3I3OA

2.06 angstrom resolution crystal structure of a short chain dehydrogenase from bacillus anthracis str. 'ames ancestor' in complex with nad-acetone
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
282
structure length
282
Chain Sequence
FVTMPAQHQNKQPGIESLMNPLPQFEDPNYKGSEKLKGKNVLITGGDSGIGRAVSIAFAKEGANIAIAYLDEEGDANETKQYVEKEGVKCVLLPGDLSDEQHCKDIVQETVRQLGSLNILVNNVAQQYPQQGLEYITAEQLEKTFRINIFSYFHVTKAALSHLKQGDVIINTASIVAYEGNETLIDYSATKGAIVAFTRSLSQSLVQKGIRVNGVAPGPIWTPLIPSSFDEKKVSQFGSNVPMQRPGQPYELAPAYVYLASSDSSYVTGQMIHVNGGVIVNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Short chain dehydrogenase
publication title 2.06 Angstrom resolution crystal structure of a short chain dehydrogenase from Bacillus anthracis str. 'Ames Ancestor' in complex with NAD-acetone
rcsb
source organism Bacillus anthracis str. 'ames ancestor'
total genus 107
structure length 282
sequence length 282
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2009-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3i3oA00
1DIGA 3KBOA 4BO2A 3GAFA 1U3TA 1Z7BA 3WICA 4OQZA 4ND5A 2UUOA 1BMDA 1I32A 4IZHA 3C1AA 2Y0CA 4BNIA 4CM9A 5I7VA 3KYDB 2VHYA 3CINA 1G1AA 1EFLA 2J8ZA 4NBVA 3VPHA 2RH8A 4FFOA 1M67A 1ZK2A 4IBOA 3UKOA 1H9BA 4BNMA 5IXYA 1P77A 4J4TA 1A7KA 2AXQA 3KTDA 3E9MA 2Z1MA 4FJ1A 2WYWA 5A05A 3OSUA 1ENOA 1Q7GA 3L9WA 1F12A 1MX3A 2FMUA 3JD1A 3KO8A 4RLSA 5H82A 4DL9A 5T57A 2G1UA 5AXDA 3WJ7A 1AXGA 3IOYA 4CQMA 6ADHA 1YDEA 4HNGA 4O6VA 2C07A 4BNYA 3VH4A 2HLPA 3ZU4A 1WDMA 3E18A 5A5EA 2GD1O 1PTJA 4Q3DA 5TLSA 3W4KA 3MEQA 2NQTA 2OHXA 3D5TA 4L76A 1I2BA 3UICA 1NFFA 4FFNA 4ESOA 1CETA 3GVCA 1N7HA 1PR3A 3U4DA 3CSDA 1UP4A 1QV7A 3H9UA 3LZ6A 5DN9A 1A9YA 1ISMA 4R54A 5TQVA 5B37A 1E1MA 1LDGA 3NKLA 4LVUA 5MGBA 5GZ1A 2VUTA 5TC4A 2V65A 1V6AA 4F45A 1ADCA 1DEHA 5H81A 2ZK7A 4XIJA 4WNCA 4F6LA 4CR8A 1UJMA 5CEFA 3E5RA 3H2SA 4NBWA 1IZ0A 2G5CA 3H9GA 3JYPA 4BO6A 3MJVA 4LRSB 5BSFA 1I10A 1DFGA 5L51A 4D3DA 1H93A 3MWEB 4GX5A 1E7MA 1ULUA 3D3WB 5G0SA 4GWKA 3ITKA 4O63O 5G0WA 1B15A 5JAMA 1HF3A 1Z7EA 2HUNA 3VPGA 3WJAA 3LT0A 3SBOA 2WE8A 2ZQYA 3JQDA 4P22A 1J0XO 1I24A 2XAAA 3A1NA 2RCYA 2BI7A 2GF2A 4FFRA 1N7GA 4N18A 1K89A 2F1KA 2YV2A 3PZBA 1AN9A 3QLJA 5IFLA 3ZNOA 3OM9A 4MVJI 3SX2A 2DQ4A 1F8GA 2DKNA 3KLMX 5IJZA 2AQHA 1ZJZA 4IS2A 1ZIDA 4PLHA 2Y0DA 3CTMA 3ROMA 4D3FA 3AUUA 4J3FA 4ZRMA 2RH4A 3DZKA 3ZDFA 1ZK1A 2QZZA 3ZZNA 4BNGA 3K9QO 5U9CA 4ALIA 2WYUA 3MTGA 3PI7A 2VOJA 5KJEA 1D7OA 4R9RA 3UN1A 2ZJ0A 2BKAA 1H9AA 4ND1A 3DOCA 2V6GA 2AA3A 2Q49A 5FEUA 4YEDA 1LEHA 4M86A 3UF0A 3E03A 5DP2A 1ZUD1 4BO8A 1RJWA 1SCUA 1YOVB 3SC4A 1Y6JA 4PLPA 4WCFA 1F14A 5HRUA 4XX0A 2GCGA 2YW9A 3GN1A 4D0RA 1T4BA 4IXTA 2IDZA 4XGIA 3D4PA 5CG2A 4LW8A 1LI4A 3V1YA 3HZZA 3S1LA 1ZK3A 4N54A 4ALNA 4I9UA 2JAHA 2JKVA 4MP8A 1LC0A 2JAPA 1UDAA 3WYBA 3AM3A 2Y68A 2Q4BA 1ZMOA 4IDAA 2FP4A 4IGFA 4D41A 5IN5A 5K6AC 2YDXA 3GR6A 4WKGA 1ZMTA 4QQRA 1ARZA 1LU9A 4BNKA 2WD8A 1PS9A 3FNEA 1KVQA 2CNBA 2IEBA 2IXBA 1K0UA 2X0JA 3QHAA 3DAPA 4XR9A 1NQAO 1P1KA 3DBLA 3DR3A 4Q3BA 4EEZA 5DCWA 1I36A 5EL0A 5G0VA 1IUKA 1HE3A 1LDNA 2VNAA 3BTVA 1W0CA 3PFWO 1PGJA 1IPFA 5JCXA 1KEVA 2EGGA 2Q1WA 4XB2A 1K5HA 1A7AA 1TT5B 4E21A 3GY0A 1PIWA 2CDBA 4CM7A 1R6DA 2ZATA 3F1KA 1E5QA 4GSLA 1CJCA 2DVMA 1XWFA 1PJCA 4BO7A 4IDEA 3L4SO 4I9NA 1NBOA 4WPGA 2P68A 1R4MB 5T64A 2QW8A 2A35A 1FDUA 5KCZA 1KVTA 1SO8A 3R3SA 4J49A 1CIVA 1PGQA 4IGEA 3UAGA 1AUPA 3GRKA 3PYMA 4I8XA 3CXRA 4IM7A 4Y9DA 5CG1A 4B3IA 1I2ZA 3H7AA 3BMQB 4FD3A 3HDYA 4MPDA 3RJ5A 4BO1A 4QFCA 3MTJA 4R3WA 2BRUA 1VJTA 1BW9A 4YRDA 4DYVA 3Q2IA 4FC6A 3QA9A 5FI3A 3GMSA 3G3EA 2O3TA 2E37A 3LK7A 4UUMA 4GX2A 4XDZA 4CM5A 2YZ7A 3KM0A 3KHUA 3Q3CA 4YA6A 2D8AA 3BTSA 5AXAA 3ZV5A 4CMEC 1PJTA 4RF5A 4NU6A 1F8FA 2PNFA 4U5QA 3CMCO 1LXCA 4I08A 4UULA 5L7TA 4CLRA 4JJGA 1HRDA 1E7YA 4J7UA 1C0IA 4A5OA 1O9BA 3AOEC 3EY4A 1VI2A 1M2WA 4ALLA 3IP1A 5LC1A 5JC8A 1MFPA 3U62A 1B16A 3FRJA 4QO8A 5DBIA 3E1KA 1VL8A 5H83A 1QV6A 3GHHA 3RWBA 4OIMA 5IG2A 2JCXA 1D8AA 3GZNA 1UZNA 1E3JA 3F9IA 1V3TA 3PHHA 4NR0A 1N9GA 5K0ZA 1KC3A 3UUWA 1U5AA 3VC7A 3A4VA 2E4AA 3TZKA 3PZRA 1RKXA 2W2LD 5J23A 2G76A 2EP5A 2XOXA 3OQ1A 2WSBA 3F3SA 1SMKA 3UHAA 3TDKA 3K96A 4YB8A 2QYSA 1P9LA 4UEOA 4PLYA 3WIDA 2NNLD 5JDCC 1R15A 1UXJA 4IIVA 3JYLA 2D3TA 2HCTA 1YKFA 2X7HA 4E5NA 1Z82A 2ZB3A 4Y6PA 2B35A 2YFQA 3L0DA 2W4QA 2CF6A 3S2EA 1SNYA 1QYWA 3WTBA 4BNZA 4CV2A 1NQTA 2WYVA 3LT4A 4KTTE 4E3ZA 2UV8A 1DJNA 3IJRA 1P1RA 2FPGA 4KDEA 3JYOA 3ZWXA 5L40A 3U09A 1M6HA 2VYND 4J2OA 4R69A 4CL3A 2Y66A 4E2WA 1KIFA 1P44A 1NQ5A 1P3DA 2EKQA 4X54A 4B79A 1P0CA 3RBVA 3T4EA 1GPDG 1YB5A 3L6OO 2I5PO 4HP8A 4NJOA 1HT0A 4L9RA 3FNGA 4JK3A 3PDJA 1EBUA 4MVJF 4R9SA 3DMTC 1DO8A 1GEGA 4BNJA 3UCFA 3ZV4A 3G1UA 3VH2A 4A03A 1EK5A 5JSFA 1VL0A 3PHLA 5COBA 4AJKA 5CDGA 3T7CA 4AICA 3QP9A 1HDYA 1QMGA 1CF2O 4MVJG 3WX0A 1VSUA 4LN1A 4AJEA 4HKTA 2GN4A 4MVJD 1MC4A 1ZSVA 1DLJA 3HUDA 3UH1A 2E49A 4FFLA 4Z0PA 2EXXA 3ROKA 4CV3A 2O3SA 4CR7A 2DUWA 4E4YA 1TLTA 4K26A 1NFQA 2GUGA 3CZRA 4EJMA 2PKRA 3EUWA 3UVEA 3WG9A 2UVDA 3FWNA 3FN4A 4AJOA 3NDJA 5ES3A 3Q9UA 3ASVA 3DBRA 3HWRA 1ZK4A 3TZ6A 3I23A 3ZHZA 4PCVA 1YL5A 3MJEA 1FF9A 2PZLA 2HK8A 3PQEA 4JROA 3VTFA 