4LG1A

Human methyltransferase-like protein 21d
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
218
structure length
217
Chain Sequence
DPLRSFVRVLEKRDGTVLRLQQYSSGGVGCVVWDAAIVLSKYLETPEFSGDGAHALSRRSVLELGSGTGAVGLMAATLGADVVVTDLEELQDLLKMNINMNKHLVTGSVQAKVLKWGEEIEFPSPPDFILMADCIYYEESLEPLLKTLKDISGFETCIICCYEQRTMGKNPEIEKKYFELLQLDFDFEKIPLEKHDEEYRSEDIHIIYIRKKKSKFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of Human Methyltransferase-Like Protein 21D in Complex with SAM
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Protein-lysine methyltransferase METTL21D
total genus 72
structure length 217
sequence length 218
chains with identical sequence B, C
ec nomenclature ec 2.1.1.-:
pdb deposition date 2013-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10294 Methyltransf_16 Lysine methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4lg1A00
4KIGA 1YZHA 2CL5A 3EGVA 3G2MA 4FP9A 5U4XA 1X1CA 2ZZNA 5D1NA 3FPJA 1VLMA 2PT9A 3MHTA 4RTLA 3LECA 3R6TA 4G56A 1P1CA 1SUSA 3GRYA 5DTQA 3S68A 5LQKA 4E30A 1JG2A 3UZUA 4OBXA 3A7DA 3M6XA 3G89A 2IDJA 3KR0A 4PINA 5HFJA 3DUWA 1Q0TA 4K6MA 3SXJA 3L8DA 2PGXA 4PIMA 1JQEA 4EK9A 5T67A 3LX6A 2BM8A 3P9NA 1HMYA 4GC9A 1O9HA 3G2OA 1M6EX 10MHA 2BR5A 3MQ2A 4BLVA 4IKPA 3ME5A 4IV0A 2HWKA 5K0CA 5CVVA 2VP3A 3GRUA 1SUIA 5K8VA 2ZCJA 1U2ZA 2YUIA 4RVDA 4PCAA 3TM5A 3SSNA 5K0GA 5CVUA 2HR1A 4KW7A 4PYLA 4FSXA 1EQAA 1L3BA 1DCTA 5FA8A 2LD4A 2AOUB 2PSSA 5DTMA 4ER0A 2B78A 1F38A 1PRYA 2A14A 5MHTA 4AX8A 3HVKA 4GF5A 4PYIA 3UJCA 2YXLA 4CTJA 4XUCA 1ZGJA 4X60A 3G5TA 3A4TA 1KHHA 4RTQA 4XUEA 5ICCA 3VC2A 3TR6A 2FCAA 3DXXA 2HV9A 3KPVA 2DULA 2AOTB 2PX8A 4GOOD 4M38A 3HVIA 4DMGA 2G8NA 5GIOE 1NE2A 4CKCA 5F2NA 3FUWA 4C03A 3GJYA 2PJDA 1RI3A 4E2WA 1SQFA 3EVEA 3NWEA 2NYUA 5EPEA 3DXYA 2EFJA 2O0LA 4R05A 5KVAA 3DTNA 3FTCA 2ZIEA 3OZRA 3MTEA 4M36A 1YF3A 4R8SA 4ER6A 3DH0A 4PIPA 4E33A 3VYWA 2B25A 2V7EA 3BGDA 4EKIA 5E2AA 2YX1A 2QRVA 3P9IA 4YV2A 2KW5A 1FP1D 1YZ3A 3NWBA 1NW5A 1SVUA 5EIFA 2JH9A 3R3HA 2NP6A 1F3LA 3FPHA 4YUYA 3FUUA 3HVHA 4KDRA 3P2IA 5E1BA 3GDHA 2ESRA 1RI2A 2GH1A 3AY0A 3LL7A 1NV9A 4QQNA 5LQUA 3GNLA 4KIFA 4PYOA 3PVCA 3FUXA 4QQKA 5H02A 2H00A 5HILA 4RTKA 2AZTA 5FHQA 3EEYA 1O54A 2O07A 3GO4A 3HA7A 4GBED 4LECA 4DQ0A 2P7HA 3HCDA 2PXCA 1JG1A 2DPMA 3LKDA 3M6UA 3BKXA 3OFJA 3EEOA 2UYCA 3VSEA 2P41A 2AR0A 2P3OA 4M7RA 3BT7A 3DR5A 1WXXA 3B3JA 3KR2A 5T64A 3SVZA 3TOSA 4CKBA 5LQAA 4GOND 4FT2A 3R9XB 1EG2A 4GOLD 3EVFA 4L7VA 1TW3A 4XUDA 5DTRA 1L9KA 4RTSA 1N2XA 4BP3A 2VZ9A 2OO3A 1FPQA 3EGEA 5GOZA 1ORHA 3LCUA 1X1BA 1NT2A 1RJFA 2P3QA 5HIIA 4GUAA 5C1IA 5IKMA 3P71T 1JTFA 2ZIGA 4FZVA 3TM4A 4C07A 1JSXA 3LDUA 4RYLA 5FADA 3UBTA 2PWPA 5EOVA 3FTFA 1O9GA 1QANA 1EJ6A 4QDKA 1QZZA 3KPWA 3E7PA 1QYRA 2OB2A 5B1SA 1IM8A 4BP1A 2ZTHA 2YTZA 3IHTA 3KR9A 1XTPA 3LDFA 4MQ4A 3QOXA 4KVZA 3EVGA 1G8SA 3E05A 2G72A 3FYCA 4X41A 1X1DA 3FTEA 3ORHA 3B7PA 3I58A 3ELUA 5DSXA 4AUKA 3IEIA 4EVIA 2V74B 3R0QA 2ZBRA 1V39A 2P1DA 5E8JA 3O7WA 4RVHA 1R8XA 2JHPA 5KQRA 4C05A 4RTPA 4DA4A 4DCGA 3HM2A 1R8YA 1VL5A 3FYDA 3FUVA 2Q41A 1YFJA 3KU1A 5FCDA 3HP7A 4RTJA 5HZMA 1UFKA 2XYQA 3UA4A 5K09A 1SKMA 8MHTA 5LQJA 3DXZA 4FSDA 1BC5A 3H2BA 4QTTB 4X63A 1XCLA 4PWYA 4V0RA 3SM3A 2C7OA 1N7IA 3BWYA 3DMGA 3M6VA 3V97A 2AOTA 2OZVA 1L1EA 3HEMA 3BWBA 3JWIA 2XVAA 2HTEA 1I1NA 3GGDA 4HH4A 3DMHA 4M37A 3ELDA 1KPGA 4R6XA 5DM0A 4EKGA 1YUBA 2ORED 1Y8CA 5GIPE 2ERCA 5IH3A 3UJDA 3C3PA 5EHIA 3B5IA 4HTFA 1NW7A 1YB2A 5FA5A 4CTKA 2R6ZA 2P8JA 1WZNA 3LCCA 1G60A 3GWZA 1P91A 2AOXA 4RTMA 2ZVJA 2IH5A 3T7SA 2XYRA 4HC4A 5DRYA 2IBTA 3PFHA 2C7PA 9MHTA 2OB1A 3NTVA 3TMAA 3BWCA 3CJRA 3KPUA 1IXKA 3M6WA 4YUZA 1JG4A 1G8AA 1ZG3A 2EJUA 3KPJA 3LGAA 2B3TA 1I4WA 3A26A 3BWMA 3KQPA 4P7GA 2R3SA 2I62A 3ANXA 5GM2A 1EJ0A 4E2ZA 3UWPA 2C7QA 4F86A 4ISCA 3Q7EA 1ZGAA 4E2YA 5HIKA 2UYHA 2UYQA 3ER8A 3HA3A 1MJFA 3D2LA 4C04A 1XDUA 2ZW9A 3K0BA 3GRZA 4V0QA 4DF3A 3GCZA 2QE6A 2ZSUA 4O29A 3RODA 1QAQA 1G55A 3KQQA 4FT4A 1L3CA 1VBFA 5FULA 3UA3A 4PCLA 2FYTA 3KHKA 2G1PA 1NBIA 2JH8A 2O05A 4MTLA 2PT6A 2PX4A 3AXTA 1M6YA 5BW5A 5JUWA 1INLA 1VIDA 3O4FA 2IIPA 5GINE 4AZSA 3RIEA 1RJEA 3TRKA 2ZLBA 3A25A 3P2KA 4RSRA 2FHPA 3CGGA 4FGZA 4XCXA 2ZFUA 3DMFA 1JR4A 4LG1A 3HCFA 4Y2HA 4PGGA 2OYRA 4PONA 1JQ3A 2OY0A 3PT9A 5LSAA 3BKWA 5LQCA 3TKAA 3UJ7A 3NMUF 3PB3A 1R18A 5EKUA 2Y1XA 3TQSA 1WG8A 2PX5A 3KQVA 3UJ9A 4DZRA 2C7RA 4ER7A 1KIAA 3DP7A 2YR0A 3GRRA 3GXOA 3G2QA 3LCVB 4LWOA 4QPNA 1D2CA 1FJXA 5KYGA 4RTOA 1R00A 5DX8A 2HNKA 3PX2A 4F84A 1X19A 1XVAA 3EGIA 5F2OA 4ER5A 5BP7A 1ZQ9A 3THRA 2OXTA 4B17A 4C4AA 3KQTA 3FRIA 2ONZA 4R8RA 3LBFA 2FK7A 1NKVA 2GPYA 3R24A 5CCXA 4P58A 4QVGA 3I9FA 3MERA 1XDSA 3IV6A 1I9GA 3EVDA 3G7UA 2ZWAA 1N7JA 3Q87B 4RX1A 2PVCA 4AZVA 4JXJA 1TPYA 3NJRA 2GLUA 1P39A 4PNEA 3A27A 5CVJA 4OX9Y 2EG5A 1ZHFA 2XVMA 1XCJA 5EQJB 4QDJA 4U7TB 2IGTA 1JTEA 3PS9A 1ORIA 4ER3A 1NW8A 5FTWA 1PJZA 5G02A 3DULA 3E8SA 3EMBA 1AF7A 2AN3A 3IYLW 1G6Q1 3OE5A 5CD1A 5EMMA 5K0JA 5K0LA 2AVDA 2I6GA 3NVKI 3TFWA 3CVOA 2PXXA 4AZWA 2OKCA 4PYKA 3P2EA 3M70A 2UYOA 4RV9A 2CMHA 5EEHA 5E9QA 5EIWA 5ICFA 4C08A 4PYJA 1VPTA 3B3FA 2O06A 2IBSA 5CIYA 2K4MA 3LPMA 4BLUA 1T43A 4OA8A 3DLCA 1WS6A 