4LG1A

Human methyltransferase-like protein 21d
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
218
structure length
217
Chain Sequence
DPLRSFVRVLEKRDGTVLRLQQYSSGGVGCVVWDAAIVLSKYLETPEFSGDGAHALSRRSVLELGSGTGAVGLMAATLGADVVVTDLEELQDLLKMNINMNKHLVTGSVQAKVLKWGEEIEFPSPPDFILMADCIYYEESLEPLLKTLKDISGFETCIICCYEQRTMGKNPEIEKKYFELLQLDFDFEKIPLEKHDEEYRSEDIHIIYIRKKKSKFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein-lysine methyltransferase METTL21D
publication title The Crystal Structure of Human Methyltransferase-Like Protein 21D in Complex with SAM
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 72
structure length 217
sequence length 218
chains with identical sequence B, C
ec nomenclature ec 2.1.1.-:
pdb deposition date 2013-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10294 Methyltransf_16 Lysine methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4lg1A00
4C03A 4NECA 2FK8A 3LECA 2YVLA 2ZIGA 3R3HA 2ZTHA 1D2HA 4RV9A 1X1BA 1D2CA 4FT2A 3HTXA 2G1PA 1XCJA 2O0LA 3DOUA 5K0GA 2IPXA 5DM0A 4YMHA 3B7PA 4E70A 5CVJA 2EJTA 2GB4A 2HWKA 4OX9Y 3TM5A 3RIEA 2QYOA 4YV0A 1SUIA 3EVFA 4YUZA 2ESRA 5F2OA 5HIMA 3NDIA 2ZZMA 3M33A 3ER9A 2I9KA 3FPHA 4O29A 5DM1A 2AVDA 3TLJA 2NP7A 1XDUA 1AF7A 2B9EA 3UA4A 5F2NA 3C6KA 3TM4A 5GINE 3G89A 4OA8A 2WA1A 5EPEA 4RTMA 2ZIEA 2NP6A 1JTEA 3PTAA 4B17A 1VP9A 5KVAA 3FYCA 5E1DA 4RTSA 2WK1A 3CJRA 3LX6A 4H0NA 4EKGA 3K6RA 2ZW9A 2ZBRA 3C0KA 3HA7A 1R6AA 3TQSA 3HCDA 1KXZA 4GQBA 2BH2A 5K03A 2IP2A 3H2BA 4X1OA 4OQEA 4AZTA 1JG2A 2HV9A 1V39A 1R8XA 2P7HA 3OZRA 3AXTA 4GBED 3MCZA 3PS9A 4PCLA 4PIMA 1I1NA 2ORED 2ERCA 3GIWA 4IV8A 1YF3A 1JR4A 4KVZA 2O07A 4GOND 4FR0A 4L7VA 4X60A 1WZNA 3SVZA 2PX2A 4M36A 2BM8A 2JJQA 4OBWA 3C3PA 4P7JA 2NXCA 4WVLA 3O4FA 4K6MA 3EVAA 4X63A 5D1NA 5K0JA 2XYQA 3VC2A 1NV9A 3OE5A 2XYRA 1XXLA 3FZGA 3NJRA 5DM4A 3ELWA 5HZMA 4DA4A 5GM2A 4FGZA 4MIKA 3SX0A 4DCGA 3FPEA 2B25A 2BR5A 2VDWA 3DUWA 3KPUA 5CVUA 2V74B 2LD4A 3QOXA 3HM2A 1XTPA 1QANA 3MCTA 1F38A 3ELDA 4YUXA 2PGXA 3BXOA 3BZBA 4XUCA 3V97A 5ICEA 2QY6A 2IDKA 3UJCA 2C7OA 4YV1A 1EIZA 3TKYA 3G2QA 2P41A 1X19A 2AOXA 4E33A 2IH4A 3PT9A 2Z6QA 3EGVA 5LQRA 5E9WA 4KRGA 1FJXA 4RTJA 3G2OA 2P1DA 2FPOA 3MTEA 3UJ9A 3FPJA 1WG8A 2OZVA 1YFJA 3DTNA 3EVDA 5GM1A 5CUQA 4V0RA 2PXCA 2AN3A 3PX2A 5KS2A 2PT6A 4C07A 1X1DA 2HMYB 5C1IA 3T7SA 4FS8A 2QM3A 3MTIA 2ZULA 2PXAA 4UOEA 4AX8A 2OB1A 1F3LA 2QRVA 5F2KA 2NXNA 1SVUA 3JWGA 1X1CA 5EMMA 3NWEA 4PYJA 4CTKA 1G8SA 3AY0A 4OA5A 2JHCA 1O54A 1XCLA 3R24A 3DP7A 2IBTA 2IH5A 2GS9A 3DLIA 2P3OA 3PB3A 5E2BA 3E23A 3ELYA 2PVCA 4KIFA 5EHIA 2ZCJA 4QTUB 2IH2A 1P1BA 1P1CA 3GRRA 3UJDA 5K09A 1WY7A 5IKMA 1XJ5A 5E9JA 4AZVA 4AZWA 4ER0A 2QE6A 5DXJA 3EVEA 2PX4A 5JUWA 5KQSA 1G55A 1PRYA 1YZ3A 3HCBA 5EHGA 5CIYA 1U2ZA 1VL5A 2AR0A 2PT9A 3P9KA 3UJAA 3GRUA 4EVIA 1RJGA 4AUKA 5LQKA 3JWJA 3GU3A 1NW3A 3TRKA 1BOOA 4R6XA 2YXLA 3B3JA 2H11A 3EVZA 1INLA 5GP1A 3UJBA 4PNEA 3KQYA 2PV0A 1JTFA 2GAFA 2AOUB 3ANXA 2IDJA 4DQ0A 4DKJA 2IFTA 4PYMA 4X61A 3VYWA 4ER7A 1ORIA 3EVBA 3M6VA 5GIOE 5CCXA 2PSSA 4FP9A 3I53A 5FHQA 5T6BA 2I7CA 2CWWA 2NYUA 3FUVA 3LDUA 2PKWA 4RX1A 2KW5A 5JR3A 5T64A 1YZHA 2OB2A 1SQFA 3QOWA 4C08A 4RSRA 2PX8A 3GRVA 1N7JA 2PLWA 9MHTA 2OY0A 3BT7A 4M38A 4P7FA 1XDSA 3P9IA 2OBFA 3KPWA 3NWBA 4G56A 3KR1A 4Y2HA 2FK7A 5EKXA 4E2YA 3BKXA 3UWPA 1VPTA 1Z3CA 5DX8A 3UBTA 3IYLW 1JG3A 4CKEA 2ZLBA 2GH1A 3E8SA 1NBIA 3GDHA 2VDUE 4RTOA 3OPNA 3PX3A 2IIPA 1L3IA 1L9KA 2UYOA 3BUSA 3FPGA 4QTTB 4AZSA 5K05A 3G2PA 2EFJA 3PVCA 1YUBA 3SSMA 2VDVE 5EMKA 5BW5A 5FTWA 1JSZA 1R18A 3MERA 2I6GA 1QYRA 2O57A 3OFJA 1EAMA 5CM2Z 3TOSA 5HILA 4CTJA 5DSXA 3EEYA 4RYLA 4LWOA 3A7DA 4XUEA 3IHTA 4A6DA 3ORHA 4RVFA 3HEMA 4R05A 5DSTA 2F8LA 3V8VA 1I9GA 2PWPA 3MAGA 2V7EA 3LBYA 3JWIA 4FSXA 4PYLA 2N47A 4X41A 1MHTA 3PLAE 1YB2A 3G8AA 3TMAA 2CL5A 4E2XA 1NKVA 4F86A 3GJYA 3R0QA 1DL5A 1WXWA 3F4KA 2VS1A 2HR1A 4LG1A 3CCFA 4YUYA 1ZKDA 4IV0A 4PYKA 5P8WA 1ZG3A 2Y1WA 3HP7A 3DH0A 5G02A 1JQ3A 2Y1XA 3KHKA 3M4XA 4RTQA 1O9HA 3HVHA 3AJDA 1G38A 4GUAA 5LQJA 5D1HA 2OKCA 4HGYA 1M0EA 3I5UA 1QAQA 2ONYA 5E1BA 3SM3A 3SMQA 4YMGA 4ER6A 3LDFA 4QQNA 4ATNA 5LQUA 3RW9A 3I58A 3LBFA 2IBSA 5HOQA 5EGSA 4GOOD 3CJTA 3G7UA 3OFKA 4MWZA 5BP7A 1NBHA 3QV2A 2Z6AA 3LDGA 3DULA 3LGAA 2GPYA 3GWZA 2P40A 4RTNA 3B3GA 4FZVA 1UIRA 2C7QA 4XCXA 5EEHA 1FPQA 3P2EA 3UJ6A 5H02A 4JXJA 4PCAA 1XVAA 3OU6A 3MB5A 3FTEA 3KQVA 1WXXA 2P3LA 4HGZA 3I9FA 3O7WA 4KIGA 5ICGA 4GOLD 1YFLA 3C6MA 1HMYA 4PGGA 5EZSA 5FADA 5K0EA 1KP9A 5LR6A 2YTZA 2BR3A 3LL7A 1EQAA 5CD1A 3KQPA 3GXOA 1JSXA 1RI1A 2AS0A 4GEKA 3ER8A 2B2CA 1KPHA 3TKAA 1G60A 5KYGA 3KPVA 2IGTA 3DMGA 1FP1D 1P91A 3UFBA 4DMGA 4R8SA 4E31A 2UZ4A 3KR2A 5FA5A 3FTFA 1IXKA 1L3BA 3RODA 2AOTA 1IY9A 2GA9A 4HTFA 1AV6A 2K4MA 1OR8A 4RTKA 4C06A 3HVJA 2EX4A 5ERGB 1SKMA 3BWBA 4PONA 5K0CA 3R9XB 3GO4A 5E1MA 1WS6A 2VP3A 3NTVA 5BXYA 2AOVA 3FRHA 4DCMA 4GF5A 5BW4A 3Q7EA 3THRA 3LHDA 2YR0A 5DTRA 2YQZA 3BGDA 5DWQA 2P7IA 3FRIA 4BLWA 2OXTA 2ADMA 3A26A 3D2LA 3SR4A 3LKZA 2NXJA 3CGGA 3KQSA 5DXAA 2QRVB 2AOWA 4HRAA 5E8RA 5IH3A 2PBFA 5FWAA 2HNKA 2NNWB 2YXEA 3G5LA 4ISCA 5LSAA 3HA5A 3MGGA 1NV8A 1ZHFA 4QVKA 1TPYA 1G8AA 2H1RA 5K0NA 2AN4A 