3N70A

The crystal structure of the p-loop ntpase domain of the sigma-54 transport activator from e. coli to 2.8a
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
142
structure length
142
Chain Sequence
IGRSEWINQYRRRLQQLSETDIAVWLYGAPGTGRMTGARYLHQFGRNAQGEFVYRELTPDNAPQLNDFIALAQGGTLVLSHPEHLTREQQYHLVQLQSQEHRPFRLIGIGDTSLVELAASNHIIAELYYCFAMTQIACLPLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Crystal Structure of the P-loop NTPase domain of the Sigma-54 transport activator from E. coli to 2.8A
rcsb
source organism Escherichia coli
molecule tags Transport protein
molecule keywords Transport activator
total genus 39
structure length 142
sequence length 142
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2010-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14532 Sigma54_activ_2 Sigma-54 interaction domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3n70A00
5FPSA 2ORVA 3GLGB 1WQ1R 2GAOA 2IBMA 1GITA 2AK3A 2RKOA 2QG6A 2ZR9A 5LPNA 5F9FA 4RD1A 3VR2A 1OIXA 1MO5A 3CBQA 1N0UA 1ZUIA 2AXPA 3UMFA 1XD8A 2OG2A 2WWXA 1AS3A 4WZ6A 2VO1A 1CU1A 3FMOB 2XXAA 1F2UA 4MKFA 3AGQA 2REXB 2WWWA 2NO9A 4IEIA 1Y3AA 2ZRIA 2QRZA 3G5UA 1E79D 3I5YA 2NMVA 1FX0A 1JB1A 5B2ZA 4P31A 3CH5A 2GILA 4C2UA 1ZM7A 4IFEA 3VR4A 4C3ZA 4EKDA 1VCOA 1GAJA 2IW3A 1TQ2A 2FSHA 3PIRA 1ZC3A 3NBFA 5JLJA 2C78A 4AURA 3QOFA 1KO4A 2VEDA 5F98A 2QMHA 2RGGA 1E9EA 2H7VA 5TXGA 2IS2A 1R6BX 2VH5R 4O25A 4HAWA 2O8BB 2QM8A 3O8DA 1SVIA 4DSNA 3VU9A 1OIWA 3FTQA 5FUVA 1E1QD 4YDHB 4PO9A 3EC1A 5KNBA 3K9GA 2IUTA 1TUEA 2GESA 4X8HA 4EQ6B 3FFAA 2D7CA 4Q9JA 4I1SA 4DCNA 1GL9B 3KZ1E 1ZM4A 4B2LA 4BLQA 5AK0A 2OFWA 2PLFA 2VLIA 3IKJA 5JWOA 4KFTA 3QE0A 5BYKA 4II7A 3K70C 2ZIAA 1ZVQA 1E9CA 1W5TA 1ZM2A 4C0HA 4K46A 2CE7A 4C0JA 4IOJA 4PSAA 1GKIA 1LV7A 2J9RA 3I3SR 3ADBA 4QHSA 4C0SA 2R6GA 2J45A 2Y8EA 3B78A 4UKDA 1FOEB 1KK2A 3QG1A 3D6TB 1GDDA 4PO1A 2I1VB 3CF2A 4LBWA 1QHHB 3NH6A 4HB0A 4IHQA 4HUQB 4Q4HB 2GJKA 2L0XA 1US8B 2QA5A 4S35A 3R7WA 2WIBA 5JS7A 1Z2AA 4L9WA 3MAAC 4MKGA 3BB3A 4A8JB 4DDTA 1KI1A 3KB1A 4JLKA 1KK1A 2GZAA 4OHWA 3T5DA 5UKDA 1X8KA 4EPYA 3RANA 5CYPA 1W5SA 1NG1A 3L2OB 1NN0A 4TT3D 1K6MA 4TMKA 2DFKB 4KBFA 4QFMA 3DPUA 4Q1DA 3TR0A 4FIDA 3CONA 3WRYC 3FWYA 4BFUA 4Q1CA 1NSFA 3AP3A 4DHEA 3RS7A 4OHVA 1FZQA 3EPLA 1NJGA 2W0SA 5CJPA 1TNDA 2NOAA 1QHSA 1N5IA 4LC1A 4DIEA 2D2EA 1DO2A 3WRXC 4QXAA 2YHSA 4LGMA 3BD9A 3RVBA 2CLDX 3QJYA 4FXPA 4EFLA 4B48A 1E69A 1W0JA 2GVDC 1VYTA 2QP9X 2XZLA 1S96A 2GF0A 3J81k 2WJHA 3GJXC 4WZBE 3QIAA 5DE3A 2E87A 2Z0MA 3DM9B 1KSJA 1XEXB 1G6HA 1CRQA 5CIQA 4ZCIA 4IDQA 4LPKA 3SI7A 1UF9A 2A2ZA 2HDNB 4ZI2A 3IBGA 1MO6A 4Z54A 4TL7A 1KDPA 1KOFA 2IF2A 4JLBA 2F7SA 3A1WA 3R20A 3WHKA 2DYKA 4JT4A 1QHYA 1GNQA 1KO8A 2DWOA 4FCTA 5FPYA 2ERXA 3TMKA 4BPBA 2ZS8A 4RFSA 5JCZA 1YZNA 4D2IA 2B7CA 3W6PA 1E9SA 2OZEA 2DBYA 2AX4A 2DWPA 1NN1A 2GRJA 2C9YA 3SFZA 1SVOA 3BBPA 1AM4D 1GNPA 4ACBA 4DSTA 4NTZA 2VP6A 4RY2A 3SJCA 3AKDA 2C9OA 3THOA 2H1LA 3RNLA 3PUYA 4LJ5A 3RWOA 4XVRA 3AB3A 4NH0A 3K09C 1E1RD 4Q7LA 1JR3D 2YC4C 2WICA 3B5JA 4CDGA 2QPAA 1X86B 5P21A 4PHGA 5DYGA 2ZRGA 3VKHA 3B60A 3SYLA 5AUOB 4D0NA 1Z3IX 4AC9A 1DAIA 4YONB 3EIEA 4L9SA 3RABA 1T8TA 5JZVA 1WB9A 1S9HA 4LV8B 4JVLA 5DHAA 4LJ9A 2NO6A 4ARZB 5F3WB 3B1ZA 4LV6A 2NO1A 1AN0A 5C18A 4ILEA 5JFGA 3LDAA 4Q47A 3N2EA 1XTJA 1AQYA 4BLPA 1UDWA 5HKKA 3R9XA 1E2DA 4XOIA 2VTKA 1IN6A 3SJZA 3CLVA 1YQTA 3GFPA 4QNRA 4EJSB 2BMFA 4O3MA 2ZM5A 4NL4H 4Q1EA 2EFEB 4IW3B 1NBMD 4BUJA 5AUNB 1N6NA 1Z0JA 2IYWA 2R6AA 3ADKA 3QVUA 621PA 3LVRE 1R10A 4DLTA 4Q1BA 4A82A 5DYIA 3SEAA 2J0VA 2V7QA 2W6IA 4BRWA 1KO5A 3FE2A 4ZDIA 1P7CA 3IO5A 3OAAA 4PHHA 3AQ4A 1RVDA 1XJ0A 3CH4B 1U99A 3LW7A 3K0FA 4I1OA 2ZI4A 3B7GA 3C7KA 4HAYA 6Q21A 5D3MB 3FB4A 2VHQA 2PCJA 3CB4A 4MDEA 5B58C 4W5HA 3MWKA 1S2MA 4JL6A 4V0MA 2HT1A 2JJ1A 1YZLA 3MUFA 3AP1A 5TB5A 1AA9A 2O8CA 1EESA 3RDPA 1KI7A 4YMWA 3RS5A 1FFHA 1I4TD 3ND8A 1XCPA 1Z29A 3UPUA 4M1TA 4Q00A 5EP1A 1G3IA 4D0LB 1KDOA 3BE4A 2WOJA 3KKOA 3CWZA 4TTQA 3RRNA 3F5FA 3B6EA 3L43A 1NIPA 3T06B 3ZLJA 4C7OA 2QTHA 1H8HA 1NI3A 2N46A 4HB2A 4KU4A 2GXAA 1Z6GA 1QVRA 4Q02A 2JAQA 2NQ2C 4BEBA 3GJ6A 3GJ0A 1TQ4A 2F1JA 4PR0A 2O8FB 4D4KA 4DDWA 3OFNA 4URWR 1HT2E 2F3RA 2WTUA 2NIPA 1Q20A 2WKQA 4GMXA 4JSTA 1G7TA 1T3HA 3THYA 1IJFA 4EDHA 1TF7A 4QHTA 3MD0A 3AF1A 2O8DB 3LAWA 4NP6A 3H86A 3BRWD 2CVHA 3M4YA 4M2LA 2P5SA 3SU8A 2QL6A 3FKSD 2IS1A 1Z47A 1EX6A 1JQLB 3CF6R 4HDOB 3DKPA 4K8OA 4BLRA 2GCPA 3FHTA 2IYRA 4Y0VA 5ELXA 4OQNA 4JLOA 4NCHA 5J4HA 1G19A 1KNQA 5FR1A 2A9KA 3CR7A 1PLKA 4OI4A 5JSZB 4CVNA 2FEOA 1XPOA 1LS6A 2VF7A 2C2HA 3PFIA 1F6BA 2GXQA 3VX3A 4HUTA 3GEHA 4N0EA 1OB2A 4M4SA 2Z6VA 5IT5A 1F5NA 5KNDA 4B34A 2RAPA 2ZTSA 1VG8A 1EX7A 1TEVA 4R71A 3JZMA 4QBHA 3IHLA 3Q7PA 3E5HA 4DLWA 2ZJ5A 4NCNA 4B3DA 3N5CA 4LC0A 3B1WA 4JT2A 1MABB 2RB4A 1ZIPA 2ZJOA 5AUPB 3PVSA 1F60A 2B8WA 4MGKR 1JPJA 3GEIA 5KUTA 2ZJ2A 3KB2A 2GJ9A 1S9DA 4RKEA 1C1YA 521PA 4AIIA 2F3TA 1JALA 1BO6A 1UBEA 2PH1A 2PEYA 4TQUS 5GJCA 1KZ7B 3A58B 3CRVA 5DIFA 3QKRB 5EE9A 3LBIA 1B23P 1VDZA 1ZMXA 3I62A 2P67A 3CZPA 3GQBA 4B43A 1R0ZA 1II8B 5KDLA 2B21A 3KQNA 3MFYA 1AZSC 4ERNA 3KKQA 5TARA 1UBCA 2BC9A 4BZQA 3GMTA 1U0LA 4A92A 5KOYA 