4LG1A

Human methyltransferase-like protein 21d
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
218
structure length
217
Chain Sequence
b'DPLRSFVRVLEKRDGTVLRLQQYSSGGVGCVVWDAAIVLSKYLETPEFSGDGAHALSRRSVLELGSGTGAVGLMAATLGADVVVTDLEELQDLLKMNINMNKHLVTGSVQAKVLKWGEEIEFPSPPDFILMADCIYYEESLEPLLKTLKDISGFETCIICCYEQRTMGKNPEIEKKYFELLQLDFDFEKIPLEKHDEEYRSEDIHIIYIRKKKSKFP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein-lysine methyltransferase METTL21D
publication title The Crystal Structure of Human Methyltransferase-Like Protein 21D in Complex with SAM
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 72
structure length 217
sequence length 218
chains with identical sequence B, C
ec nomenclature ec 2.1.1.-:
pdb deposition date 2013-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10294 Methyltransf_16 Lysine methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4lg1A00
3PTAA 1YFLA 2AOTB 3DP7A 4PIMA 3EVFA 3NDIA 5EHIA 4HH4A 5BW4A 2FPOA 1XVAA 1ZHFA 2UYOA 3OCJA 1YUBA 3JWJA 4X61A 1KHHA 3D2LA 2YX1A 3SSOA 2ZSUA 3E7PA 2ZZKA 4GF5A 4PYLA 1N7IA 1NBHA 2WK1A 3KPYA 4QVGA 2LD4A 1RJFA 4RVDA 2ZZNA 4OX9Y 2OB2A 3R24A 2VDWA 3MQ2A 5F2OA 2P3LA 3CBGA 3HCFA 3C3PA 2ZWVA 5DM2A 3T7SA 2CL5A 4P58A 4OBWA 1I9GA 4PYJA 3SMQA 4OBXA 1TW3A 2XYVA 1NBIA 2AN3A 3DLCA 2CKDA 2AOXA 3HA3A 2NNWB 1PJZA 3FTDA 3LDGA 3OZSA 4QQKA 4R6WA 5E8JA 5EIFA 1FPQA 1NW7A 3T7RA 4AZTA 5K09A 4GOND 3I5UA 2BR5A 5GINE 4XUDA 3DMFA 3JWGA 4PONA 1YZHA 2GB4A 3ER9A 3MCTA 2B9EA 5EMMA 4P7KA 1IM8A 3GGDA 4AX8A 4GC5A 1UWVA 3I9FA 5E8RA 4PCAA 4H0NA 3OFKA 4HG2A 3G2OA 4IV0A 3UJDA 4CKEA 5LQRA 4RX1A 2Z6AA 3PB3A 2AZTA 3NVMB 5EMJA 1RJDA 1TPYA 3OPNA 4PYQA 4CTKA 2CMGA 2YXDA 4X60A 1O9GA 2HR1A 2OZVA 1VL5A 2I6GA 1X1AA 1R8XA 2OPBA 2BR3A 3BKXA 2XVAA 1SUIA 1VE3A 3HNRA 3OU2A 4QPPA 5EZQA 2V7EA 3KKZA 5M5BA 3BUSA 4U7PB 2QY6A 5D1NA 5DRTA 1DUSA 3R0QA 3NWEA 1EJ0A 2NXJA 2PV0A 3KR9A 2E5WA 2VP3A 4FR0A 4KVZA 4RYLA 3DTNA 3DH0A 3LKZA 3IHTA 2IGTA 2UYQA 2O07A 4PYMA 1MJFA 3Q7EA 5CCBA 3IEIA 3UJAA 2PWPA 4PYKA 1XCLA 3G2MA 3GRVA 1P1BA 2IPXA 2YUIA 2WA2A 5DM4A 4POOA 3CJRA 1VIDA 3UJ6A 1O54A 4RTJA 2PX4A 2HMYB 3LECA 4FSDA 4DQ0A 2A14A 5BP7A 5HZMA 1ZQ9A 1XTPA 3KQQA 5HIMA 2ZWAA 1QZZA 2NXEA 4KIGA 3UJCA 3BGVA 3QV2A 3TRKA 4RTQA 3BZBA 1NKVA 2HNKA 3C3YA 5CVDA 1KR5A 5DTRA 3E23A 4DKJA 3FUWA 4JXJA 5HIJA 3TLJA 5K0CA 5DXJA 5DWQA 5EOVA 4IKPA 1EQAA 2B25A 5LQNA 3RIEA 4EKIA 5CVVA 5F2NA 5DT2A 5E1BA 1KPGA 5K01A 4FSXA 3ID6C 5K0GA 4RTMA 5LQKA 3V8VA 2OY0A 4ER6A 5HIKA 3SGLA 3HM2A 5LQUA 2GPYA 5EGSA 1EIZA 3EVCA 3OFJA 5ICCA 2FYTA 5CIYA 4Z2YA 5FQNA 3GCZA 5E1OA 2IH5A 2EFJA 4RVGA 3C0KA 2I7CA 2PVCA 3KQYA 3P9NA 5ERGB 4E2ZA 4RTLA 4YUWA 2O0LA 5F2KA 3P9KA 5KQSA 3PX2A 1YB2A 4AUKA 2QRVA 3MAGA 3FTCA 3P2IA 2Y1XA 2VDVE 1Q0TA 2QYOA 5EEHA 4G56A 5EG5A 2NXCA 1G55A 2ERCA 4YUYA 3EGEA 4FP9A 5FHQA 5DX8A 3I64A 1FP1D 3SVZA 1R74A 9MHTA 3FUTA 4A6EA 2Y1WA 2AOVA 2DULA 4FT4A 4CKCA 3ER8A 1RJGA 2PT6A 4YV1A 1D2CA 3KPVA 3SSMA 2BR4A 3THSA 3DXXA 3G88A 3DXYA 2UZ4A 3M33A 4C05A 3ELDA 3EVDA 3AXTA 3RW9A 2QRVB 4LWPA 5EPEA 2KW5A 3ELYA 3KQPA 4QVKA 4QQNA 5KS2A 1RJEA 2AOUA 2YR0A 4FZVA 1KXZA 1BOOA 5FHRA 4ER3A 2P7IA 3FUXA 2PKWA 4PYNA 1WZNA 3GRYA 5DTMA 3KHKA 2FRXA 1VP9A 3MERA 4ER7A 4BP1A 3EEOA 1R8YA 3GJYA 4E31A 2HV9A 3B3GA 2P8JA 1M6YA 4C04A 1RI2A 1N2XA 2PXAA 4ISCA 5GM2A 4HSGA 3KPJA 3KR2A 4E2WA 3EVAA 5K0LA 3SX0A 1JQ3A 3OU7A 1WG8A 4CTJA 3DMHA 2OXTA 2AOUB 5DSXA 1L1EA 4Y30A 1B42A 1JTFA 3DUWA 5G02A 4V0RA 5E2AA 3FRHA 3GRRA 4RVFA 4RTPA 3MTIA 2G8NA 3H2BA 1SKMA 2JHCA 3DULA 5EC8A 5B1SA 4C07A 1KP9A 1ZGJA 3B3FA 5MHTA 4MHTA 3FTFA 3HA7A 3P9IA 5H02A 2JJQA 3KR1A 3ELWA 1SUSA 3L8DA 3LKDA 4OA8A 1R6AA 4P7GA 5DRYA 2AOWA 2I62A 2P35A 2O05A 3G7UA 3PFGA 4IWNA 2G71A 2ZFUA 1I1NA 5DPMA 3GXOA 3OZTA 1ORHA 3KPUA 1QAMA 2JH8A 1XXLA 2HWKA 5T6BA 1XCJA 3EEYA 3HCBA 2GH1A 3Q87B 4KWCA 4RV9A 2ZIGA 5DX0A 5K8VA 3KQVA 2ZBPA 1AV6A 3NW9A 1YZ3A 3NVKI 3P2KA 4QTUB 4XCXA 1EJ6A 5JUWA 1R00A 5K05A 1Z3CA 2PLWA 2Q41A 3KQWA 3FZGA 4DZRA 3MTEA 1P91A 5C1IA 4PYOA 3KQMA 2AVNA 3HVHA 3A25A 3UZUA 1NW3A 4OQDA 3EVGA 3A26A 2AR0A 3HCDA 4L7VA 1FJXA 2BZGA 2XYRA 3LHDA 4WVLA 3BWYA 1NV9A 3EMBA 1VBFA 5DXAA 3HTXA 3NMUF 3R3HA 3BWCA 3MCZA 3THRA 4GC9A 1BHJA 3BGIA 3GNLA 1UFKA 3P71T 1L9KA 4O29A 5KYGA 4YV2A 1D2GA 1JG3A 3C6MA 3LPMA 3IYLW 3NWBA 2YQZA 4YUZA 3HVJA 2IP2A 3HP7A 4LECA 3UJ8A 3HEMA 5HIIA 4PGGA 1KYWA 4PNEA 4DM3A 3KQOA 1Y8CA 1SVUA 3RODA 3TOSA 2NYUA 3FYCA 4GBED 3OU6A 4YUVA 3A7EA 1P39A 5C9ZA 5DLYA 2IH2A 3OE4A 2IBTA 4BLWA 1VLMA 3K0BA 3E8SA 4KW7A 2ONYA 3G89A 3GRUA 2EJUA 3B7PA 1G8SA 4X63A 2OBFA 4AZSA 1JSZA 4E33A 4WXHA 1JQEA 4PIPA 1XDUA 3M6VA 2CWWA 4CKBA 1YF3A 1RI4A 3O7WA 5LQJA 3FPFA 2FHPA 2PX2A 3CC8A 3HCAA 3PT9A 4X41A 4FS8A 5HEKA 4PGHA 1F38A 2FCAA 3DOUA 4KDCA 2O57A 3DR5A 3LGAA 5IH3A 3VC2A 3VYWA 1NW8A 1WY7A 2ESRA 2PY6A 5CUQA 3ELUA 4PWYA 4GQBA 2ZLBA 1V39A 3ANXA 2ZZMA 4M7RA 3T7TA 5HOQA 2JH9A 3JWHA 1ORIA 1HNNA 5LQCA 3DLIA 5HILA 1ZGAA 4UOEA 3AXSA 3QOWA 5K0NA 2PX5A 1KPHA 2B78A 4PYIA 1XDZA 3HA5A 4HRAA 5E9WA 2FK7A 5E1DA 5DTQA 2F8LA 3C6KA 2P41A 2BM9A 2ORED 2EX4A 3LL7A 4M38A 2H1RA 5FADA 3BWBA 5C0OE 2I9KA 2UYHA 3S68A 1DL5A 3F4KA 4FT2A 2C7QA 