3N70A

The crystal structure of the p-loop ntpase domain of the sigma-54 transport activator from e. coli to 2.8a
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
142
structure length
142
Chain Sequence
b'IGRSEWINQYRRRLQQLSETDIAVWLYGAPGTGRMTGARYLHQFGRNAQGEFVYRELTPDNAPQLNDFIALAQGGTLVLSHPEHLTREQQYHLVQLQSQEHRPFRLIGIGDTSLVELAASNHIIAELYYCFAMTQIACLPLT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transport activator
molecule tags Transport protein
source organism Escherichia coli
publication title The Crystal Structure of the P-loop NTPase domain of the Sigma-54 transport activator from E. coli to 2.8A
rcsb
total genus 39
structure length 142
sequence length 142
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2010-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14532 Sigma54_activ_2 Sigma-54 interaction domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3n70A00
2NZ8A 4BFTA 1N5IA 2PZGA 3OEEA 4WIAA 2PMKA 1E9CA 2RGNA 4JIMA 4QBIA 4FWTA 1TPZA 1E2DA 3NHBA 3ZGXA 2FU5C 4BWYA 2QTHA 4LHYA 1G18A 1E0SA 3X2SA 1U0HC 2BMFA 1W5SA 4HATA 2XITA 5E7JA 3TRFA 4ZKEA 4N1AA 4ZDJA 4IOKA 4JBWA 3ZZ0A 2WJHA 2YKGA 2J9RA 1ZC3A 4PPGA 1KOFA 2E87A 3BB4A 3QY0A 4Q18A 1NN0A 1Q21A 1X8KA 3CZQA 4FMCF 3IILA 5FUYA 4QJ5A 3U60B 2W2XA 4NCIA 3A1UA 3OEHA 2YC4C 1XZPA 2QENA 4A9AA 4TMZA 3WYFA 3AF0A 1W49A 2G1KA 3LX5A 2ASEA 1L8QA 1W4RA 5C4GB 5AUNB 3DZDA 3U6BA 3EPHA 4LYJA 5CLQA 2CXXA 4IXNA 2MMCA 1DO0A 4WA7A 4G5QA 1EWQA 1G7TA 4KYIB 3GJ8A 3ZJYA 1JEDA 3MWKA 1J8MF 1OSNA 1OJLA 4OQMA 4P33A 3CX6A 4I4LA 1WA5A 5TMPA 2AK3A 4B47A 1W0KD 4DDVA 4WOPA 3SU8A 3K9NA 4PC2A 4TT3D 1DAHA 2XAUA 4BEBA 1WF3A 2GETA 2FGKA 721PA 2WOJA 3SHWA 4TT3A 3HU2A 2BJVA 2PEZA 1W2HA 5LBIA 2QRNA 2VHCA 1RC8A 1ZP6A 2IYRA 2D7CA 4LJ9A 1KO7A 2CE2X 4MGZR 4O2RA 2VF8A 2BC9A 2W0SA 3KUDA 4L15A 1SKYB 2ZVQX 3T12A 2RMKA 2REOA 1VCMA 4KFUA 4XTCS 3BB3A 3REGA 1YZGA 3EG5A 3AKCA 4W5HA 4DEYA 4DDUA 4KITB 4XTRA 5IK2A 4TWZA 3SQWA 2BHRA 1ZM3A 2P5SA 3PIRA 1UBGA 3Q5DA 4KJZA 3PEVA 1FTNA 1UKEA 2VHJA 3X1WA 3CWZA 4GMDA 1E3MA 3TK1A 3QIAA 4Q9KA 5FOUA 4B6FA 2ZE5A 5DI3A 2ZRPA 1DBSA 3U3RA 1Z06A 2XOKD 5C1BA 1RJ9A 3NTUA 5DI3B 3B1VA 3DKVA 1W36D 1A7JA 4LJ5A 4MDEA 1Z0AA 3AVXA 1LW7A 2GZAA 2KSQA 1AM4D 2I1VB 2QZ4A 3THOA 2O8DA 3DPUA 1YVDA 3NDPA 1QZXA 4OK5A 3PG5A 4TTRA 3EWSA 4DC9A 4RSGA 2V1XA 2GF0A 1E32A 2BDTA 2IF2A 2BWJA 3PUVA 5JRZA 1G17A 4TZ0A 1JR3A 1QHIA 1NSTA 2G9NA 3FHOA 3LBNA 1RVDA 4AD8A 3K70C 2OFWA 4FMCB 1KSGA 1PZNA 1EFHA 4QJ4A 3CRVA 4G5SA 2E1RA 5DLQC 3QF4A 2X77A 3C4JA 1KMHA 2ZJ5A 4XVQA 1TQ2A 621PA 4OBEA 4NMMA 4D26A 4II7A 2WKPA 2WJJA 4O25A 3WHKA 3RS5A 4A2QA 2FMXA 3I61A 2FG5A 5FR1A 1IONA 2KWIA 5HCIA 3OFND 1BMFA 4ZIRA 1IY2A 3GLHE 3MD0A 3I92A 1CF4A 3TAUA 4A82A 3BOSA 2JDID 1E69A 3W34A 2Z0MA 1JQLB 4Z51A 1OH8A 3QSYA 2CJWA 3DOFA 5AUOB 1E2LA 1SKQA 3DMDA 4PTLA 1NVWQ 3WMGA 4FMBB 3IEVA 2DWOA 1XPRA 3UMRA 2V9PA 1UBEA 2R6AA 1Z08A 4URUR 3VR3A 5F98A 2REXB 1T4GA 2IXFA 1RRCA 1OF1A 3I4LA 3P4XA 2OG2A 5GJCA 1QHGA 2ZM5A 3BFVA 4IDPA 4DCVA 2R65A 4HDCA 4YXWA 1E96A 1EGAA 2PJZA 3EZ9A 3WYAA 1F2UB 1Y3AA 4WZBE 1XTJA 5LPNA 2CE7A 5KSPA 2QMHA 5M04A 1KYIA 4NZYA 1XXHE 3KXIA 3SJBA 1ZIOA 4O3MA 3IO5A 4PPQA 5EUMA 4KVAA 4M1KA 1Q57A 2EQBA 2ZTSA 3AGPA 4FW9A 2G6BA 1NF3A 4KYUA 4CF7A 2EU8A 2MSDB 1PUJA 3PEUA 1XDBA 4DHEA 1NY5A 1P62B 1G6HA 4HLQB 4NKRA 3Q7QA 2QEQA 2ZVPX 2QY9A 3EPKA 1XD2B 1NRJB 5FTJA 5JJKA 2A78A 4Q48A 1OKKD 4MH0R 2QT0A 5K8LA 2FEOA 3UMSA 4M53A 4MRSA 2ZRFA 2D74A 2I1QA 3O8RA 3U7GA 3K9GA 3RLFA 2QROA 1ZUHA 1QRAA 3UATA 3BWDD 3I8XA 4DT1A 1CJVC 4DLUA 3PEYA 4ESHA 2J46A 3I3SR 5C18A 2N42A 1Z3IX 4JVMA 3OZXA 4BZQA 3G0HA 3KKNA 1HA3A 3KKPA 5AJVB 4F91B 3B1XA 4TYWA 4GZLA 4LOAA 3MWLA 1CLUA 3QE0A 2REBA 1XEWX 2FOLA 3BBPA 2XTZA 3ADDA 1QF9A 1VKJA 1OIWA 4XSGA 3CNLA 2ZS9A 2UKDA 2ZU0C 2GCOB 2QSZA 1MT0A 3LRPA 3Q5EA 2IYUA 1JR6A 2KJQA 1E2KA 5L8VA 4JS0A 1DVRA 4QG7A 4TYNA 2C2HA 3M0EA 2HF9A 4KO8A 4LY6A 4JSYA 2OEPA 3FMOB 3AH8A 2XZLA 1J90A 1H8ED 3EZ7A 1GKUB 2VHQA 3BB1A 3QKRB 1UBFA 1ZAKA 4PAQA 2JJ1A 2FSIA 4EPVA 4GL2A 2FPLA 5B64A 5GVRA 3QKRA 1Z6AA 3I5XA 1M34E 1K5GA 2WWFA 5CYOA 1SHKA 2XTNA 1W7AA 3GJXC 3CZPA 1YKSA 1NP6A 3SYLA 2P2LA 2FN4A 1IJFA 3KKMA 3CF0A 2G0NA 2F1IA 2IBMA 4LV6A 4HSEA 3RSOA 2BV3A 1E98A 5FTMA 1NN5A 1H8HD 1KO5A 1Q3HA 2GXQA 1JJ7A 3EZ2A 1Z8FA 3K0FA 5EXSA 2B92A 3F3YA 4JLPA 2HYIC 1IY0A 2NO6A 5HPYB 2WJYA 3CR8A 4PZLA 1T6NA 2J7PA 5FUXA 4B2LA 1C1YA 2X2FA 1F3OA 4Q1CA 1II0A 2IYXA 4A8JB 3K9LA 2ZYWX 5A5GA 4JLKA 4NYJQ 1ZUIA 1I2DA 3FHCB 3KJGA 1KI4A 1GG2A 1SVIA 1OIVA 4WVFA 2ODBA 3CH4B 2YWGA 3ZZTA 1HTWA 4A15A 2AR7A 1TEXA 1OYWA 4OJQA 2QAGC 4OJKA 1CRQA 2ZYVX 4AY2A 2QM7A 1S96A 3ZD6A 4MYTA 2I3BA 1N6LA 4MKHA 4Q1BA 4V0LA 1TMKA 1L2TA 1XEXB 2YNMA 5D3MB 1E1RD 4UNQA 1P9WA 3GLFB 1F2TB 2EFEB 2HXYA 1PLKA 3ZIAA 1JQJC 4GT1A 3BORA 4IOMA 2HJVA 1YZTA 2OM2A 3K70B 1YE8A 3MWYW 1AJEA 1WRBA 4EKDA 3AVYA 3Q7PA 4WAUA 1J7KA 2JLWA 1XTKA 1S9HA 4DLXA 1W1WA 3T34A 3UPUA 1N6KA 4CEJB 2HV8A 4PANA 4JVSB 1OLOA 1N0WA 1R0YA 1IJEA 4B73A 3I62A 2YC2C 3B13B 3NBYC 1GRRA 3BFXA 1GRNA 1KK2A 2WZQA 4WZAE 4QM7A 1XTIA 3SNHA 1V43A 3X1ZA 4B2PA 1HV8A 2P6NA 1G3IA 3ZLJA 1U99A 3W3AA 3X1XA 3QNUA 4V03A 3WNDA 4YMTA 4DUGA 