1K5DA 1XWIA 3T5GA 2J41A 4B2IA 1J8YF 2YC2C 3THXA 1Z0AA 1XB2A 1PZNA 3PUXA 1OXTA 1QF9A 4IEEA 2O8CB 1L8QA 4MKHA 3TVTA 3CX6A 1KI4A 2QE7A 3VTKA 2UKDA 2CHQA 1LNZA 5DISB 3M0EA 2MSEB 5FTMA 5C1BA 4FINA 5KO2A 5DLQC 3EA5A 1JAIA 1AKEA 2B92A 2D3WA 2Z83A 3EZ2A 2J0UB 5L3RA 1AZTA 2AL7A 4QBGB 1CEEA 2OLKA 1KNXA 4BECA 2ZVQX 3BH7A 2DB3A 2ATXA 2G0TA 3ZYCA 821PA 5JI3E 2CE2X 2AN9A 1W0KA 3CX8A 3KQLA 4A0FA 4LDJA 3PJRA 3ZS8A 4AD8A 1LVGA 1KYIA 2BVNA 2LCFA 4HZUA 2OXRA 4EPTA 1RRFA 1DARA 2FSFA 2PMDA 4FW9A 2OXCA 4K81B 1KI6B 4ZV4A 1LB1B 4P4UA 1PLLA 2RGEA 4JVNA 4NCKA 2J59A 4XSHA 2EFGA 4DLUA 4XVUA 1YZGA 3K0CC 4DT1A 2ANBA 3H4MA 3U3RA 2J7PA 3ZQJA 2D7DA 1NN5A 3GFTA 3R9WA 1SXJD 4BFZA 2J0SA 4HAZA 4DCTA 3EC2A 4HLDA 1GVNB 4YMVA 1R5BA 2V55B 1OFUX 4KSBA 4TMVA 5J4KA 1G8HA 1DELA 1H65A 3NIBA 1AS2A 2ZRMA 2JLYA 2JCSA 1EXMA 4GPTA 1G3RA 4MYTA 1OSNA 1E94E 1NVXQ 1R4AA 1G8FA 3Q9LA 4D81A 2VHJA 1Q1ZA 2OAP1 4ZPXA 3BH6A 4GZMA 2P5TB 5DO9A 2O52A 4PQFA 3B13B 3RYTC 3BJIC 4V0KA 1OYWA 4M9ZA 2HUPA 1KI9A 5HE8A 1P9NA 3IHWA 2FFAA 2GVZC 1TF5A 3AM1A 1E99A 4AKHA 1M34E 2FZLA 3I8SA 4MYUA 3D31A 2QMEA 2XTNA 2ZRLA 4GOJA 3W5JA 2CLSA 8OHMA 5FH9A 1NLFA 1ZYUA 2N42A 4WW0A 3NKVA 1Z6TA 4XWAA 4LWZA 3PV0A 1KKLA 2JLWA 1VYUA 4KV9A 1YZKA 1KSHA 1OYYA 1E2NA 1EGAA 1HE1C 4V0NA 4HYYA 4JS0A 4C2TA 4JLMA 2V1XA 4Q4JA 3ZGXA 4LJYA 1UKYA 1GIAA 1AGRA 2QPOA 4PSKA 2OFOA 3WMEA 4EPRA 5CITA 2O8EA 2WBLC 4N1AA 4LK2A 3MWJA 5JWRA 1F48A 1H8EA 1XMJA 3GJ5A 5G40A 3W9YA 2D62A 5JJLA 2PX3A 4NMMA 4RVCA 3I5XA 4PZYA 4FD2A 1W47A 1HH4A 3QXSA 2OEPA 4LJ4A 4IDNA 4TN1A 4KITB 2YYZA 1CIPA 1T91A 2IYXA 4DUGD 4M1SA 1P62B 2XOKD 3B1YA 2FDCA 3EZ7A 4KVGA 2BBTA 2QQ0A 2LKCA 3LXRA 3RLFA 3SHFA 2QP3A 2R6CA 3WMFA 1RRPA 1Z22A 3K9NA 1G7SA 3KFVA 1KKMA 1E1RA 2V4ZA 1OH7A 2FJUA 3W3AA 3W90A 1ZC4A 3ZD6A 1ZNYA 4US1R 4TSFA 2F1IA 2FF7A 3P1JA 2ZI6A 4BGDA 3BFVA 3LBHA 5C4MA 3BOSA 4UNRA 2V8OA 3U7FB 1Z0KA 1DEKA 2GCOB 3LW8A 4LCBA 2DPXA 3V4FA 2QAGC 1JXOA 3AF0A 3IEVA 1LY1A 2QNRA 1DS6A 2BHRA 3T34A 1J99A 4PPQA 5FTNA 2GKSA 4Q7JB 1OFIA 2ECKA 1Q3TA 2F43B 2P0EA 5HKKD 4URXR 421PA 1VCNA 5EXSA 1S1MA 2VP4A 1WP9A 3OEEA 2JLZA 1NL3A 4LHXA 1F2TB 1VIYA 1ZNWA 2CXXA 2IYYA 3GLGA 4EPWA 3K0AA 1JAHA 3CRRA 1RKBA 2XNDD 1EFHA 1R5OA 5BQ5A 4UXHA 1XP8A 2LKDA 4WA7A 3TLXA 2PJZA 1MRNA 1KY2A 2HCBA 3TNFA 2V7QD 5L3QA 2Q9BA 1OJLA 2BM1A 2ZS9A 2YOFA 4L8GA 4QG7A 3TW4A 1Q1QA 3VX4A 5TMPA 3AF3A 4QBFA 4IOLA 1IXSB 3TAHA 2QP4A 3QG5A 3KL4A 2VSOA 3UG7A 4AKGA 2D4HA 3EG5A 3LFUA 3FVQA 4C4PA 3GP8A 1ZD9A 1B0UA 5HZKA 3W8NA 1G8GA 3REGA 4R98A 2ODEA 4MYCA 1D2EA 1U9IA 2GXUA 1XX6A 2BM0A 2DY1A 2UZ3A 1G1MA 1U98A 1WXQA 4JSYA 2IUUA 3RS0A 2PEZA 5BXQC 5CB8A 1AGPA 1DO0A 4OQLA 3AV0B 3WYFA 4GSYA 4B3FX 1EG7A 1XTQA 5FI0B 4EPVA 1ZUNB 3R7WB 3RHFA 2W6JA 3PITA 1OKKA 2ZSBA 4US2R 3CKLA 1KJYA 1RPZA 3W3ZB 3QKRA 4Q1AA 1RYFA 2VP2A 1QBKC 3OFND 2FPKA 2BMDA 3FMPB 2ZRCA 1R8SA 3SBDA 3SC3A 4OJQA 4D6PA 3K70B 1PLJA 4IOKA 2FZ4A 5KTYA 1X8LA 1FX0B 5C46F 2HXSA 1FQKA 2ZSEA 1E4VA 4KI0A 3EWSA 3EAQA 5CLQA 3QXXA 2IS6A 1XCGB 1JR3E 1OIVA 4B6EA 1DPFA 2ZI7A 1FNNA 1PJRA 1ZRHA 2KBFA 4LHVA 5TY0A 4AKEA 1HY3A 3IILA 4D4JA 4R7ZA 5B64A 3QKTA 5EJEA 3T61A 1OV4A 2GXSA 2W2VA 3EA0A 4M53A 4OQFA 3UATA 1P3JA 4C0LA 4AWXA 3V4RA 2QI9C 2ZRNA 3I32A 3IQXA 2GF9A 2NGRA 3A37A 3KTAA 2ZI3A 4F92B 5EXTA 2JGNA 3A4MA 3EW9A 2ZI9A 2ONJA 3KJEA 3SYKA 2ZYTX 1HT1E 4DIDA 4DUGA 1ELOA 4OQXA 4MDFA 4GL2A 4KFUA 4YXWD 3KTAB 1KI2A 1XDBA 1J70A 2C9CA 2FPLA 1XXHA 2IYQA 2WZQA 4TQAA 3KQUA 2ODNA 1BYUA 4CEJA 4U02A 5GVSA 2Q3HA 1G20E 1YKSA 2R65A 121PA 1WF3A 1DVRA 2QMOA 4G5SA 3P4YA 5EXXA 4LBYA 3WMGA 1X3SA 3U2QA 5FOUA 3A1SA 3C4JA 4QJ5A 2CCJA 1KO7A 4CRWB 2V6JA 1IXRC 1XPUA 4DT1B 4M1WA 2ZSFA 1LS1A 3TK1A 2R62A 4OK6A 4IDHA 5EQTA 1US8A 1Z07A 2EU8A 4RFVA 1EFTA 1SVKA 2IX3A 5FTJA 1R8QA 2ANCA 3EWAA 3SNHA 1BKDR 1LW7A 2QRNA 5FBRB 5FL7A 5D3QA 5FUYA 4XWOA 4Q4LA 3K70D 3ND9A 3TGPA 3EZ6A 1M74A 4O0MA 3PCRB 4C30A 4B75A 3HR8A 3RAPR 3TJZA 4Q66C 2GJSA 2P2LA 5KSZA 4PQRA 2J7KA 2ZUCA 4LYJA 4QHYA 4TTPA 2QSZA 5HCNA 5IRCD 1COWD 2IHYA 1PV4A 1XEWX 1BIFA 4GDFA 5BN3A 2YKGA 4ON9A 1KZGB 3IPYA 5J4LA 2FFHA 1EK0A 5HCIA 5FTKA 5LB2A 4A2QA 1YJ5A 5EE5B 2NPFA 4NPHA 1FMJA 1P73A 3P26A 4UXJA 1KK0A 3CNLA 2BKUA 3R8CA 4MA4A 3CRMA 1G41A 1DBSA 4LJ7A 3NXSA 4LY6A 3THXB 2ZS7A 5JECA 2OT3B 4A6PA 2I1QA 1TX4B 2A7QA 1P61B 5E3HA 5H8WA 4BWYA 1XNJA 2OCAA 1CJUC 4DC9A 5G3YA 3NDPA 3RS2A 3SZRA 4EIWA 1D9XA 3FPAA 2FMXA 3SS8A 1F2TA 1ZU4A 2C98A 4D4MA 2P6UA 3E2IA 4MYHA 1GOTA 2Z5FA 2BBOA 5SZHB 2JDIA 3QPUA 3FMFA 2AKYA 3B8HA 1EFUA 1F2UB 4KCGA 3C14C 2PBRA 3VFDA 2Q3MA 1A5TA 3BIFA 3U7EB 2V3CC 3OEHD 4R9UC 4KVAA 1OH8A 4C7OB 1ZU5A 4YQFA 4XD7A 5CYOA 3BXZA 3SJBA 4ACAA 2GCOA 3NEJA 3LQRA 1XF9A 3B1VA 1TL7C 3SN6A 2XGJA 1II9A 4JBYA 4Q03A 4KLZA 2FNAA 1SQ5A 4URYR 2XZOA 1G8PA 2O0JA 3L0OA 3CO5A 3U3MA 3PXGA 3MSXA 5F2EA 1RW4A 3Q3JB 1UDXA 2C8VA 4M1KA 3MGCA 3MWLA 3CPHA 1NF3A 3LX5A 2CJWA 3SDZA 4TLCA 3BFXA 3CW2A 3A1VA 2F9MA 1KIMA 1NKSA 3QBTA 4NONA 1CTQA 2KB0A 3IEUA 5EP2A 2Q0HA 4OHZA 4OYHA 1E9BA 3DZ8A 2VPPA 4KYUA 3T1TA 1OH6A 3VHLB 2J3EA 4RD3A 3WNBA 4U5XA 4QGGA 1VPLA 2O5VA 5HE9A 3A4NA 1P9RA 5JRJA 3HJNA 1OB5A 3ICEA 4JLJA 5JJIA 1BMFA 4AY2A 3F0TA 1YZTA 4GI7A 1Q1BA 4KO8A 4Q4JB 1E2QA 1G64A 