3N70A

The crystal structure of the p-loop ntpase domain of the sigma-54 transport activator from e. coli to 2.8a
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
142
structure length
142
Chain Sequence
IGRSEWINQYRRRLQQLSETDIAVWLYGAPGTGRMTGARYLHQFGRNAQGEFVYRELTPDNAPQLNDFIALAQGGTLVLSHPEHLTREQQYHLVQLQSQEHRPFRLIGIGDTSLVELAASNHIIAELYYCFAMTQIACLPLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transport protein
molecule keywords Transport activator
publication title The Crystal Structure of the P-loop NTPase domain of the Sigma-54 transport activator from E. coli to 2.8A
rcsb
source organism Escherichia coli
total genus 39
structure length 142
sequence length 142
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2010-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14532 Sigma54_activ_2 Sigma-54 interaction domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3n70A00
2IS1A 3LH5A 3QF7A 4PO1A 2JLQA 2WBLC 4Q48A 3AUXA 4HSEA 4QHTA 4PZLA 3TUIC 2J87A 3THYB 1E2MA 4HLUA 4I1OA 1PUIA 4RFVA 5SZKB 2PEYA 3K0FB 2HYDA 4BFZA 2F1IA 4RZ2A 1YZGA 3CLVA 1HT1E 3KJIA 2C77A 1T3LA 4WIAA 4EJSB 1VG9B 2BKUA 2LWIA 4JLBA 4BLQA 1KSFX 2IS6A 4GOXA 1LNZA 1P9NA 3WYAA 3HYRA 2HT1A 4UNQA 1QHHA 2BCGY 421PA 2H92A 2ZRFA 3FMPB 4HLUC 4DLXA 2JGNA 1DADA 1GILA 1J70A 1FL9A 1V43A 3FKQA 2LKDA 5CK5A 2AXPA 4EKDA 1J2JA 3L8ZA 3RNLA 2JLXA 2QI9C 2XX3A 2IYVA 1N5IA 5CB8A 2JCSA 2J0UA 4KFSA 4Q47A 1MRSA 2ODEA 4R7ZA 1VPLA 2Y8EA 2G9NA 4DWJA 4DCUA 2WKQA 2IYRA 1U0HC 3RC3A 2ZRDA 5CK4A 1Z22A 2FG5A 3GLHE 1CJVC 2VEDA 521PA 1H8EA 2JLYA 1BO6A 3CKLA 4MRRA 4EPTA 5DI3A 4EQ6B 4M9SA 3RSOA 3ND8A 5KPJA 3AUYA 2VHUA 1WE2A 1ZCAA 3PITA 2AN9A 4PQRA 5HPYB 3ZVLA 1NJFA 5JCZA 3ZVMA 3ZIAA 2WJHA 3EZ2A 3U44B 2BV3A 4MYCA 5KDLA 3CNLA 2VP9A 5KU1A 2EWWA 2JJ2D 2GVDC 3C8UA 2JEOA 4HAWA 4PC1A 5KNBA 4O25A 2QM7A 4YMWA 4A0HA 4DB2A 2IYWA 4TZ0A 4PPGA 1FX0A 2ZS9A 1ONBA 4RD2A 2O8CA 5FL7D 3CH5A 3BS4A 5JSZA 4LI0A 2XZPA 5EUQB 4LJ7A 1XEXA 4WBSA 3O8BA 1VKJA 1HUQA 3M6AA 3N70A 4N0EA 4OQFA 3U7EB 3LXRA 4OBEA 4HUQA 2D2EA 3JZMA 3K09A 4LX0A 3KB2A 3SU8A 1G291 5A4JA 3KFVA 1KJWA 4Q00A 1G9XA 5BYKA 4IEIA 5EE0A 5B2ZA 4W7SA 2CVFA 2Q6TA 1D2MA 4BQSA 3B8HA 1D2NA 2PEZA 1CR0A 4IDPA 3VNUA 4LK2A 4DLZA 4YMSA 3SZRA 4ESVA 1Z83A 1CEEA 2ZAMA 1N6IA 3QG5A 2ZI3A 4P4SB 1PZNA 3CW2A 3K09C 2G1JA 4TYQA 4Z8YA 5BN5A 1G3IA 1UKVY 4PSKA 3GLHB 2QORA 2FSHA 2YYZA 1Z2AA 4X8LA 4QHSA 1KDRA 2ZSEA 3TMKA 2F55A 2GKSA 4HB2A 2FFQA 3I72A 1GKIA 2CJWB 4OHVA 1JPJA 4G0NA 4C0LA 3B1YA 1GL6A 4Q7LA 1R7RA 1SKQA 3R7WB 3V4FA 3VR5A 3KZ1E 2WWXA 1R5BA 3EIQA 1AZTA 5B58C 1TTTA 1CLUA 3K0FA 5JJIA 3A6PC 2D4HA 2WWWA 2DHRA 2J9RA 4GL2A 1CR4A 1E2IA 2IWRA 1SVKA 2RHDA 3U7GA 4EJSA 3OAAD 3MJRA 4A4DA 1II8B 1ZD8A 3SDZA 4LJ9A 1ZIOA 4DZZA 1DOAA 3H4MA 5HE9A 1OH7A 5HE8A 4NL4H 1RFLA 5C4MA 3CPEA 3LBIA 4Q4HB 1KI6B 4M1SA 1U9IA 1X3SA 3IPXA 4XTRA 4LYFA 2F43A 3U3JA 1TUEA 1YRAA 2BMDA 1OE0A 2ZE5A 2DFNA 3ETLA 1N0UA 2FDCA 3HJNA 4OK5A 2XGJA 2XZOA 4I1UA 4EJSC 3GJ5A 1GL9B 1H65A 4GP7A 4GPTA 221PA 4D4KA 2JLSA 4Z54A 3TUZC 2B6HA 3EZ6A 3OEED 5BN4A 5DNYB 4ZIRB 4Q5IA 3A1UA 1U9IC 1KI1A 4PANA 2EFDB 1W0KA 3R9XA 4KODA 2F7SA 1JEEA 4TTRA 5FBQB 4AY2A 1ZU4A 5FBLB 1Z0KA 4HATA 5FTMA 1EFCA 4HUTA 1D5CA 2E1RA 3TR5A 3AQ4A 3E70C 3FE2A 1KMHB 2WWFA 1ZC4A 4D4MA 3CX7A 4TMZA 3SFVA 1N6OA 1N6RA 3ADCA 1G19A 2OCPA 2CE7A 2KJQA 3U44A 4AD8A 2R6CA 4HZIA 3KXLA 1HA3A 2FNAA 5FOUA 4B3XA 4HLDA 2ZU0C 3WP1B 1OXXK 4DT1B 3GLIE 2O8DB 2V1UA 3CF6R 1Z2CA 1BH2A 1XTIA 3DM5A 3W3AA 4IKEA 4QKQA 3D3QA 1DEKA 5KTYA 3QXXA 1E1RA 8OHMA 2WSSD 3EA0A 4B74A 3L0IB 1FOEB 1QHYA 1TU4A 1XJ0A 1N3BA 1ZM2A 1CBUA 2FGKA 1T0JB 3DKVA 4JLMA 1MOZA 4JS0A 2IBMA 1OXVA 4IW3B 1UBEA 2Q9BA 2RGAA 3CRMA 4JYBA 3U3MA 5JZVA 1FP6A 1KI8A 4EPWA 1CF4A 2A3RA 1NMYA 2JDID 1S3SA 4ZI3A 5EP1A 3A4LA 5SZJA 3DDCA 1KK3A 4TMWA 3T5DA 1P75A 2VLIA 2Z0MA 4B3GA 2IUUA 2BWJA 4RVCA 4GMXA 3LW8A 5EUMA 1U2RA 3IEUA 3NKVA 3TSZA 2GCPA 1YZKA 1ZNYA 2IYXA 1HTWA 2O0HA 4YXWA 5JWRA 1IN6A 1XJQA 4N3NA 2QL6A 2QQ0A 4LBZA 4WVFA 5D3MA 3QPVA 4BFVA 2QSYA 3GLHA 4TLDA 5M04A 1DO0A 4DEXA 5EP4A 1JAHA 2D06A 5E3HA 2OFWA 1O87A 2IEYA 3WMEA 5HR5A 4LDJA 4CZ2A 2ATXA 4URUR 2CJWA 3FOZA 4ERNA 1IHUA 1R8QA 3RABA 3B1VA 5HKKD 5BXQC 1JJVA 3BFVA 4ZDKA 1TPZA 1O3YA 2ZSBA 1E2NA 5F9FA 3R20A 2P65A 4NCHA 1GKYA 3G5UA 5JEEA 1RIFA 3TSWA 4B43A 4YDHB 5FPKA 3GLIB 2WWGA 2ODNA 3KXIA 4NYJR 1NLYA 4NBSA 2P3SA 5EE9A 2BBOA 2JLWA 1Z8FA 621PA 2QPAA 3E2IA 3A1SA 1XJCA 2O52A 1ZD9A 3NWJA 1S1MA 4LBWA 2V6JA 3NHBA 2OCAA 2VYFA 3N2EA 4ZDWA 4QFMA 1VECA 3GLGE 1US8A 3U5ZB 3W9YA 5A5GA 2NIPA 4QJ5A 3W90A 1T3HA 4HLQB 2PZGA 4KVAA 4DRZA 1G8GA 2EYQA 2ZJOA 3T15A 5ELXA 3AVQA 4RD4A 5FI0B 3CIOA 1Y63A 4QM6A 3IGFA 3QIAA 4HDCA 1CRQA 3TRFA 5FR2A 4RFSB 2DWQA 2IYTA 2QTFA 3OF5A 4F91B 4KFTA 4KI0A 2EFHB 4IDOA 5J4HA 4FCVA 2RH5A 4PHHA 5IK2A 3VFDA 5JI3E 1UAAA 4EFLA 4UNRA 3TQFA 2V3CC 2FSGA 3AEZA 1OHHD 3NEJA 2F1RA 3B13B 3PEVA 1YKSA 1WB9A 3AKCA 4XSGA 1FFHA 1KMHA 4GFDA 4MH0R 2DFLA 1KMQA 2ZVQX 5TXGA 4LV5B 1ZC3A 2WICA 2W0MA 4NCNA 1FTSA 1I4DD 4UNSA 4M8NE 2J46A 4TTPA 4ITRC 4DT1A 3EARA 4FMDB 2CHQA 3LWNA 2AKYA 1AN0A 2IHBA 1KAOA 3NH9A 4XVUA 2AKAB 4YQFA 5SZIA 3RDPA 1ZNXA 1R0XA 3B1WA 3X1XA 