3I3OA

2.06 angstrom resolution crystal structure of a short chain dehydrogenase from bacillus anthracis str. 'ames ancestor' in complex with nad-acetone
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
282
structure length
282
Chain Sequence
FVTMPAQHQNKQPGIESLMNPLPQFEDPNYKGSEKLKGKNVLITGGDSGIGRAVSIAFAKEGANIAIAYLDEEGDANETKQYVEKEGVKCVLLPGDLSDEQHCKDIVQETVRQLGSLNILVNNVAQQYPQQGLEYITAEQLEKTFRINIFSYFHVTKAALSHLKQGDVIINTASIVAYEGNETLIDYSATKGAIVAFTRSLSQSLVQKGIRVNGVAPGPIWTPLIPSSFDEKKVSQFGSNVPMQRPGQPYELAPAYVYLASSDSSYVTGQMIHVNGGVIVNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 2.06 Angstrom resolution crystal structure of a short chain dehydrogenase from Bacillus anthracis str. 'Ames Ancestor' in complex with NAD-acetone
rcsb
source organism Bacillus anthracis str. 'ames ancestor'
molecule tags Oxidoreductase
molecule keywords Short chain dehydrogenase
total genus 107
structure length 282
sequence length 282
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2009-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3i3oA00
3ZU5A 2J3IA 4CQMA 3AUSA 1ENZA 3AY3A 4XIJA 2Y1OA 4TVBA 3K6JA 2X0NA 1Q7BA 1X7HA 3A28A 3RC7A 3CZMA 2YHUA 4OKIA 3VH1A 2AQ8A 2Y68A 1HSOA 1ISMA 1HDOA 4LN1A 3X2FA 1T25A 1ADBA 4CQMD 4ZQFA 2FMUA 1YH3A 1T1RA 2BH9A 1IHXA 1VSVA 2HO5A 4AJPA 3G1UA 4WKGA 5JAIA 1NQAO 2DAPA 2LDBA 3GPIA 4RZHA 4XQ9A 4CMBA 2QQ5A 3ZV6A 1MC5A 1TT7A 2X6TA 4MKRA 3VPGA 4IS3A 5CFZA 4IJVA 3GDOA 4YT5A 3V1UA 2A92A 4DL9A 4BHTA 2J5KA 3IUSA 3GG2A 2VT3A 2VRBA 4XYBA 3TL3A 5A9SA 1Y1PA 4OYRA 4FFPA 2OO5A 1O89A 2JD1A 2H1SA 1UAGA 3TZHA 1GZ3A 1GEGA 1XQ1A 1SPXA 3BXXA 2DFDA 1ZMTA 3DTTA 4KUEA 3BTSA 4BO0A 2W2LD 4A2CA 4PG4A 1YJ8A 4XGKA 2QX7A 1NP3A 2EJWA 2ZIZA 3HZZA 3TDKA 3I23A 3LZ6A 2X58A 3PTZA 3KYCB 1I5RA 2AQIA 3V8BA 3U0BA 3ABIA 2CDCA 3K73O 4OGWA 1GYRA 4RPJA 1NM5A 1LTHR 3JQ8A 3CKYA 4CUJA 2UAGA 1NFRA 4CMEA 2O7QA 3WJ7A 3JQ7B 1SCUA 4QO8A 4LGVA 3OF2A 3RJ5A 2HDHA 1P33A 2WD7A 1JW9B 2YDXA 3BZUA 3MOGA 3CXRA 4ZQEA 4C7JA 2EKLA 2Y1FA 3LT2A 3MZ0A 4OQYA 4RVSA 1ZK1A 4N54A 4YJHA 2P9CA 1HL3A 4CV2A 4YJHB 4BNZA 2NU7A 1A7KA 1IUKA 3JD4A 3KYBA 4TRRA 2NU8A 4UUMA 2I99A 1B8VA 2H6EA 2ZCVA 4MP8A 1Z73A 3KV3O 3WBFA 1A71A 3LLSA 4CMIB 1WWKA 2Y1CA 1HWYA 1EQUA 1WNTA 5G0WA 2XPCA 4CM6A 4DA9A 4I1IA 3HWRA 4U5QA 4E2WA 3BMQA 3KSZO 1GADO 4GGPA 4C7KA 4RPGA 3AK4A 4INAA 2Z1MA 3EHEA 1Y8QA 4CM1A 1A9YA 4ND5A 1T2CA 1J5PA 2P5YA 4A10A 3VTZA 1JKJA 1NBOA 4A7PA 5DOZA 3TF5A 4MDHA 1I3NA 1SOVA 4BUCA 1YGYA 4TRJA 3IJRA 1DAOA 2VNAA 4P4GA 4Q3NA 1U3WA 5AOVA 3WGQA 4ESOA 2EEZA 3E5MA 3LC2O 4LVUA 4TZTA 3P2OA 2BFPA 3GZNA 1XG5A 1Z7EA 2QG4A 5I9NA 3H7AA 1IB6A 1C3VA 1O95A 1S7CA 3W4IA 3GFBA 3F4BA 4BNUA 4E21A 3AOEA 2NTVA 3GQVA 2EKPA 4GX2A 1KC1A 1LU9A 2AQKA 4WLOA 1E3IA 3NRCA 5F1OA 1GR0A 3RROA 1ZEJA 2YUTA 3UGKA 4YAGA 4YAEA 4AG3A 1GQYA 4DPLA 5CHEA 4DPKA 4F46A 1N8KA 1Y9EA 3D4PA 4PZCA 1GUFA 3IUPA 4J0FA 4PZEA 3ROQA 4CM9A 5KKCA 1DEHA 2NSDA 4KQWA 4D79A 3TRIA 2VUSA 4TRMA 3ROMA 3RVDA 2X1HA 4Z3DA 1LLUA 5BR7A 1BDBA 2YHIA 3WS7A 1JWBB 1KBZA 1VL0A 4J3FA 3U3XA 1KS9A 3OA0A 4G2NA 4CM8B 1T2DA 2VOEA 5AYVA 1PS8A 3SVTA 1AN9A 2Q45A 3OP4A 2WD7B 2VZ8A 1QR6A 2J3KA 3GGOA 5LCXA 4IUYA 4BKRA 1R6DA 1WDLA 1GAEO 3PHJA 4OIMA 1DAPA 5DNAA 2CUKA 3H5AA 4WLNA 2V6MA 3DBHA 2HMSA 3WGZA 2PGLA 1NXQA 3ETGA 1N1EA 3VZQA 1BHSA 3DQPA 1GEEA 1FJHA 1Y9AA 4AL4A 4PZDA 5IG2A 4MJLA 2VNSA 1V0JA 2CVOA 3G17A 4QXMA 5JLAA 2AEMA 5LDGA 4NBVA 3AFNA 3NT4A 2C20A 1W4ZA 4P4NA 4ZVVA 4PG6A 2YFQA 2X86A 2XAAA 2O2SA 3ASVA 3WG9A 4JJFA 2WEKA 1XHLA 3ONFA 1MGOA 3WNVA 1E3WB 5TSDA 2D3TA 2NM0A 1U3TA 4AJKA 2DQ4A 1IYZA 2PV7A 1DOHA 4PLZA 1OMOA 5L7TA 1ZK4A 2POQX 2BLLA 2RH4A 1BW9B 1EK5A 2PZLA 4IIVA 2WJPA 3RASA 1OZAA 2HMUA 4K1LA 3WTBA 2FPGA 4BO9A 3BMOA 4E5KA 1EVJA 3H9JA 5DCUA 3U62A 1U3UA 1V9LA 2XXBA 4EDFA 4NDNE 1PJSA 3H9QA 4TZKA 3OJOA 3R3SA 1EQ2A 2WYVA 2GD1O 2YYYA 1EE2A 2GN9A 4XX0A 1EVYA 2A35A 3ZWOA 2J8ZA 3E18A 2NVBA 3NGLA 2AQHA 4DQXA 2AW5A 3QP9A 3HN2A 4JP3A 4DLAA 5JAQA 4HADA 1WZIA 4HXYA 4WPGA 3K2EA 1R0KA 3VH3A 4LRTB 4XCVA 1PQPA 3GMSA 3PRJA 3L6EA 5TT0A 1E0DA 1U3VA 1H2HA 3OEWA 4DYDA 4CR6A 4XJTA 3LT4A 3VKUA 3Q2KA 2I9PA 3I4CA 3ICCA 3CE6A 3EUWA 5G0SA 3DMTA 3MJEA 4E5MA 4XQCA 3Q9NA 1EDZA 4R68A 4CUKA 1NHGA 3PJGA 4DXHA 4HV4A 5ICMA 3ENKA 4YRDA 1BSVA 4Y6PA 4TSKA 1C0IA 2CF5A 3I5MA 3MJSA 3RUAA 3VPFA 1UZLA 1B16A 1HSZA 3V1TC 4CPDA 1DRVA 5JFOA 5TLSA 1E6WA 1DFHA 3GH3A 4ALKA 4HFRA 3C1OA 3HE3A 3WR5A 4EJ6A 5H82A 4DMMA 3QIVA 1LRLA 3JQDA 4XB1A 5K9ZA 2HQ1A 1R37A 3H6KA 5JDIC 2QIOA 1ULUA 2O3SA 2QHXA 1KIFA 2EIHA 4IJKA 1O6ZA 3INRA 5HM8A 4MIOA 3L6OO 3NDJA 1LSJA 4B4VA 4J91A 4CM5A 1QYVA 3C7DB 3RIHA 1LUAA 3OICA 1P1HA 4FS3A 4Q9NA 4Y6SA 1E3LA 3AI3A 4UAGA 5CDYA 2D59A 3VPHA 5KVSA 3QVXA 4IGEA 4P38A 3IQDB 3FSRA 3Q11A 2WD8A 4GMGA 1B26A 3LF2A 1UAYA 1E7SA 3S2FA 2IODA 3JQAD 2OGUA 3M1LA 1PZHA 4U8GA 3TZKA 5G4KA 4Q3CA 5HS4A 4MVJI 1HDXA 2RHRA 4UUNA 2FZWA 2DFVA 4OO3A 1QMGA 3AU9A 3E5RA 3Q6IA 1EBFA 3WGHA 2BGKA 5FEUA 4FB5A 2D4AA 1U8XX 2JFGA 4W82A 4IIUA 1E3EA 2G1UA 1MG0A 3JQFC 1E3WA 1K0UA 3UKOA 3EW7A 1LSUA 2NUAA 3KOUA 1F12A 2ZTLA 4ID9A 2IYOA 5IXYA 3GGPA 3ROPA 4CLEA 5I7SA 1JAYA 5JDCC 5DZSA 4GWKA 1GPJA 5GY7A 3PEFA 2WTBA 3SBOA 2UVDA 