2ADMA 3MHTA 5GWXA 5K0EA 3GIWA 1X1BA 5K0BA 2OKCA 3GDHA 3BT7A 1TW2A 3G2QA 3G5LA 3LBFA 5P8WA 2IH4A 4EVIA 4C03A 4DA4A 3IV6A 2R3SA 5CVUA 4MQ4A 2ZCJA 5K0JA 2GA9A 1SG9A 1L3CA 1WXXA 2ZTHA 3G8BA 5JR3A 4E70A 1ZG3A 3TKYA 4DCGA 1M0EA 3VSEA 2C7RA 2NP6A 4MIKA 1IY9A 1M6EX 1XJ5A 4F84A 4R8RA 5EHGA 3SM3A 3EVEA 3B3JA 3BXOA 5BW5A 3TM4A 2XBMA 3E05A 5BXYA 2H00A 2GAFA 3CGGA 3FRIA 4QDJA 5FA8A 10MHA 2G70A 3G8AA 3OZRA 4GOOD 4K6MA 4E2XA 3FPHA 5CCXA 5FQOA 3FPGA 4QPNA 5LQAA 4ER5A 2P1DA 4HGYA 5EMKA 5EQJB 4ZTBA 3CCFA 3O31A 5EKXA 4EKGA 5EZSA 5T64A 2BM8A 3TKAA 4RTSA 1H1DA 2YTZA 4P7JA 2C7PA 5KQRA 1XDSA 2P3OA 5K03A 3HCEA 3EGIA 1KYZA 2EJTA 5DM0A 1YFJA 4E32A 3CJTA 3LDUA 4C06A 4LWOA 5FWAA 3TMAA 3BGDA 3KQTA 2OO3A 4DMGA 1NE2A 2AN5A 4RTNA 3UJBA 5GIOE 2G1PA 4GEKA 3SR4A 4DF3A 1NW5A 1ZKDA 3V97A 3FUVA 3AWIA 1RI3A 2ZBRA 3TPZA 1WS6A 3OE5A 4DCMA 3I53A 4KDRA 4YV0A 4GUAA 3UBTA 3TR6A 2UYCA 5ICGA 1X1DA 2P7HA 2IBSA 2YXEA 2H11A 5D1HA 1PRYA 2PX8A 1BKYA 3NTVA 1HMYA 3BWMA 2PXXA 3R9XB 4BLUA 4B17A 2P40A 4GOLD 3EGVA 3VC1A 5DSTA 3A4TA 3NDJA 1AQJA 2B3TA 2QE6A 3QOXA 3LBYA 2YXLA 2QM3A 3GWZA 1I4WA 3A27A 3GRZA 3HVKA 5LSAA 1BC5A 5EKUA 4AZVA 4ER0A 3I58A 2OYRA 1L3BA 4OA5A 1AF7A 2IDKA 3X0DA 2EG5A 4OQEA 2PXCA 5FWDA 3P97A 5HFJA 5T67A 2K4MA 3T0IA 1G6Q1 4EK9A 2IDJA 1NW6A 3GU3A 3HVIA 3LDFA 3AJDA 3PVCA 3SXJA 5IKMA 3FYDA 4LG1A 5ICEA 2NP7A 3PX3A 5CVEA 4EQZA 5CD1A 1FP2A 2XVMA 4GOMD 4RSRA 2Z6QA 1VQ1A 4BLVA 1L3IA 4RWZA 5GIPE 4X1OA 5FUBA 4C08A 1DCTA 5FULA 3M6WA 8MHTA 2ZBQA 4P7FA 1EG2A 1QANA 5E9JA 3REOA 1MHTA 3R6TA 5EMLA 5LR6A 3LCUA 4Y2HA 1WXWA 3GO4A 3LSTA 4FGZA 1AQIA 1T43A 2P3QA 3P8ZA 3ERCA 3ME5A 5CVJA 2VZ9A 3UWPA 4YUXA 4MWZA 2ZW9A 5U4XA 1NV8A 4KIFA 4RVHA 2BH2A 3DXZA 4C4AA 5ICFA 1QYRA 4BP3A 2Z6UA 4XUCA 3CKKA 1JTEA 1N7JA 3M6UA 3KQSA 4KRGA 5DM1A 3KR0A 2FK8A 3NJRA 1U2ZA 1P1CA 3EPPA 3JWIA 4CXMA 2VS1A 3EVZA 5E9QA 1RI5A 1X19A 1G60A 1EAMA 2N47A 3DMGA 4U7TB 2PJDA 4F85A 4RTOA 4PCLA 4NECA 5GOZA 1KPIA 4HTFA 3PLAE 4HGZA 1JR4A 1QAOA 2B2CA 3KPWA 5CM2Z 2JG3A 2IFTA 1FBNA 3HCCA 3MGGA 5GM1A 3FTEA 2GS9A 2PT9A 1IXKA 2ONZA 3CVOA 3G2PA 2AVDA 3EVBA 2G72A 3UJ9A 4M37A 5DX1A 3UA3A 1X1CA 3ORHA 4AZWA 4V0QA 2GLUA 3TM5A 3O4FA 5EVJA 4RTRA 1JQDA 4BY9E 2WA1A 3LCCA 3AY0A 5FTWA 4E2YA 1R18A 5GP1A 2JHAA 4ATNA 3KU1A 5FCDA 2R6ZA 3FPEA 4CWAA 4HTFB 2ZIEA 4F86A 5EIWA 3CJQA 4E30A 2DPMA 4IV8A 4A6DA 2CMHA 1OR8A 1JG1A 5EEGA 1SQGA 1Q0SA 3M6XA 1VP3A 4MTLA 3WSTA 1RI1A 4YMGA 1G8AA 4R8SA 3LX6A 5E1MA 5FA5A 3UA4A 3UFBA 2ZVJA 2OB1A 5E2BA 3TFWA 3U81A 3SSNA 1JG2A 3FUUA 3PS9A 3M70A 2XYQA 2NXNA 1JG4A 1UIRA 3BKWA 3FPJA 3LCVB 4EMSA 3A7DA 1QAQA 2V74B 7MHTA 2AOTA 1INLA 4PINA 3G5TA 3K6RA 4M36A 1O9HA 3M4XA 3TQSA 4HC4A 1G38A 1D2HA 2O06A 2JHPA 1JSXA 2VDUE 2AS0A 2ZIFA 2AN4A 4QTTB 4R6XA 2C7OA 4R05A 3P9CA 3UJ7A 2ZULA 3B5IA 3PFHA 1VPTA 1KIAA 4YMHA 4QDKA 2IIPA 1NT2A 1F3LA 2PGXA 3MB5A 1SQFA 2PBFA 2PWYA 2YVLA 4XUEA 4RTKA 3P2EA 3B89A 5K0FA 2PSSA 3EMDA 5KVAA 2HTEA
chains in the Genus database with same CATH superfamily
2ZIUB 3R09A 3L7BA 4PIMA 1DKQA 1ZH2A 2FPUA 2D54A 5EJ2A 5IBRA 2WD7A 3AHIA 4UATA 2ECOA 3U3JA 3JWJA 5AW4A 1KHHA 1OXBB 1CEYA 1IATA 2RGNA 2ZZKA 4C3UA 1RJFA 2WMYA 1WBBA 4OX9Y 3A06A 3KB8A 3ZZNA 1GXSA 1GV1A 1GZ5A 2BT4A 2RGUA 3IOMA 3W2IA 3LQKA 2QZ9A 3CBGA 3HY4A 2IXGA 1CS0A 3ZQUA 1O6GA 1YRYE 2BI7A 1RAGA 1FYVA 5AHWA 1ABEA 2P6UA 1G19A 2QDKA 1EAYA 2J9YB 1RDFA 1RXCA 4U9HS 1KJWA 3TD2A 3MWGA 1F8XA 4G5OA 2QN3A 2VP0A 2WD7B 4OBXA 2PNJA 2HREA 4M21A 4UDOA 5B3JC 1PR9A 2NVUB 2AN3A 1MJGM 4L85A 4A2PA 3ND6A 5ICFA 2G88A 3B9BA 1OSNA 2D5CA 3EUEA 1LSSA 1NW7A 2A3RA 3D5TA 1TO2E 4MB0A 3HC7A 2BR5A 2CLKB 4ZPJA 3I04M 3JWGA 1H6BA 3GJXC 1GPNA 2HJ9A 2G04A 3QBEA 3T1NA 4ANFA 2Z95A 1T1GA 1Z0SA 2ZI6A 3OOYA 4Z49A 4GC5A 4FGJA 4JJGA 3EA5A 4YA6A 4HFNA 1YZFA 1XAJA 1YA6A 4RX1A 2GF2A 1QYVA 1Z62A 2W6MA 5AO9A 5EMJA 1E5QA 4WIAA 5KOIA 1UODA 2NAFA 1BKDR 2C88A 1YS7A 1A95A 2PGNA 5ADUS 4ZDKA 5C8YF 4JENA 3MELA 1Z47A 2OLKA 3GRFA 1DEHA 1ZJ6A 1P19A 4MIKA 5AJYA 4IH1A 1AK2A 1I2DA 1CUFA 2UUOA 1V8OA 2JFHA 3KWLA 4M6WA 1J2EA 2M6RA 3RIXA 4DV3B 5ARCA 1YKSA 1NWHA 2GBLA 4JI1B 5CVDA 4KVZA 2IYFA 3EZNA 1VSQA 1E2EA 3H83A 4AN1A 3WMWA 4WQMA 1XGKA 3FZEA 3VZDA 5F9MA 3W05A 4F2HA 4PYKA 3G2MA 2V1UA 4X91A 5HK9A 3ANMA 3REFA 2JJ1D 4HQRA 1FXUA 2G40A 3A05A 3UJ6A 4EEZA 4RPJA 2EWWA 4M6WB 4FFWA 2H8GA 2DSNA 1T6ZA 1QZZA 2QE7A 1E7SA 4HDOB 4NBNA 4CKZA 4XLZA 2Z8YA 3QV2A 4DL9A 5KC9A 1MV5A 1E66A 1U8EA 1F9EA 5FORA 3AESA 1U7DA 1OXKB 1RQ2A 2V4MA 2LRHA 2AZMA 1IYZA 3ND8A 4FI3F 1VYTA 4JXJA 4JEIA 3AI3A 3FLMA 4ZCSA 3RIHA 4TTQA 1QR2A 2X1LA 2HGSA 2AEMA 3VR0A 3MMZA 2VYCA 1ISHA 3JR3A 1OFTA 2NPOA 3PKJA 1T6XA 4WXMA 3DBRA 3SYKA 3WDLA 1WCYA 3RC8A 3P0EA 3R20A 2XUPA 1JQ5A 2OY0A 3L7KA 4WECA 3UGQA 1DDGA 4OUKX 5ALTA 2J3LA 3EN0A 3M4NA 1KETA 3WGJA 3AESB 2N9UA 5L40A 2AG6A 3C0KA 1H5QA 2I7CA 5BN5A 3SICE 1LCIA 4LZPA 2FXIA 3RRZA 4K28A 4AKEA 1J2YA 2A78A 4M8NE 2FZ5A 4OD0A 4Q4CA 2ZR7A 2QRVA 1QYIA 3ND5A 3PNYA 2ATCA 2BC9A 3EASA 3LHSA 5B1DA 2YWFA 3DBRB 3H5VA 2IS6A 5LZ9A 1FU8A 1RWQA 3FDZA 1ZH4A 1G55A 2VDRB 1VLQA 1L8OA 3JYQA 3H5NA 4YXWA 3W5IA 2PO7A 5BSMA 1B0PA 3T1YB 2FFAA 4KR6A 2M98A 8GPBA 2Y1DA 3W5HA 4F12A 1P7VA 1VHTA 3U60B 2C0QA 4FEEA 3W5UA 