4OF4A

X-ray structure of unliganded uridine phosphorylase from yersinia pseudotuberculosis at 1.4 a resolution
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
251
structure length
251
Chain Sequence
KSDVFHLGLTKNDLQGATLAIVPGDPQRVEKIAKLMDNPVHLASHREFTSWRAELDGKAVIVCSTGIGGPSTSIAVEELAQLGVRTFLRIGTTGAIQPHINVGDVLVTTAAVRLDGASLHFAPMEFPAVADFSCTTALVNAAKSVGATTHIGITASSDTFYPGQERYDTFSGRVVRHFKGSMEEWQSMGVMNYEMESATLLTMCASQGLRAGMVAGVIVNRTQQEIPNEETMKATESHAVKIVVEAARHLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Uridine phosphorylase
publication title X-ray structure of unliganded uridine phosphorylase from Yersinia pseudotuberculosis at 1.4 A resolution
rcsb
source organism Yersinia pseudotuberculosis
total genus 89
structure length 251
sequence length 251
chains with identical sequence B
ec nomenclature ec 2.4.2.3: Uridine phosphorylase.
pdb deposition date 2014-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4of4A00
3DPSA 1PR0A 1Y6RA 4DANA 4U2KA 3KVYA 1OTYA 4DA0A 1G2OA 4DAEA 1NC1A 1RSZA 4MCIA 1Y1TA 2XRFA 3BJEA 1VMKA 4EB8A 4BN0A 1Z5NA 2I4TA 3SCZA 1YQUA 5EPUA 2PGAA 4QARA 1TCVA 1PK9A 4D8YA 3TL6A 3UAVA 1ODIA 1A9QA 1JE1A 5CCDA 1YBFA 1RXCA 4PR3A 2OECA 1Z39A 1K9SA 4G8JA 1U1GA 4I2VA 4NSNA 1RYZA 4DA7A 1QE5A 3O6VA 4QATA 3BSFA 1U1CA 4DA6A 5F73A 4G89A 1Z34A 3LBAA 4JP5A 4YJKA 1Y1QA 4DABA 4LDNA 3BL6A 1OV6A 1A9OA 4YO8A 1JDUA 3PHCA 4L5AA 4RJ2A 3OPVA 3ODGA 1PR5A 4UC0A 2QTTA 3FUCA 1A9SA 4OJTA 1JYSA 4M1EA 3MMSA 1U1EA 1Z38A 1TGVA 4WKCA 4OEHA 5B7GA 1T8YA 1T0UA 3KVVA 4TTJA 4K6OA 3UAZA 1NW4A 4F3KA 1CG6A 1WTAA 1ULBA 2OC4A 5JPCA 1JE0A 1ODLA 1T8SA 1Z5PA 4NY1A 1JPVA 1V2HE 3PHBE 2A0WA 3ONVA 4F2WA 4TXJA 3UAWA 4WKBA 4R31A 4DA8A 2HWUA 1JP7A 1Y6QA 3KVRA 4GLJA 2P4SA 1Z5OA 2I8AA 3E9ZA 4QFBA 4OY3A 4M7WA 3KHSA 3OCCA 1CB0A 5CXSA 1FXUA 5KB3A 3DJFA 5I3CA 1VHJA 1NC3A 4OGLA 1OUMA 1A9TA 2H8GA 1Z35A 5EFOA 3DF9A 1YR3A 5IFKA 3F8WA 1ZL2A 3D1VA 1N3IA 3K8OE 4F1WA 4TXMA 1V4NA 2OC9A 4QAQA 5F7JA 1C3XA 2QDKA 4L6IA 3EUFA 1ODKA 4OGKA 1PBNA 3FWPA 4WKOA 4BMYA 1RT9A 1U1FA 4D9HA 1PKEA 1ULAA 4TTIA 5B7QA 1RXUA 2A0YA 5F76A 4GKAA 4L5YA 3INYA 1XE3A 4E1VA 1RXSA 4R2WA 5CYGA 1ZOSA 1VHWA 5B7NA 3T94A 1YQQA 4WKNA 3EUEA 1B8NA 1JDTA 2ON6A 1V48A 3E9RA 1RCTE 2HSWA 4D8XA 5F77A 4IP0A 1PW7A 3PNPA 4QEZA 3E0QA 3LA8A 4LZWA 4TS3A 1Y1RA 1Z33A 4DAOA 1A69A 3NBQA 4D98A 1PR6A 3DP9A 1YRYE 3EEIA 3GGSA 3MB8A 4OF4A 3P0FA 5F78A 4G41A 1SQ6A 1LVUA 1V45E 3NM6B 1U1DA 2HN9A 4GLFA 4D8VA 3OZEA 1Z36A 2A8YA 4NS1A 1Z37A 1PR2A 1B8OA 1JDSA 4TXHA 3GB9A 3LGSA 1RXYA 1Q1GA 4P54A 3EMVA 4YNBA 1K3FA 4F2PA 1LX7A 3KUKA 4DARA 2RJ3A 3BGSA 4L5CA 1RR6A 2Q7OE 1ODJA 1SD2A 2QTGA 1T8WA 2ISCA 3OZBA 4PNPA 1PK7A 3ENZA 4ECEA 5F7ZA 2A0XA 4LNAA 4YMLA 3C74A 5CXQA 2HRDA 2OXFA 4TXLA 1SJ9A 4MARA 4LKRA 1V41E 1PR1A 3OOHA 1PWYE 1TCUA 5F7XA 2AC7A 3U40A 2BSXA 3IOMA 1OTXA 1TD1A 5C80A 1ECPA 4BMZA 1I80A 3NM5A 2AI1A 4R2XA 1OU4A 4MCHA 5FAKA 4JOSA 3FAZA 2QSUA 4JWTA 5DK6A 3O4VA 3QPBA 4TS9A 1SD1A 4WKPA 1A9RA 4F3CA 5EUBA 1RFGE 2GUWA 1T8RA 4KN5A 1PF7E 4QASA 5CCEA 1JDZA 1VFNA 1Y1SA 1OVGA 3P0EA 3DDOA 1V3QE 4LNHA 4EARA 3FOWA 3FB1A 3PNSA 4X24A 3K8QA 2QPLA 3UT6A 5B7PA 4H1TA 3KU4A 5ETJA 4TYMA 3UAYA 2B94A 1TGYA 3OOEA 4GMHA 1M73E 1A9PA 5CYFA 3OZDA 5IU6A 3UAXA 4M3NA 2AI3A 2IQ5A 4TXNA 4TTAA 4BMXA 2AI2A 5K1ZA 5F7OA 3IEXA 3OF3A 4FFSA 3FNQA 1K27A 3OZCA 1PR4A 1LV8A 4L0MA 3NM4A 1JDVA
chains in the Genus database with same CATH superfamily
2YYYA 3I6ZA 3SMQA 2YFHA 1R74A 3HP4A 3P0JA 1PT8A 1T1SA 4UBOA 1DBIA 5AJHA 3N39C 1YS6A 5MGBA 2V7TA 3KAKA 4UUOA 1K8QA 1WW3A 3OJWA 3I2KA 3ZJYA 4D4KA 2OAP1 2C20A 2W6PA 2Y0CA 1H3FA 1PFVA 1T9GS 3ED1A 3VNVA 3IIJA 1SMKA 2ZB4A 5DYIA 4BNKA 1GO2A 4FLMA 2PVSA 3A3OA 3B3JA 5KVAA 1QP0A 2Q29A 1GZDA 4I5GA 3PIRA 4UMEA 1XTJA 1Y1TA 3O92A 4ID3A 4NBTA 5IYZB 1BD3A 3ANTA 3C41J 2J5QA 2SKDA 3DHWC 2KQUA 3M6LA 4MVJA 3VO1A 2JFOA 1SVIA 3R0QA 2CCJA 3JD4A 4XSVA 2C95A 4YB8A 3WJ1A 4BLOA 1KH1A 4YCNA 1JI0A 3TSCA 3LXUX 4DMUB 5L7YA 1RP1A 4IJ6A 2QE7D 4LYYA 5TXGA 2E85A 1KEEA 2C0CA 2XT9A 1IB6A 2WUWE 4MS4B 3MOGA 3IVGA 1QONA 3O75A 4TRRA 4CHGA 1Z6XA 2Z2IA 1NBAA 1UZUA 3LQFA 3QG1A 2PGOA 2OBLA 3WB9A 3TIGA 3WRXC 2V74B 4RANA 2PJRA 2FFHA 2RHCA 2VF4X 5L95A 1X7HA 2QENA 5K0CA 3RS9A 1HT2E 1VKJA 1Z39A 1S1MA 2ANCA 2H2DA 1XVVA 3EG5A 1KMMA 3O9MA 2ZT6A 2REQB 5FORA 4BVFA 5JSHA 1OT5A 5DULA 2PR7A 5EZYB 5HWSA 4FS8A 3ZHYA 2W5UA 2ZXFA 1HFWA 3N2LA 3H04A 1KZ6A 4GX2A 2AG6A 2RI6A 1V5GA 2PX2A 2QD5A 2ZBGA 2GFHA 3EXG1 3HCDA 4Q6BA 4B3XA 4ZYTA 4CKWA 2GVDC 4KQFA 1CS0B 3IA7A 1XVLA 1U9CA 2WTEA 5LU8A 2XDQA 1GAQA 3DZJA 4LW8A 1NZJA 3OM1A 3LHDA 4ZAFA 1D6SA 1VYVA 3DBRB 3KTAA 1WY5A 2X22A 5DYNA 3OOWA 2QX6A 3T3GA 1RHQA 1CY8A 1U1CA 2J5XA 4FGJA 4GOKA 3EVNA 2E4YA 2UVDA 3HJUA 3QBJA 4JUIA 3MTGA 3IBGA 4UATA 4G89A 1U5AA 2DC1A 1QPGA 3LBAA 1PWXA 3L5OA 4BLRA 3RK4A 1Y1QA 4YUWA 5JYDA 1ECCA 2EV9A 3TOXA 1EK0A 3L05A 3NHFA 3MVEA 4Y7CA 2BMEA 4OXYA 1F20A 3MPOA 4WMLA 3BICA 1L3CA 4EO4A 1FUYB 3KPYA 2O3JA 1FVHA 3VU9B 1XYYA 3OQ6A 3P2MA 4KH1A 2Z8XA 3PP8A 3T7DA 5KNBA 1R6AA 3F6CA 2JKYA 4Z2YA 4A10A 2QTTA 3LQKA 3TZCA 2OG1A 1TUGA 4O4JB 2X2OA 1QAOA 2W2LA 5IM4F 4JOQA 4TT8A 1JF8A 1MDBA 4ZV9A 3U4IA 5IDWA 1E6UA 4MWEA 