3N70A

The crystal structure of the p-loop ntpase domain of the sigma-54 transport activator from e. coli to 2.8a
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
142
structure length
142
Chain Sequence
IGRSEWINQYRRRLQQLSETDIAVWLYGAPGTGRMTGARYLHQFGRNAQGEFVYRELTPDNAPQLNDFIALAQGGTLVLSHPEHLTREQQYHLVQLQSQEHRPFRLIGIGDTSLVELAASNHIIAELYYCFAMTQIACLPLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Crystal Structure of the P-loop NTPase domain of the Sigma-54 transport activator from E. coli to 2.8A
rcsb
source organism Escherichia coli
molecule tags Transport protein
molecule keywords Transport activator
total genus 39
structure length 142
sequence length 142
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2010-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14532 Sigma54_activ_2 Sigma-54 interaction domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3n70A00
4DB2A 1VG1A 3U44A 1JALA 1M8PA 4FI3C 1NBME 4JJZA 4EFMA 2OFXA 2CJWA 3AF0A 3QF4A 3T1VA 4X8OA 3SQXA 4B3BA 4PC3A 1X8JA 3IO3A 4M1TA 5FTLA 1TEVA 4F38A 1II8A 2WVJA 1ZVQA 3BE4A 3NTUA 4XSHA 3LW7A 4YXWD 1DAFA 1NL3A 4BWYA 4JSTA 1NY6A 5CK4A 5CLLA 2CCJA 3KKNA 1RZ3A 1XEXA 1D8TA 2XZPA 1G291 1VYUA 4B73A 1KZ7B 4DCNA 3GJ7A 2RKOA 2DWPA 5FOWA 2XJ9A 2C96A 1W0KA 2QMOA 4Q9IA 4AK9A 3ZS9A 1OFIA 5C1BA 2VSOA 4DSOA 2IUSA 3THWA 2PMDA 1OXTA 2IF0A 2F43B 3N2IA 4TMTA 3O47A 3T5DA 1I2MA 2HF8A 4HB0A 1XJQA 1TTTA 1YJ5A 1FX0A 4MKGA 1KHTA 2BMFA 5E3HA 2FV8A 4Q1AA 1W49A 2AD1A 3W5IA 2B21A 1X8KA 1IXZA 2QSZA 5EP4A 3L43A 5SZHB 1JB1A 4BLSA 1NN0A 2ZRJA 3VNUA 1NG1A 1OJLA 1VHLA 4IDQA 3FB4A 2O8BB 1E4VA 3U7EB 3BRWD 5KDDA 1KDTA 3PUYA 2J7PA 3ICEA 4KAXA 2ZS8A 4B32A 1VKJA 1KAOA 3QKSB 1G3UA 1PLLA 3LH5A 4EDHA 4Q7LA 2ZJ2A 2YOFA 5GVSA 2WKRA 3CWQA 4TLDA 3MWKA 4A82A 4D81A 4BRUA 2YC4C 3ZVMA 3KFXA 3KUCA 2JGNA 1UEIA 2GBLA 4UNPA 3EPLA 4QGGA 5IT5A 4IDPA 1QZXA 1JBKA 2RGGA 5DIFA 4IOKA 4NU0A 4Q4HA 2G0TA 2QM8A 3GLFB 1OYWA 2HYDA 1ZM7A 4K8OA 1D2EA 4LHZA 4WZBE 1RRPA 1BIFA 3OFND 5FUVA 1MO5A 1G6OA 2IS6A 1EGAA 4QRHA 3U3OA 5IHPA 3R9XA 3CW2A 2HYIC 1AIPA 5KPDA 3ZLJA 2EFCB 3AF3A 4OQNA 1W2HA 4TSFD 4MYHA 1M1YE 1OYYA 3BB4A 2P6NA 1OH6A 1GNQA 3PXGA 5BYKA 1ZMXA 2NO7A 5FL7A 2J7KA 5H68A 3L8ZA 3MG9A 1TUIA 3NVAA 4OJKA 3ICQB 4UXHA 5EUMA 2V1UA 3K09C 2VO1A 4HDCA 1TL7C 1W2GA 2WWIA 2CJWB 2O0JA 2QAGB 1DS6A 5DYIA 4OI1A 4QG7A 1WQ1R 3GEIA 3GFTA 1HT1E 2XX3A 1TQ4A 3A4NA 3B1YA 4PO9A 3VR1A 2ZI7A 3ND9A 4XTRA 1H8HA 1E2KA 3SJAA 3NHAA 2ORIA 2QENA 2P2LA 4C3ZA 4KSCA 1G8PA 1UAAA 2IYSA 4W5JA 1E9EA 3I4LA 1SHKA 2GJ8A 4LI0A 4O2RA 4PQYA 3TW8B 1IY0A 5GVRA 2HJGA 4C0JA 1IN7A 1KO8A 1KI6B 4G1UC 2QGNA 3THXA 3THYB 4PAMA 1JEDA 4AURA 5LDDC 1HURA 2KBEA 3BOSA 4ZO4A 3LA6A 3AUYA 4CGZA 1HE8B 1SXJB 2RGBA 3U2QA 2R2AA 3Q7PA 1U0HC 3UG6A 3LV8A 5EP2A 5HZHA 5CB8A 5JWRA 2D74A 1S3GA 4KCGA 4RSGA 3BS4A 4A4DA 4AYXA 2QPAA 5KHOC 3P32A 2VH5R 3T34A 1LVGA 3QKUA 5L8VA 3JZAA 2OCYC 3K0FA 4PPFA 3A4LA 2NG1A 4ZKDA 3QI2A 3GJ8A 1F5NA 3EC1A 3WBKA 2GAOA 4LC1A 4U02A 1RYFA 5E7MA 1NVWQ 3SC3A 2JLQA 1GFIA 4A2QA 1RYHA 3OEEA 4Q47A 1WBBA 3P4YA 3UMSA 4DLRA 1T8TA 3BORA 4JKIA 3I73A 1GM5A 5IF9A 3R7WA 4A6XA 3QEOA 4B33A 4QJ4A 4RCYA 4Q1CA 4AYTA 2WWWA 3F5FA 4N3NA 1OKKA 2GEVA 1KI1A 3KJHA 3IQXA 3ASYA 1IN8A 2PZGA 3KXIA 1Q12A 2PEYA 5EQTA 2JDID 2IHYA 1YQTA 3Q7QA 3C8UA 1PV4A 1XEWY 1LV7A 2BEKA 2ORVA 2W00A 1N6RA 2V6IA 3FWYA 2X77A 3BB1A 3HYRA 2DCUA 2ZRKA 1G5PA 1G7RA 4MRVA 2PLFA 2ZJ5A 4NONA 5JCZA 3KDSE 4R7ZA 2XNDD 4YXWA 2NPIA 1AGRA 1G7SA 1DARA 3RS3A 4NCIA 5FFMA 3GLHA 4M1SA 5J4LA 2BCJQ 1KI7A 2OHFA 3TUIC 4B3GA 1KO1A 1DTSA 1ZUHA 2GCOA 1S96A 5AJZA 2KE5A 2J59A 4PHFA 4BQSA 2ZE6A 4LYAA 1FPMA 2QROA 5E95A 3PEYA 3VTKA 2BOVA 3GJXC 4FIDA 4I99A 1J8MF 4WIAA 1UKZA 1W0JD 4CF7A 2BJWA 2PBRA 2Q3MA 1DAMA 3BGWA 1JR3D 1XFAA 2QNRA 4G5GA 4R71A 2ODBA 3R9WA 1KSFX 5GJCA 1VPLA 3T35A 2GXSA 4Z1MA 3GJ6A 3H2YA 2WMOB 4D2IA 2K5UA 2WICA 2QAJA 4IDHA 4BLTA 5EE1A 2QP3A 1DADA 1BOFA 4TWZA 3B1VA 1J90A 1E0KA 3QKRA 3WY9A 5HE9A 1P9NA 3RRYA 3BK7A 5DI3A 4ZDKA 1R10A 4G5RA 2O8EA 5AUQA 5FUYA 3IIJA 3SJZA 5J5CA 2IYRA 1W46A 3SYNA 2BMEA 4TQUS 2O8CA 1R5BA 4GSYA 3UG7A 3OHMA 3OFNA 2DFLA 4JYBA 2PX3A 2P6UA 3P1JA 4B3FX 4QXAA 1KO5A 1E2PA 3QVVA 4Q9JA 1KKLA 3LFUA 4JLVA 4HLUC 4JZKA 1CJKC 4Q7JB 4YMWA 5JSZB 1Z5ZA 1HYQA 2A5YB 4XVRA 4B3CA 2J41A 3WYAA 3GJ0A 3HR7A 3DM9B 4KITB 4LCBA 2QUZA 1KAGA 2ANBA 5JRZA 5LPNA 4Y0VA 1IJFA 2VP9A 3W6NA 2ZYVX 1XU4A 3L82B 2AR7A 2BHRA 4GT1A 3RNLA 2IC5A 2D2FA 1OXVA 5AJVB 2HXYA 3CONA 2GZHA 4CIDA 3V4RA 1MO6A 3LBHA 3AVTA 3MWJA 5J4VA 1H8HD 2F6RA 2FZLA 3QVUA 5FPYA 4DVGA 3AP3A 2AXPA 1N25A 5KO2A 2ERXA 1DVRA 2GCOB 2CNWD 1G1MA 1G4AE 2DY1A 4GFDA 2WJGA 2FMXA 3O8RA 1NN1A 1VHTA 2XB4A 2VTKA 2XITA 4JJKA 1YR7A 1UBEA 2ZQ5A 3KZ1E 3WNBA 3H1TA 3PUWA 3RYTC 2AKYA 1XWIA 2YYZA 5KOYA 1SVKA 2IYZA 1P61B 3IDQA 3VR6A 1R2QA 4FW9A 4TLBA 4KYIB 1YRAA 3CH5A 3RABA 4YQFA 1XZPA 2Y8EA 3SHWA 4BPBA 1FNMA 2G3YA 3QF7A 1AS0A 2G9NA 4NZYA 2WMNB 2ANCA 2BDTA 1RJ9B 4TLAA 5CJ2A 1GOTA 2ZPTX 1L4YA 4ZCIA 2YWFA 1BO6A 4TYYA 4POAA 5FPKA 4JLMA 1HH4A 5CIQA 3CR7A 2WJHA 1N3BA 2B6HA 4R9UC 1KK1A 1ZINA 1O87A 2VHJA 2YKGA 4G5OA 2MSEB 1PUJA 2MSDB 4M9XA 2JJ1A 2ONKA 2G77B 3WXMA 1YR6A 3W5JA 2P6RA 