4LG1A

Human methyltransferase-like protein 21d
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
218
structure length
217
Chain Sequence
DPLRSFVRVLEKRDGTVLRLQQYSSGGVGCVVWDAAIVLSKYLETPEFSGDGAHALSRRSVLELGSGTGAVGLMAATLGADVVVTDLEELQDLLKMNINMNKHLVTGSVQAKVLKWGEEIEFPSPPDFILMADCIYYEESLEPLLKTLKDISGFETCIICCYEQRTMGKNPEIEKKYFELLQLDFDFEKIPLEKHDEEYRSEDIHIIYIRKKKSKFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein-lysine methyltransferase METTL21D
publication title The Crystal Structure of Human Methyltransferase-Like Protein 21D in Complex with SAM
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 72
structure length 217
sequence length 218
chains with identical sequence B, C
ec nomenclature ec 2.1.1.-:
pdb deposition date 2013-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10294 Methyltransf_16 Lysine methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4lg1A00
7MHTA 2O05A 4DMGA 3B3GA 3M6WA 2VDWA 4XUDA 3SR4A 3HNRA 3ER8A 2OPBA 3ME5A 3PFHA 4E31A 3K0BA 2EFJA 2PWYA 3AXSA 3PS9A 1QYRA 1KR5A 4O29A 3MGGA 3CCFA 2AOTA 3PFGA 3UA4A 4M37A 3MHTA 3NTVA 4RTLA 4R8RA 5K0LA 3HVIA 4OX9Y 1JSZA 4C4AA 2HR1A 4KWCA 4M7RA 2HWKA 2YQZA 3CGGA 2PX4A 5GINE 1RI5A 3HCDA 5E9JA 1H1DA 3FPHA 3LX6A 3FTFA 3BXOA 4GEKA 3E8SA 2PV0A 2P3QA 4ER5A 1NT2A 4QVGA 4BLWA 1AV6A 2AVDA 4C05A 2VZ9A 2JHAA 3BWMA 3ELUA 4KIGA 3UWPA 1I1NA 4GOMD 2ZFUA 5DTQA 2PJDA 3FTDA 5GM2A 3SSOA 4QPNA 4PYLA 1WS6A 3HCFA 1KPHA 2Q41A 5LQKA 3KPJA 4AZVA 2IIPA 4U7PB 1JG2A 3O31A 2B2CA 1O9GA 4P7FA 2PSSA 4ATNA 3EPPA 5DM1A 2ZCJA 1F3LA 3FTCA 5K0FA 1NBIA 3P9KA 4YV0A 5K03A 3GRRA 3CJTA 1ZQ9A 1ORHA 3G89A 3HA3A 1XJ5A 1UIRA 1X1BA 2YXDA 1JTFA 3VSEA 5JR3A 4XCXA 3EEOA 3HP7A 3JWHA 3M70A 5ICGA 5EHGA 2H1RA 3KPVA 4C04A 3NDJA 3KR2A 3FUWA 4PYIA 4RSRA 5F2KA 4YV2A 5ICFA 4GBED 2O0LA 5EOVA 3HCAA 1X1CA 2OB1A 4ER6A 3KPUA 4OQDA 5EMKA 3TM5A 4DZRA 1QANA 1D2GA 2AOXA 4PGHA 4RTQA 2AZTA 2ZBRA 2ZTHA 1YB2A 3T7TA 2C7RA 3I9FA 4PYNA 4YUXA 2F8LA 3D2LA 4RYLA 1VLMA 4CKBA 2IFTA 1DUSA 5DLYA 2OO3A 1Q0SA 1JTEA 3RODA 1HNNA 3LHDA 1RI4A 1ZKDA 2ZWAA 1D2HA 3LPMA 1EG2A 1P1CA 3I64A 4GUAA 3GIWA 4HH4A 3CJQA 2HNKA 5ERGB 3UBTA 5FA5A 4YUZA 3DH0A 2HMYB 1SQFA 1UWVA 2P40A 3EVCA 2CKDA 3EVEA 5FHRA 4FSDA 3AJDA 3THRA 3KQWA 4P7GA 2PX8A 5FQNA 5CCXA 1YZ3A 5DWQA 5EHIA 1JG3A 1HMYA 3TMAA 4C08A 1RI1A 3OPNA 5DSXA 1QZZA 3T0IA 4PYQA 4E33A 1DL5A 2FCAA 3NW9A 4P7JA 5EZSA 5CIYA 2IBTA 2IP2A 1XDSA 4LWOA 1OR8A 3BKWA 2IH4A 2XVAA 3P97A 1B42A 3KQYA 2QYOA 5EZQA 4CKCA 3G5TA 1NV8A 5EGSA 3SX0A 3TFWA 1VE3A 3G7UA 2QE6A 3LSTA 4DKJA 2NP6A 4Y30A 5EKUA 1SQGA 3CVOA 2EJTA 3KKZA 2GS9A 3KQSA 5E1DA 1KP9A 3CC8A 4P7KA 1KPIA 1RJEA 2G70A 2HV9A 2YXLA 2O07A 4RTPA 3TLJA 1MHTA 4KVZA 2BM8A 4QVKA 3GWZA 3IEIA 2K4MA 3FPJA 4MIKA 3PTAA 1R6AA 3UA3A 3BUSA 1EIZA 3QV2A 2I7CA 4U7TB 1SUSA 5E9WA 3G8BA 4IKPA 2PXAA 4CTJA 4C03A 1XXLA 2PKWA 3C0KA 2B3TA 4R6WA 5E1OA 1R8YA 3NMUF 4CWAA 3G88A 1JQDA 4BP1A 3ER9A 4FT2A 5DSTA 3FPGA 4FZVA 2EX4A 3DMGA 4QTUB 5DRTA 1MJFA 3KR1A 4YMGA 2JH9A 2IBSA 1EQAA 4YV1A 5HIMA 1U2ZA 2B9EA 2ZBPA 3ORHA 2NXJA 2G72A 3KPYA 2PWPA 4A6EA 9MHTA 2YTZA 4RTNA 1NKVA 1WXWA 4KW7A 4GC9A 1Y8CA 4PWYA 3MTIA 5DM4A 2IGTA 1IM8A 4WXHA 2BR3A 5DT2A 2V74B 4P58A 4PYMA 2IDJA 3KQTA 2AOTB 2ESRA 4KIFA 4FGZA 1O54A 5E8JA 3UJBA 4DA4A 3OZTA 3TRKA 2AOUA 4AZSA 5E2AA 1KYZA 1ZHFA 2CMHA 4RV9A 5DRYA 3P9CA 5FWDA 2C7PA 2XYVA 2BM9A 3NWBA 5EEHA 5T6BA 2A14A 3BZBA 3CBGA 1RJFA 3HVKA 5DX8A 5GOZA 5HEKA 3HA5A 1KHHA 2NXCA 2PX5A 4HSGA 2OBFA 5HIJA 2P3OA 3M6XA 4RVDA 2HTEA 4HTFA 5FA8A 1NW7A 4HTFB 5FCDA 1TW3A 1XVAA 3NDIA 3UJDA 3EVAA 3THSA 5DPMA 4E2WA 4QQKA 5K0NA 3O4FA 4V0RA 2VDVE 3C6KA 4ISCA 4MQ4A 4OBWA 4MWZA 4RTJA 2NP7A 2ERCA 3MB5A 4AZWA 2FK7A 1G8SA 3FUVA 1SUIA 4DCMA 4QQNA 3HA7A 2NXNA 3HCBA 4PCLA 1RJDA 3FUXA 3KU1A 4R05A 1G6Q1 2PT9A 2BZGA 1TPYA 2ZLBA 3DP7A 1EJ6A 2CL5A 3FUUA 3G2MA 1O9HA 3TKYA 3UZUA 2IH2A 2C7OA 3M4XA 2P35A 4HGYA 4ER7A 3G2PA 2VDUE 4XUCA 3DMFA 5U4XA 3LGAA 2B78A 2R6ZA 5FHQA 4YUYA 1RI2A 3DXZA 5CVEA 4GOLD 3PB3A 5FADA 5EVJA 4HG2A 3SM3A 2QRVA 2G1PA 4KRGA 3P2EA 4L7VA 4RTKA 3OE4A 5CVDA 3O7WA 4EKIA 1YFJA 4IV0A 4FR0A 1NE2A 3DR5A 3FYDA 4LG1A 4OA8A 3HVHA 3EVZA 3I58A 5E8RA 3SSNA 3A25A 3NVMB 3Q7EA 2PVCA 3TOSA 1G55A 3SVZA 1X1DA 2Y1XA 3DLIA 3OE5A 3JWJA 3TKAA 3P2IA 5HIKA 3U81A 4E70A 2NXEA 2XYRA 1RJGA 3GRVA 8MHTA 4PGGA 3R24A 5LQAA 3NJRA 2AOWA 5K8VA 3TM4A 5DXJA 5HOQA 2AVNA 3K6RA 3R0QA 1JR4A 3OFKA 4PCAA 4RTRA 2XBMA 5DX1A 3B7PA 2JG3A 3LCCA 4R6XA 2FPOA 2AN5A 3MAGA 1DCTA 1NW3A 2B25A 4M36A 5KYGA 3B3JA 2EJUA 2AN4A 5DTRA 4QDKA 5BW5A 5T64A 5LQUA 5FULA 5E9QA 4NECA 2Y1WA 1NW8A 3M6UA 3E05A 4GOOD 2ZZNA 3EMDA 3VC2A 2P7IA 3E23A 1QAOA 1VL5A 5CVVA 3V97A 3MTEA 4Z2YA 4ER0A 3B3FA 3HCCA 3LBYA 3B89A 5K09A 5CVJA 2PBFA 2YR0A 3R6TA 4HGZA 5DXAA 5EPEA 2OXTA 3FPEA 4PYJA 3SSMA 4EQZA 3BWCA 4ER3A 4OBXA 3VC1A 2YUIA 4DQ0A 3ELDA 3NWEA 2VS1A 3AY0A 3FUTA 3GDHA 3C3PA 3TR6A 4DCGA 3DOUA 2O06A 3OU6A 1PRYA 1I4WA 5HZMA 1UFKA 5EG5A 3BT7A 3ID6C 1BOOA 3UJ6A 3G5LA 3BWBA 5DTMA 2VP3A 3DULA 3KQOA 1VP3A 4RVFA 1QAQA 3E7PA 4PIMA 4RTOA 5HFJA 5DM0A 3GNLA 3KR9A 3UJCA 1BC5A 5P8WA 4BP3A 3T7SA 5KQRA 4PIPA 3VYWA 1G38A 4H0NA 1AQIA 3WSTA 5E1BA 4AZTA 3QOXA 