3REOA 2BZGA 4ATNA 3MCTA 5DSTA 2IH4A 5DXAA 5T6BA 5KQSA 2XYVA 3PX3A 4QVKA 4DCMA 4GOMD 5EEGA 4OQDA 1Q0SA 2AN4A 3EPPA 4WVLA 3EVCA 4P7JA 2QRVB 3M4XA 3OU7A 2CMGA 1KR5A 4GC5A 4HRAA 2JJQA 3SMQA 4KWCA 5FHRA 2AOUA 3BGVA 5HIMA 2Z6AA 1IY9A 3QOWA 2PX2A 3HVJA 3KKZA 4QTUB 1VQ1A 3TPZA 5BW4A 1JSZA 1NW3A 4P7FA 5LQRA 5DM1A 3G5LA 5K0FA 7MHTA 2QM3A 3ELWA 1WY7A 2CWWA 2YQZA 3JWGA 3T7RA 1TW2A 4E70A 5DM2A 3C0KA 1FBNA 4A6DA 3M33A 3EVAA 1D2HA 3UJAA 5DX1A 4A6EA 5LR6A 3LDGA 2AVNA 1HNNA 2HMYB 4YMGA 4YUWA 5ICEA 4MIKA 2OPBA 4YMHA 3LBYA 1BKYA 3C3YA 2FPOA 3OCJA 1NBHA 1KXZA 3C6KA 2N47A 3AXSA 3CKKA 3MCZA 3VC1A 3KQWA 3T0IA 1AQJA 4PGHA 1QAOA 5DRTA 3NDIA 3NVMB 2AOWA 5ICGA 3FPFA 5M5BA 4HG2A 4OA5A 3TKYA 4IWNA 5EZQA 4BLWA 5E1OA 3PTAA 3CJQA 3EVZA 4H0NA 2YXEA 2H1RA 2BR3A 5BXYA 1OR8A 3G8AA 5K01A 1B42A 4DM3A 4BY9E 1L3IA 2WK1A 2Z6QA 5E9JA 4Z2YA 3JWHA 2ZULA 2FRXA 1RI5A 5JR3A 3UJ8A 3P97A 3UJ6A 1NV8A 5DPMA 5EVJA 3SR4A 5KS2A 3QV2A 3OPNA 4CWAA 3PLAE 2UZ4A 1JQDA 3K6RA 2PWYA 3I53A 4OQEA 1KYWA 2IPXA 4NECA 3U81A 5GWXA 4R6WA 5EGSA 2IH2A 1SG9A 4PYNA 5CUQA 5HOQA 1NW6A 4Y30A 1UIRA 2JG3A 1KPHA 1EAMA 3HCEA 1KP9A 3HNRA 2PKWA 3SSMA 1DUSA 2Y1WA 2P35A 3EVBA 3SX0A 4RTRA 3G8BA 4HGYA 5F2KA 2H11A 5EMLA 4WXHA 2NP7A 1R6AA 3G88A 2F8LA 4F85A 5K05A 5E9WA 1RJDA 5FWAA 5FUBA 5FQNA 2G71A 2IDKA 3KR1A 2FK8A 3JWJA 2GB4A 4RVFA 2BH2A 2PV0A 4E2XA 4YUXA 2B9EA 5K0BA 2NXJA 2ZWVA 3LSTA 4EQZA 4RTNA 3HTXA 1BOOA 3GU3A 4X61A 3C6MA 1SQGA 3KQOA 4PYQA 3SSOA 3V8VA 2Z6UA 3KQYA 4HTFB 5C9ZA 1AQIA 2AN5A 3HCAA 4UOEA 5DXJA 3CBGA 5CVEA 5EKXA 1AV6A 3CCFA 3P9KA 1WXWA 1ZKDA 3ELYA 5DX0A 4LWPA 5EZSA 2ZZMA 4ZTBA 3ERCA 3BZBA 3OU2A 3KPYA 2OBFA 3OFKA 3HCCA 5K03A 2EJTA 2ZIFA 2AOVA 4KDCA 2P7IA 1FP2A 3CJTA 3P9CA 3E23A 3OE4A 3OZTA 3UJBA 4AZTA 2PY6A 1DL5A 1UWVA 1X1AA 2NXCA 3BGIA 3MTIA 3ID6C 4OBWA 3B3GA 5DT2A 3DLIA 4MWZA 3KQSA 2GS9A 4E32A 4CKEA 4KRGA 2O57A 1RI4A 3FPEA 5E8RA 4GQBA 3AJDA 1XXLA 2B2CA 2ZZKA 4YV0A 1EIZA 2QY6A 1VE3A 3MGGA 3I64A 4QPPA 4C06A 2NXNA 2WA1A 3KQMA 2VDWA 2GAFA 5DM4A 5CVDA 2VS1A 3O31A 3WSTA 5E1MA 1RJGA 5EHGA 5CM2Z 4YV1A 3HA5A 4RWZA 3FTDA 5EC8A 4E31A 1G38A 1RI1A 2WA2A 1YFLA 2P40A 4PYMA 1QAMA 2GA9A 3GIWA 4DKJA 1R74A 3BXOA 3G2PA 5HEKA 1VP9A 2P3LA 4CXMA 2JHAA 1P1BA 1M0EA 1KPIA 3A7EA 2I7CA 3RW9A 3X0DA 2BR4A 3CC8A 4HSGA 5GM1A 2PBFA 5DWQA 5GP1A 2IFTA 2ONYA 4FS8A 4FR0A 1XDZA 5DLYA 3NW9A 2BM9A 3LHDA 2I9KA 3HCBA 2NXEA 1VP3A 3OU6A 4HGZA 5D1HA 3FPGA 5ERGB 3NDJA 3BUSA 3PFGA 5EMKA 3THSA 5CCBA 3UFBA 3GRVA 3T7TA 5EMJA 2G70A 2VDVE 2PXAA 3I5UA 1XJ5A 3FUTA 2CKDA 1JG3A 2QYOA 3AWIA 3MAGA 5FWDA 4P7KA 2E5WA 3P8ZA 3MB5A 3LKZA 4EMSA 3FZGA 5K0NA 5K0EA 5HIJA 2YVLA 3F4KA 2YXDA 2ZBQA 1Z3CA 5E2BA 2EX4A 4POOA 3B89A 5LQNA 2ADMA 3TLJA 1D2GA 1KYZA 3FRHA 2VDUE 2AS0A 5E1DA 4U7PB 4IV8A 5FQOA 3SGLA 4YUVA 1MHTA 4GEKA 2IP2A 1H1DA 2PLWA 2JHCA 3OZSA 5EG5A 4RVGA 1BHJA 3DOUA 2NNWB 4X1OA 5C0OE 4MHTA 2ZBPA 3EMDA 5P8WA 3ER9A 2XBMA
chains in the Genus database with same CATH superfamily
3LL4A 1QOQB 1Z0IA 3AEKA 3CGWA 1YZHA 3GDWA 2WMYA 1Z26A 1DO2A 3V1MA 3WBFA 5H0IA 5EJ8A 3B60A 3HACA 3MHTA 1O4VA 5I48A 2O6LA 4N65A 3GRYA 5EWMB 4ZD6A 1FFEA 4Y1FA 5B58T 1JG2A 2Y9PB 1R27A 1LTQA 1RKUA 1WUIS 1ZXLA 2H4WA 3L77A 4PINA 2EZUA 3DMRA 4RDIA 4X7PA 5CX1B 2JJYA 4EFMA 2ZQ5A 4BNJA 4RKFA 5L3ZA 3U6BA 4U7DA 1YI8A 5TQ2A 3PSAA 4GDMA 5K03A 1OILA 1UBJS 1PAUA 1L5RA 1BG6A 3HUUA 4HYEA 3G7NA 4NAUA 1GGKA 3DBIA 3JX9A 3Q7IA 10MHA 5I3CA 2BR5A 4CKYA 2QJTA 4DUGA 4IV0A 4EW1A 1ZD8A 3V6MA 4YDRA 4YR9A 3KZXA 1JV2B 1C3EA 2X9GA 5ITSA 4N6OA 2VJMB 4XB6B 1VJGA 2R5WA 1H4VB 4CQMD 2QA5A 2VHUA 3OZVA 2PT7A 4HP8A 2LD4A 2X0KA 1M83A 1K4YA 2G9QA 3ICEA 4J0KA 4HF7A 3DE7X 2CDRA 1UODA 1MMFB 1L7VC 1HQYE 2BFMA 3Q88A 1NBMA 2VXYA 5JQGF 4O5AA 4UNIA 1VLLA 1I6WA 3H7IA 4G8CA 3UB3A 2HDNB 1XCMA 1L8XA 2QT0A 4G1VA 4N1AA 2ZJOA 1W5BA 2FJPA 3U3MA 3O9ZA 4HB3A 2DULA 3R3UA 1JE1A 1FYWA 4F06A 1HEUA 3GEMA 4TYNA 2YBEA 3BGSA 3K0HA 4IH4A 4EW3A 2YRWA 3VX3A 2NQ2C 2VJBA 3INYA 1JDUA 3K9HA 1ONPA 4GGOA 3EVEA 4JJKA 4M98A 4OJNA 4OP3A 4DQDA 4B4KA 4X1YA 5I5EA 5KTSA 2P6UA 4OREX 3VI3B 2HJHA 3CYFA 4MQBA 4TTIA 4MVJH 4WK6A 1MX5A 3ZJYA 2G06A 4LZPA 2BSQA 3FPKA 3I52A 2CVQA 2QTGA 5F21A 1G7RA 1ZQ1A 1U8TA 5J58A 4MUKA 4R7TA 3RPEA 4C3VA 3L7MA 2R85A 5DOVA 1SIWA 1X8XA 2RKOA 1M8PA 1OX4B 2JH9A 1XU9A 3TCKA 4ZVLA 2LCQA 3TTVA 2HQOA 2PGJA 4INPA 9ATCA 2H4YA 3DFUA 4MIYA 1AHIA 3C2QA 1UKYA 1EFLA 4MPTA 5B3JA 3RM3A 3CN7A 2RC6A 3MTDA 3N8GA 2OWDA 4X93A 4MS1A 5FYDA 1R0LA 4I4TF 4Q15A 4X95A 4XWYA 2SKCA 4YMTA 4KR2A 3PXXA 4GVLA 3EBPA 4U0KA 2X0IA 4DQ0A 2RJNA 3HCDA 1NXXA 4BPBA 3OIYA 4JV5B 3EQ2A 2V7GA 3G6KA 1W52X 2ENUA 3GDGA 4B0OA 2FZLA 2YJGA 5IFKA 1Z2AA 2IX9A 3IKVA 4YRFA 5LXTF 2P9JA 1XRNA 4XUDA 1L4HA 2D3WA 3EGEA 4PAOA 1NASA 4IIJF 4HBGA 1ZJ4A 3CLSC 1NT2A 4L5AA 4P54A 4YT4A 3LDAA 5AI6A 4LC1A 4N6NA 3EXFA 4UUBA 4NDNE 2UXCB 3U3KA 2IYTA 3BHMA 4JC5A 4D45A 2QOEA 4EJFA 2FOIA 2RHMA 1O9GA 4UXHA 3VSBA 4NCJA 3QELB 1WB5A 4WOKA 5HFNA 3EX7C 3E70C 3LVFO 2B3DA 3IQZA 3MRTA 2H06A 5EE1A 1OFUX 2A57A 1HDCA 4GP7A 1DWOA 4KQGA 4D98A 1Q7TA 1XOIA 2G72A 5KCMA 4IUYA 4NE2A 1DFHA 1NZDA 3AV0B 4LE0A 3UHAA 3WYCA 1JLSA 2P4QA 2QTAA 5DYTA 2VDMB 2X4GA 1YS4A 2F4NA 3MINB 4W63A 2QUKA 