2HFJA

Pikromycin thioesterase with covalent pentaketide affinity label
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
284
structure length
279
Chain Sequence
b'AGMFRALFRQAVEDDRYGEFLDVLAEASAFRPQFASPEACSERLDPVLLAGGPTDEGRAVLVGCTGTAANGGPHEFLRLSTSFQEERDFLAVPLPGYGTGGTALLPADLDTALDAQARAILRAAGDAPVVLLGHSGGALLAHELAFRLERAHGAPPAGIVLVDPYPPGHQEPIEVWSRQLGEGLFAGELEPMSDARLLAMGRYARFLAGPRPGRSSAPVLLVRASEPLGDWQEERGDWRAHWDLPHTVADVPGDHFTMMRDHAPAVAEAVLSWLDAIEG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Type I polyketide synthase PikAIV
publication title Structural Basis for Macrolactonization by the Pikromycin Thioesterase
pubmed doi rcsb
source organism Streptomyces venezuelae
molecule tags Hydrolase
total genus 98
structure length 279
sequence length 284
chains with identical sequence B
ec nomenclature ec 2.3.1.239: 10-deoxymethynolide syntase.
pdb deposition date 2006-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00975 Thioesterase Thioesterase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2hfjA00
3WYDA 2VATA 5D3KA 4ZGBA 1XZAA 3R3VA 2B9VA 2HIHA 1H2ZA 5AKLA 1U8EA 5KWIA 4QWWA 4BBZA 1XZFA 5CBKA 1WM1A 1ZJ4A 1JI3A 4Q05A 1XZGA 4W9RA 3EBLA 4G8CA 5AP9A 5CH3A 2RIPA 1XZLA 3FBWA 5LLSA 2B20A 3AIKA 1S8OA 4C88A 3SWWA 1X2BA 3D0KA 5JASA 3V1LA 2WM2A 2GYUA 3WLAA 1UKBA 4Q34A 5JAPA 1RYYA 3QM1A 3CCBA 1ZOIA 5DYYA 4H18A 4DMKA 2YYSA 4BZWA 1YAHA 3WK8A 3W06A 3OM8A 5FPPA 1MJ5A 3G9UA 3TRDA 4TVKA 1R9MA 2QRUA 2VAVA 2WJ3A 3R41A 4KJXA 3KWFA 1SCKA 5JYCA 2Y6UA 2GZRA 1R9NA 2JGMA 3QMVA 3FYUA 1FFEA 5AM0A 1CUBA 1R3DA 4DTCA 7YASA 1CUHA 4XX1A 4IQ4A 1ZD5A 4Q3LA 3L1IA 3IDAA 1UFOA 2WU3A 3V1KA 1AUOA 3ZI7A 1ZGBA 1XQXA 3WJ1A 4XIIA 3F96A 4B80A 3B12A 4HAIA 3WK7A 2PUJA 1IUPA 4KRXA 2PUHA 4X92A 1SFRA 3D3NA 5D3ZA 3GFFA 4XWGA 1DT5A 2C4HA 2XMSA 3C45A 1XLWA 4WFKA 1CUSA 2WIJA 4HXFB 1HDEA 2GZSA 2PU5A 1BEEA 3F67A 3H04A 3H2GA 1KEZA 3G0CA 4DLNA 4UHEA 1CFJA 1CUJA 1OILA 2DSNA 3E0XA 4J0KA 3R0VA 1BCSA 1K8QA 1QIFA 2HHAA 5ALNA 5HQ3B 4BVJA 2VJAA 1GPKA 1YS2X 2PSEA 4FNMA 1EX9A 5HF8A 4YX9A 3G0BA 3AJAA 5E4YA 2VJBA 4HRYA 3WK4A 3C43A 3BE8A 2QXUA 4O08A 2OGSA 1VXOA 1XZCA 2OGZA 2Y2UA 3LS2A 4RE6A 1K5PA 2ZJ7A 4G9GA 5ALMA 4DSZA 1UKAA 1F0NA 2XQIA 1J1IA 3WWEA 2H7YA 3IIIA 5C8XA 4LYDA 5FV4A 1Y7IA 3IURA 4C6HA 1ZJ5A 3FLAA 1VOTA 5JAOA 5AOBA 4A5SA 1ZD3A 3ZWQA 4EY4A 2NW6A 3F98A 4J0DA 5AIBA 1W52X 2ROQA 1HLGA 4BRSA 3AZOA 4QDZA 3WZMA 1LPNA 3Q8WA 3QPDA 2YASA 4U2GA 1LLFA 2GBCA 5LZ9A 4HXGA 4AMZA 4GECA 4A23A 3H18A 1QTIA 5HCUA 2ZJFA 1ZICA 1G4HA 4K6HA 4Q1VA 1DQZA 4ROTA 4B9AA 4BP8A 2O7RA 1DWPA 2UZ0A 1EXWA 4YK7A 2OAEA 4G1FA 1O6FA 2OXEA 5ALOA 2V97A 2DHDA 1E89A 1UT6A 1X70A 5K5EA 1YA4A 2WJ4A 2DCMA 4GW3A 2JGJA 4UBKA 1H2YA 1XZDA 3IULA 4KAFA 3VJLA 3UUFA 4N5IX 2ZVDA 4J03A 1UZAA 2XQGA 2PSHA 2W6CX 5ALRA 3G9TA 3ZLTA 4BTLA 3IUQA 5LZ2A 1K6EA 3C6ZA 2BGNA 1BCRA 1MN6A 3WI7A 1CUZA 1KU6A 1GPNA 1LZLA 2WUDA 5DLPA 2O2GA 3KOOA 3T4UA 1XKTA 2JGIA 4H7KA 4ZV9A 1CUAA 4UBOA 2Z3WA 1TAHA 4PF1A 1XZIA 2WFLA 4GDMA 4ZV7A 1UOOA 1YASA 4NMWA 4EY7A 3AFIA 1UK9A 5AHXA 1XFDA 3OG9A 4CIBA 3I6YA 1CRLA 3WKDA 4BYMA 3WMRA 4BZZA 1Z68A 1XRNA 4BTVA 3IUNA 1ZI8A 3L1JA 3K6KA 4X93A 3O9VA 3H1AA 1SC9A 2K2QB 4Y2VA 1N8SA 1XRRA 2VTVA 4AB1A 2PPLA 3M83A 2VJCA 2E3JA 1JMKC 1A8UA 1IZ7A 2QTBA 4UFNA 2YH2A 1FFBA 4E46A 5A7GA 4BCCA 4KEAA 2PM8A 1F6WA 3R3ZA 3ESCA 5ALDA 1A8QA 2PU7A 2XMZA 2VJDA 1CQZA 5LP1A 4L0CA 4X97A 1QOZA 5IKXA 1LNSA 5K3EA 3FCXA 3O0DA 3K2IA 5ALUA 3O9MA 3FSGA 5EIHA 4W1PA 4B9EA 1QIIA 4U2BA 4X00A 4K5QA 1BEZA 5SYMA 4NS4A 1LPBB 1AC5A 1CUUA 1QJ4A 1MNQA 1VLQA 5K3AA 3OC0A 1ORVA 1MX1A 5E4TA 1YB7A 4QA9A 4Y2UA 2FJ0A 5YASA 1F0PA 1CLEA 5AH0A 4X95A 4B0OA 3ZV7A 5AKKA 5IVHA 4MYDA 4Y2TA 4ZREA 5C8ZA 2ECFA 2XMDA 5AKHA 4CG3A 4ITVA 2ES4A 3LIIA 1E66A 5ALGA 1LBSA 3C6BA 1WPRA 1WB6A 1JT2A 1J07A 4Y7DA 3I2JA 1G66A 5AK4A 3ICVA 3C70A 4UFOA 2PBLA 5AI0A 4KE7A 1BROA 3QZUA 5DNWA 1ZI9A 4W1QA 1TQHA 5CT9A 3FWHA 1FFCA 5CXXA 4MQMA 2V9ZA 3VJMA 3O4GA 4MQLA 2HFKA 4U2DA 2D0DA 2C5GA 3WKAA 5C81A 2WKWA 2V98A 1VJ5A 5AI8A 5I7UA 3BF8A 5CW2A 3FVTA 1TKRA 3DL4A 4B82A 1AGYA 4I4CA 4P93A 5T4HA 1PJAA 3FOBA 1VXRA 1YS1X 4KACA 1QIJA 1IMJA 2HRQA 4FTWA 4NVRA 5KREA 2ZYSA 2FJPA 3EQ8A 2ORYA 5EGNA 4J0HA 4BCBA 4FLMA 5AIAA 5JD5A 4DYHA 1FSSA 2WG2A 3WA7A 1RWQA 4RNCA 4P9NA 2O2HA 2OAGA 3I6MA 3AZQA 1THTA 2XUOA 4GBGA 4YPVA 1HBJA 4J0CA 3V1NA 1YA8A 2CUTA 3F97A 1YB6A 3STUA 2GYVA 2JGKA 5LZ8A 5AI4A 2XLCA 1N5MA 3NUZA 5CRIA 3HACA 1ZGCA 4IH1A 4QWMA 2ZYIA 1QIKA 2XMQA 4FFWA 4BCDA 4W1SA 2XT0A 2AJCA 1ZIYA 4QEKA 4GWLA 5AM1A 3WIBA 4DGQA 2RI6A 5DYTA 3Q0TA 3GBSA 1Y7HA 2H7CA 1LGYA 4N8DA 5JANA 1ISPA 4U2EA 1FFDA 3WL8A 1MT3A 2WIFA 1DINA 1ZIXA 4DNFA 2WUFA 4DNQA 1IZ8A 4OB6A 4PO3X 4IO0A 2C5FA 2QXTA 3W9BA 1MX5A 2WTNA 1YSCA 5HF9A 3W9UA 2DHCA 2X5XA 3R3UA 4UBNA 4G4GA 2OG1A 1OCEA 1YCDA 5DYWA 5A71A 2QOEA 3HYSA 5D7BA 1E8MA 4TGLA 4HVTA 4M0FA 1HPLA 2CB9A 3I1IA 2WHPA 2WU4A 2XUAA 1L7AA 4C87A 3KD2A 1GKLA 3WWOA 1WB4A 5LKAA 4FFVA 3WL5A 5EHZA 5K3CA 5EHQA 1L7RA 1CVLA 2QZPA 3O95A 3WK6A 3D5EA 4JYPA 1G42A 3DJYA 5AK5A 1NU8A 5K3FB 4QDUA 3GELA 4OSEA 3A6ZA 2WHQA 4X85A 4QE3A 3B5EA 4L3WA 4EY6A 5JARA 3E3AA 3DS8A 4OU5A 4CCYA 3O4HA 4DMFA 2AJ8A 