3K6KA

Crystal structure at 2.2 angstrom of hsl-homolog este7 from a metagenome library
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
297
structure length
297
Chain Sequence
DTKMDPRDFLQLLKINAEKAEKNLPLDQKRAGMEALCERFPRAEGVELTLTDLGGVPCIRQATDGAGAAHILYFHGGGYISGSPSTHLVLTTQLAKQSSATLWSLDYRLAPENPFPAAVDDCVAAYRALLKTAGSADRIIIAGDSAGGGLTTASMLKAKEDGLPMPAGLVMLSPFVDLTLSRWSNSNLADRDFLAEPDTLGEMSELYVGGEDRKNPLISPVYADLSGLPEMLIHVGSEEALLSDSTTLAERAGAAGVSVELKIWPDMPHVFQMYGKFVNAADISIKEICHWISARIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biochemical and structural analysis of hormone-sensitive lipase homolog EstE7; Insight into the stabilized dimerization of HSL-homolog proteins
rcsb
source organism Uncultured bacterium
molecule tags Hydrolase
molecule keywords Esterase/lipase
total genus 98
structure length 297
sequence length 297
chains with identical sequence B, C, D
ec nomenclature ec 3.1.1.-:
pdb deposition date 2009-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3k6kA00
4E11A 2JGMA 3FSGD 2OGZA 3C6ZA 3FWHA 2BKLA 2WILA 5EGNA 4EZIA 3VJKA 3DQZA 2C0PA 2QR5A 3T4UA 3KOOA 2XUIA 5AJHA 1GPLA 3KWFA 4BCDA 3C87A 2WIKA 1MJ5A 4Q82A 4J3JA 2DHEA 1QIGA 4G4IA 3WWOA 3WKAA 4B82A 4Q05A 4GW3A 3C6YA 4LXHA 2PSHA 4QWWA 5A71A 2AJ8A 2VJBA 4P9NA 4YK7A 1ODSA 2HA4A 5EIHA 1O6FA 1LPOA 1UK8A 1LNSA 2LIPA 3ANSA 5CXUA 1VE7A 4E46A 4LHEA 1H23A 1EHYA 3WK9A 1AZWA 3O4JA 3PF8A 2PKYX 4C89A 3H2GA 4UFPA 4QLOA 1CFJA 5DWDA 1WB4A 5FUMA 4J0CA 1ZICA 3M83A 3R3WA 3W9UA 1BN7A 2OGSA 4KJXA 4UFNA 1CUJA 1ZGBA 2QJWA 2Z3WA 4IH9A 1W6RA 4ZXFA 3OPMA 3I2GA 1QIEA 3VJMA 5AI9A 4Y2TA 1K6EA 5FLKA 2EEPA 3MUNA 4LYDA 5BV7A 3VVLA 3WKCA 4K6HA 3ED1A 1X70A 5EHQA 2HFJA 2DCMA 2FJ0A 1XZFA 2PUJA 1DT3A 4EY5A 3ESDA 1J2EA 2WLSA 5AICA 4QZVA 1QIDA 4XJVA 1BS9A 1EI9A 1GQSA 2PSFA 1EB9A 2WIDA 1YAJA 1SFRA 5AIBA 3WKEA 3STWA 4B0PA 3QPCA 1UXOA 1EK1A 4AO6A 4D9JA 3GROA 3FVTA 3WLAA 4C4XA 4U2FA 4FOLA 4FBMA 1QFSA 1QFMA 5JADA 3ESCA 2J4CA 5DNVA 5LZ5A 4N5HX 2I3DA 5C8ZA 4B85A 1WB6A 3QPDA 4DNPA 1W4LA 3VVMA 4K2AA 2ZSIA 1LLFA 1DTEA 4INZA 4HVTA 1ZJ4A 1OILA 4AMYA 2XUQA 4AZ3A 5C8XA 3HSSA 1CUXA 4GXNA 4FNMA 4HTAA 3K9BA 1MNAA 2J3DA 2CJPA 1BN6A 2OQIA 2VEOA 3G0IA 5LLSA 5HFNA 4G8DA 1YB6A 5HQ3B 5JAOA 4OUKX 2WG2A 1XZAA 1LPPA 6YASA 1XKTA 3WWEA 5J3JA 2H1IA 4ZGBA 3S2ZA 3C5WP 4H77A 3VISA 4FKBA 1U65A 4FFWA 2WFLB 2G63A 4Q34A 2XUPA 2IIVA 1CUIA 4F5ZA 1YA4A 2C58A 3OC0A 4BCCA 4G8CA 4B7ZA 4AX4A 3DL7A 3O9MA 4ROTA 2AJCA 4FLMA 2PSDA 3Q8WA 1Y7HA 2OCGA 1YB7A 5E4TA 4MEBA 1XZKA 3NOXA 4Q3KA 4UPDA 5LIPA 1USWA 4EY7A 1QTIA 4B80A 4X97A 1IUNA 4CCYA 3FYUB 2C0QA 4ARAA 4P93A 3FNBA 2WSLA 2ZYIA 4MWSA 3UUEA 1XLVA 4J0GA 3PF9A 3AJAA 1F0PA 1JJIA 2XB6A 4BVKA 3WMRA 5DYTA 1SCKA 5FP0A 4QDXA 3O4HA 1NU8A 3HYSA 1LPSA 2JBWA 2Z3ZA 3JW8A 5ALVA 1DWOA 3NUZA 2XLBA 3C45A 5DNWA 1SCQA 1U4NA 4AO7A 4ARBA 4C88A 3B3QA 1EINA 5T4FA 5KWIA 5BOVA 2BCEA 3HC7A 4G4JA 1XZMA 3WZLA 3PFBA 3FLBA 3SX4A 2BGRA 2H7YA 3HLKA 3IA2A 5AI5A 2VAVA 4L3WA 4CIAA 2ACKA 4Q1VA 4QWMA 1B6GA 2XE4A 5K5EA 1A8QA 4B84A 3DD5A 4XVCA 1CUCA 4MQMA 3R0VA 4I4CA 2HU5A 4HXEB 1MN6A 3IUQA 1W52X 2HA7A 2JGLA 2O7RA 5AKYA 2ORYA 3VXKA 1IMJA 4BTLA 1OCEA 4OB7A 4BDTA 3H1BA 2GBFA 3DOHA 2VJCA 2WHPA 3WK6A 3BDIA 1ODCA 2HM7A 1QTRA 2XUGA 3WK5A 5FKJA 1T2NA 2V97A 1WOMA 1R50A 2ONCA 1XZLA 2AXEA 1KU6A 1WPXA 4M0EA 2WHPB 1NX9A 2HRQA 2FUKA 2BGNA 4IH4A 3L1IA 1Y37A 1CR6A 3NWOA 3KD2A 4LXIA 5EHNA 3K2IA 1AURA 4Y2YA 3HJUA 2H7CA 3FYUA 1EX9A 3H04A 4YPVA 1UKBA 5E4JA 3B5EA 5A7HA 4DSAA 2ZYSA 5D3KA 4DMHA 2HA3A 3F97A 1YSCA 1XROA 4AN0A 1TCBA 3ESBA 1IUPA 3G8YA 4FLEA 2VJDA 1DQZA 5C7YA 1E8DA 1ZD2P 4E14A 1RWQA 1R3DA 2AJDA 2X5XA 3I2FA 4KR0A 3H1AA 4QDZA 4UHCA 4ETWA 5CRIA 3V1NA 3PDCA 3I6MA 1LZKA 4RE6A 1UOOA 5HK8A 1UZAA 1IZ7A 3PI6A 3LS2A 4JNCA 5IVHA 3TGLA 5CURA 1YR2A 2G5TA 1WB5A 5IKXA 1VXRA 3YASA 3A2NA 3GELA 1TIBA 1PJAA 2ES4A 2GYVA 4OYYA 1XQVA 3R3VA 3KWJA 3WL6A 1XQYA 4BZWA 4N8EA 1HQDA 4B83A 4ZWNA 5EFZA 2WJ4A 4AMZA 2CB9A 4OD0A 1HBJA 3ICVA 3W2TA 4H7IA 2WUDA 2QKYA 3L1HA 3EBLA 1K8QA 2Y2VA 1ZIXA 2ZVDA 4BRSA 1FFEA 4QDTA 3HEAA 5CMLA 2RHTA 4X6XA 1BEZA 4DMKA 3TJMA 5A7FA 3O4IA 4KRYA 1Y7IA 3D3NA 5ALYA 1QOZA 2HFKA 4H35A 3IUJA 3KDAA 1QIMA 2UZ0A 4Y2JA 5JZ9A 2RGUA 3WL8A 4KE9A 2K2QB 2WU4A 2R11A 4BRZA 3O95A 4GHWA 1JI3A 4Y9SA 1FFAA 3C5VA 4FTWA 1YS1X 4H7HA 4U2EA 5AI6A 2XMDA 4X92A 2PU5A 4WY5A 4BTVA 2QMQA 3MUOA 1IVYA 1C4XA 3ILSA 2WM2A 2XUDA 3D7RA 5K3FB 1ZGCA 4BVLA 4MXDA 1BE0A 1QZ3A 3G9XA 4EHBA 1P0IA 2GYWA 4PV7A 5ALIA 5K3CA 3AIMA 1G66A 3V48A 2OQVA 1L7AA 2XQGA 5LZ8A 3FSGA 3V1MA 4OB8A 3QZUA 4J0IA 5ALGA 3HABA 4MYSA 4X71A 1ZI8A 3R41A 4N5IX 4CCWA 2QS9A 5AOAA 3H2KA 3STYA 1XZBA 1YASA 5CH3A 3STVA 3DOIA 3S8YA 2XMRA 2O2IA 4OU4A 3ZWQA 1RYYA 5ALSA 3UMJA 4FDMA 2XMQA 3RM3A 4UHEA 1CUFA 1CUVA 3O0DA 4DMCA 4PSCA 1MNQA 2ZYHA 4NVRA 5JD4A 4LKOA 4B6GA 2ACEA 1E89A 1QIFA 1JT2A 2HA6A 4Y2UA 3F96A 4W1PA 1K4YA 4UBMA 1C7IA 2ECFA 2WHQA 5HKAA 4G8BA 2HU8A 4BAZA 1BEEA 1XRLA 5DYYA 5AI8A 4M0FA 1YS2X 4X6UA 2Q0XA 2XT0A 3DKKA 2OCKA 1E66A 1EDEA 2Y2UA 4UFOA 2W22A 1JKMA 1CRLA 2WFZA 5AM4A 5JAUA 4I19A 4DNOA 2WG1A 4DGQA 1EH5A 4H7FA 2OCLA 3D2AA 3AUKA 2Z5GA 1A7UA 2XUAA 1E8MA 5AKJA 3U0VA 4V2IA 1QGED 3IULA 