2HFJA

Pikromycin thioesterase with covalent pentaketide affinity label
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
284
structure length
279
Chain Sequence
AGMFRALFRQAVEDDRYGEFLDVLAEASAFRPQFASPEACSERLDPVLLAGGPTDEGRAVLVGCTGTAANGGPHEFLRLSTSFQEERDFLAVPLPGYGTGGTALLPADLDTALDAQARAILRAAGDAPVVLLGHSGGALLAHELAFRLERAHGAPPAGIVLVDPYPPGHQEPIEVWSRQLGEGLFAGELEPMSDARLLAMGRYARFLAGPRPGRSSAPVLLVRASEPLGDWQEERGDWRAHWDLPHTVADVPGDHFTMMRDHAPAVAEAVLSWLDAIEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Macrolactonization by the Pikromycin Thioesterase
pubmed doi rcsb
source organism Streptomyces venezuelae
molecule tags Hydrolase
molecule keywords Type I polyketide synthase PikAIV
total genus 98
structure length 279
sequence length 284
chains with identical sequence B
ec nomenclature ec 2.3.1.239: 10-deoxymethynolide syntase.
pdb deposition date 2006-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00975 Thioesterase Thioesterase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2hfjA00
1UK8A 3EIOA 1DT3A 4A16A 4IQ4A 3DL7A 2BUBA 1XRQA 5HZGA 1XZBA 4DNFA 2DR0A 3A2MA 3FBWA 3WLAA 1MT3A 1H2WA 2ZSHA 2OAEA 1VE6A 4FKBA 4OSEA 4LKOA 2OGZA 4HXGA 4GEGA 4N8DA 4EZIA 4DIUA 1CUEA 1DU4A 4LXIA 1J1IA 5C81A 3WKEA 4OU4A 5I7UA 2OCLA 1QZ3A 5LIPA 1E5TA 3FLAA 5E4YA 4X7BA 5CT8A 3R3YA 3D2CA 5LZ7A 1XZLA 2XQJA 2ZVDA 1XQWA 4UFOA 5AI0A 1JFRA 4DSAA 3D5EA 4X95A 1H23A 2Q0XA 3DYIA 1ORVA 1HDEA 2WUGA 5DYTA 5BWCA 1LPNA 4INZA 4M0FA 4E11A 3SC2A 4UBLA 5JAPA 3VJKA 3H2HA 2Z8XA 1ZD3A 1CUDA 2DFPA 1BROA 5T4HA 3JYHA 1OCEA 1A88A 5FKJA 1CVLA 4JH0A 5E4JA 3C8HA 1XZEA 4FOLA 3FCXA 1IZ7A 1ACJA 5HK8A 1BN6A 2HA0A 1FFCA 1AKNA 3DKRA 3FYTA 2YXPX 3D2BA 2WIKA 2WFZA 4QDXA 2Y2UA 1RP1A 5HFAA 1FFEA 1U8EA 1SCIA 5AK3A 2Y1KA 3AIKA 1EXWA 3C6YA 1EK2A 5AM0A 5LKAA 1ZIYA 1EDEA 4RNCA 4MYSA 1ODTC 1MAAA 2XT0A 5JYCA 1WCYA 1UK9A 3HEAA 1ZD5A 2PX6A 5FLKA 2QUAA 4PSUA 4CCWA 3H2GA 4UPDA 1MPXA 3WK5A 1NU8A 4J0DA 5BOVA 3UUFA 2XUOA 1LPSA 1B41A 4AZ3A 2EDCA 4X97A 3C5WP 5AM5A 2ONCA 2WIDA 4G8CA 1SC9A 4WDQA 4L72A 4Q3KA 5H3HA 4M0MA 1W1IA 3C43A 5JZ9A 3R3UA 3DKKA 2PSEA 4U2EA 4TPKA 1WPRA 4ZWNA 3PICA 4DNPA 4EB0A 1CUCA 1QO9A 1UK7A 2PUJA 1LPPA 1TIBA 3WKAA 4OB6A 1YA4A 2XUJA 4J03A 4ZV7A 2ECFA 3FAKA 5LKRA 1JJBA 2HU8A 4FNGA 2O2HA 4K2AA 2WKWA 2XMBA 3O9VA 1VA5A 3WK8A 1CUYA 2HL6A 3G0BA 3WA6A 4MWTA 3R3WA 4L0CA 3ZLVA 4WCVA 4F60A 4PV7A 5KWIA 3F98A 3TGLA 2GZSA 2HU7A 4B83A 4WDRA 1CV2A 2JGIA 1XRRA 4H7HA 4C4YA 2DSNA 5A7FA 2B4KA 1TCBA 1Y7HA 3BIWA 5AKGA 1BEZA 3CXUA 3W05A 5ALNA 1LPBB 4YX9A 4KE8A 2IITA 2C5FA 2R11A 2PUHA 3PUIA 4C4ZA 3G9ZA 4FFVA 1H2YA 3G0DA 3R40A 1QE3A 4ETWA 5AH0A 2OCGA 3WWCA 1O6FA 2ACEA 4GECA 1XKLA 3I2HA 4KAJA 2FX5A 1YS1X 5CT5A 5HK9A 4PSDA 4UBOA 4NVRA 5IVDA 3W9BA 2B9VA 3B5EA 4BZZA 2QZPA 1ODCA 1W4LA 4LHEA 5LZ9A 2PSFA 3F97A 4UBIA 5ALMA 3P2MA 2QJRA 3LP5A 5EIEA 2B20A 4CCYB 1MO2A 1WHSA 2JGEA 4QLAA 2ES4A 4MQLA 1MX5A 2WU4A 4Q05A 3AUKA 4H7DA 4JNCA 5A62A 1GKKA 3G0GA 4BAGA 1L7AA 4FMPA 1YA8A 4QDTA 1TKRA 2HM7A 2XQFA 3ZPXA 1U4NA 1VZ2A 1PFQA 1DWPA 1WB5A 4O08A 1O6GA 1UKBA 3V1LA 4UUQA 3F96A 4UHDA 4WY8A 1NX9A 5AK6A 5AI6A 4MEBA 2XUIA 2Y2VA 1FJ2A 4H7KA 3RKSA 4UFNA 4W1RA 5ALVA 5A6VA 2C7BA 2FJ0A 3G9TA 3BF8A 4DGQA 3HYSA 4G1FA 3O9MA 5EI5A 2RHWA 3W2TA 3V1MA 1CEXA 3ESBA 3KD2A 4B0OA 3STXA 2JBWA 3WJ2A 3X3HA 2XLBA 4GW3A 5ALYA 2GBCA 1E66A 4K5QA 4Y7DA 4H77A 3WK7A 2G63A 3O4HA 4Q1VA 3OPMA 1C7JA 3WWDA 4BC1A 5ESRA 4BVJA 2CZQA 5ALDA 1QTIA 3D0KA 4GBGA 1UKCA 1ZI6A 2DHCA 3R41A 3K9BA 3ESDA 5AOCA 3FSGA 5CXUA 1CQZA 5HQ3A 1CUZA 2CEKA 1A7UA 4C87A 1QOZA 3G7NA 3DL4A 2JGMA 4Q3LA 1LPAB 4FFWA 5ALWA 1TRHA 1UOOA 2DQZA 3ZLTA 1G42A 4HXFB 3GA7A 2BJHA 5EHQA 2ACKA 1RYYA 4DYHA 2VA9A 4A5SA 3FVTA 1G5FA 5CXXA 1EX9A 3BJRA 1R50A 3OG9A 5CW2A 4HRXA 1X2EA 3C6XA 3GZJA 3IUNA 4J0JA 4P93A 1LNSA 2QXUA 5E2IA 1CUSA 1XZMA 4G5XA 1YCDA 4KE9A 2VJDA 4Z49A 2XE4A 1XLVA 2X5XA 2VSQA 1B6GA 4B81A 4J0HA 2JEYA 4TGLA 2O7RA 5JAHA 3PDCA 1L7RA 2BCEA 3BDIA 5CRIA 5HKBA 3V1KA 2J4CA 4BRZA 4BVKA 2J3DA 4AB1A 5D3ZA 1FFDA 1F0PA 4DSZA 3TRDA 3PFCA 5EGNA 3BF7A 4N5HX 1AC5A 5AK4A 1YASA 2WG2A 5ALOA 1K8QA 4HTAA 5AOBA 4QLOA 1SCQA 2HRRA 1IVYA 3I2IA 2WTNA 2GYWA 4U2CA 3E3AA 1G4HA 1J07A 1BCSA 5CBKA 2QJWA 3R3XA 4Y2YA 5A7GA 1XZHA 4HS9A 5AKZA 5KWJA 1C4XA 1GXSA 4YPVA 4N8EA 2DHDA 1THTA 3QPDA 4XWGA 1XZGA 2IIVA 1IUOA 4OD0A 4WFKA 5LP1A 1E8MA 1XZIA 4G4GA 3IDAA 1P0QA 1CIJA 2VQ6A 3NOXA 3OTQA 3C8DA 1WM1A 5ALQA 2XQKA 3H2KA 1JT2A 4BCDA 3G9XA 4XVCA 1AURA 5AJHA 5AK5A 5K3AA 5AKIA 5HKAA 3F8SA 2PKYX 3STTA 4AN0A 4FBLA 4BB0A 4RPCA 4Y2QA 3AFIA 2JIDA 1R3DA 2AXEA 2DCMA 5JAOA 2XUGA 4HXEB 3GROA 1NU6A 4M0EA 1DWOA 1MNAA 3LIIA 1Q84A 5YASA 5DYWA 1JU4A 5ALJA 5ALKA 1A8SA 3RLIA 5SYNA 3MUOA 2XMCA 4H7IA 1MTZA 1GGVA 4YK7A 4PF1A 3ZLUA 1MN6A 3GELA 1QIDA 4L9AA 3LIPA 3H17A 2AJBA 1UFOA 3D3NA 3FYUC 3VVLA 3HC7A 4Y2XA 5AKYA 2H9YA 4IH4A 4U2FA 5ALLA 1VE7A 4Q34A 1FFBA 2AJLI 4G9GA 5K3CA 3VKFA 3N0TA 4W1SA 5AP9A 5ALPA 4P9NA 4LYEA 5C8ZA 2O2IA 2WFMA 5ALZA 1ZGCA 1AGYA 2WFLB 1EB9A 1THGA 2XUDA 3ED1A 5FPPA 4G9EA 5AI5A 2QKYA 4KAFA 5FV4A 3F9CA 5FDFA 1ETHA 1XZFA 3KSRA 5AM1A 2I3ZA 1MX1A 5FRDA 3PFBA 4BP9A 1HL7A 4UFPA 4OYLA 3IBTA 3S2ZA 1GZ7A 3HLKA 1CQWA 