5AI6A 3OOSA 3WIOA 4WY8A 4D9JA 1R50A 4CG1A 4CI9A 3WYNA 1XZMA 5FDFA 4E15A 4G8DA 3HXKA 3R40A 3IVMA 5EHXA 2OQIA 4ZI5A 2ZSHA 5CT4A 1B6GA 1VA4A 1IUOA 2FX5A 1C7JA 3KWJA 5HK8A 1CUIA 3PUHA 1ZI6A 2OCIA 5LYYA 4X94A 1GT6A 1SOMA 4MYSA 4KAJA 4Y2JA 5CURA 1XLVA 1EB8A 5A2GA 2DFPA 1VZ2A 3H2IA 1UKCA 3PFCA 4CIAA 1CPYA 4Y2QA 3V48A 5FRDA 1UK8A 3C5VA 1K4YA 4X6XA 4KE8A 3S8YA 1GZ7A 4H7EA 5EHNA 1E8DA 2PL5A 3DCNA 5AK3A 1XKLA 5JIBA 1P0MA 5A7FA 1QFSA 1AURA 4MJ3A 1C4XA 4BAUA 3S2ZA 3W2TA 1DX4A 1PFQA 4QDOA 2QJWA 3RK4A 1EI9A 3PI6A 3WK5A 4OB8A 1CUXA 2R8BA 2AJBA 1CQWA 4WFIA 5SYNA 3DYIA 5A6VA 2C0QA 4AX4A 2IITA 3H1BA 3C6YA 1XQWA 3MVEA 1GKKA 5DJ5A 4AQDA 4UBLA 2CBGA 4X6YA 3VVLA 2OCGA 1CUGA 2Y6VA 5H3HA 1MNAA 2XLBA 5ESRA 3ANSA 4H7HA 5LKRA 3WKBA 3N0TA 4X90A 5EI5A 3RARA 2HU8A 3DKKA 4FNGA 3SX4A 3ZPXA 3QITA 3BJRA 2G5TA 3GZJA 3D2AA 5HQ3A 5IH7A 2WFLB 2W22A 4G4IA 1UOPA 2VF2A 1EDDA 5FPQA 1C7IA 5K3DA 4Y2RA 3JWEA 5D6OA 1CUCA 3G0GA 1MX9A 4H7JA 1H2XA 1N1MA 3NOXA 5DTJA 1HQDA 1EK1A 2OCLA 4AZ0A 3O4IA 2GBFA 5KBYA 3I2HA 4EY5A 1I6WA 4WCVA 4LXHA 4Q3KA 4JUIA 3MGAA 4PW0A 5I8PA 3HSSA 1QIDA 1A88A 3QYJA 3BIWA 1ZD2P 2XMGA 1AZWA 2G5PA 3JW8A 5BV7A 5FP0A 2VA9A 2HA2A 4QNNA 3QH4A 3CXUA 5C7YA 3C87A 3WZLA 5DTIA 4AZ3A 4CG2A 4W63A 1XQYA 4INZA 1VZ3A 4Q3OA 2EDCA 1BS9A 1B41A 2JF0A 3EF3A 4BE9A 2H7XA 1XZHA 2DQZA 2QVBA 1O6GA 3G0DA 3TJMA 3LCRA 1CR6A 2OQVA 3ED1A 4J7AA 5ALKA 1QIGA 2H9YA 3RM3A 5ALYA 1CEXA 3LIPA 5AOCA 1E5TA 2WLSA 1JJBA 4DNOA 1L7QA 2ONCA 2XUIA 3FLBA 4GEGA 1CUEA 1DT3A 4UBMA 3GUUA 2I3ZA 4J3JA 5T4EA 4FHZA 5JAUA 2B61A 5JALA 3WL7A 2ZYHA 2Z8XA 2RHWA 4Y2XA 4PSUA 1WPXA 3DOIA 3V1MA 4AN0A 3EQ9A 4Q82A 4EZIA 5FOQA 2BGRA 2PSFA 3I6ZA 4HTAA 4J0IA 1FJ2A 1WHTA 4Y2SA 3BDVA 3M82A 2QT9A 3IBTA 3D4LA 3BL8A 5ALVA 1QFMA 3K9BA 1CUFA 3WQHA 2C7BA 5AKGA 4BE4A 3G0IA 2ACEA 1ETHA 1JFRA 1P0PA 3PF8A 4LKOA 4AMYA 1XQVA 3TEJA 3FVRA 3A70A 3I2GA 3DLTA 3ICWA 5ALIA 1XRQA 4J0GA 3STYA 4IH4A 1NX9A 1CIJA 1TCBA 3E4DA 4V2IA 3WKEA 3SC2A 4AO7A 1ODCA 5LZ4A 5CH8A 1DTEA 1M33A 5AKEA 4B83A 4AO6A 5EIAA 4Y2YA 3F8SA 1WB5A 3QMWA 5A7HA 3VXKA 1MPXA 1TCAA 4KE9A 5DWDA 3BDIA 5IVDA 4ZWNA 5ALZA 5I9IA 4IH9A 4OD0A 5HK9A 5AKIA 3HABA 1GGVA 1AQLA 3R3XA 3OURA 2Z5GA 3UMJA 1XZJA 3BF7A 4EBBA 2JIDA 4GI1A 4BB0A 1P0IA 2XMBA 1NU6A 2WHRA 2XUKA 1BRTA 3PDCA 5AM5A 3WA6A 2J3DA 4WDQA 4TPKA 3GA7A 3C8DA 3A2NA 3D2CA 4X7BA 1DX6A 2WG1A 5EFZA 1MTZA 2LIPA 1R88A 5CT8A 3LP5A 1LBTA 2DQYA 3FCYA 1XZBA 3SK0A 4X6UA 2XUPA 4C89A 3KSRA 5CT6A 3VVMA 5DNVA 4JH0A 5JZ9A 5AICA 1LPAB 3ILSA 3FSGD 4S0XA 1JU3A 4ETWA 3IA2A 1EDEA 3MUNA 5IVKA 5AM2A 2OCKA 5AKZA 2PSDA 3ESDA 4I19A 1F8UA 1QO9A 1DWQA 4BAZA 2XQFA 4FLEA 4Y2PA 1GPLA 4Y9SA 3F9CA 3JYHA 4ARAA 3DYVA 3R3WA 4FBMA 1GXSA 1THGA 3AZPA 5IVIA 1TIBA 2EEPA 1QONA 3CCCA 2BJHA 2PVSA 4BVLA 2XMCA 2HU7A 5CMLA 1XZKA 3L1HA 4QLAA 4GXNA 4OPMA 1T2NA 3FYUB 5CH5A 2WIGA 4C4ZA 4WJLA 1CUDA 1XROA 3EQ7A 3O4JA 4FOLA 3WKCA 5JZBA 1JMYA 3WWCA 4DSAA 1Q83A 1QTRA 4F0JA 1Q0RA 3HEAA 3OTQA 4XJVA 2ACKA 1XRLA 3G7NA 4P92A 4DNPA 3NGMA 1EDBA 4C4YA 4H7FA 2WILA 3BJMA 3DDUA 1DU4A 1QZ3A 1AKNA 4UBJA 1AMNA 3R3YA 2WUEA 4KE6A 1IUNA 3DQZA 4QDXA 1LZKA 1LPPA 5AKXA 5HFNA 3N2ZB 4PSDA 1UK7A 4EUSA 1A8SA 2XB6A 1LPSA 4B81A 5ALEA 3T52A 3VKFA 2PSJA 5ALHA 4UHDA 4WDRA 3BIXA 3DOHA 4F5ZA 5ISMA 2V96A 3H2JA 2HM7A 3C5WP 1N5RA 3IB3A 1BE0A 1EA5A 4ZXFA 2RGUA 1XRMA 1Y37A 3I2KA 4HRXA 2Z8ZA 3WWDA 4QDTA 4KYVA 1QE3A 1CUWA 3W04A 1E8NA 3G9XA 3KDAA 3HZOA 1TK3A 4UHFA 5FXMA 4PV7A 2QKYA 5AO9A 3A2MA 5HF6A 2QUBA 4BRZA 4NZZA 2VAXA 3I28A 4L72A 1BN7A 1LPMA 3DD5A 2JBWA 2Y2VA 4I3FA 2VQ6A 2O7VA 5T4FA 2X8BA 4JEIA 3HC7A 3FYUC 3X3HA 4X71A 3A2LA 5ALFA 1QIMA 3CN7A 3ZLVA 2HRRA 3YASA 4CCWA 4UUQA 2D5LA 2QJRA 5JZSA 4EHBA 4H7IA 2VT6A 2WG0A 4FBLA 4GHWA 1PV1A 2WJ6A 2AXEA 2GBGA 4KRYA 5EIEA 3AINA 5AM3A 4BDSA 3HRHA 4MWTA 3M81A 5LZ7A 2R11A 1GQRA 3H2KA 5J3JA 4KAAA 2IIVA 4X91A 4PNZA 3HJUA 1OXMA 1Q84A 2BUBA 3H19A 1IVYA 3BWXA 4AN1A 4B7ZA 3ZLUA 4KR0A 1RP1A 1XLUA 4H7DA 1HKHA 1MO2A 1EHYA 4BC1A 4UHBA 1W1IA 2HDWA 4B6GA 4JYMA 1R1DA 2IX9A 2ZJ6A 1CUYA 1ACJA 5K3FA 3V9AA 1VKHA 3H0CA 1ZD4A 4BDTA 3C6XA 4EY8A 2X76A 3DKRA 5CTAA 2HFJA 4FWBA 1W76A 5ALPA 2WSLA 4DM7A 2RONA 2J4CA 1U2EA 1VE7A 1MAAA 4BVKA 4B0PA 1ORWA 2HADA 4LXGA 1LPOA 4HZGA 1U65A 4L9AA 1ACLA 1J06A 1SCQA 3PE6A 2HA0A 3C8HA 5BWBA 2WQZA 3ANTA 4AO8A 5AK6A 5BWCA 4BAGA 2XQJA 5FLKA 1USWA 1UWCA 1R4ZA 5E4JA 4G4JA 5HFAA 2J4FA 4CFSA 3H17A 3AIOA 2RAUA 2YXPX 1K63A 3FNBA 4A16A 2QUAA 4PSCA 2Y1KA 4RGYA 3D7RA 4UHHA 4XVCA 2QM0A 4YASA 3M3DA 2WTMA 2DR0A 2XUHA 2QR5A 1JU4A 4WY5A 5ALTA 4DIUA 2B4KA 5AKJA 4AXBA 4P08A 3P2MA 4MEAA 3EIOA 4LXIA 4MEBA 3BXPA 5A62A 2WFZA 2WUGA 2XUFA 2XUJA 2HA3A 2XUDA 4G8BA 3HI4A 6YASA 2C0PA 4U2FA 3G02A 4W1RA 1UK6A 3I2IA 5HKAA 4ARBA 1JJIA 2WIKA 4JNCA 4UFPA 5HZGA 5F4ZA 3IUMA 3KXPA 2I78A 2P8SA 4H77A 4RPCA 1EINA 4H0CA 5FUMA 3PUIA 4F21A 3PICA 3DL7A 2O2IA 1GQSA 1FFAA 2HL6A 3U0VA 1WOMA 4E11A 5ALXA 5JAHA 1G5FA 2HA7A 2BUAA 2DHEA 1XRPA 2JGLA 4M0EA 1X2EA 2HA6A 4U2CA 1P0QA 2G4LA 3WL6A 3HLKA 3QPCA 5HF5A 1QO7A 2H1IA 1H2WA 3STXA 1XZEA 1KU0A 3MUOA 2OLEA 5AOAA 1E3QA 4QLOA 4M0MA 3TGLA 3STWA 2RHTA 5CXUA 1EK2A 1Q0ZA 4N8EA 5LIPA 5ALSA 3STTA 3FYTA 3WK9A 1CUVA 4PQEA 2OGTA 3NWOA 2VSQA 2Z3ZA 3IUJA 