2DHRA 3HPQA 3LX8A 4IRUB 2DPXA 3CWQA 1ZNZA 5JMTA 2Q3HA 5FPKA 1E2FA 4GOJA 2IYWA 2QSYA 1X1RA 4XWOA 4CEHB 3D8BA 2QG6A 5EP3A 3B7GA 2XZOA 1A1VA 4DT1B 2BIFA 2C5LA 1YZNA 2GXSA 4MKGA 5G3ZA 1NNEA 3M6AA 4KFSA 1YQTA 4YMVA 1JXOA 3W6OA 1CTQA 2OO7A 4DB4A 2J41A 2QMEA 1F5NA 1R8QA 4RFVA 2GXAA 3OEED 3LQRA 2C03A 2BBTA 2WJVA 2EFHB 4A6XA 4B76A 1YZLA 2H18A 1XJQA 1MABB 821PA 1FFHA 2BM1A 2FFHA 2AWOA 4JZKA 4UXIA 2W2VA 4C4PA 2C9YA 2C8VA 1MKYA 1QG4A 3O47A 3IHWA 3L0OA 3FWYA 1MOZA 1EX7A 1TU3A 1KSFX 1UADA 5FH9A 4F38A 5ANRB 4AYWA 2JJ1D 5B58C 2AFIE 5DH9A 2NZJA 1R5BA 4KFRA 3QF4B 2J0UA 2W6JD 3VU9A 2F1RA 4YDHB 2JCSA 3ZH9B 3U3OA 5CITA 3QXCA 5FFMA 4A4DA 1ZCBA 5IHPA 2R62A 4MRNA 1OT3A 2ZE7A 1T5IA 1XPOA 5J4VA 1GKIA 4LCBA 3BGWA 3F5FA 3KB1A 1ESNA 1W2GA 1ZYUA 5H68A 4X8HA 4TZ6A 1ZNYA 3QXSA 3WNBA 2QQ0A 5FTKA 3ZVMA 4JVLA 5HZKA 1E9EA 1O3YA 3ADCA 1Z6YA 4V02A 3SJAA 1I4TD 3K70D 2NG1A 3DEFA 1W47A 2R6CA 4Q4AA 3UG6A 2WWYA 2BMDA 3CF6R 1ODFA 2KB0A 4V0MA 3IBYA 3PXGA 1KZ7B 3KUCA 2QA5A 4HLUA 4Q4AB 4QHTA 4D4KA 1P3JA 2IL1A 2VSOA 4H1UA 1FNNA 2ZE8A 1M7BA 4PX9A 4TQ9A 3ZVRA 1BYIA 8OHMA 4B6EA 1L7VC 4YDSA 1XMSA 4H1VA 4XD7A 1JJVA 2W6JA 4R71A 3GLIA 1OH7A 3DVLA 4HZIA 2QGNA 4I1OA 4ZCLA 1OYYA 4W5WA 2QPOA 1JXMA 2ATVA 2OAQ1 2HLDA 2ORVA 5J40A 2B7BA 4PO9A 1SQ5A 1WCV1 4LBVA 2AD1A 3DKPA 1KK0A 5EE9A 3TQCA 2ODWA 4YQFA 3PENA 1U0LA 1GNQA 4I1UA 5KNCA 3CB4A 5DYGA 4LJAA 2EW1A 4QKQA 3UIEA 4U00A 4GBMA 4F4CA 2C9CA 1T3LA 2ZUBA 4B71A 2A5FA 4IDHA 4QNMA 4YC7A 2GWHA 4BRUA 1LY1A 4JT4A 4W9MC 1NN1A 1E0AA 3UWKA 2PT7A 4AKEA 1XNJA 4ON9A 3N2EA 1H8HA 3EIEA 3TR5A 2FDCA 4QRHA 3OE7D 1IXSB 1CKEA 2HUPA 4TN1A 3K1JA 1COWD 2PEYA 1RRGA 2ZS7A 1UDWA 5CJ2A 1G8YA 3MCAA 3BH0A 2DCUA 4PFSA 3L0IB 3M4YA 4MYHA 2CCGA 1D2NA 1RRFA 3A1WA 1XCPA 1Z5ZA 3A1TA 4NH0A 1E4VA 3QG1A 1OE0A 4JVNA 4QBFA 4A0RA 4DLZA 1SGWA 3QI2A 4PQRA 3GPLA 1RIFA 1Z6XA 4RY2A 2YWHA 1Z6GA 3MRSA 2CEAA 3ECCA 2GVDC 2P6UA 1NL3A 3R7WA 3CM0A 2GCOA 2F3TA 1RE0A 1VYUA 3RVBA 4D0LB 1MABA 3TUIC 3ZVLA 4KLNA 2GF9A 1Q3TA 3VTKA 1GFIA 1BOFA 2NO7A 3U44B 1Q20A 2ZXUA 5KSYA 4HYYA 3I5YA 1V5WA 1MH1A 2EWVA 4WXRA 3U44A 2Q0HA 4AWXA 2VO1A 1T0JB 4TLEA 5EE0A 4OHWA 2Z43A 1XPUA 1GDDA 4BFXA 2NMVA 5CYPA 5FOSA 1SXJD 5EP1A 3F0TA 1D2EA 5FOWA 1SKYE 2H17A 3H0KA 1XJ0A 2IUSA 4JLVA 5FBVB 1YR8A 3FYHA 4HAVA 2XZPA 2QORA 3SYNA 2XB4A 4TSFD 3AF2A 2IYQA 3BH6A 2WJGA 2EYUA 1NIJA 3ADKA 3K0FB 2QM8A 1P61B 3KQKA 3A4LA 1IBRA 1GITA 2O8CA 4CW7A 1G7CA 1C9KA 5FI1B 4IEIA 4EFMA 2AXPA 2N46A 3PUWA 1E2QA 2QAGB 3AVTA 4KXFB 4JLJA 2PMDA 2E9SA 4LDJA 4D82A 1UPTA 1T0HB 2R2AA 4OQXA 2WPDD 4YONB 3UWOA 5DNYB 4KBFA 2W58A 1S9DA 2F3RA 3K8YA 5G40A 4BLTA 1KDPA 4DJTA 1PLLA 5BQ5A 3OHMA 3Q9LA 2MSEB 1KJYA 2D06A 3JVUA 1GAJA 1KMQA 1OFTA 2ZRAA 4B3CA 4TQAA 1MO6A 4M9XA 2FX3A 1D9ZA 2XX3A 3A58B 2A2ZA 2W6ID 3NDBB 3VX4A 3IGFA 4V0ME 2JA1A 1Z29A 1SVKA 2RCNA 1G20E 4URYR 1T91A 1Z47A 1KY2A 5AR1A 3N5CA 2W6IA 3IO3A 2VP9A 2HXSA 3T35A 3LAWA 1J70A 4B32A 4TL9A 1PLJA 3DM9B 5SZHB 3B85A 5GVSA 3K09C 5AJXA 4AC9A 3KJHA 4EPYA 3RS3A 4FCWA 3VR4A 2GEUA 4KBGA 1IXRC 4ABYA 3ICQB 3VKGA 2IS1A 2QBYA 2J7PD 2DFLA 3CRRA 5DO9A 5TXGA 2GCPA 1MRNA 4NYMQ 1D6JA 3U3KA 4AG5A 5J4YA 2QBYB 1XXHB 3ASZA 2CCJA 2XB2A 4A92A 3CLVA 1D9XA 4Q7KA 4NCKA 2IYYA 5CJPA 1X3SA 1GL9B 1T8TA 3BXZA 3THWA 1E9SA 2ONJA 1W36C 1I4LD 1ZM4A 1FOEB 3VR6A 3W3ZB 3FB4A 4OKSA 1E9DA 2YV5A 2P0EA 3U5ZB 2ZQ5A 1P75A 5JFGA 1GWNA 3DL0A 1G4AE 4WXPA 2ZETA 3GEIA 3ONWA 4L4UA 2JLZA 2H8KA 1YR7A 1M6NA 5LD2B 3H84A 3BIFA 5KTYA 1G9XA 1XEWY 3A1VA 1NG9A 1E9BA 5CLLA 3BK7A 3RRZA 3A4NA 1CULC 1WBBA 1G8GA 2QU8A 3GEHA 4B44A 1BIFA 1FNMA 4X8LA 1S0UA 1D5CA 5A4JA 4IDQA 1WQ1R 3CPEA 5FTNA 1LFDB 1S3GA 2V4ZA 4MGKR 3E1SA 4LHVA 3K9HA 3WP1B 1QHYA 3MLEA 5IF9A 1UAAA 3GJ6A 2GXUA 2YVUA 2ZR7A 4LPKA 4POAA 4WBSA 5DSZA 1GP2A 1JEEA 4L9WA 3EZ6A 3KTAB 3NG1A 1NI3A 3I73A 3W6NA 3BS4A 3KQHA 1KO8A 2XNSA 4KAXA 2ZEJA 4MUBA 4AKGA 1ZINA 3AVOA 3MJRA 4HLCA 1KI8A 2ZS8A 4ZCMA 2A5YB 1JECA 1EFRD 4ZO4A 5KOYA 1NIPA 1WDTA 1JAIA 1GNPA 4V0NA 2JLSA 5CB8A 2JLRA 1II9A 1MO5A 3QOFA 3VU9B 3K09A 1AQUA 1IQPA 1KNXA 2XXAB 3VKHA 2ZRHA 3OF5A 4UNNA 5ELXA 3CW2A 2F55A 4LBWA 4F93B 2Q9CA 1E2MA 4LYAA 1VYVA 2XXAA 4KFTA 3GCGA 2IF0A 1DELA 3I32A 1S1MA 5H8WA 1WE2A 3A6PC 2C04A 5JSZB 4JYBA 2QAGA 3NBXX 2NO1A 1XBTA 2X19A 1I4DD 1KO1A 2FSGA 1XMVA 1EFCA 2QN6A 1CJTC 4BQSA 5DHAA 1N5LA 1O87A 2ZUCA 3IEUA 1R5OA 4KODA 2JLQA 1F6BA 5UKDA 3VX3A 1Z63A 1U9IC 4RD1A 1FL9A 2OSBA 1EESA 4NHOA 5C4MA 2NPIA 2FNAA 3PR1A 4V0OA 5HR5A 2IS2A 5FTLA 5DN6D 1U90A 1PUIA 2IW3A 1H65A 2B7CA 4G5OA 4NCJA 4CVNA 4RCZA 3R20A 5JCZA 1EFUA 1YR9A 5DI9A 4QL3A 1S3SA 2Q3FA 3KX2A 3MSXA 4TMXA 5HE8A 3FKQA 3B82A 1U98A 5D3MA 4URZR 5AUPB 3OE7A 5HKKD 5FOTA 4MA4A 1N2CE 1VCNA 3FKSD 4LK2A 3TQFA 3ADBA 4KCGA 2G83A 3GLIE 1G8PA 4OK3A 5FPTA 2B6HA 5FPHA 5JLJA 4JLOA 4IVQA 4AK9A 4EPXA 1GRQA 4LUCA 2GKSA 5AWFC 2GAOA 4Q9LA 3RS2A 1IN6A 2KBEA 4US2R 2BKEA 1Z07A 4ZI3A 3HPRA 4QOSA 2O5VA 3EASA 4NCNA 1B0UA 1EFTA 1W4BA 2IEYA 5SZIA 4ZDKA 4PC3A 1RW4A 3TH5A 3KDSE 1XFAA 1UEIA 2CL0X 2VHTA 1FUUA 2VQSA 2ZRIA 3P20A 5DIFA 2JAQA 2RB4A 3C5CA 4P4UA 4HB2A 4UXHA 1EK0A 3EA5A 1NKSA 2WWWA 2VP2A 1ZM7A 2XSZA 3OAAD 1NVVQ 2Q3MA 4FD2A 2DBYA 1IAQA 1E1QA 3G5UA 3W8NA 1VTKA 1NN3A 1SHZA 5H70A 2OILA 