX6A 4L8WB 1E58A 3D81A 3TTYA 2PZKA 1D6MA 3PL5A 4A8TA 4W9NC 4AROA 1U3FA 3GEMA 3EASA 4HAYA 1P9RA 1E5VA 2E48A 1KI9A 2VS1A 4P3PA 3NAZA 5CA1B 4DHEA 1N2CB 1AS3A 1CQZA 1XRPA 1XZAA 3MCVA 5B4TA 1RRPA 3DDHA 2XD4A 5J1SB 5JFGA 3I8XA 3JD1A 1MX3A 1HETA 3NQ41 1KQNA 3UHFA 5JI3E 2CWWA 1XCPA 6AT1A 4BRWA 1EX9A 1DBWA 2ERYA 4M8KA 3INTA 4NDZA 1CJBA 1W5FA 2IDKA 1AUOA 4V0NA 4AD8A 1LJUA 2J46A 2KX7A 4OFZA 1TUIA 1NVVR 2QL6A 2WIFA 3HJRA 4IIBA 4MV0A 5CEJA 1W4RA 1L5YA 1PWEA 2R84A 3CCBA 1CDOA 3G59A 3LOQA 3PX2A 3LCCA 4HB3A 4PTLA 2PAFA 1QPZA 4KFRA 3ABIA 4Y8VA 2DETA 1LF0A 5E6RB 3FD8A 1WW3A 1JHPA 5KJ1A 1Z0SA 4JWKA 5AM2A 5MGNA 2UV8A 1UUFA 4LNUB 1QK4A 3MN1A 6PFKA 1GZ3A 1JVBA 3QEOA 5JI2E 1YS6A 5CITA 3JU3A 3Q9NA 3QU5A 5I7OA 1WB6A 2ZIVB 3HLYA 1ZNWA 3D4OA 3ZCXA 1SOMA 5HFJA 3AETB 2AMJA 2EXXA 3S5JA 3BCRA 3CZ5A 3NHJA 2CN1A 3O8BA 4OY3A 3AR9A 1E8NA 4UE6A 5EUBA 5M04A 4NONA 2AFIE 4P80A 4OQPA 2VK2A 1V6SA 4WKNA 5IHPA 3DBVO 2VKTA 3ZDBA 4C7OB 4C29A 3NEYA 5CH5A 2KB0A 4GWKA 3QVGB 1IVSA 5HBRA 1W76A 1JI0A 4AJ2A 2ZYUX 1XP5A 1RP7A 3IT2A 3EXAA 4GEKA 4W5NA 1J99A 5JQWA 5ALJA 5HYVA 2DVMA 1AHIA 3HWWA 3T5CA 3K72B 4KO8A 4B4WA 3DHNA 3NC4A 1O8BA 4MWZA 5ECYA 5E6UA 5HILA 1RWMA 1KP9A 4K81B 3Q8KA 1FS4A 3NB0A 1GQFA 2NU8A 4GI2A 4YMHA 5JRDS 2E4YA 2I3BA 3DXFA 1M1UA 3RSLA 4B48A 1PZXA 2WAMA 1TF2A 1FYXA 4KQWA 2IBSA 3GEGA 2HBYA 5KHOC 3UXYA 4B81A 2X6QA 3E4DA 1BFUA 4DILA 4A36A 2XE6A 2W58A 2ZBEA 4YDHB 4JJGA 3RS2A 1IY9A 1XXHE 2H54A 3PP8A 2ANCA 3ADCA 1JQ5A 1WMBA 4FZRA 1CJCA 3LFUA 2MYNA 1N6HA 3PC8C 2JD1A 3C1AA 1FYWA 3TTVA 4HATA 4PC1A 4C88A 4XVHA 1DC7A 1R0BA 3GUYA 3IP5A 1X8LA 3MTIA 4KXWA 2AC7A 4Y6OA 3SWWA 4DV1B 3JAWA 3W8FA 3E23A 4OMCA 1QZZA 1UDXA 2FX3A 2WTXA 3L40A 4JBNA 3O2SB 4RJIA 5D86A 3WK7A 1EE2A 1NJSA 1YR1A 2O7SA 1YNSA 3BF8A 2AC4A 2LRHA 3IUBA 1ULAA 4KXXA 2BLNA 2ZVPX 5C52B 2PU7A 2NADA 3UXHA 2FUEA 1JJAA 1BXKA 2EBWA 5J43A 1QONA 1H85A 2PVPA 4GLOA 3V1TC 1MU0A 2ZJ0A 1SXJC 2CMKA 3IJRA 3KZXA 2CEKA 5ESWA 5J5CA 1RLOA 4REOA 1AQ6A 3FR8A 4GR4A 1FRNA 4NBSA 2JFXA 4N5IX 1POWA 1W96A 2QTVA 4CKXA 1EGAA 4X8MA 1CF4A 2YJGA 3FPGA 5A3QA 2I6XA 4D6XA 3TVTA 5AHKA 5L7YA 4R9UC 4EH1A 4NPCA 1RRKA 2EIXA 5E2BA 1JBQA 3SQWA 4WZBB 1DBSA 1K8XB 4EA6A 2FCAA 3DBOB 1G38A 3LT2A 2NNLD 2PX2A 4UBOA 5D6NA 3AM3A 3B6KA 1E1NA 3BIOA 5ALEA 4EG8A 5LLSA 