5AKYA 2FUKA 3I1YA 1VA5A 1TCCA 5ALLA 2Q0XA 2JEYA 1JKMA 1VE6A 4OCZA 4BC0A 1BN6A 2PX6A 1D07A 4H35A 3DEAA 4FKBA 4LIPD 4G5XA 3G9ZA 1DWOA 5JD4A 2XI4A 3G8YA 1YAJA 2BUCA 2XUGA 3ESAA 5ALJA 2GBIA 3VDXA 5BOVA 5ALWA 1H22A 1EVQA 2ZSIA 4EA6A 2JEZA 1MAHA 3CN9A 5K3BA 4E14A 1J2EA 4BATA 4DMHA 2XDWA 1TRHA 4HXEB 1CV2A 2XUQA 3ESBA 2CMFA 3AUKA 4K2AA 3LLCA 4HS9A 3FLEA 3AILA 1UOQA 1EH5A 1QIHA 3WWPA 1U4NA 5AI9A 2I03A 2HA5A 2VEOA 4QZVA 4J0JA 4B84A 3RKSA 4B85A 4OYLA 4OUKX 3QVMA 3OPMA 1AX9A 1ODSA 2BCEA 5AJHA 2EDAA 1W6RA 4MWSA 4UPDA 3E1GA 4UHCA 3VISA 2ZYRA 3DNMA 1DQYA 3D2BA 4FDMA 2QS9A 2G63A 3U1TA 3GROA 1WCYA 3PFBA 1WHSA 4X3CA 5CT5A 4LHEA 4UBIA 4FMPA 2PKYX 2JGEA 4IHAA 2I3DA 2CEKA 5FKJA 4OYYA 4LYEA 1BU8A 2XQKA 5JD6A 1W4LA 1H23A 5C8VA 3WJ2A 3W05A 3RLIA 3B3QA 4Z49A 4DMCA 1SCIA 2CKMA 1EB9A 4ZRDA 1QIEA 2CJPA 4OU4A 5T4BA 2HA4A 1QGED 3QPAA 2J3QA 3STVA 1A7UA 1YR2A 2AJDA 3D59A 4OB7A 4RE5A 5AM4A 2XE4A 2HU5A 2AJLI 3H2HA 5JATA 4G9EA 1UXOA 1W75A 4F60A 5ALQA 1MU0A 4WFJA 2BFNA 3I2FA 2CZQA 3PF9A 3QMMA 4N8SA 2OPHA 2WIDA 3FAKA 2GYWA 3VJKA 4C01A 5KWJA 5E2IA 2WHPB 4C4XA 1EVEA 2QMQA 4K6KA 5JADA 1ODTC 4GLBA 3AIMA 5HKBA 5AI5A 2JGFA 2BAGA 1QLWA 2C58A 4K6GA 2VT7A 4FLFA 1JJFA 2WFMA 1HL7A 1T4MA 2BKLA 5DNUA 2XMRA 5LZ5A 4BP9A 3QBJA 3UUEA 4CCYB 4MXDA 4N5HX 4EB0A
chains in the Genus database with same CATH superfamily
5A05A 4G0ZA 3BWEA 3U4IA 2HK7A 2QX4A 3INGA 4QU0A 3EAGA 4P5DA 3VR6D 1CY8A 1XZAA 3H5RA 5G3YA 1R5BA 1QCYA 1QFJA 2ZCUA 1EUZA 2VSXA 3IDZA 1UJ2A 2EU8A 2ODBA 3LXXA 4Q03A 2BHSA 1PV2A 3AEQB 4JLUA 2F8SA 1A77A 1J23A 3CRRA 4E5NA 1P17A 4TXLA 1MO5A 1LJLA 1GLGA 1J7KA 3DE6X 4HLUC 4PX5A 4RU1A 2AA3A 5G0UA 1CDZA 2WPDA 5SICE 4UM8B 3WRVA 5DEOA 1ZJ4A 1DADA 1SC4A 3R7NA 3UO8B 3SDZA 4CIYA 5JAZA 4UJ5A 4MV7A 4IRMA 3GOQA 5HR5A 3C3MA 5AP9A 1SQ6A 2C9MA 3S2UA 2ZUSA 1XZLA 1MORA 2BGWA 1JR3A 4Q6BA 4H17A 4DR2B 3RT1A 3NRJA 1UMBA 3QVTA 2P6MA 4EYGA 2VDQB 5K45A 5FO0A 3SWWA 3NW9A 1QK4A 2IEZA 3D0KA 3OFKA 1KDZA 2Q28A 1TEVA 1XWIA 3IVAA 3OEYA 4HL6A 1U7XA 2NADA 3BD6A 3V1LA 5DT2A 2WM2A 4BU0A 5BMVB 4CDMA 3KSZO 1TVKA 4WGFA 3T3OA 5KUTA 3K5WA 1ZZEA 4GOXA 5JAPA 4BMOB 3IMKA 3SEZA 3IP8A 1RYYA 1IQ0A 4OQEA 1JV2B 2Q21A 2VK1A 3FF4A 4XX0A 4AZSA 1ZZGA 2WA2A 3VMMA 4IW3B 4DLLA 5JISA 2QSJA 1E1MA 4YJGA 2CVHA 1H4VB 1OH8A 1PUXA 1QFZA 2HAEA 3NIBA 3HB7A 4CKWA 3JZFA 4DMKA 3ONWA 5IXJA 4L8LA 1C81A 2XGMA 1YS9A 4NH0A 1VCNA 3K5IA 1MJ5A 4RH1A 3PPYA 3TEMA 4TZ6A 4HNVA 2GZ2A 1K6MA 3C5CA 1O9BA 4TVKA 5BNFA 2AX3A 2OOKA 1H5NA 5M04A 4DV1B 2Z98A 2H5JA 4G97A 3NJ4A 4Y30A 3PENA 4V3CA 4BQQA 2P6RA 1NR5A 4HWSA 5E7IA 1Z0UA 3IB6A 3T4PA 2JGMA 2FOLA 5EXXA 5B1YA 4GAEA 4DC1A 1TJ3A 3HPRA 5F7OA 2VI5A 1K3TA 4K28A 4MI3A 2G3YA 3RTEA 1V7CA 3FHCB 1FFEA 2YOFA 4OVKA 2PX4A 4ZZ0A 2BM8A 4DTCA 4UZSA 3U0BA 1OFVA 4XX1A 4PR3A 1GL6A 4XM1A 4M7PA 2E7ZA 2ZRDA 3DF9A 4C2TA 5AJTA 1LQTA 1SCNE 2E1RA 2IS1A 2YW2A 1UFOA 3AF3A 2IT1A 3LC0A 4FNAA 3V1KA 2KI5A 2G1AA 2KJQA 3ZI7A 4RF4A 5CD9A 2HR1A 2DPYA 5BW4A 1K3UB 3WJ1A 2GK3A 4JSRA 4Q3EA 3EF1A 4B80A 1GGHA 1T29A 1UDRA 2GK6A 4QGHA 1UUFA 2A58A 3WK7A 2ADFA 3C1OA 2LE0A 3AR4A 4RWEA 2MINA 2CCGA 3JQPA 2FVXA 3USCS 4QNMA 1RRCA 1NX6A 1ZUWA 2BN4A 5EKXA 1AS2A 4RC9A 4B44A 3CE6A 2JFQA 2CKDA 2A0WA 1LY1A 2Z8YM 3HKCB 3QVUA 4QPZA 1W34A 3PRHA 1P7VA 1L5NA 2H5LA 3GFFA 3I42A 2OD7A 4XWGA 3IQZA 1DT5A 1LJ8A 4CJXA 1QPZA 2M6SA 4D1YA 2CN1A 3LX5A 1L1FA 5C9ZA 4WFKA 1CUSA 3EAFA 1X3SA 4IIDA 4LMBA 1RBQA 3LZDA 2X4IA 4MMXB 2CUKA 4MV0A 1CZHA 2HC9A 4O2AB 1HDEA 3B1FA 4Q19A 1OE0A 4R84A 4RX1A 5NLLA 1OX6A 2N42A 3NETA 1EVIA 2SBTA 3F67A 3VR4H 4BNHA 3FWPA 3NM5A 3UJ6A 2J7KA 2W7TA 2B98A 3G0CA 3HADA 4HOYA 4BFWA 4DLNA 2O8FA 4Q4CA 4AZWA 4EHNA 1CQXA 4M53A 3U7RA 4K81B 1ST2A 2PJZA 3PUKA 1BHSA 2AN3A 2G5CA 3ONDA 3R0VA 3CO5A 1BCSA 2DPHA 4K9KA 5SY6A 1EFLA 1KZ7B 4W8OA 4X1KB 3DCIA 2I6TA 1L8LA 3PC6A 1AKWA 1Y8QB 3Q3EA 5ALNA 2QE7A 4BFXA 4D98A 3GGPA 1Y9ZA 3OZSA 4GPZA 1DC7A 3UAYA 1FX0B 1JWLA 3R9IA 3OBIA 4QOGA 2O8BB 1U3DA 2WF6A 2NYRA 1NBWB 5JQGA 1SQGA 1LWNA 3TMAA 3BKWA 4BJ1A 2W6ID 4HVCA 3T35A 4YX9A 1FSPA 1J0EA 2WYIA 4NOLA 3Q8XB 2Z6VA 1UAYA 1OHHA 1ZRNA 2OAP1 3CUYA 3QVWA 2AZTA 5I7SA 2WMDA 1IBKB 3ZHVA 1DJOA 4KQGA 1QZXA 2QRHA 1CZNA 4C0XA 4IDFA 4J6FA 2A92A 3ZLJA 2VJBA 3GRRA 2JAWA 4L2IB 1EEXB 2JNWA 3FHOA 1NRJB 1Q15A 1DCMA 1K8YB 3K9QO 4IV8A 4JOQA 3WK4A 2BH9A 1KK0A 4QQ8A 4D26A 4W9NC 1Q3TA 3C43A 1N2IA 2ZAGA 3W2EA 1OQAA 1PJ3A 2MR6A 3W4KA 1FRZA 2J3JA 2AEFA 3L6BA 3DPUA 3UWSA 3UJPA 2H1OA 4LE2A 3NWBA 2OZVA 4X54A 1Y5MA 2OGSA 4L85A 1NDUA 3Q6NA 3MXOA 5PNTA 4YR9A 3MCTA 3HJNA 3PGXA 3KT0A 1E1QD 2ASVA 3EOZA 2NMVA 4RJIA 4URXR 3EXIB 3AVUA 2JFVA 4EL5A 1PKXA 1RPJA 3TD9A 1JLSA 3M9LA 2OGZA 3NBFA 4MSUA 4DLVA 1W85B 3I39X 4RQAA 5E1BA 4WBNB 2Y0CA 1VPDA 2JCBA 2B2NA 2JHCA 3PTZA 3RC1A 2NZ2A 4ZQEA 2D7JA 2ZRBA 1PK9A 2HZBA 4J3FA 2ODWA 4EYEA 2BFEA 3H9QA 3LH5A 1UKAA 4GQBA 2XQIA 3VBEA 2JFNA 2CVOA 2GN6A 1DG1G 3WWEA 4XFDA 5KYKA 4IDQA 1AS0A 4HI0E 1P8AA 3GO4A 4Y67A 4DG5A 4ZD6A 5KMGB 4M1EA 1CY1A 1X1EA 3PSHA 5A4DA 4LF4B 3BTUA 5FV4A 2IFTA 4QUJA 3AM3A 4YHBA 4FCWA 1P1JA 2K7ZA 2QG4A 1TCVA 2GHIA 3DTYA 3L0DA 5MN5A 2H54A 1EP9A 1GT91 1NAIA 2II6A 2YJ6A 1RAAA 1NMQA 5KB3A 4A5SA 4N0EA 1VLJA 1ZD3A 2FKNA 3DD1A 3KDPA 4HB3A 4NXNB 