2WWRA 1ARZA 2P68A 2G76A 3FNEA 2CZCA 2HLPA 3JYNA 4RVGA 5IZCC 3W6ZA 1LDYA 3I6QA 3KEQA 1JKIA 4GSLA 1XQ6A 5MDHA 4M8SA 1B8PA 4DLBA 4YQZA 2W2KB 2DPGA 2W2KA 4E12A 1DFIA 4CUZA 1RYEA 1KVQA 1E1LA 3I52A 4RQTA 4K9DA 3O8QA 4Z0HO 2RHCA 1LX6A 1LDMA 3UVEA 1IULA 5FF9A 4UREA 2BRUA 3BTVA 3U4DA 3TFOA 2GYYA 3HSKA 4FGSA 3MTJA 4F3YA 1IE3A 1K6XA 2JCYA 2X4GA 3TZQA 5THQA 3AUTA 3LT0A 4ILKA 4QSMA 5GZ6A 3GAFA 2X5JO 2B5VA 1VE9A 5TC4A 3L07A 1HDGO 3GMDA 1HE2A 4CV3A 3GK3A 3QE3A 1E7YA 1K89A 2VUTA 3UF0A 2VYVA 3QVOA 4BNLA 1ISHA 4WASA 3MJ4A 2GLXA 2GN4A 4NBUA 2GNAA 1O5IA 3JYOA 4EEZA 5BSHA 3T7EA 3DDNA 3GGGA 4IZHA 2P2SA 3JYPA 4URFA 4O59O 1ML3A 4PLCA 3WLFA 4ND2A 3RJ9A 4CM4B 4EJ0A 1C0KA 1Q2XA 1SZJG 2RCYA 1P45A 3W4KA 2VWHA 2X8LA 4FSHA 4DIOA 1NASA 2D2IA 2C2XA 4II2A 1UUFA 1DJNA 4K26A 1PJCA 4TROA 3ZI0A 3DXFA 1EFLA 2C82A 4I5GA 3ZHXA 1DRUA 2EW2A 2O7SA 3VVBA 3EVTA 2DLDA 1A72A 5JC8A 1ZK3A 3LYLA 1QLHA 4ZRNA 3NT2A 1YJQA 2BKAA 1PZFA 4QX6A 4IQ0A 2Y05A 1TXGA 1GUZA 1ONPA 1DC3A 3KBOA 3AUAA 3LK7A 1YDWA 4JN6B 1XGKA 3QV1A 2Y1GA 5JYDA 4I9HA 4WNCA 4OSPA 4CODB 3A1NA 2JD2A 3H9UA 1DHTA 3TZ6A 2JD0A 5JO9A 3V2HA 3KM0A 4BO3A 1P1RA 4OM8A 4DBZA 2PD4A 1LDBA 2UDPA 1Y5RA 5IZCA 1PQUA 2B35A 2GRAA 1CYDA 1YWGO 2PR2A 4TVOA 3EVNA 3TOZA 3WFJA 3RD5A 3PLRA 4IM7A 4JP2A 3F5SA 3AM5A 3DBRA 3HNPA 2GZ2A 2GASA 1ZNQO 1YVEI 2GERA 4M1QA 3X2EA 1W8DA 4GX5A 3QRWA 1AUPA 3B6ZA 5T8KA 2DC1A 2B36A 1VRWA 1ZVMA 4CMIA 4A03A 3M2TA 1MC4A 2IXBA 1E3SA 1DO8A 4XRRA 3TN7A 4NZ9A 2YV1A 1UZMA 2EWMA 1HLDA 2EXXA 1UXHA 1P1KA 4AJ1A 3PDJA 4RLHA 4FR5A 4YAJA 3SC4A 1UJMA 3GHHA 3RUEA 4J2OA 4OMUA 2EV9A 4R51A 2DT5A 4KUHA 3RFXA 5L4SA 5F3RA 5HA5A 3NKLA 2DKNA 4S3MA 3HHPA 1F8GA 3LC7O 1YQGA 4RF3A 4YA6A 4YDRA 5BNIA 4W7HA 3DMTC 1A9ZA 3VVCA 1UP4A 3RBVA 3E8XA 4ALIA 3VPXA 3QWAA 4RF5A 4UVDA 4BB5A 4GVLA 1PJQA 1EEHA 1VPDA 4Q39A 1BXGA 5CEEA 1M6HA 3RSHA 4CMHA 3DL2A 3U4CA 2GCGA 3BMNA 2ZYDA 3NAQA 3UICA 1OC2A 1LXCA 3B1JA 4WUVA 2C7GA 3RU7A 4U6QA 1N1GA 2PKQO 4LMRA 1UXGA 2BGMA 1V6AA 3N7UA 3C7AA 3CSDA 4UEKA 2PH3A 1P77A 2NQ8A 4BMNA 4BKUA 3DO5A 5K6AA 1IY8A 2O48X 3O8QB 3OMLA 3SXPA 2GO1A 4XDZA 2W90A 1ENYA 1EFKA 3OJ0A 1AGNA 2AEFA 4XWYA 5BSGA 4IDFA 3LU1A 1VL8A 1HYGA 4J7CA 3IKVA 3KXDA 3NTRA 4KMSA 3P7MA 1PTJA 3C1TA 4HY3A 2ZATA 1XEAA 2XOXA 3G3EA 4RV9A 1IHYA 1E7QA 4EITA 2B4QA 3PYXA 5BQFA 3OM9A 3WLEA 5KJ6A 4CL3A 2P9GA 3JQCA 1BTOA 1LC0A 4LCEA 4BO6A 3WGTA 1BXKA 4R1SA 3FWNA 1F06A 2VHZA 3GEDA 1MUUA 4XGNA 3WXBA 5KVVA 1RM4A 1ZJYA 5KJEA 1WAMA 3JQAA 3RUFA 4MVJG 5BSEA 4MPDA 3RUIA 1PL6A 4IDEA 4BMVA 5IDYA 4NJOA 4HP8A 3EDMA 2EW8A 3KTDA 3KZVA 1WVGA 2I67A 5JY6A 2EKQA 4RPLA 4PG8A 4PGFA 1GCUA 1NFFA 2X9NA 5J23A 1I24A 1LQUA 4CM9D 3DZJA 1N7GA 8LDHA 4WECA 3UH1A 1PGOA 2D1YA 4O5OA 1PGQA 2R00C 2IXAA 4JJGA 3NTQA 1B7GO 3D1LA 4YXFA 3NJ4A 5CDSA 4MVJP 2YHIB 4FFRA 1VC2A 1ZCJA 5C7OO 1VKOA 5JCXA 1X1EA 4J6FA 2X5OA 5ES3A 3OIGA 4NJMB 2NVWA 4J1QA 5G2OA 3FNHA 1UDAA 3GEGA 4XGIA 1O94A 3GN2A 4WCFA 5A05A 3IDSA 1LC3A 3GEMA 4AJEA 4IPTA 1IOLA 4NBTA 3ST7A 4E30A 4R5HA 4I08A 5JW6A 5DN9A 1MFPA 4RQUA 4MIYA 1JQBA 3UN1A 4L4RA 4ZQGA 3AOGA 4BNKA 3OSUA 3WGGA 1WMAA 4C4OA 5ITVA 5BT9A 4D0SA 1E5LA 1JLLA 2CDAA 3PZRA 3MTGA 4YPOA 3ZV5A 4MP3A 3MEQA 2ET6A 4PG7A 5A9RA 3KB6A 3ITKA 3T4EA 4OH1A 4YR9A 3UCXA 4GGOA 3A9WA 4J16A 4HFNA 3RUDA 2W4QA 4RGBA 4F45A 1HZJA 4NK4A 2LDXA 3ICPA 1T1SA 1H0KA 1LJ8A 5IF3A 3LT1A 1LI4A 2B83A 4W9NC 2IZ0A 3VZPA 2CF6A 2RAFA 3ASUA 3JCZA 3ZWCA 1QV7A 3L4BA 3INTA 1S6YA 4ZA2A 2BHLA 2HSDA 4QT0A 4R16A 4GVXA 5CG1A 3PWSA 2FOIA 1R4NB 2YV2A 2D0IA 3JQGB 2C5AA 2JAPA 4CR8A 2AMFA 1YBMA 3FTPA 3OQBA 4J7XA 5EL0A 4NQZA 4Q3EA 2A94A 2X23A 4KQXA 2JFFA 3DMYA 1HYEA 2HKIA 4FQ8A 4XZ3A 1WP4A 3H3JA 3TZCA 3Q9UA 4MVJF 3OH8A 3RC1A 3NEPX 1JAXA 2EP7A 1Y5MA 3EY4A 1KVUA 1JTVA 3DEYX 3CPSA 3QQPA 3EK2A 1JKFA 4D3SA 1ZIDA 1DSSG 3DBHB 4Z3KA 2V6GA 4R01A 2BGLA 5TNXA 4L0QA 4BNVA 3U49A 1DPGA 3JD2A 3M6IA 1NPYA 1MG5A 1XU9A 2Y67A 4CMKA 1LQTA 1YL6A 2BFMA 3PXXA 1Y6JA 4WEQA 3WNQA 4B79A 5EJ2A 4Y98A 5DCYA 2ZK7A 4QTZA 2RBEA 5F5LA 5L51A 4BO8A 5JCJD 4HFMA 1AXEA 4PFJA 1Z7BA 1HZZA 1D1SA 5KCZA 4WLUA 4EW6A 5DULA 3AM4A 4UEJA 5U1PA 4WCFB 2YFHA 3KYDB 3ZWWA 4D3DA 4N5NA 5IAAA 3DZKA 4ZRMA 3TL2A 1MB4A 2O50A 4CLOB 2X9GA 4WNIA 1YQDA 4FW8A 1DC5A 3E48A 1XA0A 1UDCA 3QWIA 2Q2WA 4PG5A 1QKIA 3JQ9C 1JWAB 1B2LA 3ANNA 5COBA 2PA3A 3W8FA 4BL5A 1M6WA 1Y8RA 2V6BA 5T67A 4ZJUA 3VKVA 1X0XA 4E32A 1L7DA 4UUPA 3GF4A 4W4TA 5KTKA 2HRBA 4YWJA 1BG6A 1GQQA 1C0PA 3QY9A 1VI2A 3ROKA 3GRKA 3PP8A 4O0LA 3EGOA 2YV3A 1KVTA 2QRLA 2WDZA 1HETA 4UUOA 1ZW1A 5F1PA 1KY4A 2OXIA 2B5WA 3SLKA 1YE3A 2GZ3A 2VHXA 3Q0EA 1B3BA 4IGFA 2O4UX 1H6DA 2Z95A 5L40A 2V65A 1LDGA 3HFGA 2FSSA 1V3UA 3H2SA 1AE1A 2ZQZA 4NU6A 3JD3A 2O3UA 4FJ0A 4NH4A 4OJNA 7MDHA 4R69A 4XKJA 2AG8A 2NACA 4A26A 5MGBA 1M66A 4Y6RA 5I9MA 4BO4A 5L7YA 3FTNA 3FD8A 1LA2A 4J9VA 2FSVA 4WOJA 4XR4A 5TQVA 4AJJA 4RF2A 3ONDA 5A9SB 1CRWG 5A06A 2C5EA 4Z0TA 4BNTA 3U09A 1P1FA 3PHLA 1VJTA 3NX4A 1LDEA 4NMHA 3CUKA 1MV8A 1QV6A 1R4MA 4BIIA 4Y8VA 5A5FA 3DHYA 2CD9A 1A4UA 1P9LA 1ZEMA 5CP8A 4FC7A 3I3OA 1A4IA 3Q3CA 9LDTA 4G65A 2CNBA 3D5TA 3U9LA 1OAAA 3IMFA 4E5YA 2OOSA 4QEDA 5TX7A 3WGYA 2AG5A 3OJLA 1SMKA 1JVSA 2UYYA 2O4CA 3VH4A 3FCOA 2IE0A 4R4JA 2B37A 4JQCA 4CLRA 5CEJA 