3QBVA 1OKKA 4HB0A 2ZRBA 1XX6A 2NGRA 4JLMA 1NLZA 4JKYA 3THXA 4DEXA 4CEHA 2DWQA 4URWR 1TX4B 3QENA 4BASA 4C0JA 3LA6A 3SHFA 1KDRA 5J5CA 3AKDA 1JR3D 4HI0E 1SVMA 3C16C 2OCPA 4PXAA 2R6DA 4FXPA 5TDHA 2HJGA 4A8JC 3VR1A 2A5DA 2CHQA 2ZE6A 4URXR 2OV2A 2XNDD 1FMJA 2H5EA 1XJCA 3A4MA 1NBMA 3O8BA 1LB1B 2XJ9A 4NYIQ 4NTZA 5E7MA 1W46A 1Q1EA 4NYJR 2IS6A 1NKTA 2W0MA 4OQNA 4RD0A 3UK6A 4CEIA 2JEOA 1AKEA 1N6HA 1NMXA 2RKOA 3F8TA 1ANKA 1XCMA 3LW7A 3FVQA 3QXJA 2WWIA 4Q03A 2ZR0A 4NYMR 1VG8A 3BRWD 3UANA 2AHOA 1B23P 2IYTA 2PLRA 3LDAA 4Z1MA 4EJSB 1JI0A 2R9VA 3ZVNA 1N0UA 1G3QA 1CRPA 1J2JA 1TQDA 1OIXA 2J7KA 4S2EA 2J0UB 4Q4LA 2YWEA 4XVRA 1ELOA 1YR6A 1BO6A 1N25A 1PV4A 1S8FA 1S2MA 3VFDA 4KU4A 1DG3A 1WMSA 2BOVA 3ND9A 3O8DA 4NPHA 2CHVA 1HT2E 2F9LA 2ZI3A 2DY1A 3QXXA 2UVQA 3U61B 4XVUA 3RS4A 2IYSA 3LNCA 2OFOA 3NKVA 1LS6A 1ONBA 4Q4JA 3KL4A 2ONKA 1GVNB 3QXHA 2EFDB 3IIJA 4XJXA 1ZNWA 2W83A 4CIDA 2JLUA 4ZIRB 1LNZA 3IHLA 1BMFD 1DAIA 2OXRA 4R2HA 2HCBA 2VA8A 3VHLB 2GJSA 1X6VA 2CLCX 2HF8A 3IPXA 4JL5A 1VG1A 1KI3A 2D2EA 2YOHA 3QPUA 3W90A 5KPDA 1RRPA 2VP5A 1U0JA 1P9NA 3P32A 3U4QB 4A8JA 4RVCA 5JS8A 1KTVA 4HEJA 2GA8A 2HEIA 4KSBA 5FPSA 3C15C 1ZJ6A 4P4SB 3SDZA 4MDFA 3NC1C 4ZPXA 2ZPTX 3CX8A 3IPYA 3EW9A 1KO4A 3FFAA 1JBKA 3O8CA 3GJ4A 2ZAMA 1TL7C 2ZJAA 3LH5A 3RYTC 5HZHA 3U6KA 1Q22A 2P67A 1CJUC 1E0JA 1KI6B 1P2TA 4OQFA 3V4RA 1VYTA 4UXJA 4PSAA 3RRYA 2D2FA 1LF5A 1KSHA 5E4FA 3T61A 2OCAA 4IFEA 4C3ZA 2WKRA 3GFTA 3AB3A 4QC2A 5HE9A 2BCJQ 1F2UA 5JWRA 1KI7A 4B3BA 1GM5A 2CK3A 2CDNA 4TYYA 1VIAA 3H1TA 4FN5A 5KNDA 4MRRA 5FI0B 3K0EA 1FZQA 5BYJA 1TF7A 4LX0A 4Q4HB 5LD2C 2J3EA 3H2YA 4F4IA 3RSLA 3RS7A 1R0WA 3U3JA 4OHYA 4NDZA 3TSWA 3RC8A 2GVZC 1Q0UA 3KKQA 4R7ZA 1LV7A 1OXTA 2F6RA 5IK2D 3KB2A 4TL8A 3QQ5A 2OCBA 4DSUA 1YZUA 1XB2A 1Y63A 1DAFA 4KI0A 4UKDA 5KYKA 3TR0A 1OPXA 2GEVA 1VCOA 2QRZA 2GJ9A 3NH6A 5FL7A 5JZVA 1HQCA 1CIPA 3R8FA 1AIPA 2WTUA 4IKEA 2BMJA 1IOZA 4A0FA 1KK3A 4B43A 2CNWD 3CONA 4QXAA 2ZI5A 3TW8B 1Z6TA 4MYUA 4NCHA 4GOKA 4A6PA 4HZUB 2FFQA 2CL7X 2OHFA 3V4FA 1KZGB 2OLJA 5FUWA 1D8TA 4FCVA 1JPNA 2WJIA 2Z4RA 4RJLA 4MRVA 4HZUA 4MGYR 1UKVY 3LLUA 2ZRGA 1U8ZA 4QFMA 4RCYA 1NSFA 1AS3A 2NQ2C 4IW3B 3JZAA 4C7OA 4M8NE 4BLRA 4F7WA 3ETLA 2B8WA 2O8EB 3WYGA 4Q1AA 1XTRA 1FP6A 4LV8B 4QBHA 5KSOA 3PVSA 3KQNA 1SZPA 1U94A 4U5XA 3T5GA 3RANA 3SN6A 4DKXA 3TVTA 1Z83A 4GNKA 3KTAA 3OESA 2ZUDA 2FPKA 4DSTA 1DTSA 4JBYA 4EJSC 3KQUA 3HU3A 5EQTA 1QHHA 4D4LA 2O8FB 3R9XA 1ESMA 1QBKC 4Q7LA 2IUUA 4HAYA 4E22A 3RS0A 1A82A 2A5GA 2IK8A 4M1TA 3CUEF 1Z2AA 1UF9A 3VR2A 4E09A 1YJ5A 4P0TA 3LQQA 3PUZA 4OI2A 4GDFA 4KHZA 1SVLA 1ZD1A 1OHHA 5B57C 2Z4SA 4IOLA 1XU4A 5CB6A 4LRWA 2LKCA 1G41A 2WSMA 4IEEA 1R0XA 3W5JA 5IRCD 1DOAA 1ZM2A 4HB4A 5AJWA 2R8RA 2KE5A 1CP2A 2BVNA 1P72A 4C0QC 1E2PA 3GJ0A 1CR1A 2ZYTX 3A36A 1COWA 3FHTA 1DS6A 3IDQA 3MUFA 4DLYA 3NC0C 5A0FA 4DLTA 3RDPA 4TLBA 1ZC4A 2KBFA 1W5TA 4EAQA 2ZI7A 4DCSA 2C99A 2FSFA 1E6CA 2WV9A 4D0NA 4QNRA 1P6XA 1II8B 4DXAA 4V0KA 3AF4A 2ZANA 2DFNA 1PVOA 4HAZA 1Z28A 3ICEA 2HDNB 3OIWA 4PHTA 3TKLA 4J0QA 4XD7D 5SZKB 2NIPA 3LFUA 4PR0A 2BMEA 1U8YA 3IQWA 2IXEA 3PCRB 2V6JA 3GLFA 2C9OA 4U02A 1F2TA 1MR3F 1HUQA 4NYIR 1E1QD 2QPAA 3WY9A 2NPFA 3CR7A 4Y0VA 4ARZB 4N0EA 4AIIA 2BBOA 1XEFA 1AS0A 1VMAA 4PHHA 4D6PA 5BWMA 1H8EA 1XXHA 4PSVA 4MQBA 2EYQA 1JAHA 5B2ZA 1A2BA 1OB2A 2OFXA 5J47A 3TUZC 2QQEA 3D3QA 1F48A 3C14C 2V7QA 3T1QA 1TQ6A 1BKDR 4DZZA 4L16A 4BFVA 1U9IA 1TNDA 1W0KA 1SVWA 4BLPA 1P2VA 3E5HA 1GOTA 5JJIA 2W2TA 5BYKA 1CR2A 3ZS9A 4D0GA 5J4KA 4F4JA 4L5BA 1P2UA 3U7HB 1L4YA 2CK3D 2F9MA 3I1FA 4D4JA 4DDTA 1G3RA 4DB2A 1KKMA 2GAAA 4CT4B 3Q72A 2WPDA 1HY3A 5C46F 3FOZA 1KSJA 1OFUX 2FGJA 4P3YA 2I4IA 4BFWA 1E2HA 5JJLA 2OXCA 1U81A 1N3BA 4PQYA 3R9IA 5FOVA 3U7FB 2QL6A 5JEDA 3A8TA 5CM9C 4Q9IA 5EXTA 5DE3A 4YMUA 3AQ4A 1G16A 4FCTA 2J45A 2L0XA 5CIQA 5TY0A 4Q00A 1CBUA 1QVRA 2VHUA 4G5GA 4JBXA 5KNBA 3BE4A 1Q12A 2ZRKA 3GQBA 5KSZA 4CDGA 3R7WB 2CNWA 4Y0AA 2P5TB 1E2NA 1OFHA 1LF0A 3IIMA 3KKOA 2A3RA 2OESA 2AKYA 2FJUA 3WXMA 2P6RA 4EIWA 3IBGA 2PCLA 4G01B 4O2LA 4PQFA 3P26A 3GLGE 1TU4A 4S35A 2BCGY 3FGNA 4C9BA 4JLBA 5FBLB 4DUGD 1IXZA 3UXMA 1TQ4A 4Z8XA 2FZLA 5HTKA 2ZROA 3IQXA 3C8UA 3X1DA 3BAFA 4HDOB 3SZRA 4BZXA 2KI5A 1E99A 4LZZA 2J1LA 4AKIA 1VG0B 3QPVA 4D81A 2Q6TA 3P4YA 3L2OB 3MWJA 2MSCB 4LJ4A 2NOAA 2RGEA 4B3GA 5EE1A 2QE7A 1W4CA 1MO4A 2EFCB 4A36A 3BERA 1GL7A 5E3HA 5JWOA 2D3WA 1KDOA 3HR7A 2QGZA 4E07A 3NEYA 4ILEA 1W44A 2PZEA 1SVOA 5JSZA 1AZTA 2BJWA 3EA0A 4GRAA 1WP9A 2CCKA 2O0JA 1W36B 5FBQB 1KY3A 4N3NA 3VKWA 1T9HA 1N5JA 2YOGA 1G5TA 2QI9C 1EWRA 2EFGA 3B2EA 2AWNA 1BYUA 3RAPR 1ZIPA 2OE2A 1E0KA 1VG9B 5CDFE 4ZKDA 3QVUA 1W0JA 4LBYA 4XOIA 2WICA 4MKIA 5DHFA 1S1CA 4QGFA 1IY1A 1II8A 2ZSAA 5FOXA 3GLIB 4EPWA 3CF2A 4HUTA 5C2JB 1KI1A 3EXAA 1UFQA 4IOJA 2Q9BA 1DE0A 2OCYC 4Z54A 3CRMA 4FI3C 2ZJ2A 4TMVA 2CVFA 2JIZA 1ZCAA 1ZU4A 5F9HA 4OI0A 2GCNA 2QUZA 1T3SA 4Q47A 1UKYA 5JHHB 3SBDA 2OBLA 3GP8A 5KPJA 2JIZD 2WKQA 1ZVQA 1XEXA 2QP3A 3W8RA 221PA 2K5UA 3KZ1E 2DFTA 4EUNA 3VQTA 4C30A 2QP9X 4PHFA 1TADA 1TF2A 2CBZA 4K46A 5CK5A 6Q21A 5E7IA 4FINA 2VF7A 4BUJA 3EPJA 3QUSA 1U2RA 2ODNA 3RWOA 3TLXA 1US8A 1R6BX 2B21A 4EPRA 1SXJB 4PO1A 1XMJA 3EWAA 4BE7B 1N6RA 4G5RA 4N0DA 