3BKWA 3KQWA 4MQ4A 5M5BA 4Z2YA 1RJEA 5DX1A 3PFGA 5K01A 3AWIA 5LQCA 4WXHA 3HVIA 3KPYA 4YUVA 1VIDA 4HSGA 2UYCA 4HH4A 4QDKA 4EQZA 5CVEA 2EG5A 5GOZA 3DR5A 4CKBA 4RTLA 2CKDA 2CMGA 4A6EA 3EMBA 2FRXA 5EVJA 3T7TA 1N2XA 1QAOA 2DPMA 2HTEA 3KQOA 4QPPA 1NE2A 3OCJA 3CJQA 5K8VA 1M6YA 4CKCA 4P7GA 3EEOA 2AZTA 3DMHA 2ZBQA 4RVDA 3A27A 5EIFA 3EPPA 5FCDA 5HIKA 4E32A 3IV6A 2OYRA 3U81A 3OU7A 3UJ7A 3X0DA 3FPFA 5EMJA 1O9GA 4RVGA 3LCUA 2ZWVA 5K0FA 3SSNA 3UZUA 1R8YA 2AN5A 3KPJA 3M6WA 3NVMB 2UYQA 3BGVA 4U7TB 1P39A 5CVDA 5DRTA 2BR4A 4DM3A 4PYNA 5E9QA 5EQJB 3O31A 5FUBA 5DX0A 2G8NA 3T7RA 3HNRA 3DXXA 2XBMA 5HIIA 1MJFA 2B78A 3P97A 4BLUA 3BWCA 4LECA 3P9CA 4V0QA 2O06A 3GRZA 3LKDA 3A4TA 2PX5A 2EJUA 5HFJA 1G6Q1 4YUWA 5DT2A 5B1SA 2ZIFA 2B3TA 1KR5A 3C3YA 1DCTA 3DLCA 4QVGA 5C0OE 4C4AA 3MHTA 2OO3A 3DMFA 3AXSA 3THSA 1KYZA 1RJFA 8MHTA 5EIWA 5CCBA 3B89A 1I4WA 4M37A 5FWDA 1KYWA 3EMDA 1KPIA 3FUUA 2O05A 4PYOA 1IM8A 4E30A 1HNNA 1R74A 2XVMA 4ER3A 3OZTA 7MHTA 3K0BA 3KR0A 3S68A 2PY6A 3LCCA 2YX1A 5HEKA 3G8BA 1RI2A 4F85A 1NW5A 1NW6A 5EKUA 3GNLA 1EJ0A 3E05A 2G70A 3KR9A 3B3FA 1L3CA 1SUSA 3DXZA 3VC1A 5EMLA 2G72A 3G5TA 2R3SA 5LQNA 1TW3A 3FTCA 4QDJA 1RJDA 1VBFA 3I64A 1Y8CA 3KQQA 2R6ZA 3NW9A 4Y30A 1KIAA 4BY9E 2YUIA 3LSTA 3HCAA 3OU2A 4IKPA 3NVKI 4BLVA 1D2GA 1ZQ9A 3WSTA 4HG2A 1UFKA 4OQDA 3TPZA 3BGIA 5EC8A 5MHTA 1QAMA 3REOA 1SG9A 4PYIA 3UJ8A 3FTDA 4RTPA 2ZWAA 5FQOA 1H1DA 2GLUA 2JG3A 3P2IA 1RI4A 2UYHA 3KKZA 1SQGA 1T43A 4ZTBA 1JG1A 1KPGA 2NXEA 4DF3A 3FYDA 4RWZA 1BC5A 3NMUF 5DTMA 2XYVA 3ELUA 1FBNA 2JH8A 3E7PA 3FUXA 3FUTA 3LCVB 2ZFUA 3MQ2A 4E2WA 2YXDA 1VE3A 3KU1A 2A14A 2ZZKA 5EOVA 3P71T 4LWPA 4EK9A 1BKYA 1Q0SA 5HIJA 3G88A 4F84A 3CKKA 1VP3A 2VZ9A 4IWNA 4P58A 3OE4A 5K0BA 2ZBPA 3FUWA 3G2MA 2JH9A 4PWYA 2PXXA 2G71A 2ZSUA 4XUDA 2JHAA 5E1OA 4CXMA 4GOMD 1EJ6A 2CMHA 3JWHA 3P9NA 4PIPA 1B42A 1EG2A 10MHA 1NW7A 3LPMA 4OBXA 4QQKA 4FT4A 1RI5A 5CVVA 3CBGA 5FQNA 1XDZA 2Q41A 3Q87B 5FULA 3SGLA 1AQJA 2DULA 3M6XA 5FHRA 2C7RA 1VLMA 4KDCA 2FHPA 2I62A 4PGHA 3HVKA 5EEGA 4HC4A 5E8JA 3OZSA 4PINA 4YV2A 3HCFA 4C05A 3EVCA 3DXYA 2BZGA 1X1AA 1KHHA 1TW2A 3B5IA 4U7PB 3SSOA 3GCZA 5U4XA 3ME5A 3PFHA 3NDJA 4DZRA 2ZZNA 3BWMA 2E5WA 4E2ZA 4CWAA 4EKIA 3GRYA 1R00A 2AOTB 5DTQA 3ID6C 4HTFB 2AVNA 4R8RA 5DLYA 5ICCA 2JHPA 3UA3A 1ZGAA 4BP3A 2AOUA 1RI3A 1AQIA 3M6UA 3VSEA 2P3QA 1NW8A 4P7KA 4GC5A 5DRYA 4ER5A 4RVHA 1JQDA 2Z6UA 5ICFA 3GGDA 4KDRA 2FCAA 3EGIA 3IEIA 5E2AA 2H00A 1N7IA 3CVOA 2ZVJA 5EZQA 4EMSA 3BWYA 1PJZA 3TFWA 4M7RA 2XVAA 3A7EA 5KQRA 1Q0TA 3T0IA 2P8JA 1M6EX 5DM2A 4MTLA 3EVGA 4KWCA 3HCCA 5EG5A 3R6TA 1FP2A 2PJDA 5LQAA 1UWVA 4R6WA 4KW7A 2BM9A 3P2KA 2PWYA 1L1EA 1QZZA 3EGEA 5C9ZA 2OPBA 2FYTA 2ONZA 3P8ZA 4GC9A 1DUSA 2WA2A 1JQEA 3HCEA 3A25A 4QPNA 1JG4A 3L8DA 4PYQA 4RTRA 5FA8A 4BP1A 5T67A 4MHTA 3KQMA 5GWXA 1BHJA 3KQTA 3TR6A 3M70A 5K0LA 5DPMA 1NT2A 2C7PA 1VQ1A 3ERCA 5GIPE 3CC8A 3HA3A 4FSDA 1ZGJA 3SXJA 1ORHA 4C04A 4POOA 2P35A
chains in the Genus database with same CATH superfamily
1C1YA 4BJ6A 4NECA 1U99A 2NO1A 1V5FA 1KI4A 2A1TS 2ZIGA 4EY4A 2BGRA 1W0KD 2FWBA 5GJWC 2Y68A 3GUZA 2BV3A 4Q82A 1GKKA 4L4UA 1N2ZA 4UUQA 5K0GA 2I67A 3K0FA 4L15A 5AKHA 1L7AA 3B1VA 1MOZA 1Z4OA 1PR6A 4JUFA 2VYCA 3FNEA 5AO9A 2C7GA 5LDDC 2QYOA 1C1XB 4KHZA 1E6UA 4QUGA 4P5DA 1QRAA 4DREA 3QUTA 1YZNA 1UBCA 3W3AD 1AOXA 3SC2B 4KYIB 1QCYA 3D4OA 1CUVA 1Y81A 3E9CA 1T5LA 1NRWA 1I4TD 1K4YA 1VRWA 1XDUA 3DBIA 3SFZA 3TB6A 3UA4A 3WLHA 4DOMA 3AGQA 2E4ZA 3A0RB 3EMVA 5GINE 2PGDA 3JR7A 3K9HA 4U39A 4UEKA 5BO5A 3SP1A 2YQ4A 3VZRA 4DLWA 1VP9A 2Z3ZA 4K3VA 3OTWA 2V5VA 2WDPA 2WK1A 3CJRA 3LX6A 2QQ0A 4HDRB 4S24A 3FOAA 5ENDA 2QPAA 3NHLA 2GRUA 4K9OA 2HZBA 3WNCA 3OKAA 1KTVA 821PA 5P21A 1TIBA 1P7ZA 3NALA 4OQEA 1WOMA 4KNWA 1X7YA 1QHEA 4TTIA 1DCMA 3SR3A 1R8XA 3DTTA 3MSCA 2IHZA 3BQNB 3EXAA 4AICA 4CKWA 3OQMA 4ZOLB 5I9LA 1TTHA 5DK4A 4IP0A 5H9VA 4G1VA 4RHXA 1JR4A 1X13A 2JI9A 3IAS6 5C8YF 5D6NA 3VDRA 3NBMA 2I2BA 4WESB 1Q7CA 2R6CA 2AEJA 4CMEA 1K2WA 3HXPA 3KAJA 4RXMA 1VXOA 4UMVA 2P5SA 4A2CA 3C3PA 1A4UA 1LGYA 3F5FA 4TQUS 3VR6H 4YAIA 3ZE2B 3ZBQA 3AOEC 4Q15A 4W5TA 3CZPA 3LD9A 4GE0A 4Q39A 2C3MA 5FLXA 2BP7A 3OE5A 1XXLA 3K1ZA 4L1KA 3ZJ5A 1DVRA 1RWQA 5KU1A 1A72A 1G5RA 3B85A 4BFYA 1MRSA 4G89A 2WSMA 5I7EA 3AIMA 3KPUA 4MCJA 4WKOA 4Y2QA 5EP3A 1K8QA 1JYFA 1MA3A 1M1YB 2C9OA 2MDTA 1R3DA 1F38A 2VSNA 3I9LA 3K92A 3WMFA 3B5JA 3BXOA 3DCJA 4WY5A 1XZ8A 3C5CA 2IDKA 5KHAA 3ROPA 2ZAIA 3I0ZA 1ZR2A 1RXCA 4QLAA 4U2GA 3JVIA 1BZYA 3DB2A 2GBIA 1N8TA 2H5EA 5C32A 4I2NA 4ETMA 3WGNA 3RBAA 4N3AA 1JR3E 4K6CA 3QVGA 2IL1A 4EW3A 5ITSA 1YULA 1N3BA 1Z8NA 2ENWA 3RK4A 3G0BA 2I2DA 3ZYZA 1HSZA 2IUTA 1F0PA 2ABWA 4JLVA 3SI7A 5CBPB 3CLUD 4MPRA 4AK9A 4M9ZA 3Q88A 5C5CA 1Q2UA 3T7SA 3IUEA 4LNUA 1JR3A 1V16B 3W7VA 2XUDA 1NVVQ 1SNYA 1F3LA 3R2JA 4MPJA 5ARBA 2OCGA 1KSGA 1EH5A 2I3ZA 2WJGA 5EMMA 3SS8A 9ABPA 5KPDA 1U0RA 2OAP1 2Z04A 2C00A 2GK3A 2E7ZA 3N0VA 4INZA 2G9VA 5ALUA 3EPKA 5BOVA 1JJBA 1EUDB 5E3IA 1ZK1A 5E2BA 3BQMB 4CIVA 1U65A 4PG6A 4XQ0A 3IXLA 4J16A 1R0CA 1XEFA 2A84A 2W9XA 3PC6A 4NU0A 4D3DA 4E5YA 5JRDS 4AZVA 5JZ9A 1IAQA 1M2OB 3GDGA 4UHFA 3A06A 1JB1A 1YFKA 5JSHA 3I6YA 2PRIA 1VIYA 1G55A 1Y3AA 3BXXA 4V3CA 4Y2SA 5EHGA 