3EIHA 3W6OA 4IXNA 2PLRA 4BLRA 4XWOA 5H68A 5GJWC 2R8RA 2YOFA 5D3QA 1H8ED 2R6GA 2IA5A 3VR6A 4L5BA 3ICEA 1KK2A 3REFA 4OJKA 3I8XA 4GBMA 4PPNA 5KHOC 2CL6X 3GLGB 1YR7A 4IFEA 2GCOB 2OBLA 2QM8A 1W0JA 1LS6A 3C5CA 5DO9A 5EXTA 4V0OA 3LD9A 3OEHD 2IXFA 1JECA 2YC4C 3LQQA 4RD1A 3VHXA 2ZI9A 4I81A 4TT3D 3ZIAD 4AURA 4J0QA 4AKHA 3AGPA 4JL5A 4KSCA 2YJTD 1AQUA 1X8LA 1A82A 3UG6A 1YR8A 1OH8A 1CIPA 1E4VA 4RJLA 2ZJZA 2BMJA 4Q9HA 2O8BB 4O2RA 2FOLA 3ZVRA 2H7VA 2VH5R 2CK3A 3EZ7A 4MUAA 4CW7A 2HEIA 4XIGS 4GNKA 1G6HA 1KDPA 4QNMA 3EZ9A 3DPUA 3TLXA 2V1XA 3AVVA 3GFTA 2XNDD 5DHFA 1E2JA 1J99A 3EPLA 3PVSA 4PO9A 4ZKDA 1K6MA 4G3XA 2FSIA 5DYIA 2VA8A 4Q7JB 3TBKA 5KYKA 1T9HA 2PX0A 1A2BA 3D6TB 1W46A 2HF8A 4Q7KA 5G40A 2OCYC 3RS7A 1HT2E 4PPQA 1UEJA 3AVPA 1M6NA 5HCNA 1AK2A 5DN6A 1X1SA 1P72A 1HE1C 5CJPA 2G3YA 5CJ2A 2VRWA 3P1JA 5G3YA 3VU9B 3ZD7A 4Q02A 5F2EA 2D3WA 4CVNA 3CNOA 1G4AE 1WXQA 4A15A 5KSZA 5G41A 3K0CA 2J5XA 2QEQA 1E2HA 3A58B 4R71A 3DM9B 3W34A 4D2IA 3C14C 3WP0A 1JB1A 3QENA 4TQUS 5AJVB 3RS4A 5FUVA 2Z4RA 4TSFA 3GEHA 3ZS8A 1FTNA 3IKJA 4LJ6A 4LJ8A 3RWMB 4CRWB 3GFPA 2AWNA 2QAGA 1A2KC 1YVDA 2MMGA 3KL4A 1FUUA 4RFSA 1QHNA 4TQAA 3VKGA 4DLVA 2WAXA 2JIZA 2ZIAA 4CT5A 1HE8B 1NVVQ 3K0CC 3K70C 2TMKA 3PJRA 4P0TA 2IEZA 4RKEA 4A1FA 3SHFA 3R8FA 3NIBA 1GOTA 5E4FA 2CLSA 2NPFA 2OLKA 2W6JD 2VIIA 4MKFA 3QVVA 4GZMA 4QXAA 1S8FA 1SHKA 1F6BA 3HPRA 1ZP6A 4D80A 5F3WB 1DAFA 2QAGC 3P26A 3IIJA 1W4AA 1T3SA 2X2EA 4A6PA 4G5RA 1XEWX 2C2HA 2B21A 2QBYB 3GJ0A 3TSOA 2I3BA 4KVGA 1UM8A 2FWRA 3V4RA 5JHHB 3QEOA 2FMXA 4BFWA 4BFXA 3IIKA 5C2JB 3RRYA 4DJTA 4ON9A 2MSEB 1D9XA 2VSOA 3F5FA 1OFUX 2ZETA 3QPWA 1BIFA 5HTKA 5BN3A 2A5YB 1E3MA 4A0GA 1EFRD 1W0KD 4A6XA 1GRNA 1SVIA 3SR0A 2IC5A 1TQ4A 5JWHA 4XD7D 5FUWA 1ZNWA 4TMVA 1P6XA 4OI0A 3AB3A 1X8KA 3PUWA 3CRW1 3GLGA 1CJUC 4FMCB 3CRRA 2WMOB 2ODBA 4S35A 4V0ME 1NKTA 2YOGA 4PXAA 1UEIA 5FOXA 2LCFA 4C0SA 1NI3A 2CCJA 3UMFA 5J4KA 3AVOA 4KSBA 1G7CA 3DL0A 1EFUA 1OIWA 1NBMA 2QQEA 3IDQA 1B23P 4PAMA 2O8BA 4XOIA 4R98A 1SHZA 4JLDA 3Q5DA 3TNFA 3EWAA 5FOTA 4TYYA 3EC1A 5FOWA 1JPNA 2XEXA 4Y0AA 1H8HA 4Q4AB 2OG2A 5LBIA 1EX6A 1XTJA 4OI2A 1JJ7A 5DSZA 1IJEA 2BM1A 2I1VB 2JLVA 1DVRA 2Q0HA 1Z0DA 4PC6A 1SQ5A 3BD9A 2IXGA 1M34E 1U8AA 2AFIE 2QG6A 4OI1A 2NGRA 1RKBA 4NCJA 1KI9A 1LF5A 2RGDA 3HR7A 4PX9A 4JVLA 1GIAA 3VU9A 4O0MA 1U0LA 2GF9A 4JLKA 1M1YE 4PQYA 1PLKA 4YXWD 3RSLA 1NY6A 1PUJA 1VCIA 2GESA 2ZI6A 3MWKA 4MUBA 4F7WA 3SC3A 3HDTA 1DG3A 3HWSA 1T6NA 3T34A 4QC2A 4MRPA 5CLLA 2BHRA 4FXPA 1K5DA 1Q21A 3AV0B 3CWZA 1NSTA 4US2R 3O8CA 4ABYA 2D7CA 5EE5B 3KQKA 1IN8A 2GJAA 1WF3A 3PUYA 4TLEA 4YMTA 3GQBA 4B3BA 4DBLC 1YZQA 3VR1A 1JR3E 2W2XA 1R5OA 3HYTA 1SXJA 4BZXA 4JMPA 1ZM9A 4JLVA 2XITA 1XCMA 4Q7MB 1OPXA 1VYVA 1DO2A 3IHWA 4RCYA 3DZ8A 1CRPA 2J7PA 4LUCA 3I73A 1KNXA 4WZBE 1KHTA 3EC2A 1YRBA 4B35A 2CLDX 3GJ3A 4TYPA 2GCNA 4RZUA 1XPOA 4ESHA 2QZ4A 1SGWA 2YZ2A 3CX8A 1MRNA 1AQYA 2JJ1A 2WJYA 4ZI2A 2J3EA 2R6AA 1E1QA 2A78A 4A0RA 5EJEA 5E7IA 1YE8A 2KBEA 4MKHA 3B78A 5TV2A 4JBWA 3FPAA 1M2OB 4PSVA 1ZYUA 2PT5A 4MYTA 4AIIA 3FGNA 5KSYA 2RAPA 4URWR 3CRQA 1XRJA 2KBFA 4JT4A 4EAQA 1ZINA 1S4QA 5CITA 1L4UA 2OHFA 1FZQA 4N1AA 5L3QA 2ZR0A 2GXSA 5FPYA 2Z83A 3DEFA 4CEIB 2NQ2C 4UXHA 3TVDA 5CDFE 4NYMQ 3KQNA 2EW1A 3BXZA 1EG7A 4W5WA 2V6IA 4KYUA 2C03A 1N2CE 4CDGA 3WHKA 3IHLA 1OIXA 1Z29A 4Q1DA 5L3RA 2V9PA 4C30A 4R2HA 2W83A 1UKZA 5EXPA 2BMFA 5E7JA 2B8WA 4B3DA 2NO9A 4D0NA 3QF4B 5EE1A 4JT2A 2H8KA 1WA5A 2UZ3A 3L0OA 1XTQA 1DPFA 5FUYA 3QKSA 3UWKA 1DAIA 3QXJA 2B7CA 4JYCA 1XTRA 4PAQA 5LDDC 1NNEA 3IQXA 4BEJA 1QF9A 4JIMA 721PA 2ZU6A 3TGPA 1Z0IA 1IY0A 1VDZA 1XMSA 2KI5A 4QGGA 4Q4AA 4DDVA 4F92B 2V8OA 4K81B 3FKSD 1E32A 5EXSA 4WZ6A 4LBYA 4M1TA 1ZUNB 2OV2A 4MGZR 5FR1A 3SYNA 1MABB 1T8UA 1FQKA 5IHPA 1NG9A 3ZD6A 1BKDR 2HJVA 4DUGA 1XTSA 2OEPA 1P5ZB 4BLOA 1CJKC 1FMLA 2HT6A 1I2DA 2IUSA 1Q1ZA 2HDNB 2WOJA 2QT1A 2ZVPX 4B47A 5C46F 3CH4B 1W36B 1E9FA 4ARZA 2XXAA 1CU1A 1KO4A 2ZJAA 4LRWA 4C7OB 1IOZA 2C98A 2OE2A 5KSOA 3OFND 5P21A 1VHTA 2GJ9A 4RZ3A 1HURA 3QPUA 2VF8A 1KNQA 4I4LA 3Q85A 2J7KA 5JECA 1S96A 3LBHA 1YZLA 3QKRB 3OZXA 1L8QA 5KNCA 5JWOA 4LYAA 1T5IA 3ZS9A 3O47A 2NO6A 3ONWA 2C95A 3WRXC 3VKHA 3I5YA 4YC7A 3DZDA 1NN0A 2YWEA 3THWB 4KXFB 4TZ6A 3TIFA 5FTJA 2J59A 3I3SR 4HAUA 1VYUA 3KTAB 2F1JA 4TL7A 3VQTA 1RYFA 3BB4A 2UVQA 3CONA 1U8ZA 4LPSA 2V7QA 4EDHA 4C0HA 3AF2A 3BJIC 4QBFA 2DR3A 2ZE8A 3SNHA 1MO5A 4GSYA 3ZLJA 4LPKA 3P32A 4FIDA 1LW7A 3GMTA 3VX3A 4V0KA 3EPKA 4EPYA 2OESA 4H9GA 1I4TD 2YC2C 4MQBA 2PCLA 3SJAA 4HAZA 1KY2A 4TTQA 1UBFA 1I2MA 3RYTC 3B7GA 1G8HA 1Q1EA 4Q19A 5A0FA 1KSGA 4L9SA 1QDEA 4B6EA 4PC7A 1OV4A 4MITA 2QE7A 3MSXA 3DOEA 4URVR 1BMFD 1OIVA 2PLFA 3P4XA 4F38A 1QRAA 3AF3A 5DI9A 1G7TA 2AR7A 1NIJA 2QENA 2WKPA 3KKQA 4IDQA 4P4UA 1E98A 5DYGA 2AFHE 1KY3A 3THYA 2RGEA 4B2PA 3LLMA 2OFOA 1IN4A 1ELOA 2ZYVX 2G83A 5UKDA 2IYUA 1EWQA 2JA1A 3NTUA 1GRRA 4BWYA 1PLLA 5FUXA 2OUKA 4RSGA 2VP5A 3NHAA 4C0BA 1ZRHA 2XB2A 4AKEA 4KYIB 2REOA 1JR3A 1U94A 1EWRA 3QF4A 2AX4A 3M4YA 2IYZA 2RCNA 2VHCA 2ZRIA 4M1YA 1GP2A 1D9ZA 4BUJA 3FMIA 1A1VA 1E79D 4KFRA 4F4JA 1M7GA 3GEIA 1FP7A 3MWLA 3QSYA 2PH1A 1P2UA 1COWA 1Q57A 3OE7A 2WPDA 3U61B 4R9UC 2ZS7A 3NC1C 1P4SA 5DE3A 3RRZA 2RB4A 4FI3C 