3DOOA 4O6VA 4E0BA 1B15A 4J4BA 4GLOA 5IDXA 4NPCA 2CY0A 3NDRA 3C1AA 3U4IA 3BTOA 2R2GA 5JNLA 5EMHA 3MJVA 3OA2A 4FD3A 1T4DA 4JBHA 2O3QA 1MFZA 3HDQA 3K5PA 1OI7A 4G5HA 2HJSA 4EJMA 1R4MB 3UAGA 3WYBA 3FNFA 1ULSA 4GMFA 1TLTA 3PHGA 3DAPA 5EQFA 2FR8A 4PLHA 4CM8A 1PEDA 3B70A 4YCAA 1EE9A 1X14A 4U6SA 4D45A 5DBIA 3IP1A 3V1YA 2Y1EA 2X22A 4J7UA 5JMPA 3LVFO 3AY6A 3PLNA 1FDVA 1M67A 3KUXA 3RBZA 3PGXA 1KVRA 3I9JA 3N74A 3H65A 1RYDA 2Q4EA 1KEWA 3WIEA 5KVQA 1MLDA 4BNNA 4ALNA 4P22A 3H9EO 4DREA 5I7EA 3HUDA 5U4QA 3DZIA 4E3ZA 3SLGA 4YQYA 3H2ZA 3ZWAA 2ZQYA 1CWUA 4XYLA 4W99A 3ZU2A 1CEQA 3D0OA 4OOEA 1U2GA 5L4LA 2P91A 2HMTA 1YL5A 3OJEA 1E7MA 4JX8A 4OXYA 1ONOA 4AJHA 1ZFNA 2PTGA 3DZHA 4O1MA 2PY6A 3ADPA 3VC7A 1GU7A 3JQBA 1GYQA 3ZV4A 3QHAA 4I8XA 3NV9A 1GUYA 5I8WA 1TVEA 4N7RA 4B8ZA 1NX6A 3ZDFA 4EEXA 4PRLA 3WMXA 1DIGA 3GNSA 3QA9A 5G4KB 1YB4A 2DTXA 4IJWA 3ZWVA 2Y1DA 4WLVA 4R1UA 5T8KC 2NU9A 4GWGA 4AFNA 3WQRA 4E33A 2IZZA 4FFMA 4Y67A 2WYUA 4E2ZA 3TFQA 1PX0A 2X0JA 4ONEA 5K0ZA 2Q1TA 3S1LA 4M55A 2FP4A 3H9GA 3IAHA 1GV0A 2VRCD 1LSSA 2VWQA 4YRAA 4B3HA 3ZV3A 2FZEA 2ZJ0A 2HRZA 4MVJH 4RPKA 1X13A 3SJ7A 4GSKA 2Y0CA 5ER6A 4S1VA 3ZW9A 3S55A 1V3TA 1KETA 1J6UA 2JL1A 2QZZA 5L7WA 2P4QA 3GNQA 3PIDA 5BNTA 3KLMX 2YDYA 3GVIA 4KWIA 4YAKA 1ZXBA 4ZN6A 5A02A 3COSA 2NWQA 2O3JA 4E13A 3D4NA 1Y81A 3WQSB 1QYWA 3AM3A 1LLDA 4QFCA 1C0LA 4JJIA 2P5UA 5F1KA 3MCVA 1D4FA 2HK7A 3OIDA 2VYVD 5HTOA 3CMCO 3FPLA 2I65A 3CMMA 1W6UA 4BKPA 1OC4A 2B0JA 4M49A 4I5FA 1LRKA 2VHWA 2PFGA 2GPTA 2ZB8A 1LNQA 2E6UX 1ZBQA 1DIRA 5FYDA 4RPHA 5A4DA 1N9GB 2Y66A 1HLPA 1RM5A 3HB5X 3H3FA 3FN4A 3WGIA 3GLQA 2YJZA 3QSGA 3IC5A 4L4SA 1SEVA 5IDQA 1B0AA 4YJGB 4MVJA 3DHEA 1EDOA 4CQLA 5DDIP 1LLQA 2JHGA 1PZEA 3RUCA 3ZCXA 2VZ0A 4NIMA 5DP1A 4E5NA 5JE8A 3WIDA 2PZMA 3OETA 2GN6A 4BMSA 1BGVA 3GA0A 4G81A 2EHDA 5EIOA 1AXGA 3VAZA 3ZNNA 2FPIA 5H81A 1ZKMA 1R15A 4IDDA 3UCEA 3DBLB 1JVBA 4NI5A 5C7LO 1HYHA 1SO8A 2VWGA 3WICA 1ZMOA 5IJZA 4DQUA 1MX3A 2YQ4A 1ZXLA 1GFSA 1CQIA 4U0KA 4EUEA 4MVJM 1LBEA 1DFGA 3FPCA 3WOHA 4WLEA 2Q99A 4ZICA 1LEHA 4J1TA 4DLLA 1OOEA 2OZPA 4LSMA 2EG9A 1YB1A 3ZH2A 4ZU3A 2FWMX 1CIVA 1XDWA 1Q1NA 2OMEA 2FPPA 1EVZA 1DC4A 2ZCUA 1R4NA 2NTNA 1QYXA 4NG5A 1YDEA 5JS6A 1PJBA 4EZBA 1O9BA 2BF7A 5JSFA 4PLTA 3OJFA 4A73A 3U4HA 1KEVA 1SB8A 1D3AA 3GVPA 4U0JA 1E6EA 3D3WA 2ILTA 2VUUA 3LDHA 3IS3A 4DIBA 1VSUA 1KEPA 1C14A 2CMDA 1BWSA 1EK6A 3QW2A 4ALLA 4JBGA 2R6JA 1QYDA 4I5EA 3RC9A 2FN7A 1DB3A 2GZ1A 4AJ2A 4D3FA 1E92A 3AY7A 4RVFA 4NBRA 1QP8A 3S8MA 3PI7A 3R1IA 2DTDA 2WYWA 4LMPA 3DAGA 1H6BA 1KC3A 4CQLB 4DPMA 1L7EA 4IINA 3GC6A 3LLVA 5B1YA 5IN4A 2VHVA 3WQQA 4GH5A 4XIYA 1H6AA 3DWFA 2FRDA 3IJPA 4J1SA 5GMOA 5K6AC 1HEUA 2X0RA 2E37A 4OL9A 3WDSA 2NU6A 3CINA 3SC6A 4WJZA 3LSYA 4Q3AA 3TPCA 1ZZEA 4BVAA 3E9MA 2E49A 3PQDA 3ZHYA 2VYND 4MKZA 3ZWXA 3ZWYA 3K96A 5KVCA 5TIIA 5HS6A 5EINA 1C1DB 3ZHZA 1EBUA 4R1NA 3A06A 1YOVB 4DQVA 4RJTA 3IKTA 5C37A 2BI8A 2WM3A 1I33A 5I9LA 1U4SA 1YONA 1KYQA 4CM3A 4E2XA 7ADHA 3WYCA 4J49A 3WFIA 5L95A 3P5SA 5IZ4A 1BRMA 2XF8A 1NR7A 3JYQA 1PSDA 4AJOA 4BGEA 1X15A 1R0SA 1IZ0A 3BMOB 4E31A 2Q2VA 4CM7A 2Q1SA 1K6IA 3L4BC 3VOSA 1PQWA 2AA3A 4BO5A 5C5IA 2D8AA 2EGGA 3DHNA 4QFDA 1KVSA 3CH6A 3PDUA 5AVOA 3LF1A 4BQPA 5TGDA 3H5RA 3H4VA 1N5DA 3G0OA 1GY8A 5LDHA 1I2ZA 1Z75A 4IDGA 3PHIA 3ZNPA 3FBTA 1WLYA 1PGJA 1UXIA 2UV8A 4WEOA 2OL4A 3C8MA 3QJ5A 1BVUA 3AWDA 3HDJA 1NVMB 2NQTA 2JFHA 4NR0A 4KOAA 3VDRA 3OECA 3F3SA 4PLGA 3ADOA 5TRTA 4DUPA 1HE4A 4XQEA 5HWSA 1VL6A 3MWEB 3GAZA 3DZGA 4P8RA 2VT2A 4BO7A 4OXKA 2NVUA 1NVTA 1MP0A 2DBRA 2Y93A 1DDOA 1P1IA 1PL7A 1PR3A 4FIZA 3AUUA 5AQ1A 2GGSA 1T26A 1U5CA 3V2GA 4AJLA 3JQ8B 4JK3A 4P4LA 4WCFC 2JCXA 3BIOA 2TMGA 3DONA 4GX1A 4B8WA 2EP5A 1E77A 1XWFA 4ITUA 4JIGA 3ZHBA 4BNYA 1FDUA 1EUZA 3F9IA 1M75A 3PWKA 3I9LA 2IRWA 3RFVA 4YB8A 5CAEA 4OKNA 1ISIA 1TEHA 2VCYA 1ZSVA 5TS3A 2Q50A 3QVWA 3WWYA 4EUFA 2PZKA 3T7CA 4YT4A 4HWKA 1WPQA 2VN8A 4KTVE 1CDOA 4PLYA 4DVJA 4RDIA 2Q49A 1UP7A 3R0IA 4EGFA 2RIRA 5LC1A 4OHUA 4BGUA 4A27A 3DFUA 1E3JA 4BGIA 1FMCA 1K5HA 3ULKA 3QWBA 3ZN2A 4E6PA 5CDUA 1U9JA 1YOVA 4ND3A 1IL0A 1ORRA 4YJFB 4MINA 2YW9A 5KOIA 2OHXA 4GI2A 3RBXA 2G82A 4XYMA 1Z82A 4ZQHA 3O03A 5KJ1A 2I66A 2HMWA 4J43A 2NNLD 1R66A 4ROSA 1ZK2A 5G0VA 4BNWA 2AE2A 1J4AA 4HFJA 1M2WA 3GVCA 4YJGA 1PL8A 1DIBA 1N7HA 3C7CB 5TJHA 3KHUA 3RUHA 2VTDA 4XJSA 1X7GA 3BAZA 3BMCB 3KYCA 2A4KA 5COAA 3AJRA 1HT0A 1Q0LA 3ZW8A 3UUWA 2DUUA 4CV1A 5ITWA 3I9KA 3PIIA 1P31A 5T6BA 3KRTA 5ADHA 4HX5A 5JXWA 2VWPA 2I3AA 3G79A 4H3VA 3B1FA 1VM6A 5FWNA 5CDTA 2BFAA 4EBFA 1PS0A 3OQ6A 1OFGA 4TWRA 3IOYA 1KY5A 1RJWA 5TF4A 2QW8A 3QVTA 1NNUA 4EUHA 4BQRA 1DLIA 2G17A 5JYEA 3FR8A 1HE3A 1QLJA 1SOWA 4MKXA 1I32A 1WDMA 1F0YA 1CJCA 5HBRA 2ZYGA 2EERA 2OBNA 4MVJD 1DBVO 4H7PA 5B37A 4BO1A 4CLXA 1GV1A 1TT5B 4FC6A 1DLJA 1QSGA 3S2EA 1LSOA 1A5ZA 1I10A 2VZ9A 3WSWA 4W7IA 1GD1O 3AW9A 3O4RA 1V35A 4JCOA 1ZO8A 1ENPA 4HBGA 4JXKA 3RKUA 4Z9XA 1HDRA 4UULA 1B14A 1GZ4A 4J4HA 5EN4A 2Q46A 4KP7A 5G0TA 3VZSA 2DBZA 4CR7A 1X1TA 2FR0A 4PVDA 4TKLA 1KEUA 3ETDA 3ZNOA 1UXKA 1FDSA 2IEDA 1XSEA 5B4VA 4AJNA 3P19A 4F6LA 4CMJA 4RCVA 1YS4A 2PK3A 3GOHA 1C1XB 1SAYA 3FNGA 3P2YA 4Z9FA 3ZU3A 1A7AA 1MA0A 1IPFA 3QWFA 1WMBA 4RORA 1I2CA 2DBQA 