4OF4A

X-ray structure of unliganded uridine phosphorylase from yersinia pseudotuberculosis at 1.4 a resolution
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
251
structure length
251
Chain Sequence
KSDVFHLGLTKNDLQGATLAIVPGDPQRVEKIAKLMDNPVHLASHREFTSWRAELDGKAVIVCSTGIGGPSTSIAVEELAQLGVRTFLRIGTTGAIQPHINVGDVLVTTAAVRLDGASLHFAPMEFPAVADFSCTTALVNAAKSVGATTHIGITASSDTFYPGQERYDTFSGRVVRHFKGSMEEWQSMGVMNYEMESATLLTMCASQGLRAGMVAGVIVNRTQQEIPNEETMKATESHAVKIVVEAARHLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uridine phosphorylase
publication title X-ray structure of unliganded uridine phosphorylase from Yersinia pseudotuberculosis at 1.4 A resolution
rcsb
source organism Yersinia pseudotuberculosis
molecule tags Transferase
total genus 89
structure length 251
sequence length 251
chains with identical sequence B
ec nomenclature ec 2.4.2.3: Uridine phosphorylase.
pdb deposition date 2014-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4of4A00
2HWUA 4YMLA 1K3FA 1PR1A 5C80A 4I2VA 4NS1A 1RXSA 1ODKA 1RT9A 1T8RA 4M3NA 1TCVA 1JPVA 5IU6A 4TS9A 1K27A 5I3CA 3DF9A 4UC0A 1VMKA 4WKCA 4R2XA 2A8YA 3O4VA 4OJTA 2QSUA 3K8QA 1ZOSA 1LVUA 3QPBA 3MB8A 3FOWA 1Y6RA 3P0FA 1V45E 3UAYA 5CYGA 4DARA 4K6OA 2HN9A 1WTAA 1YQUA 2QPLA 5B7QA 1A9SA 3EMVA 2Q7OE 2OC4A 1PR6A 1Z5PA 1Z5OA 1PWYE 1A9QA 4OY3A 1JDVA 4QFBA 1TCUA 1T8WA 1PF7E 2B94A 5EUBA 4QARA 3D1VA 1TGYA 1JDZA 3C74A 1G2OA 1ULAA 1Z34A 2I8AA 4BN0A 3E9RA 1LX7A 1B8OA 1SJ9A 3IEXA 1ODIA 4L0MA 4EARA 4QASA 3UAVA 1A9RA 4LKRA 3DJFA 1Z33A 1RXCA 5F78A 4G89A 4DAOA 3OPVA 4TXMA 1CG6A 3OOEA 3BSFA 4TS3A 1V48A 4TTAA 5CCEA 1PR5A 4LDNA 3UAWA 5K1ZA 2AI3A 4OGKA 4L5CA 3PHCA 1A9TA 2A0YA 4DABA 3F8WA 4GLJA 4OGLA 2AI1A 5F7OA 3O6VA 2QTTA 1SQ6A 1M73E 4OEHA 4LNAA 1JE0A 1U1CA 1VHWA 5F77A 1Q1GA 3NM4A 4PR3A 4TXJA 5ETJA 1A69A 3ONVA 1OTXA 1CB0A 3DPSA 2P4SA 2H8GA 4GMHA 3EUEA 1LV8A 3OZCA 2IQ5A 2OXFA 1YBFA 1QE5A 5CYFA 4D8XA 4JP5A 2ON6A 2XRFA 4F2WA 1RSZA 4MCHA 5JPCA 4LZWA 1U1FA 4D98A 3KU4A 1JP7A 4F3CA 3E0QA 1YR3A 1NW4A 1T8SA 1ECPA 4WKNA 3KHSA 4DA6A 1SD1A 2QDKA 1PKEA 3P0EA 1Y1QA 3E9ZA 4L6IA 4QATA 3IOMA 4DA8A 3KUKA 5CXSA 1A9OA 4JOSA 5EFOA 3FNQA 5CCDA 4F2PA 1NC1A 1RYZA 2A0WA 4F1WA 1YQQA 3DP9A 1K9SA 4GKAA 2OECA 4F3KA 4TXNA 3INYA 3ODGA 1PK9A 2HRDA 2I4TA 3OZDA 2AC7A 1I80A 5EPUA 3K8OE 4E1VA 3LGSA 4BMYA 3ENZA 1PW7A 4MCIA 1ODJA 3NM5A 4QEZA 1ODLA 4WKPA 1U1DA 4OF4A 2RJ3A 1VHJA 3FAZA 1RXUA 3BL6A 4NY1A 4YNBA 4YO8A 4KN5A 5F7ZA 1Y1SA 5F76A 1OUMA 1B8NA 4L5YA 1V3QE 1RCTE 1JDUA 3UT6A 3GB9A 4D8VA 3FUCA 3UAZA 1Z36A 4DA0A 3LBAA 1OVGA 4R2WA 1U1GA 3OZBA 1FXUA 1YRYE 1JDSA 3FB1A 4LNHA 3KVYA 2A0XA 1Z5NA 1PK7A 4TXHA 1PR2A 1ZL2A 1RXYA 5FAKA 2OC9A 3PHBE 3OCCA 2QTGA 4X24A 1T8YA 3TL6A 1U1EA 5KB3A 1PR0A 1RR6A 3OF3A 1Y1TA 4G8JA 1A9PA 3SCZA 4P54A 1OTYA 4PNPA 2ISCA 5IFKA 4YJKA 1RFGE 4H1TA 1Y1RA 4D8YA 3KVVA 5F73A 1N3IA 3EEIA 3MMSA 4G41A 3GGSA 1JDTA 3NBQA 4M1EA 4U2KA 2BSXA 5B7GA 1JE1A 3LA8A 4M7WA 4BMZA 4L5AA 2HSWA 5F7JA 3EUFA 1C3XA 4ECEA 2AI2A 1JYSA 1V4NA 5F7XA 1V2HE 4R31A 3U40A 4BMXA 4RJ2A 4DANA 3DDOA 2GUWA 4DA7A 1Z38A 3NM6B 1Z37A 1PR4A 3T94A 3PNPA 4TXLA 1VFNA 3KVRA 4MARA 4FFSA 1TGVA 1ULBA 3UAXA 1XE3A 4WKOA 5DK6A 4NSNA 3BGSA 4EB8A 1OU4A 3OOHA 1Z35A 1T0UA 4GLFA 4DAEA 1PBNA 4TYMA 4IP0A 4JWTA 4WKBA 1OV6A 3PNSA 1Z39A 1V41E 4QAQA 3FWPA 5B7NA 4TTJA 4TTIA 3OZEA 2PGAA 1SD2A 5B7PA 4D9HA 5CXQA 1NC3A 1TD1A 1Y6QA 3BJEA
chains in the Genus database with same CATH superfamily
2Q7XA 4OO3A 4E21A 2WEKA 4ZXPA 1WBBA 4QWMA 5IVDA 1QHEA 2AJCA 3TRHA 1AQJA 2W6ID 4LRSB 1LV7A 3SE7A 1HDEA 2V7VA 2AJDA 5KYWA 1T4DA 1V9SA 5BQ5A 4CG3A 4FDUA 4KXUA 5KVQA 4UM8B 5AMXA 5EXSA 2ZKIA 1EVIA 3M4XA 2NGRA 1UOEA 4DQDA 3CBGA 1C7IA 5B37A 3SKYA 1TF2A 3WRYC 4ZVPA 3LC2O 4TT3A 2I55A 5EVJA 3F73A 4ZRNA 3WNCA 3ICPA 1JQBA 2Z3ZA 3PXAA 3Q87B 4BYMA 4NU5A 5CVVA 1PJTA 1RJWA 4JELA 3MT9A 3WIBA 5KNCA 4OJTA 1DKUA 4EHFA 4EW3A 3PUYA 1JAZA 2R11A 1G8JA 3KU1A 5FL3A 5EJ5A 3OEEA 1M2EA 4JJ6A 2NZYA 1LVUA 1NOKA 1ZZEA 3AB7A 3B5EA 1T4GA 1UL1X 2C54A 3LCVB 3WGLA 4DCCA 2R00C 4D9FA 4DV0B 1EK0A 1PHPA 1R15A 2KW5A 3VSBA 2GCIA 1QB7A 1CYDA 1NU8A 4Z4GA 3TW6A 2RD2A 3C7AA 3VTZA 4MV8A 1NZDA 2D1FA 2LKDA 4R2LA 5LZ9A 3SEFA 2VR1A 1ZI9A 2Z3WA 4U2BA 1EH5A 1U7PA 2VPXA 2XNDA 2I87A 2ZBDA 3M7IA 4P2BA 1MG5A 3DB1A 4JP8A 4RYLA 5KYVA 5KS2A 1Z0KA 4KQHA 3CNEA 1P5HA 4B7XA 4AMZA 3PL5A 2AN4A 4PE5B 3KQKA 1N1EA 4MW9A 3OZFA 4MW2A 5HRCA 5IWAB 5AKJA 3MCZA 2Z5FA 3NIDB 3P26A 4DQ0A 1O7JA 1ZVQA 3FIJA 2VF2A 1Z82A 2RI0A 1C30B 2ZVPX 4C7BA 4EYOA 1TKAA 4U7DA 5JAMA 2PX4A 2NVOA 5KX5A 1Z5PA 1USIA 4R6WA 5JEDA 3CZ5A 1B26A 3K6SA 1D2GA 4K6MA 3ABQB 1MH1A 4LC1A 2A67A 5CW2A 1H8ED 3CNBA 4LS3A 3TVYA 1L1FA 4B3CA 4MS3A 4ZQIA 1DE0A 2IDMA 4QARA 5GGXA 5CDFA 4UHHA 1CX9B 3AF3A 2WF5A 1CIVA 2N75A 4PZEA 5KOYA 3KYDB 3ZGLA 5A03A 2J46A 2VYNA 2ZPUA 4HC4A 4BLVA 1QLHA 3VMFA 3ESQA 4QOEA 4HNHA 1OT3A 2BI8A 4E70A 4PQYA 1TVKA 1G3RA 1SXQA 5L4SA 2VTDA 3U4IA 4J8PA 1P31A 4ZDWA 4HWKA 3AXSA 1YA4A 4XSGA 5FI5A 3WMEA 1E3QA 5CT5A 5TPZA 5EJ7A 1SJ9A 3WKBA 3IMKA 2Q8NA 1RRPA 5LR6A 1BX1A 4RJLA 3SM3A 3LP5A 1W76A 4R5HA 4REQB 2ZITA 4OQYA 1T3GA 4EPXA 2MSNA 2EWWA 4RV5A 5H3CA 4PCVA 5CPFA 1UF9A 5JFTA 1UAYA 