4XA8A 5KTNA 4R71A 3ESBA 5JYBA 3DSRA 3MMSA 3HJCA 4XIIA 5C9ZA 2W4IA 2YXNA 1ZD1A 4W1SA 3ESXA 5TMEA 3PXCX 1K7YA 4N65A 4F6CA 3CZMA 1IY8A 4CLRB 5ALKA 3TQHA 2P2DA 4CFZA 2ID9A 1KU6A 3IT1A 1YZQA 1EQUA 3LWDA 4HQOA 4A23A 3NGMA 4DB4A 4PR0A 2F3QA 5E6UB 5DHUA 3AI1A 4H7JA 4CMGA 1U0RA 4QGHA 4QUHA 2EAUA 1KO8A 1SY7A 4N41A 4XJSA 3QG5A 3PZBA 2WYVA 2O8BB 1L7BA 2QMYA 4JK3A 4B3TB 1ULBA 5B6JA 4QUGA 3PE6A 3ZNNA 3WO1A 5E1OA 5G40A 3K7EA 1H22A 2NACA 4RF4A 2LCIA 2UXCB 3K71B 4ZN6A 5H9WA 1GA6A 1K5PA 3IURA 1YOVA 3CLVA 4UFOA 3SYMA 4YCSA 1V2HE 5DNYB 3QELB 4PYLA 3ONVA 1RJ9B 5EWMA 5HF6A 5IM4A 1E0AA 1GLVA 2ZB2A 3REFA 1D2HA 2ZCJA 4MUJA 3S2GA 2HADA 3KKLA 3WLEA 3DLTA 4FN4A 2QN1A 1LEHA 3NNDA 3NTRA 2LTAA 2J9RA 1N6HA 1DX4A 2DTXA 2P3QA 1DELA 3ACBA 3PEVA 3PXUA 4JB3A 4NATA 1T1EA 3CG4A 3OIYA 1A2OA 2Q3JA 4ENQA 1Q22A 3MD0A 2ZWAA 4OY3A 4AN1A 1G7RA 4DBLC 3O31A 3CUYA 4DJEC 1WBBA 1AGPA 2F59A 3KHSA 3RTGA 3I5MA 4KOAA 1TTPB 2CL5A 2V4ZA 3EASA 2AA3A 3ANYB 3VYVA 2A9QA 4BO6A 3N0VA 3OIVA 1F2VA 3F47A 2P27A 1XZQA 1IM5A 4OAOA 1YL6A 3G5LA 4IZOA 3G2JA 3GYGA 3OC0A 4L3WA 1R0SA 3NH9A 2R2AA 3TLGB 5F1YA 1K2WA 5I3CA 3AUJB 4NS4A 3SE7A 1NC3A 4UARA 5FL3A 1GN9A 3QWIA 3EH2A 4K9SA 1YE8A 2JARA 3MOSA 1LBQA 3DNMA 4I6EA 4EGJA 1A50B 2Z95A 4EA8A 4Z0PA 2YQ4A 4E22A 3HO1A 2X5OA 4AZ3B 2IUTA 1T8PA 5CHYA 5L3RA 2R79A 2RFLA 5DV9A 5JCOC 1T3GA 2H0AA 1H2YA 3TB6A 4QOIA 3WHPA 1M10A 2R4TA 2ZAYA 5JECA 4ETNA 721PA 5EMMA 2VJBA 2VT6A 1NFRA 3FPAA 2XT6A 4PGGA 2GJKA 2XCQA 3NEYA 1ZL2A 2EWVA 1JEQB 4X3CA 4ZGGA 5J4KA 2V3WA 3AIKA 1HQCA 1Z83A 3ILXA 4X54A 4TQUS 3SHTA 3FRIA 3JXEA 4UBMA 4G86A 4OHWA 4OLFA 2HV9A 1SB9A 2NV2B 1I7NA 4A2CA 2VP9A 4U7DA 5AVUA 3PICA 2O3SA 3ROZA 1RE0A 5AW5A 3QKSA 1Q1EA 3LDFA 5DISB 4EABA 4LF7B 3ERCA 1XLWA 2NUTA 2YZNA 2FP3A 3CGWA 3KT8A 1C7JA 1T0JB 3OY7A 1KAEA 4BEJA 2SECE 5DBEX 3C45A 3L07A 5BO5A 2GLUA 1R3DA 3CZQA 4BFVA 4UEQA 3REQA 4DW8A 2WI8A 3BGIA 1EUDA 3WTBA 3AI7A 3IAAA 4J3FA 3SZGA 2DTDA 1NV9A 1PX2A 3PNMA 4JYCA 2WKWA 2ZYRA 4MNTA 3WSWA 3WWYA 1BJKA 4Z51A 5AQ1A 4MW9A 2GYWA 1GTG1 5ICFA 4DLZA 3VUEA 3HXMA 3C2QA 3RSGA 1D0IA 4U7TB 5JTTA 3D8UA 3LWZA 4M9QA 2OHJA 3QOXA 4ZVRA 1I13A 5JFTA 5CX4A 5ELLA 1MOQA 4WVLA 3RPEA 4JUBA 1QYIA 3TCXB 5K6AA 5K8IA 3WYFA 2FOLA 2VHXA 3DVQX 2D2EA 2Q1XA 3M6MD 4H7EA 4OJKA 1GNSA 4FE3A 1KBZA 2GRUA 4YGXB 2P2GA 3BTSA 1QGUA 2GD2A 3NX4A 4MB6A 5CDTA 2BFEB 2JJ1A 2VSXA 3JQFC 3OIDA 1PT5A 4Q82A 1EFRD 2EX1A 1PN3A 3OPMA 4LRTB 4D4MA 4NE7A 1GTRA 4DMKA 1SKBA 2D5BA 2PBFA 3LKVA 4MKZA 1KYQA 1P72A 2R7KA 4WXEA 3QEOA 2FUEA 4YCDA 1Q5PA 5IARA 1QG6A 2LUOA 2WT8A 3L77A 5C35A 1E2GA 1SCDA 4V2UA 5ITZA 2O8DB 4FEAA 4NU8X 4QUAA 1VL2A 1JYEA 1O94D 3L40A 3RM3A 2IS2A 3GUVA 1OYYA 4UCQA 4WW0A 4I4CA 4FFMA 2PSEA 3U7JA 3IUQA 5FWDA 2P8JA 2Q9AA 1EGVB 1GSAA 1ZJ6A 3BC1A 4L8FA 3KFLA 3V55A 3TW6A 2C4VA 4ZO6A 4UEWA 1BXRB 4IDQA 3AMVA 3QH4A 4ZT7A 3MB8A 4OBXA 5JD5A 2RD2A 1N34B 4GM1A 4HGNA 2H9IA 4B2LA 3NW9A 1CXZA 2C29D 3ZZ1A 1V45E 4IHJF 4YAGA 5AMXA 1PZHA 3D3WA 3DXZA 2VJMB 4O2BF 1Z7BA 3L4BC 4I99A 5LNK1 1H2XA 1W49A 2DPGA 3ABRB 1NXPA 3QP9A 4Z4HA 2JCGA 1LSSA 3DV0A 1J21A 1KDVA 3LJKA 1TM3E 5AW0A 1M66A 4CV2A 4CM7A 2WMNB 2NO5A 5ADVA 1HGXA 4NYIQ 3WP0A 2BR3A 5KOIA 3TG2A 1Y48E 4J94A 4A2WA 2JIZA 3N6VA 1W9HA 4Y1RA 1AQ6A 1JKMA 2B5WA 2HIHA 3L04A 2UZ1B 4L7QA 4WXRA 2WYOA 1NJ2A 2NXWA 4XM0A 5TQ2A 4BMSA 2ODPA 2FW9A 4DCGA 4C87A 2F00A 2QGNA 1AZSC 1XJWA 4BWFB 2O8EB 4MRVA 1EESA 1LX7A 4N9WA 2ENUA 4AG5A 4RDHA 4BLQA 3QX9A 4DARA 1QFZA 2I34A 4Y6SA 4MQEB 1NV8A 3DV9A 3D2LA 4HRXA 4N1AA 2X7HA 3TLKA 4UTPA 2WM3A 3G2LA 3NZEA 2EDAA 1DBVO 1CJMA 2NZ8A 1O5TA 3KZKA 1K75A 3DB1A 3IDZA 2PJUA 3LYHA 1ODJA 2IHZA 2NQTA 4MPJA 5T4HA 5ERGB 1QBKC 3PNKA 4E5MA 4QJ3A 1RZ3A 2UUPA 4HNAA 2AV6A 3FWZA 1WCYA 4X8MA 3WHKA 4B5KA 3CJTA 4CGZA 3GOQA 3ZWPA 2H9AA 4MW0A 3I6MA 4IHJA 3DDNA 4GLOA 4NZ9A 2AQHA 3X1MA 3DAHA 3M6XA 5FEMA 4O2BA 3PFIA 2ZRMA 5HQJA 5JSZB 2JRCA 4TL7A 3EMBA 1V5EA 4PN7A 3FPLA 1DCFA 3KJEA 5D1NA 1W46A 3H5RA 4OU4A 1XNQB 5JS7A 1MAVA 3HKEA 3HLKA 5HPYB 4OOEA 1B8UA 3UWDA 3EZLA 3OT1B 2HFJA 4XWWA 3VYSB 1DHRA 3P9ZA 1YASA 3IKLA 3IKJA 4X92A 3L7YA 3VR2A 3A9VA 1KZ9A 2D8MA 1DXOA 1NVBA 3IALA 3M1LA 3TCNA 4AI6A 1V6CA 2GCEA 3AEUB 3L8CA 4O8CA 2ZJ3A 1AGRA 3QLEA 4IZHA 1B0AA 5HFNA 3RU3A 4CU2A 4QFMA 2H11A 3JTEA 1QX4A 3ND5A 5DX0A 3ZE2B 1QFSA 3T4PA 3UV7A 3EDRA 3AFMA 3A1NA 4GSLA 5HS6A 2NU6A 3GO4A 5HFJA 1DHTA 4P33A 2PKCA 3H3XA 3TYXA 2PNJA 2QY6A 2KYRA 5JFGA 1GGHA 3ER6A 4EI9A 2WFAA 1NZFA 2OCIA 2FMHA 3L0BA 2G7ZA 2HMAA 1S8FA 5G1PA 4F9GA 1RHKA 4B8ZA 3BHJA 1K98A 4MCHA 1NR7A 4YA6A 4NRDA 4UOQA 4FDLA 4RM3A 4UHBA 3LAWA 4DDKA 3ADCA 4KO4S 4K6GA 5EZYF 4E1AA 2MWMA 3WQHA 1HEIA 3M3HA 3EXEB 5KQPA 1QWOA 3EFEA 5KTTA 2CHVA 5ALLA 2ZVDA 2L18A 3GWZA 1LDYA 2BF4A 1USVA 2Y1XA 2ZB3A 4J0GA 2WLTA 3FTQA 2G06A 1P6UA 1UK9A 4EPYA 1L4HA 4UUNA 3R9KA 4KI7A 1Y1SA 2WBLC 1TKRA 1XAHA 1PQ4A 2OORC 2NSLA 5IJXA 3VJLA 1BSVA 3D6VA 4NOMA 3UUGA 5BWOA 3CHYA 1XDZA 1NDQA 2VLIA 4FGLA 1W48A 3ER9A 3GN1A 5AW2A 5CVTA 3OKPA 3EBOA 3T4UA 2BISA 2XYGA 4MS4A 2XTJA 1FNDA 3UGJA 2HUPA 2IEZA 2ZT8A 4H1TA 5J9FA 3RVDA 2OZEA 4J8PA 4F4DA 1SUSA 1EQ2A 1P2DA 3G2KA 3ANSA 5BSWA 3D7RA 1Q74A 3P94A 4ARVA 3WV4A 4G0UA 2VEOA 1I3CA 4EHLA 3IMEA 3B5IA 5HIJA 4AF8A 