3EASA 2GK7A 3LRPA 2QAJA 3W5IA 2Q3FA 2WJGA 2NO0A 3LO5A 2TMKA 1HQCA 3HU3A 4TYWA 2GZHA 1MO3A 4HAUA 3C41J 4GNKA 2DFNA 1N6OA 5AJXA 2BIFA 3TE6A 1OXVA 4NCIA 3KKNA 3UG6A 2IEYA 1ZINA 5DNYB 3I73A 2HF9A 1NSTA 5KSYA 3T1OA 1W2HA 4A4DA 2VRWA 1NY5A 2ZJAA 4Z8YA 4DBLC 1OHHA 5AJYA 3AGPA 2R6FA 2YWGA 2WJVA 3C8UA 3VR1A 2AFIE 1HYQA 1D8TA 2OCYC 4KBGA 1N2CE 1G8YA 3G82C 5DN6A 2YWHA 1M8PA 1S8FA 3Q7QA 1G3MA 3GLFB 1RRCA 4BZPA 2ZRBA 2X2EA 3FMIA 4TLEA 1G4AE 2BJVA 1NRJB 2ZITA 4LJ6A 4TMTA 1MKYA 1XEWY 4QGHA 3WBKA 4LRWA 1SVSA 1HURA 1QDEA 3KJHA 1SVLA 2FU5C 1E2IA 4B3XA 4ZKDA 4M1MA 3BH0A 2IYTA 1WBDA 2XTMA 4MGYR 2RGAA 4QBIA 1WMSA 3QF4B 4W5WA 3ASZA 4FMDB 4LYAA 4MRPA 3K0CA 4LX0A 2CK3A 2WVJA 1A82A 3B2EA 2RGXA 1O87A 2EWVA 3K0AB 2CVFA 4RZ2A 5JEDA 1IN4A 1XPRA 2XB2A 4D0GA 4P4SA 2C99A 2WV9A 1N0VC 1DAMA 4HDCA 3NEYA 2G9NA 1RIFA 2ZE5A 1RJ9A 5K8LA 3R8FA 4V03A 1IJEA 2IC5A 4RZUA 2JA1A 4TTRA 4OHYA 5CJ2A 1QHHA 4HEJA 2GBLA 2WSSA 1NBMA 1TU4A 4JLAA 4BE7B 4TWZA 4DCSA 5JMTA 2VQSA 4X8OA 3NBZC 2WWFA 3VR3A 4FCVA 1CBUA 4Q5IA 3OESA 1OXXK 2A3RA 4LPSA 4JVMA 4DRZA 2ZSDA 1GG2A 1V43A 4LUCA 4JMPA 1OFHA 3OIUA 1U9IC 2OE2A 3OIVA 4MQBA 4KFRA 5FBQB 1S4QA 5JBQA 3UMSA 1G7CA 1E2EA 1E0AA 3I1FA 3THYB 5DGXA 2IK8A 1ZD1A 2W00A 3KKMA 4RFSB 1GP2A 1OE0A 2ZE7A 4ZIRA 1GRNA 1OKKD 2C04A 3RSLA 4ASUA 1G3QA 3GJ7A 4HZIA 4CEIB 2IWRA 1J8MF 4OQMA 3BC1A 5IK2D 3MRSA 3T12A 3ZZUA 5DI3A 1R7RA 4RD6A 2CL6X 3F8TA 4JLDA 1SKYB 4PPNA 3KXKA 4XTCS 3ZD7A 1EWRA 1YRAA 1CR4A 3QF7A 2FFQA 5EP4A 1G18A 4TYYA 1Z0IA 1E2MA 3BERA 4UNPA 4CW7A 1VHTA 1A7JA 4IRUB 2ZRFA 3K9HA 1R0WA 1O3YA 3AVTA 2A30A 1G5TA 1YRBA 4AI6A 3TIFA 2ORIA 2BJWA 1XMIA 3KJIA 4BRUA 5JI2E 4UJ3A 1YR9A 3CM0A 1N0WA 4BLSA 1N5KA 1IY2A 1SGWA 2X8AA 4P4SB 2FEMA 2VHCA 2WKRA 3TH5A 4E07A 1M6NA 5HR5A 5FBLB 2O8DA 1NVUQ 2CDNA 2HF8A 4DSOA 2IHBA 5JS8A 4PFSA 4DLXA 4B76A 1L4YA 4B47A 2H18A 2ZUBA 4AK9A 1ZBDA 2QROA 2FWRA 3MMPA 2OV2A 4Q18A 1G5PA 1X8JA 4OJKA 2ZR7A 3RRMA 2MMGA 5BN4A 1KY3A 4LHZA 4DCVA 4JBXA 5KDOA 3VMFA 4LOAA 5AR1A 4A9AA 3B85A 1U8AA 1Q57A 2IXEA 1NJFA 2HLDD 3PG5A 3BGWA 2GNOA 4B2PA 1T5LA 2PT5A 4BEJA 3G0HA 4JKYA 4MGIR 1NP6A 1MR3F 3NWJA 4QKQA 2X1VA 1FUUA 3PQCA 4I1UA 2IXGA 3HPQA 1JEDA 2DFTA 4JKIA 4IDOA 3ICQB 4FWIB 4ZDWA 5L3QB 2ZE6A 4PAMA 1D2MA 1KJWA 1MV5A 4BZXA 1CR0A 1OXUA 4F4CA 5DI3B 2VSFA 3U44A 1P6XA 2HYIC 4C9BA 4E5UA 2ZEJA 3NBXX 4QNMA 5LB4A 3DOFA 4CT4B 5FBVB 2BMEA 1VTKA 4UQOA 4W5JA 3ASYA 1W4AA 3NC1C 4OBEA 1G17A 4CZ2A 1U2RA 3OE7A 1NMXA 3SYNA 3X1YA 1NMZA 2GDJA 3ZVNA 3NHAA 1YHNA 2JLUA 1N6RA 1GSIA 1VYVA 2NO7A 1XEFA 3QI2A 1D9ZA 2BOVA 1TF2A 3IBYA 2BKEA 3IIKA 5L3SB 4QL3A 4QJ3A 2G6BA 2HJGA 1G6OA 4I1VA 2BV3A 4NHOA 2G1KA 3CPJB 5DSZA 1GILA 1A2KC 3LY5A 2CK3D 4B74A 3NDBB 3AVYA 1G291 2G0NA 4TYQA 2J5XA 2REOA 3GFOA 1DAHA 4Q21A 5FOTA 2GZDA 4URUR 1AQUA 2CMKA 2FFBA 2JLSA 3IPXA 2WPDA 2XJ4A 4HLUC 4ZCMA 5JJKA 3ZZTA 5EUQB 1VG0B 4IJMA 4LBVA 3A1UA 5GVRA 2FPMA 4A36A 3U6BA 2C77A 2IEZA 1XZPA 5E95A 2CJWB 1KDRA 2XZPA 2YOHA 4D26A 2VP0A 4JZKA 4KLNA 5KSPA 2Z4SA 4QRHA 3KDSE 3GPLA 3KXLA 3EX7C 1JEEA 2JLRA 4H1VA 5FPTA 3JVUA 5FI1B 4US0R 2DWQA 1GFIA 3P20A 2OHFA 4Z1MA 3B9PA 1KSGA 2EW1A 4JLVA 5A5GA 2ATVA 2QAGB 1DADA 1IXZA 1JI0A 3RRZA 1ANKA 4NYIR 5E7JA 2DHRA 5EZ5A 1CR2A 2QQEA 2QTFA 5TVKA 3LVQE 3FKQA 4MUAA 3I61A 2C96A 3H1TA 3PR1A 3QEOA 4QC2A 5C2JB 2H92A 3E1SA 4M0LA 2D06A 4NKRA 1L7VC 4DEYA 5G3ZA 4EJSC 2B8TA 1W36B 1OF1A 4R2IA 1J2JA 1BOFA 3AVXA 1U81A 4JLNA 3BK7A 2CHGA 2GTPA 3AP2A 3IIMA 1VG1A 1KDTA 1EFCA 2FGJA 2VBCA 2ONKA 2IL1A 4UNNA 4BLOA 2ZYUX 4LBZA 5FL3A 2CEAA 2ZANA 3BB1A 4BFXA 4E03A 3QXJA 4KAXA 4D80A 3MG9A 3RS3A 4PHTA 1XMVA 2IXFA 2PZGA 3IQWA 2KBEA 2B7BA 4YC7A 5H70A 3RC3A 4FCWA 1WE2A 2F6RA 3HPRA 1XTSA 3N2IA 4QOSA 3A4LA 4TLDA 1XTIA 4D25A 1P60A 1E98A 4Q01A 3D8BA 1BS1A 5FOXA 1ONBA 1SXJE 5DHFA 3WYAA 1KI3A 1UKEA 5KPJA 4CGZA 1HUQA 3UIEA 2ZE8A 1W7AA 1KMHA 4ZI3A 4JVSB 3GLIE 2YINC 1IQPA 5CIWA 2WIAA 3ONWA 1W0KD 1KI6A 3HR7A 3H2YA 3TSZA 4YMTA 1HEIA 3L0SA 1Z63A 4EJSA 2ZAMA 4IVPA 4QGFA 3LV8A 2NG1A 4RCZA 2QUZA 1XD2B 3DZDA 1EFRA 1ZM9A 3WP0A 5K8UA 1ZP6A 3QKUA 1P5ZB 5K8TA 4QJ4A 3R9IA 4A2WA 1ZNZA 1R0YA 3Q5DA 1DAGA 1GKYA 2ZJZA 4A0GA 2IS4A 4AKIA 5CDFA 2FA9A 4KODA 4G0NA 4PC1A 4NDZA 1DAFA 2X19A 1JPNA 1D6JA 4GMDA 1Q21A 3GLHB 5FUXA 1Z06A 3QBVA 4KSCA 2OESA 4YXWA 2JLXA 4P33A 2CL7X 3LXXA 3ADCA 3AUXA 2RGDA 1U94A 2XXAB 5H1YA 2J87A 1RYHA 1E2HA 3UXMA 4O2LA 3TAUA 5IF9A 3KKPA 1Z8FA 2GCNA 3QUSA 1VIAA 4F4IA 1E4YA 3SHWA 3ZJYA 1RC8A 1J90A 3AVOA 3HU2A 3JZAA 4M1OA 4KYIB 3X2SA 5J47A 2WWIA 1H8HD 4TMXA 1W49A 2ZUDA 3GLFE 4B6FA 4HB4A 5AUQA 1W48A 1UKVY 1P2TA 1TAGA 5BN5A 3IDQA 2ZU0C 2H5EA 4P4TA 2IT1A 1XTKA 2OUKA 3QVVA 2Q9CA 1NY6A 3NH9A 4HAVA 3MJRA 4LJ8A 4Q4AB 5FR2A 4TZ6A 1E2LA 1DAEA 4XWKA 1R0XA 2W58A 3VR5A 4IFBA 221PA 1IN8A 4MGZR 4IDPA 5J40A 4JL8A 3LD9A 4P3YA 1N6IA 4IVQA 2P3SA 4LZZA 3VQTA 1KMQA 3FHCB 1XFAA 1XEXA 1NLYA 4RCYA 2HV8A 2JJ8A 5B30A 1G3UA 2F1RA 4QM6A 5EE0A 5D3MA 4ESVA 3H84A 2SHKA 2QBYA 1UBGA 3LLUA 4FMCF 4MKIA 3OAAD 1XTRA 1SXJB 5SZIA 1NNEA 4G5RA 4E22A 1NVWQ 1YZQA 4C0AC 4EFNA 3EPJA 1C9KA 4UNSA 3BB4A 1E2GA 2XTZA 4RD2A 4TL9A 4JIMA 3C16C 1SXJA 4XH9B 1CRPA 1PUJA 2ZYWX 3NVAA 2HCJB 5L8VA 2ZR0A 3TUJC 4A0HA 4MRSA 1FL9A 2WSSD 4NYIQ 5KHOC 1W46A 