2QT9A 5JD5A 4PF1A 4AO8A 1QE3A 3A2MA 4HAIA 2GBGA 1H2WA 5ALXA 2EDAA 1FFDA 1RP1A 3D0KA 3WL7A 2VAXA 1ZI9A 1LBSA 1XZJA 4Y2SA 2DHCA 1CUEA 1DT5A 2VA9A 5K3FA 4HZGA 2XMSA 3G9TA 1NU6A 4CIBA 1QIIA 3BWXA 4UBNA 1D07A 4DNFA 2PM8A 3T52A 3M3DA 2WFLA 3WL5A 1AKNA 1UK7A 3EQ9A 4KE7A 2PUHA 4BP9A 4WDQA 1OXMA 2G4LA 1MTZA 3I6ZA 4F60A 1VJ5A 5K3EA 2WUEA 2XQKA 5JD6A 4A16A 1GKLA 2JEZA 3BJRA 2WIJA 4G5XA 2PSJA 5FV4A 4X94A 3FAKA 1QJ4A 1UK9A 1UT6A 4H7JA 3FOBA 4ZREA 2XUOA 3O9VA 4UBOA 4W63A 2I78A 4UHHA 4UBJA 2JGKA 4WJLA 1LGYA 3QMVA 5EIEA 3DLTA 1ZIYA 2CMFA 3LLCA 4AN1A 4HS9A 4BCBA 5EIAA 3LP5A 3I2JA 4DNQA 5BWCA 3U1TA 5ALMA 1MAAA 2I3ZA 4PW0A 1FFCA 1ACJA 5CT4A 4FMPA 4G9EA 4A23A 5IVKA 4X7BA 4C87A 3W04A 4H7EA 2QOEA 1MT3A 3UUFA 4GEGA 3EIOA 5CH5A 3IUMA 1QLWA 4I3FA 2X76A 2AJBA 1S8OA 1H22A 2VF2A 3AIOA 3FLEA 4PNZA 4S0XA 3E4DA 3PICA 2RAUA 4EB0A 1ORVA 4TPKA 1TQHA 1WM1A 2OLEA 3A2LA 1CUAA 5I9IA 5HF9A 1MU0A 3DEAA 3R3ZA 1VZ3A 5E4YA 4FWBA 5ALWA 2BUAA 2XUKA 2C5GA 4Y2RA 4EUSA 2GBIA 1EK2A 5JATA 1DU4A 2XMZA 3C70A 5C8VA 5CT5A 5IVIA 5JALA 3SC2A 4K5QA 3BF7A 1QIHA 1ZD5A 4QDUA 5HF5A 2WTNA 5KBYA 5HQ3A 1R1DA 3R3YA 3WJ2A 4GBGA 1JJBA 3DYVA 1WHTA 1LPNA 4CCYB 2B20A 2JGJA 3E1GA 3I6YA 4EY8A 1MX5A 2RIPA 3OOSA 1CEXA 4FNGA 1ZD4A 2H7XA 4DTCA 3HRHA 1EXWA 2V98A 2XDWA 2H9YA 4W9RA 3EQ8A 3GZJA 2VT7A 1W76A 4IHAA 3VDXA 1CUYA 3QBJA 1DWQA 2YXPX 4DIUA 2CEKA 4BBZA 5FDFA 5EHZA 5D7BA 5FRDA 3F67A 4A5SA 4Y2VA 1UOQA 1DQYA 5IH7A 2CUTA 1AMNA 4B0OA 3LIIA 1AGYA 2WJ3A 2XI4A 5AI0A 2XUJA 4UHFA 3GUUA 2V9ZA 3H18A 4BE9A 1MPXA 5FPPA 1EDDA 3BIXA 2OPHA 2DHDA 5AI4A 3HZOA 3AILA 2JGFA 3FCYA 5YASA 1EA5A 3W9BA 2D0DA 4C01A 3NGMA 3GA7A 3EQ7A 4TVKA 1UK6A 1UKCA 4HRYA 1IZ8A 4GDMA 3LCRA 1QIJA 4KYVA 4U2CA 4K6KA 1G5FA 4PO3X 3WYNA 4U2DA 1XKLA 1G4HA 3G9ZA 4C4ZA 4GWLA 2Y1KA 4RE5A 1P0QA 2WKWA 3MGAA 3FVRA 3QMWA 2HDWA 2O7VA 2PBLA 2C4HA 1MX1A 1R9NA 1CUHA 5IVDA 5ALDA 1VXOA 1SCIA 4KE8A 5ALEA 1MO2A 1W1IA 4RNCA 1SOMA 5LZ4A 1CUDA 1EDBA 2HA5A 2PL5A 2VQ6A 4WDRA 3I1YA 4BATA 3N0TA 1CUBA 2QUBA 5T4HA 3H19A 1YCDA 5ALFA 3ICWA 1TRHA 5AH0A 5A2GA 5BWBA 2B61A 4DLNA 1EVEA 1LPAB 1CV2A 2WIFA 5FOQA 1THTA 5T4EA 1E3QA 2DR0A 1A88A 1YA8A 5CT6A 1CPYA 1O6GA 2IITA 4B81A 4Q3LA 3H2JA 1CUWA 1HLGA 5HF6A 4RPCA 1XZGA 2WQZA 3V9AA 4BP8A 3FLAA 2DQYA 2OGTA 3ZLTA 3IBTA 1ZJ5A 5K3DA 2OG1A 4WFIA 1N5MA 2D5LA 4X6YA 2RONA 4ZI5A 1F6WA 1TAHA 5LKAA 4KAFA 3WIOA 1JU4A 1IUOA 5JANA 5SYMA 5EHXA 3DKRA 4X93A 4ZRDA 3ZI7A 4LYEA 4C6HA 5ISMA 2WU3A 5LZ9A 4J7AA 7YASA 3HACA 3VJLA 5K3BA 2I03A 2FJPA 4BAGA 4QDOA 2HRRA 1TCCA 1A8UA 3WI7A 1DINA 2XUFA 3IB3A 5ALPA 1QIKA 3DYIA 5CXXA 3K6KA 1XZHA 3AINA 3GBSA 4BB0A 3A70A 2WIGA 5CW2A 2GZSA 1U2EA 1QO9A 2XMGA 3H2HA 2ROQA 2BAGA 4BC1A 1XRNA 2QUAA 4X00A 1XLWA 3D2BA 4KAJA 4PSDA 4CG2A 5ALHA 4CG3A 3KXPA 5H3HA 1H2XA 1BCRA 2GYUA 5JIBA 1MAHA 1P0PA 1CVLA 1I6WA 2R8BA 1Q0RA 3BIWA 2WUGA 3WK8A 5ALOA 4MWTA 4W1RA 5HCUA 5AP9A 1L7RA 1UWCA 1KU0A 1K63A 1Q84A 2EDCA 2PX6A 3BE8A 3DCNA 3VKFA 3F9CA 3H0CA 1H2ZA 2GZRA 3IVMA 3FYTA 4LIPD 1B41A 1AUOA 3N2ZB 3RLIA 5JASA 4CG1A 4DM7A 4X3CA 3G7NA 4AQDA 4UBIA 1XZDA 1AC5A 3HXKA 3DNMA 5LZ7A 5HFAA 1Q0ZA 5ALNA 1Z68A 3QH4A 4JH0A 5FPQA 2G5PA 5HK9A 5AIAA 2Z8XA 4C4YA 5ALJA 3ZLUA 3ZV7A 4NS4A 1XRQA 1U8EA 2X8BA 1N8SA 3C43A 3OG9A 3I2HA 5ALRA 2XQIA 3WA6A 1R88A 3C8DA 1CIJA 4H18A 4HXFB 3QMMA 3AZQA 4L9AA 3CN7A 2PPLA 2CBGA 5CT9A 1XLUA 1XQXA 2WFMA 2VT6A 4BDSA 3FCXA 3E0XA 3R40A 4H7DA 4GLBA 4M0MA 1XFDA 4UHDA 4XX1A 4F21A 5AK6A 1WHSA 1WCYA 1KEZA 2OCIA 5AOBA 1L7QA 3WWCA 3BJMA 3JYHA 3WZMA 5JZSA 4K6GA 3DJYA 1GPKA 5AOCA 5A62A 3HI4A 4P08A 1E5TA 4DSZA 3RARA 2QZPA 3GFFA 1BROA 3IIIA 4G1FA 3F8SA 2VJAA 2BUBA 2HL6A 4MQLA 4XIIA 2JF0A 3PFCA 1HDEA 4IQ4A 1VA4A 2V96A 5AKHA 4W1SA 1GGVA 5AKLA 2Y6VA 3JWEA 1FJ2A 4PQEA 2HA0A 2VSQA 2XUHA 1XRRA 1W75A 4X90A 4KRXA 3AZOA 4G4GA 4J0DA 3CN9A 1GZ7A 3KSRA 1GKKA 2ZJ6A 1YAHA 2CKMA 3QPAA 5LYYA 2AJLI 1CUGA 2O2HA 1XZIA 5AKXA 5DTIA 4UBLA 1JJFA 4J0HA 5KWJA 1M33A 4YX9A 1ORWA 3OTQA 3IURA 3QYJA 4WCVA 1F0NA 1UFOA 4EY6A 5I7UA 1DX4A 2VTVA 1R9MA 3RKSA 4FLFA 3WKDA 1FFBA 1ZI6A 3H2IA 3W06A 1R4ZA 5ALQA 3WWPA 5JZBA 1ODTC 1CUZA 3WK7A 4BE4A 3DS8A 3D5EA 1HPLA 3PUHA 3I28A 4U2GA 2JGIA 4YASA 2HA2A 3PUIA 5JAPA 3AFIA 4QEKA 3CCBA 2J4FA 5AKZA 5F4ZA 4EA6A 3RK4A 5HKBA 1N1MA 3EF3A 5D3ZA 3M82A 1UKAA 1ZD3A 1PV1A 3WWDA 1VOTA 4B9AA 2HU7A 2RHWA 5JARA 4ZV7A 3WA7A 3V1KA 5AK5A 5AHXA 3ZPXA 2QVBA 3I2KA 3O4GA 3LIPA 2PSEA 1VA5A 1GXSA 1WPRA 3CCCA 1XRPA 1HL7A 3OM8A 3B12A 4RGYA 3PE6A 1XZCA 1PFQA 3G02A 4HRXA 1LPBB 1BU8A 3STXA 3W05A 4GI1A 3QM1A 2HADA 4G9GA 3TRDA 3QITA 4FFVA 1P0MA 2FX5A 1TK3A 1X2EA 1BCSA 2ZYRA 1DWPA 1XRMA 1XQWA 5DNUA 1CUSA 4W1QA 1JMKC 4OCZA 1ISPA 2QXTA 4AXBA 3WIBA 1C7JA 4BAUA 4OB6A 1DX6A 5K3AA 4GECA 4MJ3A 1GQRA 2W6CX 1T4MA 2XMCA 1F8UA 4QLAA 5LP1A 3D4LA 4J03A 2IX9A 1J07A 2QRUA 1X2BA 2PU7A 1A8SA 2J3QA 5HZGA 3SWWA 4J0KA 1CUUA 4BVJA 1QO7A 3I2IA 4U2BA 5AKIA 5HF8A 3AZPA 3WJ1A 1MX9A 3A6ZA 4UUQA 1TCAA 3FYUC 4X95A 5AM2A 4Y2PA 3FBWA 3WKBA 3WQHA 3DL4A 4Q3OA 1JMYA 2WJ6A 5EI5A 3WK4A 2Z8ZA 4IO0A 1LZLA 2C7BA 4IH1A 3G9UA 2B9VA 3WYDA 3D59A 4L72A 5JAHA 4JUIA 2P8SA 4CFSA 4JEIA 4OU5A 1BRTA 4WFJA 4JYMA 3AIKA 5DJ5A 4KE6A 5A7GA 1FSSA 4B9EA 2C5FA 5CT8A 1THGA 3OURA 3BF8A 