1H0RA 2R6GA 3O2JA 4LOJA 2XUIA 2JLRA 3SS8A 2R6R1 1QORA 1TAGA 4YDHB 4RZSA 3OZDA 2REQA 3B85A 3I6BA 3ONWA 4HDQB 4N7MA 1FDUA 2C2XA 2VXOA 1T2VA 5EZYA 4PYQA 2Q2VA 4JU9A 4W82A 1YDWA 5K3FA 4BLVA 3I05A 4N18A 3QX3A 4O4JF 2QQ5A 4XB2A 3ZDQA 3GLGA 2I1VB 2PYIA 1TZKA 2DY0A 3DV2A 3DZHA 3HNRA 2XODA 3IUPA 4UQOA 5CK4A 4TKVA 2WT9A 2IYAA 4YHHB 2QUKA 3S2SA 1UBRS 2I8CA 3PD7A 5G3ZA 2M6KA 5CPBA 4I3FA 4BP8A 3NVDA 4FFSA 4MUAA 1COZA 4PO1A 2WPDA 1ORTA 2V6MA 4HPJB 3SS9X 4IVNA 3RT7A 3Q10A 3QEAZ 4TWZA 4MHTA 4JR0A 4Y9TA 1C3OB 1R4NB 5ED0A 1ZK0A 5BW5A 2NQ8A 1II9A 2BTQB 2ZTHA 3IDFA 3I9NA 3UN1A 4BVEA 1JDVA 4G67A 3MCZA 2F3TA 1I9CA 1HK7A 3H1PA 4X7PA 5ABPA 1V39A 1JGTA 1PS9A 1SVSA 1DRUA 1UDXA 2F48A 2RI0A 3N2EA 4P58A 1N36B 1XNRB 2LW7A 1TO2E 4II2A 3ZU4A 5ADUS 4MHSA 2NTJA 2ZBVA 4MQMA 3IV6A 3T95A 3TD2A 4RJLA 1QGZA 1XPUA 3FMFA 2Z5VA 1R2QA 3LTNC 2Y0DA 3BJZA 1PJ2A 4ID9A 3SN6A 4GICA 4MOWA 3TZ6A 4F4CA 2DRIA 4UUAA 1VSVA 3LQQA 5FWNA 2XRFA 1SELA 2C4UA 1YWGO 1V7PC 4O2LA 1T5OA 4D45A 3KKOA 1NXTA 5BR8B 4ARSA 1Z5NA 5JZBA 4MUBA 1Z12A 5KCZA 1CJVC 1FE8A 1QDUA 2XMPA 3KB8A 4NH0A 3BT7A 2EJBA 1J1UA 4G4SP 2NZXA 3ZE7A 3ZS9A 1UUFA 5LOVB 3U31A 3DCIA 3HCEA 1MC5A 5KKCA 3F6YA 3GUZA 4Y18A 1P29A 2GWRA 4C08A 4ZHQB 1E1QA 1MVLA 1C9KA 4H2DA 3X1YA 1YA6A 3H8SA 4EYOA 4IDFA 4UHFA 4KFRA 4EQ6B 2ECKA 3Q41A 3TW0A 2FUG1 2GAOA 2P1RA 4R2IA 3PQ6A 2QM3A 4PFQA 2O8BA 4F9TA 3B3GA 5FH9A 3M3PA 2AJCA 1K6EA 4JQSA 3SEFA 3OQNA 2O1EA 5FI0B 1A2QA 5L4NA 4JGGA 4S0ZA 3LCUA 2YC4C 4KVAA 4Y6OA 4UTRA 1K9SA 4YXWD 2OB2A 3GFSA 4AZTA 2C84A 3I30X 1NVWQ 1UIMA 2DWUA 3UHPA 4KGVA 4KEAA 3P4XA 4Q24A 4YFVA 4EI8A 2CDCA 2VAPA 1Z5ZA 2VH2A 4HLNA 2W6ID 4EVQA 3T5TA 3N5KA 5LL6P 4S12A 4JI2B 3AH8A 1OLUB 3CW2A 5IDXA 3QVWA 6GPBA 5GJCA 1SKYE 2BBOA 1P39A 3LUGA 4ZXPA 4HVCA 3OZXA 5DBGA 1QE5A 2PH1A 3M81A 4WADA 3W2IA 1W5AA 2B8EA 3N5CA 2FVYA 1ADFA 3EARA 4CKZA 2ICAA 2RK6A 2G1AA 3JAKA 5TNXA 1BMFD 2P6OA 3IE0A 5BRAA 4CM1A 3MGCA 4QTYA 1XDUA 1UANA 5IC4A 2VYVD 3RU7A 3TLYA 3DW3X 3I2JA 1X2BA 4JGIA 1O0SA 4KIJA 2AOVA 1K86A 2WK1A 4X95A 5B3JA 4M1WA 5C52B 5BV8A 1L3BA 1OXKB 4NARA 1NN1A 1WVMA 3AYZB 1OV6A 3EIHA 2GN4A 4W7HA 3LBFA 3AB8A 1SO8A 4GC9A 1T4CA 2CZCA 1BQEA 2JFGA 4F46A 3TLGA 2P90A 3R0IA 4JYBA 3WK8A 1VE5A 1X8KA 4GP6A 5MN5A 3WL7A 3HSKA 3WRVA 4B48A 1CR6A 1ZCZA 2BTOA 3K1ZA 3HJTA 4P6VF 2QL5A 4FJ2A 2FK8A 5JJKA 1O97D 2GZ3A 2KE5A 1YMUA 3M8KA 4Y6LA 3HJGA 4EMBA 2OV4A 4BX8A 4JVMA 4AZ3A 3RC3A 3Q2IA 3AILA 3OLQA 1U2DC 1LZLA 2JCSA 4Q1EA 3DTYA 3QF4B 3SSMA 3UJ9A 3RSZA 2PQ0A 4GGOA 3TTSA 4DJDC 1YVEI 4G8DA 1GCGA 1CNMA 4KR6A 1PG0A 1JEQA 2WTMA 3DMGA 5JS6A 4CT5A 1G64A 1KVUA 1S4MA 4LZNA 5HKKA 3HL4A 1RXIA 2XNDA 1CUAA 1OPRA 3M4ZA 1MPTA 1X0VA 4R3UC 4OQFA 3ABOB 4IXNA 4XVQA 3EVFA 4G63A 3ZI4A 4L8YA 1G1MA 4HDMA 1I7SB 1Q0SA 4GUDA 1L5NA 3D1LA 2QAGB 5JPCA 1JE0A 3BXFA 1NMXA 1ZA1A 3JQAA 1ADBA 1DJOA 2ZULA 1NLUA 3DVRX 2VDWB 3AU9A 1K88A 2WKQA 1MIOA 2HCBA 3E3LA 3LTEA 3NGXA 3QV1A 4MV4A 1U63A 3KEFA 4Y8VA 4NYMR 1FA9A 4F2WA 3W5BA 1H8HA 3FAKA 4JJIA 5GV7A 4KR2A 1FDOA 1X87A 2J3JA 5JYCA 2WF5A 4F71A 4RVCA 1EZ4A 1NI4B 1FSZA 1EFUA 1R18A 2AOWA 4S1PA 1NE2A 1YI8A 1RD4A 3W4JA 2REBA 2UAGA 1XXHB 3EXAA 2JF0A 3E9MA 2Q3HA 3NB0A 5A4DA 2QYSA 1YB1A 1F17A 2X4LA 4M38A 4N54A 4U4AA 4WCFA 3VNSA 5JMOA 3QYAA 4UDYX 2J3KA 3VR5A 3SHVA 4WL0A 3UXHA 1LFDB 1BX1A 1QVWA 4N0QA 2CMKA 2PWAA 1XKLA 1GQQA 4AO6A 3L0DA 1G2IA 3OX1A 3SK0A 3M4YA 5CT8A 4A2PA 5JRJA 1LRLA 1C1YA 1GDHA 4ZCIA 1V16B 2HXGA 2QDXA 1DLIA 3BWYA 3P97A 3WKBA 4HFNA 4YS6A 3RODA 4G23A 3KXDA 3R8XA 4NMWA 5KOHB 4JLMA 4WK6A 1N5JA 2VP3A 2ZQZA 1W87A 4DSNA 3D6AA 3VR0A 2WM2A 3B2NA 4HB4A 1IK6A 3WDSA 1P60A 4RVHA 4BZQA 5DN9A 5EFOA 3TSOA 5G0UA 1HX7A 3DF9A 1EBFA 1YQWA 4H1VA 3FMPB 4RF2A 1B0UA 1GV0A 2TMDA 1CLEA 5B1IA 1PKXA 2Y2UA 4JLJA 2DQZA 3NC4A 4FIZA 4GBMA 4ZV7A 1I4EB 1D9ZA 2CLSA 5K8LA 4NWIA 4A1FA 1N5IA 5FNVF 1IG3A 3CUUA 1ZOOA 3FYDA 3RIHA 5KHOC 3EG9A 3H5NA 1IIRA 4J0FA 1M2WA 3FSRA 3HU2A 5CH5A 5EUMA 1L1FA 2NZJA 1S0UA 2GN0A 2PL9A 4YT4A 4JELA 5CG1A 2N42A 2P2LA 3CH4B 4U2EA 1WU8A 1ECBA 1Y3CE 1V9SA 1C3XA 3QOYA 3U4HA 2PQMA 1E1NA 3O3MB 5LUAA 2NO1A 3KEQA 1C3VA 4E13A 3NHKA 4FQ7A 5G1NA 2Y1EA 1SC3A 4TL9A 4CDMA 2IPMA 3QSGA 2XQJA 2UZ1A 1CCWA 1TZMA 5I8ZA 3RU9A 4JVNA 1XJCA 3GJ7A 3FUXA 1KBOA 3FR7A 4UKDA 1KI8A 2B36A 3U5ZB 3EVTA 1GTSA 4BNWA 2GJAA 1U65A 3QWAA 3L1IA 1EUCB 1LS1A 3Q6NA 3STWA 5IVKA 3EEOA 4NDNE 1N2EA 1U99A 3VVCA 1L3IA 3ZGOA 4D9IA 2XCSB 5BN4B 3JALA 3BL5A 2BCEA 3RSFA 4DUGA 1Q21A 2O07A 2IVZA 1GU0A 2A0YA 2H85A 1TMYA 4Q4CA 1J2RA 1FP4A 3WYGA 5LIRA 3Q7PA 1ZN9A 2PTHA 1GUBA 4BRSA 2F67A 1XTZA 2QE6A 3P5BA 4OYYA 1CD5A 5FNVA 4DLYA 5B2EA 4PZLA 5ICGA 1KORA 1RXSA 2XWPA 4R5HA 3SQXA 3GIDA 1DX9A 1TT5B 2P9BA 2IC5A 4EHNA 1FNMA 5IK2D 2ZU6A 3RTEA 1H2FA 3DMTA 121PA 1V35A 3HABA 3T3IA 1Q15A 2PUDA 5LR6A 2H1LA 4F84A 2V0NA 3OTQA 5E9QA 1KBQA 3QYJA 2ZUTA 2M32A 3GJ6A 1XI2A 5K2OA 1OH6A 3LPAA 3EZ7A 3P52A 1GCOA 1KI6A 1CR0A 1P45A 1SPBS 2DULA 4TS4A 4FHGA 3TKLA 1NJFA 4M9RA 4US1R 2AWNA 2P78A 1U8CB 5FTKA 3VSCA 4AQDA 2O9JA 4EPVA 4ZEVA 1QSGA 3TOSA 5BMVA 5AI9A 1KMCA 5HGJA 3HJRA 3O8OB 2YWBA 3ETNA 4GKVA 4I4NA 5JAQA 3USZA 1BIFA 1EWQA 1UJ5A 1VA4A 1KIAA 4UD2A 1FX1A 1UXGA 2GKOA 3PPYA 4Y2YA 1OWNA 3BGDA 1ZM7A 3ZQ6A 