3RS0A 1ZH2A 5TVGA 1JZTA 4J2OA 2QDXA 3EEFA 4E7PA 2A78A 4P92A 4Q1BA 4GRIA 3TXXA 4DWWA 1H5UA 3G82C 1WETA 2CJWB 3SEZA 5AQEA 3G9ZA 1CRWG 1I51A 4FBMA 4PS1A 4CYMA 1APBA 5IEJA 2P3SA 3DV0A 5LBUA 1RWNA 1JFFA 2L42A 3N1UA 4FFPA 4V0RA 5J4LA 2AW5A 5KC8A 1PWZA 3VKHA 1O5TA 1PJ8A 2MWMA 2QRJA 1DDIA 3WIEA 4ZTUB 1CHNA 1RYYA 3AZPA 3IHLA 1P0MA 1XV5A 3DMHA 4RFLA 3AHIA 3EDOA 3VDMA 3VR4A 3RAPR 3W8FA 5BSHA 2ORED 2ZYAA 1AD2A 3I42A 4H0FA 2RI6A 4NRDA 4XDYA 5DLEA 5IH3A 1A98A 1QTNA 3I72A 2PQMA 4JI3B 2QX4A 3ZHTA 4E3ZA 2Z98A 1Q7GA 5BN4B 1N4AA 4Y0NA 1H8HD 1DUIA 3AEZA 4ZVNA 4D82A 2NTJA 2JATA 2YFYA 4LY9A 4NZPA 5J2UA 5JJCA 3GCGA 4QVIA 5LP1A 3AEXA 3LKBA 3NH6A 2OB1A 5BMOA 2WVAA 3THWA 3G1TA 3LZ6A 4G5HA 3E9MA 2FZEA 3DLPX 1KVQA 1Q1BA 1R0SA 1E0JA 2Y92A 1TKCA 1WQ1R 3QFRA 5EFOA 3ZEIA 1XT6A 4AYTA 3QUAA 4O4LA 4PU0A 2XNHA 4RKEA 1S3IA 2V0NA 2JBAB 1BH2A 5KSZA 3VO1A 3BXXA 3JRNA 4O59O 4N8SA 4NEGA 4FE7A 1T36B 1G8GA 1XLUA 4IIDA 4D56A 1GO2A 1WMEA 2QE6A 4AJ1A 1S9DA 3MWFA 3W7AA 4JN6B 5C7OO 2A0YA 2G1PA 4QM6A 3R3JA 5HS6A 5JMWA 5FUVA 1FSZA 5LWHA 3BMCA 1JAHA 3UK6A 4BUJA 1JKXA 2V9ZA 5BSTA 5CT9A 4EA7A 5K0ZA 3VJKA 2P9FA 4GGPA 5B4VA 1ZEJA 4EY8A 1X86B 4ZVPA 3IVCA 1CJSA 3X1YA 1K6IA 2A5GA 2ZE8A 2ZRJA 1QIKA 1W5SA 4Y2UA 2OPHA 4P38A 3VNVA 4L8LA 2QMQA 1CETA 5HE8A 4JBWA 5LSAA 3D3JA 3S99A 4FB4A 4RA9B 1H3FA 1C0EA 1DKQA 3TLMA 1U04A 4EO7A 2R1TA 2V7PA 4Y8VA 5KAPA 3MCVA 1ZNQO 5DJ5A 5B57C 5KNBD 3UT5A 3OAAD 4U9HS 1SZCA 3D4LA 3U3XA 1MHPA 4V24A 3A4VA 2DOKA 2YMPA 3STHA 1V3VA 5A1TA 4KAFA 1DC8A 5GVSA 4LJLA 4R1MA 3FKSD 1AURA 4YDHB 2VT3A 1M5RA 1XHEA 3MOGA 4JBNA 2Y1LA 3CLRC 3S2IA 1GLGA 4CU2A 4OFBA 2FZCA 3DDCA 2I67A 4O8CA 3FZNA 4QRHA 2P5YA 2JZOA 2ZG6A 1O9BA 5DM70 3WP0A 1YR6A 3H8SA 1XNQB 1A8SA 1LCIA 2XZPA 4HT3B 1I9GA 4HEA6 4TV9B 3FPBA 2PRKA 3RF7A 1DP4A 1LKZA 1E9RA 3GLIE 1U2TA 2XDQB 4YT2A 4GDFA 1UMCA 4B3IA 4PQEA 4HZIA 4DBVO 3NI2A 4K7JA 1HYEA 1NSYA 3NQ41 3O2QB 1XCJA 1TCBA 3X2FA 1K5HA 3L82B 3BH7A 4IDBA 2JFVA 1NVMB 2GNAA 1NATA 3M6LA 2GPTA 1FRQA 4KN5A 4LI0A 1Z5PA 3CURA 2GVNA 4V2IA 2DU8A 4AWAA 2H3EA 2WWGA 5EEHA 2CZGA 2Q07A 4I5DA 2F2TA 1YBAA 2O06A 4JL6A 4JZKA 3T9CA 3TSWA 2PKEA 1NVTA 1NOKA 5JS8A 4WZBB 1T0JB 5TE9A 2JLWA 4BKPA 1LEHA 2D4HA 2GZSA 3BERA 3CXUA 1PZHA 2RH8A 4PW0A 4TXHA 3ROZA 2VAWA 4EKDA 3SVLA 1U7OA 2ILTA 2BP7A 4H7KA 4HGQA 2WU8A 3E3MA 2OFOA 3KYCA 2XHEA 2XMQA 1I7LA 2SKEA 2CD9A 4RH3A 3RS4A 5JXJA 1DTEA 4WWHA 3DR3A 1NR7A 1UKVY 3EZGA 2QGFA 4TQAA 3ZXYA 4UTNA 5LNK6 4FN4A 2IZ5A 3RT1A 5FHRA 2WTNA 5F7OA 3D6HA 6GPBA 3DT9A 2DB3A 3WK9A 4ZJYA 4YRZA 4O4IB 1VOTA 4CMJA 4UBIA 4B40A 3DVAA 3K70D 1TW2A 1VI6A 2WHPB 2GN6A 3L7AA 3QSGA 4PSDA 2OC4A 3PJFA 2I22A 3EGXA 3K09A 2RK4A 3AFGA 5TQ0B 4RMGA 3AY3A 1UAYA 3K31A 3LDGA 2YXNA 3BCSA 4WCFB 5CAEB 1UJ2A 2ODBA 2RI1A 3RJ5A 4YREA 4DADA 2B7CA 4GVXA 1XL1A 3C3YA 1C3OA 4CL2A 1QYCA 4MW0A 4JAVC 1ECGA 4NH4A 4X66B 1S8FA 4I4TB 3DZBA 3PNPA 4BQFA 1ODSA 3ZVLA 4OHWA 3R6LA 1G3IA 2CXXA 3ZXSA 4RZIA 4PGHA 2J0QA 3K3PA 5H70A 2AFIB 1JJVA 3OLYA 1LDEA 4PCVA 1KZ1A 2JIZD 5G1OA 1HLPA 4Q3AA 3NGLA 4WV3A 3ZDFA 4IWNA 4LJ6A 3W06A 4GZ5A 1RP1A 1DQPA 3QLTA 3DBHB 2CLCX 1VYHA 3A36A 2OP1A 1HT1E 3N6RA 1OI3A 4R2JA 4UCWA 4Z99A 2FOLA 5FTJA 4AP9A 2VNAA 1OROA 2VP9A 1YJ8A 3IKMB 4N48A 2DTDA 4EGQA 1XFDA 2CLHB 1VG9B 2FRXA 3GZNB 4QT0A 3TZQA 1UDAA 2Q1YA 2NYRA 3D8UA 1PUIA 1F60A 2BOVA 3OPNA 2VJLA 4NXMB 4TRRA 2CXQA 4FGLA 5ALNA 4FKMA 4ZZ0A 3CZRA 2VK4A 3DHVA 1AMNA 1A72A 3PPXA 3FWNA 1CJTC 4BRWA 4FX5A 3F6CA 3OZ7A 1KMHA 4X6UA 5CUQA 4PLWA 1C0IA 5HOQA 4WASA 2ZAMA 3BRSA 4HLUC 3T3NA 1N8TA 1VIYA 2G0AA 2IP4A 2Y1WA 4FU0A 5HFAA 3F6EX 1N6HA 3VV2A 5FEUA 1TEZA 5F2KA 3IDSA 1PHPA 2D2FA 4HADA 4D8TA 1KK2A 3AW9A 1R7RA 3S1SA 1Q7EA 1RJ9A 2EWWA 2EZ9A 1WULS 2MR5A 3I04M 4KLNA 2XUFA 4UAVA 3D2CA 1GFWA 5K8CA 1JW9B 5T5QA 1R3DA 1I0IA 2GB4A 4YRDA 3LY9A 4TTJA 3EHEA 4C76A 1TMYA 3BZUA 4FNMA 1Q92A 2ZWVA 4GAEA 3SMVA 1P7WA 1OD6A 2HV8A 4WKCA 1T3HA 1NIJA 5J5AA 3WLHA 4BQQA 3ANYB 2NO5A 5IP5A 4BJ1A 4DIBA 1C4OA 1OLXB 3JR7A 1CFJA 4NARA 4BNZA 4FTWA 1O6GA 1FOEB 1U0RA 3RRXA 3ZCRA 3KOUA 5EKXA 1IDN1 2J0EA 2BGTA 4H3VA 1OFGA 4DILA 1VI5A 2IIQA 1L5HB 2X5OA 3PT5A 5B3AA 1A9XA 1IWPB 3I2YX 4RQTA 5DWVA 3P45A 1MR3F 3G0OA 1I4LD 4G2NA 4H2DA 4OI1A 3RSHA 4LRUA 3V00A 1E3TA 3M1LA 1RYDA 1KZ4A 1XVIA 3TB4A 1UKBA 3SPXA 4QUBA 5TMDA 4OU5A 1NE7A 3E27A 1RQ7A 1RZRD 5ICSA 4BNYA 3ID6C 5DI3A 2V6MA 4AMYA 1A97A 4TWJA 1GAWA 5JVDF 2LDBA 1SFRA 1ESNA 1Y89A 3DC2A 2NSHA 2FUG1 4MHOA 3MOIA 2VQFB 2PO7A 5I4KA 1J5EB 1I7DA 2F8MA 3FNRA 5HR5A 4Q9AA 1VGQA 5CNKA 1DAHA 5FD8A 1XZCA 2VDLB 2PA0A 2BCJQ 1UBLS 5CM8B 3TD2A 2OCPA 1E63A 1Q15A 1IMJA 1Z6PA 2E6KA 4BL5A 3QKRA 1E3WA 3PF8A 4Y2YA 4MVJM 5EQFA 4DLYA 4HN4B 3MWGA 4LRSB 4P3OA 3U1BA 1T3SA 4A3SA 1E1QD 3Q5GA 2JRCA 2P9GA 4OSOA 5LXTB 1CY1A 2YNMC 1CF9A 1O96A 3I1YA 3RU3A 2O8EA 4ZHQB 3PXDA 4BZZA 3DBRB 3DHYA 3H5OA 3ZTYA 3DLTA 2OG1A 3EZYA 4WRRA 3H17A 3DMTA 3K1YA 4QDTA 3HB5X 5GP1A 3U60B 2Q3EA 3F5QA 5KTRA 2XB4A 1CUDA 5TRTA 3U4QA 4HGZA 1USKA 4MV1A 3UANA 4V2UA 1C9DB 3PWSA 4QAJA 2CCJA 5FEMA 5HKLA 3MGBA 4RL6A 3AVWA 3I4FA 5C46F 1H2RS 3FLEA 4MJLA 3U3JA 1SC9A 2VDVE 4PZPA 5KQGA 2HIAA 2CKDA 5HMLA 5FWDA 3BXZA 3IO3A 3KVVA 4P7KA 6CHYA 2GX6A 1CB7A 2IEBA 3LGSA 3TSZA 