3K6KA

Crystal structure at 2.2 angstrom of hsl-homolog este7 from a metagenome library
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
297
structure length
297
Chain Sequence
b'DTKMDPRDFLQLLKINAEKAEKNLPLDQKRAGMEALCERFPRAEGVELTLTDLGGVPCIRQATDGAGAAHILYFHGGGYISGSPSTHLVLTTQLAKQSSATLWSLDYRLAPENPFPAAVDDCVAAYRALLKTAGSADRIIIAGDSAGGGLTTASMLKAKEDGLPMPAGLVMLSPFVDLTLSRWSNSNLADRDFLAEPDTLGEMSELYVGGEDRKNPLISPVYADLSGLPEMLIHVGSEEALLSDSTTLAERAGAAGVSVELKIWPDMPHVFQMYGKFVNAADISIKEICHWISARIS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Esterase/lipase
publication title Biochemical and structural analysis of hormone-sensitive lipase homolog EstE7; Insight into the stabilized dimerization of HSL-homolog proteins
rcsb
source organism Uncultured bacterium
molecule tags Hydrolase
total genus 98
structure length 297
sequence length 297
chains with identical sequence B, C, D
ec nomenclature ec 3.1.1.-:
pdb deposition date 2009-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3k6kA00
2O2IA 4G5XA 4LXHA 1WOMA 1AGYA 3D2CA 4J0CA 1C4XA 1F6WA 2WSLA 2O2HA 2QKYA 3SWWA 1Q83A 3AFIA 3W2TA 3WKEA 2HRRA 1YAHA 5FPPA 2QVBA 5AM4A 3F96A 4QDXA 1JMYA 5JAUA 2VJDA 4BCDA 5EIAA 2DQYA 1W1IA 5LZ4A 1XZGA 2GBGA 4ARAA 4DSAA 4MYSA 1CPYA 1EVQA 4X90A 4UFNA 3FNBA 5K3AA 1IUPA 2XMCA 1L7AA 3OM8A 1P0QA 4Y2PA 3WL8A 1VE7A 3DD5A 3EQ7A 3W04A 1ODTC 3DOHA 4WDRA 1EA5A 3NOXA 4Y2QA 3ZI7A 1BROA 1X2EA 1K6EA 4ETWA 1J2EA 4KE8A 1JJIA 4LXGA 5BWBA 4GLBA 3QPCA 4OPMA 1BEZA 4BDSA 1QFMA 2X76A 5AKHA 2QR5A 3WL5A 5E2IA 3E4DA 3DKRA 4PSDA 1EVEA 4GEGA 3DYVA 1CQWA 1QO9A 2QUAA 1EDDA 2GZRA 3F9CA 2ZJ6A 1PJAA 4F0JA 4XWGA 4MYDA 4KAFA 4B6GA 5CTAA 2JGEA 4N8SA 5JD6A 3R0VA 4FKBA 2ORYA 2B9VA 2VT7A 4H35A 2JGKA 1FFBA 2XQIA 3C6YA 1WM1A 5AI0A 4H7FA 1CUYA 1MU0A 5JZSA 5ALPA 5AI8A 1JFRA 2WFLA 5AK3A 2B4KA 3SX4A 1VZ2A 2Z8XA 2XUQA 1LGYA 2JBWA 3WIBA 2QM0A 2NW6A 3IUJA 4MEBA 5AICA 2XUKA 1DU4A 5JAOA 1CEXA 2H1IA 4E14A 1XQWA 1LBSA 4XIIA 2XLCA 3L1JA 3W9UA 2E3JA 2VJAA 1LPPA 2HL6A 1G4HA 1MN6A 4EBBA 3IUQA 1DX6A 1ZI9A 1JI3A 2VF2A 2JF0A 3FCYA 3UUFA 4Q82A 