3K70B 2FNAA 2CNWD 1YDHA 4QASA 5KQLA 4A7PA 1PK8A 2P3QA 2PUCA 4QU8A 2O3RA 1GFSA 1GILA 4ENSA 5DRTA 4MPRA 5KSOA 2IW3A 1A0OA 1IJBA 2CXNA 3E3OA 4N5HX 2DETA 1Z33A 1M1UA 2D6FA 1RXCA 4JENA 4OKSA 2KBFA 3OECA 4WXEA 2W6OA 1JR3D 2FFQA 2V9ZA 1GTZA 2FGKA 4TYQA 3K3PA 4JI5B 4OM7A 4N3AA 4KFCA 5KCZA 4C01A 2MHCA 5ICSA 3O8OA 3E2MA 4TKVA 2D1SA 5IYZA 2OP0A 3R6TA 1Q0HA 1X74A 1ZN9A 4EG7A 1W4CA 2ZDQA 3OZGA 3A2KA 1T2DA 2IF0A 1EWVA 1OXVA 1SAYA 2IDKA 3BFKA 1KSJA 3B89A 2ZIVB 1QVVA 3GA5A 3RRXA 4LRXA 4W7HA 1SPXA 3GT3A 3B6IA 1W35A 3CRVA 2R96A 3AFMA 4WFKA 1D6MA 4RQTA 2QTTA 3FJ1A 3BK1A 1I2MA 1SQ6A 3E22B 2BFAA 3RJTA 5LYJF 4ZEMA 4Z7QB 3OLQA 4KDEA 1E6KA 2MMCA 2JI4A 3QMMA 2G72A 3MTJA 4LNAA 2VSQA 4TZ0A 4EPWA 3S8MA 4GF5A 1UIMA 1EA7A 2R6HA 4B3MB 5I4IA 4LF5B 1E3TA 1WB4A 2IPXA 2WWGA 3R7DA 2WYUA 4ND5A 1G8FA 5HJ7A 2I54A 3IQFA 4YTEA 4N7MA 1NPDA 3QFSA 1E3IA 4H0FA 4KO2S 4LZZA 2QHXA 3GLHB 4LTDA 2OYSA 4QGHA 4C3UA 3EFHA 5C7LO 1MU0A 2EW8A 1B6TA 2C1XA 3QJYA 3V32A 4R1SA 3HMQA 3G2PA 4PG8A 2WPNA 4PINA 1Z2OX 3LV8A 1P2UA 1UC9A 3TTWA 3DMTC 2H1IA 2VOJA 2P0YA 3G6KA 3KXIA 3QU2A 1OYYA 4U00A 4PWZA 1H42A 2P4SA 3JR7A 5LD2C 4N39A 1IRXA 3SZGA 2IOFA 3DB2A 3TSWA 1GV1A 4ZK6A 2PIDA 4PRYA 1KZ4A 2Y1DA 2PEYA 1TUGA 5JCZA 3PR3A 3DL7A 5AK0A 4OAQA 5IJ0A 3R24A 2ERCA 5EJMA 3DULA 2OO5A 4U6NA 2REQA 2OXFA 2EAUA 2YVKA 3FRIA 4JCOA 3R7BA 3TZBA 4J0JA 5JPDA 1R1DA 4LJ8A 4B3JA 4XFJA 3F49S 1JZTA 2IBTA 2AYYA 2QSJA 4A0GA 8ABPA 3LCMA 3STYA 2DT8A 1DP4A 2DHCA 2ABWA 1JU3A 3FPJA 4J4HA 3EISA 1YFZA 4RSMA 1D2EA 5CVUA 2XRFA 5JD3A 3CVUA 1TKRA 3H11A 3CLTD 3VTAA 2Q6VA 4BMPB 2OORC 3E9CA 3OJWA 4C21A 1IWBB 2J8ZA 2I7CA 1FFDA 1B74A 1AA9A 1QQTA 5GMOA 3SBXA 5TY0A 4YRGA 3OTOB 1TT5B 3GU3A 3KU4A 2NQ8A 3TINA 4B32A 2I9PA 2Z4SA 4MLZA 3NC4A 5FHRA 1E9BA 3KOXA 5K0NA 5FTLA 4QT0A 2H2WA 2QL5A 3RARA 3KJHA 1XRLA 4O4HA 4RD1A 3LH5A 1FYXA 1ZC4A 3QXXA 4QG3A 2NUPB 3ZDBA 4D45A 4Y6LA 2OM6A 4P1ZA 1X8LA 1R6AA 2XEDA 3B7PA 3N2ZB 3BUSA 2IOQA 4CFZA 1CY1A 3BIWA 1SUDA 3P2MA 5IN5A 5EIXA 3AVOA 2VNSA 2ZRBA 3D0KA 1Q1BA 1NULA 4KWCA 1WUIS 4CKEA 2V4ZA 3RR2A 5BSWA 1SH7A 3SLKA 2DQ4A 2A1UB 3QYAA 3RUIA 1U2RA 3UKJA 5AD1A 4F06A 3CUYA 4Z0HO 3D4PA 1ZXLA 1G41A 3DDUA 4D80A 3IBTA 1J70A 1AB5A 3KJZA 2A0WA 3WOHA 2TMYA 4LOKA 4I6JA 3GGCA 4NPAA 3O21A 4YP6A 3LECA 1TL7C 2Y66A 1BROA 4NNOA 2HSJA 4B46A 5TF0A 2RGXA 3LCUA 4M6WB 3RU2A 4YMWA 1LA2A 3JYLA 3N8IA 4JXJA 1CUEA 2WHPA 3GCXA 4FFWA 2DFKB 3DMFA 1QV9A 1IUKA 4KXQA 4B7UA 4ER7A 1JBQA 4WD3A 4JI2B 1K5DA 3D7LA 2FN9A 4LE1A 3GL9A 5CH5A 3U9TA 3C24A 4C0QC 3K35A 5JPIA 2Q0SA 3CMMA 1FU4A 4BNLA 4DWOA 1HZJA 3K8OE 2IS6A 1YZQA 4UHCA 2C2YA 4IXWA 2BPOA 2OA0A 2QRGA 1XL1A 2ZYGA 1DO8A 2I3ZA 1JWAB 1Y4UA 4Q37A 3ZUPA 5H4GA 1HYBA 3K1JA 1XMSA 3VX4A 4KREA 3H9BA 3PC8C 1ODLA 2O8EB 5KVVA 3DKKA 1SG9A 4JUCA 3SWWA 3ABIA 2GR9A 1RIIA 1WXIA 2RJ3A 2WYIA 4KQGA 3WTCA 1J33A 2OBFA 1WVIA 2WSLA 1MO6A 4GNRA 3S7ZA 1WCWA 4Z0PA 1Z16A 2RHMA 1GZUA 3N6XA 3OURA 3UWKA 2WSSD 3WRXC 3B13B 3NTLA 4BCDA 1VKNA 4EW1A 3QEBZ 4LYFA 4DLYA 1QOQB 3IMCA 2J3MA 1BKYA 1EDBA 2QD1A 4GBMA 2PT6A 4GPD1 3BWDD 3G5LA 1IEQA 1LSUA 2Y1GA 3PYXA 4J94A 4Z6KA 1YI0A 1Z06A 4WZAB 2VJDA 3PG5A 2CZQA 5LQNA 3KQUA 3UWSA 2FDCA 4XGNA 1V35A 4IGAA 2AZXA 4P92A 4CL3A 2QTVA 3I2GA 3ZV7A 1N34B 4P36A 5CVTA 4C0SA 1XKTA 5LLTA 3ZU6A 4XDGA 1QBGA 4QXMA 2REOA 1GHTA 4UPEA 1EFKA 2NIPA 3AY7A 2VRNA 3PEWA 3DOFA 1GRQA 2L69A 2EATA 3QLUC 1R6UA 4E7PA 4P4LA 1Q14A 5H83A 1T9GS 4O08A 1DTWA 1FP2A 1RCUA 5DCLA 3A6PC 3NBUA 2GI4A 2PKQP 5D3ZA 2DWUA 2DSNA 4AZSA 3DMPA 4H0CA 1RBQA 2VSNA 2NSYA 3KKNA 4QD3A 4QPJC 2ZYRA 5EKSA 2OBNA 3O9ZA 1ZVVA 3DVAA 3JQAD 2V0GA 1N1MA 3ELUA 4BVBA 4JLUA 5E8JA 1SBYA 1SQ5A 3OCCA 4CV0A 1BS9A 1XLTA 2ZOSA 3CUTA 1AHPA 1SHZA 2I2AA 2XUZA 1Q0TA 1J9ZA 4YA6A 4TUYA 4E5DA 1AMUA 1E7QA 4MV7A 1H2YA 3WDLA 1DPGA 3N76A 3QXGA 2JDIA 4HQKA 1F5SA 4FFBA 3MS7A 4KXWA 1RR6A 4ZU6X 2DTDA 3M3PA 3PNVA 4IIXA 4AN1A 4IHKA 1ZAKA 4DDMA 2JH8A 3CB2A 4G8JA 7MDHA 3G13A 4JX8A 1CIJA 3EVDA 4FGLA 5F21A 1PCXA 4K9SA 5SYMA 1LW7A 2BUBA 3CLUC 3WP1B 1J99A 2QZPA 3QVTA 2PU5A 2P4EA 3AHIA 5JCJA 3SJAA 3L7MA 4AZVA 2FZCA 3EG9B 4HB4A 1DEXA 4J0FA 3UWMA 2VAXA 4CLOB 3OIWA 3PXUA 1TZ2A 3RM3A 5CNMA 2A5JA 2BFFA 3JASA 3RYIB 3IL2A 2VAWA 2GXUA 2QMQA 2EVWX 4K6FA 3MGAA 3VYWA 3UW1A 1MA3A 4PYIA 5E9WA 3CV3A 4JL6A 3LBHA 2AG0A 3ML1A 2GYVA 2VJLA 4O6VA 3TLGA 4EI9A 3NHAA 3CNOA 3HA5A 4Y1RB 1Y8RB 2FWNA 3VVLA 4LBVA 5BORA 3ZDDA 1KFKB 1QQ5A 2Q8PA 4WVLA 5FCDA 3ZD7A 1UDXA 2A59A 1M8JA 4FCTA 5FBZA 5D5PA 3ZDXB 5M04A 4NFYA 3F7OA 4RA6A 4YH1A 1OH8A 1T2NA 4ODIA 2NT4A 1J5EB 4F92B 2Z56A 1E5XA 1KHTA 2ZB3A 3F78A 4FSXA 3ZXSA 2ODQA 4DQUA 4C0WA 4JI7B 5E7MA 1PWZA 3I0MA 1YDFA 3PIRA 4U2FA 5ALOA 4ECEA 1KJ9A 4Q4CA 3ZVLA 5LMZA 1G8SA 2H7CA 3K9WA 3CJQA 4UMFA 2HKIA 3JATA 4DWVA 3O8DA 1XRQA 2AGVA 3EXG1 1F1BA 1KPGA 1VLQA 3Q5GA 4FC7A 3MW8A 1RQ2A 4MWGA 4RADA 5ECYA 3WGTA 2AG8A 4B3BA 2GUWA 4BXOB 2LV8A 2E6KA 3NM6B 4CQLA 2BFPA 2UVPA 1S2NA 1XJ0A 4ZT3A 4RVSA 1BEZA 2Y0BA 4JLSA 2RBEA 2JI6A 1KH1A 1ZVMA 3RW9A 1FTQA 1T9GR 4HUQB 1L4BA 1TIKA 4ZQFA 1XR3A 2E89A 3S29A 2FMTA 5ENVA 1V39A 4IHQA 1TAHA 1TZBA 3NPMA 2YJ6A 4JEUA 1Z18A 1XZNA 2D0IA 4O4JA 4CKWA 1E20A 3DZHA 3PT9A 1NFQA 2JFHA 4GOND 2R1UA 3AERB 3MGKA 1N32B 2KB0A 1GNSA 3BE4A 