3OQ1A 4O63O 1CETA 3DBLA 4F6CA 4CV0A 1R0LA 2JCVA 3CTMA 2OUIA 1HKUA 5JCJA 1EVIA 1X7DA 4XRGA 3NTOA 4FJ2A 4E4YA 1P44A 1QYCA 4XYEA 4CM4A 1NQ5A 4M86A 3G1TA 1RM3A 3AI2A 1CERA 3G49A 3K30A 3T4XA 5IFLA 4X54A 2ZYAA 2CVQA 2CDBA 4LK3A 3PQFA 2C54A 4NFYA 1GZ6A 4QUKA 2E82A 3OBBA 2OP1A 1PJTA 1ID1A 3E03A 2DU8A 2P4HX 2EGHA 4BKOA 4D42A 4KTTE 5KWEA 3ETEA 1YXMA 5I8ZA 3C85A 4RVDA 5GZ3A 1U4OA 4MP6A 1C1XA 4J9UE 5DOVA 3DB2A 2GDZA 3UFXA 1TB4A 3I4FA 4NBWA 2DVMA 4L8VA 4DMLA 4XA8A 3AI1A 4RL6A 3WWZA 4B3IA 3D64A 5JDCA 1XIVA 3PFFA 4NK5A 1DRWA 3O26A 1NQTA 3LQFA 3I9MA 1XU7A 3K2BA 4BNFA 3GDFA 1PWXA 3NYWA 5KJFA 2A9FA 3RI3A 3WJAA 2G5CA 2C59A 3HQ4O 4L4XA 5TT1A 1GDHA 3DBRB 5AXAA 2O3TA 5IN5A 5IXSA 1W0CA 1P0FA 5T57A 1PIWA 3WMWA 4QECA 5BSFA 1PU2A 1ADCA 3DFZA 1PS9A 3OIFA 5I7VA 4FN4A 3TNLA 2QYTA 1DXYA 1K3TA 3DR3A 3IIEA 1F8FA 4JROA 1NAIA 3ZZNA 4ALMA 5DBFA 3O9ZA 1ISJA 1RKXA 4BV8A 3NJ8A 1XR3A 2DTEA 4LW8A 3NT5A 4RO0A 1XCBA 3V2UA 3DBVO 2O23A 4XR9A 1V3VA 4BGVA 1VJ0A 3BYZA 2VRCA 2VQ3A 4IBOA 1B8UA 3JQEA 1PJ4A 4I5DA 3B1KA 4H16A 5C7IO 4KDFA 4RZIA 1UDBA 4RDHA 4UEOA 3FRJA 4PN3A 1ENOA 2EJVA 1GQ2A 2IYPA 1U7HA 3FHLA 4QQRA 4WGGA 3HG7A 4IMRA 3OHSX 3TJRA 2CFCA 3GRPA 4IDCA 2ZB7A 4PVCA 2CSUA 2VYNA 1H5QA 1VKNA 4ND4A 3BHJA 4R41A 5ENVA 1Y8RB 1PWZA 4CMAA 1JA9A 2PH5A 2B4RO 4FPXA 3GUYA 3HDHA 5KJCA 3D4OA 2WE7A 1LDNA 3E82A 1PJ3A 1FDWA 4NHEA 4II3A 3K9QO 1RM0A 2AHRA 4HUJA 3DTYA 5EESA 3UW3A 3JSAA 3JYLA 4YAIA 1FF9A 1I2BA 1ZJZA 4GKBA 5FI5A 3GT0A 4PLFA 1FXSA 5A3JA 1IZ9A 4FDAA 4UVEA 1D1TA 4FOOA 2OBYA 1R12A 3UCFA 4J2HA 3DOJA 2EF1A 2Y99A 3TOXA 4CLDA 1P0CA 1KOLA 1E6UA 3U5TA 1E1KA 3D7LA 3BHMA 1YKFA 1HTBA 4FGWA 1YL7A 1K6JA 3HDYA 4CQMB 1WDKA 1NR1A 4ZHSA 3ZGYA 1YB5A 1VLLA 3N58A 5G0UA 3AU8A 1GCOA 1P1JA 1AHIA 4D41A 4DBVO 3O38A 4GLLA 4NFHA 3K31A 3F4LA 5A3VA 3A14A 2E48A 4IDBA 1PR9A 3EZYA 3WSVA 3ANMA 1WZEA 2YQ5A 3PJEA 4OQZA 5I7FA 2NVUB 5HRUA 3RCBA 3BHIA 3GNTA 4GL4A 3R6DA 2HUNA 4A0SA 4DYVA 2PNFA 4WE3A 4R5MA 2HMVA 1E1MA 1OBFO 2GF2A 1WW8A 3I1JA 1CF2O 4K28A 2F00A 2FY8A 3D3WB 3D5QA 4R54A 3DAFA 2PLAA 3GDGA 4OXNA 4Z6KA 5A9TA 4ZD6A 1H93A 1FDTA 1YQXA 2H9IA 1D7OA 2B4TO 4IXWA 4CMEC 2G0TA 4IQGA 4W6ZA 4XEHA 2ZB3A 4YT2A 5FI3A 2C7VA 2HU2A 1O8CA 1SB9A 3W8DA 1H6CA 1G0OA 1NQOA 2WSBA 2HAEA 1NAHA 2WMDA 4FFOA 4L9RA 3MJCA 2Q4BA 3MJTA 4NU5A 4R3NA 4RLSA 2DM6A 1D8AA 3CIFA 4Z0PA 1UXJA 2AXQA 3VH2A 5JDIA 1VJ1A 5GZ1A 2D5CA 4PLVA 3F47A 1NYTA 1P3DA 2BMAA 2YZ7A 4AJIA 2I6TA 2IZ1A 5ICSA 4GKVA 5F5NA 4HNGA 5T64A 1WXDA 2VTEA 4IMPA 2C0CA 4FJ1A 2Q1WA 2Z1NA 3BTUA 1DHRA 1R16A 3JQ6A 4M87A 4UVGA 3S2GA 4B3JA 4YBZA 1YO6A 3M2PA 1E7RA 2H5LA 1BVRA 1PGPA 3BMNB 4LISA 3W4JA 1G0NA 1QORA 1I3MA 4IZIA 3GZNB 3VHRA 3NDIA 6LDHA 4ND1A 5JMWA 4AICA 2BELA 2J5RA 5ENDA 3HADA 1T2FA 3GHYA 4IQ8A 4BKQA 1DIHA 1H2BA 1HDZA 4PLWA 2QRJA 3L9XA 4M54A 1TT5A 4FFNA 4BNXA 4ZGWA 1TI7A 2AE1A 3JD0A 5COQA 4K6FA 4IY1A 3WBBA 4B7UA 4QO7A 4BV9A 3CZRA 1QG6A 3I9NA 4CMGA 4DTIA 2NADA 2GSDA 5EPOA 3FBGA 2ZKLA 5L45A 2OFPA 5THKA 2JHFA 4XYGA 1JU9A 4DWVA 4BNHA 3RKRA 1Z45A 2HK9A 4KWHA 4MOWA 2JJYA 4CLOA 1U7TA 1GPDG 3RAJA 1NTOA 4Y9DA 1T2EA 4DRYA 1JN0A 3E1KA 3K92A 4J0EA 4L75A 5B12A 5AXCA 2TMDA 1ZSNA 1DJQA 2DPHA 2I5PO 1QRRA 1U28A 1X0VA 3ZWBA 1SNYA 3STHA 3S2IA 3GG9A 1RWBA 1ISGA 1XLTA 1I01A 2IDZA 2PD3A 4R9RA 3BMCA 4TMFA 5L4NA 3I6IA 5JO0A 3DOCA 5JAMA 4GX0A 4TRNA 4B4OA 4B7XA 5L3ZA 3KETA 3TWOA 2PKQP 1I36A 1PZGA 4D44A 3F46A 1T24A 1SC6A 5DP2A 3PJDA 3I83A 3KSDO 3PQEA 4BNIA 4XB2A 5ER9A 3OFSA 1G1AA 1NPTO 4Z9YA 1U2DA 1RPNA 3WB9A 2W98A 2X0IA 2V6FA 3F6YA 1EZ4A 1U5AA 2C2YA 4EI2A 1EMDA 5ILGA 2ZB4A 2Z5LA 4IDAA 3FI9A 1ONNA 4H15A 1HF3A 2SCUA 3EC7A 1YBVA 1AHHA 3L77A 5CG2A 2FHSA 4D7AA 3ONEA 4N18A 4BO2A 5DCWA 4EYEA 1CQJA 2GN8A 5U9CA 3WX0A 3RQSA 3QLJA 1B3RA 2NTJA 1HXHA 1F17A 4N5LA 1E5QA 3JQFA 4TQGA 4DC1A 2ZTMA 5CDGA 3E9NA 2Y0DA 2X7HA 2NLOA 4YT8A 2GUGA 4B4UA 3NGXA 8ADHA 1XKQA 4YEDA 1J49A 1Z6ZA 2VOJA 2ZJ1A 3JQ9A 3F5QA 3JV7A 1O0SA 1YRLA 2PD6A 3UHAA 4CJXA 2PGDA 4JLWA 4KZPA 1PJLA 2CVZA 4AVYA 4PIVA 1NWCA 4BS9A 2FR1A 2RH8A 4E2YA 1I8TA 3W1VA 1N92A 2B69A 1ZSYA 2ZTUA 3VTFA 4YVFA 1T2AA 3W8EA 4PLPA 3PVZA 3INGA 2I3GA 2D5AA 2H63A 3RWBA 3EMKA 2Y0EA 3BMQB 1Y7TA 2QYSA 3L0DA 9LDBA 3GUCA 4OAQA 1L1FA 4KUGA 4Q3BA 3VPSA 4JBIA 1F14A 4IXTA 3ANLA 4WCDA 3GFGA 4GPD1 5TJ9A 3E9QA 2E4AA 2HK8A 4NJMA 3M1AA 3FR7A 3SJUA 1E7WA 4PRKA 3JTMA 3WGOA 4FBGA 4RF4A 1BXZA 3JD1A 1NWHA 4FOSA 4IS2A 1Z74A 3PWZA 5BNFA 4MO2A 1UR5A 4L73A 3PYLA 1G6KA 1BMDA 3AOEC 4ZQBA 2JKVA 3KLPX 4I9UA 1N9GA 2DBVO 1BXGB 2F1KA 4HKTA 4J90A 1E1NA 3GY0A 4XQGA 3PHHA 2OORA 4W9NA 4IJUA 5CEFA 5B4TA 3VDQA 4R1TA 1M76A 3GPDG 1EUDA 3B20A 1W73A 2HCTA 3IP3A 4LCJA 2W8ZA 1SEPA 1K2WA 4CL8A 3ENNA 1TA4A 5A03A 2AEJA 1HDYA 1KERA 3L9WA 2QRKA 3AFMA 5JPIA 5JAZA 4CMCA 1ADFA 1NVGA 1I0ZA 5H83A 1XELA 3JQAB 4I9NA 1NPDA 5KNLA 4BNMA 4D46A 4CLRB 4YRBA 5A1TA 1ISFA 4NNJA 2PZJA 5DBGA 3HB4X 1V8BA 5EERA 3OEYA 4BNJA 1GL3A 4WLFA 1UZNA 4J4TA 3KVOA 3QWHA 1IPEA 5JY1A 4YACA 3TSCA 5JBIA 5KKAA 4Q3DA 2GR9A 5EQDA 2J3JA 2O3RA 3D3EA 4WOKA 3ZWPA 1H9BA 1ZH8A 3JQGA 4LVCA 1DIAA 4YYZA 3DC2A 3DZFA 3KO8A 4TKMA 3F1KA 3FWZA 4R3WA 2Q2QA 2J6IA 1PGNA 2PGJA 4LRSB 4AJ4A 3LC1O 3K8ZA 3QVSA 3ZWNA 4JGBA 1Q7CA 4A5OA 1HE5A 2C29D 2NV6A 