2WUFA 2ZJ7A 2OAGA 4N8SA 1CQWA 3IUNA 3G0GA 1J06A 2OAEA 3R3XA 2JGEA 4BZZA 5ALTA 4N8DA 2QJRA 4O08A 2ZJFA 5AK4A 3M81A 2HHAA 2Y6UA 5AKKA 3ZLVA 3CXUA 3C6XA 4Y2XA 1JU3A 1LBTA 3DDUA 2BJHA 1Q83A 2GBCA 3F98A 4E15A 5LZ2A 1N5RA 3ANTA 4Y7DA 4NMWA 2DFPA 4DYHA 3H17A 3C6BA 4P92A 5AK3A 3QVMA 2DQZA 2JEYA 2BUCA 4BYMA 5T4BA 3G0BA 2E3JA 1ZOIA 2VATA 5D6OA 4KACA 3L1JA 5AM5A 3BL8A 1TKRA 2QM0A 2QXUA 4OPMA 5ALLA 4AB1A 2NW6A 1UOPA 4QNNA 2OXEA 5CBKA 3G0DA 2XQFA 2B4KA 2WTMA 4ZV9A 4L0CA 1G42A 4H7KA 5DYWA 3Q0TA 5DTJA 1CQZA 5AKEA 1GPNA 4EBBA 4PSUA 3G0CA 1EVQA 3X3HA 2XQJA 3TEJA 2JIDA 3I1IA 3MVEA 1ETHA 1JFRA 4Y2QA 4OYLA 4X85A 1QONA 4XWGA 5DLPA 4WFKA 4EY4A 2BFNA 2HIHA 5ALUA 5C81A 5I8PA 1GT6A 5AM1A 5ESRA 1AX9A 2O2GA 1AQLA 1VKHA 4UHBA 5LKRA 4J0JA 3SK0A 2DSNA 5AKGA 4AZ0A 1CLEA 2QTBA 3BXPA 4ITVA 2WHRA 1LPMA 4FHZA 4WY8A 3C8HA 5AO9A 5AM3A 4X91A 4HXGA 1SC9A 4MYDA 3D2CA 5A6VA 2XMBA 2CZQA 5ALZA 3STTA 4OSEA 1XZEA 2YASA 1HKHA 2RI6A 4FBLA 1VE6A 5JYCA 2ZSHA 5ALKA 3P2MA 2WG0A 3V1LA 4H0CA 3R3UA 3ESAA 4Z49A 1H2YA 2YYSA 4NZZA 3E3AA 4QE3A 5AM0A 2PVSA 5CTAA 1K5PA 1ACLA 4BC0A 4LXGA 4KEAA 4QA9A 1VZ2A 4DMFA 2XLCA 2YH2A 3IDAA 1EB8A 1VLQA 4KAAA 4UBKA 4CI9A 4F0JA 4MEAA 1E8NA 5CH8A 3STUA 4JYPA 5FXMA 5KREA 4TGLA 3BDVA 1J1IA 5SYNA 5E2IA
chains in the Genus database with same CATH superfamily
1AO3A 4E5YA 1ZDMA 5CEFA 1NXXA 3C6ZA 2B1QA 4YAJA 3F7TA 1N6LA 1EK6A 3E5NA 3W6PA 4P34A 3EZNA 4CFYA 1IJFA 4HAXA 4JKOA 3FWHA 5JISA 3V8MA 1F8GA 4MNTA 4RQTA 4CM6A 5KTKA 4DDKA 4MUIA 1ECBA 1XWFA 4ZVKA 4HOYA 1CR2A 1D2GA 1NQTA 4OBXA 3ZCVA 1IZYA 5EGNA 5KYXB 1GKYA 2W6IA 4ID3A 2LR0A 1LDEA 2Z1MA 4HMPA 5EXPA 5EP4A 1G8MA 1CIVA 2ZXEA 3K9GA 3RR2A 2TMGA 2PUBA 1L8LA 3SJZA 3MWJA 1ULHA 1D1QA 2I71A 2Y68A 4JJIA 3ROTA 3KWFA 2EGHA 4QPCA 5COAA 3IP5A 2WIKA 3VZRA 2QDKA 4PLHA 3R0XA 3I8XA 2FW6A 1DEOA 4AMBA 3A4VA 1FFXA 3WKAA 4B82A 4X64B 2BBWA 4WZAE 2FPSA 1KEVA 1YV9A 4IIHA 4OP1A 1IB6A 2AG5A 2ZIVB 1DAEA 3IKMB 3WNDA 2Q46A 4WZBA 1M1UA 1ECCA 1MJHA 2ID9A 3ZS8A 4RHFA 3W2GA 2B8TA 3FCCA 1JLSA 4N9QA 3WLPA 4EHJA 2IEGA 4BN4A 2OOSA 3MYRA 2HA4A 1XT6A 3A25A 5KQPA 2A6PA 2O8VA 3FY4A 3OHSX 1Q95A 5EWMB 1E7WA 3BFKA 1V8FA 4DBLC 2QRLA 5IXSA 5JNUA 3PEVA 3NWBA 3V8BA 4WLNA 5CB0A 5AUQA 1XNGA 3ANSA 3QBEA 4MQEA 1NFFA 1U2QA 3QTBA 3U44A 2WAYA 5I8WA 1E96A 4OHMA 3FF1A 3S68A 1GVHA 2GAFA 1RPAA 4AUKA 3ACCA 2PR7A 1N2ZA 3I6BA 3NTUA 4OJYA 4YI3A 4C3VA 1FQWA 4ZO8A 1Z83A 2AKAB 1OBOA 3AFOA 3ZDCA 1JR2A 1Z0FA 1T9GR 5LQSA 2PKYX 1S7CA 1WO8A 2PRJA 3AXTA 2X9NA 1IOLA 3QVSA 1EQ2A 2GR9A 5LOVF 2YICA 2NYVA 4UFPA 2B7CA 1R15A 4Y6PA 5DWDA 2C7VA 4BB9A 1NF2A 1EFRA 2D1FA 4C5CA 1C5KA 4IIJB 4EI2A 4YYZA 1GPUA 1NZDA 1L7EA 2RK4A 2I6GA 3JVDA 1ZICA 1PT9A 1P4GA 3A26A 4I9GA 4L02A 1O0CA 2GN0A 3H6KA 3KZ1E 2NPFA 2PWYA 2DBZA 5JJKA 1GCOA 5CXSA 1CK4A 4E3ZA 3I1FA 2GLTA 1OI7A 4COOA 3FPSA 4KJXA 5TX7A 1CR4A 2BFDB 4UFNA 4L6IA 3EOAI 4TKZA 5TV2A 1ZGBA 3B85A 1LX6A 2H57A 1FLAA 3N0RA 3W4KA 3G5TA 4GKKB 2O3TA 4Y1GA 3G6WA 1E60A 3GRRA 4G4SO 3I2GA 1COWA 1G3UA 4JFAA 3UFXA 4YAKA 2B36A 3GB9A 3VNBA 5KPDA 3GLFB 2ZIZA 4BZXA 3L6OO 4D9MA 4H3HB 3EA0A 4QU8A 4ZT6A 1K6EA 4PPFA 3DMNA 5FLKA 3JWHA 4F6RB 2FSHA 5B37A 4TN5A 2I80A 5BV7A 4XD7D 3VVLA 1UBTS 1GQFA 1ZGAA 4Q16A 3W6UA 3WKCA 1F48A 3IBFA 3NBMA 4K6HA 1M10A 1LV7A 2J4DA 3QEJA 3IJPA 2YY7A 4ND6A 1D4FA 1J8MF 3JZIA 4LS3A 3E9ZA 4FINA 3W7AA 2DCMA 4PBRA 1IN5A 4UE2A 3JZMA 4IILA 4ZVMA 1XZFA 2AR7A 2B34A 3C97A 3OICA 4HUJA 4Z86A 3EDCA 5E4FA 4QT4A 4IV8A 2MOKA 3VR3D 5L95A 4IRUB 2SCUB 2VNAA 4A2WA 2ZQ5A 3GJXC 1XXHE 5AICA 4JOSA 4RK7A 3W5VA 1QIDA 5KO2A 2ZU6A 4AJIA 1Z6YA 4RVDA 3IVAA 2P5UA 4LRUA 1ULSA 3P1JA 3KV3O 4ZK6A 4F3TA 4C0LA 1U1IA 1EI9A 2QUIA 3KKZA 4Q93A 5DKFA 3TMKA 1IEXA 5AD1A 2XCRB 1P9OA 5EKTA 3IAXA 4TRRA 3UWPA 3QY9A 5BQ3A 2GJ9A 4P31A 2PLNA 2WIDA 2GTIA 3UCXA 1SFRA 3PRKE 1BQ3A 2R7LA 4RKRA 1GYPA 2PUWA 5DT9A 2GQ0A 1Z4PX 2HBQA 3STWA 1TAQA 1MB9A 4FYJA 3TLKA 5GGYA 3QPCA 5GONA 1T5BA 1EK1A 3ELBA 1Q1ZA 1RM5A 3LPCA 4RY9A 4U02A 2Y0EA 3DDSA 3AKEA 3GRUA 3G88A 4RH0A 4QQRA 1NPTO 3AOGA 2B1GA 3RPEA 3V4OA 1OXUA 1P18A 4U2FA 3PS9A 4FOLA 4L0DA 1OBVA 2DPLA 2O2YA 4X5OA 4J75A 4UVDA 5G3ZA 3I92A 4HS4A 3ESCA 1VLZA 2QK4A 4B40A 5KNBA 2ET6A 2YVKA 4V03A 3LAWA 1KYTA 2M6RA 4EG4A 1ZOLA 1DBIA 4CIYA 2Y9MB 2I3DA 4JLPA 4KXFB 4Z7JA 4MUFA 5C8ZA 5A9TA 1O94C 2QI9F 5CIYA 2WZDA 3QPDA 3C98A 3Q3EA 1T8RA 5JWRA 4TYPA 4PX5A 4W8OA 4C0KA 4ED9A 3QELA 1NNEA 4HVTA 5JR3A 4I4IA 3BWDD 5LD2B 2LVBA 5KVSA 4TSKA 3JQBA 5C8XA 1XMVA 3BCSA 5J58A 3IJEB 4HTAA 1OPXA 4FNMA 4GXNA 3QUCA 4LNHA 4COKA 3CJRA 2CJPA 1R0ZA 3I6QA 3PTLA 1YH3A 4CQNA 2IP1A 3B1VA 3KSMA 5LJLA 4IIYA 3LY7A 4JLUA 4M8NE 4O2RA 4Z8XA 2FQWA 5HFNA 1RTKA 4ZEVA 5EJMA 2B4TO 2NO9A 2QVXX 2GPJA 1TYBE 5HQ3B 2JD1A 4F9TA 3OQNA 3SYRA 1WVGA 2FUG6 4Z51A 4L1KA 3SVTA 3JQ8B 3MELA 4KLZA 4WIAA 4OUKX 5D3MB 5CK4A 4XPIA 2QU8A 3MJTA 6YASA 5J2TF 3PYLA 3U4IA 1I24A 4MPJA 1CS0A 2DJ5A 2AUNA 3OF5A 2I6QA 3P8ZA 3IERA 1DAIA 2FFRA 1D0VA 4Y6SA 2RHLA 4NBSA 1V5FA 4FYVA 4ZGBA 3ETGA 3EXFB 4NPCA 4XWOA 4G3XA 1YS7A 4QICA 1Y33E 3KOXA 4W7SA 1S6YA 3W6NA 2B98A 4A1FA 4QX6A 2GAOA 4HH1A 2P67A 4LRWA 4JI1B 4BFXA 4H77A 2VJOA 1Z7YA 3OUZA 5BQ5A 2CV2A 5F7OA 2VBGA 1D2HA 4TSRA 4FFWA 2HRBA 1TPZA 2B2CA 1BVHA 3T12A 