2IEYA 3U3DA 4L78A 4BRSA 2ZSKA 3THSA 5HJ7A 3DXXA 4NEGA 1WDTA 2X4DA 3CZMA 4D9BA 4Q5IA 1QFJA 2AG8A 2D7JA 1TMYA 2QRVB 2UAGA 3I76A 3D3WA 4KGZA 4MQBA 3KQPA 3ETDA 1MOSA 3D64A 1SQ6A 3FDZB 1W29A 3OFNA 2PLRA 3WRYC 2ZE7A 1ESZA 3CEPB 1BOOA 2VYFA 4FFDA 2I1VB 3UUGA 5M04A 1OTYA 1V3TA 4JBXA 4PNPA 2YZ2A 2WIFA 1T2CA 4Q02A 3EAFA 2JLQA 5IYZA 1ZZGA 3DMYA 1Z15A 4TZ0A 1IN1A 1R8YA 3H19A 4WZAA 3I0MA 2HV9A 1KDTA 4B3GA 3L4EA 1S1MA 2P8JA 4I55F 5KPDA 1C0PA 4CJXA 2HF9A 4UDYX 3FPLA 3FF1A 3EVAA 3D3WB 1NVVQ 3GJ7A 2PQ6A 3IUQA 2CY0A 1FRQA 3ER6A 4GP9A 1AHIA 2YMMA 4O2AB 4PFKA 4BEVA 3Q98A 2QLJA 3OECA 2WIKA 3R7SA 3F5QA 4UEOA 3ZJ5A 5A4KA 3FRHA 5IULC 1JXQA 1SKMA 1EYZA 2ZWPA 3IQXA 3P9SA 4ZODA 1I2MA 3IOYA 5IYZB 4M9QA 3GJQA 4LV5B 3VJRA 4B7AA 3HA7A 1U0FA 2O3TA 2J67A 2WYUA 5KSYA 4X90A 3ELWA 4ZO4A 3CIOA 2ZSFA 1Q91A 1H8HA 3Q0IA 4I3HA 4ZJUA 4BVLA 1EFHA 1V1JA 4IWNA 2YFKA 4KZKA 3OVMA 4X85A 5JNSA 3ILSA 4V02A 4V3BA 5IJWA 4NE2A 3NIBA 4MI6A 4ARAA 2H4YA 1JF8A 1B15A 4AJOA 2H4HA 2P0YA 3EEYA 3KKLA 5LNK6 5H68A 4QOSA 5EPUA 2IW3A 3DZDA 1WETA 4AS1A 1MD9A 1TQ4A 3P2KA 4MZXA 3HY3A 3S2YA 5K0SA 4J07A 3CWZA 3TW6A 2GAIA 4ETMA 2EYUA 4IGEA 4BECA 3KTDA 2PUDA 2N1MA 1W48A 1DBSA 1PX0A 2RHWA 1P91A 4R9NA 2GRAA 3TAXA 2QRJA 3ROTA 3FMPB 5I6DA 3L6CA 1ZLYA 1NW3A 721PA 4XD7D 2AXNA 4FCCA 4AMZA 1KOLA 2IU0A 3SIPA 1CTQA 2FWIA 4R3WA 4P3PA 4QOGA 1CG6A 4WGFA 5KQGA 3PSHA 4Q1VA 1MFPA 1XPOA 4W1PA 1GD1O 2COEA 1GTJ1 1M33A 1Z74A 3GBPA 3L0PA 4JEUA 1QRUA 2LWIA 2ECPA 2YOHA 2ZYRA 5KYGA 5LWHA 2E87A 3W8DA 1VI6A 2CXHA 3AF6A 3ZLUA 3TCNA 3KJGA 3PHIA 5CJ2A 1X86B 5K3DA 1J23A 1BEZA 5DN6A 4PGGA 3V1YA 3LPNA 1TK9A 3DW1X 4UHHA 5CXQA 3GEBA 1VDMA 1BD4A 3HN6A 3PHLA 5FUMA 4DSUA 3SLGA 4CHTA 2GZDA 1I24A 1ENZA 2HQRA 2GBGA 1SXGA 2OV1A 4UM7A 3RSCA 3P9QA 2DZDA 3DHYA 3ZWKA 2BDTA 4MVWA 1XZLA 1LS6A 3HBJA 2IBTA 5ICSA 3H2HA 1UBRS 2WWYA 1NPTO 3W3AH 3Q15C 4GBGA 1L5WA 3I9NA 4C30A 1N5RA 3B13B 1JSZA 3VR3D 3ZHZA 1DEKA 3VR6D 1U9YA 3GOQA 3KALA 1SBYA 3W8FA 1PJCA 3FPFA 3CPHA 1U8FO 1X92A 2OFPA 4BP9A 4MUNA 4R1LA 3KRTA 5D7BA 3N07A 4ZI2A 1TEVA 1GAJA 2AMYA 2Z56A 4W8OA 1MJ5A 1WY7A 2PLAA 2YYZA 1YGPA 2X9VA 4JLMA 4XFDA 5K99A 5I47A 1JR3A 3C8UA 3O8DA 2CJWA 3P0RA 3TIGA 4B6SA 1RHUA 3L0DA 5F5XA 2ZJ2A 4BKOA 3L40A 1U0RA 4E08A 4FOOA 4PG6A 5A4MS 5BWCA 1BRMA 3LPLA 3FHTA 2VG8A 4HI0E 4J4BA 1EFTA 3PC8A 2D3TA 2RHRA 2B1JA 2VHWA 4QAJA 4X9XA 3N2LA 1T9GS 4Y6OA 1GYQA 3CN7A 1DL5A 4MW0A 2TRSB 1I10A 2ADMA 2YC2C 4MQ6A 1OVGA 1QRAA 3BBLA 4ZEXA 3IRUA 1L4NA 4LUCA 4FGUA 1P9NA 2ZSJA 1ZO8A 1TNDA 2ERYA 4PAMA 3G5LA 5F5LA 2CJWB 4KAAA 4R8VA 3L4BA 2H1FA 4BNZA 4HLCA 2QVZX 3FFTA 2C7GA 2V98A 2WNSA 5ALZA 1E2BA 2CN1A 1Y1TA 1OLUA 3AQIA 3B1ZA 4FHFA 3I39X 1IY9A 1AK9A 2O3RA 5ALUA 4JC5A 2PH5A 2G9NA 2M6LA 5K6TA 4AS2A 2XBMA 2UXBB 1QF6A 4OQPA 2F3RA 3G8AA 5GMOA 1SHZA 2HLPA 5FTMA 5GV7A 3HBLA 3PJRA 3HGMA 5T4FA 5FQOA 1VB3A 2BKVA 1Z9BA 2BH9A 3CX6A 4QPNA 5E9AA 3G8DA 1GRCA 1HZZA 1M1ZA 3UPDA 2V8BA 1CS4C 3D7LA 3OQPA 3UV3A 1Z17A 3E61A 1DFIA 1OLUB 2XUFA 1K89A 3F96A 2RGDA 4GX1A 4J3FA 5JY1A 3AHGA 3I1IA 4X6LA 1XEXA 4ZRNA 5JPIA 3CNNA 5IN5A 3KX2A 1OB5A 5AFSA 2WOJA 5JD5A 4M99A 4UTRA 1NPDA 3MLAA 1QE0A 1UBOS 4CMJA 2LGJA 1NE2A 1PVDA 1YL7A 4PVCA 3V32A 3EWAA 5CURA 4M53A 4GEKA 2VDPB 3AI1A 5AM5A 4LF6B 1P9RA 1PEDA 1EE2A 4WK0B 3A9UA 3QHAA 5IAAA 4O4HA 1R5JA 5F52A 3PWSA 2Q3JA 1N9ZA 1ISJA 4LJ7A 2XB9A 3D0RA 3RASA 2XNCA 5ICGA 3FPCA 4IHAA 1XEXB 2P7HA 3ZTTA 3M5WA 4TYMA 1BVYF 5JBNA 2XCTB 3EG5A 1YRAA 5J5CA 4MJLA 3PGJA 4MIYA 5JAZA 4ENVA 4R1MA 1E79A 2HJSA 1RHQA 4IJUA 4PHHA 1HFKA 1HSZA 1NQUA 4TXLA 5D5PA 4FYMA 3RIGA 5FEUA 1QG0A 4MVJG 4O4HB 1N36B 1A9PA 2X5OA 4G37A 1IL0A 2YIJA 1IBRA 3MT8A 2EG5A 1Z56C 2JNWA 3K4QA 2VF8A 2HIHA 3IP5A 3AH8A 4F2DA 2BBTA 2JFVA 2PIAA 3BD6A 1CSEE 5L3VA 1EX1A 1NMSA 5IDXA 5KCMA 2NZJA 3NBUA 2Q50A 4MDYA 1VL6A 2XUQA 1BQEA 1C4OA 1NXXA 1B41A 2ECFA 3QI2A 1UJBA 3OQ6A 2IYOA 1DCTA 1JAIA 3OOHA 4Q3DA 1J7KA 4W9NC 1N57A 1Z2DA 1D5WA 3T7KA 3H8WA 4QG7A 3ZH9B 5FBLB 2QUHA 2PL3A 4HBGA 2YDYA 1WXWA 3NXSA 2HO5A 3PBKA 4HAVA 1TO1E 2FB9A 2OAEA 4CLHA 5EHZA 5I48A 5KWJA 1E6CA 1RQPA 2PKXA 1G7SA 4A10A 1O57A 3HCPA 2P9JA 1QMPA 3IXQA 3LXRA 4W7HA 1R6BX 4HK4A 2IUFA 2O7RA 2LCQA 3MBOA 3RWBA 3HUDA 3VMFA 2IYQA 5IYZF 4EJ6A 4H1WA 4BWYA 3VU8A 3B53X 3NFRA 3D0KA 4CXMA 1JI0A 4MOWA 2H4WA 3VHLB 2X9QA 1O6FA 2XUAA 5DE3A 3B48A 5TLSA 2DERA 2F64A 2MWMA 5BQPA 4BQSA 4MTCA 1CQIA 4ZN6A 2J3QA 2B2CA 2IDMA 2ZOSA 1S02A 3OOSA 4QNMA 2IFTA 4YH1A 1DKOA 3FKSA 3CVOA 1W1IA 4N82A 3HWWA 5KKNB 4EPWA 2EZTA 1Z38A 2JIZD 4FD3A 4PLTA 1LRJA 1OJ7A 4D98A 3EISA 3FSRA 4OGFA 3TZCA 5DEIA 3N1UA 4BX8A 2VJCA 4E2YA 1PNQA 1HRDA 2FP4A 1N5MA 2L82A 2FLKA 2QM7A 4TLMB 1T6NA 3UWKA 1NPYA 3UT6A 3AVPA 3BIOA 1UJCA 1ACMA 5TB5A 1CQIB 4DYHA 2HXYA 2V7QD 4N3NA 5JSYA 3UKDA 3QEAZ 1H0RA 4INZA 3ZEAA 4EI9A 2A7XA 4BHTA 1FX1A 3BXPA 4MTLA 2XZDA 4EX7A 2HX1A 1MB0A 2WVGA 3CRQA 1Q22A 3AT1A 2FW1A 5E2BA 3ZE6A 2G5TA 1GTZA 4IJKA 4LSMA 1JG2A 1DBPA 4FX2A 2FP4B 3FPJA 1W87A 2IYNA 3T6KA 3PXAA 4KR0A 3TL3A 2D1YA 4GLJA 2JAWA 2CT8A 5FBVB 1N5OX 1TRHA 1U0NA 3M4XA 1Q1QA 5B1HA 2IJGX 2WSMA 1EFPB 3OBBA 1FBTA 2QLTA 1O4VA 4NNJA 5AK4A 1EDEA 4BCDA 2BGKA 1YRHA 1U31A 1PG5A 1AUXA 1I5OA 1WF3A 2WNIA 3SQMA 1KIAA 2WTEA 