3A4VA 5F21A 5KIAA 2Q1UA 3E6AA 1DC6A 5B4UA 2PKRA 1I3LA 4E5PA 3ORFA 4B4WA 3GVXA 4MVJE 5G4LA 3EYWA 4N5MA 4RVHA 1QXSA 3KSUA 4BNGA 4DC0A 1LLCA 5ILOA 4ALJA 1H94A 4WK6A 4OSOA 4R9SA 4FFLA 3GR6A 1FK8A 2R00A 1ZUD1 3Q1LA 2BI7A 2V7PA 4YJDA 4J1NA 3SEFA 3GVHA 3RC2A 3ZU4A 3NUGA 3C3XA 4XDYA 3MOIA 3L6DA 5DT9A 4D43A 2P9EA 4GQAA 3ZWMA 2VHYA 4GBJA 3I9OA 3Q2IA 4M89A 2WE8A 3PK0A 3EZLA 5CPFA 2YY7A 1XYGA 3RU9A 4NFSA 3JQBC 2HJRA 1MXFA 3EAGA 3PFWO 3PGJA 2XXJA 3ZNQA 3KEOA 5A5EA 6ADHA 2W2LA 1JDJA 3TQHA 1Y8QB 1C1DA 1ZK0A 1GTMA 5DF1A 3H5NA 3DZBA 5AXDA 3GN1A 3W6UA 3HFSA 4UVHA 1P74A 2J3HA 1HDCA 1I3KA 3H8VA 2DUWA 4FCCA 2JAHA 3VZRA 2BFOA 4JNKA 3PYMA 2QZ9A 1U1IA 3RFTA 3SX2A 2BD0A 4GAEA 1N2SA 2PWZA 3PJFA 1Q7GA 2Q3EA 3JQ7A 5L53A 1BW9A 1H9AA 2UUOA 3HN7A 1NHWA 3MWDB 2O2YA 3UOGA 3GZ4A 3WTCA 3CEAA 3ITDA 3F1LA 4PCVA 1MXHA 4BOYA 3WYEA 2OP0A 1J0XO 3C24A 4LSWA 1YBAA 2J5QA 3ON5A 3V5NA 4KDEA 3KYDA 4K6CA 1HRDA 1SBYA 1LRJA 5C3MA 4L74A 5FFFA 4DGSA 4DIFA 2UUPA 5JC1A 3BA1A 4HNHA 5CPBA 1Q0QA 1NFQA 1UP6A 3IL2A 4BB6A 4L76A 1EUCA 1A27A 2C07A 5L9AA 4RVUA 5T5QA 2ZTVA 2X9VA 3PZBA 1Q0HA 5AXBA 5IDWA 1T4BA 1U8FO 1PJ2A 2IEBA 3PPIA 3R3JA 4U7WA 4YJFA 2X5KO 1GYPA 1ADGA 4XD2A 3HJAA 4CLHA 4OOFA 4MIEA 4B7CA 2I76A 1UH5A 3L4SO 4YTEA 3UXYA 1I30A 3FF4A 5A04A 1BDMA 4D0RA 4UVIA
chains in the Genus database with same CATH superfamily
5KSZA 3ZU5A 4AY4A 5IANA 5AJTA 4CQMA 1NW9B 1PUXA 4X20B 1WF6A 3KR1A 1NN1A 4AXXA 3I01M 4XIJA 1OQAA 4TVBA 4C0QC 2FW6A 3OLXA 3A28A 2QTGA 4TXLA 4B8YA 3CZMA 5G1OA 4UNIA 1CK4A 1KDRA 5CFOA 2VPPA 2Y68A 2P6RA 4Q7JB 2JJ2D 5IASA 1HDOA 4LN1A 1TECE 4LMBA 1URPA 2WU4A 3OM0A 3NHAA 3NKVA 3Q87B 5HE9A 4KQEA 2FMUA 3D1VA 3KD3A 2JLYA 2EOAA 2X6RA 3R0XA 3ZZ0A 1H23A 1G55A 6CHYA 3SF0A 3ADDA 3AFHA 3G1UA 4NU0A 5AJZA 1NQAO 1YB7A 1NC3A 4I3HA 4Q6WA 5EWLA 1XZHA 1LWOA 4MKRA 2FW8A 3CY6A 3QG5A 4EHLA 4GVPA 1WCIA 3D8TA 3RYTC 4Y0AA 1KO7A 2O2CA 2WLSA 3CURA 1M2JA 2VT3A 4D4IA 4AMUA 1W1UA 4Y1RB 1OXKB 1T6YA 5FA5A 3S2SA 1Y1PA 4RTRA 1RAFA 4OYRA 4N3CA 3C7TA 1QVWA 2OO5A 1H1TA 4D4KA 1Y7LA 4KO4S 2H1SA 1UAGA 5H8WA 1GR1A 3Q7IA 3T5AA 2ZWMA 1GEGA 4FGUA 4MPJA 2ZIEA 3H1FA 1WBJB 5D2CA 3QJYA 2BC9A 2DFDA 3DTTA 4BO0A 2OM6A 3AHEA 4A2CA 1DWOA 4IDQA 4Y2RA 1UOOA 3BXFA 1U1FA 3COWA 2BFWA 2HDOA 2Q0SA 2X58A 4OFWA 1YCFA 1VGRA 3JX9A 1O9GA 1YK0A 2CDRA 3VUEA 2YFKA 4OCZA 1G2IA 4PAGA 6REQA 3L8MA 4G1BA 4RBNA 3WWEA 4EPRA 2P9JA 4OUDA 4D99A 3JALA 1NVKA 2N3ZA 2OYCA 5DEIA 2HIGA 3QKUA 2YYZA 1IK4A 1IK6A 1LPOA 1L5SA 3AWIA 1L5FA 3CUTA 1GKYA 3K16A 4KGVA 4QO8A 4UW9A 3QOWA 2C7QA 1CBUA 2XTNA 4MTLA 2HDHA 1P33A 2HIMA 2QSUA 3D02A 2EKLA 1DZ3A 1NNSA 1FXWA 1SJ9A 1ZK1A 2IF0A 3CNLA 4HG2A 4LGMA 1M33A 4RKWA 2CNDA 5GGXA 4OI0A 3GLFA 1BH6A 1L3CA 1IRXA 1ZBDA 2FPUA 4NYJQ 4OK6A 3GFOA 1IUKA 5E7IA 3PITA 4G37A 1OYYA 4UUMA 1F5SA 2YXDA 4WZAE 4MP8A 2ATEA 3WBFA 1A71A 2L17A 4OMCA 1BD4A 2L69A 3AFOA 3SZMA 3SQXA 5BN5A 1MO3A 1OFVA 1PT7A 1NVVQ 2HYIC 2Y2UA 2G9NA 4HDQB 2E4XA 3HKCA 5DLEA 4CM6A 3BGWA 3O4VA 1N6LA 2XB4A 1FLNA 1UKCA 3TZLA 1SN7A 3A31A 5IT5A 4C7KA 3DH0A 2Q9CA 1JHZA 1C8LA 3NG1A 5HCNA 3G2IA 4R9NA 2H5JA 4CM1A 2IV3A 1A9YA 4MCJA 1J5PA 1B73A 1KR2A 2FJUA 3GZJA 4WN3A 4WVFA 3ISTA 3ZJYA 3MMPA 4A10A 2OA0A 4UQLA 4LYFA 2R7NA 1VPTA 2QXTA 3CNQS 4B76A 2OBMA 1J56A 1RKUA 3EGDB 3IJRA 2VNAA 3PKJA 4ZIRB 4B6GA 4P4GA 4TOIA 3KBBA 1BCSA 2K87A 3KPYA 2C7BA 3MRXA 2EEZA 3KKEA 3QPUA 4HDSB 2FN3A 3C3AA 3E5MA 3LC2O 4G8DA 4LVUA 2ZI9A 3P2OA 1PR0A 1YE8A 1Z7EA 2JGDA 2WKSA 2YIJA 4MO9A 2CJPA 5D01A 1IM8A 1C3VA 1GLGA 3BGVA 3IESA 4FHGA 4WXPA 1FSSA 4AWXA 1S7CA 1JT2A 2I4TA 3ZVLA 1YRQA 2ZAGA 1IN6A 2JCSA 4C5CA 1R0ZA 5HM6A 4FYYA 2R1UA 4TMVA 3SR4A 3IIJA 5M29A 5MGNA 1G18A 4O33A 5F1OA 5FTJA 1GR0A 1AKEA 3COPA 1WW3A 2YUTA 4R40A 5FQOA 3DV2A 4CN8A 1GUAA 1K27A 2ERYA 4UMEA 2RGCA 5LOVB 4PYKA 1TK3A 1N8KA 1Y9EA 3D4PA 4PS1A 3UTDA 2QRGA 3ROQA 5B2FA 5EIXA 2AW3A 1Z28A 1TOAA 2NSDA 1YIDA 3ZXYA 2YRFA 5IUNC 1B6GA 4QC2A 2I7VA 3TRIA 4HSEA 1KYYA 3UFXB 4UOQA 3WLTA 2BYTA 4Z3DA 3V7NA 1LLUA 3NDBB 4AIRA 2WFZA 3TZBA 1FPQA 4WKCA 1Z4PX 1PK9A 5FPQA 1P80A 1JWBB 1VL0A 3U3XA 3P9CA 2I29A 1SKQA 1L8XA 2DFTA 3N2GB 3Q5EA 3MIIA 3QUTA 1PSWA 4HDRA 6Q21A 2AC2A 3TTXA 3QUSA 1Q1QA 2OXTA 4UJ3A 3SVTA 2VZEA 3N0TA 1YZLA 2WD7B 3D8SA 3GGOA 2A7XA 2XVYA 3MPUA 5LCXA 3K9FC 1P2UA 4PQFA 4IUYA 4BKRA 4QU9A 2HA0A 2UYQA 4NCBA 1R6DA 1XFAA 3HKBB 1ZONA 1ZOPA 4LZLA 2ZW9A 3HRHA 4A8HA 1SCKA 2BEVB 3DBHA 2XCLA 2A1TS 4N9WA 4QBHA 1S2GA 2GOYA 1XZEA 1THTA 1IDN1 2J0VA 4P3OA 4EKIA 4DV3B 2P4UA 4KC0A 1E2LA 3AF1A 5JZ9A 3RTGA 2QRMA 1GKIA 1Y9AA 2AVNA 1SRRA 4KYIB 2Z1DA 3LPNA 4PZDA 1GRCA 4TKVB 4RH1A 5CLLA 3WWOA 4QXMA 3FHOA 2F3TA 2H1OA 2ENUA 4BB0A 1HA3A 1QZXA 3F6BX 1W4ZA 5DLPA 4YFVA 1VHQA 3RSOA 2WJYA 4E15A 4EG3A 3OIUA 4M8IA 2ODAA 1C7RA 1B6RA 1JHVA 2IIVA 2XAAA 2PYIA 4MRRA 4MB0A 1Q21A 4HXFB 4JJFA 5A04A 2WEKA 3GT3A 5EPUA 5K8CA 3RYCA 3K5WA 4NZPA 5LA6A 4X65B 1IYZA 1WPGA 2JJ1A 5F5XA 4ZMSA 2WSSA 1DOHA 4DIMA 4PLZA 1OMOA 3NHSA 3LL4A 1PDWA 1ZK4A 1C4OA 2POQX 2VDWA 4L28A 1RE1A 4LZNA 3SYTA 3K0SA 4TXMA 3WMRA 1GU1A 2V45A 3K70D 5U4XA 4DMCA 2ZUFA 4MWTA 4FUQA 4M9ZA 1DXOA 2FQYA 1C2YA 4LTNA 2QQFA 3U62A 1TADA 2DFNA 1U3UA 1TRHA 1KARA 1KI1A 4TZKA 3OJOA 4P5EA 3KT8A 5IHXA 3WMEA 1UINA 2VS1A 4RY9A 3R6WA 