4X90A 5C7YA 1ZJ4A 2EEPA 4S0XA 3IUJA 4Y2TA 4KACA 1TQHA 3DS8A 4IHAA 1QO7A 4GI1A 4DMKA 1WHTA 2XUAA 3IVMA 2ZJ6A 2HHAA 3VISA 4K6GA 2VT7A 3PE6A 3AZOA 4CI9A 2OG1A 1XRMA 3C5VA 4H7EA 5KREA 1QGED 3KXPA 5DTJA 4BZWA 4ZV9A 5JZSA 4Q3OA 4ARAA 4ZGBA 1ODSA 4W1PA 2OLEA 5CH5A 1CUFA 1H2ZA 2Z5GA 1YB6A 3WA7A 1EINA 3ANTA 5ALUA 1WOMA 1XQXA 3WWPA 2R8BA 2VT6A 4NS4A 1LZKA 1WB6A 2W6CX 3ZV7A 2XDWA 4XIIA 2XB6A 2XMDA 4C88A 3QPCA 1CRLA 2X8BA 1WB4A 4AO6A 1K63A 5DNUA 1R9MA 3RM3A 2BGRA 3HACA 2H7CA 1GPLA 4BVLA 1XLWA 4CFSA 1YB7A 3A2LA 1ORWA 3PF9A 1JMYA 4G8DA 1QFMA 1UOQA 2H7YA 2PBLA 2ORYA 4EUSA 1BN7A 5FOQA 4KRYA 2AJCA 5AICA 4E15A 1H2XA 1F6WA 3I6MA 1PJAA 3K2IA 3PUHA 2ROQA 3WKDA 1MNQA 1EVQA 5DNWA 5ALEA 4IH9A 3TEJA 5EIHA 4BTLA 1DTEA 5LYYA 1CUXA 1VXOA 4BYMA 1BS9A 3W06A 2VAVA 1UZAA 5ALGA 2WQZA 4ROTA 4I4CA 3M81A 3L1HA 1DWQA 1D07A 1ZGBA 5JASA 2IX9A 1CUBA 3FSGD 1EDBA 2DQYA 2ZYIA 1E8DA 3NWOA 3CN9A 3WZMA 3WK4A 1IUPA 2WG1A 3MVEA 2PL5A 3ESAA 2VF2A 3O4IA 1QTRA 1CUAA 5JD4A 3A70A 1Y37A 2GZRA 2RONA 4BAUA 1VOTA 1EVEA 3BJMA 3BDVA 2O7VA 4UHBA 1Y7IA 2WLSA 4J0IA 2OPHA 5AKLA 3ICVA 4FLFA 2GYVA 3QMMA 2J3QA 2W22A 4MXDA 4EY5A 5AKKA 1UKAA 4FDMA 3PF8A 4ZI5A 4G8BA 2Y6UA 4ZREA 1XZKA 2VJAA 2WG0A 4ZXFA 2QM0A 3I6YA 5FPQA 5FP0A 4UHCA 1UT6A 4CG3A 1OXMA 5JD5A 3YASA 5LZ4A 1VKHA 2UZ0A 2PPLA 3D2AA 2RI6A 3I2FA 3Q0TA 4JYMA 2K2QB 2OCKA 4AZ0A 1XZCA 4LXGA 2XUHA 5IVKA 1E3QA 1ACLA 3NGMA 2XMQA 3DEAA 2C0QA 3WIOA 2JF0A 4XJVA 2JGJA 3B3QA 2RIPA 3DJYA 2CUTA 4MWSA 1N1MA 1GQRA 1XLUA 3EF3A 4DNOA 4EA6A 2HADA 4HAIA 5C8VA 3OOSA 3SK0A 2E3JA 4X71A 4G4IA 1DQYA 2G5PA 2H1IA 2PM8A 5D6OA 4RGYA 4BCCA 2RAUA 5JADA 2XUFA 2CB9A 4GLBA 3PI6A 4XX1A 3AZPA 2HA2A 2JGFA 5AM3A 5AKHA 1QIJA 2AJDA 3HI4A 4IH1A 4FBMA 2HA6A 2WHRA 4QWWA 3C6ZA 5I8PA 3Q8WA 4BBZA 3FNBA 1ISPA 4JYPA 5AOAA 4EY4A 1E8NA 4X94A 3AILA 1AX9A 5JANA 2P8SA 5ALXA 2WHPA 4LYDA 1EI9A 4WJLA 1ZD4A 4JEIA 4BRSA 1VZ3A 3GFFA 3ANSA 4KE6A 2VJCA 3BIXA 2WILA 1QJ4A 5JATA 3H1AA 3NUZA 2WUFA 4BDTA 1U2EA 2PSDA 2C4HA 3KDAA 3KWFA 2BUCA 3V48A 1ZI8A 2EDAA 2WJ4A 1BEEA 2WUDA 4GXNA 5C8XA 3G8YA 3WWEA 2ZSIA 4QDZA 2XQGA 3MUNA 3E0XA 2RGUA 2HFKA 3E4DA 4WY5A 5HF6A 1EB8A 1UK6A 5CURA 4EBBA 5D7BA 4DMFA 3WL6A 3FLEA 1ZD2P 3W04A 3STWA 1YS2X 2HIHA 2BAGA 2OQVA 4H7JA 2QRUA 3STYA 2PU5A 5AKXA 4H0CA 5AIBA 4Y2RA 3K6KA 4UBJA 2WJ6A 3DDUA 3ZI7A 3WYNA 1GKLA 2WTMA 2OQIA 2HA7A 2QT9A 3LS2A 3R3VA 3R3ZA 2BKLA 1YAHA 5DLPA 4Y2VA 4OU5A 1MAHA 1CLEA 2V97A 1P0IA 4BAZA 2ZYHA 3AIMA 5HF9A 4J7AA 4Y9SA 1USWA 3IULA 3M83A 3I1IA 1LBSA 1J2EA 4L3WA 4LXHA 1CUWA 2XUKA 5D3KA 4Y2PA 3TJMA 1XZAA 5AI8A 1H22A 4H35A 4RE5A 5HF5A 3QBJA 2OXEA 5AKEA 1Q83A 4FLMA 3AIOA 3IIIA 1ZICA 4HRYA 3ILSA 3C6BA 1K4YA 3STVA 1X70A 4PNZA 2WIGA 2WSLA 4X6YA 5HCUA 4AMZA 3O95A 2CJPA 1N5RA 2AJ8A 2WU3A 1CUIA 2YYSA 3IA2A 1XRNA 4AMYA 1EK1A 4U2GA 5CMLA 1HLGA 4NMWA 1F8UA 4DMHA 4E46A 1XRPA 4KYVA 3VJLA 1PV1A 1E89A 2RHTA 4PQEA 4B85A 1JJIA 1GQSA 3F67A 4GHWA 4NZZA 3G0CA 1CUJA 5IVHA 2V96A 1Q0RA 4W1QA 4BATA 5EIAA 5ALIA 2GBIA 3HJUA 2PSJA 3WZLA 3H2JA 4C01A 5HQ3B 3I2KA 4YASA 5T4EA 2JGLA 1ZIXA 3WKCA 5LZ2A 5AHXA 1GT6A 3EQ7A 5CT4A 1AMNA 5KBYA 4FLEA 2VATA 7YASA 5K3DA 5JZBA 2QOEA 4HZGA 4U2BA 1BCRA 1EHYA 3WK6A 4X91A 3UMJA 4EY8A 1UOPA 3I2GA 2C5GA 2XMSA 4EHBA 1LLFA 1CR6A 3QM1A 5CH8A 5AIAA 3WL5A 1XQYA 1CUHA 1XFDA 3V9AA 1AUOA 5CT6A 5LZ5A 2XI4A 3ICWA 3WYDA 3AINA 1JI3A 2CBGA 5JARA 4C6HA 4OB8A 1FSSA 3DOHA 4B82A 1AQLA 1CUGA 1W6RA 3FYUA 2V9ZA 3E1GA 1EDDA 2V98A 2Z3ZA 2QMQA 4FTWA 3BXPA 5K3BA 3UUEA 4AQDA 5A71A 3BE8A 2CMFA 1VXRA 1R1DA 3O4JA 3U1TA 3STUA 1VA4A 4UBKA 1L7QA 2DHEA 1XZDA 2PU7A 4B6GA 4MEAA 3AZQA 3WIBA 2G4LA 5EHZA 2OGSA 3HRHA 1WPXA 1IMJA 4UHEA 2WJ3A 3RARA 3L1IA 3LLCA 3IUQA 3OC0A 2I03A 4BE4A 1AZWA 4I3FA 3VXKA 3IURA 1HQDA 1QFSA 2PVSA 1KEZA 2YH2A 1EA5A 2QVBA 2G5TA 3WMRA 3V1NA 1A8QA 3T4UA 2C58A 4KAAA 5K3FB 4MJ3A 1XROA 5BV7A 4CG1A 5JALA 2JGKA 4AXBA 3FOBA 2XMGA 1VJ5A 2WIJA 1LBTA 1BU8A 3D4LA 4KR0A 2XMRA 1QIMA 1W52X 1XZJA 1BE0A 5DJ5A 3CCCA 2D0DA 5E4TA 3N2ZB 4B84A 5FXMA 5CTAA 3JWEA 4EY7A 4Y2JA 4UBNA 2X76A 4KEAA 3U0VA 1Q0ZA 1MU0A 1YAJA 4U2DA 4X00A 4B9AA 2NW6A 2BFNA 4I19A 5T4FA 3O4GA 2I3DA 1BRTA 1QIEA 1QONA 4Y2UA 5ALTA 5J3JA 1HKHA 4GWLA 1M33A 2BUAA 1G66A 5IVIA 5ISMA 5ALRA 4QWMA 1CFJA 1CPYA 4BC0A 1R4ZA 4Y2SA 2QS9A 1UXOA 2HRQA 4HVTA 4JUIA 1RWQA 2WHPB 3DQZA 4AX4A 1DX4A 4N8SA 3WWOA 3MGAA 5DYYA 2O2GA 5AKJA 2VJBA 2Z3WA 1N8SA 4X92A 3WJ1A 3DLTA 2GBGA 1TK3A 3VDXA 4A23A 4X6UA 4J0GA 3CCBA 3WQHA 5DWDA 4W63A 3QPAA 3T52A 4CG2A 3DYVA 1N5MA 1SCKA 5A2GA 3C70A 3QITA 3EQ9A 3M3DA 1F0NA 2XUQA 3HXKA 1QIKA 5AM4A 2HU5A 3QZUA 4F5ZA 4PO3X 1GPKA 5SYMA 4BCBA 3IUMA 4X85A 1JJFA 1LGYA 4CCYA 3FVRA 4QA9A 1KU0A 4G4JA 2CKMA 1QIIA 4P08A 2Y6VA 3I6ZA 1ZI9A 4IO0A 1KU6A 1Z68A 3QYJA 3L1JA 3G0IA 1K5PA 3GBSA 1P0PA 1U65A 4BE9A 2XQIA 3BWXA 3VVMA 5IKXA 5BWBA 2QR5A 5DNVA 3D59A 1C7IA 4B80A 2HA4A 3WL7A 3DD5A 2OCIA 3HSSA 5K5EA 3SWWA 4MYDA 5HF8A 4B9EA 4TVKA 5JIBA 3KOOA 3FLBA 1TCCA 2HA5A 2ZYRA 4B7ZA 4ZRDA 1LPMA 4MQMA 3DOIA 5FUMA 3SX4A 4QDUA 3ESCA 4K6KA 4BTVA 4LIPD 5AI9A 3ZWQA 1LZLA 3WK9A 4FNMA 1HPLA 3GUUA 3LCRA 5ALHA 5AI4A 1GPNA 4E14A 1YR2A 4QNNA 1SFRA 5ALSA 5I9IA 5AM2A 5CH3A 1DINA 2QTBA 4QDOA 4Q82A 2LIPA 3BL8A 3B12A 1QIHA 