3BMCA 2C20A 1GV0A 3FPLA 4IIUA 3C7AA 3A28A 4ZA2A 3RC2A 3F5QA 1DFIA 2DBZA 1QYDA 2ET6A 1PL6A 1T25A 4RZIA 1B14A 3U49A 1ZNQO 4PZCA 1E7SA 3W8DA 2EWMA 2IE0A 1PGPA 3EGOA 4CL8A 4CR6A 4GPD1 2BD0A 4J6FA 1DJQA 3ICCA 1WPQA 4R1SA 1H94A 3AU8A 3FTNA 4E5YA 4AJ1A 4JBIA 3PRJA 3PLRA 1DAPA 1LRJA 2NTVA 1IULA 2ZB7A 3NRCA 1KETA 3FR8A 1V3UA 1HYEA 1UDBA 3G17A 1TEHA 1NP3A 4ROSA 4KQXA 4AJ2A 4UUOA 2DPHA 3EYWA 3JQAB 4J16A 3LSYA 3DOJA 1SPXA 4DGSA 1NR7A 1U2GA 2QRJA 3D4OA 1I3LA 1PS8A 2XPCA 2VYNA 2GERA 2X9VA 3I52A 3JD2A 4L4SA 3TWOA 2A92A 4EJ0A 5JBIA 4PLFA 5LCXA 4W6ZA 3DHEA 2FRDA 1ADBA 2I66A 2VT3A 5FFFA 1X0XA 3KSDO 3DL2A 4KQWA 4MDHA 4A0SA 5KWEA 4CLEA 2NVBA 1X1TA 3JTMA 4KTVE 1NWHA 2CY0A 2OORA 3CEAA 3VTZA 4EUEA 3I9KA 2J5RA 4IQ8A 8LDHA 2ZIZA 4FIZA 4J90A 3PIIA 1GZ3A 3CIFA 1AGNA 1FDWA 2X8LA 4CLXA 2VNSA 2YJZA 1T1SA 1Z74A 1ZCJA 2BFMA 4MVJA 2BFOA 2P9GA 4YCAA 3GMDA 2RHCA 3K2EA 3K5PA 4JIGA 4Q3NA 3TZHA 5KOIA 2DTEA 3DDNA 3AK4A 3OH8A 5G2OA 4RORA 4A7PA 4R1UA 4OXNA 3COSA 3EVTA 2PZKA 1LX6A 1MXHA 2EP7A 3VDRA 4CMIA 3A9WA 4KWIA 1HSOA 3V1UA 2VZ8A 2DC1A 2R00A 3WBBA 3JYNA 3H5RA 3P2YA 2DUUA 2EV9A 4WJZA 5CFZA 5A9SB 1AHHA 1QSGA 1R37A 2G17A 5B4UA 4XKJA 4D44A 1K3TA 5KJ6A 2JL1A 2O3QA 2FPIA 3L4BC 5TGDA 4CMAA 1B2LA 1PZEA 3M1AA 4ZJUA 4LRTB 1KS9A 4CM4B 3JQGA 3ONDA 2EJWA 4HWKA 2R6JA 1HDGO 1KEPA 4S1VA 2Q3EA 4ZHSA 1PZGA 1GR0A 1EFKA 5G4KB 1VE9A 2WM3A 4MVJE 4MO2A 3ZN2A 2QYTA 4RVHA 4R01A 1P31A 3S55A 2NQ8A 3QVTA 1GUFA 3TOZA 1YL7A 1U3UA 1DIBA 2WD7B 5ER9A 1KY5A 4OSPA 2A94A 2EKPA 2BELA 2X0NA 1E1NA 4YJGA 2G82A 4EDFA 5I9LA 1FJHA 3EZYA 4J0FA 1N8KA 3D5QA 1NVMB 1YXMA 3C3XA 2HMTA 1NPTO 4BGUA 1BXKA 1T26A 3GVXA 1F06A 1N2SA 1ISFA 1ULSA 2X86A 5AXBA 5IDQA 2BGLA 2HK7A 1C1DA 4XRRA 1P74A 3IKVA 5F1PA 2EF1A 1X7HA 3RUAA 3LLVA 3KETA 2C2XA 4J1TA 1QRRA 1YE3A 3QVSA 5FF9A 5THKA 4AJLA 2Y1FA 3DBHB 2O3UA 1SZJG 3QW2A 3LU1A 3FF4A 4WLVA 1XSEA 3ZU5A 3KZVA 3RC7A 4E33A 4YJHB 5ENDA 2IZ1A 2C2YA 4Q39A 2B37A 3RJ9A 2P2SA 3TL2A 3U4CA 3IKTA 3TZCA 1Y9AA 4G2NA 4HV4A 5B4TA 3NT4A 1R0SA 4IJKA 1MG5A 3LT1A 3RKRA 4UVGA 2FOIA 4K6CA 2NSDA 5DZSA 1SB8A 2DLDA 5A9TA 1X7DA 3HDJA 3INTA 3U4IA 4AVYA 3MZ0A 4TVBA 4YQYA 1QKIA 4NFYA 3NT2A 3O8QB 3ONFA 1VJ0A 5BT9A 4CQLA 1D1TA 4PVCA 3GDFA 4HFNA 5IN4A 2FSSA 1ADFA 4IJWA 4EGFA 1LC3A 5JFOA 1O89A 1W8DA 3DWFA 2RBEA 4J0EA 4R1TA 1XU7A 3DB2A 5TJHA 1AE1A 3CZMA 4JLWA 3RBZA 5L4NA 1NWCA 1LDBA 2ZQZA 3E9QA 3I4FA 3M2TA 2BLLA 3EZLA 1LSSA 3OIFA 5KVQA 3FNHA 4BUCA 1UR5A 5A02A 2CF5A 2VWQA 1XIVA 3GEGA 2UYYA 1Z6ZA 2PFGA 4WLUA 1GTMA 2CD9A 3AI2A 2CVQA 2J5QA 2B5VA 1A27A 1MV8A 3JQ8B 4LVCA 2GZ1A 3H3FA 3OFSA 1HE2A 1FDVA 2P91A 2P9CA 4UVEA 1HZZA 4BQRA 1BGVA 2PGJA 4TROA 2H6EA 3GF4A 1OC4A 4EYEA 2NTNA 3JD0A 1J5PA 1EDOA 1R16A 3ZWWA 4RPKA 5LDGA 1PEDA 1Q0LA 3WQRA 1ZXBA 4LCEA 1WVGA 3R3JA 3QVOA 4E2XA 1XYGA 4KOAA 3DTTA 4YACA 3CPSA 2HDHA 3JYQA 3AUTA 4H3VA 2H9IA 4L0QA 4U6QA 3GUYA 4ZQGA 3F4LA 3RVDA 4XQEA 4DBZA 3B20A 1WWKA 4CLOA 4TWRA 5JYEA 3K31A 4YT5A 1UXHA 2VT2A 4YQZA 4GKVA 2TMDA 2W2KA 4JGBA 1WDLA 1AHIA 2NU9A 4XYGA 3WGHA 2P9EA 1NHGA 3HDQA 4A10A 4B8ZA 3RU9A 5BQFA 2OXIA 1KVSA 1Y8QA 2CVOA 1LDMA 4S3MA 1ADGA 1Y8RB 1JQBA 3HFGA 4MOWA 4UAGA 4OHUA 3WWZA 1QXSA 1XLTA 2J3HA 3VDQA 4IUYA 3TL3A 4QTZA 3OA2A 4R4JA 1P1JA 1WZIA 2WDZA 2PKQP 1KVRA 4I5FA 3BYZA 5BSEA 4BV9A 5HTOA 1TI7A 3DFUA 3FCOA 3JQ6A 3RI3A 2HMSA 3VHRA 3ASUA 3IUPA 4FB5A 4XZ3A 3DEYX 1A9ZA 3WGIA 1B3BA 4UEJA 4CODB 3HB4X 3DHNA 3W1VA 4GKBA 1NX6A 2Y1OA 3NEPX 4TRNA 4ALJA 1LLQA 1P0FA 3RUIA 4EUFA 1L7EA 4A27A 1GZ4A 4K28A 5IZCA 4Q3EA 1A5ZA 3PIDA 3WS7A 4PZEA 4FS3A 5EERA 4Z9XA 2WJPA 3U0BA 5JE8A 4IINA 1NNUA 4BO9A 4W7HA 5F5NA 1YGYA 2C0CA 1JAYA 4W9NC 3TN7A 2Z5LA 2X1HA 1IYZA 1T2FA 3ROQA 1W73A 3VKVA 3ZH2A 3U9LA 1EDZA 1FDSA 1HDZA 1WZEA 5I8ZA 3TZQA 5JCJD 4AFNA 3MJTA 2H1SA 4Z3KA 3M2PA 3M6IA 5LDHA 4XJSA 4U6SA 4DMLA 3E82A 1E3SA 2OBYA 3GPDG 4QEDA 3ADOA 4WGGA 4YT2A 3I1JA 2FSVA 1HDCA 2OL4A 4FPXA 4NJMA 4RDIA 5AVOA 2B4TO 5KVSA 3RUHA 5KJ1A 3ZHXA 3H5AA 1I3NA 5IZ4A 3ZNQA 4BO5A 3BHJA 5I9MA 1KEUA 1W4ZA 4H15A 3OECA 4F6CA 2H5LA 4M49A 4D46A 4QSMA 3F4BA 2Y99A 2FZEA 4GX1A 4NFHA 3ENNA 3CE6A 2WEKA 4NMHA 3IDSA 3NTRA 1UXGA 1T2AA 4Z9FA 4L8VA 5IXSA 2Q1SA 4Z9YA 3P19A 1I2CA 2YQ5A 5T8KC 2O2SA 1LBEA 4CJXA 3KYBA 2WMDA 1DLIA 2EG9A 3JQFA 3S2IA 1U8XX 4OOEA 4PLGA 1YBVA 1J49A 1ISHA 3H4VA 3I9JA 4AJJA 4DLLA 4G65A 4DTIA 3E48A 1GV1A 5L45A 4DLBA 5ITWA 4GGOA 2JHGA 3B6ZA 5KJCA 4PGFA 3GOHA 3PYXA 4M55A 1R0LA 2GASA 3OA0A 3IP3A 3R1IA 4BNFA 4Y8VA 3ZHYA 3NYWA 2FWMX 3E6AA 1LTHR 5EPOA 5L9AA 2CUKA 1NR1A 2GZ3A 1VM6A 2A4KA 4BKRA 3I5MA 3P7MA 3IJPA 3JQBC 4YXFA 2AQIA 1RYEA 1TB4A 2ZTUA 5G0UA 5L3ZA 1U7TA 2O23A 1UP6A 1ZKMA 3AFMA 3GGOA 4HBGA 4OJNA 3HN7A 1YQGA 4JP3A 1BDMA 4RPHA 1GAEO 1QYCA 3JQCA 3NUGA 3WGGA 1MA0A 4RZHA 2PR2A 1X13A 5KNLA 3KYDA 4DIFA 4BNLA 3Q0EA 1EQUA 4IY1A 4GX0A 2FHSA 3GZNB 1V3VA 4OO3A 4UVHA 5ILOA 4BO3A 4QECA 1ID1A 1N9GB 3RASA 3IUSA 4YVFA 1YL6A 2ZJ1A 1D4FA 3E9NA 3A06A 1UP7A 2RIRA 4EW6A 1IPEA 3SVTA 3FHLA 1R0KA 3ITDA 3LLSA 4PRLA 2C7VA 4BNXA 5HS4A 2PGLA 5JCJA 4MIOA 5KKAA 5T67A 1XR3A 3X2FA 4R16A 3JQ9C 3ZNNA 2NUAA 2B36A 3DTYA 3PQFA 5CP8A 4TRMA 2VRCD 4TKLA 1QG6A 1T2EA 4XR4A 5EIOA 2FN7A 4M8SA 3BMOA 1PJ2A 4YAGA 4H16A 1IHXA 4JNKA 4EUHA 2X9GA 