3RVBA 1D8TA 4P32A 1WCV1 4DB4A 4DSNA 2MSDB 4LOAA 2R2AA 2ZXUA 3MUFA 2R6DA 2ZYTX 4FMDF 1K8RA 5FTKA 4BFTA 4C2UA 3RHFA 1ZIPA 1VG0B 2BOVA 3H86A 4BLPA 2XSZD 3O8RA 1NBMD 3QQ5A 4DSOA 4EPXA 4IXMA 1AKEA 2ZRHA 4EQ6A 4RY2A 1EXMA 1F2TB 4NZYA 3TUJC 1TQDA 3EW9A 1GFIA 1OW3B 2VBCA 5C1BA 4C2TA 4D82A 3R8CA 4BRUA 4DDWA 2AL7A 4QBIA 5B57C 2IYYA 1H8HD 4KBFA 3VMFA 2QN6A 3QKRA 2C5LA 2QT0A 5CDFA 3OIUA 1OFHA 2HF9A 1CS4C 1YQTA 3RRMA 2NZ8A 2WWIA 3PXGA 1JALA 1G7RA 2BBSA 2ZRGA 1KO1A 1OH6A 3ICQB 4OHWA 2EU8A 1SVMA 4BEBA 1XXHE 3THWA 1W36C 1TNDA 4Q4JB 1XZPA 3NC0C 2IYSA 1U90A 4KBGA 1U81A 1XEFA 3KB1A 4Q18A 2J0SA 1XMIA 4Q1FA 4UJ3A 1NJGA 1R8SA 1C9KA 1IXSB 1GNRA 4ASUA 3UPUA 1JR6A 1YJ5A 2AD1A 1F2UB 3CNNA 4G5SA 2OLJA 2NPIA 4PHFA 3EAQA 1IAQA 5J47A 2P2LA 4NHOA 5B64A 3T61A 2P6RA 4A9AA 1M74A 3BFXA 2CL0X 3MGCA 1PV4A 1W2HA 1F5NA 2QTVB 4EIWA 1QHGA 3FYHA 4WZAE 3T1TA 1NRJB 1BOFA 2IYQA 4HDQB 1E2KA 4OQNA 4NTZA 4MDFA 3MJHA 1OSNA 3LQRA 2F9MA 2BEJA 2YWHA 1U98A 2W58A 1L2TA 2AK3A 4MRNA 1AM4D 2ZI4A 1P9WA 1SXJD 4P4SA 4D4JA 1QZXA 1YZUA 2WJGA 3H0KA 2WM9B 1E9BA 1OFIA 3WMFA 2O8EB 2E87A 2PJZA 1VCMA 2JATA 2YOHA 2J0QA 1RRFA 1UDXA 3N5CA 2REXB 3RC8A 3KX2A 3AP1A 3VNVA 2GEVA 1D2EA 3QI2A 4MKGA 3KQHA 4US0R 4B2LA 2HLDA 2QMUA 3AF0A 4M1OA 2YWFA 1MO3A 3C7KA 3TKLA 4AYXA 1K5GA 1Y3AA 2B92A 2FEMA 4K8OA 3R7WA 3RS0A 2FU5C 2EQBA 2VSFA 3EWSA 1KTVA 2D2FA 2JJ1D 4DCNA 2FPLA 1AA9A 3FVQA 5AUPB 3JVUA 3UMSA 1II8A 4GDFA 4IOKA 3Q7PA 4KCGA 2W6IA 3BH7A 2DBYA 4LZZA 4NYJQ 4HAVA 3AF1A 3SJZA 2GETA 4V0LA 1NL3A 4BFUA 5AJXA 4Q4HA 1XXHB 1KI6A 3CB4A 1EESA 5FH9A 4MYHA 2N1BA 5IDVA 4Q01A 2CHVA 2FE4A 4FCTA 2IX3A 3WBKA 3CX6A 3U7FB 1CKEA 5FL3A 2A9KA 4UNPA 3WMGA 1FUKA 1KJZA 1G8PA 5AK0A 1BYUA 1L7VC 2O0KA 1BS1A 5TDHA 1W1WA 3ZYCA 4M1MA 1DE0A 2HUPA 2GAAA 2XZLA 1DARA 2FEOA 2O8FB 4DIDA 4ZIRA 1OT3A 4BZPA 2XB4A 3LAWA 4UJ5A 2FH5B 3SI7A 1UADA 4LHXA 3A1TA 4TL9A 4YMVA 4NYIR 1JXOA 2O0JA 5KDDA 1MH1A 2B7BA 3S1AB 5CIWA 4OQXA 4BRWA 4JSTA 2WAYA 1G17A 4PC3A 1E2GA 1E6CA 1II9A 1N6LA 2BC9A 3BIFA 5FFMA 3ZGXA 4G1UC 3FMOB 3QXCA 1P3JA 2XTMA 2REBA 3THOA 3CPJB 4FMCF 4IVRA 3TW4A 4A92A 5L3SB 2D74A 1VG8A 2ZRCA 2O8DA 2GF0A 2OCBA 2ZRKA 4YLGA 1CP2A 1ZAKA 2D62A 3U6KA 4TMKA 5TVKA 3L0PA 3C41J 3PUXA 2CNWA 4D81A 1NN1A 3K0AB 1KGDA 1A5TA 3RRNA 2PJRA 2GILA 2X1VA 3T5GA 4C4PA 1WP9A 3KKNA 1E2EA 1XCGB 4IEEA 4PO8A 4AWXA 4KITB 4OK6A 4DUGD 4MGKR 5K8LA 1VMAA 3Q8XB 4BLTA 2NO0A 4Q9JA 3GLFE 3HU2A 4URYR 1NVUQ 1Q12A 4II7A 4LJAA 1GAJA 1OLOA 4ZDIA 3MRSA 3UANA 1L4YA 2GTPA 2Q3MA 4JVNA 2F6RA 1QG2A 1JNYA 1HQYE 1NN5A 4OHZA 2NMVA 3DHWC 3AKDA 4FMBB 4PZYA 4QM7A 4O3MA 2ZREA 3P20A 1F60A 1WMSA 1W4CA 1N6NA 1Z6YA 4M2LA 1FNNA 1NF3A 4BFYA 3AKYA 4TL6A 2WIAA 2DYKA 3IBGA 1B0UA 4WA7A 4BECA 3QG1A 3NXSA 4ZO4A 1G8YA 1KYIA 2C99A 5CYPA 4JZKA 2CBZA 2A7QA 3ZVNA 2NOAA 4BLSA 1DBSA 4AG5A 4LHYA 3PV0A 1AGRA 2CMKA 3I61A 2AXNA 2YHSA 1FPMA 1FNMA 2CCGA 3M1IA 2Q9AA 4WXRA 1S3GA 3BK7A 5KUTA 1JXMA 5GVSA 4POAA 4HLCA 2GWHA 4JBYA 3R9IA 4L16A 3NBZC 4C0AC 2GNOA 3GLIA 3CZQA 2QPTA 3LDAA 4NH0A 2OT3B 1CR2A 1Z6GA 4WAUA 4B48A 1KO7A 4IVPA 3TVTA 1KOFA 5E95A 4U5XA 5CB6A 4CF7A 1NLZA 1ODFA 2JJ2A 2QE7D 3GLFB 3WYFA 2DCUA 3Q9LA 1AS2A 1JAIA 2GVZC 2P0EA 5LD2B 3AVTA 2MMCA 2NO1A 3EASA 3R9WA 2WOOA 2GDJA 2IHYA 4Y0VA 1F48A 3BRWD 2HYIC 3GFOA 1M7HA 2QTHA 5FPTA 3MCAA 4CEHB 4W5HA 1KI4A 3EPHA 5DLQC 2DPXA 2J41A 2RGGA 1GNQA 3K9GA 2W2TA 3MFYA 4JLJA 1E99A 3EZFA 3GEEA 3TJZA 2CHGA 2NG1A 1G64A 1N5JA 2VPPA 3AF4A 4AG6A 1ESNA 1S1CA 1KIMA 3B9PA 1CXZA 1F3OA 1U99A 3KFXA 1Q20A 1G5TA 3LW7A 1GDDA 1SZPA 4IOMA 3ZDQA 2VTKA 5TY0A 2ZROA 3PR1A 4L8GA 4Q1AA 3KQLA 5L3SA 4YMUA 5FBVB 3GJXC 3PFIA 1UPTA 2FGJA 2X2FA 1QHXA 2P67A 3X2SA 3LLUA 2EFGA 3THXB 4DSUA 2H17A 4XWKA 2HCJB 2VP6A 5J5CA 3GPLA 1P2TA 3BOSA 2HJGA 3W6PA 2QNRA 4C9BA 4DXAA 1TL7C 2C96A 4XTCS 2FF7A 2FX3A 3RLFA 3MWJA 2X8AA 2A5FA 1G8FA 1IM2A 1P61B 2BJVA 2ODWA 4F93B 1ESMA 1OF1A 2OAQ1 3SYLA 4LV6A 4PAOA 5JJKA 4JLNA 2CDNA 2HV8A 4KAXA 3OAAA 4HI0E 2GCOA 2P5TB 1E2PA 3TAHA 3B5JA 4HB0A 1HY3A 4AKGA 1G5RA 3L0SA 3SE0A 1E2DA 3KXKA 3PIRA 1YR6A 2G1KA 3O8DA 2V54A 1FMJA 3SS8A 3UKDA 1OYYA 2YVUA 1Z5ZA 3MAAC 2A5GA 3QE0A 4JJZA 4BFSA 4IDNA 2J45A 1TF2A 4DCTA 2PX3A 4CEJB 1S0UA 3C15C 4MGIR 3D8BA 3SBEA 4JKIA 1Q1QA 5AWFC 1E1RD 1G3MA 2OO7A 3AKEA 1E9EA 4PHGA 3TH5A 3EX7C 4Q21A 4QRHA 3E5HA 3HU1A 1P7CA 5FBRB 1EX7A 3OEEA 1HQCA 5BQ5A 3P27A 3U7HB 1PVOA 1Z6XA 1TMKA 1G41A 5KOYA 3K0SA 2G6BA 4IFBA 1EK0A 4UXJA 5GJCA 1TEXA 1ZUIA 3U6BA 2G77B 2ZUBA 3H84A 5HZHA 4E07A 1DAKA 2ZRPA 1QHHB 3OESA 4C3ZA 2ECKA 4IOLA 3ADKA 2B8TA 3CZPA 4DCSA 1VYTA 3CUEF 1SVWA 3BFKA 1LB1B 3I32A 4OL0A 3X1ZA 1A4RA 1RRPA 3FHCB 4HEJA 4R2IA 3T1OA 4JLAA 3KKMA 4LGMA 3B85A 4D6PA 4A2PA 4E09A 2C9OA 1DAHA 2J0UB 1SKYE 1KI2A 2E9SA 4OK3A 5B30A 4D26A 4TWZA 2HLDD 2WSSA 3MWYW 4LJYA 4GT1A 2V4ZA 2ZM5A 4CEHA 1S9DA 3TW8B 4A36A 4EUNA 1XD9A 1SVLA 2I1QA 4NCIA 2RGNA 2Z43A 4BASA 3I8SA 1GVNB 3B82A 3LBNA 1OH5A 2JDIA 1XDBA 5FPHA 4TQ9A 2OXCA 2C8VA 4FD2A 4IDHA 2W6ID 2KB0A 2OAP1 3K9LA 2L0XA 2R44A 3FHOA 5LD2C 2IS4A 3KKOA 4LJ5A 4GRAA 2A30A 1T5LA 5G53C 4FCWA 1MO4A 2WWYA 3AGQA 3KKPA 5IRCD 1G3RA 3EIEA 1OKKA 4P4TA 4Q4LA 1XB2A 4IOJA 2RMKA 1FX0B 2ZRJA 2RGNC 1N0VC 3FFAA 4S2EA 3U3OA 3UWOA 2QBYA 4IRUB 4D25A 