3EPJA 2OBNA 3KB1A 1NKTA 2R44A 1EFCA 5FR2A 4ZCMA 2NTYC 4G0NA 2G0NA 3I92A 2H18A 1UPTA 2FWRA 2Q9CA 3MJHA 5FOUA 2FDCA 3F0TA 1I4TD 2XZLA 3QE0A 4CYMA 1NJGA 2YZ2A 4CDGA 1G9XA 4I1SA 3WMGA 1Z6AA 1HA3A 3LNCA 3OZXA 3ZH9B 3FDIA 2ZS7A 2ZIAA 2P5TB 4LHVA 1G21E 3U3KA 4A8JC 1E2JA 2GJAA 3DOEA 4LOAA 1QG2A 3RS2A 4DDUA 3A58B 3DMDA 1Z6GA 4IFBA 3ZVRA 2FSFA 1QHSA 2I1VB 1ZNZA 4B48A 4CEIA 1LFDB 3AP1A 4ZIRA 3PEVA 4RKEA 5EJEA 1Q44A 4LDJA 2ZJ8A 4AD8A 2ZI3A 2W6JA 2WZQA 4PTLA 4P31A 5GJWC 4ESHA 1X6VA 2OAQ1 1ETUA 2HJVA 3LRPA 1FQJA 1T5IA 3R8CA 4B35A 1XX6A 3N5CA 5EXTA 3B8HA 3S1AB 4R2HA 5FL3A 1DAEA 4GNKA 4URUR 2LCFA 1W36D 1LW7A 1SKYE 1FP7A 1F6BA 4YMVA 3ETLA 1YZLA 4QHTA 1JR3A 2DYKA 1Z0JA 3NH6A 4A6PA 2KB0A 4V03A 4M1OA 1UEJA 4HAWA 3NBFA 1AJEA 2CEAA 3B1ZA 1Q57A 1G5RA 2D4HA 2ZAMA 1T3SA 3OAAA 5JFGA 3NH9A 4Z51A 1Z08A 2QAGC 2ZYUX 2Q9BA 4RVCA 2H17A 5JLJA 5JMTA 5DYGA 1AM4D 1G8HA 2IEYA 3RAPR 4CEHB 2GF9A 2QG6A 3K1JA 4QKQA 4JLOA 1NBMD 2GXUA 4D0GA 4YMUA 5G3ZA 3KB2A 4GP6A 4HUTA 3CNLA 1NN5A 4A2WA 3Q5EA 3FOZA 1NJFA 1P4SA 5TDHA 4OK6A 3E2IA 1TMKA 1Q1EA 2F9MA 1XPRA 2E87A 2C03A 3O8BA 1A1VA 3GJ3A 1ZJ6A 1MV5A 3VKHA 1W5SA 3D3QA 1G3QA 1E2NA 4J0QA 1IXRC 2I4IA 1GG2A 1CRPA 3RSOA 4LV8B 1E98A 2ZRAA 2CK3A 3PUVA 4KFTA 4P33A 1QF9A 4JVMA 5B64A 2I1QA 4N0EA 1GWNA 2GWHA 2AX4A 4BFZA 4BZPA 4JYCA 1KK3A 3MUFA 5CIWA 3WP0A 3EWSA 2ZSAA 4OQLA 1I4LD 2IYYA 4MA4A 3GLGB 3I61A 4FWTA 2REOA 3JZMA 1D2MA 2ZAOA 2OCBA 5DHAA 3TJZA 1NN3A 3EWAA 3ZIAA 2QPOA 4XJXA 1CBUA 2CNWA 2OFWA 2XNSA 3VKGA 1R8QA 2ZYTX 3IHLA 2OXCA 4JS0A 5FPSA 1Z47A 2C2HA 2J0VA 1QBKC 2IYUA 3OIYA 3MJRA 3R20A 3K70B 2J0SA 2YOHA 4GOKA 2YVUA 3T1TA 2WWYA 2V3CC 3OF5A 5LB4A 2GVDC 1RRCA 2LKDA 2JA1A 1IBRA 4YDHB 3EZ2A 3L0SA 1B0UA 4EFNA 4IVRA 3CPJB 1LB1B 3OE7A 4KV9A 4TMVA 4DZZA 3TSZA 1FFHA 3PJRA 5KNBA 3AVXA 4OQFA 3SU8A 1J2JA 1FL9A 2ORWA 2W58A 3QXXA 5FTKA 3WYFA 3U3MA 2O8DB 1TQ2A 2JCSA 1US8A 2PJZA 1UBCA 4Q4LA 4UXJA 2ZRFA 3GLGE 1U8ZA 3OEHA 4C30A 2OXRA 4C0AC 4YLGA 3ZZUA 5D3QA 3EIHA 5JS8A 1KZGB 1UDXA 2FN4A 4P32A 2EU8A 4AKEA 1D9XA 2C9OA 3IPXA 3FYHA 2G6BA 3SYLA 3V00A 3W9YA 4D0LB 5TY0A 2B92A 4I1OA 5K8UA 1XB2A 4KBGA 2OLJA 4DSTA 4QHYA 2W2XA 3EAQA 4Q7KA 4YC7A 4CVNA 4D0NA 2FG5A 2PZFA 3H84A 2NO9A 1AS3A 1IY2A 4GZLA 4XWAA 1IHUA 3K0FB 4JT2A 1GNRA 2C8VA 4ASUD 4BLRA 5HKKA 5E7JA 2FSHA 4YDSA 4HSEA 1E2EA 4NCJA 2Z6VA 3FGNA 4PANA 1JQJC 3BAFA 3TK1A 2BCGY 3K8YA 3IHWA 3W8RA 3EC2A 2WIAA 2XAUA 1P9RA 2PT7A 5C2JB 2IT1A 3TQFA 4B6FA 5J47A 1SZPA 1S9HA 4BE7B 2WTUA 3PUZA 4NYJR 3ZQJA 4M9QA 2PCLA 2ZR9A 2RGCA 3Q8XB 4RFSA 3QPVA 4US1R 4HB2A 3RRMA 3RC8A 1JI0A 3B13B 4JL6A 2IYTA 1YZKA 3M1IA 2HT1A 4Q01A 1QHHA 4ZPXA 3G5UA 1T9HA 1GTVA 3CM0A 4NYIR 3F8TA 4IFEA 4KI0A 2MMCA 1X8LA 1G6HA 2RMKA 4ABYA 2H57A 1OH7A 3OIVA 4DIEA 2J0QA 3QBVA 5BN3A 3PFIA 4LPKA 4HLCA 2FX3A 4PHTA 2JJ1D 1CJVC 1G7CA 1TU3A 4A0GA 1W47A 3CX7A 4TL8A 1KJZA 1E6CA 5K8LA 4LV5B 3AVYA 1W4RA 5FBVB 3HP1A 1VYVA 1YR9A 3C5CA 2BBOA 4LX0A 2QP4A 1G64A 3PIRA 4FWIB 4M53A 3WMFA 1WB9A 2ZVPX 4JLJA 2OESA 3VAAA 4I4LA 2ZSEA 1YE8A 4PSAA 2AHOA 5EE3A 4KLNA 3OAAD 1KJWA 5BYJA 3RC3A 2O8CB 1E2GA 4JL8A 4OK3A 4W7SA 1WE2A 4EPTA 2ZE8A 4DLTA 4XH9B 2FNAA 1Z0IA 3V9PA 1AZSC 3P4XA 2D3WA 4FMCB 4A0FA 1WCV1 2E9SA 4M1KA 2F1RA 2CXXA 5DI3B 2WSSA 1TF5A 4IOJA 2WOJA 3TE6A 1R0ZA 3A1VA 1N6PA 3QKRB 5CM9C 5JJIA 2PL3A 4M9ZA 2OBLA 4B3XA 3BH0A 4LJYA 4NKRA 3BERA 2B8WA 2QMHA 2ZXUA 5FI1B 3LVQE 3PITA 1ZBDA 4OHZA 2YHSA 4OHWA 3CRW1 5CM8B 3I72A 2QTFA 2Q3HA 1SVMA 4HAUA 3T5GA 2ODWA 2H8KA 4L16A 2VSXA 4ZDJA 2GXAA 5IK2A 3B60A 1BMFA 2AK3A 2WKQA 4G01B 1FX0B 4NHOA 1EFTA 4HZUA 3LVRE 1IM2A 2F43A 4P3YA 3RS7A 5CB6A 1ZRHA 3THWB 5D3MA 4DCSA 1FMJA 1MOZA 3B85A 4QBIA 5DI9A 2JAQA 5L3QB 2WJJA 4QHSA 1GZSA 3RS5A 1NBMA 2C95A 4ERNA 4AKIA 2F7SA 4F92B 3K9LA 3U60B 2X2FA 4QFMA 4QBGB 2XSZD 2RGEA 3TW4A 2X2EA 1PLJA 4PR0A 4R98A 4LGMA 1Q3TA 5H70A 4BUJA 3GPLA 1OXXK 3GFPA 4QC2A 2X1VA 3U61B 1CR1A 1WF3A 1YVDA 4D80A 3M0EA 2G1JA 2BVNA 1W5TA 1RC8A 3TAHA 4DCUA 1N6IA 4TL6A 4OHXA 3CPEA 2HT6A 1OLOA 4UJ3A 3CO5A 4JBYA 3SBDA 4QM7A 1CR2A 4JBWA 2OBMA 1LF5A 5FUXA 3L2OB 3W90A 2AFHE 3Q3JB 2WV9A 2OCPA 3ZDQA 4D26A 4EPYA 5J4HA 4EQ6B 1F2TB 3GD7A 4Q19A 1W44A 1GVNB 1IN6A 2QT1A 2QE7A 1RJ9A 2C77A 4R2IA 1T3HA 3KKOA 1E0AA 1RFLA 2A78A 3A1SA 2ZSDA 5EZ6B 3LX5A 3QIAA 1D6JA 1LF0A 1VCOA 4Q4JB 2Q21A 4MYTA 5K8TA 3ZYCA 2WWFA 4C4PA 3FMFA 2H7VA 3TIFA 3X1DA 4ZI2A 1E9FA 3O8CA 4LBVA 1R5OA 2ZRLA 2ZI5A 1NF3A 1SXJA 4QJ3A 2FEOA 3QNUA 2HCJB 4L15A 3ZZ0A 2C04A 5CK5A 4TYPA 1CTQA 3GLIB 3UANA 2SHKA 2VIIA 1KI6A 3CX6A 2DBYA 1F3OA 1KDOA 3W6PA 2ZJYA 3WNCA 1XMIA 1XTJA 3EX7C 5ELXA 1COWD 1KMQA 1FP6A 3QG1A 4W5WA 2A9KA 3RDPA 1XNJA 1G3MA 1I2DA 3CRMA 5KDOA 3M4YA 2ERYA 4JLPA 1OXUA 3BBPA 1BS1A 1RE0A 1N6HA 1Z6XA 3DKVA 4QOSA 4TTPA 2WWGA 5KDLA 3Q85A 4DLUA 1SKQA 4NMMA 2QAGA 2GCPA 4F4IA 2W6ID 3KX2A 5CDFE 5J4YA 5G53C 3BFKA 1MH1A 4Q1BA 5HR5A 1J70A 4B2LA 4V0KA 3BWDD 4KYUA 4RD6A 4II7A 3OEED 4NCKA 3THOA 1JPNA 5EXXA 2JIZD 3K0AB 1G8FA 5SZIA 2DFTA 2CE7A 4D4JA 2NO1A 4A1FA 2QMEA 4PAQA 4B2IA 3LO5A 1TADA 1OKKD 2BC9A 4LHXA 3NWJA 4Z8XA 2QQEA 1FOEB 3UKDA 3DOFA 3L0PA 5D3MB 2IBMA 4XIGS 1P5ZB 2EFHB 1XTQA 1Z29A 2GETA 2V7QD 4M1MA 1E79A 1VG0B 3UWOA 3P27A 4TQAA 2FA9A 1IN4A 3SEAA 1P6XA 