1EQ2A 3V7UA 1E0KA 2IQ5A 2QU8A 3KT3A 2YYYA 2QRPA 4XX0A 3HA2A 3ZWOA 4DIUA 2J8ZA 3ZYCA 1XMQB 1VLJA 3G2NA 1E8DA 3NGLA 3TNJA 1V71A 2FG7C 3EX7C 2IVFA 3D5EA 4DLRA 3O2NA 4BP3A 1TA0A 2XOEA 3VSDA 4DDTA 1NRXA 3NIGB 1JHAA 4HADA 4WADA 1LW7A 3QEOA 1E61A 3VH3A 2CVFA 4EPVA 4RTLA 3SK0A 2I6XA 1KGSA 3GMSA 1A8UA 3RF6A 1II9A 1U3VA 2GVNA 1H2HA 4NCNA 2CLHB 5KTNA 2CHQA 1W2HA 3T34A 3DZ8A 4J2TA 1E2NA 2HBQA 3Q2KA 4D92A 4YC7A 1Q3KA 3FFTA 1IXYA 3CE6A 3EUWA 2FCAA 4QGFA 4XQCA 3VJMA 1EDZA 2XKAA 3ZKAA 3NP7A 4CUKA 1IBKB 3KR9A 5ICMA 3KQMA 4YRDA 1BSVA 1PFGA 4TSKA 2IH2A 3QKRA 3HDGA 1C0IA 1C30B 5DM0A 4MMZB 5KQRA 4JSTA 1E2IA 1B16A 1UZLA 1DMSA 2JIMA 1DRVA 4ZOEA 3RFFA 4CPDA 4RTKA 3GB9A 1E6WA 3IDOA 1JL3A 1I4EB 4HFRA 1FFAA 2EL7A 3C1OA 3HE3A 2JFPA 4RD1A 1AU9A 4DMMA 3QIVA 4EJ6A 2Y9PB 3HV2A 2CL6X 3EGCA 3R7AA 2NUPB 4ZV4A 5K9ZA 5AKJA 2HSGA 2OCLA 1PWYE 2OE2A 4EB6A 5BYBA 2QIOA 5JDIC 1ULUA 2QHXA 2C0PA 1KIFA 3F7OA 3P2MA 3INRA 3K70C 2YVKA 1TM7E 1I5EA 4XSVA 4MIOA 4ZZ3A 3TEMA 1LSJA 1NE2A 3UWPA 1KDYA 4B4VA 3T7SA 4CM5A 1YTUA 3RIHA 1KFEB 4JXJA 2JZCA 4KZKA 3K6SB 2CVHA 3CR8A 4FS3A 1E3LA 4I9FA 1MF7A 3AI3A 4MUGA 4Q0MA 5BVGB 3VPHA 5KOJA 4BMDA 4M22A 3D2LA 3UTCA 3L93A 2WD8A 1MRNA 4UCQA 3W1WA 2F4NA 3ESDA 4CIVA 1WSWA 5FUWA 2CDNA 1E7SA 3S7TA 1NZJA 3JQAD 3M1LA 1Z2NX 2P9FA 4PCAA 3DW1X 5FWXB 1CR1A 1V3QE 3TIXB 1HDXA 4RC9A 1LW6E 1QFXA 2RI0A 3OIVA 3GX1A 4O2BF 2Q3CA 4YLGA 3V7YA 3WK8A 4CEJB 4I6JA 1FPMA 1AQYA 3WGHA 4IVRA 5FP0A 5FEUA 5JD4A 5I7HA 2XZOA 1T8UA 4P3XA 3EVGA 1R7RA 2JFGA 4LAFA 1RXYA 2GYWA 5CVVA 1NSTA 2GZDA 1E6LA 5CJPA 4MB6A 3RYCB 2RHWA 2EDCA 1L9KA 1EA7A 1RMTA 2I2CA 2XEXA 3CG4A 2O59A 3GRYA 4J0DA 4N1AA 2NUAA 3MGAA 4M38A 1K8YB 4NOMA 5IM5A 2Z5FA 1SUDA 2G80A 3SE0A 2ZSFA 1O6FA 4TV8B 3U6BA 2VSQA 2IYOA 4YMSA 3GGPA 4CLEA 1G5HA 5BWNA 4UFOA 1JAYA 4KN9S 3HC7A 5JDCC 1QX3A 1OX4A 4I4LA 3M9WA 1XCMA 4GWKA 5CNMA 1O96A 4ZALA 5GY7A 3PEFA 2WTBA 5EP3A 5A5VA 2UVDA 5F4ZA 1ARZA 3RGWS 2Z6AA 2HC9A 4IXMA 4BTEA 2CZCA 3M9LA 1Y4UA 1CX9B 3CLRC 4GOXA 2WNIA 1DWPA 4EF4A 3W6ZA 4P3NA 5EHXA 1JZSA 1LDYA 2PMDA 3I6QA 3KSRA 4Z4IA 3PQ7A 3H1TA 3DG9A 5JZOA 3C74A 4R0MA 1CE8A 4D9KA 4QE3A 2ZFUA 2G0AA 4OQXA 2QM7A 2YZKA 4RPCA 3UJAA 3UKJA 5EWLB 1GLNA 5CA1B 2W2KA 3PFIA 5IEJA 5AOBA 4YV1A 5M04A 2R47A 4AUMA 4FB4A 1D2HA 4MWOA 3P0IA 4Y1GA 3N8GA 4KX5A 2DF8A 2NXCA 2YXNA 4RQTA 4UQOA 3GLFE 1HPLA 1NJ8A 1S4MA 2H52A 3ABRB 4QU0A 1GRVA 2B8WA 4Y0VA 5DHRA 2ZWOA 3UVEA 1JQEA 2QY9A 1IULA 4U00A 3P4XA 1EFTA 4UREA 4IKPA 2G08A 4DAOA 2MDTA 3LQ4A 4GPTA 4ZYYA 1N8NA 1PTKA 3TFOA 1P61B 2GYYA 3T9BA 3C1UA 4FGSA 1Y4DE 3VAAA 3TTWA 1IE3A 2G04A 4DMKA 3IALA 1HR0B 1R0RE 5THQA 2BZSA 3R24A 4L7VA 1U28C 1QRAA 1PNQA 3N0RA 4K2HA 4LVNA 5CVDA 5ERYA 3WMGA 1O95D 3GMDA 3CISA 2REBA 3P2JA 2Q0XA 3GK3A 4JEMA 1Y6QA 1K89A 2QP9X 4L85A 3QVMA 1T0UA 2VYVA 1PDOA 5EJFA 4DV2B 3BORA 1E96A 1GCAA 3X1KA 3MJ4A 2AFVA 2ZWVA 4F3NA 2PVPA 3PX2A 1DPFA 3GXBA 2GNAA 1O5IA 5J59A 4EEZA 3ASYA 1SVKA 3C14C 2BR5A 1FYWA 3DDNA 1TKCA 1ZLXA 4PX5A 2XW6A 1QS0B 4YDQA 4G0WA 5AM1A 4PLCA 4EHBA 1J90A 3RJ9A 2QT9A 4BMPB 1A5SB 4MW1A 1Q2XA 2NTYC 4UCWA 4R8MA 1N6RA 3OEHD 1F8UA 3G02A 5J43A 4FSHA 4AT1A 1N0IA 1TW3A 3SYMA 4II2A 4YIKA 1UUFA 4Q3OA 2ZS7A 5IBCA 5K5EA 1UBTS 1EFLA 1V1JA 3K0HA 1JLKA 1JXAA 2QYOA 4FXOA 2C82A 3ZHXA 3AZOA 1BMFA 3IE1A 4MYUA 1FX0B 5LLSA 4B3GA 1JI3A 4BPRA 3DFFA 4ZOLF 3EMVA 4OHBA 5J4VA 3UQZA 2WR8A 3NT2A 1BA3A 1JG6A 1FFSA 2CFSA 3PGA1 2D5BA 1Q91A 4HB0A 3FPAA 5FPTA 1LH0A 4Y9RA 4KHPB 1IVYA 3W5BA 1JUDA 3WC4A 2WNSA 2XV1A 2YJGA 1EX9A 1OT5A 3NP9A 2ZTHA 1MJNA 2QTMA 4M0CA 3W05A 4CDGA 4D4GA 5K3EA 3ZW7A 3TW0A 2H18A 6GPBA 1KTVA 3P2IA 3R7BA 3AHCA 1AMNA 2UZ3A 4WNCA 4C9BA 5BMOA 4A0GA 1C7QA 4LBZA 4NY1A 2Z2JA 3ORQA 3NTUA 3TZ6A 3T5PA 3AB8A 5JO9A 3V2HA 2C9BA 3AC0A 4YRCA 3U9TA 3KDPA 4JCCA 4Z0NA 4ENTA 4DV1B 3TLZA 1EWKA 1WMFA 3I39X 1LDBA 1VECA 1YA4A 3UA4A 2OBLA 2LE0A 1PQUA 2B35A 3NONA 1CYDA 2PR2A 4G0XA 5EWMA 5TMEA 1VHLA 1BCSB 2H11A 4RTJA 3PLRA 4IM7A 1YZGA 2X14A 3AM5A 3RIGA 2BE9A 1IAVA 1EP9A 2PSFA 2GERA 1DTEA 1YVEI 2ACEA 2IDJA 2OO5C 2VRNA 2QGNA 3JWPA 4FDMA 4HL6A 3X2EA 4ESVA 3MOSA 1ZVJA 2BIFA 2DC1A 3NEJA 1VRWA 5K0NA 3SKVA 1XZJA 2J0UA 5JXHA 1W34A 4P3YA 1RWVA 1ULBA 1CDDA 4LZJA 3M2TA 4RJLA 1DO8A 1D6MA 3TN7A 1JHOA 3IR6A 5JAOA 2G7ZA 2YV1A 1UXOA 1WJGA 2QMHA 5B7QA 1CQIB 3RFCA 4WNAA 4A91A 2CBZA 2CHVA 3ZD7A 2VK1A 1Y3BE 3PL5A 1A3CA 2FSHA 4IQ4A 4DV4B 2QN2A 3P32A 2P8SA 3IP9A 2SKEA 9GPBA 3P0HA 3V2IA 4RLHA 4R2WA 5C53B 3SC4A 2PQMA 2XRZA 2B8TA 3O2SB 3EFEA 2HX1A 2DT5A 5D7BA 5L4SA 4QIHA 4M9QA 1TO6A 5CX4A 5HA5A 1L4MA 1K98A 4YA6A 1ZW6A 1F8GA 1ICEA 3HHPA 4RX1A 2OXRA 4JHXA 5FAXA 1MTOA 4W7HA 1E4OA 3ZOZA 3DMTC 4E94A 2NP6A 4PN7A 4HLQB 3GP8A 1N5IA 3A6FA 3E8XA 2EJBA 4MWEA 2GPBA 5EQJB 3UAOA 4ALIA 4EZIA 4MUEA 1LZLA 4OQDA 4ABTA 1D2NA 3V9PA 3LY9A 4UFNA 4BB5A 4GVLA 2ADOA 1PJQA 4KFTA 5DGIA 2RE8A 4DV5B 4Q39A 5ARDA 3ESYA 1BXGA 4UZEA 1M6HA 5D3ZA 3RSHA 1AHNA 1DKUA 2XB9A 2Q1YA 2GCGA 1A1VA 4GQIA 3BE5A 4C78A 1OKKD 1SBQA 4PEVA 1OC2A 1LLFA 2NQ2C 4JUCA 2I1QA 1LXCA 2AMLA 1E32A 3E9YA 4HNAB 4I55F 3B1JA 4POOA 1W1IA 4TWIA 2WWWA 1E79A 1W4LA 4R8RA 5AW6A 3WYNA 4DSNA 3RU7A 2R751 3LBYA 2GCIA 4K46A 4IIBA 4U6QA 3KPUA 1DO0A 2WAXA 4ZI7A 4V02A 1QZ3A 3N6VA 1Z17A 5D51S 