3I3OA

2.06 angstrom resolution crystal structure of a short chain dehydrogenase from bacillus anthracis str. 'ames ancestor' in complex with nad-acetone
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
282
structure length
282
Chain Sequence
FVTMPAQHQNKQPGIESLMNPLPQFEDPNYKGSEKLKGKNVLITGGDSGIGRAVSIAFAKEGANIAIAYLDEEGDANETKQYVEKEGVKCVLLPGDLSDEQHCKDIVQETVRQLGSLNILVNNVAQQYPQQGLEYITAEQLEKTFRINIFSYFHVTKAALSHLKQGDVIINTASIVAYEGNETLIDYSATKGAIVAFTRSLSQSLVQKGIRVNGVAPGPIWTPLIPSSFDEKKVSQFGSNVPMQRPGQPYELAPAYVYLASSDSSYVTGQMIHVNGGVIVNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Short chain dehydrogenase
publication title 2.06 Angstrom resolution crystal structure of a short chain dehydrogenase from Bacillus anthracis str. 'Ames Ancestor' in complex with NAD-acetone
rcsb
source organism Bacillus anthracis str. 'ames ancestor'
molecule tags Oxidoreductase
total genus 107
structure length 282
sequence length 282
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2009-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3i3oA00
1E3SA 1HE3A 4HXYA 1Y8RA 1DPGA 4YDRA 3GPDG 3NUGA 4BO5A 2DPHA 3OIGA 4I5GA 5KVCA 3TOZA 5DZSA 1YL7A 3L77A 3JYQA 2X22A 4I9UA 4YPOA 4FGSA 3WNVA 2C07A 3SVTA 4JLWA 3GA0A 4FCCA 3INTA 2I66A 5JAMA 1F06A 1U7TA 1ZZEA 1GY8A 4JROA 1HETA 1E3JA 2FMUA 3TFQA 1SOVA 3N74A 4HFMA 4OSPA 4U6QA 2O2YA 4URFA 1GYQA 5IDQA 5MDHA 2WEKA 4CM8A 4J0EA 4BMNA 1DLIA 3DHEA 4RJTA 3TFOA 1H9AA 5EESA 2UUPA 2J5RA 1I8TA 4XCVA 3E6AA 5BSEA 4B4WA 4BB5A 5EINA 3SC4A 3DOJA 1K5HA 3PDUA 4BNIA 4RF3A 2O3RA 3FD8A 1GCOA 2Y68A 4BGEA 3EAGA 4D0SA 3WIEA 3DXFA 2GNAA 1WDMA 4E6PA 4CV2A 3QHAA 5JYEA 1WZIA 2C7GA 1Y6JA 2NTJA 4D45A 4YVFA 5A5FA 4JP3A 2ZCVA 3FBTA 2P4QA 2YHIA 3H9GA 3I6IA 1HYHA 3KB6A 1Q7BA 3SBOA 4OQZA 3BHMA 5KJCA 1PR3A 1DSSG 3D4PA 5L95A 3ANLA 5JYDA 4AJ2A 2IXAA 4GL4A 2ZIZA 4YWJA 1H6DA 3LDHA 1DOHA 4JBIA 1HE2A 3LT0A 4WOJA 2Q1WA 3GDOA 1ULUA 4L75A 1NNUA 4N5MA 2X1HA 1A4IA 2W2LA 1EE2A 1CEQA 1CF2O 1YE3A 4IDCA 4J1QA 4K6FA 3BA1A 2W2LD 2GUGA 4R4JA 4WGGA 4W6ZA 4YRDA 2X0IA 1IHXA 1SZJG 4G65A 4BUCA 2O50A 4CM8B 3JQGB 1UDAA 4ZA2A 2WYWA 1ZUD1 4M86A 3H9EO 1Y5RA 3EY4A 2O3JA 1UJMA 2BF7A 5IN4A 2JD2A 2JCYA 2EKPA 1ZK1A 4YXFA 2NUAA 4MVJG 1T1RA 3EK2A 5CEEA 4ND1A 1B3BA 4U8GA 1YWGO 3S2IA 3HQ4O 1GYRA 3A28A 3P2OA 4DVJA 4RL6A 1T2EA 5G0WA 2ZYGA 2ZTVA 5LC1A 1DIBA 3MOGA 4MJLA 1QORA 1F17A 3U4HA 3GAZA 3WIDA 5KKAA 1ZCJA 2VQ3A 1R6DA 4F3YA 4HNHA 1E6UA 2YHIB 2D2IA 2RH8A 4HUJA 1D4FA 1HWYA 5CFZA 3H3FA 3GEMA 2AQHA 2JFGA 1LLDA 3OJ0A 2PKQP 5TGDA 1PGQA 2Y1OA 5I7FA 3BHJA 3WGYA 1GL3A 3HB5X 4WJZA 5ILGA 3I9OA 3MJVA 3DZHA 4CQLA 3DFZA 4CR7A 4E32A 3JTMA 2PZJA 4KUGA 4Z3KA 1TXGA 1YJ8A 3CIFA 1ZH8A 3C1AA 4BKRA 4DTIA 3WYEA 4FJ2A 4PLVA 4BGVA 4ND5A 4NK5A 3JQ7A 3FF4A 4GX1A 4IJUA 5TC4A 1O8CA 3AI1A 4QFDA 4PZDA 5DNAA 1MC5A 3GN1A 3HE3A 3PEFA 3R6DA 3K73O 3HN2A 4IJWA 4NIMA 4MVJF 3VHRA 3O8QB 1C0LA 4BGUA 4CV1A 2EKLA 4X54A 4RZHA 4RQTA 3WX0A 5T8KA 1E6EA 4B7XA 4NU6A 2HMVA 1ZW1A 3MZ0A 1HLPA 1TEHA 4LCJA 1JW9B 2CFCA 2F1KA 1JQBA 4AJEA 2LDBA 1NPTO 1H94A 2Q4EA 5HM8A 4CMGA 5BR7A 3GY0A 4MVJE 3ENNA 5JXWA 1QYVA 4DIBA 5JO9A 4W4TA 4ZU3A 2C54A 4FW8A 1QLHA 2Y1DA 5KVQA 3CTMA 4J2OA 3G17A 2O7SA 5A4DA 3H65A 2Q2VA 4PG8A 4FJ0A 4HFRA 3KYDA 5T67A 1TB4A 1ZXBA 5COQA 2VZ8A 1YH3A 1QLJA 2FHSA 4ZQFA 3EVTA 2ZTMA 5BT9A 1YVEI 1HYGA 5TT1A 3WLEA 4HBGA 2DM6A 4ZD6A 1PJ2A 2NVBA 5B37A 5C7IO 2PGDA 3GZNB 5DOVA 1J49A 3SJ7A 5IZCC 1V6AA 3E48A 3L9WA 1GU7A 1H2BA 2ZK7A 3DTYA 1HF3A 2R00C 3C1TA 5KJEA 4PLFA 1KVRA 5DDIP 5DP1A 1GPJA 2QIOA 3DDNA 4MP3A 3EGOA 1RM3A 1I3NA 5A05A 3FBGA 1PQUA 1MV8A 4CMJA 3JD1A 4W82A 3JD2A 3GC6A 2W4QA 4GGPA 1YDEA 2X5JO 3KLPX 2HCTA 5DULA 2IYOA 3QJ5A 1IY8A 3TN7A 3GVXA 2DTEA 1I3LA 3JQ8B 3FSRA 3NDIA 4IDEA 4BV8A 3RUHA 3TJRA 1C0IA 1OAAA 2NTNA 1KY5A 3BMQA 4EJ0A 3RQSA 3ICCA 3VAZA 1JLLA 2EERA 3NGLA 2DT5A 4RDIA 1QYDA 4XDYA 4DWVA 2D59A 3AI3A 1X7DA 3DEYX 3F5SA 4CMEA 4P38A 3F1LA 3OA0A 3Q9UA 4KTTE 4KWIA 5L51A 2EXXA 3GUCA 2RHCA 3RD5A 3GQVA 3ZWNA 5ICSA 4UUMA 1PL6A 3M1LA 3WSWA 4N5LA 2FR1A 1OFGA 3NTOA 4MOWA 2OO5A 3DOCA 3FRJA 4KTVE 2H63A 3ZHXA 3FTNA 4AJ4A 2X0RA 3BTUA 3LC2O 4ESOA 1VPDA 1NPYA 4CM7A 4O0LA 3D5TA 4P4LA 5TF4A 4D79A 2PD3A 3M2PA 2YQ4A 1N2SA 4E5KA 1NHWA 5HBRA 3DBVO 3RU9A 4Z6KA 3ZHBA 3HB4X 3ZWXA 1LRLA 3I3OA 3U5TA 1PIWA 2NU9A 2PNFA 3UGKA 1TT5B 1WAMA 3AOEC 4LRSB 1B3RA 1BWSA 4OL9A 3JV7A 3RJ9A 5JFOA 1E3LA 5L4NA 3W1VA 1BXKA 4PLCA 2GLXA 3OECA 3I9LA 5IXYA 2QYTA 2GN9A 3DZJA 3VH1A 2BFPA 3NAQA 4IM7A 1X0XA 1I0ZA 1DJNA 1WMAA 3KLMX 5TRTA 4R9SA 2Q3EA 2B69A 3G0OA 1H6BA 3B6ZA 2JD1A 5F1OA 1ZJZA 3ITKA 3JQBA 5I9MA 2Y99A 3RAJA 3ZN2A 4NBTA 3JD3A 4R5HA 4XYMA 1GD1O 1G1AA 2X86A 1TLTA 3GGPA 3Q11A 2UUOA 1T25A 2FY8A 3GUYA 3ZV4A 3E18A 1YBVA 4CM9A 1YL6A 4BVAA 5ER6A 2B0JA 4II3A 2QQ5A 4CM9D 5G4KA 1MLDA 1UXHA 5JC8A 4Q3AA 1GQYA 4RQUA 3WQSB 5DOZA 4OXNA 4XIJA 4NR0A 3HFGA 4GI2A 1OMOA 4PN3A 1AHHA 2XXBA 2OZPA 3ITDA 4Y67A 5ES3A 4EJ6A 1X7HA 3G3EA 3Q0EA 1CDOA 3ULKA 3WJAA 1VC2A 5G4LA 1BMDA 1GV0A 4AJ1A 3IOYA 3DAFA 4F6LA 3L4BC 4YQZA 3VH4A 4KQXA 4ZQBA 4E3ZA 5L9AA 2ET6A 1ZSNA 4ALLA 5EN4A 2LDXA 1PJTA 1D8AA 2XAAA 3PFWO 4IDBA 3N58A 2IEDA 5FWNA 5COBA 3KEOA 4JIGA 4NQZA 3WWYA 1P1RA 