2F55A 2XXAB 1VG9B 4BLPA 1D5CA 3QKSA 4TZ6A 4IOLA 2IXGA 3C14C 1QHGA 4XWOA 1FUKA 1ZNXA 3AKEA 2O8BA 4DDVA 5FOXA 4RZXA 4LJ9A 4L9SA 2XXAA 4M9SA 3VX3A 4ZCLA 5BQ5A 3VR3A 1VCMA 2N46A 3REFA 3A6PC 1KIMA 1NI3A 4URYR 2W0MA 1N6KA 1ZM4A 3T12A 5F9HA 2D7CA 1XCGB 4N1AA 5JWHA 3VR5A 1OB5A 2WIBA 4LY6A 2HCBA 4DIDA 1FQKA 3DHWC 1G4UR 4FMCF 2RH5A 3B6EA 1NMZA 2F1HA 3WRXC 4EJSA 2ZRPA 4GMDA 3ONWA 4HYYA 4L5BA 3RVBA 2I3BA 2A5DA 2VP0A 4JVSB 3VQTA 3FFAA 2CL7X 4OI2A 4I1UA 4E22A 4PC6A 5JZVA 2ZU6A 1GP2A 2DFKB 3AKCA 4B75A 1KY3A 1GIAA 4GMXA 2YNMA 3GEEA 4A2PA 4KU4A 4PHHA 3IQWA 3IBYA 3X2SA 2KSQA 3K9HA 3PEUA 1VG8A 1EFUA 4BGDA 3ZS8A 1BH2A 2QTHA 4IDOA 3IILA 4DHEA 1WA5A 2ZETA 3LQRA 4LYHA 4TN1A 1EWRA 4C0QC 1NRJB 2DPXA 2EQBA 2ZANA 121PA 1CR0A 4DLSA 4OJQA 2G1KA 4RZ2A 2VBCA 3W3AA 3HR8A 1UDWA 1QHHB 3Q9LA 1EFRA 5DO9A 1E96A 4Q1EA 2CHVA 1W36C 4KFSA 3LBNA 3TMKA 2X8AA 1Z28A 4NPHA 2YC2C 2IW3A 3NHBA 4M0LA 2ZITA 3KKPA 3CUEF 4A9AA 1BMFD 1YZGA 1OFTA 1P9WA 2VP5A 1MKYA 1KMHA 4FMDF 3A8TA 4BECA 3EPHA 2C5LA 5GADl 4BFSA 2C9YA 3P26A 4PPGA 3SJBA 3HU2A 1JNYA 4BFVA 2GESA 2J0UB 2OZEA 2AKAB 1ZD8A 4MGIR 4JVLA 4V0MA 2CLCX 2REXB 3A1TA 3VMFA 2EWWA 1KO4A 4LZZA 5A0FA 3RSLA 2IEZA 2EFEB 1KMHB 1ODFA 1Z07A 4EKDA 4RD4A 3RWOA 2R9VA 4RD3A 3TKLA 2ZU0C 4KVAA 3RWMB 2CMKA 1NIJA 4M4SA 2DHRA 3AF4A 3KTAB 3RLFA 3IKJA 4MH0R 4TLCA 5H8WA 3MLEA 1UKVY 1OPXA 1P3JA 3HU1A 1TQDA 3QOFA 4OHVA 3QEJA 5GJVC 3D6TB 2QRZA 4O3MA 2XTNA 1BYIA 3M6AA 2O0HA 3A36A 3Q5DA 4L8GA 4Q66C 821PA 3QBTA 1COWA 3VX4A 5L3SA 4Q03A 1QG4A 1X86B 5FL7D 3LQQA 1N6NA 2TMKA 3MWYW 2O8DA 1E9RA 3LLMA 5BN4A 1TU4A 1TX4B 1G8YA 2GZDA 2RCNA 3K0CA 2RB4A 2ZRBA 4PSVA 2V4ZA 4TMXA 2ZE7A 4M2LA 3D31A 2W6IA 2FSGA 4DLYA 3ZZTA 2ZEJA 2CL0X 3QXSA 1XD8A 4UNNA 1X1RA 3NC1C 4BLQA 1B23P 3A4MA 1Z22A 4BZXA 3CKLA 1S9DA 5EXPA 3OIWA 2JIZA 3I5YA 2F1IA 4YMTA 1JJ7A 3EPKA 521PA 4WZAE 1KDRA 4FXPA 1TNDA 4Q02A 4JVNA 3I5XA 2NGRA 4Q4HB 2XJ4A 3EW9A 3B82A 3SHFA 4ACBA 5JEDA 4MQBA 3KQKA 3VR2A 1E9DA 1Z0KA 1S1CA 2GAAA 3A37A 1P2UA 2OM2A 3NXSA 3QSYA 1NSFA 1CRQA 4NTZA 3U4QA 2FPLA 4N0DA 4B43A 3H86A 5AUPB 2QSYA 3MWLA 5KSOA 2ZUBA 1KSGA 4AG6A 1AKEA 1ZU4A 4FMBB 3TSWA 4B47A 2Z43A 1NMYA 1EESA 1QDEA 2VHUA 3B7GA 3TR5A 4UNSA 3U5ZB 1WXQA 2CBZA 3DZ8A 1P75A 3U3JA 5BXQC 4ITRC 3QXCA 1LS6A 2V1XA 2Z5FA 1XCMA 2W6JD 2W0SA 4BFTA 5JWOA 5SZJA 3IEVA 3CF6R 2JLVA 1XTKA 5TV2A 4QNMA 4Q1DA 2GKSA 2FSIA 1K5DA 4QGHA 1NG9A 3L0OA 4LSGA 2GNOA 2J3EA 3NBZC 1XPOA 1II9A 4L4UA 1U90A 5AUOB 2QMUA 1N5IA 2CLDX 2IWHA 4BEJA 1ZC3A 1E1RD 2CDNA 1HUQA 5FR1A 4DJTA 1JECA 1XMSA 1MRSA 1E0JA 1N0VC 2VEDA 2JDIA 2XEXA 1KI8A 3EXAA 2W2VA 3NG1A 4WBSA 4MGZR 621PA 1XRJA 1FTSA 4C0HA 4E07A 3GCGA 2ZVQX 4JLDA 4LPSA 2HV8A 1T0JB 3E70C 1A4RA 1N6LA 5JEEA 3EA0A 1OE0A 2P5SA 3CF0A 4MYUA 3QXJA 1YR8A 3FE2A 1P7CA 3SQWA 4L9WA 5CJPA 5EZ5A 1Y3AA 4IXMA 1E79D 3CLVA 5LD2B 2KI5A 4XTCS 3UMFA 5E7IA 4B76A 4ZDIA 2BM0A 5DHFA 1G3RA 3IEUA 2JJ8A 1NVXQ 2AK2A 4MDEA 2JLRA 4M21A 4RD0A 3N2EA 5L3SB 2GXQA 1OIWA 3BIFA 1XTRA 3W6OA 1ZIOA 1ZYUA 4E5UA 1W48A 3AH8A 1LS1A 4ZI3A 2QPTA 2ZJOA 4U00A 4MRNA 3RRNA 2BIFA 4GOJA 4Z8YA 1J8YF 3K0EA 2Q6TA 2HXSA 4TL9A 4OBEA 3ZGXA 3CH4B 4XWKA 3A1WA 2YWEA 2FPKA 4XVUA 2CK3D 5AJYA 4P4SB 3JVVA 4G3XA 1VIAA 3K0CC 3SBEA 1ELOA 3T1QA 3PQCA 1U9IC 1LTQA 2DB3A 2QL6A 4A0RA 3PG5A 1Z6YA 4P4UA 3GLFE 2B8TA 4Q9KA 3LX8A 2ZRIA 4A8JA 2GHIA 1KOFA 5CDFA 2VP4A 3GFOA 4G5SA 3BH7A 4BRWA 4JT4A 1CKEA 2IHBA 1GDDA 1XMVA 1CULC 2PX0A 2GK6A 4ON9A 1KDPA 2O0KA 1G3IA 3VKWA 1T5LA 4AI6A 5KNCA 4XD7A 3CWZA 3ZIAD 4DCVA 4PPQA 4MDFA 2JJ2A 1DPFA 5TXGA 2VQSA 1CS4C 1EWQA 3ZVLA 1XJCA 1IJEA 1GL7A 2YJTD 3NC0C 1NLFA 2MMGA 3PV0A 2UZ3A 4Q48A 2XGJA 3GQBA 3IGFA 2IWRA 3DEFA 3TSOA 3REGA 2H1LA 4C7OA 3ZD6A 3CZPA 1ONBA 3AUXA 3QQ5A 4EPXA 3T61A 4JLBA 3K9NA 2XTZA 5J40A 4Q9HA 4PAOA 1S8FA 4QM6A 421PA 1Z83A 3NIBA 4IOMA 1S0UA 5FTMA 4ARZA 4C0BA 3KXKA 1WP9A 3MSXA 2DFNA 1E69A 3FKSA 4D82A 4B34A 4PC2A 1P62B 3WMEA 1KNXA 721PA 3OEHD 1RVDA 4URZR 5L3QA 4HB3A 2VSFA 1S1MA 2XZOA 2CHGA 4TT3D 2G88A 3I32A 1QHXA 5AJWA 1GNPA 2JATA 4HUQA 4HZIA 3R8FA 4HZUB 4GBMA 3EASA 3WNDA 3GLGA 4MYCA 5G3YA 4C2TA 4ASUA 1Y63A 5HKKD 3H0KA 3SFVA 4GP7A 1U8AA 4KFRA 2JLYA 1CF4A 1GL6A 2KBFA 1OXSC 2AN9A 4GI7A 4AWXA 1HQYE 1EG7A 2ZI6A 4PO8A 4W5HA 3MRSA 4OYHA 1Z0AA 3I8XA 3AGPA 2QBYA 1JPJA 2QU8A 1AZTA 4F4CA 1U98A 3SR0A 2BEJA 1J7KA 2NIPA 2RGNA 4MGYR 2IUUA 4IDNA 4BEBA 2V54A 5FOTA 1M6NA 1W4AA 1RW4A 4GDFA 2XOKA 5IRCD 2J9RA 1K8RA 1ZC4A 2RGXA 3BH6A 1SVOA 3UWKA 3ZJYA 2RAPA 1SVWA 3C5HA 1DAKA 1SQ5A 2A5JA 2G83A 2QEQA 1WBDA 2OSBA 4QL3A 5B57C 1QVAA 4BFUA 5FH9A 2PLRA 2WPDA 4NCHA 3IBGA 2HLDA 1E9AA 1A2KC 2IYLD 3PUXA 4DDTA 5C18A 1UJ2A 4TZ0A 3C4JA 1NKSA 1JEEA 2IA5A 5FI0B 4EFLA 5CITA 2NOAA 3ADCA 3CR8A 3BJIC 2GTPA 5JI2E 2UKDA 3FHOA 1DOAA 1GRQA 4LUCA 2AFIE 4URWR 1UADA 4X8HA 1MT0A 2V8OA 1JAHA 3I1FA 3VHLB 1PZNA 4EUNA 1PVOA 1Z0FA 1CR4A 2E1RA 4PSKA 1A7JA 2DWQA 4MGKR 4CEJA 5DN6A 3K0SA 1FNNA 5EXSA 1N5KA 4B71A 2P0EA 3DM5A 3PENA 1DEKA 5DSZA 5EE9A 5C46F 2RGDA 3KKMA 2RGAA 1YZTA 4NP6A 4NL4H 4KXFB 2GILA 4KFUA 1BYUA 4Q21A 3GJ5A 1F2UA 1MO4A 2ZUDA 1N0WA 4FD2A 2XNDA 3TR0A 4H9GA 4IEEA 3KQNA 5KSPA 3TUZC 4RFSB 2JLZA 1Q1QA 4K81B 4JBXA 3KUDA 2NZ8A 1EX7A 2FFQA 5EE0A 1RRGA 2Z4RA 3GLIA 2FEMA 