4NP6A 2IWRA 3WP0A 2EWWA 4C0AC 2WOOA 4TL6A 1GZSA 3HR8A 5JCPA 3C41J 4M4SA 3B1ZA 3TNFA 3B1WA 2R6GA 2PH1A 3MG9A 3QEOA 4OHVA 2UZIR 4FIDA 3T1OA 1DADA 2FA9A 2WWGA 2LWIA 1P4SA 1GUAA 1VHLA 4RD6A 5JI3E 3GEEA 1JNYA 1Q1ZA 1NVUQ 2WM9B 3PQCA 3SFVA 3AF3A 1JR3E 3QF7A 5G41A 1XMIA 3THYB 4IHQA 2C95A 1G7RA 2VP0A 1RZ3A 4FWIB 4BLSA 4JKIA 4RZXA 521PA 2HT6A 1G21E 5CM8B 3THYA 3TGPA 2N1BA 5BW8A 4M9QA 1OFIA 4BFZA 2D7DA 4M9SA 2V8OA 1T5LA 1K8RA 5DN6A 2DB3A 4C7OB 4QGAA 4G1UC 1SVSA 1G8FA 1NBMD 1WXQA 1OXSC 2GEDA 2O52A 4Q01A 2J87A 4WZ6A 5K8UA 1UBCA 2GRJA 2QTFA 2BBWA 1FPMA 2HLDD 2FSHA 4DCUA 1GTVA 4Q21A 2C77A 5LDDC 1IN8A 3K0CC 1JPJA 3VNUA 3MMPA 2XSZD 1QHHB 2D4HA 2ZJZA 4Z8YA 3HP1A 4RZ3A 1HURA 4GP6A 4WW0A 4XWAA 2Q9AA 1WB9A 2ZU6A 1KNQA 4KLZA 2C78A 1G3UA 2VPPA 5SZJA 4IJMA 4M1MA 3U3MA 4AG6A 3WMEA 4XSHA 4LV5B 3B1YA 4E03A 1YRAA 3U7EB 1Q1BA 1HH4A 1CJMA 2ANCA 4R98A 4JLNA 1FQKA 3PUYA 1E79A 5J4LA 2GESA 2F1JA 4Q19A 4AI6A 3LBHA 2UZ3A 1G1MA 5TARA 3RC3A 2IYZA 4X8OA 2HYDA 2WMNB 3L82B 3SOPA 1EG7A 4US0R 3EC2A 3DOEA 5IDVA 2PLFA 3CPHA 3HDTA 1UEJA 3PEWA 3CNOA 1FQJA 3CIOA 1DAGA 4PAMA 1JB1A 1NLYA 1IM2A 3AVQA 3QG5A 3W5IA 3OEHD 3BD9A 1ZM9A 4GP7A 1KDTA 5FR2A 3UMFA 5JBQA 2CL6X 2EVWX 3E2IA 1SXJE 3SFZA 1OH5A 2YINC 4M1OA 1G19A 4ESVA 1FP7A 4OI1A 4FMDB 2WVJA 3SBEA 3TSZA 2O8BA 3LY5A 1XTSA 2A30A 2OT3B 2RH5A 2VYFA 3B6EA 3NWJA 3OIVA 4LSGA 3CH5A 2OAP1 2QTVB 4ZI2A 1M7GA 4ZDIA 3TAHA 4E5UA 4BGDA 4L8GA 1X8JA 1GL6A 1NBME 2VSXA 1E9FA 3TIFA 2ECKA 4LPSA 1OXUA 1P73A 5L3VA 2OZEA 5DISB 2YHSA 4GPTA 3TSOA 2DYKA 4ZDWA 2WHXA 1CJKC 1IN5A 4ARZA 4ASUA 4CYMA 3VNVA 4B74A 2H7VA 4PZZA 2IWHA 5CIWA 2P65A 4KSCA 4CEJA 3FMFA 5E95A 3NHAA 2JJ2A 1U8AA 2IUTA 5GJWC 1AGRA 3FMIA 3NXSA 1CEEA 4K81B 3T1VA 5P21A 1OXXK 3L8ZA 5K8TA 3BC1A 3ZS8A 3B5JA 4RZ2A 2ZREA 2Z83A 1KHTA 2ZYUX 3LWNA 4I1SA 3MAAC 4LYHA 3V00A 4DDWA 5EXPA 2VL7A 3CNNA 3VAAA 1FW6A 3W9YA 2OLKA 1E2GA 3QBTA 4TTQA 3T5DA 3G82C 4MRPA 4LWZA 2Q21A 4Q9JA 4TLDA 3LV8A 4JT2A 3RWMB 4CRWB 2RGXA 1G3MA 4LBZA 3THXB 5EUQB 1N6PA 2YZ2A 4B3FX 3R9WA 3AUYA 4M1SA 3M1IA 4GMXA 1X8LA 3PUXA 1TTTA 2IYVA 3NVAA 1DPFA 4HAWA 4EFNA 1N5KA 3CKLA 3B9QA 3LD9A 3QKSA 4G0NA 4P4TA 1X1SA 3H86A 4AYTA 4B75A 2ZSFA 1QHNA 2XNDA 1QHSA 2GBLC 1XP8A 3N70A 4JMPA 3AF1A 4IVPA 1SXJC 3SE0A 4RFSA 4D2IA 4JSTA 2ZSDA 4B35A 1HE1C 3MFYA 3AUXA 4LJ7A 3NBFA 2FFBA 2V1UA 1DAMA 1DARA 2G3YA 4ERNA 1XD8A 3EX7C 2A9KA 2BM0A 3WRXC 2X8AA 1HQYE 3B78A 1MV5A 2CLDX 2GHIA 1M2OB 2RGGA 2V54A 1NJFA 2Z5FA 2TMKA 2ZRNA 4HDQB 4JYCA 1R2QA 3EIQA 3GLHB 5EXXA 4C2TA 3L0PA 1KI2A 2B8TA 4HLUC 2PCJA 4GOXA 4M1WA 2RAPA 1XRJA 2FZ4A 3L0SA 3GLGA 2ZJYA 1M8PA 1TUEA 2PX0A 1OXVA 2PZFA 3A37A 1E1RA 3HYTA 2H57A 3SC3A 1E9RA 2JGNA 5GADl 4D25A 1IHUA 2LKDA 3EPLA 4B34A 4DCTA 1L4UA 3B60A 2O8CB 2FWRA 2ZRCA 2IHYA 5AK0A 5FPYA 4HUQA 2WAYA 1ETUA 4LJYA 1AGPA 2ZI4A 2PJRA 3MGCA 4HUQB 4OYHA 3RRNA 2YOFA 1DG1G 4IDNA 2XEXA 2VP4A 1G4UR 1WBDA 2J5XA 4DWJA 1A2KC 3AVVA 2WWXA 3SYKA 1Z0KA 3WRYC 2FH5B 3FPAA 1N0VC 2O8BB 3U4QA 4GI7A 4EDHA 2ZITA 2VRWA 3CRW1 5J4HA 2QE7D 4P4SA 2PL3A 2VP6A 2WMOB 5L3SA 1KK1A 3WBKA 1XTQA 3SI7A 1W48A 4EPTA 3N2IA 1HYQA 5GJVC 1KI6A 3Q8XB 2IHBA 4JL8A 2LCFA 4YLGA 2QAJA 3V9PA 3P27A 1ZNXA 5AJYA 3LO5A 3VHXA 1Z2CA 5KDDA 5EE3A 3REFA 3FDIA 1QVAA 2AK2A 4TQUS 1RYFA 3OFNA 1KI9A 1NLFA 4XH9B 4MYCA 3KJEA 3HYRA 2JLVA 5BN3A 1NJGA 2FE4A 1US8B 2D62A 5TB5A 2ZRMA 1SXJA 2WAXA 1DAKA 1N6NA 3WNCA 2AXNA 1P2SA 5AUQA 2ANBA 3CBQA 4AURA 3LBIA 1K5DA 4Q7JB 3RNLA 2QNRA 1CR4A 2CHGA 3AV0B 4C0HA 2IS4A 5G3YA 1FUKA 1EXMA 2X1VA 4LGMA 1N6IA 1HE8B 2J0SA 121PA 2RGBA 4FMDF 3RHFA 4HAXA 2ZAOA 3SJZA 4UJ3A 4UNPA 3KJIA 5L3QB 2AL7A 4PHGA 4P32A 3GJ5A 1AKYA 2F7SA 4TMTA 3KQLA 4B3XA 2ORIA 1R4AA 3TUJC 1W0JD 3SR0A 4BFSA 1QHXA 1EFRA 3BJIC 1QG2A 1ZW6A 3GJ3A 2YWFA 3ZQ6A 1P9RA 3EZFA 4UNSA 1NMZA 4PC7A 1UM8A 1Z0FA 3AP1A 4X8MA 1E2JA 3VMFA 2AKAB 4B3DA 4B48A 2FPMA 4H9GA 4PC1A 3QKSB 2VBCA 2ZRLA 4ZV4A 4LC0A 4US1R 4TSFA 1G291 1QDEA 5DGXA 3QVVA 4IVRA 3GFPA 4C0KA 1VHTA 4OHXA 2CVHA 4DLSA 2RHMA 3U2QA 4D4MA 1RJ9B 3JZMA 2Y8EA 3FMPB 3JVVA 2IA5A 2R6FA 3Q85A 4MGIR 1IN4A 4K8OA 1E2IA 2ZSEA 1P60A 2O0KA 4ASUD 2O8DB 1E4YA 1W4AA 1ZD8A 2VIIA 1OW3B 1PJRA 2RGNC 1NVXQ 2J59A 1FTSA 5JEEA 2GK7A 4QGGA 4CT5A 2VLIA 4BLOA 4A2WA 5EJEA 4Q1DA 1ZRHA 4DRZA 1OB5A 4DIDA 5EZ6B 3VR5A 1XD9A 3GLGB 4CZ2A 3PJRA 1KAOA 1UKZA 2ZRDA 4Q1EA 4JJKA 4Q4JB 2ZIAA 3SQXA 2ZR9A 2XTMA 1R5NA 4LI0A 4RD3A 1N6OA 3AKEA 2GJAA 4TLCA 5FBWB 3DM5A 1S4QA 1KGDA 2ZJBA 3GJ7A 3QKTA 4BLQA 4DBLC 2RGAA 1T8UA 4UQOA 4RKFA 2AX4A 1Q44A 5BN4A 2F43B 2ERYA 2V7QD 3AGQA 2JDIA 3ND8A 2WSSD 3P1JA 4OI4A 2CJWB 3OIYA 4MUAA 5HCNA 5LB2A 4B33A 1CS4C 2GZDA 3AEZA 1AZSC 1GKYA 1KJZA 4HLDA 3TMKA 3AP3A 5JS7A 2AD5A 3FE2A 4P31A 4TLAA 2GZHA 1RPZA 4RD4A 3WHLA 1SULA 3OAAA 2CMKA 3ZDQA 4TMWA 1CR0A 4NU0A 3GMTA 4JJZA 3TJZA 2FV8A 2JJ8A 5EE5B 3WBJA 1YU9A 2G1JA 2QT1A 4JLAA 3AKYA 3AM1A 2HT1A 4YXWD 1GSIA 3A1SA 1DAEA 1LS1A 2BKUA 2J0VA 1CXZA 4Q4HA 4PZYA 1KKLA 4G3XA 2A5JA 1YHNA 5JWHA 2WBLC 3LW8A 1RYHA 3LXRA 1ZMXA 3KFVA 2XJ4A 1D2MA 2ZI9A 2SHKA 3BFKA 1YZKA 4DLWA 1FX0B 1P7CA 3AP2A 3PV0A 3GLFE 3QJYA 4NONA 3DZ8A 3KXLA 1XCGB 4CGZA 5F9FA 1FX0A 1J99A 2VTKA 1XWIA 3T15A 4XWKA 2IXGA 3NEJA 3B9PA 3WMFA 5CK4A 3L8YA 4LJ8A 4OL0A 