4LMRA 4EA9A 2VJQA 4FGZA 1V6AA 4MI1A 3SF8B 4Z2AA 5ITZB 3FSGD 4KREA 4LS3A 5H70A 3CW2A 1Q1BA 2XT0A 3IQEA 4MWZA 2J85A 2JJMA 3WJ1A 2CE2X 4EB8A 1IY8A 1Y3IA 1EWRA 2O48X 4ARAA 4YXWD 5K6AA 3ML1A 1CU1A 2XYVA 2VBFA 5C51B 1UKYA 3QBEA 5HIJA 3SXPA 2PA0A 4JI5B 1W0JA 1BFKA 1ENYA 2I8CA 3SKYA 4X8LA 4AP9A 1KOGA 2NMVA 1AJEA 2M1XA 5HKBA 2R84A 3OJ0A 2E4ZA 5LMZA 1JJIA 2AEFA 5B1HA 3B9RA 2QMEA 4UTVA 1IN8A 1JPUA 4IDFA 1NQUA 2P0EA 3BXGA 4ZK6A 1LV7A 1Z62A 4TSFD 2J41A 2FWIA 3TX2A 2ZG6A 4KR2A 4I8DA 4X1KA 1HYGA 1EESA 3EEYA 1VIYA 4X1KB 1Z08A 4KMSA 4BQEA 5ALVA 4BMOB 3DJYA 1C4WA 4YRMA 4FGKA 1XEAA 4RV9A 3G3EA 1W85A 3GPCA 1IHYA 3AY0A 4ZAYA 4B5KA 5BQFA 2ZYIA 2X76A 3JQCA 2HW8A 2IJGX 1ZGJA 2BMFA 4FFBA 4FINA 5B7GA 5KHLB 4JJAA 4R1SA 2CUTA 5F78A 2EYQA 4XGNA 1P5FA 2JARA 3WXBA 3PQ8A 1PEAA 1RM4A 1USKA 3DV9A 4NDZA 4IGKA 1UK8A 3PFCA 5KJEA 3UW1A 1T1JA 1I4TD 2IHUA 2Z9BA 2IUUA 4KIWA 3IQWA 1J09A 2VR1A 5BSEA 1U99A 3S28A 1IY2A 1E98A 4I50F 4IRUB 4BMVA 2GJ8A 4GWLA 5JYCA 1ORDA 2EW8A 3BJEA 3C45A 3T7RA 2P2DA 3D7NA 3RR2A 5JY6A 2EKQA 2ONCA 3G7SA 4JBLA 5C18A 4RABA 3TLCA 1NF8A 4F3TA 2PLNA 5IBPA 1I24A 1YZTA 3CLTD 3SIXA 3WK5A 2FGKA 4Z1OA 2ZETA 4WECA 3OE7D 1SUAA 2HBRA 1FNDA 2R00C 2BM8A 1B7GO 2ZAYA 2EWWA 2PUGA 2FH5B 2VQDA 3KG2A 1T9CA 1P8JA 3HPQA 3DMNA 4MVJP 3MJFA 2PZGA 5BY2A 2YHIB 3ZCQA 3R4VA 1UBUS 1FP4B 1YDHA 1DTSA 1C1HA 2OAGA 5JCXA 1X1EA 1A96A 2PH1A 2PXXA 2X5OA 3GGJA 3QX8A 4NJMB 4YMWA 5ES3A 2HQBA 3V3KA 2CK3D 3GEGA 4JVOA 3GLIA 3AGPA 4QUBA 1O94A 1W96A 3GN2A 5A05A 4PNEA 4PX3A 5JQWA 3IDSA 2R7AA 1LC3A 3W5UA 4AJEA 3V8EA 1S2NA 1WRBA 4O4JA 4DHWA 3GCGA 1V9SA 2Z4SA 2PJRA 3ST7A 4E30A 4F0JA 3PX7A 4R5HA 4CWAA 3QE4A 1TMYA 5DN9A 1WOYA 4JSYA 2PXAA 3HP4A 2RMKA 5BW8A 2ZRLA 3PUZA 4OHPA 3CVYA 1WMAA 1O77A 3CRQA 2QSYA 4C4OA 1YNSA 5E8RA 1PDVA 2I03A 3HFRA 2FYTA 1UMDA 3KHSA 4YJ2A 1XZQA 2VP4A 2E18A 3A7DA 3SOPA 1M8FA 2J32A 2YJ5A 2ZYWX 3CZ4A 4FBLA 1N0WA 4FYKA 4KO3S 4AX4A 4DQKA 1S8FA 2SECE 3THWA 1XTJA 4G3XA 1SK8A 1DQSA 1G8YA 4QATA 4BLUA 2PRJA 4NKRA 1CFZA 3A9WA 1RXEA 2NU6B 1C3OA 2J9XB 1NLZA 3E2PA 4KYVA 1H2YA 3TG8A 4QA9A 1PWEA 5FL7A 1X1SA 3A10A 1HZJA 4NK4A 2LDXA 3ICPA 5AI9A 4EY6A 1LJ8A 2EX1A 2KBEA 1L4NA 1IQRA 2C78A 1Z4LA 2B83A 3ASZA 2OORC 4B33A 1SULA 4PYJA 5FXMA 3OE1A 3VZPA 1N36B 4KODA 4PZPA 2WIJA 3ASUA 3JCZA 4QUJA 5BSMA 1XRQA 4RYLA 3ZWCA 4BZXA 5CYGA 4H4DA 4MQBA 2VQEB 1AZSC 3NFYA 4ZA2A 5KYYA 3BXZA 2DX7A 4UC0A 3QX9A 1RR6A 4QT0A 1NU6A 1V45E 1YB6A 4JQOA 2C9OA 3ETHA 4IWXA 3JR3A 1ORTA 2BMEA 2DQZA 4MWSA 4ZC1A 4F2PA 5KNCH 1T9HA 5DGXA 4XM0A 4F5WA 2JAPA 2RGGA 2WSLA 3EBPA 3MGKA 1X9GA 1KJ8A 4C4SA 6ABPA 1CR0A 1OZGA 1MIOB 5EL0A 1NY6A 4BWVA 2Y3IA 4KQXA 2NZXA 3O8OB 4UTRA 5M2QA 4TTPA 4XZ3A 5LIPA 2J6CA 3Q9UA 3C5EA 2PX0A 3WBJA 2GRJA 5L3SB 3NEPX 3LS2A 1P72A 2VNHA 3I2GA 3B9PA 5M34A 1JTVA 5LZ9A 3AG5A 2YWRA 2HDNB 5DLQC 1TUBB 1JKFA 1XTIA 2UYCA 1G19A 2C5BA 2I2XB 3NU1A 3DDWA 3PIRA 1WZUA 2VF4X 4G4GA 5EG5A 3ETNA 4BBPA 4BNVA 4QOGA 2FX2A 1BCRA 2D4HA 3BWXA 1U7XA 2QR5A 1NPYA 4G8JA 2GH1A 3C0KA 4BVGA 1Q0SA 2XQFA 3FMIA 3FOCA 5AW9A 2Y67A 2ZAIA 3MB8A 1YL6A 2JZNA 1ZG3A 2LZ0A 3PXXA 3W8NA 3WNQA 1G9XA 3I6BA 1Q77A 5DNVA 4B79A 4DA0A 2P3LA 3PEVA 5J58A 1I6MA 2XGOA 2ZK7A 4S2UA 4R2LA 2C97A 5F5LA 3KOMA 3RRMA 4ZI2A 5DK6A 4GD3Q 4HFMA 4PFJA 5AJVB 1HZZA 4GOJA 5KCZA 4ADSG 4WLUA 5CR9A 4RTQA 1ECFA 1JIVA 5K0GA 3EQZA 5KTSA 4PSVA 4C6SA 1NMZA 4UEJA 1MORA 4WCFB 2WKRA 2HLNA 4XTCS 5DSTA 2JIZA 3ITNA 4KNYA 1QHHB 3DZKA 4O4IA 4ZRMA 5TB5A 4E1VA 4HUTA 2PUFA 5E8JA 1NUSA 3PVCA 4EBBA 3EQ9A 3DYBA 4XGQA 3ZTYA 4K6GA 5A6VA 1DC5A 1OFUX 2PYZA 3KLOA 3NOOA 3SMVA 4C2BA 5EWMB 3ZGVA 3EGEA 2Q2WA 1QKIA 1B1CA 1B2LA 4JP8A 2PA3A 3K1ZA 5D5PA 1AOXA 1G3MA 2C77A 4JVSB 5EE0A 4RXUA 2Y6VA 3UMRA 2V6BA 4IJMA 5LDDC 4ZJUA 3VKVA 4YRKA 1L7DA 1YI0A 4UUPA 3UYLA 2NZUG 2Z8XA 3W1EA 2WMOB 3GF4A 3K0EA 1JHDA 3B6MA 4R6XA 4W4TA 4ZEOA 3U3RA 5KMGA 1LTQA 6AT1A 3ICWA 4K87A 5K99A 3DD5A 5FPYA 4MV6A 1BG6A 3OZDA 4Q82A 3EBLA 5B57C 3QMWA 3R75A 3F9CA 4HI0E 3FG9A 1KVTA 1GWNA 1OLXB 3L41A 1T5LA 3ZQUA 4X1OA 1W59A 3T5GA 4EHKA 1DNPA 3GLGA 1BYUA 1GILA 1XTZA 1MT0A 2ZYTX 3AKDA 2H2HA 3HL4A 4EX7A 1QHXA 4MR8B 4ZU1X 1L5GB 2O4UX 1FFEA 2G70A 3HB9A 4MR8A 1VSBA 5LLDA 3OP1A 1AVTA 1NSYA 4G23A 5L40A 3NIWA 1X1BA 3ZHQA 2FSSA 3UXHA 5MHTA 4RK6A 1RP7A 1POWA 2I91A 3LZDA 1NYQA 4A92A 3EIUA 3H2SA 4YK7A 2ECPA 2MTBA 4NU6A 5IBRA 5HRCA 4RMHA 4QLAA 2O3UA 2POCA 4MHSA 2UU9B 1TM4E 3DDCA 4O8CA 4ZAZA 3OCYA 3WZMA 3SQOA 2IPLA 3HR7A 4X97A 1A77A 1ATZA 2FW9A 4B17A 4WOJA 2OQIA 2QMYA 4XR4A 3JQQA 1D03A 2XJ4A 5A9SB 5A06A 3RYIB 3I64A 4Z0TA 3WP1B 4PTZA 2D0PB 4DDHA 3BIWA 1D6SA 4MGYR 3CUKA 4NMHA 1MV8A 1ECGA 4X45A 1FRFS 1BN7A 3DHYA 1A76A 1CUSA 1T8WA 2HFJA 2JIZD 1A4UA 3E27A 2RFLA 4E51A 2H00A 2C5FA 5CP8A 5AKLA 2XDYA 4C2UA 9LDTA 1PJZA 3M6AA 4MW2A 5AVQA 1GGHA 1RQNA 1OXBB 1N3YA 1U7WA 2VEOA 4LVOA 1JQ5A 4KAJA 4P4UA 5M5BA 2QBYA 3QF7A 5TX7A 4D9FA 1I6KA 1P5ZB 1VBKA 4RA9B 4RHCA 3S8YA 1WSDA 1ZHHA 1ZVKA 2ICAA 1KZHA 1G8MA 1OWLA 1RHUA 2VBGA 3GRZA 1RWNA 2H1LA 2H57A 3KEMA 1YS2X 4R4JA 1RWKA 4XWTA 4JQCA 4DSOA 5CEJA 1ZGZA 4G26A 2CXHA 1FRNA 2PDAA 1V4NA 2NIPA 3OU7A 4DM7A 3GQBA 4J4BA 5IM4F 2ZSAA 3M34A 4GLOA 2WJAA 3REGA 3IUJA 4RIFA 3CNNA 2DUJA 3GD5A 2PGOA 3PB3A 3NDRA 1UMCA 