4BQIA 3AJ8A 1G2PA 1V5GA 4YRCA 1SB9A 3JSAA 4B32A 3N3AC 2EX4A 1J0DA 2B98A 2XDWA 4GLFA 4HQKA 3QY0A 4L5IA 2O7NA 3OQOA 2C3YA 2COKA 3ILSA 3JRWA 3KKLA 5HNKA 4AZ0B 1P7YA 1NVGA 2O2EA 1IHYA 4KUHA 4Z54A 5EIEA 4R5MA 1T36A 3FYHA 3H9GA 3L02A 5TY0A 3F1LA 1DPFA 5HS4A 3HXLA 2MSEB 1KI6A 3WNZA 4H6XA 5JD5A 2JIOA 4LBVA 4LV5B 1TZ2A 3ER9A 1G2IA 2WM8A 3MW8A 4RENA 2W42A 1CQZA 2XMGA 2W2OA 1FA9A 2TYSB 1GZUA 2YYSA 2I6QA 3G2MA 4LPKA 3U0VA 3WK7A 1TF7A 1MIOB 2D6FA 1SD1A 1R3UA 3P5SA 4C14A 4ZZ2A 1V7QA 1NMXA 2P65A 4C4SA 2E4YA 1SUDA 2ZR0A 3PC6A 3R0XA 3GJQA 4NLLA 5TNXA 5ALWA 5JU6A 1RRFA 4EYOA 4Q3NA 1I9CA 4P32A 1I14A 3A0UA 4AUEA 4AULA 3QW4B 2J46A 2XWSA 1JQEA 4CR8A 3BB4A 2INGX 5CNMA 3RTCA 2OG2A 4NOLA 3VR1A 2DBYA 3LSYA 1EXDA 1Q1QA 3KDPA 4G85A 2YXBA 1NBOA 5AOVA 5K0CA 1GV0A 4JY7A 5CDYA 1EG7A 3LC7O 1V25A 2AD1A 2N42A 3H4IA 3X2EA 2YWGA 3H2IA 2HT1A 2OFXA 4BNDB 3OE7D 4GNRA 4IJKA 2K7FA 1G9XA 2VPXA 3ZD6A 2AOUB 4B7ZA 1ZU5A 4R3UC 4Z2AA 1FFXB 4W8GA 2ABWA 4AS3A 1G21A 1ZD9A 3FCXA 4F93B 3IPXA 4K9NA 3ZCXA 1UJ4A 2WNHA 4HVCA 4Z4EA 1IRXA 3A1CA 3GUUA 2PANA 3PICA 2XT6A 2Y1OA 3GI1A 1V45E 2G0NA 3HKCB 1PUJA 4ESOA 3DXXA 3DAFA 4UUNA 5EN4A 2D3TA 5IG2A 1OPXA 3GEHA 3MJSA 2PX8A 3Q5DA 3F1KA 1UT8A 3HLKA 4PQRA 1MJHA 4M1WA 3A04A 3H6KA 4PRKA 621PA 2JFYA 1JZQA 1PJTA 2O2HA 3HZRA 2Y0CA 1T10A 1EIWA 4MI9A 4EUHA 1CY4A 4KV9A 1W1UA 4HLCA 2O0LA 4MRSA 2HMVA 4QGGA 1W9HA 1C29B 5K4AA 3K70C 1HLFA 2XIJA 4LNUA 3AR7A 3OAAA 4R8SA 4C0KA 5JIBA 1R0WA 4ZT7A 1RRMA 3G0DA 3CVUA 1JFRA 1P2VA 2M1ZA 3OOEA 4RD6A 3W2EA 2EBHX 1SOWA 2PZEA 4GR9A 3VH2A 4CL3A 4FWTA 3BB3A 5CFZA 2NVWA 3VU9B 1MX9A 2UUPA 1GNLA 3FSEA 1FNNA 821PA 3IAHA 3ZDDA 3R6GA 4FD2A 4QO7A 4NVRA 1WMBA 1WP4A 2ZUDA 4CDNA 3BIJA 4UAUA 4KDRA 2R86A 1HE5A 2OV4A 3UWDA 3GDHA 2COEA 4A9AA 5AM2A 5B1IA 2XADA 2I29A 1UINA 4NENB 3D7LA 1FLDA 3H16A 5LYJF 4W1SA 3EEYA 1ABEA 4LECA 4RKRA 1XZPA 1RM5A 1Y1TA 2MYTA 2ZSFA 3KYJB 1PNQA 4HB4A 4I9HA 4INJA 4PVDA 4RPCA 2J87A 2WUVA 2MSLA 1KZGB 4XQGA 3VSEA 4MMXB 4NFYA 2CXSA 4Q93A 5TMPA 2NU6B 5JYEA 4TS9A 3VAYA 1WW8A 1E7RA 2NUPA 4K46A 1W5AA 2PKRA 3KC2A 2GTHA 4AJKA 4E0BA 1NXQA 2OXCA 4LFCB 1AVTA 1P3DA 2ODPA 4X1KA 3IJPA 1DHTA 4PLZA 4HMPA 4EKYA 2VP0A 4C07A 4EO4A 2D8MA 3LDUA 4QFBA 3QFHA 1BMFA 2RIRA 2V55B 5CJ2A 4WCFA 1FNSA 1Y63A 2IEAA 3BA1A 3R8XA 3WJ2A 5AKLA 5AFSA 3TAUA 3KAJA 2GJAA 2ZQZA 1QZZA 1YV9A 2P79A 4H08A 4L85A 3TH5A 2QX9A 3GPDG 4FZ5A 4GGMX 1P1HA 4HAOA 4MAAA 4BLRA 1YOBA 1FRFS 2A4KA 2NX2A 3LPAA 4EZEA 4KVZA 1P2SA 3JQPA 2QYHA 3UH1A 1U02A 3QVWA 4Q21A 3T6KA 3MVEA 4FXPA 2C2OA 4LRXA 3WQHA 3ANTA 1MNQA 3CPSA 1O08A 4EVIA 3L8ZA 1TO1E 1J9ZA 1O0SA 3ZGXA 1RTKA 1XZKA 3DO5A 421PA 1WU7A 4F7DA 1HYHA 3FNBA 3PQ6A 2EJWA 4AT1A 1B6TA 3FBGA 3BFJA 3MJVA 3O75A 4R31A 2XITA 3ZCUA 4M9SA 5CG1A 3OF3A 3IQFA 3IHWA 2OHHA 2X9LA 1RLOA 1IZZA 1SC3A 4OHXA 1LC3A 3I2IA 4H77A 4EARA 3A1FA 3C1UA 3OO1A 4PWYA 2PFGA 2W9XA 2QTMA 4MARA 1Z4LA 3GFGA 2AHRA 4DLUA 2IPOA 4BLQA 4HZGA 4AKGA 4Q3LA 3T52A 1SUCA 1J56A 3D3QA 1KRHA 3VYVA 4O08A 1RKXA 1UPXA 4OP1A 4PAMA 5TLSA 2PU5A 1DGQA 2QTVA 1EUYA 4MS3B 4HQNA 1NFFA 2QD4A 2QD5A 1UBNA 5D3QA 3RK4A 1FBTA 2X8WA 1QHIA 1Z4OA 1B8OA 1EPUA 1TUEA 3R9WA 1P91A 2AOXA 3HCWA 3KXKA 1XEWX 4HBZA 1H8HA 4TLAA 3A1UA 5LJLA 3CW2A 2YV2A 3NUQA 5GJWC 2C7PA 3OTWA 5D5PA 4L0CA 4EM6A 5JSZB 3QE0A 1BE0A 1JKJA 2O8CA 2Z5FA 2C8VA 4H6PA 1KAQA 3DDNA 2QPLA 1LTHR 2RJOA 1R0RE 1EBFA 1JHUA 1VPVA 3CEAA 3MBIA 1JR3D 3EQ8A 1HDEA 2EJBA 3D0QA 3TQSA 5DLDA 1CZHA 4E2ZA 3FOZA 1XRMA 3U16A 2XF8A 2I1VB 2PN1A 5ALJA 4NKRA 1E6UA 1WPXA 4PLHA 2QSJA 3LC1O 4F1KA 3LG2A 1H23A 3UT0A 1X9GA 3B51X 4OJQA 1K9SA 5C8YA 4BQSA 1FFAA 3DL0A 5JZOA 3GLGA 2CY0A 2ZI6A 3KX2A 3B5EA 1IN1A 2XQFA 4URWR 1JR6A 1R1DA 2RFLA 2XRMA 1E98A 3B82A 3HM9A 2FKNA 2JFFA 3D8TA 4N39A 2JKYA 3SE7A 2W6ZA 3UH0A 4E11A 2FHPA 3T8YA 5JD6A 3DWFA 3GGJA 1WXEA 1ZPDA 2JDID 2LBPA 3BQ9A 1FSSA 4YIHA 2Z56A 3H7AA 1BVHA 3W1WA 3AUYA 2F1RA 4JJZA 4BQRA 5A4JA 3UCEA 4IIGA 1EX1A 4QBHA 3PB3A 1TU4A 2NN3C 2YBDA 3DMNA 3QKSA 5H1YA 3CPEA 4KSBA 5HMMA 4QJ3A 1IG3A 3W3AH 3ORYA 4G4SO 1C0KA 3ZY3A 4EG5A 2O7SA 1X7HA 2VAVA 5ILOA 3PWKA 5AI8A 3GRRA 2YR0A 3VYTB 3PPYA 4BS9A 1WL8A 2ZYSA 1E8DA 2PL5A 1AT1A 1X8LA 2VH2A 3ESQA 4LXXA 2OCIA 1Y8QB 3ORFA 3Q3JB 4Q9NA 2YJ3A 1ZR2A 2Y6VA 2HNKA 1GR1A 5HJ7A 4Q4HA 2ZJ8A 5GZ6A 221PA 3HEAA 2YQ4A 5G53C 3KEGA 6REQA 1SCAA 1UCFA 5EIAA 2O5EA 1EVZA 3L07A 5T4FA 3TTWA 4BLPA 4IQFA 5M3BA 2BT4A 4D4HA 1QXSA 3HYTA 3ILHA 4HDRB 1UANA 3G7UA 1Z74A 3RWMB 4MULA 2AV6A 3SLRA 4QUDA 5KNCA 2HPAA 1P33A 2CWDA 4UVHA 5EQJB 2IZ0A 5LC1A 1P2TA 4EB0A 3N8KA 2Q99A 4ALJA 5EJGA 2J67A 3QYPA 4D92A 1LZKA 2OAQ1 1KMNA 4A2CA 1WMSA 1YR2A 4LJ9A 4UE2A 4YI3A 3SOZA 4GRDA 4C08A 2WF8A 3EFEA 4HEJA 1VPTA 4LXHA 4AY6A 5TT0A 4DIUA 3SS7X 4FYJA 2J3KA 3K09C 2JGJA 4EBBA 4UJ3A 4EHHA 4N0MA 1JEJA 4ILEA 1ZMTA 2MT9A 1S7CA 1XCOA 2YZ2A 5K0FA 5JD3A 5D3MB 4G0WA 2H4JA 3LHFA 1XKQA 1E9SA 1FVHA 2OFPA 3WI7A 5KNDH 3BXEA 5L95A 5TMEA 3EW9A 4BFYA 2DWUA 2X86A 3C15C 3ESBA 3AH8A 4Q1AA 3ORSA 5D6OA 2YOHA 3M4XA 1H05A 3HSYA 1PSWA 3NYQA 3OU7A 4PFJA 5DGHA 4XDZA 2WNIA 5AVJA 3JS5A 1LSUA 3UXMA 1BTOA 4GICA 5KDOA 3W2GA 5IAOA 3GCWA 4KBYA 1K3FA 1D1QA 2JK0A 3ZU5A 4B2LA 2BE9A 5AUPB 2HCBA 1BN7A 4TWIA 3KKQA 3L40A 2CWWA 