3K73O 3PLNA 3C8MA 3JQ7B 3PPIA 2GDZA 1CERA 4DPLA 3GG2A 1GY8A 2X6TA 1ISJA 1MUUA 1C0PA 5TF4A 2UUPA 2NU8A 5ICMA 4DPMA 2V6MA 1XELA 3WBFA 3FBGA 1VSVA 3DONA 1E7QA 4GSKA 2NU7A 4Y6SA 2NVUB 4ZD6A 3L6EA 2P4QA 3PHIA 5FYDA 2VWHA 2IYOA 1ZK0A 3WQQA 4ZVVA 1FMCA 1I0ZA 3PHJA 4OGWA 2J3IA 3HB5X 3Q6IA 2CFCA 4K9DA 4ZQBA 4BOYA 2GN6A 2O4UX 3JQEA 3SXPA 4B4OA 3C7CB 1Z73A 3C85A 1E6UA 3OP4A 3GT0A 4LGVA 1LSJA 1YB4A 2XXBA 1I33A 4PLVA 3EVNA 3MJSA 2XF8A 2PH3A 1PJ3A 4I9HA 5MDHA 1BDBA 2B4RO 3S8MA 1JVBA 4P4LA 4OOFA 3SEFA 4QT0A 2WTBA 3PJGA 4IZIA 4G5HA 3WLEA 2DU8A 2GLXA 3B1KA 2Q2QA 3AU9A 3TQHA 4JCOA 3P5SA 2HMUA 1C14A 3WYEA 4ZGWA 3PJEA 4UUPA 4IMPA 3NT5A 3R0IA 4RF4A 2Q4EA 3BMCB 4OKNA 4W7IA 3OF2A 2IODA 3OQ6A 2EHDA 2G0TA 3I4CA 4O59O 1G0NA 2VQ3A 5DCUA 1HYGA 1HL3A 3QWIA 4DVJA 2I65A 1E3WA 5TNXA 5JDIC 1MLDA 1HKUA 4IDFA 1ZH8A 3D64A 3A14A 2VRBA 2HKIA 1ZEMA 4CMHA 4B3HA 1DBVO 3W8EA 3CKYA 4YT8A 4E32A 4K6FA 4NDNE 4NH4A 4L4RA 3NX4A 4CM1A 3AY6A 4RL6A 3DO5A 2GR9A 4MVJM 2BH9A 3PQDA 1QP8A 2HU2A 3UGKA 1E7RA 2VRCA 3I3OA 5KVVA 1CRWG 5HWSA 4LMRA 5AQ1A 1YONA 1IHYA 3O26A 1BRMA 2CSUA 3LYLA 1LDEA 1U5CA 3ENKA 4R51A 1JVSA 4WUVA 3RUDA 4Q3CA 1KEWA 2B0JA 4D43A 2YV3A 3AM4A 3QJ5A 4NK4A 1PJLA 1LLCA 3GFGA 4NBRA 2HQ1A 4RVGA 1Q1NA 3FPCA 4Q3AA 1KERA 3DHYA 5L95A 4II2A 3K30A 1PL8A 3KSZO 2DM6A 4ONEA 1UH5A 1T1RA 3H8VA 1PS0A 1CDOA 3GNQA 2BGMA 3AWDA 4B7UA 5DT9A 3HSKA 3RUFA 1LA2A 4XB1A 4C7JA 1JA9A 4J7XA 4XJTA 3WNVA 1OMOA 3P2OA 3ZU2A 4YRAA 5A06A 1Y7TA 3ZWNA 2RAFA 3GA0A 2O7QA 1TT5A 4FGWA 1LLUA 4QX6A 4J43A 4EITA 5JXWA 4NNJA 3W4IA 4MKXA 1CWUA 2F00A 3PFFA 5COQA 2EW8A 1S6YA 4XD2A 4M1QA 3CMMA 2EERA 4I1IA 1YJQA 4ZQHA 4WASA 4WLFA 3U4HA 5F21A 2D1YA 4YPOA 1K6XA 4INAA 2I67A 4CMKA 3HN2A 5F3RA 3IAHA 1R12A 1LQUA 1P1HA 3ICPA 4AL4A 3DZGA 4AJPA 4MP6A 4PRKA 2ZCVA 4Z0HO 3E5MA 1NVTA 3UFXA 5GY7A 1DSSG 4UVIA 1EMDA 1FDTA 1T24A 2IZZA 3BAZA 5K6AA 1PZFA 4WOKA 5A03A 2X58A 5DNAA 1Q7CA 3D1LA 4FCCA 5I9NA 1SEPA 3RU7A 4LISA 4M54A 3JQGB 3ZNPA 1KYQA 2EW2A 4BGVA 2ZTMA 1JU9A 5CPFA 2AG8A 4MVJP 1EUZA 2D5AA 2Y1CA 4II3A 2J3KA 5JAQA 3WGOA 1A4IA 4Y98A 3ZW9A 5JMWA 5KKCA 4BGIA 3B70A 3FR7A 2YHIA 1VC2A 2X5OA 4GQAA 3U5TA 4JP2A 4TZKA 1U4SA 1KC1A 3WOHA 4RF2A 2W8ZA 3AI1A 1ONOA 1YQDA 3K6JA 1BVRA 2D4AA 4RV9A 4PZDA 2OO5A 1C1DB 2V6BA 4N5MA 4UVDA 4ZU3A 1AXEA 1U3WA 3OICA 1DB3A 2Q1TA 4HNHA 3U3XA 1WDKA 1U1IA 4FOOA 5A04A 1KY4A 1UZMA 1LRLA 4U7WA 5L4LA 3F46A 1GADO 3S2GA 1EZ4A 1I3KA 1ONNA 3ZU3A 2YYYA 3NJ8A 1XEAA 4D45A 2AEJA 5DOZA 4CMEA 1LUAA 2VWPA 2GNAA 1OI7A 4FQ8A 1Y81A 4NHEA 5JW6A 2OP0A 2PZJA 3H2ZA 3IIEA 1BG6A 4RO0A 5EN4A 3FTPA 3AOEA 4TRRA 5HBRA 4WOJA 1XGKA 3GNSA 3JV7A 2QQ5A 3WMWA 4N7RA 4RCVA 1LQTA 1UAGA 5G0TA 5JC1A 2C5EA 2P4HX 4YRBA 4D42A 4XA8A 3QIVA 1RM0A 3PDUA 5I7EA 2VHZA 3DZHA 4KWHA 5JPIA 2QIOA 4XEHA 4CQLB 4OAQA 2ZKLA 3ON5A 3F6YA 5JY1A 4RQTA 3QRWA 3O9ZA 3GDOA 1NFRA 3AOGA 4WLNA 1YVEI 1XG5A 3NTOA 4ITUA 2ZTVA 4JQCA 5AOVA 4GI2A 3DOOA 3WGYA 3VVBA 5JDCA 4J9UE 3H9JA 4TMFA 1UUFA 1GQYA 5JO0A 5EQFA 1BXZA 5CDTA 1T2DA 4DIBA 2Y05A 4HY3A 3B1FA 1LDYA 1E5LA 3X2EA 2CDAA 1Y1PA 3GG9A 4YJFA 2EIHA 4OXYA 3DZBA 2I3GA 3I83A 3OQBA 2XXJA 3G1TA 3WSWA 3H65A 2AHRA 1BVUA 3QWFA 4CUJA 4J1SA 3W6ZA 1YBAA 5IF3A 3DMTA 2IRWA 3FI9A 3BIOA 1NYTA 1VKOA 4FGSA 4PVDA 3IL2A 3RAJA 1NM5A 3VPXA 4FR5A 3GPIA 1MG0A 1YS4A 1U7HA 1HYHA 1G6KA 2DT5A 4CLOB 5A4DA 4BKOA 3TFOA 4N5LA 3EK2A 2O3RA 4OYRA 4O1MA 5BNIA 3TF5A 4H7PA 2ILTA 2W2KB 3KB6A 5L7WA 5TJ9A 3EHEA 1TVEA 4EZBA 5CDSA 4BO4A 4GVXA 4WECA 1WMBA 1Y8QB 1SOVA 1E1LA 3M1LA 3L07A 1C3VA 1MFZA 1Y5MA 2DFVA 5JLAA 3HHPA 3KLPX 3CUKA 1Y5RA 1C1XA 4NQZA 1OAAA 4FFPA 1H2HA 2PTGA 4BMSA 2JCVA 5IDYA 5ILGA 1B8VA 1N5DA 2GN9A 4Z0TA 3PGXA 4EBFA 3HNPA 3HQ4O 3K92A 3ST7A 4CM8A 4Y6RA 4A26A 4GMFA 4WEOA 1W6UA 2JFHA 4XIYA 1PX0A 3TSCA 4CMBA 1VRWA 4DUPA 5L53A 4ILKA 4ND4A 1L1FA 1DIHA 2DFDA 5TX7A 1H2BA 4UREA 3FBTA 5IDXA 4E2YA 3OJOA 3I9OA 1PJSA 3TJRA 2PY6A 2GYYA 3VZRA 3GAZA 1U8FO 1VPDA 3WNQA 2PGDA 2VTDA 5BSGA 4E0BA 4OSOA 1H6AA 4CQMB 2Q1UA 3Q11A 5CPBA 3KYCA 3GEDA 1RWBA 3NJ4A 2IYPA 5HA5A 5EINA 4TQGA 4ZN6A 1Z45A 4YWJA 1HE4A 3WFIA 1EBFA 3TNLA 2HO5A 1LLDA 3Q1LA 4FOSA 5B12A 4ND2A 1PU2A 3DAGA 2EKLA 1E6WA 4MIEA 2Y93A 2C29D 4N5NA 1EE2A 3GZ4A 1Q2XA 5CDUA 4CM4A 3RD5A 1SOWA 4NJMB 1XA0A 1DC5A 4WCFC 3SLKA 4MIYA 5ITVA 1XDWA 1XU9A 3BMNA 1RYDA 4BNWA 1C0LA 2ZTLA 2O4CA 1B7GO 1QR6A 1A4UA 2IXAA 1ZJYA 4OKIA 4R68A 4B3JA 1X7GA 1RM4A 2HAEA 2JFGA 4KUGA 4CMJA 4U8GA 4PG4A 2X23A 5DP1A 2YFHA 4J4BA 4CV1A 4LMPA 5C7IO 3O38A 1OFGA 4U0KA 4W82A 1JLLA 4R3NA 3N7UA 1QYVA 9LDTA 5TIIA 1P45A 2LDXA 3WR5A 3V2HA 5DBFA 3D0OA 4E31A 3GNTA 3I6QA 4ZRNA 1DRUA 2GSDA 3KUXA 1Q7BA 4D7AA 1NPYA 1PSDA 4BKQA 1IE3A 1EUCA 3GC6A 4WLEA 1PJQA 5JAIA 4C7KA 2Q50A 1N1GA 2GZ2A 5CAEA 2P5UA 2NLOA 3N74A 3EC7A 1KOLA 4E5PA 4O0LA 3QWBA 3NV9A 3TFQA 2VHWA 3L4BA 4PIVA 1I8TA 3C1TA 3RCBA 3JD3A 4LSMA 4L4XA 4RVDA 4J2HA 2ZYGA 1GFSA 2OGUA 1S7CA 4XGKA 1JKIA 4WCFB 4F3YA 5JS6A 1HLPA 4KDFA 5DCYA 1P33A 4PLWA 5FWNA 5ADHA 4NBTA 3GGGA 2UAGA 4C4OA 2YQ4A 3GEMA 3OJ0A 4QXMA 5IAAA 1PWZA 1B8UA 1PQPA 3GVHA 4PG5A 3T4XA 4DQUA 3ZGYA 5HS6A 4HADA 4CPDA 3JD4A 3O8QA 1V9LA 5G4LA 2B4QA 3QVWA 4URFA 4PFJA 1ZZEA 2CDCA 2QG4A 3FNFA 2CMDA 3ZWVA 3I9LA 1HETA 2HK9A 1UAYA 1SC6A 