4W5RA 1PDWA 4P2GA 4RPJA 5M29A 2YY6A 5K0FA 4GRDA 4HRXA 3HKCB 3PU6A 1XD2B 4I55B 3VAZA 1U1CA 3ME5A 4BL5A 3MJ4A 2IH2A 4IHAA 2PSHA 4ZO7A 3TRKA 5HKBA 2FP4A 5FI0B 2C9OA 4YP0A 1N7HA 5C1DA 1G20B 2VF7A 1RLIA 2H4HA 3P2MA 4GP6A 4FYXA 1U2RA 3CLTD 2XD9A 5HJEA 1BWPA 4K9PA 4W5WA 2FG6C 1AK9A 4P84A 1KZ7B 3ED1A 1UMCB 2ENWA 3F7OA 1EXMA 3LUCA 5ALGA 3X1JA 3NAGA 3BDAA 4X66B 4TLAA 3FVRA 1VCHA 5JWRA 2ZYGA 4RM3A 1G21A 3PWTA 4KIFA 3U4GA 1CB0A 5ALQA 2X5JO 5CFOA 3LIPA 1KGDA 2SHKA 4WA8A 2PGOA 2Q2VA 2V9ZA 3IUSA 1PR0A 3KPJA 2VTKA 1HQYE 1G6Q1 3N53A 3SC6A 1GGMA 3WFIA 3NDRA 2ZS9A 1E2EA 3TRJA 2ZQZA 1S5PA 3G5MA 1YIOA 3E35A 4D45A 3TK1A 1CZUA 1WP9A 3ABRB 3OT1B 3FTCA 3OF2A 4JBIA 2ZQ5A 3UH1A 2Z95A 3ZTTA 1CZHA 4LGMA 4JI4B 1DRVA 3V8QA 2QSZA 3AFIA 4HX5A 5HM8A 3PFWO 1ZRSA 3F8SA 2QVBA 5K0EA 4J0FA 2CFSA 2H1WA 4JYZA 1RJWA 4DQDA 3U4AA 4KAFA 1VE1A 3LT1A 3TIIA 3TKYA 1I6KA 3EG5A 1T4CA 2X5XA 3D4NA 4XGKA 3RROA 4PLWA 2YBDA 2FK8A 1D2GA 3ON5A 2WAXA 4TMYA 4B44A 4U7PB 5H9WA 1WNTA 2FUG6 2F3QA 2MCFA 4BWGA 4MHTA 3COWA 5EUQB 4EJ0A 2HYIC 3DZFA 1UKVY 4DCGA 2ZIXB 2PIAA 1NXXA 4PZEA 4I50B 1CFJA 1CT9A 3ZY6A 3SPXA 1HURA 1A2BA 1Y8QB 5JE8A 3IPCA 1Z5PA 4L08A 4YUZA 1QX4A 4JSTA 4FT4A 5IVIA 1IXYA 1PL6A 4WXMA 5G0UA 3S70A 2DP4E 1CEXA 1WW8A 1NKSA 3BXOA 4MUNA 1EFPA 2HLHA 2IYRA 3LPLA 3OT1A 4BQPA 4CTMA 2H2GA 1UJ6A 4GC9A 3L04A 1XEXA 1WUJS 4NI5A 1LNQA 1JSCA 2ZRMA 3EA0A 4GPTA 5KOJA 2OGWA 1WDTA 5K0SA 4Z49A 2P35A 3S2FA 5B30A 1OOEA 2I8LA 3I1JA 3REGA 5HK8A 3GDWA 1WXDA 4LRXA 1R8YA 4EKYA 1Y9AA 4FKZA 4Q05A 4J0GA 4WXPA 4V1CB 1LJLA 1OLUB 1EIWA 4O4JA 1PS0A 2BFAA 1RI5A 1YJ5A 2P6OA 1L4GA 4KR9A 2BFWA 4KI7A 1T5BA 2SICE 2YQ5A 4TV9F 4Q4CA 2QN8A 4FHCA 4V0SA 4RNCA 2DR2A 1C0PA 2FWJA 2HKIA 3MRSA 5LQRA 3QYFA 1AH2A 3TD9A 2O2IA 4JYBA 2EKLA 3ZTYA 4E33A 3CZPA 1QE0A 3REOA 1OB5A 6YASA 2JFZA 1OIVA 3GRCA 3OOEA 2F4VB 1YRHA 1CEQA 1I6LA 4OBEA 1C80A 1G3RA 3SS9X 3FGOA 4MK4A 4EGQA 3A9TA 4BNVA 1SXJE 4BPRA 3A4YA 4JI8B 4O5OA 2X8WA 2CMHA 2X40A 4HY3A 2A3RA 3TSAA 1SD2A 1JNXX 2QKYA 2B1JA 3UMSA 4ZI7B 1WG8A 5KOJB 3AW9A 1KKMA 3D5EA 3HNOA 3IQHX 3LZDA 3U19A 4ESVA 2LTAA 3EWAA 3PA6A 4JX9A 2B99A 2F67A 1QGUA 3KAJA 1R00A 4LUCA 1SG0A 4REQB 4QYWA 1CVIA 1SC4A 3DM9B 4QFCA 2HPVA 1AA6A 5FOXA 2AEJA 1US8B 5AICA 4ARAA 2PLWA 3MILA 5C4IA 5KU1A 1AT1A 2BEWA 3TZEA 