3ICPA 3SKVA 3HO6A 3M82A 4JXXA 3A2LA 3L7LA 1IJBA 1FBNA 1FSGA 5JSUA 2IL1A 3EVAA 2RI0A 3WIDA 1WX1A 2GCOA 3H2JA 3QU9A 1N2CE 5JJKA 3EF1A 5JH7A 3PF9A 5AH0A 1QORA 3B6MA 1WOYA 1O0BA 4RDHA 4Y98A 2FSIA 3VPCA 3UCFA 3V9PA 2PZKA 5I9LA 1FFXA 4KYUA 2CV2A 4FKBA 1ODFA 2E3JA 4OQ4A 3BD6A 1QGUB 1N2GA 2QN3A 2P9BA 3T5PA 3R7BA 3CZ5A 1EFVB 1RAAA 4DVGA 5K6AC 3AUFA 3W3AA 3G8CA 1JIJA 1UJ6A 2V8OA 3C8DA 4BO7A 1NVFA 4E5YA 3IQIX 1IRIA 1V8BA 1H6AA 1R4MA 1C9KA 1RIIA 2FMUA 3IP3A 1F06A 1IJEA 2Z8YA 1VRWA 2EGGA 1M6WA 2VTBA 3MJFA 3HJFA 3ANNA 1A4UA 1Z37A 2ZRDA 5KTKA 1ZM4A 2ZULA 1AQUA 1EGQA 3GPIA 2W71A 2XYHA 4B0PA 1U8EA 4H3HB 3ETJA 2ZKIA 5INTA 3BOSA 5BSEA 5KJ1A 1NULA 2XGOA 3BX1A 4IJQA 4JB2A 1VJDA 3H2GA 1RPTA 3DBLB 2IS1A 1H2BA 2R7MA 5AOAA 4AP6A 3ZHQA 4EOGA 2C1ZA 4GR5A 5LLTA 2VK2A 2Q6IA 4FYYA 1CX9B 5GWXA 3GG9A 3T3IA 2W11A 2RHCA 2Q0HA 2WAYA 1CQWA 3HZZA 1GPBA 3T7KA 1USWA 3EWSA 4EHJA 1HQCA 2FRDC 4LNAA 4UEJA 5DKFA 3KSMA 1DDOA 3KBBA 4NPAA 1J00A 3ICVA 1MABB 1U98A 1ZGGA 1YGPA 2JI8A 4Q4LA 4TV8B 3NHSA 3QKWA 2WSSA 2CLSA 4YUXA 1J33A 1U8FO 5HG0A 3LX4A 3WGZA 3SWWA 1HSOA 2ODTX 1BOOA 2NU6A 4JJFA 1B43A 5B6PA 1QPZA 3MS7A 1AN0A 5JXIA 5DIZA 1SKQA 4NICA 3CCFA 4PTLA 3JQ8B 2VDNB 1KRWA 1UXJA 1QH1A 2IV2X 3W8RA 3BF8A 1CUXA 1B4DA 3ZLJA 3TL3A 4JSRA 3SKXA 1N5IA 2EJTA 2H57A 2HA5A 1G2OA 2YNMA 4X65B 1PR9A 1Y3HA 3L92A 4RA6A 4QUIA 2IS6A 1FP2A 1IATA 1NRXA 3E23A 4QQRA 3UJBA 5H9VA 4B3RB 3B38A 1JIKA 2AYXA 3THOA 2ZYRA 2DAPA 1R16A 1TZJA 3P9XA 4IVNA 4UXJA 4CG0A 4P22A 2TECE 1QQTA 3O3CA 1TFRA 2H1CA 2WU0A 4V1CB 1UPUA 3GMTA 4R9RA 3S2EA 2ZR7A 3FLMA 5AM0A 4I50F 3DWGA 1J2EA 4KX3A 3ZUGA 1OFTA 4BE7B 4W8OA 1KK1A 1XTTA 2CSUA 2FPKA 4QPPA 2RG1A 2C92A 5COAA 4K3VA 2QPTA 3OSUA 3EQ9A 3W2FA 2VDWA 2P9EA 1JEQA 1DRWA 1RQXA 2EGUA 4O4HB 5G40A 3O31A 4TMXA 4AF7A 3KFLA 4WLFA 3LOUA 4MW7A 2GFIA 4E5SA 2WUDA 1RI1A 3T0GA 1DTWA 1PNTA 5LA6A 4AIRA 1Q11A 2OXRA 1YFLA 4OVKA 2DQSA 1UM9A 2JEZA 2O0HA 4IQ4A 5HEKA 3SE0A 4KOAA 5E4JA 3LT2A 4XM0A 1GCOA 3HWRA 4PPNA 4G1MB 1I5OA 1C7QA 1QM5A 2PH1A 1FJGB 3PNQA 2QRHA 3RADC 4OB6A 1XDZA 1OA0A 1VKRA 2MMCA 4B84A 5LOVB 2PMBA 2IYRA 3AF4A 1JYEA 1L8OA 5D1HA 3QH4A 2Q6TA 1QWSA 1FJ2A 3ZWKA 1KAHA 2YJTD 1YBHA 3ZHBA 4JHXA 1SZDA 3T7TA 3JYQA 4JI6B 3HCPA 4I1YA 3RREA 3TJRA 4D9GA 3I62A 4MLZA 4MKFA 4JC0A 1NSTA 1SVIA 2OV1A 2ZITA 4P33A 5K51A 4DLWA 3VR6H 3TOXA 1NN5A 3FDJA 2VHYA 2IEYA 4US1R 2R8PA 1WD7A 3UN1A 1Z0SA 1A9RA 5HRUA 2JNWA 4MYRA 5E2BA 2A9KA 4UKDA 2LRHA 2KE5A 1D07A 4C3ZA 3JQGB 1DJLA 1XEXA 5JS6A 2TRSB 4V03A 3UICA 4TT3D 5EMHA 1VDMA 2WY2D 3ZIAD 4F3KA 2X77A 4KX5A 2V58A 5CT6A 3E8MA 2J6HA 3V8RA 1GP2A 1H2ZA 2C4NA 1IZ7A 3C16C 4MHTA 2WIDA 4KQHA 1QK5A 4RK4A 1FMCA 1SBCA 5P8WA 3ESZA 4FPXA 2NZXA 4IS2A 1P74A 3NYWA 4H15A 3CG0A 4K5QA 4ZT6A 1BN6A 3B1WA 3LNTA 1A5TA 3EF0A 2OOKA 3HUTA 3QXJA 2AL7A 3CVXA 1NI3A 1K98A 4WUVA 2VBCA 2WI8A 4CIWA 1VHDA 2HRZA 2IHTA 3AEYA 2BM1A 4TN5A 5LQKA 5CH3A 3DVSX 2OHOA 2GCEA 3P5BA 2BGKA 1OOEA 2LKCA 2WUEA 3ESAA 3HPQA 4H9GA 2GJ9A 2OFFA 3WBJA 2AKYA 4DV5B 1OXVA 3HADA 3HDVA 4L3WA 4I55A 5CDHA 2X0RA 3JQEA 3NTOA 4N3BA 4PSUA 4YP1A 1NJ2A 3U9TA 1PE0A 4WBSA 3C7AA 4BTLA 1W96A 2OUIA 3K9GA 4FMCB 2HWKA 4TVBA 5CVVA 5ALEA 5J63A 4A91A 5H68A 2HHHB 3HCOA 5K0TA 4XJTA 4TQ9A 3HDHA 2IPAB 3NAGA 4IVQA 1EQAA 1L3BA 2NZYA 2AJDA 3QPDA 2ORVA 521PA 4ENSA 5EUQB 5I7OA 2K7ZA 4KV7A 3RYIB 4KR7A 3BJZA 4ED9A 7MDHA 2VYQA 3UM9A 3AL3A 2J9RA 2ZRKA 4OXXA 2ES4A 2OV3A 3T5DA 1VG1A 4D0SA 4RTQA 5FBVB 1GUZA 4AO7A 1TZBA 1LB1B 1CP3A 3WFJA 1GTRA 2C61A 1TJNA 3AR5A 3DEFA 3TRJA 4KAJA 3WB2A 5AI0A 3O9MA 4LMAA 4HDQB 3HVIA 2RGGA 3SZUA 2DHCA 4NCNA 3SDBA 5CFRA 3PRHA 4BB9A 4OHVA 3JYNA 3TQIA 5D84A 4YCSA 4B8ZA 1RI3A 1T2EA 3C6YA 1P31A 4A2PA 3CS3A 2NAFA 4Y6QA 5I3ZA 1S0UA 5FYQA 1LBEA 2BHLA 3NXSA 5KVAA 3K70B 1IEVA 1FP4A 3LV8A 1RHJA 1KEWA 2GHRA 4QDOA 3PXGA 3TVYA 1N32B 2OHGA 4PIPA 3VYWA 2V7EA 1MX3A 1WMFA 3ZE1B 3PDIA 2Y1EA 1TQ4A 2B6HA 1GKKA 1JP7A 2DHRA 1M7BA 2CHVA 2VJMA 1VBNA 1NW5A 1A9SA 5J4YA 2R66A 3A4LA 3H87A 2VHJA 3CRQA 2WICA 5BN1A 1TUGA 1NHWA 4A0HA 3QVKA 1P5ZB 3ZIUA 1PTJA 5AW3A 5E1BA 1X42A 2I33A 4LOJA 2DVMA 2GM9A 4QJBA 3ZWPA 1PDOA 1X92A 3OI7A 3W6NA 2IXEA 1JIVA 1RABA 4AN4A 1PWHA 3OPMA 1WTAA 2O07A 1Z2OX 2ZBEA 2C9DA 3L6RA 3T3EA 3MMSA 2R5NA 2X13A 4PQGA 1DTSA 1W34A 1TB4A 2Z2IA 4PFKA 2P41A 3H2SA 4JODA 1L7QA 2QXYA 4F04A 1GXSB 4YLEA 4L27A 1WXXA 2Q8PA 4J1TC 4IIJB 4KXVA 4DPLA 4F5ZA 1QP8A 4MINA 1QRAA 1TZKA 1SK9A 4M0CA 3T99A 3OT1A 4EEZA 3ABQB 1T6YA 2Z58A 1V8OA 1G4HA 4MUMA 3MTJA 5CA1A 1Z2CA 3NOQA 5D7NA 5IKMA 2I3BA 4B6JA 1QIJA 2E87A 3RWBA 1HX7A 1VKNA 2BWJA 1NM5A 1YQTA 2JFBA 3K94A 3OA0A 2R1UA 4PV7A 2OCYC 5CLGA 3DV9A 4RYLA 1I30A 2EARA 5EOVA 1MJGA 4RZ2A 1NW9B 5I5GA 3ZWCA 3N2LA 1NUHA 3TE6A 2J0UA 4BLOA 3EGWA 3SX4A 1YACA 2BLNA 2H1IA 2GZ3A 5F4BA 1UPFA 5ALHA 1ZA2A 4ZVKA 1F8UA 1I4DD 4LF8B 3DB1A 4R2HA 5FWXB 1ETUA 3HJAA 2PSHA 3ROTA 1SIOA 2QXUA 3H0EA 1PS8A 1ONSA 2BMFA 2I6TA 4UTRA 5A3JA 2WAAA 3RRFA 3RSQA 4G1EB 1R4MB 1NPDA 3R9KA 5JSFA 1V26A 3UO8B 1K68A 4WH0A 1EWVA 2RGBA 3THXA 2JJ1A 2VYND 4C05A 1YL6A 2W43A 1L6RA 3MCWA 4PX9A 2GAOA 3D3WA 1R5NA 4QXQA 3FLBA 1TX4B 5KYNA 3U56A 2C9CA 1USIA 1UPAA 3QZUA 4TUYF 3IMFA 4YA6A 1IFXA 4OJMX 5IDWA 2PGOA 3DXZA 4FSDA 1BXGB 