2ZOSA 1VIDA 4INOA 3W6UA 2GDJA 2F4VB 2R8PA 1CY2A 1Z2EA 2BONA 1O77A 1OMOA 1RE0A 2B99A 3HQ4O 3HEMA 2CDRA 4J0DA 3CX8A 3VTFA 1R0ZA 2JVIA 3OC6A 2ZBPA 1YZUA 3PHBE 2BMJA 1FRFS 1DE0A 1P4JA 4ECEA 2KQUA 1IQUA 1Z36A 4YO8A 3G2HA 2OHIA 2G7MC 1A98A 2O3RA 2GILA 3WZMA 4BRSA 4FB5A 1ZMXA 3I3OA 1FFGA 2F64A 3SC4A 4U2GA 5CH8A 5IZCC 1G0OA 4O1IA 4MITA 1C8BA 5JCPA 4HXGA 1NMEA 4RVUA 1WW3A 4AMZA 2Q6IA 2IXDA 3OTGA 1PR2A 3HY3A 4JJIA 4KKXB 1CJSA 3H18A 1O89A 1NZJA 2ZBRA 5CIWA 1ZP6A 1DAMA 1RMTA 1R0WA 3ORSA 5MN4A 2CLIB 3ED5A 4G07A 5FORA 1Z2NX 1HDXA 4RIEA 4AYXA 1YZ3A 4YRAA 1ZNQO 4DOMA 4B9AA 2H8GA 3UOAB 4LZNA 1JVBA 2YWJA 2VA8A 3RC7A 2OAEA 3PUYA 1T9GS 5CLIA 3CEMA 2J3KA 4KL8S 3T1TA 3FXAA 1DC6A 1KEVA 5FBLB 5CCXA 5K0NA 3T7KA 2I2FA 1VJ1A 1E89A 1LVUA 2H59A 2WWGA 2G72A 3B8HA 1X70A 3P4XA 3RWMB 3U56A 1A9OA 5G1NA 3FGPA 3SJ7A 1F9EA 2Z57A 4NBWA 3GLVA 5EYPB 5JAMA 4YAWA 1RKVA 2IEDA 3LGSA 3GGDA 1RWOA 4CMEC 4G8JA 4HQLA 1HNWB 5TR9A 3L46A 2DCMA 3KQTA 4QYIB 2ET6A 4RDXA 5IWAB 2Q5CA 3KIPA 4R31A 4UM9D 4CLEA 4NOJA 3H2BA 1HQCA 2PA0A 1T43A 1L4NA 1XZDA 1I1OA 4U7JA 1NC1A 4R9RA 5TC4A 1UFKA 4DIOA 4IDGA 3B1YA 3B6KA 3I9V6 4N5IX 3RBAA 1PT5A 2HF9A 2O0LA 2OVFA 1ILWA 1N33B 4PCUA 1M54A 1Y1RA 3NDRA 3CNEA 2QD2A 1LSUA 2W6CX 5EMHA 4UOQA 1IZYA 1CS4C 5ALRA 5IDQA 3ASVA 4OJYA 4HR7A 2NXCA 4IFIA 4IPTA 4MLCA 1G3MA 5JTTA 3G13A 3IUQA 3GN1A 2VLIA 1K6EA 1QYVA 3AMVA 3C6ZA 2H4FA 4FZ3A 4XSVA 4YS6A 1DPFA 4G9BA 2WWHA 4PYQA 5KJ6A 2A5LA 2J9FB 4R2WA 3SC2B 5EQDA 5HOQA 4B4DA 5DLPA 2O2GA 4BWGA 5TARA 1XKTA 3OMLA 2JFPA 4G2NA 4ZPJA 1X7HA 4ZAWA 3T9DA 2HT6A 5CX1B 2B8TA 1W35A 1UMDB 2UYQA 3S40A 2Q6KA 2IGTA 2Y0BA 4D8YA 4IZOA 4DZTA 2VNJA 3TNYA 1CUAA 3GDFA 1OROA 1RHMA 3DMHA 3A9CA 1BE1A 1B8OA 1E1KA 1L6RA 1A9SA 1RACA 2NU6A 2VAWA 3G88A 2WFLA 1IYZA 3N75A 1JIVA 3OP1A 4G65A 4ZEWA 1EG7A 2YZ7A 4IIGA 1SKBA 1S2OA 4BJ5A 1JIJA 2VH5R 5TPWB 1O0BA 3TK1A 1V3TA 1KJ8A 1CCWA 1PR1A 2A2ZA 2Z1MA 1OU0A 1S8FA 4GMFA 4NMWA 4RZHA 3NHYA 3B52X 4EY7A 2VYND 3O91A 4POOA 1C9EA 2P4EA 4RHFA 4IDOA 4MQBA 2K6GA 2PNJA 4H27A 4II3A 3E22B 4GWGA 2XHZA 1I10A 4OUDB 1FB5A 4TZTA 5F4BA 1QV6A 3ISTA 2O1SA 1AIPA 2Q46A 3HB9A 3O2SB 1H3NA 1ORRA 4I55F 3WMRA 4DS3A 3RRFA 3KEMA 1RIIA 3CV3A 3FLMA 4TMWA 3VPHA 4D44A 4DDUA 2AW3A 4I1PA 4Y3UA 3QEAZ 1YHZA 3UJHA 3KV1A 3TD6A 1G2PA 4LDAA 1CC1S 4MUFA 3IOEA 4QXMA 4EYSA 3T54A 3MS4A 5HVNA 1NSYA 2FP4B 3PLNA 1JXOA 2HH9A 3NBYC 3Q40A 1SG6A 4QTTB 1TYEB 1T5TA 2XOKD 3LGAA 3DL2A 4GL4A 1MJHA 4JC8A 5TV2A 3ZBPA 3SQOA 3ZE9A 4OHCA 1R0XA 5CNKA 3U4AA 2PEYA 1F6DA 1ZLXA 1XEWY 2BE7A 2CXTA 2VJCA 3C3EA 3LT1A 4MVJM 5HIJA 1FFHA 3W5SA 5C5EA 1NJ5A 3WAKA 2BTEA 4QXRA 1T2VA 4IQ0A 1P9RA 4U8HA 2B3TA 1E79A 1IBSA 2R4TA 3IP6A 3PC7A 4UFNA 4B3FX 4MWDA 1XCPA 2XEXA 2PH7A 4QPNA 1ZGZA 2HNKA 1FFBA 1OLUB 3K5PA 1YQQA 3DO6A 2CF5A 2FPPA 3GPCA 3BSSA 3NHRA 3AH8A 3PD1A 3Q7SA 4LQCA 4YI5A 5HM6A 1XPJA 5SZHB 4DDWA 1FLNA 3VKWA 4P58A 5JH7B 3ZC3A 4FS3A 3V4VB 4B6QA 3LC2O 1SUDA 3RFXA 1D03A 1FDIA 2HLNA 3D6NB 3F4LA 3KX2A 4IZHA 4WA7A 3QLVA 5LDDC 5IEBA 4FDUA 4YUVA 2AS0A 3RIGA 4P31A 3RVRA 3RVOA 3RVPA 3UJ7A 3ZU2A 3A25A 2CLDX 2FPXA 3P0RA 4NG5A 2FETA 2J09A 2P1DA 1KZHA 3V7UA 3MTQA 2H3HA 3ZD7A 1DHRA 3PQFA 3V2HA 1HDCA 1NVVQ 1MEJA 1WZIA 3DNPA 4O2BA 3T3GA 3NWEA 1UC8A 4U9HS 1E7MA 1M1YB 2VJDA 3G5TA 3F47A 1EUQA 1Z3IX 5KDOA 1IQPA 3U31A 3UY4A 1QOZA 2IYYA 4D8VA 2P27A 2ZB8A 3FCXA 2VTDA 3M6WA 5ALUA 5L7YA 4BNNA 1KKUA 3FSGA 3R75A 2Q49A 5EIHA 1Y4UA 1ZONA 2BWJA 4W1PA 5EP2A 3I72A 4UEKA 3E5MA 1M1XB 3D0RA 1UFQA 3M5WA 3SNHA 3WTCA 3ETJA 3CTPA 2CSXA 1JPJA 1D5CA 2Q4EA 2ZIXB 3E9YA 4K5QA 3RVDA 4C4PA 2OG2A 3KU1A 5SYMA 4NS4A 1LPBB 4G0NA 2X0FA 1AC5A 1CUUA 1JTEA 3UMMA 3Q11A 3OZRA 2JHAA 3ZCTA 1MNQA 1VHLA 2Y1FA 2J3EA 3EVBA 3JYNA 3KKQA 3QXXA 3DQQA 4EQZA 2G1KA 2W43A 1J8VA 3CJQA 4L6AA 5IJZA 3ASUA 3L77A 3ZY3A 3T5TA 3SR4A 1XEXA 2H18A 4LVNA 4OQPA 3K94A 2V5UA 4L51A 3CVOA 4E08A 4EKIA 2X15A 1IN1A 1FMLA 1JHMA 5SY9A 2CMDA 2QMUA 3OY2A 3QV1A 4EF5A 4HJXA 4N5LA 5YASA 5JJBA 4Z6KA 4JWKA 5EJ9A 3ZV7A 5I7EA 2A1TR 4WRRA 1KKLA 4AS1A 3B78A 4MYDA 2RGYA 1TNDA 1ADBA 3EMDA 2GEUA 5C8ZA 1RNLA 1QHFA 5GV8A 1NQVA 2HF7A 2DT8A 4FGSA 3HUDA 4Z53A 2E82A 2ECFA 1OJ7A 1DRWA 5IYZB 1PLLA 5B4TA 4I1IA 1BU5A 2XMDA 5KDLA 4CG3A 4LBYA 4BQNA 1GL7A 1W1WA 3ZGZA 2HD4A 5CDFE 1K5DA 2EWMA 3CW8X 4QUAA 4YAUA 2G9QA 4K40A 4X7RA 3DUWA 1E66A 4A7PA 5CK4A 1IY9A 4ZOLB 3RF6A 3R2JA 5JYEA 1PU2A 2VUUA 4JU8A 3A3NA 1AMOA 2C9ZA 3LBHA 5CXSA 1SC6A 5FJJA 2V74B 5AUOB 2RGNA 4FOSA 1TAQA 5AK4A 3RG8A 5A6SA 3C70A 4FS8A 1SRQA 4M99A 2WJJA 3ZQ4A 5H81A 2PBLA 5AI0A 3GQVA 2WJYA 4NENA 1BROA 1XVTA 3DBHA 2E4UA 2FLVA 2IZ7A 5JRDS 3P9RA 1ZI9A 1ZH8A 3OVMA 4CBVA 2DHRA 2VXYA 3GVHA 3CWCA 1USKA 3QENA 3ZJYA 1P1BA 1PJCA 3ESXA 4KPUB 1G60A 4ZJPA 5HUQA 4KSYA 2R6ZA 1XHLA 2GPJA 2Q0SA 2XEDA 1E0DA 3OJEA 3VPDA 1X1QA 4HDAA 3QEMB 5C1PA 5KIAA 1HURA 4Z3KA 4FMCB 3JSXA 3UJ9A 3IVGA 2QMOA 5A0TA 2HFKA 4B75A 4BE9A 4OY3A 4ZO4A 5ELXA 3R7DA 5E1OA 3DLIA 4YRQA 1GG8A 2D0DA 1QV7A 1SM4A 1U7TA 4UUAA 1PTKA 1M2KA 4ND4A 4IIBA 1RYEA 4PFQA 4WACA 4BVEA 4EQ6B 5C81A 2W0MA 3MAAC 3W77A 1NY6A 1FU4A 3FKSA 4PZPA 3SC3A 4ER7A 1EE9A 3ZHZA 1QHIA 3RFCA 4C1BA 1U2DC 5KTOA 4NU5A 4ESHA 4RMIA 2CL0X 2H7VA 5LWQA 1EWKA 5LQJA 5CW2A 1B15A 5B1IA 3TBHA 4U8GA 