4Z4CA 4IDOA 5A1TA 2GLXA 2D5LA 4WLFA 1AKUA 3FCUB 3O8RA 3AR7A 2W2MA 1KVUA 1T0BA 4NHEA 4YP6A 4IS3A 1E64A 3HDVA 4G89A 4N3CA 5JD4A 2FSSA 2IE0A 3LQKA 1BHSA 3LW7A 1FTWA 5ALPA 5B64A 4I46A 5KOHB 3GLGA 4HAVA 2IYLD 4WCDA 3PPVA 1E2GA 1CBUA 3PICA 3S1AA 2ZTVA 1OREA 4R69A 5D1HA 1ISFA 1BMFD 1EGHA 4XOUA 3V6MA 5A4MS 4XWGA 3CF4G 1VCIA 3SFVA 4B4OA 1E8MA 2N47A 1O5IA 4F92B 1QRTA 3T3OA 1TLFA 2GBGA 3KZCA 4GL4A 1RRFA 3VA7A 3R09A 1YJAA 2C95A 4HLQB 1SXHA 1FVXA 2ZR7A 4TRNA 4WRRA 4ZI3A 1RMQA 3GJ5A 3WBBA 1DAOA 4XD7D 5DOZA 4IHJA 2QBYA 4HUJA 1SCQA 3PC6A 2HA6A 1TQHA 5FB3A 4ZVQA 3NALA 5KEIA 1N5MA 1OIXA 3N70A 1D09A 2OV6A 4RA6B 3VR5H 5JBNA 1FX0A 2DTEA 3LE8A 4HQ6A 4JFAA 2VTEA 3DNFA 4C7BA 2PKXA 1FU8A 4ZT4A 2ANBA 4N03A 4BMCA 2NZXA 3W1EA 3QHQA 2J7KA 3WYBA 4JC4A 3RWBA 4DADA 4C1BA 2OAP1 2NTEA 3BIWA 5H68A 3I2KA 2Q6IA 2WHXA 3Q6MA 2JNWA 2O2HA 4GXRA 4RV9A 4O2LA 4CMCA 2P7HA 4B3SB 3QWAA 3UPUA 2QX6A 5EGNA 1IYZA 5I7SA 5FNZA 2EBFX 5EJFA 5E1OA 1I1NA 2G0TA 5KYKA 1PHPA 3A37A 1ZHHA 2R62A 3A10A 3FWYA 1QFMA 1RWXA 4I9FA 3GJ8A 4FLFA 3GB9A 3LT0A 1EFKA 2X42A 3IHLA 1BFDA 5AH0A 3SSOA 4HZGA 4N49A 4L9SA 3W90A 2MR5A 4C3UA 4EHKA 3T5TA 4D81A 5AKEA 2YUTA 4ZOEA 3SI7A 1E3JA 2AHOA 1QSGA 4E14A 4DMLA 1VDZA 4DN6A 2HLPA 5JDIA 1D2NA 5K3AA 3QOYA 1WEKA 1QU2A 4PHFA 1MG5A 2ASEA 4WA7A 1R8SA 3ZUPA 3PUIA 2O0HA 1QH8B 4INOA 1A3CA 1AA9A 1WR8A 4EATA 5TF4A 3GY0A 2F17A 1B6TA 3PQ7A 2ET6A 3M6WA 1VJ1A 2I2CA 4GMGA 4DT1B 4FYIA 5LQAA 3ZVKA 1I9GA 2E85A 2NNWB 3NV9A 3PHHA 4PNEA 3AJDA 4UVHA 4BE7B 3GD5A 4OXNA 1D6JA 3L79A 2WA2A 3OE5A 5DK4A 3RHZA 3O92A 1E99A 5KYXB 2QTZA 3EZYA 3X1ZA 1BKSB 3ZWXA 3W04A 2QV0A 1G6KA 2JGKA 5C8YA 1BHQ1 2BC9A 4GKAA 4KCGA 4UTNA 3UBTA 4WEQA 2X1MA 1X80B 3JQ9C 2OLEA 3HDGA 2HMYB 1IHOA 3AIOA 2PNFA 5KSYA 2RBGA 1L4EA 2MU1A 2RKWA 3MT9A 1YCGA 3ICCA 3EC1A 1BN7A 1NDHA 1PUIA 1VXRA 4TZ6A 4OATA 4FEAA 2HPZA 1FFGA 1VLVA 4P4UA 4R1TA 1Z22A 1LCIA 1PL0A 3E9CA 3GARA 4X91A 2IOFA 5D84A 3V7NA 2RGRA 2XMGA 3D7KA 4E2YA 2HF8A 4M0KA 2WKRA 3MHPA 3UGJA 2NSYA 3JRWA 4YRTA 4HNHA 3N59A 3PVCA 5KO2A 4UU8A 4QTXA 3AF6A 1HRKA 1CF9A 5FBZA 1CSEE 3UWOA 2HSGA 2V96A 1H6BA 2AG5A 2XIQA 3RH0A 4WJLA 2EGHA 2Y67A 2HDHA 3FZNA 3FHOA 2R60A 1II8A 3LLVA 1PLKA 3OI7A 2WILA 1QUFA 2COKA 1QQ6A 1CS0A 5IYZA 3ZHBA 1TCVA 2N46A 3H5LA 1F2UB 2H57A 4Y2YA 5BRNA 