1BH2A 1LVGA 5G53C 4I99A 5KU1A 1XD2A 1KIMA 2JATA 3EAQA 4L9SA 2GDJA 4BECA 4M21A 2FF7A 5L3QA 4ZCIA 4OK6A 2GJ8A 1M1YE 3EIHA 5FL3A 4AKHA 2DR3A 3IUYA 4B2IA 1E94E 1Z0DA 2ORWA 1HEIA 3SS8A 1AA9A 5BXQC 2YJTD 4OHZA 1NMYA 1G7SA 4QBGB 3CPJB 4GFDA 1A5TA 4BEJA 4JL6A 2OBNA 1YZQA 4TYQA 5TV2A 1NG1A 3LVQE 2WIAA 1JALA 5EP2A 2JLXA 5K8IA 3QEJA 2GILA 4LHZA 5KO2A 4PO8A 5DYIA 2PBRA 3ZIAD 3UG7A 3LVRE 3E70C 5EZ5A 1AS2A 4EQ6A 2PX3A 1VECA 2AFHE 2AN9A 1TAGA 2ATXA 2G77B 4U7DA 2JLYA 3FKSA 4YMSA 4RFSB 4D80A 1G5RA 4M22A 1T3HA 5CDFA 4EQ6B 5KHOC 1VDZA 3H4MA 3S1AB 5AJZA 3HJNA 2NO0A 3DHWC 3K0SA 1M74A 4C2UA 5H1YA 4URVR 4M9ZA 2F1HA 4TMKA 1I2MA 3S1AA 4DSNA 2WWHA 5JI2E 3DMNA 3KXKA 1KMHB 4AYXA 1C4OA 3EC1A 3GLHA 4UJ5A 5EP4A 4TYPA 5F3WB 2OUKA 3LLMA 2BBSA 2P3SA 2PT5A 1AN0A 1ZBDA 3X1YA 5FL7D 3LXXA 1LTQA 4QGHA 4TL7A 3DDCA 1XF9A 1ZD9A 3QPWA 4HB3A 1J8YF 3NH9A 1AQYA 2IEZA 4KV9A 1GILA 2MMGA 3FTQA 4Q7MB 3D31A 1UDXA 2R44A 3ASYA 5KUTA 3IIKA 4I1VA 1KAGA 3K53A 4QM6A 1TEVA 5LB4A 5L3SB 5FBRB 4MITA 2JJ2D 2ZI6A 4F92B 2ZJ8A 4QHYA 1BS1A 4BZPA 1Q1QA 4ACBA 3EARA 5B30A 4Q9HA 4DSOA 3BH7A 1OV4A 4DCNA 3L43A 2DFKB 3TBKA 3SEAA 3KFXA 2XOKA 4IXMA 4NE2A 3AVWA 1DO2A 1Z22A 4A0GA 4M1YA 3NIBA 5F2EA 1VPLA 1R0ZA 2V55B 4XIGS 1IN7A 4MKFA 4QJ3A 2NO9A 2ZSBA 1R10A 3C7KA 2O0HA 3NBZC 3HU1A 4C0SA 3MJHA 1P5ZB 4KVGA 4A0HA 3T1TA 4DIEA 3AVUA 2C98A 1VIYA 1NVVR 1Z0IA 4C0BA 3SJCA 1CU1A 1GIAA 4A1FA 4UNRA 1XZQA 3TW4A 2HCJB 4M2LA 421PA 1HT1E 4A2PA 2RGCA 2CLSA 3THWB 3W6PA 2J0QA 2A7QA 3ZQJA 1E79D 1TF5A 4LHXA 4Q5IA 3RABA 3CRQA 3TVDA 2IX3A 5HKKA 3T06B 3B8HA 3PITA 3CO5A 3D7MA 2RHDA 3CX7A 3Q3JB 4R9UC 3FFBA 1GNRA 4OQLA 1KJWA 4RZUA 2IT1A 1FMLA 4HAUA 4PPFA 4NBSA 4QHSA 3C5HA 1G64A 2Z6VA 3IKJA 2FFAA 3I8SA 3RRMA 2GTPA 4Q02A 3R8CA 5IT5A 1EX6A 4Q66C 2QP4A 1F60A 2GNOA 1NY6A 1TUIA 4GZMA 3AVPA 1ZUNB 3ZYCA 2WSSA 4LHWA 2NTYC 3K0CA 2RGDA 1M7HA 3GFOA 2OBMA 3K0AA 4DLVA 1RFLA 2H1LA 4YMWA 4C0LA 2WIBA 2GK6A 2ZRJA 4M0LA 2BEKA 4PC6A 4BFYA 2O8EA 2VSFA 3K0AB 4PPNA 4TTPA 3HWSA 5JECA 1E2EA 2G0TA 2X2EA 4Q1FA 1RKBA 4NL4H 5KDOA 3ZZUA 1YRBA 4CEIB 2V3CC 5GJBA 2V6IA 3TE6A 2H16A 4DVGA 1Z0JA 2GBLA 5JHGB 1OH6A 1AK2A 1G8HA 2H92A 1R7RA 1UJ2A 4IDOA 3D6TB 3OIUA 5FUVA 4EJSA 4EFLA 5D3QA 3UKDA 2G88A 3J81k 2O8FA 1R8SA 4RD2A 4LYFA 2QPTA 4I81A 2C96A 2ERXA 4W7SA 2ZJOA 3PFIA 4DLRA 1MO3A 4PAOA 5BN5A 3ZD7A 1MRSA 3GD7A 4BFUA 3I72A 1ZU5A 4RKEA 4IFBA 5KDLA 5TVKA 4R2IA 2VH5R 2W00A 1OHHD 1DEKA 2YYZA 2BEJA 2IC5A 2QMOA 4ITRC 2FEMA 1VCIA 4JLDA 1G6OA 4BRWA 4ACAA 1X86B 4LJ6A 2ODEA 5JRJA 4Z1MD 2QMUA 3DO6A 4O0MA 1G5PA 2JASA 5L3RA 4BPBA 4GSYA 1K6MA 2DWPA 1A4RA 4W5JA 4LC1A 1E9AA 2XGJA 4PSKA 3QKUA 2F43A 2VEDA 2GJKA 2IYLD
chains in the Genus database with same CATH superfamily
5JW6A 5M29A 4BFTA 3Q3VA 1JEQA 3V4LA 1N5IA 2PZGA 5H5JA 1E9CA 5T5QA 4X66B 1LA2A 4LE0A 4Y8VA 1S7GA 2QX6A 2W6QA 2X7XA 4BWYA 1G18A 1W0CA 4DUPA 1E0SA 5DLEA 5I3ZA 1CC1S 4QVGA 3PSHA 4D5EA 3TRFA 3VPGA 4ZKEA 4AKSA 4DNFA 3Q41A 5I7EA 1U63A 1WB5A 2L42A 4KRFA 4ZTZB 2GR9A 1NZJA 2J9RA 2ZYDA 2YKGA 1ZC3A 3A6EA 3E61A 4PPGA 2Q5LA 5DXJA 4Q18A 3UC5A 1NN0A 1P7YA 1TAHA 1X8KA 4FMCF 4E5KA 4IQ0A 1A7KA 4QJ5A 4GPIB 3U60B 4Q37A 4NCIA 3A1UA 2EHDA 2JEZA 2QENA 1P4RA 2W6ZA 4LVOA 2O3TA 4WY5A 3JXEA 3VH4A 1J56A 2C97A 2ASEA 2J0EA 1TC2A 3GDOA 4HGPA 3TW6A 5C4GB 3F67A 1UFKA 1XC7A 4LYJA 4DBZA 4JGGA 4CFSA 2MMCA 1DO0A 1I3CA 2BGRA 2VJAA 2AZMA 3TBFA 4G5QA 1OMOA 4I19A 5LOVF 4P5PA 1DX4A 5TQJA 1J8MF 1OJLA 3LYHA 3CX6A 2IEAA 4I8XA 4RC9A 3KOXA 5TMPA 4RWEA 1TJ4A 2WF7A 4B47A 2I2BA 4E46A 2AF4C 3O1LA 5NULA 3E18A 3AERA 3P0RA 2O4UX 4K6OA 3E9DA 1AQJA 4IS2A 1B26A 4EITA 2WOJA 3SHWA 4TT3A 1UT6A 3HU2A 2BJVA 1E5VA 3QW4B 2DETA 4G5XA 2IYRA 1KO7A 5BSEA 1U8EA 1ESZA 3O8QA 2QLBA 3TKYA 3O4HA 4AMUA 3SR3A 3T12A 2D1SA 1F8UA 2RMKA 3AR5A 5T6BA 3WKCA 3JQ7A 3O8OB 2ZKLA 1MVNA 1T3TA 2UYQA 2CNKA 4R5HA 4W5HA 4DDUA 4KITB 2AMVA 4QPJC 1MU0A 1W94A 4IXWA 4XTRA 3X1KA 8GPBA 1PWYE 3B3FA 3QWHA 2BHRA 4L7VA 1MB0A 4CU2A 2Z8XA 3Q5DA 1EDZA 5K51A 3PEVA 2APJA 3COVA 3R3XA 2QRUA 1C9EA 4NFHA 4WLFA 3ROZA 1D6NA 4GMDA 1E3MA 3N2ZB 4IFIA 1CX9B 1K8QA 1RHQA 2UZ0A 4NOKA 3T7IA 4DLLA 3FCUB 1U2GA 2DQSA 5HILA 2ZRPA 3MF4A 1SQGA 4MAAA 1TECE 4UMFA 3WGLA 4UVIA 3WK4A 3GR6A 2AMFA 1XQWA 3DKVA 1W36D 3FFWA 4HH3C 3UJHA 1CUXA 3OTOB 1FDVA 1GZVA 3AVXA 2GZAA 1AM4D 2I1VB 2QNIA 4FU0A 4GE3A 4WY2A 4KQ1A 2PUJA 1CJBA 2C5HA 3LWBA 4MTLA 4OP3A 3ST7A 2O8DA 1OTXA 1Z7YA 4P22A 4BMSA 2HM7A 1QZXA 4BB9A 3RSHA 1E5DA 4RSGA 5I8PA 2JZCA 3PUVA 5SV2A 2W9XA 4EBFA 1QAMA 2E48A 3C5WP 1JR3A 1NVFA 1QHIA 1QR2A 2CHEA 3DCNA 1M9NA 3G5AA 3LBNA 2OFWA 2PAFA 4FMCB 1T5BA 4JN6B 4JUDX 4LG1A 2ZOSA 1EFHA 1X7HA 6LDHA 2YFQA 4G5SA 4BO6A 2E1RA 4AZTA 1JDZA 1YB4A 4GGMX 4IDAA 5DHPA 3TEFA 1QH1B 1FNCA 2BP7B 3G17A 4P3XA 4RH0A 2ZJ5A 1RI5A 4FBMA 1IEQA 5GOTA 5JNTA 3G9TA 3ILHA 4L75A 4NMMA 4II7A 4X6UA 4O25A 2PUCA 2JF0A 2PGXA 1RWKA 4P54A 5FYDA 4D9CA 2FRVA 5JXGA 1Y6RA 3WHKA 2A92A 4AMZA 2FMXA 4FGSA 1CUEA 3I61A 2FFJA 2FG5A 4UBJA 1ZCZA 2R8PA 3WGZA 4E5MA 3JQRA 4RSHA 3WHPA 4WOCA 1L4HA 4H3HB 3WL5A 1Z2NX 2IYFA 3IPLA 3O3CA 4RADA 1TGVA 2Y4OA 3MD0A 1JZTA 2VAMA 1AGYA 1EFPB 4X63A 5CGQB 4TTIA 2NP7A 2JDID 1FVOA 2Z0MA 3K9FC 4QFBA 4Z51A 1UCFA 4CIYA 1OH8A 3QSYA 5JXHA 4BO9A 