2HFJA

Pikromycin thioesterase with covalent pentaketide affinity label
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
284
structure length
279
Chain Sequence
AGMFRALFRQAVEDDRYGEFLDVLAEASAFRPQFASPEACSERLDPVLLAGGPTDEGRAVLVGCTGTAANGGPHEFLRLSTSFQEERDFLAVPLPGYGTGGTALLPADLDTALDAQARAILRAAGDAPVVLLGHSGGALLAHELAFRLERAHGAPPAGIVLVDPYPPGHQEPIEVWSRQLGEGLFAGELEPMSDARLLAMGRYARFLAGPRPGRSSAPVLLVRASEPLGDWQEERGDWRAHWDLPHTVADVPGDHFTMMRDHAPAVAEAVLSWLDAIEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Type I polyketide synthase PikAIV
publication title Structural Basis for Macrolactonization by the Pikromycin Thioesterase
pubmed doi rcsb
source organism Streptomyces venezuelae
total genus 98
structure length 279
sequence length 284
chains with identical sequence B
ec nomenclature ec 2.3.1.239: 10-deoxymethynolide syntase.
pdb deposition date 2006-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00975 Thioesterase Thioesterase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2hfjA00
1TAHA 2VAVA 2C0QA 4BP9A 2QOEA 4EY8A 2GYUA 3S8YA 1LZKA 4BRZA 1DT3A 5EGNA 3HABA 1EDBA 4KE9A 4N5HX 1R3DA 4J0DA 2BUAA 3ZLVA 5ALGA 1AC5A 4B82A 3R3ZA 3QPCA 2BUBA 2C5GA 4N8DA 1ORWA 4Q3OA 1DTEA 1BN6A 4DMFA 4KAAA 1Q84A 2CUTA 1IZ8A 3C8HA 2YASA 1ODTC 2XMQA 1CUDA 2FJ0A 5HF9A 5ALHA 2ZYSA 1UK7A 2XQGA 5K3DA 4FBMA 4Y2SA 5AI4A 3A2LA 2DFPA 1ZJ5A 2QTBA 3STWA 5ALPA 1BROA 3V1MA 1AURA 5JANA 4KAFA 4B7ZA 1G4HA 4H7IA 4UHDA 2VATA 2AJDA 3RKSA 3G9TA 4A16A 4CIBA 5HF5A 3DQZA 2WFZA 2XUPA 5BV7A 5DLPA 4O08A 2X76A 5EFZA 5HF8A 4C01A 4CI9A 1UWCA 1VA4A 1XZCA 1XRMA 3F8SA 3OG9A 1ZD5A 3LCRA 2WJ3A 3AINA 5AI6A 4XVCA 5EHQA 1A8UA 1QIEA 3GROA 5ALQA 1WB4A 4UHBA 1BEZA 2PM8A 1NU6A 2XT0A 2ONCA 1IUOA 5I7UA 4X7BA 3DOIA 4NVRA 1R50A 1XZBA 2GZSA 4Q05A 3WA6A 2HA2A 3F67A 3ZLTA 5E4TA 1LBTA 3H18A 4BCBA 1TCBA 1EH5A 4BTVA 4WFIA 3L1IA 1KU0A 3LIIA 5JAOA 5JALA 4HXGA 2VAXA 5AK5A 4DMKA 1IMJA 3D0KA 2QRUA 4AX4A 3WYNA 2PSJA 5CBKA 5IVDA 3WL5A 5CH3A 2I78A 3HZOA 4CG3A 4CCYB 1JMYA 1DT5A 4HTAA 3WWEA 5T4HA 5K3BA 1YS2X 5JD6A 3GZJA 1A8QA 2QR5A 4X94A 3I2IA 4X6YA 2XUJA 4X3CA 5CH5A 3LLCA 5JAUA 3F96A 2PX6A 1A8SA 4B84A 4CG1A 3D4LA 2IX9A 4FLMA 5CT6A 1CUBA 1WPRA 3PDCA 3WMRA 3HACA 4DNPA 3EQ9A 4B85A 1N5MA 1UK8A 4J3JA 4PSCA 1QIGA 4XWGA 2WFLB 3BF7A 1LLFA 3MGAA 2HA5A 1PV1A 4J0IA 3WKDA 5ALRA 3W2TA 2ZSHA 5EIEA 3N0TA 1U65A 2RAUA 1EI9A 5ALVA 4Y2XA 1W75A 1ZJ4A 2O2GA 4XIIA 3I2JA 3KSRA 4E46A 2XUAA 5K3AA 3IA2A 1XZFA 4B80A 3SK0A 2GBFA 4X97A 2BFNA 2XMDA 4X93A 1LGYA 3QM1A 4Y2JA 2QT9A 3DD5A 5D7BA 5JAHA 5BWCA 2RIPA 1TQHA 3DDUA 3QZUA 3WKEA 2ORYA 2UZ0A 1P0IA 4P92A 1GZ7A 1FFCA 2ZYIA 1ZI8A 1ZD3A 2EDCA 4J0CA 4OPMA 4DM7A 2VJAA 1W1IA 1S8OA 2VQ6A 2AJBA 5HCUA 4QDOA 1QIHA 5T4FA 4G1FA 3QVMA 1QTIA 5SYNA 4CCYA 4H7EA 1ORVA 1FFAA 5CT9A 4AO6A 1XZEA 1MU0A 4ZREA 3D2AA 4C6HA 1XZJA 4BBZA 5AKIA 4E15A 4HRYA 1YCDA 3M3DA 3JWEA 4I3FA 4J0GA 5FOQA 5JADA 1VZ2A 1H2YA 2HL6A 4UUQA 2I3DA 4JYMA 2J3QA 5T4EA 5HKBA 4FMPA 4NS4A 4DTCA 4XJVA 2XUKA 1N5RA 2W6CX 3G8YA 4Q3LA 3R40A 4W63A 2WFLA 3SX4A 2AJCA 1GT6A 1H2XA 5DYYA 3DKRA 2C5FA 3SC2A 2JGMA 3DEAA 3OTQA 4EY4A 3WK9A 1ACLA 3JW8A 2YXPX 1CUXA 3K6KA 4H7FA 1MAAA 4PSDA 3P2MA 1F0NA 3E0XA 4Y2QA 4B9EA 1X70A 3H04A 2PVSA 3H2KA 3E1GA 1BU8A 4DNOA 1CUFA 4RPCA 3FCXA 1C7IA 1H22A 1PFQA 4QLOA 4KE8A 3STYA 3CCBA 1QE3A 1CEXA 1XLVA 4MQMA 2QKYA 1EK2A 5AIAA 4OB8A 4Y2YA 3PF8A 3WIOA 5JARA 3O9VA 1QIDA 1HBJA 3QH4A 5FLKA 3O4JA 2PUJA 3WQHA 3G02A 3QMMA 1H2WA 4ZXFA 3KDAA 2H7CA 3ESDA 4UHHA 3D2CA 3O4IA 4Y2RA 2XMBA 1XZMA 1EB8A 5ALOA 3C45A 2H1IA 2VJBA 5AI5A 5AKLA 2PSDA 4L3WA 1TCCA 1CUUA 5DYTA 1QIJA 2Z5GA 3ICVA 5HF6A 5AKKA 3I2KA 2RI6A 3U0VA 5AI8A 4KACA 3WK8A 4ITVA 3D7RA 5DTJA 5LYYA 3QITA 5AKHA 1UKCA 3FOBA 5ALLA 4CCWA 1EDDA 2D0DA 5FUMA 2VSQA 2WM2A 4FNGA 4H7DA 3ZV7A 1B6GA 2WSLA 4YASA 3GUUA 5CTAA 1MX5A 3RARA 4OCZA 1L7AA 2QJRA 3C70A 1TKRA 2ROQA 2B9VA 2WFMA 1GPLA 4Y2PA 2XLCA 2J4FA 4HAIA 1X2BA 1VJ5A 3WKAA 1WHSA 5FV4A 3K9BA 1CVLA 4G4IA 4P93A 4FDMA 1VOTA 1CUGA 4YX9A 3PF9A 2O2IA 4WFJA 2JBWA 2XQFA 1QOZA 2VEOA 4BRSA 1WB6A 3R3UA 5AM3A 1Q0RA 3IVMA 3V1NA 1R9MA 3IBTA 2HIHA 5LZ2A 4TPKA 4Z49A 2QUBA 4KR0A 4MEAA 4EHBA 3B12A 5CMLA 3BL8A 4Q34A 1I6WA 2ZSIA 3EQ8A 4QEKA 4AMZA 5EIAA 4H7HA 3WZLA 2CBGA 5LIPA 3HC7A 5CXUA 1XZHA 2G5TA 1JU3A 5ALDA 5DWDA 1J2EA 3VDXA 1JFRA 2D5LA 1AGYA 1YAJA 4WDRA 1Q83A 5LZ4A 1JJBA 2XDWA 4DSAA 4EUSA 4TVKA 5FDFA 4BVLA 1H2ZA 5DNUA 2IITA 2JGLA 1BS9A 5CURA 4KYVA 4QDUA 2CB9A 5C8XA 1CIJA 1SC9A 1WM1A 1F0PA 4H77A 1FJ2A 2DHDA 3VJMA 1LPPA 3CCCA 3GA7A 1E8DA 1YASA 2H7YA 3KOOA 4UBJA 2FJPA 5A2GA 2HFKA 4UHCA 1CUHA 2CZQA 2P8SA 4B81A 1Y37A 5ALSA 3EQ7A 4A5SA 4FFWA 1NU8A 2JGJA 1EINA 1YS1X 1CUJA 4G5XA 4WY8A 3O95A 5HK9A 2PKYX 2XUIA 4UBKA 1MTZA 3WWCA 4FNMA 1CUEA 1ETHA 2ECFA 4L9AA 3VVLA 1WCYA 3VKFA 4F0JA 3WJ1A 5AOAA 1CUIA 1JKMA 1XQVA 4FLEA 3N2ZB 1C7JA 3OC0A 5DTIA 2WHQA 2NW6A 3L1JA 3E3AA 3I1YA 2HADA 1QFSA 3BWXA 4M0FA 5AOBA 1LPMA 2QVBA 5EI5A 4U2DA 3O0DA 1THGA 2JIDA 4PV7A 5ALEA 4H0CA 4UHFA 3TRDA 3WK5A 3H2IA 3WKBA 4LXGA 4XX1A 4GWLA 1XRQA 4LYDA 1OXMA 3HLKA 4V2IA 5F4ZA 1QLWA 4MJ3A 5ALIA 1QO7A 4DGQA 3D2BA 4DNQA 3ESCA 4OU4A 4WCVA 5CRIA 3U1TA 3MVEA 3ESAA 4AQDA 