4YMHA 3Q7PA 1CP3A 3EUWA 4Q48A 4KV9A 1YQEA 2QXUA 3KZXA 3MUNA 1AX9A 1E6WA 2BFEA 3P2EA 5ALJA 5K0FA 1ZISA 4BQRA 1IU9A 2PSSA 3OZVA 4QYSA 3GRUA 1SK9A 2AFHA 4HWRA 5EZQA 2ORYA 3TQIA 2R8PA 3U19A 1NDUA 2VDOB 1E1RD 2I6QA 5KNCD 4QD3A 3AP2A 4KE8A 5AMXA 1XQVA 3VU0A 1ODFA 1NKTA 1IDN1 2OHIA 3G7NA 4QVGA 4QHTA 4RVDA 3OZWA 4DGQA 2JZCA 4F8JA 4AT1A 1QQ7A 2XJ9A 2HXGA 3RC7A 2NZWA 1Y6GA 3KG2A 1SUFA 2QMEA 1KEPA 1N5LA 2BFEB 1T8RA 4Y2UA 1PQYA 1T2DA 2RKOA 2IYYA 2XUJA 2AFHB 2HMAA 3LT2A 1YB6A 3TG2A 2QT9A 1BYIA 1U5BA 4F4UA 3U3RA 4MEAA 1R5OA 3EC1A 4MHOA 1ZD8A 1IG0A 4Z0PA 5JS7A 1EQ2A 2BKUA 2ZB3A 1E60A 1O5TA 2QKYA 2CB0A 1QC5A 2XEDA 4XVHA 2EBHX 5EIFA 4E5NA 4M9XA 3N39C 5E8JA 1A5TA 1YACA 3GWGA 3T7RA 4AZTA 1G5PA 3D5EA 2QTBA 5IKPA 2YWCA 1Y48E 4OHZA 1RC8A 1FUIA 3X1YA 2FMXA 3IB3A 4CV0A 4JP1A 4DJDC 1XXHE 4RM3A 5KSZA 5KYTA 4B3FX 3T52A 1BWQA 5E8RA 2NG1A 2GAAA 1U5BB 3D59A 1SHKA 3GMSA 4TVKA 1MC4A 1V8DA 3I3OA 2B1QA 3JAKA 3O21A 1E2FA 4FLEA 3MT0A 4P3XA 1YC2A 1OX6A 3PB3A 1QC5B 3ZGNA 2YRWA 4AN4A 4RPGA 3ZC3A 4KQ2A 4KNVA 2XBLA 1M75A 4KK3A 2CLHB 5BOVA 1A9QA 2VJNA 5AD1A 5T64A 4QZVA 3QPVA 3IMCA 1PNRA 1XDGA 4U0JA 2PVPA 3LBIA 3DE1X 1SC6A 2H31A 4REQB 3HBNA 1YULA 3CURA 1RW4A 3JAKB 3TAHA 4DR4B 3NNSA 2HU8A 3ZHVA 4BATA 1VRVA 2AZDA 1E89A 1P1BA 2E5FA 2XWQA 1HL7A 4OQYA 1C30B 4CMEC 1ZQ9A 3PDIA 5HPYB 3EBOA 4TXHA 3SQNA 3VYTB 4UTPA 2Y4OA 4P2GA 1R9GA 4UOZA 1DTSA 4BIIA 3U1BA 1ZVJA 1N2JA 1P2SA 4WA7A 5EJ8A 3VR4D 3DD5A 2RAUA 1WSDA 1YS2X 4QNNA 3IQEA 1UK7A 1I0ZA 2IY7A 1RT9A 2GHQA 1GQ2A 2DBZA 5IT5A 2Q4EA 4DR6B 5EHQA 4Q00A 4EKIA 1GUFA 4EG1A 1DQSA 1QZUA 3S99A 5A5EA 1RKVA 3QX3A 1JGTA 3IAFA 3PQCA 1QO0D 2OHGA 4ZQIA 1QYDA 1TUIA 2QTFA 2G4LA 3LZ6A 4NMWA 4PX3A 5C7IO 1G41A 1GZDA 1Z36A 1S2MA 3C74A 3HB0A 4MUAA 4O4HF 2B2XA 3AW8A 4XH9B 5TT1A 1AKTA 4RY9A 1JIKA 2W2PA 3NUGA 1XWWA 3GAFA 3TMYA 3KVYA 2I4TA 5AJTA 2I2BA 4FD2A 3LMKA 3I45A 3UAZA 3WLOA 1XJ0A 1DLJA 1JV2B 2A9RA 1FW6A 1ZOOA 4QBHA 3SDBA 2QYOA 4KQEA 3EWIA 1E1QA 2NXCA 3UMBA 2GPNA 4DIMA 3K71B 2BGRA 3DKPA 2Q62A 3OKAA 2HQ1A 1ZX1A 4JELA 4F0JA 3LQQA 2FMHA 4XOUA 2AZ4A 3ECCA 4RQUA 1GKYA 1Y81A 3IAM1 3KPVA 4LIPD 4XQ9A 3SSMA 3UUEA 3GVCA 3B36A 1RXYA 3GLHA 4IEEA 4DY6A 1ELOA 2R7NA 2RHBA 4ADSG 3AUAA 2VQFB 4PHTA 3H4VA 4ZVRA 3WLEA 5EPEA 4HMPA 4L5JA 1FQJA 5EQDA 1XZKA 3SHFA 3ON5A 4HRYA 1N5IA 3T5DA 5DLPA 4M3NA 3F47A 1IN6A 3H1FA 2WM9B 2XMDA 4W8HA 1MOZA 3ZH2A 1YVPA 1Q92A 3A58B 3CA8A 2R6GA 3F3KA 4RUKA 1ULTA 1C3VA 3HN2A 1T9HA 4ETWA 1U6IA 3FTNA 3IVAA 3K0KA 4AUEA 1Y1LA 3GLHB 1LKZA 4PAWA 4XGRA 2SKCA 4MLPA 3C45A 2W42A 1V7PC 2CK3A 4PPQA 5REQA 2ID9A 5IT0A 2QTVA 4N7JA 3L4SO 5I9IA 2FX5A 4EB8A 3T4EA 2V59A 2WJWA 2UZ3A 3DDCA 4V0KA 1WBDA 1C1XA 2O4UX 1ZUNA 4A5OA 4C89A 3F9RA 2O3SA 1HE8B 1ODIA 1RRMA 4RHTA 4G0OA 1SKQA 5D3MB 1SG6A 1ZD4A 1PKEA 1U0JA 3Q5EA 2OHJA 1C7JA 4PTZA 5JVDA 2QN1A 2Y1KA 2D2XA 5F2EA 3UQZA 2IYTA 3ESRA 3I2IA 1WP4A 4J6FA 5L6MB 3LOUA 2E3JA 2H6EA 5REQB 2QTVB 2GLTA 1AGYA 2IYSA 3H1GA 4I4IA 1JJ7A 4EJSA 2I2AA 3AMVA 5GONA 4DDWA 1OI3A 1FRFS 3O2JA 1HYHA 3NVAA 1C1XB 4S35A 1P17A 3U0VA 2DBQA 1YZ3A 3GD5A 2B4KA 1REQA 2XUHA 2GBPA 1ETHA 4XDGA 3WKCA 2JFPA 4C2TA 3NHWA 4RD6A 4RL4A 3F8WA 4LXUA 4NFSA 1U8CB 1V5WA 4Q03A 5JVDB 3ZHTA 1VIVA 3N6XA 2GEBA 3CIFA 1Q19A 2XJ4A 1YCFA 2QQFA 2VAXA 1WZIA 1P5FA 3NTQA 4G5RA 4N6NA 4OQDA 1Y5MA 2RG7A 3F5FA 4L7VA 3OURA 4I46A 4PTYA 4C2UA 3NEYA 4EJSB 2PANA 5GONB 5M2QA 2WLSA 4DB2A 1U8XX 5TF0A 4K81B 1URPA 3DTYA 1E4OA 2CL0X 2XE7A 2PHZA 2XIQA 3DVQX 2J9RA 1OYVA 3CUEF 2J4DA 2MMCA 4INPA 1REQB 1XZFA 4M1QA 2BI8A 3VPHA 4LJKA 1E9VA 2R2GA 2ATIA 2HCRA 4L5YA 5TSDA 2KPOA 2H4FA 3K5HA 4CF5A 5H80A 3TQTA 4JXXA 1QH0A 3HP7A 4Q4JA 3UMYA 1FNNA 1JSLA 4G81A 5A02A 5I7OA 1AO3A 3TXYA 4Z0TA 4S2UA 4DVJA 1CRPA 1T36A 3ZZTA 3OHSX 3DAYA 3B70A 1T26A 2XGOA 3KB2A 3QFSA 1DKLA 1UBHS 2C5EA 1PK7A 5EIEA 1E2KA 3JVIA 5AUQA 2HA2A 4B2LA 2CHFA 4EG3A 1YJ8A 3G89A 3NDRA 5CR9A 5KNDD 1TRKA 4V38A 4K7JA 5DULA 3F3MA 3O91A 3QKIA 4OHXA 4Q4JB 5ALKA 4D9EA 1XDUA 3NHPA 2OZLA 4DR1B 2LP4Y 5IBQA 4UW9A 2Q45A 5KEIA 1SKBA 1E8NA 2BSAA 3PT9A 4PGHA 1F38A 1T36B 2GDJA 2WV9A 4C7BA 2DQKA 1NW8A 1E1DA 2VH5R 3PQ7A 1UPUA 4HFMA 1OLSA 4EWLA 1M7GA 3KXLA 5FTLA 1RWNA 2HEGA 1HZJA 2A94A 1Q14A 2YICA 2Z8YM 3DKRA 3BAZA 4L1KA 4QTXA 4RA9B 5SY4A 4PG8A 1PF7E 1R6TA 4MPDA 2CV2A 4ZZ0A 3EQ7A 1PQPA 3DLIA 3DZGA 3Q1KA 1KK2A 2IYLD 4M60A 2D1TA 2JLRA 3GNTA 3F2IA 4BFTA 2Z4TA 3C41J 2OZLB 1FNSA 3EUFA 1ZONA 4LJ4A 3NWPA 2GFHA 3SJUA 4Q7EA 6ADHA 3LL7A 4M38A 1MA0A 3VYRB 2FWAA 2XMPA 4K2HA 2PSDA 3L4JA 1VHDA 4DCPA 3F4KA 3AOGA 4HEA6 1WIWA 1AZTA 2NU6A 4CM3A 5F7OA 1GNLA 2XYPA 4JVMA 1OLSB 2O2YA 1AHPA 1N2CA 4M0MA 2BP7B 3C98A 4JIGA 1NOKA 2HA0A 1RYZA 3C3XA 5TX7A 1JHYA 3O1LA 3ZDAA 4R1TA 5HGXA 5L8VA 2BSXA 5K0JA 4JYPA 5COBA 4YR9A 5B7QA 5KCZA 1Y6JA 3COWA 3WKEA 4QFCA 3Q2OA 4DV7B 1U0EA 5DWDA 1NXQA 1OBOA 5ENDA 2QN6A 2WD9A 4IHJA 5AVRA 2PGJA 4J0HA 2NU6B 4I14A 3SYMA 1ADCA 1DCMA 2CLSA 3ZUGA 4E13A 5F51A 1N2CB 1ZM9A 5IAEA 1CX9B 1GCUA 3WZ2A 2QENA 2Q6OA 1E61A 1JJFA 1QNFA 1FFHA 4IJ5A 2FETA 5JMWA 4ZVKA 1FMCA 1ZFNA 3VHXB 2HK9A 3LTNC 2I54A 3HBMA 1UKZA 4DNXA 2P2SA 2ZB7A 3JWPA 4EA7A 2YZNA 1YWGO 3I0ZA 2ENUA 3INYA 4AKIA 1ZRNA 4IHJB 4EKEA 3RSSA 3EGIA 3EOZA 5CB6A 3A1TA 1Q3KA 