4HFJA 2Q1UA 5JDIA 4ZQEA 3TZHA 4UVEA 3TZQA 1ZIDA 5K6AA 5TQVA 4J3FA 1FDWA 3WFIA 3QWAA 3Q6IA 2Y66A 1O9BA 2J5QA 3ZW8A 4RLSA 4TVBA 5LDGA 2Y0EA 5JAQA 2A94A 1C1DA 1ORRA 1PJLA 3I6QA 4BGIA 2X4GA 3PHLA 3VPSA 1U9JA 2I65A 4KDFA 5KVVA 4GQAA 4A73A 1G6KA 4R5MA 2CY0A 3V1TC 3NDJA 1ADCA 4YYZA 3KSUA 4PVDA 4YAJA 3O4RA 5FF9A 4DQVA 4ZRMA 5F21A 2GYYA 3PDJA 1Y5MA 4OYRA 4PLWA 1P33A 2VUSA 4CLDA 2FP4A 4JQCA 2GCGA 2QG4A 4QO8A 1YQGA 4I5FA 4OGWA 1A7AA 3JCZA 2HAEA 1CJCA 4A27A 4XQCA 2D4AA 5A02A 4Q3DA 1VJ1A 5KCZA 4XGKA 3E1KA 5L3ZA 4K9DA 4WNIA 1C3VA 1R12A 1OI7A 2FPIA 4AVYA 4IZHA 5AXAA 4AG3A 3X2EA 1UZMA 2BLLA 2CVZA 3WLFA 3AY7A 4H15A 2NTVA 1ENZA 3A4VA 3GAFA 3KTDA 1LU9A 3H9JA 1AE1A 3GGGA 2WSBA 2HUNA 4J4TA 3COSA 4IXTA 1B7GO 4BQRA 1VJTA 5KNLA 5KJ1A 3FCOA 4FR5A 1PZFA 1JKFA 4WASA 4M87A 4OAQA 4WCFC 1RJWA 2AE1A 1NAHA 1M6WA 2H6EA 1C14A 2R6JA 3IP1A 4I9NA 1YDWA 4R1SA 2DAPA 3BIOA 1M75A 3CEAA 2GD1O 4UVHA 4TZTA 3VVBA 1LQUA 1EZ4A 2UDPA 4H3VA 1D1SA 3GMDA 1JA9A 4UUPA 1YJQA 3DC2A 4CM6A 4G5HA 4EI2A 3U3XA 2AQ8A 1O0SA 3RKRA 1E7WA 4JXKA 1SPXA 4GLLA 4DBVO 3MJ4A 1O89A 3WQQA 2B37A 4Q3CA 1LI4A 1GDHA 1NM5A 3OQ6A 4FD3A 4WLFA 3ZDFA 5JNLA 3PPIA 2Q2WA 3JQFC 2WD7A 2VHWA 3OETA 3ROKA 1A71A 4FQ8A 4ZN6A 1F14A 5G0UA 1U2GA 3EMKA 4R1UA 1XG5A 4GX0A 3F46A 4WEQA 3R1IA 4PRKA 7ADHA 2VT2A 4Q3BA 4CJXA 2D8AA 3KHUA 2PD6A 2PGLA 1BSVA 3H5AA 4CMCA 1ISMA 3RUCA 4LN1A 2PK3A 1Q0LA 3ZWMA 1G0OA 3GLQA 4J90A 1MC4A 3VDRA 2XPCA 4DLBA 3FNFA 3WMWA 3MJTA 1K2WA 5A3VA 1JWBB 1XYGA 3D3EA 4OKIA 3C1OA 1IB6A 4XR9A 1LLCA 2OHXA 3WQRA 2E82A 3ETGA 1EQUA 2GPTA 3P2YA 3DONA 1X15A 1MG5A 2H5LA 3GG9A 3WGOA 1DC5A 3RC9A 5C7OO 1YO6A 3DFUA 3GHYA 1ZJYA 2AEJA 1X1EA 3F5QA 1X1TA 3ZCXA 2BH9A 1KEUA 4AJNA 3W8EA 5I7EA 2YFQA 2ZQZA 4K26A 3NRCA 1P44A 5IFLA 3UW3A 2HK7A 3HDYA 1PL7A 4YJHA 1L7EA 3PVZA 2CUKA 2C2XA 3D1LA 4INAA 3HN7A 4E2YA 5A9RA 4YA6A 4NNJA 4RGBA 1VSVA 3DBHB 1CIVA 4NFYA 1U3WA 3AUAA 1YBMA 1Z7EA 3VDQA 1LDNA 3KZVA 3T7EA 2P9CA 4LRTB 1FK8A 5L53A 1E3IA 1MXFA 3GN2A 1NHGA 1MA0A 4BO9A 1VM6A 2O23A 4PRLA 3F47A 4DPKA 1PSDA 3C85A 3AU9A 3OQ1A 5BNTA 2Q49A 4NI5A 3SX2A 4QSMA 1HDZA 4RVSA 4EUFA 4YR9A 1N92A 4H7PA 3DMTA 4BOYA 2HU2A 2JD0A 4KUEA 1I36A 4UUNA 3D64A 2J5KA 5B1YA 2W2KB 4IMRA 1NFRA 2C5EA 2ZKLA 1LDEA 2AW5A 2EW8A 2CVQA 3ASUA 4QECA 1DFGA 3K92A 5CDTA 4E5PA 4Y6RA 4DBZA 4FFLA 3DAGA 4ILKA 2Y1EA 1XA0A 3KRTA 3ZI0A 4CLOA 3EVNA 1YOVA 4NBUA 3WYBA 1UDCA 4YJHB 1I2CA 5CHEA 4ZHSA 3ZH2A 4B4UA 2AG8A 1PX0A 3QVTA 1NASA 3ROPA 1PS8A 2P91A 1DC3A 3QWIA 3ZNPA 1U3UA 2FZWA 1ZFNA 2FWMX 1T26A 3NTQA 2ZYDA 3I9KA 1MP0A 1ENOA 1LSJA 1BXZA 1B8UA 1ISFA 1BXGB 4OM8A 3GHHA 1Z6ZA 4QXMA 1U2DA 4HP8A 3TRIA 4OIMA 4EBFA 4A7PA 3JD4A 3A9WA 5GY7A 1SMKA 2OP1A 5CDSA 3B1JA 4UAGA 2BELA 2AG5A 3OH8A 4M1QA 4W9NC 1WMBA 3C8MA 1LDGA 1DC4A 3CZMA 1P1IA 3JYNA 4E2ZA 4UVIA 5CDUA 2AMFA 3K5PA 2Y67A 4PFJA 2YY7A 4K1LA 4KDEA 2ZB3A 2OUIA 4CM3A 5BSGA 3NX4A 3RKUA 2JCXA 2YQ5A 3RU7A 1SCUA 3U49A 3JYLA 1E6WA 4CLOB 5JLAA 4TQGA 4CMKA 1YOVB 1LX6A 4DLAA 4BKQA 4D44A 4O6VA 2PV7A 4NU5A 5CDGA 3JQ9C 3U0BA 5KOIA 3DZIA 4WPGA 3QQPA 2QX7A 1SB8A 1SO8A 2G5CA 2PZKA 5IDXA 3V5NA 3OSUA 4R41A 1C0PA 4CODB 4L73A 2Y05A 4GWKA 4LK3A 1YQXA 5JE8A 5A5EA 4ND3A 1Y8QB 5BSFA 3VH3A 3F4BA 1JDJA 2GN6A 3MJSA 4S3MA 4EDFA 1IPFA 1Q0QA 1DHRA 2QYSA 2EP7A 5ENVA 5A1TA 1ULSA 2OFPA 5G0TA 4WECA 4DIFA 1K89A 3HSKA 4XJSA 3JQGA 4PG4A 3MTGA 2B36A 2C29D 4FN4A 2DKNA 4ND2A 4IGFA 1B14A 2HDHA 4KWHA 2VCYA 2A4KA 4YRAA 4ALJA 4B3JA 2IRWA 4BNJA 3DZGA 3LT2A 1E7MA 5JO0A 4XDZA 4M54A 1WWKA 3TDKA 1HZJA 1PQPA 4WK6A 2D3TA 1WW8A 1GAEO 2BHLA 5JC1A 1HDOA 4FFMA 4EGFA 5I9LA 3IMFA 5B4VA 2WYUA 5CEJA 4RF4A 3PJDA 5KVSA 3E9QA 4I08A 4BNZA 2JFFA 1YXMA 1GADO 1DIHA 4JJIA 1DRUA 4PGFA 2J3HA 2NACA 3WTCA 1T4BA 1WXDA 3AUTA 1E5QA 1ONPA 1QMGA 1V0JA 4I5EA 2OL4A 4BO2A 1P1FA 1UP6A 1FDTA 3TZCA 3RUAA 4DREA 4LSWA 1AN9A 4YT2A 4FJ1A 1B8VA 1ZKMA 1IYZA 3DHYA 5T57A 3NTRA 5THKA 6ADHA 4JJGA 4YEDA 3OP4A 3UAGA 3D3WA 2P4HX 3AOGA 3O8QA 4R16A 2YHUA 1B8PA 3R3JA 4R69A 4UREA 4A5OA 3OHSX 4YBZA 3I5MA 4N18A 3ZV3A 2B35A 2OBNA 1I24A 4J4HA 1QYXA 4GGOA 4IY1A 3H9UA 1N1EA 2GZ1A 4BNYA 2HMTA 1I5RA 2O7QA 1DEHA 3WS7A 4CLRB 4DUPA 1RM5A 1HDRA 1XQ1A 3GOHA 4IDAA 3DTTA 3U4IA 3DAPA 1R0SA 2C2YA 4M89A 4AJOA 1VSUA 1L7DA 3W6ZA 2PTGA 1XELA 5KIAA 1A4UA 4AFNA 4R01A 1X14A 2O2SA 1VLLA 5IJZA 3C7DB 3CMCO 3BZUA 4IJKA 2AEMA 1NVMB 1RYDA 1BVRA 4ALNA 4NJOA 3CH6A 1D3AA 3FTPA 1VJ0A 2BFOA 3V1UA 1DC6A 1HSZA 3OICA 4XQEA 4Z0PA 2AQKA 3RUFA 1HLDA 4D7AA 9LDTA 2CDAA 4OHUA 4FGWA 1QV7A 5IZ4A 1LXCA 3GZNA 1GZ6A 4ZVVA 4CLEA 4W99A 2HO5A 4HKTA 1UXIA 2HLPA 1W0CA 4DA9A 1PJ3A 1HL3A 1ADFA 2CD9A 4EZBA 1EUDA 4D3SA 3PP8A 3D3WB 4EW6A 1PQWA 1V3TA 4PLGA 5A03A 1QV6A 2NV6A 3ANMA 1ID1A 3VPFA 4L4RA 1DLJA 1ZK2A 4IPTA 4CPDA 4NBWA 2O3TA 4Y6SA 4IZIA 3U4DA 2R2GA 2VHYA 4JJFA 1DIGA 3JQ8A 4W7IA 3UICA 2EF1A 4YAGA 2HRZA 3W4JA 2O48X 3Q3CA 3IP3A 3QW2A 8LDHA 3ONFA 4GVXA 1OOEA 3W8DA 5U4QA 1LC0A 4I8XA 4QX6A 2CF6A 1E1KA 4UEKA 1LLUA 4UEJA 3UH1A 2VZ9A 1K6XA 5IZCA 2CSUA 2I3AA 3WXBA 3ADPA 4TKMA 4NHEA 5I8WA 1XQ6A 2R00A 1I33A 3GNTA 1WPQA 1V3UA 3B1KA 3BAZA 3ZWCA 2JHGA 3ZNOA 3S2EA 1ZVMA 3KETA 4XEHA 1RKXA 3PGXA 2HJRA 5C7LO 1ML3A 5DCUA 3IJRA 1DJQA 1ONNA 5IDWA 3DBLB 4DQUA 3PJFA 4RORA 1HTBA 1NR1A 