2WHXA 2H92A 4JIMA 4OKSA 3GLHB 3BB3A 2ZSFA 2FU5C 1U0JA 4LJ8A 5P21A 2RHDA 3FFBA 4DKXA 4Z54A 5L3VA 2FZ4A 2WJIA 4KVGA 3DL0A 4KO8A 5C4MA 2IXFA 2GJKA 1FMLA 2FFAA 3NBYC 4MUAA 4US2R 5EP3A 5FPTA 2XB2A 4NYMQ 1A82A 3B2EA 1YRBA 1P2VA 2JLSA 1KSHA 4H1VA 1XD2A 2OG2A 2IS4A 4LHWA 4MUBA 2QA5A 1OFUX 1Q3HA 2ZREA 4ARZB 3RHFA 2A5GA 4Q1FA 3T1OA 1ZM2A 4NBSA 1F2TA 1CXZA 1OHHA 2GVZC 3AEZA 3OIUA 5FPHA 2NPFA 4O0MA 1T8UA 1UBGA 4V02A 3RANA 3U6KA 3GLIE 3RS0A 4EIWA 2CVHA 5B30A 2VA8A 1JJVA 2JJ2D 2KWIA 2VF8A 2ZYWX 3MD0A 4QBHA 2GEUA 3V4FA 2CVFA 1NMXA 2C99A 4HAXA 4WA7A 1I4DD 1ZNYA 4AG5A 3K70D 3R7WB 4MRSA 3SNHA 2AWNA 1SXJC 2HEIA 3MCAA 5KPJA 2IYQA 3IIKA 2CLSA 1N5JA 2QI9C 2OE2A 3F3YA 1R0YA 2ZUCA 3WRYC 1DBSA 2CCKA 2PH1A 1AS2A 4IVQA 4V0LA 1C4OA 1UBFA 5FUWA 4JLNA 4RY2A 1MR3F 4A0HA 2EFGA 2R65A 4I81A 2VL7A 3EZ6A 3TVTA 3L0IB 2FJUA 5ANRB 1AQUA 1KI3A 5BN5A 5JCPA 1TUEA 3CRVA 3QJYA 2P67A 4FN5A 2ZR0A 1OH5A 2PZEA 2ZRCA 3PEWA 1Z3IX 1YZQA 2MSCB 4FMDB 4EAQA 1CIPA 2D7DA 5A4JA 3C15C 2OLKA 4PXAA 2QE7D 1L4UA 4HB4A 4TT3A 2H16A 4TMWA 4X8MA 3ADBA 4LBYA 1Q22A 3B5JA 1XPUA 5KSYA 3VU9B 3WBJA 1H8EA 1HY3A 2BJVA 2BWJA 3CB4A 3I8SA 4W9MC 2PJRA 2VPPA 5TMPA 2C98A 1E4YA 3KJGA 4RJLA 4DXAA 2IS1A 4XD7D 3G0HA 1ZM3A 2ZRGA 3QG5A 2FH5B 3KXLA 4PZLA 2QZ4A 1ZNWA 2RHMA 1CLUA 4V0NA 5FOVA 1JXOA 3CNOA 1C9KA 1J99A 3FHCB 2ZRNA 4BASA 1E32A 4WXPA 3HJNA 1NVVQ 1ZIPA 1OB2A 1XF9A 1HV8A 2YOGA 3OE7D 1M74A 1Q1BA 3AQ4A 4DT1A 4JSYA 4RKFA 2BV3A 2OO7A 2OT3B 4F7WA 5JSZA 1KTVA 2EFDB 4DLXA 2NZJA 3CPHA 1XEFA 2ODNA 2VP2A 1S2MA 4DWJA 3R9IA 1IOZA 2ZI4A 2XTMA 3LLUA 2VLIA 3A1UA 5FBWB 5BW8A 1NIPA 1QHYA 2XOKD 1KK2A 2IS2A 4DEYA 3EZ7A 4EPWA 2ZI9A 2VF7A 4HLDA 4RFVA 4WXRA 2VRWA 5M04A 5LB2A 4PZZA 4CT4B 4LYJA 4AKHA 4BZQA 3AV0B 1ZU5A 3NEJA 2GRJA 1OH8A 1F60A 2HLDD 2O8EB 1DG3A 4QJ5A 4WAUA 3AF2A 1AQYA 2VP6A 4V0ME 2WWHA 1KNQA 4JMPA 2DWOA 3LW8A 1ZM9A 3FMOB 4HATA 1VECA 4EJSC 2QTVB 2VHQA 3CRRA 3HWSA 4UNQA 3B9QA 1HEIA 5JI3E 2VHCA 1SVLA 3HU3A 5F98A 3WHKA 2GZAA 2A7QA 1IY1A 4BFXA 3EZ9A 4GZMA 4LHYA 5HCIA 1MABB 1DE0A 2V7QA 1VCNA 3Q72A 1G16A 2AD5A 3S1AA 3FPAA 5G40A 2ZRDA 2ZE5A 5DLQC 1SVSA 1Z06A 3FMIA 4HEJA 3U4QB 2ECKA 2WBLC 2YWHA 3VU9A 1U2RA 3CRQA 3MMPA 3L8YA 2RGNC 3NDPA 5DH9A 5JBQA 2WKPA 3K09A 2IF2A 4ESVA 3DO6A 4C2UA 2BKUA 5F2EA 1RKBA 3DZDA 4TTRA 4CEIB 1E3MA 2BBWA 2ZROA 2H5EA 3B78A 4B44A 2IUTA 3GMTA 4BFWA 1E2HA 3ND8A 4TMKA 2YV5A 3KKQA 4DUGA 4Q9LA 3CX8A 5F3WB 3W8NA 1NSTA 1SKYB 2A30A 2J5XA 4HAVA 1CP2A 4WZ6A 1XEXB 4ILEA 4RZUA 3RS4A 4LK2A 4PC7A 2GCNA 3UATA 1II0A 5EE5B 3RRZA 1GKIA 5EUQB 1RRFA 1DO0A 2FGKA 4B6EA 1PJRA 1II8B 3T06B 1UFQA 2ZR7A 2PEZA 1E9CA 1NVVR 1XBTA 2IL1A 3K9GA 1E9SA 1Q1ZA 5AUNB 3SS8A 4M22A 1U81A 4OK5A 5HZKA 1WMSA 1GSIA 1Z2CA 4PQFA 1IAQA 4BLOA 1CJUC 1R0WA 1YU9A 4S2EA 4LJAA 3TVDA 5DN6D 2WSSD 1P73A 2DR3A 3ZQ6A 1XMJA 4UNRA 2FF7A 2O5VA 2YINC 3VHXA 1CJTC 2YWGA 3TNFA 2N42A 3NEYA 3PR1A 4RD1A 5KU1A 3J81k 4FINA 3KQLA 4GPTA 2WWXA 3KTAA 3KJEA 5TARA 3HYTA 3LDAA 4QNRA 3I3SR 1L7VC 1M7HA 2AXNA 2J45A 2ASEA 1XD2B 4WOPA 1R8SA 1XEWX 1Q21A 2D62A 3KJIA 2ATVA 4MRPA 3U7GA 1M7BA 5LBIA 1IONA 4IKEA 1GKUB 3SYKA 2GJ9A 2ZJAA 3BC1A 2ODEA 1CJMA 4ZDWA 2IK8A 4GOXA 1EFRD 1KSJA 2CL6X 3AVPA 4LJ4A 5FBLB 4EPVA 2A2ZA 4KBFA 4U5XA 5JECA 3UPUA 3QUSA 5H1YA 4PPNA 1FTNA 4TTQA 1JXMA 4Z1MD 1UKYA 1R6BX 1XXHA 1CU1A 1XP8A 1OV4A 3JVUA 5JRJA 4A92A 3THXB 3NKVA 5DGXA 4GRAA 3CBQA 4TYQA 5G41A 2FGJA 1VYTA 2OFOA 5JS7A 3TH5A 3AVVA 4AY2A 4RD2A 4NYJQ 2O52A 4RCZA 2Z4SA 1AK2A 2JLUA 1G8GA 1OHHD 3E1SA 1F2UB 4XSGA 5A5GA 1T0HB 1MABA 5J4KA 4FCTA 2BKEA 2QRNA 2F1JA 2J1LA 5AR1A 3TQCA 2LKCA 5EP1A 4KJZA 1U8YA 3U6BA 1Z0DA 2V55B 3D8BA 3P20A 2C9CA 4E03A 3CNNA 1E0SA 5HPYB 1ZCBA 1R4AA 4V0OA 2IYXA 3EIQA 1Z63A 1LY1A 3IPYA 4MKHA 4AYWA 3I62A 1N6OA 2FPMA 5UKDA 8OHMA 1SULA 3SN6A 1X3SA 2W83A 2LWIA 2NMVA 1U94A 4LV6A 3WHLA 1Z6TA 3AP2A 3IO5A 3DKPA 1G17A 4UXIA 3D7MA 4KODA 3G82C 4LYFA 1GAJA 1OFHA 1KI9A 3AKDA 4CZ2A 3LXRA 4LRWA 1G7TA 1E99A 4LBZA 3W34A 1XD9A 4NYIQ 4CEHA 1L2TA 3QXHA 2ZJZA 2R6DA 1AGPA 1KI4A 4IHQA 4DC9A 4DRZA 1E2MA 1O3YA 3EA5A 4B2PA 4EJSB 4AKGA 1W4BA 4NCNA 5TVKA 4Q18A 3GLFA 2GF0A 2EYQA 4PO1A 3GEHA 3ADKA 1OSNA 1OT3A 1OIVA 4PX9A 1MRNA 3FTQA 4DBLC 3PVSA 1GL9B 4BFYA 4DT1B 4MKFA 3FMPB 1FZQA 4IJMA 1ESMA 1F48A 2QM7A 1H8ED 3BFXA 4Q4AA 3WP1B 2QBYB 1ZUIA 4AC9A 1IQPA 4DCTA 4DLVA 1AN0A 1XCPA 2WJVA 3HDTA 3SE0A 3SFZA 2UVQA 3CZQA 1G19A 4ZKEA 3SOPA 1ESNA 5KNDA 2FOLA 3BFVA 5B2ZA 2B7BA 1G41A 4WVFA 4CRWB 2J46A 2JEOA 1WRBA 3ECCA 1Q20A 5HCNA 1HTWA 4URXR 2R6FA 4HLUA 2IXEA 1QHIA 2Z83A 2ZJBA 3QPUA 2QP9X 1S4QA 1T3LA 3DPUA 4TLEA 4D4KA 4C0SA 2WM9B 4M1WA 1HE1C 2HDNB 1EK0A 2PCJA 4PQRA 1D2NA 4ZIRB 5IDVA 1QRAA 2BBTA 4HUQB 5FOSA 5L3RA 3GLHE 1SGWA 4AIIA 4QBFA 1E2QA 4DSUA 3GJ4A 3KQUA 4EPRA 2CHQA 1D9ZA 1KY2A 1KI2A 1ZD1A 4TYNA 2O8FB 1NP6A 5K8IA 3LY5A 5B58C 3QKTA 1VDZA 1WDTA 1JAIA 1ZUNB 4HDOB 4DLWA 1E2IA 4Q00A 1JR3E 1DG1G 4QGFA 2EW1A 3W3ZB 2A5FA 2P65A 1TEXA 2GK7A 3EG5A 2ZSBA 1VIYA 4OQXA 1G20E 1YHNA 3CIOA 1X1SA 5DNYB 1U99A 2EWVA 3QF4B 1EXMA 2OEPA 3U44B 5DISB 4FCWA 5CLQA 4B3DA 1EFHA 2P3SA 1A2BA 4IRUB 4C7OB 4XOIA 4TQ9A 1KGDA 5CYPA 2BBSA 1V43A 4Q5IA 6Q21A 3VNVA 3QY0A 3T15A 1KYIA 1ZW6A 3PCRB 2QT0A 2V9PA 4TMZA 2NO6A 5FTJA 