3ZU5A 3PFNA 1A8QA 3FNBA 3VRHA 3DMDA 4OM7A 1M1ZA 2C5BA 3E2PA 4MP6A 3ZV3A 3IEVA 1CR6A 1PQPA 1Z08A 3CUYA 3VR3A 1FNSA 1MQSA 4NZZA 4E1BA 5F2OA 3QITA 1T4GA 3FROA 3ADCA 1R0BA 4BNJA 3EG9B 2PLAA 1DC8A 3ESYA 1NYRA 2ZT5A 1FB5A 4I4TB 5KYGA 3MTEA 4YT4A 3I4LA 1LZLA 3RR2A 3DL7A 4M76B 1K4KA 5LOVA 1HDYA 3DR5A 2ZBEA 2XVMA 4JXJA 1N1GA 4DCVA 2JCBA 2R65A 4B5KA 2CVOA 3HFRA 3ELWA 2PJZA 3EZ9A 1TT5A 1Y3AA 5J2TF 1YDMA 4OUKX 2ECFA 1Y1PA 5H83A 1L0BA 5KSPA 2IIQA 2QMHA 3DLIA 3ITEA 4ND2A 2QHXA 5M04A 3DQZA 1HE5A 4YECA 1F6DA 3JWHA 2IDKA 3OQBA 4O3MA 4CMIB 3M3HA 4GM4A 4R1UA 5ELLA 3OKFA 1MHPA 3DV9A 1Q57A 1PNOA 2CV0A 3HDYA 1L5NA 3MTIA 4M1EA 3U49A 3HVUA 4LWQA 2HU8A 3LDUA 5CB4F 1E18A 3KYBA 3FUXA 4XJVA 2MSDB 3PEUA 5ALPA 1XDBA 4CHGA 4DHEA 4EVRA 4EK9A 5T8KA 4BWVA 2CEKA 1G6HA 1KZHA 3JRXA 4H3KB 3S29A 3BILA 4X6LA 2XCRB 4XKJA 1YBAA 4ENVA 2VF2A 3WWDA 1OBCA 4GMFA 1JLSA 2B36A 3W4JA 4R9VA 1PYDA 1OR8A 4J2TA 4I5GA 5AI4A 4M53A 4BWFB 2D74A 4NENB 2I1QA 4LQLA 2GYYA 2QZZA 3JQFA 3KLBA 4GP9A 1CS0B 1SC3A 4E94A 4E33A 1FNBA 4INJA 4DLUA 2PANA 4L08A 5CDUA 2ACKA 4GLLA 2Q29A 1GCUA 4TXHA 4C6RA 4HSGA 5FT9A 5CVJA 3RC1A 4KNVA 1HE4A 2ISSD 4BZQA 2H7CA 1J49A 1W6UA 1KFJB 1IHDA 2X5KO 3B1XA 3EEQA 1CUGA 1Z88A 1NM5A 1B2RA 1VBMA 1ZZEA 4R05A 4W7HA 1OBVA 1NW7A 5DEIA 3JX9A 4WUVA 2OXTA 5DBOA 4BNYA 1UZLA 4QELA 3RFXA 1N9GB 1S8NA 4S1VA 4ZV7A 3K1AA 1QF9A 1USWA 1OIWA 2FEKA 2H7XA 3AJDA 2HK6A 4XSGA 4Y6QA 1Z4MA 2UKDA 2ZU0C 3FNIA 2GCOB 2QSZA 3ZDXB 3LRPA 5SYAA 1NNSA 4O2AA 1M2KA 1ABFA 4MVJA 5COQA 4F97A 5JY1A 5L8VA 4RFLA 3RSCA 1BWRA 1FVHA 2HQRA 2C2HA 1OU4A 3IEPA 1H05A 2XODA 3M0EA 3N07A 4B4UA 4FYWA 4F3TA 2XLCA 2HZBA 2GFIA 4JSYA 3B20A 4J4BA 2WLSA 4KN8A 4PZUA 1PG2A 4YUXA 1J90A 1AN9A 1FVXA 3NUGA 3BB1A 1TMGE 2WAMA 4R68A 1ZAKA 3ZK9A 3ZU4A 2JJ1A 3ND7A 4F2DA 4EI8A 1L4BA 3DQPA 5B64A 1TYCA 2CMDA 1AQNA 2NNLD 1GR1A 3BVPA 3OETA 4KXQA 5CYOA 3WK8A 1B8UA 5D1NA 3UAVA 2XTNA 1U5BB 2OXEA 1BE0A 3B53X 3ETJA 2VRNA 1OAKA 1BQ3A 3W9BA 3ZBPA 3SYLA 2P2LA 4N5MA 1IJFA 4F12A 3CF0A 3ZGNA 4JUFA 1TZBA 1GPAA 2G0NA 2HIHA 4GWGA 5JXJA 2IH2A 2OWEA 1YDEA 1E98A 1NN5A 4F3KA 1FU4A 1Q3HA 4X3OA 5JJ5A 3EZ2A 3P2JA 3K0FA 2V6MA 5EXSA 3ZDCA 3F3YA 4JLPA 5F1KA 3G9QA 1LK5A 3CR8A 4PZLA 1M73E 1RR6A 1C1YA 5EWJB 3P9QA 4GOLD 5KINB 1B8NA 5D5HA 1II0A 2CJFA 1SKBA 2D0PB 5C7OO 5LJIA 2AS0A 2WJZB 3F9CA 4UATA 2C57A 2X3UA 3VH3A 4LDQA 4RJKA 1XL1A 2FW1A 3NV9A 2CMHA 5JNUA 3ZBQA 4ZHQA 4DCGA 4PZAA 5AVTA 2PTHA 2B61A 3EZNA 3LQ4A 2A9VA 1PZFA 5BNZA 1ULAA 3OOSA 3ZV6A 4OSOA 4DGQA 2QAGC 2QLFA 4OJKA 1WPQA 2QM7A 2ZSIA 1QIFA 3DAPA 4A1OA 1V37A 4XJSA 2O3RA 3E23A 1FUEA 3ET5A 2HC9A 4IDGA 1RLTA 3VDQA 2CLEB 4LTNA 4PYMA 2Y1FA 2VR1A 2I3BA 3CSSA 4V0LA 3U31A 1B43A 2YNMA 3AONB 4K88A 1QF7A 4TRJA 3WOVA 5JYCA 4UNQA 2WYIA 2YMQA 4G1VA 4HDKA 3A2NA 2IQ5A 2OQ2A 2WDPA 1JEYA 2H3EA 4R1MA 3NT4A 5EKSA 1DC3A 1RBMA 3MWYW 4KPUA 3B1JA 2VK2A 4GEGA 5KWEA 2XKKA 2JLWA 2D1FA 3ZHQA 3LYLA 1S9HA 1P0FA 3MWGA 3WGVA 2DPLA 1AO3A 2VTEA 2ZIXA 1U28A 4G24A 4N7MA 4BBZA 1OLOA 3ZDZB 1QC5B 4PLGA 3NBYC 3R7LA 3E1KA 3FNEA 3IJPA 1CZLA 1GLNA 1MLDA 2IEIA 4QM7A 5IYZA 3D6JA 1ECLA 4G81A 1V43A 3X1ZA 1SU7A 3IR5A 1TKAA 3EWNA 4QPDA 4A5OA 1C8VB 3D1LA 2JFOA 2P6NA 5F7OA 3ZLJA 1U99A 1YZFA 1KETA 1JHQA 2EERA 3NFRA 2VF4X 3BHNA 5LA6B 3X1XA 2JFFA 3WKAA 3QNUA 4V03A 1GYPA 3JZIA 5LWQA 3GLVA 2QT9A 1W76A 1X0XA 2YVLA 3AERB 3O5AA 4L7QA 4DUGA 3UJAA 4NWIA 3HZOA 1VA5A 5AM0A 2DPXA 2XUAA 3CWQA 4EATA 5IVPA 1LLFA 2E3JA 5FO0A 1XO1A 2FKAA 1UXJA 4GOJA 1K4MA 4KK4A 4TSKA 4ZVRA 5TS2A 3RSQA 5HUHA 5JAOA 3D8BA 2JZOA 1VLJA 4KL8S 4DY4A 4EHHA 4EY4A 5A1TA 5G3ZA 4MPDA 1K5PA 3M6AA 4KFSA 3TNJA 3C3XA 1LKZA 2L69A 1GEGA 4FNGA 2QL9A 2YXEA 4D92A 1L7PA 2I4MA 2VOEA 5EJGA 1XCLA 1LTHR 1U6IA 3DTVA 3IH5A 1JYSA 5C5EA 1YL5A 1XVLA 2YN4A 3ZBUA 2WJVA 2H18A 4W6ZA 4N12A 2JFQA 821PA 3UAGA 5HQJA 4L4ZA 4LTMA 2ZW9A 1NVDA 2JHFA 1KTIA 4II3A 4OHRA 2WF6A 4KNYA 1WV0A 2FZCA 4YHBA 1Z2EA 1SVNA 2IOFK 1DWUA 1GA4A 4C4PA 1T2DA 2ZDGA 3QU5A 3AIIA 4HNTA 3I45A 1KORA 4RLFA 5I8ZA 3IT0A 1R4MA 2C7VA 4B7AA 2ARKA 3FPSA 4U3JB 1SBYA 2EW2A 5IKOA 2JJ1D 1HQKA 4FC6A 1VJRA 4IIBA 3OOWA 1KOGA 1LX7A 5EHQA 4OPMA 1MORA 2B94A 2J0UA 1C5KA 1FSPA 1VZ2A 2FQ1A 4X64B 4YYEA 3QVJA 2J3IA 4AJJA 1LPMA 4C6SA 2Q1XA 3O7MA 1R6AA 2QVCA 1TAUA 2I2DA 1WDKA 2I76A 4QEZA 5EWLA 3ZCRA 3V48A 5J9FA 2R62A 1OT3A 4ZQBA 2FZ5A 4HQLA 3T54A 3QELB 1VBNA 1Q0HA 1QH1A 1Q77A 1SXGA 2CL5A 2BP7A 5JT1A 1ESNA 1W2GA 1DFGA 3QXGA 1ZNYA 3IAAA 2I33A 3QXSA 3WNBA 5E1DA 5CGZA 4MR7B 3WV4A 4C03A 5HZKA 2A4KA 2AOVA 1M6VA 4OIMA 1Z6YA 2TECE 2GFHA 3ECAA 3ZK8A 4C22A 3H75A 1O0SA 3K70D 2NG1A 1ZD3A 4JELA 1NV8A 2BMDA 3CF6R 2D0IA 4O5OA 2AE1A 3VO2A 2CB0A 1UOOA 2AT1A 1Z4PX 3KUCA 2Q50A 2C5GA 2QA5A 4CMEC 1M1UA 1YB6A 4IKOA 1O97C 1PHRA 1RYBA 4D4KA 1T25A 3TRHA 2VSOA 3K5HA 1QH8B 3OSUA 2ZUWA 1FNNA 4H1UA 4XYBA 4TQ9A 4JDPA 1Q15A 5JNSA 4WY8A 2P78A 7REQB 1C7RA 1FFDA 1YNOA 3LUPA 1VA4A 3C45A 4ZCLA 4BQNA 5B1YA 4YAGA 1UXIA 4C76A 2QPOA 2ATVA 4D3SA 2GN8A 5CXQA 3D7RA 1YHZA 2OAQ1 4RQTA 5DMHA 3EG9A 4G5HA 1JV2B 1PW5A 1N2JA 1O5OA 3E0QA 3HKDB 1G1AA 4MHOA 1EK5A 1YUNA 2AD1A 4L3VA 4R0NA 3DKPA 5KCZA 2GX6A 1T29A 3TQCA 2ODWA 3MBKA 5D00A 1ML4A 4AM8A 3KQSA 4RQBA 1KYWA 5E9WA 2VQ3A 1DT3A 3VJLA 3OCCA 1GNQA 