3NLLA 2J0UA 2YN0A 1G8GA 2O3JA 1FYXA 3T5BA 3HGTA 3X2SA 2B21A 2FEAA 3PQDA 4QBGB 3WXBA 4NPHA 1GTRA 5I48A 2PZGA 4DDHA 1YQ9A 1XT6A 3WB2A 1UMBB 3NRBA 1L5HB 3PBKA 1YS1X 3L4BC 1NN5A 1KC3A 3PK0A 4KACA 1NRWA 1XD2B 2TECE 2YY5A 4QX6A 1CKEA 1NQOA 3OPVA 4FTWA 4PCVA 4JIMA 3AETA 3RRZA 3VTAA 2W9XA 2WJVA 4IXTA 4RXMA 3OQIA 3EBPA 4NYIR 5FUXA 1TVKB 4DV2B 4O4HB 3QMPA 5KVSA 2J32A 4GRAA 1NMZA 4WH0A 3H16A 4J0HA 1MHTA 3IUEA 3QWBA 4AMBA 3ENNA 3BBPA 4XX0B 1RBYA 4KK4A 4PPNA 7ABPA 4EPRA 4KQXA 2H4HA 4FW8A 2X6QA 1FSSA 3GAMA 5MF6A 3FCEA 3PHIA 1N7HA 3BB1A 4ZARA 1RZUA 3N8IA 2O8DB 2YN2A 4CKYA 5CD1A 3KJIA 4YMVA 4IHQA 5LYJF 4CR7A 2J9YB 3I2YX 2O2HA 1NN0A 1HFEL 2BC9A 2G9NA 3BGSA 1UOEA 1YBFA 1JQEA 3JQBC 4AY6A 1HBJA 1HG0A 1KYVA 3V1NA 1C1DB 1YA8A 4YI3A 5A9SA 2UDPA 4Q5IA 1HOTA 2QW1A 3STUA 3UFBA 3KB2A 1POXA 5LZ8A 3V4LA 4AWBA 5AI4A 2FQ1A 3V9PA 2A0YA 3OQMA 4L76A 1N5MA 4K3UA 1EFRD 2GHTA 5C8DA 4PYLA 1OYVA 4QTUB 5EHIA 2PX3A 2JBHA 1GL3A 1C3EA 2R2AA 3EXAA 4JQYA 4RKQA 4TTAA 1EUYA 2G8LA 4G1VA 3WMXA 3C4VA 3F2VA 3U1VA 5FH9A 3CUVA 1JIQA 4FFWA 4BCDA 1OH6A 3I1JA 3NKLA 4W1SA 2XT0A 3DV0A 1SN7A 3H5TA 1Z6GA 5BUSA 3A14A 3NOOA 4PIVA 4QFBA 4AVYA 4K9QA 4O8CA 3FPGA 1PTJA 1GRQA 4KXQA 4JT4A 4OIMA 4GZ3A 5IX8A 3FSEA 1U0HC 5F2EA 2WTEA 3RSGA 5A9RA 2NO7A 3CG0A 3LCVB 3Q0TA 4GSLA 2VK2A 4YXWA 1YKFA 3DPSA 2FE4A 5CNMA 2H7CA 1Z08A 3PGKA 3PJDA 4PQRA 4M6WA 4DV3B 2E1PA 5JANA 4C7OA 3KQYA 5JZOA 4MS3A 5H7XA 1TJYA 3LOUA 2GTHA 4ND1A 1FFDA 4U2EA 5J40A 3ZVRA 5CB4B 1WXGA 1ZISA 2EOAA 3NOQA 1DINA 3HVJA 1KMQA 3MWEA 4KXWA 5KTTA 4LRQA 1PK7A 3M2TA 3RVKA 2WUFA 2LV8A 3I09A 1AZTA 1X7YA 4DNQA 4JHLA 3CRVA 3A1DA 5CA0B 2ZB2A 1O03A 2HK9A 3KVRA 4YRZA 3C7CB 5SZIA 4WNAB 4G5OA 4ZJUA 1KVUA 3WGKA 4M7RA 4D4JA 1RKXA 1BDHA 1KIMA 1FDOA 1J49A 2HMAA 2XV1A 4UDYX 5BN5A 3AW8A 1JDNA 2GXQA 1MX5A 3QTBA 1AK1A 4LCBA 4OQFA 1C3VA 1CLUA 1T24A 1ZDMA 3F74A 4GGPA 4L6CA 1P7WA 4MICA 5HF9A 3W9UA 4BMZA 1S9DA 2ZEJA 4YWHA 4HC4A 4J2OA 4OOEA 5KYYB 2O8FB 1X6VA 4PBTA 2BMFA 3SI7A 1W2WB 1E1CB 3RV4A 1FS6A 5MDHA 3FZQA 3EODA 3ORRA 1BCSB 4AJKA 1WMBA 3TUIC 3WYEA 2IWHA 1JQ3A 1RHRA 4EO9A 5D7BA 1Y9DA 1RLTA 1Z38A 4JDPA 1RZRA 4QOEA 1HPLA 2AOUA 1G19A 1W4BA 4RD2A 3ABRB 5F35A 3EC7A 3B1KA 3HWX1 3TOSA 5FBQB 5BYAA 2WU4A 3AGQA 3OFNA 2V3WA 3WRXC 1FXUA 1GKLA 2DQ4A 2HRDA 3LUDA 5CYFA 5DN9A 1NUUA 2RH8A 5AWFC 5DHRA 5TMBA 3WWOA 3WSTA 4M9RA 4D97A 1PF7E 4FFVA 3CGWA 1JLLA 2A84A 3WL5A 1W5AA 5K3CA 4UXJA 4AY5A 1QHXA 2N75A 3ROEA 3K2QA 2BR4A 5EHQA 3L7OA 4GH5A 1YZHA 2C9DA 1CVLA 1T4BA 1VSQA 3O95A 5BQ5A 4QUKA 4EFDA 5FLEX 3RVMA 1OGYA 5EJ7A 2W4QA 4LK3A 1G42A 4YVFA 5AK5A 1YIDA 2R0QC 2MHCA 1IC6A 1JJVA 1Q91A 3PVCA 4AZTA 1KH2A 5JSYA 4QDUA 2IW1A 1UBOS 1EWRA 3ETGA 3GZNA 4UM9B 3COPA 3A6ZA 2WHQA 4X85A 1F1JA 1I5OA 4QE3A 1UKVY 3R4VA 2YFQA 2XYGA 2X0JA 4GG1A 3AUTA 1EFDN 2OTCA 2UUPA 1YL7A 4EY6A 4BQFA 4O33A 3UOGA 3VDNB 3C3CA 2C2WA 1UXJA 2ZT6A 3E3AA 1JBEA 2CHEA 3NYRA 5E3IA 3TGWA 3JARA 4EJSA 2HI0A 1GQQA 2BZGA 2P78A 3T7DA 5JG7A 4G0UA 3N0VA 4NYMR 1ZU5A 1U8XX 2GCEA 4WY8A 3LRXA 1SIUA 3AKEA 1GA1A 2C2YA 4R40A 4CG1A 3BBLA 3PL5A 2BMEA 5EFOA 4CI9A 3MHTA 2ECOA 3SBXA 4TUYF 3IAHA 3WYNA 3DXZA 1XZMA 3H5VA 2VQEB 3S27A 5K4HA 4B87A 4CT4B 4E15A 2CK3D 4IMIB 3IVMA 3IXMA 3HJRA 4FK8A 4PVDA 5EHXA 3K70C 3CRQA 2MMGA 1Q1NA 2GN0A 1YZYA 2AUMA 1Z6TA 1B6GA 1ZS9A 1K98A 2C94A 2QX7A 2YWXA 3DEJA 4RA9B 4WNYA 2Q4DA 3MJFA 2Z2KA 4U1RA 1KDOA 2O8VA 3A1UA 4ZVPA 4S2UA 4FVTA 3F6CA 2PRYA 1Y3AA 3OZGA 1T6ZA 2ZSDA 4J90A 3THWB 5CA1A 3CZCA 1P5FA 2CXXA 4PNPA 3ND5A 2Q6TA 5HK8A 4MW7A 3VSDA 2VCHA 1H4SA 1ZI6A 4IJ6A 1ISMA 4LJAA 2IQIA 4C7XA 3D0OA 1RXCA 5JOQA 1JE1A 1V8BA 4LRTB 3EWAA 3EOAI 4G23A 2AD1A 3DMPA 4ITRC 1D6NA 2D2IA 3B51X 4LV8B 4U3JB 4XKJA 4C7MA 4RHUA 4MYSA 2GPNA 5TSDA 1ABEA 1RI3A 4QUHA 1MOZA 1NUAA 2BJWA 2RHBA 5IT9A 4LDQA 1XLVA 2ZB7A 2PZAA 3EZXA 4L28A 3RFUA 1O6CA 1F06A 4REMA 5D7NA 3GVXA 4RV4A 2DFPA 2B6NA 4DJ5X 1P18A 1PJ8A 4EPTA 5AHOA 4I9UA 3IUPA 2IODA 4GYJA 5LBTA 3DLCA 5ULLA 1U8YA 1LDGA 1O94D 1I8TA 4ZCRA 1O1YA 1FP7A 3WHLA 1PR9A 3M6FA 3A11A 1CR4A 4CMIB 3WVNA 4F38A 1WL8A 3HI6A 1ID1A 2B7LA 1JX6A 1UK8A 1Z12A 2RE8A 5D1HA 3C5VA 3V00A 1JEQA 1M74A 1K4YA 2BEVA 1N7IA 2Y4OA 3QKSA 4UCWA 1YDGA 3NI2A 1ORTA 4ZHQF 1GZ7A 1MP0A 3SNKA 2E49A 1FXWF 2GAIA 2P77A 2QZ9A 3PG5A 1N0VC 4ZXPA 1OX4A 2DMRA 2AFIE 3CRZA 1NFQA 1OZAA 1E8DA 3DR5A 4IO1A 4J49A 4MB6A 3UCFA 4RTOA 2UUBB 2HT1A 1D0SA 2HCJB 2IRWA 3MLBA 3GLRA 2GD6A 4EF6A 4J29A 1W8DA 5JIBA 2E55A 4H3KB 3I9FA 2BDTA 5IKEA 3ZZ0A 4DV7B 1AURA 4TRMA 3O3OB 1C4XA 3MK31 2V7XA 2JAHA 1IY0A 1NW6A 4P80A 3S2ZA 4A0QA 4YMUA 2JRCA 4PGMA 4YBZA 4F6CA 3D8UA 4MJLA 4RZSA 3RK4A 4CV0A 2PD4A 1XEAA 1EI9A 3NDPA 1O6BA 1ORIA 5K2MA 3UW1A 2BE9A 1IK6A 1F48A 1WDLA 3A6GA 4QT4A 4BXOA 1A7JA 4Q24A 1U0SY 2P30A 4OBEA 4ZOAA 3PIDA 4CEIB 2FLKA 3L49A 5GAJA 4S35A 5SYNA 3BE5A 1KI6A 2QVYX 3AG6A 3QUQA 1Y4ZA 4DIMA 1UH5A 4AX4A 1KTVA 5C2JB 4HB0A 2RIRA 2PWYA 4TZKA 5E9JA 5CFOA 5KX5F 5ECDA 1XXHE 3EHEA 1CU1A 4GOND 4YP0A 3LKBA 5BW6B 2EX0A 4DSNA 2IHBA 3K4HA 3N2IA 4MV9A 4CUKA 1C9JA 5FOWA 1Z0AA 3PPVA 4UBLA 2XSZD 2CBGA 1PW7A 3OU2A 4IR7A 3Q9UA 5I51A 1EX1A 2UVPA 5EWMA 3BK7A 2Y6VA 5D2CA 4QHTA 2GXSA 2P3QA 5LU9A 1J0BA 3L7LA 4R1PA 3HFRA 2WZDA 2EHJA 4GXTA 3AP1A 3PWKA 1I5EA 