1OC2A 4IDFA 1BDBA 1EQ2A 3PRJA 3QLJA 4FSHA 2BFAA 4XB1A 3RFVA 1NWHA 4PLTA 1MG0A 2O3QA 3RUEA 4R54A 1YKFA 3OMLA 3ROQA 4I5DA 1OC4A 4BV9A 2V65A 3W4IA 4ZICA 2WD8A 4OOFA 4IUYA 5DT9A 4BNUA 5JS6A 1TT5A 3E8XA 3WGTA 2J3KA 2NQ8A 2JCVA 4N54A 3OJOA 1AUPA 1GV1A 5TX7A 3AI2A 4N5NA 3PZRA 2DBVO 1RWBA 2PLAA 2YYYA 4PG6A 1H9BA 3GVIA 2DUUA 1I2ZA 4XB2A 3I1JA 1KVSA 1N8KA 3GEDA 3I4FA 3DZKA 5IAAA 5L45A 4XKJA 3L6OO 3NT4A 5DBIA 3V8BA 2QW8A 4EEZA 2G0TA 3GFGA 1ZK4A 8ADHA 1IULA 3JQCA 4OXKA 1EK5A 1GQ2A 3DB2A 3LK7A 2VYVD 1T2DA 4DPLA 3K2EA 4ITUA 2A35A 1BHSA 3FPCA 2P9EA 4PLPA 4FPXA 1ZEMA 2PR2A 2G82A 3H6KA 3I9NA 3CKYA 3OJLA 3WSVA 1H93A 1Q0HA 4GLOA 1WNTA 5TT0A 1NYTA 4BO1A 5A9SB 1QXSA 4LVCA 4U0KA 4BO8A 1BGVA 4B3HA 2VZ0A 3NT2A 1H6CA 1BRMA 4L4XA 3HHPA 4CUJA 2X9GA 5EQFA 2EGGA 2A9FA 4D43A 5KTKA 4GKVA 2B83A 1M66A 4WLEA 2VWGA 4WLVA 5AXCA 4WCDA 2P5UA 2JAHA 5T64A 1YL5A 4FC6A 4GSKA 3HDQA 2EP5A 5F3RA 1NFQA 4S1VA 4J4BA 3IAHA 4CMEC 1P3DA 2WMDA 3UN1A 2YDXA 3K2BA 1VKOA 5FEUA 4CV0A 1HSOA 1VRWA 4QTZA 2IXBA 4MIOA 4TWRA 4WKGA 2X0NA 3CPSA 1LSOA 3ETEA 4C7JA 5A3JA 1Y9EA 1DO8A 4W7HA 4A03A 3VTFA 2EKQA 5EMHA 1EVJA 3IKVA 5FFFA 1KVQA 2CF5A 5JCJA 5DF1A 4NBRA 5JCJD 4MP8A 3OFSA 1JWAB 1N7HA 1SEVA 2SCUA 5EPOA 5A9TA 4U6SA 3K6JA 3LVFO 4J0FA 1NVTA 2VRCA 4AL4A 1RPNA 2B4RO 2BKAA 2VRCD 3LSYA 4XX0A 3LU1A 5T5QA 4HADA 1P9LA 4MIEA 2CDBA 3UKOA 3EYWA 3OA2A 4Y6PA 1LRJA 1W73A 4KUHA 1HE5A 1LA2A 3WR5A 4CMBA 3FR7A 2I3GA 4CQMA 5EJ2A 4UVGA 2I99A 3LF1A 2RH4A 4WLUA 5CEFA 4CQMD 4DC1A 4CL3A 4CMIA 4CR6A 4YAEA 3ST7A 3E5MA 1GUFA 3WBBA 3VC7A 3D7LA 1T4DA 3QWHA 4D0RA 1LSSA 2ZCUA 3JQBC 4QEDA 4JX8A 3MJEA 1MFZA 2Y0DA 4PVCA 3EDMA 3MCVA 4IJVA 3GF4A 3LC7O 4RVHA 1PJCA 3SC6A 1K6JA 3C7AA 1Z45A 1DRWA 4GX2A 2Y93A 4MVJA 4O59O 2VOJA 3E03A 3F9IA 4MVJD 4TRMA 1ISIA 1WDLA 2OBYA 2X9NA 2ZTUA 3AJRA 3G1UA 3GEGA 3PLRA 3GDGA 1P1JA 3AU8A 3OBBA 1FF9A 1I10A 3S8MA 1W8DA 3L4SO 4M49A 4MKXA 1SNYA 1PS9A 1MGOA 1N9GB 4OH1A 3JQ6A 3H8VA 3AW9A 3OM9A 3EZLA 1EMDA 1O94A 1EEHA 4LCEA 5B12A 3ROMA 3BMCB 3ZZNA 3EC7A 1YB4A 3P7MA 4XZ3A 3UVEA 4Q9NA 1E3EA 3RASA 2FPPA 4JNKA 3WOHA 1ADGA 1LNQA 2GSDA 2Q1TA 3L07A 4J16A 3I9MA 1K3TA 4YJDA 4O1MA 1MFPA 3WJ7A 5ICMA 3EW7A 1PGNA 4CQMB 3PFFA 2C0CA 1M2WA 4JBHA 1OBFO 2WDZA 4CMIB 3CUKA 4E12A 3KVOA 2DLDA 3ZWWA 5K6AC 2VUUA 4NZ9A 1P31A 3FN4A 2BRUA 1VL0A 5J23A 1FDVA 2IZ0A 3KSZO 2X7HA 2FR0A 2FPGA 1UAYA 4GVLA 4E21A 3UHAA 3HADA 3IL2A 1EVYA 4XR4A 2X5OA 1YB5A 4H16A 1JVSA 2NWQA 3L9XA 2EGHA 3B1FA 2HJSA 3KEQA 4LISA 4BL5A 5L7YA 4RO0A 4C7KA 3B70A 1GR0A 5GZ6A 2CZCA 3T4XA 1QKIA 3MWEB 3WFJA 4E30A 4RLHA 3KBOA 4XQGA 4OXYA 2JKVA 4RPLA 5JDCA 3S2FA 4KOAA 1ENPA 2VOEA 5H81A 3TSCA 3I4CA 2Q99A 4ZQHA 2OXIA 2NM0A 3RC1A 4GWGA 3PQDA 3ZWOA 3Q9NA 4DLLA 4BIIA 1PZEA 4DMLA 1GTMA 3RBXA 4LMRA 3UCEA 1JKJA 4IIVA 1I3MA 3ONDA 4NBVA 4MINA 1HXHA 2EIHA 3DBHA 2HMSA 3ADOA 1KC3A 4GH5A 2NVUB 1IUKA 1WDKA 3P19A 3EZYA 4J49A 1JTVA 2G1UA 2E4AA 4WCFB 4DXHA 4IBOA 2HMWA 3RBZA 2DPGA 2VNSA 1MB4A 1ZXLA 3JD0A 4C4OA 2VTEA 4EITA 3IIEA 3VZPA 1T24A 3JSAA 2HK8A 3IS3A 5EQDA 4U0JA 5ITVA 3U9LA 1EVZA 4BNKA 1N5DA 2HMUA 3ZNQA 2DVMA 1DDOA 2YJZA 5T6BA 4PG7A 2VTDA 5BNFA 3CMMA 4FFNA 2OORA 4E2WA 2IZ1A 1IE3A 3GNQA 1GEGA 3QY9A 4TVOA 4NMHA 5B4UA 2W2KA 2Q45A 4FS3A 4ROSA 1EVIA 1UAGA 4N7RA 1E3WA 4E4YA 1LDBA 3LC1O 1U8XX 4IS2A 3OJFA 4IQ8A 1P45A 4BO6A 2I5PO 2EHDA 4WUVA 3GGOA 4DMMA 5BSHA 3NDRA 4UULA 9LDBA 4K6CA 4BO0A 4R3NA 1VKNA 4YTEA 1I30A 3JYOA 4AJPA 1M76A 3VVCA 3W8FA 3TQHA 1QR6A 2H9IA 2Q50A 4UUOA 4R3WA 2YW9A 5DBFA 3T7CA 4BQPA 3RSHA 4HY3A 1Z7BA 3CXRA 1YGYA 3ZU2A 2CDCA 3UCXA 3ZW9A 1XLTA 3PYLA 2X23A 1GYPA 1BXGA 1CERA 3PGJA 2RBEA 1RM4A 3W6UA 1HDXA 1KBZA 3AFNA 1Q7GA 1F0YA 5KKCA 1UXJA 2WE8A 3BMOB 4MPDA 4AJIA 3K96A 4RPJA 3GPIA 2NVWA 3PJGA 3PHJA 2GN4A 2UYYA 4BNHA 2OOSA 4BNWA 2DBZA 3PIIA 3PHGA 2FZEA 5L7TA 2WE7A 4Z0HO 1E3WB 4J1NA 4YT4A 4FC7A 3VH2A 4J2HA 5DBGA 3QVXA 3TL2A 2JAPA 3VPHA 2ILTA 4BNLA 3MWDB 4FFPA 1KC1A 1O95A 4NDNE 5EL0A 1I01A 3WGQA 2VHVA 1R0LA 1R4MB 4NPCA 2EJWA 5HWSA 4J7XA 2TMDA 3AY3A 1MX3A 4B8ZA 2AHRA 3WMXA 3MJCA 3DZBA 5B4TA 3LT4A 4IIUA 4RVDA 1J6UA 4XGNA 2Q2QA 4CL8A 3K31A 1NAIA 3AK4A 4W9NA 3O9ZA 1Y8QA 1ISJA 2E48A 3QWFA 1AXGA 1EE9A 5L4SA 1D1TA 3ZU5A 3UCFA 4RDHA 4RCVA 1JVBA 3RC2A 3TZ6A 4TRRA 3IJPA 5A06A 3HWRA 1NVGA 2PH3A 1S6YA 3DMTC 3O26A 3LLSA 3PI7A 3IC5A 5ENDA 2IE0A 4OQYA 1UXKA 5JPIA 1YBAA 2Y1CA 1LC3A 4JBGA 2GRAA 1PS0A 3RIHA 1E7QA 1U1IA 3R0IA 3V1YA 5JY1A 2UV8A 3NJ4A 3AFMA 4IMPA 1B26A 1E92A 1ZEJA 2AE2A 1XHLA 4U7WA 2EWMA 3WWZA 2HSDA 3PQEA 4K28A 2J3JA 5CG1A 4XQ9A 5AXDA 3EUWA 2RIRA 1KEVA 1UR5A 1B2LA 1LDMA 1UP4A 2QHXA 3AM3A 1XGKA 4FB5A 4EJMA 2BMAA 2FSVA 1U4OA 1T1SA 4OJNA 1X13A 3RJ5A 3HJAA 1F8GA 1DBVO 5ILOA 4RF5A 3WG9A 4U5QA 1A72A 1YQDA 1DXYA 3PIDA 1NPDA 4DC0A 3JQAB 5CDYA 3PLNA 2FN7A 4A10A 4QO7A 3FHLA 3WYCA 4O5OA 4CM4B 1PJSA 2CNBA 4L0QA 1EBFA 4MDHA 1AHIA 1L1FA 4JCOA 3IQDB 3MOIA 4NFHA 2I6TA 3GRKA 3VTZA 3ZHYA 2NNLD 3HDJA 3RUDA 4GAEA 3D4OA 3H5NA 1E7RA 1FDSA 4RF2A 4XGIA 4WLNA 1PZGA 1R0KA 3WGZA 4BMSA 3RC7A 4ALIA 2X6TA 4LGVA 4CLRA 4YJGA 3C3XA 4P4NA 2BD0A 1K6IA 5I7SA 3UF0A 2V6GA 3JQDA 4A2CA 5IF3A 1ADBA 3ZWBA 3VKUA 1ZO8A 4KMSA 2NU6A 1P74A 1O5IA 1Z75A 4ID9A 4F46A 1M67A 1XEAA 3QIVA 3EHEA 4R9RA 