3MT9A 3F73A 4QU0A 2NU7B 3LT2A 4MMZB 5AOBA 3WIDA 1RMTA 4E51A 2FKAA 2VNIA 3MINB 4EY3A 2FN7A 4W6ZA 4Y6PA 3INGA 1FMLA 1ZICA 4HN4B 4G56A 2CNWA 5TPWA 1EYZA 1P9RA 2AMVA 1IN8A 1LBEA 4D02A 4MEAA 1ZGCA 2HXYA 3CXUA 2PJZA 1XA0A 5DMHA 5HE8A 1E1RD 4H3SA 4M0KA 3SR4A 4BVLA 2AGVA 3R9WA 2HQSA 3VU1A 2YNMD 4JHXA 3K72B 3GAFA 1U7WA 3EXEA 1JDBC 2OLJA 3W5UA 5G41A 4BP3A 4JN6B 3LUKA 1K7SN 5DT9A 2LP4Y 4XQCA 1UMKA 3T3MB 4IY1A 1Y4ZA 2OG2A 2QL6A 2XEDA 3TZBA 2OT3B 2W90A 4LYHA 4DDHA 5F12A 3SYKA 2A8YA 4WBNB 2O5EA 3BDAA 2OQ2A 1QHEA 4FDMA 4JA0A 4I55A 1Y80A 5T5QA 3ZQ4A 1SULA 1A1VA 2PKWA 3DNPA 2P9CA 1XQ9A 1YB5A 3ZHXA 2YX1A 3WLSA 1ND5A 2WUGA 3K5HA 1Y4DE 4YNBA 5FV7A 2YY5A 1ACJA 3UXYA 2AFRA 4JI5B 5E95A 1HFKA 3GDHA 4EPTA 2HJSA 1A3CA 1ULTA 2NWQA 1IHYA 2QTGA 3ASYA 1ZIOA 3PA8A 3QHQA 3VFDA 4B76A 5IVHA 1DT3A 3IB6A 4XSGA 2OUKA 2GZHA 3N8GA 1I01A 1U0HC 2NLOA 1M2OB 1RTKA 2H3EA 4CLDA 1XLTA 2JLBA 2VSYA 1SG6A 2WVGA 2WNHA 3KQQA 3O4IA 3GQVA 3ONEA 3R4VA 5CA1B 1CIJA 3OKAA 1QG4A 4NMMA 3LE8A 1PHRA 1USIA 1RI1A 2B5VA 1R9NA 4DR4B 3ITEA 4K9LA 1T0IA 3H4TA 1TJ3A 3EGEA 3IA2A 2OXFA 4FZVA 3HTXA 1PYGA 1WY7A 5C37A 4MVJH 4R8SA 1XNJA 3E05A 4I4TB 2K7FA 1QS0B 3CR3C 2RHLA 3RSOA 1Q6ZA 4WGFA 2PO5A 4GOOD 9ABPA 2Q3FA 1UL1X 2I2AA 5JARA 3NXKA 1I6LA 1JQAA 3C5EA 1Z4MA 2NYRA 3G59A 8AT1A 4K26A 2V97A 4LKOA 3JQ9A 2FWJA 1D1TA 2AMYA 5LOVF 3SF8B 1TQ8A 1LC3A 2ZJAA 5KWSA 2V59A 4ZHQF 1CYDA 2BSXA 1C3OA 2JI6A 4JLUA 2JBAB 1YE3A 2R8RA 3LI2A 4KWHA 3T7AA 3AK4A 2I4RA 1BKYA 1D0SA 1LPOA 4X3PA 2QTVA 2GK6A 1JZQA 1UXKA 1HMPA 1MV8A 1CF9A 1QIJA 1VCOA 1I36A 2ASVA 1YHNA 2F43B 2PH3A 3LCRA 1WKBA 4NX2A 2UUOA 5CLHA 4KPEC 5ELXA 1L8QA 4OUDB 4TLAA 1DDOA 1M2KA 3GNTA 3PUWA 4LE1A 2A30A 3QVMA 4FZ5A 4HQLA 3VNQA 3AQ4A 2EFGA 3IXMA 4IXTA 2Z0MA 4RWEA 1SKMA 5HIMA 1ORWA 3CLSC 1WP4A 1WXWA 2PAAA 2IA5A 5FBKA 3LW7A 4YROA 4CIBA 4Y2XA 3PX2A 1E2QA 1QRRA 4OAPA 4K40A 4UUMA 3VR4A 3U7GA 2AJDA 1AZWA 4R3NA 3VX3A 2G77B 8GPBA 3EH1A 4EB6A 3FI9A 2EYQA 1QFMA 2B2XA 3G0BA 1VKZA 4RCVA 2H65A 1PT6A 1V7ZA 2OCAA 3BMQA 5LOVA 2XDYA 3I2IA 2IEIA 2WKRA 3O8QA 3N07A 4ZHQA 1JRLA 2ZRAA 3A1CA 1J06A 2FRDA 3U44B 3UT6A 1YR8A 4HMPA 4XDHA 3IMFA 1JPUA 3BXGA 1Z15A 1HTBA 2JBWA 1U6IA 1BWSA 2EZTA 3WGUA 4MKIA 5CAEA 2ESRA 4LDZA 4FE7A 3EN0A 2BHTA 5IDQA 2WSSD 5ALWA 1W47A 1G63A 5KNBH 2N47A 3PDHA 3DYIA 3VJKA 2WPNA 2FMIA 2VHWA 1CRZA 3EZ9A 4YMGA 2YBDA 3UAXA 1RQXA 5BWNA 1RJGA 2VDLB 4BO4A 2BTEA 1E2KA 3WGZA 4ZAGA 1HDXA 2CMFA 1QV6A 1NW6A 2QY9A 3OZIA 4X90A 3SX4A 3AHIA 4C1NA 2GAFA 4MPPA 4XGNA 1W4RA 2XTAA 4PM4A 3AFHA 2V0CA 4WEOA 4PZCA 3RIXA 1C7QA 2Z9CA 5J5VA 1L8OA 2GO7A 2PY6A 1TI7A 1YR9A 1VCIA 3CMMA 3FIJA 1IB0A 1GQRA 4NOJA 4U9HS 4Y2UA 3S2IA 3LW8A 2ACEA 4ZDKA 5BORA 3CX3A 1OH5A 4XGRA 3SYRA 4DHWA 3H6KA 3LDAA 4OXQA 3PBKA 3AY7A 3BD9A 3NM4A 4BEBA 1OAAA 1Z5VA 1E0SA 3AERA 4LSZA 5FUVA 3W5HA 2QE7A 4ALIA 1QQ5A 5A0VA 4KLAA 2C9OA 2HCTA 1F5SA 3R0XA 3DEHA 4W6QA 1QYWA 2IZ6A 5GZ6A 5BSHA 2JLVA 5L53A 2PSDA 2HJRA 1NKSA 3HVKA 4KQ2A 4FFVA 3PLNA 5M3BA 5CVUA 3VH4A 5DSZA 5E7MA 3JQBC 1NASA 3GP8A 2P9FA 2PMEA 1TMKA 2XYPA 1OI3A 4HX5A 1W1WA 1D6NA 1Z6TA 1J4AA 3FYUC 4V24A 2I54A 3WO0A 1WDMA 4C5CA 1UMBA 1MJNA 1J8MF 1RKXA 4KO1S 4ZI2A 1D6JA 2AD1A 2EJVA 2WM8A 1XKTA 2XJ4A 3BJEA 3U80A 5HQ3A 1KYVA 3BSYA 2WVJA 1LDGA 3H5TA 3PDUA 4YUVA 4YJFA 3TNJA 4INZA 1Z7EA 5A4MS 1QP7A 5H02A 1SD5A 2A9JA 2YN0A 3HFRA 4JVOA 1Y4AE 4R8RA 4DM4A 4QARA 4I9NA 1TCVA 1WOYA 1A8SA 4FCWA 5AVWA 4LHZA 1OIWA 2C2OA 2PXHA 1ZZEA 4KE7A 4QBFA 1LWOA 1YNOA 4P0QB 3BRWD 2VUSA 2RBKA 3RREA 5FT9A 2ROQA 5G1OA 1JEYB 2O2YA 4Y9UA 4KRFA 4GVPA 3WJ7A 4X44A 3B2QA 1W6RA 3IPRA 4HF7A 4ECEA 3U61B 1G9SA 2QUZA 3E9EA 2IHTA 5F98A 4RTRA 2GARA 2RCYA 4Y3UA 3VUFA 5KJ6A 1QPZA 3QUAA 3FD8A 3E3AA 1XEXB 4BKOA 2DHRA 3RBVA 2QF7A 4PC2A 1FS6A 1LSUA 1DAGA 3TIVA 1KVSA 4ZJPA 1XA3A 2ZR9A 1DKPA 1JUDA 1OIVA 1OGYA 4UAVA 1SBHA 2BLNA 5K51A 3RNOA 3QXSA 2VG8A 3KYJB 1MGOA 2RGUA 1G42A 1MAHA 1XCGB 4OA5A 5C51B 2BGJA 3YASA 5KSZA 5K03A 1I32A 3VZSA 3TQCA 1E2FA 3KHKA 4BZXA 1OOEA 3CVJA 1EX9A 3MJDA 4H9GA 4OD0A 2UUBB 2R1VB 2I76A 3PPWA 2FFAA 4L16A 2JFBA 2ZJ8A 4MHOA 1XPRA 1VIMA 4OM8A 5UKDA 3LC7O 3RWBA 5A4JA 3U7EB 2Q9UA 4E4YA 3TGWA 3MHTA 1IRIA 2QT9A 3AUYA 5F35A 3H1FA 4TKUA 2PUHA 4Q7KA 1RHJA 2FR0A 2IUEA 1UZMA 2R7LA 4D0NA 3A6LA 3LBHA 4PPQA 4QX6A 5AJXA 3PS9A 2OKGA 4GM0A 4J7UA 1N8NA 1SUAA 3RFCA 5A62A 6AT1A 4JROA 3TAHA 4HNUA 2AZTA 1H2WA 1M0TA 2C2ZA 3KOXA 4Q7EA 3RVKA 4GBGA 2J6BA 5EGSA 3GFVA 1CUIA 3QOWA 5E9JA 2C61A 3GP3A 1YV9A 3R3YA 4RV9A 4KWCA 4C0AC 4CM6A 4OP3A 4A15A 3CSUA 4Q0MA 5ILGA 4C4PA 1IZ7A 3RYIA 3CU5A 1NJ1A 1OAOA 2C3YA 4RF3A 5CRIA 2FMUA 4HG2A 3PUXA 3AKDA 2VP2A 4DMGA 2EG9A 2J9FB 2AC4A 3HDYA 3P19A 4GXTA 2Z43A 2WLSA 1GILA 1Y9AA 4D6XA 2YDXA 3LPLA 4RKRA 4YR9A 1YS1X 1EIZA 1V6AA 3GJQA 4H7HA 1E9DA 1SKAA 2V5VA 3DXYA 2RG1A 1XRJA 4AX8A 2XYVA 2IOYA 1ULUA 5IUJC 1TLTA 2A2ZA 4TT3D 4LV6A 2VDMB 4MIKA 1WU7A 4IW3B 3MXOA 3THYB 1NBHA 1S2DA 3K70C 3QKRA 4TUYB 3AUSA 4BO5A 3HN6A 3Q11A 4HT3B 3I5UA 4ROSA 2ZT7A 1CUGA 1DSSG 2JDID 3KTOA 4FYXA 1LA2A 2A5FA 1R4AA 4PIPA 3GVHA 4IIJB 1P9WA 1AK2A 3A37A 2V03A 3QE2A 1XTTA 1XOIA 4MS1B 1TO1E 2FETA 3R9IA 4JJFA 2OXRA 3V34A 2P67A 1JSLA 1IH8A 1R1DA 4RPIA 2AN1A 2ZSJA 1EUCA 1Q83A 4DPMA 1W0JD 