2JATA 4L4UA 4G1UC 1DE0A 2KE5A 3CPEA 4AYTA 1SZPA 1YR8A 2YNMA 1BYIA 1NG9A 4TMZA 2P6NA 2A5DA 2WWGA 4L15A 4B33A 3PUVA 2D74A 3U3JA 3U60B 1A1VA 1V5WA 2R9VA 2XSZD 3L0IB 2JJ2D 1VECA 4PZLA 1W2GA 3Q5EA 3CWQA 4OHXA 3HYRA 4V0ME 4CEJB 2QPTA 3QQ5A 3NG1A 1S0UA 1E96A 3MLEA 4PANA 1OPXA 3SFVA 1QRAA 2V6IA 2OM2A 3TW8B 5LD2B 1ZCBA 2EFDB 2VL7A 2E1RA 4LSGA 5AJVB 4XIGS 1YZUA 5A4JA 3HP1A 3C5HA 5CLLA 3REFA 1JR3A 1I4DD 2AHOA 3X1ZA 2XJ9A 4PSVA 4PX9A 4HI0E 2YZ2A 3OEED 5SZKB 1CP2A 2BMJA 2XAUA 3MCAA 4HAXA 4DEXA 1GWNA 4H9GA 3KQHA 3A6PC 1OH5A 1L2TA 2H57A 2P65A 1HE8B 2QN6A 4KHZA 4BASA 2WJJA 4FI3C 2JIZD 5KYKA 4AYWA 1WDTA 4NCJA 3PEVA 3BAFA 3TVDA 2IUSA 1TTTA 1L4UA 3U4QB 4Y0AA 2XNSA 3HYTA 2LWIA 5CM8B 4A8JC 3U6KA 2GK6A 3SR0A 2FG5A 1E3MA 4CEIA 3HDTA 1LF0A 4Q48A 4DLZA 1E0JA 1WRBA 2XOKA 4WXRA 5TDHA 1U8ZA 1YR6A 2PMKA 2F43A 2EFHB 4A6XA 4HSEA 2ZRKA 2ZI5A 4RJLA 5KU1A 1UJ2A 2DCUA 3K53A 2ZVPX 4NU0A 1ZCAA 4ABYA 2BBWA 2WJYA 2EQBA 3AVPA 3ADDA 3EPHA 3IGFA 4Q9LA 1Q44A 3P32A 5FTLA 2BDTA 3L0PA 4C0BA 2GETA 1Z5ZA 3GLHA 2OLJA 1SULA 2XB4A 4IXMA 4TLAA 1XU4A 2I4IA 5AJZA 3U3KA 4DLRA 1OW3B 1NLZA 3UK6A 4OKSA 3I8XA 2KI5A 2C95A 1KTVA 1TMKA 4DJTA 2ZSAA 2C5LA 2BBSA 4PTLA 4MITA 1W36C 1COWA 2FE4A 2V54A 4KXFB 4D82A 5M04A 2IYLD 2OAQ1 3K1JA 1N6HA 1FTSA 1T9HA 2W83A 1BH2A 3PUWA 1E2KA 2G1JA 2NTYC 2EWWA 2PLRA 1XD2A 2RH5A 3CIOA 2VHUA 3FYHA 2YWEA 2A5GA 3PEUA 3QKSB 4I99A 2PZFA 3X1WA 1W4BA 1U0JA 3UWOA 4E09A 3Q85A 3FHOA 1KHTA 3BS4A 4OK5A 1FP6A 3VHXA 3QPVA 5BW8A 1MT0A 3NC0C 1QVAA 1MH1A 3NTUA 4WVFA 1I4LD 3VR6A 3QXHA 5JHGB 1JQJC 4ZIRB 1KSFX 2IYVA 2MMCA 2QT1A 5LD2C 1NKTA 1M2OB 2YV5A 2A5FA 3B82A 4F4JA 5J4VA 3SBEA 5KDDA 1T3LA 1ESNA 3U44B 4TQ9A 4TLBA 1XZQA 5FL7D 2W2TA 1KI8A 2DFLA 3LBNA 3L8ZA 2ASEA 2KSQA 2OBMA 1KGDA 1CS4C 2OCPA 2A78A 3RRYA 4J0QA 1GTVA 1OT3A 2QMUA 4DLYA 1SKYE 4PZZA 5FOVA 2RGNA 3ZDQA 2O8BA 1GRQA 4XVQA 3Q72A 1MOZA 2QENA 2GA8A 1Q0UA 2EYQA 1P2VA 3EIQA 4A8JA 1E32A 1W0JD 3PUZA 4GP6A 3KUCA 2A5YB 1E9AA 4G5GA 3TBKA 1AIPA 4NYMQ 3KX2A 1SVWA 4X8LA 5KSOA 1ZW6A 4B44A 1TEXA 2JJ2A 1ZD8A 5EUMA 1E2JA 3ZVLA 1E79A 5TV2A 3GLFA 2WOOA 3LQQA 4S2EA 2GJAA 3SE0A 2V1UA 3O8BA 1MO4A 2VA8A 1VKJA 2IA5A 2Q21A 3W6OA 3X1XA 1JXMA 3OF5A 4MUBA 4NE2A 1NVVR 3UKDA 2FSGA 4M9SA 4LYHA 2ZXUA 1R2QA 1GKUB 1NIJA 4PC7A 4PC6A 1IOZA 1KO1A 4PXAA 2AD1A 2ZAOA 3TRFA 5BWMA 2QGNA 2RCNA 1XJCA 2WWHA 2QU8A 4PAQA 2GEDA 1C4OA 1IN7A 2W6ID 3TR5A 1E6CA 3U61B 4RD4A 1BMFD 1QHIA 1RZ3A 2JIZA 4JYBA 4BFYA 5CDFE 1NBME 2ZYVX 3PENA 1IBRA 4PO8A 4B71A 3BWDD 5E4FA 3O8CA 2C03A 4DXAA 2FOLA 2VHTA 2O8FA 1IHUA 1N6KA 1X6VA 5FUWA 3OEHA 4RD0A 4V02A 1Z6XA 1M7BA 2JJ1D 3PEWA 1II0A 4V0OA 1W4CA 3I72A 4P0TA 3QPWA 4JYCA 3T35A 1Q12A 1VCIA 2OFXA 2J0UA 1ESMA 4RKFA 5ANRB 3ZS9A 4GZLA 2R44A 4Q19A 1AS0A 4B73A 3KFXA 5CK5A 3AKCA 3EPKA 2CNWA 2ZJYA 3EIHA 1J7KA 2PJRA 1SXJC 1R5NA 2ZROA 1XXHB 4BFWA 1CJKC 2G3YA 4BFSA 4L16A 5LDDC 2EYUA 2AR7A 2O0HA 2X77A 4DCUA 3AVVA 4JJZA 1X1RA 1GL7A 3SOPA 3TQCA 1T3SA 4CEHA 3I4LA 4AG5A 5A0FA 1U90A 3CRW1 2FN4A 3THWA 3VKGA 3K9LA 2HLDA 3K0FB 4ZDKA 2YVUA 2RGNC 2OSBA 2PZEA 4OK3A 4TT3A 3TSOA 3WXMA 1IN5A 1II8A 2K5UA 4TYPA 5AWFC 4RZXA 1VHLA 3CF0A 2GJ8A 3CX7A 3FFBA 1DOAA 3VAAA 2H17A 5L3VA 4FWTA 4DDVA 3BORA 4Q9IA 2ZRPA 5FPKA 3CUEF 4OI0A 2Z4RA 1U8YA 2XITA 5EXPA 1W44A 4EPXA 3OIWA 2AWOA 2J46A 3NHBA 4DSUA 1YU9A 3ZIAD 1N6LA 1IY1A 2P6RA 3B1XA 3UWKA 1Z0DA 2V9PA 2HT6A 1CR1A 5LBIA 2JLQA 3EZFA 1ZUHA 3F3YA 3U7GA 1X1SA 2PCLA 3AF2A 2ZRDA 4WXPA 5HPYB 3V00A 2J0QA 1LTQA 1T0HB 1D2NA 1XJQA 4XJXA 1OLOA 4HLUA 1JR6A 1UM8A 2ZQ5A 2H8KA 4YMSA 2IYUA 4G3XA 4OI1A 2Q6TA 2QY9A 4IXNA 2G88A 1OHHD 4YDSA 1GM5A 2WAXA 2HXYA 1FMLA 4POAA 4DDUA 1M7GA 2RHDA 3T1QA 5CK4A 2R8RA 5EP3A 2F9LA 1JBKA 2VSXA 1CJTC 5FOWA 4MRNA 2BEKA 2HEIA 2X2FA 1RJ9B 2KJQA 3RWMB 3ZQ6A 3AF4A 5SZJA 5B57C 4LI0A 1NVVQ 1Q22A 4TL8A 4XTRA 1YVDA 1JJ7A 3L82B 1T5IA 4B3GA 3VNUA 2UVQA 2IF0A 3QY0A 5IK2A 3TQFA 4LJAA 2WAYA 3ZVMA 3QF4A 1T4GA 2O8EB 3KQKA 4Z8XA 2PT7A 4M8NE 4N0DA 1TQDA 1Z28A 5FFMA 4BFVA 1AKYA 4PHFA 4IOMA 4QM7A 2CLCX 3EARA 5GJVC 4CT5A 3DOEA 2VP5A 1XRJA 2WKPA 2GEVA 1E9DA 4HB3A 4KFSA 3WYGA 1CJMA 2ORWA 3FGNA 2R2AA 1NMYA 1WA5A 2E9SA 3MWYW 1ZM3A 2J7PD 2QE7D 4P32A 2W6JD 5CM9C 721PA 3DMDA 2WMNB 1OFTA 2G77B 2F1HA 4UXIA 2QBYB 1EWQA 1IAQA 2WWYA 4ITRC 1QHXA 2W2XA 3GLIA 1TU3A 2AK2A 4GFDA 3TSWA 3QNUA 1E2PA 4KJZA 1XD9A 2OILA 3DO6A 4HLQB 4F7WA 3DVLA 3EZ9A 4JBWA 1LFDB 4MH0R 1DTSA 4OI2A 1P75A 3HWSA 1Z83A 3K09A 3LA6A 3O8RA 1DAKA 2JLVA 3ZVRA 1P4SA 1YE8A 1ZIOA 4WZAE 2FX3A 2BEJA 2QEQA 4XSGA 1PUIA 2GBLC 4LHWA 3KXIA 4CIDA 3VKWA 1Z08A 4UJ5A 1FNMA 4FMBB 2D2FA 4M9QA 4MRRA 1E1QA 2YJTD 1CJVC 3CNOA 4JLPA 3EXAA 2CCKA 3UMRA 2CNWD 1HV8A 1RFLA 5FOSA 2R6DA 3CNNA 1QHGA 5J4YA 1GUAA 3GLGE 1WBBA 1CLUA 4O2RA 4Q7KA 2CL0X 2QZ4A 3X1DA 3PEYA 2IYSA 1Q3HA 5EE1A 5EZ6B 5BYJA 3S1AB 2WSMA 3DL0A 4DB4A 3IIJA 3OHMA 5IDVA 1UAAA 2VP9A 1JJVA 3DEFA 4GP7A 2XNDA 2NZ8A 1KJZA 2VF8A 4HZUB 2IWHA 5HZHA 2OBNA 3JVVA 4WOPA 5KNCA 3KJGA 3TKLA 4CEHB 1UPTA 3CR8A 2J1LA 4ARZA 3T15A 2JEOA 1PVOA 4URVR 4FMCB 1N5LA 4RZ3A 2ZREA 2EVWX 4YMUA 3M6AA 5JHHB 3K0EA 2B6HA 4B32A 3THWB 3LLMA 1G4UR 1GL6A 1N25A 3AUYA 5JEEA 5IHPA 5K8IA 1OXSC 1W4RA 2YWFA 2Q9AA 1M1YE 1S3SA 3U7HB 2QT0A 4ASUD 1FUKA 