1U0TA 3PI6A 2Y3IA 3P9KA 1B26A 4CIXA 5MN4A 4FFMA 3EASA 5LQKA 3ASUA 3BXEA 2ZOSA 3JASB 2GLTA 1P7WA 1FXWA 2ID9A 3FWHA 5AM3A 5JASA 4DUYB 4QDXA 4FD3A 3E3LA 5I7RA 3O3OB 1TMYA 1GG9A 1YZGA 2R8RA 1OT3A 3B82A 4NOMA 3S1LA 3SU8A 5FOWA 4W63A 1RZVA 4EW2A 2HBYA 4N3GA 4LXQA 2IFTA 5D5PA 1ADGA 1LDBA 3CUUA 4OXYA 2O8EA 5DHRA 5F73A 1DCKA 4L08A 4BECA 2P68A 2Q0SA 4UPEA 1XTUA 5JSQA 1NUSA 1YHYA 2WJPA 5DT9A 4MH0R 3JX9A 4NAVA 1G2PA 1KQNA 1A50B 4KR0A 4CKYA 3GBPA 2UUOA 4WNAA 1RLMA 4GWLA 2QD5A 2AXPA 4NH4A 3L41A 1HNWB 4C76A 1GZ7A 2VJMA 5HRUA 5BMVF 4MUYA 4EJSC 4M55A 3M3DA 2OFFA 5L7YA 4EEKA 3TOVA 4AJNA 3DL4A 1I6WA 1ZUHA 3OPNA 1B1AA 1P0IA 1XZJA 3KTOA 1H66A 4WN9A 3TXAA 3VUFA 1DLJA 2BMAA 1X7GA 2O48X 5D3QA 1YUBA 4UOZA 1OZGA 1W581 3A04A 2HBQA 3MERA 5K8LA 2SKDA 1NLYA 2QMZA 4B9EA 3AONB 5DSXA 4C2BA 3EEYA 1Z5NA 3LHKA 1PYOA 3WR5A 5AW8A 3ZS9A 1LPNA 2HIMA 4QL3A 5GPBA 3EWAA 1SZJG 1ZNZA 2C04A 4LRQA 2C54A 3D6AA 3MPOA 3HKEB 1Q1ZA 1HDIA 1LPAB 1T1GA 1XAGA 4KVAA 2Y0BA 4JLWA 3V8VA 4B3JA 3SDBA 1JBKA 3DZ8A 3Q7IA 5FBLB 5LL6P 4WFIA 2FR1A 3VR4A 2ZAYA 3KDPA 3NP9A 1L7PA 2HI0A 1SXJD 3JWPA 3FKSA 1GU0A 3AESB 3K0AA 5M2QA 5JSKA 5DNYB 4IYRA 3OD1A 1MC8A 2WMOB 1DKMA 1CRPA 1WKBA 2ZRAA 1WD5A 2A3RA 3G0OA 3ZW7A 4AF6A 1YNSA 2XUAA 4QVIA 3HP7A 4CFZA 4ZHQF 4DR5B 1YVUA 4AL4A 3EIHA 4Q9HA 2QN7A 4NCAA 4OHPA 3IP3A 3I2IA 1QZUA 2NUAB 4BIIA 3N7UA 3PQ3A 2GLXA 3T94A 1QIFA 3AJ8A 3K0SA 4Y2UA 3H7IA 3GUVA 2D8MA 2R11A 4IX1A 4PFJA 3SXUA 5JH7A 3I01M 1GUDA 5CT5A 2WU8A 4P34A 2YKGA 3BFPA 1FQWA 3RRFA 4EZEA 4V0OA 2ZT8A 3KALA 3GWZA 4ZCMA 1I7DA 2V7WA 5K2MA 3DV9A 4YRBA 1EX1A 4K1LA 2QTVA 3UJ6A 1V7CA 3I4CA 1QJ4A 4RHYA 4B47A 3TD2A 1DV2A 3TLEA 3DJFA 1DHRA 3WVNA 2PTGA 1VSQA 3UMRA 2GASA 1EG7A 1YL6A 3G0GA 4EF5A 2DBQA 3IEUA 3Q4GA 5FL3A 1KSJA 1P73A 4UVDA 4L76A 2W42A 1YBHA 1KVSA 3JXEA 3MS7A 5FWNA 2J33A 4PAGA 4DAEA 4BX0A 2GM5A 1LBTA 2OZLA 2PS1A 3VFDA 4KXVA 4S04A 1M74A 3P9RA 1FP1D 3L7DA 1QE5A 3RFXA 2FNAA 1WBJB 5LP6C 1ZW6A 1Z34A 2WKSA 2FJ0A 3H05A 5GJCA 3KSUA 4JJ6A 3VO8A 1KEPA 2EX4A 2XUZA 2D5CA 3QHAA 4HRVA 3C48A 4LJ4A 1YNOA 4I8XA 5G0VA 4IXTA 1PSDA 4PGAA 5HMLA 5ILGA 2DETA 4GI5A 3L2OB 1Y4UA 3IAUA 4RXTA 3BL5A 5DTRA 3TZLA 4MOWA 1PAUA 5DHFA 4K9DA 1X7HA 3I09A 2QVBA 1CNEA 1KYVA 1N9ZA 1UMCA 3G7SA 3IHLA 3ZGVA 2GQ0A 3BFJA 3AEQA 4NNPA 3F3KA 3LKZA 3DEIA 4ND7A 4BBZA 4GR4A 4CNBA 3DOFA 2NW6A 3KQSA 3RF7A 3OY7A 3URKA 4KAJA 1D6SA 1RRMA 2CMKA 2A8YA 2QRVB 3UPDA 4HD8A 2YJZA 3LFTA 1P0MA 2FE4A 5KNCA 3AB3A 4QT0A 2NUTA 4RVCA 1FYDA 1U7WA 1YSCA 2CXUA 2QRMA 4CCYA 1CY4A 4MQ4A 2APJA 4J0GA 4AIIA 1VM6A 3L0ZA 3PFGA 4JC4A 3O93A 3GPLA 2ZRMA 2BGKA 3L93A 5JROA 4YUVA 1VYVA 1V6AA 2I76A 1RYEA 2EG5A 5IASA 4C7VA 1RM3A 2IYEA 1SCJA 3KQNA 4ZXPA 3T7TA 3P52A 4KQFA 1AZSC 1EHIA 2R00A 5JD6A 2Q0QA 4OYHA 5AWFC 3C7DB 4O4HB 1IY2A 4P7GA 3UT5B 3X1JA 3ZEAA 2ZYGA 5I47A 3IURA 2GD0A 5FCDA 2DFDA 2CBXA 1LTKA 2FPUA 2OYRA 4MR7A 4F7DA 1K5HA 1UMDB 3BCHA 3IGFA 3STWA 1NRXA 5JYEA 3KTDA 2YJGA 1WMBA 5JALA 1WZCA 2BFDA 2LNDA 3UAXA 5DYTA 4BXOB 1I80A 1X0VA 3DYIA 5F3WB 4EB8A 2B78A 3P97A 3CUVA 4IRXA 5EWLB 1QIEA 1KO5A 2XITA 4H4DA 4N3CA 2HAEA 1NVBA 4R1LA 4V0KA 2HDNB 2X4LA 4UHEA 1HGXA 2VNIA 1B1CA 4A6PA 4DVGA 5JBNA 1K6EA 1I01A 1RKQA 4DZZA 1XZLA 3WJ7A 5JNUA 2DZDA 1CVIA 2JW5A 1I2AA 2Q4RA 1NI5A 2FEAA 2WKRA 1WSWA 3L0DA 3M6AA 3ZHBA 4BV8A 4EPVA 4YREA 2HO4A 3CRZA 2JGJA 4FFOA 1RXVA 3SLRA 3I6BA 2HXYA 1BFDA 3GEEA 1GSAA 3ICCA 5EZYB 3Q0TA 2Y1CA 3CZAA 3RC3A 4BV3A 2PY6A 2H1LA 6NULA 4ZEMA 1Z45A 3H6KA 5AI4A 1NW6A 2QBYB 3DUFA 4LZLA 1YTUA 2FFRA 3ETCA 2X8WA 4QUJA 3VC1A 3IPYA 5E6RB 3HI6A 1HEUA 2AR9A 2XRFA 4UEJA 1D07A 1ZIYA 2FX2A 2R6ZA 5CCDA 2NU6B 2FZVA 1EFUA 3TBKA 3BB4A 1EUCA 1I6MA 1U31A 3UCEA 1Z6YA 4CRWB 5EC8A 1T8UA 1YJQA 2BKXA 3V4PB 3EWSA 3FTDA 4QJIA 4ENPA 4AO7A 3CSUA 4AKGA 4JJGA 2G7MC 4WSOA 1OX6A 3UT6A 4CTMA 1YMQA 2BGJA 4IY1A 2FGJA 1YGPA 5EIHA 3SXPA 4XQ9A 3L6UA 2GX6A 3A3YA 3C6QA 3EGOA 1R12A 3OO1A 3PIDA 4XM0A 5KTRA 2WSYB 3L8FA 2W5UA 4CLDA 1B0PA 3FUTA 3QZUA 2F48A 2Q9UA 3GVCA 3N05A 3ZNPA 4V24A 4CW7A 5BSHA 4QC2A 1HT2E 3OCYA 4JFRA 1R5BA 3ANMA 5H1YA 2RKOA 1DFGA 4E5SA 1M83A 2JIQA 4LA4A 4MV7A 3CZMA 1DRWA 1C4OA 5C7OO 3LRXA 2CDNA 3E9ZA 1TZKA 4Q16A 4LHZA 2PAAA 1MHPA 2WPDA 3B6IA 1TNDA 3RSQA 5TQ2B 1FOEB 2D54A 1KZ1A 4OBXA 4ZI2A 5BN5A 3TSAA 1ILWA 2IZ7A 1QQ7A 3HGTA 1KQFA 3EFOA 1YQ9A 4EHNA 2AL7A 2V8BA 1QVVA 4I81A 4UU8A 3LY5A 3RGGA 5HJ7A 3FFTA 2X1LA 3M4ZA 1E7QA 4GLOA 5BWLA 4EBBA 2FKAA 4O3FA 1OH6A 1UPUA 3PFHA 2C3PA 5I4BA 2ZZNA 4MIEA 4QUIA 3TBHA 1TEZA 4DA8A 3GRYA 4WXPA 5JSZB 2VWPA 3CNNA 5D84A 5A6SA 1DARA 1XCGB 2D5LA 3UA3A 4DWVA 2D7JA 2QQEA 3GBSA 1ZJ5A 4LJ6A 2WWTA 4YB8A 1PEKE 1WEHA 2FGKA 3CH7A 3MMXA 3MWJA 3QWFA 3TZQA 5IPFA 3BFKA 2NO7A 2GPWA 4NU6A 4CR8A 1AT1A 5C53B 1PV2A 2RHLA 3NJ8A 2G77B 3LUJA 5DHAA 3EOAI 3EVGA 221PA 3I6MA 3SQNA 2YHBA 1SXQA 1DKPA 3R5XA 3WAJA 2H06A 3TFQA 2REQA 2FW0A 4ZVMA 4MRAA 1CNFA 4YRIA 4IQGA 2PWYA 3I52A 3I9V6 5BQPA 1I5EA 2FYTA 4XGNA 1X8LA 3B6MA 4RIGA 4YECA 5F77A 2G80A 5EY5B 4FD2A 4DRXA 3K31A 4QDZA 5BQ5A 1EVQA 3C6YA 5IN5A 3A9SA 4RTRA 3LT0A 1F6DA 2HV8A 5F3RA 4JOBA 5L3QA 2XGGA 3P96A 3PD1A 3AR9A 4J7AA 4JJKA 3OOEA 4UHCA 2K7FA 3PDHA 1L5OA 4HZUB 5JJCA 5DPMA 1FP7A 3TTTA 3ZGXA 3FFWA 4PG5A 1T1JA 