3Q87B 3S68A 4X1OA 3G8AA 4FT4A 2GB4A 2FYTA 3GRUA 4RVHA 3CJRA 5EIWA 4KDCA 4WVLA 4POOA 3NVKI 3B5IA 1JG1A 1KPGA 1YUBA 2CMGA 2OZVA 4XUEA 1AF7A 2R3SA 1N7JA 3HM2A 3BKXA 5CUQA 4B17A 5EIFA 1L3IA 2UYOA 4GC5A 2C7QA 4C07A 2DULA 3I53A 2AN3A 5LQJA 3IYLW 1SKMA 3A26A 2JJQA 4UOEA 4Y2HA 3P8ZA 5LQNA 1X1AA 4E32A 3OU2A 3UJ8A 5FTWA 2P1DA 3GXOA 2PLWA 1R74A 4HRAA 4IV8A 5K0GA 1INLA 2UZ4A 4FP9A 2Z6AA 3LDGA 2GLUA 2WA2A 3MERA 3LKDA 3P9NA 1WY7A 5G02A 3X0DA 3LECA 5CVUA 2GA9A 4GQBA 4R8SA 2AOUB 2Z6QA 1L9KA 3EGIA 4E2XA 3LDFA 2V7EA 3KPWA 2GAFA 1F38A 5K01A 1BKYA 3IHTA 4E2ZA 4PYOA 1Z3CA 4M38A 1NW6A 5K0CA 2UYHA 2ZIGA 4BY9E 2IPXA 3DTNA 1G8AA 2BR5A 2AR0A 2YVLA 2I62A 2FK8A 2LD4A 3EGEA 3KQPA 4X63A 2ONZA 3PT9A 2ZWVA 1EAMA 5D1HA 3SGLA 4IWNA 1T43A 2PXXA 1KIAA 3A4TA 4GF5A 5IKMA 1ZG3A 4PINA 3ELYA 1XCLA 4CKEA 2JHCA 3EMBA 4FSXA 4LWPA 4FS8A 3C6MA 1VPTA 3OCJA 4MHTA 3EVDA 2KW5A 3V8VA 2ORED 3GCZA 5CD1A 2IH5A 3EVBA 2WA1A 3MQ2A 3P71T 1M6EX 4A6DA 4JXJA 4K6MA 3KQQA 5M5BA 1JSXA 1D2CA 4RVGA 1VP9A 5KQSA 5LQRA 4RX1A 5GIOE 2G8NA 5E2BA 5CM2Z 3R9XB 5K05A 1G60A 1FBNA 1R00A 1WXXA 2XYQA 1SG9A 3DMHA 3KHKA 4RWZA 5B1SA 2AOVA 5ICEA 4ZTBA 3QOWA 4BLUA 3OFJA 4CXMA 3ERCA 4DF3A 1P1BA 5EQJB 3KQVA 3T7RA 3TQSA 5BW4A 3UJ9A 3AWIA 2PXCA 1JQEA 4RTSA 2QRVB 3DUWA 1QAMA 4GOND 1L1EA 1IXKA 1ZGJA 2PY6A 3M6VA 5K0EA 3AXTA 2ZZKA 3UFBA 3MCZA 3GGDA 1VIDA 4QPPA 4EKGA 3LL7A 5BP7A 5LSAA 1NV9A 1VBFA 4AX8A 4BLVA 4E30A 3EVGA 3ANXA 3REOA 4PNEA 2ZSUA 5EKXA 5EC8A 4RTMA 2E5WA 3RW9A 1XDZA 5FQOA 2JH8A 2DPMA 2ZZMA 3KQMA 3G2QA 2PX2A 1P39A 3GRZA 5HILA 5K0JA 3HVJA 5F2NA 3UJAA 1ORIA 2WK1A 2PGXA 3BGVA 3UJ7A 1JQ3A 5E1MA 1WG8A 5LQCA 4EVIA 2BH2A 3FTEA 5FWAA 2YXEA 1YZHA 3PX3A 3R3HA 3HEMA 3JWGA 5K0BA 3DXXA 2ZBQA 3OZSA 5D1NA 5EMLA 2FRXA 2H00A 3FRHA 3TPZA 3IV6A 3HTXA 5GIPE 5EMJA 5GWXA 3DXYA 5IH3A 2FHPA 5C0OE 4X60A 2OYRA 3L8DA 2ZIFA 2P8JA 4F84A 5MHTA 2NYUA 3C3YA 1JG4A 2OB2A 1N2XA 3HCEA 4LECA 3PLAE 3GRYA 3GU3A 1RI3A 5EMMA 1XTPA 5JUWA 1N7IA 2I6GA 1YFLA 1YF3A 5LR6A 3BWYA 2ZIEA 4PYKA 2UYQA 4YUWA 1FPQA 2P41A 5FUBA 1L3CA 1L3BA 3F4KA 4AUKA 1NBHA 2ADMA 3ELWA 3M33A 3P9IA 1I9GA 1V39A 2CWWA 1X19A 2IDKA 1VQ1A 3LKZA 5DM2A 4CTKA 3PX2A 2QY6A 1PJZA 3KR0A 4F86A 2N47A 3LCUA 5CCBA 3EGVA 2OKCA 4X61A 5C1IA 5ICCA 2ZW9A 1WZNA 3FRIA 2EG5A 2G71A 2OY0A 4YUVA 5KVAA 2P3LA 2ZVJA 2AS0A 5GM1A 1NW5A 4V0QA 5KS2A 1FJXA 1SVUA 1IY9A 2PT6A 3JWIA 5DX0A 3H2BA 3A7EA 2H11A 2BR4A 10MHA 3FZGA 2NNWB 3FYCA 3A7DA 1FP1D 3GJYA 3I5UA 1EJ0A 3LBFA 2YX1A 4OQEA 2JHPA 5HIIA 3EEYA 1M6YA 4YMHA 1R18A 1M0EA 1KXZA 4F85A 4HC4A 2GH1A 4DM3A 5GP1A 5T67A 2QM3A 5H02A 3A27A 2ZULA 3SMQA 2XVMA 3BGIA 1BHJA 4X41A 3EVFA 1Q0TA 5C9ZA 3CKKA 3G2OA 4QDJA 1ZGAA 4PONA 4EK9A 2I9KA 1FP2A 2P7HA 3LCVB 1P91A 5EEGA 3GO4A 1XDUA 4MTLA 3SXJA 4KDRA 3OU7A 2ONYA 3MCTA 4C06A 5BXYA 3RIEA 3PVCA 1KYWA 2Z6UA 4OA5A 3OZRA 3P2KA 3DLCA 3FPFA 2UYCA 1XCJA 4G56A 4QTTB 3LDUA 1R8XA 2O57A 1AQJA 4E2YA 5F2OA 2GPYA 3BGDA 4EMSA 1TW2A
chains in the Genus database with same CATH superfamily
3HFRA 3WBBA 3ICOA 1GR0A 4KBGA 1E9SA 4MIOA 2CUKA 4HAYA 1LNSA 1J1ZA 4XUDA 5GGYA 1DRUA 3QELB 1Q5PA 2I1WA 3O82A 2WUVA 3U4AA 3VNQA 1ZR2A 1RYFA 1Y7HA 2AX3A 2IEZA 5BN5B 2CLIB 1Q2XA 2Y6UA 1AKVA 3ZHQA 4H15A 5A3QA 1DQNA 2JEZA 1B8PA 3RANA 1LWOA 2HK7A 3UB4A 3ZZ1A 5BSGA 1JLKA 2QLFA 1ZH6A 5GVRA 3JQQA 4M76B 4PC1A 4AP6A 5CDHA 3LUDA 4JOSA 4PRLA 1IC6A 2TRSB 3FW1A 1R2QA 1ADBA 4O1MA 5DLEA 5EE9A 4IKEA 4YP6A 2YJGA 3HP1A 1EK5A 1HWYA 2D74A 2ZRDA 3VX4A 2Q4OA 3DEFA 1L6IA 2B1RA 1K6EA 2FFQA 3H8JA 4O08A 4DEYA 1GUZA 2IYWA 4M3NA 3LBAA 4BC1A 3TUJC 3KYDB 4TQ9A 3TCXB 2YKGA 1UL1X 2HWYA 4BEWA 5JMWA 3SYLA 3OWXA 4M1MA 4Z9BA 4ENTA 1MX5A 2IZ1A 3NYIA 4FGWA 4C3OB 2ZIXA 2QORA 4U7PB 4AULA 4BHTA 1ML3A 1XAJA 2B2CA 5ER6A 2G7MC 1SY7A 4P7FA 3DA8A 3T5GA 4D97A 4YP7A 3SS9X 1U2RA 2GHQA 2XWPA 3ZDYB 3PXGA 3AEKB 1AVTA 1G5HA 2OC4A 3N8IA 3UG6A 3FN4A 4KXXA 2RH4A 3G89A 1XJ5A 2ACWA 2P27A 2GJ8A 2XX3A 2YXDA 3AI3A 2NU9A 2B82A 3AUSA 3OCXA 1E60A 1E0DA 4LOJA 5CFOA 1QO9A 3EVNA 1UAGA 4LVCA 1QOPB 5EHGA 4NV0A 4BNLA 3FHLA 4BFLA 5FWYA 5LP6B 3FUWA 1JQAA 1PG0A 2JFQA 1V3QE 4P83A 2VNHA 2EQBA 4J76A 3TPFA 3DO6A 1UP7A 4LNUB 3X1MA 3JQEA 1S8AA 1CD5A 1TLFA 2RGBA 5DHRA 1E7SA 1A9ZA 2NIPA 4NMMA 4K26A 4WCFB 3W90A 4YRJA 4DLTA 1GXSB 1WW8A 3EXG2 3MT8A 3ZK7A 3WE7A 1N9GA 1P0CA 3PJEA 4ZICA 3M4ZA 4PYNA 1OMOA 2BN4A 4QYXA 3ZE0B 3GP8A 2BFDA 1L5KA 3ND8A 2C29D 5KSPA 3QFFA 3TSWA 2XUPA 3EIEA 1KFCB 1BVUA 2FWRA 1PK9A 3X43A 4BKUA 2ACVA 4HH4A 1P1CA 2DZDA 3W7VA 2HNKA 1QC5B 2ACEA 3DFMA 1A9PA 1CQPA 4RO0A 4V03A 3TEMA 4RKWA 3V4SA 5FAKA 2YWBA 2HPZA 3M6AA 2ZUFA 4IY1A 3TR0A 3TMYA 4AUNA 5JRZA 1ZH4A 2C97A 2ZJ8A 4AJKA 3H17A 2Y92A 1BDMA 2BLLA 4MGKR 4UXHA 1JS1X 3EZXA 2V0CA 3WK6A 2GZ2A 4ZKEA 3ETGA 2XLBA 3EA0A 4FE4A 4Y6LA 1XZIA 5BYBA 4UUPA 1OZHA 5IZCC 3P4UA 2HX1A 5JYCA 4MV7A 3E0QA 5A6VA 1EFPB 3OF5A 4R2WA 3KOWA 4EW2A 4XGRA 2M2IA 4EELA 1A5ZA 4X64B 5BRNA 1BMDA 3VR6D 1P29A 2QMEA 3G5TA 1NV8A 2R65A 1VJRA 4RD2A 5B2EA 1SG6A 4D8YA 1AZSC 1ZUD1 3KZVA 3PSAA 3KKZA 4EKDA 4YRIA 4F7DA 1USGA 1SK9A 3H5RA 1QG6A 5COAA 5K3AA 3GRCA 4YP1A 4PCUA 5EHNA 2G07A 3UW1A 1VKOA 3CB4A 4K86A 3FR8A 4Q7MB 5AM3A 1RPTA 1IUKA 3NIDB 3NUZA 1SZDA 1Y6ZA 4M46A 4L4SA 4C03A 