4JJKA 4DVGA 2MSDB 1U0HC 3WNCA 2UZIR 3ZIAA 4ESHA 5GADl 4EAQA 2ZRAA 4W9MC 4PQYA 4GOKA 1G5RA 4G5OA 2ZRJA 3GJ8A 3LNCA 4ZCLA 4UNQA 4LYFA 1FP7A 2OCBA 3TUIC 1YR7A 4TYNA 3IUYA 4G01B 1F3OA 3FKSA 1UEIA 3QENA 5GJWC 4XD7D 4NBSA 1JNYA 2ZPTX 4L5BA 4PPFA 3RSOA 1RE0A 1T0JB 4GRAA 2NZJA 3C15C 3T1VA 1TPZA 2AKAB 4DLSA 2BCJQ 5E7MA 3RS4A 4IKEA 1UBFA 3B9QA 1E0KA 4M21A 4Q4AA 5GJBA 1H8ED 5DI9A 1N6PA 4F93B 5J5CA 2CCGA 4DZZA 2AXNA 3HU1A 3WNDA 4A2PA 3AKEA 1HQYE 4M9XA 5JWHA 1KAOA 1M7HA 3H0KA 4B3BA 1DG3A 3QSYA 5FBWB 5DN6D 3FDIA 3BFKA 2ZU6A 3OE7D 4RSGA 3TUZC 1KK3A 2FSIA 4PC3A 2ZJBA 2G83A 2FGKA 4GT1A 4URZR 3RC8A 4OL0A 2AFHE 5JCPA 1MABA 1VCMA 4I4LA 1I2DA 2QGZA 4R2HA 2ZETA 3K0SA 1QHNA 1E9RA 4TSFD 4QGAA 3QKSA 3KUDA 1KAGA 1D5CA 1XMSA 5F9HA 3AVUA 1T6NA 5CB6A 1G7RA 2ERYA 3VNVA 5G41A 3U3OA 4GOXA 1Q1EA 3L8YA 4G5QA 2JASA 2WPDD 3P4XA 1GZSA 3IO3A 4BFTA 5JSZA 3LH5A 4C0QC 2GEUA 1UADA 2JDID 3W34A 3WP1B 3GJ4A 3K8YA 5G53C 4NYJR 4TZ0A 2GWHA 4HLCA 2F55A 3FOZA 3CZQA 4HDQB 4B3CA 3V9PA 2I3BA 1FW6A 2FH5B 1WCV1 3OIYA 1UFQA 2BWJA 2QTVB 1Z2CA 4DLVA 1N5JA 3Q8XB 3SJAA 3P27A 3GLIB 3CRQA 1XBTA 2IYZA 4ZKEA 3ECCA 4AG6A 4CYMA 4W7SA 3E70C 2EFCB 2XSZA 1QG4A 3MJHA 4FMDF 2WHXA 1FQJA 4PPGA 3AVWA 1P9WA 1Z6AA 3GD7A 3D3QA 3GJ3A 1FTNA 3AVQA 4ZO4A 2WM9B 3WBJA 1HA3A 4F38A 3D7MA 4I81A 1S3GA 2VYFA 4LV5B 4H1UA 3DKVA 4V0LA 1XXHE 1ZNXA 1GNRA 2HYDA 1CKEA 2XX3A 3A8TA 3M1IA 4WIAA 1SHKA 4YLGA 4BLTA 3GCGA 1E9FA 2ZRHA 2QORA 4DB2A 1SVMA 3GLHE 2RGBA 5EE3A 4DKXA 1E0SA 3LX8A 1AK2A 2PX0A 3QEJA 4JL5A 3ZH9B 3ZZ0A 4D4LA 4BQSA 2BCGY 4TMWA 5H68A 1Z6YA 2GHIA 2FV8A 2ODWA 2VIIA 3O47A 4N3NA 3S1AA 2XEXA 3UANA 2HJVA 4EFMA 1TADA 3AKYA 1KMHB 2CHVA 2REBA 4Z1MD 4DWJA 1G9XA 1CF4A 3N70A 1TQ6A 4A0RA 3A1TA 1LF5A 3NBYC 2Z43A 1UEJA 1N3BA 2QAGA 4B35A 4Q9KA 4NYJQ 1SHZA 3OZXA 4Q7MB 1ETUA 2A5JA 4A1FA 1K5GA 4A15A 3DMNA 4U00A 4X8MA 4HUQA 1IONA 1RRGA 2W0MA 4Q4HA 4IVRA 1HTWA 3QXCA 2WJIA 4WAUA 2GAAA 4CF7A 2RGCA 1W36D 2QSYA 2AWNA 5KPDA 5DH9A 1P2SA 1FPMA 3U4QA 1TUIA 3I92A 2O0KA 1GRRA 4M1YA 1P2UA 2RHMA 1P72A 1JECA 4AYXA 2RMKA 3SQWA 3DDCA 2OBLA 4WBSA 4U7DA 2DR3A 3SQXA 1A2BA 2WMOB 1G21E 2CBZA 2AD5A 2QM7A 3GEEA 1S1CA 4FN5A 2PL3A 3W6NA 4M22A 5E7IA 1E2FA 1UKZA 3DM5A 5L3SA 4Z51A 4MRVA 1IM2A 1AJEA 2H16A 1SKQA 1I2MA 1QG2A 4Q1FA 2NPIA 4C0KA 2ODBA 2N1BA 1Z0FA 3LWNA 5AJWA 1NN3A 1MRSA 1QZXA 1Y63A 3DHWC 1IY0A 1CXZA 1ZAKA 3AH8A 5C4GB 1ODFA 1EFRD 4TL6A 4NYMR 4ZDJA 5JRZA 3U5ZB 1W1WA 4EUNA 1VG9B 4Q9HA 1CULC 4LHYA 3W8RA 3A36A 1ZJ6A 5FPHA 3ETLA 3WY9A 1G16A 2MSCB 4PAOA 1XCMA 3C5CA 4GBMA 4HATA 4EQ6A 1A4RA 1T8UA 5HTKA 1DG1G 3VU9B 3AEZA 3WHLA 1K8RA 2YOGA 4NZYA 2KWIA 2ZJ8A 4F91B 1VMAA 4PC2A 2OO7A
chains in the Genus database with same CATH superfamily
5B6IA 1CIVA 1LZKA 3N6VA 5FO0A 3WK8A 4Y9DA 5A0TA 5CRIA 1GITA 2PS1A 5SYMA 2QG6A 5F9FA 1CFJA 1YB2A 4XAQA 5LOVA 3R6DA 5LPNA 1VL2A 5E6UA 3JQ7A 2VCYA 3RJ9A 1OI4A 5JBNA 3EIUA 5HNKA 4D9BA 3DEKA 3N0XA 2WWXA 1M1YA 3B20A 1DQZA 4P7KA 1EUCA 2PL9A 4I9GA 3FMOB 3G13A 1Y5LA 4WZ6A 5IAJA 4UFNA 4FR2A 2QNBA 2X9VA 3WGVA 2ZZNA 3R40A 4KDEA 2IUEA 1UFKA 1ZS9A 2ZRIA 2XCQA 3HVJA 5I9SA 4D8UA 3I5YA 1JB1A 2A9OA 1LBEA 1R66A 3EEFA 2I65A 3CH5A 4P31A 4W7IA 4XDYA 3UO8B 4C3ZA 2O57A 1LDMA 1M8KA 5LVAA 1RC1A 3QLUA 5DSXA 3WGGA 2RJNA 3P9QA 2ODPA 2A7XA 3NBFA 5FKJA 5JLJA 2C78A 4LXHA 3OZSA 4WEOA 1SQ6A 1ADBA 4WUVA 4AURA 2I6XA 5JLAA 3WZLA 1WEKA 2WTMA 3QOFA 1KO4A 3LKBA 4E4RA 5F98A 2QMHA 2QK4A 1E9EA 3L84A 4LZAA 5CAEB 4BEWA 3BIOA 4CE6A 2IS2A 2YBDA 3H8WA 1EVLA 3ICVA 3KDPA 1OAOC 3ZCUA 4ZOCA 5ITSA 2QM8A 3MHTA 1SVIA 2BYTA 2AFHA 2QRQA 4DSNA 4DJAA 3I6YA 3ZV4A 1AUXA 1OIWA 3FTQA 3G8DA 5FUVA 2OVBA 3UXYA 1BD4A 3WQQA 1Z15A 3OICA 4PO9A 1ORWA 3K9GA 1SC3A 1TAHA 3QWFA 2IUTA 1G5QA 4IGKA 2GESA 4X8HA 4XKJA 5GOTA 4EKYA 4UMFA 1BHJA 3WYBA 4ZGBA 1LV8A 4D5EA 5JMWA 5KU7A 1GL9B 3PDIB 4ZEMA 3KQOA 4Y9RA 2PLFA 3IKJA 5HSGA 1QMPA 1T24A 1UODA 2CFTA 2CNLA 1JTFA 5J23A 1U04A 1TCAA 4Z4FA 2I62A 2P9FA 2ZIAA 1ZM2A 5DBGA 2H8GA 2FSPA 1S4MA 2Q5LA 1HYEA 4R8RA 4TN5A 3VVCA 3W04A 4OLBA 2PSSA 4K46A 4C0JA 3ETHA 3T3EA 3A6KA 4OHRA 4RS3A 1SQGA 5KX5B 3RAFC 2XMQA 1JH8A 1CQJA 3OTIA 1PK8A 2ID9A 3V1UA 2NTEA 2O2JA 4EY7A 2J45A 4KZPA 3EWNA 3B78A 3OC0A 3COPA 1FOEB 1KK2A 3S7ZA 3QG1A 4DCPA 3BWMA 3BBLA 3D6TB 4GBGA 1JU3A 2I1VB 5KNLA 2YUTA 1FP1D 3NH6A 4OGFA 3DULA 1K2WA 4Q4HB 2GJKA 1RPAA 2L0XA 2QA5A 3B51X 2NVUB 3UH1A 3ACCA 3RSZA 1LC0A 3E1KA 2Z3VA 1Z2AA 2IYFA 3HEBA 4N7JA 5JS7A 1XL1A 5J2TF 4DDTA 3KPJA 4H3VA 4B40A 4QFCA 3RARA 3QU2A 2JZCA 4JLKA 5JSHA 3H5RA 3UOWA 2VAMA 3D8NA 1C9DB 4GVPA 4RHUA 4Y7CA 3DDWA 3IQIX 4QLOA 1KMIY 1ENZA 4L78A 3RANA 4AZ0A 3GIDA 3SQLA 4CFYA 3QMVA 3V7NA 1H23A 3UYLA 1XDSA 2ZTUA 1FTYA 3KEQA 2G5PA 5KI6A 4W5OA 5CXQA 4ZT6A 3CMMA 3TJRA 4YCMA 1VE7A 4FFBA 4FIDA 1VCHA 4TTVA 3P9RA 4BFUA 1CCWA 2PUDA 4MR8A 3H2HA 5ICCA 3GXOA 4KXLA 5SY9A 3RS7A 1FZQA 1PFWA 5BSVA 2ZIFA 2BM9A 1E4EA 1I8TA 3EA4A 3UK7A 2D59A 2GSDA 2JD0A 3N86A 5I7SA 2J85A 1ZVVA 2VRCD 1SQFA 3C4VA 2NOAA 5E6UB 2D2EA 2IX9A 3VJLA 3RGWS 3UFBA 2P8JA 1XKXA 2QU7A 1XKQA 2YHSA 3CE6A 3DL2A 3MPOA 1M9NA 2JI7A 1X7YB 4RL6A 4G0MA 3RVBA 5CLFA 4IY1A 2GVDC 3OPYB 3N53A 4IX1A 4PLTA 3J81k 3I39X 3QVWA 1FBTA 1PL7A 5IYZA 4BMZA 4D0RA 3RU2A 2Z0MA 1DFHA 