2GF2A 3S70A 5F52A 3BUSA 1SVIA 2XODA 1OBCA 1QE5A 1VSVA 1T13A 2LIVA 3C8MA 3EFBA 4QC2A 4YP5A 4BECA 4E5MA 4WJZA 4XLLA 3H1EA 3FJOA 4TYQA 2FSSA 1UBSB 2WVHA 3OWOA 3RARA 2G4CA 3RPEA 5J4VA 5JNUA 5JJKA 3L6DA 4D3FA 1C7QA 3DKKA 4ETNA 1VKJA 3ZPXA 2K5UA 4Z7NB 3IBCA 2M1ZA 2G5TA 3SDBA 3PCRB 3ZJ5A 2NU6B 4RV9A 2PHZA 2CSUA 2Q1UA 2GASA 3OSZA 5EVJA 1VCMA 2WFLB 5BNIA 2V7VA 4KR3A 1E7YA 3KOMA 4BQIA 2AN1A 2FPMA 3VPSA 4V0NA 2AOTA 1UOPA 3ZYCA 4HH0A 2PE5A 1EDDA 1CNMA 1E3IA 1U9YA 2XJ4A 3JWEA 1TA0A 4X8HA 2I7DA 1QRUA 4UE2A 5EJEA 2IOQA 3PRJA 2FCAA 2IYSA 2XYVA 2ZI3A 4K6OA 4F6LA 3G0GA 5IK2D 5LCXA 4W7SA 1YQDA 1AQYA 4NICA 1H2XA 3ZHSA 3A6JA 4Y1RA 3MT0A 3X1DA 5DTJA 5D5HA 1QCCA 1HQDA 1XFAA 2OCLA 4AZ0A 2WYOA 1LLDA 3O4IA 2D3WA 4S1TA 2GBFA 2F00A 2BFOA 2GD1O 3V4PB 5BRAA 4MH0R 1QGDA 4IF4A 3H8VA 5KBYA 3D8SA 1J0XO 3B1VA 1FX1A 1J0CA 2PO5A 3LK7A 2GERA 2VPIA 3O4FA 4GVPA 3FUTA 1LBHA 4KQKA 3WLEA 1HZJA 1MJNA 4OFXA 3UGKA 3CLUD 5F1OA 3KNZA 5U9CA 3U19A 1PR4A 4QD3A 4DUGA 1UBGA 2XA9A 4HWRA 3ADBA 2IPLA 3OOYA 4M89A 1U7UA 2F1JA 1CTQA 1WY5A 5I8PA 1PFVA 4DF3A 2XW6A 2FZVA 1V4BA 3I45A 3C8ZA 3UC5A 4C43A 1G2IA 1BWSA 3IQDB 3QVLA 2FPPB 1B14A 4FHCA 4LDPA 4LI0A 5L7TA 1LLCA 1PI3A 2O0HA 2G5PA 3JW8A 2B37A 2IU3A 4M1QA 1PX2A 1HFWA 3LUGA 3RTCA 2HA2A 4F7WA 3BK1A 3TZQA 4TROA 5IASA 3HNOA 2XF2A 2RJNA 1NQTA 3KQSA 2HXGA 4J91A 4RACA 5H16A 3C3WA 1KE1A 3ZKAA 2D7DA 2JARA 3QH4A 1F38A 4FU0A 4DJAA 3X1WA 2YQ4A 5B57C 5C7YA 3BH7A 3LAWA 5FOSA 3K1JA 1GTMA 1ATIA 1NF2A 1ZCFA 4HH4A 4O2BB 3VR2A 4CG2A 2OBNA 3EYAA 5AJZA 2UZ1B 3FMVA 1SXQA 1ENZA 1VZ3A 2QLMA 3E1SA 1Y98A 1K27A 2GVNA 3EEFA 3O7MA 4UAVA 3RSZA 3BA6A 4A36A 2BP7B 1GHTA 4KGXA 5EZQA 5TPZA 1BS9A 3N0XA 5K99A 4RGVA 4PC1A 1XZHA 3G2KA 3U09A 3P32A 3FJ1A 3FMPB 1SZDA 1NVDA 3N2KA 2DQZA 4K9DA 4TN5A 4H1WA 3TBFA 5F5NA 5CDFA 3C3AA 4XB2A 3RC3A 3AHJA 2GK7A 1F5NA 4H1HA 3TAHA 3C2QA 1Q0QA 4P2BA 2F8MA 3BRSA 3X1MA 3VZBA 4L5AA 1QIGA 3B9BA 1KSHA 2H9YA 4I55A 2L17A 1P6XA 2ZYWX 1VYHA 1GL9B 1P77A 2PBZA 3ELUA 1NVGA 3EN0A 4JGGA 1E5TA 5ALYA 1JJBA 1FTGA 1H93A 5E3HA 5DKFA 4J4BA 3ENZA 1XEXB 5IULC 4GEGA 2PMEA 1MDFA 3R24A 2HBZA 3P19A 1CUEA 3I9OA 2N3ZA 2HHCA 4WESA 1DT3A 4M1SA 1JU9A 3GUUA 5TS3A 1ULHA 3SE0A 2IE0A 1EP2B 4N1AA 4F11A 4Z49A 2J9ZB 5JAUA 1TM4E 2DZDA 2B61A 2HV8A 2ATIA 2Z8XA 1WULS 2WVAA 1AQUA 3NBUA 3S2GA 4MVCA 2H4ZA 3ZOZA 5K6AC 4B73A 1W2HA 3AYZB 3HL4A 1WPXA 3C3KA 1NAHA 4CTNA 5C35A 4X5OA 3V1MA 4XARA 1D1QA 4C6RA 4MJ7A 4DB2A 2B7BA 4Q82A 1C9YA 3N3AC 3GRYA 5CJJA 1J0DA 3TJZA 1L7NA 2TMKA 3F1KA 1CJCA 3GLUA 3DHNA 3IOCA 4LZOA 5DNYB 4S1WA 2IW3A 1U0BB 4J0IA 3IBFA 1YI1A 3E9EA 2Q6LA 3G49A 4JP5A 4FILA 1O3YA 1VJCA 3WRYA 4K05A 4WUTA 5GJCA 2IPXA 1NPDA 1OFTA 4IUBS 1FS4A 1WHSB 3KXLA 9LDBA 1XPRA 4EJFA 3W6PA 1ADCA 2C7BA 2QTLA 5K09A 1OH5A 4HSEA 4ZRNA 1GU1A 3L7MA 1Q7GA 5A6SB 2I9KA 3HMQA 5JMTA 1VG8A 4FGLA 1JFRA 3JTEA 5REQA 1P0PA 1VLMA 3F7OA 2RHJA 1P2SA 4ICIA 5I01A 1HE4A 3DBHB 4LKOA 1W44A 1WE2A 4WNCA 1SQFA 3KOUA 4CLXA 1NKSA 2Y77A 4B6SA 2QE6A 1BDJA 2GPBA 2Y3IA 1TEHA 2X6RA 1JSLA 3MELA 4Z4QA 3CR8A 1QPBA 1FUKA 2Q3JA 2FU5C 3EVDA 2V45A 2JLCA 3D4PA 5B2ZA 1TCBA 3DMRA 6NULA 4FWTA 3E4DA 5KOHA 1LI4A 1JDVA 1LSSA 1E5DA 1MW9X 1PGPA 3FYHA 4MWZA 5DFAA 5LLDA 3EIUA 3F9IA 4H4EA 1C1YA 2X0EA 1AQJA 3CXRA 1JPVA 4HS4A 4N12A 1UPBA 1E64A 1UJNA 4WCFA 5GGYA 3VKGA 5LZ4A 2QGFA 1ISSA 1ZD9A 2REBA 3EVGA 3IP3A 1KY5A 1K8RA 3PQ8A 1DTEA 2F2TA 3EZ6A 1GUYA 1XJ5A 1M33A 4IG9A 3NBMA 2FVYA 2D2VA 4LOIA 2KE5A 1RJGA 1XP5A 1L2TA 2XA2A 2EIXA 5AVXA 3PNOA 1VBFA 1N1EA 3VR3D 3PUXA 3EPRA 4EEZA 2C2GA 2PQ6A 3GP3A 5AVQA 5A02A 2J0UB 4RSGA 2YJNA 4XYBA 4QYXA 4DREA 1Y8ZA 2R6FA 1NC3A 2C04A 1WY7A 3NT5A 2HMUA 1TCAA 1KO7A 2XNSA 4MQEB 5IVDA 4NYIQ 5ALZA 1L1QA 2IH5A 2IXTA 1I9GA 2GF9A 1U7OA 1O95D 1W73A 2EG5A 2R84A 2X8AA 2V6MA 3IPLA 1FNCA 3T3HA 4B4VA 1WBDA 2OZLB 3WB0A 2FA9A 3ECAA 5C7OO 2QSYA 1S3GA 4CUJA 5A06A 2VUTA 3K92A 3EARA 2NU8A 2DGDA 3LQ1A 1HT3A 3OQIB 4HX2A 1F1BA 1LH0A 1U5BA 2C98A 2I29A 3ZCVA 4EG7A 4ENUA 2IBTA 4GICA 2GXAA 3R3XA 5JECA 5I8ZA 3N2GA 1XIVA 4P2GA 3UMJA 3W5BA 2Z6UA 2JIDA 4E0BA 2XCUA 2P2SA 4JBIA 3ZCQA 3OQHA 1DBWA 2IF2A 4B1FA 3PEWA 2IS4A 3OIYA 4F93B 3GV0A 4W5TA 1GOTA 2J33A 2VJLA 1OY1A 1Y33E 5HPYB 1VKRA 1VG0B 2E4VA 2I67A 1N2ZA 3KZOA 4P34A 5A9SB 2QZZA 2BFBA 3GMDA 1MABB 3G2LA 3KL2A 3NVDA 1IJFA 1X15A 3ZYZA 1FSFA 3BPSA 3DOFA 2ZDGA 3HYLA 1BJTA 2LRHA 3GNTA 1P5RA 1W5BA 4TPKA 5FBKA 3A1FA 5ICFA 2XRYA 3H5OA 3A2NA 1D4FA 4TQUS 2VTBA 4P0QB 4EJ0A 3F3MA 1ZM7A 3P94A 1JGTA 1XZPA 5JUWA 1XA0A 4O63O 4HFMA 4X7BA 2WD7A 4UARA 5TLSA 4M1KA 2C95A 2P1RA 1EE2A 2WG1A 5CJPA 5FTWA 3TZEA 4Q4JA 4OH7A 1MAWA 3DV0B 3MM4A 1LRJA 4UE6A 1K4MA 2YWDA 2XUZA 3OUTA 3LP5A 4XJSA 4KFCA 2ODEA 1VCIA 1GYPA 2YVLA 4RCZA 4HT3B 4MMZB 5DSXA 4RTKA 3OD5A 3I8OA 1WMEA 1XDSA 2WSSA 2AHRA 4X20A 1U8FO 3O5AA 3K0HA 3LPCA 4BMSA 1LBQA 3KL4A 4K0KB 2PL9A 4QEDA 1BHQ1 3KSRA 4G25A 4CR8A 5KYXB 3QU2A 4KFSA 4TMTA 4E07A 3VVMA 5DNVA 2GRAA 1B8VA 1YOBA 1DWUA 4M9SA 5AICA 3QI7A 1LPAB 3TQRA 3VKVA 1N2CB 2Q07A 2OCDA 4S0XA 4LZZA 2GEJA 3AM4A 1CZKA 2D1RA 3MWEB 4OJNA 4TKUA 1KP2A 3IA2A 1EDEA 4RHYA 5LWHA 1O4WA 4UREA 1IBMB 5HQJA 3O8RA 4RVGA 2QUZA 1P1RA 1VBNA 3CZ4A 2J46A 5IVKA 3I52A 4YCBA 1E1RD 2J67A 3FHTA 1POWA 3VR0A 1IHUA 