4K6GA 2JEYA 3WK6A 4AB1A 4INZA 1MJ5A 4KRXA 3H17A 4UBOA 2W22A 2OXEA 4QDZA 5CT5A 2XUGA 3BJMA 2WIGA 3C43A 1N1MA 2CJPA 5ALJA 1WHTA 2J3DA 4HZGA 5DNWA 3C6XA 4FFVA 1NX9A 5K3CA 2LIPA 1W6RA 4Q82A 4UHEA 3A2MA 3I6MA 4BC1A 1TK3A 2WUEA 3G7NA 1SCIA 3H1AA 3H2HA 2PSFA 4QA9A 4MYSA 4G9EA 4DMCA 2QXTA 3W9BA 3WYDA 5LKRA 5KBYA 4UBMA 2BUCA 3LS2A 3DYVA 4LXHA 3K2IA 1LPOA 1DQZA 2ES4A 4JH0A 1UK9A 4MWTA 2PBLA 3DLTA 1TIBA 2QS9A 1XKLA 4BE9A 1CUZA 2R8BA 2ZJ7A 4LKOA 5ALUA 1AX9A 1EDEA 1HL7A 5A71A 3TJMA 4RE6A 2C7BA 3HJUA 1DINA 3NGMA 4M0MA 3TEJA 2Y1KA 3FLEA 4P08A 3EF3A 1LPSA 1R4ZA 1XKTA 3WWPA 5ALNA 3V1LA 1XQXA 4OB7A 1K8QA 3C6BA 1OILA 4X6XA 3WL8A 2VT7A 4HXEB 1UOOA 2QUAA 2BKLA 3PE6A 2QM0A 2XUFA 4U2EA 2WU3A 4S0XA 3KWFA 3WI7A 3FSGA 5CW2A 5D6OA 2OCKA 1PJAA 4DIUA 3WA7A 3A70A 2B61A 5JATA 4AN1A 1ZGCA 5BWBA 2O7RA 1CUYA 4G8BA 1IUNA 3JYHA 1UKAA 2XUQA 2XI4A 5CT4A 3C6ZA 1ODCA 4FBLA 2RGUA 2WU4A 5AK3A 4ZV7A 7YASA 4PSUA 4NMWA 5D3KA 1ZIYA 3AUKA 1XZDA 2Q0XA 5FPPA 3QPDA 4FOLA 4FKBA 4OYLA 2C4HA 3FVRA 1JI3A 4C88A 4BVKA 2FX5A 4BYMA 4ROTA 2XMCA 2GBCA 4FLFA 5AM5A 4B83A 5AIBA 5HFAA 5HQ3A 1WPXA 2OPHA 1XQWA 6YASA 1MO2A 5DJ5A 1QIKA 4AZ3A 1VA5A 2V96A 2WTMA 3M82A 3KXPA 5JD5A 1BN7A 1SCKA 4X85A 3CN9A 1GXSA 3DL7A 5JASA 2X5XA 3BIWA 1XROA 1XZAA 1KEZA 4LYEA 3H0CA 2XLBA 3GELA 4OU5A 4BB0A 4GXNA 1JMKC 3G0IA 2XQIA 2HA4A 2OCIA 3BF8A 3RLIA 5ALZA 4PF1A 5ALYA 4EY7A 2DHCA 1DU4A 4PNZA 3F98A 5EIHA 3IUMA 2WTNA 1OCEA 1E8NA 4BAZA 1CUVA 3AIMA 4X95A 2HA7A 3EIOA 1DWPA 4ZI5A 2XE4A 3T4UA 1UFOA 4K6KA 3DS8A 3ESBA 3W04A 4NZZA 4H18A 4N8SA 2B20A 3GBSA 5HKAA 2H7XA 5ALTA 5JD4A 5HK8A 1XLWA 3Q0TA 3DNMA 3R3WA 2VF2A 4P9NA 4UFOA 4AMYA 3ILSA 4TGLA 4IQ4A 3VJKA 5C7YA 2GYWA 5AK6A 2OAEA 3O4HA 2WKWA 5AOCA 1QO9A 4H35A 4BAUA 4C4XA 1F8UA 3DOHA 1XLUA 1Z68A 2VA9A 4BC0A 1AZWA 3AZOA 5AKZA 1C4XA 3DYIA 3IDAA 4UPDA 4L72A 3R41A 4BDSA 5LZ9A 1T4MA 1CPYA 1G5FA 1TRHA 3I28A 4RNCA 4EB0A 3C5WP 5SYMA 1FFDA 2XQJA 2HHAA 1LPNA 5T4BA 4KAJA 4OUKX 1N8SA 5ALMA 4AO8A 1XZIA 3BDIA 1BE0A 5IVIA 4G8CA 5AKGA 3ZPXA 1G42A 1GKLA 3FYTA 4DMHA 1VLQA 3R3VA 4AN0A 2XUOA 4Q3KA 2GBGA 3HI4A 3FCYA 5FP0A 1W4LA 2RONA 4MWSA 2ZYRA 1QFMA 2WHPB 4K5QA 2G5PA 2V98A 5AK4A 3G0GA 1ACJA 2Z3ZA 4UBNA 5ISMA 4C87A 1K63A 5A6VA 3R3XA 1HLGA 4U2FA 3F97A 1BRTA 1GGVA 4X71A 1E66A 3QPAA 5A7HA 4E11A 5HFNA 1UXOA 3VXKA 3G0DA 1YB7A 4C4ZA 3IB3A 4UFNA 2CMFA 5E4JA 4L0CA 2BGNA 2O7VA 5IVKA 1YA8A 1DQYA 4A23A 1FFEA 1QGED 2HRQA 1E3QA 1XRRA 3I6ZA 1Y7IA 3TGLA 4KJXA 1USWA 5LZ5A 4OYYA 4MXDA 5KWJA 2XMSA 1VKHA 4K6HA 3HEAA 3ZLUA 5AKYA 3X3HA 3LP5A 5DNVA 4OB6A 3ZI7A 1L7QA 1J06A 5FRDA 4QZVA 1BCRA 1IZ7A 4F5ZA 1A7UA 2JGKA 4BVJA 5AJHA 1MX1A 3FNBA 5DYWA 1AUOA 5E2IA 4FWBA 4WJLA 2WJ4A 2HA0A 2WQZA 4QE3A 3H19A 2WJ6A 3DKKA 4QWMA 3IUNA 1YB6A 3BDVA 4C4YA 1VXOA 2WHPA 3D59A 1G66A 2WLSA 3I2HA 3AFIA 3FVTA 4E14A 3WJ2A 2HDWA 1JJFA 1HPLA 3AILA 3HXKA 2R11A 2V9ZA 5A7GA 3WK4A 2EDAA 4HS9A 4KE6A 1A88A 3A6ZA 4MYDA 1GQRA 2Y2VA 2Y6UA 5I9IA 2BJHA 5IH7A 3AZPA 1GPKA 3B3QA 3BXPA 3W05A 1XRLA 1SOMA 5AKEA 1W52X 5ALWA 3I2GA 2YH2A 1DX4A 1EB9A 4F60A 1VZ3A 3QYJA 2ZYHA 4QNNA 3T52A 1Q0ZA 1M33A 3FSGD 3MUNA 1QZ3A 2JGFA 1R9NA 2X8BA 1QTRA 2QMQA 1AKNA 4JNCA 4KRYA 1IUPA 1TCAA 3IURA 4IH9A 1ZI6A 3R3YA 2OLEA 2Z3WA 5FPQA 4GI1A 4GEGA 3G9XA 4W1SA 3OURA 3F9CA 2Y6VA 5JAPA 1P0PA 4EY5A 3H1BA 5JZSA 2Y2UA 2PU7A 1R88A 4F21A 1XZGA 1EA5A 2QZPA 4CG2A 1LNSA 1AMNA 3WLAA 3RK4A 1THTA 3OPMA 2AJ8A 4H7JA 2C58A 4WY5A 5ALXA 2BCEA 1IVYA 3ICWA 5IKXA 1EVQA 2WG2A 3MUOA 4GHWA 3NOXA 4BTLA 5ALFA 3WIBA 1EVEA 4AXBA 5AKXA 1QIIA 1RWQA 3FYUB 3M83A 1MT3A 3DL4A 3HSSA 4Y2UA 2PSEA 2G63A 1RYYA 3QBJA 5HQ3B 1LZLA 3WK7A 4PO3X 4J0KA 1BEEA 1RP1A 3UUFA 4LHEA 1CFJA 2AXEA 2XUDA 2VTVA 3EBLA 4CFSA 1XZKA 4X92A 5FXMA 3DJYA 3OM8A 4M0EA 1X2EA 1P0MA 4Y9SA 2JGIA 5AKJA 4J7AA 1QJ4A 4U2BA 2PPLA 5J3JA 3G0BA 3UMJA 5A7FA 4H7KA 4QDXA 2WUGA 3AJAA 4RGYA 1WOMA 3NUZA 1ZI9A 4HVTA 5ESRA 5LZ8A 4X6UA 4G9GA 4K2AA 3WKCA 2WIDA 5AM1A 3W06A 1HDEA 3D5EA 1SCQA 1ISPA 3IUJA 2QJWA 2CKMA 2DQYA 1B41A 2WILA 1KU6A 1UKBA 2OGSA 4KEAA 3IULA 2VJCA 5YASA 5AHXA 1ODSA 1K6EA 1Y7HA 3FLAA 3ED1A 3PFCA 4W9RA 3L1HA 2HU8A 1CR6A 1ZOIA 3GFFA 4DLNA 4U2CA 4WFKA 1CQWA 4GLBA 1U2EA 4KE7A 3G9UA 1FSSA 4B0PA 4BE4A 3UUEA 1ZD2P 5AM0A 2XUHA 1XQYA 1T2NA 2ZJFA 2I03A 1YSCA 3B5EA 4IO0A 4EA6A 1ZD4A 5CT8A 1XRPA 2GZRA 2OCGA 4JYPA 1LPAB 3IIIA 1ZIXA 2J4CA 1MAHA 4GBGA 1AQLA 4BZZA 2HU7A 3V1KA 5K5EA 1JJIA 3FYUA 3E4DA 2JEZA 3O4GA 3V9AA 1ZGBA 3V48A 1JU4A 1CUAA 4OSEA 3WWOA 1E5TA 1CUSA 3FBWA 2OQIA 5AICA 5JIBA 3H2GA 4YK7A 2HFJA 1J1IA 4HRXA 1LPBB 4I19A 5AM2A 4EY6A 2OGTA 3PICA 4ZRDA 3R0VA 3VISA 5LP1A 4G4JA 4EZIA 2PSHA 1GKKA 2WHRA 2E3JA 1QIMA 1UOQA 1DWQA 3H2JA 1P0QA 2DQZA 1R1DA 1GQSA 3WWDA 1MNAA 4AO7A 5C81A 3WL6A 4N5IX 4IH1A 2DCMA 1XFDA 4UBLA 4X00A 1YAHA 4ZWNA 2OQVA 2AJLI 4Y2VA 5LZ7A 3LIPA 2IIVA 2HA6A 1BCSA 1HQDA 3W9UA 3M81A 3G9ZA 1E8MA 4GECA 2BAGA 5LKAA 1U8EA 2GBIA 4ETWA 4X91A 5E4YA 2WIJA 4MEBA 1LBSA 3I6YA 2H9YA 1MPXA 4LXIA 2I3ZA 5JZBA 2OAGA 1JT2A 3STXA 2DR0A 2K2QB 2WUDA 4B6GA 1K5PA 3IUQA 4BATA 4N8EA 4J0HA 2YYSA 3S2ZA 3D3NA 1UK6A 4IHAA 4G4GA 2FUKA 3A2NA 4W1QA 2Z8XA 2VT6A 4RE5A 1GPNA 3FAKA 4AZ0A 3C5VA 2DHEA 4DYHA 5BOVA 3FWHA 4BCDA 1QIFA 5EHNA 2ACKA 2XQKA 5AH0A 