2ATXA 3ZVNA 4H1UA 2BMDA 4LC0A 3TGPA 4KLZA 1V5WA 1YZUA 1L8QA 2IYVA 5FBQB 4PHGA 4OI0A 5KSZA 3VR4A 1XTIA 3AKYA 2W2TA 1R0XA 1GRRA 2OV2A 2WJYA 3LXXA 3AVUA 5SZKB 2PMKA 1N5LA 2R6AA 1DAIA 3SJCA 2FE4A 4DSNA 1K5GA 1ZAKA 3FHTA 3HPQA 4F4JA 3LWNA 4DUGD 3AVQA 1DO2A 4Q4JA 4UJ5A 1E1QA 4C0LA 1UKEA 2BMJA 4XVQA 1DAHA 2WAYA 3X1ZA 4JLAA 1C1YA 4TYWA 4P4TA 5JJLA 1G5TA 4G5QA 3THYA 2F9LA 1GILA 2AWOA 5IK2D 4EQ6A 3X1YA 4FCVA 1YKSA 2QORA 3SZRA 4LJ7A 1R7RA 4IVPA 1KJYA 2J7PD 3KQHA 1E2DA 3CF2A 1P2SA 1ZD9A 2FFHA 3DMNA 1E2FA 3K53A 4JLKA 1Q0UA 1E9BA 1PUIA 2D2EA 3AVOA 1NNEA 4URVR 1Z8FA 4CEJB 3EZFA 3U3RA 2CCGA 3BD9A 4U7DA 2GBLC 1FW6A 2R6GA 1ZCAA 2QY9A 1TF2A 2VYFA 2EVWX 1W7AA 2ZRMA 3IIMA 1XJ0A 4ZV4A 3MAAC 2XSZA 4LBWA 4KHZA 1CEEA 2R8RA 5E4FA 5HTKA 4LWZA 1W0KD 2X19A 4NH0A 2O8FA 4P0TA 4RZ3A 1VCIA 4S35A 1QVRA 4TSFA 1E2LA 1VMAA 1W4CA 3AB3A 1GITA 2V6JA 4IXNA 4IW3B 5KYKA 4NE2A 3AM1A 4UKDA 1DELA 5HE8A 4CT5A 5JHGB 4IEIA 4I1VA 4F91B 4TL7A 3FKSD 1OW3B 5KTYA 4HDQB 4UQOA 3ZD7A 1NLYA 3LAWA 5FBRB 1VTKA 1W36B 3WYGA 3AVWA 1M34E 4X8LA 4NYMR 5AK0A 5BWMA 5F9FA 3FVQA 1TPZA 3TUJC 1JQLB 3KFVA 4KSBA 3QPWA 1MO3A 3VFDA 3X1WA 2GJSA 2C78A 1XXHE 4K46A 2L0XA 3LD9A 2OAP1 4D4MA 2Q0HA 2VHTA 2OUKA 3AGQA 1OF1A 3UXMA 1M2OB 4Q4AB 1T91A 1R5NA 1UF9A 4JL5A 2R6CA 2WOOA 1AKYA 5AJXA 3TLXA 3K70C 3ASZA 2IYWA 4OHYA 2N1BA 1SXJD 3B1WA 3NDBB 3TRFA 4PC1A 4LJ6A 2JLXA 4JKYA 2NO0A 4US0R 3UIEA 2BM1A 4HAYA 1NVUQ 1SVIA 1NY5A 2GEDA 1ANKA 221PA 2J87A 1OIXA 4M1YA 5DE3A 4OI4A 1EX6A 1SXJE 1UM8A 4OQMA 4F93B 3DVLA 1P60A 4HAZA 3B9PA 4NDZA 3SI7A 1HQCA 1PLKA 1ZP6A 4WW0A 4O25A 5C4GB 1S3SA 3X1XA 4E09A 1KO7A 1XDBA 2ZRHA 3QENA 4O2LA 2A3RA 2WAXA 3NBXX 4HLQB 2WSMA 3K0AA 1N2CE 3KL4A 3EIEA 2Z0MA 3BXZA 5FTNA 4DEXA 2ONJA 5KUTA 4A36A 1DAGA 2HF9A 1RIFA 2IX3A 3N70A 3ADDA 2QN6A 1TAGA 2WPDD 2Q3FA 3C41J 4DDWA 1QHNA 2Q9AA 1KKMA 3E5HA 2KJQA 4MITA 3O8DA 4D6PA 3B1XA 4M8NE 2CE2X 3EARA 3OESA 4GL2A 1YZNA 1Z2AA 3TAUA 2QGZA 1JR6A 1BKDR 1IN5A 1A5TA 1U9IA 4PFSA 5JJKA 4DLZA 1SHZA 2NQ2C 2UZIR 1GUAA 5CYOA 4ACAA 3GP8A 1KK0A 1XXHB 1IXSB 2R62A 3U7FB 3IUYA 3HPRA 5TB5A 3UMRA 3SDZA 1U0LA 2ZS9A 2F3TA 4D25A 4MRRA 2PT5A 2JASA 1P2TA 1RPZA 2F3RA 1XTSA 2QQ0A 4OL0A 1FUUA 1GKYA 4Y0AA 4A8JB 4C9BA 4QGAA 1LNZA 2EYUA 1G18A 2J0UA 4CW7A 1M7GA 5JHHB 3FKQA 2HUPA 4Q7MB 2FFBA 1GRNA 1T4GA 1NLZA 4P4SA 1HT2E 2D06A 2GA8A 1K6MA 2OCAA 1W1WA 5AWFC 4PZYA 4A15A 2GDJA 5GJBA 1TQ6A 3H4MA 1N0UA 3MGCA 1TF7A 4HI0E 2AL7A 4D4LA 4B74A 1E1QD 4YMSA 1W0JA 2JLWA 4MKIA 1AA9A 2OILA 2REBA 4YONB 1E1RA 3UK6A 2B7CA 4LJ5A 3U7HB 3C16C 3DDCA 4DB4A 3C7KA 3TBKA 5LD2C 2ZM5A 1T6NA 1XZQA 3AF1A 4C0KA 1E94E 1P72A 3LBIA 3MFYA 1H65A 2ZTSA 1US8B
chains in the Genus database with same CATH superfamily
4DB2A 1LZLA 1T4CB 2PFSA 3FCAA 3IPCA 4GGOA 1JALA 1N0HA 3H1PA 2RONA 3KOXA 4OQQA 3RFTA 1D2CA 2PGLA 2DR2A 1KPGA 4I5EA 1OBCA 3SQXA 2PX8A 4B3BA 4EBFA 4KVFA 4YH1A 5FTLA 5DSXA 2Z56A 4F38A 1CVIA 1CY6A 2WVJA 1N1DA 1ZVQA 1JMVA 3NTUA 1YCFA 2GYUA 3LW7A 1Q16A 4B6SA 4JSTA 1J25A 3HYNA 4BJHB 5A3VA 3KKNA 3NWPA 2DLCX 3C1TA 3IL2A 1A9TA 1G291 4DCNA 1P9LA 3O1IC 1RYEA 4WL0A 4AK9A 1OFIA 1EG2A 1MB3A 3AU8A 3RTAA 5BSGA 1P5FA 1G66A 1OT5A 1IE3A 1Y6JA 3THWA 3V8MA 1LC3A 1M6WA 1OXTA 1SG9A 1UBOS 3N2IA 5GV8A 1EUZA 1PEDA 3EZLA 5KHAA 2F4VB 1XJQA 2IQ5A 4MKGA 3UJNA 1BS2A 3JVIA 4MYSA 4DUPA 5BT8A 3V1TC 3IBSA 3SFTA 4Q1AA 4Y3UA 5DZSA 3W5IA 2Z8YM 5EP4A 4NK5A 3C6QA 3L43A 2VJMB 5SZHB 3IUPA 2F67A 3INNA 1NC1A 1E3WB 4KAJA 4P7GA 4IUYA 4ZVOA 3VNUA 4D3ZA 1BQ4A 5CHYA 1VFPA 1XP5A 2Y1EA 5CX1B 5TPZA 1LLFA 1O0BA 3F5SA 1KDTA 1JR4A 3PUYA 3OTOB 2ZS8A 3AR4A 4EABA 1KE1A 1TGYA 3QKSB 1G3UA 1F9EA 3CN7A 3R3XA 4EDHA 3F98A 3C4VA 4X1YA 1KZHA 2PKWA 1NFQA 2YOFA 3S2YA 2YRFA 1GLVA 2WB4A 5GVSA 4D81A 2LD4A 4IHJF 2QXTA 1RKXA 2VTBB 3ZVMA 3KUCA 5JY1A 4GLLA 1D09A 4RSRA 5IYZA 1QGDA 4IDPA 2WR8A 5GIOE 4EOGA 4NU0A 5K3SA 5KTOA 3B3FA 1U1GA 1D2EA 2W4MA 4LHZA 4JI4B 3AHHA 3EVEA 3OFND 4Z86A 1G6OA 3VH4A 4YV7A 2KMLA 2QR5A 4G1BA 2IS6A 3FCXA 5F2OA 1Z35A 2UZAA 2ODAA 4Y6QA 1M9NA 3CW2A 1QFJA 1YGYA 2ZAGA 1IBCA 1CRWG 1NQUA 1ZVMA 3C6YA 5KPDA 1F5SA 3WLTA 1GYQA 4DQUA 3ZLUA 4OXKA 1HYGA 1QV7A 4KE6A 5EHZA 2R7LA 3BJMA 3JQBC 1OYYA 3LUBA 3JWJA 4M0MA 1MVNA 4ZRDA 2QL5A 3ZCXA 1ZMXA 3IKTA 1Q0ZA 5FL7A 3CW9A 3EFHA 2OGUA 3DFKA 3QMPA 2WUGA 3MG9A 1TUIA 2FWMX 4P1ZA 1L4FA 3ICQB 2A0XA 2BKVA 2EG9A 3K09C 3ZLTA 1W2GA 1YQGA 2IZZA 1PNRA 1T4CA 5HJ7A 4QG7A 5FBKA 5AHXA 3G59A 7GPBA 2HTEA 3FDJA 4W5QA 4DA7A 2XX3A 1FLAA 3A4NA 4MS4B 1BCRB 3LDFA 4UEKA 2ZI7A 1BVHA 3AOGA 3ND9A 1L1RA 2IHTA 3PKIA 4I14A 2PNFA 5ECGC 4CG0A 3NX4A 3E0XA 3NHAA 2W93A 4ETWA 2D2IA 2QENA 4ZHQA 4PR3A 4LY3A 3KOWA 4M0UA 4C3ZA 1N2EA 4JLSA 2IYSA 3A4TA 1E9EA 4CT5A 1CB0A 2EATA 4PQYA 3SCZA 2WFLA 4KK3A 1N2GA 5GVRA 1ZWLA 2I4RA 3S0JA 3BRCA 1C8BA 4LW8A 1AY0A 3S40A 2ZIUB 1Z2OX 3TL2A 3ZV4A 1ZX1A 1K89A 1OWPA 1X7XB 1Z8HA 2NN3C 2O48X 2P75A 2VJQA 4QUEA 4RXMA 4YGXB 1KMIY 4ZQIA 1CZNA 5P8WA 3BOSA 3O6VA 1FF9A 1RP7A 2G28A 4L8FA 1ND5A 4Y1RA 4C04A 3UMVA 1WLYA 3OZIA 3HN2A 1B0ZA 1SXJB 3U2QA 1ORTA 2HQRA 4CKBB 3AR7A 2FSVA 1U0HC 5DP2A 5EP2A 1UXGA 4L4ZA 3V7FA 1S3GA 1IBLB 4RSGA 4U2EA 2ALJA 2QN8A 1XLTA 2P4UA 2W6ZA 3BS4A 4LK3A 4PF1A 4YS6A 4BNIA 4C6SA 4YV2A 3MWGA 3T34A 