1NMQA 1HY3A 4NAUA 1XZNA 2B9VA 5BN4A 4E4TA 1U2RA 4EELA 2RAPA 1O8CA 2AN4A 2EWMA 2D1YA 2ID7A 2PK3A 3RG2A 5A2QA 5LWHA 1JFVA 4ZOLB 3HU3A 3AF0A 3QRWA 1KFEB 4FD2A 4J16C 5D6NA 2JAQA 3FPEA 2I8AA 5EXTA 3HZZA 4QYWA 3FTEA 1Q0HA 4B3DA 3WICA 1TT5A 3AHEA 3KJIA 2JFUA 1WW2A 2Q0HA 4UEJA 1M76A 2WZQA 2BEUB 3EFOB 1N5RA 2KWIA 2ORED 4Q05A 5JJCA 4BB0A 1U0JA 4BO9A 2XQKA 1MO2A 1EGQA 4KQMA 5JADA 5M04A 5CB8A 4P36A 1A4XA 3W6PA 3B70A 3NEPX 3QU4A 2QVYX 2AFHB 3PU6A 3WX0A 4LC0A 4DJJA 4ZI7A 4M60A 2CFRA 1XL0A 2P5UA 4Y2JA 4WBNF 1QYDA 3VC2A 2Q50A 1DX6A 4WCVA 1UM9A 2AJBA 2CB0A 2BM9A 1NZDA 3BMCB 4KN9S 3V8EA 2QM8A 5TF4A 3IKMB 1WS6A 3GDWA 3OIGA 2H18A 3ZV3A 4S04A 1CY6A 2BRUC 1POXA 4QBIA 3CZPA 4CEJB 2FLKA 5JANA 5JXIA 1UIRA 1IZ8A 2JJMA 1YR3A 3KT0A 4IINA 1Z0SA 5P8WA 5JXGA 3CVXA 5TJ9A 1JVNA 3V4PB 1OBVA 1BTOA 3V4LA 1AXRA 5K0TA 4CMKA 2MYTA 1P0CA 3K1YA 3ROFA 3OLXA 1A96A 2WJ3A 1HURA 4HZGA 2Q28A 4RK5A 3PF9A 1NBOA 1YBAA 5DNUA 1G291 2QRUA 1NM5A 4TXMA 4F1WA 5CA1F 1U3TA 2YS6A 1Y8AA 3GLTA 5F7JA 4L15A 2PYZA 1OWLA 3AFNA 4DRXB 3PPVA 1IOVA 3QVTA 1L4YA 2YWRA 5CT6A 1C41A 2I2CA 5F2OA 5FBRB 3RANA 5IT0A 1DWQA 2QUIA 3GF4A 4G5XA 3W2HA 1QRSA 2WHPA 3KQLA 3DDUA 3T3OA 2JGDB 1Z0DA 4I4TF 4ZOEA 2F3PA 3LP8A 4KXFB 3PPXA 1BWPA 7GPBA 3KKNA 4F3NA 1EFRA 3F74A 2BKEA 1NRXA 2Z9DA 3WLHA 3VQTA 4A6XA 2J45A 1O87A 3MWDA 3A31A 3HFGA 5K6TA 1VL8A 2BFFB 1CR1A 2N1MA 2PT5A 3EQ9A 1JTFA 1IEWA 4X6XA 2E4WA 1EPUA 5M7EA 2I5PO 3JQ7A 4FYMA 4IEIA 1NXXA 3ZVMA 1A8QA 3G2PA 2P3OA 1X7XB 4UTNA 4N03A 1O94A 3C3PA 4Q19A 4QSHA 2Z2JA 1RWMA 3GZNB 3IESA 3LKBA 3RFXA 4AAYA 3BWVA 3SAJA 3NBAA 2K7ZA 2X0EA 1M2OA 1PDVA 1XELA 3Q2OA 4TV9B 4W5QA 4ESEA 3SWWA 3ND9A 1DCKA 4IFTA 2IIVA 4Y0NA 5CA1A 1ZXXA 3BWEA 2ZYGA 2Z08A 3NVMB 2BP7B 4D5EA 3N75A 3IHKA 5JO0A 5K8TA 3D6UA 4LVNA 1FPMA 3F97A 4RACA 3VBCA 5I01A 1KAHA 4ER6A 4PAWA 5K9ZA 3E0XA 3T8YA 3ZOKA 1E3DA 4M98A 3ZKWA 5KTRA 2G4VA 3CBQA 4H0CA 5D5HA 1Q1BA 3WL3A 4I4TA 1C8BA 2AFHE 1MRSA 1QS0A 3JTMA 2QNRA 1Y9JA 1KNXA 1BE1A 4I1YA 1A7JA 1OBFO 5U4QA 2VJAA 4ZCRA 1Z63A 3JYLA 3R3WA 4C0QC 4PQRA 2Q8PA 1SNYA 4UMFA 3ZE0B 1BYUA 1RI3A 4AS3A 4YLEA 1VFPA 4ZZ2A 2AN3A 1CRWG 4JUFA 4KE8A 3E3OA 1QIGA 2HK7A 3MYYA 4FR2A 1NLYA 2JBAA 2NQ2C 3RVQA 3HBLA 2FG7C 1JJIA 1EJ6A 1IL0A 3KVOA 3K5PA 3KJGA 3OZRA 4UBLA 4YECA 5E6RB 1ZUHA 3LKZA 5TS3A 3WI7A 2F1IA 4A8PA 4Q3LA 1QXSA 2ZVPX 1D1PA 3WG9A 4I4IA 4ZU1X 1NRIA 4RVOA 3ZVLA 3GJ8A 4FS3A 1HO3A 3NRJA 4M37A 4E5KA 1MB2A 2C5HA 2JGKA 4LYAA 5FTWA 4Y1EA 3U0BA 4TTVA 2VJCA 4BGUA 5JTUA 4Q4JA 1M0EA 1EQAA 1WZNA 2V8BA 2Y0EA 2YWXA 2VQDA 3Q87B 4DF3A 3MYRA 1AA6A 2H1CA 3E7FA 2A5GA 5AM3A 3FYHA 3I92A 3GJTA 2P0YA 1GU1A 1M1XB 3FWHA 2X0FA 2HTEA 3UB2A 4KDFA 2DTEA 3B3FA 1G4AE 3SM3A 3WRYA 5JDCA 1KSHA 1PFWA 4LWPA 4CE6A 3VHXA 1Z36A 1GNPA 2QV7A 2ZTLA 5HKAA 3CLKA 2FXVA 4ENPA 2R68A 1V95A 1DARA 4PYKA 2JGMA 4P7KA 4UE2A 1B8OA 3EZXA 4QZVA 3JSXA 4KXVA 2H2HA 4Y6QA 5TRTA 3SP1A 3VH2A 3I53A 3EXIB 2INGX 1SXJD 1U2TA 4OJMX 4DSTA 2GCIA 3F7OA 1SQGA 4P0TA 3A6GA 4UULA 1IBRA 4WNYA 5I8PA 4WRRA 2WNIA 2PRKA 1LBTA 4GZMA 4XD7D 4V0MA 1VG9B 2XNJA 5MFZA 3ITDA 4ENVA 2HJHA 4EW6A 2X23A 4G2TA 1IBSA 2V7PA 1KU0A 1VP3A 2O7NA 4PY2A 3ENVA 5FRDA 5A5DA 3QKUA 1ORDA 3COZA 1P8JA 3KL2A 5CEEA 3FTNA 4HEJA 5BOVA 5DCLA 1E6MA 4PX3A 1JTEA 1F60A 4PLTA 4UZSA 3GFTA 3I0ZA 3O74A 4LNAA 1VMEA 4CQNA 4HQRA 3GGPA 1WDLA 3DZBA 4PNHA 4AW9A 1HDIA 1GOTA 2QQGA 1CX9B 2ORVA 5K8VA 3EOBI 2GPAA 1QB7A 1CW2B 2IYVA 2PZAA 2GEUA 4QKQA 1ZVQA 3IODA 3OZ7A 2QTAA 3EB9A 4EJMA 2OLEA 2YW2A 1TADA 1QHSA 5JZ9A 3GMIA 4YRSA 4KIGA 2Y9MB 1U11A 3DH0A 3DKPA 1V8OA 4PPGA 1QH8A 1A5ZA 1AGYA 3WWCA 2EKBA 3C8HA 2AC7A 4QEDA 5GV8A 2Z2YA 3EGIA 4G4GA 2XPCA 5IMBA 4E3WA 3PNQA 1C2TA 3NLLA 4MYSA 1HE2A 1TD1A 3AR4A 3DQPA 3DVSX 4RH3A 1D2GA 2PFKA 1Q44A 1T5DX 2QU7A 3I9LA 3ZHSA 3WOHA 2L42A 5IT5A 2VDKB 1RQGA 1BDBA 5FA5A 1EWKA 3CS3A 5BR1A 5B12A 3EF1A 3TBHA 3JRWA 4G2NA 2QT1A 5BT9A 5AHKA 1IJEA 1V7CA 5FAKA 1FLDA 2Q2OA 5BN5B 4B7UA 5A7FA 4WIAA 1CJTC 3BAFA 1I4WA 3CFYA 1RYFA 3IO5A 4OXNA 5FLYA 2O1XA 4NL4H 4WKPA 4ZP1A 3ILHA 1P2GA 4MWBA 2IDMA 4TN5A 2EP5A 1DU4A 1IE3A 2ZTUA 3K0BA 2P9YA 1WCIA 2GSWA 5EGNA 1K5GA 4LBVA 3X1WA 3HCCA 2XTNA 4QE3A 4UQLA 5FLKA 4BNDB 4UPDA 1QHHA 4PC3A 3UANA 1HRDA 1KA9H 1XRNA 1QAQA 4KXMA 4OH1A 4PO8A 5CTJA 2WIDA 4YLYA 2I9KA 1MO3A 2VP6A 2OCPA 2VN8A 3SDBA 2HHHB 1YR7A 1S5PA 5F1PA 1LW6E 4C3UA 4RPGA 4ANFA 4BU1A 1T1JA 2PM8A 3A70A 3QEJA 1I2AA 1C8KA 1Z47A 3PNSA 1T25A 2BFWA 2I29A 3LP5A 4LY6A 2JS7A 3DPUA 5B6PA 2R0QC 4U9UA 4ETMA 4Q1FA 5AFSA 1G3MA 2I1QA 1AO0A 4MQ4A 3C4VA 2VTEA 3INTA 3CF4A 2C2MA 2Q3LA 3UHJA 1F38A 1U94A 3UHFA 4KODA 4ZVLA 2OE2A 4JS0A 3HUUA 3QU5A 1CU1A 4I1IA 2ZFUA 2HSJA 3QNUA 1FX0B 4KQXA 1GGKA 3GEPA 2J59A 1WB5A 1AUQA 3MZ0A 1NIJA 2JCXA 4FCVA 4BO7A 5CLFA 6PFKA 3AVXA 5ALEA 2D2IA 2B82A 3LCCA 2HMYB 3OJOA 5L45A 5CD1A 5T4FA 4RFSB 1AKNA 1OGIA 1VSUA 3T0GA 3GLIE 5D87A 1E2MA 2AH5A 3HBJA 4QNMA 2PVCA 3U5TA 1JKXA 5EJAA 2QEQA 3TIFA 3UJCA 1M1UA 1Y3HA 4JR1A 3LRXA 4QUJA 4BNMA 4ZTUB 3BA1A 3KOZA 4XVHA 5CFRA 2UZ3A 4F45A 2H2WA 3CF0A 2M9MA 1NKVA 1T29A 3BIOA 4ZT5A 3H9CA 3LD9A 3IEKA 4R05A 3B13B 3HJBA 3QXJA 1DKQA 1EVKA 1CZRA 4HXYA 4MJLA 1SU6A 1JG2A 4BLWA 5JS8A 2P41A 4J4TA 1ESZA 4RD6A 4E2ZA 4EY8A 4IDNA 2R1VA 