3K6KA

Crystal structure at 2.2 angstrom of hsl-homolog este7 from a metagenome library
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
297
structure length
297
Chain Sequence
DTKMDPRDFLQLLKINAEKAEKNLPLDQKRAGMEALCERFPRAEGVELTLTDLGGVPCIRQATDGAGAAHILYFHGGGYISGSPSTHLVLTTQLAKQSSATLWSLDYRLAPENPFPAAVDDCVAAYRALLKTAGSADRIIIAGDSAGGGLTTASMLKAKEDGLPMPAGLVMLSPFVDLTLSRWSNSNLADRDFLAEPDTLGEMSELYVGGEDRKNPLISPVYADLSGLPEMLIHVGSEEALLSDSTTLAERAGAAGVSVELKIWPDMPHVFQMYGKFVNAADISIKEICHWISARIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biochemical and structural analysis of hormone-sensitive lipase homolog EstE7; Insight into the stabilized dimerization of HSL-homolog proteins
rcsb
source organism Uncultured bacterium
molecule tags Hydrolase
molecule keywords Esterase/lipase
total genus 98
structure length 297
sequence length 297
chains with identical sequence B, C, D
ec nomenclature ec 3.1.1.-:
pdb deposition date 2009-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3k6kA00
2RHWA 5AKGA 1E8MA 3W05A 3HABA 1HPLA 5AICA 2AJ8A 1EB8A 4W9RA 2ZYRA 2PL5A 4DTCA 2XMBA 7YASA 1EVEA 4ZI5A 4AMYA 5CRIA 2W6CX 5LZ4A 4DYHA 1XRLA 1FFEA 4J7AA 2R11A 3KSRA 5AK3A 1XZHA 1ZIYA 3WYDA 2YXPX 2PBLA 5KBYA 2X8BA 4A16A 3WWCA 2HHAA 1BU8A 1QO7A 1LZKA 4KE9A 4A23A 4Y7DA 2VAXA 3VXKA 2LIPA 2XUKA 3C6XA 4YK7A 4XVCA 3LCRA 3FLBA 1DWPA 1XZMA 3Q8WA 4EA6A 2WHPB 2YH2A 3E3AA 1G42A 3I6YA 3D2AA 3VVMA 5AKXA 5CMLA 4UBIA 4UHCA 5FRDA 4G9EA 2ZJFA 1LPPA 3EBLA 5A71A 3G7NA 3DEAA 5C8ZA 4J0HA 4KAJA 1VE6A 5T4FA 2WU3A 1NX9A 2WQZA 3W06A 2H7YA 5BOVA 3RARA 3WL7A 1JU4A 5AKZA 1IZ8A 3WIOA 2HA3A 1WB4A 1ORWA 4FFWA 2G63A 5DLPA 5ALHA 4BRSA 4B80A 3WK5A 1A8UA 1XRNA 4PW0A 4QLAA 4AXBA 2GYWA 1RYYA 3H2JA 3EF3A 4ZREA 1GXSA 3WA7A 2FUKA 5CH8A 2PPLA 3CN9A 4H7FA 4P93A 4WJLA 3C8HA 4J0GA 4X91A 3IDAA 2BGNA 4CG3A 5KWJA 2EDAA 3KWFA 4JEIA 3R3WA 1E3QA 3QH4A 5CW2A 1VZ2A 1ORVA 2PSJA 4WCVA 4X93A 4OB7A 4EY6A 1TCBA 2JGKA 3OOSA 4ARBA 2XUQA 5EIEA 5FXMA 4BC1A 2HA0A 1J2EA 5IVHA 1B41A 2BJHA 1F0PA 3WWDA 4BAZA 4PQEA 4C4ZA 4Q3OA 1FFBA 1HDEA 3G9UA 1CR6A 1H2YA 2BUAA 2QT9A 4WDQA 3GUUA 3HLKA 4KEAA 1MNAA 4HAIA 2V98A 3PFCA 4Q3KA 2CEKA 4X71A 4J0IA 5D3ZA 2D5LA 3H2KA 2B4KA 1CUDA 1TKRA 4F0JA 1J06A 1SFRA 4C88A 1VLQA 1XZKA 1MTZA 5JAOA 5FKJA 5BWBA 3I2KA 3P2MA 3DCNA 4H7KA 2OCIA 1ZGCA 4HXGA 4AQDA 3WI7A 2CKMA 5F4ZA 3H1BA 2JBWA 2Y2VA 1Y7IA 2OG1A 1DINA 2O7RA 1DQZA 3FSGD 4H7DA 4MYDA 2WUDA 1G4HA 3QVMA 2VTVA 1Q83A 3H2IA 3NOXA 4H0CA 5I9IA 2XUPA 2PU7A 3B5EA 3C6BA 3H18A 1WM1A 3VJKA 2VT7A 3VJLA 1H23A 1ZGBA 4HTAA 1EXWA 2XUDA 1DWQA 2ZVDA 3DJYA 1LGYA 3SX4A 3WK7A 4FMPA 4KRYA 1CUZA 5DYYA 5JIBA 2WJ4A 3WIBA 1UKCA 3WWOA 4BP9A 1WB6A 2OAGA 2J3DA 2WUFA 4H7IA 1JJBA 2WJ6A 1N8SA 1W1IA 5FDFA 3WK9A 5HFAA 4XX1A 2Y6UA 2BFNA 1YA8A 1LPNA 5ESRA 4UFNA 1UOQA 5DJ5A 1XFDA 4MQMA 2WFZA 4BC0A 5C7YA 1N1MA 4M0MA 5HZGA 4H18A 4D9JA 4JYPA 4NS4A 3DL4A 1XKTA 1ACJA 5A7FA 5AKHA 3WZLA 1MPXA 4O08A 5D7BA 1UXOA 5AM0A 1X2EA 3H2HA 3UMJA 2OQIA 2QJRA 3G9ZA 2HA2A 5ALQA 3N0TA 5AM4A 4N5IX 5I8PA 4QDXA 3U0VA 3GA7A 4IQ4A 3GFFA 3G0GA 5AHXA 3BJRA 4E14A 4J0DA 4RE5A 2QS9A 5ALIA 4B0OA 3QBJA 3QITA 5H3HA 4WDRA 3EQ9A 1FSSA 1ODTC 1XRPA 2O7VA 3G02A 1LPOA 5IVIA 4ZWNA 2HU8A 4OB8A 4OUKX 1XZFA 4WFJA 4FOLA 2Q0XA 3CCCA 4W1PA 1TQHA 1LPBB 5JAHA 1YB7A 3ICVA 3LIPA 2WU4A 3KDAA 5EHXA 1AQLA 5CBKA 4Y2TA 4L0CA 1TIBA 3I2FA 4FHZA 2DR0A 3ANSA 4JUIA 4HVTA 4ARAA 3HXKA 1MN6A 4DMHA 2GBFA 1UFOA 3MUNA 1Q84A 1HQDA 4KACA 2GYVA 4QDUA 2H7CA 4DIUA 1YCDA 4OCZA 4U2CA 4UHEA 2HRQA 2J4CA 3O4HA 3WMRA 3H0CA 4LYEA 4G1FA 4AMZA 4EY4A 3ESDA 4B83A 1VKHA 1D07A 4GDMA 2X5XA 2P8SA 2CJPA 3F96A 4ZV7A 4G5XA 4BCBA 3C6ZA 1W76A 4X92A 4G8BA 3FLAA 1MAAA 5JZSA 4S0XA 2QZPA 1J07A 1XQYA 1BN7A 4P9NA 2WFMA 2C0QA 1F0NA 4JYMA 5ALYA 1XKLA 1C7IA 1OCEA 5EHZA 4BDSA 1U4NA 3F8SA 4TVKA 4BE9A 1ZI6A 1QFMA 1CUEA 3OTQA 5AI8A 3BDVA 1BCSA 2ZSHA 3WKCA 4UBKA 1MX1A 3FOBA 5ALOA 4PSCA 3HI4A 5LZ2A 2RI6A 1CQZA 2XUGA 1QZ3A 1ZD5A 3ZLVA 3DKKA 1WHTA 3R3VA 3SK0A 5HQ3B 2C5FA 3BE8A 1X2BA 5K3FB 2ZYIA 4YX9A 1C7JA 1CV2A 5HF9A 4Q34A 3DYVA 2WIGA 5EFZA 2CB9A 4KE7A 3IA2A 4B6GA 3S8YA 1E5TA 3G9XA 2Z3ZA 4DLNA 4NZZA 1C4XA 3JYHA 3O95A 1O6FA 5IH7A 1I6WA 4C6HA 1JFRA 3BF8A 1HBJA 3AIMA 2DCMA 4QWWA 1R9NA 1JMKC 1XZJA 3W9UA 1BS9A 2G4LA 3PFBA 4IH1A 2V9ZA 1CUIA 1WPXA 3FYUB 4N8SA 4GI1A 2XQFA 4UUQA 1A7UA 2PUJA 3G8YA 2QTBA 2WM2A 4KE6A 5C8VA 4U2FA 3DD5A 5ALTA 4MYSA 3RM3A 2G5PA 5AIBA 1OXMA 3I2HA 4FWBA 4BAGA 1CPYA 1ETHA 3W04A 1H2WA 3O4GA 1Q0RA 4M0FA 4DSAA 5C8XA 3A70A 3T4UA 1W52X 1BE0A 5JZ9A 1ZI8A 1WPRA 2JEYA 4EY5A 5K3AA 1N5MA 4CFSA 2I78A 4OYYA 3I6MA 3GELA 4AB1A 5DTJA 2QKYA 3OURA 3R41A 5EIHA 5EIAA 5JALA 1UOOA 5AKKA 3O4IA 2YASA 4DNQA 4UPDA 3VISA 1P0QA 2ACKA 4X94A 1QIJA 5K3BA 3BDIA 1UK7A 1YAHA 4INZA 4QLOA 2ECFA 3NUZA 1XZGA 3QPAA 1NU6A 4X90A 1R9MA 3S2ZA 2DFPA 2RAUA 4RPCA 3T52A 1QIKA 4X6XA 3DKRA 2CZQA 4DMCA 3AIOA 1EDDA 5FV4A 1H2XA 4KAFA 2ACEA 3SC2A 1JMYA 4B81A 4EB0A 1P0MA 2WHPA 2I3DA 5JAUA 2Y2UA 1MX5A 4F60A 1DTEA 2JGMA 6YASA 2DSNA 1PFQA 5DWDA 3O0DA 3C8DA 2VF2A 3I2GA 2PM8A 1MNQA 5EHQA 1AURA 1UK9A 1U8EA 5D3KA 5FUMA 1AUOA 1PJAA 3NGMA 4AO7A 4RGYA 1IMJA 1XZBA 4KE8A 1E8NA 2YYSA 4BVJA 4BAUA 1K8QA 