1LLFA 3AINA 5AK6A 2WFLB 3IVMA 1F0PA 1S8OA 3F97A 4X91A 1DT3A 1LNSA 1DWOA 4X93A 4AX4A 3ED1A 1XZHA 1SFRA 2OCLA 4UBLA 3QMMA 4UBNA 4BZZA 6YASA 1A7UA 3G0BA 3H1BA 4XJVA 2HU7A 2QRUA 3R3UA 5DTIA 2QS9A 4B84A 1DWPA 5EIHA 1Q0ZA 5KWIA 1R50A 1M33A 1YS1X 1E8DA 4PF1A 1ZOIA 2DHCA 2XQKA 1P0PA 3DNMA 4ITVA 4X92A 2IX9A 2WILA 2OQIA 3R41A 5C8XA 1L7QA 2DQZA 1YCDA 3HXKA 4GXNA 3WYDA 5FRDA 2XT0A 3NUZA 1U4NA 4H7DA 3WKCA 3K6KA 5AI9A 2V98A 1W52X 5CXXA 4B82A 2EEPA 4KEAA 5AM1A 4YX9A 3WK8A 3G9ZA 1YSCA 3I2KA 3OG9A 3VISA 1USWA 1QJ4A 1MNQA 1UOQA 1G66A 4BP9A 2XQGA 1XZIA 5AHXA 1CIJA 4PV7A 2OG1A 1JU3A 1FSSA 3H1AA 4JNCA 3CCCA 1A8SA 4J3JA 2JEYA 3WZLA 4MEAA 5AI6A 4OSEA 2J4FA 5IH7A 2CB9A 1EXWA 2Y6UA 3DS8A 2K2QB 4N8EA 4G8BA 4FDMA 3O4JA 1UKAA 2FUKA 5HK9A 1WB4A 4F60A 4TGLA 5ALHA 1DQZA 1CUXA 1WCYA 1ETHA 4PNZA 2WFMA 4U2DA 3WL6A 1LZLA 1LPMA 1DQYA 2CZQA 1R1DA 4X94A 1YR2A 4AZ0A 3N2ZB 3D3NA 4AXBA 4KYVA 1EX9A 4H77A 2PU5A 3WK6A 4YASA 5A7HA 4RNCA 2XUHA 2Y2UA 3G9UA 2WUGA 5LZ5A 1QIFA 3M83A 1JU4A 3JW8A 3R40A 3HRHA 4J7AA 2I03A 2Y6VA 4KACA 2QXUA 1JMKC 1JKMA 5D7BA 1AUOA 4ROTA 5AKZA 4BBZA 3VDXA 3SC2A 5HQ3A 4UBIA 4FWBA 4QDOA 1K63A 2HADA 3OC0A 3E0XA 2VQ6A 4QDUA 1AURA 2VJBA 4KAJA 4HXEB 4MQMA 1UOPA 1IMJA 1MO2A 1SCQA 1RWQA 3LIIA 1UFOA 1BCSA 2Z5GA 3V1NA 2OAEA 5JAHA 2P8SA 3C8HA 4BCCA 4EUSA 1QIGA 1WB5A 3WK7A 1GZ7A 3B3QA 3M3DA 4C89A 1ZI6A 5D3ZA 5LZ8A 2W6CX 1VOTA 1MTZA 5HQ3B 3W9BA 1XRPA 3W06A 1CRLA 1TCBA 3WI7A 3AIOA 3IB3A 2BUBA 3T4UA 5IVKA 2WUDA 4QNNA 3U0VA 1XLVA 1EK2A 2R11A 1VXOA 2ECFA 1ZI8A 1B6GA 1BEEA 1P0IA 3QMVA 4MQLA 1A8UA 3PF8A 5DNVA 3I6YA 1H22A 4PO3X 4DNQA 4DGQA 4PSCA 3BJMA 1I6WA 4W1QA 3STUA 4Y2JA 1DWQA 4H7IA 1MPXA 4BAUA 1YA4A 3QM1A 4F5ZA 2CEKA 1XZAA 4Q1VA 4ZWNA 2PX6A 2H7YA 3DDUA 4UHCA 3A2NA 2BUAA 1TRHA 2FJ0A 5DYYA 4H7JA 3STWA 3WWOA 2ROQA 4FBMA 1UKBA 3R3WA 4W9RA 1N8SA 4NS4A 3WYNA 2XMSA 2BJHA 1H2XA 4S0XA 4ZGBA 3I2GA 5DWDA 4LKOA 2PUJA 2CBGA 2O7RA 1UK9A 2JIDA 4BRSA 1HLGA 3O4GA 1ISPA 2IIVA 1YA8A 4X71A 5CMLA 4X97A 5CXUA 4UBKA 4IHAA 1QIEA 1CLEA 4OYYA 4Q05A 4Y2YA 3QPDA 2DSNA 2CKMA 3BL8A 4J03A 2RI6A 1H2WA 4ZV7A 4TVKA 