1CEQA 2VWGA 1R4NA 4XYMA 3DBLB 4G81A 2OZPA 3BMOB 1YWGO 4GGPA 2AQKA 4HFMA 2WWRA 3Q2KA 1GUZA 1QLHA 1GDHA 3PK0A 4A2CA 8ADHA 1M75A 4WCDA 3BHMA 1WXDA 4U0JA 4BMNA 3JQ8A 2GO1A 2R2GA 3VVCA 5COAA 1XHLA 2I99A 2OP1A 2O50A 2PD4A 4NZ9A 2X0IA 1HTBA 3INGA 4DREA 4NIMA 4K1LA 2NACA 5T5QA 1RPNA 1X15A 3LDHA 3OJEA 3Q9NA 4BKPA 1JDJA 5DDIP 3GUCA 3GLQA 3NTQA 4IQGA 1JKJA 5JMPA 5ICSA 2Y1DA 3QE3A 2CZCA 3K2BA 4TZTA 4AJHA 1XKQA 2Z1NA 3MJCA 2VOEA 4R41A 1BXGA 3FWZA 1BW9B 3AUSA 1ORRA 4KMSA 2VCYA 3R6DA 1LSOA 4BL5A 4PLZA 3I6IA 5CEJA 4BV8A 3B1JA 2VUSA 4IQ0A 3NDIA 2W90A 3RC1A 3ZV3A 2O48X 1E7WA 3OHSX 3PTZA 2JJYA 2DPGA 1N1EA 2DTDA 1GPJA 1G0OA 4WEQA 2QRLA 5EQDA 4WK6A 4BNNA 2FR0A 4CLRB 1DHTA 4BO0A 3WTCA 2YDYA 4J1QA 1LNQA 2ZYAA 4RPLA 1PJBA 3E8XA 1DC3A 2Y0EA 3JSAA 3F1LA 1O94A 3LT2A 1Y8RA 2C54A 3D7LA 3N58A 3PJDA 1NVGA 2B5WA 3W4JA 1JTVA 1ZBQA 5HM8A 2Y1EA 4NG5A 3HJAA 1E3LA 5A1TA 1E3WB 1IB6A 1J4AA 3EMKA 1UXIA 3PGJA 4R5MA 2V6FA 2AG5A 2HMVA 4CM3A 4QO7A 4YJDA 7ADHA 4Z6KA 4KP7A 3WGTA 4MVJH 4AG3A 5A9RA 3S2FA 1O95A 1GYQA 4D79A 2LDBA 4WE3A 1A72A 4GAEA 5EMHA 2YY7A 3OJLA 4PG7A 2O3JA 3I9MA 4UEKA 4YTEA 3RSHA 4RVFA 2HRBA 2OMEA 3OETA 4JXKA 3KVOA 3WIEA 4WNIA 1KBZA 3EDMA 1ZO8A 3OJFA 4ZICA 5A5FA 5TT0A 1HXHA 4RJTA 2NV6A 1GCOA 4CM6A 4PG8A 1HDXA 3PVZA 1DDOA 4XDYA 3K8ZA 5FI5A 3HADA 1L7DA 3BTUA 3CH6A 5C7LO 1EVYA 4TVOA 1PL7A 3ZCXA 1H6CA 1Z75A 3KEOA 3ANNA 4RF3A 1TA4A 1E77A 3F47A 4I5EA 3DFZA 4TRJA 3RQSA 1EE9A 2GPTA 3W6UA 4B8WA 4M89A 1IY8A 2IZ0A 1E3IA 2B83A 1OZAA 3RUEA 4BGEA 2V7PA 2YV1A 1EEHA 2J6IA 3D4NA 1RM3A 3IMFA 4BNUA 5CEEA 3OEWA 3D3WA 2I3AA 3G79A 3GFBA 2BFAA 1GCUA 4KUHA 1ISIA 4CLHA 5B4VA 2Q46A 5TRTA 2PD6A 4MINA 3HFSA 3RC9A 1GU7A 3PYLA 2PZMA 3OMLA 3ZWCA 1BTOA 4GBJA 4EI2A 4UUNA 4DPKA 1E3EA 3IQDB 1UDCA 4XWYA 3WXBA 3VOSA 2PD3A 2D5CA 1NASA 2X0RA 1ONPA 3ZHBA 3BXXA 3V2GA 1JN0A 5CHEA 3VZSA 4B4WA 4J1NA 3DBRB 4F46A 2E82A 4E13A 4W9NA 3OIGA 4XRGA 3AY3A 5IDWA 4IMRA 1HWYA 1GYPA 5EESA 4L74A 3C7DB 4E5KA 1JAXA 2JD2A 4HXYA 3SC6A 3IC5A 3VAZA 4DC0A 1Q0QA 4J91A 4AJNA 4XYEA 2ZYDA 2D0IA 1MC5A 5F1OA 3MWDB 1J6UA 1T4DA 2GRAA 2NWQA 3H9QA 4GLLA 3ONEA 2HSDA 4P4NA 1E6EA 4XQ9A 1YRLA 4ZQFA 2ZCUA 1YOVA 2Z95A 4ZQEA 3TOXA 3GHYA 4XYLA 4IDCA 4YR9A 5JY6A 4A73A 1EK6A 4GVLA 3VKUA 2Q99A 3DAFA 3GRPA 1DRWA 3LF2A 2X5KO 2YHIB 1FK8A 3MOGA 1NTOA 4E30A 2VHXA 4XGNA 4XCVA 4BNTA 9LDBA 4HFJA 4TSKA 2ZB8A 1GUYA 2QRKA 2C59A 1K2WA 3STHA 2VZ0A 3EAGA 2R00C 1ZVMA 1GZ6A 4FJ2A 3WSVA 3GVIA 3L9XA 1O6ZA 3VH1A 1ZW1A 4XYBA 1PZHA 5T8KA 4PG6A 3RROA 2ZB4A 4BS9A 5A3JA 1HDOA 1VKNA 5KJFA 4R1NA 3H5NA 6LDHA 2HJSA 3LF1A 4I5GA 4ND3A 1I5RA 1YB1A 4OXKA 5I7SA 3LVFO 1JWAB 2P5YA 5BNTA 3ZV6A 1TT7A 1WAMA 3NGLA 1HSZA 1HEUA 2VTEA 3RFXA 4YAJA 2DAPA 3SJUA 3GVPA 3OIDA 2FZWA 2JD1A 3OBBA 3RFTA 1IZ9A 5BNFA 4GLOA 1V35A 1LSUA 2B69A 2Y67A 3JQ7A 4YDRA 3BTOA 3WQSB 1U3VA 2SCUA 4LCJA 3JQBA 4R5HA 2FR1A 4OH1A 3RUCA 2X4GA 5GZ6A 1N92A 1H5QA 2C7GA 4CMGA 3PEFA 1U28A 4I5DA 3L6DA 5DF1A 1R4MA 3MCVA 2NVUA 4IDDA 4BHTA 5THQA 3AY7A 5U4QA 1KVUA 1HZJA 5AYVA 2PK3A 1XQ6A 3ABIA 3PJFA 3KRTA 2HJRA 2EEZA 3BMQA 3UCXA 4CMIB 7MDHA 1GL3A 1GD1O 4NI5A 2PWZA 4RQUA 4WLOA 4PLTA 3IS3A 5JO9A 4EJ6A 5A3VA 4ALMA 4DIOA 1ZXLA 4P38A 5KTKA 4IS3A 2Q45A 2H63A 4W4TA 3GDGA 3ZWYA 3D3EA 4EEXA 4GMGA 4D3SA 1YJ8A 2Y1GA 1WMAA 3QWHA 5JYDA 4FC7A 2VHVA 3V2UA 3JQ9A 3ORFA 2POQX 2BHLA 1YH3A 1OOEA 2NM0A 2PKQO 1TXGA 1H6DA 3PWKA 3ROPA 1NXQA 1PQUA 5DBGA 3WGQA 5C5IA 3WDSA 4LK3A 4MKZA 2UDPA 3TRIA 4BNVA 2D59A 1CQJA 4FN4A 4DQVA 1ML3A 1T2CA 2C82A 2OUIA 5I7FA 1DPGA 3WGZA 1RM5A 3ZWBA 4DLAA 1BWSA 1QYXA 4NFSA 4RDHA 4RGBA 4J7CA 4GL4A 4YJGB 1K6JA 1SAYA 4YJFB 2AEFA 3DZFA 3MOIA 5L4SA 4MP3A 4NBUA 4YAEA 1H6BA 2EGHA 1OBFO 2OBNA 1CYDA 4M87A 1HLDA 4DMMA 2AW5A 4AJIA 2JFFA 1JKFA 1PWXA 4BKUA 2I9PA 3ETEA 5L7YA 2D2IA 3DQPA 2W2LA 1FXSA 3PHGA 3WFJA 4BVAA 5F1KA 4QUKA 3ANMA 1B3RA 2TMGA 1JWBB 2BGKA 5DOVA 1D3AA 3KSUA 4FDAA 3DZJA 4E5MA 1DFHA 2GN8A 4FSHA 3UW3A 2HMWA 4DBVO 2NTJA 1MGOA 2QHXA 3OEYA 1M66A 1PGNA 2AE1A 3UOGA 4BB5A 1F0YA 3JQAD 3V1TC 4NU5A 4B4VA 1ENPA 1O5IA 4CUKA 4DXHA 2BFPA 3PWSA 4L73A 4B7CA 2QZ9A 3JCZA 4XQCA 2DTXA 1C1XB 1GQ2A 4XQGA 4PN3A 2VYVD 5JNLA 4JX8A 1HDRA 3QY9A 4CM8B 3TPCA 1X0VA 2BMAA 1YBMA 3WB9A 2E6UX 1DC4A 4BIIA 4FFMA 2PV7A 2NU6A 3BZUA 3UXYA 3LQFA 1SEVA 1VJ1A 4O5OA 4GH5A 3VPFA 3ZWPA 2QX7A 3F5SA 1DIAA 5ER6A 5JDIA 3DXFA 1O0SA 4FJ0A 3ANLA 1JW9B 1ZEJA 4Q9NA 1DXYA 4MJLA 4P8RA 5U1PA 1P1IA 4DQXA 5I8WA 2HRZA 5F5LA 3KYCB 3NDRA 1DHRA 4FW8A 4J9VA 3RIHA 4YBZA 1MB4A 2WE7A 5KIAA 4BB6A 4D0SA 1EUDA 4Y67A 4GWGA 5GZ3A 2X9NA 4RPJA 1DRVA 4BMVA 4E12A 1E0DA 3GK3A 2PH5A 3EW7A 1EVIA 3LC1O 3QV1A 4P4GA 3ZW8A 1M6WA 1BSVA 1LRKA 3ULKA 3DMYA 3HDHA 3WMXA 4B7XA 1X14A 1F17A 1HE5A 3HE3A 1MP0A 3BMNB 3WLFA 5IZCC 2YHUA 3C1OA 4IDGA 5TT1A 1NAHA 4FBGA 1DOHA 1NAIA 1SBYA 1UZLA 4RLHA 3AUAA 1U2DA 2X5JO 3L77A 4DYDA 2JHFA 3C24A 4E6PA 3PXXA 2Q2WA 4CUZA 4HX5A 1XCBA 1VLLA 1PGOA 3VPSA 4OM8A 1PQWA 2X22A 3ZWMA 3PWZA 2EJVA 1Y9EA 3RBXA 4OMUA 3PP8A 3NAQA 5DULA 4YAIA 2Q2VA 1U9JA 5TSDA 2J5KA 1CQIA 4IXWA 1M76A 2DBRA 3GQVA 3JQAA 3RFVA 3WYCA 5KVCA 3DBVO 1K6IA 4CMCA 3AFNA 5CDYA 1UXKA 1YO6A 3AW9A 4DRYA 4B4UA 2O7SA 2I6TA 1E1KA 3AJRA 3VZPA 1P1FA 1XQ1A 3HG7A 3QQPA 3G0OA 4DC1A 1I01A 