3JW8A 5JAUA 4KRXA 2FJPA 4QEKA 4H7FA 4DTCA 4J0KA 5HFNA 2Z8ZA 3I1YA 3VJMA 2XLCA 4PW0A 4OUKX 1J06A 2C0PA 3OM8A 4H18A 4KE7A 3I28A 1P0MA 2BGNA 3H2IA 2WHQA 4ARBA 5EHNA 4AO8A 4BDSA 3FCYA 5LLSA 3AJAA 1TAHA 4B0PA 4KJXA 1JKMA 1SOMA 3RK4A 3A6ZA 4C4XA 4F0JA 2JEZA 3W9UA 1DT5A 1YSCA 1DQZA 1JU3A 5T4BA 3S8YA 1HBJA 6YASA 3EBLA 1VLQA 3WKBA 5AO9A 5EFZA 3QMWA 3WL8A 3CN7A 2D5LA 4J0CA 1OILA 3D7RA 1QIGA 4X3CA 4DNQA 4PSCA 4UHHA 3R0VA 4ITVA 2HDWA 4P92A 1A8UA 4WFJA 4OYYA 4D9JA 2FUKA 3IB3A 2VEOA 3M82A 3QVMA 4DMCA 2HA3A 1DX6A 2XUPA 4F21A 2WUEA 3KWJA 3HZOA 2GYUA 1S8OA 1XKTA 1IZ8A 3DNMA 3H1BA 1MX9A 1ZOIA 5CT9A 4BP8A 5K3EA 4GDMA 1T2NA 5LZ8A 1CUUA 3H19A 3DCNA 4RE6A 2WIFA 4UHFA 3H18A 2VAXA 1UWCA 1XQVA 2B61A 2PSHA 4QE3A 4EY6A 4X6XA 1I6WA 4DM7A 3QMVA 3QH4A 1R9NA 1EH5A 2QUBA 5A7HA 1W75A 4OPMA 4C89A 4W9RA 5ALFA 3C87A 2ZJ7A 5IH7A 2VTVA 1QIFA 3H0CA 2I78A 1MJ5A 2J4FA 1T4MA 3EQ8A 4J3JA 4AN1A 2WFLA 2GBFA 3FWHA 4CIAA 3A2NA 1JMKC 3WI7A 4AO7A 1XRLA 4OCZA 4FWBA 1FFAA 1IUNA 1TCAA 1X2BA 3FYUB 5EHXA 2ZJFA 3G9UA 4WFIA 3HABA 2ZYSA 2OGTA 3C45A 3H04A 3OURA 4OB7A 2HFJA 4QZVA 1K6EA 5JD6A 2QXTA 4N5IX 4V2IA 1CUVA 2YASA 5F4ZA 2WM2A 1QLWA 2XMZA 4DLNA 1ZJ5A 1LPOA 3O0DA 2H7XA 4K6HA 5DTIA 3G02A 3I2JA 1W76A 2OAGA 4FHZA 1R88A 4UBMA 4X93A 5K3FA 4CIBA
chains in the Genus database with same CATH superfamily
1TW3A 2V6BA 1UK8A 2OR3A 1DT3A 1U28C 2A9FA 4K9RA 5E8RA 5A3JA 1MIHA 5FAKA 2HD4A 4NHOA 3TTVA 1NR5A 2GS9A 2BUBA 3FJ1A 1XRQA 3CNBA 1NLYA 4PPQA 1I2CA 2NM0A 3T7IA 1XPRA 4PRLA 5KOJA 4DFDA 4M1KA 4KDFA 2XZLA 1ARZA 3WLAA 3WRXA 3MWGA 4PPYA 4B34A 4Z5XA 2ZSHA 1FF9A 1NMZA 2E4XA 4FKBA 4LMRA 4MJLA 2PX5A 7ABPA 4N12A 2PWPA 4UQPA 2QAIA 4WQMA 3JU3A 5L7TA 2VH1A 5EQFA 4E4RA 3ZVNA 2X2OA 5KHAA 5CA0B 1FZQA 2CYCA 4NZPA 3T1TA 4HH3C 3EDYA 1GSAA 5C37A 1F6BA 1M1YB 5EZSA 3AEXA 4HQOA 5CU7A 5CFMA 3WKEA 4A0GA 1UJ6A 3DUFB 2VZ9A 4GOND 3U62A 3FUXA 4YRAA 2BFAA 4ON9A 3LF2A 3R6GA 2IEAA 2B6HA 2NU7B 4OU4A 2GZ3A 3U7FB 3VU9A 4G5HA 2MSLA 3H99A 4RO0A 1U0NA 4Q9KA 1QHXA 1H4SA 1U8UA 5E4YA 4X7BA 1RHRA 5EMNA 5C5IA 4EPXA 1OZGA 1W4BA 2IZ7A 1E3EA 4PLGA 3LPAA 1E3MA 3D2CA 5FYDA 5LZ7A 4AKGA 1XDDA 4DG9A 4CIDA 2DULA 4J75A 4DA9A 3KT6A 5FL7D 4HN2A 1VJ1A 2Q4RA 4YGXB 3UJ7A 3UH0A 5HIMA 1BOFA 1MPTA 5FPTA 4G5YA 1DO2A 4LY6A 2O8FB 1NT4A 2IPXA 4Q7LA 4Y18A 1JR4A 1RWOA 1SXJE 2DM6A 2HMYB 5BURA 5I7EA 1XCPA 4G81A 2D2VA 2OYCA 2YX1A 4OLBA 1Z18A 3WLMA 4L6IA 3DBRB 3MRVA 2DTXA 5DYTA 4Y1GA 1LPNA 3ZW9A 3GFOA 3D4NA 1PFYA 1YRAA 1ZCBA 2HBQA 1NUSA 5JMOA 2A1UA 2XNCA 4IMJB 3GVXA 1ES9A 5I7WA 2PWBA 2OFWA 5CIQA 2E4VA 4KIUA 4UE6A 3VTKA 1CEQA 1BSVA 1XNQB 3LK6A 2VRCD 4OK3A 1R9GA 1OLOA 1II9A 1HFJA 1PQYA 5EGSA 1V0JA 1MTOA 1MIOA 1RLMA 3E70C 1WXGA 3L7YA 5ALUA 2ZM6B 3O7WA 5EKXA 4MAMA 2W4IA 3GFBA 4B7AA 4AMBA 5JAPA 4M0UA 3W2IA 3KJXA 2ZJ3A 3LO5A 4ZVPA 5EZYB 1UQTA 3M1YA 3I9V6 1A2KC 1KY3A 1CRQA 1NW4A 3U13A 3AIIA 2VUUA 3TCNA 2BPOA 1ZD3A 1VE3A 1XU9A 3I73A 1OWPA 3DE7X 5A2QA 1T34A 4NMXB 4DCUA 4UMEA 4M6WA 4QG7A 2TSYB 4RC9A 1XK7A 3CX4A 3GFRA 2JGDB 1KR2A 1A88A 4JODA 2JZOA 4LCBA 3VU8A 3I62A 2NP7A 3E1KA 4RK6A 3G2PA 4KB5A 1NSTA 3NJ4A 4LN1A 4FJ0A 1IHPA 5LIRA 4Q4JB 2WICA 4MRSA 5E4JA 2PRIA 4DMMA 3IAS1 1XZEA 5DHFA 3W5BA 4QM6A 5BN1A 2BZ0A 1IZ7A 1ACJA 2D5CA 5DTMA 1SKBA 5HK8A 5JT1A 1BN6A 2HA0A 2YWDA 3PQFA 3R5FA 1QQAA 3B1YA 4LQ4A 5BUCA 1FFCA 3GRPA 3GRUA 3CNQS 4LMBA 1PO7A 3FYTA 5IAJA 3FD8A 3IIKA 3T5TA 4RTPA 3EEOA 3NXSA 4HAOA 2WFZA 2I3AA 5IK2A 1GNLA 4D3YA 1KEKA 1PSDA 4QPZA 1QCZA 1IHUA 1PZXA 2DQ4A 2Y2UA 3VV2A 5AVSA 1KEEB 1U8EA 1IBCA 3MEQA 3AIKA 3N28A 5JOQA 1EK2A 1MW9X 1QRSA 4Z9AA 3BIJA 2VYQA 2CVHA 2ICAA 4PFJA 5LKAA 2CT8A 1ZIYA 3AO0B 3FGOA 4WK0B 2I4IA 2YHIB 1TVKA 2OQRA 3LLSA 3V4OA 4YCCA 1PS0A 4L50A 4XCXA 4JUAA 4AJNA 1D2HA 2VHEA 3B82A 4O33A 3R8XA 4D9IA 4MYSA 4J1QA 4DCMA 1QXSA 1KMMA 1BGVA 2XCLA 4M1WA 4OI2A 1X13A 2YRFA 3KYIB 4XXHA 2AFIE 2XT0A 1Y3FE 1WCYA 5FX2A 3GEMA 2NVOA 3OF3A 2FWBA 3PUKA 1PDOA 4BQPA 3BCHA 4S1NA 1DAKA 1HDCA 3COZA 3CPHA 2D5BA 2P78A 5DYNA 3NTQA 1GA4A 5KTKA 1ZR4A 2G9VA 2QUAA 1OKKD 1J8DA 3UKJA 4OMDA 3DL2A 2JD1A 4BUCA 5BMVB 3HXOA 3LFHA 2CNNA 3U60B 2DKOA 3C7TA 1NU8A 5BOVA 1SZJG 1W59A 1KBZA 3SFZA 4CFZA 5HKOA 2MINB 3IKLA 3OC6A 4J16C 5B12A 1GNRA 3ZTWA 4CF4A 1TTTA 3IBGA 3ILVA 2KSQA 1B0ZA 4TKVB 1GZ3A 2FWMX 4G07A 3O8DA 1Y3BE 3EG9A 3SR4A 4W6ZA 2CZCA 4NK5A 3OLCX 3EYWA 4CMKA 3BGVA 1SC9A 1KZ4A 4L72A 1GCGA 4NFLA 2E5LB 1RBYA 2R8RA 4NFHA 1CB0A 4Z1OA 1VJTA 1RT9A 3PQ8A 5H3HA 3HMQA 4M0MA 3I9LA 3OKPA 4Q15A 1E1LA 4HGPA 3DW3X 5ERXA 1R16A 1H4VB 5DXFA 1ZH0A 3UAWA 1H5NA 2B7BA 1CDDA 2EERA 3G59A 5ITSA 1LBEA 2I2DA 4B4KA 2ZJBA 2FUCA 4R9VA 2PSEA 3H16A 1QHSA 2B83A 3OBIA 3LF1A 4JQCA 5DLYA 4DB4A 1QO9A 1UOEA 1JR3D 3AUJB 3OU6A 1WQ1R 1K4KA 1NXPA 1P2DA 3UJ9A 3GVIA 1L4GA 2WAMA 4YYEA 2CD7A 4U6NA 1YJBA 4CV0A 1G60A 1L5FA 4HWKA 4N9QA 3I0MA 4OB6A 3PV0A 2H17A 1W35A 1W46A 4ENPA 2R84A 2HJ9A 2VCEA 5BOSA 4DNXA 2HU8A 5CB4F 3ZCXA 1ZK0A 2IPNA 2LW7A 1BH2A 1NLZA 2GD2A 2WT4A 5JU6A 2WKWA 2IHUA 3IEXA 2O1EA 4ZU1X 4YUXA 1Q7TA 3F46A 3PEWA 2CFSA 3EGEA 3O8QB 4LRUA 4URWR 4GKBA 1PJ3A 2HL6A 3F5SA 5A03A 1GNQA 3G0BA 3HB5X 4MWTA 4C4TA 1YTLA 1HDGO 2QTNA 4FMDF 4L0CA 3ZLVA 2YJNA 3SR0A 3EEIA 1W4RA 2F3SA 1M2FA 1UZNA 4O0LA 2KHZA 