1LVGA 3R76A 1JAZA 3F74A 3GFSA 4MZXA 3RC2A 1ADGA 2SBTA 5DBHX 3LC1O 3N76A 2CXQA 2FZCA 2QQ5A 1BE1A 3LQYA 1KARA 1LBQA 1ISMA 1TIPA 1OZ0A 3GLKA 3PGVA 3QI2A 3I30X 1MX9A 2GPNA 1F5NA 2BJHA 3KQSA 1U80A 2JCGA 2GAOA 2ZJ6A 2W2OA 4HTAA 3LL4A 2XH8A 4EG0A 1MFPA 4O08A 3JQGA 3JQPA 1GFIA 2EKZA 1V1RB 3SXPA 4C76A 3GWZA 3AFGA 5EGSA 1JSCA 1P7YA 4GR5A 5JQGF 5F3RA 3P4YA 1T8TA 5ER6A 3BORA 3QEOA 2ISSD 2GD0A 1NU6A 2WAOA 3BWBA 1BVYF 4Q1CA 4LOJA 2FE1A 2JAUA 4AYTA 1R0LA 2OD2A 3ICOA 3ZLVA 5HILA 4N3NA 2H1OA 2YFHA 4G23A 1CT9A 2GEVA 1KI1A 1FS5A 3IQXA 3TTSA 1IN8A 3PXXA 4NZOA 1LV8A 2PZGA 1JEJA 3N75A 5T3YA 3I3OA 4MP6A 4WZZA 4M1QA 2G5CA 3KSRA 2IHYA 4FTWA 1NNSA 2WLSA 1ECCA 5D7BA 2EDCA 5LZ8A 2QF7A 5JAUA 2W00A 2IKSA 2UYQA 1PJ2A 4FD3A 2GM9A 3TM5A 2Z6AA 3HYRA 4ESEA 4XWYA 4RVUA 2Y66A 3CLUD 1JYEA 3KSMA 4GM4A 4PCAA 3CZMA 4L0CA 1G7RA 4FLFA 4MRVA 2VYVA 2ZJ5A 4NONA 2Q4EA 4N03A 4OHMA 2GX6A 1AGRA 5T4EA 3FOAA 5AVTA 1EEXB 4GLFA 1B1AA 4M1SA 5FFMA 4BNNA 4TVOA 3R3VA 1KI7A 4D79A 3A28A 1V8OA 1TK3A 3RBAA 2OHFA 3T1NA 5ES4B 1FVHA 2G6TA 5A7HA 3R09A 4YP1A 1PN3A 1RHJA 5AJZA 1HLPA 2ZE6A 3QBDA 2QN9A 3C8HA 3ZCQA 5E95A 1SURA 3X3HA 2P9JA 2LDXA 2FUCA 2A1TS 4FIDA 2VJBA 3OWOA 4I99A 1W0JD 3RR2A 4CMAA 4YR7A 2VHVA 4D3FA 4CF7A 3HJRA 1NBEA 2N75A 1DAMA 3AYXB 4B7XA 4CG2A 1WXFA 1XFAA 2QNRA 4G5GA 5TEWA 1Z2EA 4LYYA 3R9WA 1VPLA 2HAEA 3WVNA 4Z1MA 4KMRA 3GJ6A 3KAKA 4L51A 1BWQA 3DF7A 2HK8A 4GGMX 5F76A 4LF5B 4LZOA 1F4LA 4KXNA 3O9MA 2QP3A 1D2RA 4QVKA 3QKRA 1RS0A 3IAS1 5E6SB 4YRRA 2HK9A 4G1MB 4L3WA 1MPXA 1YS2X 3ZWOA 4FFVA 4F86A 2V7VA 3BK7A 4AZWA 1Y1QA 5IEJA 1IN1A 4HMOA 1A9QA 2XMCA 3NBQA 4WDQA 5FUYA 3WYCA 1PJAA 2HA2A 3IIJA 2I1LA 2RCYA 1BJRE 2IYRA 1FB5A 1AKVA 4HJXA 2XDQA 2GN0A 1QNLA 2BMEA 2N47A 2YIJA 3MJEA 1HG0A 1QJCA 3AM4A 2I7VA 4IGKA 2DFLA 2PX3A 4RTQA 1SA0A 4NWIA 3ROXA 4XJTA 3T3HA 1YJ8A 2RHWA 5LYJB 1S2OA 3JARA 3LT4A 5AVUA 4Q9JA 1JUDA 3LFUA 4JZKA 4HLUC 1CJKC 1RACA 2RDMA 1YS7A 4Q7JB 1OUMA 4YMWA 2UAGA 4DQ0A 4K40A 4XVRA 2XB8A 4GYJA 4BMCA 3DM9B 4Q1VA 5JNWA 5IASA 4MHSA 3PRKE 3QX9A 2CXHA 5LPNA 4UMFA 2VP9A 3R6WA 2V03A 4RDIA 1WDLA 2HQBA 5DRTA 2ZYVX 1P5RA 1SHTX 1I0IA 3L82B 2IZOA 4DWWA 2O50A 3DR3A 1JSLA 4CLXA 1IBMB 3CONA 4HDNA 4DNQA 4M7WA 3NDRA 3T5CA 4PLHA 3LBHA 5NULA 1KYZA 1YK1A 4GGPA 3IC5A 3MWJA 4LGCA 2V4MA 5B1DA 5IC5A 1W35A 1ONSA 3AP3A 3W7BA 1I30A 5EUCA 1SUIA 5KO2A 3A0RB 2Y3IA 2GCOB 4ND1A 1G1MA 1AF7A 2B8JA 2ZSHA 2VUHB 4MUFA 4EKNB 4TV8B 4PIVA 4BLVA 4I36A 1NN1A 1VHTA 2XITA 3ED1A 3K5PA 3TEMA 1ZMTA 3W1WA 3KZ1E 4EUKA 1TC2A 5MFPA 1KOJA 2DC1A 1PWYE 2ZPUA 4ER3A 5DNAA 3DP9A 3LMKA 3KR2A 2ZJ1A 3R2JA 4Y2JA 2ZCJA 1JPUA 2AKYA 5F1OA 5KOYA 5F4ZA 3U9SA 4ZJZA 2EIXA 1NP3A 4XUCA 1QFSA 3JRWA 1R2QA 3WYFA 1ZI8A 4OGGA 1KC1A 1YOVA 2ZB3A 1JHRA 4N40A 4MR8B 1CDOA 5D5HA 3RABA 1BXRA 4YQFA 1XZPA 4IQ0A 1QPGA 4PLPA 3H9UA 3QF7A 5F51A 4P35A 5F12A 2ANCA 5JAMA 5JOQA 1RJ9B 2Y76A 3QLTA 2P6MA 4CMJA 5CVJA 2HH9A 4KR0A 1M1XB 4Z4HA 4N76A 1UP4A 4ZK2A 1NM5A 1CE8B 1FFAA 2QD3A 1LXCA 3PPVA 3F2IA 1LVHA 3UCEA 1HH4A 3A6ZA 5HOQA 5K6AA 2WJHA 2O2GA 2B6HA 1KK1A 4QDUA 2FN7A 2VHJA 1JWLA 3H7IA 3KTDA 2MSEB 3IH5A 4O2BA 5L4LA 4M9XA 1CB7A 3OT1B 4GOND 5EC8A 3WXMA 3EPJA 3KB1A 1NKTA 2R44A 1EFCA 1CE8A 4EW2A 4ZCMA 1DRKA 4LX8A 1TPYA 3ROGA 4B3RB 3AX6A 3I39X 2NUAB 4XUDA 5D5PA 1XHEA 4KNVA 2FDCA 3ZDDA 1OTYA 4W9NA 4NFYA 5DXJA 2A1TR 4G5XA 4CYMA 2AJBA 3E82A 4JJ6A 2JCVA 1NJGA 4DNPA 2YZ2A 3GMDA 4OFBA 4ZVQA 4MR8A 3DLPX 2F00A 1HA3A 3PQ8A 3ZH9B 2OCIA 3BM5A 1V9SA 4KC0A 3QW4B 4L76A 5EXDA 4LHVA 1G21E 4JZYA 3U3KA 4A8JC 3QEAZ 3DOEA 3V8BA 2XUZA 1GUYA 4KN6A 1WWKA 4EVQA 4B48A 1VGVA 4GQIA 3UGKA 4DEVA 3RF6A 4JT9A 3ED5A 4ZIRA 3EUWA 4RTKA 4RKEA 5TJHA 4LDJA 2PGXA 1CG6A 4HBGA 4RXUA 1KP3A 2WZQA 3EGOA 2SNIE 4KWIA 3HI4A 4P31A 5FHRA 1I9CA 3WQRA 3CYFA 3DNPA 1D6MA 2PHZA 3PLRA 3CKYA 1NJ8A 3LM8A 3ZKWA 1ETUA 3IAM1 3LRPA 3G9QA 1TFRA 4I6EA 5FLYA 3DOUA 5KC9A 5EXTA 3G7SA 2WIJA 3B8HA 4BQIA 3LF2A 4MR9B 1SBYA 2HQSA 4YRAA 5BW4A 3G5TA 4HAOA 5TLSA 1SKYE 3WJ1A 3ABRB 5LVAA 2Y6UA 3GIDA 3ETLA 3A9RA 2GKOA 4PTZA 3G0IA 1C0IA 4HX2A 2ZIXB 2GBCA 4PZAA 10MHA 2KB0A 5HSGA 2FW9A 1VRWA 2VNIA 4R40A 1O94D 4B83A 1L3BA 2CEAA 3B1ZA 4GKJB 1Q57A 3EHDA 3O03A 2OK7A 2D4HA 1E61A 2P5UA 3H87A 2H65A 3K0HA 3N2GB 4KG7A 3AILA 3JQ7A 3WG9A 2BMAA 3RAJA 1KDYA 1L7MA 1P17A 2QAGC 1ZXLA 2ZYUX 5DGCA 3HXMA 1ONNA 1AM4D 1G8HA 3RAPR 4CEHB 3M4JA 3KQMA 3NJRA 3SC2B 4JLOA 2GXUA 1NW6A 1H5QA 2V74B 5H16A 1KS2A 2O59A 1KF0A 1TK9A 3FPFA 2J4DA 4C6TB 3WIBA 1VBFA 3BCHA 5G0TA 2PXHA 1NJFA 1BDBA 4IIYA 1P4SA 1FYXA 1IH8A 3QWAA 5E4YA 4AUMA 3EDRA 3SHOA 3E2IA 2VYND 1TMKA 2F9MA 2OAEA 2YIDA 3O94A 3SIWA 1U65A 5EAIA 2CV1A 2P11A 4DSOA 2GUWA 4D43A 1X1CA 5GGYA 5JYDA 3R3UA 3EVTA 3ZE6A 2HR1A 5DXFA 3QNMA 4OU4A 2YZMA 1W5SA 3T9AA 1I14A 3L8GA 4ROTA 3BTSA 4ZHQF 3OFJA 4J0QA 4H4DA 3SF0A 1GG2A 3W2FA 1WPQA 8LDHA 2SKDA 1I0ZA 5BORA 3GQVA 4V1CB 4KFTA 3IXLA 3WGNA 3UJ6A 4DCMA 2I1QA 3DTVA 2EFYA 2GD2A 2R79A 3EGVA 4GPZA 2GWHA 1NM5C 1SPBS 1WW3A 2C3OA 2Z95A 4U9IS 1AA6A 4QAJA 2AX4A 2Z9DA 4G4JA 1L5GB 3VJMA 4XWWA 2HBYA 1QZTA 3WYEA 2FMIA 1RABA 1X2EA 2C1XA 1T1SA 4EGJA 1PR1A 2OORC 1CUSA 1BS9A 3Q8WA 1E3QA 1A96A 4JJEA 2OC9A 3GLGB 4KREA 4MI6A 2QLNA 3R0ZA 3OZTA 3TE7A 1RMTA 1C8VB 1V3VA 1D2MA 3L4SO 