1CRLA 1MJGM 3TFQA 4D3DA 1L3CA 5JAHA 1NE2A 2RK3A 1LW6E 3OEWA 4ZI2A 5T6MA 3LPDA 1I51A 2WG1A 1KDPA 2IF2A 3WHKA 2F7SA 2O3UA 3PEEA 3R20A 4QT0A 5BV7A 2DYKA 1N57A 1W4ZA 1C9NA 1RWXA 3HNPA 3N2KA 2DWOA 4F1WA 4JCCA 1V71A 1ZJ5A 2ERXA 4BPBA 4D1YA 4CF4A 2Z95A 1YZNA 4D2IA 5LUAA 1E9SA 4LXGA 1ESDA 3I2GA 3OWHA 4N6GA 4BAGA 1MX3A 3Q3VA 1LWOA 4PY2A 3UMGA 5A5DA 1TZ2A 3HL4A 5H83A 1NF9A 2VWQA 1H2EA 1Z5NA 3NHLA 1UWCA 1WPRA 2RGWA 2WIGA 4RY2A 3L1JA 4GP9A 1UUFA 1RZRA 5J43A 2H1LA 3RNLA 2GCIA 3PUYA 5B3KA 3AXSA 2PBZA 4IV0A 4J0GA 4NH0A 2E85A 3O8OB 4XR4A 1JR3D 2QGFA 5AW5A 1YOVB 3COJA 1YIOA 4U7GA 3ZWCA 2JG3A 3LYAA 4HWTA 4Y2PA 4PHGA 1HTBA 4IDBA 3GX1A 4MQEB 5EY5B 2ZRGA 3VKHA 1F8FA 3B60A 3DDSA 1JRLA 5IYZF 5KJ1A 4X71A 4JLUA 4AC9A 1X42A 1CUJA 3F78A 3HN2A 3EIEA 1R4ZA 4RVHA 3KHUA 3RABA 5KNDH 1WB9A 3BA6A 4HQNA 4LV8B 3W4JA 3DPIA 1OLUA 2E4YA 5F3WB 4OUDA 3GA5A 1M2WA 2QV7A 3B1ZA 4FFVA 2H7CA 4LV6A 4QLBA 2PIAA 2QT9A 2XW6A 4P93A 5C18A 1EMDA 1ZWKA 4IFIA 4ILEA 5JQGA 3ZU3A 5CBPA 2ZWAA 1VI2A 4Q47A 5J1SB 5AT1A 4ZYUA 1XTJA 4YP9A 3CEMA 1P7YA 3QH4A 1UDWA 4L57A 5HKKA 1GZUA 1RBMA 1AKQA 3OLYA 1E2DA 3K3PA 5EA2A 5DT9A 4IILA 4EYOA 5CCEA 3OUUA 4QNRA 4WK6A 1B00A 3IPLA 2ZM5A 2D5BA 1MJHA 2ZBRA 2R1VA 4Y1FA 1QAMA 1YJXA 3LC7O 3TDMA 4BUJA 2X5OA 2IYWA 3ADKA 621PA 4LRUA 3LVRE 4DCCA 4WK0B 2F9FA 4M8LA 2JIOA 5AHWA 3OPNA 1B6GA 4B6GA 5GIOE 2J0VA 1JWAB 1TM7E 3GH1A 5CTJA 4BO9A 4C6SA 1VHQA 5BWLA 5FJIA 1PJSA 3UH0A 3W9UA 2PGDA 3CU5A 3D4OA 5LZ2A 3LT1A 3JWGA 4U2EA 2R47A 4YAGA 4FFOA 2LPMA 4R54A 3LW7A 3QNWA 4I1OA 3K0FA 1N75A 2ZI4A 6Q21A 3RHSA 3SVZA 1EFPB 1L0BA 3WLKX 1E6MA 3AFHA 4CIAA 4X41A 3CZRA 4U6SA 1NV9A 2QN3A 1S5PA 2QRVA 1A98A 3ZHRA 2HT1A 2JJ1A 2PX8A 1YZLA 3WV4A 4HGYA 1RACA 1RAHA 1TZMA 1GQRA 3AIOA 1WG8A 4XUGB 3RDPA 2QVGA 4LVUA 4WZAA 1I4TD 4E6EA 5IJWA 1V3TA 1Z29A 5KQMA 1CJCA 1WU7A 4MICA 5AO9A 5EP1A 1BXRA 2QVXX 3TTTA 1T2VA 3UCXA 4JXZA 1SAYA 1PW5A 4TTQA 3TTSA 1YDWA 1GJRA 2VYVA 4HNVA 2ZG6A 5LQMA 1YVUA 4HX2A 3MT8A 4RADA 3KSMA 1FDSA 1KOJA 1VLZA 4DRXA 2VPWA 5TX7A 1M73E 4C7OA 2K2WA 1R0CA 2N46A 2ZDGA 1JHQA 1PHPA 1NVDA 2AZ4A 4U2GA 4U3JA 4JQYA 1VBFA 5FYDA 4ANFA 3EBPA 3PWZA 4FOLA 4AQDA 4DUZB 3LS2A 4Q02A 4LDNA 1X7ZB 4G1VA 1ZOPA 4D4KA 1C1DB 1W85A 1Z34A 2O1EA 2ZBQA 4URWR 5K0SA 4QJIA 2NIPA 2PWYA 3SSOA 2AG8A 1G7TA 5LP6A 1T6BY 1YFJA 3ESZA 4ZEXA 4QHTA 2LDBA 1YASA 3MD0A 3STYA 4NP6A 3QMPA 5AKYA 3P9XA 1ZN7A 2I8AA 1SUCA 1UZMA 3H86A 1DSSG 3FSEA 5G4LA 3VOBA 1EU1A 4DV5B 1H1DA 1OY1A 5EG5A 3W4IA 4DOMA 1XMQB 5TMBA 4EGFA 4GR4A 1PNRA 4I4IA 5ARCA 2V6GA 3W2IA 3CF6R 4MW5A 4MDYA 4PIMA 3KWMA 3FHTA 3N07A 2IYRA 3LC1O 2HWYA 5C3MA 1R8JA 2NTVA 4NCHA 2I1WA 1N4DA 4UPEA 2R2GA 3CR7A 1PLKA 3F97A 4OGKA 4OI4A 4C4XA 4IH4A 1CW2B 3C5WP 4RE6A 1IUPA 4MLDA 2C2HA 2QTTA 3CG0A 3HKCA 3K05A 4PO3X 1XN4A 3JAWB 4HNRA 4N0EA 1GPWB 3OZTA 1HG0A 1BA2A 2HZ7A 1T0IA 3LZ6A 4EMBA 1F5NA 1RXSA 3WGUA 2ZTSA 5E1MA 5A06A 3QHQA 3Q7SA 4QBHA 5DM2A 1PJ4A 3E5HA 5E6SB 2V6MA 2ZIXB 4B3DA 4LC0A 1ADCA 1OVGA 2P78A 4BNLA 3DBOB 1F60A 3UTDA 3SZ3A 4NIMA 3H9QA 4NPCA 3T3NA 2UVPB 1W5EA 2GJ9A 4YI5A 3ORRA 2PH7A 2OWEA 3B7PA 2JJYA 4O4JF 4AIIA 2DH6A 1JALA 1R64A 2PGJA 3INRA 1Q3KA 4ND2A 3PNLA 3WRVA 1KZ7B 4AX8A 3A58B 3A32A 5DIFA 3QKRB 1A77A 2VHXA 5EE9A 1VDZA 3T1NA 3CZPA 1Z3CA 4LNHA 4B43A 1SK8A 4Z9XA 2BELA 4YAUA 1BNCA 2NXCA 1KDYA 2C4NA 2OMKA 2P9TA 1UBCA 2UZ1A 4U39A 5TARA 1EVYA 2I5PO 2FPSA 3O9VA 4A92A 3L07A 4BNDB 4OF4A 3T5GA 2VNIA 4P4LA 4B2IA 1O1YA 1KWGA 1OFGA 2ONYA 1NYTA 3KEMA 3EK2A 4PRKA 1I5RA 1Z7BA 2JANA 4WT7A 5BSUA 4EDFA 5ES4B 3DKRA 1SKUA 1OXTA 1QF9A 1FC0A 2VDUE 3EUAA 4OSEA 3TL3A 3K5WA 3TLAA 3LBYA 3AB7A 4ZVOA 4E11A 2CHQA 5AW4A 4FILA 3M0EA 2MSEB 3LCJA 5FTMA 4FINA 4BMXA 2QLBA 2GK3A 5K2MA 1JAIA 1JIJA 2MINA 3UC9A 3O4RA 1TJ5A 4XWGA 5ELMA 2R25B 5L3RA 1U6JA 1Y3HA 4TZKA 2V58A 5E0KB 1E1MA 2AL7A 3QK7A 4EX6A 4NG4A 3BFJA 4AN0A 4FQ8A 3GVCA 4JXJA 4X54A 5KQLA 4DC1A 4X66B 1RI3A 4UBLA 3JSAA 2G9ZA 2DBZA 3AB8A 3BH7A 1WUTA 4BN4A 821PA 1ODIA 5JI3E 2NU7A 2FG6C 1W0KA 4PM4A 1FXUA 3GOHA 4ITUA 1H1TA 2V5UA 2Y0CA 1LVGA 2V74B 3E8MA 4QELA 5JYCA 3PJEA 2BVNA 2LCFA 3I1IA 1I4EB 4H3KB 3Q87B 4BLWA 2FP4A 3H05A 4B5KA 3INGA 3R5FA 4LY0A 5CVJA 3OX3A 1PK7A 3U49A 1GGEA 4JVNA 4NCKA 3EIWA 1M5UA 4X45A 2WT9A 4E3WA 3H3JA 4CKBA 2AH5A 1Q84A 2UYGA 2W4IA 4XSVA 4XVUA 2JJQA 3K0CC 2ANBA 3O92A 2WIKA 5TMEA 2R0QC 5CLHA 3HLKA 2ZJ7A 3FNQA 4K05A 3GFTA 4YAJA 4BYMA 5CFQA 1Z4IA 4ZAXA 4OX9B 2O23A 2XWPA 4DCTA 2PNFA 4HLDA 1ULSA 1UK6A 3NOVA 4XX0B 3SM3A 1GVNB 1V6SA 3FPLA 1IHDA 1FFBA 3O8QB 4HHEA 5CT5A 3GNQA 2V55B 4F8YA 4M0CA 4FNAA 4L4SA 1J25A 1H65A 2AJ8A 3NIBA 4ALNA 3MB8A 5JS6A 2YJ6A 5ECYA 2JCSA 4UBIA 2JLYA 1ZJWA 2YVAA 1E94E 2W8BA 1ZSVA 5HQ3A 2QTNA 4D81A 5BN5B 4RDIA 2O1WA 4WZBB 4ZPXA 1GSAA 1YRYE 2HHHB 2I9KA 2H08A 3B13B 5JROA 4MV0A 2I6QA 1ZEJA 1W35A 2BRUC 1FJHA 1HE3A 2TMGA 5DHTA 2CV2A 1P9NA 2GVZC 1FFDA 1BVHA 4BVFA 2R84A 2FZLA 3IC5A 4PICA 2Q5EA 3HI6A 3CCBA 4BNJA 2QMEA 4MWCA 4YI3A 3PU6A 3QOXA 1NLFA 1KY4A 4EB8A 1GLVA 2JGRA 3T5TA 4MS1B 4OOFA 1N1GA 3EH1A 4YRKA 3GQBB 3NKVA 1IY8A 4MRAA 4UHJA 4XWAA 5I4IA 4GDMA 4LWZA 3WJ2A 2YICA 3PV0A 1GN9A 1KKLA 4IQ4A 1HLPA 4LY3A 3A10A 1E1NA 1JHOA 1EGMB 2GYUA 1SOWA 3IOCA 2P4HX 5K6AA 3LCVB 2ZQYA 1NURA 2QRMA 1IRXA 