1EXMA 4DNQA 1KQOA 4XDYA 4BMDA 2B1GA 1PN3A 5P21A 2DE0X 3TN7A 4MQEA 4HMOA 4UU7A 1BE8A 1URPA 3BHIA 3STHA 1X92A 4J7XA 4N9QA 1VPTA 4KN9S 3UANA 3MJSA 4PC6A 3I64A 1KMIY 4BVHA 1YVPA 2G5TA 1WJGA 1TYCA 4DAEA 1D2CA 1D2AA 2CD7A 3LT4A 4QPCA 3I45A 4FEEA 3VNRA 1KRHA 1OFGA 2PD4A 3GUUA 1W2HA 4WZBB 3IH5A 3AONB 1SXJA 4EBBA 1ZM7A 1QGUB 1NP3A 3ESRA 1U80A 3LUPA 3CZMA 4L8GA 4UM9B 3LSYA 5I7RA 2X3UA 3OM8A 4L22A 4YJFA 5ULLA 2V0CA 3TMKA 2EL7A 4MEBA 4P3OA 4XIIA 3CF2A 1ESCA 4BFSA 1B7GO 5GV7A 2XXAB 5LYYA 2QVXX 1RBMA 3BGDA 3KQMA 5BR1A 3EGDB 5JZVA 1PJ4A 2ZRAA 3UQYS 2D2EA 2F6RA 3A6DA 1K86A 3DEKA 5DT9A 5LDGA 2HWUA 3BB4A 1PJCA 1SIWA 2QN7A 2GKSA 2C20A 4A2PA 4RV9A 2YFHA 3VR6A 4FNGA 4KQXA 2GNPA 3IX7A 4KQ2A 1Q7BA 3DTVA 4TQAA 4WY8A 5TVKA 2BEJA 5J2TB 3KC2A 2N1MA 3NBZC 4FYWA 4KLAA 1IOVA 4MUGA 1XSEA 2FWRA 4LXIA 1MTOA 1OPXA 1F2UA 3KIPA 2YWGA 2Y77A 2IBSA 2A7XA 1YCDA 2WJZB 4O4LF 3AUSA 1C3OA 4JJ8A 3K05A 2NU9B 3LA6A 4WKCA 4Z51A 4DM3A 4UAVA 1S0UA 5ECDA 2W2LD 1T36B 1DJLA 1M33A 1ZIOA 2CE2X 2ZIUB 1P9RA 3IAM6 3Q8XB 4KIWA 3LVFO 2CL7X 4URXR 3INGA 1ZOSA 4EG5A 3F4LA 1UPXA 2Y6UA 5JDIA 5JASA 5FP0A 3C8ZA 3OUTA 4WNAB 2FPXA 4FD2A 5EGSA 2FY8A 4TRMA 4UEWA 2HMSA 3T3DA 2PBZA 1MRSA 4GRAA 1H1LA 2YBDA 2XWQA 1SRRA 3M4JA 3NHJA 4TV8B 5FI1B 3F97A 3ZGVA 4NEGA 2XCSB 1IZ8A 2VQ6A 3U3XA 3VYVA 4FGZA 1Q3TA 1K7EB 1PNOA 1UZLA 3ER8A 4EELA 4PW0A 4CWAA 4AX4A 1TC1A 3AOEA 1SCUA 4LQCA 5EQDA 3RUEA 1W2GA 3RGGA 3RB8A 3DOHA 3VJMA 1BX3A 4ENPA 1VG0B 3EXAA 4QAJA 3AX6A 3ROPA 3SICE 2VBGA 3KFXA 1XZLA 2W6IA 4D42A 2JAPA 1JYFA 2ZUTA 3U4AA 5LU9A 1IE3A 4MW6A 4G63A 3CKYA 4JMPA 1ZNYA 2PXXA 3DHYA 2J5KA 4OBEA 4FIZA 5E3JA 3ZBQA 3N53A 4N47A 2YCBA 5K3CA 5EIEA 1HK7A 4IQ4A 4YRPA 5TT0A 3QY9A 2Y3IA 4ENTA 3UK6A 1PYOA 2NACA 3C5CA 2JD0A 1JYEA 5A3SA 3RQSA 5J2UA 5TE9A 4ZQBA 3K9GA 5CNIA 2MYUA 3DLBA 3UUGA 4JEMA 2RHOA 1TEXA 2OZLB 4RKYA 1KFJB 5CAEB 4F56A 6REQB 5IAGA 1Y7TA 3SZLA 4BRUA 4CEIA 4OSPA 3SSOA 2CXTA 5K99A 2J4FA 4JUAA 3M3DA 1C3LA 4D1YA 4EZBA 4L0QA 4YIKA 2Q1SA 4KHPB 1UM8A 2MU1A 4TSFD 1Z75A 5CJ2A 1QONA 1W5FA 2ZS9A 4DBLC 3IBGA 2GHQA 1HMPA 3WY9A 2JCBA 2JJ8A 3V55A 1IOZA 3H8SA 2CSUA 5KAPA 2BEWA 3COZA 3DWFA 3HE3A 5CP8A 4J0GA 4B3IA 2GSWA 4YXWD 2G08A 4P84A 3W3ZB 1PW5A 5EP1A 4BAUA 3OQIB 1ZMTA 2G67A 5FUYA 3D0OA 5HCNA 3DAFA 3WLMA 4TVSA 3E8XA 4RENA 3N9IA 1UDWA 4J2HA 4UDNA 2OAGA 4JLJA 1JJ7A 1PSWA 1XOIA 3LUHA 4RVGA 1TO1E 3WFJA 2XD9A 2DY1A 2YXNA 3R3JA 5HG0A 1D4FA 4TZTA 2X5NA 3PHJA 3KZOA 3QVJA 1DEAA 2X9GA 5K6AC 2GEJA 3HXKA 1A8PA 3ABRB 5ALJA 3RAFC 4IIDA 3L93A 3IPCA 1HDYA 1ONSA 4PHGA 1COWD 1QQ7A 3IUNA 4QQNA 2Q49A 2GX6A 3KPVA 2O8FB 2YC2C 1XRSB 4QOSA 3C3XA 3I6QA 3T7TA 4DMKA 1EM8B 4P0PB 1CG6A 1GFWA 3OOEA 1IPFA 1E18A 1FP4B 3CEPB 3ROEA 1H8EA 1R6XA 4EYEA 4YAKA 5HBRA 1C50A 2ZSJA 5KQPA 4LX0A 4LDNA 4R6XA 5IEJA 1ILWA 3D3EA 1DX4A 1ZI6A 2ENWA 5F1PA 3CZCA 4UMDA 3VPHA 2XQIA 3AUKA 5HP4A 1DOZA 1QIGA 5K3OA 3T1TA 2B69A 3I4FA 1ZJ4A 2XRZA 3NIBA 1YVRA 4NV0A 2JLQA 1PNTA 5ALMA 2FHSA 4UM5A 1XLUA 5DWDA 3K30A 1WF3A 4Y67A 3SMVA 1KI6B 4ZOEA 4F45A 4TQGA 2B3TA 4MKRA 2JIQA 5CA0A 1QX3A 2OHOA 3PFFA 4G65A 1PL8A 1U0OC 2YWDA 1JU4A 4II2A 4OK5A 3KDAA 1R5JA 1JT2A 4S0XA 4GZ5A 4QRIA 4WRRA 4DLRA 4XRGA 3A9SA 4BPRA 4MQMA 2CNWA 2FEKA 3I5XA 4G4IA 2A84A 4IVPA 4U1RA 4WX2B 4DMFA 2O6HA 2FDRA 3R9WA 2PK3A 3A36A 2EZUA 2AUMA 1AZTA 1JR3A 5IRCD 4U5XA 3MJTA 2P9JA 3O8QA 1UBRS 1JIJA 5E1OA 2BEUB 1A9XB 2YVAA 3BCUA 1Q2XA 2AOTA 1TMYA 2ODWA 4TLLB 2YMLA 4EA6A 2OAQ1 1Q21A 3QVSA 4KO1S 3JCZA 4TMZA 2QV0A 4DHEA 5IKMA 1N0HA 1NBAA 5JC8A 1EXDA 1XUOA 5DHUA 3B48A 2OHFA 2YWEA 3BMOA 2GNAA 3HGTA 2XUFA 3RUPA 1JVBA 3WB2A 4KI0A 2WR8A 5EWMB 4J91A 4EJSB 2XQKA 3EJ6A 5AKIA 4EG8A 1D2MA 4KFTA 2PX2A 3WNQA 1TXGA 1XP5A 1AUVA 1Q7CA 1QIHA 2IUSA 3GAMA 4S1VA 2AMVA 4AQDA 3HP7A 3ZHTA 3WWDA 3TJMA 4U2EA 1UXGA 2QZZA 3NTRA 3ZCUA 1OREA 3SYMA 5ICGA 1JQEA 1RPNA 1PL7A 2BN4A 5HEKA 2XB9A 2HA5A 4I9HA 3P4UA 4DBLE 5CNKA 2EL9A 4XM2A 1GKKA 4P3YA 3ANLA 2W58A 2MINB 2GN4A 2D2FA 4BLPA 2OVFA 4OQ4A 3OT4A 2EFGA 4OQXA 3AR4A 1AUXA 5F51A 1U9JA 5I9NA 4EG4A 3BA6A 4I9GA 2HSDA 3MJCA 1UBEA 2OL4A 3FYCA 1KDTA 1MQ9A 4TTVA 3ZQ6A 4ZCMA 1UXKA 5ALUA 4D44A 2XMCA 5CB4F 2DOKA 2GA8A 4FB5A 2ZRCA 3JRNA 5JFGA 1GRVA 2PN1A 4QUGA 1UPAA 4Q93A 1XNGA 1I36A 1UH5A 3DMRA 4I1OA 3EGXB 2ZXFA 4L4UA 3TB4A 3WAKA 1U8FO 2HZBA 5DTRA 4ACBA 3A1VA 3E5RA 4F11A 1JA1A 2CZGA 1LF0A 4HMPA 3ZUGA 4G5YA 1CR1A 2P41A 1JR2A 3KQQA 4E51A 4DA8A 1G18A 3KUKA 1DAFA 3M9LA 1UJ4A 3NXSA 1P72A 3A9CA 1NVFA 3VBEA 1R9NA 2HRQA 4ZV9A 2GEFA 4HWGA 5IHPA 1OZAA 4LCBA 2RJNA 4TWBA 2P3LA 4LYHA 2WWWA 4RGYA 3V7FA 3OQPA 5BN4B 5CCDA 2XA9A 3WTBA 5L7WA 1UMDA 2EZTA 3AL0C 2NXNA 2VAMA 4N48A 3IPRA 2R8BA 3AEKB 5BSFA 2G17A 3MHPA 2WICA 1NXVA 2BTQA 3VC2A 1PYGA 1J1IA 1Q16A 3AL3A 2CJXA 4QELA 4PONA 4BIMA 3KRTA 3IODA 4EY6A 5D87A 4HNTA 3VHXA 3JYQA 1BVYF 4D9EA 3ROKA 2CHEA 3OPQA 4K28A 5AJHA 2OFOA 2VT3A 3FNGA 3WYEA 4BKPA 3S6JA 4UNIA 5HPYB 5LBIA 4TTTS 1I80A 2UYYA 2W2NA 2C8LA 2WUEA 4GQBA 2X8LA 4HH1A 5JD5A 2IHZA 5KYUB 1R3UA 1ZKDA 4TWAA 4IV5A 4ICIA 2JZOA 2YV5A 3ZJ5A 3EN0A 3NBYC 1Y5RA 4ASUD 4Y2PA 4E1AA 4ZCIA 1C4KA 2QMOA 3AU9A 3QP9A 4L74A 3AW8A 4KODA 4Z4IA 3NV7A 3ZYCA 1STOA 4RTJA 3IIMA 2F59A 2H4HA 3QQPA 1XALA 1Q6YA 4UTNA 2OQVA 