3BIWA 5JADA 1CUXA 5T4HA 4GHWA 3WL5A 1FFDA 5JARA 4B85A 4KRXA 2XMQA 1WHSA 4KR0A 1QLWA 4G4GA 2JGJA 2B9VA 5EHNA 5LKAA 3BIXA 4ETWA 2HDWA 2RHTA 4YPVA 4BVKA 2UZ0A 5JD5A 4FLFA 1ZICA 4MEAA 5AI5A 4B9AA 2GBGA 3WWPA 3L1HA 5HF5A 4C87A 3FBWA 5JATA 3STXA 4DM7A 4K6HA 4X7BA 2OXEA 4OD0A 5JAPA 2OGTA 4AX4A 5JD6A 4I4CA 2HA6A 1YASA 3FVTA 2OPHA 1GPKA 1EB9A 3QZUA 2I3ZA 2VATA 1A8SA 3GZJA 3H1AA 1QIMA 3WYNA 3FYUA 1YS1X 3G0DA 3AFIA 1CUFA 3D4LA 5ALZA 4I3FA 3BL8A 3ESAA 5FOQA 5ALXA 3F67A 1DWOA 2GYUA 3K6KA 1XLVA 4L3WA 1S8OA 1ZIXA 1WCYA 4EY8A 3RKSA 1RWQA 2XT0A 2QUBA 4CG2A 1ISPA 4X3CA 2WIFA 1GPNA 3DDUA 1AKNA 1GQSA 2QR5A 1QOZA 3DOIA 2HFJA 1QIDA 2JGEA 3TEJA 4QNNA 1Q0ZA 4E46A 4B84A 2BUBA 3WJ2A 1GKLA 1ZD2P 2BGRA 1IUPA 2XQIA 1B6GA 1ZJ4A 2CBGA 3TJMA 5A7HA 3IUJA 2XMDA 5AKJA 3VKFA 1XZDA 4L72A 1XZEA 3KOOA 3DL7A 3O9VA 1T4MA 2QUAA 3H2GA 5HFNA 3EIOA 1N5RA 1YB6A 4BTVA 5EI5A 2CUTA 2DHEA 1HL7A 4EHBA 4C01A 1USWA 4RNCA 5CT4A 2VJDA 4GW3A 4DNFA 5CT9A 4I19A 5JD4A 3W2TA 2PSHA 1K6EA 4MWSA 1W4LA 3D0KA 5DTIA 1IZ7A 2Y1KA 1Y7HA 1YR2A 2DHCA 2PSFA 3C5WP 5IVDA 4UBMA 2XUFA 2PUHA 4WY8A 4B0PA 1QFSA 2XI4A 1U65A 2G5TA 4ROTA 4HS9A 1UZAA 5LLSA 4QWMA 1CUYA 1A88A 3FSGA 2XQKA 3A2MA 3IBTA 4MEBA 5T4BA 4IHAA 4OSEA 2AJLI 4XIIA 2X76A 1ACLA 3DLTA 4H7EA 3AIKA 3JW8A 3TRDA 2JIDA 5CT8A 3ESCA 5AOAA 2BAGA 4MJ3A 1JU3A 1JKMA 1FFAA 1XZIA 2JGFA 4Q05A 2ZJ7A 2JF0A 2B61A 3IVMA 4Y2QA 4PSUA 5FPQA 5HKBA 1BEZA 3C87A 2EEPA 4UFPA 4W1QA 3L1IA 2ZYSA 4GLBA 1THTA 1MAHA 4CG1A 1MO2A 3R3ZA 1W75A 4KJXA 5AI6A 1E8DA 3G0CA 1VXOA 1QIIA 2V97A 3HC7A 1CLEA 3R0VA 4M0EA 1M33A 2WTMA 1UK8A 1VE7A 3LLCA 3ZV7A 3BXPA 3FWHA 1CRLA 1UWCA 2QOEA 5ALMA 3X3HA 1EI9A 1ZOIA 1CQWA 4DSZA 1SCIA 1EVQA 1QIGA 4C4XA 2C0PA 1XQXA 4AN0A 4FNMA 4BDTA 5A7GA 2VQ6A 3K9BA 2XMCA 1QE3A 1VJ5A 2Y6VA 4FKBA 4Y2VA 5K3EA 3A6ZA 2OGZA 3V1NA 1XROA 2WHRA 3E0XA 5AOBA 2O2IA 5CXXA 2XDWA 2DQYA 1QIFA 4B82A 1YS2X 4AZ0A 1R4ZA 2BUCA 1SOMA 5YASA 3PI6A 4HZGA 2VSQA 1E89A 3AZOA 1CUHA 4QA9A 1L7QA 4OU4A 1UK6A 1CFJA 2VJAA 5IVKA 2QXUA 2AJCA 1LNSA 5AI9A 1KU0A 5A62A 3F98A 2VA9A 5K3FA 3PE6A 2HL6A 4QDZA 1LBTA 2VJCA 1XQVA 4G9GA 4X95A 5JANA 4IH4A 2V96A 2WIKA 4GXNA 3H17A 4LXGA 3STUA 2HIHA 4Y2YA 1TK3A 5E4TA 4FTWA 1RP1A 5HF8A 2XB6A 2HRRA 1FJ2A 5ALWA 5JASA 1EK1A 2D0DA 5T4EA 5DYTA 4XJVA 4H77A 4K6KA 3DOHA 3IUNA 2WUEA 4OPMA 3LP5A 3CCBA 4QEKA 3PUHA 2QJWA 5AM2A 4LHEA 1DU4A 3KD2A 3M83A 2ZSIA 3DYIA 5J3JA 1YAJA 5FP0A 4PSDA 1CUVA 3AUKA 5LP1A 1UOPA 2WILA 3IULA 1H2ZA 3GBSA 3M81A 5LYYA 2XE4A 5KREA 4HRXA 2Z8XA 1OILA 4LXIA 4FLEA 3FCXA 1L7AA 3V1LA 1BN6A 3I28A 4Y9SA 1LZLA 4UBOA 2H1IA 3WLAA 1QONA 1Z68A 4PNZA 1NU8A 1TCCA 5FPPA 4W1RA 2OQVA 3PICA 3HSSA 3IUQA 3QMVA 5AM5A 1XLUA 2Z3WA 4G8DA 1XRMA 4Y2PA 1QIEA 4BVLA 4Y2SA 4EY7A 5JZBA 3BWXA 5HK8A 4PF1A 4C4YA 4BZZA 4EUSA 3MVEA 1VXRA 1AX9A 2HM7A 2WUGA 4BCDA 2O2HA 4N5HX 1VZ3A 2XMZA 5ALGA 1JT2A 5LZ7A 4IO0A 3U1TA 3MGAA 4Y2JA 4QDOA 1L7RA 4JH0A 1XRQA 2BCEA 1R1DA 3LIIA 1MU0A 2XUAA 4DMKA 5LZ5A 3OM8A 4FBLA 5AK4A 4BP8A 1R50A 4P92A 2W22A 3QPCA 3V9AA 3I2IA 1ODCA 5AH0A 5AIAA 2GZRA 3WK8A 2WTNA 2FJ0A 5K3CA 2XMSA 2VJBA 1EK2A 3WZMA 5ALVA 4KYVA 4ZRDA 3M82A 1EX9A 3AJAA 2FX5A 4HXFB 2ROQA 5HKAA 5AKEA 2XUOA 4H35A 1GKKA 4C89A 2PU5A 5EGNA 2B20A 2WFLA 1UKAA 1K63A 3ESBA 3R3XA 5ALFA 2HADA 1ZJ5A 3ZLTA 4KAAA 1LBSA 3HJUA 4GECA 3WKDA 2IITA 4ZV9A 3R3UA 5LIPA 4AN1A 4CCYB 4U2GA 3KXPA 2C58A 5ALEA 5ALJA 1EDBA 1DT5A 3ED1A 3UUEA 2K2QB 3HZOA 3O9MA 4G4IA 4P08A 3A2NA 1QIHA 3FNBA 4J3JA 5DNWA 4J0JA 4EZIA 1BRTA 2OCGA 5HF6A 4XWGA 1CVLA 3ICWA 2DHDA 3PF8A 4BRZA 1IUOA 2RIPA 2IX9A 1LPMA 3CN7A 4LXHA 5AI4A 3FYUC 3HRHA 3IURA 3VJMA 3EQ7A 2J4FA 1THGA 3IIIA 2HA7A 4IH9A 3C45A 1LPAB 4V2IA 3D2BA 4W1SA 4FLMA 3IUMA 2WKWA 1A8QA 2XUHA 4K5QA 4FFVA 4Q82A 5SYNA 2WLSA 3ZWQA 2QRUA 2NW6A 2HA4A 2XLCA 1F8UA 4NMWA 2BKLA 5LZ8A 4QE3A 4X6YA 1ZI9A 3OPMA 3STYA 2ES4A 1O6GA 4UHHA 4FDMA 4X00A 3E1GA 4AO6A 4WY5A 5LKRA 3QMMA 2WG0A 4N8EA 3I1YA 3D3NA 1JI3A 4HRYA 3FLEA 2WHQA 4W63A 1HLGA 4TPKA 1TCAA 3GROA 3QM1A 2PSEA 4JNCA 4FBMA 4QZVA 2QXTA 1MX9A 2WSLA 1K5PA 1H22A 3W9BA 3V1MA 4HXEB 2RONA 3Q0TA 3N2ZB 3BJMA 1LPSA 2XQJA 3R3YA 1XLWA 3UUFA 1CUUA 2GZSA 3WKAA 1BROA 2ZYHA 3HEAA 1QTRA 1R88A 1AZWA 5ALLA 4UBLA 3CXUA 1EDEA 1VA5A 2XMGA 4A5SA 5ALSA 5DNUA 1CUCA 3F9CA 4DMFA 4G4JA 1CUBA 3EQ8A 1DX4A 1DX6A 4BBZA 3AZQA 3A2LA 5AKIA 3WWEA 3DNMA 4PV7A 1CUSA 2HA5A 4CIAA 1WOMA 2WIDA 2Z8ZA 1LLFA 2HU5A 3TGLA 1IVYA 4GEGA 4UHDA 3WK4A 3H04A 5AKYA 3B12A 3HYSA 3WL8A 2JGIA 1SC9A 2H9YA 5BV7A 3QPDA 3RLIA 1SCQA 3G0BA 1CUAA 1AGYA 4X97A 4H7JA 2E3JA 2WG1A 4B7ZA 3D5EA 5ISMA 1ODSA 3B3QA 2JGLA 1CUJA 5CXUA 3VVLA 1CUWA 5ALNA 2XQGA 5LZ9A 5A6VA 3RK4A 2EDCA 4GBGA 4ZGBA 5ALRA 4BCCA 2QVBA 1EH5A 2OAEA 3L1JA 4Y2XA 5C81A 3I1IA 2J3QA 3WKEA 4F5ZA 1HKHA 1U2EA 3JWEA 4WFIA 1J1IA 4B9EA 5AO9A 1G5FA 4QDTA 2H7XA 4AZ3A 3PUIA 1GZ7A 4UBJA 4CI9A 5DNVA 2AXEA 3AINA 5E2IA 4U2DA 1PV1A 5FLKA 1XRRA 1TAHA 2O2GA 3WKBA 1WB5A 5DYWA 3STWA 3VDXA 3AILA 4PO3X 1G66A 4YASA 5HCUA 3G9TA 5ALDA 1KEZA 3C6YA 2XUJA 2IIVA 1EA5A 4LKOA 2PKYX 1CIJA 5K5EA 4OYLA 1CEXA 3O4JA 4RE6A 5IKXA 1JJFA 5CH5A 1UT6A 3ZPXA 4Q3LA 2PSDA 5JYCA 3V1KA 2JEZA 1DT3A 4J03A 1E66A 4ZXFA 4Q1VA 4DGQA 3I6ZA 2OCKA 2I03A 4BTLA 1TRHA 1ZD3A 5ALPA 