4W9NA 5TPWB 1TKAA 1XCLA 4DQKA 4E5VA 3IE1A 2I6FA 3M6VA 5GQSA 5A2QA 1K6EA 3FKQA 3UMRA 1T35A 1NMSA 2DFLA 3HBNA 4CM7A 4M37A 1H6CA 1W0KA 4HPWA 4IMIB 5FJJA 5ITZA 4RZUA 1UJNA 4WADA 4Z4IA 1DAMA 1FXWF 1C0PA 3Q41A 1FE8A 2CB9A 5TF4A 1UDRA 3LC2O 4BNLA 4LY3A 5FTNA 4IQ0A 4RTMA 4TUYA 1YJXA 1Z56C 3HSKA 3OUTA 4OAOA 1ZVMA 4QOEA 4L4YA 2HQSA 2A7XA 4B6RA 4M7PA 1OYYA 4LBZA 2A5JA 4KQJA 4PGFA 3T9FA 9MHTA 1DDGA 2PGDA 4AU1A 2OQIA 3F78A 5I9SA 1PR2A 1KSGA 1NN0A 1U11A 1M2OA 2B61A 5B1HA 5J5VA 5COQA 1IUNA 4EEXA 1RWWA 4YR7A 1G8AA 4M9XA 5BNIA 3MT9A 3RB8A 3GLHB 3K8ZA 2BJWA 4GKAA 4DUYB 3OF5A 5E4FA 1RWKA 3HA3A 4G5RA 2ZW9A 2RE8A 2UZ3A 2IZ7A 1K5GA 4K6CA 3OEYA 1M1XB 1PW5A 3ZX4A 2W22A 1QAQA 3DHWC 1RRGA 5FULA 1VPEA 5F7XA 4ACAA 5AP9A 3UA3A 5FNVA 4CF5A 3PKZA 4DG8A 3EJWA 5CH5A 2PX4A 2WJZB 3LOQA 1M6YA 1SA0B 3WO0A 2XLBA 3KETA 4BO6A 3JVEA 3AM4A 4YV7A 4CVNA 2Q50A 3WV4A 5GINE 4J3FA 3D7RA 5JAUA 2CDNA 2VH1A 3IAM1 3M5DA 1ZOIA 3DZJA 4UBLA 2JHFA 2X8AA 3F49S 2OBYA 4NH0A 3V1LA 3Q2IA 3P4YA 4R2KA 3G8DA 1CK4A 3MQ4A 3MUEA 2I2AA 1IBRA 4Z86A 5HUQA 5BYJA 3L1UA 4ZI5A 2JFOA 2VDWB 1DIOB 3ZWWA 1UXHA 2EW1A 1P60A 1P1JA 5FBZA 4NYJQ 4UNRA 3WFZA 3DP7A 2XE4A 4S1WA 3ZWAA 1IDOA 2PUHA 4XPIA 3DE3X 3IMKA 4LWOA 2NUAA 1MAVA 5CYGA 2HHLA 1DI0A 2FXIA 3OMLA 1FMFA 3NHRA 2C7GA 4JH0A 3GFTA 1P4RA 4IDOA 4D79A 2V7TA 3BD9A 4L75A 2KX7A 3UGTA 3THRA 4ZDJA 1Z5OA 4J4BA 3KQTA 5CDGA 2WSIA 1EFPA 1SK8A 3G49A 1D8AA 4OPMA 5KTPA 2GO7A 3QMPA 3RJZA 4IM7A 4Q0MA 1DQNA 2QNBA 5HOEA 1HG1A 4Q3CA 5JI3E 1J6UA 4ND6A 4OO3A 5GZ1A 3RVBA 3NJRA 1H0RA 3CSSA 5LUBA 4UMEA 4OX9Y 3L1JA 4D81A 3W5SA 1V8FA 1B23P 1Y4DE 1AN9A 3TOVA 4ER3A 2G25A 5LZ9A 1B8PA 2I7TA 3BC1A 3NBFA 1A7UA 1U8CB 2I7DA 1SEVA 3N2KA 4Q6BA 2QKYA 1MJGM 1G6Q1 2KLHA 2GKOA 3K1AB 3OCZA 3OE5A 4LYDA 4JJGA 3TO5A 2AVDA 1XEXB 3AO0B 2YHAA 2RKBA 3DOHA 4G89A 4X8OA 4DC1A 1PNVA 1K5PA 4MQMA 1GL6A 3MQFA 1DWUA 3B3FA 2PUCA 3LVQE 2K4MA 2OYCA 4KPFC 4P0QB 2PNFA 1N6RA 3L1KA 6PFKA 3ADBA 1J25A 3IXQA 1OYOA 1X0XA 1RRCA 2BFOA 1PJ2A 4JGBA 2QN7A 4RPHA 4KGXA 4DCMA 1CJVC 4NULA 3WGYA 2ZRAA 2FFHA 4ZRMA 5GIOE 1NF2A 1ESCA 2VHVA 4FW9A 4BFCA 1JI3A 2ZI3A 5B2ZA 1UWKA 2H5LA 2RH4A 3V8NA 4I4IA 1QVZA 3RUCA 2JJQA 4PNPA 2R47A 1V3QE 2I03A 3ONEA 3PJGA 1IY9A 1L8LA 1L7MA 3D1VA 3QU7A 1IQ0A 4EHNA 1SKUA 4I55B 3UAXA 3IODA 4CIYA 4Z5XA 5LMNB 4P7FA 3H9UA 3OOSA 5LQRA 5GGYA 2Q3LA 3QEMB 3DTVD 2HHAA 3SM9A 5IUNC 1GQ2A 2OAP1 3UK0A 4IOJA 2ZAOA 3KE9A 3KXIA 2XEDA 3LFUA 2O1SA 3MWEA 1A77A 3A1SA 3EIOA 3QBVA 3SAJA 3LWDA 3FJ1A 3K5PA 1T4GA 3KV1A 4YPOA 2VSOA 2XUQA 4MITA 3E61A 7YASA 5ICEA 3JQ7B 1CE8A 4WOCA 5PGMA 1T6NA 4PN3A 4DLPA 1W30A 2FPOA 4FE4A 4K1LA 3VR5H 2J5QA 3QWBA 3NIGB 4I9GA 2N47A 3K96A 2GCIA 3B13B 3FNIA 2ISCA 4WLOA 3LYHA 4RF3A 2EKPA 5E0OA 4OGGA 5FUWA 3AVPA 3WB9A 3E1SA 1QAOA 5ICGA 1ZOSA 3I6BA 1J4AA 2E18A 4TMTA 5FB3A 5HRCA 1UT6A 1HNZB 5JD4A 2DF8A 1RSZA 4PN7A 2DGDA 1CQIA 4O5OA 5JYDA 3AF6A 2CDCA 1O3YA 3GK3A 4MNTA 2H1RA 2VPPA 5DNWA 1NIPA 1S4MA 4S24A 5FTLA 1X70A 2ZRHA 1EINA 1YB7A 1Z5VA 1RYZA 3P2JA 4C7JA 4NL4H 1T4CA 1J99A 2YWJA 4BGUA 1DIAA 5KSOA 2JI6A 2C59A 2I2CA 4GMGA 3TTTA 1NV8A 1TCUA 2EW8A 3UMBA 1HKHA 4FMDB 4KO4S 3PLAE 1RPNA 1EP9A 2ET6A 1G5RA 4FHDA 4IVRA 4KK3A 5TQ0A 4BPRA 3Q0TA 4HDNA 4YN3A 3L8HA 4PZCA 2DUNA 1ORTA 3SFVA 3HVRA 4MVJE 2Q5OA 4J16C 3Q0EA 5DTJA 1CYDA 3Q9UA 2MYUA 2FN8A 3ISVA 1V5FA 2EDCA 4D8YA 3TOCA 2NPIA 2XYPA 3ZK9A 1NW6A 3LCMA 4YRJA 1C0LA 1EAMA 2DR0A 5KAMA 2WKWA 2GCGA 4IRXA 3ZQKA 1SVWA 1GPKA 4CW7A 3WLQA 1DFGA 1MG0A 1ZEMA 2I78A 3PFNA 1LI4A 3QIAA 4O2BA 4RZXA 2UU9B 2VWPA 2O3RA 2AFIA 2FUG6 1CUBA 1Q3HA 3AQ4A 4ZVRA 5FUBA 5A5VA 1LY1A 2IYPA 1B73A 2ROQA 3ZWBA 3LAWA 4DMMA 5KYVA 4Q1DA 4OY3A 2NXJA 1NT4A 2HCRA 1FUKA 2CYCA 2XUPA 2PFSA 1RIFA 2W90A 3WADA 3AK4A 3E9YA 4P5DA 4U7GA 4E5NA 1I7SB 4AC9A 1ZK2A 4KQ1A 4QQ8A 2XD4A 4R16A 4EZIA 2R87A 1AV6A 1WXWA 3WICA 5DT9A 3IEKA 2YWXA 4IGFA 4ZEOA 1T29A 3EXG1 3B1KA 2A33A 4C88A 2FPRA 2C4UA 3HFSA 5M7EA 2H2GA 3DGFC 3UCXA 2P7IA 3AKEA 1XKXA 4DBLC 2HREA 3UHJA 2G4CA 2WWWA 3WRYA 2WILA 3MTIA 2XWJI 4D9IA 1RWXA 2VCYA 1EK6A 1E7SA 1UOOA 1ZM3A 3MGAA 4HUJA 3C6QA 1OV4A 1AM4D 2E0IA 2FRDA 4E32A 4C4TA 2FSVA 2R8BA 4HQOA 4A7PA 1YR3A 4MQFA 1XROA 3FB1A 3TLBA 4B2YA 4JLOA 4QHYA 2QRMA 5AWFC 4N5LA 3N53A 2HN9A 3HI4A 4EHBA 1NC1A 1S89A 2RAFA 3CR7A 4G2TA 3THXB 4L7QA 4PLCA 1SRQA 1L5WA 1NVUQ 2VXCA 1UC9A 3CF0A 3DOJA 4R0NA 5CLHA 3UYLA 4DLXA 3G59A 4G4GA 2XQVA 3TX2A 1AGXA 1SUPA 2VS1A 1JHMA 6LDHA 4AS2A 5E1MA 4OHZA 4J3NA 2GDZA 2XGJA 2YV4A 5CB0A 3WLTA 3F6PA 4BMCA 3V1YA 4DZTA 3QU5A 2J1LA 2F9MA 1BFDA 4JI8B 2C3OA 2ZSJA 2H2IA 4QD3A 2HRBA 3N59A 3B6KA 2CJXA 3WMEA 1RAIA 4P4SA 5C5EA 2ZRIA 1HYGA 2VRBA 3BMQB 1YO6A 2PBFA 2YN4A 2NU8B 4PQFA 4B74A 2VPZA 5CXXA 2XZLA 4H6VA 3W6ZA 3IR5A 3NOOA 5I9TA 5EZYB 1GR0A 1V2GA 5DI3B 4ALMA 2QLNA 4OYYA 5I9BA 4A1OA 4DLSA 4QBTA 3B7WA 3THSA 4L8GA 2D0OB 2IEDA 2W6PA 1RKVA 3GRVA 3AVYA 1SWVA 3GLFA 1BOFA 3KT8A 5DNAA 4FCVA 4C0XA 2C2GA 1YMVA 1JG3A 2QYOA 2OHJA 3LH5A 4CM5A 3G5MA 1MC4A 2GEKA 4GI3A 4NEQA 3T7AA 1UC4B 3IGFA 1L4GA 1NG9A 3UMFA 4G5OA 4LGCA 4B3JA 2JFPA 2Y9MB 1CRLA 3PVZA 5FV7A 1J70A 4WMLA 5TVKA 5FBLB 1BDMA 2J9FA 5DN9A 1VHLA 5C8VA 5KKCA 2XCQA 2GUWA 2I3AA 2Q4RA 2HA6A 3DT6A 1FQOA 3IBSA 