3Q8WA 1E89A 3KWJA 1CLEA 5JZ9A 3STVA 4C89A 2OCLA 5D3ZA 1YR2A 4OD0A 1XZLA 4BAGA 2HM7A 3AIOA 2WIFA 1O6FA 3G0CA 1EHYA 5AI0A 5K3FB 3PI6A 2C0PA 1L7RA 4WDQA 2DSNA 5HZGA 1H23A 4BZWA 3WZMA 4ZGBA 5I8PA 4UBIA 1CV2A 4JEIA 2JF0A 2WG1A 4JUIA 1SFRA 3OOSA 4EBBA 4DSZA 2RHTA 3PUIA 4HXFB 1YA4A 4X90A 5H3HA 3VVMA 3DCNA 5JYCA 4Y7DA 2V97A 1VXRA 5IVHA 2EEPA 5A62A 2WIKA 2B4KA 4B9AA 4IH4A 3PFBA 1EK1A 1EXWA 2BGRA 2PUHA 4I4CA 2ZVDA 4CIAA 4DNFA 1XRNA 1EX9A 5C8VA 5FKJA 5EHZA 5AI9A 4GDMA 2RHWA 3QMVA 1J07A 5K3EA 4YPVA 3HYSA 3CXUA 3BJRA 5AP9A 1UT6A 2GYVA 5LLSA 2OGZA 1CUWA 4FTWA 2PU5A 4ARBA 4D9JA 5KREA 2JGEA 4U2GA 1MN6A 1UZAA 5AM4A 2PL5A 5CH8A 2ACEA 3I1IA 1UOPA 3ANSA 3I2FA 2QXUA 1DWOA 3AZQA 4LIPD 3FLBA 3BIXA 1O6GA 3C87A 4PW0A 5KWIA 1ZICA 3STUA 1U4NA 4UFPA 4Y2TA 3VJLA 3ANTA 4B0OA 3C6YA 1FFBA 2HU5A 4ZV9A 3HRHA 2HA3A 4MQLA 4W1PA 4BP8A 2VJDA 2OG1A 3FYUC 3CN7A 2ZJ6A 3AIKA 1MX9A 5K3FA 3ZWQA 4PQEA 1VE6A 3NWOA 3KD2A 4J0JA 2WUFA 5EHXA 4FHZA 4QDTA 5CXXA 5C8ZA 3QMWA 3BE8A 3O9MA 3STTA 4J03A 3YASA 4Q1VA 2XMZA 4W1RA 3PUHA 2XB6A 1VE7A 1DX6A 1W76A 2O2HA 1K4YA 1CUCA 2G4LA 3RM3A 1QONA 5ALKA 4GW3A 3C8DA 4BDTA 3SWWA 2XMGA 1HKHA 4QLAA 1CQZA 3WL7A 1F6WA 2Z8ZA 4G8DA 1D07A 1MNQA 2WG0A 4ARAA 2XMRA 2HRRA 4BCCA 2CEKA 5AO9A 1WB5A 1CRLA 4QWWA
chains in the Genus database with same CATH superfamily
3VYTB 2QD5A 3CLKA 4E1BA 1TAHA 4MVJI 1W48A 3GUVA 3RIYA 1JDVA 2VAVA 3VPFA 4JLVA 8GPBA 5KJ6A 1Y9EA 1WMBA 1F6BA 2X41A 4DMLA 2CXQA 1LZKA 1MB3A 1DT3A 2VWGA 3GDOA 4HDNB 4KLAA 5JJ5A 1YRAA 2GA9A 3K32A 1EU1A 3HKDB 4EB6A 1Y6FA 1LJ8A 4HYQA 1R3DA 1O5OA 2Q41A 2IYQA 3RSQA 1PX2A 3ZLVA 2YJ3A 1MO3A 2O2EA 3A36A 2VUHB 2X19A 1RQGA 3ZVMA 1PZFA 1WZUA 2I6FA 1SELA 2O20A 3JWIA 3RFTA 1I94B 2WPDD 4E21A 2BUBA 2QLLA 3SS9X 2R85A 2P9FA 3BEDA 4N8DA 3Q7IA 3UFXA 2OC4A 3K31A 3UC9A 2J5RA 1PJSA 1SXJE 1A2KC 3QEKA 1KK2A 1OZAA 3CR3C 4RS4A 5ESXA 2A0UA 3I4CA 1SD1A 2AN4A 1W4CA 3E22A 2M1ZA 2R00C 1YUNA 2PQMA 2XMQA 3MMSA 5DIFA 3WL4A 1EUCB 1VECA 2PMDA 3KQQA 4A03A 3EN0A 4M1EA 2IODA 1E2UA 1T0PA 3DSRA 5JFOA 4YS6A 5K3DA 1ZK0A 1QC5A 1XPJA 4URYR 5JV5A 3J80A 3D5TA 4CEJB 4YJGA 4IQGA 1U1DA 4IDPA 2DFPA 3DTTA 4IYJA 4TTTS 2C7GA 1W0KA 1R6XA 2F2TA 3NANA 1BROA 3HDQA 5ALPA 5G1PA 3V1MA 4K9LA 4BGVA 4FX2A 4Q9KA 5G1NA 2CXHA 3JY6A 3O8LA 2WNSA 3S2UA 3ZWXA 4NSNA 1DP4A 4I6EA 4LOIA 4AS1A 1K5DA 4XIFA 3GRKA 1OTYA 2AJDA 5FOWA 3RKSA 3V4ZA 3ZX4A 4K46A 4BKQA 1MW8X 4NU0A 1W4BA 4LJYA 5KNCD 4YCNA 1S2IA 2H18A 1CJBA 4CEHA 1P2FA 2PWBA 3C14C 3GP5A 5DI9A 5B36A 3AK4A 3MD9A 3PNOA 2YYZA 3DVAA 4M1TA 4ZHQB 3DQZA 1ZNQO 2C3UA 4EKEA 4ATNA 2IV2X 5BV7A 4B44A 3LBNA 2GPWA 1OLXA 1QAOA 1E9BA 4O08A 4RJLA 5HF8A 1MD9A 2ZTVA 1SD2A 2H4JA 1VA4A 1XZCA 1BE1A 1HE3A 1WS6A 4CF5A 2GYYA 4CL3A 1O95A 1X7GA 3F8SA 5HKKA 3ZE7A 4Q37A 2SHKA 1O87A 3L93A 4GUDA 1K0UA 1U0EA 3FE2A 5EXPA 1NN3A 1LTHR 4C9BA 3URMA 1EBUA 4FJ2A 4HDAA 1Z9BA 2ZLBA 3FMIA 4G1CA 2Q7DA 2Z3VA 1XEAA 1QIEA 3LBYA 4N3NA 3WGKA 4F2PA 2VXCA 5JW6A 4YLYA 3BH6A 3KYDB 5FHQA 2CHQA 1BEZA 3AEQB 4J1TA 4XUEA 3H7IA 1NU6A 1A4IA 2J67A 2J6IA 4M0DA 2Y71A 3QVOA 1I2CA 1ECGA 3BGVA 1IUOA 2Q6OA 5AW0A 1VHJA 1RBZA 1WNFA 4BLQA 1P7CA 2G77B 3RIGA 1G8JA 2RGCA 4JJAA 1R4NB 4RTRA 2YRWA 4WOBA 4X7BA 3TN7A 1G8YA 3MWLA 1Z2DA 4PBSA 1W0JA 4HNHA 2GZSA 1YQDA 2D2VA 2FE1A 4Q05A 1C3OB 1XZQA 4EO4A 4UOZA 3IBGA 2P62A 1PL0A 3H2ZA 1XAGA 2KMLA 3TQOA 4G4SP 3M1LA 5E4TA 1LBTA 4JI3B 3ZLTA 3C3PA 3TZBA 1RR6A 5C46F 1TCBA 2WWFA 2WJJA 3I0NA 5FADA 1GRVA 4BTVA 4WFIA 2VT3A 3D4PA 5L6LB 1KU0A 3EC2A 3LIIA 4H1HA 2PBZA 4ZGGA 4JBHA 3BKWA 3P9PA 2X4GA 3AEYA 4RANA 4BO9A 5IJ0A 1CRZA 3GEGA 2Y1DA 4HXGA 1V71A 1YRQA 4BMYA 2VLBA 1QK4A 1GUBA 5C8YB 4DMMA 2LDBA 5A5EA 3FFAA 3CO5A 1XB2A 3EAFA 3WHKA 1B4DA 2JFYA 1ZM7A 2WZDA 1GP2A 1YDMA 3M0EA 3P52A 4NAUA 5C0OE 5L51A 2PSJA 1GLVA 5CBKA 4QT4A 4RXTA 3UZUA 3VC2A 5CH3A 4B32A 3TAUA 3MJDA 1G2IA 4HOYA 1ELOA 2ZRMA 3NJ8A 1JSRA 4O5AA 1RNLA 4WZBE 3TMYA 3K16A 4CG3A 3AMVA 2JHAA 3KVOA 5CM2Z 3R5KA 3A9CA 5DBFA 1V9LA 2IYAA 2PO5A 4N3AA 3OSZA 2YHIB 3UMRA 3VH1A 1V3QE 3FNRA 3NT2A 1LLDA 5T4HA 2VJMA 1N9KA 1KOFA 2YZGA 4O2BA 1YS2X 3QLUC 3V4PB 3EUFA 3KELA 4Q1FA 4CQMA 4EGCB 2YINC 2OQ2A 1JA0A 2GVNA 4QUJA 4RFSA 1A8QA 1WY5A 1FMLA 2PZGA 5CW1A 4ZYXA 3LV8A 1J7JA 3X1JA 3SU8A 2ZUEA 1R4AA 1GYPA 1GTMA 3GUYA 2CNDA 4PSVA 4M0CA 1YZTA 5LU8A 4I55F 3A10A 3LLCA 2YYYA 5CH5A 1U8UA 2A35A 2C2GA 2O1WA 4RUKA 2SNIE 2Z95A 4REMA 1DV2A 1G6Q1 1A8SA 1Z22A 4B84A 3VU1A 1JR6A 4DAEA 4JK3A 4CT0A 2R96A 3X2FA 3OP4A 7REQA 2IX9A 3EASA 1L7XA 1RMQA 4I6JA 4TMFA 4D43A 1CUBA 5BW8A 1DAKA 2CVQA 2HQOA 5ER9A 2C3OA 5DH9A 1U9IC 5HTKA 4MI3A 3WMRA 3LUFA 1QMGA 5DB4A 3B1ZA 1GLGA 2D6FA 3UCXA 4IP0A 1RTKA 3RTBA 4HPWA 4U6QA 1B0ZA 3URKA 4ER3A 4HUQA 3AV0B 1USIA 2KWIA 3CY6A 4DNPA 4UARA 2IYTA 1N5MA 4B85A 1UK8A 3HI6A 3H5IA 1JR3A 1QIGA 3G8DA 2X0NA 1IZYA 1Z8HA 4YP7A 4EYEA 4XWGA 5ICSA 1EJ6A 3BF7A 4HPJB 1LLFA 2F62A 3MGAA 4Q3NA 3WGNA 4YCAA 1F6DA 4NOLA 3RNOA 4AMUA 4WERA 4F3KA 4EG5A 3HO1A 4H7PA 3NBKA 1TJ3A 2ZKIA 4HEA6 3SC2B 3ADOA 3I5XA 2QP9X 4G2TA 3KXDA 2WYIA 4DEVA 1FPMA 1JHQA 2RARA 3WV4A 4AURA 3N0TA 2A92A 2J3MA 4RIHA 5C1PA 2XKJE 1II9A 4WECA 1XVTA 2FEPA 3QNMA 4WLNA 5BXYA 5GJVC 5A4DA 1JRLA 3CUWA 1RE0A 1B0AA 1A98A 4PG7A 5FI1B 3UHOA 