1WAMA 4MVJP 2Z9DA 4K40A 1N7GA 3WFZA 4GIBA 4MZDA 3M8KA 5BN3B 5LXTA 3F98A 4CEHA 2OXTA 2GZSA 4LHWA 2EKZA 3PXAA 5FOSA 4RVSA 5DVZA 2X4IA 2ZJAA 5K6AA 4R71A 2BIFA 3VOTA 3W4IA 3SOZA 2QQGA 4JB8A 2VYND 4DN6A 2P2LA 3N8DA 1HRKA 1BFDA 5A7FA 5IT0A 1K92A 1N0IA 4AF8A 3M4XA 1GZ6A 1H85A 3DUWA 2BJVA 1KTIA 3UMCA 1LLQA 3HUFA 1Y7HA 3RAGA 4EHDA 4ZDIA 1J8FA 4QDKA 5E0KB 4B43A 5JBQA 1EFVA 4MIEA 3Q2KA 4UTXA 3H6GA 4XEUA 1BEZA 1DL5A 1E9EA 1OUMA 2ZRDA 3UANA 3VTZA 3QUQA 4NCIA 2FK8A 2GXSA 1G0OA 1P6QA 2UAGA 3B7WA 1XMSA 4EGQA 2IITA 4C4ZA 4PGAA 1TZ2A 5K0ZA 1GGNA 3SJCA 1RI1A 3PPIA 2MWMA 1JR3E 1U3VA 2ZE5A 3RJ9A 4L8LA 5IJXA 1QE3A 4ETWA 4V0QA 2YTZA 1NUQA 4DYDA 5CBPB 4NFSA 2O1XA 1OH6A 3M2TA 1CW2B 3KEQA 4LDQA 1JAXA 4ALNA 4BU1A 5EMMA 4CV1A 4DCSA 3LXXA 1LRJA 2X0FA 1IVSA 1C1YA 1FTQA 1RWKA 1XKLA 1WV1A 3KZOA 5T41A 3SBEA 1VECA 5BWLA 1LDGA 2BGIA 4C6TA 3H2YA 4RVGA 4JLWA 2ZUVA 4I9NA 2I62A 2FUNB 4NBVA 5CNMA 1UAAA 1HYGA 2WZQA 1L1EA 4AW9A 2MCFA 1BXGB 2IYXA 1QS0B 2YOFA 3A9CA 3AU9A 1ZONA 4M86A 4WGFA 1RRPA 1TJ3A 1TK2A 4B6FA 1T4CA 1RRMA 5CT5A 4RTSA 4PSDA 3OT5A 5WRFA 4BASA 1ZU5A 1WSAA 4CIVA 4ONEA 1Q12A 4YJ2A 2B9VA 4ZO8A 3A0RB 4II2A 2GPJA 4BZZA 1T0UA 4YXFA 1PYGA 2JJ2D 4ER3A 5AR1A 4ZU3A 1ISGA 3CZ5A 5LMZA 2B4QA 3CEHA 4YS6A 4HDQB 5LZ9A 2PSFA 3JYOA 4KG7A 2V3CC 1C3XA 3DZ8A 1JT9A 3N0XA 1QANA 3BC1A 3FYCA 4CLEA 4JOSA 4R5MA 4RTOA 1Y6FA 3S29A 5CX1A 1T36A 4NBLA 1YB4A 5ENDA 1WHSA 2FPIA 4BNMA 2GTHA 4NNOA 5DBOA 3S6JA 5C18A 721PA 4PC6A 1BD4A 3TLEA 5DGIA 5E9JA 5ITZB 4DSOA 1E0AA 3PI7A 2JRLA 4U3JB 1VLHA 4O6VA 3QA3E 4MYRA 5A62A 4WLVA 2QXYA 1QAMA 2XKBA 2PDAA 1M2OB 2HWWA 4TMXA 2X8WA 3LYAA 5IANA 2A3NA 2ORVA 2QE6A 3AUSA 1YA8A 3UT0A 1D1PA 1SC1A 2YZMA 2PXAA 4QDTA 4WRRA 5SZKB 5J4LA 1TM5E 5HTOA 4F3RA 7AT1A 5LP6A 3WLIA 4EJSA 4EX6A 2IZ0A 4C7BA 1NBHA 1VZ2A 3EN0A 4F04A 4CODB 2GHIA 1PFQA 1DBVO 1IJEA 2JCBA 1AGRA 1O6GA 4MUIA 2ZRBA 2GCPA 4UUQA 4UHDA 3OBBA 1NX9A 3QA9A 4AWAA 5AI6A 3TSWA 3MJCA 4LWPA 1BE1A 4JX9A 4XX0B 2EQBA 4YP9A 4WXRA 1TYCA 3PR1A 1JG6A 3RKSA 2ATCA 2C31A 3AG6A 4MI1A 2GCOA 3ABIA 1XP5A 4JUFA 1Z2NX 3D8SA 5B1EA 5A6VA 2V5VA 1H4TA 2C7BA 3SPXA 1D7OA 1ZUHA 2R00A 1V9SA 5C1IA 3T3DA 5GJVC 1C50A 2EIHA 3NLLA 4TLMB 4DM4A 1Z2OX 2YZ7A 1JSRA 3BF8A 4MUHA 2I66A 4UNQA 5A9SA 1UBGA 4DUZB 1GUBA 1WVMA 2NXCA 4D1YA 2GN8A 3L05A 2JH8A 1OFUX 5HKLA 1PYOA 4IOMA 4KXLA 2WMOB 1LB1B 4KAXA 3RYTC 3ZWNA 1FYDA 3O8LA 4B4OA 3WXMA 1N36B 5F2KA 4CU5A 2Z3VA 3LCVB 3E81A 4ZGGA 1JA1A 2R79A 2QK4A 1Q74A 1W73A 2RHWA 1T3HA 3L7NA 4MP8A 3K5IA 4XLTA 3V1MA 3LDGA 5IXSA 1DCTA 1TMKA 4B3DA 1KAOA 3OP1A 1I32A 1WY5A 1RAAA 4B3GA 4HYQA 3WHKA 3ZE8A 4MVJH 4DV5B 4OO3A 2Q3JA 2WAXA 2Q3LA 5TB5A 5CDGA 4EHKA 2H11A 2QRZA 5COQA 4ZV4A 2JBWA 1WUYA 1GYRA 1G8GA 4J7UA 3WJ2A 1CB7A 1D2AA 3X3HA 5BWMA 2WMYA 4U7HA 1TYBE 2V7WA 3HYLA 4JC0A 1F38A 2IXFA 3OEEA 4GBJA 1KI6A 3TLMA 2O3UA 1GRRA 2XDQA 1N3IA 4JSYA 2HPHA 3GFTA 5ALYA 3RF6A 3TBHA 4K5QA 4KQ1A 4FEAA 2ZITA 4OOFA 1JR6A 2UUPA 1R4MB 1EKXA 2C61A 5FL7A 5I9SA 3AXSA 3NWEA 4C20A 2FSPA 3OEYA 5IX8A 1FP4B 5JVDB 1C7JA 1O2DA 5JNUA 1Z6ZA 3DXFA 4LJSA 5TT1A 4I99A 4JXXA 3J81k 3TW4A 3BQNB 1Z0DA 5ALDA 2LE0A 5DFAA 1VLLA 3CMMA 1NQOA 1N2GA 2HCTA 3A9TA 3HRKA 5ENZA 3K9CA 1ZI6A 4CMAA 3D0RA 1L6RA 3LX5A 2I6TA 5JSHA 4DIOA 1NR1A 1QWOA 5JMWA 5KS2A 1U5BB 4OHRA 1SKQA 3R41A 4YO7A 1T24A 4AY2A 3ESDA 2W6QA 1KKMA 3BWVA 1C0EA 5JYDA 3SMQA 1GITA 3JZIA 4PAMA 4X1YB 4EELA 5HQ3A 3ROFA 1NATA 3B78A 1A7UA 3DE5X 4IXTA 5ANRB 4MV0A 4R6XA 1A2OA 3ZU6A 1UM8A 5FO1A 2DXIA 1NSYA 1QK5A 4NCXA 1B6RA 3W8FA 1RZRD 2Q46A 4NJMB 3K32A 1GCUA 2N3ZA 3TSCA 4YT4A 3SFTA 1ATIA 2YXBA 1FRQA 1K75A 3DL4A 3Q9UA 4Z53A 2VYCA 3HJGA 4MQFA 5BQXA 1V5WA 4Q3LA 1SKUA 1VSBA 2AMLA 5IKMA 2FX2A 3QSYA 3GBPA 4FQ5A 4KDCA 4CEIA 3HDQA 1DGQA 3I3SR 1PLJA 4LX8A 1L5MA 1TRHA 2AEFA 1UOOA 3OQ6A 2CC2A 2ZTLA 4RKRA 1RQGA 4MGHA 1KZHA 2VHCA 4G0PA 3E22B 1TA4A 1IJBA 1RYYA 1ZIOA 3LT4A 4DYHA 4IV0A 3EY9A 3ERCA 4C2UA 2MSNA 1DG3A 3G5TA 5B1YA 3TF5A 4KYTA 1T1RA 3FVTA 1T6YA 2WLTA 3WGJA 2C95A 1A72A 2XBUA 1R6BX 1UJ4A 4TSFA 1E5DA 4BMCA 4HDKB 1OJ7A 3RIEA 2VRWA 3GJ5A 5A5GA 3GEDA 4FI3C 2DVMA 3ZU3A 3NANA 4NNPA 1IB0A 4YCBA 2X7XA 3COVA 4LJ4A 4LJ8A 3OG9A 1TF2A 4ED9A 4GZ6A 1QRRA 5KQGA 1QRTA 1V8PA 1B14A 2QY9A 2DT5A 4TMZA 1IZZA 4GS5A 2NO9A 2JIMA 1LNSA 1U98A 2VWGA 2Z1MA 3QTLA 4B7XA 3FFXA 4NYMQ 5E2IA 2C2WA 3VDRA 1HE2A 1ZH2A 2Q1TA 3MOGA 1PNQA 5JW6A 1B3RA 5M7EA 1Z29A 3L1UA 2OFOA 3KXLA 4WZBE 3GA0A 3MBKA 1RJ9B 1I01A 1YCDA 4KE9A 4PLPA 1QH8A 3NGLA 1O97D 4WX2B 1Z4IA 5ULLA 4GU5A 4OK6A 1G291 1RKUA 2VSQA 5CVJA 3OLZA 5JCXA 2GX6A 4G1MB 1DKPA 4PNPA 1JPUA 3IVCA 2CNKA 4HNSA 5FQOA 1AVTA 3DE6X 4CR7A 4F8YA 4I6JA 5KNBH 1LBQA 1ECFA 1R0WA 1ZL2A 1A9OA 3FUWA 5JSUA 5JCZA 1JXAA 4OX9B 1WMDA 3QEMB 1YACA 2FRXA 1PW7A 4TGLA 3RNOA 4EVQA 4MUAA 1Z0AA 4Y0NA 2PQ0A 2YHSA 2HQBA 1NW6A 2BCEA 1IRIA 2BGKA 3JAWA 3PLRA 2GNPA 2Q7OE 3CEPB 1EXMA 2O57A 4HVCA 3V1KA 2VRNA 5A6SA 4MMXB 4BRZA 3AHEA 2J3DA 4K0RA 3RJMA 1F0PA 2OXIA 1YU6A 2GRAA 3TRDA 3ORYA 2XAAA 3PFCA 5KAMA 3BF7A 2MJLA 4OXXA 3WLHA 1KWKA 1VKNA 1Y6QA 1YASA 2WG2A 3VH1A 2VDJA 4YAFA 1E64A 4JVOA 1XI2A 4QLOA 3SEFA 1ANKA 2CW5A 3D9QX 3ACDA 3KS9A 3OLQA 1M5RA 1DELA 3MSCA 4HWTA 3IV9A 1PZMA 3FBTA 4D8VA 1K8RA 2IHBA 2BONA 2V0GA 