1E6LA 2AJDA 4D25A 4RWZA 1CIJA 1MC8A 3OM8A 5E9QA 3BRWD 3NGLA 3FOEC 2Z4SA 5JMOA 3IDFA 3AGPA 5LB2A 1JRLA 4TXNA 2G9ZA 3BAFA 3IBTA 4TRRA 4RESA 4BEJA 2VJNA 3Q6IA 5AXAA 4IH4A 1QF6A 3HYCA 4LKOA 5TPZA 1L5GB 4M55A 5ABPA 2WJPA 3DLTA 4PLPA 4Y6RA 2AI2A 3CW2A 1OA1A 3SAJA 2I1WA 2MSNA 3F6PA 1VJGA 5TMDA 4CFSA 4PO9A 1TCCA 1YL5A 1RAHA 3Q1LA 4G0QA 4I4TA 2H17A 3BGDA 3GCWA 3OEYA 5HIKA 2ERXA 1J0CA 1VL1A 1WCIB 3A6EA 4LPSA 1CKEA 3P9XA 4TS1A 3UYKA 4EI2A 3IE1A 4WESB 2CB9A 4MQ5A 4W7SA 4YQYA 4DKJA 2OL4A 4L0DA 3DZDA 1KNXA 2GA9A 3UICA 4NICA 3GPLA 2UYHA 3WRXC 5AHXA 2ZT5A 3GAZA 3N8DA 4ZT3A 4KLRA 4NE7A 2F3RA 4PZDA 2ST1A 4AY4A 1A8UA 1OX5A 2I2FA 3W2GA 3CNLA 1V16A 1F51E 3FDXA 4YT8A 3T35A 1DMRA 1L8LA 4LGVA 3EC7A 3V8BA 1C2TA 3AFMA 4DR6B 3OPQA 3HM2A 4F1KA 2BUAA 4YVFA 2IHVA 2X15A 5A02A 2WIAA 2CUZA 2QTRA 3LBIA 3MOSA 2JHCA 1SEVA 4ZQFA 1A95A 4JZYA 4HLNA 4BNXA 5JSZB 1K08A 4HYTA 1LFDB 3SZGA 1U2SA 4BKMA 2BEUA 1NQ5A 2ATCA 4P7KA 2PMFA 3V1KA 1RJGA 4ENSA 2BL4A 4BC0A 3WDSA 3VDXA 4MIEA 2ZI7A 1QFZA 2WIBA 1CY4A 3E05A 4X3PA 3T3GA 3RRBA 4GKJB 1OH7A 4ZODA 1P4AA 4WCFA 1YZGA 2DLCX 4O4HF 3EY9A 3NV7A 4JL6A 4ND6A 3FB1A 2ZUFA 1B6GA 3OY7A 3OT5A 1Q12A 3HU1A 3I5XA 1TEZA 3M2PA 1H5UA 1ZHFA 2IY8A 1AKEA 1NJ2A 1GA4A 2V97A 3LNCA 4BGIA 2PCJA 1ZICA 3LF1A 3ZD9A 4K88A 2OBYA 3GDHA 3X44A 3DP9A 1EK1A 3KSAC 3G02A 3SLGA 3S5UA 4ARVA 3OQNA 2BTQB 1ADCA 1MUUA 3G0OA 1A5BB 5E38A 1S02A 4DB4A 3QKRB 1IK6A 4OAQA 5CR9A 1DX6A 3RT1A 3S27A 4ZYLA 1ADFA 1CPYA 2QU8A 4IOLA 2G9VA 1QB8A 3OQ1A 4GICA 4EI7A 4MLPA 4P5PA 3WDKA 1ZOLA 2VYCA 1Z73A 4JL8A 4NNOA 3B1WA 5JEEA 2PYZA 2WJZB 4FBLA 4H60A 4JVMA 4CCYB 5AW9A 5KDOA 1TQ4A 4R54A 2HR1A 3OZBA 1MHTA 2MT9A 2YMPA 1KAEA 1QG0A 4LCJA 3AP1A 3ZTWA 5K7SA 4KTVE 2HO5A 4E5YA 8LDHA 1Z0DA 2O2YA 2QEQA 3C14C 3AFNA 4YMWA 5EQTA 2O3QA 3O38A 3OETA 2FI1A 1NMXA 3OEHD 4FHZA 4EY7A 1XQ9A 5A3JA 5I4IA 1YZYA 3HL0A 1XTUA 5BN3A 4IAOA 3O1JC 3DFKA 4BO3A 1N7GA 3AU8A 3H86A 3K6JA 3OX1A 3TR0A 2CLOB 3TNJA 3WJAA 3E84A 2WJ3A 2Y1XA 3AVUA 1Y81A 2FETA 4JNCA 3SHWA 1RKVA 1QJ4A 1TIPA 3GJYA 4CKBB 3WK4A 2OBBA 1MVLA 2BY4A 1E9VA 5EFZA 1JHZA 4YJ3A 3WGIA 3O75A 2R8RA 1E69A 1PKEA 1XQ6A 2XR1A 1SRRA 4ND7A 5K0TA 3GT7A 2CVHA 5GOZA 3HKBB 4HNAA 5I45A 3GL9A 5L8VA 1WU7A 3KV1A 4GT1A 4IDFA 1L4BA 5H3CA 1SUIA 3UHAA 2ZBGA 3CUKA 1CY2A 2G07A 2VNAA 