1DFHA 1PGOA 5KJFA 3GR6A 1U5CA 3O38A 2HKIA 3HDHA 5DP2A 3VPXA 5JMWA 3GVPA 1W6UA 1NBOA 2GF2A 3ETDA 2EJVA 3W4KA 4Q3EA 1UUFA 3OIFA 4R51A 2DC1A 3DMYA 4E0BA 2DBRA 2P68A 3BYZA 4OMUA 2B5WA 4ALMA 2I76A 1O6ZA 4B79A 4PIVA 4A26A 3RUIA 1ZNQO 3N7UA 1B0AA 1UXGA 3ZU4A 5JCXA 3HFSA 3B20A 1Y8RB 1SBYA 5JAZA 4TSKA 2QZ9A 2EW2A 2NU7A 5C5IA 1U3TA 2VWPA 2FOIA 2WWRA 3AM5A 2EG9A 4YQYA 3KYBA 3UOGA 2UAGA 4LW8A 3RBVA 2FR8A 4OOEA 1ONOA 1KERA 4EYEA 5ITWA 4E31A 4YJGB 2ZB4A 3H2ZA 4KQWA 4CV3A 3NGXA 4ALKA 1XIVA 5CAEA 3ICPA 3FNHA 3ZHZA 2E37A 2BGMA 2UVDA 4QFCA 3RFXA 2Y1GA 3ZU3A 2VNAA 2W98A 3PTZA 3VPGA 3SEFA 2VHZA 1RYEA 3TZKA 1ZMTA 4XD2A 2I67A 4FOOA 2IEBA 3CZRA 3ZWVA 5F1KA 2O4CA 1IZ0A 4TRJA 4RV9A 3DR3A 4QT0A 3DWFA 3DBLA 1Y81A 4DGSA 3DQPA 1JU9A 1XWFA 1MXHA 5TNXA 3BTVA 2EV9A 4BB6A 1YB1A 4BNVA 3WDSA 3Q2IA 1C1XA 4HV4A 1GZ3A 2B5VA 1B16A 2YV3A 1Y1PA 2J6IA 3ZNNA 3KYCA 3HZZA 3SLGA 2I9PA 2IDZA 2NLOA 2BGKA 4DRYA 1HKUA 1DFIA 1CWUA 1G0NA 3E5RA 5TS3A 4EUHA 1PR9A 2C82A 2ZB7A 3DBRA 2Q4BA 5EIOA 4GX5A 1YS4A 1KIFA 1TVEA 5H82A 4MVJP 1NQOA 1PWZA 1GZ4A 4UEOA 4PLHA 3D0OA 4BNGA 4OO3A 4XIYA 1P0FA 4J9VA 3E9MA 2DU8A 3IKTA 4YAKA 3QA9A 3KO8A 4HWKA 5DCYA 3LZ6A 1WVGA 1KY4A 4L9RA 3ZV6A 4BNMA 3FWNA 1P77A 1IOLA 3TPCA 1SOWA 4YJFA 3WNQA 1EUCA 3F6YA 1AXEA 3QVOA 1IL0A 3FNEA 4J1TA 2P9GA 4RVGA 3G79A 3DL2A 4J43A 1NXQA 5F5LA 5A9SA 3ENKA 1PU2A 2C59A 4Z9YA 4Z9FA 2BI7A 3GDFA 4CMHA 3ON5A 2YV2A 2CMDA 1C1XB 5T8KC 4IS3A 1SB9A 4P4GA 3F3SA 4B4VA 1VE9A 4E13A 4XWYA 4R1NA 4D42A 3KYCB 2DUWA 3E82A 3PWZA 1WLYA 4EUEA 3RWBA 4ZJUA 1XU7A 1XDWA 1CQJA 3NV9A 1E5LA 2GGSA 2J3IA 2VT3A 2WM3A 4CQLB 2X5KO 2O4UX 3DBRB 2XOXA 4CM1A 3I23A 4FFRA 2JHFA 3LF2A 3SXPA 3U09A 3WTBA 3ASVA 3JQ7B 2FRDA 2GERA 2OMEA 2X8LA 1GQQA 2F00A 2NU8A 1W4ZA 2DTDA 4NJMA 4DPMA 3WGHA 4WOKA 1HDYA 2VYVA 4R68A 3E9NA 3INGA 1T2AA 2BGLA 4YAIA 1U8FO 5GZ1A 1SC6A 4P22A 3K30A 5LCXA 4CUZA 3L6DA 3H9QA 2B4QA 4YJFB 5ER9A 1H5QA 5AXBA 3S1LA 4DYDA 2PWZA 4Q3NA 2W8ZA 2PGJA 3AOEA 1HDCA 2GN8A 2YDYA 3NEPX 3PQFA 4E2XA 4RVUA 3M1AA 1LDYA 3T4EA 5IDYA 1H0KA 2ZB8A 1PJ4A 4IGEA 2YV1A 2PZMA 2C20A 4G2NA 3AUSA 4FOSA 3KXDA 3Q2KA 3H3JA 3OIDA 2VN8A 4AJKA 5G0VA 3WBFA 2Z95A 3DZFA 3V2GA 3GT0A 3KYDB 3AUUA 4BO4A 3FNGA 3H5RA 1NFFA 5JBIA 1KEWA 3L0DA 4BKOA 1R4NA 4F45A 3ZWYA 3K9QO 3QP9A 2DBQA 4O63O 4UVDA 1PL8A 5IXSA 5MGBA 1KYQA 3G1TA 2C7VA 5JMPA 3TOXA 2X58A 7MDHA 2V7PA 2W90A 2C5AA 3DOOA 3F4LA 3FWZA 1EDOA 4BKUA 5A04A 4WNCA 3VOSA 1SEPA 4NJMB 2PY6A 3V2UA 1NQAO 1Y9AA 4GSLA 2VUTA 4LMPA 1N7GA 1ISHA 2D1YA 4LVUA 5TLSA 2JFHA 3AM4A 5I9NA 5AQ1A 1IHYA 5EERA 2IODA 3Q1LA 4Z9XA 2Q46A 3BMQB 4BMVA 3PK0A 5U1PA 3L4BA 4BNXA 5TSDA 5C3MA 1A9ZA 4Y8VA 1N9GA 4XYLA 1DIAA 1D7OA 4BNNA 3GVHA 3BHIA 2JJYA 4D46A 2Q1SA 4MO2A 3UUWA 3BMCA 3OJEA 4IDDA 2QRJA 5L40A 3CE6A 1QP8A 1X0VA 3QWBA 4L74A 4IDGA 5L4LA 4GMFA 2D0IA 4Q39A 1HZZA 5F5NA 5HA5A 4OKNA 4AJJA 1NQ5A 3QVWA 4NH4A 1NX6A 4B3IA 1R4NB 3QVSA 2HQ1A 1XCBA 4M55A 4BHTA 3RVDA 4XYBA 3U62A 3RFTA 1M6HA 4FFOA 3KM0A 3FPLA 5LDHA 3WGIA 1KS9A 1LTHR 4E5YA 4ZQGA 3I83A 3GFBA 2TMGA 1QSGA 5CG2A 3HNPA 4MVJM 3SLKA 1FXSA 1Z82A 2V6BA 1EUZA 2VHXA 4MVJH 1OZAA 4XRRA 1GCUA 1X7GA 1GFSA 4ZGWA 1E1MA 3CINA 4D3FA 3KOUA 3ONEA 1XSEA 1V3VA 5F1PA 4GKBA 2QZZA 2RHRA 1NQTA 3BMNA 2GO1A 1J5PA 3GZ4A 3V2HA 1ZSYA 3AWDA 5COAA 1J4AA 3DO5A 1PJQA 5JW6A 3I52A 2J8ZA 3A14A 1LLQA 2FSSA 2QRKA 1XU9A 1Z74A 2WTBA 4B4OA 4RPGA 2Y0CA 1BW9A 4MKZA 3TWOA 4YACA 2AEFA 4GBJA 1LQTA 4GMGA 2HK9A 2G17A 1ZMOA 5HTOA 5L7WA 1N1GA 2B4TO 4YT8A 3AY6A 4L4SA 1A7KA 2V6MA 1FJHA 1H6AA 2EEZA 4PG5A 5G4KB 1TI7A 2NVUA 3PJEA 1JAXA 3NKLA 2DTXA 4IQGA 5JDIC 5K0ZA 5JY6A 4NFSA 1EFKA 4CLHA 3VZSA 2DQ4A 1HT0A 2D5CA 4WCFA 5DCWA 5KWEA 4XYGA 2D5AA 5ADHA 2G76A 3PZBA 3MTJA 2H1SA 3H7AA 4NG5A 1GUZA 4JK3A 3ZWAA 2P2SA 1SAYA 2ZJ0A 1YRLA 4XYEA 1E1NA 5BQFA 5I7VA 1EBUA 1CRWG 2X9VA 1U28A 1A9YA 2Z1NA 1GEEA 1EDZA 4IQ0A 1K0UA 4F6CA 4NK4A 3A06A 3TNLA 2ZQYA 5KJ6A 4HNGA 1BTOA 1S7CA 2AQIA 3RCBA 1QYWA 3BMNB 3PHHA 4E33A 3JQFA 3K8ZA 1J0XO 2NQTA 3U4CA 1Q7CA 3SJUA 1BG6A 3I9JA 4IINA 4RZIA 3ABIA 5C37A 1PTJA 1BW9B 3RROA 4QQRA 4RPKA 3TL3A 2Z1MA 1C1DB 1HYEA 1TA4A 4BNFA 2VYNA 4DIOA 3FR8A 4HX5A 1FDUA 4TKLA 4J91A 1E7YA 2VYND 1V35A 6LDHA 4MVJI 5THQA 3WB9A 4AICA 4E5NA 3QV1A 1VL6A 3JYPA 3JQEA 2A92A 1QYCA 5AOVA 3GMSA 4IXWA 4RPHA 2YZ7A 1LBEA 3IUPA 5CPFA 3LQFA 1XKQA 3CSDA 3ZWPA 1HDGO 3C7CB 2ZYAA 4WLOA 1DIRA 5IG2A 5K9ZA 1Y7TA 3WICA 4B7CA 1R16A 5TJHA 3BMOA 2XF8A 1VI2A 2RAFA 2PFGA 5JDCC 4CMAA 3PYXA 3LT1A 3WGGA 2P5YA 4QUKA 2WYVA 3D4NA 4A0SA 1P0CA 1GPDG 1UZNA 3ZGYA 3QSGA 4YRBA 1WP4A 1XR3A 1LJ8A 4DYVA 1NWCA 1ARZA 2IZZA 1QG6A 2E6UX 1PEDA 5G2OA 5FI3A 3VZRA 3DHNA 3H4VA 1QRRA 2QRLA 3OQBA 4PLZA 3QRWA 5CP8A 1HE4A 2VRBA 4AJHA 5U9CA 3LYLA 1KEPA 1R4MA 3GRPA 4B7UA 3MEQA 4Z3DA 2PH5A 1C0KA 3INRA 4FBGA 1ZBQA 4D3DA 2PD4A 1DRVA 3PWSA 2BI8A 2CVOA 4PZCA 3RI3A 2ZATA 1LSUA 2JL1A 4P8RA 4YB8A 4J7UA 2PZLA 4D41A 4CR8A 4LSMA 1EK6A 2X0JA 1BVUA 3STHA 1WZEA 1P1HA 3NJ8A 4I9HA 2PA3A 4XA8A 4KZPA 1DAPA 4FDAA 2ZTLA 3VKVA 3HG7A 3NYWA 3O03A 4RVFA 5TJ9A 3UXYA 1JN0A 2V6FA 2XXJA 4E5MA 4CM5A 1JAYA 3KUXA 1KOLA 2YFHA 1ZK3A 3OEWA 5AYVA 4Y98A 3S2GA 3M6IA 1R66A 2VWHA 3HUDA 5H83A 3GK3A 1YONA 3BTSA 1B15A 1NR7A 1U5AA 1Z73A 3X2FA 3TF5A 