1BEEA 4BYMA 5AI0A 3QMWA 1GGVA 1SCKA 4X85A 1XQWA 1MT3A 4MQLA 1GT6A 4BATA 5I7UA 2WJ3A 2WFLB 1UKBA 1FFCA 3C70A 2ONCA 4MXDA 3YASA 3STVA 4K2AA 3C5VA 2VT6A 3OG9A 5K3DA 4UHBA 1IUNA 1BCRA 4EBBA 1XZAA 2OGSA 1ZD4A 1T2NA 5AK5A 2C7BA 2FJPA 3FVRA 4DNOA 5CT6A 3STTA 3D2CA 1VOTA 4L9AA 4H7HA 5AJHA 1XZCA 3HACA 3ANTA 4Y2UA 2ZJ6A 3E4DA 4BB0A 5SYMA 3ZI7A 1AC5A 1JJIA 1KU6A 2GBCA 2RGUA 1R3DA 1VA4A 2QMQA 5D6OA 1DQYA 5CH3A 3DS8A 4Z49A 5AM3A 4Y2RA 4OB6A 3D59A 4FNGA 2AJBA 4UFOA 2C4HA 3DQZA 2OLEA 3IB3A 3G0IA 4BE4A 2DQZA 3ILSA 3D7RA 3C43A 3H19A 1X70A 3F97A 1K4YA 2QM0A 1EHYA 1QJ4A 2ORYA 2XUIA 5E4YA 1P0IA 3WJ1A 1Y37A 3MUOA 4U2EA 4NVRA 3QYJA 4BZWA 5BWCA 5AKLA 2C5GA 5AM1A 3I2JA 5E4JA 4OU5A 3WK6A 3K2IA 5HQ3A 4K6GA 3PF9A 1GPLA 1AMNA 4G8CA 3NWOA 3FYTA 4MWTA 3WQHA 4X6UA 4DNPA 2PVSA 4LIPD 4WFKA 2HU7A 4LYDA 4F21A 4ITVA 1EINA 4J0KA 2PX6A 2GBIA 5AOCA 3ZLUA 4UHFA 3FAKA 1YA4A 4AO8A 2XMRA 4CIBA 3R40A 4GWLA 5CT5A 3WA6A 3LS2A 3V48A 1GQRA 3AZPA 5ALKA 5CURA 4N8DA 1XZLA 1CUGA 3KWJA 5HK9A 2OCLA 3OC0A 4J0CA 1QGED 3WL6A 4CCWA 1P0PA 4UBNA 5AP9A 4E11A 2HFKA 5A2GA 3SWWA 4TGLA 2XLBA 2VEOA 2CMFA 5ALUA 5AK6A 2WG2A 3PDCA 2Z5GA 4CCYA 1F6WA 3M3DA 2R8BA 2VAVA 3BF7A 1MJ5A 3FCYA 1W6RA 5CTAA 1YSCA 4U2BA 2WIJA 5KWIA 1QTIA 4E15A 1QO9A 2AJDA
chains in the Genus database with same CATH superfamily
2QUHA 2OV4A 1ULSA 1WWKA 4IIDA 3L49A 4BWFB 1L7NA 3OJLA 4BUCA 4UXHA 3N70A 1TVKB 4UMEA 2X1VA 2KLHA 2TECE 2DTDA 4WD3A 3KUUA 3INYA 2AJ8A 1EB8A 3BG5A 3DTNA 2PNJA 2QLMA 1TQ8A 2AXQA 1YU6A 1IM5A 2RGAA 2V1XA 3OD1A 3TMKA 4ETIA 4EL5A 4MNTA 2PL5A 2Y1WA 3W3ZB 3BRWA 4NJEA 3OQMA 1G5RA 2NXCA 3AUJB 1JXMA 1XWIA 2G7MC 3Q12A 2OG2A 3REOA 3M5WA 2Q9AA 4MUEA 4LKRA 3P2JA 4DVJA 2P65A 1G59A 2IT1A 1AXGA 2WAAA 3AMVA 3I8XA 1PX0A 1SVSA 4IIXA 4KC0A 1YH3A 4ZI5A 1QS0B 2W6CX 3VHRA 1SXJD 3VYTB 4UU1A 4H27A 4H6XA 5KVQA 1WQ3A 4MR8A 3WBJA 4ESHA 1WUJS 2LIVA 2BGLA 2PZBA 2JLAA 1FFEA 1VIDA 5ESWA 1KAQA 3AL2A 1OGIA 2JZCA 5TF4A 3S2IA 1ZR2A 2C07A 2JCGA 4JGBA 2H4XA 1SG0A 5EWJB 3GV0A 1S7GA 1WBJB 1T43A 1X3SA 1J1ZA 1PN3A 3NHUA 3CF2A 5KYXB 2CV2A 1EE1A 3BXFA 4DMRA 1ZLXA 5H81A 4RFVA 2H29A 2H1OA 1GAWA 2VF4X 3Q7IA 2WD7B 4EFKA 4A16A 2G80A 3BZWA 5EC8A 3RKUA 3TSAA 4C0SA 3QEOA 1VMEA 2EJWA 2P2LA 5AJYA 4O5AA 5IC4A 1BU8A 2HQRA 2BEWB 3KZCA 4K0RA 3HA5A 4KE9A 4RVHA 1JDTA 4MS4B 4ZYXA 4GUAA 1X8XA 4KR2A 2WV9A 4G65A 2YQ5A 2RAVA 2LIPA 5F2EA 2QAGC 1C1XA 1SHLA 1KJ9A 1RM0A 5F9MA 1EM6A 3ROFA 1P81A 5JCJD 4TLMB 2V6BA 3NRCA 5G02A 3U17A 2D2XA 2VUSA 5DYIA 4DLSA 1H8EA 4EA6A 4YAOA 6AT1A 2WHPB 4Q37A 4JJ6A 4TRRA 2R85A 2HF7A 2HF2A 3IQHX 2JFVA 1YS9A 4YPFA 2IYXA 5CB4F 2FLVA 1OXXK 5FRDA 2IU6A 4G9EA 3KLPX 2P2YA 3GVPA 4L51A 5AVUA 1LPPA 1HDGO 1A0OA 3DLHA 3AF0A 2FEMA 1A9OA 1FDOA 3ILYA 3DEAA 3QU7A 4IWNA 2XBUA 4MUXA 3RRXA 4J0HA 3A28A 4PZUA 4KSBA 5T4FA 5TVGA 1PJ3A 1X1QA 2QL5A 3WLPA 1FMJA 1KDOA 2GESA 2ZBVA 4QYXA 2DWPA 1WX1A 4GBJA 4X1IA 2WQZA 4BB9A 4B6JA 1E5LA 1ID1A 4DYVA 2H7YA 4BX2A 2P30A 2W6JD 5BOVA 3BFXA 3BFPA 3WL7A 2GD1O 1HDZA 1JU4A 1IN5A 2NYAA 5AKZA 4QJ3A 1H3EA 3JYNA 1WB4A 3AM1A 1U0BB 1Q92A 2PX4A 3PNLA 1YU9A 2H9AA 2XB8A 2PKCA 1VG0B 1P5ZB 4GSLA 1DDIA 1XCJA 4WBSA 3NOOA 4DKJA 3HPRA 1XMJA 2JFZA 1X1CA 1VFNA 2C7GA 3AM4A 3RBZA 2O2ZA 4P4NA 3UAOA 5P8WA 1E4EA 2EV9A 4F2GA 1FXSA 1EWVA 4PW0A 5B6IA 1ZGAA 1E98A 4C7XA 3EIXA 1MOPA 2ZT5A 3EPKA 3ZNNA 4G2TA 3G2KA 1AB5A 1H8HD 1LB1B 1U0RA 4CQJA 2ECPA 2QMEA 5TY0A 4K6MA 4NE2A 3U3DA 3ZU5A 3CN9A 3FWPA 4N49A 1B23P 5C53B 1Z7YA 4P93A 4G6ZA 2J07A 4WJLA 4IAOA 4WN9A 3U1BA 5F7OA 2ON6A 4J0GA 3OY2A 4BNXA 1BVHA 3TS1A 3FTCA 1IIRA 1KFCB 2DY0A 1NASA 4MINA 4U9UA 4Y98A 1L5KA 4DHWA 4X62B 3QV2A 2O8FA 3ICEA 3G6WA 3EGIA 3IERA 1Q17A 3T5GA 4DARA 1J22A 7MDHA 1DSSG 2FX2A 2Q28A 3EWSA 5DGIA 4DJDC 2GF9A 4AVYA 2V4ZA 2RDMA 4JEIA 3R3WA 3HRIA 2XZLA 4R3UC 1PF7E 2Y1DA 1ORVA 4RY0A 1UDXA 1ZH4A 4UDXX 3UJPA 4D46A 1E7QA 1SUIA 3DB1A 3IOMA 3AB3A 3JQAB 3S2SA 4D9IA 1QE5A 1VC2A 3OOSA 2ZJ8A 3MC1A 1ZYUA 2A4KA 5CP8A 2O1SA 2XQVA 3B7PA 4URUR 1BMDA 5EIEA 5FXMA 2VQDA 3R23A 2B69A 1E7WA 1XN4A 1MG5A 1TW3A 1PNVA 2XCUA 2B8JA 3E53A 4HNRA 3TCXB 4BO0A 4CMGA 4G84A 4YCAA 4BLVA 4F85A 1CU1A 2CL7X 1B41A 4FT2A 3AVVA 1I2ZA 1VLHA 3COSA 4HMPA 4J1NA 4BAZA 1M2WA 1KZYC 3ZD7A 1IONA 5CNIA 5L4SA 1PX2A 4L9SA 4AJKA 2I54A 3L40A 2B3DA 5NULA 5J2UF 2ZI3A 5LM3A 4C4ZA 2IY9A 1PL0A 1JEJA 3OAAA 4OFWA 4WKNA 3ZIDA 3ASYA 1OA0A 2CHUA 4WDQA 2QT9A 3EY9A 4WGFA 1DDGA 3TPCA 2HF8A 2V1UA 2BONA 4Q3KA 2HZ7A 3WJAA 1JTVA 5K8IA 2A0WA 1WXIA 3F7MA 1SCBA 2M2IA 5D8DA 2C84A 1H2HA 2J5QA 1EDOA 3FDIA 4IG9A 4RVFA 4X71A 3W8FA 4BXOA 1BG6A 3RYHA 3H2KA 3K3PA 4LJ8A 5L8VA 5JCXA 1T0PA 3MFQA 5NLLA 1CUDA 1TKRA 1J06A 4C88A 3IJPA 2VHZA 1VLQA 2FSVC 2OHHA 1XZKA 4LG1A 3FBGA 3I4CA 4Y1RA 3KB1A 4H1HA 2C59A 2W00A 3OE7A 1U3TA 4F2PA 3I2KA 3NBYC 3FUCA 1DKRA 3O90A 4YMUA 1FY2A 3KZMA 1NF8A 5CA1B 5G4KB 3MHTA 2QVCA 3HCBA 4EW3A 2BHNA 1VQ1A 4I9HA 2YXNA 2IP1A 3VU0A 1ZK1A 4TLBA 1G9SA 1JAZA 1I9CA 2OHFA 3AEUA 7AT1A 1JN0A 3EPLA 4GPTA 4G67A 1VRWA 5BT8A 2ZB8A 4Q4DA 2GKSA 3DZCA 4M76B 3SEFA 1U2QA 1O87A 4LHSA 4Q1EA 3D7MA 4GKVA 3NXSA 5EA2A 4BLTA 4X66B 1QF9A 1QVRA 3E84A 3QI2A 4EWLA 3KZVA 3AW8A 2EKQA 1INLA 1SUBA 2LRHA 3MCUA 1EUDB 4H0CA 4QXOA 3PXGA 4JODA 3C6BA 3GGGA 3GNTA 