2JASA 4Z51A 3U3KA 1AKYA 1G3UA 4RD6A 5JSZB 2HXYA 4M9XA 3AH8A 4TMXA 4UKDA 1X86B 1X8JA 5JEDA 1UKEA 3T1VA 1PJRA 3QOFA 4KO8A 3RS5A 1XEWY 4V03A 4FWIB 1KO5A 2QRNA 4HUQB 5HKKA 4MDEA 3B1ZA 4DLSA 4Z1MA 5IK2D 2OZEA 2DWOA 2DY1A 4OHXA 1TADA 3VKWA 2QP3A 5F9HA 2BBTA 1RYHA 4IHQA 4EFMA 5H8WA 2ZUCA 4FW9A 5JJLA 1ZW6A 5AJWA 3U3RA 5L8VA 1UFQA 2RGCA 4D0LB 1NIPA 1WQ1R 3NH6A 4LC1A 4PQFA 3L82B 1SKYB 3RS2A 1Z07A 2RGBA 3MG9A 5J40A 3X1DA 4DEYA 5AUNB 5JCPA 3SYKA 3PENA 2VHQA 1UBCA 1Z08A 2ERYA 2GZDA 3T35A 4BPBA 2QMOA 3AVWA 2VF7A 4A82A 3ZZUA 3UMRA 3VAAA 2XTNA 2CVHA 4DVGA 2PZFA 1LY1A 1YU9A 1HV8A 4LHWA 2EYUA 2QPOA 2CNWD 3KJEA 2C78A 1RPZA 4XWAA 1LFDB 4W5JA 4MRVA 2ZPTX 4P3YA 5EP2A 3BH6A 2ZE7A 2GJKA 3EA5A 4CIDA 3LX5A 1OXUA 1XMJA 4LJ4A 3SQWA 1AGPA 1N6PA 2J0VA 3CR7A 3IILA 5C4GB 5FTLA 2IYLD 2ONJA 2ZITA 5BW8A 2ZE6A 3IBYA 1DTSA 1Z06A 1N5KA 4PPFA 2IW3A 1OHHA 1OJLA 3GP8A 1W0JD 1XWIA 1E69A 5BYJA 3AVXA 2ZI5A 1PLJA 2C9CA 4AYTA 2X19A 2F1HA 1Z0AA 4IJMA 2HCBA 5J4YA 2KSQA 2F43B 3WNDA 3NBYC 2R65A 1KI7A 3X1YA 1KK1A 3ND9A 3EG5A 4DLUA 1E2QA 2GA8A 2CK3D 4JVSB 1G4UR 3W8RA 2OBMA 5H1YA 3DOFA 3BWDD 4E03A 1RC8A 1DAGA 2HXSA 4I99A 4LYJA 5CLQA 1QBKC 4B3CA 2KE5A 4PZZA 5AUQA 3W3ZB 4C0QC 2O5VA 4HAYA 3W5IA 1W48A 2ZJ8A 3KQUA 5KO2A 1MT0A 4V0MA 1V5WA 3GJ6A 1OYWA 3SJBA 1T8TA 1G3QA 3KUDA 4QOSA 2QP9X 1XU4A 1Q1BA 3WRYC 3PQCA 1R5NA 3K0EA 1KAGA 3KUCA 3FMFA 3PUVA 5DN6D 3TE6A 4V02A 1RRCA 5JBQA 2WIBA 2YNMA 2PL3A 3GD7A 3OEHA 2W0SA 1E0SA 4TT3A 4OQMA 1TF7A 4RD3A 5EE3A 3B1XA 2XNSA 3DMDA 2XJ9A 3K70D 3TR0A 1M8PA 4LC0A 1E9CA 1WBDA 4QG7A 1Q3HA 1W2GA 4LHZA 2WJIA 1YR9A 3ZH9B 1NVXQ 4FWTA 4TSFD 2DFTA 1YZNA 4ACAA 4B3FX 3ZZTA 5ANRB 2J1LA 4JKYA 5AJYA 2XNDA 4GOKA 4HZUB 3LVRE 4M22A 4M21A 1I4LD 2JIZD 2H57A 3IUYA 4GI7A 3BB1A 4BE7B 4M9ZA 4H1UA 2CE2X 3BBPA 2GEUA 3DVLA 5LPNA 5CIQA 2A5JA 2BBWA 3LA6A 4JLOA 2AK2A 1R2QA 4B75A 3GJ7A 4CEIA 1ANKA 3RWOA 4LBVA 1GSIA 3BE4A 3CBQA 2ZRLA 1CR1A 3F8TA 1VIAA 2FFBA 2GZAA 2CL7X 1E9RA 1R10A 1SVSA 1R0ZA 1VTKA 4N0DA 2PBRA 2YWGA 1GTVA 1IXRC 5D3MB 4CGZA 2QUZA 4XH9B 3F3YA 3LVQE 2JJ8A 2QMEA 2H18A 3LV8A 3H1TA 1IY1A 4U00A 2GXAA 3IPYA 3OIVA 1Z28A 2BJWA 4X8HA 1LVGA 3B9QA 4F4CA 2IL1A 5LB2A 4E22A 1KSHA 4QJ4A 2ANCA 5CM8B 1SVOA 4JL6A 3KJHA 1NG1A 1E9SA 3QXHA 2QROA 4BGDA 4C0JA 1HYQA 2PCJA 3KDSE 4UXIA 2FFHA 2WHXA 3PUZA 4QGAA 2P5SA 3NVAA 3WHLA 4Q03A 2ZS8A 3EPJA 1MABA 1GG2A 3AP3A 4XVQA 2VP4A 2LKCA 3CR8A 2JLZA 1W47A 4OI4A 2W6JA 5DISB 2JAQA 1TQ6A 4B2IA 4LSGA 3ZQJA 2NZJA 2OXRA 4G5OA 4I1VA 4QGFA 3C5HA 3T12A 3I62A 1XD8A 3NDBB 4NMMA 4QHYA 1US8B 4NKRA 4URXR 4NE2A 3SJCA 1JQLB 2GHIA 5F98A 2AD5A 3ZQ6A 5JS8A 2ZSAA 4C7OA 3CO5A 3VR2A 4DIEA 2ONKA 4G01B 2IUTA 1Z47A 1ZNZA 4URZR 2VP2A 2NO7A 2VSXA 2OILA 1UBGA 2FPKA 4E5UA 4JL8A 1Q22A 2MSCB 1CJMA 1KK0A 1AS3A 3QXSA 1J8YF 2NTYC 3ZZ0A 4B71A 3B2EA 1MV5A 1EFRA 3W5JA 1G5PA 4CT4B 2IXEA 5IF9A 1M7BA 2BIFA 2FN4A 2N42A 4XD7A 2FPMA 1EFHA 1OXTA 4CYMA 1IN5A 1TUIA 4LHVA 6Q21A 4L9WA 2G0TA 3T1QA 3W8NA 2ZSFA 4B6FA 2ZJBA 3KTAA 4OYHA 4JVMA 1G18A 4EFNA 4WW0A 1VG1A 5LB4A 5JFGA 2QGNA 3NG1A 2CLCX 2ORIA 3KJGA 2W00A 2ZJ5A 3C16C 4IVQA 3UIEA 3VHLB 1TQ2A 5SZHB 1E0KA 2ZQ5A 3Q7QA 4AKIA 1NP6A 3SOPA 5G3ZA 1W7AA 2BVNA 3A4MA 1ZCBA 2G0NA 1E2LA 4Q1EA 2WKRA 3NDPA 2C9YA 5KNDA 2ZRBA 1IONA 3CF0A 4PC2A 4TLBA 4M1WA 3QY0A 3UG7A 5IT5A 5JLJA 5FOVA 1E96A 2EFEB 1N6HA 4HZUA 4X8MA 1XF9A 3MD0A 2GK6A 2RKOA 1XPUA 4KV9A 5FTNA 2Q3HA 4PSAA 2J7PD 1WBBA 3BAFA 3IIMA 4JJKA 4B44A 1CJTC 3V9PA 1R0WA 1QG4A 5BWMA 1GITA 3FB4A 4DHEA 1JBKA 3BC1A 3QBTA 1AZSC 2X77A 3QUSA 5HCIA 1OKKD 4OHYA 1IBRA 1ZD1A 2IWHA 3PG5A 4G5GA 1KI3A 1YZTA 2WTUA 1E1QD 4Q1CA 1XPRA 4B33A 3TK1A 4RZXA 1IN7A 3BERA 4M9QA 5HZKA 3LX8A 3DMNA 1JEDA 1GWNA 4MRSA 2SHKA 1DG1G 5DHAA 5EZ5A 4A2QA 1U0JA 4C0KA 2A2ZA 3OIWA 1D6JA 4NP6A 4ZCMA 3ZJYA 4ZDJA 2ZSDA 1Q3TA 1KZ7B 3I5XA 1X1RA 4RCZA 2K5UA 3WY9A 4Z1MD 5K8UA 3ECCA 2OBNA 2QRZA 1E94E 4HB4A 2ASEA 3QNUA 2IS2A 4FINA 4B76A 3F0TA 3OIYA 4TLCA 4P31A 1XX6A 5GJVC 2ZJ2A 3A1VA 1N6KA 2R62A 2XOKA 5GVRA 1IY2A 4TMTA 1RVDA 1W44A 4M0LA 4DLTA 1A7JA 2BM0A 5J4LA 3A37A 2EWVA 3K70B 3UATA 1R6BX 1R0YA 2F3TA 1SULA 2AWOA 3K1JA 4UNNA 1CTQA 1U8YA 3QKUA 3W6NA 4A2WA 4NYIQ 2GJ8A 2GEDA 1NN3A 2UKDA 3P4YA 1F2TA 3QKTA 1HEIA 2I4IA 2ZEJA 3IO5A 2VQSA 2FZLA 4MYUA 2QAGB 1NBME 1TEVA 1WDTA 4Q9KA 5CYOA 4QBHA 3T06B 2JLRA 2C04A 1J90A 4HB3A 3SHWA 1QHIA 1RZ3A 1G16A 1NVWQ 3NEYA 3OHMA 3G82C 2IF0A 3IQWA 3VR4A 2CCKA 4ZCIA 3L2OB 3RS3A 4BZQA 4M53A 2FSFA 3DKPA 4XJXA 5EZ6B 2QU8A 2UZIR 4QBGB 4Q4JA 4ZKEA 3LRPA 2Z6VA 1XD2B 2A5DA 1T0HB 2Q3FA 1XMVA 2FZ4A 4HDOB 1R4AA 1F2UA 3VX4A 2QAJA 3CRVA 4RKFA 2FV8A 3G0HA 1OB5A 4U7DA 3IEVA 3ADBA 1LS1A 4DDTA 2FJUA 4ACBA 5L3VA 4KLNA 4HYYA 1W4RA 4LCBA 3BORA 4MGYR 2ATVA 2DFKB 1AS0A 4PTLA 4B32A 2FFAA 3UXMA 1NMXA 3NBXX 1QHSA 3A1WA 4I1SA 4JSYA 1Z6AA 4EPRA 5KPDA 2Z4SA 4OJQA 3FKSA 3BGWA 2O8EA 1W49A 2R6FA 3JVVA 3FHTA 1YHNA 5E7MA 1W5TA 3LO5A 4G5QA 4KJZA 2H5EA 4GMDA 4YDSA 4Z8XA 4X8OA 3EXAA 4K46A 1SXJE 5JRZA 2GJSA 4M1KA 4NCKA 2ZTSA 4OQLA 4ZCLA 1KO8A 1N25A 2BCJQ 2XAUA 1TU3A 2F3RA 2V7QD 2ZR7A 5DGXA 2GK7A 2ZRNA 1MO6A 3D7MA 2IK8A 4XVRA 2P6NA 1RW4A 4A8JB 2GXUA 1IXZA 2RHMA 1P2SA 2ZAOA 3I1FA 2FA9A 1EFTA 1E9DA 4A0FA 3PEWA 3K53A 1RE0A 2ZUDA 3X1WA 