4L76A 3P5SA 5CPBA 1MUUA 2WD7B 1FMCA 3PYMA 1T2FA 4MP6A 1TT7A 1RM0A 4BNTA 5JAIA 1V8BA 4JN6B 4JP2A 1HRDA 3IUSA 3R3SA 3GG2A 1AGNA 1KVUA 4J1SA 4DL9A 4BO7A 5HRUA 1IPEA 4M8SA 5G0SA 3A1NA 4R1TA 1ISGA 1IZ9A 1A27A 1DAOA 5FI5A 1EFLA 1P1KA 4WE3A 1PWXA 1H2HA 1VL8A 1GUYA 4G81A 4PLYA 4PZEA 2POQX 3ORFA 1CETA 5TIIA 4KP7A 2GASA 4BO3A 1CYDA 4YT5A 4MKRA 4Z0TA 3ZV5A 4XRGA 5JSFA 2DFVA 1BDMA 1UZLA 2HRBA 4MIYA 5FYDA 2GZ2A 1T2CA 4TROA 3D5QA 4B8WA 1Q2XA 4OSOA 2GR9A 4CLXA 3GNSA 3JQAA 2VWQA 2O3UA 2ZJ1A 5DN9A 1KETA 3KV3O 4TRNA 2BFMA 3JQAD 3OF2A 4CM4A 4DQXA 4L8VA 5HS4A 3PWKA 4GPD1 4ONEA 4BKPA 1I32A 1E0DA 1PZHA 2PKRA 5BNIA 1F12A 4TMFA 1CQIA 4ZRNA 1I2BA 1LRKA 4JGBA 1PGJA 2OP0A 1F8FA 4EEXA 2PKQO 3ANNA 1V9LA 2YUTA 3QE3A 4Y9DA 3NT5A 3PHIA 2WJPA 5GZ3A 3M2TA 1UDBA 2OGUA 3JQ9A 3VZQA 3GVCA 3G49A 4ND4A 4BS9A 2NADA 3S55A 3OEYA 3KSDO 2RCYA 1NP3A 1Q1NA 2E49A 2O3SA 4J6FA 4YCAA 4CUKA 1E7SA 3BTOA 1ZK0A 1U3VA 2AXQA 1NTOA 5AVOA 1ZSVA 3FI9A 1HEUA 2AA3A 1LEHA 3PXXA 4AJLA 1JKIA 1UH5A 5GMOA 3F1KA 4II2A 2Y1FA 1LUAA 4XJTA 3L6EA 4TZKA 1DHTA 1KVTA 4J9UE 1I3KA 3BXXA 4I1IA 1E77A 5HS6A 3UFXA 2GDZA 2Z5LA 3H2SA 5I8ZA 1R37A 1PJBA 1R15A 2DFDA 1U7HA 3IDSA 4HFNA 1U4SA 2NSDA 3C24A 1ENYA 4WEOA 4FIZA 1DB3A 1PGPA 2IYPA 4PCVA 2GZ3A 1E1LA 3GH3A 3LLVA 5IN5A 4J7CA 1UP7A 1A5ZA
chains in the Genus database with same CATH superfamily
4HXYA 4W9RA 4MW4A 5DLPA 2BGUA 2E4ZA 3D43A 3WMGA 4EGSA 4ZHQF 3O83A 4INJA 3NUGA 1YR2A 2XGSA 2WU8A 2ZVJA 3MJFA 3OIGA 4I5GA 4MUKA 5DISB 3TRKA 2QN3A 1FVXA 1GAJA 3L77A 4MDFA 4OQPA 2RGEA 3JYQA 4BC0A 4I9UA 5EJGA 3SU8A 4YPOA 3AUFA 2C4MA 3A1VA 3HEAA 2PZ8A 3T7JA 2IT1A 4JLWA 2OUKA 2YVQA 3INTA 5JAMA 2DT8A 4YAWA 1GY8A 4D92A 1VE6A 4PWYA 5A7GA 4OSPA 4URFA 3BKWA 2O2YA 1GYQA 2FSVC 2AXNA 2WRZA 3K0CA 4KIFA 4GKJB 1OI4A 2QX9A 1U9YA 4QC2A 3DHEA 4RJTA 3T8YA 2OWDA 1I8TA 4LDPA 1DL5A 1R4AA 4BB5A 1N6NA 3L7MA 4O4HB 2YVLA 4AECA 3DOUA 1R3UA 3JXEA 2O3RA 3NC1C 4YRGA 4RY8A 1WQ1R 3UFXB 3EGWA 4D0SA 1VCNA 2EFCB 4FDTA 1N6RA 2EAUA 3UWOA 4MS1A 4E6PA 3BE4A 1FLNA 3BRSA 4WN3A 4A6EA 4DY6A 5JNWA 1ESMA 2ZI5A 4N3CA 1SCUB 3Q3IA 2JCBA 5KX5F 4B3TB 5A5FA 3UATA 4KXNA 1YFZA 4IIDA 2ZCVA 3D2AA 3FBTA 3W2IA 1EK0A 2P4QA 1KARA 3H9GA 5IUJC 3I6IA 3KB6A 4TS9A 3SBOA 2E7ZA 4DA8A 3FH0A 1RI5A 3SC2B 1PR3A 2HT1A 1JFLA 3MJHA 1XZEA 1BU5A 5L95A 4MWCA 3SAJA 2IXAA 4AJ2A 2ZIZA 3SBEA 2RH5A 4RA6A 1H6DA 3LDHA 4ASUA 2IS4A 5DMHA 4Z4GA 2Q1WA 2Z2JA 4BX2A 3O93A 3SZOA 2QRNA 3UXMA 3TINA 4L75A 2X0FA 1CUSA 1KP9A 2QMZA 2PBFA 4MI9A 2XKBA 2QTVB 2ZBUA 4FT4A 1EE2A 1CF2O 1YE3A 3B8EA 4J1QA 4S05A 3BA1A 4FM9A 3NHAA 1T8WA 4NTZA 4WGGA 5DGIA 3V8NA 1XO1A 1RHKA 2N46A 3ZHVA 1S02A 2G9UA 9ABPA 3NHYA 2X0IA 5C1PA 2J7KA 4C7OB 2H0AA 1VKRA 4G65A 5AT1A 4BUCA 5JPDA 3JQGB 2B99A 2GVDC 2H29A 2WYWA 3IAEA 3M33A 2IOQA 3N2ZB 4KWTA 1ZUD1 3CNLA 2VIIA 3HO6A 4M86A 3WV5A 3RVBA 1S2MA 3IRVA 4KR2A 2JD2A 3H8WA 5CYGA 1ZK1A 4NS1A 2J4CA 3D8HA 2GOYA 4GUDA 5CVCA 1T1RA 5B7PA 1AT1A 1BGXT 4BLPA 4DABA 3LWNA 2YS6A 4ND1A 4H0CA 1P0PA 1G7SA 1N2EA 3P2OA 1O08A 4Q1EA 4XE5A 1NXTA 1VBKA 1T2EA 3KQWA 3L7KA 3LUAA 3LX5A 3OMWA 4MS1B 4RL6A 4X60A 4AY4A 1E8DA 1NI4A 2MSWA 2PM8A 3AB8A 3F6RA 4LRYA 1NURA 3I32A 2MCFA 4B8YA 4B6FA 3OI7A 4AUEA 5JALA 2ACVA 3L49A 3V7NA 2WU0A 2G5GX 3BIFA 3FYTA 2ZIVB 3I4LA 5GOZA 2D2IA 2RH8A 3KQOA 4HUJA 3BN3A 4WX2B 5BRAA 1HWYA 2AS0A 3H3FA 3VKGA 1CZKA 3OJ0A 2O20A 1H8HA 2BZSA 3EF3A 5TGDA 1BEEA 2FOLA 3QOYA 4PE5B 3KVYA 4RA6B 3WGYA 4WJZA 1VDZA 1KWGA 1H2XA 1ZYUA 3LIPA 4MUJA 4E32A 4IJMA 1DJOA 4W1RA 3G6WA 3JTMA 3WL5A 2DUMA 2AIRA 2I4LA 1J5XA 3WMFA 1YJ8A 3U7HB 3OBIA 2XB8A 4FCTA 3BCUA 2OBLA 4BKRA 3C1AA 5AKZA 5LQKA 2OGSA 1GTZA 5H59A 3VHRA 4H3HB 4FJ2A 3AEXA 4EJSC 1A9PA 3ZVKA 4TWAA 4MPPA 2DPLA 2HV9A 2IEGA 2HCJB 3VO8A 3TQSA 4DZTA 5IF9A 4GX1A 5M04A 1NVVR 4ND6A 3WL3A 1FDRA 4ZJYA 5B3JA 1HQYE 4GT1A 4DZRA 3PEFA 3W5BA 1YRQA 1FSZA 1I9GA 3K73O 4BGUA 2I55A 2F3QA 4MVJF 13PKA 4CV1A 1TQ8A 4KAXA 4CIDA 4K40A 2GAOA 4OJYA 4RMIA 4UW9A 2HGSA 5KOHB 4NZNA 1JHVA 3LA8A 3V4VB 4A0RA 4NU6A 2ZIXB 3QFFA 1NYLA 3PRYA 1GA1A 3MZ0A 1TEHA 2CFCA 2F1KA 1JQBA 1GL7A 3TSOA 4AJEA 4K0KB 3X43A 3DMFA 4DDKA 1RP1A 4MUMA 3UJ3X 1H94A 2Q4EA 3FYCA 4CMGA 4BFYA 1CR6A 3E2MA 3SXJA 3EPJA 2QZ4A 1ZD5A 3GY0A 3MMSA 3AERA 1SC9A 4DIBA 4W8OA 1ZVQA 1GG5A 2PQ2A 5JRJA 1NXWA 4OF4A 1NI4B 1SIOA 3BB3A 3NO4A 2X2OA 4JLAA 4M1MA 1R3DA 2B30A 4DYHA 2XRMA 2Y1DA 5KVQA 3H1GA 3IVXA 1ZI6A 3SYLA 3G17A 4FWTA 3PDIB 3REGA 4C6RA 5LB2A 3VSCA 4HFRA 1K2VN 2PUDA 1ZXBA 2IHKA 4JKYA 5KNDD 4DSOA 1FW6A 1RRVA 4K1XA 5F7ZA 2FHSA 3M1YA 5FJIA 2I6GA 4YPFA 5I3ZA 1UPUA 4ZD6A 4ZKDA 1XZQA 4G0PA 3WYGA 3WHLA 4N76A 2NVBA 5C7IO 1G5RA 5A62A 5L4SA 1YR9A 3GZNB 1J49A 3ADCA 3EXG1 3L9WA 4M1EA 2ZK7A 4AMZA 3VNVA 3GFVA 1TD9A 2ZBFA 5YASA 3DDUA 5KJEA 3QPAA 4Q9IA 4YUZA 2RHOA 3ANYB 1VTKA 3EGOA 1C4OA 1TU4A 2RHJA 2P9QA 1I3NA 4NYMR 4JNCA 1Z88A 1FOEB 3THXA 3RF7A 5DHAA 5SYAA 1RD4A 3DFMA 4EKDA 1DBQA 4IXNA 3PPXA 1SKMA 2XE4A 1B42A 2W4QA 2IITA 1SG9A 4M0DA 2X5JO 4OX9Y 1VHLA 5JJKA 1K8RA 1XQYA 2WIBA 3DP9A 5FBKA 2CXNA 1B93A 3QHPA 3FSRA 3NDIA 3W2EA 1A76A 2CBZA 2QTGA 1GSAA 4PSCA 1CJSA 1JLLA 3AERB 2X2EA 3F96A 3NEJA 3MTDA 1OGIA 1RFLA 2SNIE 5CW1A 1J06A 3TSAA 2XOKD 2Q21A 2G1KA 3NHMA 5L51A 4KVZA 1IH8A 1LVUA 2AMYA 3OA0A 