4BO8A 4KHPB 2D7DA 2X14A 3E3AA 1INLA 2QI9C 4GC9A 4LPSA 3KQQA 3RW9A 1BCSA 3JWPA 2HF7A 1BRMA 4TTVA 5L7WA 3VR4H 5LLDA 4QC2A 3GJ8A 1EFAA 2G71A 4H1TA 3X2SA 4E2XA 2M6SA 2EJCA 2QJWA 3R3XA 2VP9A 5A7GA 4E1BA 4K86A 1KAMA 3UOWA 4MKRA 2I5PO 3LQYA 1ZBQA 1HYEA 3M2PA 1PWHA 1HDZA 1K7YA 3KUDA 3P2EA 1Z4JA 2EZUA 3AK4A 3FPCA 4JB0A 3TN7A 3RT1A 5FI5A 4D5GA 2XWBF 3DZKA 3FVQA 3FNEA 4PINA 1P6UA 1UBUS 3KAQA 5EMJA 3UKDA 2OSVA 1JNYA 1S89A 2OCXA 3GLUA 2J9RA 4DDHA 1T0IA 3GAMA 1C30A 1RYEA 1DBQA 5B7PA 3GLFE 3LW8A 2IIVA 2PZMA 3U4QB 4WFKA 2GK7A 4HBZA 4NICA 3COPA 1P0QA 5I48A 3MUEA 2Z83A 2F67A 3LC0A 1E0KA 2O6LA 4WUTA 1IBRA 4MGKR 5FADA 1O89A 1PT5A 1WSWA 1JJ7A 1LDBA 1HE4A 4W5JA 1RQNA 1UMBA 4IGFA 2JJ1A 5ALQA 1QH9A 5DEOA 1KHTA 4JA2A 4NMHA 2OCYC 3AUAA 1T15A 4WOPA 4O4JA 3CF0A 2R48A 1KOFA 1FTWA 4Z4CA 1LRLA 1MXFA 1UPCA 2ID9A 2NYAA 4FSHA 4Z8XA 2PKYX 5K3AA 3H9JA 4C06A 2BBWA 1KRXA 1M6EX 4YQEA 1R8QA 2H1RA 3I83A 3WP1B 4HDAA 4FU0A 4IIHA 2IWRA 4F2HA 1U9ZA 2GWRA 3SXJA 2G9ZA 4JUBA 1N8KA 1JIJA 1MEEA 2W2MA 3CTMA 4FW8A 4GPD1 4AN0A 4F4JA 3NASA 1A71A 3OIWA 1NE7A 3LVQE 2EZ9A 1OLUA 5IAGA 3IXLA 4QSMA 4RZXA 1H2EA 1N6RA 3K3PA 2DH5A 3IJPA 5C4GB 4BJ3A 1WU8A 4MI3A 3TQQA 4DCOA 2JK1A 2L0XA 3GAAA 3SLGA 4LJ5A 2NIPA 2ONJA 3U3RA 4A2QA 2V4ZA 5DDIP 4FCVA 1YVPA 3U4CA 1OY1A 2CXRA 1Q22A 4O4HB 2OFPA 3PR3A 1MNAA 1Z15A 1MB9A 1JNXX 1ZLYA 5L3RA 3T9BA 3OMWA 2Y67A 3CZMA 3PYXA 4FC7A 1J23A 1Z5GA 4OL9A 2QMYA 1GL7A 3PUVA 1A8SA 3GCDA 1RIIA 4IJQA 2JVIA 2H16A 2PGJA 5B4TA 4KLRA 4KUHA 2Z43A 3NS7A 1Y89A 3V4PB 4PXAA 5IJ9A 4U63A 4FUTA 2BN4A 5F5XA 2VNKA 1B93A 2OPBA 5BW4A 1RYZA 4Q12A 3JS5A 2IV7A 1JMVA 2FR0A 4YK7A 3THXA 2LDXA 3QXGA 1YZNA 3RODA 4QGAA 1DX9A 4OQNA 4BLRA 3VV3A 4PC2A 4QNMA 4B73A 1QIDA 1RYMA 1SEPA 1EJBA 1YDMA 4Z4FA 2JCXA 4HXYA 3MBIA 3T1OA 1G2QA 4ZYYA 3TTSA 3RUEA 4DJAA 4MPPA 3CSDA 2JS7A 2PX8A 4KKXB 1NUAA 2AJBA 3CHYA 2IXDA 5LQAA 3OKAA 3CO5A 4RGVA 4BBPA 4JLMA 1ZGGA 3GOHA 2J67A 1VTKA 4NCBA 3A28A 4BFWA 1F2DA 3QVJA 1N33B 3PHJA 4LZPA 5AKYA 1XA3A 1E3WA 2IYAA 4OQZA 3WLNA 4MIOA 3SX2A 1UZMA 2RDMA 4UZFA 3IHWA 1E9BA 3CSUA 5J4HA 1K6IA 4FMDB 4HLQB 2XWPA 4KWEA 3VDNB 3T1HB 4GOLD 4C4OA 2BSQA 5E8JA 1YVUA 2HCFA 3GRVA 4BV2A 4HQ0A 1WP9A 2Q4EA 3IUEA 4G9GA 4J2TA 4RY9A 3R3JA 3DB1A 2IXGA 1M8FA 4GRDA 4UOZA 4QYMA 2VTKA 5I9LA 2Q1UA 3F3SA 5ALPA 1S02A 2PL1A 5IC4A 1DG9A 1LC0A 1USKA 4P9NA 5C8DA 2O2IA 2WFMA 2ILTA 3P9CA 2BFFB 5ALZA 4U1RA 3RROA 1ZGCA 1I7NA 5KHLB 1CCWA 3BFJA 4QQKA 2PUBA 1WU7A 2E85A 3VR5D 4EKEA 1ZH8A 1WDWB 1AGYA 2JAUA 2Q4BA 2X23A 2ZRKA 3JQQA 3LP8A 1NC1A 4K1XA 4PRYA 3B1VA 4MW9A 2FPMA 4ARZA 2GOYA 4EVRA 4B6EA 2A5DA 3A25A 5B1SA 3SEZA 3VYVA 4QD3A 4CT4B 1JLMA 1QGUA 5AUQA 2WQ7A 1G8AA 4Z86A 1YC2A 3KHUA 1D4OA 2QKYA 4QU8A 3F9CA 2ILVA 2QP4A 2ZROA 1UMBB 3K9LA 1XZFA 1Q5PA 3JAWB 4WZAB 1CDZA 4F9GA 3AKCA 5I47A 4DR6B 1PT6A 1OI3A 4ZYZA 1BWSA 4BP9A 1JEOA 1M7HA 4PYLA 4BX8A 3GDHA 5JAMA 1VLMA 3O5AA 4NZMA 3S2ZA 3U5ZB 3F7NA 3HLKA 3MXOA 4R1UA 4OYHA 3GGJA 4K3VA 4L6AA 4LC0A 3WB9A 4BVHA 3L04A 5LXTF 1T8WA 2WF8A 1C3JA 3EXG1 4ND4A 2NZYA 4I4TF 2A58A 4S0XA 2IUYA 5LYJF 3NC4A 4Y2TA 3TGWA 5BW8A 1L7NA 5EN4A 3JZDA 1QKJA 4LI0A 4NC9A 1OI4A 4G0WA 2JIBA 2OLKA 3IIEA 3IR7A 2C5AA 2H5EA 3I30X 3OZEA 3EX7C 1U0HC 4FYIA 5C7IO 1T3LA 4MEJA 4MYUA 1SG9A 2VCHA 1J25A 1XTJA 2UXDB 2XUAA 4GRAA 4HDCA 2BGJA 2YIJA 1XWWA 4E4TA 2HHAA 1OWLA 2FQWA 2GUWA 3I61A 1ZMOA 2R60A 3O91A 4HJXA 1A4IA 5F3DA 3VISA 1NNLA 1J7KA 1VMKA 2X19A 1NVDA 3PE6A 4O4HF 3AR6A 4HEA6 5J43A 3FZQA 1BKDR 4QATA 4DCNA 1YFLA 4J8PA 2I4NA 3BGWA 4KOEC 3MTQA 1WKCA 2FQ1A 3MWYW 3C5VA 4NS1A 2IQ5A 4TWAA 4RETA 2BR5A 4KX3A 2EIXA 2VSNA 4UNRA 3KDPA 3OZ7A 3UW1A 3RTEA 1QR2A 1ST3A 1EE1A 4PZUA 2QQ5A 1PV4A 4Q3OA 4QXAA 1EFPB 3N70A 3Q72A 4F1KA 1BMTA 1DZIA 3K71B 3I3OA 1PSWA 4RHXA 1QYRA 4B6SA 1ZOSA 3EZ9A 2FDCA 2NSDA 1SCDA 3CJRA 3NATA 4MJ7A 5CH5A 1H2ZA 2CSUA 4JBNA 2FSGA 1SKAA 2MHCA 3DAFA 4AIRA 4MDHA 1LSSA 4EKDA 4TMWA 3CUWA 4IQFA 1YUNA 3IXQA 5H4GA 1Q7CA 2DPGA 1GU0A 1C2TA 2G6BA 2WTEA 1OWNA 1ZMRA 4G5FA 2XVYA 1X8KA 4BNUA 2RHCA 1LZKA 3TMYA 1NVVR 5ICCA 3A4IA 2P0YA 3ZE9A 3KZCA 4RKEA 3UXEA 3KSAC 3OJOA 2XB6A 3VPFA 3P4YA 1FDWA 3ON5A 1YQQA 4LF9B 5GGXA 1WB4A 2CUNA 4RFVA 1UEIA 5DNUA 5HFJA 2J6IA 1X3LA 3CR8A 3LM8A 3RM3A 5EJ8A 2BGRA 4DKXA 1PFVA 4H6WA 3QY0A 4AF6A 3GPIA 4HDNB 4KGVA 4HDSB 4BYGA 4CFSA 1JAIA 5DCWA 2RE8A 1UWKA 2KE5A 2ZATA 2BEUB 3SD7A 1LFDB 5C8YA 3MCZA 3PF9A 3PLAE 3KLMX 4JBLA 2HPVA 4WESB 3VI3B 2PBLA 4D74A 3GLGA 1YB1A 2GAFA 2ORYA 4ZO4A 5HVNA 1IE3A 5EIOA 5FOQA 3EPKA 1R8YA 1LX6A 1SQ0A 2AJCA 2D2IA 4P33A 4YCJA 4CTNA 1DOAA 4NIMA 4EH1A 1BDBA 5KNCA 2GD0A 3Q9LA 1GVHA 3WGQA 2BFCB 1SOAA 3UGKA 3RS0A 1K89A 1VJ0A 3KTAB 4RFSB 4FR2A 4H9GA 4Z4IA 3PUHA 5G41A 4C76A 2ROQA 1XHFA 3LY8A 4DBLC 4GSYA 1UDRA 3K35A 2BT4A 3GUVA 4KQIA 3V8QA 2PY6A 1G41A 5DNWA 1XALA 2ZYDA 5CPFA 3HKDB 5BR8B 4UMVA 1ZN2A 5EIHA 2G80A 4OUDB 1DTEA 2UZIR 3DM5A 3GAFA 3ZGNA 2NZXA 4JKIA 1UJBA 2JFQA 3VHQA 2UZAA 2WYVA 3NP7A 4PZ0A 4QHTA 1G8YA 5REQB 3HP7A 4BYMA 1I1QB 3IRUA 1BS9A 2AB0A 4LG1A 2O5EA 4KSCA 1WNFA 4WT7A 1H1LB 4LBYA 1HZJA 4JP8A 1Z4QA 5TQ0A 1ZW6A 1N6HA 3JSAA 4LQLA 5LQNA 3X44A 2JI9A 3W5DA 4I1YA 3T0GA 3GLSA 3ND6A 2ZKLA 5IWCA 3E18A 2XKJE 2EP5A 4LJRA 1Z2EA 2GLXA 5K51A 4OKIA 