1JXOA 2WMYA 1R10A 1J8MF 1ELOA 3VJLA 1E2DA 2CDBA 1N78A 1ZGBA 4OQZA 3SKYA 4D97A 1Z5VA 1A72A 1EG7A 2PZEA 4HTAA 2V6MA 1EXWA 3S2GA 4RTQA 4MUIA 3UPTA 1X94A 5HJ2A 1DWQA 1RAHA 4WKGA 5DHAA 1P1CA 3TZHA 2CEAA 2PS3A 3WLFA 1Q0TA 3I23A 4KRYA 1J5PA 3I05A 4TWZA 2W7TA 3MGGA 3V2GA 1PP4A 2XBLA 4PYMA 5B4UA 2HSWA 3L2OB 3H9BA 2GTPA 2QP4A 4ZQFA 3VNBA 4BASA 1KDZA 4E7PA 3E9MA 1YDMA 1DC4A 3OY7A 1GCOA 2ISCA 1T4DA 3IBYA 4X1KB 5F1KA 4KCGA 1NY6A 4OI2A 5LQUA 4EJMA 4X3PA 3UJDA 3ZCRA 1UKCA 3W4JA 1Z13A 1E6EA 1BFDA 1XN1A 2NTVA 5E2AA 1JHMA 1HDXA 5C7LO 4WI1A 5DISB 3E23A 3OEHD 4H6VA 3CSSA 3O2JA 3L18A 3W7BA 2WUFA 1KJWA 2Q6IA 2R2AA 3EODA 3E03A 4AJ1A 3A9RA 3A25A 3KTFA 2XE8A 3DB2A 1Y7LA 5HIKA 1KAEA 4KQCA 3L4KA 3WLLA 1F06A 4IGEA 1H2BA 5BW6B 3KM0A 1WKVA 3H65A 2JD2A 3E9EA 1U90A 4AF8A 4YO7A 1U7OA 3IVXA 3VPBA 4EABA 1Y6FA 4L8LA 4MGHA 3MJRA 1OROA 3EE6A 3FFBA 3I30X 4F12A 4ZQHA 2QPOA 3CLRD 1R6XA 2BR3A 2X6QA 1XDZA 2BFNA 1YA8A 3ETNA 1NQVA 1Y6ZA 2UAGA 1XLTC 1V0JA 3HN6A 3NYQA 5EE9A 4U39A 5FAXA 4C0QC 4CUKA 1G8MA 1UOQA 2MMCA 4U1RA 4DXDA 3LI2A 1TYEB 2WFZA 5CIQA 1VPEA 1Z7GA 3BK7A 1MJGA 5HZGA 4B46A 2XDAA 4NS4A 4MDFA 3C3CA 5E9JA 5EJFA 4AURA 4YRRA 2C92A 1PFYA 3I9JA 1K0UA 3OT5A 1KYQA 1A5TA 2QJFA 4O08A 4EUEA 5KOYA 5D7BA 3LWBA 5L4NA 4KDEA 2VP0A 4R54A 1X2EA 2VXOA 3QBDA 1L8OA 3USZA 3WB2A 2VYND 3CNQS 3R6LA 3OM1A 4HB2A 2AOTB 1ADGA 1XB2A 4RK1A 2ZRLA 4NU8X 4KQFA 3T7CA 3W2HA 1FDUA 5EVCA 1NQXA 1MRSA 3RG8A 2BYTA 4MW2A 1Z2CA 1NTRA 1PKEA 3CWCA 1JAIA 3H99A 4FSDA 4OJYA 5FTWA 1R8QA 2B7LA 3QVXA 5K3SA 1R0SA 4N5IX 2PWAA 4D7AA 4YCJA 1OU0A 2OGUA 4QDXA 2D5CA 2LZ0A 2XCIA 1KMQA 1HE8B 1E4YA 1VHJA 1ZGHA 4FYIA 3ZEIA 3OTOB 3HU5A 4J0DA 5CPBA 2FN9A 4TKVA 4RE5A 2GO1A 2X3FA 3DMYA 3RVLA 2CV0A 4KXMA 3ZXIA 2WYHA 4MS3B 4RXUA 2PT5A 1CYEA 4NG4A 1XNQB 1X8LA 1PKXA 3HCFA 1P1BA 1PEKE 2VAWA 4WDRA 4ZZ0A 4POOA 1FSSA 1B26A 3LCUA 3VZCA 2ZOSA 4GNKA 4BUJA 5IBCA 3WX0A 3FPFA 1VJDA 1CZOA 3WZ2A 5JNLA 1DUSA 4MIYA 1GKUB 3RJZA 2Q3BA 5FD8A 4MW9A 3F4BA 4UQLA 3G02A 3H5RA 5DYNA 1OX5A 1G21B 1RHRA 1ZH6A 4ZWNA 5IVIA 2PX3A 3ROMA 4LN1A 5JYBA 3BWBA 1FA9A 4LXUA 4OB8A 1XZFA 3G88A 1ZAYA 1T10A 3T9AA 3T5BA 2PD6A 2XB9A 2Q0XA 1AB6A 1W73A 4P36A 1TQHA 1LPBB 1KS2A 1QMGA 1YB7A 2C8VA 3NATA 1HTBA 3SS9X 4C4OA 4CMEA 1ONNA 4KQMA 4YUWA 4E5PA 1HZJA 3ICVA 3MRVA 2C5BA 1QGUA 3PYLA 4FR5A 3Q5GA 4TSRA 5EINA 4IDPA 3ZCUA 5LYJA 1K8RA 5EHXA 1HO3A 3QXHA 1HYGA 1OFTA 2GCOB 4IOKA 3RIXA 4F5EA 3S1LA 2Z2IA 4RGVA 5JFOA 3I2FA 4IDFA 5DLEA 4LYYA 4K81B 3K9NA 4UM9D 4FSXA 2DR0A 3AERA 1GAXA 3QBEA 4D0RA 3CZQA 2YS7A 5AJZA 3T3OA 3COZA 5HCNA 4KQXA 1QZTA 2ORWA 1EZZA 1PR0A 4Y6SA 3HL4A 3ZHRA 1N2CA 4B7UA 1Q7GA 1DVRA 1MN6A 4FKZA 4IIVA 4IV5A 1A9RA 3UKDA 3IUYA 2HWXA 2A1UA 2B35A 2HXGA 3JZFA 4GEKA 3UATA 4NQRA 3TW0A 2OXCA 2I2WA 3HCEA 4KACA 5DGDA 3T4EA 1N2SA 4PGHA 1WNFA 2ZSDA 4QDUA 3DMNA 3RC3A 4L74A 1OGYA 1YCDA 2QTHA 3GIDA 1EFPA 4P3XA 4P81A 3UOAB 4YJKA 1VHLA 4UHEA 1Q22A 2HRQA 4PX9A 5JSUA 1MG0A 4DWJA 2GB4A 2ZIFA 2D4AA 2P9CA 3EK2A 3O4HA 3ZGVA 3PT5A 2FK8A 2ZB3A 4DBLC 2YWCA 3H0CA 3QEJA 4IICA 4HX9A 4K9PA 2E6UX 3F2IA 2NVUA 3L8FA 3VU8A 1HURA 4QTUB 3ESDA 1O9BA 1QFYA 4TLCA 2PLNA 4XWTA 4IDNA 4ZVNA 4DSUA 2ERXA 1SKBA 3JARA 3KPYA 3BYZA 4IMJB 4IS2A 4N01A 1N6OA 1OC2A 1PEAA 3GB9A 1JAXA 4PPFA 3S8EA 2K6GA 3EFEA 1U1GA 4PBSA 2PJDA 4N4AA 3CLTC 4L08A 1KYYA 2IS1A 4Z9BA 2AFIA 3OESA 1SUEA 4S2UA 1BA2A 4HX2A 4K9KA 3KLNA 2LCFA 4ZYVA 2B82A 3SFZA 2N42A 2ZJ2A 3CO5A 3GYGA 5CEFA 3D64A 3KT3A 4I5FA 4IRXA 4ZP1A 4MVJM 4V0RA 3M6LA 3OE5A 3V3TA 2BKXA 3MELA 4ER0A 2GRAA 3A7DA 4GR9A 2BBSA 2JD1A 1NQWA 5AHOA 3KKEA 2H2AA 2YN2A 4X92A 4XUCA 2HT6A 3THYA 1C7ZA 3KE9A 4TWAA 5IZCC 4D6XA 3L0CA 1T9GR 2PPVA 1ESMA 5JZSA 3Q1LA 1I4LD 4D8VA 1RBMA 2W2XA 3A1TA 4Z6KA 5HGXA 3QHAA 4GQIA 3G2LA 3TQTA 1PUIA 4LDQA 5JSKA 3JYLA 4QXMA 3WLSA 3WSWA 2WQ7A 4DLBA 4HLNA 2ODTX 3ETLA 1TO1E 2Y0PA 4QODA 2B3TA 3U4GA 4AJ9A 1YBMA 2AXNA 1F0NA 4DDKA 3R8FA 1PS9A 2ST1A 2A0YA 1B8VA 3DPSA 3MJCA 1X7XB 1RJ9B 1ZBDA 2ZI7A 3H11A 1X39A 1TQ4A 1QZXA 3I3OA 4KK4A 4BDSA 5HOEA 3U31A 2ZJYA 4B4OA 3ELDA 3FZYA 1FFXA 4LRXA 4G1BA 4Z9FA 1R37A 2BEVB 4YUVA 2XOEA 2ODEA 4WECA 3U19A 1ZAKA 5HE8A 3N2NA 4AXXA 1RPAA 4P0QB 4N9QA 3KQYA 1Y9EA 3OTQA 5AI8A 3WC4A 4E21A 2ZSHA 3ENNA 4EYKA 5BSVA 1Z5NA 1T4BA 3L7YA 5IM4F 4XOIA 2AJTA 2KM1A 3HBAA 4AP9A 5CIYA 4AY4A 4F92B 3U7GA 1CQZA 1DRKA 1FF9A 4OJNA 3ZY2A 5CITA 2M6LA 3PKZA 1EBFA 3HMKA 4ER3A 2PRKA 2I1VB 1ZD5A 2C97A 3ZLVA 2HB6A 1BE6A 2ZBGA 4ZQBA 3ZCPA 2X40A 3BMNB 2ENUA 3SK0A 5HQ3B 3HUFA 3IP1A 3LUFA 1I5OA 3BE8A 4DJ5X 3ZDYB 3RBXA 1Z0AA 3LDHA 2H7VA 1OKKA 1QH9A 4QYIB 2Q99A 1CV2A 4HWKA 4BMCA 2GSWA 1JL3A 4KFUA 3GD5A 3DL2A 1V45E 5IKPA 1F0KA 1V8PA 1U2ZA 2X7HA 2CFIA 2EGGA 3P4XA 1LVHA 1TF7A 3ZHVA 1IJBA 2YQ4A 1T0IA 1Y4DE 2AG1A 2WIGA 3AVQA 2RJNA 1T4CB 3AHEA 3OEED 3N6VA 3OBBA 3RSZA 1RJFA 3S8YA 4YRFA 2X0JA 3SZ3A 3SR4A 4UW9A 4RA6A 2WU1A 1U8FO 3OTIA 3V9PA 2A9PA 2IYFA 3G9XA 1US8A 3OPXA 4D96A 2EYUA 1Y1SA 4I81A 2XSZD 3OQBA 3VH1A 5KNCA 1I01A 1P6QA 1UM8A 4UUBA 3VC3A 1SXHA 2PHZA 2XVMA 3JYHA 1O6FA 2PJUA 3LRTA 1MR3F 2VBGA 2EGUA 5BMVA 1I6WA 2CHGA 2J33A 1SU4A 3FD8A 2VJNA 4HQNA 4TQ9A 2PS1A 1TM4E 3BF8A 4IKEA 1PJLA 1TGYA 3LDFA 3CUUA 4PLWA 4F45A 3I5XA 1MEJA 2P2NA 1LLQA 2VHYA 