3QPCA 1X8XA 3C0KA 1AXRA 2F3RA 1P2SA 1TAHA 3ZU6A 4CWAA 3HB4X 4MR7B 3R0XA 3PZRA 1LW6E 4TKLA 4NVRA 2JLQA 4QTUB 1AUPA 1Y3HA 3MWJA 2B9VA 3S1AB 1WQ1R 3FX2A 4JLOA 4KB5A 3HH8A 1JKMA 4PPYA 4LK2A 1E7RA 2SECE 4L76A 2CFRA 5H70A 3UMVA 1EX1A 1YZUA 1B93A 2AK2A 4XZ3A 2YZKA 3B1KA 1SKYB 3GUZA 2G72A 4G0NA 4LRUA 4B2YA 4YJKA 1WJGA 4UMDA 2GDJA 3A05A 5ENZA 4HBGA 1IXZA 3AVUA 1RQ7A 1TU4A 1U11A 5D8DA 1BWPA 1CZUA 4WXHA 1C0KA 4ZVMA 3DWEX 4KQ1A 4CMHA 5DNUA 4P58A 5IZCA 1DKQA 1SA0B 4DHWA 3LPAA 4E6PA 3GFTA 4FGZA 1YIDA 1EBUA 2M6LA 3SCZA 2AOUA 3N53A 1Z2AA 1XFDA 4UNPA 1I4LD 5C4MA 2JGIA 3IDAA 5IXJA 1PE0A 2JLRA 4Q9KA 2VYNA 5L45A 4MB2A 1Y7LA 2Q9AA 1NQOA 1BDBA 4DS3A 2QW8A 2GZMA 2QUAA 4DJFC 1GKLA 3GH3A 3HA5A 3QU5A 3QUBA 2NXCA 2CFOA 4LW8A 5CW1A 1E77A 2A6PA 1QKIA 1DBVO 1TUBB 3KKKA 4R1QA 3T4PA 1NP6A 1XP8A 3PPYA 4ENPA 2PLAA 3ZVNA 1U0BB 2BTQA 6YASA 3DB1A 2FLVA 4L0DA 3ZE2B 2DSNA 2AT1A 4AQYB 1PT9A 2QSZA 1PZNA 2XCOA 4WEQA 2C9MA 1OHHA 1FYWA 2D5IA 3CZMA 2HI0A 3QVVA 2A5JA 1M10A 3H5NA 3HA7A 2QBYB 2ILTA 1OWLA 1RJDA 3QM1A 3DAOA 2XA2A 4EX6A 2BFCB 2JVJA 3Q5EA 4P54A 4X92A 3DP7A 1H2RS 4A73A 1I2AA 2C8LA 4W63A 2IW1A 1WSDA 2R11A 2UU9B 3LGAA 3QHPA 4IVQA 3CRQA 3PDIA 3FB4A 1HBJA 3KJQA 3V1YA 5TSDA 5J63A 1JLSA 4TVKA 2VDKB 3K15A 4U3JA 2I2XB 4G01B 2PUHA 2E9SA 2BKAA 3C6QA 2EL7A 3L1IA 4URWR 4JSTA 3FYDA 4IMIB 4RZHA 5FPSA 2FUG1 3IPYA 4G5RA 4IVRA 4HF7A 3DMDA 3HCWA 3AFOA 2HDNB 1JTVA 4JROA 2ZJAA 4AN0A 3AFMA 1XNGA 2IYSA 3HPRA 3IP8A 4XDYA 1W36B 2AEMA 2NVOA 4S2UA 3R24A 3NJRA 2J6BA 4MS4B 5LB4A 2GX6A 4YMUA 1JH9A 1VYUA 2Z0MA 1EBFA 4KE7A 4BQEA 3GGJA 5EKSA 1FFAA 4OD0A 3HK2A 2Q5IA 3IQFA 4PCAA 2O9JA 4QQ8A 2LP4Y 5DX1A 4DARA 1BN6A 1OUMA 3W7AA 1M2OA 3D5QA 4HLDA 2HUNA 2QLTA 2J0VA 4KHZA 3ENKA 4HRVA 3EC2A 2ARKA 3LIPA 3OMLA 1H9CA 3ZV5A 1JAIA 1FUKA 1LRLA 2VP0A 3VNAA 1GPH1 2W5UA 3E23A 2CVPA 4GR9A 4Z2YA 3QA9A 5KREA 3GFPA 3E7WA 3U44B 2YR0A 1H2WA 4JDPA 1H5UA 2DBQA 2XA9A 1KH2A 3AGPA 4I1IA 4KTVE 5AW5A 3FSGD 3STHA 4DQ0A 3GX1A 2C2OA 3E18A 1PQWA 4ZHSA 2D5BA 4HCJA 3TL3A 1FLAA 3LK7A 3A1VA 3DT6A 2BGLA 3QU2A 2L19A 1PVDA 4IZOA 2H8GA 1E6KA 3G5LA 4O2BA 4RVFA 5A4AA 5G3YA 1FP7A 1JA9A 3ZN2A 1CUJA 1T0HB 1KI4A 2RFLA 1Z8NA 4Q4AB 3IUPA 2ZUTA 3U4GA 5ALVA 3IEVA 1J5XA 4DY4A 2X1HA 4BNMA 2O5EA 2OFOA 2LDXA 3Q87B 3PR1A 1F8UA 5E6RA 3S68A 3ZIUA 1MABA 5AFSA 3WLAA 3G8AA 1XG5A 3NVKI 4RVHA 3ZNPA 4G0VA 3JPYA 1OQAA 1J0XO 5TY0A 3VSBA 2R9VA 1JG1A 1KO7A 2BHNA 1MW9X 4GE3A 5I48A 3HM2A 4ZDIA 1M75A 4N8SA 1KMHB 4ARCA 1NTRA 1T5OA 1JDZA 3ICVA 4NEHB 1JU3A 5IEBA 1ISRA 4LRTB 2FP3A 3P9YA 4GRDA 3E22A 4KACA 4LDJA 4QUEA 4YAGA 4O2AB 4NPCA 2FHSA 1X2EA 1NVDA 1W5SA 2O8VA 3H0EA 1IZ7A 4KXQA 4LY9A 3KLBA 2G1UA 4HRAA 3TDMA 5AKHA 4C4XA 4DM4A 4NBLA 5EP3A 1A2BA 3MS2A 4LPKA 1VE6A 4JP5A 1DRJA 1PWXA 1PR9A 4DV1B 5ALFA 3L0PA 2WYHA 2X1LA 4PSDA 5FBWB 2J5XA 2HA7A 4EGCB 1I14A 1E79A 2WKSA 1BS9A 4DGQA 1QGUA 5JXGA 1BKYA 3CYFA 1Z3CA 2GAJA 4R2KA 5K0CA 5JPCA 3WZMA 2UYHA 2O2EA 1C1HA 3WLSA 5KHLB 5CVDA 3U3MA 1IPHA 1Z5GA 3EGEA 3EWSA 1QZTA 2ONZA 3T52A 1U4NA 4LWZA 4OV6B 1XXHB 2I2BA 4XJXA 3TD2A 1TI7A 4OLBA 4IWNA 3X1YA 3PHLA 4W1SA 2HCJB 2WJHA 4LOAA 5JH7F 2YJ5A 1KIAA 4F6RA 1EGQA 3SS7X 4B45A 1TOAA 1JA1A 5C34B 1FVXA 1YOBA 1W87A 2MDTA 4QE3A 3FDZB 2GESA 4TZKA 3D64A 3KTDA 5JMTA 4AMZA 3GT7A 3AHHA 3HVUA 2ZREA 3BXGA 4DYHA 4KH0A 4ZVSA 4BDSA 2B0JA 1EK1A 1K92A 4RX1A 3HVRA 2VLBA 3SC4A 1RZVA 1TYCA 1SCKA 4QM6A 3TAXA 1SG9A 1UQTA 2ZIZA 1CY1A 5A04A 1GRVA 2OLEA 3LO5A 4M9UA 4OK6A 4IH9A 1UM9A 5JYDA 1RHUA 1P1HA 2R84A 1P1KA 3U1BA 1DP4A 1ENYA 2RH9B 5KCZA 2OBNA 3E35A 1O8BA 1ADJA 3BE6A 3NEJA 3NBZC 4C5BA 4QBTA 1U99A 3H0CA 1VIDA 3OQIB 1ISMA 3PNMA 1KY3A 4F72A 1OGIA 1UMBA 1NUAA 1E3WB 2FDXA 2PKRA 2VJPA 3P0HA 3RS8A 4E30A 1MAUA 1VBKA 1YJ8A 3AESB 4NMLA 4RGYA 3F6YA 3K0AB 3R7NA 4D02A 1CP2A 4JY7A 5AKLA 4A2CA 2X41A 2GSDA 5DYTA 4IJWA 3LLVA 4A8JB 1RQ2A 1R5NA 1G5FA 1GZ7A 3BGVA 3Q3EA 4N0QA 5CJJA 4A03A 2XMZA 5LN1A 2WU4A 3QKSA 4KKXB 3JATA 2GFQA 2YN0A 1LK5A 3OZSA 4IUBS 4XFKA 2VK2A 1Z35A 2PL1A 3NOQA 4GPBA 4MS1B 1HPLA 1V3VA 2OG1A 5GWXA 4KO8A 4F2GA 5IX8A 2FHPA 4LHVA 2WD7A 4CE6A 1XZ8A 4EBBA 4WGGA 5LWQA 2P8JA 3T3EA 2BY4A 3JD4A 4UM9B 3QFCA 3U5ZB 1QBGA 5ALKA 2CHQA 1ZMOA 2MSKA 5GJWC 1AB5A 2FG6C 3C4VA 3CEAA 3WLNA 5HCNA 3ZHRA 1ZA2A 4O4LB 3WSVA 1NBOA 3C3KA 1SWVA 3L1UA 3Q6NA 4ARUA 3O3OB 2I9PA 5LR6A 2C84A 1YNSA 4KN8A 5LMUB 2W6NA 3O03A 5G53C 1FX0A 1IWPB 3IEXA 1IPEA 1C4KA 2H1VA 3NNNA 4OMDA 2P67A 2Q1TA 1EB9A 4KGZA 3F4KA 4FWBA 4H16A 3S44A 3PC8C 4XX0A 3SC3A 1I9GA 2VP6A 2IDKA 4XVRA 1NNEA 1K3FA 5EIAA 2IP1A 1DPGA 1TQ4A 3ITKA 1Z0DA 4LFBB 4BZQA 4EPTA 1SKQA 1YA4A 4ISBA 2ZYUX 2DY1A 4RM3A 4YNBA 2C2YA 3TJMA 1P18A 4YDQA 5JYEA 1C8VB 4C1NA 4H1TA 1U0HC 4H77A 3FMOB 4AKHA 2MT9A 1QU3A 2PRZA 1FJ2A 4UCQA 1T13A 1S5PA 1VPEA 3A8TA 5TVKA 1EEXB 2AS0A 2AX4A 3PL1A 4OAOA 4WUTA 1ZW6A 4QREA 5EE0A 3PQFA 4MLDA 3VO9A 3WIVA 4KP7A 2QD3A 4B6GA 4BS9A 1GU1A 2KHZA 1V3TA 4MA5A 10MHA 2P4HX 3QLTA 1N2HA 4R1UA 2GRJA 5C5CA 1FU8A 3O3MB 1LI4A 4DM7A 2HDOA 1NVVR 2RHHA 1EM8A 2PUWA 1XALA 2ZUBA 3JARA 1M2FA 3G6WA 1WW2A 4R84A 4WLNA 3NVDA 3PJGA 3S4YA 3SF0A 4DM3A 3AUYA 5T67A 3MEQA 4AS1A 3U26A 2W8BA 4PXYA 3GQVA 4TRRA 4JLMA 1JHMA 2XUFA 2CNKA 4NFYA 3ENZA 5AW2A 1Z7EA 1KNQA 