3GJ4A 3JZAA 3OFNA 4P33A 4AK9A 5JRJA 3I92A 3TAUA 4AYWA 1X6VA 1IJFA 3Q72A 5TARA 1XXHA 3WYGA 4DSTA 1NSFA 4DC9A 2YKGA 4V0NA 5TB5A 2H1LA 3SFZA 1ZBDA 1Z3IX 2OSBA 3TQCA 2ZJYA 3U60B 2VHTA 1ETUA 4W9MC 5KSPA 2VO1A 5AR1A 5GADl 1W4BA 5FL7A 1Z0JA 5FPSA 1JQJC 1UKYA 3L43A 2O8FA 2ZANA 2ZI7A 2CXXA 2IT1A 1ZJ6A 5FI1B 4Q9LA 1P9RA 2QMHA 1Q0UA 4PFSA 1ZM3A 1W5SA 4DLWA 3WNBA 5EP3A 3CF2A 1XCPA 2R9VA 2BDTA 1JR3D 3U4QB 2ZRAA 3QBVA 5H70A 2PT7A 2PZEA 3BB3A 3QEJA 3S1AA 4DLRA 4TYNA 1G6OA 4QJ3A 3ASZA 1XBTA 4PHTA 4UQOA 1CULC 3FDIA 2VP0A 3L8YA 3H2YA 1NVVR 1SXJB 3U2QA 1COWD 1KDTA 3OE7D 2WPDD 3PCRB 3AVYA 1BMFA 4FN5A 3LY5A 2CEAA 3SN6A 4AI6A 3K0AA 4JLPA 4DKXA 1ZVQA 1GZSA 2KWIA 1XFAA 1KDOA 2QP4A 1TF5A 1N5LA 1XD2A 2ERXA 2Q21A 2Z5FA 5EQTA 1VCOA 4JBXA 1GM5A 4ILEA 5CM9C 2WMNB 3QJYA 1OB2A 1J8MF 3AM1A 1P62B 1E4YA 2VHJA 4KLZA 1W36D 2YINC 2ZYWX 3REGA 3LXXA 2W2VA 2XTZA 1II0A 3A4NA 1E0JA 3CPHA 2GBLA 2WV9A 3M0EA 3RANA 2BEKA 1XTKA 4O2LA 1KKMA 1DELA 3C4JA 4TLAA 3WBJA 1E79A 2GZHA 1S2MA 3CWQA 4XSHA 2WVJA 1ZU5A 1P60A 1RJ9B 2PMKA 2DWPA 5L3QB 3ADDA 1GUAA 2G88A 4L4UA 2ANBA 4HAXA 1MKYA 1MR3F 1KZGB 1Z0FA 2H16A 1AIPA 5EXXA 4GZLA 4WXPA 4KHZA 4GP6A 1XP8A 1AJEA 4M4SA 1ZMXA 5K8IA 1LF0A 3PEUA 3I4LA 1UF9A 4ASUD 2GBLC 1HH4A 3VR3A 2ZRMA 4TL8A 4TYWA 5JHGB 2XSZA 2D7DA 1NKSA 4QL3A 4OKSA 4WOPA 3IO3A 4GOJA 4A8JA 3HP1A 4U02A 5AUOB 1UDWA 3K9HA 4RD0A 1FW6A 1S9HA 3QKSB 2QA5A 1NLFA 4LYHA 1VCNA 1KKLA 4NU0A 5DIFA 4NONA 3LNCA 3RAPR 1XNJA 1J7KA 3ASYA 5AJZA 2WWHA 1KSJA 1WRBA 3HPQA 4DCVA 1DS6A 3K9NA 2P6UA 3Q3JB 3GLFA 3FFBA 3LFUA 4A8JC 2QY9A 5JI2E 1Z6TA 1GRQA 3AP2A 2RGXA 4TN1A 3QVUA 1G7SA 3B6EA 2ORVA 2AHOA 3WXMA 4PR0A 5FBWB 1E2FA 1T4GA 2QSZA 4L15A 1OXSC 4QNRA 2XJ4A 4F4IA 5TMPA 4Q1BA 3GCGA 2ZR9A 1JI0A 2BKEA 5DI3B 1P2VA 4YONB 3AVUA 2EVWX 2GAOA 4ARZB 1ZM4A 2XXAB 2Q9CA 2QGZA 2EFCB 3CM0A 3N2IA 3U4QA 2PMDA 2ORWA 3V00A 1GKUB 4EPVA 2GRJA 4DLYA 3GJ8A 2DB3A 1BYIA 3K8YA 4KU4A 4MA4A 3UK6A 3HR8A 4AC9A 3Q5EA 1OFTA 1ZM7A 1EGAA 4MKIA 3MLEA 4B73A 1LV7A 5J4VA 3J81k 821PA 1FQJA 2YV5A 1NY5A 3FTQA 2OFXA 3NBFA 1N0WA 2O8CB 2F9LA 1E0AA 1GL7A 1NMZA 4LWZA 1Z63A 3THXA 4Q9IA 3HU3A 1XEXB 4D0GA 1ZUHA 5KDOA 2JLUA 3BH0A 4ZPXA 2XOKD 4NDZA 5JMTA 4NPHA 2WZQA 3DO6A 3SBDA 4DDUA 2N46A 3A36A 1GNPA 1XZQA 1C4OA 3E1SA 1SXJC 2V55B 1QVAA 4LY6A 2OM2A 4LV8B 3SQXA 3WNCA 1P73A 1G20E 1TAGA 1T91A 1UJ2A 1VHLA 2WJVA 4QGHA 1DAMA 3SEAA 3D31A 5DH9A 5K8TA 1DAEA 5C18A 3FWYA 4D4LA 2IF2A 1KJYA 1RRGA 1C1YA 1G21E 1QVRA 1VIYA 2VL7A 4US1R 1IQPA 1LTQA 2WJJA 4KFUA 5FOSA 1G1MA 1TX4B 2GXQA 4ZV4A 3PEYA 1Q44A 3VTKA 2ZYUX 121PA 1E9AA 4H1VA 4B34A 5JS7A 2BMEA 5GJBA 1RJ9A 3B60A 3A8TA 3MMPA 2WSMA 4Q66C 4NYMR 4CEJA
chains in the Genus database with same CATH superfamily
4ND1A 3ZQUA 3QF7A 4JP3A 1BS9A 2WBLC 4N6NA 4PO1A 1AZLA 4Q48A 4EA8A 1YSCA 2AW3A 4HWOA 2H5LA 3C8DA 2VJAA 5M5BA 3JWHA 1E2MA 2F8LA 2ZP1A 4HLUA 3F6EX 4QUBA 2MYTA 4BCBA 2QVLA 2HO4A 5CH8A 3BSSA 4RFVA 4OQZA 2ZYAA 1PYDA 5EZQA 4RZ2A 3TXYA 1WW3A 1SRQA 3CLVA 5KIAA 3AUJB 4KQIA 5IARA 1WXGA 3WWOA 4EJSB 3H2KA 3LCRA 1VG9B 1QFSA 4YRAA 4JLBA 3ES9A 1X1QA 2IS6A 4FFSA 1QF6A 3WLOA 1P9NA 3HYRA 4MUNA 1L1QA 3IBCA 3PPWA 2BUBA 2FLKA 4D8UA 1QHHA 1FQWA 3DNFA 5DHRA 1ZD5A 1KYWA 1N9KA 3I53A 4FS8A 3FMPB 4DLXA 2FF5A 2ZIVB 4DLBA 1DADA 3L6RA 1TZKA 1J70A 1V43A 4MJLA 1JKJB 2P9EA 2UVPB 5K99A 4A8PA 5ENVA 2DM6A 1TM4E 4DLLA 1PN3A 1YAHA 5M3BA 3S0JA 2HBYA 1J2JA 1WKCA 2XDWA 3L8ZA 2O1WA 2JLXA 2P4EA 2IYVA 1N5IA 3RYIA 4O4LA 5CB8A 2FZGA 4R7ZA 2ODEA 4H3HB 1ADBA 4X6YA 3GJTA 5ES4B 1TI7A 2WA2A 1JB9A 4DCUA 2IYRA 3G2IA 3N6XA 2BGNA 2P2YA 3A32A 4OV6B 4WSOA 4GU5A 1Z22A 1N92A 3DOJA 3HUTA 3U0BA 1LTHR 2X4LA 1BD3A 1X92A 1XTVA 4MP8A 1ORWA 4BNVA 1Y6GA 1BO6A 2DU8A 1N2ZA 1D07A 3D6HA 1MGOA 4L2IA 3F2IA 4RV4A 1DWOA 5DI3A 4BB9A 2EFYA 3SJ7A 4EQ6B 4HT3B 2BP7B 2PGXA 5JFTA 1Z2PX 1PKXA 2C07A 2WP8J 3OCYA 4PQRA 1ZVVA 1NYRA 1NJFA 2XCOA 3OLCX 5CGQB 2R7NA 1SC9A 4DYHA 1Q0PA 2G7MC 1JR2A 2HA5A 4MXDA 3D8NA 2QVYX 3NWPA 4MYCA 2IPNA 5KDLA 3CGGA 1N9GA 2DQ4A 2VP9A 4IKOA 2EWWA 3DB2A 4YO7A 2ABWA 3E03A 4PC1A 1CJBA 5TQ0B 2BEWA 4YMWA 3FA2A 3U5TA 3LKVA 1BAPA 1JG4A 4KE8A 3AC0A 4O5OA 1R0RE 2HSJA 2CFCA 3JD1A 1ONBA 2J4DA 2QMQA 4PCUA 4BNYA 1H2WA 1TECE 3TQQA 3AI2A 2ZJ6A 3SYTA 4EITA 4RTMA 3G9XA 3UMGA 1M2WA 2R1TB 1EINA 5IDYA 3QWHA 4WJKB 1QK5A 5TE9A 5F23A 2NUAA 4GMFA 4Z0NA 2YBDA 2HGZA 1VKJA 4DCOA 2BEVB 3LVFO 4I5IA 4OQFA 4RA6B 1LSSA 3IBSA 2AV6A 2P9BA 3HEMA 4FOSA 3MCWA 4HUQA 2D2EA 3KT3A 4AICA 3SU8A 1G291 4N5LA 4QTXA 2HO5A 5EE0A 3WQRA 3MINB 4W7SA 4S0XA 1OBVA 1ISMA 1D2MA 3NRJA 2H3HA 3P9ZA 4XB2A 2PHZA 3M1LA 3MHTA 1E6WA 1FLVA 2PEZA 3QTTA 4Y1RB 5B1EA 4D5GA 1CR0A 5JAQA 1KDVA 3PUJA 5C37A 4LK2A 1BWPA 1VBKA 1GG8A 5T4EA 2Q07A 3QSGA 4GAEA 4UULA 4RIIA 1LBIA 2ZAMA 3I6YA 2ZI3A 3P9NA 1MX3A 1P4JA 3N8DA 1C8LA 2BHLA 4RQTA 4GX1A 5FA5A 2C83A 2JC3A 4E2FA 4YJHA 3CW2A 3K09C 4DMUB 5AVYA 1G3IA 3HACA 1TCUA 3WB2A 4HH0A 4JBIA 1WCYA 1RBZA 3JALB 4F6RB 2ZSEA 1I2ZA 4LDQA 4AFNA 4BIMA 1H0KA 2GKSA 4HB2A 5DMXA 2RHJA 1U9YA 3OP1A 2OC9A 2CJWB 3RC1A 1JPJA 1VBFA 4G0NA 1ZUD1 4M88A 1YFZA 5H83A 5AYVA 1GL6A 3JYPA 2FRXA 2GYUA 4HDMA 4R1QA 4CV3A 1R7RA 3NFRA 2VAXA 2ONCA 3KZ1E 4QVIA 3EIQA 2G1UA 4OLJA 2HRRA 5A0VA 2II6A 2DHRA 3C74A 