4S1WA 2R5WA 5TJHA 1NQUA 4UULA 5KJ6A 4AJHA 5LMNB 1CF4A 5F3RA 3KQHA 1ENOA 5FO1A 1RS0A 1I6MA 4P35A 3ZBUA 2H3EA 2XH8A 2II6A 3MSCA 5CD9A 1W85B 2VQFB 3D3NA 1G5TA 4PGHA 4FD3A 3RTBA 2RG1A 1SG6A 3JU3A 1BVRA 2HXSA 1PT6A 4QX6A 1FJ2A 3OEWA 1J5XA 2ZIXB 3RVQA 1HURA 1JHVA 1W48A 3D4OA 3GB9A 5JQWA 3OP4A 4PIMA 4TPKA 1X7GA 3GLQA 3QF4A 4YLGA 5ECWA 2VDMB 2FEXA 2GCNA 2P11A 3TLEA 3WXBA 4XDZA 3P2OA 3X1KA 3RHTA 2Z6AA 2PR2A 1EUCB 1OVGA 2FDXA 5JJLA 5CK4A 1U6IA 2BYTA 4S3MA 4RK0A 5AKXA 1RYYA 3DEAA 2I6SA 3JQEA 3AYZB 5EMMA 5JZMA 3PPWA 1V8BA 2C3MA 3BREA 3R3UA 2NW6A 4MS4A 2AC2A 3I6BA 3QE3A 2HCBA 4V0SA 1YDWA 3L46A 1UBHS 2LCIA 1Q91A 3NVDA 2VP0A 3IIEA 4L50A 3RWOA 5IWCA 2JVKA 2R5FA 3PF9A 3ZGZA 4BO6A 1NQXA 4B80A 3COVA 3BF7A 5BP7A 5EHXA 5JC1A 5L4LA 3SY8A 4D0GA 4HTFB 4MIOA 3RC2A 4NENB 3NDJA 3VJLA 3PGLA 2HU8A 4FQ5A 4E30A 1GGJA 3BZUA 4UPVA 2P9CA 2FMFA 2RARA 3FFTA 4JT2A 4E5UA 2VEDA 1DBSA 2WSSA 1UMCA 2QNIA 4WH0A 3ZE7A 3ZHBA 2C0QA 4EJFA 4CMCA 3D64A 3D6HA 1G7CA 5CX1B 2CMGA 3JRXA 3BWBA 1VIYA 1W0JD 3UT0A 1P7VA 2H48A 1RAFA 3H1GA 3KD3A 4M4SA 3K6KA 3SCZA 1CRLA 1OTYA 2R8XA 5ES4B 5SY6A 5LYJA 1KTIA 2VUSA 2O3SA 3D3KA 5DASA 5K0LA 3ME5A 5FT9A 4YP0A 1HDOA 3LCRA 5JS2A 4DC0A 3RF7A 1XMOB 4BV2A 3V4FA 1N1GA 1EFVA 1NUSA 1XQWA 1UBOS 1Y5MA 2D59A 3I01A 2C61A 3SK0A 5I9BA 3U3OA 1KAEA 2IZ6A 2OAP1 3LKVA 4E94A 2A0UA 3BRQA 2O1WA 3KFLA 1UWCA 1B3RA 1YZ3A 5HA5A 5BSMA 3VSEA 9ABPA 1QO9A 2LW7A 4ZMSA 1YT5A 2MJLA 4PC1A 3QVWA 1V7ZA 4OI4A 1U0BB 2CHVA 2Q5LA 1FB5A 1U8YA 3W2IA 3L0CA 1WA5A 1WHSB 3I58A 4KXVA 5KYKA 5LQUA 3HXQA 2Y2VA 4NAUA 1FTWA 1JDTA 4M83A 4LOAA 4DW8A 2Q2NA 2Z8YM 2XDQA 4HDQB 5E1BA 3JQAA 4WZZA 1XZBA 3MFQA 2CVOA 1XRMA 1UOPA 3G2OA 4DLWA 2ALJA 2PSHA 2UZIR 2QBYA 1EPUA 1WUKS 3LS2A 4U6QA 3SSAA 4BMZA 2YIDA 4C29A 2HR1A 1J9GA 4L5AA 4MQUA 4BVEA 1E2BA 4OB8A 4DQLA 4YT2A 2NV2B 2OHJA 2JFBA 4KYTA 5AHWA 4IF6A 5KKCA 4B43A 1P74A 3CEMA 4UATA 4OIMA 3PEEA 4AS1A 1U7DA 3E84A 1JSXA 1FTYA 1P2VA 3K9BA 5LB2A 1XHLA 2VYVD 4ARVA 4HVCA 3ELYA 4P7FA 3ACCA 1MVOA 4ZO4A 3VVCA 3WRYA 2R0QC 4IMJB 2Y4OA 1EX6A 2YIMA 3P9ZA 2ASEA 2DCUA 3FR7A 4XQEA 4DANA 1R4MB 3GPDG 1BOFA 4N54A 5TQ0A 1DWPA 2BMJA 2JFWA 2WFLA 5CBKA 3NHKA 4GYJA 2OV4A 2VUUA 4QDKA 3H5VA 5D51S 2BMDA 5J59A 2IHNA 2ROQA 3NV9A 1YL6A 2WTNA 2EBHX 5DYIA 3PPVA 1YB1A 3AESA 3I61A 4MO9A 1MIOA 1XE3A 1DU4A 4JLVA 1XCOA 1IM2A 3LHKA 3OY7A 3PUIA 4CIDA 3PGMA 4RVFA 4J0CA 4OH1A 4CGYA 1WXDA 1ZUNB 5BOSB 3BGSA 2I71A 2R751 2YJ3A 5C8DA 1Y1PA 2D0DA 3AJ9A 2F64A 2IXAA 3LNTA 5EWLB 4LC9A 4DCOA 4F97A 5LWQA 4YXFA 3C4VA 2V98A 2HW8A 2KI5A 3WA7A 3HKEB 1GLNA 3P2JA 4WBXC 3GMSA 4P7KA 4TYNA 4G1BA 4HSEA 1LD3A 2XBLA 5JIBA 1ECFA 4IP0A 5CLLA 5A05A 5DBEX 3I9KA 3R5JA 5AXDA 3UXMA 1J0AA 5IULC 4DDHA 2F8TA 1BMQA 2MIIA 2DTXA 2QW1A 3D2LA 2ZU6A 1UBSB 4XUCA 1S2OA 2XXJA 4GPBA 4F3YA 2Z58A 1NDQA 3AB3A 3EEYA 4UNPA 5LVAA 2RB5A 1LWOA 1R00A 1ZWKA 3IAS6 1ADYA 2O52A 3LBYA 4OKIA 1QH8A 2QU7A 4XWGA 1A4UA 3A4VA 2AXNA 3L6RA 4RANA 4EKYA 2JAWA 2QMYA 4BFXA 2JGFA 2GN0A 3ZTWA 2M1ZA 3BFJA 1K4MA 4JLBA 4LC0A 4MMZB 1DBQA 4ARSA 2CKDA 3USZA 3KXLA 5FTNA 3PUVA 5KI6A 4CTNA 4D82A 2C7PA 1WXQA 5A04A 1Y6QA 5LXTF 2XF2A 2D7CA 3RYHA 4AJLA 3M1YA 1L8AA 3OQMA 5G0TA 1JB1A 3K31A 5FO0A 4EF4A 2ZUEA 4PPYA 3NG1A 5CT9A 4I1IA 5C80A 3KZCA 3LDFA 3PQ7A 5THQA 3DTYA 4CT4B 4XWOA 2IZ7A 2FW8A 1BW9A 3LYHA 3LQRA 4G1CA 4FEGA 4I3GA 3QFHA 5BYKA 4GQAA 5FHQA 1I0IA 2RH8A 3RWBA 3IAAA 4U9UA 1FXSA 3GJRA 2PS3A 4ENWA 1GR1A 1SY7A 1X9HA 3OI7A 1B41A 1ISJA 4BBPA 5BRJA 2FFRA 4IUCS 3MBOA 1XZJA 3MPUA 1VP9A 1KY2A 4X1IA 3L07A 5AVUA 1C4OA 4Y1EA 5AK6A 5EOVA 5KCMA 2K7FA 1SIBE 1X7WA 3REOA 4EVSA 1PNRA 2QR3A 4PCLA 2IYTA 1WMDA 3O26A 2QTBA 3SMQA 5IT0A 2ZBPA 1QH1A 3EIOA 3K2IA 1ECCA 1B4DA 3P5SA 2OSBA 4R5MA 3GQBA 1Y6RA 2P8SA 4KIFA 1J90A 1IRIA 2AN9A 2AT1A 2I78A 3R3XA 1PLLA 3FOEC 3G5AA 5EC8A 5EE0A 3S2IA 4L8LA 3FNEA 3FYUC 3AHCA 2JGLA 4Z49A 4ZRDA 2HWYA 3GJTA 1ULUA 1D6JA 3EBOA 3VKWA 3U7QB 2I4MA 3N3BC 1EUZA 2WVHA 3EXG2 1QYXA 4IV0A 1RZRD 5KYTA 1KWGA 1JG1A 3NTXA 2ODAA 1F4PA 4FEYA 4ZI7A 3VDNB 5K8UA 3OE7D 4BFUA 1GGFA 2GS9A 3DL2A 3LKBA 3OUUA 2VAVA 3DE6X 3LQ1A 1R16A 5HKBA 3AILA 1V1RB 3A28A 5I47A 4BWGA 4WZ6A 2UDPA 1U65A 2YZKA 1C80A 1VE9A 1VSVA 5D7BA 2DFNA 3P5BA 3UW3A 3TQTA 4YMGA 5CUQA 1M1NA 3EXEB 1H0RA 3W05A 4C6SA 3N5CA 4MSUA 3ZCVA 2E21A 4OU4A 4UHKA 3T8YA 1K9VF 3M6WA 3V4RA 2QRZA 3SJCA 5LOVF 3PJFA 1PZXA 1Z17A 2W2LA 4BVLA 1QAQA 4ZYTA 4RQBA 3MRXA 4MUHA 2PMBA 1JVNA 4LXGA 3HUEA 4TTQA 4H4EA 1QE0A 4BGEA 3GFBA 2FE4A 2WG2A 4CLEA 5ELMA 3T5BA 1QGZA 2YDYA 3DCNA 1UZAA 3QKSA 4KX5A 4O2BF 4D57A 1N3LA 1E1YA 2O14A 3SEZA 4H1HA 5K9ZA 3JZAA 4M99A 4QFCA 2C31A 3IHWA 1Y8QA 4JQCA 4QPPA 4MVXA 3KELA 2MCFA 3V2HA 5J1SB 3ZVKA 1QLJA 3NPAA 5FUXA 1L7AA 3DMTA 4QXPA 1TIBA 1USVA 1B8OA 4QWWA 2AN3A 1QXSA 1BCRB 3PQEA 1GUAA 1P0MA 1PX2A 4UEOA 4YAGA 2I8CA 5JV5A 4EB0A 2G1JA 2NUBA 1SVLA 4DR2B 3EVZA 2C3YA 4URVR 5FOSA 1VE3A 5KWEA 3NWBA 2X8WA 2YYYA 4BRWA 3N2GB 3A3NA 4WFJA 2C8VA 3JAMA 1BCSA 1M34E 4U5QA 3DE7X 3ITKA 1QHHA 2C2KA 4LKRA 1N5DA 1VCNA 3ANTA 4G89A 1IONA 2PLFA 3PHIA 4ESEA 1ZICA 4FHFA 4C88A 2CLMB 1RM4A 2EDAA 1ZQ9A 3JQFC 3UA4A 3HABA 2ZQYA 5KQMA 1GTVA 1VYTA 2DFVA 1F06A 1IB0A 3C7KA 1DC5A 4TS3A 2H4XA 5IKEA 1OX5A 5TGDA 1KVSA 3A3PA 