3ZTTA 4WPGA 1IY1A 2X6TA 3IAEA 3NHPA 4TN5A 4EG7A 1QORA 4O8ZA 3B3GA 3A14A 1E1QA 1LV7A 1XZJA 2C1XA 1CY1A 2CVOA 2AOXA 4JIMA 2CC2A 3TR5A 3W9UA 3PFBA 1UIRA 2V9ZA 2AOUB 2DWUA 1P73A 5FWYA 2HW8A 3ZU3A 1PS8A 3FYUB 4WLEA 4N8SA 1HDCA 3F4LA 2NZ2A 3Q5EA 4F1WA 1OH8A 4KR6A 3O4RA 1JPNA 1IL0A 3K16A 4R1QA 1B7GO 1N1EA 1A7KA 1VCHA 4H2DA 3VV2A 5A4JA 1ZLYA 2PUJA 2V9CA 3AR8A 1RYFA 2NUTA 2QTBA 2WM2A 4KE6A 4DIFA 4BTEA 1Z0SA 4D9FA 2IS2A 3MB8A 2W11A 5GOTA 3W0LB 2I3BA 4CKZA 3T7SA 2QLJA 3ES9A 4LYFA 5KQLA 3DD5A 5IAKA 1YONA 4MQ4A 1KPGA 2NQ8A 4JNKA 1WULS 4LK3A 4MR7A 4O4HF 3RYTC 3MA0A 4C9BA 1Z26A 3TM4A 1OTYA 1PFWA 2ID9A 2EFHB 1IMOA 2BFBB 3KELA 1YK1A 4BAGA 4BB5A 5H4GA 3SSNA 1H2WA 1V16A 1Q0RA 1YL7A 1RMQA 4GX2A 4L3OA 4M0FA 2H8GA 3IEUA 3A70A 4UMVA 1DE0A 4DSAA 2VP6A 4J2OA 4LJ7A 2C4KA 3SBEA 3ZLBA 1ZI8A 3A36A 3C3DA 2VYCA 3P5SA 4IIBA 4L8WB 1ISFA 5K3AA 4UATA 2MR5A 3I6MA 4RO0A 1GQYA 2RC6A 5F7ZA 1SIWA 3Q4GA 2Q4DA 3JTMA 4EBFA 2FFBA 2AL7A 1C3OB 2ZRNA 2ZB7A 4RPIA 5EIHA 4D9EA 3C3YA 2K4MA 2DPXA 1P1KA 2JFFA 2WUVA 1MC4A 3KCQA 4HEHA 4GYWA 4QQKA 1Z73A 4TXMA 5K51A 3SLKA 3OEWA 1UFRA 1KDYA 4LV5B 4Q3AA 1UQRA 5JALA 2ZAGA 1P39A 5JD3A 2PUCA 4F71A 5KTYA 1Z5UA 4GWGA 2B5VA 4EYEA 4MVJH 2HO4A 3K2QA 3Q9UA 1FQKA 4JJ4A 4ERXA 1MHPA 1QQTA 3PQ3A 4RZSA 2FRVA 1QIJA 3EWAA 2X4LA 5K3BA 1YJAA 1U5BB 3HTXA 2MSLA 4IDEA 4LISA 1D2HA 3KJXA 1T91A 1TZJA 4CDRA 3C1AA 5BSRA 2ZPUA 1U2GA 2Y1FA 4FU0A 4HR7A 1N92A 4RADA 6GPBA 2DBVO 1ILWA 3AW9A 5EWMB 4ZVLA 3K70C 2JANA 3NUZA 3DE6X 4OATA 4R31A 5KO2A 2HLNA 3IAUA 2BVNA 3GFSA 4X90A 2QUJA 3U4QB 2GM4A 3VNUA 1DBQA 1UPFA 2IYSA 3CPJB 3H2SA 4Y9RA 2DFPA 2RAUA 2V3WA 3NHBA 2CYBA 3C39A 4JJIA 4YWHA 4EJSB 4EGAA 4NDNE 4Q7QA 2O1EA 2PUGA 1W35A 2ZTHA 3DKRA 4LTDA 3FCEA 3NTQA 1JYSA 3ZE8A 1DCKA 4LUCA 4WXYB 2CZQA 4KX5A 3AIOA 5DNDA 4NATA 4HVLA 5J58A 2DLNA 2VC2B 1G4AE 4RIIA 1BD3A 4XXHA 5CVJA 5ESDA 3K31A 3TNLA 4ARIA 3EUFA 1N2OA 4XR4A 2ACEA 3BAZA 3EQZA 1EWKA 3SC2A 1YACA 4B81A 1Y4UA 3F4KA 3FR7A 4MQEB 3ZDXB 4RFSA 3DAHA 4D99A 2W2QA 4F56A 1SXJC 2GK6A 3FVQA 2I33A 2JZOA 1I3OA 3I9KA 2BD0A 3L7DA 1MX5A 2FJUA 3UMGA 2ODWA 4LDJA 2EKDA 2QE6A 1FJHA 1X0VA 1ZRNA 2VDWB 5B57C 6YASA 3HCRA 1IQ0A 2DSNA 1TYAE 1PFQA 2IXGA 3MT7A 3U40A 5DWDA 3M4ZA 3C8DA 4MK4A 4E09A 2GUGA 5A9SB 1HFWA 1AXRA 3GDGA 3PA8A 1GQFA 2F1JA 4DEXA 1KQPA 3QPVA 5IJ0A 5T5QA 4ER7A 2J32A 1JXQA 1ZCBA 8ADHA 4ZI7F 5UKDA 4HMOA 3EZXA 4OHUA 4O4IB 1C7EA 2E5FA 2PM8A 3D6VA 2C3OA 5TGTA 3SBOA 5CFOA 5L7WA 1N7IA 5IX8A 2BTEA 3D3QA 4KH0A 1F7VA 1ZN9A 4OFXA 4C4SA 5AJVB 4LCJA 4FNAA 10MHA 4A8JB 1DXHA 1ECGA 3F5DA 5DCUA 4ZHSA 3F9IA 1OBFO 1NXPA 4URVR 4W7HA 4EFMA 4FILA 2GETA 4UXJA 4HLUA 5LOVF 2BBTA 1DO2A 3BJIC 1B6RA 1H94A 1JQKA 1H6DA 4R8KA 3NGMA 5F7JA 3C3EA 3QF4A 1SBTA 3GXOA 3TLBA 1KYZA 5ICSA 2IOFK 2YRXA 3W90A 3A6PC 1W8IA 3EUWA 3F6YA 4IMPA 1KFEB 1ZRHA 1K8QA 2W5UA 4O4JF 5IDVA 4DJFC 3OIYA 3B70A 3TGPA 2C95A 3AO0B 3WL5A 4CU2A 1IM8A 2Z4RA 1W94A 2JVKA 2C2YA 1DJPA 1ENYA 2A9RA 4HDKA 4HYEA 4MV4A 3S2EA 5JARA 1G1MA 4HZIA 4KRXA 5DRYA 1U6KA 3PFKA 3PJRA 4RX1A 4Z4FA 1KARA 4KR0A 5AT1A 5DHFA 3VR4A 6Q21A 1CJUC 3CYFA 4KSYA 4BMXA 4GO1A 4QSHA 3TR0A 3ZTYA 4YWJA 1I7LA 3CLTD 3BULA 1TZ2A 1Y1QA 4ILKA 3I37X 2PL3A 5E6RA 4UMFA 1UF9A 4CM7A 3VNVA 1U1DA 1XD2B 3GGDA 3OF5A 2IU3A 4Q7EA 5I9TA 4E30A 4F2HA 4X1YB 3OZRA 4DIEA 3GPDG 1JEQA 3O31A 3B1ZA 3QVGB 2YNMD 4BVKA 2KE5A 3OOYA 2VDLB 3UXEA 4D3YA 2IYVA 2ZRIA 4M1ZA 4UTPA 1ZICA 5AI5A 3QXCA 4JR1A 1Y1PA 3KPWA 4J1TC 3CLSC 5TMBA 4RJTA 1VGRA 1VL5A 2EU8A 3GA0A 3FBWA 2AMVA 3L1HA 2X0FA 3BXEA 4YQZA 3SOPA 3TF5A 3CNBA 2FPXA 1KI2A 3CHYA 4YN3A 1YGYA 4DEVA 4BMYA 2Z2ZA 1C0LA 3O93A 3VBCA 2OAP1 3K09A 4LF9B 4L2IB 1T15A 2NVBA 1KGSA 2Q3LA 2Y1CA 3FTEA 1RADA 1NHWA 4Q3NA 2DFDA 3RIEA 3CLKA 3PTZA 1RBZA 5A5DA 1KI4A 2VI5A 1N8NA 2B37A 4Z4CA 1S2NA 2FQWA 4EITA 5JAPA 2X3YA 1NVUQ 4K6CA 3WGVA 2II6A 2GCEA 2OGTA 4UHKA 3DW3X 4NCAA 421PA 1D0SA 2R7KA 3TE6A 2XA2A 2FZWA 2RFLA 2XGOA 3KAPA 1SQFA 1UWKA 2C5AA 2HA6A 2I6TA 3D6UA 3O1JC 3WICA 3WWZA 2PX0A 1KOLA 4CV1A 3ED5A 1LWNA 3QKUA 1UJNA 3FVTA 4GPBA 1Y4ZA 2JW5A 2OPHA 1U2SA 3JS5A 1GPKA 3TFQA 4DLTA 1A97A 2Q3FA 4DY4A 1E2QA 2VATA 2WKPA 2YWRA 2UUAB 5GZ3A 4Y6LA 4GC5A 3SZOA 2EFYA 2LNDA 1BOOA 1IYZA 4HN4B 4DUPA 5K0SA 3UHFA 3L6CA 5TX7A 2GILA 2FZKA 1RCTE 3SXUB 3WYNA 2V54A 3F2VA 1TC2A 3FYUA 4CETA 3DXYA 1OIVA 1IDOA 5M3BA 5LL6P 3AJDA 4NENA 1CUFA 4ZQCB 2W70A 3CCFA 5CR9A 3PHCA 4I3FA 4Z1MD 4XM1A 5A03A 1SZPA 3BL8A 3OZXA 2ETVA 3A4MA 4R6XA 1L1FA 1ZK0A 1TQ2A 4J3FA 3EXEB 2ISQA 1RKBA 4F46A 1U7DA 4MVJI 1OH5A 1U98A 2BH9A 2HBYA 5IJ9A 5KC9A 4QBIA 3F67A 4GKKB 2ZYWX 2AMLA 2X9GA 4KQGA 4DV2B 1XLVA 5KJCA 4L3WA 4BXOB 1M1UA 1ZIXA 2H08A 2O07A 1H6AA 3OSZA 3VU9B 3Q88A 1IJFA 3H3JA 2P3OA 2IV7A 3U6KA 4X1YA 1NVTA 1P77A 4TT8A 4PAQA 2ZRAA 3JQCA 1T9GS 1PO7A 4R16A 3RKSA 4G36A 2F8LA 2JRCA 4AX8A 4F9EA 3HUDA 6ADHA 4IJ5A 1BA3A 5B2EA 1EJ6A 3LSTA 3ERCA 2SKDA 3ZXXA 1Y0BA 4MVJG 4L0DA 1E79D 1NW8A 1XTSA 2ZWAA 2XWPA 4X3CA 4Y9TA 1O95A 2H1LA 3VSDA 1UZNA 5DASA 4ABYA 4B5LA 5K8UA 2CK3A 3TD9A 3L1KA 1B4DA 1GPNA 3F3KA 3KQSA 5FOTA 1NAHA 1ULTA 2W2VA 4DZRA 4ZVUA 2IHJA 5T8KA 5JI3E 4HFRA 3GBVA 4FOOA 4D57A 4HT3B 3MGKA 3VAYA 5K4GA 2ZTMA 1SWVA 2R48A 3H11B 1B2LA 1RAFA 3N2KB 3NJ8A 1JDPA 2D2VA 