1UOOA 2GPAA 3HFJA 4GPD1 4V0NA 4IKPA 4LDZA 1CEXA 3T4EA 1L5QA 1CWUA 5JTTA 2J3IA 2YTZA 3RSCA 4Q4JA 4WPGA 1YA6A 2QMZA 3EDMA 4KWIA 4HL6A 4LJYA 4DYVA 2JBAA 3WMEA 5CITA 5K0CA 1AUOA 2Q29A 4I1RA 3WNQA 3D8RA 1R9MA 5JW6A 4LK2A 4DIMA 4IIHA 3THSA 3GJ5A 3STUA 3UN1A 4NMMA 2HWXA 1UXHA 1JEOA 1P44A 1VJ1A 2GZ3A 4RVCA 1FIUA 3LDUA 1HH4A 3QXSA 1H2FA 3ZJ4A 3DAHA 4IDNA 1M1UA 2YYZA 3ND5A 4OQZA 2G70A 1ZCJA 5E1DA 2J3QA 3B1YA 2FDCA 1J7JA 2PPVA 4LISA 4KXVA 1SG6A 4AJNA 4J76A 2QNIA 1J1ZA 1P1CA 3RLFA 3SHFA 2HA2A 3I6ZA 3OD5A 4HQFA 3PPVA 1G7SA 5BORA 1UK9A 3KFVA 4OJTA 1KKMA 5JZBA 1U0FA 1Y9EA 2OB1A 1ZC4A 4YV2A 4J0IA 2SECE 4US1R 4CCAA 3ZD6A 3D9QX 4TSFA 4DNQA 5SYNA 1UMCB 2YS7A 2ZI6A 1GQ2A 4MPTA 5C4MA 3FLAA 5T41A 3BWBA 3QITA 1C3OB 5I3ZA 2A92A 1GGNA 2GCOB 1GHTA 1I2CA 1NI5A 2WINI 1GV0A 4CQMA 2QS9A 3L8DA 5A6VA 4FVTA 4KO3S 1Y9DA 4U0JA 2QAGC 1JXOA 4Y2SA 3N3AC 3IEVA 1LY1A 1MDFA 1HMYA 5D85A 5EPUA 2BHRA 2YIDA 1ESCA 1VXRA 2DFVA 2FK7A 2GKSA 2I80A 4Q7JB 4UEKA 4ZRDA 3QYJA 3K5PA 1Q3TA 2CUKA 2F43B 2XRFA 4Q9NA 4URXR 421PA 1QGED 5K3DA 3VVBA 1T8PA 1ZR4A 1M2FA 4RH1A 4UEWA 2XCSB 4WLVA 3DQQA 2PKWA 3FPJA 3C8MA 4LHXA 2LCQA 4CIVA 4QDZA 4TS4A 1GYPA 1ZNWA 2IYYA 3EAGA 3JWJA 2PLWA 5B1YA 1U1EA 5DFAA 2VZ9A 1G8MA 1KVSA 1IUOA 5BT8A 2ECQA 1EFHA 1YFLA 2A9PA 4UXHA 2QUKA 3NTOA 2LKDA 5KYTA 1EXDA 2AFRA 3F1KA 1MRNA 3FZEA 4CQMB 1BU5A 2V7QD 4AZWA 2ZS9A 3VX4A 4ZQEA 3AF3A 1PJLA 1HFKA 3D4BA 1YXMA 3F5QA 5L7WA 4QBFA 2ID8A 3IR6A 4DG8A 1TW3A 1IXSB 1N92A 4YT4A 5L6MB 4JB8A 3LI2A 3KBOA 3EG5A 4N65A 3NTRA 3GP8A 5BOSA 1U9JA 3FYTA 4JVOA 1RC0A 5HZKA 3M82A 4JR2A 3ZEAA 4RSMA 3W8NA 4GI1A 4R98A 2JAXA 3QLEA 1D2EA 2UZ3A 2BM0A 5AH0A 2ZB7A 1QNLA 5I01A 3OJOA 2O3SA 2R11A 5TPWB 1WXQA 2TSYB 2RH8A 3RS0A 1OAKA 4O4HF 4BLUA 3VH1A 3T5PA 5D1NA 3KQSA 1DO0A 2FPIB 2XUPA 5AVOA 3WYFA 4WBXC 4HYQA 3RFFA 3WNVA 1OOEA 2PM8A 1CNMA 1EG2A 5FI0B 5IBQA 3C3YA 4BCBA 1U2SA 1U8EA 1WDLA 4EY5A 3HO1A 2W6JA 3PITA 2PG3A 3H2ZA 3U4IA 5EJ4A 3HB5X 4OPMA 5T8KA 1YS9A 3CKLA 2A57A 2ENWA 4DC0A 2ETXA 5EFZA 4CI9A 2NWQA 1RPZA 3RT9A 4X92A 1L7QA 3CKMA 3KPYA 5IXJA 2VP2A 4H7PA 5T57A 1SR8A 4N7MA 5A04A 3VSBA 1QBKC 3N2NA 3OCCA 3D4NA 5AKKA 4XFDA 1QIKA 1XYVA 4MW9A 1TKBA 2DR0A 4MR9A 4OJQA 3LHFA 3QZUA 4EL0A 3NBKA 2GTHA 1M34B 3WDMA 2ZSEA 4OY3A 1NM5A 1XF1A 2YXNA 2WSIA 1GAXA 3EWSA 1RYMA 2EG5A 3S1SA 4DREA 4WLOA 5CLQA 2C5GA 1IXKA 1JR3E 1OIVA 3RLIA 4JR0A 4ZT3A 2ZI7A 1NUQA 4OJNA 1JVSA 3FTEA 2VDLB 3RK4A 4CG3A 4V0QA 4LHVA 5JXWA 3WHPA 1QYVA 3IILA 1U8TA 4R7ZA 2KMLA 5DYYA 3FJYA 3KT0A 3QKTA 3TRKA 3OCYA 2OORC 4C7MA 1OV4A 3PYMA 4Y18A 5EJEA 1O6FA 3DZJA 4YQYA 5F9MA 4H7DA 5JY1A 4XM1A 1P3JA 3D6FA 3OWXA 5ALRA 2NYRA 5TT1A 3PWKA 4YIKA 3HI4A 4LHSA 5IJZA 2AFHB 2QVBA 2YW2A 4RK0A 4AY5A 1B6TA 1JG6A 3OBBA 1SG9A 1W73A 2DQ4A 3EH2A 2Z3ZA 3A4MA 4YT8A 4G4GA 5I7RA 2ONJA 1L3BA 2FWPA 4BPRA 4JAVC 4M87A 2RHGB 1ELOA 2XQKA 3RPEA 4GL2A 5I45A 5A0VA 1WLSA 3A0UA 1BJTA 4WJKB 2HHCA 2Y1LA 1QANA 3OTHA 2MSNA 3R3HA 3KPUA 4MVJG 4WI1A 2DE0X 1U9CA 2XUIA 2YVLA 3EODA 2FCAA 3NPMA 2ZYHA 1V1MB 4YMIA 2BGLA 1XXHA 2C88A 2IYQA 3IVAA 4TQAA 4NQRA 1E58A 5T4HA 4BQRA 2O6LA 2UU9B 1BYUA 5KNCD 2HJWA 2Q3HA 1YKSA 3I1YA 5EJFA 4JX8A 4UHEA 1WF3A 5CPBA 2XVMA 2PSFA 2BKVA 2M1XA 4L0MA 1SWVA 3ZJTA 1GFZA 5J1TB 2KHZA 4PQGA 1OB2A 2VR1A 3BZWA 4NMLA 5G1NA 4LBYA 4B6QA 3V2UA 1OLXA 1WZNA 2GJ4A 4YHBA 3U2QA 2HW8A 1TFUA 1Z0SA 2VHVA 5FQNA 2V6JA 2X5JO 3WGHA 1UXGA 4JJ4A 3AEKA 2W2PA 3AR5A 4H7FA 2B35A 4I9FA 4MZDA 4YCSA 3MILA 3PD7A 5EQFA 5JZ9A 1GZ4A 1OGJA 4F2GA 2GNAA 1T2CA 5D01A 3WIOA 2ANCA 3EWAA 3K73O 1GPKA 5M2QA 2CN1A 4IJWA 1EXWA 5D3QA 5FBRB 4XWOA 3OJCA 4F2HA 2ZBFA 3OQMA 3ND9A 2B1IA 1XDUA 1BGXT 1CD5A 1K08A 3CLTC 1ECGA 4D8WA 5FX2A 3Q98A 2E5LB 3JW8A 4GXTA 4DMRA 4G1CA 3K96A 4Q66C 1R16A 1ISFA 1ORHA 2P2LA 5F5NA 1NQ5A 2L42A 2ZUCA 3GVPA 4LYJA 4N49A 4A23A 1VE6A 3A6EA 4BFCA 4DTIA 3F5SA 1M6VA 5BWBA 3K1TA 1K75A 4CM8A 4GOMD 1CSEE 3BXHA 2I78A 4K9PA 5IRCD 1COWD 1Y80A 1RVV1 2ET6A 4GQIA 1A5ZA 1XEWX 1BIFA 3PNQA 4N82A 4ON9A 1KZGB 5JTUA 4HC4A 3D7SA 3F8SA 3NB0A 5KTSA 2EBFX 5JALA 1A8QA 1AKMA 5HCIA 1ZGGA 5LZ8A 5BXYA 4R2MA 4MS1A 4JQCA 4CF6A 3HKCB 4HOYA 3IKMB 1RZUA 3LQYA 4ALLA 3R8CA 2PSJA 3JTMA 5CNKA 4C0WA 1IBSA 2I0FA 2MU1A 3M33A 1H9CA 1RI2A 2ZS7A 4V3CA 3RTBA 3ZV5A 2E21A 1P2DA 3BL5A 5IX8A 1ZRMA 1P61B 1WPXA 2NAPA 5AM2A 1NVEA 2QD5A 1M6VB 3FSGA 4AB1A 3OOJA 3KSZO 1JDNA 1RWKA 1ZY2A 2EZ4A 4LOJA 5G3YA 1SBZA 2PNJA 5GWXA 3PT5A 4RK4A 4ZU1X 2I1LA 1IRIA 3A9SA 3MLAA 2B1GA 1MIOA 1QHFA 2FMXA 2HWUA 2Q49A 3EVGA 4A16A 1P1KA 4JYAB 2UYYA 3TTVA 1OX4A 4NK4A 4D97A 3E2IA 1PI3A 3LUFA 3MOSA 3QFRA 3U31A 4DWVA 2Z5FA 1YVEI 1ID1A 2EJCA 3GFFA 2X7HA 4O59O 2JDIA 3FUTA 2C4TA 5C35A 2AKYA 3M6WA 3VFDA 3FWNA 3GJYA 1NPYA 2QV0A 2HY7A 3EIOA 4L73A 3OEHD 2P2YA 2YHUA 5IJ0B 3K1AB 2CZQA 5HWSA 4JSRA 3RBAA 4C7OB 1ES9A 3A6LA 3W79A 2OD2A 4XD7A 4X63A 2ZUEA 1SCDA 3K4PA 1FS6A 3HDHA 3R24A 3SJBA 4ACAA 4YUAA 4TXHA 5EMMA 4FBMA 4KJXA 1UOPA 1TL7C 3CKYA 4LQ4A 1IEXA 1ZOSA 4XJVA 4GR9A 4PLCA 3HXMA 1SQ5A 3RTGA 3T7KA 2OPHA 3O03A 4NJEB 1B0ZA 4NEHB 3L0OA 4TWBA 3U3MA 3ZWOA 3PXGA 2VOJA 4FGSA 5COBA 4IMPA 2C4UA 1W8IA 4ZI7B 3WWEA 5EHZA 1FFWA 2AVNA 3G9XA 1N4AA 3KYDA 2IIPA 5JC8A 4M1KA 5DWDA 1T2FA 4TS1A 4X93A 1NF3A 3ZDEA 4CKZA 