1LBHA 1VKHA 3HVRA 1USVA 2WJ3A 4E5KA 3LFUA 4W9MC 4CL0A 1WCIA 3A28A 1UKBA 2JCYA 4OUDA 2AN5A 3NAMA 1OVMA 4I6JA 5BVGB 3K3PA 1LV8A 4JJAA 3OE7D 3VH4A 2HT1A 3LBAA 3DBHA 3RC2A 4HUTA 1NW5A 2AI3A 3BD9A 2QSUA 3DKKA 3RS3A 1ZCJA 3TVTA 4OU5A 2CHEA 3OE5A 5AVXA 4BGUA 3DBLA 1ETUA 1RJWA 4MYDA 1ZGBA 4N5DA 3WK9A 4CFSA 1IHUA 3N8HA 3F7NA 4LHXA 4M89A 4RXMA 4XM2A 3LIPA 2C5FA 3MWJA 1VL1A 5FV4A 3NANA 4B6PA 4B5KA 1T2NA 1QIMA 3UXHA 3VRHA 1MB3A 3NTVA 1HMYA 1YR1A 4PV7A 2OC9A 5ENZA 4ND6A 4G1FA 4OUDB 2BFPA 3E5NA 3I32A 2JJYA 4IR7A 3DBHB 1WABA 6YASA 5LD2C 4U6QA 2JD0A 3LY5A 1OXVA 1GYRA 1L8AA 2F9LA 4DV5B 1GUBA 3DBLB 2EV9A 1SZCA 4GH5A 2H18A 4NWIA 1BFKA 3C1UA 2GO7A 4PN3A 1V8FA 2TECE 4HB0A 3P97A 3CFYA 2IDJA 1VRWA 3AVUA 1MX9A 1NVGA 1AGXA 2VOJA 2XF2A 4LG1A 4J8PA 2I3DA 3AZPA 4LY6A 3CO0S 1RRVA 5CXUA 2GHRA 1OXMA 2XB2A 1XLVA 4TOIA 2RGAA 4DV2B 1F7UA 4LX0A 5E9JA 1MNAA 2E5LB 1L4MA 4V0LA 4KIJA 2W93A 3ZI7A 1MHTA 1CJBA 4EY5A 3HDVA 5I45A 3KB6A 4IYJA 4YREA 3UHPA 4I1UA 3OMLA 2QAGA 5KWVA 1ZMOA 1K92A 3QWIA 4QUEA 4XIGS 1EH5A 1O8BA 5F78A 5E6RA 3RSZA 1JWBB 3O4RA 3UAGA 2R6R1 2QXYA 1QYRA 3TR5A 2J4FA 1ZM3A 4LE1A 2PUHA 3G13A 4WT7A 3PVSA 3BOSA 3CISA 3X1DA 3U6BA 3A6PC 3VPGA 3ZN2A 4L5BA 1OU0A 2LKCA 4M0KA 4BNYA 4LF9B 4H7JA 4TL7A 1EAMA 4B82A 3FA2A 4F5WA 4RTOA 3KD3A 5DNVA 3PX7A 2QAGB 1GO2A 2ZSDA 2BEWA 5IASA 2ZR0A 5CM2Z 3IUPA 4H4DA 1WOMA 2WYWA 1RE0A 3M9LA 3MGGA 3PU6A 4ED9A 1FA9A 2Q2QA 2E4AA 3P96A 3RGGA 3IUEA 1A04A 5IW8A 2ZU0C 2NQ8A 4ENPA 2I8LA 4RAOA 2W6CX 5JNVA 1ADGA 2ZI3A 3FVWA 3BJIC 4ENUA 1U1DA 3QXJA 4V0QA 4MMZB 4EPYA 5ARBA 2GGSA 5CFPA 3QRWA 5IJ0A 5JVDF 1ID1A 1ZD3A 1ZOIA 1CC1S 3L5OA 4WN3A 4A5SA 3KUDA 4GYJA 1E7YA 4G36A 3KJNA 3RS7A 2JJ8A 4JSTA 2VK2A 2C1EA 3LUHA 4ZA2A 4TTRA 1W6RA 1XTRA 3TX6A 4A6DA 1NZJA 4BCBA 3E9RA 5GONF 1Q3HA 1FNCA 1X0XA 3L82B 4Q15A 1T0HB 5F4ZA 5JV5A 1MZVA 1U11A 3MAJA 3J80A 4MUMA 4WNYA 5I8ZA 2R62A 3H3JA 3X44A 2Q1UA 4ZPXA 5K7SA 1IY8A 3A0UA 4Z51A 1RVDA 2WKRA 5FKJA 5IJ0B 1EFCA 1ADJA 2DPXA 3N8GA 1W0KA 4QARA 3G5MA 5JAMA 2PUEA 1O97C 4XCQA 3CU5A 4Z3OA 2X0EA 1Y9AA 4X24A 2R8XA 4C2BA 3V2UA 2VNAA 4B4DA 4EVSA 5L53A 1E3LA 2GEFA 4CDMA 1J1UA 1V71A 2UXDB 1CVLA 2CD9A 2CLEB 4N5LA 5DYIA 5IJXA 2C7OA 1V16A 4W63A 4GWGA 1HNXB 1DOAA 1AKRA 1W1WA 3JQFC 2E7ZA 3IDZA 4OHPA 2Y1EA 4JOCA 3DVAA 4K9LA 2VDMB 4LOKA 4IAOA 3V8QA 2GBFA 2LZ0A 3AC0A 3N2KA 4ZWNA 3FCUB 4R5HA 3TUZC 1PYGA 3V1TC 4IJ6A 2FPOA 3EWSA 3V8RA 4AF8A 3CUSA 1K86A 3ZXIA 3BMCA 3QUSA 5MN5A 4C9BA 4UDXX 1RYBA 5KVSA 2IYEA 4IHKA 2DBVO 4AJJA 5IF3A 1Y33E 1DT3A 3M1YA 3HYCA 3DVAB 1MA3A 4YPVA 4Q7LA 4Z1MA 4AMUA 2ZCUA 3MVEA 3ONWA 3L7OA 2IHVA 4OBWA 1IVYA 1TEHA 3OPYA 4NBSA 3X1XA 3PI6A 5AICA 9GPBA 2E55A 2JGMA 3DJFA 3RRJA 4EB3A 2VWHA 2JAXA 1QKIA 3BMCB 3KD2A 3SJAA 3FPAA 1G1MA 1Z7EA 3ANLA 1OWPA 2CKDA 1EP9A 2IUTA 4FMDB 4L0CA 4PLPA 4RTRA 1FJGB 2HWYA 5CFMA 3ZJYA 4HT3B 2HNBA 3BXGA 1CP2A 1Z45A 4FGLA 1XN4A 2A1TR 5GVRA 2WFLA 1OI2A 1YS9A 2YJ5A 2IU4A 3THOA 3OEHD 5CDHA 3INTA 4ZVLA 3OX2A 4O5OA 2D00A 1S6YA 3OPYB 2I80A 2O4CA 1ENYA 1B0UA 5G4LA 5JSZA 3ACDA 1PJRA 4XDYA 2FHSA 2FUG1 3QJYA 4DEVA 4DIUA 1WJGA 2WWTA 4ZCLA 2H2AA 4B32A 4V1CI 3FNBA 2EBFX 4KN8A 3AX6A 4MWEA 2VJLA 3TXAA 1S3GA 5PNTA 3G2NA 1FVFA 2OXCA 2YXDA 2OMEA 1AT1A 1RKBA 3FHCB 3LYAA 4XVRA 5AOBA 1VE3A 3LQ1A 1V2GA 3M9XA 4J49A 4LMRA 1ZK4A 1J25A 4CMHA 1Z6GA 3R1IA 3EQ8A 3H7IA 2QMOA 2KJQA 4XGQA 5FNZA 3BD7A 2E5WA 3KR9A 8ADHA 5JSZB 3F9CA 4MWGA 4IRXA 2GPSA 4ZT6A 3T9FA 1JT9A 3SZRA 4X45A 1D1SA 3LE8A 1E32A 4IHJF 1RD4A 1KI6B 2XOKD 3DYIA 4IIJA 5L3ZA 5A5FA 1HDZA 1Y6FA 1C9DB 1EWVA 1XCLA 4Q66C 3WAKA 1C7IA 3ISVA 4FQ7A 5JJCA 5LU9A 2IZ6A 1EFRD 2OGTA 4GKKB 2D1FA 3KUUA 4H3SA 1UH5A 1XMJA 2Y77A 2YV2A 2ZJ3A 1WHTA 1XN1A 3W78A 3EG9A 4NZMA 2Z08A 3TR0A 4EHLA 3UW3A 2VF2A 4IMPA 3F97A 4WAUA 4F1JA 2ETVA 2ANCA 2X40A 3FUWA 3EH2A 1FMLA 1JHXA 4J76A 1NJGA 3UICA 1VYUA 3LCMA 4IIJB 3WLKX 3S8YA 1K97A 3NYIA 4J1NA 3RIEA 3V1NA 4DLRA 2DR2A 3NX4A 4BIMA 2IQ5A 5CDSA 3UB2A 4TVBA 1H22A 2DBYA 1U2EA 4H6VA 3H0CA 2OO5A 3HCNA 1EK5A 2ZTMA 4J91A 1WHTB 2GPYA 4KFTA 3TQRA 2XITA 3EG9B 4HPXB 1OV6A 2X14A 3DO6A 4H7EA 1HOTA 2HSJA 1CNEA 2BV3A 1BQ4A 1Z73A 2HSEA 2PM8A 4RZXA 1ADBA 5DSZA 5KKCA 5HQJA 4KXFB 2GKGA 4FYWA 4R2JA 2H8KA 3G1TA 1V2HE 1OQAA 1E5TA 3GH3A 3GV0A 1XF9A 2G8LA 3D3NA 3PQFA 5DH9A 1G5IA 2VDVE 4B75A 3N3BC 4Y2VA 5EEHA 2ERCA 4NMHA 1XLUA 3AVTA 1JFVA 2IYAA 1QHNA 1UXHA 1USWA 3F8SA 1VCNA 4TMVA 3ZXSA 5JY6A 1U9JA 1R16A 2RARA 4EOGA 2AOVA 2IYWA 1GUZA 1OFIA 4MW9A 5HKLA 1AMNA 3W5DA 3U5ZB 2JEZA 4UMFA 5DYGA 1CQPA 3CLSC 5KQPA 3HJUA 1M3SA 1GGNA 1JG7A 2HHAA 2CGEA 2MTBA 3NEJA 5L4NA 3PQ5A 5B6IA 2ZROA 3OAAD 3K0HA 2R00C 3PNMA 1H8EA 1U7XA 2CNWD 3BMOA 1SRRA 3SZMA 5HR5A 1E0SA 2Q3BA 4BKQA 3F73A 4QGFA 1II0A 2NIPA 5DN9A 1VKZA 3ZDXB 2AN9A 2WYVA 4JASB 5ESRA 3PEWA 4DLSA 3R3XA 3RHZA 4X1YA 2P7IA 4I8XA 3S70A 1EXWA 4XYEA 1U04A 2PEZA 5DM70 3TEJA 1GAQA 3SHQA 4CV2A 3EDRA 1FNBA 1TYCA 1NQWA 4RV4A 3GLFB 2ZUWA 2JIBA 4RMNA 2QL9A 4PAGA 1JPVA 4DMMA 2AJDA 1M6YA 4E31A 2PXAA 3RUDA 5KJFA 1Z26A 3BMOB 3JAWA 4B6FA 4DM7A 3FTPA 3CVUA 2NYRA 3DNFA 4JI7B 5DI3A 5KUTA 1RYEA 2QT1A 4TLAA 4MS3A 4XD2A 5LFAA 3MQ4A 3NT2A 4X1YB 1KHTA 1DBVO 4ZZ1A 1B3RA 5EP3A 1LF5A 1M2WA 4GX0A 1MG0A 2BHLA 2GNPA 