2ZTUA 4H4CA 5AM0A 1I2ZA 4Y2SA 5DHAA 4ZARA 1E5QA 1RZVA 1IHXA 1NYQA 1QAOA 3EWAA 3NFYA 1ODSA 3ZIAA 1MXFA 4II3A 2OV8A 1R8QA 2ZYTX 3O8OB 3IXMA 3IHLA 3C4QA 1N5OX 3BMXA 4MWCA 1QBKC 3BRQA 1B3RA 1ZKMA 5JVDB 4BDSA 1GPKA 2Z98A 4EHHA 3DAGA 2YQ4A 1EZ4A 3MJRA 3HWWA 4G0XA 4H0NA 4HO1X 2XMRA 4BPRA 3RVQA 1CEXA 1FJXA 1P7VA 2VSNA 2Z8YA 2QYSA 2GVDC 2LKDA 1K7CA 2OD7A 3B48A 2H2AA 2OHXA 3HADA 4JXJA 3EZ2A 4QAQA 4DQVA 1B0UA 5CLIA 2NSDA 4XYBA 1LB1B 4LVUA 5JYCA 4KV9A 4DZZA 3TSZA 1FFHA 5LLDA 3PJRA 3S8MA 2RC6A 3O84A 2W58A 2NU7B 3L1IA 3QXXA 3SDSA 3T9EA 4CDRA 2QE6A 4KN9S 3ZBTA 1US8A 5F1PA 4WN9A 3ZIDA 4B6QA 3WLJA 3N8IA 1VE5A 1Y3DE 3TQHA 4LDNA 1SBQA 1TLFA 1X7YA 2OXRA 3OEHA 3DMRA 3QVOA 4C30A 5KJCA 4I2VA 1BA3A 3RVJA 4OA5A 3ZZUA 2IGBA 4ND7A 4K3UA 2VPZA 1ACMA 5JS8A 3IEMA 2IH5A 4DV2B 2FN4A 4IQ4A 2CJXA 4EFDA 2XA2A 3G2KA 1XLWA 3IPXA 1NA5A 2G6BA 3I9V1 4UTZA 4X1KA 2ZPAA 4FUTA 5TY0A 4I1OA 1V3UA 3GUZA 1UIRA 4MVYA 4YC7A 2W2XA 3EAQA 3ZBQA 1AB6A 2AN1A 1Y33E 4MUKA 3WAGA 1YFLA 2HFJA 1GQQA 4NFLA 3ADPA 4PYQA 4RL6A 1FU8A 1ADYA 1ISSA 3SBOA 4AU1A 4OBWA 1FSGA 1IHUA 4REOA 1DWQA 2G4LA 3K0FB 3BD7A 1PWHA 5JZMA 1N7GA 5HKKA 1J33A 2FOXA 4JVOA 3IKVA 3W5VA 2BEUA 1CNEA 4YXFA 1FP1D 2AQIA 3O73A 1I9GA 4HSEA 3DL4A 4ZYTA 1LH0A 4CIWA 2AW5A 3PKJA 2Y0CA 2C5AA 4PANA 4BX8A 5HIAA 1Q6YA 1ODKA 2ILTA 3BAFA 5HZGA 3QBJA 4D42A 3BQ9A 5IF9A 3CZAA 3K8YA 1M0TA 2JFNA 4RF3A 2WIAA 3RTDA 1MDFA 2IT1A 4JBNA 4XOUA 1S9HA 4Y6OA 2BI4A 2ZT7A 3BX1A 3PUZA 4NYJR 5D01A 4M6WA 2X8JB 4JEHA 1ABEA 3A3YA 2O06A 5E9JA 2LXNA 4CNBA 5IT4A 4PE5B 3QPVA 4EHNA 2BPOA 4US1R 3ROEA 5KWIA 4BBPA 5FOQA 1YZKA 4PHCA 3SIPA 3MUNA 4Z3DA 2HT1A 3L7IA 4UQPA 3HB0A 3G5UA 1GTVA 4V1CI 4HWGA 4MUXA 1WUKS 3TM4A 1PKEA 2JI6A 2WUWE 2WV7A 3PHBE 4R2MA 4CFYA 2P3OA 2RH8A 4KQ9A 2VT6A 5GWXA 4FGKA 1G6HA 3VR3D 1CUJA 2G9ZA 2H57A 1OH7A 4UM9B 5HDBB 3AEKA 3PFIA 1U0NA 3Q1KA 3D59A 4WV3A 1OH6A 3C3AA 3BZUA 1TU3A 2D2VA 2DX7A 4X9XA 3RT9A 4AW9A 3AR3A 4FYMA 1V4NA 4FHDA 3VZCA 5K8LA 4P2BA 1JYFA 3IDZA 3AVYA 1W4RA 4LI3X 4BQPA 3JVDA 5FT9A 3PIRA 4M53A 3DZKA 1WB9A 1P4GA 3DNMA 1CQJA 3H5VA 1EBBA 3VAAA 4I4LA 3KBBA 1XF1A 2ZSEA 2R7NA 5JZ9A 4ZOEA 4ZCQA 1XMOB 5DTMA 5BYJA 3RSQA 2PPVA 1QAQA 5BSUA 4W7SA 4UBJA 2ZE8A 4DV5B 3MELA 5EJ2A 2FNAA 4TKVB 4UM7A 2P9ZA 1AGYA 3P2MA 1WEKA 4ZD6A 1NWCA 3MQFA 2QM0A 5DWVA 3P4XA 1USIA 1WCIA 4ZN6A 3G9XA 2D1FA 1ZJWA 2GEKA 4H7PA 4QLOA 5F2NA 3KYDB 4M1KA 1ZZGA 5DI3B 1UWCA 1AKRA 2CXXA 3ANTA 3G5LA 4CMCA 4GAEA 4XARA 3RAFC 1JU3A 2CF6A 2Q9UA 3NM4A 5IYZB 2IE8A 1N6PA 3ZZMA 2PL3A 2VDOB 3Q3HA 1H0HA 2OBLA 5CYGA 3BH0A 1H85A 4JLUA 3BHJA 5IMBA 3ZWQA 2B1JA 4B3JA 2ZIZA 3AC0A 1Q77A 3UAGA 4RTMA 1E6EA 1LI7A 2P1DA 3NETA 1ZBDA 1ZGAA 1J6UA 2AI1A 5LA6F 4OHZA 5CM8B 2C29D 5JMWA 5HBGA 2DR0A 3CLRC 4DWOA 1P5HA 3MTEA 3PPIA 2V6GA 1SVMA 4GUAA 3RU2A 3GCWA 1QGZA 1XDDA 4RSMA 4LNUB 1NJ6A 1QQTA 3E7WA 4ZDJA 1WJGA 5LMCA 3E3OA 3OPNA 2IP1A 3QHPA 1NW8A 2W90A 4J9UE 8AT1A 1BMFA 4L5CA 2WKQA 2Z09A 3L7KA 1WZIA 4NHOA 4H60A 4RACA 1TVMA 4KXUA 4ZP1A 2CVPA 4CKEA 4JUFA 2W98A 4U2DA 4HZUA 1MPTA 4P3YA 1BRTA 1L4HA 5JNLA 3THWB 1NQWA 1RWOA 3OC0A 3VYVA 3E0QA 2C9DA 2QVCA 1FMJA 4PVCA 3NKLA 3B85A 1GTZA 2AOUA 3ZU3A 2JAQA 5LDGA 4QHSA 4P7KA 3QITA 1NBMA 2C95A 1BE8A 3ZNOA 1XAJA 1A98A 4OPMA 3U60B 1EFDN 4QFMA 1A04A 1JS1X 1K92A 2QDKA 2UVPB 2XSZD 3I2JA 1NU8A 2QSJA 3NTOA 4IIVA 4R1UA 5DTIA 4C4OA 5E9WA 4MGEA 2C7VA 4AMGA 1TMOA 5KWEA 1BXZA 1OBHA 4M3NA 4NE9A 4RNCA 2ORYA 2XI4A 1P77A 1Q3TA 1C50A 2EV9A 2CZGA 4LGMA 4R01A 4BUJA 5C7IO 1PVVA 1QF7A 1RXUA 1TJNA 2PUFA 4QWWA 1LLUA 2FWAA 3L5OA 4ZWNA 2X1VA 3TRDA 3TTWA 4NICA 4MJXA 3D54D 1NNLA 4ZAFA 1T8PA 5CX4A 5H3CA 1S8AA 5KVSA 1RC8A 3R44A 4HPXB 1KBZA 5LMZA 4IDFA 2XWPA 4OHXA 3CPEA 4XQ9A 1OLOA 2I4OA 4JBYA 1PG0A 2YR0A 2OBMA 3L2OB 3DLTA 3ROQA 3W90A 3ZWXA 4UTPA 5A5EA 2CY0A 4DM7A 5IDQA 5J4HA 4I19A 5LFAA 4FKBA 3FLMA 3L8FA 2BGKA 2XLCA 1RJ9A 2IX9A 1SHJA 3LC7O 3ORSA 3PFKA 3WLHA 2MYUA 3B12A 5FWNA 4WLEA 3A1SA 5J23A 1EX9A 3OSUA 3LIIA 3TLKA 3D5QA 5EZ6B 3R7DA 1R4MB 3LX5A 1LF0A 1NF2A 1GPAA 2JFVA 3MMZA 3M5WA 1ZY2A 3T9FA 4QU9A 1LBHA 4B4DA 3TG2A 1F0YA 5JECA 2M6KA 4OP1A 3OY2A 3PB3A 3T7RA 4ZI2A 4LE1A 1DAPA 3STTA 3A3PA 1P33A 1RWXA 4X1IA 1LSSA 4KR9A 5AVSA 3CB2A 3KZCA 1MQSA 4TYPA 3GLIB 3VR5H 1I3LA 2EGUA 4NZPA 4FR0A 3WV5A 3AESA 1K7SN 3WGJA 2SHKA 1EX1A 1QCYA 4K7JA 3CX6A 1KDOA 1DQSA 4MLZA 3EX7C 3RFVA 2F9FA 2Z2KA 3HTXA 4Y9SA 3T41A 4G0MA 1IJKA 3QG1A 4PZPA 1YF3A 3WK9A 2WF7A 4Y2HA 4BNVA 3RS9A 1HDCA 3A4IA 5EJAA 5KDOA 4S24A 4R2XA 3STHA 2BN4A 3N86A 3ZNPA 5KDLA 3DKVA 5EJFA 5BSKA 2FPGA 2ZXFA 4MK4A 3TOVA 2GCPA 2XCLA 3CN9A 5TJ9A 3L4BA 4KPEC 2PFGA 3BFKA 1MH1A 3ZGLA 4GXRA 4EB6B 4KDRA 3V4VB 4B2LA 3HZHA 4KYUA 1WPRA 4QQFA 3QXGA 1LX6A 2WRZA 4GVXA 3THOA 1QE5A 1SZCA 1U3DA 2JIZD 4FFBA 5EXXA 1MF7A 3K0AB 4EEZA 2C00A 4HQRA 2CE7A 4HRXA 1V2HE 4LDZA 2QMEA 4A1FA 1OLSB 3EXEA 2JKVA 1T6XA 4MS1A 1K3FA 2C58A 2TMYA 3LO5A 1TADA 4B2IA 2WF5A 4UC0A 1KAQA 1OLUB 2J67A 2N0SA 2GUGA 4O2AF 1YCGA 4FHGA 4Z8XA 1AUPA 4IH1A 2AUNA 3AHJA 4HNAA 1Z26A 3SSOA 3T4UA 2IBMA 2P8SA 4XIGS 1URPA 3KJQA 4UM8B 1CP3A 2FTKE 2I67A 1OY1A 4NNOA 3TZKA 4D9KA 4ZZ1A 5KTKA 3E7XA 1Q7GA 2QQGA 4AY5A 4C4TA 4WX2B 3SG0A 2XTJA 3R3YA 3UWOA 5B3KA 1IQUA 1Y80A 2FA9A 3D81A 4UOZA 