5M29A 5LMNB 2ZRDA 3THYB 3F6EX 3I23A 4XIIA 4DWVA 2JH3A 1YI0A 1C1HA 3PC3A 3I2JA 4HDKB 2ZRLA 5ICCA 1NMSA 1JW9B 4DRZA 2JS7A 2R4TA 2XCQA 3ACCA 2DY0A 3IA2A 3JQ9C 3T5BA 4FFBB 4B80A 2XZLA 3E9QA 1OKKD 1OYYA 3PXBA 4OMDA 1KOGA 5EUMA 1EM8A 1XJWA 3AF3A 2IYOA 1EQAA 3HZZA 4MIYA 1QGUA 4DKJA 4U02A 3QM1A 1GZUA 3LPLA 1ILEA 3OF2A 1I0ZA 3DD5A 3KZXA 4IFTA 4QHYA 4RSGA 4Q9IA 1SAYA 4B73A 4QYIA 3OPVA 2RIPA 1ABFA 2Q62A 5FA5A 4IXNA 3ZVLA 2AC2A 3RASA 3GLGA 4JXKA 2IUFA 3K0AB 1N0IA 1V7PC 1WZNA 1YQQA 1RJ9B 3B53X 3DDUA 4J4HA 1ZRNA 2JIQA 3MGKA 3SIXA 4XW2A 4BNDB 3SX0A 3FUXA 3PFHA 3WKEA 2ORYA 4ZVRA 3HB5X 3VH3A 2WTEA 2GX6A 4RZQA 1G1MA 5FWAA 3WAJA 1OGIA 4Y6QA 2OY0A 2FSUA 2O7SA 1Y6GA 5EG5A 4IPTA 3L0IB 1RBMA 3IT3A 1MJNA 2P9BA 2VH1A 421PA 3ABZA 2HUPA 3B48A 4OPMA 1B0PA 5G0WA 4TXLA 4Q7QA 1ODKA 3DV0A 5MFZA 3LOQA 4JHXA 3T06B 1A27A 1W1IA 3FPJA 3FFXA 2TMYA 3GJ5A 3NEPX 2M6SA 4K3UA 4CL8A 4E2YA 1KSGA 2JANA 3JSXA 4J2TA 5HCUA 1AXEA 2GN4A 1Z33A 2XZPA 1NBIA 3DW3X 5T4FA 4H4EA 4HSEA 3K1JA 4ZV4A 1CSEE 3OCXA 3IT2A 1QTIA 4LAFA 2NU9B 5SYNA 3RYIB 2E4UA 3AC0A 1N4DA 2EL9A 2WMOB 3OPYB 1DE0A 1BW9B 1PK7A 2N47A 2C84A 1ISHA 4G07A 1B1CA 3PJFA 3VYVA 5TF4A 1OD6A 3KFLA 2I5PO 4QPNA 5ES3A 1FFAA 2GJSA 4KQHA 4PX3A 5CT9A 1XZEA 1SZPA 2A9KA 5JVDA 4B3DA 5INTA 2O2CA 4GI3A 4RL6A 3TZCA 4M46A 4CVNA 1VL8A 3LY9A 1DCTA 1G63A 1F0KA 2ZE6A 1CETA 3H86A 1U9ZA 2KLBA 2QP3A 4Y2HA 1Q1ZA 3RT9A 1VDZA 1G4UR 3BIFA 5E1MA 2IHJA 3DBIA 3WLIA 3ZI4A 2ENWA 2FXIA 3ZWPA 1BG6A 3VR5A 1ZY2A 2HJRA 2HJ9A 3JWEA 4GPBA 1RLTA 2HSZA 2FJUA 4YIKA 3RABA 4CMEC 4XM2A 5BSGA 1TEHA 2CXOA 2XVZA 1T6NA 4EG8A 1VZ2A 1IBKB 2I3GA 4FB4A 2I1LA 1DAHA 3KSUA 3R6GA 5JPIA 2EWMA 4LGYA 5T4EA 3SR3A 3UGJA 4FMPA 1E69A 1TFUA 4H31A 1Z3CA 3TM5A 3I8OA 2DRIA 4E2ZA 4B6PA 5EJFA 3COJA 2AFHA 5FUYA 1N5RA 3EXIA 4QX6A 4TM8A 4DXHA 4EECA 4KLCA 2W6CX 3SMQA 5JSUA 3K94A 2J32A 1X0XA 3G8YA 3TOVA 4RTLA 1VSQA 3R40A 1V16A 3ROKA 3V4LA 3VUFA 3K8ZA 2WFLA 4F11A 3QVUA 4QSHA 1GT6A 1BDJA 3Q3HA 4PNEA 2NO5A 4U5QA 4OP3A 2JATA 5DYYA 4ZT4A 3K70D 1I4DD 2JBAA 5TSDA 2YHSA 3GOHA 2FUCA 2HQRA 4L07A 1L4UA 5FBWB 2JGMA 1Y3HA 4EY4A 4JJZA 2HB6A 5DBIA 4QJ4A 3JTMA 1AH2A 1EDOA 5LXTB 4YT4A 1RRKA 1XU7A 4NCXA 1C7RA 3K0KA 1RYFA 3HLTA 3KLNA 2RHHA 3AUJB 1B76A 4R1SA 1G7SA 4Z4GA 2DSTA 2V7TA 1GPMA 3IKJA 3K6KA 2B3TA 2DX7A 3IE0A 4FJ1A 1U2SA 2G17A 4GMHA 4JSTA 5ITZA 2QBYB 1MAAA 2XEDA 4LC0A 2ZYWX 5FBQB 4U2KA 1I3OA 1XAJA 3E0XA 5CVEA 2QE6A 3HPRA 5G3ZA 5TEWA 4B9EA 1E3JA 1AGPA 1S96A 1X70A 1TVCA 2H4WA 2C4WA 4YGXB 4ZEMA 4Q0MA 1C0EA 1Z5WA 4RPCA 4P3YA 2GDJA 1QQ5A 2IY7A 3C7TA 4L85A 2VBIA 2QQ5A 5J4VA 5LDDC 3L7CA 2ZDGA 1C4OA 1NBMD 4ENPA 2AXPA 1W5AA 2F7SA 3I1FA 1JWLA 1E2BA 2VJOA 4G0ZA 4JITA 4BVBA 4JP8A 1B0UA 1QE3A 1SCUB 2VAWA 1ZWKA 4PPYA 1AS0A 5K9ZA 1BHO1 1PR5A 1R2QA 1ONNA 4OB8A 3EBOA 4MW6A 1JHYA 1ZH4A 4GPIB 5EPOA 4LJ6A 3WIOA 3WLTA 1B8NA 4URXR 3QH4A 4HDCA 4AF7A 5FLKA 4DHEA 4B3XA 1DFGA 5JCJA 3WQHA 1S9HA 2IUYA 4C03A 1A3CA 3GRCA 3KXLA 5IK2D 2QRKA 3IP7A 1RYDA 1N5IA 5B58C 4YRPA 1HDCA 2H7CA 2JIZD 5KCMA 3M34A 3AX6A 3ESDA 1QHSA 2I2FA 3U39A 1WU7A 3N8GA 4YY3B 1WW3A 1TM5E 3OOYA 3PTAA 4PLHA 3AF6A 1A5AB 1O95C 2NUAB 1XZMA 4C5CA 1U28A 2FPIA 3H8SA 5BN4A 3O8RA 2A58A 2CXXA 2DZDA 1PQUA 2ZSAA 3Q15C 5GGXA 2ZAMA 3TKLA 5ES4B 1AS3A 2GN1A 1TZBA 1TCCA 1EGAA 1W8DA 3WLHA 3QOXA 4HUTA 3CF2A 4XPIB 1S9DA 5FNZA 2JFZA 1N5JA 4MV3A 3I01M 3ZZUA 3H1PA 4J1TC 3ZDRA 5TT1A 2PGIA 3DWGA 4UEJA 1A9XA 2FSSA 2IFTA 5AKKA 4WXPA 1EM6A 3K6JA 4I81A 3V6LA 1ZN8A 4HFMA 4YJFB 4L8WB 1CJTC 3WK8A 3ZY2A 1JEEA 4G1BA 4IIEA 3BCRA 4ITVA 1TA4A 4WE3A 1OH5A 1XRJA 1ZUWA 2VYCA 1XHLA 3WBJA 1U0LA 4YROA 3VSAA 4IJUA 3GIDA 3K15A 3JALB 3D7RA 3ECAA 5DTJA 3U3DA 4JOBA 3TG2A 1UKCA 5CITA 1X38A 2VUTA 3ZEAA 5A1TA 3GJTA 3GVIA 4CCWA 5F64A 4RFVA 5K0TA 1EDDA 1UBMS 5LP6A 3LFHA 3IEVA 4FJ0A 2GLUA 3ZJVA 4PZEA 2X2FA 5JQWA 2D0DA 2P8JA 2VSQA 4FNGA 1PUIA 2OD7A 2W58A 1IUKA 4L3OA 2P9ZA 4OLHA 3OEEA 3RC9A 3MS7A 1NOKA 4N01A 4MQFA 4K9RA 1GSAA 5J5AA 4D3DA 3HRIA 3HVRA 1F9EA 2F67A 1EFTA 4MW7A 4XDHA 1JKFA 5DGXA 3RUAA 5H9VA 1NJSA 3OX3A 2C9YA 4D81A 1PK8A 2V7BA 1HV8A 3CKKA 1LDYA 1CDDA 3RRYA 2QJRA 3GZNA 3LPAA 3C70A 5MN5A 1TKRA 2JGRA 2C5BA 5AHRA 5H81A 1YE3A 4Y9TA 5B3LA 5GIOE 1BHJA 2PUDA 5K0BA 3ZYCA 3TD9A 1RC0A 1YACA 5DO9A 4Y2PA 1J23A 3IPLA 2XLCA 3AUXA 4HEJA 1KP3A 4F3CA 3L41A 5C3MA 3CRZA 3PPWA 1X2BA 3EGWA 4HWSA 3HB1A 3RYHA 3WNCA 3F73A 2B8TA 4IVQA 2BFMA 2BTOA 4QUEA 4R2JA 1GU0A 3ROZA 3QG1A 1NUSA 1G18A 2A14A 2XECA 2Y77A 1JL3A 1SO8A 3VKUA 1YS4A 4QAJA 1NV9A 3L79A 2VJKA 5JD3A 3IA7A 1LQ2A 4OFXA 2HF8A 3GHHA 4FSDA 4NCIA 4P93A 2BZGA 4B3FX 4LF6B 3AB8A 3HCEA 4YX9A 3U4QA 4FHEA 1KZ4A 2O2IA 1X14A 2XQFA 3FHOA 2UZ1A 1UP7A 2E49A 2FSVA 5GONB 1N2CB 5DNEA 1MOPA 2JFBA 5KQSA 4ZHSA 4A91A 2P6RA 1WB6A 5BMVF 3MTIA 4GUAA 1QVRA 4RQUA 2XZOA 3O6VA 4LHXA 5MFPA 4WW0A 2HIHA 1ZP6A 3AM5A 1OUMA 1NQAO 3VH4A 2A6PA 3ZWDA 1P3Y1 3G82C 2A1IA 5PGMA 2NIPA 1PS0A 4CCSA 4RY9A 4J16A 1N6RA 2B37A 4ON9A 1XCGB 1BKSB 2H2HA 2Q6VA 2ZSIA 4I2NA 4AMZA 1HK7A 4GOND 4M88A 4YQFA 5FUXA 2FEAA 3ND7A 4E3ZA 5IYZB 1M72A 2X6RA 1QG6A 3WZLA 1GNTA 2OV1A 1QUEA 1E1QD 1RQLA 1TEXA 4F56A 3ORFA 3RWBA 2IS2A 1W5SA 5DKFA 3GP3A 4RM2A 1Z0JA 1KI7A 5FUWA 4MV0A 2G5TA 3RIHA 5EIFA 3M5CA 5ENVA 