1E9VA 3ZZMA 4BATA 1E1RA 1C3EA 4YDSA 1K7SN 1D5CA 2WLSA 1QFMA 1DC8A 4L4XA 2QL9A 4MUXA 3G59A 4P5EA 3N59A 4Z9XA 1ZICA 2VJDA 2ZI3A 3FWZA 1ZOLA 2RARA 5EGNA 5HS6A 5KYUA 3U4DA 4BFCA 2P6UA 3ZV6A 2HBYA 3PC8A 4MUMA 4G56A 3RSQA 3STYA 3JV7A 2O57A 4O4HB 4ZDKA 2M6RA 4QU9A 3TUZC 4Z4EA 4WK0B 2Q6TA 3ZBUA 4LJYA 1PGNA 4FYWA 1KZ4A 1R5BA 2YRFA 5SV2A 3L8HA 5CA0A 4G86A 2R6JA 5NLLA 1FFDA 2PM8A 3B3GA 4RMJA 2CLMB 4Q39A 4EYGA 4BFZA 5K8IA 5DH9A 1CJVC 3HMQA 1CJCA 4MP8A 1FDOA 3PHGA 3EXHC 2OPHA 1OPXA 4UD6A 3D6MA 4J7CA 4DJ5X 1QE3A 2NU6A 4I9HA 4P3PA 4I3HA 3MHTA 3VKHA 2Q4TA 1DBRA 4X00A 1PUXA 3ED5A 4TMXA 3MK31 3QMWA 4Q4CA 5JJIA 1N2CE 2CLKB 4MYTA 2AC7A 4YEDA 3CGGA 5EJ5A 3I09A 1QFXA 5EHQA 2Q4RA 2OBYA 4OUDA 1D7OA 1M34A 2IIVA 2Q6KA 1DX9A 4Q4DA 5AW6A 1P4HA 2DCMA 4FYVA 5JFGA 3OCVA 1NL3A 2W2LA 4P2BA 1RYZA 1NT2A 3RU3A 5BV8A 1AV6A 3JD2A 4LHEA 1CHNA 4KMRA 3CIFA 2EYUA 4C7MA 1CR0A 5EZ6B 3LFHA 3F7TA 1O57A 3K0FB 3IO3A 3N87A 3N3BC 1FYXA 1Q0HA 2PJDA 3QW4B 1T9HA 1W94A 4MMYB 4QPNA 1SVOA 4RXMA 4XX1A 3OC6A 3ZQ6A 1A8IA 3P2JA 1U6KA 1QV7A 3U0BA 3IVRA 3TTUA 5LKAA 3N7TA 3NFYA 1JG2A 4CGYA 3I6MA 5EMNA 1S3FA 5JMPA 3ZGZA 1C14A 5D7BA 4ZI7B 1L4MA 1VGQA 3FTCA 2OK8A 1JDTA 2DHEA 3ELBA 1QYVA 4N7BA 3UV3A 1GL7A 2PZFA 2RH5A 1ORHA 2PAFA 1V35A 3GLVA 3RJTA 2FUKA 5LKRA 4J29A 3CX8A 4PRYA 4U0KA 2WYVA 3RRBA 2AXQA 2VJYA 4DQKA 4TTPA 3MIIA 4K9RA 2GN6A 2DR3A 2JS7A 2ZDHA 2WNHA 1E3LA 3EXHA 2F1JA 3HP7A 1CFZA 1EVEA 3JWHA 4W8HA 5F5XA 2P6PA 3QU7A 4RSRA 4ECEA 1U7PA 4Z54A 5B7QA 3PUJA 2F3PA 3HYLA 5AI8A 2BBSA 2CL6X 2NQ2C 4ND2A 1U2EA 2QN9A 3R0VA 2G1JA 3FMIA 1EESA 1FYEA 3HRKA 5IVIA 1N0WA 1KAHA 4JH0A 4X1KA 5DGTA 2QRKA 1YDWA 3DE4X 5AW4A 2NT4A 4CNBA 2G9UA 2GBIA 2XUJA 2JLAA 1QNLA 5FWXB 3NBKA 3OWHA 4JLSA 5LVAA 2OO3A 2CFSA 3CVUA 2E85A 3MYRA 1HNNA 4DV0B 1LJLA 1E1CB 2XMCA 1T8SA 4ALMA 2FGJA 5TPWB 1XA4A 2CLCX 4MGEA 2B21A 1H8HA 3DTVA 2WT8A 1IWBB 2P9ZA 1IRIA 2WIJA 3HGTA 4FFRA 2DWUA 3RVDA 4MQBA 5FNVA 4YRLA 5FH9A 1X7WA 2QU8A 4Q4JA 3AEQA 3O4HA 3R5HA 2I4MA 4GLOA 5DWQA 1HMYA 2FW0A 4YJGA 2Q46A 4JYAB 1SBIA 2FN3A 3OZAA 1N2CA 1SHLA 3NTLA 5I8PA 2B1QA 1OGJA 2YJ4A 3FAKA 4YMVA 4G07A 4L08A 1KQOA 5MF6A 2ZR9A 5JJKA 2IH4A 4LDNA 3MA0A 3FOEC 1NATA 1PT6A 3GLTA 3R5TA 4RD0A 5EGSA 3WNVA 4UZSA 1XZKA 4HNHA 1WKVA 4LBVA 5LPNA 3AUUA 3O9ZA 2E6KA 4TM7A 5FEUA 3FFWA 5FLEX 2HV9A 3L06A 1W7AA 2J85A 3GLSA 3WYNA 2E4ZA 4F9FA 3O21A 1OC4A 1GZ5A 2IXEA 3VDQA 4NQZA 4ZYVA 1G20E 4G9EA 1ZVMA 1M7GA 3A6GA 3DVQX 1WRBA 5HKKA 3ZWBA 4HB4A 3CRNA 3UO8B 4V2UA 2HHJA 1UDRA 1GKKA 3C8MA 4RXUA 2XEDA 4AMUA 3I04M 4BX9A 5H16A 1NUTA 1VPDA 4E5YA 1GNLA 4DCCA 3AIIA 1VG9B 2QPOA 3P96A 2YOGA 3S7TA 5FX2A 3FOZA 4M0MA 2GN2A 4NENB 4RVNA 6CHYA 2IBSA 2WJYA 5EWMB 4G5XA 3KELA 2VKQA 1PJCA 3S8EA 1EFDN 1C7EA 2QVZX 3ETEA 4KUEA 4DC1A 2PEZA 4WESA 4Z1MD 4WADA 3JQBC 5KSOA 1A2KC 1RT9A 3B82A 3IPXA 5B5SA 3CKYA 1RQNA 2OHFA 4PWYA 3EB9A 2HWUA 4QAJA 5LA6F 1RWQA 1T0BA 4O1HA 4KIFA 1I4TD 3OZTA 2OCYC 1NE7A 2YZ2A 3D3QA 4D9KA 4AMBA 5IVKA 4RV9A 4I9GA 2X2OA 1O94D 3FNEA 5D3ZA 2G76A 1QSGA 2DFNA 1QGZA 2X3FA 1ZCBA 3OBBA 4IIXA 1BU5A 1XJQA 3LDAA 4B3RB 1FFXB 4PZUA 1WA5A 4R1SA 3TL2A 3JVEA 1O97C 4XTCS 1NURA 2PX5A 5DTIA 1Y4ZA 2Z3WA 4ZMRA 3HBNA 3UJDA 2NTJA 1EDDA 2QIOA 1P3DA 2XIJA 3JZDA 3NKVA 5TV2A 2ZJ5A 4LZNA 4FJ0A 4QFMA 2VP5A 1H94A 4BRZA 1UR5A 2FSPA 2GAIA 3G8DA 3WKAA 4OBWA 2AG1A 2ERCA 1A5SB 4FYIA 3W5AA 1E9DA 1IM5A 3T7EA 3FMVA 1VHDA 1YZQA 1R3DA 2ETVA 1K66A 2AL7A 1WP4A 4FBMA 4G26A 4PCLA 3ICPA 4GSKA 4PC3A 4RZQA 5D7NA 3W78A 4AJ2A 4ZCMA 1A9RA 4LE0A 2I4RA 5COQA 1FCJA 2EWVA 5T4HA 3TOZA 1YGYA 4KPYA 3IESA 5C8VA 1HT0A 2JAHA 1L4HA 3I6BA 1JFLA 3JQBA 4AJ1A 4NULA 1C9YA 2C58A 3HACA 3OMXA 4RTLA 2CJWA 3DXZA 4OSPA 2XQJA 5DSZA 2D0DA 2XNJA 4IZIA 1DX4A 2KSQA 3EZNA 1CNFA 2R47A 4WQMA 4MP3A 3L82B 3CBQA 3D7LA 2QTWB 3DKKA 1G20A 3MT0A 3IA2A 4PFKA 5E2IA 4Z4QA 3ORYA 1A4UA 2OECA 3DXFA 3NH6A 2WC1A 2V45A 4MDEA 4BRWA 2EL9A 3IELA 3PTZA 2II6A 3DTTA 1N2IA 4L5AA 3TKAA 3WWZA 2EV9A 4ZVLA 1XJWA 2IS4A 2FSIA 1DEKA 2B1JA 3KXPA 4DVGA 4UQLA 3CW8X 4K2HA 2Z2IA 3L8EA 3OF2A 3WZLA 3SP1A 2AZMA 4DLLA 2AOWA 4O5OA 4CKBB 2H2FA 3OMWA 5K8VA 3PC4A 1EFAA 4L15A 3PICA 1VBMA 4DSTA 1CZKA 5C32A 5K3FA 1AQNA 5LLTA 3B7PA 3ZI0A 1CLEA 4M49A 1PR5A 4G4SP 3HNPA 1DCTA 5JD3A 2BL4A 2B25A 1QZXA 2OCXA 5LWHA 1XZJA 4QDKA 1RADA 4DDVA 5JI2E 4C2TA 2C3PA 4DLZA 2V7QA 1E2JA 2PLNA 4RORA 3VC2A 2NUBA 1CDEA 2ECOA 2Y1KA 5AKYA 2QW0X 3OZUA 5BSFA 4KGDA 3SZ3A 3I73A 3DCIA 2WUGA 5IDQA 4NCAA 4R2HA 2QZ4A 1OLOA 1U1CA 1I51A 2C2GA 4ZO6A 1NY5A 1T5LA 2XOKA 3WLMA 4AIRA 4FE3A 1KDOA 5AHKA 3RRYA 4J9UE 1KMMA 2FDRA 4L5YA 4OBEA 2JIQA 1DRVA 3GUCA 5E7QA 3I62A 5CW2A 3HHEA 3KQOA 3QVGA 5FYDA 2SKEA 2VHTA 2Q21A 3L2OB 4GI1A 1TO2E 4XM1A 4A1OA 4BLTA 4CLOB 2DQZA 3A1DA 4Z8XA 4P35A 5HFJA 3BWVA 5CNIA 4LE2A 1UKVY 1E1NA 2VTDA 4IXTA 5A0TA 3LXRA 2VSYA 4Z3DA 5KPDA 3PJRA 1MUUA 4AZTA 5DIFA 1W0JA 3BMNB 3HY4A 5KWEA 2E5LB 2MSLA 4ENRA 8ADHA 5J2TA 1A77A 4MGIR 3WLIA 1K3UB 1SXJD 3N0TA 1JHAA 1VHWA 1Z5WA 2VRNA 4DB4A 1N8SA 1RRCA 2H08A 4RNCA 3UMCA 1PSDA 1N7JA 3WYCA 1P45A 2B6NA 3BKXA 2WRZA 2I8LA 3FWPA 1PFQA 4M2LA 3ROXA 4J8PA 1O0SA 4NBVA 5E7IA 2GM3A 4KR7A 4CL8A 3ZOZA 2JJQA 4N39A 2GZ3A 3ORRA 1TF2A 3Q3GE 5KEIA 4O4IB 1AZWA 2QX7A 