2GA9A 3CKMA 4P6VF 2JIMA 4JLBA 4DBZA 1ULUA 1QAMA 3B48A 4NOLA 3PKIA 1CP3A 1Z73A 4Q34A 2OA0A 4HR7A 1JALA 3P4YA 2XUPA 5U4XA 1V8OA 1Q92A 2IIVA 2AMJA 2HBRA 2QZZA 4LY9A 3T3HA 1Z0ZA 1AVTA 1CUIA 1E6KA 4F5ZA 1YA4A 4F4DA 2W42A 2AG0A 2EW8A 2C58A 1R74A 3IEPA 4LOLA 2GAIA 1K5DA 1QK5A 4L8LA 4PZYA 5L4NA 1DLIA 1FFWA 2QD4A 4H1TA 4ROTA 1E9DA 1SHZA 4F92B 5LWQA 4ALLA 1IDOA 4OJNA 1FU7A 1P4JA 1ECJA 3CUUA 4L73A 3IDOA 4ANFA 5E4TA 1NIPA 5EP2A 3K16A 2Q9CA 2AEJA 2NU6B 5LIPA 4D56A 2R47A 4ZQCB 3DZKA 3UK2A 1T24A 2R85A 5FWYB 4R1SA 4QRHA 3A9WA 5GM2A 1GTJ1 3EVDA 4MUAA 2FUCA 4LF7B 4X97A 4HH4A 1OVMA 2C0QA 1VCHA 4D2IA 2J8ZA 2CEAA 4P93A 1YZGA 3F74A 3N28A 2DPHA 421PA 2AZXA 4RK6A 5JNRA 2ZYIA 4W9MC 2G9ZA 4IVNA 4C4RA 1MO5A 2W2LD 1MGPA 4MVXA 5JQGB 3RC8A 3DBIA 3SHFA 1PTKA 2A78A 4U9IS 3REQA 4BVKA 4IICA 2CBXA 5JFOA 2H1LA 2QMYA 2JH3A 3HR7A 3K9WA 4HADA 1QFXA 2L2QA 4ISBA 4WCDA 3VR4H 4E5PA 5KZMB 2QZ4A 3L8FA 3NHUA 3O4HA 2DH5A 3LBFA 4AL4A 4U6SA 1CJMA 4ZQEA 6REQB 4HKTA 1LPSA 1TJPB 3JW8A 1KO7A 3OFJA 3UANA 2XLBA 1JFFB 1I6MA 2H3HA 3D4PA 2VK1A 2EZTA 3F5SA 1CR1A 1O7JA 5CM2Z 3LL7A 5DNWA 3T7RA 2YKGA 1BX1A 1U4NA 3L0SA 3VTZA 4AO7A 3RV3A 4DT1A 1SC6A 5ICEA 4F7WA 5F1OA 3D6HA 4QO7A 1ISGA 5DH9A 4LSMA 2CF5A 4JT4A 2H4ZA 1KZ7B 4Y2GA 5T4FA 2A59A 3TE7A 4BVGA 1QHEA 1TLLA 1L7VC 2JH8A 1GRQA 3V8RA 2VZ0A 4UJ3A 1V48A 2GCPA 3LBHA 3BSSA 3ICQB 2VDQB 3WZLA 3PFBA 1KOLA 4PS1A 1ZMRA 2IEZA 3ANMA 2BGRA 2IHJA 2WD9A 3TLGA 1MX3A 1AHNA 1JU9A 3F3KA 4FYYA 4XX0B 3ZKAA 4DRXB 1YI8A 3RS5A 5AI5A 4EECA 1AF7A 1DIBA 1BG6A 3VDMA 2ACKA 5IN5A 2VDUE 3DOCA 2X41A 4AJOA 4EYSA 4QWMA 3LY8A 3LI2A 5BN4B 4ZT7A 3KVNA 4BGVA 4ZZIA 1GU0A 2YXBA 4RULA 5D85A 3KSBC 1J33A 2D8MA 2QD5A 2BGGA 4BUJA 4IAOA 1RLTA 1TIPA 1DKUA 3MWDA 4XVCA 1T1JA 5A6SB 1DTSA 2V6FA 2WNSA 2B92A 3Q7EA 4JCOA 1I3OA 5CCBA 3IUQA 3LC1O 4F46A 3OTHA 3P97A 5KJ1A 3RAEC 1ATZA 4LGMA 1NI4B 4RVOA 3THRA 4CIXA 4MEJA 4BQPA 2Y1EA 2OCXA 2Z8YM 4JDPA 4X1IA 4KQXA 3PC4A 3GA5A 2DH6A 5AKYA 4YRSA 3ETHA 3ZI0A 3UJNA 2OSBA 4NZMA 5DNEA 1FQKA 2IDMA 1JG6A 2IU4A 2NPOA 1R00A 3I39X 3PPXA 3QLJA 4UVEA 2NZ2A 4C04A 2CDCA 1IMJA 1WW8A 1Y6RA 5IX8A 4P5PA 5H16A 2PUDA 1QGDA 1NUQA 4YEDA 3GLFE 4J7UA 3D4OA 1YKFA 2QQEA 5SY9A 3BWBA 4EDHA 4OB7A 1UMBA 1PD0A 3P94A 1FPQA 1OXVA 3DMPA 1WUJS 2DFLA 2VZEA 2Q5OA 3O83A 4K26A 1U0RA 5IWCA 2QPTA 2Z98A 3R09A 3KPYA 4OUDA 3HB1A 4Q9KA 2BHSA 1JJAA 1AMUA 1TZBA 2IT1A 2XUGA 3AY6A 2XE7A 5K8VA 4MJ7A 3MS4A 3TIIA 3VR5A 3OWOA 2ORIA 2AF3C 2VPXA 4WKGA 1I7QB 1T2NA 1NQXA 4GM4A 4I99A 4PHHA 3WYGA 1F3LA 1WY7A 4B32A 1BXRB 5BMVF 2J59A 4LHXA 1LF5A 4HQRA 1OAOA 2ONCA 3OZUA 1UDWA 3WHLA 2MSWA 2Z2KA 3B3GA 4S1VA 1T2FA 4RM2A 1PS8A 1NLYA 1KU6A 4J1QA 3URKA 1WPXA 1J25A 3UHFA 4FXPA 3QU9A 3WNCA 4BNUA 5L51A 4Z9YA 2R8EA 1RHUA 5CFPA 1FIUA 5AJZA 1KI8A 3OQ6A 3CWCA 5AW6A 5H0IA 3VNAA 4ZO6A 2XNHA 3KV1A 2XSZD 5IJWA 3ADCA 3IODA 2J5QA 3PUVA 2QN7A 1NJSA 2HYDA 2B0JA 1E9AA 3ETCA 3I23A 5DBHX 4D43A 2J9FB 4YCJA 2VYQA 3KD2A 4R9NA 1JQ5A 2HBZA 1E9CA 4B31A 1NYTA 1P8AA 2Z4RA 3MRTA 4LXIA 4DJTA 4NE2A 3WLFA 2HKIA 4DLLA 3DPUA 3UCFA 3GRAA 3USES 1YUBA 1NW4A 3TW6A 2NNWB 3P9CA 3W78A 5IDXA 2VJQA 5KQSA 1IIRA 1MB4A 1HUQA 3RSGA 1E2LA 3EPHA 4KUEA 3JYPA 3TTWA 3P9SA 3LT1A 4G9BA 2XX3A 2FFQA 4YAUA 1OY1A 4LWQA 5A7HA 2PX0A 2ZS9A 2ZYSA 1K6MA 3GXBA 4BQOA 1XP8A 3BKWA 4ZQBA 5E7IA 5EMHA 5EHIA 2FF7A 1W93A 3FJ1A 3GRFA 2ICAA 1H8HD 1TO1E 2WJPA 3GDFA 3LWZA 3D6AA 5DRYA 3ON5A 4FLEA 4FQ5A 4OLAA 1KDRA 1ZKDA 1P77A 4GI5A 4OAPA 1PZFA 2J30A 2YOFA 5I4CA 2IYTA 1YE8A 1ZD2P 2W6MA 1V43A 3QXGA 1H1DA 2XV1A 2ZBVA 1ZITA 1OWPA 3R5KA 4HDCA 3GH3A 2FFJA 5BMVB 2MYTA 4ZTUB 1R3DA 2X5XA 2CVFA 1RM4A 3RTGA 1KIAA 1Y1LA 4C4SA 4UHCA 4ZYLA 4QFMA 4KQWA 4PR0A 2BSAA 5LBIA 2EBFX 4S24A 4DYDA 4ETWA 2SKDA 4YUWA 3KYDA 3V1NA 4E2XA 1BW9A 1VPVA 1IL0A 4LTDA 3B6MA 1LZKA 4RE6A 3PP8A 1Q21A 1T4DA 3CWQA 4D4GA 4XEUA 2P4SA 3ZCRA 2GJ4A 3CCFA 2BBSA 1ZH8A 4ETMA 3N2KA 3T61A 1SVNA 1UZAA 1KBQA 4GH5A 1ACMA 1JAIA 3LS2A 3M8KA 2WWRA 5C5IA 4EW3A 2WYUA 3NH6A 1MOPA 1Z33A 1O03A 4NDAA 1HE4A 3LW8A 3TGLA 4QQKA 1WAMA 2ZBQA 2DG2A 4MRPA 3ANXA 3RD5A 3SBEA 3DTTA 5CURA 3LLVA 1BHSA 1KIMA 2C57A 4Q4AA 4XDYA 1CVRA 1I30A 2J3EA 1PHRA 2PUTA 4MV0A 3SY8A 3QEBZ 1G7TA 5IKXA 5J2TA 4S3MA 4KC0A 5FBHA 3A2NA 1TIBA 1Y9EA 1FX0A 2VNHA 4XOUA 5JU6A 2A0UA 2ES4A 3ANNA 4GX0A 4OYYA 2FPIA 2I4MA 3O26A 1EJ6A 5TJ9A 4IVQA 1U3DA 2RGBA 1RPNA 3P26A 1C1XB 3Q5GA 4MS4B 4PZPA 3R3VA 1U2ZA 3AGQA 1CDDA 1KAGA 2F9FA 2QX8A 2CLOB 3A6KA 3QLVA 1XBTA 3A28A 2Y1GA 3L0CA 3QU2A 5FL7A 2VP9A 3LK7A 4Q7LA 3SNKA 4MV4A 1XQ6A 4J1SA 5EFZA 2WJ4A 1BKDR 3BMOB 5BQPA 5P8WA 4BNHA 4DDWA 3QQPA 1HBJA 4FS3A 4EHKA 5E3JA 1MRSA 2XKBA 4FE4A 3H5WA 4Q4LA 2CLLB 3MTEA 1PNVA 2GPSA 2SECE 4H7IA 3EXAA 2OO5A 5CB4A 4Z4EA 3FDJA 2QKYA 4A0HA 1HMPA 5CNMA 4BMXA 3VO9A 2JJYA 3NIWA 3FTDA 2XGMA 1TT5A 3SJUA 4WOJA 1UMBB 4BNZA 2ORVA 1I5OA 4JJFA 2HSEA 2IY7A 2E4WA 5KX5B 3O8RA 1Z5PA 3CR8A 4BKQA 5EWLB 5TPZA 2QRMA 4BRSA 3PGLA 3F7NA 3MWFA 4XTRA 3TNJA 3DF9A 2V58A 3KWLA 2W83A 1W25A 2CD9A 1IQRA 3BTVA 1QGAA 3GLGE 1TUBA 5CMLA 3ZKWB 1CULC 1OI2A 4WWHA 1SN7A 1N3YA 1E5LA 1C9MA 2GPYA 4PG4A 2VF5X 1NVXQ 4DMKA 3KT6A 5H4GA 1B1CA 3OE7D 3N7UA 1FDUA 3KUKA 3LLUA 4YB8A 3S1LA 3DO5A 4M1TA 3KVYA 5T6MA 3D5QA 5EXEA 4HP8A 