3E3AA 1RLJA 4O1HA 4UCQA 3NONA 2EXXA 1EGAA 3CRQA 2IZ5A 2CL6X 1I6LA 4Q05A 3Q2OA 4WXRA 4EHLA 4QFMA 2F8TA 3JSXA 4GMKA 3V7FA 3M1LA 4N5LA 2FR1A 1OFGA 4WESA 2OO5A 4KTVE 1MIHA 1UBTS 3EQ9A 3HU2A 4YFYA 3BTUA 3AF0A 5KTOA 2V7GA 4LHVA 4B3XA 4JOSA 4A0FA 2NZJA 4ROTA 3BF7A 3OE7A 4B3CA 3KZOA 3KPVA 4NE7A 4CM7A 5C5DA 3D5TA 4GWLA 5C5EA 5TF4A 1Z0ZA 4D79A 4KR3A 4KH1A 1BX1A 3E3NA 2I87A 3VU1A 3NH6A 3WIUA 5CM8B 3X1ZA 5HRAA 1X94A 2NNWB 5T6MA 2YQ4A 3ECCA 2VXYA 4FONA 4Z6KA 3TW8A 4P4SA 1COZA 1I1NA 4D4HA 4D9EA 3THXB 1NXXA 3U5TA 4R1QA 4JWTA 1WUHS 2ZBDA 3O2QB 1TT5B 2D0PB 1W1UA 3OSZA 5C34B 3H1PA 2BUAA 3AOEC 4HYTA 5JNSA 3CJQA 1EE1A 4HC4A 1XMSA 4KLAA 3TTYA 1E9AA 1KEZA 4KPEC 1NUPA 3W1VA 3D8UA 5K8TA 5FA5A 1TLFA 1J99A 1IXZA 3I9LA 2JASA 5AKGA 1U0NA 4LZOA 4UE3S 3G0DA 4IM7A 1X0XA 2IWRA 1I0ZA 1Z8NA 2H07A 1ECFA 3SR4A 3VPAA 5TMBA 2HPVA 4DDWA 1YZTA 3H5OA 3KLNA 1QH1A 3B6ZA 3I2GA 1WKBA 1KAHA 1V6SA 1Q0SA 5F1OA 5HQTA 1DVRA 3T3GA 1R2QA 5HSGA 3RAJA 2A3RA 1B1AA 4I1RA 2X0KA 1MDBA 2JEZA 3DVLA 2W6ID 4JJEA 5HCUA 2P6RA 3VNBA 3DUWA 1Z34A 4E46A 2FY8A 2FETA 2IYWA 1DEKA 2ONJA 3OM0A 4CIYA 1M2NA 3LX6A 1TTPB 1KDRA 2C61A 4H7KA 4V2IA 4II3A 2HL6A 4GOXA 4IV5A 4ITRC 5AVZA 2Y2UA 1UXHA 2IZ6A 1BE8A 3TK1A 1XP8A 4DR5B 3QX7A 1RLMA 3UUEA 3QNMA 5DW0A 1NA5A 2IE8A 1JDVA 1V2GA 2H2IA 4QGFA 4RUKA 3AVVA 1MH1A 1PZNA 2PSJA 2X5XA 4HAIA 4JC5A 3SDBA 2ZSAA 4KHZA 4ZT6A 3KDSE 4P4SB 3FCEA 1ADJA 3LM8A 4BPBA 2EF0A 3HDGA 3Q0EA 5J4YA 3KPJA 2ECPA 4CL0A 1QYRA 1JMYA 2IKSA 1VC2A 1BDJA 5G4LA 4AJ1A 3B52X 1TTTA 1L6RA 4ESEA 1F51E 2QMOA 1NW8A 3EWIA 4QRIA 4D2IA 1RRCA 1X7ZA 4A8HA 4YCDA 2BSQA 1N0HA 1RBMA 5BPFA 4GP6A 2IHJA 4MK4A 3INYA 4LYYA 5F3DA 2QQ0A 2F3UA 3KEOA 3FDZA 4JIGA 3PFCA 2OMKA 3FTQA 3WWYA 3TPZA 3KTAB 4ZQEA 1CRPA 4QDTA 2R1UA 3TZQA 1B4DA 1VECA 2ZZKA 1FUIA 3AR6A 5TQVA 3TLBA 3IIMA 2BMDA 1A4XA 2D1RA 2C3OA 3MMXA 2OGWA 2J5QA 3Q6IA 4H7FA 3ZW8A 1SBNE 4RLSA 1OTXA 1U02A 2B82A 3PF8A 2B8NA 2OCYC 3QTTA 1AGPA 2G70A 4PNPA 4URXR 1PR2A 3GLVA 4DKJA 4I1OA 1C1DA 1M7BA 3I6QA 2X4GA 1FSSA 3F71A 3HLKA 1L4YA 2QD1A 3FPGA 3OU6A 4HNTA 4PX9A 2RHHA 3UYLA 2JAXA 5KVVA 2XOEA 3NHPA 4C7VA 3P8ZA 1JLSA 3OTHA 3HCPA 5HDQA 1OFUX 4L72A 5K3OA 1AKVA 3R7SA 2OYSA 3V1NA 1QAOA 3CH4B 3EIOA 3NPAA 1ND5A 3DYIA 5FL7D 1J2YA 4ZRMA 2WG0A 5JHGB 4CG2A 3TD9A 4ENTA 2IUFA 2O0LA 2GYYA 4BV3A 3E3LA 1YR6A 1QU2A 5AJYA 3LC0A 1Y5MA 3CE9A 5DTJA 3TQIA 3OPXA 3V3KA 4E03A 1T8YA 2VUSA 4G4SP 2GCGA 2QG4A 3H99A 2FW6A 2HZBA 3G85A 3FWHA 1YQGA 1C9YA 1Z0FA 3E8MA 5DV9A 3ZOKA 1A7AA 3DE7X 3JCZA 1T5LA 4RK4A 3T3EA 3OZGA 1Z4KA 4WACA 4A27A 1B2RA 2D4AA 1X7ZB 4KLNA 2OAP1 2VUIB 1KDOA 4QQ8A 1SRQA 5DI9A 5AKHA 4K9DA 3ZCSA 3CF6R 1C3VA 1P75A 1Q50A 1KK0A 4AVYA 5E7MA 1FS6A 3A6DA 1UZMA 3OLQA 3TUIC 3WLFA 3AY7A 5KNCA 2CWDA 2PKYX 2OXEA 2GHRA 2IU6A 1HOXA 4J16C 3DFFA 1F6WA 3H9JA 1AE1A 3GGGA 1D4ZA 2GPWA 1D6MA 1CR0A 3L06A 3SIXA 4OFXA 4U2EA 4J4TA 2PJUA 5K8LA 1NU8A 1IXYA 4HVCA 4IXTA 1WTAA 1O4VA 3W3ZB 4BQRA 4CHGA 4BU0A 4FR5A 2WM2A 1UZUA 2GSWA 2LIVA 3BK1A 1NAHA 1M6WA 2H6EA 2ZIGA 3GCZA 2R6JA 1N57A 2IXFA 4Y3UA 4I9NA 2XCRB 3SY8A 1ORVA 2JGJA 5IULC 1UBKS 5ES4B 2OHJA 2GD1O 1YAHA 4TZTA 4QJIA 1W5EA 4L51A 4RMHA 3MUFA 2EATA 3DW1X 1SZCA 3M6XA 4L4UA 2EG5A 3IEXA 4I46A 5TGTA 4GKAA 1JIVA 5DTEA 1JA9A 4NC9A 5BQXA 4G5HA 5CFRA 2ID8A 3T1YB 2JW5A 5EC8A 4EW2A 4FYWA 1THZA 3KV1A 3PEEA 1E7WA 1USIA 3EGCA 3LBHA 3TIXB 1OJLA 1RXEA 3K1AB 1THMA 1JR4A 1O89A 2XX3A 2ZOSA 4WAUA 3QY0A 3J81A 1A9OA 3NHRA 4ES6A 3KVVA 1GDHA 5IC6A 5KO2A 4FD3A 4GZLA 1T9ZA 5IVHA 1P5FA 2V7TA 3C8UA 5BWNA 1K5PA 2F90A 2Q2WA 3F7OA 3PPIA 4IFEA 3JQFC 2WD7A 4D6XA 2VHWA 3OETA 3GWZA 1E2PA 3DGFC 1F14A 3DE2X 5G0UA 3P9NA 2HIGA 3R7NA 1KZYC 3HP4A 4YDHB 2CYAA 3BFPA 2ZBVA 3QEMA 4YO8A 3S7ZA 5HXAA 3R1IA 4G8CA 5JS1A 2V03A 1MHPA 2JC3A 4R9VA 3MHTA 2DHEA 3WE7A 1XZHA 4PYMA 2F55A 1CZUA 1KH2A 2HT6A 3H5AA 4GQBA 1ZONA 2C3YA 1IRIA 1EB8A 4ENRA 4FKZA 3GLQA 4DLBA 2HDWA 2XPCA 2WU3A 4NE2A 1EWQA 3O9VA 3D3EA 4EF4A 2WHEA 3EVCA 3G5AA 4OKIA 4MNTA 3D4BA 2YKGA 3B3FA 1IB6A 1YRBA 2Z6VA 3CTPA 3RSFA 1N33B 2X8WA 3VZCA 4U4AA 2ZANA 2E82A 3ETGA 3OCXA 3OCCA 4OATA 4LBYA 1K8ZB 1X15A 3C98A 1Y7PA 4DCVA 5JARA 3NOVA 1YO6A 1RI4A 4US1R 2GAAA 5C31A 4DQDA 3F5QA 3ZBTA 3Q8LA 4F3TA 4Z9AA 5ALWA 1LPPA 3ZU6A 4FSXA 4KE6A 1Z25A 1TAHA 3JVEA 4BPRA 1P44A 1YZGA 1W36C 3F6CA 4H1VA 2HK7A 3IIIA 2AYYA 1JYSA 4G5OA 1DO2A 5JYCA 3E7DA 2XNDA 3FUUA 3D1LA 4QBTA 5A9RA 2C0PA 5GGXA 2B2XA 3D02A 1P7YA 1QGUA 4KNVA 4RGBA 5HCNA 4DNXA 3AR8A 5ECWA 4TL7A 3A9TA 3SYKA 5JTTA 5J2UA 2J30A 1W46A 2MSLA 1ZC3A 2Y1WA 2GCNA 3EWAA 5EP1A 4EFMA 1M6NA 5DYTA 3SFZA 1E3IA 1MXFA 3GN2A 4CQJA 1SKQA 4ZC1A 4E07A 4OQQA 4W8GA 1VM6A 2ACKA 2XGGA 3U3OA 1M6EX 2O23A 2XUKA 1U1CA 3H2HA 1E1CA 1LPMA 3UAZA 3R4VA 3NBYC 1B76A 1PSDA 2BHTA 4MQ6A 3KB2A 5BNTA 4UU8A 1RBYA 4FHGA 4L9AA 3USZA 3ZVLA 5FDFA 1WMEA 4QSMA 4O3FA 4EUFA 1DQRA 3CU5A 3CLVA 1U5BA 2NXNA 3DVRX 4H7PA 1JI0A 4KUEA 1OYYA 2JLUA 5B1YA 2TRSB 4IMRA 2XLBA 1WB5A 4Z4HA 2LCQA 2AW5A 3RSSA 3LUJA 2VJDA 4IZ6A 4NMMA 1JEDA 3ASUA 1GZSA 4QECA 1GNTA 1XRRA 3I45A 2CSXA 1G17A 1T4CA 1V9CA 2PMBA 1RAHA 4YJ2F 4C0SA 3U7FB 5KSYA 1UBNA 3GJ7A 4TV8A 4JB3A 4MAAA 1U7PA 4ILKA 2Q8QA 3CRVA 1SK9A 3KRTA 3KZCA 3EVNA 3O4VA 3ZI0A 2ACEA 3RRYA 1YOVA 4R8MA 3TBHA 