2B8NA 1XTTA 1Z4KA 1GLNA 3KHSA 5FLYA 1C3OA 5DGCA 3U39A 5BXQC 4BU1A 1INLA 2H7CA 2BMEA 1VMEA 3ABQB 5JV5A 5AW8A 4URUR 4V3CA 2BELA 3D7MA 3X0DA 2QB5A 7REQA 2Y4OA 4GNRA 2IE0A 1J25A 1Q22A 1LNQA 5FTNA 4NHOA 1IMOA 3W4KA 4CJXA 2OP0A 1OAOC 2W8ZA 4OKSA 4MI9A 3BZWA 1CY8A 1YL5A 4YAJA 1KNXA 1FQWA 4UQOA 2GJ9A 4CR8A 4EPYA 1FQOA 4HB3A 2FPGA 5JAHA 4GSLA 1TX4B 3HN2A 3HRHA 3LKVA 3HM9A 3K6JA 2OXEA 3OIDA 2XXJA 1DARA 1X94A 4I1PA 2B92A 1L7RA 4HYYA 5ISMA 2J8ZA 4UUMA 4Z0NA 4AY6A 1W6UA 5BMVB 3QX3A 4EJFA 2HSDA 2KW5A 1F2UA 1G6KA 2WVAA 2VEDA 1Q7TA 4MR8A 4QAQA 3VSAA 1KDPA 3EVBA 2C61A 2WA1A 3G02A 3F0TA 1NUPA 3M4NA 3OKPA 3P71T 3JQAA 4RH1A 4GR5A 1BE0A 4CKYA 1FRQA 1V7ZA 1ZK4A 5DN6A 5KQSA 3UENA 4CUZA 3IAS1 4CI0B 3VA7A 2BGIA 2NZUG 4I14A 1LV8A 3UHPA 1VDMA 1ADGA 3TZCA 1PX2A 4P3KA 3P9PA 2CHVA 2IKQA 4MW0A 4NOLA 2XT9A 2BHSA 4DJEC 4Z4FA 4G5YA 4P81A 5DOVA 5DK6A 4ADSG 4FWIB 1NBME 1C8LA 4B3FX 5KOYA 4W5WA 1S8FA 1JBEA 2DUJA 1Q77A 3CLSC 5CD9A 1NOKA 1CS0B 1NMYA 3EC1A 4L2IB 1RJ9B 3OIFA 1UK9A 1S4MA 1NVBA 3NPMA 3PBKA 2QD4A 3UJ3X 2C3OA 2WWWA 5EC8A 5DYYA 3OTOB 3C98A 1CY7A 1BEZA 3GQBB 3MRXA 4U0JA 5CA1A 3JY6A 5FAXA 3EZ6A 1BXZA 1MF7A 2CWDA 1MC5A 1OYOA 2J5RA 4KQXA 5FPTA 1WG8A 4IQ4A 5FUYA 5HDQA 5LQCA 4TRMA 2F4VB 5KVQA 3G7SA 3IEUA 3KUXA 1E2IA 3QY0A 4WINA 4Y1RA 1XAGA 4YJFA 4QFCA 2NUPA 4EHFA 4UQPA 3BK1A 4RMIA 2X3UA 4EFNA 3MRTA 4ZAYA 2A78A 2B7CA 3V1LA 4XWTA 4MIEA 4X60A 3L8DA 1ZK3A 2OV8A 2I2DA 5FBZA 5HKAA 1B6RA 2HIGA 4G1FA 5B36A 2V96A 2ZSBA 4LECA 5F3DA 1O95C 4GKJB 4LX0A 5FO1A 4XRRA 3A6PC 1IN8A 1RXYA 1N7IA 3C8UA 3NBQA 4UVEA 3K8ZA 5AM0A 3KQNA 3LFTA 1VSTA 5WRFA 3QVXA 3OIVA 3Q7RA 1NZDA 1P8AA 4GR4A 4ZT5A 4NU8X 1MB0A 3ONFA 2P41A 4M7WA 1T6ZA 4F2HA 1L3CA 1UPXA 1PG5A 1U0TA 2ADOA 3F49S 4KV9A 5GONB 3S27A 3SBXA 3V2UA 1E9FA 1O7JA 3AL0C 4B2IA 1Q0TA 3HFJA 5HUHA 1OBVA 2FW1A 2R97A 3N8HA 1VQ1A 2XRZA 4L50A 5A9SA 2QY6A 1GT6A 1CUFA 4GP7A 2FF7A 2Z9BA 4G0QA 2BM1A 2DHCA 4KVGA 3JYPA 4P4TA 3ZDDA 4UXIA 1DOZA 3ADKA 1DJPA 1ECBA 2OC9A 4Z9YA 1OJ7A 2WHPA 4YALA 4D1YA 3D7NA 1MEJA 2PFGA 2D1RA 5CP8A 1CHDA 3SFVA 3RC3A 3R3WA 3ZKWB 4IJMA 3RG8A 4DDWA 4INAA 3VC3A 5KVAA 5A5DA 5KS2A 4Q9AA 1CF4A 1ES9A 1YBHA 4HWSA 3A7EA 3LXUX 3SXUA 2VK1A 2D3TA 2GK7A 1NXPA 5EJEA 5SY6A 4EHBA 3C14C 4RE5A 2C2XA 2VUHB 3GDWA 3T3DA 4F1KA 3M3HA 3EEYA 3AR2A 3H1TA 1V95A 5AW3A 3VOAA 5C5DA 1ZZGA 5HRUA 5TMBA 4B5LA 1JF8A 1NBMA 4D9HA 4I6GA 5EZYF 3W5HA 1JAYA 3EFEA 1O95A 3EHEA 4ZOEA 3UV6A 4MXDA 3KXKA 3T35A 3TLXA 3MLEA 2OGUA 3Q3JB 1OIWA 2BFWA 1RPJA 4JI7B 2VNKA 4YRRA 2IU6A 4FC7A 3VJKA 4G41A 4JNCA 1WUKS 4MVJP 2ONYA 5BXYA 3RIGA 2NZ8A 3MD9A 1EZ4A 3WGHA 1DWOA 3EXEA 5JFOA 1JA0A 5J1TB 2GPYA 5F4ZA 2JI9A 4II2A 1D6SA 4YYZA 4F5YA 4OGGA 2ECFA 2J67A 5JCJD 2V1XA 3CNEA 4MAFA 1QFZA 2EJBA 3TSYA 1EH5A 1JKFA 2MYUA 3E7FA 3HNRA 2EZTA 4Q82A 1BX3A 2VUIB 1XD9A 3H2GA 3H3XA 4KO3S 4OL0A 1ZJJA 4D80A 1NM5C 3E9CA 5IN5A 1KYTA 4O29A 2WKWA 4EY4A 3LMKA 2AOTA 2D2EA 4ENWA 1J07A 3B1VA 3EPKA 3WGNA 1I2DA 1BVYF 2MMCA 2O2YA 2XMRA 1O1YA 3TW8A 5FBHA 3X44A 1VE7A 3IJEB 2HWKA 2CHGA 4GYJA 4DE5A 3WWEA 3RO7A 2JCSA 4RPGA 3L0IB 1N0IA 1NY6A 1RBMA 2IHVA 2NQTA 3FPHA 2PCLA 3LX6A 3LY8A 3UMGA 1LX7A 4JMLA 3DWFA 2P3QA 1N9ZA 1SVLA 4ER5A 2IYOA 3AFNA 4KWIA 5IBPA 3ZWAA 3L7LA 2ZUCA 3DM5A 4GG1A 3SOPA 5GZ6A 1FBTA 3LYUA 2ZFUA 2NYRA 3D81A 5GM2A 3ROQA 1V4VA 5ES3A 4PYLA 4ESOA 4EG1A 2P2YA 2RGNC 1PLLA 3TSCA 5G0VA 2RBGA 3N2KB 3OJCA 3LPLA 3DZDA 3M8KA 1UC5B 3GBSA 4HQ6A 4X91A 5L51A 1L5SA 3UB3A 3O31A 3GFRA 3IIIA 1N2OA 3PNQA 2AI3A 4KHPB 3OTWA 4DHEA 2IX3A 4JJZA 5J4VA 1JN0A 2VI5A 4P3NA 4YJ3F 3JZIA 5FEMA 2Q07A 3I30X 3LT2A 1UBNA 1SBZA 1KH1A 3FHTA 4MVJF 5JAPA 2IUFA 2J59A 2IHTA 1QUEA 1MN6A 4OI1A 1FTYA 4PNHA 3DHWC 1Q1BA 3EEOA 4GMXA 1NM5A 4ITUA 4H6WA 4DWOA 1I6KA 1RHQA 1MKYA 3HNOA 3IIEA 4J75A 4MX8A 4PYIA 4HAZA 2W6IA 2YVKA 5DJ5A 4D98A 3UMRA 1OHHD 2VEOA 2GD0A 3R8CA 1Z6YA 2ODEA 4UPDA 4UUQA 3WGOA 5K5EA 2RHGB 4BFVA 3AR6A 1TYEB 1ZD8A 1DV1A 3ONEA 3PVSA 4MCIA 4MKXA 2ZCUA 3RUIA 4E0BA 4KEAA 2PBZA 4A16A 4YUXA 2QUZA 3BRCA 4KQCA 4N8DA 4PXSA 3L92A 1AK1A 2Y8EA 4PTZA 1EUYA 4OXKA 2QNRA 3OE7D 1SQ0A 2NU7B 1G17A 1CUIA 3BL5A 4I36A 5CFZA 1J5EB 1QCZA 3GIWA 3TXAA 3LWNA 2RGNA 3WA6A 1QHFA 1B41A 2B4AA 2XSZA 2YW2A 4ZZ2A 5INTA 1FS4A 1WZCA 1QZ3A 4K9SA 1D4AA 3H6GA 4V0NA 4PX5A 1U0SY 1PJLA 4OUKX 1NFQA 2YJZA 3W6UA 2P40A 4BO8A 2EQ5A 3U7GA 4P7GA 3PX7A 3S2IA 2CLSA 4ZC8A 3U3JA 1CY6A 1T6BY 1TTTA 5E7JA 4ALJA 1QZZA 2XAUA 4C20A 2P62A 3SZRA 3KSBC 1R4MA 1T3HA 3GC6A 5FD8A 4G1VA 1LDGA 2WT9A 1KU0A 2GFHA 2VAWA 1D3AA 1BE6A 1L7VC 3QLJA 5EZQA 2WYIA 3W4IA 5CXUA 4J3NA 4O0MA 2RGXA 2BFFB 1N9KA 1ADYA 1CS4C 1X7YA 2AD1A 3GG9A 3IR6A 3R3ZA 2Z9CA 4HNRA 1Q7GA 4LA4A 5MGBA 1LK7A 3FIUA 2EJTA 4DNQA 4YONB 3HZOA 3JYOA 3CC8A 5L40A 2XMQA 4P84A 4ABYA 4C2AA 5LL6P 2JGNA 2QXUA 3D2AA 3L7JA 2JBHA 2BM8A 4IHJB 4MHOA 3ZHXA 2BISA 4L51A 4XGQA 2ZS7A 4OFBA 2VXOA 1E1LA 3TGLA 3BUSA 1A9TA 1NSFA 1D2NA 2I8AA 3O8DA 1SUSA 4L22A 5E9WA 2P0YA 4HHEA 3G8BA 1Z4QA 4X90A 1PFWA 3H87A 2VIIA 1OA1A 2BFEA 4M8NE 5CDYA 3J80A 2J0QA 4R6WA 2B3TA 3CKLA 3UT5B 1GCAA 4J0IA 1AN9A 1VGVA 2GNOA 1S8OA 2VNSA 4F8JA 1I4DD 1V2GA 4ZQEA 3TI7A 4WN3A 1Z06A 3ROGA 4YV1A 5EJ6A 2FP4B 1SVNA 3I37X 3A3NA 3ON5A 4TOIA 3WKDA 4WAUA 