1MMFB 1M6YA 1POXA 2OZLB 4PRKA 3BG5A 1DJQA 4IGFA 3T0FA 2DLDA 2IW1A 3HVHA 2WUWE 2H1RA 3UIEA 1AKTA 2AFHA 1B93A 3IDZA 4U00A 4BNNA 1CUHA 4WBXC 3PPVA 2ZSJA 4B71A 3NIFB 1W34A 2IFTA 2A5FA 4F5YA 4QNMA 2EATA 3G59A 5BN3B 1ZRSA 4BNHA 1Z6QA 3CUSA 3LDFA 3W8EA 1E0AA 4MV4A 2A33A 3AETB 3VH1A 4DSZA 4IYRA 1V8OA 3M9WA 1XNJA 5D6OA 4R2MA 3V33A 4GKAA 3TR5A 1H8HA 3OE7D 2POQX 2JLAA 3AJAA 5A7GA 1W9HA 1Y1SA 3L05A 1KEZA 1TKRA 5GGXA 3ESZA 4GKKB 1COWD 1WB6A 4RTJA 2PEYA 3KS9A 5CJ2A 4YJ2A 2DUUA 2GN6A 3MCAA 2WKWA 2DCUA 2A1IA 2J5BA 1RLUA 2I3ZA 3LUDA 1GU1A 2UU9B 3RBXA 1T1SA 1XCPA 4U5QA 3A1TA 4FOLA 3Q87B 1OE0A 4HQRA 1E3TA 1ZUWA 2YASA 1ZIDA 2GTIA 5I4IA 4PQRA 3RI3A 4H1WA 3D7LA 2YWHA 3IPAA 4MP8A 4OJNA 2PWPA 3FVVA 1Z6GA 5G02A 2QJWA 1NQOA 2XZTA 1NQVA 3IALA 1QIHA 4DR3B 4EYOA 4ETNA 4PQGA 5ECWA 3R7WA 3CM0A 1CZUA 5F3DA 5MDHA 3EA4A 3Q7RA 4X61A 5JCJA 1PHPA 4A3SA 3CEPB 4E7PA 4PNPA 1RHUA 1MABA 1V3TA 2EKZA 3R7DA 1XZAA 4DW8A 1WUTA 5JBNA 4O8ZA 2NO7A 3U44B 3BMXA 3CXRA 2Z3VA 2GN0A 4BX8A 4ETMA 1UBKS 4B8ZA 3V3KA 4WXRA 2HV9A 2QX4A 2J4FA 3EXHC 3SM9A 1BXKA 4FYYA 1T0JB 1ZKMA 3LMKA 3PNSA 4QEKA 2FJ0A 1IQRA 1D3AA 5TC4A 3RU7A 1KEPA 2QTMA 3HTXA 2DULA 3F3KA 3ZKAA 2R7NA 3PBKA 3HL4A 1D2EA 3GT3A 4OHUA 5FBVB 1XJ0A 1YJXA 2IUSA 4NBUA 1JYFA 1Y33E 1T3GA 1YR8A 2JLBA 2O05A 3WLIA 3UBTA 1BXGA 4HAVA 2BFBB 1YFKA 1SCIA 5CTJA 2QORA 3MJCA 1ONSA 2W5UA 2IYQA 3AF2A 3I39X 2VWGA 1VSUA 4FP9A 1RJFA 1P61B 2QTWB 4WN9B 1Q0QA 5I5GA 1VHDA 1IBRA 4TV8B 1C30A 4CW7A 2O8CA 4IZ6A 3G1WA 2EW8A 1BJRE 1C3OA 1YTLA 3F4KA 1I4EB 2N46A 3PUWA 4UMDA 3SC2B 4EWLA 1LDEA 1XQVA 2PMDA 4GU5A 4JLJA 4YUAA 4DMHA 4LDJA 4Z4FA 4HQNA 4DUYB 2WPDD 4YONB 3UWOA 3ZV5A 5BOSA 3IMFA 4PGGA 1RI2A 3B6IA 3FHLA 3K8YA 1KJ8A 5G40A 3PLNA 3K7EA 3W1VA 1Y9ZA 4BLTA 1T9CA 4DJTA 4NV3A 4TTSA 2FMUA 2D06A 4DWOA 2FTKE 2Q5HA 2Z08A 3QFSA 4CTOA 2ZRAA 2J85A 4B3HA 4TQAA 1MA3A 1XTBA 5ULLA 1L3IA 1GADO 3A6LA 3A9VA 1AGXA 3HN6A 3CNHA 3IGFA 4OYRA 3VX4A 1SVKA 1GCAA 1JEQB 2P1DA 4D74A 1IH8A 3OJOA 2DHDA 4U6QA 2B4TO 3HYSA 2NO5A 1BGVA 1J70A 2D0DA 4B32A 3DM9B 5C81A 1R6VA 4W8OA 5GVSA 5LFAA 1YFZA 1NR5A 4KQHA 3KJHA 2O19A 1K7FB 3RS3A 3VR4A 1Q7CA 4CKEB 1VKOA 1SCKA 3WR5A 4QDXA 1Y6JA 5DZSA 2DFLA 4PEVA 4ZJUA 1D6JA 2BTQA 3ILSA 1G42A 1KP2A 1YJAA 2HGZA 3P96A 3U3KA 5HNKA 3OQMA 2CCJA 4B7ZA 3CLVA 3GUZA 1PFVA 3HBNA 3G9XA 4NCKA 2B9VA 5KTMA 2IYYA 4CM5A 2HO4A 2W4IA 2NT4A 2YHBA 4ENSA 3VYVA 3PICA 5L6MB 1T8TA 3BXZA 2ONJA 1JIKA 2O7NA 2XUQA 5FJIA 4CKZA 4ND4A 4YMGA 1FOEB 3D02A 3VR6A 1JHYA 4I6GA 3SIRA 1DXQA 4YT8A 1E9DA 2WZCA 2YV5A 2P0EA 1PR6A 2PMFA 3A04A 2SCUA 5HMMA 5JFGA 2Z6UA 3RRXA 1GWNA 4RGBA 2W2NA 2C20A 3PRJA 4WXPA 4Q05A 4OHMA 2QNBA 2ZETA 3IKVA 2IGTA 3VKUA 3KUUA 5L53A 1AZWA 1MENA 1P5JA 3E15A 5LP6A 1YR7A 2O5CA 3WAKA 2CJXA 1PTJC 3H84A 3NDRA 4F9FA 2FW7A 1LLUA 2GK4A 3A1VA 3CLSD 4FMPA 1NG9A 3E3OA 5E6UA 4U63A 2Q5JA 3UQYS 3BK7A 3TX6A 1IY8A 2P30A 3HCCA 5K3DA 2O3QA 1G8GA 1SCDA 1L7EA 1U1CA 1S02A 1BIFA 1FNMA 1NKVA 3A7EA 3DDWA 4X8LA 2AJDA 3N3BC 3R3VA 3JQ7B 3O8OA 3CPEA 1TTPB 4G4SP 4TSRA 5FTNA 4RDCA 1X70A 1S3GA 1L5KA 3PVZA 4BCBA 1XMOB 2ZVDA 5EQJB 3K1TA 3WP1B 2CDCA 3JASB 3KSZO 4EUSA 4NFSA 1ISHA 2VT3A 4W99A 2R87A 4TZTA 4BCDA 1KRWA 1TT7A 2PQMA 4X1IB 4LPKA 5EGNA 3U3ZA 1UWVA 5DSZA 3HV0A 3KTAB 3ENZA 3JQ9A 1F4PA 1H2WA 3I73A 3K73O 2NTNA 3NG1A 3KJZA 4TTVA 2I6SA 2XB6A 3MUEA 4O2BF 4HK4A 4A26A 2P3LA 3L18A 4HGZA 2NSHA 2ZS8A 2W48A 3PGLA 1JAIA 1GNPA 4FBGA 4OA5A 4V0NA 5I5EA 2IXDA 1RKQA 2JLRA 2Z5GA 2B8NA 4IRXA 2ACEA 3ZHUA 4F0JA 3DL2A 4PG5A 2CLMB 1NVAA 3I9FA 4YEDA 3BSSA 1P0IA 4LYAA 3WIBA 2FR8A 3GCGA 4XQEA 2FRDA 3IXMA 3PTZA 4KWIA 3WTCA 3HNRA 2BGTA 1X7WA 1LVHA 1GTMA 4YJFA 5IC4A 4DV0B 1RDFA 4G65A 3U9SA 4PVDA 3RYIA 2Y0EA 3MIIA 2D59A 2NO1A 1H22A 3Q0EA 1EKXA 4OVKA 3GVIA 1DEAA 1XBTA 2L17A 2FR0A 5A2QA 2FSGA 2J3JA 2V3WA 2HW8A 4C4ZA 2BGKA 4OFBA 2QJRA 4G89A 5K7SA 2BFEB 2R1TB 1Q95A 5T67A 1W4LA 1QAQA 3HABA 4QEDA 2ZUCA 3ZK7A 5HRUA 3TWOA 1AH2A 1SMKA 4KODA 4MJ3A 1A9PA 2NM0A 2RBKA 5UKDA 3GCDA 4HWSA 3VX3A 1WXXA 1IDN1 4EMTA 1Z63A 1FL9A 3C97A 2WM8A 2A88A 1ONPA 1QB8A 2WU3A 3FHJA 2FNAA 5H02A 4AG3A 2IS2A 4FX2A 1H2EA 4D9GA 3FBWA 4Z1MD 4DTIA 1X94A 3AR7A 4G5OA 5T41A 1ZL2A 4RCZA 3DE1X 5JCZA 4DMCA 5BW4A 2HWWA 3F71A 4OREX 7REQA 2Q3FA 2QXTA 2ZIFA 5AQEA 5I7AA 2C5EA 2FW9A 1G0NA 3FKQA 4WNCA 2XDQB 4YB8A 1K86A 4ZYUA 3JQGB 5BNIA 2D5CA 1FMFA 3TQFA 4FHGA 5B1HA 1F06A 4M0PA 1AHIA 2G83A 2H2FA 4JEIA 5LOVB 3GLIE 2A1UA 1Z9BA 1UFOA 3BWVA 4K0RA 2B6HA 4I14A 2X6RA 3F47A 1O94D 4IVQA 4LNUB 4MW7A 4RZSA 2NU8B 1XRLA 4AK9A 4U39A 3CISA 2Q4TA 1EGQA 1FXWF 3ETNA 3OZSA 3DPSA 2H1VA 1Z07A 1ZMRA 1HXHA 1I1OA 1FLNA 1M3SA 3AM4A 3AW9A 1LC0A 1B0UA 1O54A 4GYKA 4ZDKA 2XCLA 2UVPB 3EHDA 1JPVA 1W29A 1XFAA 4ZOAA 1NOJA 1UEIA 1VI6A 3V4OA 4BO3A 1FUUA 1PVVA 2VQSA 2ZRIA 2JAQA 2RB4A 4UXHA 4LF6B 1YJ8A 3IA2A 1EK0A 3EA5A 1IRXA 1NKSA 1CQJB 2WWWA 1NBOA 3K0BA 5FNZA 3ZIDA 5IN4A 4WLVA 2C59A 1N36B 1JQ5A 2Q3MA 3I09A 3MAGA 1OI3A 4NZNA 3QJGA 4K6KA 1BE1A 4LSWA 1D0VA 1LI4A 3DFMA 3EN0A 4Q3EA 4TZKA 5GMOA 3W8NA 5JANA 4KQJA 1SHZA 4FNAA 4BN0A 4HNVA 1SUSA 2Z30A 3H9EO 4HB0A 3ER9A 2FSSA 1XKQA 3A1EA 1MVLA 4JLMA 5SYMA 1NLZA 1T6XA 3THXA 1RHMA 4DJFC 1TX4B 1L8LA 2WDZA 3QENA 3T99A 1GTSA 5TEVA 3LA6A 3RHSA 1KDRA 