3X0DA 3WHPA 1PD1A 4AYXA 1CYDA 4FT4A 1DTWB 4JL8A 3WSTA 1JR3A 1L7EA 3L2OB 4LZJA 4OQLA 3ZKWB 2BI7A 4EW2A 4ANFA 3AF2A 3UK0A 1PN3A 3HK2A 3NWOA 4M8IA 3GRAA 2XQVA 4D9BA 4QJ3A 1FVOA 2PZKA 4XWWA 3QVGB 4PRKA 3ZWOA 5CCBA 4RD6A 3UG6A 1G2OA 3T06B 3SJUA 4GRIA 3IV7A 2CJWA 2EV9A 2PKWA 1GCOA 1KXJA 1U0TA 2QD3A 4KLZA 4RAQA 1K6JA 5DI3A 4EB6B 1A9RA 2AOXA 4MKHA 1OXBB 5JCPA 3P96A 4BQFA 3FDZA 1H9BA 2WQ6A 5TEWA 5EUMA 1NFRA 1RC1A 1OYYA 1CUAA 1SXHA 1U2QA 1KO1A 1P44A 2W43A 1A77A 3A70A 3AEUB 2GPAA 3K0AA 5E6UA 4KVGA 4EPVA 4PN3A 3H11B 4BAUA 2HWUA 1VOTA 1ENOA 1EVEA 2D6FA 4QPDA 2EBHX 3WTBA 5E1MA 3FKSD 3H8WA 1SOWA 1WLSA 4AWXA 1V3TA 4X7RA 3BDVA 2ZBQA 1PT9A 1PVDA 1RI5A 2O7VA 5E1BA 3SS7X 5FOTA 2QSZA 3K1JA 1NUPA 4ZT3A 1G21A 4PLWA 5I8ZA 3LTEA 3OM0A 4YCLA 3E9YA 1U99A 1ULSA 2EGUA 1NQ5A 3DAPA 5DNCA 4JVSB 2GN0A 2CDNA 3RYFB 1E1KA 1NE2A 1JHZA 2PZEA 2W93A 1NF8A 5JMPA 4EQ6B 4F12A 1Y5IA 2A9PA 2GYVA 3DM9B 3JQGB 4D26A 2P41A 2W22A 3ROQA 1F2VA 2H63A 3IQZA 2WWYA 1GRVA 2HLHA 1UKAA 4FDMA 1PJCA 3GB9A 2YJGA 3H65A 1W48A 2X0JA 3QWBA 4F2PA 4IZHA 4G8BA 6NULA 3IQFA 1TC2A 4WCFB 5LMNB 1AKVA 1ZN7A 2ASVA 4NEGA 1CY6A 3RSCA 2Y6UA 4XIFA 1UEXC 3DMGA 1YOBA 1NW5A 4Q7EA 4ZREA 2AC2A 2JFFA 2IZ6A 3IDFA 1WY7A 1K7FB 2GKGA 2P6MA 1O3YA 5CLLA 2C2MA 1QHEA 2WVAA 3PIIA 4MW7A 5EKSA 4ZAVA 3U7IA 1WJGA 5FPQA 3ABQB 5JSZB 5EQJB 4UHCA 4DQUA 4BUJA 3QBVA 1QMGA 3PT9A 3ZY4A 5FORA 4PHTA 4RF4A 3RFXA 3ZX5A 1J9EA 3YASA 4CTKA 1C0KA 3CGGA 3FWYA 5E6UB 4WBXC 4H4DA 2RI6A 2C2HA 3B1XA 3Q0TA 1U7UA 2GBLA 3D6JA 2PKQO 3HJAA 4DANA 2XUHA 3KDSE 1D5CA 3ROGA 3GUZA 4BMDA 4WKBA 2QD4A 1E3QA 1NVBA 2F1IA 2OT3B 3CBQA 2M2IA 2IZ1A 3NGMA 3PA8A 4L9RA 3DJFA 2XMQA 4QASA 4V2UA 3WGMA 1CF4A 2C0QA 4R1TA 2YY5A 1HDOA 4A8JA 5CITA 5C51B 3S55A 4NH0A 3WYAA 4XJVA 4ER0A 4OAQA 4URHA 1ORHA 3DBLB 3MGGA 5B58T 4C29A 4DABA 4E6PA 3NORA 4RHCA 2AQIA 1E2HA 1VHDA 4JOQA 1O77A 6ABPA 1KZGB 1IEVA 3UOAB 4LHZA 5DMHA 3QKWA 3TEFA 3HA5A 1T4CB 1UC4B 4ZJYA 4EA6A 4R1NA 2DPYA 5BNZA 3RYHA 3BPSA 4MH0R 4HEJA 5JFTA 2FMTA 2KM1A 1YIAA 1PQPA 5T67A 3SK0A 2BLLA 1G5HA 1EZ1A 4G4IA 1V5EA 1XD2B 1ZP6A 4TYYA 1FRVA 1H8HD 3JRXA 3I9FA 1WXFA 2JHAA 1BVUA 5HQTA 2G5PA 3GO4A 4JQSA 3FAZA 2H1IA 1H1LA 2QL9A 3JQCA 4Z0NA 3SYMA 4HAZA 3WAGA 4DQ0A 2V1UA 1KNXA 4LE0A 5CBPA 5D6OA 4RKFA 3VR3A 2UZ1A 2BF7A 1MB3A 2WJPA 3HY3A 3I1FA 3W7VA 2QJFA 3WQRA 4FD2A 4RVUA 4AK9A 4RPGA 1ZJWA 1YDWA 2X9NA 2HNKA 4RJ2A 4OUDA 4GLBA 3RS4A 3RYFA 3PI6A 3HCDA 4OH1A 4XX1A 5IZCC 3GGSA 2NUAB 4P3XA 5DX1A 3L6EA 1G38A 2H8GA 4RSRA 1ND6A 2VR1A 2VBGA 3IYLW 1YKSA 3AJRA 2GBLC 2C77A 3OESA 5AKHA 4AJ2A 1KETA 1QIJA 2BL4A 4IH1A 3SHWA 2VNSA 2B3DA 1QP8A 5BR1A 1A76A 1E5QA 5GQSA 2ORWA 5I8PA 1E9VA 2ZAYA 4Z7QB 1ISPA 3H5RA 1H9AA 1TM7E 2JL1A 4WESA 1P81A 5CAEA 1M8JA 2RI1A 4DLLA 3UJHA 3B85A 3BXGA 3QFSA 2WM8A 1NM5A 3C7KA 3IIJA 3X1YA 4ER6A 2UXBB 4LYDA 1FFXA 2WSMA 1OFVA 1X1CA 3HBLA 1ZD4A 3FOCA 3P0HA 4OHXA 3OJXA 1YZLA 5BN3A 4URXR 1MABA 2KW5A 2R7NA 3DZJA 1SUAA 5ERGB 2C4UA 4YBZA 4EGSA 1N4DA 3NBFA 4RY8A 2JHFA 1DOHA 3B48A 3DGFC 2VJCA 4L8VA 4JQYA 2HTFA 1TQDA 4LPKA 4FXOA 5BMVA 1ICEA 4TV9F 2OBMA 2Q9UA 5EEGA 3OPXA 5THXA 3AL0C 4FFBA 4ZP1A 3MAJA 1DXYA 5JZVA 3GARA 3GZ4A 3PJEA 2LBPA 1Z37A 3OJLA 3WSWA 3CWQA 3EXIB 1N2ZA 1L1QA 3QJYA 4RK0A 4XB6B 1R7RA 1VI6A 2QTAA 1Y9JA 3CNLA 4PVDA 2P9QA 5KNCD 5DRTA 1Z0KA 4XM0A 3HJBA 3H7IA 2YY6A 4YRMA 3OPVA 3UB2A 5L6LB 1C9DB 4I1VA 4MRPA 2IGTA 1XPJA 1DHRA 5IRCD 4XUDA 3T3PB 4LDNA 4DCPA 2J9FA 1TVKB 2Z8YA 3CS3A 4K03A 3SMVA 2P9ZA 1BFKA 1KVUA 4DV7B 4AUNA 1JHYA 1SBNE 3ZHBA 4EL0A 2A33A 3SHTA 4EBFA 2XRZA 4JJ8A 1G2IA 3NM6B 3ULKA 1A9XA 2B3TA 1L4HA 1T13A 1RKQA 4GOJA 5KYXA 2B9EA 4E21A 4MPJA 3HWSA 5JCOA 1XJQA 2GPSA 2H0RA 2G07A 2LTAA 2W4QA 1SD1A 2ZB8A 3LG2A 3WV5A 3U39A 5LOVA 3HLTA 3FOEC 1RC8A 3EULA 1OVGA 2PGDA 2AG8A 1Z28A 4N7JA 5JNTA 1GAJA 3EMBA 3LLMA 1JHMA 4QDZA 2WV9A 1YH3A 3NX4A 2JLUA 1JI0A 5J5VA 5CG2A 2X0NA 1K3FA 1EBFA 2IHZA 3E0XA 4BNTA 4F4HA 1ZHHA 4QJ5A 1KJWA 5DSXA 4RMJA 5EJ2A 4UM9B 3VKUA 3E4DA 5KX5B 1Z16A 2A78A 2JGDA 1HZZC 4L95C 5CURA 4B09A 4M0KA 1JIIA 2MR5A 4HNAB 1SB9A 2BJWA 4C6RA 1RQ2A 1X7YB 2PMWB 4HAUA 3U3DA 1O94C 1XEAA 2CLCX 2GK6A 3UIEA 4CI0B 4DMFA 1CU1A 3O0TA 4ENSA 4DSUA 5H8WA 1A69A 5KOYA 3OZTA 1YQTA 3STWA 1ZC3A 2ZBPA 4A0SA 2OD2A 1GXSB 2BAGA 2I6UA 2N9UA 4HNVA 4MWOA 2R1VA 3PNVA 4B48A 2RGDA 4L8GA 5ITWA 1V9CA 3ROZA 1AJEA 3KOYA 1ICIA 1TA0A 3TKLA 3IMGA 4MDEA 3CH5A 3DFUA 4H0CA 1JQBA 4P4TA 2QRGA 3WGHA 1X38A 2QVZX 2VYNA 4Y2RA 4MVJG 1Q21A 1JLKA 1P17A 2NUTB 1M6VB 1C2YA 3O1LA 4XQ9A 1P61B 4J07A 2XTNA 4PIMA 2KB0A 2CK3A 2CKDA 4UATA 4FX5A 4ZT2A 2HK8A 3NKLA 1FIUA 1N92A 1H93A 4F3TA 4TTIA 5JSFA 4ZTBA 2N1BA 2PL3A 4RLFA 3ROPA 3PP8A 3R3VA 4HUJA 4D6YA 2BKLA 3PWSA 1YAHA 2DZDA 5CJ2A 5DLPA 3EGDA 2EJUA 3GZNB 1TZMA 4N01A 4RK7A 3ZNPA 4E1AA 2Z5VA 2IXBA 2F17A 2D59A 1JLLB 2CVQA 4AP5A 5C32A 3A05A 1P0IA 4ENWA 1KDVA 3LUPA 4PX9A 1FC0A 1ZKDA 2N47A 3AVXA 3FTCA 4WZ6A 2O0KA 1G3QA 3TRKA 4HLDA 1QHIA 1CUWA 1Y9AA 1HH4A 2H4FA 2YZ2A 3ZDRA 4Y2PA 2L17A 1TO6A 2O23A 3ITDA 4ID9A 1QF9A 1Y48E 1XZAA 1JG2A 2IPMA 3OMXA 4L02A 3UY4A 1W2WB 2X0KA 3AWDA 4GO1A 2ZRFA 5GV8A 4DSNA 2G08A 3TKAA 1CZLA 3FZNA 2WTUA 1M83A 3JR3A 4HUTA 1TKBA 3VHXB 2OXEA 3LT5A 3ZDDA 1IBKB 5HOQA 3QPWA 4RTRA 