4WDRA 1P6XA 1QIDA 4BVHA 2F55A 5WRFA 1BTOA 1ZK0A 3OPQA 1YDMA 3P9IA 1MENA 1XT6A 4MVWA 4BNYA 1ILEA 3D1LA 1RTTA 3KJFA 4TZ6A 3BJZA 1KAHA 1ZMOA 3C14C 1XZMA 5I9TA 5IUJC 4XWOA 1EA7A 2R4UA 2PRJA 1J24A 3JSXA 4PYRA 4Y9RA 1SAYA 2E4XA 2CLLB 4BAGA 2O8BA 3M83A 3NP9A 3AWIA 4IO1A 2VPTA 1A5BB 4PGGA 4CM7A 2ZUTA 3TZ6A 3FCYA 4YJGA 4M9SA 2XXAA 2P9YA 2Y67A 5GONF 4ZCLA 5TS3A 3C3MA 4C5AA 1SHUX 2QL7A 4BNMA 1KIMA 4DADA 5A1TA 3A6PC 3UAWA 1N6KA 2R8BA 4Z4QA 4YAUA 1Z0SA 1XCGB 2PUEA 4OF4A 4PG4A 3VR5A 1WPXA 2OV3A 3AJ9A 2WIBA 3AXSA 1P80A 1VE7A 3GVXA 4L8VA 3EZYA 4O4JA 4DIDA 4OXRA 1M6EX 4FR2A 1FU7A 3EMKA 5EOVA 3ST7A 3B6EA 2F1HA 3SX0A 4EJSA 1CUBA 3PX2A 4BB6A 2IBSA 3PNYA 2A5DA 2ZCUA 1OFVA 1OU4A 4K6MA 4OI2A 2RHRA 1WF6A 4LIPD 4OMDA 4E22A 1WX1A 1EVKA 4Z9YA 1KU6A 2M9MA 3AKCA 5JQGA 1V3TA 2ZDHA 5TT1A 1A7AA 1EBFA 2VK2A 5DHQA 3W05A 1KY3A 5CG2A 1GU7A 2FEXA 5IAOA 1QIJA 4A2PA 5B6PA 3IBYA 5FLXA 3MUOA 1E89A 4I46A 4L0QA 1VG8A 4LMPA 4BGDA 3AFOA 3I09A 1T2CA 5CFMA 3NTVA 1RJEA 4MI3A 5COAA 1BH2A 2NZVG 4LZAA 5LUBA 1Q17A 4IDOA 3IILA 4DHEA 5BT9A 2G1AA 2ZETA 3FOWA 1TW3A 1Z4KA 3INTA 1L4KA 1DIOB 2H2DA 3B51X 4LYHA 1SXPA 2EQBA 4O4HF 5BMVB 3W5DA 4OY3A 3V4OA 2VBCA 1GFWA 1UPBA 1IIRA 1L3CA 1UXOA 3EH2A 3W3AA 1D2HA 5KWVA 3OZGA 5DT2A 4R8SA 3OP1A 5K3FB 4Q1EA 1DMSA 1M2GA 2CHVA 2WJWA 3JQGB 2WVGA 3RYHB 5K03A 3TMKA 2C42A 2HHLA 5CVTA 5EZYA 4QOIA 3VNQA 1Z28A 3URKA 3VAYA 3A6GA 3BIWA 3EGWA 5DMXA 1MOQA 3FPBA 3IUNA 3TDKA 5I9LA 1MU0A 1OFTA 3ZCUA 3F9RA 1KMHA 3NVMB 4BECA 3LG2A 4LWOA 3HDYA 1AXGA 2QVXX 4BFSA 5LYJF 2IYAA 3L1JA 1R00A 3P26A 2HLNA 1JNYA 1U2GC 3H97A 1K8ZB 3HU2A 4BFVA 2J0UB 2OZEA 1LJLA 2R48A 1UWKA 2NSHA 3DFMA 1BKYA 4IGIA 1L5VA 5CB4B 5KTRA 1QZZA 3W2IA 4JVLA 3A1TA 1XZCA 2WB2A 5A0FA 4LZZA 4R41A 4XFJA 3RAGA 3WLLA 4J8PA 1GT6A 3UW1A 3SYTA 4BIMA 3M5DA 4I5GA 3HHPA 2ZU0C 2NVOA 4URHA 2CMKA 4WINA 2WIFA 4M4SA 2DHRA 3AF4A 3EIUA 3MINA 3L7CA 3QJGA 4PLFA 3WBBA 3NVKI 3DLIA 3MLEA 1Q83A 3EF1A 2Y71A 4OHVA 4QFCA 3IMKA 2BKXA 5C53B 4DIKA 2XTNA 1CJBA 3O4FA 4RVHA 2D1TA 3KCNA 4RNDB 3L04A 5BSHA 4X7PA 4OB7A 1BN6A 2I6UA 3KD3A 1G4HA 1TIBA 3Q5DA 4HEHA 3PHHA 4Q66C 4QECA 1COWA 3ROPA 4DL9A 1KETA 1Y7LA 2RG1A 1FYFA 4Q03A 4EI7A 2GM4A 3MWYW 3LLMA 5KSWB 5IVHA 1MW9X 1XRNA 4ZQGA 3IJPA 2AQHA 3M3HA 5KKCA 2ZRBA 3Q15C 4PZCA 4QTZA 3QUTA 2H29A 2R96A 2B99A 2PRKA 2R47A 3EZNA 3FGZA 3D31A 1OA1A 4DLYA 1RU3A 5B7PA 5E38A 4C4ZA 3R6LA 5JZOA 3QXSA 4JWTA 4BLQA 1X1RA 3A4MA 3IQGX 3BICA 4S1NA 3UYKA 3GVCA 2QPLA 3VC2A 5K6AC 1HG1A 5BPHA 2ZWIA 4X41A 4CL8A 4UU1A 2JIZA 5JQGB 1NGSA 4B8WA 1KEKA 1BVRA 2DH6A 1TDJA 2J9FB 2NUPB 3QLEA 4MARA 3ILXA 4IINA 4QRIA 2W71A 3TZQA 5ITVA 2QW0X 5JCOA 2GYYA 1KDRA 3ONNA 4PBSA 1YQWA 2P77A 4JK3A 4Q02A 1E5VA 4F2DA 4JVNA 3I5XA 2FG7C 3SZOA 3UUGA 3NTLA 1ODTC 3EW9A 2IIVA 3BHIA 4I8XA 4LOKA 5DK6A 5JEDA 2GASA 1Z5WA 3KQKA 1Z7WA 3B3AA 3RW9A 3A37A 1VHJA 5IAJA 1UIMA 2OM6A 4AF7A 1RYDA 2VTBA 3EQZA 2X0RA 3U4QA 4B43A 4GZ3A 3JQAA 3H86A 4C20A 2VAPA 1KYTA 1AHIA 1QE0A 3MWLA 3DF9A 3DMYA 3HCWA 4KGVA 4AG6A 1Y6GA 1AKEA 2IHZA 2QVLA 2XGGA 3P0EA 2FLWA 2H1HA 4BO5A 5A5FA 1HMYA 3FWNA 3L1KA 1SWWA 4IZOA 1EWTA 2R1ZA 3LCVB 1QG6A 4XVHA 4EFKA 1WXQA 4K9KA 2UU9B 4BLUA 4JB0A 4IWYA 4CR8A 5BXQC 2R4TA 4ITRC 5ICSA 2V1XA 3TSAA 1H93A 1PJ8A 1XCMA 2HHAA 1TXGA 2W6JD 1QTNA 3ZWWA 5CFNA 2YTZA 3HM9A 5JWOA 1V3QE 2X15A 1C8LA 4HNRA 3IEVA 5ADHA 2BFFB 3MIIA 4LYEA 1YS1X 1MAHA 3VISA 2FSIA 5DOVA 1K5DA 1I6WA 1L6IA 1NG9A 2Q50A 3L0OA 5JD3A 1GGEA 3QFTA 2E0IA 3O4GA 4GOLD 3KTOA 1V9CA 3I8OA 4GKVA 5AUOB 2QMUA 3KEOA 3QUQA 4XSVA 1LRKA 2C4MA 1ZC3A 3CNEA 3GG9A 3DMTC 2CDNA 1HUQA 1Z62A 2ZYGA 1GZHB 3T5TA 3Q6MA 1MRSA 1N0VC 2VEDA 5EGNA 3USES 2CV2A 4DCPA 2AG8A 3C8ZA 1MUUA 3N8KA 4PCUA 4MVJP 4LFCB 2ORED 3A9UA 1V1MB 1ZH0A 1XRJA 4TKUB 4ZOLB 2AFHA 1LPOA 2J4FA 3AIIA 2EIHA 4IIBA 4EI9A 4EMBA 2ZVQX 1NUUA 2X1MA 3IBTA 3PHJA 3R5TA 1T0JB 2P91A 3EPRA 3O8QB 1U2EA 2I6XA 2Y9MB 3EF0A 2QYHA 2UZ0A 4F6RB 3CF0A 5JADA 1YR8A 3I5MA 3KV3O 4XAQA 1P7CA 4J75A 4DMFA 3R5KA 1E79D 1KPIA 2HI0A 1E7QA 3NLLA 3E8MA 5AO9A 2KI5A 2ZIXA 4LQLA 4RPGA 5JNVA 2G7MC 3SX4A 3C3CA 1HDRA 4IS2A 3IEUA 3C5WP 5DHFA 3LY7A 4HQNA 3VC3A 3DHYA 4ES6A 5FNVF 2AYZA 1ZIXA 4KXLA 4RD0A 3TB6A 3N2EA 4IDGA 5CH8A 3LBAA 4UTRA 3QWHA 3BIFA 1GG9A 1E8NA 1XTRA 4D9IA 1SUWA 1X9GA 1XGKA 1ZIOA 1J09A 4KZPA 1P9OA 5U4XA 3VJRA 3AH8A 1FY2A 4FFMA 4IXWA 4OHBA 4BQNA 2QLLA 4WGGA 1IEVA 4AB1A 2IXTA 3GUVA 4KRGA 3RRNA 8ABPA 4BKPA 3QU4A 2HJ9A 3KAJA 2OSVA 5C34B 5BNFA 4D9MA 5IJ9B 4YY3B 1MEJA 5A04A 3T3NA 3A04A 2WUFA 1GV0A 2DAPA 3OKFA 3ZGXA 5IS2A 3CH4B 2DQKA 2COEA 4CMHA 1FP2A 3D64A 3A1WA 3FXAA 5E1OA 2HPHA 2ZB4A 3UHAA 1MHPA 3H2BA 3K1ZA 5EMJA 3WYNA 4X20B 2VOJA 4RABA 4C03A 4P4SB 4Z7JA 4G3XA 1BCSA 1NXVA 3GBPA 3UT6A 3GZNB 4WXEA 5AW4A 1M72A 1ZONA 1SK9A 3E9QA 1LTQA 1FNSA 1QC5B 2QL6A 4RH1A 5CCEA 3PG5A 1Z6YA 4P4UA 4IFIA 5IAAA 2B8TA 1N2JA 3LX8A 4MCJA 5E1MA 3NRCA 3HB5X 1TECE 2GHIA 1H0SA 1OA0A 2JI4A 2XWJI 4LXUA 1LSOA 2VP4A 3OCYA 4RVSA 5EINA 5CDFA 1KJ8A 4XD2A 2O8FB 3MJSA 3DULA 4NG4A 2OENG 3ORHA 1V7QA 5F33A 4NOLA 3V8EA 4ON9A 1KDPA 3VKWA 4YLEA 4AI6A 4EYOA 5FEUA 5KNCA 4MDFA 4DCVA 2EX0A 3HG7A 5ICMA 2IY9A 3OPYB 4O4LA 3SXUB 1GN8A 2CXUA 4X00A 3ZVLA 4PS1A 1U3TA 3CS3A 1GL7A 2YJTD 3FYCA 5F1KA