2YJ5A 3CLRC 1NRWA 1CUIA 1FP4B 3R3VA 4I50F 1BMQA 4J0EA 3CR7A 3N0TA 2O1EA 4FYMA 4E4YA 4MVYA 1GZ4A 4DR1B 5C18A 3LSYA 5FQOA 4EQ6B 1DAGA 1WBBA 1LRKA 5LR6A 4AKSA 2P9JA 2LCIA 5EIOA 1DKRA 4IX9A 4UHBA 4KFTA 4OGGA 2Q21A 2HC9A 2DR3A 5B1DA 2BR5A 2JVIA 2P9HA 5CXQA 1SMKA 1UOEA 3FPHA 5A7FA 1JI3A 2FG5A 1BNCA 3PFCA 3QHAA 4DRZA 1C5KA 2Q8QA 5HRCA 2EP7A 1XU7A 4WZ6A 1Y4UA 1U9IC 2AG0A 3BWCA 2BVNA 4S04A 3QG5A 3J7TA 4RD3A 3ZE1B 3AB3A 1W73A 4EYSA 3K1ZA 4JJ7A 4JSYA 2GS9A 5EAIA 3MQFA 3VZDA 5WRFA 4TV9B 1YGPA 2LGJA 4P36A 4R51A 3Q12A 2DSNA 2EBHX 3MJEA 2OFXA 3KCNA 1CF2O 2MMCA 4FDAA 2RC6A 1TAHA 1OFVA 4IIHA 5IC4A 3EIWA 5KYGA 3EBLA 2DCUA 2F3SA 4PGFA 3H11A 1SIOA 3QMWA 4CR6A 4EF5A 2ZSDA 1PFVA 4G0NA 2C99A 2I4RA 5BYKA 1QG2A 1V1JA 4HXYA 3S3TA 4R9VA 1D2AA 2OCDA 1AVTA 4ZREA 3CN7A 4MPDA 1E3SA 4QXOA 5C5CA 1T6XA 2JB9A 3FRIA 1AGRA 1RLMA 3M6MD 5DISB 3S6JA 1MAAA 3TNDA 3ZWBA 3A1UA 4DYHA 4M9ZA 1P7CA 1F8FA 1WZNA 1G0NA 3G2NA 1PJCA 2P1ZA 2W00A 1E7MA 2JJ2D 4Y1RA 5DHQA 1A5AB 1M2NA 4KC0A 2D3TA 3E2MA 1YRYE 4CLRA 2CNOA 3HCWA 3EX7C 5DB4A 3RFUA 3IIIA 1KO5A 3PXCX 4HS9A 4K9MA 4XVCA 4TZ0A 1IWBB 2VHJA 3R7FA 3LXUX 4L78A 2DKFA 2R25B 4K40A 4JQYA 3E48A 3GOQA 5FPHA 2G7MC 1JSLA 3OICA 4QO8A 2WD7A 3UF0A 4OL9A 3I6BA 3IT1A 3EZ2A 2WTUA 1U4NA 3T3NA 1MH9A 5BSRA 3ELYA 3MJCA 5LL6P 5K3SA 1Z2DA 1FYFA 1YH3A 2H92A 2X1VA 5A71A 5CFRA 1NBWB 5J4KA 1G5HA 5LNK1 2ACKA 1KNQA 2QRLA 1TPYA 1SULA 2EKQA 4P3KA 2GXSA 3AESA 4CF3A 3VPAA 4D9KA 1VHTA 1ZGBA 5MHTA 4G4JA 1EB9A 1D0SA 1GCIA 3BCUA 1E8DA 1DPGA 5G02A 4D02A 2JAUA 2W2VA 1F1JA 4B6SA 1LI4A 3H4MA 3G0CA 4OMFG 2NU6B 4ER0A 1U2ZA 4X7MA 1OC2A 2XYHA 2ZYRA 4Z9XA 3VX3A 4EHLA 1MG0A 3LDFA 3FI0A 1N9KA 1WUTA 2ZT6A 3QA3E 4FS3A 1GU7A 1NNUA 1J8MF 2I34A 4LWQA 5DIZA 3VPFA 1JFFB 4MRNA 1FLDA 5EZYA 4D4HA 4EL0A 5KJFA 1W0JD 1EG7A 4G86A 4C6HA 4L57A 4YRFA 4KYTA 2GILA 2QQ0A 2XXJA 1Z6GA 2ZRFA 1W1WA 3KJIA 3KSUA 4XJTA 2QA5A 2FZCA 3HVJA 4U2KA 3B5EA 4LBVA 5AM0A 4BLRA 3U3XA 3TQCA 4CLEA 1QHFA 3JQ8B 2FMTA 1AB6A 3M1YA 2D5BA 3FNGA 2UYQA 1GZ5A 2WM9B 4MKIA 1F14A 2OO7A 3ER8A 1I2ZA 1OTXA 1X7ZA 4PG5A 3K9CA 2CXXA 4EELA 5K2MA 4JB2A 2B0CA 1OBCA 1Y7IA 5HF8A 5BNWA 1OT3A 3IVRA 5AJZA 3A3OA 3DFZA 5ICGA 4IGAA 4YRKA 3E9MA 5BWCA 1TVKB 3JYHA 3MXOA 1R0ZA 1PZEA 3A3PA 5CTJA 5FUYA 1E7QA 3PQ6A 3KT3A 1RT9A 2C8VA 4QUKA 