1KI4A 2ZEJA 2O5CA 2X2PA 4IOKA 2P2DA 1NRIA 1O0CA 3AI3A 3IIIA 3SZRA 3LBNA 3NUQA 3VU0A 3ZE6A 2AOTA 3KZMA 1RE0A 1ZICA 4HRYA 5EHIA 4BNFA 3C6BA 5F12A 4ZCMA 2VH2A 2BW0A 4ZQFA 1XL1A 3JD1A 3QGMA 3QXJA 1XLTC 1JAHA 1H3EA 3Q7RA 4IRUB 3WMWA 4AMZA 3FW1A 3E58A 3F8TA 4O4LA 2ISCA 1M3SA 1ZCAA 2WU3A 3JVUA 1NW7A 3HB4X 4MJXA 2PNFA 2E6KA 1BE8A 1RVDA 5K20A 1TJ4A 2ISQA 1U0BB 2C2OA 4QPPA 1XRNA 2H4HA 1W581 3Q6MA 4DRXB 4G67A 5FIUA 4H1HA 2PQMA 5CMLA 2HEGA 4NMWA 4DMHA 1ZXLA 3G8DA 2E7ZA 4FFSA 4OJYA 1LEHA 4MHOA 3E9RA 2FQXA 2FDRA 2QIPA 3D3QA 1F2TB 1LLCA 2C96A 2HK9A 4MW5A 4BZQA 1JDPA 2EFDB 4M1QA 1P33A 2B2NA 3KALA 3MGBA 4NBRA 3UAGA 3VSAA 4EARA 3RU2A 2GJ8A 1U2ZA 4D9MA 1GQSA 3HU2A 5DWQA 5KVVA 1PU2A 4FNOA 2DH6A 4JZKA 3PVCA 2FG7C 4L0QA 4UCXA 4JVMA 4O4IA 4HX5A 1ZJYA 4W1QA 4WLUA 3NFRA 1BX3A 3BX1A 2TS1A 4P7BA 3DV0A 1VCOA 2CN1A 4ZAZA 1ZGAA 3C7CB 1HG0A 3WYEA 1LKZA 3VOSA 2PSJA 4NU0A 1I36A 1NY6A 1UXGA 2ZDGA 4GZMA 4CKYA 4DPMA 2EHDA 4C7XA 2J59A 4ZRNA 3TZ6A 3ZHOA 3S7ZA 4D4LA 2C78A 4ZZ2A 4C01A 4H60A 4J4TA 1RKBA 4BQEA 3ETHA 3IAM1 1CTQA 1QZXA 1GCAA 2JGLA 1QQ6A 3EVNA 4GOMD 5DBGA 3TQCA 3MMPA 4LNUA 4KWIA 1QO0A 2ZJ1A 1EJ0A 4QJIA 5AHXA 5BNWA 1GT6A 2O14A 3SZ3A 2RGAA 2DF8A 2VDWA 2WIBA 2HJRA 4PANA 5F64A 3HB9A 4G5RA 2D3TA 4A2PA 3IP3A 4YMUA 4JP3A 1I0ZA 1U7ZA 1IN4A 3EODA 2R2GA 1FJGB 4O4JB 1XU7A 3ZKAA 1GNSA 3OFNA 1QC5A 2CFOA 1JEYA 4S2UA 1GQQA 4V38A 1KJJA 3K92A 2ON6A 4B46A 3WK6A 4D92A 3I4LA 4EY8A 5GJBA 3CF6R 5JDCC 3RASA 3WLRA 4DHWA 3U9TA 1G55A 1NX6A 5F9FA 4YTEA 1U1GA 1BEUB 1Q3TA 1IWOA 1JIXA 3A4MA 3R3SA 3DO8A 3NGXA 4EHBA 2B0JA 3BXZA 4LVUA 4PYRA 3KKEA 4AG3A 2QI9F 5KC9A 2X0IA 1CR6A 1T3ZA 1JH9A 3QM1A 1TLFA 4REMA 5AVYA 2H1VA 1V3VA 2WWXA 3BMXA 4ND7A 4LVOA 4OFXA 5AIAA 1XQYA 1XFDA 4XSVA 4BO7A 3A1EA 3HDGA 3B3GA 3T7JA 1FDOA 1HFWA 1BHQ1 2FZEA 3ADOA 2G0AA 3T35A 1V16B 3TDKA 2R5WA 1YQXA 2C99A 3ZYZA 1AXEA 2IELA 3UC9A 3V8MA 3AINA 3KTDA 3WYDA 4B4VA 5JNSA 5LQKA 4DW8A 4JI2B 2BE9A 1ZU4A 2BMAA 2YIDA 1JYFA 1RCTE 1ZUIA 3OCUA 5HIJA 4IG4A 5BRNA 1XNJA 1PSZA 1OAAA 1CUGA 4IIXA 5FBQB 4B82A 1HTTA 3BH7A 2V9ZA 4FDLA 3EXHC 4CJXA 2KPOA 2XWQA 3T9EA 4GGPA 2ZYAA 3D8NA 4M46A 2XEXA 3UT5A 2R6JA 2V98A 4FTWA 2P75A 3T95A 3BXPA 4LRSB 3OCZA 5DW3A 2BEVA 4A8TA 5IEBA 2HB6A 2ZUWA 5HUQA 1FNDA 3BK7A 1RZ3A 3OFJA 4TZ0A 2ZB4A 4O1IA 1KIFA 4NJEA 1R1DA 3O4JA 2QJTA 4BTEA 4IKOA 3PJRA 4PAQA 1EFKA 3STUA 4W7IA 1WULS 2H31A 2NOAA 2R1UA 4HNUA 3O2SB 2HC9A 4EA8A 1BWQA 4E1VA 3UJ8A 3UK1A 5KNCH 3P4UA 2AOUA 1H0HA 4XLZA 2O7QA 3F2VA 1KZ6A 3WIBA 2PH5A 1NXWA 3P52A 2G4LA 5L95A 4JHXA 2IBTA 1SBHA 2JHCA 2QUIA 4DKJA 1LVUA 1JEQA 1MJHA 1U80A 2DQKA 1U2PA 1FMTA 1XXLA 4MP6A 2WJ3A 1L8OA 3NIFB 3TQIA 1RWVA 1N9KA 4FKMA 3ZWYA 2F6RA 3X43A 3RC8A 5DTRA 3OC0A 1X9HA 1NOJA 1CULC 2A9JA 2JZCA 4I66A 4OAOA 4HB4A 4BE4A 2OORC 5IKPA 1RLUA 1M2WA 5BNTA 2LPMA 4R7TA 1YTUA 5KVSA 4P98A 2OORA 2A9KA 3B89A 3MW8A 3N7TA 1E98A 4KO8A 1T9GR 2NTVA 5F1KA 4UQLA 2VXBA 4MARA 1JWLA 2KS6A 1SZCA 1EA5A 5CFQA 3J7TA 2NUPA 2WJGA 3BICA 4KQHA 2CXXA 3P0EA 3AJ8A 2Z2IA 4OBBA 3V1NA 1FS5A 3BSSA 3CKYA 3T4UA 1M6HA 2R6CA 3AW8A 3SYNA 3D6TB 4D82A 5IU6A 4FHGA 3NC0C 4EAQA 1R66A 1WX1A 2PXCA 2AYZA 3B53X 1A04A 3ZV3A 2Q45A 3WAKA 5BV7A 1XTBA 3DL0A 3LY7A 1WXXA 5GIPE 3PQCA 3EGIA 4CG1A 2PJUA 3NHZA 3CE6A 3ORFA 3V8VA 4EPRA 4AXBA 4QVKA 2XMGA 2Y1EA 1DAOA 2YJ5A 1DJLA 3F6PA 3CF4G 1P0CA 1THZA 3ROXA 1DZ3A 3EZ6A 1BU8A 2EKDA 4U9IS 2FMUA 1DRKA 4DADA 3SJ7A 2FSVC 1VPVA 2H48A 2EKQA 4KDEA 3G1TA 1GUAA 2IYLD 4IHJB 5D3QA 3S4YA 4MP3A 5K0FA 1CDEA 4PLCA 5GY7A 1LDYA 4KR0A 1ODJA 3QE9Y 2ZG6A 2AI2A 1DAIA 3RE1A 5HJ5A 4CEIB 2PUEA 2GQ0A 1UFKA 4AXXA 2PUWA 2JZNA 1GZHB 1QKIA 1WW2A 1W52X 1XZJA 2OZEA 1OXKB 2F55A 3PEYA 4MHSA 2Z8YM 3CCCA 1K5DA 5JV5A 4YFYA 4H27A 3W5SA 5FXMA 1M0WA 3LT0A 4NJMA 3ZW8A 3EA4A 3EOZA 3GP3A 7GPBA 2DFVA 4ZVRA 1H5QA 1GGJA 1RRKA 1SIWA 2GPNA 1AF7A 3H2BA 3L7JA 3KETA 4DLBA 2I2FA 4Q1FA 3RV4A 3UA4A 1XIVA 1PK7A 4KEAA 4YHBA 1TT7A 3QXXA 1ZCFA 3U0VA 3IEMA 3G82C 3UCXA 1NI5A 4G5QA 1P7WA 4NJOA 4RULA 1G5RA 4HG2A 3VNRA 1Q92A 2G17A 2CUZA 3WL4A 4PCVA 2OBNA 4P1ZA 1NVUQ 3SDSA 2MYNA 1T1GA 1L7PA 3GXOA 1EX6A 3I09A 4JLNA 3RJZA 4US0R 4C7OA 3FIUA 2NVWA 2I3DA 1UAGA 1BRTA 4XWYA 1RM0A 2O2JA 3R8FA 3TTWA 1CR2A 1DI0A 2DE0X 2Y0PA 4BMNA 4AAYA 4J6EA 4V3BA 1ZH6A 1NBMA 3TD9A 4CNBA 1QG4A 2V1XA 1WDMA 2QNBA 3BXEA 3E7FA 3OLYA 4CF7A 5D3MB 4R8MA 1PTJA 2YQZA 4R3WA 3QVVA 3RYCA 2W6ZA 4QWMA 1GARA 4RZHA 2H18A 1PDWA 1VYHA 2BHNA 2QS9A 4Q1AA 1UXOA 3TG2A 5DTQA 1RWQA 1OX5A 2Q3MA 3DQZA 1Z4OA 4Q19A 4AX4A 1II0A 1ZMBA 3RREA 1OZHA 3QU9A 4DA0A 3MGAA 4CV2A 1VKZA 3C2QA 1KARA 3L7OA 3PC2A 1ADGA 4HUQB 4UAUA 2OHJA 1GGEA 4XYBA 4BLOA 1TCUA 2VJBA 3UFXB 2V7GA 1S2DA 4MKFA 5G4KA 1RYBA 3RUFA 3ADCA 1II8A 2JDIA 5CG1A 3T38A 1YQEA 2V7XA 5EJFA 3AW9A 1NMQA 1YS4A 5JUWA 3MTDA 3GC6A 4UTRA 2FVYA 4FB5A 1AO0A 1AMOA 4PYOA 4ERNA 2W6IA 3VNQA 5ABPA 3C39A 3BEOA 4P2BA 4TL6A 2QX4A 3FBGA 1KBQA 1GEEA 2PEZA 1RXSA 1L8AA 2PD6A 3ONDA 3T52A 1O1YA 3WX0A 1JJAA 2KYRA 3CA8A 1TADA 3K20A 3FPBA 3OZVA 3DE2X 5EJ6A 2G04A 2SHKA 3QITA 5A4AA 3D1LA 4IIFA 1HA3A 3EQ9A 2NGRA 3ORQA 3ZDZB 1ZNWA 5C52B 3PQDA 1FUKA 1QIKA 3EDMA 4LGVA 4XB2A 5AM4A 2C3UA 4NOLA 3WG9A 2VXCA 3QZUA 4EVIA 5KX5F 4JLVA 3N76A 2HPZA 2GFHA 2Q5JA 3AERB 1XP8A 