4YUVA 3GLHA 4QYMA 3ZIAA 1EX9A 1BYUA 1WQ3A 2PLAA 1MH1A 4IOLA 1D03A 1QE0A 2QK4A 2VCHA 3SJ7A 3WIBA 3L0SA 4L72A 2QVCA 4AD8A 1L7PA 3BRWA 3ZV7A 4C4XA 1ZJZA 2Z5GA 5FNVB 4Z9FA 5F3DA 4IQ8A 3QFTA 3EC7A 4U9IS 2C88A 4ZT2A 1U6KA 1IY0A 1IMOA 4YXWA 1KHTA 3Q9LA 5ALIA 1N25A 5D1NA 3KL4A 3FPJA 4RJKA 5JSKA 5JQWA 1NURA 4BNKA 4CHGA 3R6TA 1XD9A 2QSZA 4JXZA 2J9YB 3W7VA 3AI1A 3G89A 3SBDA 1T0UA 1YRYE 1RM0A 2QMHA 2EERA 1C7EA 2H7CA 3AEUA 4FFMA 4EJSC 1SHTX 1QRDA 4F11A 1DLJA 3ZCQA 4JYPA 3TFQA 3DFKA 4XLZA 4OI2A 4CMKA 4NABA 2PCLA 4F4UA 3BGOS 5MDHA 5EWMA 2YUIA 5IPFA 1W88A 2R4TA 3AETA 1K7CA 3BZWA 5CFOA 2HR1A 2HM7A 2G6BA 2CNDA 4PYLA 5JCOA 5GADl 2WT4A 4TYQA 4U7WA 4A0SA 4ER0A 3OZDA 1SURA 3TLGA 2J4CA 2A14A 4KB5A 5BYAA 5MHTA 4GF5A 5DEOA 3D8NA 5JYCA 1PTKA 4X6YA 2IXTA 1TXGA 1KH3A 4Z49A 2JFHA 3OWHA 3E9NA 3SZGA 3ZYCA 2ZIAA 3DQZA 3I2JA 1JDPA 3TR6A 4CNQA 4ZI7B 1XWIA 1H2EA 5KTNA 3NX4A 2H9IA 3ZWQA 2XIQA 1W25A 4HEA1 2CHQA 4DMUB 5DIFA 4E12A 5JBNA 4ACBA 1AKWA 1SBYA 5C32A 1ID8A 3QNMA 2IXFA 5A7HA 3FGOA 5MFPA 4I1RA 4WGFA 2IQIA 4NZOA 4B9EA 4NCAA 3IT2A 4OMDA 1MC5A 1D2AA 2V3VA 1C14A 2V0CA 1GA6A 3PUZA 3QFFA 1ZGCA 1VGVA 4GMHA 4K6FA 4CLRA 1PNRA 3D8BA 1HE3A 4G6ZA 3GN2A 4PG4A 4RORA 5DV9A 1K92A 2GZHA 2CXPA 3PNVA 2DLCX 1EB8A 3Q7QA 1QG2A 1XYVA 3CV3A 5ANRB 3R40A 2A67A 2RDMA 3TSAA 3B6EA 3MRSA 4C4ZA 5LP6F 4JLKA 3UHFA 4G09A 1Y7TA 2ESRA 1GOTA 4US0R 3X1JA 1JR3E 4AQ7A 2CDBA 4IBOA 4F4CA 4LOIA 2PAFA 4D74A 2BUAA 2V7VA 2DX7A 2HA2A 1O95A 2BJHA 2IYNA 3M6IA 4MVCA 3BKXA 4ENQA 3NHAA 2X9NA 3GYBA 2C0CA 3B8EA 1EE9A 5F64A 4FT2A 3KTOA 1WUJS 2FX3A 1NLYA 2OILA 4IINA 1ORRA 3U4AA 4BU1A 1LLUA 2AJLI 3A11A 3FVVA 3D3NA 1DMRA 5JRDS 1EVIA 3WKDA 4FDVA 4IILA 1KYYA 4NMWA 2D13A 2WFAA 3P0FA 4D8UA 3ICOA 4K2AA 5AK0A 1H9BA 4F3YA 1B15A 4DMHA 3IPYA 4QREA 2ZYGA 5FADA 2PWPA 3IUPA 4KO3S 3A4MA 2EWVA 3FMOB 3I6MA 1CLEA 1TA0A 3VPDA 2GLXA 2WKQA 2LVBA 1NMYA 2YOFA 4XIFA 4FONA 4K9SA 4L73A 4MCIA 5ALDA 5AUOB 3QE3A 5AQ1A 4IIYA 1GQQA 4PLPA 4RHCA 3ZE8A 1D6MA 1TK9A 2KJQA 4FGKA 4KNWA 3DEZA 3A14A 1X1DA 3EXFB 3FTEA 3I58A 5U4QA 1MP0A 1LW6E 2FHSA 1QZXA 3L06A 3WGLA 2OESA 4UU1A 5B7PA 4JCOA 4PM4A 2ZBRA 1V9LA 4QWWA 3PX7A 3PKIA 1YQUA 3GLTA 1NJFA 2C9ZA 2WV7A 2ZRMA 1VCMA 3JAKB 4RVHA 1T24A 3SQOA 3IIKA 4D9EA 3GIDA 4ZEMA 5JZBA 4RTPA 1QCYA 1CF4A 3BIWA 2F00A 1Y4AE 1PFUA 2AFIE 1V8ZA 2AEFA 2X5KO 3E5MA 4BUCA 4G0VA 3BWXA 1YFJA 1N9GB 3I05A 3DPSA 3HP7A 4JFRA 3GPCA 1SQ5A 4RIHA 4LF9B 3SY8A 4GYWA 2Q0QA 3U4IA 5LQJA 4LSZA 1E8MA 4FM9A 2WF7A 4WLNA 3MINA 1JQAA 2WRZA 2ZRQA 1GRRA 2OZVA 4ZOEA 1F9EA 2IYQA 4K87A 3GJ8A 2WKSA 3IKLA 2R97A 3T06B 4KYTA 2C4KA 1AKUA 4A0FA 4E5KA 1M34B 1DRJA 1GGJA 2ZI4A 3A9WA 3WL5A 1CERA 2EF0A 2XDAA 3FCCA 2JS7A 1ZI6A 2WKPA 3CLTD 4G97A 2CD7A 2Z2JA 4KN8A 1E2LA 4EAAA 3A6KA 1M0SA 4JJ7A 5L6LB 3LQ1A 1RRKA 1DNPA 2EYQA 3JYHA 3EXHA 3MRVA 4ML3A 4X91A 4RFSA 3E53A 5COBA 5DRYA 5JMTA 3FHJA 1ONOA 2VPWA 2AE1A 2AR9A 4FLFA 5E3HA 3LUAA 1MOSA 3WL7A 1ZKMA 4ZCTA 1QUFA 5JAOA 2ZSHA 3SEQA 1S3GA 4PC1A 3LTNC 3PHIA 4XKJA 3KPJA 1S3SA 4RQUA 5BOVA 2B3TA 3N07A 1P5FA 1CT9A 3OM9A 3OECA 3FCEA 2O9JA 2JD2A 2BEVB 3OCCA 3K05A 1S8NA 1QLJA 1RLMA 4I6JA 4AMBA 3GR6A 5TR9A 5LMCA 3RFVA 1KY4A 2WHRA 3AF1A 1E9AA 1NFRA 1KJIA 4O29A 2ERXA 4YQEA 2PEZA 1N8SA 2PRIA 3FNHA 5J2TF 3KQQA 2HSJA 2JFXA 3SYKA 4CDMA 3GFSA 4HWGA 2Q46A 3KHKA 2O8FA 4BVJA 1SULA 3AYXB 5EHNA 3UK2A 4GG1A 4UNSA 1DT5A 3OESA 1N6IA 1UZAA 5C7YA 3OQIB 5I7WA 5BR8B 1P2DA 4GWLA 1AS0A 1YCGA 2DP4E 2I2XB 5F9FA 1J23A 1IU9A 4F92B 1JQKA 2HYDA 4QFDA 5JADA 4PGGA 1JKMA 3PFFA 4I6EA 4KPUA 4NQZA 5EQTA 3KUXA 3R8CA 2P67A 2FW1A 3BKWA 5BVHA 3SZRA 3WQQA 3ZGNA 1LBSA 3NMUF 1IZ8A 2V5VA 3IMGA 2QE7D 4S35A 3F2VA 3FNGA 4MXDA 1BX0A 2PX5A 1RYFA 3L41A 4WY8A 3VHRA 2FWBA 4WOJA 2WHXA 1P2BA 4RHFA 5H81A 1E3DA 2AMJA 4XX1A 1X39A 4CM9D 1FJXA 1EHIA 4DMCA 4KVAA 1PSDA 1EP3B 4C5BA 5A3RA 4EY3A 4D6PA 2CUKA 5DBIA 3DS8A 3DKKA 1I6MA 3VXKA 5GGXA 3R3YA 1GG2A 1I5EA 2EF1A 2AFVA 2HD4A 2R1TB 3CH7A 4OTZA 3LBFA 4OB7A 2ZUUA 4EUNA 1T9GR 1MRSA 5B4TA 3M6AA 1H0HA 1TF5A 3C4JA 4NIMA 4V0NA 2ZYIA 4KQMA 2OK8A 4Y6OA 5CTAA 1N6NA 5FBHA 3TAXA 4BV2A 4F4DA 4LMPA 1GRVA 5IN5A 5KX5F 2BDUA 1WHSA 5HW0A 3RS3A 5JNTA 2B2XA 4AY5A 1WEHA 4ERXA 2Z08A 4Q7LA 4PC2A 3QEBZ 2IOFA 3OZUA 3ZE0B 2Q3MA 3V2HA 2ZU6A 4BMSA 1JHZA 2C1EA 1XNGA 2IKQA 5L40A 3KTFA 1RXVA 3L0ZA 1JPVA 4RLSA 3V42A 2J32A 1KMQA 4PYKA 4YMIA 4AZWA 3MWLA 4WFQA 4BVGA 5ICFA 4X7BA 4M7OA 5CK4A 3DFIA 3VSAA 1ZL0A 3UOAB 1VMKA 1XN1A 5AKHA 3ILVA 1T43A 1UBRS 2JCBA 3L84A 1AO3A 1WS6A 1YUMA 2W2KA 4N7RA 4QEDA 2UXBB 1M2VA 4F3CA 3NHYA 1I5RA 4B73A 4WZBE 3X1XA 1VPWA 4ZOBA 2VXBA 4LTMA 3ZCPA 5IZ4A 2JLSA 1E1LA 2C5EA 3PUXA 4GQIA 4DIKA 4Q9KA 1VSQA 1QTRA 1Q0SA 3GUYA 1RMYA 5KWJA 2E85A 3DEYX 2BM0A 2H18A 4BUZA 4DV1B 5IKEA 2O2SA 4REOA 3OJFA 4PC3A 2WC1A 2VDJA 2C31A 3ROQA 1DBQA 2QF7A 4TPKA 4W5NA 1EZ1A 5KNCH 3STVA 2FQQA 1XD8A 3IBGA 1HO3A 1OFVA 3HVJA 3ZU6A 5EJ5A 4XWGA 4WKBA 1JSZA 4R8LA 1ZW1A 4IXWA 2BP7B 1T5LA 2ZS8A 3WIVA 4BAZA 4GYKA 5FBWB 4C2AA 4TT3A 3KYCB 3TZHA 4BX2A 4E70A 3W9SA 3D7NA 1JDJA 1EHCA 1QHYA 2PTHA 5FWYB 5HE9A 3S29A 3ZLUA 2ZYDA 4KQIA 2UAGA 4M88A 2KBFA 4C0HA 5J43A 4N3AA 1GQSA 4YMGA 3EC1A 2OPBA 2ZI9A 1P0FA 2ACEA 3CKLA 4MR8A 3RASA 3HV0A 3VHQA 