3P9SA 1R0WA 4UDOA 1G19A 3ROKA 2WPDD 4OI1A 4K6KA 1EWVA 5EGSA 4TYNA 2QGNA 1M7BA 1JIUA 3B9BA 1TGVA 4UAJA 5C1PA 2YN2A 4PX5A 2B8JA 1CERA 2GI4A 1P8AA 4IICA 4JNKA 1BJKA 2L2QA 2FPWA 3PHGA 2GAFA 1KZGB 3OCJA 4KIUA 2J4DA 4KJXA 4JMPA 4LWZA 5JDCA 2FPOA 2YY7A 1UJMA 2OKCA 2AIRA 2CJWB 5KAMA 1AZWA 4BO9A 1DG1G 2GQ0A 2F43A 2F3PA 4P1ZA 2G7ZA 2VOJA 1R8XA 1KHTA 3LQRA 1B15A 3R7SA 2XADA 5JECA 4YRDA 4NZPA 1DO8A 3RKSA 2JZOA 4B17A 1Z0UA 5C3UA 5FI3A 2BBOA 1FXSA 1NHGA 2ZWAA 1IY1A 1BD3A 3STYA 2C4KA 3DBLB 3O8QB 3WMXA 3L0PA 2Z2IA 1P5HA 3AJAA 4B74A 1TVKA 5AVZA 4ZRDA 5JSUA 3UJNA 1E18A 2J3DA 3M0EA 1EM8A 5DBOA 3UAXA 2DFPA 2JEZA 3KAPA 4Q19A 2P77A 2Y05A 4H7KA 2E87A 5CGZA 2QDXA 1QRUA 2WYUA 4TROA 1IZ8A 1ZNZA 2TRSB 2ESRA 1L7QA 4B6QA 4D6YA 5J2TB 2UUCB 3PX3A 3R0QA 4DCSA 1BKDR 1OVGA 2VYVA 3NDBB 4NCKA 3WY9A 3QVJA 3LXMA 1T2CA 3RVLA 2IVFA 3Q3HA 3HLKA 3OWXA 4EY3A 2ZI3A 4Y1EA 4X71A 1H3EA 3BK1A 4B35A 2R7NA 2AQ8A 3PNKA 2E37A 3GZJA 4MVJE 5FTJA 1LTHR 3LPNA 5EOVA 3NDPA 1XAIA 4UE2A 3QEMB 4B8ZA 1N5OX 5AKZA 2VHTA 4W63A 4D4JA 3ST7A 4AC9A 1H2RS 1DKPA 1ZN7A 4FGUA 1E6CA 5EQJB 5IK2A 2WM2A 1O77A 1UFVA 3NO4A 1W75A 3CR8A 2CNWD 1YZUA 2QN1A 2I66A 4DHWA 4Z5XA 4KL8S 2J6HA 2FPGB 2CFCA 1EP3B 1CJVC 2PGIA 4M0DA 4LOAA 3WRYC 1ZL2A 1DX9A 5HKLA 1Z6XA 3DE4X 4EGCB 4RU1A 4WDQA 4NJEA 5I51A 1VPWA 2VQEB 3MTEA 2H1HA 1FNMA 2ZAMA 2PQ2A 5IH3A 5I4CA 1GZ7A 2W4QA 2AN4A 3IBYA 2W71A 4Y2SA 5GV8A 1FMJA 2CVQA 4CWAA 1CUWA 2YICA 1X2BA 1H4SA 2ZYIA 1L1EA 4BNYA 1D9XA 4UTXA 1C8BA 5LD2B 3H5OA 3IT3A 2NO6A 4M3NA 5A9SB 3A6FA 3GU3A 5DH9A 3CR3C 4QD3A 1SK9A 1JTVA 2W4MA 3E53A 1NG1A 3WLFA 2VJMB 3L7KA 2XAAA 3CZCA 3UCEA 1B76A 1KQOA 3KL4A 2O7RA 4RWEA 5TMEA 1ZXBA 4LSGA 2J5QA 2VATA 4MJ7A 1EE9A 1WY7A 1PJQA 4R9NA 5ED0A 4N0DA 2AYZA 2OESA 3RV3A 4DC1A 2OENG 4NE2A 4ZVTA 4WGGA 3G0DA 1T2AA 2C54A 1UPTA 3GVPA 5E2AA 3VC7A 3VOSA 1ZY2A 5L4NA 5K8CA 3NEAA 1XXHA 2PX6A 2B98A 3KBBA 4EYKA 3EEYA 1R0LA 3I9JA 3QA9A 1NQWA 1KJJA 1RRGA 1IWPB 5A9TA 4AF6A 3GUVA 1ZC4A 1P2BA 5CD1A 4ARIA 4B85A 5EHNA 1E3TA 2WIKA 5K01A 1NXQA 3CPSA 1NY6A 3BFVA 2PEYA 3H9UA 1PJ8A 4P7FA 2DJ5A 3PRYA 5IAOA 1U4OA 3G1TA 4GVPA 4V1CA 1C9JA 1O0SA 5AI5A 3TX6A 1IHXA 1J2YA 3GJ7A 2RI1A 1AKRA 2GN2A 3ZCUA 3K6RA 2AOWA 1N3IA 5ENDA 1GL6A 3ZWDA 1C29B 1NP7A 2C78A 2PTHA 3KB8A 3TSCA 4CEIA 3O03A 1QE5A 