4MARA 2PWPA 3IS3A 3N05A 4JYBA 4N47A 4UREA 2XBLA 3T38A 4EVSA 1L7DA 4ZEMA 5C8YB 5BWBA 2P9HA 1IEWA 2Q1SA 4OI0A 3QF7A 1IM8A 1G21A 1YVEI 2P9QA 2WILA 4MRRA 3D8NA 5DKFA 2RI1A 2ZWOA 1TYBE 2W90A 5IW8A 2YXBA 1T4GA 1TM5E 4GPAA 1NR1A 2AJ8A 3W5VA 1ZHFA 4EI2A 2CHFA 4LRWA 1YMUA 1ISJA 3OEED 1MRNA 4B80A 5KZMB 4MVCA 4Y1FA 4FKBA 4AJOA 5AKXA 1ZNWA 3EYWA 4OBBA 1RJFA 4I8XA 2G9VA 3C48A 3FJYA 1UPTA 1BEEA 3NC4A 1AHIA 4QG3A 3KP1A 2PMDA 4URYR 3D6AA 2W93A 1FU7A 3PHIA 3K1AA 3DFZA 4GSYA 5CLQA 3LBHA 4MW9A 1IJBA 1JR2A 4QHYA 2VVTA 4X6YA 5C4IA 2XGJA 2UXDB 2OHOA 1A9QA 4PHTA 5TGDA 3UK6A 1IHYA 1KJWA 5DPMA 3WY9A 3IEKA 2H1LA 4E2WA 3UAZA 4UARA 2QX4A 1PV2A 4WX2B 4B32A 4LDQA 1HFWA 4TWJA 1BG6A 2D1YA 4EQ6A 2SNIE 4MWZA 4KQJA 3EG5A 3DC7A 5CYPA 3U17A 3F6BX 3LRXA 1ESCA 5CIQA 4K9NA 1VA5A 3IRUA 4IIVA 4TSFA 3VH3A 1Y7IA 3VRHA 1L8OA 1ORWA 4BX3A 1JEYA 3B13B 1OBFO 3FUUA 2CL5A 5BSMA 4CG0A 3EBOA 3FZQA 5DBGA 1SBCA 2C7OA 2QQ0A 1GTMA 2P9YA 2V97A 4I1OA 1B2LA 3G13A 2J3MA 4G0PA 2RB5A 3QKWA 2MSEB 1BA2A 5GPBA 1EUCA 1D2RA 1EG7A 1UADA 4YHHB 5D2CA 3TNLA 1Y37A 3IMCA 1AD2A 4EKIA 3K73O 3ZK8A 4GZ6A 5CH3A 1QMPA 4K05A 3G0DA 5K3OA 5AHOA 1WP9A 3E70C 2AJBA 3UHAA 3A25A 3NVMB 1JWAB 4TM8A 1GU7A 2OXFA 2CNOA 2R7KA 2X58A 1V11A 5J4HA 5JSFA 4UNSA 3WHLA 1RMYA 1KI3A 2W6QA 1TEVA 1ULTA 1X3SA 5HIKA 3TLGA 2F6RA 4BKQA 2PX0A 4IJQA 4JXZA 3FCXA 1L6RA 5I9SA 1NQVA 1L4KA 1Y98A 1Z73A 2B20A 3D6JA 4M8IA 2OWDA 5AJHA 4RHCA 3GROA 2PTGA 3BCSA 5I8WA 4I55F 3TX2A 2XKJE 1GGMA 5K6AC 1CUXA 1E6LA 3OSUA 1RC1A 4PSCA 4NLLA 4XWGA 5B53A 4ALKA 6NULA 4FFDA 2ZYGA 3F2VA 4HN2A 3TF5A 3GVIA 4JNKA 1L5YA 2XR1A 4OX9B 2FEKA 2JA2A 3EWIA 2YYZA 1D9XA 1EFHA 2G17A 3MTGA 4RJTA 5B4VA 3K16A 3N7AA 1KR2A 1YQWA 1JHOA 1KU6A 2JIZA 2O1SA 3KAJA 3KD2A 3QXGA 4GZMA 1IJEA 1KFJB 3IQGX 4ARSA 5IJZA 2HBRA 3HFSA 5K09A 4QJ3A 4HY3A 3M3PA 1T8RA 1XKTA 2I2CA 1W4RA 2J9ZB 2QV0A 4HDOB 3KFLA 3VC1A 5KU7A 4LNHA 5FUVA 3TW0A 5AVVA 1D8AA 1WCIB 3P7MA 1HSOA 1K08A 2W6MA 3OU6A 1CULC 3U16A 1I5OA 2ZTUA 2BFPA 4AD8A 4QRHA 4DLYA 1UFKA 2O8EB 3QX7A 5CDFA 3INTA 1Y1SA 1JR3E 4URXR 5HQTA 4XLLA 4PIMA 2NU8A 4XYEA 1EWVA 4BPRA 1XZDA 1DLIA 2OD7A 4HEA1 4R1PA 4UULA 4BP3A 2OYCA 1GTL1 3UHFA 2HRBA 2AMFA 2VPQA 1P2GA 1RW4A 3DBIA 4RADA 4WIAA 4LYJA 1I3CA 4FOOA 1G2QA 4IMRA 4PAOA 5PNTA 4IIBA 3UMMA 2ZE6A 1RBQA 3LE8A 1MX1A 4J2TA 3RVRA 1F14A 3IHLA 3KE9A 1YMVA 4DR3B 5K6AA 3B5IA 4H3SA 1BXGB 5EWJB 1SOAA 2JFYA 2PYIA 3KLOA 4C3ZA 3V48A 1VKZA 4DUYB 4BLRA 2WYWA 5DM60 2DULA 3AG5A 3QHQA 5CGQB 4X7MA 1T3LA 5AVRA 1LDEA 1PP4A 3NHWA 1JYFA 3P8ZA 4KCGA 4R2IA 4RY8A 2UZ3A 2X4DA 4AZ0A 4XJVA 3D4OA 1C3VA 9LDTA 5FTWA 3GZJA 1JHUA 3HN7A 3TZHA 5AVXA 4ZHQF 4FKMA 4GWKA 2Q5EA 2FPSA 1EWTA 4QOFA 1GGKA 1R6UA 2VH2A 2ZRGA 1XLTA 3MMPA 2AFVA 3RFUA 3L7CA 4QOEA 5T41A 2NT3A 3QBDA 3K31A 4Z49A 2ZRLA 3G0BA 1G3IA 3SJBA 1SD5A 1TVCA 4BLPA 4B4VA 2O0HA 1UT6A 2W11A 5KAMA 1EXVA 1A50B 1NW6A 2QL7A 3Q7SA 3CUTA 1HLDA 1XT6A 4C2UA 3AEZA 4EG3A 1QGDA 2LVBA 5IVDA 1WUHS 1TM3E 2VHVA 3BJIC 1KKLA 1URPA 5LNK1 2H07A 4LZAA 1KMCA 5F9HA 2FE4A 1JP7A 3OBIA 4JKOA 1E1RD 1BQ4A 2O8DB 1RLTA 1DIHA 2E6UX 2DKFA 4BE4A 4PGAA 1JNYA 1K8RA 5DBHX 1L1FA 1JDBC 3WL8A 2W2PA 1P0PA 3WMWA 2XWJI 3QU9A 3WYDA 3ZY4A 1QLJA 1ZL2A 4NDZA 4D74A 1PL7A 2V7VA 1PLJA 3F6RA 3PFCA 2JLYA 4QXRA 1Z2PX 3EXIA 4O2LA 3KQQA 5I7UA 3JTMA 1PJ4A 2OXRA 1VYVA 4FYPA 5EMHA 1DZ3A 3DMYA 5CM2Z 3T3NA 1TVKB 1CQXA 2IE8A 3VZBA 1VKRA 3FCEA 3BQ9A 5FTMA 2IYEA 1WM1A 4GGPA 4N82A 4DF3A 5HR5A 2ZXEA 4YBZA 3G2JA 3GV0A 4KLCA 1YS7A 1E98A 2PXCA 2CLDX 3COSA 4GQAA 1JR3A 1H8ED 1F5NA 1C4OA 1LDMA 1UPAA 1WXFA 2HUPA 2PR7A 5DVZA 3GJRA 1BN7A 3VHLB 2EC5A 2OLJA 4C01A 5C18A 1RXCA 2ZSUA 4JFRA 3T1YB 1BXRB 1JNXX 4EABA 1P5RA 4LHZA 2IYYA 3HO8A 1COWD 4HKTA 3PNBA 3B70A 4UDXX 2D5AA 2BPOA 3H2HA 2J3DA 1F8FA 1SOWA 4JJ6A 3VJRA 4BMOB 3QZUA 2I78A 2ODWA 3Q7TA 1V8OA 1LTQA 2WF5A 3OURA 4O4JA 3RYIB 5DT9A 3D1VA 1U2PA 5ELMA 1KEZA 2IPOA 5BORA 4MV8A 3W2EA 1L4NA 4QDZA 2P4EA 3WHKA 4C88A 4ITVA 4OYYA 5JADA 3WP1B 5LZ4A 2Y05A 1ONNA 1GG5A 4PXAA 2VJCA 2BH9A 4WERA 1N36B 5I51A 3OOWA 4Y2SA 3RD5A 3UUFA 4NQRA 4UTRA 1WE2A 2HGSA 2CCJA 2OFXA 2FXVA 4HUQA 1WNTA 4M6WA 3X1XA 1DLJA 3A9UA 4WOJA 3FVWA 5EMMA 2XRYA 3W2IA 4KXUA 4CV0A 4G0XA 2VTKA 4DFDA 3U3KA 2F64A 4GM1A 1TUEA 5FV7A 4MQEA 5HTKA 4AP5A 4X1IB 4D79A 3ZLBA 3HJFA 4RETA 1IHDA 4MWEA 2YDXA 2DQ4A 1T5SA 2J87A 2PSJA 4BFUA 1NLZA 3NBXX 5TQ0B 4JDUA 5K6RA 5KVCA 2Y9PB 3G1TA 1ZFNA 4Q12A 5HM6A 1TAGA 5FV4A 1NULA 4BVJA 1Q16A 4TPKA 3WVNA 2N47A 4OIFA 2JGKA 4A23A 2ZI7A 3OX3A 5AKGA 3OJWA 2H5IA 4NJMB 2FEAA 4OAQA 3WAKA 3IBFA 1WZNA 2XNSA 4KMOA 3D02A 2X15A 4A0QA 2NZVG 1R0LA 2PNJA 4BFWA 3FPCA 3BH6A 5GM1A 4Y2XA 1QXSA 1WPXA 5JISA 4B3MB 3OFND 4H35A 1UXJA 2ZJZA 3OTIA 2X4GA 2PAAA 1UDXA 3PKZA 3PPVA 2DFDA 1CZRA 4IDGA 5DX0A 3WK8A 4E5DA 1BZYA 4QGSA 1IY1A 3VPAA 4ZAXA 5EJAA 3IE1A 3DNMA 3G49A 4DEVA 5B2FA 5CURA 5IU6A 3AJEA 5BV7A 1H8HD 3PI6A 1EX7A 3DTVD 5BWNA 4KI0A 4Z9FA 3ANYB 5ALMA 1XI2A 5DIZA 2DTEA 1DELA 4DIDA 5AUQA 3SMQA 2Q5OA 2NVWA 5C8ZA 5K51A 2DF8A 4TQAA 1YSCA 4PONA 1DEAA 2WWGA 1HL7A 2CDAA 2XCIA 5DP1A 2J5QA 3OX2A 5AOBA 3PXXA 3VR5A 4CF7A 5K3SA 1DKLA 3AVPA 4TYPA 2QXTA 3V7YA 1MAAA 1IB0A 4HLNA 2CF6A 4JMPA 1MH9A 3GAMA 3EZYA 2VCYA 2J9FA 3BD9A 