4RF2A 3VOTA 2O1WA 4A0RA 1TFRA 4JVNA 3VVMA 3C3AA 4WOPA 4KC0A 3LDHA 3BXZA 3GUCA 3QV1A 5AH0A 1PJSA 4MV8A 4OM8A 4OYRA 4R9VA 1NKTA 2D4AA 4PFSA 5G0SA 4LMBA 4LRWA 16PKA 3C5HA 3BA1A 1U2DA 3TE6A 3FDJA 3RDPA 3UYKA 3B7PA 4ZVVA 4IDPA 1J49A 1OIWA 5AFSA 5A04A 1CZNA 4O25A 3TGWA 2C8KA 3FAZA 3FFAA 3IO3A 3V6LA 2Y71A 5DM1A 5IUKC 3BK2A 3K8QA 2QRLA 4MGIR 2GARA 1U0JA 3ICOA 5B7NA 4Q02A 4L72A 4U2FA 2DFKB 3GN1A 1KAQA 3C6KA 1UJBA 4OA8A 4J1QA 3LWBA 4KUGA 3RS9A 4Z4GA 2DVMA 4WFJA 3QG5A 3QA3E 3UXHA 3WRYA 1V2GA 1A9ZA 1NOJA 2VT7A 2YNMD 3KQHA 3R0JA 1R66A 3A6HA 3WDKA 5B7PA 1OROA 3ORRA 1DE0A 3K6KA 4IR7A 3C0KA 4BQNA 3W4JA 6ABPA 1EFLA 1OFUA 5DK6A 2CVPA 5AKEA 1U0LA 1FFBA 2Q3FA 4IXMA 4D8WA 1UBSB 2OV4A 1NATA 1JQBA 1TPZA 5GADl 5JS1A 4BRZA 4CEJB 4MKGA 1J0EA 4FZ5A 4IV8A 2VHJA 4DBZA 1X9IA 3DD1A 3F6EX 3DCNA 2ZI3A 2OFPA 3DE1X 3PYXA 2WNIA 2KQUA 3AUSA 4X63A 4ARBA 2QLJA 4W1RA 2KYRA 2VCEA 3O4HA 3EVAA 4PLCA 4FZ3A 1WCYA 3GDWA 4HRYA 3OKPA 2ZSFA 3HVUA 4LZPA 1K3UB 4DLTA 1KEEA 1Q0LA 1V2HE 3BHNA 1L8OA 3FPEA 4WLNA 3THOA 2Y27A 4M0EA 5HSGA 2WM3A 4NYIQ 2YWRA 4FOPA 1PUJA 2VPXA 1ISIA 3K1AA 4RE5A 4FBMA 2OP0A 4JLUA 5JZBA 3M89A 1DC5A 3BMOA 2IHJA 3TJZA 2QTAA 1U5AA 1VMEA 4NU8X 3G2QA 2A1UB 4CG0A 3PGKA 4AJ2A 5C1DA 3SK0A 1PBNA 3HKDA 4E33A 4CLRA 3LZDA 4ZMBA 3EUEA 4IDNA 1KYIA 1LX6A 4HWGA 5E9WA 3AKZA 4D9NA 3PIIA 4CIWA 5KYYB 3SJAA 5T4HA 2A0YA 1O7JA 2V0CA 3JD4A 4OJMX 4DV6B 1UANA 4G0VA 1EFCA 2WTNA 3U3KA 1UFQA 3PKZA 2JK1A 3IS3A 4IJKA 5BSWA 2WJIA 2HLNA 3V34A 5JI2E 2H4JA 3EUWA 3UY4A 1LI5A 4XDHA 4D43A 4FS8A 5TEWA 1JFTA 4DADA 4KKXB 5CB8A 2ODWA 5CDFA 3AZOA 2FG5A 4JEMA 5CYFA 1U7DA 5LYJF 2X58A 3RVSA 4F1WA 5ALMA 3QSYA 2XLBA 4M9QA 3AF1A 4YP5A 4ARZB 4RZHA 2JGNA 5DGIA 3DP7A 3U5ZB 2GS9A 3W5HA 3PB3A 2PD3A 2QHXA 2WYVA 3HACA 4UU1A 5E6SA 5FUXA 3W06A 4CF7A 2ZUDA 1XU4A 3AM1A 3ZWXA 3WGLA 4PR0A 5IKMA 2QG9A 3BMNA 3FNIA 3S99A 2B36A 1EVYA 3OCVA 3ZQ6A 1A9OA 1PR9A 1I6KA 1XCOA 3WGHA 4D4MA 5KQSA 2BSQA 2YYSA 4E07A 3VMFA 3AF5A 1OU0A 1YZ3A 1FSPA 3TK1A 5CIYA 2PVSA 3ZDQA 4FFSA 5DF1A 3QEJA 4JGGA 1RJGA 4I14A 2DT8A 2OLJA 3KOOA 3OPYB 3QUSA 4R6XA 1LK5A 2QN1A 3K8ZA 4PSDA 4UCXA 4YRJA 3UJBA 4JSYA 2FDXA 2DBRA 1KDYA 5KX5F 3FPBA 3UVEA 1T34A 2ZCVA 2FQ1A 1ZCJA 3LUPA 2QJWA 4FXPA 1M2JA 1C0PA 1E3MA 5C3MA 3HEBA 4TRNA 2HA0A 1N78A 1YL5A 1Z08A 2E4VA 3DV0B 4OHWA 4DQDA 4MI3A 4YN3A 2Z5FA 3TLZA 2I7CA 4DUPA 3NHJA 1MAVA 4YX9A 2O8FA 3ZHRA 1V7ZA 3EQ8A 4RX1A 3L04A 3C85A 1EFKA 2AC2A 1NUHA 4RD4A 3BXPA 5JVDB 5EJMA 5IVKA 2IEGA 4UNNA 1UBUS 4ARSA 4PHCA 5C8XA 3T4UA 4URVR 3QE9Y 3HUDA 3EAGA 1E2GA 2BI8A 3U56A 2ZWPA 4GS5A 4WXEA 4Y67A 2PKRA 1VPTA 2GF2A 4H77A 1VG0B 3N1UA 1CDDA 2ZLBA 3E8XA 1V4BA 3E8SA 3NTRA 1JU9A 4L16A 7ADHA 4MK4A 1K0UA 3A3KA 2WM8A 1V5GA 3OECA 3DV2A 3VI3B 4MI6A 1NZFA 3OC6A 3ZK8A 4RVSA 1THZA 1PFKA 2LUOA 3SSMA 4PPNA 2WJAA 4N6NA 5FTWA 3V8PA 1TJ3A 4HAXA 3X1YA 3ZJUA 1N9GA 2I6GA 5CHEA 1RRKA 4KRFA 1Y6ZA 1CERA 1DBWA 1KY5A 3V42A 4KOEC 5JS7A 4LWOA 4LXXA 3ORHA 3OLYA 4H7HA 4NZPA 4UTOA 5ELLA 3U4GA 5JTTA 4C0SA 1HMPA 1KMHA 3BD8A 4A2WA 3BEOA 3MEQA 1MVLA 4IFBA 4TTVA 3WXMA 4V0ME 3REGA 3JWIA 1U5BB 1YB2A 1XDBA 3HB7A 1HFJA 1P6QA 1JAZA 4B3MB 1TJ5A 3A31A 2CKMA 3KYJB 2NG1A 5TSDA 5JQWA 4N5IX 4R2IA 4NAHA 4YRSA 3GUYA 1MG0A 5TMDA 2F1HA 2R1UA 2RGNA 4LXGA 4OP3A 4ITUA 1DO2A 4K6HA 2PKYX 1DIGA 2Y05A 4V0MA 1ISGA 1ZG3A 5ILOA 2WHQA 3CX7A 3N0TA 2YVQA 1KE2A 3ZQ4A 1UQRA 1JQ3A 2G8LA 4CKXA 3RYIA 1ISSA 4L8LA 4M8LA 5CNMA 7YASA 1SU6A 5AD1A 2F3QA 2Y4OA 2O0MA 2OKCA 2QZJA 4RA9A 5FTLA 3DCIA 1M0EA 2DR0A 2E55A 4OI0A 3AYZB 4PLZA 1Y7HA 4WKGA 5JW6A 4FVTA 5FUYA 2B99A 4KTVE 4WKCA 5K3FA 4MWZA 2A1IA 4ZA2A 4MUFA 1H2YA 4D3XA 2NVOA 3EW9A 1CUUA 1S3SA 3KUUA 3PNKA 4HLUA 4XGKA 5EJFA 2PGLA 3IBTA 1NJ5A 2H07A 2UV8A 2DE0X 1KGSA 2B6HA 4QREA 4UMFA 4JYZA 4O3MA 2JA2A 3P7MA 2ES4A 4HDAA 4J0CA 2RONA 4MYUA 4JB8A 1K5PA 1M6NA 2BR3A 1B0AA 3R1IA 4Z4IA 1T9KA 3PVSA 3BERA 3WK6A 1EDOA 1EK1A 2QA5A 1OWMA 3JARB 1UK7A 1D6JA 3UUGA 3ICQB 4JJEA 1JSCA 1Q1NA 2G63A 2IGTA 1WD7A 4YJ2F 5D5HA 4ACAA 1LH0A 1UQTA 2H57A 2VUTA 3DZIA 3KYIB 4R8SA 3CH6A 5CCEA 4OJKA 1DC3A 3MNFA 1VHJA 4Q3AA 5E0OA 4F60A 5EUCA 2W4IA 2XE4A 4BJ1A 2VCYA 4TMKA 2HADA 3O4GA 3WIEA 4RTKA 4EG7A 1Y6GA 1SKMA 3ZIAA 3L4BC 5B1YA 1XALA 5CYGA 5ALYA 3F3SA 4EY7A 4M89A 4MQBA 1D2AA 1JPVA 2IXDA 3E9MA 4YJFA 4DCMA 5THQA 3CF4G 1KZ4A 4PSUA 1PT8A 1R64A 1Y42X 3B6EA 5SZKB 4MAMA 4BDSA 3ZI0A 1V1MB 1GIAA 1MOPA 1RFGE 2QD2A 3B20A 3H65A 4LDPA 3IPLA 1YV9A 4QOGA 4YAEA 5K6AC 5L3SA 1QO0D 2WINI 2R5NA 1DEAA 3H9UA 2WHXA 2BRUC 1K7FB 3GI1A 3V00A 1H8ED 1S3IA 1G21E 1JFSA 1G7CA 2GETA 4LYFA 3FOBA 2DX7A 1EVLA 2XODA 1VKHA 1K3TA 1KSHA 5DE3A 4W5QA 1TPYA 1UUFA 2OK7A 1DEXA 2QLFA 5BRAA 5LJIA 1ZMOA 5CA1A 3G2NA 1LTHR 4L3VA 1HNZB 3V48A 3AWIA 1KBOA 2A9FA 5DI3A 1L7RA 1E1MA 1P77A 3KPYA 2CJWA 1CQPA 1OYYA 2IHYA 5TVGA 3PUJA 3TSCA 2UVPB 2PSEA 3MQ4A 3G2HA 2NV6A 4N8SA 2DHCA 5AI9A 4M76B 3TTSA 1W47A 1IDN1 3GVPA 3I1IA 3IUQA 5C37A 4DBVO 4P81A 3E8MA 5JJLA 2OMEA 4PNHA 5T3UA 4DYDA 1EA7A 2VRNA 4CDRA 1DBRA 3B9BA 2N75A 1E7WA 5AVJA 3VPDA 3ZY2A 3UJ7A 3QX9A 2WJWA 2Q4EA 1V3VA 1WQ1R 3EZ2A 4MR8A 2FR0A 4TXNA 1WOYA 5LD2B 2PLNA 1LU9A 4PN3A 1NPYA 1TEVA 1X80A 3CCCA 4QEKA 1RC8A 2FLVA 4C0XA 5DNWA 4WLEA 4BP9A 2OVFA 