1EIWA 3BWMA 3OOHA 1D4ZA 3PL1A 3C16C 2OCPA 2QQFA 1T6ZA 3GWGA 4FXPA 5TDHA 2HJGA 1XRQA 3D0QA 1JHXA 2I65A 1T9GS 4FYHA 4MW1A 4WCDA 2X0FA 4A8JC 4CG1A 2CHQA 2ZE6A 3EBPA 3R77A 4P3OA 4UUQA 3UOWA 2I91A 4NPAA 2NZUG 3GEBA 1NBMA 3O8BA 4PY2A 3LUBA 4BXOA 1LB1B 2XJ9A 4JJ8A 2DCMA 1OD6A 4NTZA 4TS9A 1F0KA 1PP4A 3K1AB 2IS6A 4IAOA 1NKTA 1H2HA 3ZLTA 2PUAA 4V38A 3NUZA 1N6HA 1YJBA 3QXJA 3FTNA 4JX9A 4O2AB 5TPWB 4Q03A 3DLHA 2VRBA 4NYMR 1J6UA 3BRWD 4KXXA 1JDBB 2AHOA 1OWPA 2PLRA 1SCNE 5AKKA 4Z1MA 1B23P 4U3JA 2XUPA 4OXRA 4DNQA 3RYHB 1OTYA 3H5WA 1F6WA 1Z7EA 4FM9A 1IHYA 1YDGA 2J7KA 5JVDA 4MQLA 4S2EA 3PFFA 2W90A 1PW7A 4Q3KA 4C7VA 2VXYA 2PSEA 1GTRA 1W8DA 4M46A 2I4LA 2QJOA 3D4LA 3E9QA 2PE5A 4NPHA 1DG3A 1WMSA 5TMDA 3ND9A 3O8DA 1ZSNA 2CHVA 2MIIA 2ZI3A 2YDXA 4TV9F 1PS0A 1OAAA 3DE0X 3MOGA 3RS4A 2IYSA 3CF4A 3HSSA 5DK6A 1PU2A 2Q27A 1Q7RA 3GMIA 3OJ0A 4FLMA 3V7WA 4P7BA 4QDKA 4BJ3A 3GBVA 3H13A 3HVRA 1CFZA 3X1JA 5AVOA 1Q0TA 1W19A 2A0FA 3WLOA 5EJ8A 2JLUA 3IHLA 1YB2A 1GNTA 2H2WA 1DAIA 2FPWA 3KOUA 2OXRA 4PFJA 3V97A 4X7BA 5DYTA 2GJSA 1UC5B 1X6VA 2HF8A 3MPUA 4NNPA 5KPDA 3G2QA 4FGJA 1RRPA 3OD1A 1P9NA 4LVNA 4ARVA 4GICA 2IEBA 2G04A 5JS8A 2CGEA 2XEDA 2DH6A 3K8OE 2GA8A 3O7WA 4KSBA 4MPJA 2Z3ZA 2XTJA 3SDZA 3MELA 4Z86A 2OCGA 3JWIA 1MF7A 2FX5A 4GG1A 5KYTA 4HF7A 3VNRA 5L45A 2ZAMA 1TL7C 3LH5A 3N0VA 4KXNA 2WQ6A 1G8JA 3F7OA 4N39A 3PX3A 4OQFA 4CR6A 4C0WA 1CUWA 1DUIA 1LRKA 4A6EA 4Z7OB 1Y8QB 1M0WA 2RGRA 1BW9A 2E18A 4C3ZA 2ZZNA 3GL9A 3JATB 1F8GA 3O2NA 5HF6A 4CG0A 3T3NA 3BIXA 2NUTB 2BCJQ 5HE9A 2Z56A 3AJ8A 3VAYA 1XN1A 4MVJM 1J7JA 1KQFA 3DBOB 2CK3A 4ANFA 1F7UA 3SF8B 3G2MA 1QS0A 3Q3CA 4XPZA 4MW2A 4RVOA 3RG8A 4DIOA 5EJ4A 3CC8A 4FYVA 2HA5A 4MRRA 4QVKA 5KNDA 3K0EA 3W7AA 5BYJA 4P83A 1GQ2A 1G2IA 3AR9A 2YUIA 3FYUC 4P98A 3P9XA 5ESRA 2EG5A 4Q4HB 2V7VA 2H31A 4RYDA 4BO8A 4YDQA 1BHSA 5DM70 2J3EA 1UL1X 4XQ9A 3ZLVA 5K3CA 2A58A 3RC8A 3W5IA 1UKCA 1Z7WA 6AT1A 1HMYA 4LF9B 1LV7A 1X3LA 2G07A 3GJZA 2JG3A 4Q7EA 1N2SA 5IK2D 3GP8A 2JL1A 2BHSA 1QV7A 2EKDA 4KQEA 2OCBA 3MXOA 3I9NA 4QOHA 4U2CA 3ZXXA 4DSUA 1DAFA 1Y1QA 3PX2A 5ESWA 3KWJA 4HNUA 2V65A 5G1PA 1MC8A 3F4BA 1AIPA 1YIOA 4QICA 5BMVF 4QX6A 2JFYA 3N8DA 1IOZA 4B43A 1Y1RA 2X9NA 3OKCA 2C7QA 1BDBA 3OPQA 2FKNA 2BSAA 2HMUA 2MWMA 2ZI5A 3Q9UA 3ER6A 1Z6TA 4QXAA 2E5WA 1KR5A 5GONA 1VP3A 1A5SB 4YV7A 5C31A 1NUUA 2R5FA 2OHFA 3OLZA 2P5UA 3UHJA 2JAHA 3DP7A 4HZUA 2XLBA 1NF2A 4CM1A 4YY3B 1SBTA 1CUZA 3LLUA 4DBVO 4OKIA 1D09A 1N2EA 1NSFA 2Z3WA 4RCYA 2NQ2C 5H4HA 3JZAA 3K05A 3QX8A 4URHA 4ZT7A 4F1JA 4M8NE 4BB5A 3ICOA 3PC2A 2RG7A 1DQYA 4F7WA 1SU4A 1PGJA 3ETLA 5ECYA 2YUTA 1DDIA 2EBFX 2HNKA 4R2LA 4YDRA 1E6EA 1WCIA 4Q1AA 4LV8B 4X60A 4QBHA 5KSOA 1XNHA 3PVSA 5JIBA 2X8WA 3WDKA 3CRNA 1SZPA 4K9QA 1MB3A 3WL7A 5KX5B 3A25A 2ZUTA 1RI4A 3IX7A 4GPAA 1LFAA 4ALNA 1Q16A 3V55A 4RO0A 4CM3A 4RQUA 3KZXA 4J4HA 3KQPA 1CY0A 3UMGA 3ONDA 2VJMB 3KTAA 4WA8A 4CLOA 4MGHA 2YQ4A 3VSEA 4DSTA 4BE4A 4LYEA 1KZ1A 2CLLB 3KQUA 1WCXA 5EQTA 3PQ4A 1QE5A 2J9XB 2W8ZA 3DKIA 1ESMA 1PZEA 4KOEC 1XKXA 3EVGA 1PJ4A 2R66A 2RHOA 4OYYA 3S7ZA 3AR4A 1H0SA 4E22A 4AQYB 2YXDA 3FUUA 4FONA 5AW7A 2ECPA 4F85A 1M0SA 3F2IA 4PG4A 1ZD1A 3KJNA 4WK0B 1A27A 1Y9EA 1F8FA 1AG9A 5MN5A 1JSRA 4UU0A 1W59A 4LRWA 2LKCA 1G41A 2HHAA 3NYRA 1EK1A 5HKOA 3OJCA 3DEZA 3KFLA 2YY5A 4N3CA 1X7WB 3HLTA 3LC7O 1DOAA 1AK1A 3MOIA 4HB4A 4YJFB 3W5JA 4ARBA 1Y6GA 3LCJA 1WQ4A 3RVOA 4L6IA 5HDBB 1ZUD1 1QYXA 2LGJA 3H5TA 3NHWA 4UUPA 4L78A 4DR6B 2G63A 3N9IA 3RM3A 3FHTA 4F6LA 4DLYA 2ID7A 4KDRA 4OU5A 3NC0C 4FDAA 4RY8A 2RHLA 1KVQA 2LV8A 2W70A 4DLTA 4Y3UA 4MUNA 4DR2B 3CLTC 3A0RB 5T7BA 1E0DA 3FWNA 5NLLA 1GFSA 2WV9A 4DXAA 2O3JA 4MUMA 4EG5A 4S24A 3EODA 2VAWA 2TMYA 2PD4A 1PVOA 5DWDA 1K27A 2B7LA 3PF8A 2HDNB 3OIWA 2I6FA 4PHTA 4XD7D 3QIVA 5FLYA 1RI3A 2UYHA 3ZVKA 2R8BA 3AHIA 5K8CA 1B7GO 1TZKA 2SBTA 4IWYA 1U8YA 1BHO1 4O4HA 3IYLW 1W85A 2F62A 4MV5A 5A4DA 2H85A 4U02A 3TINA 1KEUA 4NYIR 1MR3F 1HUQA 3OY2A 3TJMA 2DE0X 4WMLA 1AKRA 1PJ2A 2G76A 2NPFA 2IDMA 4N0EA 5DX8A 1H5NA 2BBOA 3PPXA 3IS3A 2GEBA 1XZLA 1JFVA 4Z4EA 3EW7A 5K5EA 3AFHA 1H8EA 1L5YA 5IJXA 3OMXA 4WXYB 3HKBB 4WE3A 2Q4BA 2VATA 4LXQA 5B2ZA 3DB2A 1UMDB 3SLGA 1QGZA 2CXTA 1CEQA 2QM0A 2QQEA 5J47A 5ALGA 1BDJA 3INNA 2V7QA 3ORYA 1TQ6A 1DDOA 1BKDR 1NYQA 3HWRA 1PQYA 1ADBA 4MUJA 1WZNA 3U5TA 2A1TR 1U9IA 1TNDA 5B3JC 1RAEA 3L1HA 4NC9A 1GOTA 2AXEA 3H5OA 1E3EA 1O08A 3NWEA 3PJEA 4IJWA 4O2BA 2FPXA 4JBNA 5ITSA 2PR2A 3ZS9A 2CLIB 3W3AD 1BE8A 3WL8A 4L5BA 4BNLA 4DQUA 3CVOA 2JFNA 4H7JA 5M2QA 2IP2A 2BH9A 3L6BA 2JIDA 1UMBA 3JQAA 3SXUA 2F9MA 1ZRMA 1H1LA 1P17A 1XFDA 1SPXA 1QIIA 1Z68A 3FPHA 3I1FA 1B41A 1GPMA 1UKAA 2PU7A 3OQIA 2BSXA 1F8YA 2C5SA 1VI5A 2WPDA 3JD4A 4H77A 1KSJA 2FGJA 3CKYA 3PQ6A 2I4IA 4TYMA 1G20A 1SN7A 3A2MA 4LC9A 3HCBA 1O1YA 3AUUA 1PTJA 3I23A 1U81A 3VUFA 2WIKA 1U1EA 3DEJA 3FIUA 3EDRA 5FOVA 2YY7A 1EG2A 4ND8B 3JCZA 1YFJA 2QL6A 5JEDA 1BCRA 2ZWMA 4TRMA 3SEZA 1WF6A 2BR5A 1E64A 2PKQP 1SFRA 2LR0A 4WERA 1L8OA 2ZP1A 2J45A 4NF2A 4OP1A 1GVHA 1XCOA 4H0NA 3QRWA 1PQUA 1K7SN 2FPRA 2CJPA 3JAKB 1GGEA 1O9BA 3N39C 4RPLA 1NUQA 1Q12A 4WOBA 4BGUA 5KSZA 4G85A 4M86A 3R7WB 4AJ2A 4Y0AA 4CDGA 2GN1A 2MSKA 4LAFA 5JU6A 1XMQB 3USES 4MIOA 1FP4B 4MR8A 4X85A 2OESA