3JW8A 4HWRA 3OD5A 3VYRB 4O4HF 2WF7A 5CT6A 1CRPA 4BDTA 1AIPA 2XUJA 4AY2A 3RKSA 1C30A 4JU9A 1T4DA 1ZCZA 4KU4A 3DWEX 1XTKA 5H3CA 1UMBA 3M6LA 1HE1C 4EVSA 1UEJA 3R3VA 2HJSA 1QZZA 1Z8FA 5B30A 1M74A 1GPWB 2KW5A 4O2AB 4AMGA 3ZDDA 3MELA 4B83A 2HF9A 1TLTA 1LPSA 2PX2A 3DAPA 3OPMA 2FR8A 5CLHA 5EQFA 3ZDZB 2VDWB 3ILVA 4GI3A 4HQKA 3B70A 3RVOA 4PGGA 3VR2A 3WV5A 7REQB 1X14A 3KCQA 2ISSD 4Y0NA 2M2IA 3PUIA 1CXZA 2Z0MA 4D45A 4RV5A 4C22A 4HB4A 2Y1EA 3RBZA 3PLNA 1DBIA 3AY6A 3KUXA 4WXHA 1KYTA 4BPBA 3PGXA 2WDPA 4Q7LA 1R64A 1Z0AA 1KZYC 2MINA 3N74A 3RIMA 3BX1A 3CTPA 1QIJA 4C6HA 5IAKA 5KB3A 1V26A 8AT1A 5KVQA 4BV2A 5J2TA 2WU1A 1XKTA 3FRHA 1JS1X 3H9EO 2QE7A 2QK4A 3NANA 4TM7A 4DREA 3HO1A 2H65A 2ZZMA 5I7EA 4MZXA 2IYRA 4QGSA 3DZIA 2J0SA 4X62B 3R5SA 3JYHA 3SM3A 3QHPA 3WLPA 4Y6OA 4FP9A 3D0OA 4RMGA 4D9CA 3MMNA 3E05A 1ONOA 2O57A 4C3ZA 2PTGA 1KJYA 1E94E 2VHTA 1U9ZA 1G60A 4MV8A 4TMYA 1T5OA 2MR5A 1UPXA 4BZPA 5CM2Z 3WRXC 4C07A 2BGNA 2YTZA 5I8WA 3UXEA 1GUYA 1TVEA 4N7RA 1R5JA 3I1FA 5FOSA 4B8ZA 2AN4A 3UV6A 1QQBA 2YWHA 1Z0UA 1YB4A 5BR1A 5BWLA 1J7JA 4BN0A 4NLLA 2V7TA 2Y1DA 3WSTA 1UAAA 4UM5A 1PCXA 1QR2A 4I36A 5T8KC 1OGJA 3H5WA 1WCYA 3BB1A 4E2ZA 2WYUA 2V55B 1PX0A 3HKEA 3V8NA 1VKZA 4ONEA 4Q4DA 4RHUA 1V4BA 4JI8B 3AJ8A 2FP4A 3H9GA 4BCDA 4I1UA 2V4MA 1LSSA 5ESDA 4RKRA 2OFOA 3PFGA 4B6PA 3ITEA 1TZ2A 4MAFA 1EJBA 1Z4QA 3ORHA 3QW4B 4PGMA 1OYWA 3CZQA 4N01A 3ZQ4A 1S4QA 1V8OA 2JK0A 2FDXA 4PR3A 5JAUA 2OHGA 2PCJA 4XFJA 1V3TA 3ZGZA 3VHXA 2V3WA 1J6UA 2XVAA 2EZTA 3BWDD 1ZITA 2NYAA 1SVWA 2YMQA 3P9PA 4M6WB 4OJYA 4XOUA 3MWKA 3C3EA 3QUBA 1IBSA 1TQ6A 3LPMA 3OCJA 4N3NA 4BJ6A 4TM8A 4YAKA 5A02A 2O3JA 1T9AA 3FIJA 1R4AA 3IEMA 4MR9A 3QK7A 4G24A 2B98A 2FMKA 2XMSA 4UDNA 4YPVA 2XVMA 2H07A 4XUDA 4QFCA 4ZCRA 4JJIA 1Z0JA 2P5UA 1NW4A 4BEBA 4EMBA 4XLZA 5IULC 2GPNA 1TF5A 1D4FA 4QPJC 3EOAI 3UT6A 2PUBA 2VYVD 3L1IA 1Q1ZA 1S3SA 3CMCO 3GPBA 3PFBA 3RVRA 1G6HA 3CMMA 3DNFA 4O2RA 5TVKA 3R74A 2UXBB 1W6UA 1YOBA 4BKPA 1LCIA 4A36A 1JAZA 1EFDN 2OY0A 1B6SA 1VA4A 1T5DX 1USGA 3NPMA 1BEUB 4M7WA 4I5FA 5AK5A 3ZDYB 2ESRA 3VR6H 3RSGA 5FYDA 1CKEA 1N9GB 3GJYA 1RM5A 2JVJA 3OIYA 2PKXA 1FOEB 1JR3A 3GLQA 1DMRA 3HY6A 3EF3A 2FFQA 3ZJTA 4EYKA 1CULC 2E4YA 1H22A 2O1XA 1M2OA 4GPZA 4OYLA 5IDVA 2QLFA 4YJGB 2C3OA 3TJMA 3CN7A 1W0JD 1IG0A 2VF2A 2WG1A 4GLJA 1IOZA 4OI4A 2JS7A 2QVBA 1DKRA 2ZEJA 5AI5A 4UZFA 3RUCA 4Y2JA 4N8SA 1T3LA 4OXIA 2PAAA 3OETA 1TJYA 4BMSA 1MV5A 3GA0A 3I2FA 1N0VC 3UJ6A 5TMPA 1GN9A 1ZKMA 3UCEA 2A58A 4MV4A 1FUKA 2R60A 3IV6A 3LCRA 4LJ9A 5C7LO 4TLEA 5KNCD 1T6BY 3WICA 2HHLA 1EX6A 4KBYA 1H3FA 1L5RA 3IOMA 4MVJM 4N65A 1T9KA 1WF3A 1IU9A 1XNQB 1IEQA 4F84A 4LHSA 4N8EA 4WCVA 2GUWA 2BBSA 4DLLA 5HIIA 1X7YB 3LPLA 2GHRA 3FBWA 1YB1A 2QD4A 3ZH2A 1XPRA 4RA6A 2VSXA 2WOJA 2P9ZA 3SQLA 1CIVA 1XDWA 2OMEA 4ZYUA 1DC4A 4UMVA 1R4NA 1V6CA 5ULLA 1YQUA 1YDEA 4D98A 4KIFA 3NAZA 5EXTA 1NI5A 1QHFA 3AKYA 5B6PA 3L7IA 4M0LA 5DYWA 1BKDR 1OZFA 4V0KA 4KB5A 2ZYVX 3QF4A 1YQQA 1R6AA 1D3AA 3GVPA 4UU8A 5FOTA 1UC4B 1E6EA 3GLIE 2XB2A 2GWHA 1YMVA 4RQAA 2VQ6A 1UJ2A 3TGLA 1GTRA 2R68A 2DQKA 2VP2A 3FTDA 3IS3A 3TQRA 1BWSA 5AKIA 4GC5A 1WTAA 4LRQA 2ZBPA 4M4SA 1XA3A 3W7AA 4IEIA 1JEDA 3BFVA 2GZ1A 1JJ7A 1IN4A 4X24A 4MGHA 4FZ5A 4WRRA 2H9AA 4YUWA 5HQTA 2FETA 1JEEA 3D4IA 2JJ1D 1QP8A 3M5CA 1SXIA 2XA2A 3PI7A 4LOKA 3TTTA 4WBNB 4ZMBA 2RONA 3SN6A 1Z3CA 3Q88A 1H6BA 1KC3A 1RAEA 2RHLA 2CK3A 1EFRD 1HTTA 2QIPA 1ABFA 3LLVA 5B1YA 2HQRA 2N0SA 3GRUA 3VX4A 1DV1A 4DV6B 2JFQA 4J1SA 5GMOA 3A6ZA 4D0GA 1HEUA 2X0RA 2XCIA 4OL9A 1EM8A 2NU6A 2VK2A 3CINA 4REQA 5FD8A 3SC6A 3WDSA 1RFGE 4EHNA 4CIAA 3LSYA 4Q3AA 3TPCA 3CW8X 2IYQA 1RJ9B 2B3TA 2OV6A 2JF0A 2VYND 2HNKA 3IEPA 3O1IC 3P1JA 2YJ4A 4LE2A 3FDJA 4UMDA 5I7OA 5JH7F 3DAYA 1VIVA 1HQDA 5EINA 5LQSA 8ABPA 2VNJA 1HNWB 1ESDA 4M1TA 2NSLA 1M9NA 1EBUA 3KTFA 1QC5A 1PUIA 5A3SA 3X2SA 3ND9A 4FMDF 4LYHA 4QDKA 2VPYA 1I33A 1W46A 2O0MA 5I3ZA 4AP5A 1PK7A 4YMIA 1IPHA 1M2HA 3G2MA 5ALFA 2HV9A 4P0TA 2XB6A 3NTVA 1SWWA 1QH9A 4J49A 3TMYA 3WFIA 3WYCA 5HHTA 3P5SA 5IZ4A 3U80A 1Z4JA 5ALHA 3DHVA 4QJ3A 1PSDA 4AJOA 4WJLA 1UBFA 2YIVX 3QI7A 5LQNA 1RI4A 2A78A 4CKCA 3BMOB 2WIFA 1ISPA 2Q2VA 3B51X 2GSWA 1W6RA 2Q27A 4IICA 4GIBA 2ZAOA 1JZQA 1PQWA 4MGIR 1S0UA 3JWGA 5DNWA 3TSWA 5D8DA 2DHCA 2CV0A 1OR8A 2V7EA 1MGPA 3R41A 2YWDA 5IJ9B 1WMEA 4D5GA 5A4FS 2ZSHA 1YI8A 1A9OA 3SR0A 1N5DA 4WY2A 1NV9A 3F3KA 2XMBA 3IBGA 2VP3A 5LDHA 5KWIA 2UYHA 1D4OA 3ZE1B 5F2NA 3FBTA 4E22A 1WLYA 4E7PA 1LPNA 4BYGA 4FEEA 4CI9A 3TXAA 4AZSA 2QQ0A 3A1FA 3HO8A 3AWDA 3O92A 2E87A 1VL2A 3IA2A 4TX1A 4X6YA 4ZAFA 3U3DA 4D8VA 1TYBE 4J75A 1OLUB 4A6PA 5A6SB 3PFNA 3D2AA 4QNRA 1KOFA 4QXAA 5TRTA 1HE4A 3WFZA 3LDGA 3FB4A 4X66B 3MWEB 3NOVA 1MN6A 4ISBA 3CLSC 2J3DA 4NMXB 1N8TA 2BFFA 1I51A 2HEIA 3HLTA 4BN4A 5DNEA 4OXKA 1IBLB 4MQLA 1L7PA 4HN9A 3ZC3A 2OWEA 3ZLTA 3AM1A 1JNYA 4CF7A 3HXQA 1PR3A 1ZRMA 4NFLA 5AQ1A 4UTXA 1RD4A 2GGSA 3GIWA 3V2GA 2OKCA 4NWIA 4OUDB 1O03A 2H1WA 5FBLB 3V1MA 4RAOA 3A1EA 5B3JC 1LD3A 2MSLA 3BIOA 3MMZA 3DONA 3N8HA 4QREA 3RRXA 3SM9A 2E7ZA 1E77A 1F0NA 3U44A 1PI3A 1RQXA 1VA5A 1W85B 3A6HA 3THSA 3U7EB 2JH9A 3AB3A 2QRQA 1PK8A 2XUPA 4REOA 1QF9A 2AJ8A 4ZVQA 1T1IA 4WXYB 2IRWA 4F9GA 2JBWA 1SGWA 3NBKA 2ZSUA 4OKNA 4ZAXA 1E58A