1JU3A 2FDRA 2W8ZA 5DWDA 4ZVKA 1QV6A 5H59A 2W70A 3REQA 2XRZA 5IJ9B 2VTBB 1PR6A 4G1VA 2WSYB 4DZZA 3ETHA 4KPEC 2H2FA 1T3SA 1ZUHA 5EKTA 3PXDA 4UZSA 1OLXB 2DE0X 4BASA 2JLXA 4O6VA 2EG5A 3KAPA 2FZKA 4Q18A 4PVDA 1WZCA 3ZUGA 2CNNA 1HE5A 1IRIA 2EP7A 5HOEA 1YRYE 3ENWA 1CF9A 2BGMA 1BXGA 1H0RA 2AHOA 2Q7XA 3QA3E 1A5TA 1NFFA 3LQ2A 4XVQA 5ECYA 4E2FA 5DNUA 5JHGB 5C7OO 1WHTB 3R7AA 1BS9A 2JAXA 4FINA 3OLQA 1VL5A 4QO8A 4XOIA 2LP4Y 2BM0A 4GVPA 4RKWA 4E0BA 3LW8A 5CEFA 1Y4SA 4RPIA 4P82A 1WF3A 2VUIB 1NI5A 2Q29A 1U8FO 5TS2A 1RIIA 3VQTA 4CUKA 5B2EA 3U4GA 5CVCA 3Q3EA 4CE6A 3R8FA 1C7FA 1JPVA 3PNYA 1R0KA 5HMMA 1ZUNB 5THXA 3FTDA 2VJLA 5CFPA 3AFMA 5C7LO 4HP8A 4PYRA 3VO1A 3X1DA 1G7CA 3TZ6A 3CCCA 1FLVA 1PUJA 2FFRA 1DAOA 3GA7A 1E8DA 1ECJA 2IW1A 2O06A 3QU4A 2ZB3A 4B43A 1XBTA 5FO1A 2PA0A 1JPUA 4Z5XA 5HOQA 1FMJA 1OBVA 3KOUA 5LUBA 4OX9Y 1M6EX 3ZJYA 5F98A 1U4OA 5BV2P 4WHMA 3X44A 1UXIA 1UPXA 1UR5A 2CEAA 2P8SA 3K72B 4OJKA 1WV1A 1JDZA 2HIMA 3OJWA 4M8NE 3VR6D 1OGJA 3VTAA 1PGPA 4DRYA 3L2OB 4P0TA 4PYNA 2J59A 2UXCB 1VSTA 1Z2EA 5ALSA 2QY9A 3RANA 1GYQA 2L2QA 3Q85A 3DNFA 1QTQA 2JGJA 1MQAA 3R76A 3UT5A 3IIMA 1OC2A 5JI2E 3WGHA 1YS1X 2E4VA 4RHUA 2P7IA 3A1CA 4G5XA 3EVEA 4ERXA 4UNPA 1MJFA 4DR7B 2VPYA 4RZIA 3WWCA 3A3PA 1D04A 3E53A 3F6SA 3GGJA 5E0KB 1OAOA 1J33A 3L04A 1KYZA 2FKAA 4UDXX 2H4YA 3VVLA 3DBRA 3JZMA 2DTDA 5HJEA 4BX9A 4U7HA 3WJ1A 4DLSA 4GYJA 1ZCAA 3E5MA 2HJSA 3INGA 3BZUA 3I9V1 3B7PA 3AFNA 3IYLW 3PV0A 2QY6A 3H5VA 3N2ZB 4KDCA 2DWPA 4TTIA 4Z4QA 2WHQA 2HO5A 3NALA 4LYYA 5J4HA 3NWEA 4KXYA 1QH9A 1MOQA 4G8JA 1Z26A 4UVEA 3J81k 3L1JA 4LGCA 1PTJA 2VJMB 4MKGA 3RWMB 3SVLA 2HADA 4P98A 2FN9A 1QFSA 2Z4SA 2I2CA 3TLXA 3PZRA 4NV1A 1LPMA 3LVRE 4IEFB 4Q16A 1RXWA 2D5AA 3LKZA 3O0DA 1XMXA 2X5KO 3GRUA 3AF1A 1R74A 2BISA 4FE4A 1WTAA 3QLTA 4PFJA 3GN2A 4RK7A 5BN5A 3QKIA 2JLAA 4H0CA 2G1AA 3D7LA 3IOCA 1L4FA 3M3HA 3GLTA 4HAYA 3H2IA 3HFJA 4CN8A 3E7FA 2X58A 1JBKA 5L45A 3HYNA 1F5SA 2P5YA 4A8PA 2CYBA 3HEMA 4PS0A 3VDMA 4V2IA 4YAFA 4AXXA 4Y1FA 2QVLA 3CINA 5F4ZA 1QLWA 1AB5A 3EDMA 4XFDA 4D1YA 1ZH8A 2AEMA 5HDQA 4LHYA 5CP8A 4C1BA 3DV9A 1AMUA 1YFJA 2CV0A 3CYFA 1QO7A 1A9ZA 2GJ9A 2MYPA 3P2KA 1M54A 4C1NA 3MTBA 3TL3A 4X65B 2HMAA 2A1UB 2W2QA 3DB2A 3D2BA 2HZBA 3F5QA 3GXBA 3W8DA 2IHBA 2YZMA 4WCVA 8AT1A 5JSQA 2ZUFA 4UCFA 3GY0A 3IO5A 3PNVA 5CRIA 4AKEA 2I71A 2JJ1D 2GWHA 1L5GB 5D8DA 1I6KA 2CJXA 2AQIA 3ESAA 3TZKA 5CBPA 3OCZA 1PT9A 3QU9A 2C29D 1G21B 4FPXA 4E4TA 5IHXA 2JEYA 1C8KA 1SVIA 4INZA 4KRXA 3E4CA 1PZNA 2CHFA 2XUGA 1K2VN 3DVRX 1Q0LA 1GZ3A 2BGLA 2BGJA 5ALJA 1E9DA 1RHQA 2C0CA 4M21A 3RUHA 3KHSA 2ZFUA 1U8CB 1SU7A 3O7WA 3RV3A 4A92A 4BFVA 3ETJA 3GMDA 4RK1A 3UK2A 2BFPA 1T8RA 4DGSA 1MXHA 3I53A 4GOJA 4Q82A 5JR3A 5IU6A 1T9KA 2IWRA 3UK7A 4BX2A 2X2EA 1E5LA 3I6MA 5B37A 1RQNA 5JY1A 1TK3A 2WUEA 4JLPA 4EBFA 1LSJA 1PDVA 2QN3A 1T6ZA 3OQHA 4EMSA 2PSFA 1BMTA 2WU0A 5K0SA 1EM8B 4AZ3B 2OO5A 4A0SA 3DFMA 5IWAB 4DMCA 3ZCSA 1A2BA 2QLJA 1LW6E 2AOTA 3PDIB 4OQMA 1JB9A 2BUCA 2QGNA 4ZALA 3UK0A 3UMYA 1BH6A 1L5SA 4LXHA 4UW9A 2QDXA 5E6SB 4BMDA 1I0IA 3ZHCA 1ZW6A 1YVEI 2OVBA 3CX4A 3UG6A 1P2SA 2NVWA 4O5OA 2ZULA 4HQFA 5F9HA 4MWTA 4KR6A 4GX0A 1TF7A 1UKZA 4NYMR 7AT1A 3LPMA 3PEUA 5IBQA 3X1WA 5E3HA 2O57A 5FTLA 2QS9A 1H85A 1VHWA 2R7LA 2ZJ7A 4DE5A 3QE3A 2CJYA 4LKOA 5IZ4A 3IESA 5ALUA 4RY2A 1CYEA 1DEAA 3SP1A 4RIGA 1KXJA 4XVHA 1B74A 1GFSA 2UYYA 5IAOA 5REQB 4BFLA 3TUZC 1JA9A 1U28C 2Q6KA 2ODQA 4Q4JA 1RXCA 4MUYA 2PZMA 1PYOA 4KZPA 1AKRA 1QKIA 1HLDA 3E2MA 3I92A 3LLVA 1U7PA 4BMCA 4CMAA 1YHNA 3DXXA 3PNSA 2P3LA 2Z56A 4NJOA 4YP9A 4XE5A 4WOPA 5LNK6 1LPSA 5I7FA 3OQ1A 3WWPA 5ALNA 3QPUA 4RKQA 5LJLA 2XKBA 3CM0A 3F49S 4KCGA 4QPPA 4KQWA 2DFKB 5KU1A 1DFHA 4KLRA 2ETVA 1NRIA 3N2KA 3H3JA 1RCFA 4JXJA 4CM4B 3ZD6A 1K8QA 4Q93A 1ULUA 2PGDA 2WJVA 5A9SA 3DEJA 3C6BA 5K0ZA 3AUUA 3AR9A 1E99A 3HL4A 3WYAA 1NR5A 2Y93A 4PQGA 3ND6A 2LE0A 3D81A 3I01A 4HXEB 1UOOA 4B87A 5KSOA 5IRCD 2QUAA 1RM5A 3AVQA 3KK0A 3LT0A 5KNBD 1J0EA 1T3GA 2IS6A 4HQ6A 2B30A 2XUFA 3T3MB 2IUSA 2WU3A 5D2CA 4YMVA 2D1RA 3T15A 3HJCA 1UEIA 3WI7A 3T3GA 5KTPA 2QX6A 4BO1A 2P0EA 4K81B 5D84A 4DIUA 3WA7A 1OH7A 1MAUA 4G23A 3A70A 1E7MA 5LP6C 4AN1A 4I9UA 3HO6A 1MF7A 3IAUA 1PR9A 4LZZA 1U7UA 2OC9A 1JJVA 2ZBGA 3IV6A 3O8NA 5BWBA 4C7OB 4PS1A 1R66A 2FZ5A 5AMXA 1HT3A 1MA3A 2J3IA 1QZTA 3PYMA 4JODA 4W9NA 5HCNA 1EWKA 5GTDA 4JVNA 4EB3A 1IUNA 5C9ZA 3E5HA 1T4DA 3AIIA 3JCZA 1U7XA 2XI4A 1T0IA 4O4HF 3VNAA 4MLDA 3D0QA 5BOSA 5J63A 2X8JB 1NT4A 4IF6A 2FI1A 3C6ZA 3FTPA 5AVSA 4FBLA 1Z6PA 2QVCA 3EIWA 4KTTE 5AK3A 4ES6A 7YASA 5KYUB 4R5MA 1VBFA 1BU5A 5D3KA 1L3BA 1RQ7A 1ZIYA 2VJQA 2L17A 4HDSB 4I8DA 3U4AA 3EAQA 1XZDA 3G5MA 2Q3LA 4YXWD 4RGQA 1K27A 1OC4A 2A9PA 3PUJA 4BFZA 1SIWA 3ICPA 3RFXA 3HPQA 3PFFA 4FKBA 1AKWA 2O8BA 3D6UA 3W6UA 3X2SA 3ZLJA 1D0SA 2ZYDA 3IOBA 3ZXUB 4UCWA 1P5RA 1WCXA 2V6JA 3LK6A 2POCA 2UYOA 2G80A 3KQOA 4AY4A 2Q27A 3G2LA 2PJUA 3VR0A 4D9CA 3FTFA 4RJJA 4G5YA 1JI3A 3NWBA 5BRAA 3GQBA 4C88A 4BVKA 2FX5A 3M6WA 1VG0B 2ZGVA 1YI8A 5K8VA 2Z6AA 2F48A 2GBCA 2FSVC 3L7AA 4QUIA 1E1CB 3X1YA 2WTBA 1V7QA 2P6NA 1USVA 4LRSB 3W7VA 1HE4A 5HQ3A 1RI4A 4LI3X 2XDQA 3OAAD 4OUDA 2OPHA 1XQWA 3TTWA 4BZXA 1L4EA 4LZLA 1MO2A 4L22A 2HOQA 3T7KA 3V8QA 4H60A 1OFVA 