4AJ4A 2VYVA 4IDBA 2VN8A 4LSWA 3V5NA 4BQPA 4KUEA 1V0JA 4JN6B 3SLGA 5C37A 3AI3A 3QSGA 3LC7O 4IPTA 1D1SA 4DA9A 3ZI0A 1EVZA 4TKMA 2FY8A 3H9EO 5C3MA 2CVZA 3O4RA 3KOUA 2YUTA 1VL6A 4KZPA 1QORA 5EJ2A 3VZQA 4CM9D 4Z3DA 3GN2A 3MJ4A 3WWYA 3ETDA 3I9NA 4L75A 3GH3A 2JCYA 3JQFC 3KEQA 1NPDA 2PA3A 3QVXA 3UCEA 4JBGA 3INRA 4YYZA 4CLDA 1DIRA 1B8PA 4YAKA 1IL0A 2J3JA 1ENYA 1WW8A 4DWVA 1OC2A 3BHIA 4JBHA 4QFDA 4W99A 2PLAA 4RVUA 2AEMA 4IJUA 2NADA 2IEDA 3DC2A 3V8BA 2BI8A 1GQQA 1EVJA 1SB9A 1ZSNA 5A9SA 4HUJA 4JJFA 3T7EA 5B1YA 3LC2O 2NVWA 1ZSYA 4CQMD 1E92A 1NHWA 1R4NB 3ETGA 1BHSA 1IOLA 1WLYA 1LJ8A 2W98A 2AMFA 2A9FA 4NPCA 1B26A 2VZ9A 5TS3A 5G4KA 1R66A 1WP4A 3AM5A 1GYRA 3H6KA 2I76A 1I3MA 1QLJA 4J4HA 1ENZA 3ZWAA 1V8BA 2FR8A 3FD8A 4IJVA 4RPGA 1GEEA 3KV3O 3BA1A 3DZIA 5K9ZA 2WD7A 2AQ8A 1PJ4A 1A71A 3QWAA 3SJ7A 4BNHA 4NK5A 2JD0A 5GMOA 4OQYA 1YDWA 3RKUA 5BR7A 1EQ2A 5BSHA 3G49A 5C7OO 5JAZA 1I30A 2VUUA 1ISGA 2BF7A 5ENVA 2FPPA 1X1EA 1BXGB 1Q0HA 4ID9A 1MXFA 2RHRA 4MKRA 4ALKA 4CV0A 3ADPA 4RVSA 3KXDA 3W8FA 2DBQA 1ZFNA 3FSRA 3NGXA 1DC6A 4JJIA 3DBHA 4HFRA 2OFPA 3ZWOA 2E48A 1U4OA 1PR9A 2C5AA 2AE2A 5T6BA 1C0KA 2OOSA 1H0KA 1YQXA 1B0AA 3VH3A 5AXCA 4YT4A 4OL9A 4E2ZA 4PLCA 4YJHA 3GGPA 2DBVO 1O8CA 2O2YA 1NQOA 3O03A 3H3JA 1WNTA 2GGSA 1DAOA
chains in the Genus database with same CATH superfamily
1DIGA 3KBOA 3LNCA 1TFRA 3FJ1A 4BU0A 1B76A 1DCKA 1QH8A 1JFTA 3PUIA 3EDCA 4EI9A 4JJEA 4ZDIA 3OE1A 2GM3A 4PHFA 2J8ZA 2OG2A 4G36A 2DFNA 3W5VA 2XQGA 4C9BA 5H68A 1E5XA 1YVRA 3BZBA 2NQ2C 2JK1A 3GRFA 2VXOA 1A98A 2AFIB 1H9BA 4B0PA 4HVCA 5IXYA 1BKSB 5BMVB 1X7WB 4HGNA 2AXQA 3VTKA 2Q9UA 4G5SA 4HGPA 2DR3A 2Z8YA 2WYWA 4TWZA 4LNAA 3WE7A 3ZJ5A 2V0GA 1ENOA 1JHUA 1RQGA 5GM2A 4B73A 1F12A 4RLSA 1EJ2A 5DWDA 5T57A 3PD1A 1M9NA 4OGLA 3I6BA 1MCZA 4CHTA 3P9KA 3Q72A 3IOYA 3K1YA 5A6VA 3DVAB 1Q12A 3NCHA 1E6KA 3ZU4A 2C2KA 3SQMA 2GD1O 3U7QB 2GHTA 1C8BA 1PTJA 1L8LA 4NOLA 2HREA 4ZZ0A 3KJQA 2NQTA 2ZUDA 2NAFA 2JFZA 4E22A 3HY4A 4O2BF 2IYNA 4FFNA 4GM1A 4Z2AA 5LMNB 2IIBA 3ND8A 1N7HA 3B7GA 3EEQA 1AK2A 2B1JA 3HYNA 5IC4A 9GPBA 2NYVA 1ISMA 2R1TA 4HR7A 2LD4A 3O4VA 3CLVA 5HJEA 2D13A 1DAEA 4G25A 5MGBA 3SICE 2GD2A 4J0CA 4GZMA 4CF6A 4F45A 5KYGA 1ADCA 5LSAA 1OBVA 3TM5A 2FUEA 3GJQA 5FPHA 3SHVA 3V8EA 2ZYIA 4CMJA 4WNCA 2IHTA 4AP6A 4RYLA 1XXLA 1UJMA 4GC9A 1IZ0A 2A2ZA 2G5CA 3O2QB 4QU9A 1E1RA 4DJ5X 1M0WA 3EUEA 4DS3A 1JJAA 3L79A 5BSFA 2XRMA 1B2RA 1FFHA 2H9AA 2WUEA 3A32A 4GX5A 4X00A 1RW4A 4UHHA 4XUEA 5JHHB 4GWKA 3TVDA 2JFNA 5KQGA 1Y8ZA 2HRRA 1DV2A 3T94A 4N8SA 1RU3A 5JAMA 4WZBA 1N3BA 1RXYA 1W49A 2WE8A 3JQDA 3TSWA 4P22A 2HCFA 1J0XO 3N2ZB 2FSFA 2WC1A 4TV8F 3RRZA 5AVQA 2OYRA 2OCDA 1E2FA 1OYWA 1DKOA 1M6VA 2TECE 4X20A 2OD9A 2FG5A 3L4EA 2M98A 2YV2A 2Q3DA 1AN9A 2JKYA 1TM1E 1STOA 3BH0A 3OM9A 3QLJA 4G23A 2DQ4A 2XE7A 3Q3JB 5EMLA 2FB9A 3ZNOA 3KLMX 4ZANA 2ZI6A 1GA1A 3K8OE 4QYSA 3O84A 4YMSA 4CYMA 5EJ9A 1QFZA 2BP7A 3KEFA 4E07A 1W4LA 3PCRB 5FR2A 3WLNA 4BNGA 1W5EA 1G5PA 3MTGA 4I55A 4PYQA 2ZJ0A 3CPJB 4MV9A 1FXWA 4DE5A 1H9AA 5LIRA 3IHKA 1IBLB 3DOCA 2Q49A 3R8CA 1N6OA 1P2BA 5LM3A 5LKAA 1SXJA 1XTJA 4Q01A 3UF0A 1Z15A 5C4IA 5JTUA 4KFUA 5IUNC 2WHPA 1RJWA 4K86A 1H3NA 4X95A 4ND6A 4OLFA 5DEIA 5KYTA 2QBYA 4QTXA 1PLJA 4WVFA 2IDJA 4GR5A 1GTZA 4G2TA 4Y6QA 3ZGZA 3ZD7A 3O21A 1EZ1A 4FT4A 2I2FA 3GN1A 3BS4A 3HNOA 3NBKA 2IDZA 4XGIA 4CKEA 2O8EB 1FQJA 2VO1A 1VL1A 4NCNA 1NMEA 3CT6A 3EVCA 3HC7A 2Y9MB 4YIHA 1LI5A 3S1LA 2C00A 3VHLB 5DK4A 1Q1EA 2HTEA 3WJ2A 2JAHA 1A9PA 1LC0A 2J0UA 2JAPA 5JZBA 1UDAA 2QRQA 4AW9A 3AM3A 2Y68A 1IFXA 4UCFA 3ZK8A 1IY9A 2VF5X 4IDAA 5KYUA 3VKHA 4M0EA 4D41A 2QVLA 3SHQA 4Q4CA 4Q7MB 1SU8A 4WKGA 4ETWA 2QZJA 1PDVA 1ZGBA 4M9ZA 3C6MA 1ARZA 4MX8A 4A4DA 1T5HX 3NWPA 1U0FA 4BNKA 4G8DA 3FE2A 4GIBA 4MZDA 3FYSA 3OWOA 1OFTA 3LWZA 1FYEA 1MABB 3PC2A 3QVGA 5FHRA 3WVNA 2FXVA 3PBKA 3A6LA 3DAPA 1NQAO 1P1KA 1SD2A 1SXJE 1WXEA 1RQNA 2HF9A 2Q28A 3CUSA 3DR3A 4NV1A 1I36A 5DCWA 5EL0A 4DUGA 1HE3A 4LF6B 1LDNA 1WR8A 2VNAA 2Y77A 4LY6A 1DTWA 1B0UA 1PGJA 2PSFA 1V5FA 2QDXA 3D4IA 3D3KA 1IPFA 1VHTA 1FQKA 4I99A 2G9VA 5JCXA 2GD0A 4ZIRA 2EGGA 2Q1WA 4XB2A 3BJEA 4JU9A 4KPEC 1G21B 2IPOA 4DV2B 3CISA 4CM7A 1J0DA 1T4CA 3ZLUA 4B2IA 3W2IA 4GSLA 4DLSA 4ZOLA 1UINA 4IDEA 2YXBA 3E7XA 2PJRA 4LJ6A 7MHTA 1CJSA 3DEKA 4WPGA 3LUJA 4TVKA 4YRLA 1U0NA 2JLZA 4QUAA 4YROA 4JI3B 1Z5VA 1KVTA 3ZVRA 4PYKA 5DIFA 4CKWA 5F78A 3UAGA 1VI6A 3PRKE 5CG1A 4QXPA 1KDVA 3EG5A 2WVGA 2MU1A 3DTVD 3H7AA 3HL0A 1W0KA 3HDYA 1FFXA 4B5LA 4RTOA 4QGFA 3BQ9A 2CE2X 2BRUA 3U31A 1FX0A 3BILA 3EVZA 1JPNA 1ZD1A 4DMRA 4QGSA 4MWTA 1EXMA 3GMSA 1PP4A 1H0SA 3G3EA 1JV2B 5LQMA 1YUBA 3CLRC 1IHPA 3Q3CA 5SZIA 2D8AA 3BTSA 4Q05A 4CMEC 1PJTA 2V59A 2VDVE 3KZ1E 4W5WA 4AMBA 4DR2B 1BMQA 3VDXA 4GNRA 3FGZA 4D02A 2JLQA 5L7TA 4OHCA 1W4BA 4CLRA 4A5SA 4JJGA 4CKBB 4HGRA 3ZTTA 5KPDA 1GN9A 4A5OA 5L3VA 1AQLA 2XGOA 3FI0A 3UZUA 5T7BA 3FSEA 4G5FA 4GMHA 5BUQA 2ENUA 4P7BA 4D3XA 4ALLA 3IP1A 5EUMA 1MFPA 3HLYA 5EZQA 1YU6A 1BS1A 1TC1A 1KI6B 3CZQA 4KQGA 4YS6A 3GOQA 3O1HB 3QLEA 4QO8A 3T7JA 1J8FA 1QV6A 2F2TA 2YIVX 4BBPA 2RH5A 4OIMA 2C7OA 4QPNA 5FBQB 3VR4A 2JCXA 3G2LA 3HYSA 1DS6A 1RXUA 1UZNA 2I2AA 3IILA 3T1YB 3KJNA 4P3NA 3ZHSA 5K0ZA 1KC3A 3CWCA 1Q19A 2UVPA 