1GQOA 2ZYSA 1YJ8A 1I80A 3LLMA 3CLSC 3G13A 3GW8A 3EIUA 1G20E 4V1CI 5K8VA 3HRIA 2EEZA 2X41A 4WBNA 1UPXA 4CEHB 3FWPA 2V9PA 5KTPA 4HPWA 1R37A 2QLLA 3K9WA 2YV4A 4G85A 4F3KA 1H6DA 2WP8J 1KVQA 3QYAA 3IYLW 3IR7A 2AI1A 4U1RA 5J2UF 2CBXA 4LS3A 3H7AA 1TYCA 3B12A 2RGNA 3GVCA 2J59A 3IP9A 4NXMB 5TSDA 2RHBA 1U2GA 1KZ1A 2J7PA 4K03A 5GONF 2FQWA 4S35A 2XWQA 1NQVA 2XQGA 3IXLA 1F5SA 1ZD8A 3RTBA 2HNAA 5CB4B 2HU5A 1J8YF 1QYXA 4F9TA 4CM6A 1JHUA 1MRSA 3TMAA 1DXOA 3BXFA 3ZI4A 4GAEA 3B1KA 2F55A 2C1EA 1EAMA 1KJ9A 3HDHA 3WL7A 5EP3A 1A8HA 1PBTA 4PIPA 3HZZA 4XI9A 4BYMA 2ZAYA 4QLAA 2ZE8A 3WA6A 3EAGA 5C35A 2INGX 3W9YA 3KWMA 4HDRB 5A4FS 2I03A 1SC9A 1Z6TA 1Z75A 3TRFA 1HORA 4KKXB 3UK6A 5JPIA 3OZFA 4BKOA 4CNBA 1NL3A 3L82B 4OD0A 1OIWA 2V9CA 1H8EA 1O9GA 1OLXA 4QVGA 3BF7A 5LQDA 3KQLA 2JEYA 4XSHA 3ZWNA 1Q3KA 1URPA 1CRLA 2Y3IA 2PX5A 1EX6A 1HT0A 3IAUA 4Q93A 3ZIUA 4U0JA 3T9BA 3I5UA 4IIFA 1JYFA 2D1FA 3CLUC 1YULA 4LV5B 3U44A 5CA1F 4TKMA 5CXUA 2C3UA 5KTMA 3PE4A 4J03A 3ZZNA 2V4ZA 1TF7A 3IE2A 4JHXA 4KVGA 3LKVA 1P77A 2EG9A 4KOAA 4PBRA 5DN9A 4P81A 5B53A 5IKPA 4RPGA 5E6RA 3T3IA 2IH5A 4PNPA 4NG4A 3VOAA 5ADUS 2QYTA 1W59A 5AXDA 2AT1A 4G1BA 1WP4A 3R4VA 5LP6C 1MP0A 3ZY3A 1JA1A 2W6ZA 4IQ4A 3DR5A 5CH8A 2GCNA 1EVJA 1WZIA 5AVKA 5ITWA 3DZHA 4D98A 2C98A 2QUIA 1T6NA 1X15A 2CJXA 3CVXA 4R05A 1M0WA 4RA6A 4CUKA 1CNFA 3PKJA 1NTOA 2F6RA 3ZHOA 5A5VA 5A7GA 4MS1A 4ZOCA 1RDFA 3EVEA 2FWIA 3O4HA 2PGJA 4ICIA 2R6FA 4WOJA 1NUTA 4YAUA 1QH8A 1AQIA 3OPMA 4HDOB 4HXEB 4M0EA 4NXNB 4HLUA 5KJCA 2IS2A 3QG1A 1SA0B 2WV7A 2ZW9A 2H5LA 2IIBA 2WV9A 5L4LA 3L93A 4OK3A 4A4DA 1N77A 3BE5A 4PN3A 3U9TA 4CL2A 1QOZA 2V0NA 2OO5C 4KREA 3A4NA 4NKRA 4LZJA 4A8PA 3CUWA 2HWWA 4X1IA 2XPCA 1Y9JA 1ZIDA 1I1HA 2RCYA 2IXFA 3ASVA 3R8XA 3T5DA 2VDKB 3QVUA 1Q74A 1Z7GA 2HSJA 3WADA 2DUNA 4MW6A 1YVUA 4CR8A 3GFOA 3RUEA 3CZQA 2VP6A 4LTMA 2K87A 4B3BA 2AN9A 2F00A 3C98A 4OHOA 2C07A 3RSQA 4I4TF 1L6RA 2DFVA 3AJ8A 2I0FA 4YMIA 4EENA 1E0JA 2W2NA 1ZIXA 1U8CB 2QZJA 1KI6A 2ONKA 2OK7A 3AIIA 4EZEA 2HBZA 3JYQA 2VH2A 4LDRA 4NY1A 4D79A 4BLTA 3ZV3A 2OECA 3IODA 2JIPA 2RGDA 5B2EA 3TDMA 4YMGA 1X74A 3R5JA 2DF8A 1QH9A 2VHUA 1D04A 2VUIB 5YASA 1KS9A 3QLUA 4G63A 3BL5A 4YN3A 3P96A 3N3AC 1IG3A 4EKNB 3K53A 5FOQA 1NX6A 1G60A 2C5FA 5EXXA 4PM4A 2WTMA 2VQ3A 1HWYA 3E18A 4D9JA 