2GQ0A 1J1UA 4AJ1A 1AOXA 2RHDA 4EJSA 2VWPA 4H27A 3SDZA 4XDZA 2BGJA 4DZZA 3H4MA 5HE9A 1KJ9A 4B7AA 4QPPA 2AXEA 3H11B 4KLRA 2H07A 3KU1A 1QO9A 3LBIA 3LY9A 3COWA 3Q6NA 4YJ2F 2RG1A 3FYUC 4LYFA 3T4EA 3Q40A 1OUMA 4BLUA 2JIDA 2P2DA 2XUJA 2ZT5A 3A3NA 3R3SA 5YASA 1JKJA 2UVPA 1IG3A 1Y9DA 2FDCA 1AKRA 4BO1A 3HJNA 2XGJA 1KARA 2XZOA 4I1UA 4NCXA 2V65A 3IKMB 1V16B 3VI3B 5H5JA 3PDIA 4E2XA 3ZJ4A 4I9UA 4Z54A 1AD2A 3HJUA 4UPEA 2OCGA 1IRXA 1JKIA 1RYYA 3CSUA 2PMEA 3OEED 1TKBA 1W59A 2B4QA 4AMGA 3A1UA 5DNYB 4J4HA 4Q9NA 1U9IC 1E58A 3I45A 4FYVA 4BNNA 1C3VA 1LW6E 1W0KA 5AKXA 3T7TA 2VBGA 5D6NA 3WGUA 2FI1A 5BMOA 1SEPA 2Z5GA 4DCCA 4Z4FA 5EI5A 5FBQB 3U48A 1R0LA 4AY2A 3FJ1A 5FTMA 4HATA 4DM7A 4HUTA 1EFCA 1IK4A 1D5CA 1NF8A 3VPDA 3AQ4A 2BP7A 2JRLA 2Y1EA 1KDZA 5GAJA 4RHCA 2YVQA 3GNSA 5CD9A 4RH1A 3LPAA 2XUGA 3ADCA 4X7MA 2WUDA 4BV3A 3DBRB 2KJQA 4BMOB 2Z1DA 4I14A 2LCIA 4P34A 4F8YA 5K0ZA 2DBQA 1GO2A 3PNPA 3WP1B 4C03A 4DT1B 3CR3C 3C1OA 4AP6A 3GLIE 5J2TA 5TQ0A 1SCBA 3H5WA 2XNCA 3DM5A 3W3AA 2FOXA 5ELMA 1DKQA 5FPQA 4IKEA 1QZTA 4QKQA 1YH3A 5JZ9A 3D3QA 2BI4A 2BTQA 3HNRA 5GV7A 1DEKA 2Z2JA 1EDEA 2VHYA 1E1RA 3BM5A 4HQRA 4HRXA 1NZDA 4EI8A 2I3DA 3IUSA 3EA0A 1KBQA 8OHMA 1FOEB 2QUIA 3F97A 1XIVA 1CBUA 3PDHA 1T0JB 3DKVA 4JLMA 1DBRA 3C3DA 1MOZA 3MT8A 4FILA 4QA9A 4JS0A 4RA6A 3FKJA 3RTDA 3RT1A 4B4OA 2Q9BA 1R9JA 5DCLA 4BCCA 1I10A 4DW8A 1O9GA 1F9EA 3B12A 3RFFA 1YQGA 1NNUA 1FP6A 2WG1A 4PONA 3I42A 1BEEA 1KI8A 3U3MA 3IVAA 1XHEA 3E1KA 4TSKA 3ZX4A 1J24A 1RMTA 3ANMA 4Q16A 5SZJA 3RFCA 2DJIA 4QO7A 4Y1RA 1YI1A 4HOYA 4KIGA 1P75A 5JASA 3RNOA 4Q1VA 2Z1NA 2Z0MA 3PNSA 3F5MA 2G08A 1M66A 3EVDA 4L6CA 5EUMA 4RACA 2DTDA 2IYXA 1HTWA 1V5FA 3O75A 2Q3CA 4H6PA 2JZCA 4P36A 1PBTA 2Q1XA 1V47A 5DXJA 5LOVB 3H16A 4ZI7B 3BE5A 1PS8A 4FR2A 5KOIA 4BFVA 4DEXA 1JAHA 3TD9A 3OO1A 4ZC8A 3RHSA 1X42A 2Y76A 1ZSYA 1ULUA 2VWHA 4D4IA 3BD7A 1MJHA 1WEKA 1XKXA 3A9VA 4ZVPA 2CJWA 5H3LA 2YDYA 5BPHA 1YS7A 1EB8A 2WF9A 2O1EA 2CEKA 2JGEA 4BE4A 5BXQC 3H3XA 3BFVA 4OLFA 2PO7A 4E30A 2AYZA 1G5HA 1SQFA 5K0LA 1O1YA 4TKMA 5H7XA 5F9FA 1DHTA 2P65A 1RAGA 3HWRA 1SFRA 3OQOA 1C14A 1Z13A 3W5BA 2X0FA 4YDHB 5ALXA 2WWGA 2QK4A 2P3SA 4QU0A 4QWWA 1GNSA 2IZ1A 3ELWA 2QPAA 1LDYA 5AK4A 1H23A 2O06A 1IK6A 3C3EA 3JQDA 3NWJA 1VL1A 3P9SA 4I4TA 4YWJA 1U0EA 4NBSA 3FBTA 1K92A 3M6UA 4M3NA 4QFMA 5ALIA 4EB6A 4WE3A 3E53A 3JYQA 1L5OA 1MQSA 5E2BA 3RG2A 4QJ5A 3L6EA 4I50B 3W90A 4UE2A 4YMHA 1HE3A 5I7OA 1MJGM 2MSNA 2EYQA 3K92A 4UDOA 3BGSA 3T15A 4DRZA 5H4GA 3MTIA 3AVQA 1EAMA 3W2GA 1ZDMA 3RAEC 5FI0B 5C8YB 1X1CA 2IPAB 1OC4A 3IGFA 3I2FA 4UTVA 1CRQA 4U9IS 1JX6A 5EQDA 1EMDA 4RFSB 5BWLA 3S27A 2CMFA 1UIRA 1DAPA 1F5SA 4ZTUB 5EMJA 4HADA 5EJIA 1ENPA 1TK9A 4KFTA 3MQFA 4DN6A 2D3TA 4HNAA 1DNPA 4PHHA 5GONB 2P30A 3OX2A 2ZW9A 3HJGA 4INPA 2XQIA 1KYZA 2PS1A 2Y66A 4BU1A 2FSGA 2J07A 5J2UB 1OHHD 2BISA 4JROA 1YJAA 3NBUA 3V1NA 4JP8A 5D5PA 1YKSA 2CXPA 5G4LA 3L4BC 5JXHA 3AKCA 4XSGA 3VU8A 1FFHA 3MPOA 4R5MA 2DFLA 2VK4A 1KMQA 1JZQA 1L7RA 2W22A 5DEIA 2M6KA 1PW5A 3UCEA 1ZC3A 3L0DA 4G5YA 4NCNA 3AILA 1JEJA 4QQRA 4UNSA 2OHOA 4YJ3F 4PLFA 3D81A 3N2KB 1C3EA 3LLSA 4QARA 4DT1A 1QH8A 3EARA 5EG5A 3UJDA 2VH2A 2AKYA 5FWYB 3WSTA 1BFKA 2E1PA 2RARA 5JSYA 2IGTA 4XWWA 2A14A 1CQXA 4QIHA 5EPEA 2RHOA 4XVUA 3FCYA 1PV2A 2QI9F 3NTRA 4LHSA 2ZM6B 1NUTA 4AULA 5JALA 4HTFB 1NBIA 3ZJVA 4P2BA 2HTEA 3L1KA 3BJMA 5GJWC 3LYAA 3ZBUA 1RS0A 4DL9A 1WPQA 5D3QA 2IA5A 2UUAB 3VR6A 4L5BA 4X62B 2FZKA 4Y9RA 1VIDA 4I46A 1U4NA 3GLGB 3N2YA 1CETA 1VJ1A 1YR7A 2W6NA 3IEXA 4YMIA 4TV8B 2QM0A 2OBLA 2QM8A 4CNQA 3JAWB 1O6ZA 5DO9A 2H1OA 3NATA 4V0OA 1STOA 3OEHD 4RD1A 2ZI9A 4TT3D 5JNVA 2QVCA 5C5DA 4O4LF 1J0BA 3AGPA 4JL5A 4KSCA 1ECFA 1SQ6A 2IZ0A 1AQUA 1X8LA 1A82A 2I7CA 2LTAA 3HDJA 1CIPA 2HU5A 3K15A 3K73O 4R40A 1WLYA 1RWXA 3DFZA 1PL7A 1ZISA 2PD6A 3L05A 4Q9HA 4KZPA 3IKTA 1V3TA 2WD7B 3ZBPA 1KQFA 3N74A 3TLCA 1SBTA 3F49S 4NZMA 3K35A 4MUAA 3U13A 1NVEA 4CW7A 1PS9A 1OFVA 4QNMA 3VAZA 2EWMA 4K0KB 1PR6A 2WU4A 4RDHA 1KVUA 5DGTA 2JBAA 4F3TA 3GFTA 2XNDD 5DHFA 1M75A 1Z0ZA 2ID9A 3LWZA 3M3HA 3PVSA 1BTOA 4TRNA 3BXOA 3IUNA 2XA1A 4LSWA 4D9GA 2PRSA 3OHSX 5KYKA 2OPBA 2NYRA 1ESZA 1FLDA 1T9HA 2WZCA 3IB6A 3Q3EA 3QX9A 5EKTA 4RAQA 1A2BA 3D6TB 3TIGA 1QRSA 2GBIA 1B8UA 5G40A 3BMNB 3F3MA 4X91A 5E4YA 1C0KA 5JQGA 1HT2E 1NT4A 2FPXA 2GZSA 4RH3A 3OJEA 3AVPA 5HCNA 1L5QA 1AK2A 4L73A 3JQ7A 1X1SA 1C50A 2EEZA 4LI3X 5BSUA 4EHFA 2EZ4A 3EQ9A 2CC2A 2VRWA 3AFNA 3P1JA 5CJ2A 1GUYA 2G8LA 4INZA 5G3YA 3BMQB 1U02A 3UT0A 3CNOA 3JAKB 2YFQA 1WXQA 3SVZA 4FFPA 2AJBA 1RRKA 5G41A 2XCTB 1TZBA 3ANXA 3A58B 3EF1A 1XG5A 4JYPA 3PRKE 4I50A 5AKIA 3W34A 4D2IA 2WB2A 2PGDA 4NVRA 1XLVA 4J76A 3E22B 3C6YA 3ISJA 4N3AA 3M4JA 3LCMA 2FETA 4NENB 4CRWB 3RUFA 4QG3A 2G4LA 4RFSA 3KL4A 4PTYA 2YL2A 1QHNA 3LUAA 3PF8A 4QBKA 1XYVA 2WHPB 1QE3A 4MO2A 5DDIP 4ER3A 2XZDA 2JIZA 3OPYI 3L07A 3ONNA 2AG5A 2XVXA 3EXHB 4CT5A 1GGKA 2QMYA 1AMNA 2X58A 4G63A 4O4HA 2PSFA 2TMKA 4G65A 2Z5LA 4YBRA 3D3WB 4RKEA 5F1OA 4AZ0A 3D2BA 3PJRA 3SHFA 5IAEA 3FOEC 5E4FA 1RAEA 1RHUA 2OLKA 3EBOA 2VIIA 2JFHA 2QZSA 3QVVA 4DA4A 4U2BA 4QXAA 1N78A 3KHTA 3P52A 1F6BA 1RI3A 1X80B 3W1EA 4D80A 3D8HA 1IZ9A 2QAGC 4ZN6A 3M9LA 1GD1O 3E0QA 4JZYA 1BWRA 1QGZA 2OQ2A 