3SEQA 3E8MA 3A1SA 1FRFS 1UT5A 3FY4A 3DAOA 1NVUQ 4TLDA 4EGJA 5JARA 3NBFA 4JJ6A 5AW3A 2JS7A 1XMPA 3ABQB 1RKXA 1PG2A 2GETA 2XY4A 3TZKA 1DQPA 4MWBA 5IF9A 2WSBA 4FYKA 3MTAA 4MIKA 1GKIA 3CR8A 1IRXA 3UPUA 1J22A 4PNEA 3TDKA 1VJGA 5LP6B 1X1QA 1I5OA 2VH2A 1P9LA 3ZK7A 1YR9A 5NLLA 2XADA 1DDGA 3H8SA 2Y4OA 3H5WA 1A04A 1THGA 2A30A 2NNLD 1OAKA 3CTPA 5CJPA 4YRNA 1BVHA 1GVNB 5KTTA 4EF5A 5C5EA 2WSSA 1K2VN 1V5IA 1YCHA 3GLRA 4JI6B 2ZB3A 2YBDA 4PHGA 2FWNA 2YFQA 3WBKA 3BL6A 2FRXA 3EZ7A 3FZYA 2XUAA 2Q5CA 3QMMA 2VNHA 1OT5A 4WKBA 4QU0A 4BNZA 2Q8QA 1NQTA 5ALEA 3JS5A 4MVYA 1CZOA 3LT4A 1TZKA 4KTTE 1YCGA 1YFJA 3IIIA 1MOZA 2QYHA 4MI6A 2Z2JA 2FPGA 4KDEA 3VAYA 2FQ1A 3A31A 3JYOA 3PA6A 3ZWXA 5C7YA 3U09A 5HQ3B 1M6HA 3R6TA 5AK6A 1C7FA 2R1ZA 1UT6A 2ECFA 2M32A 2BEWB 4CL3A 2IKSA 1K5PA 1L7PA 2CXNA 2EKQA 2PZFA 3C7KA 3I8SA 3NORA 4JLJA 1QFYA 3EDRA 1BZYA 1XZDA 1EXWA 3IQWA 4ZVQA 2I5PO 3V7NA 5E8RA 1HT0A 4JLDA 3X1XA 3DC7A 3FNGA 5J2TA 4KPYA 3HJUA 4Y1RA 4R9SA 5FPYA 3ZHRA 2BOVA 1ZR4A 1LW6E 2ROQA 4ZCLA 4RSRA 3JALA 4L5CA 2WW8A 2VCHA 3DCNA 3DM5A 2EKDA 1TYAE 3FRIA 3P97A 3PHLA 4HWSA 4PO1A 4AJKA 3MGCA 4AICA 1EIWA 1ST3A 4IHKA 4HAYA 1SPBS 2WAMA 1T10A 2R4UA 3T7RA 4S04A 1VSUA 3D8UA 4LN1A 3UXEA 4AJEA 5AVWA 1NUTA 2CB0A 2GN4A 3AXTA 4WXYB 5D7BA 1DO0A 1MC4A 4EKGA 3FHOA 3UH1A 3AEZA 1QRTA 2JGDA 4FFLA 4Z0PA 3K9FC 1NRJB 1TZBA 5JZVA 1QIGA 2EXXA 4JLNA 3M70A 1Z4QA 4Q1DA 3SXUA 4F5ZA 2PMCA 3CZRA 4IFBA 5FAXA 3WB0A 2PKRA 3DCYA 1T1GA 4EJMA 4D26A 3IXMA 2D0PB 2H4JA 4C08A 2QB5A 4L5AA 3KQUA 3OOWA 4AJOA 1U1DA 1YR8A 2OBXA 2QQEA 2C61A 3NDJA 3ASVA 1SY7A 3PNLA 3SYNA 1ZK4A 1XL1A 4LEIA 3I23A 3IMEA 2WIJA 4UUBA 2Z6VA 3DYIA 2PZLA 3EGIA 1WQ3A 1TKBA 3ZDDA 2XE8A 2A58A 3VTFA 1MAUA 4F5YA 2NPFA 3C7AA 1P1CA 5K3BA 3F5QA 1DFIA 1QYDA 3RYIB 4RZIA 2ORED 2X4LA 2B8JA 2Q5LA 3CH5A 1B14A 1UOEA 2FGJA 3PNMA 4JU8A 3L6BA 2EJTA 3KQSA 1NY5A 3SBDA 4C4AA 3VR0A 1QTRA 5BV2P 3LXXA 1YZFA 1ATIA 2V9PA 4IIEA 3TZEA 3W8DA 1JRLA 3EGOA 2IX3A 1H1LA 5CURA 1V6SA 2CJXA 5IYZB 5JZSA 2OXTA 3T1HB 1DJQA 4RM2A 4NX2A 1D1QA 4D57A 2QPLA 4BZQA 2GA9A 5B7NA 5HKKD 1V7CA 2FPSA 1D9XA 4P2GA 4EF4A 2O8BB 4FCWA 3Q5GA 5C34B 3AFOA 4V3CA 5AHXA 2J87A 4CTJA 4NMLA 1LRJA 2NTVA 1NYLA 1OGYA 3FSGA 4I0WB 4BJ3A 3FHTA 4KXNA 3B9BA 2QL5A 1JDNA 2VDKB 3T6KA 3NATA 1T4GA 4G24A 4DMFA 1OLSA 3UV3A 5KMGB 3DEZA 3OF5A 4ZDKA 3SQDA 4KITB 4EB3A 2P5SA 1SOMA 3OT1B 4ROSA 2WTAA 2ATXA 4UUOA 3R9IA 4AJ2A 1YDHA 2E1PA 3USES 3MGBA 3PC8A 1UJBA 4FHEA 2I34A 4ZVMA 3KKKA 4EG3A 2OCGA 1EFVB 1U2GA 2J1LA 3IE0A 1DAHA 1B8NA 4PAGA 2QVBA 1DWQA 2OAEA 1U7ZA 3P0JA 2XCSB 2QAJA 1PS8A 5I7RA 4LZOA 3O47A 1UEJA 2BZ1A 3TOSA 3VC3A 5LCXA 4MTCA 4DA8A 3AETB 1HM5A 3KR0A 3PDWA 4DBLC 1ADBA 3F2IA 2I66A 4LYJA 2VT3A 2YIDA 4EZEA 5FBVB 1QU3A 5HUJA 4R2IA 2GNPA 4XUCA 2H1OA 2H2WA 1VYUA 5FBHA 2OORA 4EUEA 3CEAA 5LPNA 3I9KA 4US1R 3MPOA 2J5RA 4R8MA 1Q6ZA 4D9KA 2VP4A 3T5CA 4DANA 2FZKA 4J90A 5DM1A 2X9QA 3PIIA 5IU6A 4HSEA 3L0CA 1FDWA 4U2DA 5ECWA 1BKDR 5F7ZA 1T8UA 3H4TA 2VNSA 4BU1A 4YR7A 1ZJ5A 4ZQCB 1Z74A 2IVZA 1E2UA 2WJAA 2XTZA 4EPRA 2AMJA 5F7XA 2ZTHA 2EKBA 4UDOA 5JEEA 2QMHA 1QCCA 4FEGA 2IX9A 3K5PA 4MRRA 4BX8A 5KOIA 2HCRA 5CT8A 1JQ3A 4K6GA 4GPBA 5G2OA 3TJMA 1J33A 4OXNA 1QTNA 2PWAA 3COSA 2IUSA 2EP7A 1MXHA 2KMLA 3HN6A 3K09A 3Q15C 5DYYA 5E9JA 4C0SA 1HSOA 2OO7A 4MV6A 2B6NA 3ZTYA 1ST2A 5C1PA 2WWVD 3WBBA 3JYNA 1VG1A 2Z5GA 5I4KA 1KZYC 3A27A 1IBCA 4TMTA 4WJZA 4O4HA 1R37A 1XXHB 1XZKA 2QAIA 4XKJA 1G16A 5K51A 2BTQA 2Y2VA 5KJ6A 2GFIA 4TV9B 2O3QA 4P31A 3L4BC 1C4WA 4P54A 4IMJB 4CMAA 1YFKA 4C1BA 4D4GA 1AXRA 3MS4A 3P4YA 5DIZA 1PT8A 4EFMA 1V16B 1T9HA 3TX6A 1LWNA 4A6DA 2NXNA 4BN5A 3RAFC 4HN9A 1N8TA 3BG5A 4JEMA 3D4LA 2Q3EA 3AIOA 1IN1A 1Y1SA 3CG0A 4BVJA 2PLWA 2YCBA 4P5DA 1VE9A 2PAFA 2QUBA 3L8FA 4JOCA 3C3YA 4KYIB 1OYOA 1AU9A 1NN3A 4UNPA 3VYUB 3D31A 5EE9A 4WVLA 3PGVA 2I55A 2XX3A 5AESA 3WLHA 5HNKA 5LR6A 4X3CA 5AW8A 4F0JA 2XZLA 2NQ8A 1GUFA 5K3DA 5TEWA 5BVGA 2ERYA 4M9UA 3SVLA 1SU7A 4GD3Q 4YFYA 2NO4A 2XNJA 5I9LA 1XFDA 4CF7A 3P94A 4PYMA 3RV3A 3WGMA 4L6CA 2V7QA 1K08A 1YXMA 1M2OA 4RK0A 2V7EA 1E89A 1NPTO 3BFKA 2OT3B 1SR8A 2IOFK 3NHKA 4YAGA 1F06A 1RXWA 1BQ4A 1N2SA 3IEUA 4A0GA 1ULSA 2X86A 5AXBA 2EAUA 2FPPB 1ODFA 2HK7A 5IDQA 3IKVA 4HQRA 4PYJA 2EF1A 3BSYA 3RUAA 2Z8ZA 1BC5A 3KETA 4BQSA 2YS7A 2WIKA 1NOIA 3LCUA 1RXSA 3DBHB 2O3UA 3PL1A 1FC0A 1SZJG 3RS8A 5AIBA 3PITA 3QW2A 3LU1A 4WLVA 5FWXA 1E2LA 2FWBA 3ZU5A 3E9CA 4B3FX 1R6AA 4E33A 1EXNA 2AZTA 4IP0A 2IZ1A 2C2YA 4A91A 1W93A 3HTXA 5MHTA 5AP9A 2B37A 1S2OA 2F8SA 4PO3X 3SHFA 3IKTA 2HU8A 1U6JA 1UANA 1ZMRA 1XP5A 4G2NA 5FULA 2CBGA 5BN4B 3VQTA 2HT6A 5B4TA 4P0QB 1R0SA 1S9HA 3VV3A 1QBGA 3AB3A 3CUEF 3PNPA 3RKRA 4K6CA 1PYOA 3D3JA 3FB4A 2FX2A 5C35A 3B1YA 3L7JA 3U13A 2DLDA 4TKUA 2VKTA 2NUPA 3ROTA 4K9MA 2X3YA 3INTA 2FW9A 4ZYYA 1Z33A 4K6HA 3ES9A 4AVYA 1U9YA 2GZSA 2G1JA 3EB9A 4QUEA 1YQQA 3T5AA 1JA0A 1QKIA 3Q7QA 2NOAA 4EW1A 1EP3B 4BBAA 3BREA 3KALA 4UAJA 5DHRA 1QJCA 2A5GA 2ZGVA 4PVCA 4JI8B 2GBFA 3FTFA 3JRXA 3ITNA 1ADJA 2WF6A 1CW2B 4EGFA 3O4HA 1BWQA 4U7PB 3GZJA 2IE8A 3P9IA 1O89A 3C5CA 3NRBA 4IKPA 1W8DA 2YN0A 1C3LA 5LNK6 1DZIA 4JYMA 4OLJA 1H2ZA 1XU7A 4RC9A 4RTPA 4KX3A 1EVQA 4FB4A 5KC9A 5L4NA 3IXQA 1D2HA 1NWCA 2ZQZA 3M2TA 1FNMA 