3VX4A 5BV7A 4NBUA 1ORDA 3WYBA 1NJ5A 3FOZA 4YMHA 1UDCA 4LY9A 4W1PA 4QPZA 4LJRA 1U8AA 5CHEA 3A31A 1NRXA 1MC1A 2BZGA 2OT3B 1AD2A 1VPVA 1S3FA 3QVMA 4FHCA 3EF0A 1XPRA 3WRXC 2IIQA 1JEAA 3S5JA 4NV0A 3TOVA 1DC3A 1KJYA 4HYYA 3QELA 1WL8A 4QYMA 1T26A 1KAGA 2ZUWA 5ECGC 3CNEA 3U44B 2FEMA 3OIUA 3O8NA 4JVNA 2NZVG 5BVHB 4DJ5X 1BXGB 4OM8A 4KMRA 4MDEA 3IQXA 5JQWA 2KBEA 1SU7A 4PQEA 1N5JA 1U2DA 1XVLA 3TRIA 4MW7A 1W5FA 5CDGA 3VR2A 1MRSA 3L8CA 3T35A 3JD4A 5H8WA 3KQNA 5A4KA 2OP1A 5BRNA 5HMMA 5CDSA 3DF7A 2W5UA 3OH8A 2AG5A 2H59A 4W9NC 2QLLA 1WMBA 3ER6A 2IUYA 4M7RA 2P2CA 3L93A 4NEHB 1P1IA 1DIOB 4ZYYA 3DXXA 3L40A 2IEAA 4BWFB 5BP7A 2Y67A 2ILVA 2DE0X 4L0CA 1SHJA 3G9TA 4HMOA 3EPKA 1DAIA 1YZLA 1T4CB 1YI1A 2IY8A 4MXDA 1MB2A 4GS5A 2JCXA 2JARA 4RK7A 3RU7A 1OH6A 2W0MA 3B1YA 3U49A 5JEDA 3H1AA 4OHZA 3OZFA 3P2MA 3FDFA 3K0HA 3SBDA 4B82A 1Z2EA 5JLAA 1YOVB 2WB4A 1LX6A 4BB0A 3IIJA 1FLDA 3RM3A 4MLPA 1DT3A 3U0BA 5KOIA 3GAAA 1Q0TA 3NMUF 4WXPA 4O5AA 4X8LA 1JE0A 5AVWA 3DZIA 1P8JA 5KHAA 3QG5A 4WPGA 4DBLC 1T0UA 2QX7A 3SEAA 4YMTA 2G5CA 4JJZA 1K06A 3OFVA 3D8TA 3ONWA 4JZYA 4RSMA 4DV6B 3WGUA 4YRNA 3LH5A 2VHCA 2Y05A 4GWKA 4LK3A 2PGAA 5JE8A 2KW5A 4XUCA 1PWHA 1NN1A 2GN6A 4KQKA 4MLZA 4B3BA 4DY4A 1Q0QA 3AR3A 4J03A 4C89A 1JGTA 3CC8A 4KE7A 3H0KA 2MSNA 3L0ZA 4FX5A 4TN5A 4F21A 5EJ8A 1I13A 1KDVA 4Y2HA 3HNOA 1KGSA 3RC8A 4Q9AA 4OGLA 2R84A 4AKGA 4MYCA 1PKEA 4FDMA 2B36A 1EKXA 2C29D 3A05A 3ZS9A 4CW7A 4ND2A 1HY3A 4FVTA 4KE8A 1B14A 1E0AA 2H4YA 1OY1A 4PGMA 1HURA 3QUCA 2CW5A 4KI0A 4K87A 4LVOA 4OK5A 2CKMA 2BFDB 2E85A 2I03A 4RE5A 2XNKA 4AMYA 2JIBA 4BU1A 3LT2A 3QEKA 4ZOBA 3EXHC 1DX9A 3TDKA 2ZJ2A 1PQPA 2A8YA 2D1TA 2D3TA 2Z6AA 1RAEA 4HSGA 1HDOA 2DECA 3A7DA 5JC1A 3IJEB 4UUQA 5I9LA 4LRUA 4DMUB 4A1FA 1I4TD 4H31A 3RQIA 5B4VA 1DWQA 3EHDA 4K6MA 4RJJA 5CEJA 2QT1A 3OC0A 1ELOA 2JFFA 4BX9A 1GADO 4QOFA 2D0OB 1DIHA 2FFQA 1HOTA 2OCIA 1GSOA 2J3HA 3Q7PA 2YXLA 4MA4A 1PEAA 3D7KA 4KPFC 3WTCA 1ZNXA 2UXBB 4DGQA 3AUTA 3ZTYA 5ANRB 3ODGA 2HMAA 1LB1B 3D6HA 4XARA 1MB3A 5E1MA 4MMZB 5F64A 5JROA 1SQGA 1W2GA 4HB3A 4TKUA 3ZX5A 1RYFA 1UP6A 5FFMA 3KZ1E 4A8JA 4D4JA 1NBAA 2H9AA 4DREA 1EG2A 1H42A 1VGQA 4O2BF 3AUKA 3FSJX 1EDBA 3FFTA 4NOLA 2A1TS 2Y0PA 1TDJA 3DHYA 4I4TB 3RE1A 1OT3A 1HT2E 6ADHA 2QRPA 2YZNA 3A1FA 4QOHA 4RDCA 3BQ9A 3OP4A 2A59A 3G2QA 2CXSA 2VF5X 4LAFA 5JISA 2X2FA 1XDZA 2C9OA 2YHUA 1ILWA 1B8PA 1HQDA 3IRUA 2IHBA 4EG4A 1E2FA 2Z4RA 3X2SA 3I5MA 1RTTA 1RS0A 2B35A 3MBOA 4UHJA 4XIFA 3EDOA 4GGOA 1A9RA 4HEA1 3EPLA 1XTSA 2VJPA 3ZGXA 2GZ1A 2R96A 1T0HB 5JI3E 1DEHA 3EEOA 3HY4A 4HJXA 3TJZA 4CLRB 2PUGA 1SXJC 3KJXA 4JEHA 4MZXA 4O4LA 4YQEA 3GOHA 3GGCA 3DTTA 3EMVA 3H2GA 3U4IA 1FL9A 3KCNA 2YR0A 2C2YA 3EB9A 2BV3A 3SFTA 4JL5A 3AKDA 3DMGA 1DMSA 1M2EA 2PTGA 5KIAA 1X14A 2O2SA 1VLLA 3UQYS 3JQRA 1IZ8A 3W8RA 3ESAA 1JFTA 4MYDA 2DWQA 4HDAA 1BVRA 5CCDA 4ALNA 1Z83A 4EG7A 1UJ5A 3CH6A 4X3CA 1JEOA 3GRAA 1D3AA 3FTPA 3LT5A 3C97A 1BE6A 1DC6A 4WW0A 1SQ5A 2CYCA 1SVWA 1ATIA 1IQPA 1SCKA 3GFPA 4QYXA 3RUFA 3FAKA 5E2AA 5LB4A 5LXTB 1GTJ1 3NFYA 1G9SA 4HH4A 3O4HA 1UQRA 1GZ6A 1SPBS 2AMLA 4RKFA 4W99A 4CLEA 1Z29A 4ZDKA 3NKVA 2HO5A 2QTHA 1NZDA 3IEKA 4TMTA 3MAGA 2INGX 4IWYA 3AYZB 3GT7A 3EYAA 1PSZA 3ZGOA 1TJYA 2I3BA 3PP8A 1QHXA 5DBOA 3RU2A 2HA6A 1EQAA 2IYZA 2IUEA 2QAGC 5FNVF 4HZIA 1SKYE 1BHQ1 2CLDX 2RMKA 3MMZA 4O0MA 4Q01A 4TYYA 2O3TA 3PSAA 4JXJA 1II0A 1T5TA 1VE5A 3E7WA 1XF1A 4LUCA 3AJDA 4TS3A 2ZZNA 1IN4A 2EF1A 3WSTA 2HRZA 4F4JA 4YAGA 5LXTA 4UM9D 3IP3A 1PUJA 4I4NA 4G3XA 2JANA 4GVXA 3AKZA 4FZ5A 4UEKA 4QX6A 1EM8A 2XZTA 1XRSB 2VZ9A 1KE2A 1K6XA 1K86A 2YMMA 4TKMA 4JASB 3WXBA 2ZSKA 4J8PA 4UQLA 3G9QA 2PBLA 5I8WA 4WQMA 4C87A 3WAGA 2H16A 3RTAA 1WPQA 3IUMA 1ZD8A 1AV6A 3BAZA 1VE7A 5CA1A 4PIMA 1ZVMA 3BWEA 2Q3HA 4W6QA 2XUZA 2HJRA 1V26A 3PXAA 1EBBA 1X80A 3HXMA 2OCBA 1ONNA 1E1YA 3NCHA 4DQUA 4ML3A 2HSEA 1S8NA 4LBWA 4MAMA 4UHFA 4V0MA 4EPWA 4MHOA 5KQLA 2B5OA 1CRZA 4N0PA 4W9MC 1P18A 5AVKA 3RIXA 3AV3A 4GSYA 1BMTA 2DH6A 2FA9A 2M2IA 2QV7A 5K0GA 3T5PA 1KOJA 1C7RA 1TCVA 2DZDA 4FSHA 4H17A 3RFVA 2PUFA 4BP9A 3U6BA 4QFBA 2HX1A 4ZVSA 1G8FA 2MMCA 1FNCA 1DDGA 4J7AA 1UOEA 4JC4A 3DMDA 1PT7A 2AUNA 4WUTA 1EB9A 3OMLA 3ROQA 3JASA 4I5DA 5DRTA 5ALPA 3IXLA 4CFZA 2D6FA 3W4IA 1IY2A 3MINA 2WD8A 2YFKA 4IUYA 3BIXA 5DT9A 3L0BA 4NICA 4JUFA 1KSJA 3UJ8A 4BFZA 5CFLA 5LD2B 3WGTA 4X64B 2JCVA 1FMJA 3OJOA 1WMDA 2CNWD 5G1PA 3NI2A 3IAS1 5DLYA 3GWGA 5EMKA 2QS9A 2YYYA 4AQ7A 5KTPA 4KDCA 3JWPA 2HF7A 1UMCA 4KX3A 3GI1A 4MLCA 1JS1X 3T5MA 3CW8X 4ACAA 3I4FA 2Q1YA 3OZ7A 2R6DA 5A7FA 5C80A 1FMFA 3SVTA 4NLLA 2JF0A 1B0PA 3GQBB 5KB3A 2RG1A 1IAQA 2CXQA 3C70A 4NYIR 3R74A 2KHZA 1IULA 5EIBC 4AS1A 1R8SA 4BATA 1L7XA 1EX7A 4I55A 4QVIA 1OBCA 2JFYA 4L5BA 1QTRA 4WKPA 5E8JA 2VYVD 5CA1B 1T2DA 3QUQA 1M8GA 4O2AF 1W5SA 4LY6A 2XCUA 4J0HA 3C8HA 4AYXA 2OA0A 1QCZA 1R1DA 4PLPA 2VO1A 3AEUB 4KBYA 4DNQA 1ZEMA 2XA1A 2IQIA 1E59A 1Q15A 2Z5GA 3Q3GE 2XJ9A 4UPVA 4E2FA 2I6FA 3OJLA 1Q0HA 1WNTA 1D2EA 3G82C 1NYTA 2ZBGA 3MWKA 2QLNA 4IICA 1J09A 5IM4F 2FI1A 4K46A 1QXSA 1NBIA 2BY4A 4HI0E 3UTCA 4B3HA 2VZ0A 2AZMA 2VJBA 1GZDA 1BRMA 3EMDA 3FZEA 4FMBB 1E94E 4JBNA 1IMOA 4NULA 4QJ4A 4AB1A 5M2QA 3HHPA 2X9GA 4UJ5A 4FNGA 1IJKA 3KOZA 3ZYZA 4D43A 3NBQA 3Q87B 