2Z6AA 1G21B 1RWVA 4MA4A 3U39A 2CXUA 1OI2A 3M4XA 4RMHA 4W5NA 2JFYA 4TUYF 5LM3A 1ZNWA 1SVKA 5D01A 2FUG6 1KQNA 1CZLA 5IKOA 1B74A 4XKJA 3ZHOA 2A5JA 1UBKS 3K94A 4FEGA 3L8EA 2JI7A 3IVMA 3Q3VA 5EIXA 1W7AA 4IIJF 5AT1A 1N2GA 2WJVA 2IOQA 4JI6B 4ENUA 2X5KO 4IUDS 1Y6JA 5B58T 4CR8A 1KJWA 4DC0A 4D9CA 2DQSA 2Q6IA 2VFAA 4RSGA 1UWLA 3G8CA 4KXUA 3GHYA 4LXHA 4DAEA 1LLDA 2QAJA 4QYSA 4TMXA 3RVPA 3SZUA 3ESYA 4HDCA 3LKDA 4YXWA 2KJQA 2F17A 1JEAA 1BGVA 1RYMA 3ZDXB 5CB4B 2HA0A 3T3HA 4O4LB 1I7LA 5CYPA 3RS0A 3S40A 4EGSA 3LZ6A 1DIHA 3JR3A 4NQRA 3CX4A 2EZUA 3AP2A 3G9TA 3TFWA 2W6IA 1ZESA 3BTVA 3G5AA 4HZUB 3E7PA 4ZOLF 2NUAB 1X77A 2BEKA 2PKEA 3U09A 4LHWA 1EFAA 3RK1A 1ECLA 3SCZA 4GKKB 1QG0A 2GVZC 1P75A 2OTCA 1FFXB 4OMCA 3IAEA 1GPKA 2CNNA 1GTMA 1DT5A 2OFWA 4P84A 4RGVA 1OR8A 1OW3B 5JEDA 4XGIA 1PJZA 4ZICA 1AE1A 2FSGA 2REOA 2WKPA 4IKEA 1BMFA 1ZGHA 2A9RA 3A9UA 3DMDA 1AZTA 3ET5A 3H9GA 4BNTA 2GXSA 4QOGA 2VYVA 5DGIA 2C96A 1ZGBA 2KMLA 4BZZA 4C2TA 2XH8A 1RKQA 1M7HA 1FDRA 2PWPA 4IIJA 1QDEA 4L3OA 1H05A 4J3NA 2J46A 3R7LA 3U7HB 2FPGB 4PPNA 4DLUA 4YBZA 3F8TA 5BQ5A 4DMRA 3K09A 4BUZA 2RGWA 1L5OA 1TEVA 1SBNE 1T3TA 4BXOB 2FMXA 4JQOA 2P6RA 5EESA 1M34A 5H16A 4AY5A 4YRLA 1II0A 3ZDFA 4LOLA 3QY0A 3DFFA 4M22A 5LB2A 2QLTA 3OCUA 1ODTC 2EARA 1FZTA 4BKRA 1VI2A 3IRUA 4D8UA 2NW6A 4NBKA 4PPYA 5COBA 5GZ1A 1MXHA 1VSBA 2PVPA 4MWTA 4BVJA 3L43A 1ONNA 3BE4A 1DBRA 4U7GA 2VA9A 3W8DA 4CKEB 4QEKA 3PR2B 1O96B 2IT1A 5EMNA 1Q0UA 3B78A 4FFOA 1G21E 1C9YA 2DKOA 3DBLB 2YJ4A 3L7LA 4HB3A 2BEUA 1U9JA 3EFOA 3FM9A 4RBNA 4ZZ0A 4WE3A 3WGQA 2Q4TA 2YJ5A 1KZ1A 3RRJA 1EVQA 1KMNA 4RMIA 3J7AC 1NQVA 2RH5A 3FZNA 4PO9A 5H3HA 1A9OA 1JDUA 2AFHA 5DTQA 2K5UA 3AIIA 2FE4A 1CUZA 2Z2KA 4NYIR 3TIIA 3W04A 4Q9LA 4AJHA 1HT3A 1S2IA 3C3BA 1GZ5A 3Q3CA 4NJEA 3SX2A 4B44A 3VDXA 1V43A 2ATCA 3WGMA 3ZWMA 2LKCA 1TVKB 4R84A 3UGTA 3GGDA 4YVFA 2O1SA 1UWKA 5DHPA 5FPTA 3JQ8B 5LFAA 2QVGA 4KR9A 1NJ8A 4L9RA 4G5SA 3UJPA 2H17A 2UVQA 4RPLA 4ZIRA 5T6BA 3UK1A 2FJUA 3KYCA 1C3JA 3RV4A 3TO5A 1GNVA 2HSDA 3ZBUA 5AJWA 1O6ZA 3CONA 3T38A 1RJDA 1QPBA 3E9CA 2V7UA 2QXYA 4OL0A 4BTVA 1EAMA 3BEOA 2QVBA 4TV9F 1DOHA 3DGFC 3QPDA 3NCHA 1JDPA 4LSMA 5FAXA 3DE7X 3TR0A 1ORRA 1A4UA 3HH8A 2ILVA 3FKQA 3DOOA 4EJSA 3D81A 1G3QA 3U7FB 4DRXA 1CVLA 3SBEA 1SCIA 7ABPA 4V1CB 5LMZA 1TVCA 4LTMA 4A6DA 1R0CA 1K0UA 3JVEA 3HJFA 4EHKA 4QOJA 5IJ0B 5HIIA 1DBWA 3T0FA 2DETA 4OBWA 3AETA 4R9SA 3CSSA 3ZE1B 4NENA 2IRWA 4LI0A 5A4KA 4Z4CA 5IRCD 2RE8A 2ZJYA 1BE0A 1H6DA 3OF5A 3PEYA 5AM1A 2BFFA 4P31A 5AVSA 4MDEA 4RZHA 1U8UA 3AESB 4ARIA 1DI0A 3VZCA 1X7XA 5IS2A 1IYZA 5CP8A 4YASA 4TQ9A 3OA0A 1E5TA 2HPZA 3A7EA 1AA9A 2C2BA 1V96A 2B4TO 2WUFA 3SC2A 3T7IA 5HEKA 4ISCA 2FX3A 1NUPA 4X1IA 5REQB 1CERA 2P1DA 4S1NA 2DUMA 2H59A 1TIKA 2PD6A 3L8MA 2NVUB 5B64A 5L6MB 3A6HA 1KKMA 3HQ4O 4DB2A 3GLFB 3GLIB 2ZSFA 3TSWA 3HU1A 3NYRA 4DR2B 1R16A 2WE8A 4IWYA 4DIFA 3RYFB 1WBDA 2ZU0C 3MBOA 4IBOA 2QJWA 1MZVA 1N9GB 1QIDA 3CJRA 2JD0A 1PZNA 1ZXBA 3F1KA 4UXHA 5FTJA 2PR2A 3U16A 1C30A 1Z4NA 4OQDA 4CM5A 1C4XA 1C0EA 1P5HA 4R9NA 5M34A 1BFUA 1UP7A 3AY6A 5LLTA 2HEIA 3QZUA 1TK9A 1VE7A 4EI7A 4C0JA 1XAJA 1WUHS 4YAEA 4G36A 1YB4A 3EPJA 2AKYA 1SZDA 1DADA 1VBFA 2QMQA 3OU2A 3S28A 3ZD8A 1VC2A 2C59A 2AB0A 3TB4A 4A0SA 4X0EA 5JWRA 1EXVA 3BMOB 1AHHA 3BUSA 4KMOA 1X7DA 2BONA 2OZVA 2C5EA 5DEOA 3AL0C 2JLXA 3BRQA 3IELA 1TF2A 5JW6A 2OFOA 2FOXA 3UH1A 1UC5B 4ZQHA 1ZP6A 1GRVA 1J2EA 3TG8A 4KYIB 1ODSA 3DQZA 3MWYW 3ND8A 5H1YA 3GGCA 2IV3A 4CMAA 3OCZA 2DLDA 4BMPB 5BVHB 1W36B 2X41A 2ORWA 3OTWA 1E2HA 1N0HA 1LQUA 2M1XA 4U6SA 5EI5A 1NVEA 1ZIYA 4FP9A 2Z5LA 4PINA 4DR5B 4LJYA 1NY6A 2QVCA 4ZYLA 2GA9A 3N86A 5K0BA 2AN5A 3I39X 3HVIA 5IK2A 1PBNA 1FDVA 3RHSA 5I4CA 1OXUA 3GA0A 3U7QB 1RRGA 3FA2A 1Q6YA 3T5CA 2QJTA 3NTLA 1L7MA 3B52X 1SHKA 4KFCA 4P0PB 1MQAA 2V9CA 4FEEA 3ZN2A 1IVSA 3P9QA 1SU4A 5HIAA 4ZYUA 2OV1A 4UEOA 4YXFA 4YREA 2VOEA 2GGSA 2I7DA 4ZALA 4U39A 1UZNA 2CY0A 2AEFA 4IS2A 1QVRA 5EP3A 3S55A 3JQQA 4UXJA 4NONA 1MKYA 4KXWA 4O6VA 3VPCA 1T3SA 1NGSA 1Q0RA 2ACVA 3D2CA 4II7A 2GLTA 4D5GA 4C21A 1UC8A 1RKBA 2BDUA 2W0MA 4GKAA 4OI4A 3V48A 4U6NA 1XE3A 1PBTA 2B8JA 4LOHA 3TL3A 2BEVA 3M83A 2OBFA 3EOZA 2B2NA 4H60A 1LGYA 2AOTB 3GDGA 3NORA 4PGAA 5EL0A 4C0BA 3IVRA 1FYEA 4TKMA 4IL5A 5EQTA 3S4YA 3UK7A 1DEKA 1JH9A 3PC3A 3GLFE 2ZRPA 2X5NA 3U3MA 2Q5HA 3WDMA 2I4MA 4G1EB 2YRXA 1M1NB 3ZJ4A 3BFJA 5CDUA 5E2IA 3R7FA 1WOMA 1E1RA 3HA5A 3VR4H 1UAGA 2HQRA 3B1FA 3E8SA 2WU4A 3OWXA 3PQ3A 5TEVA 5PGMA 4RULA 1WG8A 4UNRA 1FQKA 2IIBA 4WNAA 3CH7A 1PEYA 5HS4A 1R0LA 5DP1A 2PUAA 3PGA1 5ALZA 1T6ZA 3CCFA 4MW5A 4OHBA 3S29A 2QJFA 4NFSA 4BP9A 1PW7A 3M89A 2P6UA 3ESZA 1OILA 4OLBA 4KPUB 1PT9A 1H85A 4J29A 1X7GA 3T5GA 3IVXA 3ZDEA 2HM7A 2ZRIA 4TS3A 3RV3A 2JVIA 2X1MA 5HILA 3FF4A 2PUEA 1Y1RA 1Z33A 4HMQA 5CXUA 4S1OA 3NBQA 4YQFA 3B36A 1W94A 2AMJA 2IHBA 4FYVA 4B82A 5DW0A 3ROEA 1KJYA 4E31A 4OV6B 4RGBA 521PA 3AM5A 2WWRA 3MTIA 1CUJA 1J1IA 4WFJA 3WL8A 4RSRA 5BYKA 1OH8A 1VMDA 1UPAA 2IXGA 2FPRA 4BNVA 4KPFC 4FHFA 1JB9A 2ZREA 1IJFA 1B26A 3F96A 5C4IA 1V8BA 2WR8A 2DUWA 4QC2A 3WQSB 2W2KA 3O2QB 1TM2A 1JQEA 4RD0A 1W76A 3BVPA 3S81A 1JIUA 2Q5LA 4ZJZA 3ESAA 4DV3B 4QFDA 3EAQA 4ND2A 3IS3A 4PWYA 4XIYA 3OHMA 1GHTA 5FUQA 