1ZSNA 5LA6B 1N8NA 1GPYA 4M76B 1QIKA 3TLBA 1JHUA 3ORQA 5BV1A 2VP5A 4J16C 1MEOA 5GVRA 4RELA 4JA0A 4LISA 3UV7A 2GAJA 1N5DA 2VJYA 1TCUA 3Q3JB 3Q1LA 3U3KA 3R3SA 4QPCA 1KK3A 4MQ6A 3T7RA 2GS9A 1MUUA 4MS4B 2X5XA 5E8JA 1PE0A 1UEXC 4BQRA 4PE5B 3QJYA 1A7AA 1XXHB 1N6KA 1NSFA 2EX1A 2XJ9A 1NXQA 1H5UA 4QOIA 3O5AA 3Q4GA 1BA3A 4LFAB 1C9NA 3UA3A 1RAGA 3R3HA 4PYMA 4HF7A 1QH8A 4DANA 1OWNA 5TGDA 3N3AC 4JR0A 1O57A 3LNTA 4LZAA 1YTUA 1IN6A 2YFHA 2D5IA 2YFKA 2UVPB 1A1SA 1PGJA 2AC4A 2UDPA 3FGZA 2QUIA 3A6LA 3NWJA 4IVNA 4RF2A 1I5OA 1Q0TA 1O96A 4YQZA 4GXNA 5FYDA 3ZEIA 1F4VA 2XQIA 3N2NA 4MRNA 3OBIA 1SC6A 4LYJA 3PNBA 5LMUB 3VO8A 2PUCA 1DUVG 5ALZA 5CA1F 3QSGA 2PLFA 3EISA 3WTCA 3P9XA 4O4IF 2AUMA 2CUKA 1ZXBA 1RPZA 1GL7A 2DHCA 2H07A 1P1HA 5JJLA 4QXMA 3OJFA 5DX1A 1UP4A 3KZKA 3N70A 1A9XB 3F98A 3PSAA 2AR9A 5F73A 3I2YX 3IKVA 1WW2A 2ACWA 4E88A 4H6XA 1GCIA 1FA9A 2BMDA 3VGPA 1PBNA 3HB0A 3JVIA 3W5HA 3PFWO 4KHZA 5FBKA 2YTZA 1E8NA 2GHTA 3V3KA 1XE3A 3KYCB 4IRUB 3WFZA 1U02A 1O58A 3KLOA 2ZR7A 4JQYA 3IUBA 1OVGA 5L4LA 1P91A 3SDZA 1SJ9A 3MB8A 1FVOA 4J0QA 1MC4A 2ESRA 1PWZA 1K08A 2QP4A 4QQ8A 5CYFA 1V37A 4AL4A 2VHWA 1E4VA 4HAUA 5IF3A 4JXXA 1N2SA 2XE4A 3N5KA 5CX1A 4PCVA 4YJ2A 4TWRA 1B43A 4IDEA 3FNGA 1SBTA 5DTEA 3TGLA 4BXOA 2HH9A 5AXAA 1YMVA 4FEGA 1BDHA 1JTEA 1XA0A 4DL9A 5KPDA 4EJFA 3VZCA 4NZZA 3K2EA 3WWZA 1LQUA 4DB2A 1TUIA 1DNPA 5BMOA 2JLUA 3AONB 4LG1A 3UJDA 1M2VB 2Q8PA 3PCXA 3PUVA 4PG6A 4QQFA 4HJRA 2SKEA 3CLRC 5TARA 5HKAA 3VA7A 4MPTA 5CA0B 4MWOA 4TS9A 4UUAA 4QFMA 4MIOA 5DBHX 5D1NA 2W6NA 4QNMA 3QX8A 4O3FA 4RC9A 2GUGA 1M2JA 2BRUA 5CFMA 3L0YA 4BLRA 4EZBA 1EMDA 3QHAA 3Q0TA 3HS3A 3IIKA 1U3DA 3K4HA 2N0SA 4UDOA 2AYZA 2HD4A 1P8AA 1OAOC 2GEDA 5D5PA 3VU3A 3IV9A 3HO8A 4MVJP 1HI9A 2EARA 3VJKA 2BMWA 5I51A 1E79D 4H16A 2GYWA 1Q50A 3DO5A 1RMYA 2IT1A 4H08A 4HGNA 1AGNA 4QLBA 5JZMA 1IRXA 3OX2A 3GF4A 3D6NB 4G84A 4ACBA 2CCJA 3TRHA 3V4FA 1VCNA 1XXLA 1GZ5A 1PTJC 1DKUA 1KI8A 1TIPA 2IXAA 1TD9A 2V54A 2W37A 4JVLA 4WVFA 5T6BA 1Z6XA 3TJRA 2EYQA 1F8UA 3AL3A 3DOHA 3EYWA 3OX4A 3P2YA 4UUBA 4C4XA 3AR4A 4YAGA 4EHHA 2VA9A 3TB4A 1E2MA 1V6AA 2AF4C 2R1UA 1P9NA 3LTEA 2XCOA 4LSMA 3C4QA 4WV3A 1C4XA 5IDXA 4W5OA 3TL2A 4OKSA 2V5AA 2GARA 3M4NA 4IGFA 5FWXA 4BDSA 1QCCA 1T4MA 2P2SA 5I9MA 2HXGA 4Q7EA 4ZYTA 1K7YA 3U3RA 4Q9HA 1SNYA 1KYIA 3L06A 1H4TA 3E2IA 4HAZA 7GPBA 3ICEA 3CJTA 3EGXB 2HMWA 3M9WA 2VF5X 3R0XA 3ZCPA 2XAAA 1TRHA 3DD1A 1X1BA 3IDZA 1AHNA 4D98A 3OLXA 5DE3A 5C5CA 1PJCA 1QCDA 2HCFA 4GPAA 2XQJA 2NV2B 1JBQA 1V8DA 2AE2A 2I29A 3L0CA 3NTOA 4B1FA 3T3NA 3UWSA 4FHCA 4UE6A 4OUKX 1RLUA 2BC9A 3HR8A 3CGGA 4AO8A 5ALMA 2P9TA 2ZRFA 3FWNA 1B00A 1B14A 3GMTA 1XZIA 3HSYA 4LJ8A 4OXQA 2VH2A 2JIRA 2VF7A 2H6EA 1BE0A 1SUWA 4YRFA 4G8CA 5IVIA 4RM3A 2FWAA 4MVXA 4Z0HO 2CXSA 4NULA 4ZDWA 5AKGA 3H9JA 2ONJA 3LQ4A 1A0OA 3LL7A 4HWGA 4GR9A 2PPVA 1G42A 1IEWA 4DIOA 3QQPA 4JB8A 5I9SA 4DDHA 3NHPA 4DMHA 3EZ6A 1VLQA 4O59O 3RU3A 3HGMA 4MVJA 3U17A 1N2ZA 2I0FA 1GGJA 2OWEA 3I42A 2XZTA 3WYCA 4AN0A 1S3GA 4PLVA 3RPEA 1KI6A 4NYJR 5TMEA 4CFYA 2GBGA 1E6LA 3ENKA 5EZYA 3N7AA 4I0WB 2B78A 2HPHA 3FCYA 4L2IB 4QC2A 1EUQA 4KHPB 1KRHA 2YY5A 5FP0A 3EPRA 1V5EA 2PA3A 1NI4A 1W4LA 1U3TA 4N5LA 3Q9UA 3G2QA 6REQA 2WT9A 4W5TA 3RUEA 3IBSA 4YMHA 1XCBA 3TKYA 3SX2A 4YCBA 4FW8A 1G8PA 4F4IA 2D3TA 4K9PA 2ZIUB 4U6NA 4WWHA 1WBJB 3FXAA 2ALJA 2GZMA 3ER6A 4NBNA 5EYPB 3VV2A 4B74A 1NUUA 1CZRA 5AK4A 3R6TA 4FT2A 3AEUA 2OO5C 3B1FA 3CLHA 3VC1A 3NEAA 3AUSA 1L5HA 3MJSA 4TXHA 3ZQ6A 2Z3ZA 3W5DA 2HHLA 4C87A 2P0YA 4FMCF 2QG4A 2FW0A 4HH1A 1A5BB 1HLGA 1M6VA 4Y9UA 4F5DA 3AHCA 4ND2A 4WCDA 3RRNA 1H8EA 1E66A 2F9LA 1GG9A 3W3AA 4LSZA 5HGJA 3BBPA 4J2HA 4KYTA 1PD1A 3M5DA 5IDVA 4D42A 3RYFB 2DR3A 3OEHD 1IIRA 2D4HA 3GUHA 3NASA 1COWD 4MUAA 1IDN1 4OK6A 2NMVA 5E6UA 1ZGHA 2WABA 2V7UA 5KX5B 1Q0HA 2Q0HA 2H59A 2A0YA 5J4KA 3EXEB 4IJ6A 1NP3A 3WGIA 5LCXA 2BFWA 2AQKA 5KTRA 3LWBA 2J0SA 4B7CA 2HW8A 5K51A 4N0PA 2YWHA 4K6MA 4WAUA 5G02A 2D1FA 4NZPA 1L7PA 1ABEA 1YB7A 3RF6A 4V39A 1ND5A 4K6CA 1A4XA 1I1QB 5L40A 3ASUA 3K05A 2WDPA 3ADPA 1GUFA 3CUSA 4F46A 3O0TA 3MAGA 3QJ5A 1Q1NA 3TTTA 3NNDA 2H2AA 1NGSA 1E96A 1ADGA 2BGNA 2QPTA 3ORSA 3OZUA 1XTIA 1QHHA 2XY4A 3A3NA 3WICA 3V1UA 1P1IA 4N4AA 3AVXA 4EG3A 1MDBA 4B33A 1D8TA 1HEUA 1DQYA 4AJ2A 1G20A 1SN7A 1QBKC 1LVHA 3EGIA 2B92A 2Q5LA 1C9JA 1FFEA 1QGED 1RLIA 2HRQA 2WTAA 1O03A 1B93A 4YAUA 4IGAA 1E7QA 2QU8A 2V7QD 1JAXA 2VRWA 3EFOB 4I8IA 1AQNA 3FETA 2YMQA 1O8CA 1ENOA 3QY9A 4L1KA 3VTZA 1DWUA 4E2WA 2OOSA 1ZOSA 2WMNB 2AR0A 3HJAA 3O47A 4EA7A 5TS3A 3SHWA 2FPMA 3BBLA 3SYTA 1H2FA 4KMRA 4MYHA 1J1UA 3I76A 1VKHA 3RYCA 4XQCA 1U3WA 1P7YA 4L9SA 1M2KA 3X43A 4FWTA 2AQHA 2BGKA 3ZLUA 2X5OA 3QUCA 3DQQA 1A9PA 1X7XA 1UPTA 2V8BA 1TNDA 2YXNA 3MD0A 5AKYA 3X3HA 2NV6A 2NP6A 1D6JA 4HB2A 4WA8A 1X74A 1QHGA 1QRTA 3SKYA 5DNVA 1RTTA 1I13A 3IIJA 2ZUUA 4W9NC 3MTAA 1USGA 1D4AA 2OP1A 2XKKA 1NAIA 2X8AA 3EA0A 3M9XA 4E5YA 4QZVA 5LMZA 4WCFA 1TEVA 1U90A 2CLFB 3W7BA 1U7OA 3H75A 3OE7A 1A7UA 3W5JA 3EPKA 4UAVA 5LD2C 1HNWB 2C1ZA 1NMQA 2CYCA 2YWCA 2CVOA 3H16A 3M1IA 3DC7A 4FFSA 1WF6A 3CZPA 2NNLD 1BGWA 4FBGA 4Q9AA 3RDPA 4LXQA 3RS3A 2OZEA 3KTOA 5HNKA 3RAPR 1TQ4A 2BZSA 4BZPA 4CN9A 1JA1A 3ZWVA 1FDVA 4ZJYA 4OLAA 3AEXA 