4YV1A 3HLTA 5EN4A 2OCAA 4J29A 3TR6A 1T24A 2Q1UA 4CIWA 1JS1X 2IQIA 3QKRA 1GRQA 3RU2A 2CHEA 2XQIA 2OR3A 3M1AA 1X1TA 1DAOA 2H4FA 2CBGA 4GXTA 4LECA 2YY5A 4Q15A 2IXBA 1GSHA 3MLAA 5EL0A 2P9BA 3TJMA 2YZ7A 4PGGA 3IUJA 1NQ5A 3ZCQA 2WICA 1PJBA 2C2XA 4OSOA 2AZMA 2XB4A 3QKSB 1UXJA 4NENB 3TN7A 2PN1A 3KT6A 4KMMA 2C31A 4QBHA 4LFBB 3L4EA 2FQYA 2GJ9A 4L72A 4BMSA 3EA0A 2OORA 1KK0A 3NR2A 5A4DA 5M34A 2V7GA 4A7PA 4OGLA 3OLYA 4FW9A 4CRWB 5CLLA 3KBBA 1M66A 2VA8A 2HAEA 2X15A 4KIFA 1YB6A 3NGXA 4I50B 5EI5A 5GPBA 4RM3A 1YBFA 2C61A 2ZWOA 3K35A 4B48A 1WS6A 1TAUA 1JA1A 2BCJQ 1HL7A 3OQ6A 2VJKA 1IRIA 4CM4A 2YL2A 5DNEA 1YI0A 5HHTA 4B8WA 1C0PA 2VJDA 4GW3A 3AHJA 4DNFA 3GVCA 2FZLA 4LXQA 4Q1AA 1JHPA 3CZMA 5LA6A 2WWFA 3BE5A 5H70A 1NJ1A 3OLCX 5E38A 3NHAA 4J94A 4PZDA 1NUQA 4AF6A 3LPDA 3MJFA 5DM0A 2OV2A 3HKBA 1O08A 1OZ0A 1KY5A 2JFBA 1Q1QA 3NDIA 3OWHA 4JI5B 4CLOB 3ZWPA 5FTJA 3CUWA 2C1ZA 1I1OA 3VMMA 3KQTA 3RUDA 2Y1KA 1QU2A 2LDBA 2J09A 3PU6A 3VKHA 1JT9A 4YRGA 4MQFB 4AZ3B 1HY3A 2DHCA 2PSFA 3JCZA 1I2AA 5BSUA 4GE3A 5F78A 4UBMA 2PXCA 3ETJA 5B5SA 4KWIA 2P1ZA 4BFSA 4WY8A 1QQ6A 4I6EA 1GGHA 1OTXA 1V8ZA 2UDPA 3AJ8A 4I1RA 2PUBA 2XI4A 4FYPA 1YJBA 4JVMA 1SUCA 3KTDA 3L6DA 3BHIA 1XCLA 3PG5A 3IV9A 4FGLA 3C1UA 3IUBA 1MQ9A 4N0PA 4Q1CA 3K9CA 2NGRA 4RHYA 4HS9A 3K6SA 3IEVA 1SNYA 3A4NA 3BWMA 4FR0A 4P3YA 5G1PA 1WXEA 3ZHTA 3Q40A 4Z7JA 5A05A 3AEYA 4DV7B 1KERA 4IO1A 3D6FA 4UUMA 1OXKB 3RQSA 3M1IA 1AZSC 4NMMA 4KOEC 5T4BA 5JO0A 3N2YA 5FAKA 3ADDA 2X76A 1RRGA 1YQUA 1QYDA 4QOFA 4H7EA 4ND5A 1T5IA 3S29A 2VF7A 4WNCA 2J9RA 2ZBEA 3T38A 2A1TR 1M74A 1CZHA 3HGQA 2NZWA 2EGHA 5IDYA 1RXSA 1XA0A 2F43A 3LY5A 4UCQA 5EP2A 1NDHA 4MVXA 3D6TB 4RSGA 3W2IA 2PUVA 2JIDA 3EXIB 4NZ9A 4PZYA 3ROKA 5A3QA 1KO5A 1TUIA 2IPMA 2X1LA 3T7IA 1F2UB 3WNDA 3UMVA 2Y1OA 4GNRA 4A8TA 1G7RA 4GVPA 2JK1A 3CB2A 4PTYA 4QNMA 1CJVC 2O2XA 1QAQA 4TKVB 1X1BA 1JU3A 2AG0A 1MF7A 3FZQA 3MT9A 1EVYA 4E13A 2I6UA 2KBEA 2B61A 4C6TA 4DB2A 3KKNA 3MOIA 2OILA 4ENUA 4PSUA 5JCOA 2VWHA 3BL6A 4KLAA 3IJ5A 3NUQA 2ZWIA 2HNKA 3AHDA 4ZOCA 3WB9A 3E3LA 3NDBB 4CKWB 5L40A 4C4TA 1K9SA 1NUHA 2EF0A 3TD6A 3A1DA 1QRSA 4F9TA 3WB1A 2F3UA 3KKQA 4DR3B 2VDNB 4UFPA 5FWXB 4D92A 4W1QA 2AD5A 3L1IA 3Q7QA 4QYIA 3BBLA 4O0LA 1YHZA 1ADCA 2DPHA 4PZCA 2BGJA 1JMVA 3F6PA 3TRKA 1PL6A 2FFRA 4H1WA 1GL6A 3V5NA 1EWRA 1P5FA 1WQ1R 3A1WA 3QYFA 1IWPB 2O14A 4YP7A 1PGPA 1U7HA 1TJYA 1GZ6A 1W75A 2AEMA 3UQZA 3UT0A 5JAIA 3PHGA 1XWFA 4R1UA 3RC8A 2PL9A 1HK7A 5AI6A 1E8DA 2VDUE 4P53A 4HDMA 5HCIA 2CL6X 2TMYA 2PGXA 3BRWD 5IPFA 1GPH1 1RS0A 3R7WB 1BSVA 1VJTA 1LDYA 1DEXA 2EZTA 1J6UA 2V8OA 3HC7A 3OC6A 4MDYA 4WZ6A 4KNYA 4N76A 1P8AA 5AVSA 1RXVA 1FFHA 2A0UA 3SX2A 2W4IA 4ZTZB 2Z98A 3DCJA 3EOZA 4AUEA 3ITNA 4CFZA 2WTMA 4KXVA 1LXCA 1E20A 1JLLA 2I66A 2W6MA 4HH3C 5DU2A 3AESA 2CUKA 3HE3A 3RS9A 2W2KA 4GICA 3BXPA 5BN4B 2BEKA 5BUSA 1EK5A 1RI5A 2WSSA 5EWMA 1PDWA 1VLVA 3C74A 2FPOA 1CRLA 4G0UA 1EBBA 1LV8A 3RSLA 2OO7A 2W2NA 3JD1A 3FW1A 2HPZA 3X3HA 3BGIA 1EI9A 4BNFA 4ENWA 1Z63A 2CL0X 3GT3A 1CQXA 4EJSA 3FHJA 1CQWA 3ADPA 1SCIA 2EIXA 3L77A 1EVQA 1DBRA 2FWBA 2C0PA 4NQZA 3T9CA 4C4XA 4UHJA 1WMFA 4TV8F 1UIMA 4WKCA 3V4SA 4AN0A 2YYZA 1Z5OA 1YFKA 3HU2A 1YKFA 4PZPA 3RODA 3AR7A 3N7TA 1Q91A 1YB2A 2XNJA 2VQ6A 2UYHA 1MJFA 4ZKDA 4K9MA 4QPCA 1LKZA 3UIEA 4BNYA 4HOYA 2XMCA 5TQ2B 2VP5A 4J9VA 4FKBA 4BBJA 2Y6VA 5EUCA 2HK8A 2R68A 4FFMA 4JASB 3CBGA 4B75A 3DVSX 3M6XA 4N3AA 5CD9A 3UJ8A 1YOBA 3RREA 4QPPA 3UA3A 1PBNA 2R44A 3QUTA 4KG7A 3AUSA 2NSHA 3L8YA 2I4IA 4XGRA 2BKUA 4E4YA 1HI9A 2DCUA 4W82A 2O2IA 5I9SA 3CF4A 4K9NA 3RUAA 3CVJA 1M1NA 1GZSA 2XDWA 1DJNA 1XI2A 3ANXA 4ICIA 4LVCA 3UCFA 2DQYA 4JP5A 3LZ6A 4V24A 1N5IA 1NRJB 5KI6A 3AFHA 3M6WA 4HFMA 3K09C 3QWHA 1QCDA 2IHTA 3ZQUA 5B30A 1F8GA 2RAFA 5B64A 1AHIA 3C4JA 3THXB 2H92A 2N3ZA 2P6UA 4IQ0A 4WX2B 5DRTA 3Q7EA 5EG5A 1IOZA 1BX3A 4ML3A 4CHGA 4YBRA 2ZYDA 2BI8A 4PSVA 5CDFA 3R9IA 3SYKA 2PKRA 1V7QA 1XWWA 4KOAA 4PINA 1E89A 4DCUA 1GRCA 1CJCA 4QA9A 1S9DA 4RH3A 1K3UB 1OZAA 1R66A 2EW2A 3OUUA 4AMGA 5DCWA 4M1EA 1GUAA 1UK6A 1Q6ZA 4QHSA 5TQ0B 5HXAA 5JH7B 1CFJA 5IVKA 2J9YB 2AQ8A 4MV8A 3FNHA 4RUKA 1R7RA 2JFGA 2QTFA 3AI7A 2C20A 2W9XA 3UYKA 2L69A 1SBIA 2OL4A 1KU0A 4PAWA 2G8NA 2FY8A 5LN1A 4LJLA 1ECBA 1N3BA 1NMXA 4JBIA 1D0VA 3BGOS 3SIXA 4Q24A 3V42A 2O8BB 3ELWA 2NVOA 4B3RB 1YKGA 1LA2A 3K9WA 3WGHA 2QTLA 1GFWA 4TZ0A 5HQTA 1QGZA 3CLUC 1JPVA 2RGGA 4NCIA 4Y8VA 2GPSA 2O5VA 4DKXA 1U3UA 1YS6A 2XITA 1U02A 4CMCA 3DE7X 3PXUA 2BDUA 3IHKA 4UM8B 3VU3A 1ZY2A 4BJ5A 4KMRA 1P18A 1NBMA 2IP4A 3D6HA 4Z3OA 5I8WA 1W87A 3X1DA 1ZK4A 4B6RA 1I8TA 2CWDA 4YCCA 2HIHA 1O0CA 2P75A 3ZZNA 1NVFA 1Q19A 3T5TA 4MVCA 2PNFA 1NSYA 1KDRA 1X9GA 3A1UA 3KU4A 2ZIXA 4RQBA 3NC4A 2ZU6A 5LA6F 1GG8A 4A8JC 2VDJA 2JC3A 1M67A 1UT8A 2PJZA 3BKWA 1RP1A 2XRFA 3GOHA 3KTAA 3EULA 2HRRA 1FJ2A 1ZJWA 2B8WA 4D0NA 1MORA 3OU2A 2OXIA 5L95A 1T8WA 4YDQA 2CXSA 3HGTA 1DEHA 2GHQA 3HM2A 1VHTA 4RQTA 4REQA 2D0DA 2J0SA 5JECA 4R2IA 1GLNA 1OLSB 1SCAA 1YIDA 2Q6OA 2XXJA 4URZR 3DOHA 1JQ5A 4I5DA 4MUNA 3O38A 2BFFB 1F2TB 5CBPB 3CCBA 3O8OB 4E5DA 5B3JA 3R9KA 4XRGA 1P0CA 1TGVA 1GPUA 4LHZA 1GCUA 3JD4A 1GGMA 4GAEA 5IP5A 3HXOA 1YTUA 3ADBA 5E3IA 1BHQ1 1DU4A 4JQSA 2I4TA 2ZSIA 4G1VA 4JOBA 3D1JA 1CY7A 