1O6BA 5E38A 4EP1A 4XAQA 3W2GA 2X7JA 5SZHB 3IEPA 2Z1NA 3ANNA 4K3UA 4BLPA 4BMNA 4AMGA 4BNDA 1G5TA 3TMYA 5HW0A 1O2DA 3O21A 1GG2A 1PJTA 5ITSA 1PR2A 3AL3A 1UH5A 3NYQA 3WGOA 1H1LB 2WTAA 4ZDIA 1DAKA 1ESMA 3MCWA 4TXHA 1NDUA 1FNBA 2ZDQA 4X6LA 4EAAA 4HPXB 2YHUA 4FQ8A 5JS1A 4F92B 1A04A 3E23A 3O1JC 3ZEIA 3ZDRA 1LF5A 3M1AA 3N0WA 4OYRA 4TL8A 1HRKA 2XMCA 3AYXB 5F9MA 4EH1A 1XKXA 5HTOA 1CF4A 5CDHA 1SG0A 3V8RA 3Q0IA 4YRBA 3K0KA 1I4TD 1LDNA 2PRSA 4B43A 1IRXA 1SPXA 1US8A 2FSIA 2ISCA 3L8DA 3OZBA 4I5DA 3JATA 4HVAA 1UKCA 4H7FA 1HZZA 2YZMA 3HWX1 3EVCA 1USKA 3WDKA 2HGSA 4W1QA 4W5TA 4ED9A 2GCOB 3U37A 2GK3A 3R3JA 3ZCSA 4BYGA 1PD1A 4MWDA 4EGAA 1I24A 5F7ZA 3WBJA 4IJMA 5HFAA 5BNZA 3NNSA 4WJLA 2AZMA 4PRZA 4CMEA 2WF7A 4L0CA 3KC2A 2B99A 1B2LA 3BULA 2WWYA 4ZV4A 1P4HA 3HN2A 3CNLA 1K8ZB 5DF1A 5EMLA 3WB0A 4O4LF 2Y1OA 4RTSA 2BBWA 4K9RA 4L8VA 4OU5A 4XWAA 3UM9A 5KTOA 2H06A 1L4LA 1RC8A 1UKZA 1RBQA 3EZ6A 4PLWA 2FMKA 3NIBA 5BUCA 3KTDA 3L1VA 4R0NA 2NU8B 4EMTA 4TMYA 1U8YA 2C5FA 3J7TA 3TCKA 5CT9A 1LPNA 2J32A 3S2EA 1QU2A 1PZMA 3UJNA 2FE1A 2ZS7A 4AJ2A 1T5BA 2EQ5A 1E32A 3NBKA 3PFGA 1MT0A 2HIAA 2HMVA 3LSTA 5GM1A 3UICA 2OB1A 4B31A 5B53A 2WZDA 4O3FA 2V6IA 5LC1A 1SXJB 4LA4A 1ZZGA 3X43A 3ZJ5A 4EEKA 3EZNA 5EYPB 3OFVA 3DT9A 2JB9A 4PVCA 4LJ7A 4WDQA 5D3MA 2JGLA 4ZEXA 5AHWA 2JCBA 4RKWA 1OZAA 2FG5A 4REQB 4RUKA 1J5PA 3FRHA 4B4OA 3B9BA 1Q92A 3AEQB 4OREX 2WSSA 3GZTB 1VPTA 1M7GA 1A9RA 1NF3A 1B0PA 1NUHA 1ZI6A 2QN7A 1Q77A 3IBFA 4GYYA 4KIWA 3VR3D 1KIFA 2ODQA 4DC1A 2QZZA 3FYSA 3PVZA 1ULHA 4NBSA 1HDGO 4NMLA 5A9TA 3HO6A 1SUCA 5L3SA 2WJPA 2Z56A 3EJ6A 4WK4B 3ACDA 2XVZA 2CV2A 1LQ2A 1V0JA 4CKCB 2HRRA 2VPZA 3OURA 4OYHA 3LUJA 5H0IA 5JLJA 5ICCA 3TNYA 3UJ3X 3QY9A 3UKDA 5C5EA 5G0VA 3WNDA 1D4OA 5EVCA 3DZFA 1ULZA 1EP3B 3GT4A 3IJEB 5DM0A 4FK8A 2YJ3A 4ARAA 5KWJA 1WD7A 4YGYA 1DJPA 3JD2A 1X8XA 4AROA 3MN1A 4X24A 3WMXA 1UJCA 3V8MA 1I2CA 5JZOA 1G17A 3FJYA 3Q3EA 2J5KA 3CZAA 4LRSB 4EL0A 4LGVA 2IYTA 2Z4TA 3B6IA 3L46A 3P2IA 4NU6A 1QC5B 2GBGA 4P3YA 4URUR 3NWBA 2VT3A 2PZEA 5D7BA 3PUHA 3WNQA 1CJUC 4CL2A 1ZPDA 2FZWA 2QN9A 4LS3A 3I12A 4UBKA 3C14C 3H5IA 4KRYA 4Q3OA 2B1IA 2JFPA 2C4MA 5DTRA 2OPHA 3T7RA 4CR6A 1WB6A 3LRPA 1VYUA 4JI8B 4QTXA 2VK4A 4TWIA 4I5EA 2QMHA 4GE3A 4B33A 2BE9A 1EFVB 2AR7A 3QU9A 4M49A 4LQ4A 4QXQA 4XJVA 1KDOA 1COWD 5ALYA 4MAMA 3VI3B 1NTRA 2JZNA 5JXWA 5LDDC 4UPVA 5T3YA 2O2JA 1XMOB 4Q9HA 3C3MA 4DIKA 1JR6A 3AJ9A 4K3VA 4L08A 5KOYA 1EBBA 4IQ4A 1WNTA 1HTWA 2QTRA 1DEXA 3QU7A 4ZAZA 3GEIA 2R47A 4R40A 1K92A 1CIVA 1EG2A 5FOXA 3VYTB 3FNQA 3H4IA 4ZHSA 4JYAB 4FGWA 3IILA 4FLFA 1PR4A 3JRXA 5AVQA 4YT5A 3QXXA 2BSQA 4EVSA 4B3JA 3LUDA 2ZWVA 3MUEA 1ZJWA 2QSYA 3PZRA 4MVJM 1L6RA 2FR8C 1ABEA 4LECA 1XQWA 1SXJE 2VPWA 3I32A 4RY9A 4GX0A 3KWLA 1YZTA 4K9DA 5BRNA 1YH3A 2OBNA 1TO6A 3PUYA 1R3UA 3BHMA 3CUKA 4RABA 1CP2A 2NPIA 2JGJA 4EJ0A 3D2AA 4LXYA 3BRWA 1OT3A 1WQ1R 4WH0A 5CVEA 2IHNA 3WLJA 2Y4OA 1U8EA 1NBEA 3F90A 1OTYA 2WHRA 3FR8A 4JX8A 4ZEWA 4XYEA 3EHDA 3L1KA 5JE8A 4DCVA 4ZEMA 4BPBA 1U31A 1KI9A 1XFDA 4F5EA 3K1AA 2X8JA 1J0BA 1DQPA 1LPAB 1DZ3A 2I6QA 5IJ9B 4E32A 4MCIA 5TMPA 1QHXA 4M86A 3K6SB 3QKWA 2QW0X 2E4VA 4GO1A 1LK5A 1CE8B 2Z3ZA 1OX5A 4HJXA 2YMPA 1T2DA 2N9UA 3LECA 1ATIA 3R24A 2NO9A 1PK9A 3I3OA 4BN4A 2ZZMA 3HJNA 3I9OA 3O4HA 1J49A 2VT7A 4DWJA 3UAVA 5CJPA 1N92A 1YNSA 2R00A 3CPHA 4GRAA 4MYTA 4OO3A 3MILA 1AS2A 2X8LA 4M9SA 4ER7A 4F1KA 4V1CA 1SVUA 5K4AA 5IT4A 1EFPB 1NQAO 1YZNA 5K09A 3EGVA 1NW8A 3VC1A 1MFPA 3PK0A 5PNTA 4ND7A 3BB4A 4HLUA 4ON9A 5IJ0A 1ZH2A 2V7EA 3V8BA 2EU8A 3IUSA 4QYXA 1G9XA 3AONB 1M8PA 1KAOA 1XZEA 4V02A 1SC9A 1RQPA 4ZQIA 1MAAA 4MWOA 1UMCA 2CUZA 2D00A 1L2TA 3I2HA 2WAAA 1MZPA 2JFXA 2VNJA 4L85A 3LT5A 4DV0B 1QCDA 1CUHA 2HA6A 2Q49A 1ISMA 4RQAA 1L5HB 1L5FA 2A5LA 2NZUG 2PGNA 2PEZA 4NDZA 4W7SA 3T3DA 1G8PA 2X42A 4EHHA 3O6VA 4DS3A 2CBZA 3OSUA 4IIEA 5DTIA 2OPBA 3SZ3A 3T9EA 4ZMBA 5K0FA 1EGHA 1UINA 1YS9A 5C32A 5F73A 4RPHA 3IP3A 3THWA 2A7XA 1SB8A 1RWWA 1GSIA 2GN6A 3C3KA 2P4QA 2ZIVB 4Q5IA 3GLFA 1N6RA 1RZVA 1VRCA 2GI4A 3GLIA 4HLCA 4DDUA 3W9SA 2C78A 1WMBA 4BNYA 3EIWA 4E5VA 2BAGA 1OC2A 3F3MA 4NG4A 2BEWB 4TT3A 1E1CB 3VSEA 1YQXA 1N9GA 2GR9A 3CLRC 3OJCA 4IOJA 2YJGA 2JIDA 4IG4A 3QMVA 1E4OA 4ZA2A 3ZNQA 4GPTA 1M3SA 3R09A 2ZWOA 3W9UA 4KH0A 1P91A 2JDIA 2RAFA 1P1RA 3P2JA 2Z9BA 4RD4A 4OXXA 4J03A 4ETWA 4MSUA 3F6SA 5IDYA 2O8VA 2ZE6A 1DUSA 1K9VF 3DP7A 1S6YA 3PXEA 4LY0A 4OJTA 5I45A 1VSQA 3OZGA 3F9CA 2WHQA 3B60A 3RAEC 1NU6A 2VSOA 4QULA 1IG0A 4A6PA 2PRZA 4O2RA 2GEKA 2RHRA 5FUXA 3U6BA 2G6TA 2VATA 3R6DA 1MABB 3ROXA 2QAGC 5AVZA 4CEIB 1HE3A 2CFSA 3NAQA 4RKEA 1W0JA 2GCPA 2O7RA 2XXAB 4QQRA 4JLPA 5ALMA 4U7FA 1T2EA 1RQRA 1QH9A 2VPQA 5SY9A 3WGHA 1IEQA 3B7GA 5F2KA 3KKQA 2R1ZA 3FPBA 1YO6A 1XEAA 2R2GA 3AOEA 1DRWA 1BOFA 1AIPA 1ZONA 1YUNA 2PZLA 2B69A 5IW8A 4OM7A 4BUCA 2WJWA 1BW9A 1Q1AA 4IMIB 1OZ0A 5T57A 4PG8A 4KWEA 2COKA 2HJVA 4NTZA 1NMZA 2I66A 3DCJA 3HN7A 2EIXA 3PHHA 1TYZA 3ICVA 2JH3A 2QYTA 1H6AA 4Q37A 3V33A 2A9FA 2RBGA 1ODLA 3BIFA 3D59A 3EGXB 1G5IA 3LLMA 2CFTA 4TM8A 4XFDA 1B42A 3DEYX 3OKFA 1WXDA 3Q8MA 2H1FA 2HIMA 3LHIA 4NY1A 1G4HA 5FBZA 1Q7TA 3FNGA 4E11A 4NJMB 3FPCA 3I1YA 1Y6GA 3LBYA 3LWBA 3MUNA 5CPFA 4AZWA 1SBQA 4YHBA 3K9NA 