1TIBA 3EZ6A 2HWXA 3I2HA 1CLEA 3ZD7A 2HMAA 4IJ6A 4X1IB 4F5YA 1BE6A 3ICOA 1G1MA 1ZO8A 1ETHA 1Y7TA 4JKIA 3PJEA 1S9HA 3ETGA 2NZ8A 3KZNA 3Q9UA 3FBWA 5KSPA 4DRXB 3AYXB 3R3YA 1Z0IA 1E7WA 1KEVA 3CKYA 4EA8A 1LQTA 1W5TA 2H9YA 4H0FA 1Y33E 4PY2A 4QSHA 2HIAA 2P40A 3GIWA 3SR3A 3C85A 1PR1A 4Y67A 3UJ6A 1IFXA 1UF9A 4E21A 1V7QA 1XPOA 4D3FA 2B61A 1C3OA 1XEFA 3C3BA 1AXGA 3LM8A 4PFQA 2PG3A 2PRZA 5JCOC 4Y7CA 3H5VA 3O9MA 1FE8A 4TWBA 1IN5A 3UPDA 1JEEA 1H4TA 3NM4A 1X1CA 2P9FA 2P9CA 4YCLA 4ESOA 1Q50A 2VNIA 3QVTA 2HFJA 5JRZA 1NC3A 2EP8A 3CSDA 3U7HB 2WINI 6Q21A 2KLHA 3I12A 2CT8A 1LPMA 3H9BA 4M0LA 4I8XA 4KKVA 3VSAA 4ZYYA 1Q7BA 2XF8A 4RYDA 4HAIA 2NT3A 4PLHA 1GQ2A 4E2WA 2HTFA 3B78A 2XT6A 2CSUA 1F60A 2C4TA 3DEKA 3FBTA 3L0ZA 3O8OA 3UK0A 4IMRA 1HE1C 3QF7A 4K28A 4R2KA 3VRHA 4DDTA 1NULA 1U7WA 1RJEA 3LQ1A 4G5SA 4OOFA 4H7JA 1J0BA 5I7AA 1O8CA 3BOSA 3CF6R 1PBNA 1N6OA 4P5EA 1W30A 3HN2A 1HYGA 1PKXA 3IQIX 3RRXA 3L0DA 3TRIA 1IJEA 1ZR2A 4NZMA 2ZR8A 1P2TA 4D0RA 3TZ6A 1F5NA 1LPAB 3HS3A 4AF7A 4CDGA 1CUUA 3T7JA 1AQUA 1SPXA 2YNMA 3NZEA 2II6A 3Q0IA 4XM0A 4C43A 2YZKA 3PITA 5LVAA 1LU9A 1UOOA 3HY6A 4I4IA 4WT7A 5K4AA 4X8LA 1VLLA 1F12A 3OIYA 3F5DA 1ORRA 3STUA 3VBEA 1C1DB 1KJYA 3VPXA 4B4VA 1RAIA 3QQPA 2HJRA 2ZETA 2AMFA 3K1JA 2WR8A 4MR9A 1ENZA 3AF5A 4TQGA 5AR1A 3RJ9A 1NDQA 3LGSA 2PIDA 3TTSA 3E0XA 3BM5A 4OYYA 4AG3A 4C9BA 4CEJA 1R0CA 3N7TA 3KCQA 4V2IA 5I7VA 3E7PA 3H1GA 4BP3A 1IOWA 2BJVA 3HO1A 4BHTA 2GETA 1Z5ZA 5CM2Z 3G17A 3FA2A 1ZUNB 3O4VA 4KE7A 2NU7A 3HCEA 4V02A 5EPOA 1UJCA 4MLCA 5KAPA 1ML4A 4UEKA 1RJFA 4WEOA 2P5SA 2YWHA 3PDUA 2ZSJA 2HXSA 4IJVA 4N0PA 4P35A 4RJLA 5HMLA 2GD0A 2QLJA 4GQAA 4UM9B 1T5DX 1BX3A 3WAJA 5LOVB 1X1RA 3H6HA 3GO4A 3RTAA 4N6GA 3TW0A 5A0FA 1BGVA 2D2FA 3Q41A 2RGBA 4OX9Y 2XWJI 1DQYA 4EG5A 5HIMA 4LDJA 1DRUA 2PD3A 2L19A 1S1CA 4FHDA 2IY9A 1Q16A 4QHTA 3H17A 2D8AA 1AMOA 2AE2A 2O2JA 4QWWA 2CJPA 1TQ8A 4RK0A 5JJCA 4IIJA 1HRDA 3DE5X 1OKKA 4YB8A 5A0VA 1L5LA 1MNAA 1S2OA 1TU3A 3P0EA 2DOKA 4JJFA 4DMKA 2Q41A 1BSVA 1OZGA 4ARCA 3E8MA 1PVOA 3P0JA 1QP4A 4D8TA 1KEUA 1M5TA 1MZVA 4RD4A 5F3RA 2IUEA 4HEHA 3ZVMA 2VK1A 3PJRA 2B34A 1E77A 3LWDA 1EFRD 3AR8A 5FL3A 3COPA 4TMXA 3CZRA 4CLOB 4YMSA 2MINB 3FNHA 4D6PA 1DZIA 1P1BA 4A0RA 3CPEA 2ZWMA 1V47A 4EG1A 3TBFA 4KHZA 4F4HA 2RG1A 5M5BA 3UQYS