5FP0A 3NU1A 1CF4A 2GCIA 3DXZA 3OX4A 2Y9MB 2FQXA 3KUXA 4ZXPA 1UOPA 5ICMA 3CVWA 4JEUA 1I30A 3B1XA 5AQ1A 1WUYA 4D6YA 1YJXA 2A9OA 4ZODA 4ZICA 5DM1A 2FUEA 3M81A 2XT9A 3KSMA 1G0NA 1O2DA 5IBRA 2IH5A 1RC1A 2DKOA 2XE4A 3B36A 1CR2A 1VP3A 3KYCB 3FCXA 4HBZA 2IDZA 1DIOB 2XYQA 5BN5A 5GV7A 1BTOA 4D8XA 4W5OA 4RVNA 1LZLA 3C0KA 4UBOA 2H1IA 3X1WA 5K2OA 3WLAA 3O73A 5TDHA 5JWRA 3SF8A 1I7NA 1NU8A 1I4TD 3AY3A 5KVAA 1CQIA 721PA 5FPPA 2V7BA 3VYWA 4W1RA 4YPOA 3LK6A 4JJAA 5CM9C 1ZNZA 5JMPA 4A3SA 3MWLA 2OA0A 5FQNA 1DOZA 1E7YA 2GO7A 4TL6A 2O6HA 3DTVA 2AE2A 1U8TA 2XIQA 2AVNA 4EHHA 4C7BA 3E7WA 5TQVA 1RU3A 3X2FA 5AM5A 4AROA 1HNNA 1XLUA 5BUQA 3CT4A 1NNEA 3I04A 4Q7JB 3BMQA 3EVTA 4WACA 1SY7A 2CXTA 3QFCA 4ZFNA 1FRFS 4BVLA 2HLDA 1VPLA 4Z0PA 3WDKA 4Y7CA 5JZBA 2MDTA 3IMGA 2H17A 2P35A 4GR4A 1XMQB 4K0KB 1I7DA 1DUIA 4PF1A 4LSWA 2Q7DA 3EMVA 1M2NA 3AWIA 4L6CA 4BZZA 3O75A 2V03A 2QN7A 1E4OA 4Q4LA 3L0IB 3IO5A 3IQWA 2VOEA 3V1TC 1WXWA 2WUGA 3GQVA 3NNDA 1ODKA 1ADFA 2XMZA 2YDXA 3CVUA 3OPYA 5ALGA 5BSHA 4AUNA 5TEWA 5B12A 3ZS8A 5B4VA 5B3JC 1WR8A 5CA0F 3VVCA 4A9AA 4IDDA 4IOMA 4DWVA 1CTQA 1BWQA 3RUEA 1I33A 2HWYA 4RTLA 3OM9A 4PAMA 4DSOA 5DSTA 5DF1A 5F5NA 2XUAA 4UZSA 4MYRA 1CNEA 3DDWA 3AR6A 1ZEJA 2AN1A 4LV6A 3OPQA 1P3Y1 5G41A 3ANNA 1WDTA 4BP8A 4EG5A 5JCPA 2W22A 3NEJA 2ZRCA 4I14A 3LA6A 2GSDA 4QYMA 3QPCA 4NJOA 4ZCTA 3V9AA 1QX4A 4L95C 2QYHA 2EIHA 1YQEA 4Q3BA 3K9GA 5AH0A 2GZRA 3ZZMA 4K6FA 3WK8A 1VMKA 5K3CA 3VDNB 2X42A 4AI6A 1PR6A 4TYPA 3K8ZA 2QTWB 3N05A 3KYBA 4II7A 1WVIA 5FPSA 3T41A 1DAIA 4IF4A 4KQKA 3WTBA 2BKVA 2PGIA 5F2OA 1BKDR 1IEVA 5IN4A 1YQWA 4CCSA 3GW8A 4GIBA 1EHIA 3DT8A 1BU5A 4TKMA 3DEYX 1GA1A 3RC9A 3WZMA 5IW8A 5F23A 4X7MA 1NJ5A 1Z36A 3A1EA 3E05A 5AUOB 4F3YA 3PLAE 4QTXA 4F9FA 5CD1A 2J3IA 4Y67A 4TL9A 4MEJA 1A2QA 4E5KA 5AKEA 3CX4A 1HORA 3L4JA 3JQPA 4BWYA 2XUOA 4PHFA 2O8CB 4FEEA 1BW9A 2GYYA 1CG6A 2I4OA 5JD4A 4MUBA 5TQ2A 4ZCIA 5EGNA 2B20A 4KO8A 4MQ5A 4QX6A 2NV2B 1UKAA 3JV7A 3K0CA 4MMZB 2E4WA 2D13A 4XD7D 5H83A 3LUBA 1T1SA 2BEWA 2NXEA 2R3SA 1ORDA 2ECOA 1IXKA 2QI9F 3GRVA 1OBVA 3VSAA 3ZLTA 1BXZA 1DKQA 1PFVA 3KJGA 5JJLA 2G8LA 4K05A 5BSKA 4CL3A 2QWXA 5MGBA 2WVAA 3ETCA 4GZMA 2C7PA 2BSQA 2QJOA 4JOQA 4ZV9A 2CHQA 3EZGA 3R3UA 1RYDA 2QV0A 3DR5A 2B4YA 3IH5A 3UCXA 4AN1A 2GEBA 4CCYB 4NJEB 1U3VA 3L04A 3I9LA 2XXBA 4U2GA 3WGJA 3S1SA 4TWJA 1YRHA 3HLYA 4GRDA 5FB3A 3E27A 3KXPA 2C58A 4XVRA 5ALEA 1NLZA 2FZ4A 5ALJA 4L8VA 5HUHA 3ZXUB 2HYIC 1USKA 2FYTA 1DT5A 3ED1A 3LTEA 4D0GA 1IEXA 1QPGA 3PNSA 1M2OB 1R12A 1SIBE 3S0JA 1TA0A 5KJFA 5K8JB 3QX8A 3H42B 2JI7A 5AUNB 3A2NA 1ZHHA 2RE8A 2O48X 3FNBA 3RRFA 2H2IA 4BFTA 3ANMA 2P6PA 1X74A 5IM5A 2H1WA 4YRAA 3CV3A 5DNWA 4Q0MA 4DDVA 3AG5A 4K9QA 1SVIA 4JBXA 2IDJA 2JGNA 2V6IA 2IKQA 4UTNA 2OCGA 1E7RA 2QVGA 1DKMA 3DT9A 4XWGA 1H9CA 2FPMA 1UOEA 3ICWA 5CDGA 2AOWA 4OHMA 4BRZA 5FUQA 4Q66C 1AHPA 1XK6A 1NMQA 3EOAI 4JZYA 2IBMA 3S4YA 3QLVC 4MKFA 4KLRA 2DMRA 2ZBFA 3G5LA 3IUEA 3JY6A 3PUYA 5JHGB 3N58A 5AW1A 2JLWA 4UNPA 4C7VA 3ZWDA 4HFJA 4ISCA 1P31A 1TT5A 4G97A 1QCZA 4LS3A 1QZZA 3FCCA 3QUSA 4PFJA 1NF9A 3PUXA 3QGMA 4QD3A 1XZPA 4IH9A 2VK1A 4AZTA 4B3FX 5LCXA 2VF8A 4V2IA 4LXXA 4HQFA 4EH1A 2IUEA 3GFGA 4DS3A 3AX6A 2M6KA 2JDIA 4JC5A 4YTEA 1W88B 2ZWPA 1JKJB 2I4MA 1G4UR 3CH4B 1OT3A 3DV2A 3COWA 1FDWA 4X7RA 2WKWA 4JMLA 1DG3A 3UANA 4QFCA 5TEVA 3UOGA 4K5QA 3KR0A 3GH3A 4ZTBA 2PE5A 5HRAA 3IEKA 1LC3A 4J0FA 3WR5A 1J8DA 1N9GB 3STHA 1N1GA 2HA4A 5IK2D 1P2UA 1X1EA 2XLCA 3JWIA 3PWTA 2WSBA 1TMGE 2IHYA 5FTLA 1VG8A 2I4RA 2JAPA 1ECLA 3STYA 4LXYA 2HHHB 2V7WA 1CY2A 3GLQA 2CLLB 6ABPA 2YBEA 2DBYA 3C85A 5K6RA 1O6GA 1L5OA 1GEGA 5KNDA 4FX5A 1ZK2A 1DC5A 1L2TA 1QSGA 2AKAB 2ZQZA 5IJAA 1WMDA 4H1TA 2CYAA 2P3SA 4AO6A 3W5AA 5A0VA 3GRFA 3Q41A 3FDXA 3QMMA 3FRJA 5IYZF 4KQIA 2WG0A 2OMKA 4L85A 1KZ9A 1ZWLA 1SK8A 2M98A 2NX2A 3ETEA 4BBPA 2AEFA 3DF7A 4L27A 2XDQA 2JI6A 2GMWA 1IEWA 1FDTA 1WP4A 5HKOA 4W63A 3UCEA 1E3TA 2D3TA 5T3YA 5BW8A 1UINA 5K0BA 4V1CI 4C5BA 2Z6AA 1MHTA 1ZMOA 1PJ4A 3BSWA 3E4CA 4F8YA 4TPKA 1TCAA 1TPYA 1U4OA 4IJUA 3K0AA 2JIQA 2ILTA 1WSDA 1XALA 1AS2A 3CX6A 2HXSA 4CWAA 2X8JA 4E5SA 4N0MA 3AHGA 3L8MA 1MTOA 2ARKA 3DP7A 3ZU2A 3HO1A 2FEAA 4F2WA 2RI0A 3ADCA 2QXTA 4LMAA 2DOKA 4QQFA 3Q8KA 2RSLA 1H69A 3RVPA 5KX5B 1CJTC 1YVPA 2Q41A 1H05A 4C0BA 2IOFA 4Q48A 5DO9A 4NOMA 5F1PA 3V1MA 4C6RA 1NR1A 3K6JA 3VKUA 4OHYA 2F3SA 3RRYA 3PXBA 1HE1C 5FPHA 4IWXA 3GLGB 2X9LA 2IHNA 1U0SY 4L9RA 2KS6A 1MDFA 3PBKA 3SSOA 2VHVA 4B74A 1CWUA 3GNSA 4OXQA 3W7AA 3WKAA 2XECA 1BROA 2NO5A 3GX1A 4MQBA 4OBEA 2GLTA 3GMDA 3IQFA 1T2DA 5CG1A 3HEAA 4G0WA 2QNIA 2IYQA 3EH1A 3RK0A 1R88A 2DGDA 2BN4A 5JPIA 3IAS6 1RM5A 2UUPA 2B1JA 3EMDA 1HF3A 2HMYB 2YX1A 3ABRB 2GM3A 3PEUA 4HLQB 1WF3A 3D9QX 1B2RA 2C98A 3HDHA 1Q3TA 5K8CA 2UZIR 3QSGA 2DETA 3NTXA 4UBLA 4HWTA 1VA5A 5JPCA 4FUQA 4M0KA 2XMGA 3FMVA 3NGLA 3HB4X 3OZUA 4RK0A 3I9V1 5ARCA 1ODLA 2C2MA 3RCBA 4XDYA 3BE6A 3MTDA 3RSCA 3SE0A 1QHYA 3WADA 1ESNA 1XDGA 4A5SA 1QQAA 3WRXC 2G1KA 2O8FB 2DT5A 2ETXA 2C3MA 2HGZA 2RGNA 1I94B 4QQNA 4WNAA 1RQLA 4FHEA 3R7SA 5DX1A 4DQLA 1VL0A 3ANYB 3O4FA 4A15A 4AQ7A 4OP2A 1CUBA 2YOFA 4NI5A 5THXA 1DX6A 3SHQA 1L5SA 2IL1A 5JZVA 3TZLA 2JFOA 3WWEA 1HOXA 1GZUA 4MPDA 1WMBA 4M55A 5ITVA 