4NU8X 3RRFA 2HAEA 1G4AE 1XRLA 3KAQA 1CW2B 2GTPA 4C07A 4IY1A 4C3VA 1ODKA 1DV2A 2PMCA 5DHFA 2O1SA 2G5PA 3RTDA 1QGYA 3LKDA 2ZTSA 5B7NA 1Q0UA 3Q5DA 4XARA 5FOXA 4BRUA 4CCAA 3PITA 4DCVA 2ZSEA 2HUNA 4PYRA 3ZWWA 2ASVA 3JAWB 1M6WA 2CSUA 1UBJS 3ED5A 1BS9A 1J5XA 1JE1A 1F4PA 1FFWA 5DI3B 4ZVUA 2L69A 3V7FA 2Q3HA 4KMRA 4MS3B 4NCHA 4CLRB 1OX5A 4R2WA 5LQDA 1CIJA 2P69A 4DADA 3HZOA 4PS0A 3KFXA 4B74A 2PQ0A 5EZ6B 3DE6X 1BFUA 2JRLA 4LY9A 2OK7A 3W5BA 2UZ0A 3A36A 5AKJA 1E9DA 1C0LA 1GTRA 1L5VA 1OX4A 1R00A 1WHSA 3NDBB 2WKPA 1TGYA 2C2XA 2HEIA 3FVQA 4UMVA 1S2LA 1UAAA 2PG3A 2AVNA 2CXSA 4ITVA 5FNVB 3SKXA 4MSUA 4UU8A 3H0KA 2PVSA 3LUCA 4L3VA 4Y6LA 4M0FA 3TK1A 3HCDA 3GFBA 4NI5A 1SCKA 2YHAA 3VHQA 5ICMA 1EBBA 1BH6A 1ILEA 3GGOA 3CUVA 3SZUA 5IPFA 1THZA 5THQA 2CLIB 2WF8A 2OCAA 2XF8A 2H65A 3EW9A 4DLPA 1ZICA 1DJNA 2I4MA 4BFUA 4QOHA 4AJPA 1QOZA 1N7GA 1PT7A 1QRRA 2LDBA 4QXQA 1IJFA 3R3UA 5JCZA 1SVUA 4Z4GA 1CJTC 3BQMB 4JJZA 3OUTA 4NQRA 4O1HA 4R69A 4QSMA 4MB6A 3TSCA 4D7AA 4BPBA 4ZAFA 4ARCA 5D3QA 2C3YA 4IIDA 1SXPA 2IH2A 2G3YA 4BTLA 4WY8A 3K0BA 4ZVNA 2WF6A 3EXHC 4UU0A 4GYKA 2FE4A 3KSRA 4E5SA 2EARA 2VJBA 1SCAA 1YS1X 1HTTA 2B7BA 1A8QA 2OORC 3EAQA 3MMPA 4D99A 1GQFA 2H2FA 5SZIA 3V8NA 1SY7A 3W3AA 4OJNA 5IBCA 3I34X 2IHUA 2R68A 5BO5A 4FS8A 1PR3A 4BBPA 3G9XA 2FCAA 4H15A 5L3QA 2W6QA 2O57A 1AKQA 5H1YA 4P4UA 4XRRA 5KO2A 3IXLA 5HF5A 1O77A 1EVEA 1Y3HA 2PY6A 3L0SA 4OVKA 2ZLBA 3S8EA 3ZIUA 1EGQA 4EA6A 3EZLA 4BEJA 1S8FA 4DJTA 1EUZA 1N6HA 4YRTA 2HHLA 1IHYA 1A9TA 2WE8A 4OHUA 4DRXA 3L84A 3QOYA 2BHRA 3E9QA 1PDWA 3OOJA 1L7NA 1HXHA 4IIUA 5CT6A 2ONJA 2ZIVB 1HE5A 5L3QB 1K5DA 2QWXA 2ZIZA 5JISA 1QGZA 2ZSIA 3SBEA 3ZGLA 3ZYZA 4Q1AA 2EHDA 4ZRMA 2NUPA 1VLZA 5TMBA 2R6AA 1ONSA 2TMDA 5B2FA 5JXHA 1ML3A 3LBFA 1KY3A 5HDBB 3D81A 1SVMA 5JATA 4NKRA 2DTXA 1LBQA 3ANSA 4FN4A 4PO3X 2WT8A 4RZSA 1OW3B 3UXMA 4YXWD 1T5LA 1L3CA 3K4HA 3T5BA 1JQKA 1O96B 5D84A 1P2UA 4Q7KA 5EJ7A 2FEPA 4GXTA 2C7RA 1N5JA 3RVPA 3RRYA 4ZDJA 2K7FA 1J99A 3ZWQA 4D8XA 5JJIA 2WSBA 3O93A 3HCOA 1N77A 4CCYB 3NEPX 1JMKC 1XVUA 3OZRA 2RCYA 3GCWA 2NUPB 1R37A 2H7CA 5J4VA 4Y6GB 2DQYA 5JDIC 4XRGA 1LXCA 1WNTA 3CMCO 4YRFA 4CT0A 1VHQA 1UBEA 1ZCZA 1XP5A 4F04A 1MQ9A 3N86A 2D62A 4TMFA 4Y2GA 3JPYA 3VAAA 3DDHA 3MRXA 5A3SA 2C5BA 2EZUA 3QGMA 3LS2A 3AL0C 1H1DA 4IIJF 1CK4A 1R9MA 2PYDA 1YVEI 1ZQ1A 1XDSA 2B4AA 5IXSA 3SAJA 1AUOA 4PFQA 3WK8A 4B6JA 2YWHA 4KR7A 1TB4A 4DMGA 3K9LA 4IIFA 1SD2A 4G2NA 1A4RA 3AHEA 4Z7QB 4YHHB 1EFKA 1QQTA 2COKA 1NVMB 2GFQA 2FG6C 1RSZA 4DF3A 1GZ4A 1C3OA 1GZHB 3DEJA 2PEYA 3M1IA 3NHLA 3LW7A 3QU2A 5LQSA 1EZ1A 3QM1A 4PF1A 4UUNA 5J59A 1SQ5A 3ZJTA 2FEAA 4DN6A 1RXVA 3PNVA 1A1VA 1QONA 1M9NA 4N0EA 4YWJA 4EVRA 2PX8A 3N05A 3C8MA 3V1LA 4AJIA 1H8HD 3HSSA 3T3MB 4HNVA 1D1QA 1JEYA 3BWMA 3TFOA 5AUOB 3M34A 1EXMA 2DFKB 4Y1FA 3KNZA 2CHVA 2EFEB 3N58A 3N0TA 2ODBA 4YQYA 2P6OA 4MMXB 1FB5A 1GPBA 1C3OB 2IPLA 2MYUA 4NCKA 3PZBA 1PW7A 1PR5A 4QNRA 4OBEA 3X2EA 2HLDD 1QZTA 1MW9X 3QY0A 2XY4A 4LGVA 4ER0A 4RNDB 2PUAA 2ZWOA 3ASVA 2CFRA 1JALA 1ADFA 1M7HA 1UJ5A 2FPMA 2IZZA 2PXCA 3EZ9A 1QO9A 3HJNA 3NOXA 1ZU5A 2VYNA 3GRKA 4FYIA 1NW6A 4FJ2A 2F4NA 4NOLA 1H2ZA 1GKKA 3C1AA 4AQDA 1JEYB 1KEZA 3OZFA 4P53A 5I7SA 1ICIA 1VDZA 3AB3A 3AW9A 4WRRA 2HFKA 1B74A 1F60A 1X8JA 2R6FA 3KSUA 1T0BA 3QA3E 4TWJA 4RO0A 4XWGA 1W46A 4IDOA 2O2EA 1LBSA 3KTFA 4LFBB 3P0FA 1H4VB 3DBVO 1F2TA 4LISA 4YP1A 5FULA 3AETA 1HLFA 2PUCA 1CUCA 2YJNA 1NRWA 4TLEA 1H4TA 2JI9A 3R6TA 1EJBA 4HS4A 4I66A 1U2DA 4RGVA 2VF7A 4Y2HA 2AMFA 5EVCA 1KH1A 5K0TA 4GX2A 3GLFE 4RA6A 4RK5A 1E0AA 3ERCA 5ELMA 3RAGA 2QZPA 4AIIA 5U4XA 3A2NA 1Z8NA 4IZOA 4KTTE 2O2CA 4L8LA 3A1WA 3VH1A 3TL6A 3RK1A 1R27A 4JBLA 4BV8A 1K8QA 2VXYA 4B44A 4CN8A 4JA0A 3SY8A 5J1SB 3IVMA 3R0XA 3OE1A 3AR9A 3LDHA 4H27A 4KQIA 4KRGA 1F2TB 1ODCA 2VF5X 3SIWA 4D5GA 4YT8A 3AETB 4X71A 5ESXA 1K3UB 4GR5A 2Z5VA 1Y8ZA 5C8DA 3EFEA 4A82A 1UPFA 1VHJA 4W99A 4YC7A 4PQYA 4IGKA 4RA6B 3VPCA 2C96A 2DGDA 2H51A 3JZMA 1SXJA 4KUHA 4HTFA 1ZL0A 2Q2WA 3A6GA 1Z83A 3ADPA 3DE2X 4HGZA 2Q21A 4P35A 1OT3A 3NHZA 1XRJA 5CU7A 1JI3A 3N59A 2JGDB 1IMJA 1J8VA 4EHKA 3BZUA 1VC2A 4HEA1 4JB0A 3KC2A 2YVKA 2YVUA 4MKRA 4TX1A 3NHUA 2W6NA 3ORHA 4HO1X 4EARA 1T9GR 2Q49A 5H5JA 4KOEC 3QPDA 2XKBA 2Z9DA 1G64A 1KGSA 2YVAA 4LY3A 1A8HA 1VGRA 4IDEA 4CQLA 5HX7A 4HTFB 4G0WA 1R15A 5GY7A 2I71A 4MI9A 2RSLA 1KS9A 2XTAA 2HF8A 2P4SA 5E3HA 2A5FA 2WHQA 1JG1A 2AFIA 1M6VA 4MW5A 4KX3A 1J0XO 4S12A 5DJ5A 3WLLA 1P7YA 1V37A 2O7QA 2X9LA 1NVEA 3GCDA 3I2YX 3QX8A 4WXRA 4BQFA 1RPAA 3EGDA 4LEIA 5EIBC 2B5VA 1XOIA 3VR2D 3E1SA 3IEPA 4YP0A 4EO9A 3MGKA 1FJHA 3Q6IA 3A2MA 1KZ7B 2ZRAA 3FJOA 3QUAA 4AYWA 4OFZA 1INLA 1HUQA 1M2VA 1TGVA 4TUYA 3MRVA 3GY0A 1QB7A 1T34A 5AVTA 5C4GB 3WIDA 1ZESA 2AFIB 4KGDA 1L2TA 4LJ8A 1K6MA 4JBHA 2VDUE 4UQLA 5ITZA 1X8LA 3VVBA 1PIWA 3BH0A 4J7AA 5NULA 1W96A 1ZAKA 3EGDB 5JZ9A 2AKEA 1GR1A 2I8AA 2V7WA 2G7MC 2XH8A 1XUOA 1DJOA 1MO6A 1B14A 2OFXA 2XYGA 4GM4A 4W5TA 2HHJA 5H16A 3HWSA 1DPGA 3II6X 3NWOA 3H5WA 2X2FA 3LZCA 1QB8A 1WA5A 4P4SA 1Q1ZA 3O2NA 1MN6A 2KX7A 4EHIA 1M2VB 3B6JA 2SKEA 3NT4A 1IZYA 2WAAA 2C0PA 3KEOA 4TUYB 2IX9A 2PTHA 2YX1A 3IURA 3AIKA 5HIMA 4LC0A 2GN8A 1XU9A 4BKPA 3VYSB 1OJLA 1PEYA 2NPIA 1D09A 4EUHA 