4B47A 2FNAA 4AG3A 2F8TA 2ETXA 4MW7A 5CLIA 2P30A 1XMPA 4PYRA 1BCSA 2FSFA 3LX4A 1OJ7A 2PE5A 3OEYA 3U60B 3QIAA 3FNIA 4L9AA 1VG8A 1SBZA 2PMWB 4M1QA 3FHOA 3NBMA 2O8FB 1VRWA 3F5SA 3RG8A 5B37A 2QT0A 3KVRA 4K2AA 2A9KA 4N0MA 1N1EA 1Q50A 3E7WA 1SXHA 1X70A 2AD5A 3NTQA 4QFBA 4R1MA 4BDTA 3RHFA 4F2GA 1XJQA 3HYNA 4NV3A 2XCLA 2ZK7A 5LYJB 5KPDA 4Q9NA 4TMFA 1KP2A 5KDDA 2PT9A 2XGSA 1CB0A 4H1HA 4HGYA 1KK1A 2GSDA 3EY4A 3FPHA 1LFAA 1BFKA 3G2OA 2NAPA 2IYRA 3H2SA 4HSGA 1HZJA 1J42A 1Z88A 2D54A 4NECA 1EJ0A 5DBIA 5KHLB 1XX6A 1ZS9A 3TK1A 3VPXA 4RY2A 2W6JA 4O0MA 4WZAB 4B3FX 4YJHB 1BRTA 3OBBA 1VECA 3BWCA 3BH0A 2I6FA 2Q9BA 2I2DA 9ATCA 1J2JA 2Q5FA 2XMQA 2YV4A 3N2YA 3QUBA 4LVCA 4PAMA 2HL6A 1HA3A 4MJXA 3I28A 4TSFD 3GMTA 4NIMA 4E3ZA 4QDTA 1JKIA 3IBSA 1I3MA 2G04A 3JZMA 1DOZA 3OMWA 1OCEA 5LQRA 5JJBA 3ELUA 2FPWA 2Y1GA 3ORQA 1P62B 3F8WA 4MV7A 3ZC3A 2V7VA 2D5IA 3O26A 4MDYA 3SJBA 4ACAA 4WOBA 5AW3A 3AF6A 4AJJA 1ZD4A 1P74A 3PE3A 4L5IA 3PF8A 1ZK3A 3VVMA 3D64A 3KFXA 1VSTA 2VDRB 3RVJA 4CM4B 4B35A 2X6RA 1NRWA 3AF5A 4JC4A 4PLYA 3ZHBA 1L9XA 5A5FA 1GQFA 1E6EA 1H66A 3QJYA 4FZJA 5ALHA 2WY2D 4K46A 3V1MA 3VXKA 1OXXK 3CLSD 3I4FA 2GX6A 3DWGA 4MWSA 3KQUA 1E1MA 4XFKA 3M1YA 1ZHHA 1Z07A 3T54A 4P7BA 5AK5A 3OQVA 1H1LA 2JZCA 3MLEA 4JAVC 5DM1A 1IY2A 3CW8X 2C7VA 4PHCA 4AZVA 5L4LA 2EQBA 2IYUA 1PKEA 1E1KA 5I47A 5I7WA 1ULAA 2PUTA 3ESCA 2H4ZA 4FMCB 3B12A 2AZ4A 2ERYA 3PNYA 3RD5A 3SVTA 2B7CA 4TTIA 5KYVA 1XHEA 3RK0A 1V26A 5AI6A 5B7QA 4JENA 1C9NA 3S3TA 3MTJA 4INJA 2X0KA 2ZIXB 2Q3DA 3T6KA 3A25A 4G81A 2CJYA 4KAAA 5NLLA 4CIVA 4PRKA 2NADA 4LIPD 4UW9A 1N6OA 1J56A 2CT8A 1RADA 3DZCA 2A59A 2EYUA 1J0AA 5DGHA 1AGNA 2OO3A 1ZOSA 3DVAA 4ND6A 1G7TA 2BIFA 3OTIA 3KAQA 1NOIA 4INPA 1JAXA 2QRNA 4HEHA 3NR2A 4J0IA 2R8YA 2CHGA 4TGLA 4WKNA 4ZK2A 5JISA 4JSYA 3SDZA 2ON6A 2QQ0A 4KCGA 4NPHA 3W7BA 2II6A 1LX6A 1QGED 3HNPA 3KDAA 4YRPA 2G4LA 1IUKA 1E8NA 4WK0B 1W85B 5EWLB 3MJSA 2PPLA 3ADOA 1P5RA 1IEXA 3FCUB 3W1VA 4YH1A 1BHQ1 4YP5A 1AT1A 4ZXFA 1I7QB 4KO2S 2OYCA 1Q2XA 3R4CA 3WMWA 4WZAE 2MJLA 3RCBA 2ES4A 3O38A 4BS9A 2B25A 2H5JA 3E15A 4B1FA 1RAHA 3RVRA 2P9GA 4HGZA 1BH2A 1PHPA 1YFJA 3RSHA 1DTSA 2C4NA 2HWYA 4HYEA 1ZRNA 5TY0A 5EIOA 2IPXA 3NJ8A 1F6BA 3OCJA 3W4KA 1D3AA 1UZLA 2B4YA 1WHSB 4KYUA 2E89A 4NAHA 1U3VA 3UMVA 3DXXA 5ECGC 2C07A 3AHFA 5L40A 5JH7B 1GT6A 4RA6B 4OSPA 2AG5A 1PUJA 3A0RB 4UAJA 3EC1A 4DLPA 1P7CA 4R8MA 3BA6A 3URMA 4R41A 4B87A 3U4DA 4DLSA 1ZA2A 4NK4A 5U4XA 1LC0A 1D2CA 2OGWA 2BD0A 1ZU4A 2RGYA 3AEQA 2CCGA 3QQPA 1FXWF 4Z9FA 3WRXA 4TYYA 4N3BA 2FA9A 1IWOA 2HR1A 5HZHA 2ODEA 3ACCA 2M2IA 3HKCA 1FLVA 4L8GA 3OZEA 3AWDA 3SIWA 2AXPA 1W19A 2P4HX 1NPYA 2VHQA 4LOKA 1USUA 4X7MA 1Z37A 1VPLA 4DJAA 3JU3A 2XXJA 4HWOA 5KIAA 2C7PA 4AMUA 1LTKA 1RXYA 5LDGA 4Y2HA 3WB2A 8LDHA 4DMLA 3I9JA 1T35A 2AFIB 2BW0A 5AO9A 1XXLA 3Q8XB 3O0DA 5DBHX 3RS2A 2PXCA 4YLGA 3SIPA 5LWQA 3PQFA 2ZOSA 3QA9A 3AVOA 2C5SA 2QPOA 1K4YA 3F98A 3AY0A 5DNVA 1QC5A 1NQUA 4HFJA 2GF2A 2RGRA 3ZDCA 4ZAVA 1TUBA 5CBPB 1I5EA 2PO7A 4XIGS 3TAXA 3FI0A 1NMSA 2WE7A 3W8NA 4AECA 1U8XX 1T1RA 2CGEA 1CEEA 1RKVA 2JLSA 4CKBB 1KYZA 5G3YA 1NNLA 3WDLA 4TVSA 1PR9A 1F2UA 4FJ0A 4J1TC 4ZO9A 3TVDA 4CM9D 2CLCX 2OEPA 2RJNA 3NALA 4LEIA 3RE1A 1JXOA 1P1FA 2BFNA 2CXRA 3ULKA 2VCYA 3ZYCA 1VLZA 5A05A 1L1EA 1UJNA 2ZBFA 4ZVUA 3FYTA 5BW4A 5IVDA 1ORIA 4OAQA 3IHTA 3IJRA 2XUKA 3KOMA 1F6WA 1V71A 2R7AA 5GGXA 1OWMA 1RBZA 2YC2C 5G4LA 3GUHA 4ZYZA 1EK1A 1XIVA 3UJ7A 3KSBC 1M5RA 2JEZA 4QUBA 1ENZA 4B7ZA 3PFBA 5KC8A 1DIRA 4B32A 3P26A 3TNFA 1U7HA 3U40A 1UC4B 1TU0A 3L8ZA 4FCTA 3ROTA 3PQDA 3T3EA 5CJ2A 3RYTC 3VDQA 3L7NA 1U4OA 1GQYA 3M2PA 3VDMA 1T9ZA 2CC2A 1RQNA 3FFTA 4IIVA 5AM5A 3LG2A 3V5NA 1NJSA 1BVYF 1E5QA 1WSWA 2NGRA 2Y1WA 1N6KA 1W1UA 3FGZA 4OFXA 5JLAA 1EVLA 3SJUA 5KYWA 2X1LA 5EHXA 3LS2A 4FFRA 2ZRHA 1PZFA 3E5RA 3WFJA 3NHAA 3GNSA 4ZPXA 3COJA 3OEWA 2QW8A 2H2GA 4YRQA 3VVBA 1PUIA 4JWTA 3O4VA 3B9PA 3HHPA 4JR2A 2R8ZA 1E0KA 3AG6A 1R0RE 1KZHA 5TC4A 4PAGA 4BV9A 1RFGE 2QQEA 4TRNA 2EHJA 2GNOA 1MOSA 2GUWA 3VKVA 2YTZA 3N9IA 5IJ9A 2Y99A 2ZBDA 1UWCA 2ATVA 1TF5A 4LXGA 3LZDA 2R96A 4LX8A 2P69A 3EEYA 1K6JA 1E89A 1KJZA 1I51A 2JLZA 3QFFA 2Q4DA 1FTSA 1VFNA 4M88A 5AW7A 1WA5A 3F6BX 4ZGBA 2VZEA 3DBHA 4Q1AA 3D5EA 4KQWA 2CDRA 1C29B 4JDUA 3GFQA 5K7SA 3AIOA 2AR0A 2W8BB 4PLPA 3IQWA 1D07A 2NNLD 2WIGA 5LD2B 2AFIE 2EFEB 1YDEA 3PSAA 4WERA 1DJLA 2QGZA 2P79A 2FPMA 3OE7D 1PGQA 5JOQA 3PFFA 1G7SA 3KU4A 4TYMA 2ZIFA 3L2OB 2PX5A 1JIIA 2XMGA 4Z7QB 2AL7A 1TGYA 3IX7A 4IFBA 1NBME 3K96A 3IT0A 5INTA 3UUFA 1ZM2A 5TT0A 1G6Q1 1NSFA 3CWCA 4HDSA 5HDBB 4F5YA 4PG6A 4EW3A 4ZZ1A 2Y6VA 3W2FA 4D42A 3S8EA 1QHNA 2Q0SA 3WIVA 2QTCA 3GA5A 2P9EA 2O2DA 3OQOA 3ZV4A 3ZY2A 1PJ3A 3UF0A 1T5IA 1H6CA 1TOAA 2IIQA 1P7YA 2JD1A 3AUAA 4JIGA 5J1SB 1ZUNA 1L5HA 1P19A 4BGVA 1VCHA 4MR9B 4B7AA 1AKYA 1HYGA 4PG4A 4X84A 1N2JA 4LV5B 5LQKA 1KYTA 1SR8A 4NYJR 4U00A 3OF3A 4YAFA 2J41A 4ENRA 4BO8A 4KFSA 4Q39A 3H99A 3L6RA 4MCJA 4ESOA 5JCOA 3L84A 3B20A 3R9XB 2OCYC 2J67A 3K0FA 4F3YA 4EHAA 1EB9A 2KSQA 2HDOA 3UFXB 1JHDA 2EHDA 5DE3A 2VQ3A 3OF2A 2RJOA 1E2NA 4RK6A 4Z3DA 2DKFA 1DZIA 1T26A 2AEEA 4J7AA 3BZWA 3KLBA 4GDMA 2I4IA 5GWXA 2GHTA 1DIBA 2A58A 3EHEA 4MVCA 5JS2A 3IQHX 4R69A 3ABQB 2P2NA