1PWXA 2V96A 3SDZA 2OV3A 1R6XA 3UBMA 4P9NA 4DAOA 3TNYA 3BFXA 1SCJA 5B7NA 3EXHB 4MI3A 1KIMA 3AU9A 3I2KA 1SUDA 1CTQA 3IEUA 1M6HA 4YV7A 1E9BA 5G1PA 3T1TA 1OH6A 1QJ4A 2J3EA 3WNBA 1E60A 2ZUWA 1NJ5A 4QGGA 4U5XA 2GPSA 2AYXA 3IVGA 4GECA 3RVJA 5HE9A 4D56A 1P9RA 4G1FA 4EJ0A 4ONEA 5JRJA 4JLJA 2XD4A 1KR2A 2WTNA 2XQGA 3N28A 2H4WA 3CF4G 3PL1A 3Q7EA 4MJLA 4AKTA 4AY2A 1HBJA 1QFZA 2JA2A 3AFNA 2XGOA 1FF9A 1Q1BA 3DL4A 5BUQA 1AQIA 4KO8A 2C2KA 3G23A 3T0GA 1E2QA 4YRCA 3X1KA 3ZX4A 1L9XA 3EASA 5BSGA 1ZK2A 4CM1A 4YCNA 2GK7A 5AVXA 1NVFA 2QAJA 5EL0A 3W5IA 1QF6A 3IT2A 1JX6A 2QQFA 1P9OA 2XYHA 4BO5A 2NO0A 2VDPB 5LLDA 1HQCA 1QGYA 4WV3A 3VPSA 2CVQA 1MO3A 1HE4A 2XLBA 4ZGWA 1IHYA 3OZVA 3K1YA 4DWOA 3RQIA 2BIFA 2C97A 3GIWA 1R8YA 2XHZA 4NCIA 3UG6A 2IEYA 1E3WB 2WHEA 1PU2A 2B9VA 3DXZA 3HP7A 1SCIA 3PX3A 2HF9A 4BQEA 4DSZA 5KSYA 1XXLA 1U5AA 2YIMA 3T1OA 2P77A 3V1KA 2XKKA 1BJRE 3G6KA 3GG9A 4D9HA 1CUBA 1VLLA 1K68A 4A4DA 2MCFA 4DYDA 5AVWA 1RJWA 4U2DA 1E8DA 4NK5A 2IP1A 6PFKA 4TZTA 2V6BA 3CTPA 3G5MA 1KVQA 1U0RA 2QTWB 3OPXA 4YP1A 3TZKA 2W8BB 1XZLA 4QOGA 2WJVA 1HKUA 1G20B 2OCYC 4KBGA 1CZUA 1N2CE 4A0QA 3JZIA 1UMKA 3K8ZA 1BE6A 3WK6A 3EEQA 1XLTA 4LNUA 1LPPA 1Q7TA 1X7WA 5DN6A 1J2EA 2XH8A 3Q7QA 4Z2YA 5FNZA 2ZTMA 1GDHA 1XR3A 3BE5A 2IYNA 3AX6A 3BGVA 1ULBA 3FMIA 4ENQA 2ZITA 1Y5MA 3RUHA 1UM9A 5AM5A 3Q8LA 2E82A 2FXIA 1OX4B 1VMEA 2BHSA 4HS4A 5G4KB 4EOGA 2F1OA 4Z7JA 3C7CB 1MNAA 4I2VA 3T9CA 2XB9A 1QDEA 1SVLA 4M1MA 1WBDA 4TQGA 3TF5A 5ADVA 4TPKA 1R6VA 3FYUA 2RGAA 4P84A 2HTFA 4PONA 5C7LO 4FMDB 2HF2A 3PT9A 1HK7A 2CK3A 1A82A 1ST3A 4LKOA 2XB2A 3K0AB 4RZ2A 1EWTA 2CVFA 5JEDA 1FY2A 1XPRA 1NQAO 5FWXB 4MLPA 1DAMA 2OP1A 3NEYA 5HVNA 1RP7A 1L3IA 5LKAA 4KKVA 3BJMA 3RFTA 1A8IA 3TQRA 1Y3BE 4ZQBA 1QK4A 1EUDB 3CMCO 4MVYA 4A8PA 4ZMSA 2EARA 3LNTA 2UXBB 3T7IA 4ARIA 2JA1A 3NATA 3EXG2 1GU0A 3TFWA 1E92A 1IVNA 1RLJA 3VKFA 9GPBA 2V8BA 4HEJA 1OQAA 3H5WA 1TU4A 2IOFK 4L08A 3NC4A 1EK1A 1HF3A 2Q62A 2XMDA 4X8OA 4IVNA 3DC2A 2FQ1A 4UM9D 4OGWA 2VT2A 3VOTA 4QT4A 5C5CA 1CBUA 4Q5IA 5B2FA 4LF9B 4YN3A 1QZUA 3TQHA 2A86A 2ZIXA 3E81A 3ELYA 3VKVA 3FWKA 2H1SA 1GG2A 2QN7A 4LUCA 2JCGA 3G2JA 1EA7A 2VDQB 1ENYA 4KFRA 2I6GA 5H81A 4CQLA 1E0AA 2B4AA 3TRIA 3T5MA 2IK8A 1XAIA 3KKMA 1WKVA 3TRHA 1GRNA 1OKKD 2C04A 4MQ4A 2O54A 1EAMA 3E9MA 3FTCA 2IWRA 3TD6A 1J8MF 4OQMA 5IK2D 1R3UA 2ZCUA 3PC8C 1X2EA 3MRSA 3M1LA 4HNUA 3AEQA 4WESA 4BO1A 2FPPB 5DM1A 3VTZA 4AXXA 2C4KA 4KQXA 2VOEA 4PPNA 3ZIDA 2JFXA 3DTVB 1EWRA 2OHHA 2FFQA 4V0SA 1TQ8A 5EP4A 5CDTA 1P4JA 3LWBA 4L2IB 5JCJA 1KP3A 5LKRA 1E2MA 3BERA 3R3XA 4NULA 1VHTA 1LPSA 1L6IA 2HSEA 5AI9A 3G2MA 1C9JA 1A5BB 2H4JA 4BKPA 1O3YA 2K7ZA 1YB7A 3AVTA 3SSAA 1XDZA 1HI9A 1YRBA 5ITZB 2ORIA 3D43A 1X1AA 3KJIA 2PVSA 4UJ3A 4C3OB 1Z26A 1YR9A 2H1IA 3DUWA 3QVLA 1N0WA 4NQZA 4DJDC 2YY5A 1IY2A 2IOFA 3HXLA 5HUQA 2X8AA 5FWXA 2O2SA 4E07A 2P5YA 4TYMA 1JB9A 1M6NA 5CB4A 1QP0A 5FBLB 3JD1A 1JG1A 4NAVA 1Q16A 3I6IA 3R3JA 4DSOA 4S1TA 4DLXA 3PWTA 3FZNA 5IN5A 1KOLA 2MINB 4B47A 3FVVA 5L53A 3ZJVA 4AK9A 4F2DA 3W2FA 2RHJA 5EZSA 5IVIA 3MMPA 2FUKA 3GLRA 1G5PA 3SQNA 4JXKA 2ZR7A 3RRMA 2MMGA 4LHZA 4UCQA 4D9KA 4YBZA 4QASA 1NXXA 2FZ5A 4LOAA 3OQ1A 1JAXA 2X9QA 1Q57A 3DFZA 4IS3A 4B2PA 3PG5A 5IP5A 4IYRA 2GBPA 7YASA 3F3SA 3NTXA 2PANA 1KE2A 4BKOA 3TLMA 1VJ5A 4F9TA 4MGIR 4LF5B 1MR3F 3UV3A 2BFOA 1P1HA 4FIZA 4UHDA 3WLAA 2CDCA 3C6YA 2JVJA 3NWJA 3T94A 4EBFA 3PQCA 2IRWA 2AQHA 3DJFA 1XZIA 2WFLB 4I1UA 4JKIA 3DXXA 1PL8A 1PNQA 2WIDA 4QUJA 1XCJA 2GH1A 3IR5A 1Q91A 1EXVA 2P75A 4AMYA 1CUAA 1HLGA 2C2WA 3E9ZA 1D2MA 3M9XA 3S2EA 3WV5A 1CR0A 1NONA 2RAUA 2AE1A 3HSYA 4IJQA 4Y9SA 1B15A 1MQSA 3IB6A 4RKWA 3NOXA 5C31A 1YDGA 1P6QA 5AKHA 2P1RA 4XM0A 2A0KA 2CV1A 1Z2OX 3M6MD 4QNMA 3DOFA 1RXIA 1STOA 2WF5A 4AXBA 1JFTA 1CUDA 4M1ZA 3NV7A 4CMGA 5JZOA 3NC1C 5H02A 4GZ6A 4L6AA 2HJSA 5CDGA 1V8PA 3I01A 5F52A 2W2OA 5LLSA 3W3AD 3UBTA 3OE7A 1SXHA 2AX3A 4XX0A 2B36A 4OU5A 4S3MA 3X1YA 3TEFA 3KZOA 1K88A 4JBHA 4QDKA 5SV2A 1VYVA 3FZYA 5JRDS 1EFAA 4WCFC 1D9ZA 2BOVA 1QNFA 4QYSA 2BKEA 1RWVA 1YRLA 1JA9A 4MWDA 5IAAA 3AG6A 5E1BA 2C59A 2G5CA 2PGIA 2WY2D 1JFSA 2A6PA 5IPFA 2G1KA 2R4QA 3CPJB 1EK6A 2JFZA 2WW8A 2FFRA 3IV6A 3MGKA 4B74A 4H6VA 1WQ4A 5C0OE 3ZIUA 2X9GA 3DDOA 2J5XA 3LE8A 3LJKA 4Q21A 4WZZA 1DAHA 3UEOA 2Y77A 4MQ5A 4ZVQA 4HVLA 1ZVMA 2YV3A 1KQ3A 4I5FA 5JU6A 2GAIA 4RC9A 1AQUA 2CMKA 2FFBA 1O89A 3OQVA 4K1LA 3UK2A 2WPDA 2AVDA 4KLRA 3D2CA 3M5PA 2XUAA 4L0DA 4UE2A 4E1AA 2GZRA 4G07A 2JRCA 5EUQB 3WFJA 3ND7A 4G89A 1G6KA 3A1UA 5EKSA 7AT1A 3V2HA 1DB3A 1L5RA 1D09A 1XTTA 4AQYB 4RGYA 4EW6A 2PS9A 4J7UA 1GPH1 4D26A 1CRZA 1WV0A 1U0GA 2VP0A 1TZBA 1J8QA 2Z4SA 4KLNA 4QRHA 2XCRB 3ESDA 3R5SA 3JVUA 1M2EA 3STWA 5FI1B 4US0R 3L4SO 2QI9F 1GFIA 3P20A 3LHSA 3LCUA 2EW1A 4JLVA 2QAGB 4HG2A 2X0NA 4R4JA 1JI0A 4Y67A 3R3UA 4BGIA 5A6SA 1ODTC 1FSFA 2DHRA 5A4FS 1H2XA 4MUAA 1Q5PA 1UFVA 4AJ1A 3I61A 3TRDA 1FXWA 4E5SA 1W36B 4WRRA 1AH2A 1ZFNA 3D3WA 2C7GA 2NU8B 3FOAA 4DAEA 1ACLA 1T2EA 2VT3A 3PIDA 5JC1A 3LY7A 4DEYA 4EJSC 1E7SA 5E4TA 3HNOA 1OF1A 4R2IA 5EZYF 3WOVA 1QFJA 1V6CA 2BZSA 3AVXA 4NBRA 1JHVA 2FOXA 2VNJA 3BK7A 3CLUC 3N8IA 3RE1A 3I4FA 3ZNNA 1EFCA 1Q6ZA 2I87A 4LXXA 3BHNA 2QXUA 2ONKA 5AK5A 3S8YA 3OX1A 2GD1O 2X14A