2JHGA 1Y8QB 3L41A 4KRYA 1DHTA 1YJ5A 4GU5A 3IPXA 1Y8ZA 2DBYA 3OQIB 1Y3HA 1PF7E 1GY8A 4R0NA 4KW7A 1WBDA 5E9QA 3MD9A 1JKJA 1U2SA 3SYTA 4HK4A 3L0DA 1W4ZA 3IUPA 4YQFA 1ELOA 4EEKA 3FFAA 3WL8A 1SJ9A 5LYJF 1PP4A 3U3MA 1CZNA 4BX8A 1NY5A 4CDNA 1P2SA 4PBSA 2Q2QA 2WD7B 2DBRA 1FQOA 2Q9BA 3E7FA 3F46A 3GDOA 3O95A 3T15A 3V2IA 5JEDA 1FFAA 1T1SA 5EERA 3M4JA 4WACA 1XSEA 2VJMB 3T3MB 2J7PD 1TZ2A 1A1VA 1JVBA 1QH1B 2CE2X 1L4MA 1M1XB 3A6GA 4UCFA 2MMGA 5AI6A 4RKQA 1PKEA 3BMNB 3ONWA 4QC2A 1GG9A 1OKKA 2AG6A 3OZRA 3ODGA 4A0FA 4ZMSA 3ZHOA 4MR9B 5IU6A 2H11A 3I58A 1PNOA 3A04A 3S2UA 1Z7WA 4HEJA 3G49A 1GP2A 1KI9A 1N6KA 4ON9A 1IVYA 3ZJ4A 4EMTA 1TKBA 3V4RA 1VHLA 3ILSA 1NULA 4K81B 4KUGA 2H65A 1DIOB 1XU9A 3GV0A 3RVMA 1P3Y1 3WO0A 1EQUA 3L8DA 4DHWA 4OXYA 1ZGCA 2V8BA 2Y66A 1F8XA 1G41A 1OI3A 3BMCB 4HWOA 3DF7A 3DJFA 4RZUA 2UKDA 1BE0A 2NYAA 3G9XA 3PRJA 4REMA 4DQ0A 3UT5B 4WNAA 1P0IA 3MWYW 1DL5A 2YL2A 3WVNA 2BPOA 1CY6A 4TTSA 2PXHA 3HBMA 2TMDA 3ESZA 3SI7A 1SEVA 2RI0A 2VG8A 2FZWA 2OCPA 4NG5A 4PV7A 1PQYA 3HQ4O 4WN3A 1QV7A 2MDTA 1AZSC 4BJ6A 1QG2A 1RXSA 3LWBA 2JAPA 5K3CA 3LP8A 4URYR 1QG4A 4GVPA 2NU7A 3NPAA 4BMVA 2C2OA 3ZDQA 2FZ5A 2YZ7A 2GUWA 5HUHA 121PA 4MS3B 4OB8A 3VYTB 4C6RA 1PE0A 3UT5A 4J0IA 3LT4A 5D2CA 4IUBS 5ALGA 1WWKA 4MYSA 3BMCA 2ZUDA 4P3KA 5DMHA 2BMEA 4R6XA 4XVQA 3KQUA 1C0KA 2F6RA 3ESXA 2OUKA 4CCWA 1E7QA 1NXSA 3U2QA 1U8AA 1I13A 1BFUA 4TUYA 3VRHA 2B0CA 5CVDA 1UMDB 3STYA 4AY5A 2DY1A 5LC1A 1HR0B 3VSCA 2ST1A 1RJ9B 3E81A 4DV2B 1SIUA 3GEPA 3FHTA 3DOIA 3TZ6A 1T35A 1KJJA 1KERA 4BVEA 2CF6A 2CUZA 5I9SA 2I2FA 3PR1A 3MF4A 5EN4A 4MH0R 4MIYA 4OTZA 4Y67A 2JPDA 4TL9A 4EUKA 2GLUA 5I47A 1IPFA 4PRYA 4N1AA 1D0IA 2C94A 3D6UA 4F2DA 3UMJA 2PZFA 2R97A 4OMDA 4MS3A 1FDWA 3M4ZA 2FG5A 4INPA 4NJMB 2W8BB 1IWBB 1EHCA 3T7CA 3ESQA 1H3FA 3AVOA 1CUVA 3NOVA 3NW9A 3O0DA 4UHEA 5CK5A 3T0GA 1GGJA 3TSOA 1U5BA 1NV8A 2XXJA 2DT8A 1YZTA 1FYEA 2P9EA 1KARA 4R98A 1KE2A 4AECA 5FEUA 1JH8A 4J16A 4B6GA 4X1OA 4WKOA 3DE7X 1R9JA 1W96A 1X7YA 2F48A 1JT2A 4N5DA 2RIRA 4XPIB 4YMTA 3GEBA 4Q9DA 1WJGA 1A0OA 2H48A 1K4YA 3QFCA 4FR2A 4LZOA 4Z0HO 4EFMA 4OBWA 1C81A 1J8YF 3GN1A 2ECFA 1BJRE 4GLOA 4XLZA 4YJGA 3R7SA 3WAJA 2PKWA 1GR0A 3NXSA 4URXR 3IMKA 4Q48A 3TSWA 3T34A 1IWPB 4LF5B 3KB6A 3AU9A 4BAZA 1PR1A 4MUMA 4I3HA 4QUKA 1XRLA 1AUPA 1Z47A 4KPUB 4CRWB 3HY6A 3V97A 3CINA 1VIYA 3RKUA 4LOAA 2WT9A 4O4JB 5KHOC 1RWOA 3MGCA 2ZJAA 1BSVA 5A5FA 1NZFA 1U2GA 2CE7A 3HVJA 1WS6A 4MP8A 4F45A 2KYRA 2OPBA 3LWDA 1Y9ZA 2WRZA 3BD9A 1Z74A 3S2EA 4GWKA 2WPDA 4NU6A 1YZUA 4G63A 4KVFA 1KDVA 4LE2A 1E66A 4HDNA 4KRGA 4BJ1A 1F0YA 2YN0A 2VBCA 4KSCA 1Q6YA 1YQEA 4YJ3B 2FEKA 2JIPA 1JBQA 2Q28A 2QPAA 3LX6A 1JT9A 1SQ0A 4FYWA 4RF3A 3KLOA 4UAJA 4MP6A 4UFOA 3PNQA 2V7EA 3TRHA 3VZCA 4Q02A 5KX5F 2D2EA 3EVFA 2YVAA 4I5FA 3IB6A 3I6IA 4YRTA 1AUXA 4AAYA 2OHXA 3HL0A 1WG8A 4MRAA 4B7AA 3AVQA 3I73A 2OXRA 5DSXA 4ZAXA 2XB8A 2H9IA 4E22A 1H94A 3UPDA 2MSNA 4WKCA 4IDPA 2B78A 4M1KA 1NUPA 1EXDA 1FSZA 3AVUA 2PYDA 1WU7A 1U6KA 4KMSA 2Y93A 2JAXA 1RKQA 1H5UA 4KZPA 3T4PA 5FWNA 4H4DA 2Z2IA 4YALA 1NOIA 4GP7A 1E1CB 2JCVA 2ZYDA 1N9KA 2ZWIA 3H0KA 1TA9A 4QOFA 4KYUA 2GPAA 4O33A 1EA7A 1KFCB 1SOAA 2XBUA 2FUNB 1XOIA 3VYUB 2DUWA 4LG1A 4GL2A 4YECA 2C29D 5HWSA 2AEFA 2XUAA 5B30A 2FMHA 2BZ1A 3MJCA 4PXYA 4B6RA 4HDRB 1IM5A 4M8LA 1QGED 1Z5ZA 2C9YA 2YZKA 3IULA 5JD5A 3KRTA 4JI7B 1P19A 3NHKA 2ATXA 5IAEA 3O8QB 3K9CA 2LZ0A 1ZEJA 5GIOE 3K5WA 3BEOA 4JJEA 1DKNA 2FQQA 1IEVA 3A2MA 3IKJA 2CMGA 1DC7A 1PFVA 3HFSA 2ZROA 3RKRA 4LNUA 4TKVB 3TLXA 2P68A 3MFQA 3N6XA 2DERA 2O8EB 3ACDA 4WEQA 4FB4A 3BGVA 1HG1A 4JASB 1G21A 1AB6A 4KQJA 4D98A 4OX9B 1WABA 2ZBPA 4F8YA 3MA0A 2PD6A 1QUFA 3L4EA 3O84A 4PG5A 4ZU1X 2IH4A 2R6FA 1Y6QA 3JVVA 3QXJA 3AL0C 5E7MA 4B8YA 1LBSA 1XZJA 1IBLB 1LBHA 4Y2SA 1PGQA 4B3SB 1J24A 4ZAYA 5I5EA 3ZTYA 5JMOA 1JTFA 3DXYA 4BY9E 1I4LD 2LCFA 2X1HA 3I8OA 3JWJA 2WTBA 1Q5PA 3M6XA 2HJRA 3AK4A 2CBZA 3QI2A 1QRRA 3FPAA 2VPYA 3P27A 3FPLA 1TGYA 1IN8A 2JJ8A 5HIIA 3RT9A 3TXAA 5IHPA 2NAPA 4Q66C 3AQ4A 3G9TA 3O0TA 3Q2KA 3BWXA 4UBNA 3WAKA 1J2TA 1R6DA 1VYVA 3AR5A 4QUDA 4Z9XA 2P0AA 2V03A 1KSGA 3T52A 4BBJA 2WFLA 2XTZA 4QOHA 1FVXA 4GZ5A 3WL5A 3WNBA 3E8XA 4D97A 3FG9A 2FMUA 1PDWA 3NC0C 4ZEOA 3C5CA 1G6KA 2EWMA 3KZCA 5IULC 2H06A 2AKYA 1QCCA 1SURA 3C3AA 3DEIA 2ZRGA 3FCUB 5I48A 2DHRA 3GARA 4HXYA 3O90A 1GSOA 4LF4B 4LOIA 4ND1A 2VTBA 4KQ2A 3EXG2 3C7KA 3KZXA 4IINA 1WB9A 1J20A 4J07A 3V7WA 3LLMA 3WRXC 3R9WA 4FHEA 5KVQA 2YFKA 1YRBA 1MTZA 2O6HA 2W2LA 1UPTA 2XQVA 4NAVA 5LU9A 1YB1A 1YRWA 2PT6A 3EXIB 1QS0B 3AF5A 4GX5A 4F60A 1ECPA 1EGAA 4L78A 2PS3A 1C80A 5DRTA 1GGMA 4ACAA 3SZ3A 3CV3A 2ZDGA 1XIVA 1GRCA 3CT6A 3EA5A 1QXSA 4Y98A 2JEZA 4S2UA 2J48A 4JBGA 1OFVA 2O7QA 4OM8A 3U4HA 1M2WA 3QOFA 3Q6NA 4WZAA 2IS6A 3FAKA 2YMLA 1OPRA 1M6HA 1OXBB 4IJKA 1PWHA 5FYDA 4G5GA 3I9KA 3ROPA 3MEQA 3VPFA 4KTTE 1C8LA 2I1LA 3BTUA 3EIHA 3FOBA 4O5OA 2ZJYA 3RYFB 3O9VA 1A8IA 1C8VB 2DY0A 3M49A 1TAUA 3D0QA 1W1UA 3NKLA 4UBJA 4RJTA 1XJCA 2NWQA 4G0PA 2HQ1A 1KXJA 3V55A 2Z08A 3AEXA 1G21B 4BLOA 2CMFA 3LLCA 4QUAA 4XUDA 4E03A 4Y9RA 1X14A 4HS9A 2OK7A 3FMVA 4NFLA 1BX3A 3PFGA 5DM0A 1G8HA 3LP5A 5EIAA 4ASUD 3QWHA 3DT8A 1H0KA 1F7VA 4WUVA 2PPVA 1JX6A 1S9DA 2Q6OA 2QF7A 1RPTA 