2BLLA 2GAOA 4J0JA 2HPHA 1TQ6A 4HPXB 3IE2A 4AP9A 1L1QA 3TBHA 2REOA 2QNBA 2ZAYA 5FNVA 2ZXEA 1Z6ZA 2PFGA 2WLSA 3GA7A 4GYWA 4QOSA 1PVOA 2RHBA 3VC1A 4MPTA 2J5QA 3UMYA 1A27A 3LFHA 3D54D 2GZ1A 1CRZA 3FMGA 2R7MA 2XUJA 5BV8A 1QO9A 3DMPA 4UVEA 4BQRA 1EK1A 2PGJA 1CS0A 2A5JA 1RRFA 2KE5A 3GF4A 2FTKE 2IZOA 1WEHA 3BMXA 4EYEA 3FVVA 2IYXA 1I7NA 1QYRA 2VPTA 1AQYA 3LVBA 5KTYA 3JD0A 2PUEA 5JAPA 1J5PA 1K5GA 2GESA 4DCMA 4LF8B 1YF3A 1JKJB 3OCUA 4C4YA 3MRVA 2IYUA 2CHGA 1TJ4A 1WVGA 2YWCA 2FSGA 1ACMA 3PNSA 4JP1A 1YDGA 4G5YA 2ZUFA 1EKXA 1PD1A 4XSVA 3DLIA 1IB0A 4GDFA 3GJ4A 2ZIUB 3CPSA 4JY7A 4YACA 1ZJJA 2IUUA 2MINA 5KX5A 2Z4SA 2ZIVB 4QTYA 4H3VA 2H9IA 2QN7A 4HDMB 4UNQA 3DLBA 3T1VA 4CEIB 3GUYA 1ICEA 4PSUA 3RVDA 2BKLA 3VPBA 3IVGA 2RC5A 1DKNA 1GGFA 1A5SB 2CXPA 2ZDHA 1JILA 3IOMA 3PDIA 3K35A 4U7GA 3ONVA 5F9MA 3ZLTA 2YZGA 1E2EA 5KQLA 2HWXA 1UXHA 1JP7A 2WAXA 1XTPA 3NKFA 4P34A 1S2NA 1KZGB 4RELA 4RVNA 3H42B 2C3OA 3AILA 3IT1A 4IOMA 3HDQA 3P9ZA 3Q40A 3UAYA 3ZE8A 1Z2NX 4E6EA 1BMFD 2OXIA 1VG8A 3SS7X 2PUGA 3ET5A 3DKKA 3P2EA 2HPVA 1IPHA 1JQBA 2C2HA 3HXTA 4UAGA 4OHUA 2RKBA 3KTOA 4PR0A 1QXSA 4PWYA 3VDQA 3WLJA 1HV8A 1P1BA 5AW4A 2Y6UA 4R4JA 3SE7A 4W5NA 4I5FA 3VI4B 3F67A 1RBQA 3NHBA 5BSEA 4XWWA 5HTOA 1ILWA 4ZEXA 3DFUA 1FU7A 2D62A 3ASUA 3F8TA 4FB5A 3WGIA 2HHLA 2OC9A 1B3BA 1VLVA 4G0MA 3DHNA 4ISCA 3NEPX 4TRNA 3SK0A 3NNSA 1V48A 3N0TA 4NYJQ 1IDOA 2BSQA 5C18A 4Q19A 1EFPB 1GZ4A 2WPDA 2EC5A 2B8WA 1WTCA 1A5ZA 1FS6A 3PIDA 4I50B 1FVOA 2DB3A 3PKJA 2BEVA 4MUHA 1IY1A 4V2UA 5DHFA 1WXHA 1NXVA 3GWZA 1JAYA 3TN7A 2BFEA 2X1HA 2VRWA 1VKJA 1ZJ6A 1ZL2A 4CIVA 3ROQA 1Q1GA 1ZUWA 3AR8A 3FHJA 3MCZA 4URVR 1OH6A 4HLCA 3P32A 1EDZA 1FDSA 1XZQA 3L8DA 5I8ZA 3TZQA 2Z0MA 3AYXB 4EG1A 5JCJD 1PYGA 3EF0A 1JI0A 5DM4A 2CCJA 3M6IA 3FWKA 4RJKA 1HA3A 1DXHA 2VAPA 1KY2A 2ZUEA 4B3RB 1E3SA 4F91B 5BR1A 3TRDA 4UW9A 4CDGA 4YQFA 3TE6A 1V8OA 2IDMA 2FA9A 4WGGA 4AS3A 4BFTA 4YT2A 1J0AA 5F51A 4EMSA 4B3TB 3SGLA 2V6IA 1T15A 2FVXA 3UMCA 5M7EA 1NURA 1V25A 3NVMB 1X1SA 1BJTA 4M3NA 4BXOB 1G8HA 4UHBA 4RA6B 3TEMA 3RUHA 4FCVA 4D80A 1GQOA 5KVSA 5JH7F 1HYBA 3L06A 3H5IA 1YDMA 1I3NA 4G67A 3C3MA 5ALIA 3SYKA 3ZNQA 5I9MA 4W1QA 1N3IA 2XNSA 4N5DA 4JQYA 4ZAFA 2JJ1D 5FHQA 5FPSA 4CQNA 3R3ZA 4F6CA 4IEIA 1QC5B 2J7PD 2E6KA 3IRUA 4FSXA 2VK2A 2Y99A 2FZEA 1UQUA 1B1CA 2YL2A 4NFHA 3CE6A 3NTRA 2C9MA 1VE3A 1B0ZA 4Y1GA 1TOAA 3PPYA 4Y3UA 2Q1SA 4DN6A 3ABSB 4V1CB 4Z53A 5AVKA 2QVYX 2AR7A 2YQ5A 4FR0A 5T8KC 3TLCA 1DE0A 2XGMA 2XXAA 1Y3CE 3PV0A 4CJXA 2WMDA 1EFRD 3GT4A 4MWCA 1U8XX 4O4JF 3OZCA 2GEVA 3TMYA 2J9XB 1J8VA 1U0TA 4YRTA 4AO8A 1ISHA 3H4VA 3I9JA 4DTIA 3DKIA 3A04A 4DLBA 4GGOA 4C4PA 2BWJA 1T6BY 2E87A 1XBTA 3IAEA 4RNCA 2OCKA 4NLLA 4B9AA 1CUUA 2YMLA 3LO5A 2QM7A 3AVYA 2WABA 3V1MA 1P39A 5JD5A 3ZVLA 3R1IA 4EQZA 4Y8VA 5LXTB 4ZOAA 1R0ZA 2ARKA 5EPOA 5L9AA 5D3MA 3EDQA 4ZT3A 3WIOA 4ZYXA 4MRVA 1C7RA 2A4KA 2CWWA 3P7MA 1Z0DA 1KIAA 3TKYA 4B2LA 1W2GA 4MKFA 5J5AA 3R9XA 4PZ0A 1VKRA 1BAPA 2WV7A 2AQIA 2ZTUA 3H5OA 5L3ZA 1U7TA 1ZD8A 3DKRA 4QAJA 2WU4A 4QC2A 3SIWA 6REQB 3HN7A 5IDVA 5AKJA 1YQGA 1ODSA 1BDMA 1C9MA 3GLGB 2IS1A 3NUGA 2J4CA 1MA0A 2JI9A 5F9HA 2WJ4A 2ONYA 3KYDA 4P80A 3LBFA 4DIFA 3TDMA 3L8HA 1EQUA 1IQUA 2FHSA 4AY3A 2WMYA 2HBRA 1ZMXA 5ED0A 3ONWA 1UBKS 2B9EA 3PNKA 5IBRA 4DLZA 5AW2A 4MJ7A 4KRFA 2HK6A 2QT0A 4MS3A 1N9GB 1MAAA 4ZFNA 1MF7A 3IUSA 1W5BA 3IQEA 2ZPAA 3H11B 3SVTA 4EW6A 1IPEA 4KQ2A 3JWEA 2RONA 3KB2A 4C14A 3EMDA 5KNDA 3U5ZB 3F3KA 5E1MA 2HZBA 4BNXA 2PXAA 4H2DA 2PGLA 1GG8A 4QZVA 1A2KC 3I45A 2XA1A 1BWRA 4JYCA 3D6UA 4BJ1A 3DYVA 4R16A 1RWVA 1EB9A 1BCRB 4DLRA 2B36A 5AK5A 2AMVA 5CP8A 3N8KA 3BCUA 2B2NA 3F6PA 4TRMA 2VRCD 2WKWA 3IOCA 1T2EA 1A77A 1NOKA 2HNAA 4TKLA 2FN7A 1S96A 4M8SA 4XR4A 4XI9A 4DM4A 4DV6B 3OMXA 1M3SA 2BFBA 1UC8A 4H16A 4Z1OA 1AKVA 2YWGA 4RTMA 5FNZA 1V11A 2VAVA 3A4LA 2RB5A 2X9GA 4I1YA 3CF0A 1CB7A 3K73O 1AJEA 2EDAA 3C8MA 3D7SA 3UPTA 1QGYA 1CERA 4WV3A 1YA8A 1FNSA 2HIGA 3DL4A 3TEJA 2JGFA 5IMSA 5KEIA 4RESA 3OEHA 1C0PA 1I9GA 2I4IA 4W8HA 5TF4A 1TVMA 5K05A 4GL2A 5DI3B 5FL7D 4JAVC 5ICMA 4Q1CA 5KYXA 4Q7QA 1K8RA 2ZXFA 4LDJA 2WHXA 1YS6A 1VSVA 2BY4A 3GLVA 2H4ZA 1E7QA 1UXOA 1XVVA 3H1TA 3UOAB 2XMRA 4EL0A 4MGEA 2G7MC 4Q9AA 3T5BA 1SZCA 2VF2A 2DWPA 4HDAA 1KAQA 1PT5A 4PYLA 1KDYA 5IT9A 2B21A 5FYDA 4FFWA 2HQOA 4ZVVA 4E1BA 4LJ4A 1JSXA 2J3IA 3CSUA 3HB5X 4AX8A 1YNOA 3ZS9A 4J0IA 3G02A 2DZDA 4K9DA 4BOYA 3Q5DA 4JL6A 2O4UX 1FYFA 3C7CB 3Q3EA 1E6UA 1AO3A 1NY6A 3OP4A 3SKXA 1M33A 3JATA 3ZDRA 2DHDA 4JXZA 1G9SA 1YB4A 2F4NA 2E4VA 1I33A 3E0QA 3I53A 1W88B 3N6VA 3T7AA 2AD5A 2BMJA 2FAXA 4C4ZA 2G88A 3HBLA 5MDHA 1TW2A 1CJUC 4HDNA 4P4LA 5E3IA 2ORVA 3PJGA 5KTPA 2XKBA 3L0PA 4IIXA 4TVSA 3FNQA 1QRUA 4HH1A 3DDHA 1OPRA 3TQHA 1OCEA 1LD3A 1T36B 3C3PA 4DYHA 3WYEA 4JEIA 1CJTC 2QMYA 1OKKA 3GLSA 3PJEA 5AW5A 5ARCA 3HKDB 4IMPA 4AI6A 3FBWA 5MN5A 4HH0A 4B80A 3KB1A 1KAHA 1WCIA 3U16A 2AR0A 2GPJA 2W71A 3L4KA 4O59O 1UJ4A 4A2QA 4KQJA 5AW1A 2H00A 1G0NA 4H3HB 2GEFA 2JGKA 4YONB 1IAVA 1E64A 1HL3A 1G17A 3QWIA 3ZWQA 4F3TA 1E3WA 1LFDB 3L01A 1TU0A 3OQOA 4DB4A 5K0GA 2HA0A 1BYUA 4IDFA 5K0NA 1HNZB 1AKMA 1BA3A 1H2EA 3E81A 3HKEB 4G4IA 3OOYA 3G9XA 1ZEMA 5FADA 5G02A 5BXQC 1KK2A 1MT0A 1L7VC 3EGDB 1WXFA 1GAJA 3FZNA 