3IOMA 1FLNA 2OOSA 3KSDO 2OCAA 1HZZA 4BV8A 5DRTA 4IS3A 3JQBC 2WDPA 3LUBA 3EIFA 3TW6A 2ZJZA 1QQ7A 4A36A 5EZQA 5K6TA 4RV4A 2Q49A 2A1UA 1RS0A 3GJ0A 1EB9A 3CJQA 1C3OB 4QXMA 4RFVA 3MS4A 2QL5A 3IQHX 4LVNA 1X74A 1Y1SA 2WV9A 1OR8A 4ZK2A 1YT5A 5U9CA 1B42A 2JD1A 4B3BA 4C1BA 3PHBE 3HB4X 5E9JA 2GJ8A 4R8MA 2FPLA 1ECJA 1KKUA 1SCUB 3S55A 2XUGA 4QYWA 1U7HA 5EVJA 3R41A 3QV2A 1QIEA 1G4UR 1G7SA 3ZI0A 4FVTA 1WMAA 2RGCA 3QMWA 1RWOA 2R8OA 2YFHA 3VU1A 3HJRA 3EGCA 5IKPA 4U9UA 3OZWA 2H1LA 4EPTA 2AJBA 3MNFA 3OJ0A 3UIEA 5JSQA 2JLBA 1WXDA 1YB6A 1H2HA 2D5AA 1XZFA 2EEZA 1UR5A 1MPTA 4C4RA 2G5PA 5DGDA 4AW9A 1L0BA 2VHEA 5ER9A 3O8DA 3S7ZA 2P35A 4G1CA 4CU5A 1IB0A 3KB1A 3LVRE 4RE6A 4D46A 1EFVA 2VQEB 3DUFA 4FYPA 3W1VA 5AVYA 3DW1X 5JHGB 1SCQA 4B6PA 4BNWA 4G23A 1RJDA 3KVYA 4LBWA 4CQMB 2Y67A 3SQMA 1C30A 1VGRA 1CJUC 4L2IA 4MPJA 3E3NA 4TL7A 3T1NA 3TBKA 4DXDA 3FFTA 3GGSA 3PQ4A 4YRIA 3F67A 1LZLA 3GU3A 2WIJA 4CLOB 2FNAA 1OTXA 3GROA 3SFTA 3Q11A 3RNOA 2H85A 5KTOA 4F9GA 1WNFA 5LYYA 3WAJA 4UNNA 1T1EA 2CBGA 3COYA 5AKZA 1VG8A 2F1IA 1Q1GA 2WJ4A 2XB8A 1XRQA 1EFAA 3JAMA 2HF2A 2OGUA 3HKEA 2CF5A 5JYBA 3BXHA 1XJ0A 2AOVA 1KIMA 3RUPA 5LIRA 5SICE 4MYDA 3ZHZA 1I3LA 1VJ5A 4H1VA 5ALQA 2G67A 3W34A 3S2FA 2NXCA 4OBWA 3CM0A 3L46A 1PD1A 1WM1A 3H9CA 5FPHA 4FIZA 5NULA 5ALVA 3TDNA 1FUYB 1U3CA 3EIXA 1G5QA 1LLQA 3F8WA 1SU7A 1OVGA 2ECPA 4ZARA 5CFMA 2QZ4A 4B09A 1A9XB 1DEXA 4DR5B 1VG0B 2CFCA 5SZJA 4AYWA 5FOQA 4TV8A 2A88A 3H8WA 4INAA 3TK1A 4DYVA 2I1WA 4BQPA 4BKQA 2CEAA 4HFMA 4BLSA 1JLLB 3GP8A 2UUAB 5DZSA 2UUBB 4ALNA 1V48A 2IWRA 4CF7A 1YS2X 1QYDA 2PRSA 3OE7A 3BMNA 4L57A 4D43A 5ECYA 1MJ5A 3BVPA 1K7FB 1G38A 1CEEA 3RR2A 4IG9A 1FTGA 2P3LA 1XXHA 2GTPA 1FXSA 3AHJA 3ZWXA 5IAAA 1QH1B 3A9RA 4PFQA 5FLYA 3L6CA 3ILYA 5HCNA 3IIJA 3LT1A 3RH0A 1F12A 2WR8A 2PD6A 1QFMA 2FSSA 5CW1A 5ARCA 1AOXA 1QHXA 1TM3E 2DT5A 3ONFA 1F17A 1JE0A 2FUNB 1AKNA 4DXHA 4HUTA 3TUZC 1GPYA 2A1TR 4FFRA 3PFGA 2QZPA 1KAEA 1U3FA 2PZBA 2QAJA 2LZ0A 2R1VA 2LIVA 3CR3C 3P8ZA 5JARA 2YWHA 3GAZA 1KZHA 5C5DA 1LD3A 1Z15A 2XA9A 4ND8B 4XJSA 1G63A 1SCNE 1ZD3A 2IVZA 2J8ZA 1V6CA 1KTIA 4QXAA 4AYXA 3OT5A 3SHTA 1EM6A 4IW3B 3TLJA 5JASA 5LQNA 2DECA 3KQUA 1IM5A 3AB8A 2E49A 1R6VA 1WSWA 5CHYA 1MAAA 1RRVA 4D6XA 4DJAA 5F9HA 3SGLA 1MHTA 1J8YF 2BEVA 4YRKA 2ZXEA 2DE0X 4L6AA 5LA6B 1XN4A 2QI9F 4PZZA 2OYSA 2P9YA 5CBPB 6ABPA 4B9AA 1G7TA 4FFDA 3DOUA 2JCGA 2NM0A 4I14A 1NX9A 4JUDX 4MH0R 3P94A 5K3AA 5AVWA 1ZD1A 2OM6A 2FGKA 3NUGA 1OI4A 2GILA 3EG9B 3DMTC 4P7JA 3AJEA 5CGZA 5T3YA 2XD9A 1IULA 3B12A 3MXTA 1KRXA 2OBBA 2FPGA 1Z13A 3CUUA 3EGVA 3MWDB 4MAMA 5GOTA 5IULC 2H1SA 3CZ4A 4A0QA 2AMFA 1HTTA 3UV7A 4DDMA 3HB7A 4OLHA 4F46A 1QQAA 3U4DA 2DSTA 3R23A 1KZ6A 4GM0A 2JI4A 4GI2A 3HJHA 4YAWA 1T25A 2GYYA 3S8MA 3S68A 3P9QA 1QR2A 3HJNA 2GN8A 5E7QA 4C6RA 3NYRA 1YU6A 1NUPA 1U3VA 4JQSA 4K9QA 4WNYA 1TUIA 1MB0A 1P29A 2P6MA 4YGXB 2HDOA 2Y0BA 5B4UA 4GECA 3PPVA 1OLSB 2W7TA 1T3GA 3AU9A 4HFRA 4DVJA 2X0EA 3AHEA 3VDNB 1VSTA 4ZO7A 1MIOA 4UBNA 5JMPA 1T15A 4R3WA 5CGQB 3KWJA 1PL6A 3QOFA 1F4LA 2AN1A 5FXMA 4OXNA 1UFVA 2ACVA 2X1VA 1EFKA 3HBMA 4G25A 1QRSA 5HIAA 3C3JA 4J4TA 3D7KA 4WZAB 5F35A 3LT5A 3ZDAA 3G2NA 2ZRLA 2WUGA 3FGPA 3K72B 3P9PA 4TS1A 2HQ1A 3V8PA 4CN9A 3CEHA 3DA8A 6AT1A 2G9ZA 3KB8A 2OORC 1R8JA 2P5UA 4II2A 3M5PA 4E6PA 4QYXA 4LI3X 2IYFA 2ZK7A 3QA3E 5KQLA 3TI9A 1G20E 4I08A 3UBMA 3HCNA 3CWCA 1RR6A 2FX2A 2OMKA 3A9SA 2HA3A 5EJAA 3YASA 1OY1A 4FB5A 4XTRA 5EXPA 5EQDA 3N0XA 4MZXA 4BC1A 4DHEA 5D87A 4BCCA 2AUTA 5IYZB 1HDZA 2WYWA 3K5WA 1ULBA 1G3UA 4C6SA 2FPUA 1C1XB 3EA4A 5DM60 1XZGA 3PHJA 3T7JA 1U0LA 4DFDA 3UKDA 4XWWA 3JPWA 3PC7A 4KN9S 1CJKC 2FCRA 3CX7A 2PJDA 4KPYA 3OSZA 3OMXA 5ECDA 2NYUA 1GZDA 5E9AA 3PSHA 2O0KA 3LJKA 3LLCA 1KI1A 1X7ZA 1MOPA 4O6VA 3VZBA 3TNJA 5DCUA 3SYMA 2FP3A 2K2WA 3C5HA 1JBEA 3KIPA 2GARA 4ALLA 1P2GA 3LQFA 3PTZA 2YDYA 3SJUA 3QGMA 4A73A 1FP1D 1G8FA 3ZKWB 1D5CA 3D6JA 3FGZA 4NONA 1OX6A 1LDBA 3E9EA 3HZOA 3R3HA 4UM5A 3ADCA 1ZCAA 3D9QX 3GT3A 2DKNA 2QRPA 4CCYB 5C31A 2C58A 1NYTA 3PWTA 4P4LA 1RADA 2EQBA 3C5WP 1NQTA 1KWKA 3LXXA 3ZI7A 4KPEC 1Q22A 3ASYA 3LL7A 1NV9A 1DAEA 1TADA 1CY0A 4RLFA 4EJ6A 1SQ6A 1F5NA 3KNZA 4FYIA 3RC7A 3WLPA 1CFZA 2AF3C 2HT6A 2VXOA 4RTKA 1WJGA 5HBGA 1E79A 4BVHA 1LX7A 3PPIA 2GAIA 5CB4B 4HNTA 4HJXA 5ALFA 1ZAKA 3KR2A 1F3OA 4NCXA 1UBFA 2X4IA 4CKBA 1VE5A 4X1IB 1DOZA 1EG2A 3DDHA 3IXLA 4XXHA 3AEKB 3U13A 2GT1A 2PNJA 4UTPA 1ZX1A 4KXYA 4J0GA 3PE6A 1FPQA 1QFYA 4YP6A 2O7RA 3IDOA 2P3QA 3N58A 5C1IA 5JPDA 1A76A 3OY2A 3P71T 4KXWA 5L7YA 3O8NA 3FWZA 4S04A 3ASUA 2J41A 2O20A 4GLOA 5TARA 4AROA 4X45A 3UUGA 4EF5A 2D5IA 2WUWE 1F2TB 4G86A 1V9CA 1SUBA 3T9BA 1KOJA 5K2OA 4NJEB 4OSPA 5CX1A 2CUTA 3GJRA 5JFGA 2Q5CA 3ES9A 3P2YA 4M1MA 3QTTA 4BO9A 2RARA 4JKOA 3TUIC 4CIVA 5IZCC 4HQ6A 3UK7A 2AZXA 3ZTTA 2PKQP 3G85A 4JJ4A 2QYTA 4W1QA 2IY8A 1G8SA 4CG3A 2AHOA 2BMDA 2H48A 4X71A 4TLCA 3MA0A 4ZICA 1P7VA 3PENA 1DAOA 2HUNA 1LVGA 1XALA 1YBFA 1T2NA 2B8WA 4YCAA 4KR3A 3U31A 1Y6QA 1NP3A 1Q21A 5DHUA 4DRZA 1BMDA 4YCJA 2IZ6A 5KKAA 5JATA 5JCOC 1VL5A 3KB2A 1PYOA 3KKPA 4RTJA 5CU7A 5F1OA 3G13A 4ZA2A 5H16A 3PI7A 1SKMA 3AU8A 3WBKA 4OKNA 5DP2A 5HM6A 4CMGA 3TPFA 1CW2B 3SNKA 4P93A 1UKZA 1U5BA 3T3HA 3IP1A