1JLRA 3FB4A 3E27A 2O5RA 3K53A 4OMFG 1IHOA 4PYRA 3QI7A 1ADGA 1OLOA 1GNLA 1WXHA 1RRFA 3AYXB 1RI4A 2BISA 1A50B 3M0EA 4JMLA 4PW0A 2ZTMA 3SM3A 2IS1A 1H2FA 1XEFA 2WLTA 1T0IA 3KSZO 1ZVQA 4NSNA 3H87A 1OC2A 4DLYA 3U0BA 4C7JA 5IVKA 3ZXSA 2ZULA 3NBYC 3W04A 2BBTA 4HPXB 4H7EA 2AW3A 3VKUA 2QOEA 1MT3A 4YJ3F 4GEGA 5CVCA 4DRZA 1E1KA 4EAQA 1C29B 2ZWMA 4TL7A 2ZZNA 4DRXA 1IWOA 5JE8A 1KF0A 5JC1A 2NAFA 1H22A 2IZ5A 3PU6A 1EUZA 3FPFA 4DEYA 2WT8A 1AJEA 3KYIB 2WF9A 4GVLA 1Z9BA 2WJAA 1KY5A 2FQXA 4KN8A 3PICA 5AUNB 3L6EA 4X44A 5REQB 3T7EA 3VHRA 3ZCQA 3HCPA 4EB0A 3I0NA 1QQAA 3RRNA 5KTPA 3CB2A 2RHBA 1RABA 1JQ3A 2NZ8A 1WM1A 1PWZA 3OT1B 5F64A 3GGGA 3P2IA 1BDJA 3A2LA 3SAJA 4A15A 1KRWA 2R96A 1M8JA 1JFFA 1QS0A 3DLHA 1CW2B 1MU0A 2DWPA 2EVWX 2FCAA 3G1WA 3S44A 3TDNA 1NI4A 2H3EA 2XADA 5BSUA 1TU4A 1SZDA 4R2XA 4LUCA 4IYJA 5TQ2A 4UUBA 1KKUA 1RP7A 2EWWA 3E18A 3ZK9A 4OQMA 2Y27A 3R5JA 4FWBA 4QU5A 5LQMA 4NK4A 1M5UA 4W82A 5DEIA 2BELA 3I5YA 5EWJA 2YV3A 4QJBA 4I0WB 2PZJA 4FKMA 3DB2A 1MV8A 2GBIA 3NHLA 4JI8B 2Q62A 4PSVA 2V7TA 2ZXFA 4PHFA 5CT5A 4DS3A 5IJ0B 1Q0LA 3LDGA 3SC2A 4QM7A 2BIFA 2CHUA 1Z2AA 4D8YA 3NORA 1PL6A 4LDNA 7MDHA 4L0MA 4K5QA 3FZYA 1N6IA 2B3DA 2GVNA 4QDUA 1NQVA 3ASUA 3BK1A 5CDFA 5BYAA 4UTOA 4B45A 1BDHA 1NJ6A 3G2QA 2WINI 3M1AA 3WJ2A 1PL8A 5KNBH 5B2EA 4RJJA 5J5AA 3NALA 3UGQA 1QHFA 4J6EA 4GBJA 1EKXA 1QH9A 2P9GA 2UZ1B 4PTLA 4YRFA 5LBUA 3DFMA 1KAHA 2G36A 2EXXA 2IYAA 1E63A 1OLSA 1UXKA 3CNBA 1P2VA 1U8ZA 1VJ0A 3HCDA 3W9YA 2PWPA 5I4KA 2B3TA 1OFUA 2RIPA 3NC1C 3OOSA 4JP5A 3GD7A 2O57A 4DQDA 1CQIA 2QTNA 1ZD4A 2EJWA 2VA8A 5DM2A 1N3LA 4DTCA 3UFBA 4O2AA 721PA 4QEDA 4UTPA 3BL6A 2ZRFA 3UZUA 4FQ7A 3WIUA 5IUJC 1JXOA 1EFVA 1H0RA 1E69A 1GZSA 2AR9A 2VT7A 3GLGA 5DK6A 5HIMA 2AI2A 3IAS1 1CUYA 1KJNA 1UPXA 1UEJA 2C2XA 2Q3HA 2IEIA 3ABIA 3KG2A 4TXNA 5NULA 3SQOA 1U4SA 1YBFA 1BXGB 2YXPX 2IUUA 1FW6A 3H9QA 2BHNA 4DIUA 4DSNA 3BGIA 1E7YA 1AKMA 3EGVA 1EAMA 2W2TA 4MCJA 1UJMA 1GPJA 4MULA 1MW9X 3UJCA 3F67A 2I91A 3PQDA 1LLCA 3PEYA 1UOQA 1CQIB 3DGEC 1C3OA 3GJRA 2JAWA 4D9KA 1SKMA 4RADA 1UPCA 4Q9NA 1PJ8A 4FZ5A 3KKQA 1H1LB 2UYOA 3KKOA 3VSDA 1M2HA 3EAFA 3LIIA 5JSYA 2IP2A 3CRQA 3IDZA 4NBRA 2EX1A 4UU1A 5DFAA 3ZY5A 4D3FA 2G8NA 2Q1YA 2W4IA 1QHHA 4D41A 3W5SA 2WJ3A 4JYCA 5PNTA 4AJNA 2O05A 2FWNA 4WMLA 1HTTA 1P17A 3H1FA 2HCBA 2CFTA 5IW8A 2YW2A 3E9MA 5HZMA 3BB1A 2VHXA 3AB7A 3LDUA 3NNSA 5FQOA 2HWXA 3ZWNA 3O8NA 1XQ1A 4L27A 4WPGA 3BIXA 2OPHA 3ZUPA 1KTIA 4OQEA 3SC2B 3KTDA 1JEDA 2G25A 2IPXA 1AK2A 5AI4A 4Z0NA 3G5MA 5AUOB 1L5FA 5JMWA 1ZJYA 3E3OA 3CX7A 4L7QA 3KFLA 2JGFA 2OR3A 3FCYA 2DTDA 4FR0A 3SIWA 1EA5A 1ZK0A 5ELMA 2DUJA 3GH1A 1KC1A 1AK9A 4JL8A 2HF8A 3JQFC 3L4BA 4QUIA 2D0DA 3PC3A 4C01A 4BNGA 5EE0A 3HRIA 3GA7A 2CXXA 2VDWB 1SUFA 2V74B 4KIFA 4LRTB 5L3RA 2VPZA 4KYVA 3MMPA 4U2CA 3WOHA 1VB3A 1BJTA 4Q9IA 5LUBA 4R69A 4IIFA 1FJXA 3ELDA 4OMCA 3RVNA 4C4ZA 3BZBA 3EGDA 3K0AB 4DLUA 3QNUA 4LGCA 3P2OA 3DTVA 1IBCA 4NC9A 3C4VA 1TGVA 4RE5A 3BJIC 5DLYA 5K7SA 2YHAA 5LQRA 3ZBQA 1TUIA 2X13A 3C3EA 4D0RA 1RJWA 2GJAA 2QJTA 3LSYA 4BEWA 2MINA 2NTEA 5CVEA 2O07A 1IJEA 1PJZA 2FZKA 5EIOA 3GVIA 2XY4A 1QYWA 1EJ0A 1PFUA 1S1MA 4ILEA 1DPFA 8MHTA 5CB6A 1QC5B 2C4HA 2HIGA 1MX1A 4XIGS 1TU0A 3I0MA 2MCFA 4I5IA 2HT6A 1XAGA 3OJEA 2I6XA 3SYLA 1UBRS 4RLHA 1AKQA 3OH8A 4JWKA 2O0KA 4IF6A 5JG7A 4NYJQ 1ZRNA 3IRVA 2HPAA 1KRXA 1LH0A 1MO2A 2B1RA 5BSRA 3SP1A 3UJ6A 1M7BA 2OILA 3HYLA 1GLGA 3V6MA 3IQXA 3UGKA 1E79D 2RC5A 3OFKA 5JLAA 4FWIB 3LDHA 4RZQA 4LJ6A 4YV2A 1Q7GA 2VQ6A 4R1TA 5IWAB 4MVJI 3O92A 2D7DA 1ZINA 5AFSA 4JLNA 2JIRA 5C35A 1YJQA 2R1VA 4IG4A 4NEQA 5D87A 3KQHA 2BGLA 3G85A 2QYTA 2Q7DA 4KYIB 3RJ9A 1CUBA 1O94D 1L7MA 3VGPA 2YN2A 5KTRA 4WD3A 4CR7A 1KO5A 4M21A 1D09A 3RQIA 3W4JA 3WLIA 4DIOA 4PONA 1FZTA 2EKLA 3OLVA 1T2DA 2OCDA 4Q4CA 4TKMA 1C3XA 5AH0A 5KVAA 3U9SA 1FTYA 1ZRSA 4DLNA 4IDAA 2V7WA 3LM8A 4ND4A 4YCLA 3GNTA 2PZLA 4MW6A 4ZAZA 4EARA 5CA0F 5K8UA 1GN8A 1CF4A 1ENOA 2CY0A 1TC1A 3QKUA 4ZOLF 1E3QA 3KVVA 5T4EA 1KEPA 2I1QA 3BHNA 1DXHA 2XVXA 1VL5A 2XDQB 3FIJA 4BFZA 3VJRA 5TMDA 4Q3LA 2FZVA 2O8DA 4ZZ1A 4KFUA 4LXYA 1QPGA 2FEXA 3IBCA 1HLGA 1U0NA 1E1QA 5HF6A 4CU2A 4ZCTA 3U56A 1N8KA 2VPIA 5CVUA 1FBNA 2WQZA 4LCBA 1RDFA 5E3IA 5J2UF 4REOA 3SS8A 1KJ8A 2OGTA 4BB5A 3IBTA 1ZJ5A 1YVEI 2X1MA 3IVGA 4KODA 1MTOA 1Q7TA 4LDAA 4D1YA 4DUGA 1QP7A 3L8MA 2ID8A 4X6YA 1OH8A 5HQTA 4H6WA 2LWIA 1XCMA 4X3PA 1FS4A 2HJHA 4EQZA 4ODIA 1M6VB 3WIOA 3AUFA 5TMEA 2C61A 3O9ZA 1LLQA 3BXFA 3W7BA 3G7UA 2O8FA 3LUBA 3ENVA 2I99A 1B74A 2Z58A 2AN5A 2MSDB 4JJ4A 2XWPA 3GJ3A 2ZPUA 3B20A 5KHAA 5C5DA 2P0YA 4D9EA 5LZ9A 2Z6QA 3GAAA 1WSAA 1G6Q1 3A9SA 3VH3A 3RG2A 2XIJA 4LXTA 1XAHA 4ND7A 1FSPA 1PR0A 3NYIA 2GKSA 4WGFA 2RD2A 2VOJA 3RSLA 2HRRA 5EZ5A 1WBJB 4ZT5A 2GB4A 1MZVA 4N39A 3NHMA 4UNRA 3BSFA 5L8VA 4UTRA 1S9HA 1QU3A 1KSHA 2AH5A 4HUQA 3G8DA 2IPNA 3HYTA 2XUFA 4NYMQ 5DGTA 2JBHA 3QUBA 2A9PA 1QIKA 2CXRA 5BN3B 4KIJA 3B9PA 3R7WB 3K6KA 3OVMA 1L5OA 2QN3A 5D6NA 2EQBA 3RYIB 2AQ8A 1XZHA 2FFHA 3AINA 3TNDA 3RSSA 1GWNA 1N0VC 1JG7A 4ZOLB 1A4IA 1GDDA 4PYIA 1GTG1 4R3WA 2V59A 4EKIA 4HLQB 4MPRA 1A9OA 5HUJA 5JNTA 5CW2A 1B7GO 1NTOA 2GZSA 4BFWA 1U2EA 1LC0A 4PO1A 4EJSC 2XE8A 2YDXA 5BNTA 5IANA 3HZHA 2PJDA 1GFSA 3WS7A 1DO0A 1U3UA 