1QQ7A 1TZCA 2Z8YA 4ZALA 1RABA 4G5RA 5IW8A 4CDNA 3KALA 2FB9A 2I2AA 2WG2A 5HF8A 4YP6A 2C2HA 2MT9A 2I6GA 3GT7A 1LZKA 1TVMA 4WPGA 1EK5A 1FNBA 2H2DA 3BL8A 4XAQA 1EDOA 3KYCB 1Q0RA 5DFAA 1ISGA 4ZMBA 3JV7A 1UBJS 1CRLA 4F1KA 5C2JB 4MVJP 4X61A 3UMVA 1TT5B 3F5FA 2B0CA 3BICA 1OFUX 3COZA 5FF9A 3IE2A 1U8TA 1NU6A 2WNHA 5JSKA 5F7ZA 4WNCA 1ND5A 1T10A 3JYLA 4Y9DA 2XLBA 4L6AA 4EUHA 5BN3A 3AEUB 2DECA 1TO6A 2QR3A 3IXQA 3OKPA 4A0GA 7GPBA 1GRNA 1SVIA 2FWIA 1A72A 3M9WA 4KQ2A 4O1HA 4ARVA 4BNDA 1PVVA 4OI0A 1FFSA 1P6XA 3WIVA 4X85A 2FVYA 3BA1A 1IQRA 1U28C 2NXWA 2Q9UA 3ICPA 3PUWA 1ZSNA 2LBPA 4RJJA 4Q24A 4C4AA 3GLGA 1FUIA 2WMOB 3T4UA 4TV8A 2QZ9A 3AR6A 4PXAA 4UDXX 1E7QA 1I2BA 3FPBA 5FOXA 4FPXA 2CCJA 1Y8RB 3AR7A 1IVSA 4ZOAA 5TQVA 1ODKA 4V1CB 4F5WA 3DL0A 3TN7A 2RG7A 5EIOA 1BJTA 3IDQA 2ATIA 3D6NB 4PAMA 4XGIA 1I0ZA 2WD7A 1F6DA 4AS3A 5LQAA 3WBBA 1SHZA 5MFZA 4EEKA 1DKRA 2W2PA 5FOTA 1F0NA 1NQWA 4MWEA 1YI8A 1H66A 4DHWA 5A4IS 2DERA 3NAMA 5FWNA 3FVVA 1H8HA 3C3BA 2QTWB 2QM3A 4P82A 4CMAA 1CF9A 1WDWB 2OG2A 2G6TA 1EBBA 1ULSA 3HVUA 5LBIA 2BH9A 2YQZA 4RTRA 1EA7A 1FS6A 1IJEA 2BM1A 5BW4A 5DHUA 2JLVA 3CUUA 4UUAA 8MHTA 4D96A 3MCUA 3CG0A 2Q0HA 4QRDA 4ZAGA 1PSDA 4PC6A 1XDGA 1SQ5A 3DULA 1UZLA 3BD9A 4L4ZA 4AZWA 2IXGA 1F14A 2XODA 1U8AA 2AFIE 2QG6A 3DAGA 3MUNA 3PGVA 4FEGA 3HVKA 1KI9A 1I3OA 2E5FA 2ZBPA 1QIDA 4LNUB 3ECAA 4PX9A 5ER9A 4JVLA 1GIAA 2J5RA 4O0MA 5J58A 3I6BA 3I28A 1M1YE 1IEWA 2Q5QA 3BMQA 3HXTA 3I58A 4NJEA 3V3TA 3EXIA 1NY6A 1PUJA 4HH4A 4NFHA 3RSLA 3GP5A 2Y68A 3SC3A 4BNGA 3HDTA 4MV1A 1DG3A 2PAFA 2X8LA 4ZZ2A 1T25A 1SOUA 2FR8C 3G0CA 3M6XA 4CKCB 4QC2A 4GF5A 2ZB8A 4IF4A 3VO1A 3A4TA 3CWZA 4FYIA 5D87A 4PW0A 4ABYA 3FGPA 5GTDA 3GROA 3IA2A 1O8CA 1Q3KA 1WF3A 4NENA 4YRSA 3PUYA 1TIPA 4TLEA 4K03A 1E92A 3LJKA 3VR1A 1F6WA 5IZCC 2W2XA 4GI2A 2WHPA 2B3TA 5KTPA 1GFSA 5EGNA 4BJHB 4BZXA 4X5OA 1DBWA 4ARCA 1RYBA 1ZM9A 1EQ2A 4JLVA 1XA3A 2XITA 1XCMA 1XR3A 2ENWA 1VYVA 4H7PA 4Q7MB 5B1DA 2EKBA 5ELLA 1QBGA 4FTWA 3TTYA 1YNOA 2O2ZA 1IYZA 1AA6A 3TOVA 4R69A 3R24A 4B3TB 2E4WA 5K0EA 3QMWA 3GU3A 1Z0UA 1KNXA 4U1RA 4R0NA 4WZBE 1KHTA 3EC2A 1GLNA 1LBTA 2CLDX 3PC6A 1DXHA 5A1TA 5DI3B 3FCUB 4TYPA 3AR4A 1YDWA 3ZKWB 3PD7A 4MICA 4ESHA 4EP1A 2BFDA 2YCLA 3RF6A 1Y4AE 2I22A 5DGIA 1AQYA 1V7QA 4IIBA 1KDYA 4ARSA 1ULTA 1DCMA 4HDKB 1L3BA 3Q5GA 3QMMA 1DJMA 1CUXA 1E1QA 4PICA 1DTEA 2QUJA 3B6MA 5E7IA 2PSHA 2DSNA 2KBEA 3PNVA 2WI8A 1QCZA 3FUWA 5TV2A 1XRLA 4AAYA 2P90A 3NAQA 4YLEA 1TT5A 2PT5A 4G67A 4MYTA 4AIIA 3PE3A 2XRFA 4NNOA 2RAPA 4Q3CA 3CRQA 1XRJA 3DMRA 5TT1A 3AEUA 4IJKA 2B4TO 4X63A 3IE0A 2VN8A 1S4QA 3O2SB 1B1AA 1L4UA 1JIJA 2OHFA 4FBLA 4L6IA 4QT4A 2AI1A 4ZJUA 3EGEA 1JYEA 1QH1A 4G0WA 2IRWA 2GXSA 2OA0A 2H6EA 2JI4A 1YDHA 1V8OA 2VNHA 4UXHA 3L6OO 2QE6A 3BXZA 3TZHA 2C7QA 1EG7A 1RI5A 5CIYA 1A8SA 1DWUA 2V6IA 4I4IA 4KYUA 1SOWA 3NP9A 3O8QB 1TK2A 1KYTA 2BUAA 1C1XA 4K2HA 1AKMA 1BVRA 4RIEA 3UV7A 3WYBA 5FX2A 2X42A 4EELA 1Z29A 3I9LA 2JZNA 3I9OA 5CBKA 4EI9A 1NQOA 2W6QA 4OQEA 5EXPA 3UZUA 5C31A 4OAOA 3UJ8A 5IUJC 2B8WA 4UVIA 4DTCA 1C0PA 4XFDA 4YXFA 4L9AA 1EE2A 1OBCA 2I2DA 1K89A 2TSYB 2ILTA 4OYRA 2C2BA 2RGRA 3MLBA 2H2FA 1U3TA 3NI2A 2CVQA 2POCA 4JYCA 4R7GA 3LWBA 2WU3A 4BOYA 2ZBVA 3IQXA 1PSZA 4BEJA 3EMKA 2PA3A 4MW1A 4YGYA 2C3UA 2O3RA 2ZU6A 1Z0IA 4N49A 2KI5A 3QTBA 2BEUA 4HLNA 3TGPA 2HJHA 4EENA 4XEUA 5E0KB 1YCFA 5FPPA 4Y1EA 1E32A 5EXSA 2JAWA 1PAUA 2OV2A 3FPEA 5FR1A 3ACDA 5F21A 3KAKA 3H6KA 4YPFA 1HMYA 2E2WA 1ZGHA 1EQUA 4YUZA 1L3CA 2PH5A 2ZBFA 5D84A 1FP1D 5TPZD 2YV2A 5JY1A 4IIJA 2ODAA 5IHPA 3VKVA 1U0GA 1O77A 4JQZA 2GT1A 4EZIA 1DKOA 2HJVA 3ENZA 5IJ0B 1GAWA 2OEPA 5DHPA 1ZOIA 1VFPA 1H2BA 4BLOA 5AXCA 4ZTZB 1OGJA 1XZIA 4R05A 2HOQA 2IUSA 4HP8A 3B1JA 3SBOA 2K7ZA 2HDNB 3HADA 2EZ9A 3HUFA 3TCKA 4KR0A 2Q5IA 3AONB 5C46F 3DOCA 2Q5OA 1CQZA 1PBNA 3M5DA 2G71A 1L5VA 2QF7A 5TVGA 5KSOA 5P21A 2GJ9A 1GRCA 3WLFA 4CE6A 3AHHA 4I4LA 1XELA 3Q85A 5DTIA 2J7KA 5KTTA 4G9BA 2LCQA 5ALZA 4ZAFA 3TQIA 4XQCA 2PX6A 1EXNA 3Q0TA 3VC3A 1I3KA 1E3JA 4FFBB 4DQXA 4CMGA 3O47A 4Y2HA 2XAAA 2NO6A 1N2CB 1DC7A 3BVPA 1EP1B 1KKUA 1H2FA 2FZ5A 1L1RA 4YC7A 1XZ8A 3DZDA 1JFTA 4YRNA 1AF4A 1NN0A 1QRUA 2AJDA 4UE6A 1IUKA 2PBZA 3I3SR 4HAUA 2RCYA 3NASA 4MHOA 3TEFA 2AVDA 1J09A 3AEKB 4FB4A 5E4TA 1LPPA 4WH0A 3PXCX 3BB4A 4RL4A 3D0OA 1XZCA 3QFRA 3JSAA 5BNZA 2B82A 3R5KA 5TR9A 5FDFA 3A6LA 2C4TA 4P0PB 4RESA 2Z3ZA 3BJIC 4L4YA 5A5DA 4I19A 2DR3A 4D3DA 3PPIA 4A2CA 1JV2B 2ZE8A 5CPFA 4HS9A 3SNHA 2M32A 5FIUA 1NWCA 3E9MA 4FGKA 3P32A 3PNMA 4EHAA 4OQ4A 3CLSC 4L51A 1GV1A 3ORRA 4EPYA 2I54A 3EXG1 1I4TD 2YC2C 3OQHA 4MQBA 5I8PA 1HYHA 5JQGF 1UWVA 1I7QB 4UHBA 1DEOA 3UXEA 3B7GA 4GMGA 1R0BA 2J32A 2G04A 4A0QA 4D9BA 5CCXA 3JAMA 4L5AA 3RI3A 1QDEA 3GR6A 3MCZA 3LPLA 3QELB 4B6EA 3NAGA 2P2GA 3QEMB 4GC5A 2QE7A 4LZAA 2P2NA 1KEEB 4HXFB 3P4XA 1U2PA 3RYCB 1BWSA 1LPBB 1GSOA 1UXGA 3EOBI 2AR7A 3QFHA 1NIJA 3KEMA 7MDHA 2WKPA 1Y42X 2MJLA 4Y6GB 2DCMA 5AW1A 2ID7A 5DYGA 4I50F 4CTOA 5ALRA 1KY3A 1AKTA 4X3CA 4B2PA 2EARA 3ZJ5A 2PQ6A 3NETA 1IN4A 3AUUA 1RRMA 3N8KA 1SG9A 1NYQA 1RTKA 2Y05A 4CLDA 3ENVA 3HKCB 1PW7A 5FUBA 1GRRA 3P0FA 1U9ZA 3WK4A 2OUKA 1Z37A 1CDZA 1QGOA 2VP5A 1B1CA 4NBUA 4RSGA 4YJGA 5DGCA 4BNJA 4F3CA 1RQLA 4AJHA 5IKMA 2ZUEA 