3V2IA 1CQZA 1R66A 2HIMA 2JCYA 2XQVA 3UWSA 1KK0A 1WSBA 3EZFA 5F2OA 3F78A 3NNDA 1KY5A 2NX2A 3OJOA 5LQKA 4DSUA 4RTOA 3ZD6A 4U7WA 4PTYA 4E4RA 3AERB 2I33A 4L02A 4QHSA 4R40A 1YHNA 1B0PA 4F60A 3BHNA 1J8QA 2H4ZA 3T7IA 4QBFA 3VQTA 1UBSB 5EUCA 1L2TA 1FNNA 3E7DA 4NSNA 3U48A 1BSVA 3VR4H 2Q0QA 3LRPA 3FPSA 3O75A 5M7EA 4X6LA 3KTOA 3ZXUB 4QJ4A 5IXSA 1MO5A 1RZRD 1ZD1A 2BYTA 1ORRA 1B0ZA 1YI1A 1Z2OX 3TH5A 5A5VA 1N2GA 4KQWA 4OHBA 1JG7A 1MVNA 2BCJQ 4AKEA 5IABA 3ZD7A 5KNBA 2NM0A 5BOSB 2EU8A 4RMHA 1C81A 3AY3A 3A9TA 2JL1A 1I7SB 1Z12A 3BL8A 4HI0E 3N75A 4HDSB 1K27A 5C1DA 1AGNA 4QVGA 4XPIA 2BGTA 1RHJA 2IYZA 1DIBA 5HCUA 5T3YA 1EFLA 5DI3A 4FLFA 5L3QA 3ZG6A 2M98A 5HIAA 1BDHA 2AXEA 2WIDA 1NC3A 1NI5A 3TRIA 4WNAB 1M7BA 4OP1A 3DCYA 2P4SA 4TSKA 1M66A 3I6IA 1J0AA 1JDPA 1YRBA 4GZLA 4DJAA 3VNSA 1SO8A 2O2HA 1OLXA 3HBLA 4H1HA 1GG2A 2V5VA 3HJCA 1HTTA 2OORC 3T7CA 1ZR4A 4B84A 2PSSA 1E2HA 3DZ8A 2ORVA 4AVYA 1PDVA 1Z5UA 2KX7A 2Y0PA 5MFZA 2BEJA 4UZFA 1EQ2A 4Y6PA 4YV0A 5K03A 1GPMA 1SU6A 2HO5A 3EDRA 3I2KA 5LBIA 4XCQA 1P0QA 5AI9A 1I3OA 1ZK1A 2Y99A 3IDSA 4JVNA 1XEXB 1NVKA 1VECA 3OZCA 4BUCA 1T8YA 2FKAA 3FGPA 3G2KA 3I5YA 5FPKA 4XYLA 1XU7A 1KSFX 4Y9UA 4TZ0A 1W2HA 1SRRA 4R71A 1C1DA 3FDXA 4MV1A 1O87A 3HCAA 5EOVA 3T06B 3DEHA 1HDOA 5TQVA 3ZQKA 2GF9A 2A9FA 3F74A 4ZCQA 3DL0A 1L4BA 5IAJA 4AFNA 1BW9B 1NP7A 5IVPA 2AZTA 3CW2A 1EVZA 2XMPA 1ND6A 3WNDA 1QTIA 4R9VA 1V0JA 3L4EA 1T4CA 2A9RA 1ABEA 2OHXA 1SCAA 2VA8A 3WWCA 1YE5A 4OL9A 2IEYA 3ANLA 3Q9LA 4EB6B 1QX3A 4F46A 3HKBA 1A8HA 3KSZO 2WW8A 3PUXA 5E4YA 1ZEMA 2WMOB 1QVZA 4I4LA 2ZI5A 4CM1A 5LC1A 4LXTA 1QU2A 4DKXA 2BF7A 2OORA 4LJ8A 4NZZA 4RPJA 4CYMA 2A1TR 5U9CA 4N5DA 1H05A 5F76A 3DYBA 4FK8A 3GMIA 4BVHA 3BK7A 2FEOA 3T94A 5HHTA 5IHPA 1M7HA 3SQOA 1T4MA 5A4JA 4TV9A 2IYVA 3P26A 3OPNA 3IR7A 3ODGA 1J0CA 2P9BA 4RKRA 4URVR 2G09A 3IDZA 5DI9A 2IP2A 4WJKB 5TT1A 1T6YA 2XVAA 3HCOA 5DCLA 3KQYA 3TECE 1YFZA 2FAXA 2PPLA 3EZ7A 1T0UA 4BJ6A 3RYFA 5E95A 1OTYA 3AZQA 1EB8A 2ROQA 3K35A 3VR2A 5IT5A 3LLSA 4YRAA 4Y30A 3CVOA 2C4TA 2Q7DA 3JQ8A 1I32A 5AVUA 1AUVA 3SR0A 4RTPA 4KFCA 1A9YA 4I1VA 2GFIA 1HSZA 3PL5A 3HU2A 4PFJA 3PUVA 4EO4A 1BS1A 3KKEA 4JZYA 1AC5A 1SVWA 3H9GA 4ZV7A 3KHUA 4IKPA 1QV6A 3OJ0A 4REMA 1ODFA 4GPTA 3V4VB 4JUAA 5E1OA 5GJBA 2H3HA 2DFLA 3IBCA 3RS5A 3AVYA 1BYUA 1XQ9A 4Q4LA 2EJCA 2R1TA 1J2EA 4CLHA 2IPNA 4FZVA 2C31A 2PUVA 3TQTA 3JQGB 3W0LB 3IJPA 4LXIA 1N6OA 1MU0A 3N28A 4EIWA 5C5IA 1NN0A 1U2DC 3G2NA 4R4JA 4E5UA 5FOQA 3TG8A 3K96A 1U2ZA 1HY3A 1J0BA 1TF7A 1ZD5A 4MRMA 4E15A 5B2ZA 2XTNA 3ZEAA 3ZJ4A 1Z5VA 4YCSA 2V59A 4RJ2A 4J7UA 5LZ2A 3ZHZA 4P22A 1GRCA 2FSVC 3FB1A 3R44A 5JLJA 2B83A 5BSTA 3NAQA 4DZTA 1NMSA 3COYA 4ZP1A 1SAYA 1ZSVA 1USWA 2O23A 2PWBA 2YIMA 1Q1EA 3HJBA 4JUFA 3N2EA 4MAAA 1EFTA 1Y6JA 3IQEA 4HXYA 4PQYA 4YQZA 3BMOA 4AZSA 2DEUA 1KYZA 2PTHA 3DAPA 3M3DA 1J9ZA 1UOOA 5B64A 2ZYIA 4CTNA 3RADC 2YL2A 3KT6A 4ZODA 1Z6PA 2FPIA 3CF0A 3LD9A 2W2NA 4PZ0A 1NC1A 3ZHCA 4KR3A 1JIJA 1OLUA 4A36A 1DBWA 1FJHA 1NHWA 2P78A 1KHHA 1L8XA 1MJGA 2W43A 4QEDA 2BHRA 3T54A 2AN9A 4E03A 4K3VA 2AZDA 3L6DA 3C7KA 3HWRA 5ANRB 3I9LA 1RAEA 1XVAA 4IEEA 5DCUA 1RE0A 3C6ZA 2NQ8A 1ATZA 2EGUA 3D7RA 4LGMA 4MW6A 5IJ0A 4B3CA 4OCZA 4KN6A 4ZQGA 1KETA 1O77A 4KQIA 4PO9A 3IOEA 3LA6A 4MQ4A 4RF2A 2QROA 2B6HA 2WBLC 3CIOA 3S2UA 4RTJA 5L7TA 4KZPA 3TSAA 2FK7A 4ARAA 1VXOA 2ZIXB 5KX5F 2WD8A 1H1TA 1H3FA 1W5TA 3FUXA 2YOHA 2YV2A 1U2DA 3IBGA 2PT9A 2EVWX 1TPYA 2QZPA 4OJQA 5K4HA 2DWCA 1O9HA 3KFXA 3UZUA 4JT8A 1N33B 4YO8A 1OU4A 1MAWA 3OT5A 1RI2A 5KO2A 2NU9B 4GOLD 2FPKA 2C5GA 1QE0A 1QJ4A 3Q7IA 2XBUA 3SM3A 1I4EB 2FSVA 3HGMA 1WX1A 3P2EA 4UNNA 4XKJA 2A9JA 1U7TA 3QH4A 3G5UA 3O7WA 1KQFA 4P4LA 2XNDD 5DNWA 1U6IA 2FX3A 4JU8A 3RE1A 4E7OA 4LY6A 3QE9Y 1MQAA 2DBRA 4N3AA 4CLDA 2ABWA 1L5QA 2FZGA 2WF8A 4URHA 1KQNA 3JQAD 3X1WA 1IZ8A 1DAMA 4BQOA 1P0MA 4YCAA 1YS6A 1QZUA 4GRIA 4PHGA 4D0LB 5BUZA 1KI8A 4M0KA 4B4UA 4YV7A 5JY6A 1GNRA 1ELOA 4Y2RA 2NOAA 3N07A 4WH0A 4Y67A 3EGOA 5BT9A 4DAEA 4F9EA 1V45E 5JBIA 3HXOA 5BVGA 2VJLA 1N9GB 5TNXA 2D1TA 3R20A 5TC4A 2OAEA 3RFVA 4WMLA 5AVQA 2BFDB 1GN8A 2N3ZA 2OM6A 2ZAMA 2NMVA 3KT0A 1ZJ6A 3GEGA 3DO5A 3OZGA 5A2QA 3F2IA 2PUJA 3T34A 3WG9A 4RTRA 4AKIA 1OFIA 1YKSA 1HZJA 3QXJA 1VSQA 5LOVA 1TTHA 3IVCA 1B3BA 2AQKA 2QT0A 3E53A 4AF7A 5IK2D 1ZOSA 2PGNA 2X6QA 5EXTA 2I34A 3VTKA 1USUA 4AJJA 4COKA 4O3MA 3WIBA 1G2IA 2VDMB 3S2YA 2J3KA 3PGMA 2DUUA 3IB6A 4ER0A 4L57A 2YNMD 1F51E 1U80A 2OXTA 3OQJA 2HM7A 3SEAA 1YIAA 2XHEA 3PDJA 3HWX1 3KEMA 1YU9A 4NPAA 5B37A 5IKPA 3QY9A 3M2TA 3GDHA 2GBPA 3HU1A 3GZNA 4B76A 2VQFB 4RV5A 1MX3A 5B6JA 4ZEOA 5HZMA 2ECKA 3Q7PA 1ZM2A 3PUWA 5C46F 2YHBA 5IBQA 5SZJA 3VYRB 2ODNA 2J4DA 1BMFD 2G08A 3HDJA 2E4UA 4WDQA 4AJEA 2FPPA 4WLOA 3GNLA 2BONA 3VI4B 4D9JA 1V9CA 2V7GA 5BQ5A 1IQUA 4OQ4A 2OO5C 4ZAZA 4F4CA 2OVFA 2XT0A 1M33A 4H3HB 3CJRA 5JQGA 2XE6A 4Q03A 4DAOA 1UT5A 2BUCA 2CMGA 3D3EA 3F47A 1T36A 4MUJA 4HDMA 4IXDA 4MYSA 4YAOA 1AQUA 2AN3A 2FPLA 2ZSIA 3IHWA 5E4JA 3R09A 2JLSA 4W1QA 3R6GA 5H7XA 3OCCA 2J3EA 1T3SA 2JFWA 2ZVDA 5JATA 3OU2A 1I3NA 4RVCA 4L0QA 4B31A 1TAUA 1E2NA 1L5VA 3QKRA 4IV8A 1SJ9A 2H5JA 3KCQA 2WSSA 3C97A 4K88A 4LWQA 3WRWA 3RF7A 1JHDA 3K9BA 5EP2A 2HC9A 1WZEA 3LUHA 1F6WA 4DIBA 