4XWTA 2QLTA 2FNAA 2Q8NA 1JXMA 2WJ4A 1E9CA 3EUEA 3P96A 1DDIA 3B6IA 4RENA 4DJEC 2VHXA 2I4TA 2ZBFA 1GT91 2WQZA 1NOIA 4AJ1A 4C06A 4YMLA 1JXAA 2ECPA 2JCSA 1P39A 3B70A 1AQ6A 5JNSA 2QRLA 1EJ0A 4FZVA 3BMQB 4QE3A 1QOPB 2R8ZA 4BO6A 2RGDA 1HE8B 3DKKA 3OIGA 2B1QA 4QWMA 5AXBA 3ICCA 1IXSB 2VRBA 2QYTA 3HCAA 1T4CA 2AZDA 5KUTA 1QX3A 2NSHA 2WHPA 3E7PA 2PT6A 2ET6A 4MVJH 4F4JA 3D59A 1G66A 6CHYA 1D7AA 1PVDA 3CF4A 1DCMA 1PFYA 3NNSA 4F3TA 3FVTA 3PZBA 3KZNA 2RH9B 3WJ2A 1ES9A 4DBVO 2HDWA 3C5EA 3UKDA 5BSHA 2DFNA 4OL9A 2V59A 1V95A 2C31A 1XAIA 4YONB 3P2IA 4F6RA 4FGUA 5TGTA 1SXPA 2AOTB 3O2QB 3CPEA 1Z34A 2O14A 4DMUB 1MIOA 1JKXA 4LZOA 3V34A 4LJ4A 1GSIA 2Q9UA 2V9ZA 4ANFA 4PANA 1Z3IX 4MWDA 4XQGA 4GOXA 3G7UA 4Q03A 1JHZA 4TV8F 4AUNA 4DCJA 3BD7A 3DTVD 4LRUA 2H16A 4IZIA 1KDRA 3IFSA 5CK4A 3T5CA 5HYVA 3NT4A 3NBMA 4HDRB 1PZGA 3KOXA 1BAPA 3DZCA 4MYDA 2C59A 2P65A 3F6RA 1CNFA 4NESA 1JEAA 1RYHA 4S0ZA 5LQSA 1GQRA 1XNQB 1A9SA 3L9WA 4ZOQI 1YFLA 5HZKA 5KTNA 1PD0A 4ZQIA 3AZPA 3KHUA 3W3AH 1G9XA 2O50A 3CHYA 3JYLA 1VLLA 4DVGA 2FRVA 2PX0A 3B3QA 2VSYA 3L8MA 3E15A 2PZLA 4NENA 1R9JA 5AKEA 4PN7A 1T29A 1W52X 5AHOA 3DFKA 3Q2IA 4WL0A 5TVKA 4JBLA 4R8KA 1MJGM 1ZYUA 3DL2A 4MWZA 4C08A 4JYAB 2RK6A 3U4IA 1TZ2A 1I1NA 1WCIB 1YR8A 2FZLA 2YH2A 1EAYA 3IAM1 4C0HA 3OT1B 4DCNA 3SYMA 4FI3C 1QWOA 4KXFB 5LQUA 1HYQA 2XYGA 3O73A 4YI3A 3QYJA 2ZYHA 2D0OB 3SN6A 3IUYA 4AG6A 1Q0ZA 4BNFA 2ZAGA 4NK5A 3L6EA 3KUDA 1TE2A 3MUNA 3H1EA 2JGFA 4ZMRA 2C9BA 3DE1X 4I1YA 3OE1A 1QTRA 5DU2A 5D3MA 4A8JA 4ZVSA 3VZSA 2EQAA 4NQZA 3LX4A 3FTEA 1EE2A 2H0QA 2APJA 2PZAA 3F6BX 1N2CE 3PNQA 1GEGA 1AN9A 1OB2A 4ARZA 1ZI6A 4NOJA 2PMEA 2OLEA 4KNVA 9ABPA 4RTNA 2Z3WA 3OTOB 3AL2A 1ZG3A 3L4EA 5FPQA 4E5SA 1ZHHA 5BSMA 1QGAA 4NONA 3G9XA 5E7QA 4ND8B 4TL9A 3RGWS 2WUVA 3IKTA 3Q2KA 2YWRA 2WAOA 1S8FA 1GTVA 4EUHA 4RTSA 4QQKA 2VTKA 4ZRNA 1I8TA 4WLVA 2VQDA 5F1PA 3WLPA 3TNYA 4DBLC 5AW8A 2Y2UA 5JZSA 4U7PB 3ER9A 1LI5A 4ZPJA 1Z0IA 1GZSA 5EJ7A 1QB8A 4TWAA 2NNWB 2XNJA 2HC9A 1EA5A 4HB4A 4MQEA 1RQ2A 4KX5A 4WPGA 1YF3A 4KNYA 3RK4A 2VT2A 2BRUC 2QRHA 3KXIA 4ZI2A 5FI5A 2ZDHA 3R09A 2ON6A 4O33A 1UC5B 2BJVA 3FZNA 4RZHA 3W8NA 1GV1A 1W2WB 3LQQA 4P80A 2C58A 5HCIA 5ALXA 2J7PD 5CFNA 1ZONA 3GRZA 4M1WA 2LXNA 3IMKA 4GM1A 1TAQA 2UUOA 3VM6A 1QTNA 1L5ZA 2OHFA 4IIJF 5A4AA 1SU8A 3RBVA 2NQ2C 1PJ8A 1VG9B 4DQVA 1PT5A 2RHOA 2W6ZA 3Q5EA 4DDTA 3MUOA 2OV6A 4F9GA 3OQOA 3PEVA 1A9TA 4DG9A 5SZHB 1HDOA 1T6BY 3U9SA 4NCJA 2GD2A 3WNBA 5J2UA 1NW9B 4WRRA 3EMBA 3KSDO 1NJGA 3LUCA 3DMGA 4KIGA 2VVTA 3WIBA 3AVYA 1DUSA 1UXJA 4S3MA 4BMZA 3AY6A 3BB1A 1Q3TA 5KDLA 5C32A 2I2WA 3ND9A 3R9KA 2H9AA 3DL4A 5DASA 1S1CA 5BPFA 4W5RA 1HGXA 3NYRA 4ZCIA 3KQYA 1PWHA 3A1WA 3TLAA 5HQ3B 1WDWB 5KIAA 2NYAA 3LECA 2NZ8A 1M1YA 3EEBA 4J0KA 4G9BA 2FOLA 4OLJA 5J59A 3V4SA 3ZE1B 1KEUA 1CFJA 4G5SA 3ZIAD 5ECGC 2EWVA 2XUDA 1J21A 2QRZA 2CFSA 1QE0A 1B2LA 1LX6A 1R16A 1T26A 2IEGA 3JQCA 1FFWA 4Y1RB 5HILA 3WQRA 5FXMA 3DJYA 1M1NB 4C4PA 3RTCA 1Y98A 3J81A 4JQCA 2EX4A 1XTQA 3DAYA 3MB5A 1AY0A 4BO8A 4E09A 1X2EA 2YS6A 5J47A 3EXG1 5JMOA 3IJRA 3LQKA 4Y9SA 5H7XA 1YZ3A 2AJTA 3WSVA 1ZK2A 2IEYA 2Q9AA 3GGOA 3OY2A 4XYBA 2BEJA 5JWRA 4GX2A 3TRKA 2AUTA 1DXYA 3UJPA 3LF2A 1O4VA 1QJ4A 2B2CA 2HEIA 2HZ7A 2PPLA 1KY5A 2YVUA 4MB2A 4N3GA 4PIVA 5J3JA 1FDUA 2D7CA 3G0BA 3V2GA 2XTZA 3UMJA 5LLDA 3MHTA 1RPAA 1LK7A 2ATVA 3B6KA 2B4RO 3N8KA 4O4JB 4H7KA 4QDXA 3DZGA 1NIJA 1MB9A 3DT6A 3IT1A 4RGYA 3HB9A 4ZT3A 4A0FA 1WCWA 1PV2A 3M2PA 1K4KA 3SAJA 3SY8A 3A4TA 2WWRA 3NJ4A 4RADA 3EZXA 4MR7A 1JEOA 4C4RA 1IQUA 3RHSA 4D0GA 1DRKA 4CV0A 2PH1A 1OB5A 1OFUX 2BD0A 4MH0R 5EE3A 4DDWA 3UPDA 1GQQA 2JHCA 4OA8A 3WKCA 3IVRA 3W06A 2D2IA 3P71T 4F4HA 1NY6A 3VX3A 2HDHA 4RULA 4PZUA 1SCQA 1ISPA 1CZLA 1T5BA 2WF6A 3HJNA 2YHUA 3ILHA 4P34A 5F33A 4B17A 4D9EA 3VR6A 1G8FA 5HSGA 4YDSA 2W6MA 4JHLA 2IZ0A 1KDPA 2VPZA 1Y5LA 3CZ4A 3IERA 3KEGA 1UKBA 3BFVA 1F8XA 3C1OA 4HG2A 4QXPA 1F0YA 4EYOA 2NUTA 4URWR 2VJCA 4M89A 1Y3BE 3FTCA 3I4FA 4MWBA 4EENA 4C05A 1AN0A 5AHXA 1ODSA 5JYDA 1K6EA 3F6PA 4HAWA 2Q3MA 3T9AA 4FFRA 5EJ4A 4YJ2B 4IV0A 3H9QA 3JRNA 2OHHA 4DIBA 4EHKA 1FEZA 1GGFA 1JSCA 4V0KA 3U5ZB 5KWVA 3T3PB 4RTOA 1UIMA 3BD9A 1SU6A 3BWDD 4L73A 4DLNA 2GETA 1AE1A 3DO8A 3FOAA 1NQTA 3QELA 1R27A 5M3BA 4F38A 1WETA 3A9RA 1FSSA 2PGXA 1S89A 3D4BA 3G9UA 3O92A 5C31A 5TY0A 4IX1A 2VOJA 4BE4A 4WN3A 3GLKA 3F8TA 3ONEA 4PX9A 2QF7A 2EJUA 5AM0A 4GKJB 5B7GA 4RTKA 2J33A 3B2QA 3B5JA 4ASUA 3P26A 1G21E 2CLDX 2XCIA 4HADA 3BMCA 3EPPA 3E7XA 1BJTA 3IDQA 2BVNA 2O3TA 2NXEA 4S1NA 3C97A 4N03A 1LRKA 4PYJA 1OXBB 4FX5A 4REOA 4YJ3F 6PFKA 3BXXA 4ZDJA 1LPAB 3WS7A 4CQNA 2J4CA 1EG2A 4GE0A 1U5BA 1G3MA 2JKVA 4KDRA 1CJSA 5ELLA 5JRJA 3E9NA 4GNKA 3COSA 2NO0A 2LCQA 1ZUD1 1WX1A 5JQGB 3V1KA 5GZ6A 3M70A 1BX1A 2H2GA 3OFNA 2I8CA 1PJ4A 3OU6A 5K5EA 3O3CA 1XZNA 2C07A 3FYUA 3E4DA 1QMPA 2Z2XA 2ZYVX 3OZWA 1KBQA 4NKRA 4DR5B 1HYHA 1IJBA 1Z25A 1NY5A 5E3IA 5E9AA 5JS6A 2FMIA 3TSCA 2JHFA 3F7MA 3D3EA 3WWOA 3NBQA 5JJIA 1PG5A 5IVHA 1DCKA 5D3QA 2PGLA 3FZYA 3CH7A 3IR6A 4LY9A 4NATA 5JS2A 5AW4A 2D13A 1XQ9A 2JJ1A 4WCFC 4YCLA 4RNDB 5LB4A 2QTLA 1L4BA 1WDMA 3QXSA 3T41A 2A3NA 2WVJA 3BXGA 2GSWA 2R2AA 4UVGA 5EWMB 5EMKA 4BUCA 1RABA 1QP0A 4HRXA 4II7A 3BZWA 4I19A 3NIBA 