1W4AA 2ZROA 1FLDA 2ZWMA 1I32A 1MLDA 5ITWA 2CCGA 1KVSA 2IV2X 2QY9A 2VCEA 2W4QA 4PQFA 1WKBA 2OV1A 2WIDA 4YMHA 1CULC 4ME6A 3GLFE 3CU5A 4CEJA 1JLLB 1ZDMA 1LLFA 1R15A 3NAZA 1KSHA 4KXQA 4LJ9A 2WR8A 5E7IA 4GEGA 3UWOA 4XD7A 3DLAA 1XDDA 3AH8A 3ZG6A 2N9UA 4KQ9A 3WK4A 1QDUA 1GDTA 3FJYA 4B31A 1FNNA 3HYSA 2WYVA 3S28A 4DRXB 4LSZA 4LJSA 2RHLA 1SC9A 3WISA 1WEHA 5ILOA 3UMBA 1ZGJA 3W5CA 4KPYA 2H9YA 1BO6A 4BNJA 3RKRA 2XV1A 4PYJA 3QPDA 2H4HA 4M8IA 3S8MA 1SCQA 3PC6A 1GTVA 1XTTA 1HLPA 3G0BA 3M2TA 3P96A 3QVOA 5DZSA 4CW7A 1XF9A 5T41A 1MCZA 3P0IA 1O95D 1PLJA 3AKDA 1SOWA 3PC8C 4I66A 4Z5XA 1EM8A 3ORRA 1KFBB 3OT4A 3C5HA 4F4HA 5I51A 3QSYA 3DFZA 2DSTA 4TT3D 1PRYA 1A5SB 5BV0A 1D1SA 1ODSA 3N9IA 5KDOA 1KI8A 4LNAA 4K3UA 3D3WB 4BFUA 1NW5A 5L3RA 1F14A 4LE1A 4AAYA 4EATA 4RENA 2C9ZA 5A6VA 1QHIA 2FR8A 2QQ5A 1QJCA 3HCOA 4GBGA 1PLLA 1NXQA 4ZGBA 5ALRA 3MBKA 3NAGA 4BCCA 4OX9Y 4PRLA 1OLOA 2Y71A 2OWEA 5GZ6A 2WT4A 3R5JA 5JI2E 5IM4A 1YR9A 4PCLA 3TLGB 1EH5A 3ZDEA 3JVVA 5MF6A 2BE7A 2YN0A 3M70A 5C81A 4DV3B 4LFCB 2XYRA 4L0QA 2BHTA 2VG8A 5JR3A 2J30A 5JRZA 3M3HA 1RDFA 4F5ZA 3RFCA 1VGQA 2QRHA 1FDIA 1E3WB 1DX9A 1HKHA 2IOYA 3JWEA 3KWLA 5IC5A 2C2OA 5K6AC 5MFZA 1J1IA 4OQXA 1NR7A 4AYTA 3TRHA 2SKEA 3ZCTA 3A6LA 3O2QB 1SZDA 1XTPA 1FE8A 3FPEA 5BN5B 1SKAA 1QK3A 2HOQA 3D8UA 3NXKA 1TTQB 2W83A 2PANA 4LZLA 4UUAA 1FRZA 1L1RA 1VLJA 1ZA2A 2DFLA 3CEJA 2PZMA 5A6SB 4EKDA 4ALJA 3PUIA 4FQ5A 1BJRE 4L5IA 4LRSB 4ZMRA 3QFHA 3AF5A 3L3BA 4U7WA 4AUMA 3KP1A 3M5CA 3QRWA 3MJ4A 3U44A 1J7JA 3PNMA 2CDAA 1SO8A 1U9IA 2G70A 1QK4A 4RSHA 3D0QA 1BVRA 2PGNA 4OGGA 4TKZA 4U2DA 2IODA 2P9TA 4D8YA 5KHOC 1V1JA 3SBXA 3LP6A 3R7BA 1N2GA 1PV1A 4C3ZA 5DLQC 1V6CA 1E69A 3EW9A 5LP6B 2OUKA 4A92A 2D00A 1WB5A 2BMWA 2FPGB 2HK9A 1T36A 3DC2A 3SJZA 5EE5B 4BJ3A 4RTRA 4CIYA 1G8PA 3ZZUA 4J1QA 3W6OA 2Z43A 4PRKA 5LBTA 1O0BA 2H2GA 1SUSA 2CFCA 3HVRA 3IKLA 5HSGA 3AILA 3GT7A 1G66A 3VDQA 1UMDA 6CHYA 4F93B 2ZCVA 2O3SA 5LQRA 2VNAA 2YNMA 5GONB 2UYGA 1Z35A 3EVAA 2IIVA 4AS2A 3ONWA 1MB3A 2HYDA 1VSUA 1U0EA 3PFIA 1PJZA 1XPUA 4AG3A 4B2LA 4EB8A 1KI7A 4GI7A 5JH7F 2V7PA 2VXCA 1VYHA 1GFZA 1M72A 3DDSA 4OFZA 5T64A 5K5EA 1RQPA 4X8MA 4RIFA 1YZQA 4REQB 5HNKA 1M8GA 3V7YA 4GGMX 2RD2A 4KHPB 3G5UA 3UGTA 2NNWB 3VR4D 1XMOB 3DXXA 2QY6A 4FHCA 1UT6A 4EF4A 5EIOA 3ZPXA 3KVOA 5EKSA 4CG0A 4HZUB 5JYCA 5HMLA 4ZOAA 3NEYA 4QLBA 3KSBC 5I4CA 2WJVA 2G06A 2D5BA 1DT3A 3PIIA 5DOZA 5BXYA 1PJ2A 1R16A 3PVZA 5K05A 4JYBA 5MN4A 2P7IA 2WJGA 2BLLA 3DC7A 4KK3A 4FGSA 2OCKA 2B98A 2VQSA 4P4UA 3TG8A 1L8LA 1PD0A 4CTJA 3R74A 5DN9A 4NMHA 1W34A 2X0KA 1AE1A 3CW9A 3T9BA 3HM9A 3OOEA 1ZD3A 3EDQA 2D1TA 2MSKA 4HWSA 5ALPA 1PDOA 4NPCA 2H54A 1TTHA 2HMUA 3DKIA 4JVNA 5E8RA 1Q6YA 2R8OA 3CSDA 1MW9X 1I24A 1QAMA 2FUG1 2VHUA 4PYKA 3K96A 3ORSA 4H4EA 4XCQA 1DV1A 3LX8A 3ESYA 5J4LA 3Q3EA 4C05A 4RIEA 1U9YA 1N8TA 1FUYB 3MGBA 5CLHA 4BZPA 1MT3A 4I9FA 1TTPB 4DPLA 4ZO6A 3AU9A 3LXXA 2FN3A 1SUWA 3LUGA 4JMPA 4EVRA 4PWYA 3IMKA 1ZK3A 3Q6MA 3R5HA 4JQOA 1T0BA 2ZPTX 1FFSA 3NBQA 4IZOA 1N33B 2F90A 4U9IS 5LDGA 3TTYA 3PNQA 2F3TA 5L6LB 2O3UA 4DLUA 1GV1A 1GIAA 1UMDB 2Q2OA 2YC2C 4BO2A 1ANKA 1X13A 3IVGA 3M9LA 3AR2A 4H0FA 4L78A 4ALLA 3GZNB 4L1KA 1PG5A 3FPGA 2AQKA 2Q3CA 4K2AA 1R74A 1C14A 2EWWA 3WHLA 5HX7A 3FCUB 1AGNA 1PT8A 2HCTA 4UHBA 3LDUA 3S5UA 1IUNA 5JLJA 3COJA 2QRMA 1EJBA 2CWWA 2WT8A 2BR4A 1P1IA 1TE2A 1PD1A 4P22A 4RMJA 3RWOA 3W4KA 5H0IA 1T2NA 1Y8QB 1SU8A 3K2EA 4H6PA 1QNFA 3RJ5A 2HIGA 3TX6A 5AK5A 1EDZA 3Q7SA 4L07A 3CWQA 1NVDA 2FJPA 3W5BA 1WP9A 5CT6A 4YROA 1QMPA 3R5FA 2WB2A 4HQKA 3AEZA 4YRDA 3WQQA 2MYTA 3LCCA 4RELA 3WLMA 3CGWA 2B1IA 3HFJA 1U2RA 1W4CA 4LQCA 3P2KA 1A9PA 1WG8A 1XD8A 3U4CA 4R71A 4Y9DA 1BGXT 1FFXB 1QOQB 2BKEA 5A3RA 5E0OA 1N0IA 2GOYA 3E8XA 1QV6A 3OFJA 5BURA 1QP8A 1GCIA 2GZHA 3NANA 4H9GA 2ZJ0A 1E60A 5HJ7A 5CLIA 4EQ6A 3FNEA 1ZR4A 3TNYA 5EZ5A 4QM7A 2OHOA 2RK4A 4HUJA 2IVFA 2PQMA 4OP3A 5E6SB 2W90A 1WCV1 4ZVPA 4ASUD 1KU6A 3K0HA 4UEQA 4Y0NA 3ZQ4A 4JI6B 1O94D 4ES6A 3D4NA 4LTMA 4W9NA 4JP3A 3R6WA 3ONNA 4KN9S 3ABOB 3T6KA 1D9XA 3M4NA 4Y2RA 3BICA 2PMWB 2C2WA 4PQRA 5IFLA 3THYB 4KQEA 1SCNE 1YRBA 4JT4A 2PRSA 4LZZA 4UVEA 1W0CA 3B53X 1XEAA 2LGJA 3LRPA 1V1RA 4FHDA 2QRGA 4G1UC 4P5PA 5SZJA 5AJXA 1RWPA 4NEHB 3PGVA 1MXFA 4HDNB 4RH0A 5EJ8A 2WEKA 3DMFA 5JT1A 2QPAA 4BVGA 1I1QB 2O9JA 2OLEA 3AR4A 1V8OA 5SY9A 4IOLA 4DL9A 1FNBA 5F21A 1TVEA 2BELA 3MJEA 3DMRA 3T12A 3RO7A 5KHAA 1PG0A 4XQEA 1E1LA 2P9QA 4IXTA 1GTMA 3T7KA 4EUHA 4E5UA 3H19A 4V3CA 1VI6A 1FRNA 3DHNA 3EZ2A 4JHXA 5DTEA 1BHJA 1X70A 5K09A 2QM0A 3MS2A 1GOTA 1R9GA 4L57A 4NU5A 3KQQA 3SI7A 1EHYA 1SKMA 4DLZA 3ZGXA 2PTGA 5EEHA 3EEBA 3HEMA 3MEQA 3LY8A 3OPNA 3WHKA 1NG1A 1LS6A 2ZREA 2W98A 5KCZA 2JIMA 1E0AA 3T9FA 1P0IA 1Q1GA 4O3FA 1SXQA 1XVAA 4NBRA 4A1OA 1ISJA 1SJ9A 1KDTA 3QYJA 4BZWA 2X22A 1Z6TA 3PPXA 4OHZA 4O2AB 2QE7D 1P7YA 4G1EB 5BWCA 3LMKA 4P2BA 2FE4A 3TK1A 4XM0A 3W3AH 1JBEA 2AYZA 5C3UA 1U81A 2OWDA 1G3UA 3HWSA 1J1UA 1OD6A 2XGSA 4OU5A 2JJ1D 5AXCA 3TM5A 5ENVA 4BEJA 5HQ3A 2FKAA 2P5UA 3OJFA 5DW0A 3OZEA 3RAFC 1T4GA 2OO5A 1NDQA 3TLMA 2GXAA 5FA6A 1OZHA 3OUTA 1KH2A 3LVBA 1Q44A 1E1QD 3I6IA 3FDZB 1NN5A 5IBQA 3TOSA 3VR0A 5A3JA 3OLVA 3DOUA 4X6UA 4X20A 1R6TA 4BFYA 4YALA 4ZVMA 2AW5A 4HDRB