1P1KA 4WH0A 3GIDA 1Y3AA 3R24A 4X8OA 1PW5A 2IHZA 4TMWA 5AM4A 1QKKA 2V97A 1P9WA 4RMIA 2ARKA 3M81A 4IH4A 1XD9A 3QVMA 4OHMA 5GADl 2PS0A 2JBHA 3BILA 5CLJA 2OAP1 3GOHA 4P4SB 5AUNB 3T5CA 4G8CA 2JIOA 4L16A 2ABWA 4HQOA 3MWLA 4AF6A 2IYVA 5I7VA 1LTQA 1N2GA 5EN4A 4O5AA 3UB4A 2B36A 2EX0A 3EC2A 3QXSA 2VT2A 4K9KA 1YXMA 3PXBA 3K2QA 3LSYA 1Y34E 2SBTA 3WV5A 2BGJA 3MAAC 3NNNA 3S2IA 2C4MA 2NNWB 2QEQA 3LDGA 3OF3A 4UAGA 4JL5A 1TTQB 2GCOA 4TRNA 3EDYA 1PO7A 3U16A 1ZBQA 3OT1A 4Q9AA 3VX3A 1JNXX 2V7UA 3WB0A 1IZ8A 3EODA 3VPBA 5FLKA 3I5XA 2R8ZA 3WKBA 2B9EA 2VA9A 4RKYA 4Z7JA 1JIUA 3GGDA 1NY5A 2MSKA 3OM8A 1YT5A 5I51A 1C9EA 2DUWA 2FP3A 2P77A 4IZ6A 1I5RA 2BKXA 1HH4A 1VJGA 2HCJB 2X8WA 3G2OA 4FINA 4MH0R 4NK4A 2CUNA 4XOIA 3LGSA 2MMGA 1YNOA 1A5ZA 3AF0A 1MIHA 3KZKA 4A91A 2NVBA 1ZRSA 4ENWA 1EVZA 1PJAA 1Y37A 2GCOB 3IT2A 4O02B 3QELA 1UXJA 2D5AA 5EHXA 3BKXA 3OT1B 1DC6A 2O3QA 1N2EA 1ZEMA 1QZXA 3CCBA 4RD3A 3WMEA 3AOEA 1VJDA 1O5OA 4EL0A 4ON9A 1XKLA 4UCXA 2A0FA 3PG5A 3TQHA 4MEBA 3UOWA 2XX3A 3I1YA 3OF5A 4HDNA 4MROA 1CIPA 1QGUB 3TJZA 2P9FA 2QLNA 4P83A 1UJMA 1D6JA 1TLLA 3C48A 4OQMA 2ACEA 1O95C 3F98A 3GA0A 5JPDA 2OAQ1 4D4MA 3P0IA 2FZCA 1V1MA 3N76A 3QELB 1PZEA 2JANA 1MO2A 2PLFA 3PGMA 4HVCA 3GQVA 2HMYB 3IO3A 3LECA 2GD1O 4IDBA 4DQ0A 1M34E 2A9JA 3OIGA 3ZXUB 2L17A 4PZEA 4ESEA 2JFGA 1K9SA 2YIMA 3N3AC 4FKMA 2VPPA 5CYFA 5TNXA 1A7JA 1Q1EA 3OPMA 1KC3A 2ZSAA 5KKAA 1ATIA 1QX4A 1U80A 4HDNB 2HNKA 5B55A 1NP6A 5DCLA 3KQKA 4WZBB 3ASZA 4LK2A 3HKCA 3OPQA 4J7UA 3E23A 5BR4A 5C1PA 1W4BA 1OFVA 1K88A 2YJGA 3BHJA 2M2IA 3NORA 4ZDIA 3O73A 2A5GA 3CM0A 2B25A 1SULA 3O8BA 3O95A 1OAKA 1V1MB 1EDBA 2FV8A 3E9EA 3DOCA 3PTLA 4F46A 1EUYA 3Q85A 3QSYA 1M2EA 1U3GA 3CKMA 4DHWA 1AHNA 1PI3A 4PSDA 3LF1A 5CLQA 3RG8A 2RKBA 5E7IA 5CB8A 3HXOA 1SOWA 1UINA 1U3DA 1YB5A 2WABA 3ZXXA 2CXUA 4A2WA 5KAPA 3DWIA 1Y5NA 2P9BA 4WGGA 3ITEA 3TBHA 3BSFA 2ZETA 3HKCB 5ED0A 3K09A 2J3EA 3VVCA 3DEYX 1PS0A 4HX9A 5C51B 4R8KA 5AVQA 3WLQA 4WLEA 3TYXA 4D25A 1UAYA 4F3NA 3QFHA 4UU1A 4U2GA 3P9KA 4BLQA 1OV4A 3PX2A 3RS9A 1Z8DA 4N49A 3V2HA 3E58A 1U3FA 3T9AA 4H59A 4EJMA 3KETA 3OQNA 1E63A 1YZQA 1TZJA 3C6YA 1SVNA 4IIGA 1ZNZA 4UEQA 3G1WA 1E9RA 3WHIA 1ZM7A 1UZAA 5FHQA 3ROXA 1V6CA 3TSWA 5CCEA 2BMVA 4TXJA 5IVKA 1U8ZA 3FGPA 3JD2A 4Y9RA 1XEAA 4YT5A 3OQVA 3ER8A 4IRUB 4X6XA 4B79A 5A71A 5EJ6A 1MAAA 5EKDA 1HEYA 1V7ZA 1QFYA 2W0MA 3IAXA 4KBFA 4NICA 3F4BA 1GG9A 2RH5A 1P80A 2NTJA 3L7JA 3P4XA 3OKCA 4CG0A 1U1FA 5EJGA 3RUPA 4QVKA 3ECSA 4C0QC 5H3LA 1VCMA 2Y0PA 2HJHA 4L2IA 3LD9A 4W8GA 1XRPA 1U6KA 3NTUA 1U9CA 3HYRA 4HH0A 5BQXA 2C5GA 1AURA 1XZGA 1GA4A 2HM7A 3GRYA 3QEKA 4BMZA 1DG1G 1G8KA 1V11A 3IVGA 2ZDGA 1GDDA 1HE4A 3NKLA 5B3JA 4E3WA 1QCYA 3PUVA 3FOZA 1EI9A 1ZR2A 4PO8A 1G8MA 5IM4A 4I8IA 4ZU6X 3SYRA 4B87A 5AJWA 1I7NA 3QYJA 4G6ZA 4QEDA 4YAIA 1T4DA 2FGKA 3QJ5A 4QRIA 1UDXA 4UUPA 2WWHA 3CXRA 4L2IB 3IT3A 5JAHA 2ZUUA 1OKKA 1DZIA 3K35A 4HNAB 4Q93A 5I7FA 3U7FB 1G4UR 1JU3A 2V4ZA 5TEWA 1LC3A 1WW2A 1G20A 2D2VA 3LC7O 2OHXA 1GA6A 1V11B 2QUJA 3QEMA 4RMHA 3MF4A 4I1PA 5JJKA 1V45E 3P9IA 2CXXA 3VR1A 3BFKA 4D96A 3ZWYA 1T1RA 2OCGA 2BZSA 5DRYA 1BEUB 4F5YA 3NGMA 2O05A 3IR6A 1I1NA 3IP3A 3HJAA 4TZ6A 3IGFA 5L6LB 2FSGA 3KPUA 4UM9B 2WIDA 2HYIC 4IEIA 4BQQA 4OHWA 2FUCA 5FPKA 4LSWA 5K8VA 1G20B 2M1ZA 4DPMA 2ISSD 3NVKI 2K5UA 5LCXA 4X65B 2A0UA 1PAUA 5D51S 1CZNA 4FHEA 1MFZA 3IAAA 4URYR 4MAMA 2MYPA 4XCXA 5GJCA 4ZCTA 4LCJA 2ZXFA 2CB9A 4IMRA 2Q41A 3GK3A 1J9ZA 2A35A 4K3VA 4D45A 4EH1A 4BXOB 5DP2A 1ZOPA 1N3YA 2WQ6A 1FLAA 3A25A 2B35A 2KM1A 4XB2A 1A9SA 1SUCA 2XT0A 3HV2A 3LHDA 1RHRA 4I1RA 4YB8A 3P0HA 4JQZA 1DZ3A 4FDLA 1G2PA 1U5CA 4A6XA 3I83A 2W2MA 2Z2XA 4FMCB 3HXQA 3I05A 1SU7A 1Z07A 2ZB4A 4GWLA 3PF8A 3C3JA 3WGHA 3P71T 3GUYA 3U5TA 2I0FA 4WKOA 4CIXA 3ZX5A 4TUYF 4PCUA 5IFKA 3O92A 2G1JA 2VAWA 3ZE8A 2IP2A 4ZAZA 2W6JA 1XA0A 1PVVA 4J0FA 2ATVA 1HDOA 4PNEA 4G0UA 4J6EA 2J3JA 3DKIA 1F2UA 3DEKA 1EWKA 4GBED 2OBNA 1DRWA 4M1OA 2BFBA 2IOFA 1HKHA 2MYNA 3R3VA 4PEVA 1WMEA 4P3YA 5T6MA 5ADWA 1ZXLA 2E4XA 4HB4A 2P68A 3PHHA 1SCJA 3LLVA 2HCTA 3VR4H 4E6EA 3FOBA 5B1YA 4DDMA 2AEEA 2OBFA 1PLLA 5HKKD 1XAIA 3CN9A 1KARA 5JI3E 1RXEA 3UJ3X 2XOEA 1PLKA 3UCFA 3DV0B 3UHFA 1BNCA 4J0CA 4HYTA 4E2FA 4Z5XA 2Z3ZA 4A1OA 3C7KA 3KIPA 3SYNA 4EO4A 3CC8A 5C5IA 1F2UB 1S8OA 1LI4A 4EKNB 3VYWA 4QDXA 2AWOA 3EYAA 4IYRA 1X74A 2VPQA 4BFVA 1YZUA 3VO9A 1DDIA 2G6BA 3BRSA 1R0LA 3LQRA 4X84A 1B0AA 5BWOA 2GR9A 5A0VA 1FQWA 3JD0A 1KYIA 2AUNA 2ZJFA 4GBMA 2JLSA 2UKDA 1H93A 3EB9A 4IX9A 3GBSA 4MV6A 2B8WA 3B82A 3FR7A 4DUPA 4UOEA 3SIXA 2E48A 3WYAA 4BPRA 3OKPA 1RP7A 1M2GA 2BM9A 1J42A 3OUZA 4YJKA 2V6FA 1I1HA 1R0ZA 3SQDA 4WJZA 1VCOA 1J0AA 4IQ4A 4YEDA 4D8WA 5GTDA 1HL3A 3K5IA 3O4VA 4I4NA 1T3SA 2X2EA 2Z4SA 4DRZA 5L4SA 1QVZA 1X1BA 1T5OA 3L06A 3VZRA 121PA 4B4VA 3U4MA 3H1EA 4P5PA 3KLBA 1IZZA 2ZS9A 1DX6A 1QV6A 3AB8A 3EF3A 4Y1GA 4BCCA 2HK6A 1W5FA 3KSDO 2GETA 3AIIA 1P5JA 4BN0A 1E7MA 2NWQA 2Z83A 4AY5A 2TMYA 4DSTA 3GR6A 3H6GA 4XFJA 2H92A 4Y9TA 5EHGA 3ZV4A 1SCQA 1TQ6A 3I1FA 3AJRA 3SEAA 2NGRA 4QDJA 1C80A 3UWOA 1U3TA 3EPHA 2QN2A 2V1XA 3T5GA 1YDEA 2RH8A 2ID7A 3ZKWA 1CY2A 1SO8A 1X1TA 2DM6A 2DQZA 1MHPA 2WZDA 4MW6A 2ILVA 4ER5A 5A06A 4DHEA 1J39A 2XVYA 1R2QA 3N2IA 