4UFPA 4AO6A 1B41A 3D7RA 1EH5A 1CUEA 3FSGA 1XZEA 3H19A 3I2HA 2OCKA 1XLUA 3QYJA 5AKKA 4M0FA 4DMCA 1ZJ5A 3R3XA 4EY8A 3WA7A 3V9AA 4W1SA 4EB0A 3KWJA 4G1FA 1XQXA 2PPLA 2XQJA 4AN1A 3T52A 1LPAB 2DFPA 3BF7A 4GHWA 1TKRA 1ZD2P 2V97A 1P0MA 1ORVA 2XUFA 4G4JA 3DKKA 4P9NA 1ACLA 1XRNA 4P08A 1G5FA 4CIBA 1L7RA 3MUNA 5ALJA 2PM8A 5ALOA 4ARBA 3DQZA 3H2IA 5AM0A 1FFCA 4AO7A 1QIKA 3KSRA 3PFCA 4H7HA 4Q3LA 5ALLA 3V1MA 3G02A 5A7FA 2CMFA 3CCBA 1IUNA 2H9YA 3WWDA 5BWCA 1UOOA 3FVRA 2AJLI 2IITA 3NWOA 1R3DA 5CT9A 2HFJA 5C8VA 2PSDA 3I2JA 3D2BA 5LP1A 4H7KA 3G8YA 2WG2A 5JANA 3ICWA 5SYNA 2O7VA 5KBYA 2OCIA 4IH9A 5BV7A 1CUHA 4DTCA 1XRRA 1MAHA 3FVTA 4X95A 4AO8A 2WTNA 4KE6A 2RHTA 2XUIA 3ESBA 5K3EA 5FKJA 4BVKA 3HI4A 3G0DA 5T4EA 5DYWA 4WJLA 3C87A 2FX5A 2OXEA 5FUMA 1VA4A 4KAAA 2ZYRA 4U2FA 3G9TA 1N5MA 4BVJA 4UHDA 4X85A 2UZ0A 5AKYA 4B0PA 1CUAA 4HVTA 3WKDA 5C8ZA 1QONA 2B61A 3DL4A 4N8DA 1XLWA 5C7YA 5ALGA 1H2ZA 3H18A 1EB9A 3SK0A 4X6UA 4JYMA 3PFBA 4C4XA 3KDAA 3L1HA 1Y7HA 1XQYA 3GELA 5ALUA 3JYHA 4LYEA 2XUGA 5AKXA 1F8UA 3R3VA 4FLEA 2LIPA 5J3JA 1QIDA 5EHZA 1RP1A 4G4IA 1SC9A 2XMGA 4DSZA 1HKHA 5T4FA 5AM5A 2RIPA 3RM3A 1CUCA 1VA5A 4G9EA 1GPNA 4DNPA 3OTQA 2WIDA 4GBGA 3ICVA 2ZYSA 3R3YA 4BB0A 4KRXA 5I9IA 2D0DA 2OGZA 4EY4A 2WU3A 3FYUA 3H2JA 5JZ9A 2GYVA 3H2GA 2QJRA 1GPLA 5DLPA 2WHRA 2X5XA 1A88A 1G42A 2VATA 2GBFA 2RONA 3R3ZA 2WTMA 4FOLA 5K3BA 3QH4A 5JAPA 4AMZA 3O9MA 2ZJ7A 1Y7IA 2GBIA 1HQDA 4I4CA 5CT4A 2HFKA 5FV4A 4OB7A 1HBJA 5IVIA 1MX1A 3FYUB 4QEKA 1SCIA 5LZ9A 1XQVA 1CUWA 1ORWA 4C87A 1BN7A 4FLMA 4KJXA 1JJFA 4WY5A 5KREA 5AK5A 2WUFA 3IBTA 4J0IA 3G0GA 2JGIA 3BJRA 3WQHA 4FNGA 2ZVDA 2J3QA 3ILSA 3M81A 1XZBA 2XMZA 2ZYIA 1VE6A 3ZV7A 3AUKA 4DMKA 2XDWA 2HM7A 3FCXA 4YPVA 5HF6A 5CT6A 4Y2SA 1BE0A 3S8YA 1XKLA 3GROA 1LBTA 1WHTA 2DHDA 3IIIA 2WHPA 3LS2A 5EHNA 4FNMA 3TRDA 1N1MA 3VJKA 2PVSA 3K2IA 3FLBA 4HXFB 2QT9A 3K9BA 2XLBA 1YB7A 2WIKA 4CCWA 3X3HA 4X7BA 1W4LA 3QZUA 4B9EA 1K5PA 2Z8ZA 3DL7A 2ZJFA 1EK1A 2OGSA 1U2EA 4RE5A 5DNWA 4G9GA 3ZLUA 1D07A 4G8CA 5ALRA 3BE8A 5ALZA 2HU5A 1CVLA 2WM2A 1KU6A 3A70A 4BVLA 2EDAA 3PICA 2HRQA 2H7CA 2WHPB 