1ZQ1A 2JFZA 4I19A 5BNZA 3GJ7A 5JALA 3CBQA 1XTIA 3LPDA 4X64B 2BT4A 1QO9A 1MTOA 2C7GA 3GUCA 5BN5B 1I3CA 1M1ZA 3MIZA 1VL2A 2HQ1A 1RABA 3GARA 1ZNZA 4FLEA 3DMGA 4NH4A 2VYVD 2ZUCA 4RLHA 4CM5A 1V96A 2EC5A 1XHEA 4DL9A 1JDZA 1M76A 1YR6A 3CRW1 3KOXA 4HGRA 5LYJA 4Y0VA 3W8FA 5C37A 3K6SA 2NXWA 1VG1A 1J5XA 4EGCB 3K53A 4MVYA 2HMTA 3TEFA 2NTJA 5IJ0A 3VO2A 2MSDB 1KQPA 3N2NA 4ADSG 2ZVJA 1THGA 4Q48A 2OV3A 4WN9B 4Z9YA 3R9KA 2GEFA 1C3LA 1DBRA 1BW9A 3WAJA 3W5IA 3EXG2 3ANXA 2AOUB 4TTSA 2NO5A 3DO8A 2VO1A 1L5SA 5DLDA 2VPYA 4D45A 1M73E 4CN8A 4EYQA 3G89A 5K0TA 1F8GA 4GXNA 3EVTA 5KNCH 1GAQA 4IWXA 3DDCA 2I6SA 2VNHA 1FPQA 2DF8A 1IONA 1UANA 2CXUA 4PLZA 2NV6A 1N4DA 2BVNA 1PWZA 3DEHA 4JUAA 3L40A 5DOZA 1NOKA 2FSHA 4Q47A 2HO4A 2OFFA 5HNKA 4U7DA 2NP6A 2BR3A 3IHKA 2W6JD 3ER9A 2OPBA 1XC7A 3JQAA 2FUEA 1ZR4A 4Z9BA 3RSSA 3A37A 2HBYA 1GG5A 1FF9A 2MR5A 1GN8A 2JJ2D 1TK2A 3CGGA 3KPWA 5LNK6 2QEQA 1K8XB 2V7QA 4QECA 2RBGA 1C41A 2POQX 3GZNB 1Q83A 4HPJB 4DSAA 5B12A 5BNTA 4XH9B 4H1VA 2F6RA 5I9MA 1Y34E 1HOXA 1UBUS 1T34A 2NM0A 2RB4A 3GW8A 3HU5A 3R7SA 1N9GA 4GIBA 1Q0RA 3HEAA 3OTQA 4WQMA 3FWZA 3ILYA 4U63A 2AR7A 2P4SA 1GFSA 4MR8B 3JARB 4P92A 2NYVA 4MGHA 3RBXA 1EDBA 4DNPA 5K7SA 4H7FA 2F3RA 3C15C 4GMGA 3THOA 1JBKA 3TXAA 2PX8A 3DDUA 4B6RA 4DUYB 3DFZA 1AUXA 3EMBA 3JQ6A 1AKNA 5GIOE 2RGRA 3HUFA 1DC5A 2PRIA 4ND8B 4ZT7A 3E27A 2GZDA 4LNAA 4A2PA 4CTJA 3QHPA 3ZCRA 3F8TA 1OT3A 2YRXA 4JLNA 3RK1A 2BV3A 4KE6A 1WXXA 4CM9D 2GARA 1NUSA 4KN8A 1IPEA 4MGYR 4ER6A 3SP1A 2V6GA 3CA8A 1NXTA 2CJXA 4QDXA 5IMBA 3RO7A 1TUEA 3M6VA 3VTKA 5KSYA 1OI7A 1XRSB 4PPGA 1EXNA 3N2ZB 4NABA 4DADA 4DQXA 2FR0A 1UK7A 2PD3A 1FTNA 2YJTD 3G7UA 3K3PA 3KFXA 3RASA 3OT4A 3GUZA 4NAHA 2QUKA 3VVBA 5HRCA 1YE5A 2J3HA 3U26A 4D79A 2JLSA 5C3MA 4H6WA 1LDBA 2B1QA 3AYXB 1E9RA 2AFIA 4WY2A 1QZZA 4JLVA 1G8AA 3OMWA 3BIXA 4WDRA 1MW8X 3I4CA 3X43A 3ZWPA 1V7PC 1D2EA 1KO5A 5ISMA 4E4TA 1KYWA 2I76A 4RVCA 2YCBA 2V96A 5DO9A 2WWVD 4UKDA 5BYJA 3T3MB 3H2JA 4REQA 1RI4A 2HM7A 3REQA 3T3EA 1DVRA 1CRWG 1KI7A 1N5RA 1FU8A 1P1IA 3BWVA 1N5KA 3H3JA 5CLQA 5A3QA 2C2XA 3NNSA 2HN9A 1J2UA 4Q9IA 1Z45A 2HQSA 3ZJTA 4A3SA 1GRNA 1ETUA 4AKHA 3I2KA 1XRMA 3PEFA 3D7NA 2VXOA 4HRXA 2NVBA 3QYAA 4L5IA 4OHRA 3JQFC 1PL0A 4KYVA 3WWDA 1J5EB 1T9DA 3CEPB 3R5TA 2VNIA 2WM9B 4FX2A 4WNIA 5B3KA 1V8FA 1C9MA 4BP1A 1M7BA 2FRVA 2YFHA 1JEQB 1QE3A 5AW9A 1QYIA 1E8NA 3G9XA 4RPHA 4MAAA 1KMCA 1B16A 1FA9A 3EGWA 4UU0A 5HQ3A 2IY8A 3ZCUA 1Y9EA 1EJ6A 2E5WA 1QH8A 1U9IC 4RKEA 3U39A 2O0MA 1SQSA 1K6JA 3UMFA 3KPYA 3SQMA 3ZGLA 5IT5A 6REQA 1FNSA 2PGLA 2AG0A 2RK6A 5HF6A 4KDCA 3MWJA 4US0R 4D8TA 4TUYA 2HMSA 1JMVA 1LTHR 1JXQA 2VAXA 3I28A 1UEXC 1X38A 5GGXA 3U3DA 1XAJA 2E0IA 1VKZA 2QTRA 2QL9A 3D8NA 4KG7A 3U9LA 3VC1A 4R71A 1TYZA 2F1IA 2W4MA 2Z4TA 2ZJ1A 2CHQA 4I3FA 4P38A 4ZI3A 3GBPA 3KOWA 4J1SA 2VQ6A 3OI7A 2P2DA 1P45A 4FC7A 5TF0A 3BXHA 1J39A 1KI6B 1KP3A 1OXSC 2D4AA 2O50A 1UJ4A 1WXQA 1OZGA 1Q6YA 2NSLA 2W2KA 3HC7A 4AJOA 3FYUC 1GG9A 1ULTA 3RS0A 1JHXA 1T3ZA 3RVLA 2PT7A 3B5IA 3TSCA 2HWWA 3OY7A 3UKJA 1Y5NA 3GH1A 1RYNA 3AESA 1JTVA 3I83A 4FCTA 3EGCA 3HDVA 4YRPA 4RS4A 2OK7A 5T6BA 3YASA 3ZLVA 1ML3A 1XJWA 1WV0A 2INGX 5GMOA 1KTIA 1GTSA 4M1WA 3BHNA 1O0CA 2ZBVA 1U63A 3QSYA 3RGGA 2NQTA 2P11A 3PL1A 4WBXC 4RFVA 4EHBA 2VT6A 5JO0A 4J76A 1M66A 5H80A 4DA9A 1PV1A 4GMHA 4INJA 4HB2A 2YKGA 3OOJA 2B8JA 3C7KA 3KVYA 3HLYA 2ZT5A 1PWEA 3BEDA 3LECA 4D4KA 1U6KA 4UNRA 1IMOA 4L4RA 1IXRC 3GFQA 3O0TA 1ZIOA 3FKQA 3IR6A 1V4NA 4BDSA 3RTDA 8GPBA 2FMIA 3HRHA 4MWTA 1JH9A 1R10A 2R11A 3TDKA 2B2CA 1DIAA 4I4TF 4FCVA 4IV5A 1XTVA 3CISA 5KTNA 2VLBA 4GUAA 3R23A 4U7FA 3CS3A 4RK6A 1GTZA 4X91A 1E3EA 4QU8A 4ZHQA 2ZUEA 4JLKA 5JNRA 1OXMA 1B73A 1ES9A 1NW5A 3DDNA 3DH0A 3W5JA 1E3LA 2I4MA 4OHPA 4DRXA 5HMLA 2AOTB 1G8HA 4C0KA 4MVXA 3ZK8A 4S05A 3EX7C 3LYAA 3OMXA 3NORA 4M8NE 1FRNA 3S55A 1MA0A 3SSMA 1TTTA 5ECYA 1MO2A 2Q2VA 4WI1A 3USZA 2JASA 1SULA 1YIOA 1HUQA 1LSOA 3HY6A 4BC1A 4ANFA 4Y1RB 1Z18A 3SGLA 3PQ2A 1E6CA 1KJIA 1YJQA 2PT5A 4B71A 4UOEA 2W90A 3VUEA 3A9WA 3L8FA 4YP1A 4AZ0B 2R44A 4KLCA 3FNFA 1PDVA 2IX9A 2BSAA 3VPCA 2ZJ6A 3CH4B 2OOSA 1CUYA 4ZKEA 4P3KA 4IOMA 1ACJA 1D4ZA 1Q50A 3U44B 3OTIA 5HIAA 1ZD4A 1VRCA 1Q0LA 1M5TA 2Q1YA 2O1WA 3PC8A 4Y98A 2JFUA 3P0EA 2BRUC 3NIDB 5KX5A 1PRYA 3GWGA 3OIGA 5EP4A 1YD7A 1ENOA 2HFJA 2ZU0C 4Z51A 5AW3A 2IEAA 2H1WA 1U8TA 1XCGB 2HIMA 2WSLA 3E3OA 3L18A 5ICEA 3URKA 1DMSA 1EJ0A 1L5MA 2I99A 4HB4A 3MJHA 1EDZA 2WA1A 4MUXA 3EVNA 1VE7A 5AT1A 3ZE1B 3O3MB 3E9NA 2FSPA 2QJTA 3SICE 4B0PA 4BX9A 3W4JA 1CIPA 2OFWA 3KFLA 2PXXA 1WP4A 4TWZA 1JHOA 3AP3A 4HZGA 1IHYA 1UPAA 2HXYA 4WKPA 5FI5A 2CV1A 2TMDA 3WBJA 1NVBA 1US8B 5EPOA 3PE6A 4C5BA 2EJUA 4ZCPA 4Z1MA 4DQKA 1UDXA 1ULZA 3LQYA 1YQTA 1Y3BE 4N76A 4RVDA 2ID4A 3DTNA 3KKMA 4HDCA 1A8PA 4LHSA 4WLOA 1XTJA 4C04A 2WQZA 1UBRS 1EQ2A 2BFFA 2E6UX 4CT5A 3UAZA 4UD6A 5J43A 2XQJA 5FLKA 5M2QA 4X1YB 1BE6A 1R4ZA 1YDHA 1R37A 3CKMA 1C8VB 5E4JA 3ZHTA 1ADJA 3RVBA 1CD5A 2GZHA 4U5XA 3FTPA 4H59A 4YNBA 4RD4A 2V4ZA 5HFAA 3WO0A 4ETMA 5ADHA 3EHDA 3RYCB 2JHGA 4AURA 4AO8A 2J4FA 3GPLA 1JEEA 3AOEC 1EWQA 3VTZA 3QFCA 1JNYA 3PXUA 3O6VA 3AIOA 4ZV4A 5C80A 2RAUA 3OH8A 2MYNA 1EM6A 4L0QA 5CCEA 4A16A 2FQXA 1XEWX 2JL1A 2D06A 2RKOA 3T7JA 3VNUA 