5MN5A 3R23A 3OQJA 2FR1A 2QLTA 3OJLA 4QNMA 3SQMA 4A1OA 4RELA 2OWEA 1XJ5A 3FPEA 2BGUA 3UKDA 3OLQA 4EVSA 1I2MA 2BR4A 4HBGA 1QR2A 4KBGA 2GCNA 1WKVA 2P3SA 4D0SA 4EF6A 5LL6P 2XEDA 1KVRA 3KXPA 3X1DA 2VH5R 1KYIA 1XEWY 3H2BA 5DB4A 1CQJB 1QQTA 4JP8A 2GDZA 4ZMBA 3DMGA 1GA6A 5JIBA 2GEKA 3FPHA 1CVLA 3GU3A 1YQDA 2ZRLA 3DL0A 2I3AA 4OXQA 5F35A 4CNBA 3T3NA 2A0XA 5EWMA 1Q0RA 5FA6A 2WUGA 3NCTA 4CT0A 2ZUWA 2PT7A 1HT2E 2R5WA 3IAAA 5FO0A 1NJFA 1FDIA 2FAXA 3LD9A 5AP9A 3S2GA 5CCEA 4V39A 2BI7A 4LOJA 1A3CA 1Z6QA 3WMEA 1UWCA 1EU1A 1KU0A 4FDUA 5ER9A 3AP2A 2FE4A 1E2EA 1K63A 2PMFA 2B5VA 2XSZA 3EGWA 5M29A 5F2NA 5LN1A 2CDNA 2W4QA 2A1UB 3CW9A 3I45A 1YS6A 3TSZA 1SQSA 4GDFA 1WDLA 4TN1A 1UJ6A 1S2IA 4G2NA 3S1SA 3BE8A 2VF7A 3DCNA 4LYFA 3ST7A 3H0CA 1JLLA 1S0UA 2E1RA 3FYTA 4AJ4A 1K98A 2R1VB 3BPSA 3GT3A 7MHTA 4XEHA 3HWWA 3JQBC 5EFOA 3MIZA 5JAZA 3RLIA 2CFSA 1FUYB 4F3YA 2FHSA 2WSBA 2YNMC 1AE1A 3SEZA 2R5NA 4J0QA 4P4NA 5EE3A 2PJUA 5CNKA 4ZK2A 1B0ZA 1GAWA 3G0OA 4C03A 1E1NA 3DAYA 4CG1A 3QNMA 2IH5A 1BKYA 1FFHA 3A31A 3G7NA 5HGXA 5JXWA 2NXCA 1Q7EA 2PO5A 3ORSA 2JLVA 3CEHA 5HX7A 4C6TB 3HXKA 2LTAA 4GPD1 4P4TA 4V24A 1VSQA 2PK3A 2R6ZA 1C50A 2VUTA 1V3UA 3DLPX 3KAPA 3T9CA 2ZE8A 1RWVA 5CIWA 3CNLA 4R6WA 2XCLA 4DL9A 1ID8A 4XQCA 1Q0ZA 1Z75A 2ADMA 3OQBA 3IQHX 4JH0A 3GW8A 1ZN9A 3TVTA 5FPQA 1R0XA 3N2NA 3R44A 5HK9A 2BFWA 2FPMA 3U4DA 2Z8XA 3Q10A 4C4YA 3AF2A 4HQNA 3ZLUA 4IRXA 1N5IA 4HFJA 4YRQA 4QPNA 4GP6A 2V1UA 4X1IB 2EF0A 4ES6A 1Q1BA 3AF3A 3EFOA 3IT1A 3W2FA 5C80A 2XOKA 4MW4A 5IBRA 4EAAA 3PFFA 4WVLA 2ZYUX 3OG9A 3I2HA 3HDQA 5ALRA 2P79A 2ECOA 1R88A 4Q9HA 2OBFA 1YDHA 4XUGB 3C8DA 1E64A 3UTCA 3ABSB 2CMKA 4S1NA 2VQEB 3HV0A 1TX4B 1SCAA 3QKWA 2QIOA 1KAQA 3AZQA 2CLMB 4L9AA 5TVGA 2P30A 1J9ZA 4GL4A 5FTKA 4ZJZA 3K4HA 4OHYA 3D8SA 1Z6GA 3VKWA 1QO0D 1W581 2PYIA 5DASA 4P84A 2WM9B 3A6PC 3VR6H 5TMBA 3BN3A 4URVR 1ZYUA 3B9QA 1S4MA 2HEGA 2WFMA 1GQQA 1RYMA 3K15A 4G09A 5KYVA 4JELA 4MTLA 2VT6A 2G28A 2C1ZA 3E0XA 3I01A 3MJRA 4UUAA 1R8XA 3ZDAA 2OV3A 3R7AA 4XXHA 2XRMA 3TLGB 4HJXA 1LLDA 1P31A 4GLBA 1YO6A 2JARA 2QUZA 4M0MA 5CYPA 1T43A 4PQRA 1PZGA 4UHDA 2CXTA 3DUFB 3KKEA 4R1OA 2IELA 4Q21A 4Z9AA 1M67A 5AK6A 3LA8A 1QTNA 3HJTA 4LHYA 4QATA 2XJ9A 1UZLA 4J2OA 5A4KA 3AM1A 2B83A 1N0WA 3A0UA 3LQ2A 4HVCA 1E98A 1KEZA 4UMVA 2NX2A 5AOBA 4EG3A 3DAPA 1X1CA 2NUAA 1L3BA 2JFOA 1KSFX 3RWOA 1N0HA 4KX5A 2P8JA 4YT4A 1ZXBA 1PR6A 2AG8A 3H05A 4HPJB 1FFGA 2EOAA 4K6GA 4E51A 4RK1A 5KX5A 2PH3A 3G89A 5A62A 3W5DA 2PCJA 5AK0A 3L84A 4RCYA 3H3XA 4E70A 1HDCA 1RAAA 1WVMA 2DT5A 2OCYC 4N03A 3TOSA 1C7QA 1JEQB 2JL1A 4DMMA 5B4UA 3VPCA 3LHIA 4U00A 3VR5D 1YHYA 4MVJP 4KLRA 2AX4A 4AI6A 3EPJA 1BROA 1U0LA 3Q6IA 3F8SA 4ARVA 2F43A 2YS6A 4B6OA 2BUBA 4OQPA 1U28C 4M2LA 3DEYX 4INOA 4TLAA 1WLYA 3UY4A 3RS7A 5EJ8A 2JFHA 3OM9A 4IMRA 2DE0X 4CKWA 2A9RA 2IHUA 1UAYA 3IPYA 2NZYA 2ECQA 1DSSG 2D5BA 2GK3A 2V96A 2W2QA 2W93A 1X6VA 2PH7A 2WWGA 1THZA 4XFKA 1L4GA 1QHGA 3K2QA 1AQIA 4Q6WA 1ZKMA 2Y6VA 3E82A 3JWEA 3PDIA 2RDMA 2JNWA 4BXOA 4I08A 2Q3EA 2VHQA 4FWTA 1QTQA 3EVAA 1IBSA 3EEFA 4UHKA 1P8JA 4DDMA 4IUDS 2EFJA 1UAAA 5KNCH 1B23P 2O0MA 1PZHA 3WBFA 2BYTA 1FXWA 1IH8A 4LYGA 4HNSA 1G6HA 1GR1A 1XRRA 2Y05A 3HY4A 4HB0A 5TF4A 4GAEA 1QU2A 3L8GA 3VZPA 1GZ3A 3PUZA 1V25A 1UR5A 5SYAA 2QUJA 3PX7A 3B7GA 2POQX 4R5MA 4F2GA 4BO0A 2NT4A 3QXHA 2F3QA 4HUQB 4KRXA 3E48A 1J8QA 2H4FA 3OCWA 4OOFA 4YQEA 1UEXC 2B7BA 1MB2A 1Q0HA 2NV0A 3H8JA 4J0DA 3CN9A 2WE7A 3WDMA 1G16A 2HLPA 1EFDN 2Q4TA 5DN6A 5A5GA 3UA4A 2ZJ6A 2C0CA 3BICA 3DV9A 3H7IA 2CKMA 1CIPA 3QFFA 2E4AA 1GKUB 3K3PA 3QPAA 4KXMA 1J42A 4RCVA 3OE1A 2CHEA 2BEWB 3V32A 2REXB 2CL7X 4H1HA 3WDKA 2AJLI 1GTZA 1KQPA 1EEXB 1V37A 1XZIA 4O1HA 5DTIA 3F6EX 1JJFA 4ZT2A 4YJHA 4ZCRA 2GVZC 4ZZ3A 4M0KA 5IF3A 3IP8A 5DLEA 3ZU5A 1SIWA 1JXAA 2X1VA 4C0SA 4FQ8A 3U7JA 4GLFA 1DIAA 1GCUA 1ORWA 2DGDA 2PGAA 4CQMA 1G7RA 2QB5A 3CJQA 3IURA 4JP3A 5KTOA 3BBLA 2JIZD 3U17A 3U39A 4EY6A 4FGWA 4RLSA 1U0HC 2ZRJA 5KYNA 3L7KA 5I7UA 1DX4A 4URZR 1IQ0A 5H59A 1P6XA 5L3VA 4P3PA 4IOMA 3PFHA 3JYQA 5BT8A 4O2AF 1TF2A 2OVFA 1G8KA 3RKSA 4LJKA 1NSFA 4G0MA 4IHKA 1TKAA 1USGA 2CL6X 1HT1E 4FLFA 1ZI6A 2EU8A 3H2IA 3WKDA 1DZ3A 3E9CA 3WZ2A 4K6FA 4C2TA 3FUWA 3MBKA 5JZBA 5JSHA 3QKTA 4JBLA 2QBYA 3P9QA 1HPLA 3U31A 5DU2A 4ZFNA 3NBXX 1K4KA 5IC5A 5FPHA 4ECAA 3HB4X 1U3VA 4GR5A 1NM5C 4JIGA 3A1SA 1S3GA 3DPSA 4FSDA 5IAJA 3D2LA 1WDTA 3ETNA 3GJYA 3NUQA 4NG4A 4Q4DA 4Z1MA 5LB2A 3UK0A 3WYBA 1EP2B 4FI3C 4QEKA 3IUSA 4TMVA 2J9FA 1SD1A 3F3MA 3O2JA 4OLHA 5F4ZA 4QOEA 5KU7A 3T1NA 3L46A 5JDCC 1E92A 1AXGA 4TKLA 3JQFA 3L4BC 2MR6A 3IEUA 1WXDA 4WESA 2IOYA 3LL4A 3ZU2A 4EA6A 2O5CA 4OGFA 3GGPA 4B74A 5HKBA 2Q4BA 4BO1A 1N1MA 1VECA 1FTSA 3EF3A 1DBWA 3M82A 1JLMA 1RWNA 1A4RA 2Q5EA 3LGSA 4R4JA 4NPAA 4LYAA 5TS3A 1A9TA 3RRZA 4IQFA 4INAA 1ABBA 3GRZA 1LI7A 1VOTA 1NXTA 4OJQA 4UHJA 3S2YA 1ZD8A 3CVWA 3N87A 1U2DA 1IPEA 1RPJA 2QVLA 3H83A 4QGBA 3OP1A 5CFZA 2CLFB 4YP9A 1FP4A 1DJNA 1XNQB 1JI0A 3IQGX 1VCOA 2V8OA 1A7KA 1O97D 1T4BA 2Y3IA 3NR2A 3RUHA 1Y6GA 1I1OA 1JIUA 4BEJA 3I2KA 4JBYA 2BI4A 1RLJA 2WEKA 1UXGA 3COPA 4D3SA 1JYEA 3B7PA 3MD0A 1XRPA 1Y3CE 1HL7A 1G5IA 1FP7A 3MBIA 3OLYA 4FGSA 3AWIA 1YWGO 3NRJA 1TI7A 4P83A 4PX2A 4MQBA 3MTQA 5JQGF 