3IULA 1FLDA 4EYOA 4JIGA 2OZLA 3G85A 3M5CA 2AOUB 3MCUA 2A4MA 4A2WA 1SK8A 2WG0A 1F38A 1E2UA 1RQPA 1UINA 3U3DA 1OJLA 3BMQA 3JTEA 4A3SA 1GSAA 2X77A 2YVLA 3EDQA 1DFHA 5IEJA 3GZ4A 4FI3C 1Q17A 3UWMA 3WDMA 1II8A 3BTOA 1UFVA 4EJMA 1W59A 5KJCA 3D8UA 1DKRA 1XZNA 5I5GA 4I08A 3BA6A 5F1PA 3Q3HA 2OO5A 2JBWA 3UYLA 2PT7A 1MT3A 1CJMA 2BTQB 3A4NA 1Q21A 4LFAB 4W8OA 4EF6A 2OV2A 3M1LA 2CL0X 3P2OA 4ZV9A 1E96A 1XIVA 1QR6A 2P6MA 1COZA 1GAWA 2G8NA 2G1AA 2Z57A 4KXMA 4XB6B 3I1JA 3RHTA 1W93A 3DMHA 4TXNA 1QKJA 4D81A 5ICEA 1U9YA 1FDTA 2D2XA 1JG6A 1M72A 2CXTA 3LF2A 4I66A 4KSYA 5EQJB 5F5LA 3UJ9A 3F97A 2BUAA 5AVYA 3ZDEA 1H3EA 3S1SA 1OX4A 2XGOA 4LGCA 3UVEA 4HFNA 4MEJA 2DBZA 4U3JB 2PU7A 2AUNA 4B0PA 3L1VA 5K0EA 1Y42X 3EJ6A 3G6KA 4OFWA 4U9UA 4UE3S 5BNFA 5BP7A 3V4RA 1IY8A 3CXUA 4RD3A 1T10A 3PUYA 4U7DA 5DHQA 5EXSA 2WQ7A 2WSIA 4ABTA 5EKXA 5L6MB 2LKDA 5ALEA 3ZJUA 1QQ7A 3O2QB 2WZDA 3L8FA 3FDJA 3RABA 1GUYA 4J0EA 3CT6A 1KF0A 1V5WA 5ARCA 1TEHA 4H2DA 1N2JA 3UAOA 5FBQB 1CQIA 1SHZA 3KXIA 1L4FA 1S2NA 1N5LA 3OY2A 4H0CA 2I8CA 3KNZA 3NRJA 5D5PA 1BH6A 1KH3A 4Z99A 1A71A 1P2FA 4DXHA 4HAUA 4LXXA 5E0OA 1A1SA 2IHBA 2GOYA 2W6CX 2R86A 1M2OB 1J6UA 4IX9A 4Z86A 1RYNA 4C1BA 3RTDA 2AV6A 1X3LA 4MJXA 4Q4HA 1H85A 2EDCA 2Z5VA 3GAZA 2V6FA 1Y3BE 3D7SA 3IUSA 1R6DA 4D0NA 4DIFA 3MG9A 1N3IA 1BHO1 1CW2B 1SUFA 3LPCA 1JIUA 2CNNA 5ECWA 2I1QA 3NM5A 2HA0A 4KQKA 4HLUC 2VP9A 5DEIA 2W42A 3JALA 4ENVA 3FFBA 2VF2A 4EI7A 5MN6A 2O1EA 4NCIA 1X7ZA 2DXIA 3GWGA 7MDHA 2ZRFA 3ML1A 1Q14A 2NO1A 3T9CA 4EPVA 3DOIA 4OJKA 1K89A 3RRFA 4B85A 2IEGA 4O2BB 4OJTA 4B4WA 4BNDB 4CZ2A 2B4TO 2I22A 5CLFA 2IQIA 2JFZA 1Y3DE 4QYMA 3U13A 1JE1A 2ZSEA 3AF2A 1QPZA 5J9FA 2HF7A 1IN6A 1ZIOA 3JVUA 4G0ZA 4Y3UA 3ONNA 5IC6A 5F5NA 4AWAA 1RWNA 2VPTA 4C7JA 4KWHA 2PT6A 3RBZA 4XYBA 4AY4A 5LD2C 3VU1A 5E6RB 5IDWA 3ZZTA 1MABB 4RA6A 2YYAA 1L8AA 1VLZA 4GGMX 2QVYX 3PD1A 2JHPA 3R3JA 4PHHA 3PZBA 1CE8A 2H4YA 4P86A 1JFVA 1U94A 3KB8A 4K28A 1MOZA 1VFNA 4L07A 4XE5A 4RVUA 3E22B 2XE8A 2B4KA 2FQ1A 3ETDA 1LBHA 3X3HA 1UWCA 3EVFA 4EFDA 2XZDA 1BRMA 2IQ5A 5B3LA 2RGUA 4JLUA 3NALA 2CUZA 4QYTA 3TRFA 5JE8A 1NONA 3IVXA 5A4FS 2AQHA 2BEWA 4UW9A 2R8ZA 3EFBA 1B0AA 5EZ5A 1KSJA 4HLUA 2FRVA 2PZJA 2J1LA 3WIEA 4B4OA 3DHNA 2AMYA 3MCTA 4DWVA 1TK2A 4ESVA 3G2HA 2EBWA 4DV5B 1E32A 1NZJA 1Z07A 2L18A 2FI1A 3TB6A 2XXBA 1QGUB 1SULA 2A1IA 2YXPX 3LDUA 4IEFB 1VMIA 3Q1LA 4F5ZA 1KRHA 1HXHA 4Q5IA 1ZNYA 4ND4A 4ZRDA 4D3FA 1P2TA 2O05A 4JJEA 5E3IA 1FTGA 2AF4C 3G0HA 1V25A 4UASA 3PFHA 3UC5A 4B0OA 3BQNB 4IF4A 1A4RA 1ULSA 4C9BA 2FMXA 2IVFA 1KR5A 1KYIA 5F33A 1MDFA 2E82A 3CCFA 5CIWA 3W5UA 1N3BA 3MJ4A 4F6RB 1XTIA 2BGGA 2RCNA 2PU5A 4LMBA 4G8DA 4EMTA 4UHBA 1M76A 3DFFA 3MELA 2HPHA 3F6EX 1H2HA 1SZCA 5JW6A 2YQZA 4FYXA 4OQXA 4BUJA 2B1GA 1E5DA 1HORA 2QTTA 1UPFA 4PCVA 4EPRA 1AXEA 3NAGA 3VNRA 4L6AA 3PRHA 3C1AA 4XM2A 4CMJA 3IBYA 4GAEA 3QWIA 2IPLA 5T4FA 4MW1A 4YYEA 3NHLA 1DBQA 2VZ9A 3FKSA 5L95A 2PUAA 2V6BA 3C5VA 1UM9B 2GYYA 4FQ5A 1D6MA 1RBZA 2Q2OA 3FTDA 2WDZA 4FB4A 2QD5A 1Q3HA 3KWJA 1YKFA 4LJRA 1M3SA 4QU5A 2I2FA 2OESA 2JJMA 3IP1A 4F3TA 1YOVA 1AK9A 4L5IA 2I55A 3ZDAA 1UMBB 2C9OA 3OCYA 3QPVA 4ATNA 2NTYC 2DKNA 1UXIA 1YR6A 1IJFA 2CL7X 2GK3A 4MEBA 3BCUA 4S12A 2Q6OA 1OYWA 3GJXC 3GW8A 5KWSA 2X0IA 2EFEB 4ZVPA 1KI7A 5IYZF 4JEHA 2FB9A 4PX9A 1JHYA 3BH0A 5G3ZA 1QTRA 2ODPA 3LC0A 2B2XA 1LLFA 3PRYA 4L9AA 3TTXA 4C7BA 1GKIA 2XMDA 1F4VA 3QKSB 4D44A 5H83A 3PR2B 1TM7E 4YV2A 3AU9A 3GAAA 1PFYA 1PFKA 4GBED 5F7JA 5KBYA 3BXZA 1YUNA 2CBGA 4W82A 5ECDA 1DAEA 4G5QA 4P9NA 2CVZA 3ET4A 3KB2A 1W88A 4QSMA 4TSFD 1JMYA 5EXDA 1ZX1A 4TS9A 3EPLA 3MOGA 3PQ3A 1OXBB 4BL5A 4LJ7A 4J6EA 5IF9A 3HR7A 5EL0A 3GJ0A 1TCAA 2JI8A 1RKVA 3HN6A 2EFCB 3CEJA 2HLDD 2J45A 4WY5A 2LDBA 5ECYA 2COUA 2R66A 3KRTA 5IJ9A 4RKFA 2XNCA 3A1TA 4UVHA 1PBNA 2LV8A 5ESRA 5H80A 2BD0A 3N86A 1N5RA 3KDPA 4FNMA 1FX0B 2Y9MB 2ZT5A 2ZWAA 4L28A 5FOWA 5JNLA 4C4OA 1YB5A 3GPBA 3CJQA 4NRDA 5AKEA 1G5IA 3SXPA 3UGTA 4D0GA 4ZO4A 4EYSA 4F4DA 4K1XA 2VOEA 2CV2A 2AZ4A 3WO1A 1G3QA 1TIBA 5F73A 4I7EA 4EUHA 2CMKA 3DT9A 3EVEA 5A62A 4GD3Q 4R1TA 4DV7B 1XCBA 2RAFA 1Z6QA 1N6KA 3CN7A 2HU5A 1JKIA 4NH0A 4NK5A 1RI1A 1DO8A 4CF4A 5ELLA 4YAFA 3K9GA 4ZU1X 1SIBE 1XZPA 2DPHA 4AMYA 2AB0A 2JFHA 2GF0A 2QYOA 3I92A 1IZZA 2HBZA 1SKUA 1GPDG 3MJEA 2OXCA 3O0TA 1ENZA 4OLHA 5H0IA 1YACA 2QE6A 5TR9A 3ZYCA 3DAGA 4BP8A 3O0DA 1E5VA 1QF6A 2AA3A 1G19A 1QP8A 3A37A 3JARB 5FHQA 3CG4A 1DGQA 1H0KA 1OAKA 1Z75A 3O93A 1SU4A 2V6JA 4K87A 2OGWA 2JIZD 2B99A 2W8BB 3MPOA 3U7IA 4TMZA 1EIZA 2I7CA 1WU8A 1IZ9A 5EXXA 1HA3A 2UZAA 4XFJA 1Y8ZA 4YCCA 3ETJA 4IDAA 5IUKC 4MWOA 1CZOA 2XECA 3K4HA 2VQ6A 5TF0A 2ORYA 5KYUB 1GTRA 4G85A 2PSEA 3FPGA 5LQDA 2VNIA 2EX4A 5CR9A 4LSZA 3EEBA 3GNQA 2BMFA 1VDZA 2HHCA 3X1JA 4MDYA 2ZKIA 1J33A 2IJGX 4CL3A 3G5AA 2QG4A 3FKQA 5B58T 5CA0B 2CV1A 1BWSA 3JQ6A 3UGKA 3FTPA 2QLBA 4PC6A 2ZAGA 2B4RO 5DM4A 2ZBFA 4HFRA 5LZ5A 3HDTA 3WS7A 3F73A 2AG5A 3PIDA 1SC3A 1VLJA 3RS9A 3S7ZA 1PL6A 1PUJA 2NU6B 4JLAA 3JVIA 4JT4A 2H85A 1CKEA 3ZWNA 4AO8A 2X7HA 3HDHA 4OQNA 3SJAA 5IJWA 3IAS6 4G1CA 4BMXA 1P6QA 1Q3KA 4ND8A 4DUGA 2C5AA 3EASA 4MIYA 1LLCA 3NHUA 3MGCA 4OUDB 4TWRA 5GOZA 1Z88A 4A4DA 4PZEA 1IQ0A 5FLKA 4ASUA 3W5IA 1A9SA 3GUYA