1W5EA 1PQWA 3HK2A 3Q9NA 3SC6A 1MB0A 5CCEA 4V0KA 2ZYSA 4TL8A 3A37A 4I46A 1G7SA 4P9NA 3K0FB 4TSFA 4ZZ0A 1N6HA 3W04A 2VNHA 4X6XA 2QG9A 3RVJA 4N6NA 1E1RD 2P77A 4D3FA 2ZG6A 3GFFA 2E48A 2GPTA 3G1TA 3NGLA 1VSQA 4YXWA 3VX3A 2CFRA 4XCXA 1KWKA 4KJXA 3I6IA 1XVTA 3X2SA 1VLJA 3H7IA 1M73E 4WA7A 5D1NA 3FFAA 3WC4A 1PI3A 1GKLA 2JLAA 3T5PA 3FDIA 1LXCA 4JT8A 4Q9LA 1FX0B 1NQOA 1U1CA 2OBBA 2EQ5A 3IELA 3LK7A 4HDNA 2OB1A 4FVTA 1UODA 3ETCA 4MVYA 3R9KA 1F12A 3PC2A 2NVUB 1OILA 3Q3GE 3Q2KA 4BEJA 3G49A 2UYOA 3E9EA 3I05A 4QDZA 3S3TA 4JJFA 3RUHA 1CUAA 1PJ8A 3TLBA 2V8BA 5C1IA 5SZIA 2FWIA 3HV2A 4CT0A 1XTZA 1QFXA 1COWA 1QRAA 1PLKA 3LDUA 3HBAA 1M6YA 4YR7A 4WXPA 4ZIRB 1AE1A 5BV0A 3VU9B 2AFVA 3C5WP 5FTMA 1IHOA 1LS1A 2BSAA 2A4MA 2J0QA 1D1PA 1PU2A 5PGMA 3HNPA 3DKRA 4TQUS 2DR3A 5DM1A 3EGOA 3HXOA 3FIUA 3NO4A 5IANA 1FUIA 4MI6A 3MCWA 4N01A 3G1UA 2QE7D 3GA0A 4A6XA 2PWYA 1XTJA 5AXCA 5C2JB 2V7QD 1FZQA 1ORTA 2IQ5A 4EEZA 3C98A 4OQEA 4QOJA 1DBRA 1YBFA 4I1YA 1XRJA 3JVIA 2XUGA 4YN3A 4UCXA 1E89A 1OXXK 2GJAA 3IIIA 5I8ZA 2P5YA 3PQFA 4R8LA 3NKVA 4UU1A 1H3FA 1ATIA 2PCLA 2O20A 3ETGA 3GH3A 3M5WA 4C89A 5CD1A 3L8ZA 1UDCA 4RS3A 2ON6A 1WCV1 2YUTA 3O4RA 4PTYA 1OB2A 4GBGA 3G2KA 2PH7A 4V38A 1AKNA 1K7XB 4HQRA 1ZR2A 4UOZA 1FUUA 3VNUA 1K75A 1N2OA 1SM4A 1YFJA 4BNDB 4U2CA 4PSDA 1KE1A 1MB3A 3JQ6A 3LP6A 2YNMC 4BX9A 4QJ3A 3RUCA 4ZYVA 2HGZA 3PEFA 5JSQA 5BQOA 1TPZA 5L3QA 4DRXA 1P1RA 3Q9SA 3DL4A 5DBOA 4BNGA 2BM0A 2J48A 2IEDA 4FHDA 4JIGA 4MVJI 4CM8B 4ED9A 1GQOA 3DE5X 5EG5A 1SZCA 1RMYA 2YV3A 1E79D 4YRQA 2G70A 1DOAA 3DDNA 4HZIA 4O4LA 2G5GX 5EUMA 4Q3BA 3E9ZA 3VHLB 1AKYA 1A7AA 2XE8A 4IIBA 1I6WA 1HI9A 3IAM1 3TH5A 1E5QA 4ZOLA 1R4AA 2ERXA 1NVBA 4N7JA 1NR7A 1ZO8A 4I5IA 4I55F 3T9CA 3O47A 3DV0A 1SVUA 1GCAA 1QC5B 2IHVA 2MYTA 3KTAA 4ARBA 4BKQA 2JAQA 2V6BA 2YMQA 5BVHB 1K3UB 4F93B 1NF9A 4H3HB 4EAAA 3NR2A 4MLPA 1YQQA 2ZVQX 4Q3DA 1YULA 3EIWA 4KRYA 5C9ZA 5C53B 1KC3A 5C35A 2BH9A 5B36A 3LO8A 4QQRA 4ZXFA 1KO8A 4FU0A 2FFJA 4N5IX 3FVVA 4KU4A 2FLVA 3ODGA 5FUMA 4X84A 3DLIA 3GIWA 3QTBA 4RPIA 3ID6C 2VH2A 4ZYUA 5A6SA 2GTIA 1O96B 4EPVA 1JG4A 2JCXA 2X5OA 3OFJA 4GLOA 4L08A 2LZ0A 4ZHQA 1XZGA 1TPYA 3C3YA 3DBRA 2CC2A 3TE6A 2AK3A 4IH1A 1HNZB 1PHRA 3WNVA 4PGAA 4C0XA 2UYQA 1S89A 5DNEA 3LWBA 1K1EA 3IDSA 5DXFA 3ZHXA 4TL7A 4WFIA 2A9VA 1Q11A 3DT8A 2IEYA 3QU5A 2VNAA 4X1KB 5ALRA 5K3BA 1N4DA 1G3UA 5A9RA 2B1QA 1DRVA 2IHBA 3E9DA 3MWLA 1O6FA 3ZTTA 4R2IA 2FZKA 3FCCA 2COUA 1U1DA 2FH5B 5TS2A 1L2TA 2SKEA 1VP3A 2IYYA 2MSLA 4F5ZA 1RM3A 1D7AA 1V6CA 2R25B 4KN8A 2V3VA 4BP3A 2DJIA 3CF4A 3OU7A 3UAOA 3OWHA 4C04A 1QHYA 1DAKA 2BR5A 2OILA 3G59A 3R5HA 1NUUA 3B8HA 5KOHB 1J0DA 2FG5A 2FJ0A 2G1UA 1XI2A 3FCUB 4M1OA 5DH9A 4CF7A 1SKUA 3K0CC 4QBHA 2PSJA 2PZJA 3GLKA 2Q7DA 1X77A 2XTMA 4Q7EA 2J41A 2QENA 1OE0A 3B6JA 2H92A 3LXMA 2E7ZA 2BF4A 1TADA 1KYWA 1JKMA 1JHUA 3FVQA 2H4WA 3IDZA 4MOWA 3UT6A 5JEEA 3W8EA 1XG5A 1Y3HA 5CFPA 5UKDA 1FP1D 2J7KA 4URZR 4PYQA 3MIIA 1Z5VA 3QVUA 4RMJA 1QZ3A 4XD7D 2V7XA 3ZHZA 5D01A 4QT4A 4IHJA 1IZ9A 1ZGJA 4UDYX 3SQOA 1YONA 1Y3DE 1ORRA 3FSGD 1B0ZA 3OZBA 4WEQA 3ZDRA 1YS9A 2IF2A 3GG9A 3IUMA 2W2XA 3LPDA 1PDVA 1QTRA 2H4JA 2W11A 3RKRA 3VKFA 4GPAA 4ASUA 1JNXX 4GM0A 4GOKA 2FVXA 1X1RA 4X62B 4YCSA 3W5DA 4BQIA 5JJKA 2NO9A 1IEVA 2EEZA 3AH8A 1MOZA 1K4KA 2BM9A 3MUFA 2VCHA 3BTSA 4PSUA 5DTMA 3OJLA 1E0SA 1KI8A 1T3SA 4YRDA 3B6EA 5AOCA 4N82A 1EJ0A 1QIIA 3DOOA 1VLMA 3D31A 4KQCA 2OO7A 3TL6A 2VPYA 3OFSA 3T3GA 3P9RA 5L8VA 4MVWA 1BU5A 3UICA 4XEUA 4FJ1A 4LDJA 4MR8A 3DC7A 3EZYA 3UPTA 2PO5A 1ODSA 1N5RA 4G09A 2ORIA 4EDFA 3IO5A 2Y1OA 2BFCA 1XPOA 2IX3A 3AWIA 3EMDA 3VGPA 2X9QA 1F8GA 4LPKA 4AUNA 3GD5A 1YIAA 4IINA 3B38A 2IV7A 1YCFA 1H2BA 4GYKA 4QUIA 5IC4A 3W7BA 1PJAA 4JJ4A 4XE5A 5TQVA 5AIBA 4YY3B 1I4LD 5EIBC 1ENYA 4HMQA 3T5MA 3NOXA 1XNQB 5JYEA 1B43A 4J3FA 2VK8A 1JT9A 1MJGM 2XITA 4O2RA 5AJUA 3RVNA 3IIKA 3S40A 2W5UA 3EF1A 5FDFA 1VLLA 4ER6A 5KYYB 3K6JA 2I4IA 1ZMOA 2OV6A 3GGSA 3K5IA 4Q9IA 1R0SA 3UJCA 4CRWB 3C3KA 3ROZA 1P9LA 4ML3A 1NA5A 2EBFX 2FN7A 1BXKA 4KE7A 4TMKA 3ZW9A 3OY2A 3AUAA 4J1TC 1EP1B 1IG3A 4Q1FA 3SKVA 5AUNB 5C4IA 4H6XA 5DCYA 2APJA 3DZGA 4R0MA 4PHFA 1PJQA 2FXIA 3UGQA 3BGOS 1L7EA 3JD1A 2R7AA 4R1MA 4HDSA 4MWEA 1W30A 3RFVA 1UBTS 2AI2A 5B6JA 1DWQA 1YVDA 1W0JA 2JLUA 4Y0NA 1QDLB 2V74B 3MOSA 4LF7B 3NS7A 1JSRA 3OMWA 4BLOA 3Q12A 1N9GB 1AIPA 1WLYA 4LE0A 4UDOA 3DBLA 3HYTA 3RKSA 1O5IA 3GP3A 3H7AA 2ADOA 4RSRA 5T41A 1AD2A 1PV4A 3FUWA 2R1TB 1V8DA 4GICA 4I6GA 5HW0A 5EJ2A 4YAJA 2QJRA 4QTTB 5B55A 1FLAA 4FLMA 1U0EA 1NBIA 4KUEA 3UOWA 2HTFA 1E96A 1GUBA 4DM4A 2BGKA 1KKLA 3OT5A 4PNZA 1ICEA 2K87A 3CN9A 3QKRB 5EMKA 2VH1A 4C87A 3SZRA 4DLSA 1SUWA 2P75A 4IDDA 3QWIA 5EIHA 2QQEA 4CE6A 1XEWY 5CB4A 2ZIZA 5ER6A 3VUEA 4XWAA 4I5DA 4WMLA 4CIWA 2PJZA 4MGKR 5AI5A 5MGNA 3GZNB 4BTEA 5CFRA 3KOOA 1BH6A 4A8HA 1P19A 3TOZA 1XK7A 1K98A 4FILA 1KJNA 1T0UA 4UDXX 3UC5A 3AUTA 5BMVA 4RHUA 1O95D 3DAHA 1R0RE 3ORQA 3LX5A 4JWTA 3RKUA 1GLVA 4YIHA 2BMVA 2EWMA 3H2GA 2Q9AA 4YLYA 4KVAA 1KDOA 1PS9A 2F3QA 3MJRA 3VSDA 4IJVA 3CSDA 2O3QA 4QAQA 5DT2A 2ZSAA 4BNYA 4Z9YA 2FMKA 2E4ZA 2X8AA 3URKA 3V1MA 2VYVA 2O2YA 2CB0A 5B5SA 3MCVA 4LEIA 4H4DA 4QREA 3S5UA 1RQRA 4X8HA 3GNQA 5DHFA 1JPJA 1Y7PA 2ZRIA 