1LNQA 1YXMA 3VDQA 2JHAA 1NVMB 3IAFA 4IFEA 1XZCA 1O0SA 1PFQA 3JATA 4PZEA 1WF6A 4UD6A 3T94A 3U61B 4QJ4A 4YJ2F 2DBVO 2JAQA 2I2BA 2X5KO 1RQLA 4GI1A 2VDPB 1TVKB 3JVIA 5TEWA 1DEKA 2R48A 3N2KB 1N25A 2VRCA 1SUEA 1XLTC 4P86A 4H17A 4I1PA 1RJEA 2DETA 1NT2A 1EX6A 2E55A 3NHSA 3QVGA 3JZFA 4JR1A 2OV6A 1B8NA 3MWDB 4KR9A 2JEOA 3U4CA 4E2FA 5B3KA 2EP8A 4MSUA 4WZZA 5BSTA 3DA8A 1DWPA 5E0OA 4EZBA 2R00C 2RSLA 3PL1A 5G0TA 1QHYA 1TF7A 4C4XA 2YV4A 5BXQC 1Z4IA 2H16A 4QBKA 2DLDA 1JLKA 4AXBA 3RSCA 1DX6A 2OUIA 4HX2A 1BOFA 3LUPA 3TBHA 4AZVA 1SA0A 2IYRA 4D9BA 4XCVA 5CDHA 2ZUCA 1CJTC 1V5IA 1F8UA 3N8NA 5IXJA 2ZS7A 3FOEC 4ITUA 4TLMB 3PT5A 4QLAA 4XFDA 1F3OA 1XE3A 3CO0S 3B36A 3D4LA 4WK0B 5IT5A 2B5OA 1OKKD 3GGJA 3DHNA 3GP3A 1GKIA 3AF0A 1DAHA 2PXAA 2IX9A 2Q3JA 3E0QA 4DIEA 3CKYA 1P81A 5B2ZA 2YV5A 4CZ2A 2WSMA 3HN7A 3BMXA 4NCIA 2R6DA 2QRUA 3UWMA 1IY1A 3ZCXA 1XVLA 4TTRA 1KO4A 1KS2A 3REFA 5HZGA 2CYBA 3ZHRA 1UPBA 3OOWA 3SWWA 1D04A 2DKFA 4N3CA 1M2OB 1EWKA 4JXJA 2QYSA 4JJZA 5E6RB 3K09C 2PS9A 4DBVO 4M0CA 2CV1A 4KR2A 3VC2A 1JQBA 4OFZA 3A9CA 5FBQB 3GFPA 3I2YX 1JNYA 1JXQA 2KBEA 4HQLA 2FDXA 4MKZA 4K9MA 4ETNA 1NVTA 1Z56C 2Q8NA 4MA4A 2AC4A 4RHEA 3AR2A 1X94A 3LF2A 4WBXC 5HUQA 2A9KA 2Q9AA 2I8AA 5CG2A 4L07A 3H11B 4UUQA 3BMQA 3VTAA 4PZCA 4DWWA 2O0LA 4KFSA 1TEVA 1UQUA 1GEGA 2JFFA 4PZAA 3F7OA 3REOA 1PGOA 5GZ3A 2K6GA 1WY5A 4OSPA 4JITA 4LISA 5EQFA 3H8WA 3FBWA 1PD1A 3OOHA 5LU8A 5BY2A 1MENA 2PGJA 1P4SA 1XTZA 3DWFA 4CLRA 1W19A 5EI5A 3FBGA 4TYMA 2Z8ZA 3LBAA 2Q3BA 3W79A 1MHPA 3FKSD 2GETA 2CK3D 1I2ZA 3QHAA 1TUEA 2WZBA 3AWDA 4ER0A 2P9BA 4OA5A 4EW1A 4IH1A 5IFLA 4RENA 1YCGA 2OOKA 1WMAA 1ECFA 1THMA 4A91A 4ZTZB 1WRBA 3FJYA 3ITEA 1I4WA 1VHDA 4IFTA 4IO1A 1GZ5A 4BV3A 4BFUA 3LZ6A 4CFSA 3TLCA 4EVIA 5KNDA 1QPBA 3WBJA 4E2WA 4Z3DA 1L1EA 3H1TA 3PHBE 5I9MA 1PNRA 1WMDA 1KMMA 4BP3A 4EF4A 3J81A 2UUPA 1SVLA 4R41A 4DQUA 1RRCA 1OZHA 2G7ZA 5ADUS 3ZW8A 1RXUA 3AIKA 4M7PA 3CQ9A 3LOUA 4B8WA 2IIPA 5DJ5A 1O95C 3ESRA 3ZZTA 4U6QA 1FSSA 3ABZA 4ZQHA 2DQ4A 5K51A 1VPLA 4I1SA 1V35A 1ZONA 2R751 1LNZA 2RGXA 1THGA 1YRAA 2L69A 2ZUBA 4OJTA 4RD2A 2AOVA 3GFVA 1E6LA 1TMOA 2PVCA 2VT2A 3DBLA 3E61A 3OCCA 4IHJB 5EAIA 4D8WA 4UTNA 3K5HA 4HL6A 3QEMB 3T5BA 5KYGA 1PN3A 1SCBA 1Z3IX 2OAGA 3NTOA 5GZ6A 1C1DB 3ZV5A 3IEXA 1DG1G 2G1JA 4J0FA 2QAGB 3NFYA 3IUNA 1XTVA 2HDOA 4MRNA 1J06A 4QYMA 1YHZA 2AC2A 1EIZA 3PLAE 3DWGA 2JGEA 5DTQA 4HWGA 4BZZA 3BHMA 3W5IA 4YRKA 3WGHA 3FUXA 4QOJA 2H2DA 4JB3A 3TLAA 1V6CA 3MGKA 5E95A 1OH5A 1KEUA 5B3JA 2BMFA 1EK0A 4MDEA 1OLXA 2HHAA 2YNMD 4TS3A 1YJXA 2D59A 4FSHA 3S99A 5AKKA 3FTEA 1PR3A 3B6JA 3SZUA 2ABWA 1SZCA 5JQWA 3CXUA 1W2HA 1LBTA 3OLCX 5H4HA 3ZEAA 3DDUA 3QLUA 2ENUA 3AG5A 4KNVA 2HF7A 3I9FA 5GINE 3QA3E 2P27A 4PTYA 1Q83A 1RHRA 3CNHA 3EY9A 2GBCA 3K0CC 5HVNA 4JBXA 2WR8A 2JDID 1QNFA 4NDZA 4OGKA 1EE2A 3F5DA 1Y1PA 3VUEA 1E1QD 4RGQA 3OSUA 2C5HA 4NTZA 5LWHA 3WICA 4E15A 1XJWA 1VLHA 1S8NA 4HRAA 3ZW7A 2QORA 4A73A 2IBTA 4MKGA 2H1CA 3PLRA 1BWSA 1P4RA 1ABEA 5DBGA 4FJ0A 2JA1A 3U3ZA 2Z0MA 4J8PA 3BWVA 4NMWA 4RTQA 2DFPA 4E08A 5K0TA 2ZR7A 1SCJA 2VRBA 1POXA 3H17A 2FSPA 1DBVO 4KQIA 3JQEA 4E4RA 5F98A 3A36A 5KDOA 4RWZA 4CEHA 1LI4A 1ZQ1A 2VDMB 3FR7A 1JPNA 2JEYA 3KQSA 4RBNA 1DO2A 4URHA 2CNWA 2IDJA 5GONB 1XPOA 2ZI3A 4BYMA 1SK8A 3W4IA 3U3JA 4WNCA 4XFJA 1A9SA 1VMIA 1KOFA 1ZOIA 4IDOA 4HATA 4KACA 2R6CA 1U31A 4RF2A 4C3OB 2XNCA 2XTJA 2PZAA 3FZNA 1IDN1 3B1WA 3DSRA 3UAZA 5ECGC 1I1QB 1N1EA 3JALB 1L8QA 1N6NA 2KE5A 3EGXA 1W0CA 3L1JA 3P9ZA 1HH4A 3P9IA 1KMQA 1GNVA 2UZ1A 3NDJA 4FCTA 3ZXXA 2QZSA 3JX9A 4F12A 1I32A 3MXTA 2I7DA 3U81A 1SRQA 2JJ1D 2QW1A 2VWPA 1X1AA 2E82A 4EMSA 5L6LB 5ESXA 2GYYA 4AB1A 2UZAA 2NW6A 1UOPA 3EMDA 4QNNA 1EFKA 3UHJA 2IA5A 1H6BA 3AUSA 4N5MA 2YJ6A 4NMXB 4PC7A 1NJ1A 2XQFA 3CNNA 3DDWA 4UW9A 3A3YA 1O4WA 1XEWX 3K94A 1KSJA 2HSDA 2P41A 1W5AA 4WUTA 4DLBA 4PCUA 1MO3A 1TM1E 3IE0A 3P0JA 4L0CA 3Q0TA 2AF4C 5DTJA 4QVGA 2QAGA 1W5FA 1M5RA 1MFPA 1MP0A 3A10A 5AKEA 3EXHB 2XPCA 3FYDA 3W5CA 2W98A 4WZ6A 2PEYA 2ZSKA 3OEED 5FWAA 3PJFA 1DC5A 4Z5XA 3UMBA 2NO1A 3LYUA 3S7TA 3AIIA 4OQYA 2B82A 5CLHA 2PFGA 2JBAB 2XDQA 2V7QA 3WGLA 4LCEA 3M89A 2Y1WA 3U7IA 3W3AD 4BFYA 4DCUA 3UOGA 2JIDA 4RIHA 1YMQA 3I1IA 1YZVA 4OQ4A 4RESA 1Y3AA 3JD1A 3D8TA 2GMWA 3MTAA 5KMGA 3HU2A 3VH1A 3NGLA 3KKMA 2I34A 4PZZA 1IYZA 3CRNA 3BB3A 4LRQA 4WZBB 4WFKA 3EVGA 2WA1A 1WMEA 2EL9A 4HWPA 3TYXA 2TMKA 2OL4A 3H99A 5A0VA 3BREA 3UWDA 4RVHA 2QA5A 2QBYB 2YJ3A 3UH0A 1W48A 2GZDA 1AQLA 2V4ZA 4IX1A 1Z4KA 3FUCA 4J0JA 3SK0A 2GFIA 4I9FA 5H68A 3I53A 4JBIA 4NP6A 3K30A 4M38A 2DSNA 3LFUA 4Y9DA 4BNXA 1P0FA 3CZRA 2QTBA 3KZKA 1GA4A 1E77A 4IEIA 2XTMA 2AGVA 2O8CB 4II3A 4BQQA 5JUWA 3UJHA 2WHRA 3LYHA 2HREA 4EO4A 1TYAE 1LPMA 1JMVA 4H0NA 1E2HA 5AO9A 2XD9A 1M2VA 3LA6A 4AZWA 1GV0A 3EF0A 2IYSA 3UQYS 3HGTA 3C15C 1AXEA 3NHYA 3TBFA 1NQ5A 4DQKA 4WLUA 1OT3A 1PSWA 2Q6TA 3VBEA 3ID6C 2PIDA 4OKIA 5A6VA 3ADKA 3O8QA 1FL9A 3ROZA 5ALZA 2BEWA 3R6GA 1ISRA 3IAUA 2C3YA 1WLSA 4RZIA 2DWOA 1A7JA 1YOBA 4DKXA 4WQMA 4FEYA 3L6DA 4GOXA 1YS9A 2AD5A 4XQEA 2YFHA 3Q8LA 4EGCB 1GGKA 1J49A 1B8OA 1BWPA 3MOIA 1W4RA 3WTCA 1X3SA 1U81A 3C39A 2GZMA 1T4GA 4LI0A 2LDXA 1UM8A 2PE5A 1DRKA 2GKOA 2RHRA 3FZGA 3JYLA 3QJYA 3CUSA 1PFKA 1FP1D