4WLEA 3G7NA 2K5UA 4OYHA 3MINB 5AXCA 4DEVA 2P5UA 5T64A 5J9FA 1F7UA 3TM4A 2QVLA 4FC6A 4GSKA 4XWAA 3IGFA 1XZJA 3KT8A 4ZZ0A 5J47A 3PFIA 3UC9A 2VVTA 4DN6A 4DADA 4H6WA 1FLVA 5K99A 5LQJA 3LO5A 2P1DA 1C3EA 3GZJA 3UBMA 3U60B 4CMEC 2OVFA 2QPTA 1H4VB 1OSNA 3LL4A 3MCTA 4ZO9A 1HSOA 1QIFA 2IXBA 4TWRA 3TAUA 1REQA 2NZUG 5EQTA 3ETEA 2E3JA 2GO7A 2W43A 2D2FA 4A03A 4EUKA 4I55B 1EVJA 3VR6D 1XXHA 4JQYA 4OLFA 2PWYA 4KQGA 2WY2D 3SF8A 4EHNA 4MJ3A 2XMBA 4NBRA 5JCJD 3QNUA 3FSGD 1T91A 2O5CA 1JG7A 4X71A 2QMEA 3PQ6A 1OLSA 3SI7A 3ZKWB 4JI5B 5A3RA 3LVFO 1NVXQ 4NYJQ 1FTYA 1RPNA 4MS4A 1HA3A 4BVFA 2A9KA 1RPJA 1Z9BA 1S7GA 2ZAOA 2AKAB 3BC1A 3HMQA 3JWEA 1AKNA 5IH3A 2WFAA 3LU1A 4QPPA 4XX0A 3TCNA 4B73A 1KOFA 1WB9A 3INNA 4G8BA 4V2UA 1DELA 2FAXA 3C4JA 4B43A 3COZA 2RGAA 2CDBA 3EEFA 3PTLA 2NUTA 4GI5A 4L15A 2YZMA 2YBDA 4ECEA 1XJQA 4MB6A 1W73A 4KUHA 3P2JA 3R8CA 5FAXA 4TMZA 1J5EB 1WSBA 5EKUA 3GP5A 9ATCA 4CCYB 3ZD7A 3HFRA 4HJRA 2LD4A 1E5DA 3UJBA 3L8EA 1GT91 3L8HA 1GPUA 3RG8A 3UAWA 3HBFA 3KOYA 1CXZA 2I99A 2RH4A 3FSEA 3L7LA 2X8JA 4WLUA 3R76A 3VV3A 5CEFA 1KEEA 4BKMA 2CB9A 3NHWA 3RFUA 3JARA 3D7LA 1YJCA 4C7MA 4D0RA 1YZYA 2ZCUA 3JQBC 4J94A 2ZDQA 3EVAA 3MTEA 4MKGA 4JX8A 3MJEA 1KZGB 5EJAA 2Y0DA 1F3LA 1REQB 4L8FA 3WKBA 4PVCA 5E95A 5BNZA 1UM9B 4RE6A 4UAVA 1O5OA 1T0PA 1D0VA 2MR6A 3SE0A 1K6JA 1CY6A 1O54A 2HF2A 3C5HA 1QG0A 4GPIB 1XXHB 2PSHA 1N3LA 1K4YA 1NMXA 3E03A 4IIJA 4D0GA 2C3MA 1P4AA 3SF8B 1ISIA 3T5TA 2ZTUA 1BXRB 2P5TB 3A3OA 4XIGS 4IZOA 1N5IA 1WCYA 3PLRA 4AMGA 4BVGA 1H9CA 3VU0A 4GZ3A 2NO1A 4FP9A 3OBBA 1OLSB 1FF9A 4GE0A 4QAQA 4ZAYA 1R5OA 5GPBA 4II7A 3L4SO 2QI9C 3KZNA 4JYMA 4M7PA 1PS9A 1W4AA 1NLZA 4V1CA 1M0WA 3EBOA 1TCCA 4FZRA 1UQUA 1XVAA 4GUAA 1PW5A 5JAPA 2Q4DA 3AR2A 1PJAA 3NDPA 3EDQA 3AKYA 3EC7A 4KEAA 4M9UA 3GJ6A 3IOMA 3RJMA 1VGRA 4QRHA 4QEZA 1RZ3A 2Q1TA 3CWZA 3AP1A 3PVCA 5IJAA 1QZZA 5AW5A 1QRUA 5JNRA 3CLTC 2FG7C 4YJDA 2W8BB 4NZZA 5CXXA 1PGNA 4IHJB 2I8CA 4CG0A 4E09A 4EABA 3ZDDA 2C0CA 2Q3FA 4P54A 4FI3C 1CY8A 1NI5A 1OBFO 2F1HA 2XITA 3B5IA 4JUDX 4QBGB 3Q72A 4P5DA 3QV2A 621PA 4PX2A 3ANXA 3QF4B 3G2KA 2BRUA 3LUKA 1DKUA 1MX5A 4AN4A 3OKFA 3EUEA 4U9HS 2OGTA 4C0LA 3KSZO 4RMNA 3U61B 2X7HA 1UAYA 4U02A 3OX2A 1KFBB 2WP0A 2FMKA 3OM1A 4X61A 5AKIA 5HKLA 3UHAA 4TTAA 4L95C 4B44A 1N1DA 1QG2A 3QJGA 1QJCA 4XR4A 4L3WA 5EZSA 3L9XA 3C3BA 1QZXA 1GRCA 4EA8A 1XNQB 2PH1A 1H5NA 4KGDA 4ILEA 1IWPB 1WF6A 4LISA 3WIOA 4C0XA 2QPLA 5L7YA 4RO0A 4C7KA 3CEMA 1PNQA 1Z3CA 4KXWA 4XOUA 3T1NA 2CZCA 3VTKA 1QKIA 1FP1D 1UKEA 5E3JA 4TSFD 2J5XA 1DXOA 4XQGA 3IP6A 3UJ7A 4KPYA 4PC7A 5JLJA 5GJVC 4DCTA 4V1CB 5JSZB 4U2GA 2HA0A 2PIDA 1C9EA 3I0ZA 5B1IA 4EYGA 2DUNA 2JH8A 4MTLA 2B0CA 1KNQA 3LQ2A 4IVQA 3MG9A 4TOIA 1HM5A 3A4YA 2OXIA 2QTRA 1KYVA 3P26A 4RCZA 1P5RA 4GWGA 2FPWA 4E14A 3ZWOA 5I7OA 3Q9NA 2P3SA 2E4UA 2OPHA 3SQMA 4DMLA 1DKOA 1E2EA 1JKJA 1TEVA 1H2EA 2JZOA 2QTTA 4LMRA 5BSTA 4US2R 3C3JA 5GADl 2JAQA 1U1DA 2FMHA 1HXHA 4LS3A 3WWDA 3R3ZA 1LI5A 3DBHA 3U1VA 5JS8A 3N87A 2Q4OA 1WDKA 3P19A 4J49A 3EZYA 3VYSB 4XGRA 2Z3WA 2YJ4A 4OJQA 3K9LA 2BFBA 5KVAA 2BWJA 4IBOA 1V5WA 4KXMA 2EW1A 3I58A 5CM9C 3TLAA 3VHXB 3A3YA 1KIAA 2Y76A 3LP5A 3WBJA 4C4OA 4BQEA 3NIBA 2JLWA 4ZO7A 3IIEA 5CURA 3JSAA 4EITA 5HE8A 5KQRA 1AF4A 3W7VA 4XWWA 1SVNA 5EQDA 3V4SA 1G5HA 4U0JA 2PSFA 4UM8B 2H85A 5ITVA 4O3MA 2G6BA 1C7ZA 4X90A 2YNMA 3O1LA 2XYHA 3JWIA 2KBFA 4BNKA 4P81A 1A9QA 3PPWA 4IUDS 3HO1A 3ZNQA 1KJNA 1DDOA 2DVMA 3AVYA 5BMVA 4M98A 3EFBA 4PPNA 4F0JA 3OWOA 1R8QA 4X1YA 2VTDA 5CDFE 4KPUB 5BNFA 3CMMA 3BB1A 3PQ8A 2OORA 3SBXA 1IBSA 1W36D 4Q66C 3QY9A 2BE9A 4TVOA 1IBCA 1ST3A 2R47A 4W5QA 5B4UA 2VNKA 1E9CA 1XYVA 2W2KA 4G67A 2ETXA 4ZVLA 3VBCA 4DNOA 1SC1A 4FS3A 4MRSA 3L7OA 4DF3A 3GO4A 5AM4A 4E4YA 1B1CA 5I01A 1LDBA 3MT9A 1C3LA 1F0KA 3OAAA 3TNDA 4FHFA 1EJ0A 3PCTA 4U6NA 2F2TA 4V03A 5E7JA 4H6PA 4WUVA 3RYTC 5IMSA 2LWIA 1USGA 1U9CA 2DHCA 4K6CA 9LDBA 1O9HA 2AFVA 2X4DA 3N53A 3OP1A 3EARA 1A2OA 1SXJE 3FPKA 3JYOA 4RHEA 4YTEA 3VVCA 2RHTA 1KY3A 2H4HA 2FDXA 1O87A 1QR6A 1CZHA 4UUOA 1SA0A 1B8OA 1A7UA 4HN9A 3C4QA 5EPEA 4P6VF 1N2CE 2BFBB 2QTZA 4R3WA 5HIAA 5IVKA 1SELA 4BQPA 3RSHA 2EL7A 1N34B 1D8TA 1T9CA 4HY3A 1IN5A 1V47A 2OGZA 3F3KA 2I1LA 4B3MB 3M6LA 3GFFA 1H4QA 1PV2A 2LXNA 3X1MA 1NJ6A 4EWLA 1GYPA 1JSLA 1XFAA 5FPHA 4E4RA 2WIFA 2GCPA 3AIMA 2RBEA 3CA8A 1RM4A 5LWQA 1KBZA 1ZUWA 2GZSA 1X7WB 2ZI7A 3AFNA 3UAYA 1Q7GA 4BLVA 1F0YA 3U3ZA 5FWYA 5KKCA 3TXXA 5FTJA 2YWBA 4MPDA 4MV6A 4AJIA 4YCNA 3QE2A 3MAJA 1WZCA 1A5TA 2J31A 4D80A 1KJZA 5IBCA 2OOSA 2QD3A 1J1UA 3LOQA 2FZEA 3K1ZA 4LNUB 3EIFA 3UMVA 4Z0HO 4NSNA 2GXUA 1H65A 4F4UA 3QVXA 2CK3A 4GKKB 2IXGA 5LKRA 4PSDA 5MN5A 3RT1A 1RZVA 1RHUA 1O95A 1GKIA 2B20A 1G9TA 4QTTB 1L4KA 4UXJA 4YN3A 2VHVA 1R0LA 3TLEA 3IAM6 2EJWA 1K27A 2O0MA 1C3JA 3AY3A 4INPA 3HVUA 2P2ZA 3M5CA 3EOZA 2H2WA 4GP7A 4B09A 1J42A 3DZBA 5LZ4A 3LT4A 1KZ4A 4ZI7F 1NNEA 2IOFK 1DRKA 2OBXA 2ODAA 1YNSA 5ALOA 3IDZA 2O0JA 2MYUA 2ZUFA 1MRNA 2I8AA 2RG7A 2W11A 1LPSA 2HYDA 2J5BA 2XAUA 2DR2A 2E48A 1EE9A 2V97A 1D1TA 4IP0A 4JX9A 1R6VA 1WCIB 3DDSA 4K03A 4JU9A 4RDHA 4HUTA 1JVBA 3RC2A 2BDEA 3ESQA 3TZ6A 1KRHA 1N6KA 1GPKA 5E38A 5A06A 2EEPA 2Z6UA 2ODQA 1P5JA 3TTTA 1VXRA 3IC5A 3I01A 2IE0A 3STWA 3CSUA 5JPIA 2BGGA