4M9QA 2B8NA 1TGVA 3GGJA 4XVCA 4HNUA 5FT9A 4PO8A 1VBMA 1UBEA 1N6RA 2PWZA 2CL7X 3HJHA 5BR8B 3NHPA 1SK9A 3M3DA 2GK4A 1ZN8A 2WYWA 1T6YA 2FK8A 4I55B 4DSOA 2IDZA 2ZUTA 3PX7A 1M7HA 3EMVA 1MMFB 3PU6A 1SVWA 2O3QA 2WC1A 3AUJB 3H9BA 2WTMA 3KEGA 4FC6A 4LECA 3ZVMA 1PJLA 3N53A 4LYYA 1CS0B 4IUDS 1JU4A 3PNLA 4JKOA 5TMPA 3V5NA 1N8KA 4BYGA 3AY7A 2I3GA 3RYHA 2B4KA 5AKJA 2J87A 1DQNA 4P8RA 1C80A 3FPLA 3H75A 4WIAA 3ZN2A 1SUCA 2GA8A 2O05A 3FBTA 2WWWA 4JLAA 1K68A 2JH3A 3NTVA 1ZVKA 5I4BA 1DC4A 4IYRA 4II2A 4TSKA 2MCFA 1U8CB 3D6FA 1HMPA 2JKZA 1NPTO 3EIOA 4DLPA 4B7UA 3I58A 1CE8A 3LVBA 2CDNA 3DOEA 1JAZA 1LKZA 4B4OA 3OJXA 3GC6A 3HBJA 5C3UA 4BBPA 4D9HA 1BTOA 1ZA1A 2C00A 2XUJA 4O3MA 3G6WA 4DBZA 3VA7A 1FZQA 2IBSA 2P4QA 2QQGA 2XUDA 1PQWA 3ITDA 3L1UA 4KW7A 4BO3A 3N8HA 4G8BA 4N54A 4FE7A 2QRVB 4ARVA 2OORA 1PWHA 3EGIA 5C8YF 3GLQA 3KQWA 2ZUUA 2CXPA 4EW6A 4RZ2A 1M2JA 4XQ9A 3CU5A 2FZLA 3WC4A 4EABA 2AMVA 1CR2A 1PR3A 3G02A 3M6LA 4NBTA 4F2GA 5F98A 3K0SA 4I08A 1WW8A 4IDAA 3DZCA 3TTWA 1UXKA 1UK6A 1NZFA 4I8XA 4TRJA 3H6HA 3OOEA 1QHNA 4I2NA 2DBVO 3DZGA 5K05A 4MV3A 3GNSA 1NIPA 2J3MA 2DX7A 4RD1A 4DGSA 5LOVF 1E3SA 3DDZX 4FI3F 4ERNA 3G0HA 4UFPA 5I7OA 1GCUA 1N92A 3Q3IA 3K6JA 1HX7A 3I32A 4GM4A 2QRZA 3M3PA 3IEKA 2YNMC 1Z47A 4A8JC 4ML3A 2BMWA 2P8SA 3B38A 4MRAA 4UQOA 3MS7A 4XFJA 3CZMA 4WCDA 5FO1A 3U9SA 4H77A 1DTWA 1YH3A 2W2QA 3I5YA 1Y3FE 2VSNA 3QSGA 4CIXA 2UU9B 4Q9JA 2ZIVB 1EINA 4HWKA 4ZO6A 1EFVB 5IDYA 2IPMA 4MV4A 5EKUA 1GPAA 1O08A 3PUIA 2CV0A 5KOHB 3WJ7A 1IB6A 4F21A 3PICA 2FX2A 1W5TA 4Q93A 2AFHB 1GSIA 2YXDA 3E7DA 5K3OA 1FFAA 3VZSA 3U40A 2OXTA 3U0VA 2V7EA 4E11A 4WCFB 5FYQA 5H68A 3QF7A 3QNUA 5CDHA 5ALXA 2VT3A 1P5HA 2B3DA 2GAFA 4ASUA 3C3XA 5C5CA 5FNVF 1TZBA 1D1PA 1A5ZA 2GESA 4KREA 4G36A 3NHZA 2JBAA 1U1IA 2I2WA 2KLBA 4ZTBA 4ZTUB 4NY1A 5FBHA 2AG6A 2IBMA 3DDOA 2F1RA 3OPYI 3W2IA 4DIDA 3BD9A 4L4SA 4DR5B 1B0ZA 4NIMA 4BX8A 5FX2A 1DJLA 2Y1GA 1VDZA 1EDOA 1SUAA 1EGAA 5EL0A 1P0QA 4LYHA 1E6WA 4MWBA 2UUCB 5HF5A 3OIVA 3A6FA 5LQNA 3QWIA 3E2IA 1W5EA 2H1IA 3RVQA 1NQAO 2ZLBA 5CYPA 3AG5A 5BPHA 2C2HA 4JP1A 4PSAA 4WMLA 1ECJA 4UDXX 3C0KA 3MUOA 4O4LF 3SZUA 4E2WA 1EUCB 3GEIA 3D1VA 5AOAA 2BFDA 2FQWA 1GA4A 1UT5A 3P97A 2QYTA 1E3QA 3ZHYA 4KQFA 3TZCA 1KVQA 1WKBA 3KV3O 3WB1A 4RJTA 1C0KA 2R65A 1KQ3A 2AN5A 2WMOB 1YZVA 4O3FA 5JBQA 3EUAA 3HZRA 1H2FA 2DPLA 2GVDC 1VRVA 3K71B 2OGWA 3JR3A 3HBAA 4R01A 3SHVA 2DKOA 3WK9A 1QVRA 4YUAA 1QFYA 5BYBA 3SS8A 4URFA 5LBIA 1Y3CE 2VXBA 4RIIA 1EA7A 5L3VA 1BS1A 4HDOB 2G9VA 3HXPA 2NG1A 5A5GA 4JQOA 5AW8A 3FSJX 4E5SA 2IEBA 1DKOA 4PZYA 3Q0EA 3U37A 3EZ9A 1WABA 1KJWA 2BFBB 2EVWX 4MARA 5I9LA 1JG4A 1CP3A 4IIJF 5EZ5A 1GAJA 2B5WA 3TS1A 1BN6A 2GUWA 4F1WA 1YCFA 5KQGA 3DEAA 1JDPA 4JR0A 1UZLA 1NGSA 2AI2A 5IRCD 2ISCA 2QR3A 4LIPD 2J59A 5EP1A 5EPUA 3HFSA 1DWOA 1L5ZA 4FMDF 3HFJA 4A10A 5ICCA 5ILGA 2VTBB 4OJQA 1G3IA 1YAJA 2AT1A 3GNQA 4G89A 2XUGA 1J2YA 4L4UA 5B7NA 2XZTA 3M6MD 2WD7B 1PJ4A 1CBUA 2GBIA 1UBJS 3H8SA 4YCJA 4D7AA 5BOVA 3ZV4A 1S01A 1DRUA 1H22A 2G04A 4Q4JB 2ZSIA 5ALWA 3LPAA 3RRMA 4QGSA 4F3YA 1BSVA 2FDRA 3LQKA 2GBLA 4F8YA 1D04A 4UEWA 3LQQA 3GP5A 3NHLA 4E14A 1NJ2A 1KVSA 1LS1A 4LY3A 1Z8NA 2ZAMA 4BATA 5C7LO 4RY8A 4B3RB 5U1PA 4LYFA 4HDSB 4ETIA 3KPVA 1PG2A 1JIKA 4PU0A 4HXEB 3B9PA 3EA5A 4ER3A 2JFGA 3CB4A 4HEQA 2OHHA 2CMFA 1E9CA 5EMNA 1H8EA 4O1MA 1Z17A 2ZWIA 3SYMA 2AOVA 3LTNC 4M9ZA 4TMYA 2NUPA 1V1RB 3ZNPA 3DVAA 5FOVA 1U6IA 2FW6A 3D8HA 3UAWA 2CFSA 1YTUA 5CEFA 3GQBB 2GPAA 1QHHA 2H9AA 2ZAIA 1EH5A 1QIHA 4B3SB 4GE0A 3FFTA 4HG2A 4FJ2A 1Q1AA 5BSMA 3TCXB 3WWPA 1CNFA 1ZBQA 1FPMA 2AKAB 3O1LA 5D6NA 5EOVA 1Y4DE 3D31A 4D0GA 3ZW7A 4KWIA 1DEAA 1V26A 1Y6GA 4J2HA 3CH5A 1HRKA 3CZ9A 3L4SO 2VEOA 5F77A 2R6AA 1N6LA 1ISHA 1T4GA 3MJEA 4QZVA 4ACBA 2CNNA 2VHYA 1QH9A 3JYOA 4O4IA 4YROA 2YY7A 3GEGA 2YY6A 4B84A 3LDUA 4XRRA 1E2JA 1MKYA 1T2UA 4BUJA 2V5AA 5LYJB 3K6SB 4BY9E 2XOEA 2PDAA 4O6VA 1XO1A 3T1QA 4BGVA 1EG2A 1VHTA 3VSAA 3DMNA 5DX1A 3CRNA 1P4GA 2BCEA 4TLCA 3RADC 4ZODA 3NYIA 1MUUA 13PKA 2FEKA 1BW9B 2HZ7A 3CPJB 1NLZA 1GQFA 3G1UA 3LLSA 1OKKD 4IJUA 4RZ3A 3TLBA 4UHCA 3ZHUA 4EUHA 4WL0A 1FS5A 3PFHA 2A88A 2VPPA 3IPRA 2QRJA 1VLZA 2DERA 3DNMA 3QPBA 1O5OA 1M8KA 3WNDA 3TLGB 5JEDA 1WXEA 2R48A 3A6KA 3X1ZA 2PN1A 3MT9A 4KI7A 4EG4A 3TFWA 3EGDA 4BQEA 1NXWA 4WXRA 1DUVG 5B2EA 2YWHA 4OHUA 3OQ6A 3CW2A 3ECCA 2Q3HA 3BXFA 4B48A 2R7NA 3KCNA 4X3CA 4E5VA 4M9UA 3JQAB 1AXRA 1W0JA 1PJSA 2PKYX 5IN4A 2ZXUA 3L7AA 1A7AA 3QK7A 2QN6A 2I3DA 2CEKA 3D1LA 4B2YA 5FKJA 5EVCA 5L3QA 4FE4A 4OYYA 1ULAA 1BU8A 3EC1A 4LYEA 2PTGA 4CCAA 5JD6A 1W4LA 3W79A 1KK3A 5LR6A 3WJ2A 5HTOA 4LF8B 4YRNA 1RYMA 2NU7A 3RLIA 1DC8A 1EP1B 2E4AA 3H9UA 1N2JA 1QH0A 3RLFA 4A0HA 4YAKA 2AVDA 1RI2A 1B1CA 1A2KC 1BXRB 1XD8A 2C59A 2FFBA 3BD7A 3H9EO 3HLTA 4QUEA 5LA6F 3W7BA 3LNTA 1DARA 2BFCA 3NEYA 1QCDA 1QIEA 2BR5A 5P8WA 1DEHA 5EXPA 5DXJA 1T8RA 2CJPA 4UAJA 2PIAA 3WBFA 4YUXA 2IYAA 2DFTA 3QPAA 4OXIA 4QG7A 4N6OA 4HEA6 4MIEA 5A1JA 4CIDA 4ZYZA 1VLHA 4KIUA 1CHDA 4CKCB 1TRKA 2DOKA 5KNCD 2AJDA 1S3FA 2H65A 3D59A 1JSCA 4KFTA 4C4TA 1W4ZA 2XE4A 4BGEA 1N9ZA 2ZWOA 2XTAA 3BULA 1OUMA 3EJ6A 4ZI7A 4QBFA 4AY2A 1SHKA 4WVFA 4DBVO 2CFRA 5FFMA 5JATA 1PR0A 3PFWO 1VP3A 3VU9A 2Z30A 3WYCA 3GI1A 2GM4A 4JBGA