4EX6A 1MORA 3HCNA 2VHXA 3BE6A 3HNRA 2ZTMA 2J3DA 4L51A 1AUXA 1BSVA 1M34B 1SVMA 2R9VA 4GPZA 3ZVMA 1DDIA 2ZSDA 2A9RA 4K9SA 3WL8A 3M83A 1VJCA 1M6VA 1R6TA 2KJQA 2MYPA 4G23A 1O2DA 2L69A 2W6PA 2X76A 4V0QA 5LYYA 2JGDB 2PZLA 1EA5A 9LDTA 2ZSKA 4X8MA 2VAVA 3O4VA 3C3YA 3QP9A 4CMIA 5CDHA 5IFKA 4QVGA 3ZN2A 4QXOA 1KJQA 2PPVA 4DNPA 5A2QA 3NIBA 3BIWA 4MI1A 3UK2A 5J1SB 2R66A 3H3JA 3R8FA 3B89A 1KY2A 4M1QA 4JS0A 1N2SA 1BXRB 1U4SA 4UEQA 5COBA 3NBZC 3ZY5A 4FFVA 5DLYA 1WVGA 4J3JA 1NL3A 3SAJA 1QRSA 3VHXB 1F20A 1GTVA 4DYHA 1JVSA 1IUNA 4DZTA 4LCBA 4S1OA 1I8TA 2JDIA 3E05A 5AVSA 1BCSB 1SR8A 1QMPA 4II3A 4JBIA 2YINC 1KC3A 3SDZA 4QXMA 4YCAA 1QYCA 5KYUA 3THWA 3LZ6A 2HTFA 2H2HA 4RDCA 4QO7A 2O3SA 1UJ5A 5E3JA 4BNLA 5LQDA 3KKLA 3GWGA 3LSTA 3AKYA 1TA9A 4Q9AA 1KEUA 3G0HA 2VNJA 2Q5HA 1UXGA 2JI6A 3DL2A 2C9DA 4P4SA 1T0IA 2DHQA 1U3CA 1FS6A 3HY6A 1ABBA 4DV4B 1RRGA 2IA5A 5DCLA 3BCUA 1Z6PA 2J3JA 3MMZA 2FMTA 1JAXA 2D2EA 1T36A 3OMWA 4CMKA 2CCKA 4YVFA 5E3HA 1N7HA 1JIVA 4Y1RA 4NP6A 4RWZA 1HYGA 1AMOA 4KSYA 4PFQA 3LLVA 1FBNA 1YR8A 1SUCA 3ASZA 2WWXA 3E7PA 4HKTA 4K86A 4NMMA 4F3YA 1GWNA 1WDWB 1G4AE 1VYUA 4QXQA 5FJJA 2G3YA 2V1XA 2I5PO 1SY7A 1OA0A 3LOQA 2ISQA 3DHNA 1MH9A 4B1FA 3ANYB 2H48A 2XXAB 3CHYA 2VZ9A 2J85A 4X0EA 1Y5RA 1SVSA 2XTMA 3GFBA 1HTWA 1YR2A 1R9MA 4FJ2A 4E5KA 4A82A 4JI4B 4IH4A 2JHAA 2I2CA 4MZXA 3TRHA 2UKDA 4OK5A 4CQMD 1UZLA 1RI5A 2FUNB 2YMMA 4D98A 5KNDA 2JCBA 5ITZA 4C89A 4KQ1A 2ZGVA 4F5EA 4DS3A 2FHPA 3SJBA 1TVKA 1GJRA 4EF4A 5AK5A 4E2ZA 2XHEA 2GSWA 3EVCA 4INJA 3NS7A 1KP2A 3HYTA 5T41A 2BCGY 2EF1A 4ZVTA 1FTNA 3VH3A 2VHCA 1Z16A 3EZ6A 3HKBB 1SD2A 2HQRA 1WV0A 5AKYA 1E7YA 2CFIA 4ONEA 1IWOA 1XZPA 5T5QA 3DDHA 3IEPA 1OU4A 1U2GA 5LU9A 3GLGA 4HUQA 4BO1A 4F21A 1UT5A 2QR3A 2AQ8A 3RIXA 4R41A 3UOGA 1MJHA 2AOUA 3NVAA 1HDXA 5C8YB 2FSSA 2X5OA 1YU6A 3DDSA 4MVJD 4S1VA 2JJ2D 4W7IA 4B79A 4ER5A 2OMKA 4C0BA 3SQDA 3FOEC 2Z6UA 4BEVA 3WRXC 2BMDA 3FE2A 3CVOA 3RUAA 2F7SA 2XVAA 1KJNA 1M75A 2BFWA 4HHEA 4J43A 4ZO9A 2I4OA 1K5DA 2VEDA 2HCFA 1FP2A 1XLTA 4F3KA 1KK2A 4UM9D 2VF4X 3KDAA 5AOAA 2YY6A 3AY7A 4C0HA 4YRMA 2C94A 4JXZA 1YKSA 4UBKA 2XUJA 1NVDA 3AILA 3V32A 3I4LA 1L5SA 3S5JA 1ZO8A 2GGSA 2R79A 2IVFA 3BXGA 4FEEA 3RRMA 4BV9A 2ONJA 1E9VA 3DGEC 4KQMA 1L7DA 1MDBA 2J3LA 3CUSA 2C61A 2B35A 4HQ0A 2WWYA 2EDAA 1NBMA 5T4BA 4MHTA 1FDTA 3QBJA 4IZOA 5BV0A 1T8SA 1QPGA 2FPPA 4QU8A 5G0TA 5LZ4A 2XQGA 4D4HA 1L5HB 3W6OA 2CUTA 2GCOA 2G5PA 2R8OA 2O2ZA 4B40A 1XRQA 1SVOA 3GC6A 4FYMA 4YNBA 5G4KB 3VHLB 1KEVA 2VYND 1V43A 4WBNA 1R6XA 1R50A 3NT5A 1NVGA 1V1RA 4D41A 4N4AA 4W5WA 4YYEA 1J99A 2FLKA 2I3BA 1IZ9A 3VR5D 4XB6B 2IX9A 4PZLA 4ZI3A 3OZIA 4ZEXA 5CVJA 2EJTA 3M9WA 2HWKA 4QODA 2XF2A 5EHZA 4MNTA 4OX9Y 1AKWA 2AD1A 4PXSA 3F9RA 2O3TA 5EJIA 2PG3A 3WB1A 4BFVA 4AYTA 2H1IA 1U1FA 2ECPA 4XGIA 1XYGA 3OICA 2EATA 3GFOA 3W1EA 1OXXK 1P17A 4PAWA 5BORA 1NF8A 4BBJA 3TM4A 2VHTA 3CZRA 3G89A 3KS9A 3HKCB 4EPRA 5CXQA 3ET5A 3OQPA 4C5BA 3U40A 2FRDA 3V80A 1UOPA 1XHFA 3HXLA 3B3AA 3JZDA 4Q9DA 4OXRA 4UUPA 3X2EA 4GPTA 3U09A 4EF6A 1HA3A 4YGYA 2XCQA 3AIKA 3M9LA 1KXZA 4JFAA 3WJAA 4BHTA 1X8KA 2IP2A 2RK3A 1HKUA 1ZD1A 3PUXA 4QBTA 4NRDA 3WZ2A 3ZK7A 1BU5A 1V9LA 1GPH1 3CA8A 2HV9A 3LWNA 1AUOA 4PZYA 4CM9D 5BN1A 4WW0A 5BN3B 3A4LA 4A91A 3FOCA 1N25A 2HLDA 3KT6A 3FROA 5EQFA 3VPBA 1IY0A 2VHWA 2ZYUX 2QMUA 4C0KA 2V1UA 2EL9A 1KK3A 3N8IA 4D5EA 3CVXA 3K2IA 2O8BA 4AMYA 1O58A 3MWEB 5AJUA 3VH2A 2NXCA 3NHMA 4BQFA 4GPAA 3H5NA 3HMKA 2YHUA 4DJTA 5D1NA 3ZGLA 4Q7LA 4ND8B 3EGDB 5IKEA 1BVHA 2CVZA 5FL7D 1ZYUA 5IAJA 4RNDB 1TGYA 2AG1A 4FGZA 4I4CA 4MIKA 3RROA 4DIOA 4EA9A 3CPEA 1EWQA 4MS1A 2VDWA 4CMEC 2BFCA 2J9YB 2WSIA 3K5IA 5KJCA 3Q98A 3EFBA 1MW9X 2BKLA 2H2DA 3KD2A 3N0XA 4R7TA 4YJKA 3Q3CA 2XDYA 1KJ8A 5DI9A 1HFWA 3Q40A 3V97A 2VHVA 3WB0A 4YUXA 1ZVVA 4MO9A 2UUPA 4PQYA 1GVHA 5BMVB 1ZAKA 4OQ4A 3ADOA 3RC1A 4O4IF 3GVIA 3UXEA 1DC7A 1XZEA 3ND6A 2A9VA 2ALJA 1NP3A 1CRLA 2BSXA 3LQQA 4YLYA 2H2FA 2ZJOA 1XTRA 4CMHA 3ZGZA 3GJ3A 2WJZB 3HG7A 4MVJM 3ZCTA 4I9HA 4RQTA 2C5HA 2SICE 3CB2A 4YDHB 1HWYA 421PA 1JDSA 4HB3A 4PZAA 2GAAA 1TUBA 3EK2A 4JU8A 3T3DA 5J3JA 1T26A 1QKIA 1AG9A 2FPIB 3D43A 4OLJA 2AFIA 4Y1GA 4V0RA 4C7XA 1X3LA 2LW7A 1RAGA 4BB5A 2JIOA 2W6QA 3A58B 5K7SA 3SVTA 2H1OA 4IHQA 3RK0A 4PANA 3IRVA 5A5FA 3GQVA 3RAGA 2DFNA 1N3YA 4FBGA 3V6MA 2EIHA 3AY0A 2QLBA 4GP6A 3L6DA 4TVSA 1B16A 1EDDA 1WJGA 1YACA 2REBA 3R24A 4UD6A 5AESA 5HZHA 1YI1A 4Q1FA 1E5QA 4HPWA 1PWYE 2JZCA 1XLVA 2PT5A 1OD6A 4DARA 4MUIA 1TK9A 3C4VA 3TIXB 3UJDA 4ZICA 5JAPA 2QUZA 4L0CA 3OSZA 4AUNA 1CYDA 3INTA 1BO6A 3DEFA 1X7WA 4CHGA 1CG6A 1DTEA 1LBSA 4OSOA 4RQUA 4ZHQB 5JUWA 4GKKB 1XNQB 4X3OA 1P0FA 1QVZA 3OIDA 1BD3A 1K9SA 1ZXXA 1EKXA 4PTZA 4AYWA 3UAGA 2WVJA 4J16C 4FDAA 3G9ZA 5KMGA 1EXNA 4MO2A 5IC6A 4UCWA 5JISA 3IB3A 4UKDA 1PO7A 4F9GA 4TQ9A 3TE7A 1UADA 1ELOA 3D2CA 1DPGA 5JXJA 1GU7A 1CXZA 1Y5LA 3WDSA 4Z3OA 4URZR 1T9ZA 3E9YA 4X61A 3WMEA 4LWQA 3CIOA 2A57A 3LP8A 2FMIA 4BNTA 1Y80A 3R6DA 4JIGA 3MPUA 3HXTA 5AP9A 4C4TA 4N76A 1YZHA 4MROA 1YOVA 1WSAA 4LSZA 2YN0A 3FWNA 1II8A 2QV0A 1WPQA 1CZUA 2I80A 1EI9A 3E5MA 1JZSA 4H3SA 5CDUA 1W30A 2P2LA 3BT7A 3E61A 5AM2A 3THXA 2C42A 4E2YA 3QE4A 2QPTA 3QJYA 4CG3A 4TKVA 2FWRA 3JQBA 1Z28A 