1PDOA 1RYBA 1P19A 3FVQA 2PAAA 2JK0A 2FB9A 4FP9A 2OGTA 4QSMA 1PKXA 4QOHA 4LE2A 3Q40A 1T9ZA 3GGSA 4POAA 2Y1WA 4CMIB 4CU2A 4EM6A 5E0OA 1U7HA 2AYYA 4OBEA 3MTQA 1CZKA 3HBJA 3HYLA 2D06A 3VISA 1S0UA 4LF7B 3V42A 5AXCA 3T95A 2IK8A 1C14A 4ALMA 1V9SA 2WWGA 2YIVX 3LT2A 2GLXA 3BA1A 1ZJWA 5JSZA 4U6SA 2G0AA 1D1SA 4NXNB 1A69A 3H13A 4QTUB 4U5XA 4M9ZA 1BXZA 2PEZA 3AQ4A 4ABTA 2X22A 1ML4A 4D4LA 1NN1A 2VPTA 2PSHA 1DAMA 3KEMA 4Z8XA 1VCHA 3ACBA 1IOLA 1C9MA 1DG3A 2E9SA 1D1QA 2G83A 3FHCB 1YVUA 4GC5A 4UU0A 5DGCA 4H3KB 4LRXA 4ZTBA 3UAXA 1W4RA 3CNBA 2VYND 1RRMA 2PGOA 3BORA 3DGEC 4R1UA 1JFTA 3OJ0A 4HJXA 1UOQA 3CX7A 3PT9A 4ISCA 4X1KB 3EEFA 4AP5A 4GMGA 1AK9A 1Z5VA 3THXA 3CSUA 1PR3A 3UTCA 2VTEA 1J2RA 1G38A 4EKDA 2P11A 3L8EA 4GRDA 1Z7WA 5B3JA 2CHVA 2RI0A 1L5HB 3A4IA 5K8TA 1RPJA 2ZIVB 4HT3B 3K0FA 2PUAA 3TG8A 2PGAA 3WGGA 3NEYA 1VCOA 1H9BA 3FZQA 1OI4A 4G56A 2NSDA 4IH1A 3QU5A 2Z2JA 4LWZA 2JJMA 4XLLA 2DCMA 4G36A 2E5LB 3VYSB 2XV1A 3QX7A 4JUFA 2QTCA 5IEJA 3KHKA 2VDVE 1NQOA 3PJDA 1DELA 1JZQA 3HA5A 1S3SA 4Q6BA 2NVUB 2RB4A 4DM4A 3H05A 2IE0A 4MR9B 1V8ZA 2AJLI 2BONA 5BMVA 4B71A 2MHCA 1V11A 2PYZA 3FY4A 1KSFX 2ODAA 4RZSA 3NCHA 3NBYC 2ZWMA 4BNUA 1P1FA 3N5CA 5JH7A 4FGSA 5FWDA 3CVVA 1U3GA 4QAQA 4JLOA 1RKVA 1PJ2A 2Q1SA 2X4DA 1ZN9A 1QJCA 5EIBD 5K99A 4RKRA 3ITKA 1A7KA 3C8ZA 3H2BA 3WRVA 1X3LA 4ZODA 1VRCA 3ESQA 3OZRA 3RW9A 3LFTA 3M81A 3PRKE 5A2GA 5K8LA 4BNJA 4GECA 1Q14A 2BAGA 1XNJA 1RVV1 2RHCA 5LKAA 2JVJA 4X91A 3EEOA 5E4YA 3H9EO 4GL2A 3DW1X 1G20B 1IQPA 2Q99A 3CF6R 3F2VA 4MV7A 2DPXA 4PRZA 2QN9A 1KIMA 5I7OA 1GPDG 4IJVA 4O2AA 5IKOA 2K5UA 2OXRA 2OHVA 4JP2A 3QRWA 2FMTA 3KKMA 2VWPA 4TS4A 1FLDA 4A8JC 2OAGA 4JBXA 3T5GA 4D74A 3SPXA 1BO6A 1Y1SA 2ZSDA 3C1AA 4IG9A 5GJWC 5H70A 3WQSB 3ZGVA 5TX7A 2PS3A 3LUGA 3STXA 2DR0A 4DIEA 1GNSA 4YBRA 2ZBQA 4EITA 4CJXA 3G2JA 3L0BA 3N39C 4OBWA 3U26A 3F1KA 3EUWA 2XBLA 5IEBA 1KVSA 3IUQA 4BV3A 4BATA 1MB4A 4J0HA 1RRGA 1EFCA 4ZOLA 2P40A 5IFKA 4QVGA 2AC7A 2Q2OA 3IAAA 3V9PA 2AVNA 2WSMA 1AJEA 4OKIA 3C6QA 4H6WA 3OETA 4L08A 4JP3A 2IOYA 2FSIA 3D6HA 1PJLA 1T3HA 2NUBA 4XSHA 1NBWB 3PDUA 4K8OA 4ZVOA 1RI1A 2NOAA 3FAKA 3K70B 4O25A 3GIWA 2YWEA 1DARA 3GLIB 2Q9CA 3ASZA 1TOAA 4DYHA 1H9CA 3RTEA 3FWHA 1XXHE 1VYTA 5DN6A 5IS2A 3VR2D 1IXRC 2D1YA 1QIFA 2VIIA 5BR8B 4PNPA 4EEXA 2JCVA 3I34X 1XPUA 1CIPA 1HRKA 4L50A 4GWKA 5IN4A 3PWSA 2NTVA 2CN1A 1JAIA 2FPPB 1MRSA 1N36B 4J49A 1RKBA 1Z17A 4C89A 5T8KA 5D3ZA 3AV3A 1IHDA 3ESRA 5K03A 3HCCA 2CVPA 2FX2A 5DF1A 1FFGA 1N34B 1TADA 4ECEA 2AWNA 4REQB 1RZRA 2VFAA 1CTQA 1ULAA 3IGFA 3OIDA 4LOLA 2WDZA 5CHYA 5DIZA 1PQWA 2QLMA 4EKYA 1IVSA 4BAGA 4OIFA 1AQIA 2Y1LA 4B2YA 2QI9F 4DLTA 2WIFA 2FV8A 3AB3A 2DUWA 3KHTA 3NH6A 1NLUA 3G0CA 2PUVA 2ZRQA 4RX1A 1FBNA 2OKGA 3SVTA 3RVQA 1DKLA 5AI0A 2RH5A 1YB1A 4W5JA 1ULTA 2IF0A 3UB2A 2V7XA 2Y99A 4RGBA 3Q8LA 3SLKA 1O3YA 1QQBA 1J90A 4LPKA 4HMPA 4NBWA 1H23A 4AUMA 4YMIA 4FMDF 1U8ZA 3ZJ5A 2NZXA 3AP3A 4M9QA 4MB0A 2EZ8A 4ALNA 4ZGBA 3HK2A 4QJ5A 3DKVA 6ABPA 1UDAA 1IL0A 1AUPA 4JEIA 2JF0A 2YV4A 4P4NA 3MOIA 2GMWA 2WI8A 3FLMA 1P0FA 4AM8A 1MVLA 1IONA 1ULSA 1MQ8B 2PQ0A 2RHTA 4RA6A 1AD2A 4O2LA 4HXFB 1YA4A 2GJAA 3G17A 1UFRA 1WD5A 3MUEA 5EEHA 1U80A 5BXQC 4RMGA 1D2EA 1TVKA 3QLVA 3SEFA 4D3YA 4MRMA 1HDYA 2R44A 2RH4A 3JQAD 3LVFO 1TU4A 4LDJA 2QL5A 3OJCA 4O0LA 1VHQA 4ZYYA 1QPBA 1U0NA 4W5HA 4Q39A 4PZYA 4C7XA 2PUHA 5JCPA 4I55B 4PLCA 4CIAA 2I3AA 3DMFA 4DNFA 3ER8A 2R8OA 5E7JA 4H6VA 4N54A 4C4TA 1X7WB 2OORA 2CDRA 4C0QC 4DEYA 4DR4B 4RH1A 2ZJ8A 5C8VA 3PB3A 1FJHA 1ULZA 4OXIA 3GVXA 1RZ3A 1GUYA 4OQZA 5B30A 3V80A 9ATCA 1KORA 1DOAA 4Z0PA 2FPOA 2RHWA 10MHA 1QRAA 2F3SA 2H7VA 2P3QA 3CEMA 2VZ0A 1QHXA 2ZITA 4KQKA 5EKXA 2I7VA 4YPVA 4IEEA 1KSHA 2C5SA 2Y9MB 4CM8B 4KIWA 2G25A 1USKA 3AVTA 2MR5A 1GVHA 4XJXA 4DYVA 1I10A 3BJRA 4MQ5A 1Q17A 1RPNA 2VYFA 2WNHA 1I3CA 3JXEA 5AP9A 2IPNA 5T57A 4DJTA 2DH5A 2PTGA 1N0UA 4X8MA 1T3ZA 2AX3A 2XKAA 1E9EA 5D00A 4A6DA 2C2OA 2R9VA 1DXOA 3BFXA 1E60A 1R5JA 3I37X 3B1YA 2IYFA 1IZZA 1CY0A 2PU5A 1DO0A 1ZQ9A 4ZI3A 4C20A 2NSJA 1BH2A 4MCAA 1T34A 1E92A 3V7WA 4RK6A 5A3SA 1YK0A 3KD3A 3Q0EA 1W88B 4HZUB 2QMEA 2JLBA 3BXOA 2Z57A 2X40A 1K88A 4CGYA 1SVSA 1T8YA 1CULC 3KOZA 1SB9A 4N5DA 1AQJA 1MFZA 3MIIA 2ACEA 4HHEA 4P5DA 3A1DA 2AZXA 3BK7A 2WJZB 2VHEA 4JFRA 3QKRB 4IDOA 5JMPA 1KQFA 4BNXA 1KYTA 1K7XB 1JFFA 1HXHA 2Y0BA 1F12A 3DOFA 4PHFA 5BYBA 2EQ5A 4R3NA 5ICGA 3IO3A 4GU5A 1FTQA 5IJXA 1DWOA 1NVGA 1UJCA 1NURA 3BQNB 4HQ0A 3U7RA 5FD8A 5SY4A 3TCNA 1JNYA 3C87A 3MCWA 4MKRA 5SY9A 3BRWD 3NTRA 5C4IA 5KS2A 2A9RA 2C92A 2NUPB 3T7IA 1BX3A 4TS3A 3NORA 1QSGA 3LUJA 2VBFA 1E2IA 2PH3A 3EZ2A 3H1TA 2J8ZA 4ER5A 2PZEA 1FP4B 1PQ4A 1UMCB 1UFVA 1HETA 3I58A 4GYYA 1O08A 3OU2A 1FU7A 1W59A 5B57C 3PWZA 4RPGA 3VJLA 1YOVB 2I34A 1Z2NX 4IFEA 4B0OA 3AFGA 5B6PA 4E5DA 2WU1A 1PJTA 3JTEA 4KH1A 3TFWA 2CK3D 2VHYA 4I8XA 2NO7A 4ZV9A 3K09A 4YCSA 1KEVA 1W87A 3HRHA 3R4VA 4R8VA 3W6NA 2HA3A 5BY2A 1SZJG 1YJ8A 3PVSA 4NFYA 4RHYA 3UA4A 3JAKA 4DDVA 3T7DA 2IJGX 4XLTA 3BYZA 4AFNA 3NU1A 5FX2A 1OV6A 3FYUC 2ZJ6A 1NXOA 1YL7A 3AIKA 2RGNA 5DHTA 1MX9A 5K3FA 3ZWQA 3R0IA 1T6XA 3NRBA 4MNTA 1VE6A 4M1QA 4D8VA 2GN0A 2W43A 2Q6IA 3CEAA 4ITUA 4U63A 5FB3A 1XA3A 3F4BA 2Y8EA 1CZUA 3ZWCA 2WR8A 1EGQA