4LDZA 3DFUA 3EYWA 4BP9A 4DSAA 3WIEA 1XXHE 1C1HA 1D6NA 1YSCA 2QNBA 2W0MA 1ZW6A 2C82A 1N2XA 3JYPA 3ZZNA 2IYQA 3D7MA 1ZBQA 1V5FA 3LLUA 5JSFA 4LWOA 4R16A 2V5UA 4GI5A 5KTKA 1PZHA 4CKCA 3KBOA 5HM8A 4PEVA 2I62A 1U5AA 4C06A 1CP2A 3VBCA 4HGQA 1UM9B 3OZRA 2OMEA 2PLRA 3ZJVA 5CJJA 2AF4C 3L43A 1IZYA 4Q7JB 1SC4A 1H5QA 4PX5A 4DGSA 5BXYA 4OI0A 1YBHA 3WMRA 5AHRA 5I5GA 3CIOA 3PTAA 4QNMA 3WQQA 4C0BA 1F8FA 2IL1A 2C5SA 4MRRA 4BZPA 3HB7A 3WJAA 1YTLA 4DV4B 2JAOA 4UTPA 2FN4A 4PX9A 3WGGA 3RI3A 2D3TA 3JD3A 3A11A 1BQEA 4L2IB 1USUA 5KNCH 1IG0A 3TX6A 1LRJA 3V00A 4RETA 4KQEA 3WLEA 3GZ4A 1XRRA 4GMXA 5EXEA 3N59A 1RP1A 2R66A 1KO1A 1BIFA 1GD1O 2O1EA 3HRHA 4K8RB 4Y2RA 1L8XA 2FG7C 3EFOA 3P0FA 4YJ3B 3UKOA 2ZWOA 5A5EA 2CXQA 2WIKA 1E3MA 3DCYA 4AWBA 4NJEB 3QBEA 4DEXA 1LEHA 3FD8A 3U4GA 2QM8A 2HLPA 1JQ3A 3L7JA 4BO9A 1ESNA 4AJPA 1WTAA 3R76A 4R7GA 4Z3OA 4DLNA 3T7JA 2J3EA 1CEYA 1U5BA 3U3MA 4DUGD 4KXLA 4QYXA 2ACVA 2YY5A 4GPZA 4N76A 1IM5A 4Q03A 4DR4B 3DEIA 3UCXA 5BR7A 1A50B 3ON5A 2AL7A 2FZLA 3T0IA 1GTG1 3USCS 4NCHA 2GFHA 1ST2A 4X1YB 4DSUA 2ZM6B 1VHTA 2OBXA 4H6WA 4MRMB 4GDMA 3ZK7A 2QSZA 4QODA 3U7EB 1A9SA 2P0AA 3AZQA 1E2MA 2FLKA 4W5WA 4CPDA 2VA8A 3FFWA 3IEKA 4L28A 3EJWA 4BV8A 2GCGA 3C4QA 5JU6A 5B58T 4I4TB 2X1HA 1LH0A 2KLBA 5SZJA 3EUWA 2NU8B 3AKEA 2UZ0A 4OXXA 1YUNA 1N1DA 2J0VA 4P4SA 4Q16A 5IUJC 2XKKA 3GLIB 5JO9A 3OTQA 1YMUA 3GH1A 2K7ZA 3KR1A 4GPEA 4II7A 4JJAA 3H4TA 4LBWA 3CM0A 2P9GA 3VR4H 2O5RA 1S3SA 1TGYA 5ITZB 2Z5LA 2C7VA 1BFUA 3KL4A 4PO9A 2Q3JA 3TQFA 1ZK2A 4D74A 1T8PA 4EATA 1JTFA 2YY6A 2DM6A 4UFPA 4FOTA 5H9WA 5JWHA 1WPXA 5TB5A 2C4KA 2QN9A 2IOFK 1JEQB 3QEKA 1R12A 4ND1A 4E4YA 1M2HA 3MERA 3RJ9A 1EX9A 3USES 1NQAO 2QLBA 2PS1A 1GO2A 5TNXA 2XJ4A 3QEOA 3NU1A 1YK0A 1H9CA 1JMKC 2FP4B 2IXGA 3HLKA 4DB4A 2XA1A 2FWBA 2VSYA 2B25A 1OAOA 2DC1A 4UE6A 2XZDA 1RZRA 2C96A 3IPXA 2AVDA 3QX3A 3IA2A 1UFOA 5FFMA 4ZYYA 2FR8A 3L7AA 1EJBA 2YWBA 3RSFA 1ADGA 1AKMA 1VM6A 3A26A 3B20A 3OE7A 4OHFA 3CN7A 3EXHC 5FRDA 4C76A 1YJ5A 4Q4HB 2ZVDA 5TF4A 1VL6A 4EGSA 2F3TA 5DHSA 2E2WA 3BD7A 1HYHA 4F9GA 2XSZD 2V7GA 5F78A 5JSZB 1GPJA 2ODPA 2YH2A 3AM5A 3RVBA 1FNBA 3T54A 1KMHA 5K8JB 5BR4A 2FFHA 3EZXA 1DC4A 4DIBA 1CEXA 3BFVA 1XK6A 3K9CA 3K92A 4YMIA 3CBQA 4GM4A 3B1YA 2VTKA 4RUKA 3S8EA 3WIOA 2GD6A 1GM5A 3HJTA 4Q7QA 4EBFA 4JLAA 1GSAA 2M6KA 4BNFA 2G1AA 3RSQA 4DTCA 3IQGX 1ZN2A 3NATA 1NXPA 4CLRB 3DEZA 5JQGF 1E69A 4XWYA 1CSEE 1PGJA 2XQGA 1HBJA 1FFCA 3K9NA 4JLPA 4O2AB 3U1VA 1G60A 2G40A 2GF2A 1USKA 4R8KA 1K8XB 3R5FA 4JGGA 3DE2X 4KR9A 4ZZ3A 5IAEA 1RPZA 4XYBA 4TM7A 5FOVA 1L9KA 1R6VA 1XF9A 3OD1A 4MKHA 1FC0A 4M0UA 5AVYA 4LQDA 1XJCA 2ZVJA 1PFKA 1D2HA 2FSFA 1RTTA 5AM2A 1K6JA 4DFDA 1P18A 2WMOB 2YYSA 2JKZA 3ERCA 2AFHA 4PR3A 1WPQA 2J9FB 4NTZA 2VDOB 4W1QA 5DU2A 4K9RA 3B9RA 3ILXA 1HX7A 1LS6A 4G0ZA 5C1BA 3B3JA 2ZQ5A 4BNJA 2BFNA 4Y9TA 2Y0EA 3H8WA 4YCBA 2D06A 1P2GA 4Q7MB 4IUDS 3OHPA 2GYWA 4J0IA 2ONZA 3V6LA 2F1RA 3WSVA 3EBLA 2C2BA 4MV5A 5K3DA 3ZZTA 3KAPA 3FOAA 1EBFA 5D84A 4MVCA 3DR5A 5TDHA 4RPCA 4M1MA 3CX3A 3PNMA 5T5QA 1FS6A 3K8YA 1XJQA 2C04A 2FCRA 4LZJA 5A6VA 3UOAB 1V1MB 5HDBB 3G0GA 1NX9A 2WAYA 3EUEA 3M81A 4JXKA 4JVSB 4KO8A 3E7FA 4B6QA 1RABA 5K6RA 3Q6NA 4YRNA 1GSHA 2DLCX 1ECBA 1QH0A 3AEYA 1MQSA 2AOWA 2NZUG 4US1R 2NVWA 3GO4A 4FDAA 4R41A 1L7BA 1E1RA 1J2YA 1NNLA 2FA9A 4R54A 1B0PA 1OY1A 2ZIWB 1W44A 3IAS1 3KWMA 2I3GA 5AJTA 4M1ZA 5HJEA 2A5DA 3DFZA 1NF8A 3TVTA 1R8QA 1RBYA 1MLDA 3IEIA 4HFJA 4HS9A 1YHZA 4MYHA 5EZQA 3WK8A 2W48A 2ZCJA 3D6NB 5LIPA 4P82A 3LT0A 3OIGA 3VNSA 5DDIP 1B6SA 1SCJA 2IC5A 3I9JA 4TMYA 2DJ5A 5JPCA 5LXTA 1GL9B 4XPIB 4PSAA 2IIVA 3FVRA 4J1NA 3TSCA 3H65A 4H7IA 4PZDA 2Z4RA 4CM3A 2JI7A 1MHTA 1MC5A 3GJ5A 4KPFC 5DCUA 1ECPA 4BBZA 4EO4A 2IITA 2ZYUX 4G4SP 4WXRA 4EWLA 2JD1A 1Q0UA 3RLIA 5JAZA 3IHLA 1NBOA 4W8HA 2IX9A 1RLUA 4M8LA 4MJ7A 1P8JA 2ZFUA 1U3FA 4A6PA 5I7SA 5M34A 2ATXA 2Y27A 4JXZA 4PHHA 4CHGA 3FPGA 2HZ7A 4YT8A 2YJ4A 3AC0A 2JLRA 2O7VA 1NNEA 1NXWA 3WA6A 2GO7A 5CTAA 3QKTA 3KJXA 1UIRA 1U0NA 2OXCA 3UJAA 3B9BA 3KQNA 2QE7A 2YWHA 1VA4A 2V7QA 5M5BA 5A0VA 3DF7A 2JGDA 3QBJA 5EIBD 3GJYA 4IBOA 3N2KB 1E0DA 1RYZA 4LF9B 2GFIA 1PJZA 4ROTA 1EFTA 3JQ7B 3GUHA 3OLYA 3HM2A 5AI9A 1FSFA 1YJ8A 4ENRA 5AJXA 5KWIA 1E61A 1EU1A 3RV3A 3G9TA 5ECGC 2WWXA 4X7MA 5KU1A 1M9NA 5KWJA 5BN5A 4G5SA 1ONBA 2OCGA 4YJGA 2FW0A 5LC1A 1OWLA 2F2TA 1GAJA 2C2XA 4TVKA 2GSDA 3FNHA 4Y2QA 4M8SA 5JJ5A 1NU6A 4AZ0B 1OXUA 3HYSA 2Z5VA 3RS5A 2B1RA 2R97A 1E1CB 1B1AA 2HA0A 4LJSA 3D8HA 5AOVA 2O8BA 5KINB 3MS4A 1KAHA 1GDTA 2BHNA 3QITA 4ZT4A 1VZ2A 5C4GB 3OETA 2VG8A 1T91A 3BE6A 4R4JA 1XDDA 3CLSC 2D00A 4MW5A 5I48A 1JEYA 1GITA 4KYIB 1E79A 2XUPA 2AN1A 3MXTA 1DC8A 4JP3A 3ZWVA 5F1OA 5LOVA 5FTKA 3IERA 3C1AA 1DRUA 5AQ1A 3IKVA 3U16A 3ADCA 4J0DA 3T3OA 2VWQA 4WI1A 2OR3A 1NDHA 2PAFA 3ENQA 1UZMA 2DBYA 3MB5A 3VVBA 2DFDA 2HBRA 4V2UA 3NAQA 3DQZA 3EZ7A 2GJSA 4RVHA 4UBOA 5H3LA 1QTNA 3AFHA 4GBED 2E82A 2BC9A 1VPDA 1N33B 4KK3A 2CFIA 4IZHA 4OFBA 4M0DA 2GERA 1QHFA 3VPXA 2WD8A 2Z2XA 4J16C 2J5QA 3THWA 3OOSA 1G0NA 3WFIA 1WDKA 3D81A 3A3YA 1OI3A 1VXOA 1RWVA 1ACMA 3VGJA 4P7BA 2FZGA 4JNKA 1JZSA 1A1SA 1L7NA 1GNPA 1S9HA 3JAKB 4RA9B 2IIQA 2CK3D 3A1FA 3QGMA 5AKZA 1JX6A 1ACLA 3PTLA 1YXMA 4PQRA 3BQMB 