3VBCA 3RSFA 1CRQA 3UJ3X 3ZWOA 5KDOA 3UFXA 4EHKA 1P2SA 2CVQA 2VDUE 4LHVA 2ZYAA 2WJHA 1E2NA 3NBKA 1TAQA 5KYWB 3A4NA 1Z5WA 2V9CA 2VDVE 1HFKA 1W29A 5A5EA 3D0OA 3QPWA 5IM5A 3BJEA 1JBQA 3S6JA 2XUKA 2GDZA 1AZLA 5CPFA 2BI4A 3FNRA 5F35A 2GTIA 4RYLA 4RLQA 1PJQA 1YBVA 4MR9B 3A2LA 1W8IA 4RYDA 2W2NA 4XUEA 1PEYA 2MYUA 5CIQA 4QRIA 1EIWA 2XY4A 3R41A 3T5BA 4MITA 4LRYA 2PWPA 2OC9A 3PLAE 4FSXA 2V7QD 4NCBA 3AHFA 1N2EA 3DBLB 1XELA 2HX1A 3GJYA 3KSDO 5LC1A 2OV6A 1SVWA 4QT4A 5ELXA 1WTAA 4FHGA 4BNWA 3KZ1E 4EYKA 3ZKWB 3OTGA 1P7PA 1AQNA 3LUGA 1QHHB 4HNGA 1WBDA 2IYSA 2XE7A 4Y2YA 3NH9A 3DZGA 3R6GA 4ZV7A 3TR5A 2Z9BA 3LHFA 4HWKA 1BQ3A 4NS4A 1BG6A 1BXGA 2CJPA 5ESXA 2J1LA 4RVOA 5EWMA 3EXIA 5CH5A 5M3BA 1PV1A 4R83A 1H22A 4JHLA 1LJUA 3L8ZA 5JPCA 4MJ3A 2X15A 4G5HA 1YAJA 3WQBA 3I5UA 4J2OA 1WXEA 4U2KA 1ZM2A 1PR4A 1XQVA 4XIIA 1E3JA 4KJZA 2I6TA 3SYMA 3G2IA 4PSKA 2COKA 1DG3A 1LRJA 3RASA 2B98A 3WGVA 4OKIA 1L7NA 2HSGA 1S6YA 3MJSA 5I01A 3ZU4A 2IUYA 2Q1UA 2GPYA 3C1AA 3AUTA 3OT4A 5IG2A 4LMRA 4I4NA 4BFWA 1MQ9A 5SZJA 3ZNNA 4TYYA 4MRNA 3BHIA 1E7RA 1M7HA 3G0IA 1JS1X 1O0BA 4PLWA 4EYOA 1EDZA 4RHEA 2J9FA 4FI3C 2WTBA 3HRKA 2BEWB 4IVNA 3GY0A 2VPZA 1W6UA 3L79A 4IDCA 1M5TA 1ONSA 1Y1LA 2DCUA 2R1ZA 2YBEA 3KJEA 3Q6NA 4HAUA 1GXSB 4CIYA 1NJ2A 1KI6B 4QBFA 1H3EA 1MT3A 1Y4AE 3DMGA 4BVLA 4CM4B 3FTFA 3W2IA 5KSYA 1N1DA 1T9GS 4FYJA 3ZU5A 1A7JA 2B8EA 4DA6A 1N6KA 2JGIA 4JA2A 4RMIA 1FW6A 2NO5A 1JHVA 1SUEA 2FH5B 1M76A 1Y63A 1IN5A 2G83A 4EHAA 1GOTA 1LNQA 4EX7A 1L7EA 4PTLA 1NRIA 2HIAA 4KBYA 4P5PA 1UC8A 3NTVA 1RHMA 4H7DA 3V7NA 1G17A 1E63A 1ZY2A 3BMCA 1CFZA 3D6HA 4IDFA 3FRIA 5C18A 4HBZA 4UHKA 3G2LA 1V4NA 4TVOA 4ZT2A 1N32B 1SIBE 2ADMA 2WIAA 3BDVA 4TUYF 4BNNA 4O2AF 1MKYA 3R5FA 3WQRA 1Y1RA 1G9XA 4PHFA 4Y2VA 3B2EA 5JS2A 1H0RA 3VNSA 2ZJ8A 5CFOA 1T5IA 2G5GX 1DKLA 4MVXA 4RHFA 4D0RA 3MGGA 1CUIA 3O7MA 4XJTA 1T6YA 5K0NA 2L19A 4R81A 4RZQA 1JDZA 3H4TA 1Z2PX 5DASA 1N3IA 1H9CA 3NBQA 5K01A 5LQCA 3TQHA 2Q2QA 1P4HA 3N87A 3PQCA 1Z4JA 1KI7A 1JR3D 2PIAA 3WMXA 4CYMA 4BO9A 3Q3EA 3UENA 4NIMA 1V96A 1Q7GA 2CKDA 2NZYA 4DJ5X 3FKQA 2R8EA 2OXIA 1FRNA 1S8OA 2DPMA 4MYTA 5IJWA 1JWAB 2CUKA 5MGBA 2HY7A 3CJQA 4KPUA 4LY3A 5LCXA 5K8VA 3MJCA 1U90A 1MOQA 2H1SA 2V4ZA 3D8HA 5HK8A 5BUZA 5IWCA 2QWXA 4Z9AA 3TW8B 3A4VA 3F7OA 3KG2A 1VHDA 1NVWQ 4QUKA 5K2OA 1US8B 1P2VA 3IV6A 4IEEA 3LYAA 5A0TA 1OKKA 8OHMA 3PPVA 2WY2D 2VSXA 4ZVPA 3DONA 2CVHA 4D8YA 1U4NA 1AIPA 1X6VA 4TLEA 3M6WA 4ZQIA 4B2PA 3Q8WA 3KXKA 1IN8A 2R00C 1MU0A 3B2NA 2YS6A 3QEOA 5KI6A 2DKOA 1N8SA 1ZK4A 2G8NA 1YE5A 4LDZA 5CEEA 3UAWA 4X1YB 1EX7A 1Y6QA 1EFPA 2PBZA 4N03A 1L5VA 3GPCA 4QO8A 4WK4B 2PMEA 5FDFA 1I4LD 1HE4A 1RAAA 3EG5A 3TIGA 2RMKA 2WWFA 3NDRA 4Q3KA 1TVCA 5A6VA 1W2GA 3UC5A 2PL1A 3C3MA 2GR9A 1M0TA 2ZS8A 3NHAA 1U1EA 3AR8A 2MSCB 1KYZA 2NZUG 1EWVA 5TPWA 1OH8A 1ML3A 5CCBA 3EZYA 4LZWA 4X44A 4XWGA 3RU3A 3ZOZA 4PF1A 1KPIA 1RM5A 2X86A 3ONVA 1JMVA 1R74A 2BHSA 3L6RA 1E96A 1MAWA 1WDLA 3OJLA 1J21A 2YHIB 5A9SB 1N6PA 4DLSA 1AURA 1QHIA 3UH1A 2O5CA 4GYWA 5JAQA 3CTPA 1G41A 1TQ2A 1O96A 3E9DA 2Q07A 3T4PA 4OQZA 5BSEA 4I6GA 3OO0A 1PSWA 3L9XA 5EN4A 2O4UX 1YDHA 2R6DA 2RI0A 4QU5A 3I64A 4TL8A 4DLNA 1LF5A 3MLBA 3WWCA 2YUIA 4I50A 3NVKI 1A69A 1C41A 2QL6A 3TLGB 1X87A 3IDFA 1D2GA 1ZQ9A 4A4DA 2D5BA 4BQIA 2B37A 2C2WA 3FYUB 1W35A 2UZ1B 1MAUA 3FX2A 1V41E 1ND6A 2PGOA 3CCBA 5KTKA 3HXMA 2OSBA 4OQYA 4Q4AA 4XPIB 1Y7TA 1A76A 1PL6A 2AMYA 2C7VA 4CCAA 3HQ4O 3X2SA 1F14A 1RHUA 1Y9JA 2BE7A 1KERA 1PZFA 3SQXA 3D7KA 2CE2X 4G67A 3W78A 1BC5A 5HQJA 3ROEA 1UXOA 3K9QO 1BWQA 1MA0A 1D5WA 1TGVA 1TM5E 1O5OA 4MUAA 2YXDA 3FKSD 4DG8A 2VTEA 3HLYA 2P0EA 2ZZKA 5FOQA 4IG4A 2VUSA 13PKA 4IRMA 2J30A 3B51X 3T7EA 2BGLA 4XYEA 4HT3B 2QP9X 4NE2A 5AKLA 4P58A 3A6ZA 2IZZA 1MRNA 1ZVJA 3K3PA 1GD1O 1WW2A 4BO5A 3H8VA 3QGMA 4OXKA 3ADKA 5E1OA 3UM9A 1A8QA 5LLSA 3EZGA 3VNUA 4KUHA 1M6HA 3PFNA 1WHSA 3NRBA 4RH3A 3ZV6A 3MGCA 4E94A 2GWHA 1OC2A 3N3AC 1COWA 5ERXA 1WNTA 2PQ2A 4BNVA 1NSYA 5KKAA 4ZYZA 4JKYA 2FX3A 4O4JF 3JRWA 3PDIB 2FN3A 5L6LB 2E5LB 2IV3A 3ZD8A 1JP7A 3G1TA 4DDHA 3HBNA 3KD3A 1MB3A 4I4TA 2CLDX 4MB0A 4MPTA 3GLFE 4OMFG 4X1KA 2BUAA 2FKNA 5IT4A 3BAZA 1BH6A 3GR6A 1ZGAA 3IDOA 4P7BA 2QI9C 3X1MA 5LP1A 4LV8B 1E1RA 1NI4B 2D3WA 2Z9DA 1H3FA 2ZRBA 3N6VA 3Q6MA 4U3JA 5F7JA 3GLFA 3E70C 4G4GA 4BGVA 1ZXLA 2OE2A 1K66A 2QXTA 2H00A 5E2AA 5KVQA 1Z5GA 4WTOA 2B8TA 3G2KA 2W2OA 3ABZA 3DAOA 4JL8A 1GU1A 3L43A 1A9XB 3FPKA 4JITA 5J23A 3IAHA 1F2VA 1F6WA 3HLTA 3QPUA 1BCRA 4Y1EA 1OPXA 3UHAA 1L1EA 5HQTA 1QG2A 1U2RA 1WTCA 1RWNA 2H31A 2ONZA 2XKJE 2I71A 3OJXA 3FDXA 3QX8A 4Q37A 1LRKA 4GKAA 1D5CA 4WEQA 3S7ZA 4F4JA 5GVSA 3A25A 4YDQA 2VHUA 1PJAA 3HP4A 2XT6A 4IXDA 3DT9A 2ORWA 3LWZA 3DDOA 4UNIA 3TCKA 4OHKA 1G64A 2OQVA 4OI1A 1BHJA 2MINA 3D8TA 2B1JA 5ALTA 4M7WA 5CM9C 5A4MS 1SK8A 5L4NA 1NQTA 2X5JO 4XRRA 1E20A 1RE0A 3LO8A 1G18A 1ZM4A 1R0BA 1ZMBA 2FZKA 1NDHA 1PSZA 3MTDA 4GPIB 4C03A 4LFAB 5KNCD 2CD9A 3OKFA 4BO6A 2IS6A 3MCVA 5EINA 1CS4C 5BR7A 2RH4A 3OM1A 5KKNB 1W88B 1DB3A 3IULA 2CL0X 2RHBA 3JTEA 2VP0A 1HL3A 2C5EA 2D0IA 1JVNA 1NNUA 3WK4A 4B34A 5IAOA 1EXVA 5KBYA 4NYJQ 2GB4A 5AXDA 4CODB 1MUUA 4ED9A 2POQX 4QG3A 3A2KA 1SUIA 4D4GA 1ORDA 4X7PA 2P2GA 1Y33E 2YZMA 2P4EA 