2W58A 1EG2A 2R2AA 3DC2A 3OQBA 4U00A 2WSSA 5CEJA 2HSDA 2FJUA 1GPKA 2JKYA 3DH0A 1OC2A 2QB5A 3B1KA 1AXGA 1LQ2A 3ABRB 3ACBA 3AFNA 5TY0A 1FLNA 1XVLA 1QDEA 3HNRA 3ISVA 4YCAA 4KR9A 4K28A 3MCUA 4QU9A 3RQIA 4YNBA 3IUMA 4UAGA 4XH9B 4X85A 1XRJA 3TOCA 3OX2A 4J94A 4K26A 4I4TA 3WRYC 5KKNB 2UU9B 5THQA 3MQFA 4H6PA 4W5QA 1TZJA 3L1KA 1WZEA 1U0JA 1A1VA 1XN1A 1UXKA 2ETVA 4PZEA 4PX5A 5L4NA 3SQXA 2FN7A 3RB8A 1T8RA 3N3AC 4GKKB 4YJKA 3O1JC 4Z4EA 1ZK4A 3O21A 3FVRA 3C48A 1M6VA 3FFTA 3OEHA 1CY0A 3BCUA 3D4PA 3INYA 2AE2A 2GCGA 4QA9A 3VH3A 3VUFA 1XZQA 1E5XA 4G4JA 1EVIA 2A0UA 2UUOA 3QVXA 4FZJA 1QIIA 4WZBA 3N5KA 4D6XA 1PNRA 5K3OA 1P91A 4Q4CA 1DMRA 4G6ZA 2XXAA 4YJHB 2LCQA 3FF4A 3I6ZA 1FFGA 2E48A 2O7NA 1G1AA 3JQBC 2X3YA 1KU6A 2JATA 1YRYE 4BLSA 1GD1O 3IH5A 4WKCA 2WAOA 5FL3A 4Z7NB 4Q1CA 3VZRA 4F96A 1EGQA 5JO9A 2C7VA 1P0PA 2XA2A 3GR6A 1VPDA 2HMVA 3BORA 4G0YA 1VCNA 2Q7DA 3QXHA 1UBHS 4PQFA 3MN1A 5JPDA 3DT9A 3TH5A 1YFKA 3M4JA 3MAAC 3QX7A 4FPXA 2VF4X 5HTKA 1YRBA 1Z0UA 4BNWA 3OLVA 4B47A 1YZVA 1LJ8A 3MGCA 1F06A 1WVIA 4A0FA 2L82A 1W85B 3L6DA 4PTLA 1IG0A 5HIAA 1C7IA 2FE1A 3AKEA 4K6FA 4PLYA 5BQOA 2IDZA 5HM6A 1B0PA 2X77A 1E4YA 3PC6A 3FTEA 4L27A 4CM4A 1KXZA 3AUXA 2GI4A 4K2HA 1CJCA 1FOEB 4MYDA 4Y0VA 1E6EA 4ZMRA 3DT6A 2ANBA 2OV1A 2HT1A 4FB4A 5L45A 4FYPA 1C9KA 3GQBA 2OYRA 1US8B 3VPGA 4CL3A 2WVGA 1UMDA 5F23A 3SC2B 3AUFA 4Y6RA 4HEA1 3B1WA 3W8EA 5DP1A 1LPMA 1S2MA 4DAEA 5BW6B 2GEVA 4S04A 3TIIA 1M2HA 3DOIA 5FUMA 3H8VA 2W42A 3IAEA 4QDUA 3GWGA 1DPFA 2AZTA 3FYDA 4HTFA 4PWYA 1I4LD 2VHQA 1G8HA 1E79D 1LRKA 2C1ZA 2D1TA 3DAYA 4K6KA 2OV4A 4HD8A 5AI9A 4BTVA 1ZEMA 1I3MA 2I4MA 3G5AA 2CSXA 3H2ZA 5GM1A 3Q3IA 1V45E 3GUUA 4JT4A 5JWRA 4D98A 1QCYA 2XR1A 1O5OA 1WCIB 4MIYA 1O5TA 4POOA 1F9EA 2QUJA 1W5SA 1JE1A 2GNOA 2ZJ5A 3FCSB 3G68A 4FYYA 5ALSA 1E6CA 2BKAA 5I9IA 2IYQA 4D0NA 5CH3A 1Z5ZA 1C41A 1POXA 2B1JA 3HXMA 2WM9B 1X1TA 2QTBA 1B8OA 2Q5LA 3SKYA 1KMHB 2WFAA 1E6UA 4Q82A 4B2LA 3LFUA 2O5RA 2QX9A 3G85A 1UBNA 5I4BA 3KPYA 4MPRA 3A6HA 3DZBA 5KMGA 4YPFA 5JAUA 3THYA 1DE0A 1IEXA 1EBBA 3QW2A 4OX9Y 3OE7D 1E79A 3FR8A 1MO6A 5HDBB 1ZAYA 1TU3A 3W5AA 1XCJA 1LNQA 2OECA 1WW8A 5EEHA 3MNFA 5HRUA 3Q0EA 1CJTC 1N2BA 1NN0A 3LD9A 4YI3A 2Z8ZA 3FZEA 1T9DA 2PX3A 4A6PA 5LLTA 2BFMA 3RFTA 3PUZA 3VJMA 4M8SA 3X1MA 1P1HA 3IMFA 4PPFA 1XTKA 3IE1A 5A0FA 4MO9A 1J06A 4QELA 4PM4A 4K8OA 4EY3A 5J2UB 5AQ1A 3VPCA 2C0PA 9LDBA 2ZREA 3OM8A 3P5BA 3RTGA 1K9SA 1L8LA 2XRMA 5ER6A 4LGCA 5F1OA 1P0MA 4BN0A 1VE1A 2DBQA 4W7HA 2R47A 4BFYA 2BM1A 3DDWA 1PZEA 2WHQA 3QW4B 3L8FA 4HH4A 4N5DA 4K9SA 4EHHA 1Y0BA 5DXAA 3I32A 3FCYA 5AUNB 3O26A 2OM6A 1YUBA 2UZ1B 3AUUA 1NNSA 4OQFA 3RK4A 4MVYA 1Z5OA 3FI0A 1DEKA 1Q19A 2H1SA 3OJFA 4MQEB 3RYIB 4F0JA 2LKDA 3GGPA 3EZGA 4GNKA 4YP5A 3QWHA 4H17A 4IFIA 2NQ8A 2P91A 2QV7A 2ZYUX 4DXAA 1VLQA 1Z7BA 1SXQA 1HNNA 3TMKA 1P2GA 2IPAB 4Z4HA 2AZXA 3G2MA 3IKVA 2FEWB 3AM3A 4IIEA 3RS9A 2B82A 3SAJA 5KIAA 3WL8A 1KK1A 2E49A 2YZGA 4RQAA 3SIPA 3G79A 1UJNA 1LJUA 4IQGA 3UFBA 4D45A 2QRJA 3FN4A 5EUBA 4KR3A 4QUDA 4J0CA 1OILA 2V7EA 2ZW9A 3PXBA 4HQ6A 1LA2A 3DBLA 4YJHA 3IQEA 1QIGA 1OKKA 2QG9A 2XTAA 4JS0A 4LMPA 4D9HA 4A0HA 1A9SA 3B1JA 2ZPUA 5IASA 3R2JA 4DLUA 3LFTA 3R0VA 5DZSA 2QWXA 4TTQA 1SXIA 3OIUA 3L6BA 2Z9BA 3TDNA 3FTNA 4DM3A 1LY1A 1ZVVA 2AIRA 1T3GA 5BORA 1R0CA 5HMMA 2YR0A 1G3MA 1EE9A 1E4EA 2WKQA 2FW6A 4EDFA 4FEGA 1TIKA 1Q0LA 1XDZA 4WKNA 3REQA 2UYOA 4N41A 3N1UA 1CZOA 3KD3A 5CD1A 1JGTA 2Q6IA 3AC0A 4ND8B 5DNAA 1TVCA 2Q3CA 4B6PA 4ITRC 2FUKA 1MO5A 5IW8A 4MR9B 4F4DA 5JVDA 3NDJA 3IAHA 4O4IB 2HA3A 3AESB 2FPUA 1WEHA 2VRBA 2ZJOA 4TRMA 4HZUB 4Q9AA 5GJCA 4WSOA 5H59A 3RCBA 4E5DA 1ATZA 1LS1A 2GYUA 1Z25A 4HFMA 1ESNA 4P5EA 4RKWA 3TLXA 2IJGX 4ZEWA 3FZYA 3U1BA 3ZH9B 3O84A 1QU3A 3A26A 5F33A 3GL9A 1DIBA 2EX4A 2FQYA 5DOVA 4F9TA 4PX2A 4UC0A 1MX9A 4UEOA 3IHKA 1TLLA 1GRCA 4FDTA 1U1CA 1ZSYA 4U7TB 1N2JA 2WD9A 5GOZA 4MUBA 4BP8A 2WNSA 1HQKA 4L4RA 1ODKA 3WGUA 5ICEA 5K3EA 3EEFA 5CVCA 4IYJA 2PUAA 2ECQA 4JELA 3OPYI 3OZCA 3HCFA 3B6EA 1CUUA 1XTSA 1NWHA 2HLDA 3OWHA 4IIYA 1M6WA 2PGOA 4M6WB 1M1NB 1TAQA 1YZ3A 3VNVA 4RH3A 3ZBUA 2C03A 3JQAB 4UCQA 1EVZA 1N25A 1NBAA 3ANMA 5A0TA 2HTEA 2WIFA 3TK1A 2BV3A 3TCXB 3H18A 2G3YA 4EEZA 1GZ4A 4PONA 1Z6TA 2ECOA 3CLTC 5AVTA 1JDTA 2BF4A 3NHKA 4QE3A 4FMBB 1G8KA 1II8B 2G70A 4QRDA 5GAJA 2NNWB 1EUQA 2ZTMA 1LUAA 2VHWA 1ODFA 1IN7A 4TS9A 2AOTB 4K9PA 2O2DA 3FCAA 3EHEA 3BRWD 3F3KA 1UXHA 3QH4A 5B7NA 1KZ9A 2I7TA 4PBRA 5FBKA 1IXYA 1O94D 3INRA 5KQLA 2GAIA 4JI6B 2RSLA 4CL2A 3B36A 3FRHA 5DF1A 5IHPA 3BMQA 4OPMA 3AEUA 5IT5A 4C89A 2XODA 1W5EA 3DZIA 1Y63A 4KBFA 4CXMA 2C8KA 3DQQA 3G17A 4NAVA 4KMRA 1U6IA 4JCOA 1SO8A 3WGLA 2H9AA 2P79A 4KZPA 2A30A 4GC5A 2QBYB 3LBIA 1V6AA 1BO6A 3IDQA 1QIFA 3N6XA 4HY3A 4R98A 4DIDA 1N2CA 2NUBA 3HXLA 4GLJA 3NRBA 2DWCA 3J80A 2ZS7A 1FP7A 1FFSA 4MS1B 3B3AA 2Y0EA 4DG5A 1JFVA 2QX6A 1OXSC 3M5PA 3Q87B 4NZNA 3EQ8A 4BBAA 5J1TB 5C1OA 4A8HA 2WFLA 2GBFA 4ZVVA 2JLSA 3A2NA 3PA6A 4FK8A 3QFRA 1VGVA 4EI2A 3OLXA 1Z45A 1KH3A 5F9HA 4RTJA 5ELLA 1GR1A 4AO7A 1RWBA 4OCZA 4NPCA 3MOSA 5TMEA 1KBOA 1Y8QA 4DR1B 1UPXA 1FFAA 4YLGA 2IU0A 1A8PA 3QFHA 1E4EB 1YI0A 3QI2A 4ZT5A 3U3ZA 3T12A 4ENQA 5B7QA 1JVSA 5F78A 1GZDA 2IGBA 3I45A 4D9EA 5I8WA 1LLDA