2A94A 2C03A 2NAFA 2VBIA 4ARCA 3MD0A 4Y2XA 4OXYA 3ORFA 3KLOA 2Y1XA 1NOJA 5FTJA 3K6SB 4E12A 1JAXA 3UAZA 4DA0A 1KFCB 2DZDA 2HV9A 3F6CA 3FMVA 4OOFA 5FYDA 4WESB 1UKCA 5H1YA 5JZ9A 2C92A 1ZCZA 3EVCA 3Q5DA 2RHLA 3RS4A 2F55A 3CSUA 3NAGA 1OFUX 4P3PA 1YRYE 4QYWA 5FOUA 4NPHA 4BJHB 2W43A 1BWRA 2TMDA 4ETMA 4IYJA 2ZWVA 4UBKA 5A0TA 1JALA 2TRSB 4Z99A 3HJRA 2BW0A 3GHYA 3MTDA 3LRPA 4CVNA 3KOZA 1C0LA 1PTJC 1ZH6A 5CU7A 1Z08A 2H2AA 4Q9KA 4YAWA 3R0VA 1SKYB 4E5YA 1KVRA 2XZOA 4UNQA 3MLAA 3GLFA 1E2LA 3TSZA 1W88A 4AJ9A 2ET6A 3ADOA 3CRRA 3L0PA 2WK1A 1IQPA 3NBKA 4LFAB 3ILVA 4KTVE 4EYGA 3AFOA 1BG6A 2ZT8A 2XIQA 5BV8A 2VWGA 1RWWA 4OP3A 4DG8A 1K8YB 3WGJA 3WKAA 2IP4A 3VH4A 1LC3A 3GK3A 1RRVA 3HP1A 1DLJA 1BGWA 1HYEA 1SVOA 1GZ7A 2YR0A 4FUTA 4PZCA 3TR0A 1NNSA 4P5PA 4JQSA 2NZ8A 3QUQA 3FWYA 3DHWC 3M5PA 3N3AC 4MUKA 4QJ4A 1VDMA 2V3CC 4TVBA 4Z1MD 2B8WA 4Q19A 1T2VA 4QEKA 4XD7A 3FR8A 3JXEA 4YI5A 5E1MA 3X0DA 3PP8A 1U2ZA 3OTWA 1YB7A 5AVJA 4IZIA 3FSGA 4MGHA 1GUDA 4MW0A 1XEXB 3VDXA 1HTWA 2GPWA 3ICOA 2AMYA 3CC8A 5BYBA 4CLXA 3DUFA 5HYVA 2LDBA 3PA8A 4Y6RA 5ILGA 2H54A 2WJHA 2FW7A 2Z2ZA 4NQRA 2ONKA 2Z6VA 3A6KA 2XY4A 5JS1A 1WPRA 3RANA 4HAVA 4B3GA 3NBFA 3G8YA 1NN5A 2C4NA 3BMQA 2I2DA 3Q3CA 5HUHA 3ND8A 1DLIA 2ZROA 3FKQA 3GRPA 4V02A 3T0GA 2BFDA 2SBTA 5F23A 3L1KA 4IMPA 3JVEA 1G9SA 3NHMA 3PR2B 3TO5A 2PL1A 3SIWA 4MGZR 2XAUA 3SC3A 2IYOA 4BKRA 4LHSA 4YRMA 1WU8A 2GPYA 7REQA 3PLAE 3VOSA 4GX1A 1QDEA 2X6TA 2F3PA 3UCEA 4QQKA 4MAMA 1AXGA 1SBIA 1V2HE 3PUZA 5CR9A 4K7JA 4JR2A 1W49A 2WZQA 4UOEA 3ZCRA 3INRA 3ZH2A 4HT3B 4AY2A 4WHMA 4OA8A 3GJ3A 2CXPA 1SN7A 4KE6A 5KC9A 4F2DA 4DUYB 5L51A 3UN1A 3OOJA 1IBSA 4JYPA 4TRRA 3TW4A 3D6UA 3A1CA 2FQQA 1Q0SA 4EA9A 4NYJR 4KR7A 2FK7A 4J29A 5I3ZA 3LW8A 2F67A 3SM9A 6YASA 2CNBA 3ZKAA 1MG0A 3ONFA 1NN0A 3GJSA 3UAXA 3ZVMA 4DDVA 4R81A 1HG1A 3CXUA 4D8WA 4ZMRA 4FW9A 5JTTA 2H1VA 3DD1A 3FW1A 1P0QA 1CUCA 3UO8B 2AWNA 4O63O 2P68A 3CEHA 3IBSA 2B2NA 3FYUA 4GX0A 2ZKLA 3EEQA 4MHOA 4R1TA 5AWFC 1QZTA 3VZBA 1FYEA 2BFMA 4YRRA 2BLLA 1XTSA 2ZREA 1PVDA 2FPLA 2Q6KA 2QZJA 2QEQA 2JFVA 3HYNA 1FVXA 1BVUA 2WTXA 3H8JA 2AKYA 1C9EA 2WIFA 1OV6A 2I3AA 1TFRA 3STWA 3LUAA 4OHXA 3BAZA 2AFIE 4Z4CA 1XTRA 4MS1B 3B7GA 4MNTA 3RFXA 5KHOC 4J3JA 5TARA 2KE5A 4L5BA 5HZMA 3RJMA 2O2JA 4IIJA 2DX7A 1OIWA 1WW3A 1Q0LA 1SQGA 1W9MA 2BKAA 2JVJA 2ZI5A 2J5BA 2ZJ2A 3I5UA 3I8SA 4G9GA 5G0WA 1D1TA 4M8NE 1LY1A 2BGLA 1ZH4A 2JLBA 4HEHA 5JZSA 1JG7A 3LF2A 4XPZA 3SQWA 1W0CA 3P8ZA 3AOGA 3L7OA 4FX2A 4YJDA 2PMDA 2P4UA 1CJUC 4BN5A 4I1SA 2PX0A 1RRMA 1CQIA 3G2NA 2GYYA 1X2BA 4HI0E 3P19A 4HBGA 2J45A 2WJWA 4Y2YA 5C3UA 1ILEA 3LIPA 5E7IA 2OG1A 4MYSA 3WGIA 5K6TA 4YJ2A 3EZ9A 5IVPA 1TJ3A 3RS3A 4FB4A 4A0FA 1WVMA 3VR6H 2REXB 3LKZA 4RESA 3B7WA 3PDIB 2WDPA 4R2KA 4X8MA 1XZQA 2X15A 1JHAA 3HFGA 4AROA 4UC0A 3RYCB 1TUIA 2QAGA 3NQ41 4EL5A 4RZQA 4PYLA 4ZI3A 2PRSA 1NQ5A 2VXYA 4JBNA 3BXZA 3DE4X 2X0DA 1AZLA 5E6RB 2ZZNA 3QJGA 1O95A 1JIXA 4RZXA 4MB2A 1ANKA 4ISBA 3H5AA 4EQ6A 1RI4A 5JW6A 4MUMA 1KXZA 1VBKA 3V1KA 1CUFA 2WFAA 2YV1A 4Y0AA 4I4LA 3T5DA 4KIGA 1XYYA 3SJZA 1W6UA 3YASA 5I8WA 5J2TF 3BZBA 1FFGA 3LU1A 2UVDA 3EXIA 4AY5A 4EMSA 4YCCA 5CDGA 2BJVA 1QHNA 3CUSA 3JQFA 4JOCA 4WJKB 1CUSA 3NHLA 4UU0A 5JH7F 1QZUA 1ZJ6A 3K2QA 1ZGCA 1I4OA 4O0MA 4PIVA 3T1VA 3HJFA 1N78A 3OG9A 4BMCA 4CDNA 1BRTA 1DC6A 4XX0A 1JQLB 1OPRA 2QMZA 3C70A 3OQ6A 3V8MA 5C5CA 5JRDS 4JDPA 2WYWA 3AEUB 1BS2A 3WWOA 1CZHA 4NE9A 2F3UA 3KT8A 2GPAA 2YDXA 1YL5A 2WVGA 3Q1LA 2XHEA 4HAYA 2RCNA 3AFGA 1O4WA 5D2CA 5REQB 1CUXA 1ZBDA 3BB3A 4BC1A 5CURA 3D8RA 1A97A 3HPQA 5JRZA 1G2PA 1UJMA 3KAKA 4L3OA 1U2EA 4JB2A 2X4GA 3PX3A 1QK4A 2FZVA 4PY2A 5C7IO 3B9PA 2ZTMA 1N8NA 1THMA 2HADA 1CJBA 4H15A 2BISA 2H59A 2Z08A 3QKIA 4ZAFA 1NLMA 4TKLA 3F6BX 4MITA 3SAJA 5CFNA 1TA0A 5GM2A 1A04A 1T1RA 1TCUA 2QMUA 5I7HA 1Z22A 3QVOA 3EIHA 2FZ5A 2XEXA 1DX6A 3LFTA 2PRJA 1FRQA 1UOOA 1QYIA 1WW8A 2WUDA 4OIFA 2YFQA 3D8TA 4CM7A 3LY8A 3JV7A 2CFSA 3NP7A 5HDQA 2ATCA 5DMXA 4K26A 4UUQA 1L1RA 3MQ4A 4FYHA 4QL3A 4UVIA 3TKYA 5AUPB 3TTYA 1M1YB 2XDYA 4FHEA 3NOOA 1CRQA 4U9HS 5B3KA 1B76A 3K70C 4I1PA 4BNZA 1TEHA 3P52A 3RRZA 4ZAWA 1DT3A 4PG6A 1CVLA 1PX0A 5K05A 4KR2A 3N05A 3AT1A 2CUNA 1HDXA 3H5OA 2W6NA 5H8WA 1YU6A 3L8DA 4DUGA 3G0BA 1CEEA 4MPPA 3ROMA 4B85A 3HKDA 1GSIA 1KO7A 5FB3A 3GEGA 3TG8A 1NVAA 1DKNA 4OH7A 4F6RA 2GWRA 3CX6A 1A9RA 4RPLA 3STVA 1FFHA 4WNIA 4R8MA 2ACWA 1P0FA 3ANYB 5BMOA 1M75A 4HVLA 4MV4A 3IR7A 3UENA 2YUIA 4DAOA 5COQA 1IBMB 3P94A 4K6KA 3U3JA 3BRCA 1S2DA 2XMPA 4FFBB 2W8BB 3HV0A 5T4FA 3FZEA 4B17A 2X40A 1CZNA 4FE3A 4OMDA 3Q5EA 3TSYA 3KUCA 4ZANA 1KA9H 3KEFA 4P3NA 4Q0MA 1SOWA 2EX4A 2HK9A 1ZX1A 3SZ3A 3X1JA 2IRWA 3HLYA 2FPRA 3HB0A 3JD4A 5HFAA 4D5GA 3FPFA 2YJTD 2ZTLA 3JWJA 4UTVA 1Z0JA 5CM8B 2G9VA 3CWQA 3U26A 3OU6A 3MMZA 3AQIA 3PHCA 3U7GA 1Z0FA 5HKAA 3VYTB 2GK6A 4IOMA 5EJAA 2PJRA 3WNZA 3NORA 3FRJA 4UZFA 1Q0QA 4W5QA 4R9NA 2PVCA 4DT1B 1KZGB 1FDOA 3CLSD 2JLVA 2ZYVX 4PZUA 1DV1A 3GEMA 3R77A 5LA6A 4DQVA 2M2IA 2P1ZA 3MNFA 3T7IA 3TLGB 2I6QA 3WK5A 1ZR4A 1PS8A 2OSVA 2WZDA 4J07A 2DBZA 4BO8A 2EFHB 5JJBA 2JHCA 1SKQA 1OH6A 4K88A 5F9MA 3KHKA 1PYDA 5IT4A 1J2TA 1L4KA 2P62A 3E1SA 2Q5CA 1Z83A 3AB8A 2H6EA 1XWIA 2X13A 4KQJA 1SBZA 4X0EA 3VNQA 