3K5WA 1QH8B 4LX8A 3NDIA 2NU8B 5LYJB 1GKLA 1EEXB 2X9QA 1IMOA 1T0HB 3TH5A 4F6LA 5AJYA 1ZD8A 1PLLA 1LI4A 1A9QA 1U2DC 1AHNA 1Y3FE 2ZUUA 1MPTA 3DMYA 4H60A 4OGWA 4RTMA 2YOFA 1UEJA 2OL4A 3FMGA 1NBWB 1VBNA 1XK6A 4KLCA 3RT7A 5HE8A 3OAAD 1WUHS 3E3OA 4WA8A 4EKGA 2YJ5A 4OH7A 5ADVA 2PJUA 2E21A 3S2YA 3K9CA 5TT0A 3IT1A 1Q74A 1R6AA 3CINA 3R0ZA 4XEHA 1PX0A 3E7XA 2QAIA 3IQFA 1ZD2P 4BMSA 5FPYA 3SIPA 4MV1A 2CV0A 5AKJA 1KMMA 2C4WA 4DJFC 1YS1X 5JYDA 2AG0A 3WLLA 3AXTA 2R0QC 2WVGA 3PEUA 2VDNB 2BHNA 4HLQB 4TMTA 3V9PA 2G1KA 3WRYC 5C5EA 3THYA 1E9SA 1IRIA 3N7TA 4GOND 2PMKA 1F2UB 3QYJA 2FWPA 2LDXA 2C4UA 3I3OA 5I7SA 2XPCA 1H69A 5KX5B 1NPTO 2QNIA 3KFLA 3BJMA 4OO3A 1VMDA 4G09A 5KTNA 4EI2A 2QP4A 1DXQA 3FVRA 2X0EA 2K2QB 4F04A 2Q5FA 1A9PA 3AUJB 4IJWA 5LJLA 2YYZA 3COJA 2I6FA 1KZYC 3DUWA 2G28A 1QH1B 2Z2YA 3H04A 2LP4Y 3TL2A 4V0LA 4I5GA 2HF2A 1NXVA 1G1MA 1Z9BA 3EC2A 3KSBC 4DIEA 2VSFA 3LUAA 1JJIA 2WFLB 2ZE6A 1JDTA 3E7FA 4IZHA 4DGSA 3NHKA 1SBHA 1CQJB 1P62B 1YJ8A 2W58A 3PT9A 4IWXA 4J76A 1U3UA 2H1VA 2RIRA 1V45E 5A7GA 4HDSA 2FPOA 4C2AA 3I9NA 4C0AC 1J1UA 4A2QA 2BE9A 5HM8A 2WE7A 4IG9A 3MJEA 5CUQA 4FEYA 2I6XA 2IYXA 2IDZA 4RE6A 4S1NA 1EX6A 1A96A 1VG1A 1BXZA 3HJAA 2Z30A 1GRCA 4M98A 4BWYA 4TMXA 1GN9A 2QM3A 1B8PA 4X7BA 1AMNA 1KFKB 3ZY4A 1RRPA 1X1RA 4XYBA 4ZALA 1MNAA 3CLRC 3HU2A 3LLMA 2YMPA 2Y0EA 3PPWA 3VO1A 1F5SA 4DMFA 1VKZA 3QE3A 1DAFA 1JDPA 4NVRA 4Q0MA 4TMYA 1LPMA 3ULKA 4GFDA 3E18A 4RY9A 4BB9A 3QY0A 5K3OA 4O4LA 1UAAA 5E4TA 4B4DA 1IY8A 3HJBA 2NYVA 4GSLA 3SNHA 4L4XA 2F8SA 3EEFA 3DT6A 2ZWIA 1GL9B 1Q3KA 3EXG2 1IONA 3BB3A 3EVEA 3LIPA 2JFWA 1HV8A 2NSYA 2XVZA 3IIMA 3IQDB 3KLPX 3KXDA 3PT5A 1GPWB 4PGMA 4UVGA 4Y6PA 1KMCA 4KBFA 4P4NA 2JFPA 4BYMA 3ZI4A 1I2ZA 1SHUX 2WPDD 4M86A 3FW1A 1C3LA 3K94A 2YICA 1H5UA 3CR7A 5FO1A 2K2WA 3ETNA 2Q3LA 2GZ2A 2QT0A 1TCBA 2FUG6 5DYWA 3QEKA 4ZIRA 2Q6LA 3Q5GA 2C2MA 2QL9A 2ZUSA 1CJMA 4YRKA 4ZDKA 4NE7A 4R3UC 7ABPA 4Z5XA 3HFRA 1PZGA 4R51A 1JBEA 2OD2A 3GEDA 1YD7A 5EE9A 5F1YA 3TGLA 1IHUA 1IJKA 3DEYX 5DM70 3EG9A 4WZZA 3ER6A 1G21B 3NBYC 2P69A 1MXHA 3K2BA 5FLKA 2E6KA 1ZK0A 4OBEA 4QOSA 2C5FA 2CL6X 5T64A 2NTJA 2XUIA 5TNXA 3FWKA 4EGFA 1CYEA 4M9RA 2W11A 3MTGA 2C2ZA 3HL0A 3R9IA 4JLPA 1OLSA 1BJTA 2JFGA 3KPWA 4WOCA 2F3RA 5EKXA 3R44A 5SICE 3R7FA 2A5FA 4IDEA 1QS0A 1ICEA 2WYOA 4YJ2B 4ACBA 2N42A 1QK5A 4HR7A 2VT3A 5CH3A 1N5DA 4QGFA 1E1QA 3JAKB 2UYOA 4HDMB 2AI1A 4D0SA 2GN4A 3LFUA 2B7LA 1N5OX 5CNJA 4TYPA 2Z2JA 1QIMA 2ZXFA 3EA5A 1E62A 2B2XA 2VEOA 4LK3A 4NX2A 5EMKA 4KXUA 3AL3A 4MWOA 3ZJVA 2QU8A 3A6GA 3BAFA 1FJGB 4AWXA 4D9KA 1IN6A 3BILA 5DBIA 1G59A 5BW6B 3LCRA 1OJLA 2Q4OA 1W85B 3H84A 5JJIA 3KDSE 1C80A 3P0HA 4NLLA 1U2SA 2H5IA 3PXCX 1NXXA 3VDQA 4PO9A 3X1ZA 1A5SB 2Z2ZA 1Z06A 5DBHX 1SOUA 3HZOA 4YA6A 3G8AA 3BGSA 2IUUA 1E0KA 1P0QA 1NKVA 2VYFA 5K45A 1KYTA 2X7JA 1FNDA 4AJ9A 4UHHA 4RKWA 1QF9A 1JIJA 2YY7A 4Q4HB 1ENZA 2A5JA 4ZTUB 4LDQA 1SCIA 3HB1A 1LKZA 2E9SA 4TV9F 3D6JA 5DN9A 2H7VA 1E1LA 1IH8A 1MQSA 4G0QA 2A0FA 4AP9A 2J3EA 5BNIA 1AO0A 1YDWA 2DB3A 4LS3A 4FE7A 2AJTA 3ODGA 4RF4A 4TM8A 4BZXA 1L4HA 1QLWA 4FCCA 5I9SA 4DR2B 4KR3A 1N1GA 1T9HA 5A71A 3R3YA 1CULC 3QI2A 4GUAA 4ES6A 5I7OA 1GEGA 1H2RS 3LKVA 4IHKA 1XTZA 1CZRA 1VDZA 5B55A 3EZFA 1WABA 1OAKA 2AJLI 1ZDMA 3G6WA 1PUIA 2RGNC 3LQKA 4WDRA 2EBWA 4LAFA 3SQMA 1CJBA 1CJSA 4BAGA 3KE9A 3GCWA 4E13A 4Q18A 5IAEA 4DEXA 4K2AA 5KAMA 1YVDA 5JDIA 4ROSA 5B57C 2G4CA 3ED1A 1ZZGA 1BU8A 1XD8A 3H99A 5KTSA 1B8VA 5A2GA 2FG6C 4PLFA 5CEJA 4HQNA 4J91A 1KRWA 2J9GA 3R7WA 3M6MD 3FHCB 2IVZA 4GOKA 1LLUA 1Z4LA 2AXQA 3CN9A 4KIGA 5IBQA 2IHBA 1P5JA 4BN0A 4MQLA 2YH2A 4AUEA 1XEXA 3LMKA 1M6WA 2IUFA 4K26A 4PRZA 3H8WA 4ZVRA 3R6WA 4F4DA 1NC3A 1H2HA 4HLUC 2P91A 2YZ7A 5KYGA 1MJ5A 4NBTA 7MDHA 2HJWA 5CYOA 3MG9A 1YBFA 3H2KA 3ZD9A 3LX4A 1OYWA 3L82B 3JAMA 2GA9A 4I5DA 3EDYA 3KXLA 3H8JA 1WMEA 3PZBA 3T7AA 4ZTZB 1JFLA 1PZXA 1OWOA 2F8TA 1TEHA 3RVLA 3R9XB 1WS6A 1A8HA 3ZX4A 5K8CA 2GRJA 3S1SA 3VYRB 4GZMA 3MXTA 1Z74A 1E66A 4JBWA 4RD2A 4RNCA 3SF0A 2F4VB 3SM9A 5EL0A 3ESCA 3FIJA 4B6JA 2HNAA 2AR7A 3G9UA 1J22A 1FUYB 5DCWA 4S3MA 4BLWA 3T1VA 3ZCSA 3L7OA 5KTOA 1XAHA 2DECA 2RG7A 3N8GA 4KFTA 4DDTA 5IKXA 2B1IA 4Y98A 2RJ3A 2PBFA 5FWAA 2HNKA 1QB7A 3RU2A 4WCVA 2Y1FA 3CLRD 1XU9A 2X13A 3L1VA 2VTBB 1V0JA 2AC4A 4P0TA 1Q1EA 4BLOA 3L7KA 2X5XA 4C7KA 3W8DA 4WOBA 1W8DA 2CNLA 5T8KA 4ZV9A 1SAYA 4JI2B 3SHVA 2W70A 3U9SA 4CKBA 1UFOA 1A2BA 1IBSA 1PNVA 1YMUA 3AHGA 3AI2A 1OI3A 4FC6A 1E8DA 1T4GA 5EWJB 1QAOA 2IP1A 4MS3A 4QPPA 4JT4A 5EIBC 4GQAA 3RSGA 1P33A 1WKCA 3M6LA 3WSWA 5KOJB 1KDPA 2H85A 3DMHA 4RVDA 5HX7A 1ZC4A 3MRTA 4XR4A 3UOWA 3ZZUA 4MQ5A 1QGZA 4DR7B 5DGTA 3L05A 2VHYA 2PKXA 5DLDA 5HNKA 3CLTD 3QOFA 4PU0A 2XECA 1CE8B 1KU0A 3TWOA 1D0SA 5CA0F 3RRXA 3WYCA 3A1EA 2V0GA 2Q1SA 3C3DA 4M88A 2XR1A 1NX9A 3HBAA 5EQJB 1NKSA 1V7QA 5FPHA 1IOZA 2QIPA 3COSA 5DX0A 1CR2A 4XYLA 3PITA 1VJGA 2AWOA 2FFQA 3CH4B 4KLZA 4KXFB 4Q6WA 4R8LA 4BVGA 3S8YA 3DLPX 2HA7A 2FVYA 4TRMA 4MLCA 3BWCA 1E4OA 4M4SA 1ISJA 4AN1A 1XTBA 4X7RA 3VKHA 1FLDA 2P2NA 4PLHA 1FXSA 3DE5X 1ECBA 4GWGA 2AFHA 1XFDA 4IDGA 5HFJA 1XZDA 4JUDX 1C30A 3AV0B 3PFIA 4R8KA 1YK1A 3JQ6A 3KHUA 4Z0PA 3PFCA 1IHOA 5FH9A 2O19A 2FW1A 3EEIA 1P80A 3IVAA 4TMVA 2BJHA 