4GWKA 4KWHA 5EZSA 3PA8A 4Q18A 2QR5A 3CF4G 4E94A 4V0OA 3ZW9A 4WZBE 4EI8A 1VE6A 1A5AB 1M0WA 2HOQA 4BE9A 5AUPB 2GUGA 2X42A 7GPBA 2C99A 3JD4A 2HY7A 2EIXA 1LPOA 5KPJA 4YTEA 5DKFA 3KBOA 1AV7A 1KYZA 1L4FA 1NC3A 3JYPA 3FE2A 4FYJA 2NT3A 4M76B 3JWEA 3BGDA 3OY7A 3ZKWB 4IXDA 1DP4A 2P9HA 4URZR 3SR4A 4ZK2A 4CM1A 5IN4A 4L3WA 3TPZA 3TZLA 3H9BA 2BBOA 4DCMA 2Q3MA 1YS4A 4L76A 1PX2A 2YZGA 5CX4A 3AYZB 3SF8B 1TC1A 3L7DA 3N28A 2C5SA 1EEHA 4UXHA 1UK9A 4AY6A 1JDJA 3IP7A 4HWPA 5ESDA 1KMCA 4KUGA 3A2KA 2DPGA 3FSGD 3GAZA 3OZGA 1B93A 4ZQBA 4HOYA 4PS1A 1B76A 1LNSA 1GLGA 3G0DA 4B17A 4NU5A 1MXFA 2XWBF 3JZFA 3QHQA 4X6UA 5AI5A 1MR3F 4RC9A 1AQJA 1JDSA 3GWZA 2E82A 3PRJA 3T7JA 2VAVA 3H5LA 4U3JA 1EBFA 4B85A 1XCGB 2WP0A 5FOWA 1NZFA 4REOA 5JROA 1RHMA 3SXJA 1KI8A 5FPSA 3UK1A 4F4JA 1K0FA 4Z99A 1EFVB 1XRSB 3NHJA 3AG6A 1MRZA 1L5OA 1QU3A 5B64A 5DGTA 4KR9A 3K70C 1FK8A 1U7TA 2D4HA 4FFMA 5FUWA 5CVEA 3KQLA 1GPAA 1JHDA 4YRPA 3G6KA 4ND7A 4UNSA 2FWBA 3RHFA 1YZLA 5FUBA 4AKGA 4DR5B 4MQFA 5I9BA 3B78A 3F9IA 2QR3A 5J2UB 4U3JB 3REOA 4KQKA 5J58A 2PKQP 4NAHA 2O48X 2FJUA 4NOKA 1YIDA 1NLYA 1OC2A 3MPUA 3TO5A 1B6GA 4FXOA 3ME5A 2RCNA 3G9QA 2QPOA 3L8YA 3TJMA 8LDHA 5MN4A 1B0ZA 2CDNA 4B6RA 4BMXA 3LLCA 2XRYA 5IJZA 3QLVA 4CPDA 4KVGA 4IGIA 4GX5A 4F3KA 5LWQA 3BK1A 1A8PA 4JGBA 3RO7A 1BJKA 2WTBA 3BAFA 3RVLA 2QRNA 1JKXA 4MQFB 5KDOA 4Z4IA 1HT0A 2IUUA 2IC5A 2AD1A 3TZEA 4E5DA 2A3NA 3OZCA 4HGQA 3REQA 1TF5A 5B6PA 5IM4F 2HV8A 3MWKA 4ZGWA 2FMTA 2HH9A 1K7XB 2NU8A 4UTOA 3T4PA 1HR0B 1A8IA 4PHGA 1CF4A 1JR4A 2VUUA 3KPWA 3DUFA 1TQ2A 3LFHA 4U7HA 1RKQA 2ONZA 1IUPA 4KYIB 5BSKA 1BXZA 1L7EA 4DT1B 3L18A 5JQWA 3WGMA 3GJRA 4H3HB 3TIVA 2W2LA 4CKBB 2ODQA 1EHYA 1CUAA 2EKLA 2Y27A 3M2PA 4KU4A 2ZYIA 5A9SA 3TQFA 5AJHA 3D3EA 1S8NA 2YXBA 3LCCA 3REQB 1M1UA 4EF5A 4H4EA 3CX8A 4NOMA 2HZBA 3C4VA 1A27A 3MXOA 3Q88A 3TW8A 3V4LA 4BMNA 4XB6B 1I3CA 4FR2A 5DNWA 4CM9A 3DAPA 3NS7A 2YIDA 3OJXA 5F1OA 1SBCA 2CL7X 3DUFB 5AKZA 1CVIA 1JQJC 4A8JC 2KLHA 2VDJA 5EEGA 5KYUB 3EWNA 3LU1A 3O03A 4FUQA 2O19A 4TRRA 4FMCF 3KVNA 2J9FA 4EZBA 1GZ6A 1XLTA 5GV8A 4DAEA 3FOFC 3Q4GA 3UA4A 5HM6A 2F59A 4NYIR 5A9SB 4R1SA 5IVPA 3T1HB 3M70A 2BUBA 4RS3A 3IV7A 3G59A 4AZ0A 3WNVA 4ZHQA 1MC1A 2HLHA 4UBOA 3DAOA 3LGXA 3UG7A 3ZU5A 3N75A 3LX5A 5MFPA 2XGJA 3K6RA 1ISGA 5ALWA 4QGSA 4K86A 1CZLA 1UDAA 1DXHA 3ABRB 4ND8A 2FOXA 1AMUA 3VDNB 1RM4A 2ZUEA 1XZQA 3IKTA 2B37A 2ERXA 5ETJA 1EBUA 3P9CA 4WADA 4Y0AA 2AX4A 4ZV7A 3L93A 3KEGA 4QDKA 3TVYA 3IVRA 3WHKA 3OTIA 2C4WA 1M54A 4NCIA 4DILA 4QX6A 4B3BA 3FMFA 1T4CA 4AZ0B 5KVAA 3SZ3A 2RIPA 1ND6A 1PK9A 1JDBC 2EF0A 2AH5A 2BGGA 3EZ2A 2W6ZA 4J0KA 3STUA 2V55B 3E70C 4FB5A 1WX1A 1XWFA 3GQBA 4KBYA 2ZSUA 2YQ4A 3ZBPA 1NBHA 4PN7A 1FP4B 1MTOA 3A0RB 2BPOA 5T4HA 3UTDA 4E6PA 5HUJA 4JUAA 3OEYA 4XZ3A 1GPKA 4B43A 4B3CA 3MQ2A 5E4JA 3P9RA 3QFFA 2A86A 4KH1A 4L3OA 2OGZA 4A0SA 4LZNA 1T4CB 4X20B 4COKA 3PGXA 4KPGA 5H7XA 4HLDA 2NZUG 1ST2A 4NEQA 1SC1A 3T7SA 3F67A 4YR7A 1EWTA 2PZFA 5KHOC 1PGNA 2CVPA 4N1AA 4BNHA 2XYVA 3VDQA 3GQBB 3CPJB 3UATA 3ICCA 2XZPA 4LJAA 5LB2A 1ZBDA 4Z4FA 1PJZA 1BS2A 1QNLA 3AWDA 3DMPA 3QYPA 4KXLA 4YMIA 3VTZA 1K6JA 3AUXA 3FKJA 4BLSA 4W9NA 4UVDA 3FPKA 1A88A 4PONA 4DLWA 2NX2A 1VE9A 3LV8A 2UVPA 1U4SA 3PUIA 2IS2A 4GPTA 4EHDA 1IRXA 4DMRA 4L57A 4R3NA 4R5MA 3IUMA 1K7CA 4KWTA 3CZ5A 2HSWA 2WSSA 1M2HA 1QPBA 4L4ZA 4G89A 3N53A 2IITA 3E5MA 3PPXA 4KVFA 4DCUA 4ES6A 2A5LA 1WTAA 1D6SA 1RBQA 2VNIA 5AHKA 3QE9Y 2J87A 5EJAA 4E1VA 4JMPA 2OPBA 5LDDC 3GPDG 2BR3A 1K7YA 4J2HA 4JU8A 2B98A 2GJSA 3F3SA 2UVPB 5JU6A 1PJ8A 1PZGA 3FJ1A 4UHJA 4HDQB 4O8CA 5C8VA 2QL7A 5FXMA 1KL7A 1XZPA 4M1MA 1JZTA 2UYQA 1IIBA 3GNQA 4ZOQI 1N5DA 3UWMA 3K5PA 5DNCA 5K8LA 1SK8A 3NHMA 4JJIA 4FW8A 3UXYA 1QRSA 2PD4A 3PCXA 1XA4A 1R0CA 1AC5A 2IZ7A 1IXZA 4EJ2A 4JBGA 1CHNA 3LF2A 4POOA 2QG9A 4YAUA 2O2IA 2P4QA 4Z9XA 2PX4A 3HCRA 3K1ZA 4MQMA 1NSYA 2X86A 3TTYA 2BSQA 3RHTA 1AY0A 1YQDA 1JDPA 4GI1A 3PGVA 2FZKA 4DLLA 5FBWB 3MJCA 4N7MA 4RMJA 4X3PA 5BV2P 1CKEA 2CE7A 4AG5A 5HJ5A 4S1NA 2HMVA 1RZRA 2R5NA 4CIBA 3ONDA 2GK6A 3VZSA 5AM0A 4PZDA 4ZKEA 1LVGA 1U3UA 1OROA 1T4GA 1NJ6A 1YJQA 5K01A 4FSXA 5BNIA 3KJZA 5AM1A 2WM3A 4C1BA 5LBIA 4F11A 2JGNA 5FA6A 1SBHA 1C7FA 1C7RA 1W47A 2C8JA 2Q5CA 3F5MA 3GJTA 3ND7A 1QLHA 2ZUCA 3E48A 3OICA 3OFJA 5CIYA 4Z2YA 2H85A 2DHEA 4P9NA 4TSFD 3KSBC 4LXIA 4E2ZA 2C4UA 3A1SA 2JA2A 5JEEA 1UEJA 4UNQA 3CF6R 3W5SA 3VU1A 3FTCA 5AVJA 3AO0B 2PD6A 2C3MA 2VT6A 2GQ0A 4RDCA 3WKDA 3TIIA 4YUYA 2EZ4A 1I30A 4YLYA 4NSNA 3T7DA 5LZ4A 3THXA 3H9EO 3I9JA 4GVPA 2RGGA 5AVWA 1TT5A 4MRAA 3IA7A 4A6EA 1AZWA 2ZB2A 3NGLA 4YV1A 5HTKA 3UXEA 3OMXA 3V33A 3WQRA 1S2DA 3I6IA 2BR4A 4FBLA 1LWOA 5AHOA 1P2DA 4EGAA 3A8TA 1TK2A 4N18A 4EW3A 3V4OA 5HOEA 3MFYA 4HEHA 1SNYA 3PD7A 4Y6RA 3C6XA 4DEYA 3SVTA 4KQ6A 4IIHA 2J8ZA 1PWXA 3BMNA 4YDRA 2RB5A 2IHTA 1JSCA 4UFNA 2EW8A 2CFCA 2MOKA 4YAOA 3T5TA 3THXB 5DCYA 1PJ4A 2V5VA 3DV2A 4UUMA 1GN8A 1TJNA 3ZY6A 5B1IA 4P3KA 2AB0A 1KU0A 2GTHA 5DTMA 2IKQA 2IY8A 4CCSA 3R9KA 3IQZA 2CLCX 3DFZA 2WHYA 2JJ2D 1BYUA 2XIJA 3R8FA 1E4EA 4K6KA 2VUIB 3V1UA 5HNKA 3U7RA 3MS2A 4IWYA 5SZHB 3O26A 3VNAA 4OK5A 4M1EA 3K73O 4C0AC 3BMNB 4E21A 7AT1A 3CVYA 1RHJA 3ZCTA 4YUAA 2XAUA 3DT6A 4Y30A 5CFQA 1CUDA