1N0VC 1R0LA 5T6BA 2RGEA 4BNVA 3PEYA 2BKVA 1C0EA 2B4AA 1T9AA 2BI4A 1ISIA 2XSZA 4IPTA 1AS0A 1P0IA 1RPAA 4E5MA 3COJA 2GESA 1ST3A 2Q3LA 1WWKA 1IBCA 4H17A 4OK3A 3K1YA 3KR0A 1JEEA 5BPFA 1MB9A 3GFPA 3SHVA 1OX4B 2UZ3A 3HXLA 4TS1A 5GJCA 2W6CX 2ZTSA 1O9BA 4KP7A 1JSCA 2X1LA 5LN1A 1CQJA 2J3QA 2R1VA 2EFEB 3BX1A 4Y1GA 1YASA 2WC1A 4YAFA 3REGA 4BZWA 5CEFA 1GZ4A 1DIOB 4GMHA 1EB9A 1IY0A 2OCAA 1RQPA 4MCAA 1J97A 3V4SA 4XIGS 2FN8A 3IPAA 1U3WA 2GBGA 4EHHA 2EKLA 2UVPB 2QRPA 3Q6IA 2AVNA 1RFLA 1X94A 3U9SA 1LLQA 2YS6A 5IPFA 4QTUB 4ZVSA 2ATEA 5IBPA 3STTA 5AVOA 3GPLA 1RYMA 2FEAA 1DRKA 2ENUA 2GAFA 5IMBA 4D8XA 2B35A 2CV0A 2YV4A 3R9XB 2WYHA 1K7FB 5TV2A 4MPTA 3ITDA 4KGVA 2ZBFA 5KJFA 2CNDA 4O1IA 3AG5A 1WEHA 4N8DA 1W4RA 3PFKA 1GPWB 5COBA 2IVZA 1MA0A 2Q6LA 4JY7A 4N03A 4CCYA 1BXGB 1ZXXA 3E1KA 1EE2A 3HCDA 3L5KA 1U1FA 1X39A 2CD9A 2YZNA 1W5TA 1YFKA 1DT5A 4I5FA 3Q7IA 4OI1A 2IBMA 4GE0A 1L7PA 5DIZA 5BYJA 3KQPA 3IT1A 3KSZO 2G25A 2CHGA 2H9YA 1RIFA 2Z8YA 3K0CA 7ADHA 4HLUC 1KZ9A 1HC7A 4Y6OA 4F4FA 1TYDE 3B85A 2IXFA 2W70A 2PZKA 4WIAA 1U0LA 3ODPA 5SYNA 1PWHA 1JXQA 4ZI7F 2GT1A 2UYCA 1LX6A 1SBHA 1Z3IX 5B64A 2G8LA 2VJYA 3EDQA 1V8PA 4HDKA 3ZLVA 1UDRA 2ZS7A 2ZIFA 4X61A 5DM4A 1A7KA 2DPYA 3ETHA 3T7SA 3UFXA 7ABPA 1EUDA 1V5EA 1FFWA 1GARA 2XMQA 2ZQZA 4MQ5A 3EC2A 3WHLA 5DBFA 2WI8A 1PUIA 1MB4A 4QXRA 1VG1A 1OF1A 3RBXA 4UFNA 3BA1A 2CLHB 2IPAB 4RTQA 5LJLA 2O2HA 1GV0A 4K8OA 1CERA 2XLCA 4CNQA 1GZSA 4B34A 5EXDA 1J8DA 1MEEA 4FSHA 2FU5C 3SD7A 4HDRA 1U7HA 1F2UB 3DLTA 4GKAA 4C1NA 5BQ3A 2JPDA 4OMCA 3I92A 2GTPA 4XM1A 1Z0DA 5K09A 5JNUA 1CUYA 3WHKA 1F7VA 4OAOA 1FFXA 4PC7A 1H3NA 2Z43A 3JZIA 1SBTA 4BFYA 2E0IA 2A9OA 1SVWA 4Q3EA 2IS1A 3OZDA 3QI2A 2ZRKA 2E5WA 3RC1A 1ODFA 4HEJA 1LRKA 1N3BA 2DSTA 4WCVA 3W2HA 5JT1A 1KEKA 5JHHB 1ZUD1 2PXAA 1IVNA 2YVUA 3ETLA 4CQJA 2Q5QA 4BMYA 2GBPA 5G53C 5DJ5A 1PZFA 5F12A 2OXIA 1KI2A 1PW7A 1CYEA 1ORIA 1DKMA 1ODJA 1X9IA 2R65A 3NM5A 3VO1A 2AMLA 2ODNA 1G20A 4QEZA 3U81A 3X43A 1C1XA 5FWXA 2QUKA 1FRZA 3TB6A 4P32A 1AN0A 3WYBA 4OF4A 1RQNA 1KZ1A 2IELA 2ZJYA 1VHJA 3FHJA 4PFKA 4RSGA 1QTQA 4A36A 3LI2A 2F62A 3MTIA 4UBLA 1WETA 4JBIA 2UUBB 3PR1A 2VDRB 2Z09A 3J81k 1N2IA 4YNBA 4LDRA 3QUBA 3VR0A 2VUTA 3BMNA 3UH0A 1SCQA 4HYYA 3SFVA 1ZSVA 2WJ3A 3HU1A 3FHOA 3FVTA 1K2VN 3FY4A 4L9AA 1ZC3A 1FMJA 1CETA 3FPAA 4GFDA 4MQ4A 2SNIE 4OXIA 3OPYA 4PPQA 4R40A 1ZNQO 4WQMA 5FULA 4OHZA 5IM4F 1LPSA 5EJEA 2CV2A 4OX9Y 3W5UA 4EAQA 2C84A 4E33A 2B0CA 1JDUA 4X60A 1L4YA 1IY1A 2WT4A 3LHFA 2BD0A 2QM0A 5WRFA 5AXBA 4CEJA 5BSVA 2EU8A 2XMZA 3Q15C 1GQYA 5CDUA 2NNLD 4J1TA 2EG5A 2ECOA 2HA2A 2WNIA 5EZ6B 1WE2A 3RWMB 3SLGA 4OATA 3BAFA 3L0IB 3GWGA 4EKNB 1P7WA 3UTCA 1GN8A 4FFMA 3FETA 3I6MA 5A5VA 4QU5A 1G5HA 1MFPA 3NIGB 2A0FA 4NJMB 4S2EA 2NTEA 3DKVA 3FB1A 4H0NA 4BECA 3UMMA 3K15A 2RAPA 4HAWA 2PLWA 5F35A 1ZOIA 4FZJA 2BI7A 1WCIB 4G07A 3KT6A 5C37A 4DTIA 1V3VA 2NG1A 3OF2A 4KHZA 3UHOA 1U8UA 3WGVA 1PVOA 1NHWA 1YQXA 2O7NA 2QRLA 4NBVA 4QEDA 2YQ5A 5IDVA 4B48A 3M2PA 1EX7A 1L5SA 3D3JA 3KO8A 1EGAA 1W1UA 3WL8A 1QCDA 5MDHA 4PCAA 4XIFA 4DLTA 3A05A 4AKSA 1XLVA 3EPRA 4BB0A 1SUAA 1GSOA 2ODTX 3K0EA 1E4YA 1Z4NA 1HDGO 5EKDA 3EDCA 3KJGA 4LXYA 5BN3A 4F72A 2F8SA 1OLUB 1NVKA 4FMBB 2Q8QA 5CNJA 3UB3A 1QCYA 1TYEB 1G16A 2WD9A 4QUDA 3QU4A 4R01A 2QORA 3IOYA 4YONB 4HV4A 3EEOA 1F8XA 1VJ5A 1XDGA 2ISCA 2J9YB 2JFPA 3I04M 1UT8A 1TK9A 2CK3A 1SA0A 3ZE9A 4F5YA 5EE1A 4FJ2A 3GN2A 2VSFA 4DBVO 1ZW1A 5DB4A 1Z4JA 4KOEC 2A4KA 2CMDA 2HPAA 4YDHB 1EDZA 4H1TA 2Z2IA 2I91A 2J7PD 5IKXA 2ZRHA 1QIFA 1VE7A 4IDQA 4MWDA 1B15A 1N3IA 3G85A 2CZCA 1JMYA 1QSGA 1WDWB 5GWXA 2J0UA 1XU4A 3DOJA 4LN1A 3MMSA 3CS3A 2HU5A 3RYFA 5EQFA 4DCSA 4TL6A 3VJRA 4L4XA 4ZVVA 3JALB 2B4TO 3RREA 3VMMA 1JH9A 2Z6UA 1USWA 4RGQA 1II8A 3MJ4A 4FDLA 5BRAA 4G86A 3PYLA 4KRFA 5ADUS 4P4NA 5HQ3B 4RD6A 2XJ9A 2PBLA 1KEVA 2NO1A 3JS5A 1MX1A 1NOIA 5AI0A 4YBZA 3SJUA 3GLGA 1KJWA 1M5TA 4MVJH 3AP3A 4KMSA 1OBOA 2PFKA 4D9GA 4OXNA 2HMTA 4OQLA 3TNFA 4RE6A 4Y6QA 4A8JA 3EUFA 2G1KA 3QW4B 4ZJZA 1CVRA 3BJMA 4ZOBA 3DUWA 3OQVA 2AV6A 2Z6QA 3ZX4A 1E59A 4XWWA 3W06A 1G21A 2IEBA 3LYLA 4I50B 3JPYA 4GVLA 4MP3A 4HZUA 3HHEA 1KIAA 3DH0A 4FOSA 3E5NA 2W2KA 5EEHA 4CR7A 1NVVQ 3A10A 3OM1A 3W79A 5EJ9A 1HEYA 5L7TA 4REOA 1EWKA 4TXLA 1LTHR 2QTHA 3FCOA 4Z1MA 5E0KB 3TZEA 3UQZA 4DA4A 1GNQA 4EKIA 4ZTZB 1MABB 2AOUA 2JW5A 2XA2A 2ZUCA 1Q5PA 2IHUA 1H2EA 3C45A 5TEVA 2V97A 3E3NA 1XMJA 1JFFA 4QYTA 4UZSA 4CF4A 3NRBA 4TN1A 5ITSA 5KBYA 1QYWA 2FMHA 3AWDA 2VZ9A 3LJKA 1YAHA 2XUAA 1L5RA 1YC2A 3Q98A 4KXFB 1YS4A 4AYTA 3K70D 1N92A 2QYTA 3C3MA 3M2TA 4NICA 5ALLA 3UXYA 3ZQUA 1YRBA 4N7RA 1O5TA 2QA5A 2F3SA 3VR1A 3G2IA 5KHAA 4GLFA 2X0NA 1RHMA 4B8ZA 2VP5A 4JLMA 4OHOA 4A2QA 3OC0A 4YMSA 4K9OA 1G5RA 1M2OB 2CYAA 1Y6ZA 2Q3FA 4XRRA 1NX6A 5A7GA 1EB8A 2FPGB 4B6PA 9LDBA 1Y9ZA 2AQHA 2OQIA 3PV0A 2QVGA 3DZKA 4GHWA 5JAUA 3EF3A 2E1RA 5T8KC 1GNRA 2BGTA 1HSZA 2PKYX 3U44A 3UHPA 1A1VA 2Q2VA 1M8KA 3A25A 4BX0A 5KSWB 1QGAA 4DC1A 3I34X 4AJOA 5JXJA 3FPLA 4FFVA 3TF5A 2RGAA 4NFLA 4YRCA 4FR5A 2C4MA 3EXFA 4MWZA 4ALMA 2FX3A 3QW2A 3ER6A 3IA7A 2FQXA 2JARA 1NZJA 5FWDA 2ZCVA 1N8TA 1P7ZA 2VP6A 4AJNA 4DMMA 3NHRA 4WVFA 2Y0CA 3RSHA 5FYQA 3WYDA 1J23A 4M3NA 1RC1A 1SURA 2C97A 3FYHA 4YRZA 1VPLA