3AXSA 4U0KA 1BVYF 1KAEA 4XLTA 4XSGA 1CUDA 3ITNA 3VPFA 4Q6BA 4E4YA 3QKRA 4F1KA 2R4QA 2WLSA 4J1TA 2FPKA 1KYWA 2QLTA 3FUUA 2B4KA 3KAKA 3LPLA 4ME6A 2Y1KA 2JHFA 1X39A 1ADYA 2X0JA 4PM4A 3IE0A 4JXKA 4TKLA 1RR6A 4TWAA 3WIBA 3JD1A 4OJNA 3TX6A 3OCCA 4Y2XA 3WLMA 4LF8B 3C5VA 3CWCA 2BFBA 1W76A 1L7XA 3CLSD 2G04A 1GEEA 3CZ4A 1V9SA 4MQEA 5BNFA 4AC9A 2I1LA 3AM4A 5D00A 4V1CB 1WP9A 3BXHA 2R3SA 1XEWX 3EW7A 2AN9A 4FYWA 4TV8F 2RKBA 3NCHA 4KK3A 1IWBB 1ODKA 4H1TA 4BY9E 1Y8CA 3T99A 4Q1CA 2YN4A 4NY1A 2B21A 3I32A 4OP2A 3WYGA 1CR6A 2FCRA 5IJZA 4G1BA 4Q3DA 4EGQA 1UXHA 3M81A 3RTBA 2QB5A 4UU7A 2QMQA 4ALJA 1VGRA 1YRBA 2LCFA 4BMXA 3MFQA 4K8RB 4JVMA 4JODA 2ZTLA 2JGLA 1GCOA 2V7VA 3TEFA 5HS4A 2XQVA 3KXPA 1CLEA 2PU5A 4EUFA 1O03A 2VL7A 3PC3A 4QSMA 2MCFA 2X9LA 2XLCA 1IM5A 4QX6A 2R8YA 4DLYA 1ZH2A 2WIFA 4KQXA 3BD9A 3NM4A 3TQQA 1KF0A 1V8OA 5ELMA 4XVQA 5DTMA 5IJ0B 1Z4MA 1ZESA 4XSVA 2MWMA 4NENA 4DWJA 1VECA 2GM4A 4WECA 5AI6A 3GP3A 4TXHA 2YFKA 1P9WA 2RDMA 3IKVA 2QY9A 1IPFA 2C7BA 3G88A 1X92A 1GQRA 2QX4A 5JO9A 4KN6A 5CX1A 3N2KA 1VL0A 1KNQA 1I4OA 4GW3A 5FBVB 1LQ2A 5BUQA 1TQ4A 4S2UA 2A7XA 5ALEA 1D4OA 1XVUA 1ZJJA 3I6IA 4KYVA 1ZITA 1TU4A 3ZHYA 1NAIA 2GKSA 3D7SA 3LC1O 1DAEA 1JKIA 2Z1NA 4QQKA 1H1LB 2O5EA 2G9QA 5F1PA 3USCS 4C88A 1NN3A 4P54A 1SULA 4KQ2A 3NAMA 4RCYA 2FPSA 5LBUA 4D74A 4LF6B 2XWSA 1J06A 1CFJA 2AMVA 2IODA 5JFTA 2GCPA 2RB4A 5D85A 1YDGA 1NW4A 1NT4A 2PZ8A 1OLOA 1A2KC 3MTJA 1W2WB 3LO5A 1NHWA 3GX1A 1HKHA 2AOTB 1DAIA 3HJUA 3OQ6A 3RHZA 4B7UA 5A1TA 1Y9EA 4J2HA 5K20A 2VOJA 1M8FA 4BRUA 1GVNB 2HHCA 2FTKE 3DE7X 4DV1B 2BMJA 4WK0B 2JGAA 3W2TA 3ZDBA 5EZQA 2XVXA 3FF4A 4FGJA 3GFPA 1DHTA 2QJTA 1U2GC 3GBVA 3U3XA 4OFWA 5DM2A 1TKRA 4CFSA 1O6BA 4A26A 1RMQA 4TGLA 1P45A 2PMCA 1XMXA 2O2GA 3VDNB 2JFXA 1L4BA 2BM9A 3KC2A 2XNJA 4L5IA 4OJQA 1Q6ZA 3EGEA 1NNLA 4XD7D 3T3IA 3VSDA 3ZIAD 5BXQC 1GUFA 4FC7A 2VP2A 1KS9A 2ZITA 3M7IA 1IZ7A 3O8CA 2R1TA 1KJ9A 1JG4A 4LDAA 4BEBA 2AEMA 3ZVKA 4JZYA 5CDSA 3IUMA 5BUCA 4BP1A 4QWWA 4OATA 4FYIA 3OEHA 1YJXA 1HDRA 1XLTC 4A8JA 4D25A 4O4IB 3M70A 1CB0A 2FSUA 4C6TA 3O75A 1LVUA 1VJ1A 1HLDA 2YWBA 4NQRA 1D9ZA 3HA3A 3WYDA 4POOA 4ENQA 2E3JA 4KAFA 1GAWA 2FK8A 4A8HA 4Q03A 3OC0A 1VE7A 4RV9A 4Y7CA 1D2CA 1ZH8A 3MBIA 4DLLA 4TQAA 1D0IA 4CKCB 3RG8A 5EKDA 3IOEA 4S1PA 5KWIA 5DBFA 5FNVF 4A0QA 2YWJA 3QTBA 2O6HA 2QTWB 3TM5A 5I45A 4D79A 2W2MA 4UTNA 1W5EA 4L07A 4Q4DA 4RQBA 3CR3C 3KKEA 1R6DA 4TTSA 1DTSA 3R0VA 4L5CA 4FOOA 5HW0A 6REQA 1X1QA 5ED0A 4D6XA 1LBQA 2JB9A 4LJSA 2OD9A 3OM0A 1FYEA 4G84A 4OYLA 1P7CA 2VJDA 3DSRA 3PTAA 5K8JB 1LDEA 3I92A 2CLMB 2BF4A 1DQNA 3C39A 3E03A 3FVVA 4U02A 3UMYA 3TRJA 2WV9A 3OOWA 5DDIP 5FWXA 3GLUA 5IDVA 3MQFA 1E5VA 3SHFA 1NGSA 3AR4A 1IXYA 2VUHB 3UMBA 3H2JA 2AKAB 1JEYB 1E2IA 1J6UA 5LZ5A 1D3AA 2FRDC 3LF1A 1LWOA 3PS9A 5FJIA 3ZWYA 2KPOA 1AQLA 5GZ6A 1TT5A 4MPPA 1IRXA 5IANA 1O95D 4DUGA 1ZHHA 2P90A 2GFQA 1KA9H 3IQIX 3ZWQA 1Y5MA 5IF9A 5HF9A 5CXSA 2JCSA 2AQHA 3QPAA 3QWBA 1EGQA 1S3FA 2GHQA 3KEQA 1JEJA 1IDOA 1Q5PA 1TE2A 3QLEA 4P53A 2X0NA 5ARDA 3VR6A 2KS6A 2EGHA 3UW1A 3KJHA 2QUKA 1CUJA 2ATCA 1BNCA 1C3OB 1I32A 2XYQA 4KRYA 4UDXX 4BQOA 1GNTA 2VXOA 1ZRHA 3ELWA 4PQRA 2V6MA 3KJQA 1YASA 1NE7A 4OFZA 2FPGB 4R2HA 1PS0A 2HL6A 3ETGA 4R0MA 1QB8A 2WZQA 5BNZA 3O83A 3NO4A 3F6SA 4RY0A 4UUAA 4C6RA 2ID4A 1X70A 2WPNA 3BZBA 3F5SA 4V39A 4XUCA 1B2RA 1MIHA 3TEMA 1LC3A 4RF5A 3ZE9A 2BPOA 1IXZA 1W48A 3AZQA 3HZZA 5E9AA 3U7EB 2YRFA 3IVRA 3NM5A 4UJ5A 4UNRA 3IKLA 4WJLA 4D9JA 2VH2A 1SUWA 3EGVA 4EY8A 1E79A 3ROZA 4D0GA 1ML4A 2P1DA 3GRPA 3RRJA 3WK8A 3PV0A 5I4KA 2GD6A 5GV8A 1D2RA 3RSZA 1U2PA 1X1SA 3AQIA 4HFNA 4HMQA 3DOJA 4RPJA 2Y0PA 3GCDA 4DIKA 1QK4A 2QRGA 1E3DA 1EEHA 1G9TA 1OA1A 2DFVA 3RYHA 2H4ZA 4RETA 3G02A 4LQ4A 1E1CB 4J0QA 2CB9A 2DAPA 4EQ6B 4FW8A 3RSSA 1E4VA 4DV5B 2X4IA 5J2UF 1P44A 2XCRB 4TPKA 1YQQA 3QITA 2PM8A 2WHPA 2JHCA 2DLCX 1MC4A 4ALIA 2X5NA 3WZMA 5HM6A 4J3NA 3G2JA 2FSVA 3IT0A 1DIOB 2JVKA 1C14A 1WUIS 2GN0A 3EZXA 3U3ZA 1LEHA 1RWVA 3ZR4B 1WY7A 3RFUA 2JGRA 3IIEA 1CUSA 3GARA 2RGXA 3GLKA 3GLTA 2IKQA 2OHVA 3NETA 4IX9A 4PXYA 4L5JA 1E6MA 3ZLUA 3QU7A 3GK3A 3N2LA 3I2YX 4G5RA 4O2BF 4EB6A 4EVIA 1NVMB 1R4NB 1G20B 3H1BA 4RZSA 4JGBA 3VPAA 4NXNB 4X24A 3EVZA 4PTYA 5GP1A 5KNDD 5F5NA 2PV0A 2AUNA 2Y2VA 2NU9B 4DYVA 2PRYA 3NGLA 4JJIA 1FRVA 4LFCB 3UOAB 4BMNA 3KJGA 3WYNA 1N8NA 3B1YA 1RLTA 2Z1MA 1GHTA 1W4RA 1PZNA 4LPSA 4MYDA 2C9BA 1J8DA 2ZJ7A 2C1EA 1U4OA 4U5XA 1DJMA 5FA6A 5LZ2A 1RYMA 1J7KA 2D1FA 3LRPA 1LW6E 5T6BA 2IUEA 4Q7JB 4NZ9A 1A0OA 1SM4A 4PS0A 2PKWA 1B15A 5DISB 4BNDA 1AGXA 1YRQA 4ZU3A 4M1KA 4RSRA 3LC7O 5D3ZA 9MHTA 3OEYA 1G7RA 1C9JA 1P7VA 1Q92A 4QGAA 3VM6A 1L5MA 3I83A 3P9IA 1RVV1 3GV0A 3WL4A 4ZJYA 1H65A 1QJCA 4Y2HA 3QVUA 2ZQZA 4WGGA 1QPBA 1PDVA 4HB4A 1XPOA 2CDAA 4HNSA 2BELA 1RYZA 1XRRA 3P9YA 4H3KB 3P19A 4OY3A 3WK5A 4JV5B 3PCTA 2H3EA 3BDAA 3W2EA 1LLDA 2GHRA 4AZSA 2F8MA 1HBJA 3AC0A 1CP2A 4ADSG 3MS2A 3ESBA 2BSAA 2DXIA 4A3SA 3JZFA 4EG0A 3TW0A 4X6LA 2GHTA 2JZNA 3A3NA 3CZQA 3JQBC 3OFVA 3QUCA 3VV3A 3C8HA 3M8KA 5IYZF 1GM5A 3GJRA 3JQ9A 1XHLA 1D1TA 3N86A 5IXSA 3CT6A 5AOBA 5D7NA 4DLBA 5KYXA 4ND3A 3WMWA 4D1YA 2GA8A 3F5MA 4EH1A 3R3JA 2R96A 1U2EA 4CM8A 1OZAA 4TUYB 3MAGA 3PBKA 1MW8X 1L8LA