4RELA 2AX4A 2IQIA 2RCNA 3VDRA 2ZRIA 3IDFA 4M1YA 3GEBA 4O4HF 1SC3A 4O3FA 4AP5A 2CKDA 1T9KA 4ZAVA 1Y82A 3FLEA 4EKIA 3DE2X 4OGLA 2UYHA 1E79D 1I7LA 3HM9A 2W48A 2V6FA 3AFHA 3QSYA 3GPIA 2FQ1A 1XKLA 1LPMA 4RORA 5BYBA 5TRTA 1P2UA 3ZE2B 1JG2A 5LWHA 4MWTA 4LFAB 1A77A 3A2LA 4R9UC 3ESCA 4KX3A 3TTVA 5C5CA 1PWXA 3QX7A 4YCAA 1F2DA 2W2NA 2F4NA 3RVBA 1G8JA 5DCYA 4DY4A 1WCV1 4DSNA 2EZ8A 1WZIA 2Y1KA 2WKWA 1ECCA 1P8AA 4LOAA 3OZEA 2HLHA 3A4YA 4IS2A 1K8RA 2BKLA 1TQHA 2CUNA 2FSVC 2XY4A 5DXAA 4QREA 5EEGA 1RYEA 2Y1OA 2BKXA 3OSZA 4NBRA 4BO5A 3T9FA 1GZ6A 2B4RO 5IJ0A 3U80A 2QW1A 2X9VA 2YUTA 2HIHA 3CKKA 1N36B 1GZVA 1GPWB 1G21A 3V42A 3DB1A 4EPXA 1AKEA 4OM8A 3SX2A 3LU1A 5TS2A 4W5NA 1NQUA 4NZYA 1UZAA 4ZXFA 2DHEA 3PR3A 3CNHA 3LOQA 1C9EA 5ESWA 3RUCA 1OW3B 1QDUA 2VBCA 3BPSA 1SQ0A 4H4CA 1YMQA 4D82A 2IEBA 4U2GA 5JTTA 3OBIA 4Y2TA 2BPOA 2BZ0A 4KBFA 4B7UA 5JANA 3R3ZA 3VMFA 2QN6A 4P86A 3HRIA 3M83A 3HJBA 4TV8F 1HLPA 3KXPA 2AFRA 4FFBA 2GDZA 1OFHA 4BRZA 4LJRA 2VJOA 4EZEA 1CS4C 2P4QA 1NJSA 2RFLA 3HKDA 5DHSA 3RRMA 3U3DA 2V98A 1KS9A 3OPQA 3WL8A 3WXBA 3UUFA 1OH6A 1EX1A 1IHPA 3ZHZA 2EU8A 4B5LA 1IEVA 1M1NB 1K68A 4BO0A 4BEBA 2CSXA 1NRXA 1JQAA 3DMPA 3ETCA 4Q4JB 1TJPB 3NC0C 1CJSA 1XEFA 4Q18A 2J0SA 1A5SB 4UJ3A 1JDZA 1R8SA 1C9KA 3HZRA 4MS3A 3UPUA 1YJ5A 1F2UB 3CNNA 2Q6IA 3L3BA 2FPUA 2P77A 4JGBA 1IAQA 1PEDA 2G28A 2HPAA 1XVLA 4NHOA 5J47A 4Q3OA 4DV1B 1C7RA 3O8LA 3DLCA 1J0XO 4X6UA 1TE2A 2JBHA 2VJCA 3OTQA 5IHXA 4MUGA 3VUEA 2DLNA 3ZDDA 3BBLA 4LMBA 5EIWA 3CCFA 1Z68A 4X45A 5CT5A 4WZAE 1JKXA 3KSUA 4TWIA 4HDQB 1OI4A 4U6QA 1RC0A 2IOFK 3OLXA 2BFOA 5IJ9B 6YASA 3NOXA 5IJWA 3SQDA 5LXTA 1SG0A 2DQKA 4ZU1X 2F9FA 2YZMA 2BEJA 2YWHA 1U98A 3Q1KA 4H4DA 1W6UA 4MUJA 1G9SA 5FHQA 4PRKA 5HFJA 4D4JA 1SXJD 3UGJA 1VA5A 1XAIA 4QDJA 4XCQA 4Y6RA 4Y2RA 3QELA 3UOAB 1NSYA 1ECLA 1S2NA 3QEMA 4LZLA 4PIPA 3KELA 3WLSA 3ZC3A 4DIUA 4DV3B 2YOHA 2V5UA 3FTNA 1RRFA 3N5CA 5BNTA 5KWVA 3KX2A 3IP6A 5D85A 3KQHA 4B2LA 2HLDA 3TKLA 2J5QA 1Y3AA 1A2OA 2PPVA 3R7WA 2FU5C 1TD1A 4JBGA 1TM3E 5K0GA 1KTVA 2AG6A 1B0ZA 4DCNA 2FPLA 5THQA 2BSAA 1AA9A 5AUPB 1MW9X 2GOYA 3N5KA 4JC8A 1S7CA 2CYBA 3HZZA 4YJFB 5JVDB 5AJTA 1II8A 4BJ1A 4IOKA 5C3UA 4BN5A 3Q7PA 1IUOA 4KCGA 4YAIA 4BFUA 4HAVA 3AF1A 1GUZA 2GETA 2YH2A 3WS7A 1JE1A 4N5DA 4G25A 3IR7A 3D2AA 1XXHB 1YB7A 1Z7WA 3CB4A 4HQ0A 2R86A 4OIMA 4Q4HA 4AMZA 2GD1O 4I9HA 1JHRA 5ABPA 5FH9A 4NU6A 1QP4A 1FUYB 2CHVA 3QVSA 1J20A 4E31A 3CYFA 3CX6A 4KN5A 3U7FB 3QFFA 1YO6A 4NIMA 1OLXB 4RKYA 4GR9A 1NVBA 1OZAA 2XQJA 3H17A 3QW2A 2MR5A 4UNPA 5LDGA 1CRWG 1UBNA 3ZK9A 5B5SA 2PQ0A 1SBQA 3GRAA 1JVBA 2JFGA 1O2DA 1LPSA 2FPGB 2R00C 3QU5A 1THGA 1L7VC 4EY7A 1BS1A 1H94A 4O4JA 1BW9A 5TDHA 2IVFA 2HUPA 2Q4EA 3N0XA 4EG8A 2FEOA 3AY7A 5ALMA 3P2KA 2EC5A 3QYPA 2GHTA 4ZIRA 2Q0XA 3PNQA 2H7CA 1P17A 5IBRA 3SI7A 1UADA 4LHXA 3A1TA 1QV9A 1YZHA 3RJMA 2WTNA 5ALFA 3DG9A 4YMVA 3BT7A 5HOQA 1JXOA 4UM8B 3PFFA 4MZXA 1NM5C 2A94A 1D4ZA 4BO2A 3S1AB 1NUQA 4Z49A 2GJ4A 2V59A 4BRWA 2V0NA 4ITUA 4OOEA 3WTBA 5KOHA 4H7IA 4EM6A 1EVKA 3MBIA 4L3OA 5FEMA 3TOCA 1N6LA 4BAUA 1GN8A 3BIFA 3WDMA 4F3RA 3N7TA 3THOA 4A92A 1DT5A 4XR4A 2OXTA 4HNUA 4S1PA 3QEBZ 2GF0A 4XM1A 3U6KA 1NFQA 1CIVA 1OTYA 2H48A 3UUWA 2YS6A 4CMEA 2OCIA 1SCDA 3RRNA 2PJRA 2GILA 1M1NA 2VH1A 4K26A 2MYNA 4LKOA 4DV2B 3QUTA 1D2RA 1P1JA 1X7HA 2X1VA 3K1TA 4WZZA 3T5GA 4HGQA 3ER8A 4PO8A 2H1VA 3TEJA 1LJ8A 1SQGA 4DUGD 4MGKR 4D57A 4FHFA 3Q8XB 3BWCA 1L5FA 3IX7A 4URYR 4B8WA 3RWBA 2R84A 2X0RA 1V5IA 2PWAA 4EARA 4NMHA 3FTPA 5SYAA 4IIGA 2Q3MA 2LXNA 2E6KA 4YMGA 4I5DA 1QG2A 1JNYA 1XAJA 4MLDA 5SYMA 5CFMA 3L7OA 3D59A 1J8FA 3K9BA 5J1TB 3TS1A 1C8KA 4I1IA 5JIBA 3LXUX 1PNOA 4ID3A 4LXHA 5IJ9A 5EWMB 3QGMA 1LWNA 1T34A 4WY8A 5IVDA 2P35A 4P93A 5E7QA 2Y1XA 4IIJF 1EVLA 2H2GA 3ZU5A 1W4CA 1N6NA 3F6PA 4Z9XA 5KNBD 5C51B 3D4LA 4BFYA 4TL6A 1SKUA 3GZ4A 3FWNA 2B7LA 2VZ0A 5LBTA 2D2VA 2QRPA 4J1TC 4KPFC 3RIGA 4BECA 3QG1A 3NXSA 4ZO4A 3UENA 4EB8A 4ZWNA 1G8YA 1KYIA 5CYPA 2G63A 2VJPA 4JZKA 1W8DA 2A7QA 2DZDA 3NCHA 5BSMA 3T7DA 1T26A 1J8DA 8ADHA 3PTAA 4LHYA 1MT3A 3ICWA 3PV0A 2YW2A 3R3YA 5ALYA 3CH7A 2AXNA 1XQ6A 2A1IA 1FNMA 4JJ7A 4P2GA 3QIVA 1XT6A 4Z3KA 1WWKA 2RGWA 3R3XA 3N2GB 4FZ5A 1XKTA 4H60A 3BK7A 1A9ZA 4R31A 4WXRA 1AKNA 1H2XA 1ZN9A 5BSKA 4G85A 1DCFA 4POAA 3OHPA 4Y2SA 3LK7A 1TUBB 4XA8A 3R9IA 3O3NB 4J1NA 1U2QA 2BZSA 1C30B 4L16A 3EJ6A 5CHYA 4ZAXA 3JQ6A 2NU8A 5ISMA 2QPTA 1YK1A 1Y33E 4YJFA 1EPUA 5B6PA 5JVDA 3DVSX 1G42A 1RWQA 1V41E 4WLVA 3JQCA 5FJJA 4B48A 1D2HA 3R6LA 1HTBA 4KE7A 3CZ4A 3E8XA 3GWZA 1P81A 5CB6A 1NLZA 1ODFA 1CUHA 3HJTA 1SQSA 5K8JB 2NZVG 2HFKA 3DV9A 1NBHA 4KC0A 5L7WA 5LKAA 1POXA 5CDGA 2C9BA 2IQ5A 3PC3A 3Q9LA 1I7DA 1AS2A 2GVZC 1UXHA 1TJ4A 1E3DA 1PWHA 3A31A 3R9WA 3G3EA 2FPGA 2XKBA 4BB5A 2FW8A 3TZEA 4AM8A 3BRWD 3A2NA 3IOCA 4Q6BA 4AMUA 3KQMA 1ZLYA 3MCAA 3WGVA 1VGVA 2J41A 3DE6X 4FJ2A 1ZI8A 4LDAA 3IUJA 1O4VA 1VKHA 2JAXA 2WAMA 2ZDGA 4ZAWA 3KOMA 3P5SA 4K9LA 4TXJA 1VPVA 4ZV9A 1FNDA 2PGNA 1ZOOA 5JJCA 5KU7A 5LZ5A 2P4UA 2NG1A 2WUEA 5TLSA 4OFBA 4R9RA 1GGJA 1DC3A 2C5FA 4LF6B 4M89A 1UZUA 1JPUA 3T3PB 3T0GA 2A58A 2BCEA 3KFXA 1Q20A 3QH4A 1G5TA 4MIYA 4AY3A 4BX3A 2C20A 1SZPA 4IOMA 4X90A 3E15A 5DTJA 3ZHXA 1OZGA 3EXFA 4WN9A 1VRVA 2BONA