1SXPA 5EIBC 1JIIA 3RHSA 1DAMA 4YT8A 1TX4B 4GMDA 2W8BA 3Q0TA 5KWVA 2JDIA 4K6FA 3NX4A 1PTKA 5LQCA 2ZSDA 3AHJA 4RL6A 3R74A 1TK9A 3KQYA 3URKA 4EAAA 2NP6A 4Z51A 5JMTA 1QOZA 2JC3A 3NHAA 3WLLA 1CRWG 3RG8A 2XWSA 1FOEB 5HWSA 2UKDA 4MHOA 4A15A 1IHYA 3S5JA 2CSUA 4DB2A 1Q22A 3LYLA 1EEXB 3MN1A 1GLGA 3WISA 2YYZA 4R51A 4WUVA 1R6VA 3NUZA 1QQ6A 2VDWA 3RUDA 4AQYB 2P9BA 4D43A 3AM4A 1Q1ZA 2VK1A 2H1IA 3CH7A 1Q1NA 4G0XA 3R44A 5L95A 2R8BA 1KU6A 2JZOA 3OOHA 1R5NA 4X8LA 4NULA 4ZHQA 3W5CA 1PNRA 4MUYA 5C8DA 3KSZO 4JDPA 1AB5A 2GJ4A 4DT1B 1T1RA 3NWEA 1CDOA 3VSDA 4C7XA 5I7UA 1FFEA 3UJHA 1N2BA 1QZZA 4EB8A 1KYVA 2HHHB 3RUFA 1LA2A 1Z8FA 3PG5A 4PPYA 1XD9A 3D8HA 4J7XA 5A4JA 3HKCA 2ZCJA 4YRAA 1K7YA 3A0RB 1DPFA 3ZWNA 4G4SP 1AD2A 4RTLA 5C0OE 3MSXA 2RHJA 4OK6A 4QX6A 4GDMA 4IX1A 3MS2A 5CM2Z 1JHRA 3W4IA 1MX1A 5FA8A 3FCEA 2ZR7A 3PFFA 1VXOA 5CLIA 3TDNA 3V1LA 4B6PA 2QMQA 4JDUA 4LJAA 1NUAA 3KOOA 4EFNA 1F4PA 1FUKA 8ABPA 3CMMA 3V34A 4RY8A 4ERNA 2YMMA 3TLMA 2ZUUA 3ESYA 3CPHA 2ZIAA 4UOEA 5IH7A 3LL4A 4QJBA 3IAXA 2VBGA 5FLXA 2BLNA 4HWOA 1BX3A 4KGDA 5IPFA 3IAHA 3A9SA 4QDTA 1XD8A 2G77B 1YB7A 4YV2A 4HGQA 3X1DA 4JASB 1P1HA 2YJNA 2ZBDA 3SR0A 1HNNA 4TT3A 2F8MA 3TRJA 3IEPA 3F5FA 2GA8A 5KU1A 4Z0HO 4F4IA 3UA3A 4DZTA 2HSWA 2FZLA 1DSSG 2O2ZA 4E09A 2VDLB 1EMDA 4RV4A 3UPDA 4D96A 2IZZA 2P6OA 3BAZA 1PZFA 1M6NA 5H1YA 5LYJB 3RB8A 2X58A 1SXHA 3HXQA 3ELWA 1CBUA 1PKEA 1VDMA 5I9NA 1WOYA 1E1YA 1KI2A 2JHCA 3RU7A 1ZGCA 4HZGA 3JQGB 4GVPA 2F1JA 3EAFA 1HDIA 3MAAC 5EHQA 4ZCMA 3I01A 1J20A 2VUHB 2EW2A 2R2AA 4OQPA 3U1TA 4BLOA 2ZTMA 4FGJA 3C5VA 1JU9A 5K3EA 3UT0A 1SKQA 1ZUHA 3PT9A 4OY3A 5JCPA 4CKCB 2CT8A 3HVKA 1FIUA 4OBXA 5ALGA 3AIIA 3I2JA 1P4SA 3LECA 3ZW9A 5JMWA 1J0BA 3NHMA 2AOTB 4QUBA 5KKCA 3B70A 5BSKA 2H4HA 3FR7A 2JRLA 3HVIA 4PIMA 1J7JA 1JU4A 5AI9A 1W46A 2IY8A 3L4JA 2Q5HA 4RF2A 2WT9A 4OB8A 1VCHA 1A2OA 5C32A 4MXDA 4QM6A 2H4XA 3LDUA 3ZXUB 4M1MA 2IEGA 3AP2A 2R44A 3TH5A 3LRTA 1NQXA 2VQEB 2FUNB 3JARB 1KEEA 2O7NA 3VOBA 5IT0A 4UHKA 2V6BA 4N9WA 2XD4A 3OICA 1WO8A 5ERXA 1DB3A 2Q1TA 3VBCA 4CVNA 3AL0C 4DNXA 5NULA 4PFKA 3ZDCA 3VNUA 1U1IA 3L8GA 5HFNA 4LXTA 4EY6A 1PR1A 5A04A 1UBEA 2O8VA 5HKAA 4CEJB 5L4LA 3L7KA 3ASZA 3F46A 1ZPDA 2H16A 1M74A 2CFRA 1DEOA 1ONNA 2E18A 3HU3A 3UENA 3K6SB 4P81A 5EY5B 4IDNA 3ISTA 4AY4A 3H8WA 3NEYA 3F98A 5MN6A 1CUJA 2XMBA 2GNAA 4U9HS 1N9ZA 1Y81A 3BWDD 1KQGA 4TLEA 1CR0A 5D7NA 4PGGA 3QVJA 3FPHA 2VATA 2XVXA 2OBMA 3LZDA 4QD3A 4RO0A 5HBRA 1NRWA 2KJQA 5IAEA 4ANFA 4WOJA 4K05A 1XRQA 2Z04A 4R2HA 2GPAA 3HDVA 3JV7A 3FDXA 3WMWA 4MB2A 1Z63A 1HDEA 1SKMA 5KYKA 4HHEA 5DXAA 2P4HX 1RQRA 1XTBA 3E7WA 4JC8A 4YUWA 1VHWA 2B92A 2PE5A 1H4QA 1Q74A 5FOVA 4YAUA 5GV7A 3V7WA 3PDUA 1ISRA 2AOVA 1G4UR 4TT8A 3WO0A 2EJBA 4BQFA 3EY9A 4LBWA 4JC0A 5CCEA 1NQVA 2F3PA 2QTVA 5H9WA 1CIPA 2BKEA 1UBTS 1PQ4A 1E32A 3ON5A 1TO2E 4TYQA 1D1PA 5K03A 3ONNA 2C9OA 3D6FA 2IZ7A 4YNBA 3PXBA 1X9IA 4WLNA 1DVRA 4OM7A 1XG5A 2DMRA 2GM5A 1ZBDA 2ZTVA 4ITUA 4JQCA 4AN4A 2EZ9A 1YD7A 4TS4A 4YLYA 1GU1A 3RT1A 3PX2A 4EKEA 3I0NA 3EPHA 3VVBA 1PSZA 3PTLA 4J9UE 2OXFA 1RJ9B 4KVZA 2YVQA 3UIEA 2UZ0A 4YRGA 2J9GA 4Y0NA 5IX8A 2W6IA 2JCSA 4O02B 3UO8B 3FXAA 2RGUA 2PL1A 2QP9X 3EWIA 3FIUA 5IBPA 1H0HA 5B7QA 4JI4B 1RQPA 3PL5A 4BYMA 4NHOA 1T2DA 3UB2A 4I2VA 4JLBA 3P9YA 4HY3A 1PW7A 3B1FA 4R0VA 5DGCA 5CVCA 3NHFA 3JAKA 5KNBA 3AR9A 1E5LA 3BFJA 3CPEA 3N8NA 4AUMA 2Z9CA 1WF6A 5C80A 3GG9A 5HXAA 4U6NA 2JRCA 4UPDA 5IKEA 5JISA 3I05A 1KHTA 1T4MA 1VKHA 1DARA 4R2JA 1VKZA 2EJUA 2W83A 3C74A 2HDNB 2F8TA 3DS8A 1GZ5A 4ZAZA 3UT6A 5EUQB 3H65A 3KOMA 2QTAA 4YC7A 1DT3A 4J1SA 4CUJA 5EJ6A 1O6GA 2I4TA 3TB6A 3NTUA 4ER3A 4Q9DA 4QWMA 4LI3X 2VT6A 1P19A 3GLIE 2NTYC 1I2MA 4LOJA 3WNCA 4KVGA 2FDCA 1NM5A 4BFLA 3IA7A 3L7CA 1MG0A 2F1OA 2A88A 4QQ8A 5GJCA 1HY3A 1HYHA 1CD5A 3OFVA 4G5OA 1G6KA 1SC4A 5LQDA 4CLOB 2WYOA 3EISA 2IOQA 5FTMA 5CNIA 3REQA 3T9BA 3KUCA 3D6JA 1TMKA 4AYXA 4O2AF 2DRIA 2YY6A 3TF5A 2FJPA 3TLGA 1I4TD 3EHEA 3FZQA 5TJ9A 4EZBA 1WQ1R 2AN4A 4RTRA 1IZ8A 2GPWA 2WFZA 1B6TA 2XNDA 4GVXA 4M9SA 4N40A 1GAQA 1DNPA 1Z5GA 4CTNA 2M9MA 4F2HA 1ZI9A 1FBNA 2BGRA 2EFGA 4FK8A 3M1LA 2R68A 1AC5A 4DY4A 3EOZA 2AFHB 4H31A 3QOYA 1OAAA 1H2HA 4BMSA 4WJKB 1K98A 2M6LA 1AS0A 1N6RA 4B47A 1YZYA 3LDAA 3PGXA 2GCIA 2QY9A 4DLVA 5JVDA 3EXFB 3K92A 4NBSA 1SQSA 4Y6RA 1G8SA 3U3MA 3ZBTA 3B6JA 3HSYA 2YY5A 1Z3IX 1L1FA 3IQFA 2DFDA 1XQWA 2GYVA 3HA7A 2X1VA 4DG5A 1P18A 3HDGA 3V8RA 2MWMA 2BCJQ 2LUOA 2PY6A 2GYYA 3VKGA 5DHSA 4NABA 3JWPA 2WUGA 3WNQA 5DHTA 5EP4A 2CV2A 4E0BA 2XDYA 2NMVA 2Q9BA 3P2JA 2VHEA 5HIMA 3CZ5A 2P2CA 1KKUA 3Q11A 5MFZA 4V0MA 1MIOA 2C5FA 3DT6A 4U2GA 1OY1A 1RWBA 4EQ6B 2CJPA 1OZ0A 4EH1A 3DNFA 2FE4A 4K9SA 4QOGA 4RKFA 2IYPA 3VDMA 2FMTA 3NR2A 5EKDA 5ITZA 1TYDE 1CVIA 2BUCA 3OOJA 5MFPA 5EINA 4P53A 3NVDA 4EGQA 2OXEA 1PO7A 3WFIA 1UBNA 5TMEA 1EBFA 3W0LB 1WBDA 3TNLA 1LLDA 2G9ZA 1BRTA 1T9KA 4ND2A 5B12A 3I72A 4GP7A 5LWHA 1CCWA 2WDPA 3GL9A 3BSFA 3EA4A 5F3DA 3FRHA 3L1VA 3JW8A 1SWWA 2FDRA 3N2IA 3L1UA 1P9RA 2Z09A 4JELA 1UKAA 4N5NA 3IXLA 5KOHA 2WVHA 3VU1A 4CM4A 2PUDA 1CQWA 3F74A 1X8JA 4JYPA 3FCXA 4ZCQA 1SOWA 1XA0A 4DARA 2H06A 5ITVA 2A1UA 1YMQA 3BMNA 1XU9A 2BGWA 1RYDA 4PBRA 1NF8A 2B2XA 3ODPA 1C0LA 3ZY4A 4KHPB 2LCIA 3BEOA 1II8A