3LCRA 3WIOA 2PSHA 3VXKA 3OPMA 4AQDA 4E46A 4W63A 2QTBA 2ACEA 4QLAA 3ANTA 4OYLA 3RK4A 4WFJA 5K3DA 1LPOA 2V9ZA 1ZIXA 4JH0A 2PU7A 3IURA 4J0JA 5AJHA 2VAXA 3DOIA 4C01A 1CUZA 4IH1A 5FPQA 3GBSA 4U2GA 4OU4A 1XZFA 3KD2A 4HZGA 1BU8A 3VKFA 4H7EA 4DLNA 5CH8A 1R9NA 5E4JA 1XFDA 5DJ5A 1U8EA 1AKNA 5LZ7A 1EINA 3C6XA 3FSGD 2WIFA 4EHBA 5JATA 1QTRA 1ZD3A 4QWWA 5I8PA 4EA6A 4CG3A 4BZWA 1CUFA 5K3CA 4FHZA 2DHEA 4EZIA 4IQ4A 3YASA 5FDFA 1GPKA 2XMDA 3VVMA 3A6ZA 1VKHA 1Q0RA 3BWXA 1UK8A 4B85A 3BDIA 3WMRA 2G63A 4BDTA 3EF3A 5HKAA 2C7BA 3WK5A 3ZLTA 2HA5A 4FBLA 4X6YA 4JUIA 1HL7A 2DCMA 3HACA 1DTEA 1ACJA 2VTVA 4JYPA 3PDCA 5CT8A 1Y37A 1Q84A 5ALNA 1WPRA 2GYWA 4K6HA 4MXDA 4GECA 5JZBA 4B83A 1ZGCA 3Q8WA 5ISMA 5HF9A 2VA9A 2OAGA 1FFDA 4U2CA 3VVLA 4W1RA 5A71A 1VLQA 3G9XA 3WJ2A 5AOCA 1QO7A 3FYTA 1TAHA 4WDQA 3VJLA 4UHEA 3PUIA 4B81A 1XKTA 2DR0A 2OLEA 5JYCA 2FJPA 4F21A 1QIJA 5FLKA 3LP5A 4DIUA 3WL7A 5HKBA 5I7UA 5JASA 4QWMA 2Z3ZA 1UXOA 5ALQA 4Q3OA 1E8MA 3LLCA 2VT6A 1UK6A 3PUHA 1VJ5A 3IUMA 5AI5A 3N0TA 2VJCA 3HC7A 1O6FA 3ESCA 4OUKX 3I6MA 5LKAA 4O08A 3WK4A 1MT3A 3WWPA 1THTA 4RE6A 1FFEA 2YASA 3I28A 2ONCA 2WFZA 2WJ4A 1R9MA 3Q0TA 1BCRA 3B5EA 4PW0A 1T4MA 5FOQA 3QBJA 3A2MA 5CURA 1GT6A 2XUAA 2PSFA 5AKLA 5EGNA 5A62A 4EY5A 1CQZA 1MNAA 4KR0A 4UPDA 5HK8A 1FFAA 1SCKA 3O9VA 1CUSA 5LIPA 3ZWQA 1W6RA 4L0CA 2VSQA 4FMPA 4QDZA 4G4GA 4H0CA 1BRTA 3HLKA 1AMNA 4LHEA 3WLAA 1DINA 3ZLVA 1DT5A 1GQRA 2XMBA 5ALYA 4UBJA 2XQFA 4HXGA 4DMHA 3KOOA 4FFVA 4DM7A 1RYYA 5HCUA 1U65A 3EQ9A 1ZGBA 2QUBA 2Y2VA 5DYTA 1LPNA 5AKGA 2AJCA 3I2FA 4JEIA 2X8BA 4QE3A 5AOAA 1XRMA 2C4HA 3C5VA 2BAGA 3EQ8A 2Q0XA 4HRXA 5CRIA 1CUGA 2XMRA 1YAJA 1THGA 1KEZA 3HYSA 3STXA 3IUNA 1E66A 1QLWA 1UKCA 1BN6A 2BGRA 5AIAA 4DYHA 5EFZA 1TQHA 1ODSA 4BTVA 1MX9A 1JT2A 4QA9A 5ALSA 4FTWA 2HU8A 1QTIA 3WK9A 2O2GA 5AKEA 5AM3A 1QIHA 2YXPX 5E4TA 5IVDA 3GUUA 1IZ7A 2WUEA 1GQSA 2OGTA 5H3HA 2GYUA 5AKIA 1QIIA 2BFNA 5K3FA 3WWEA 1XZJA 1E3QA 3H04A 2G4LA 5JIBA 1J06A 4ZXFA 4CG2A 4Q34A 3QVMA 4HRYA 3G0IA 3AIMA 5ALMA 3D0KA 2PSEA 1H2YA 4Q3KA 1EI9A 4UBMA 1LPBB 4GI1A 2XMQA 3CXUA 4QDTA 4PSUA 2BUCA 1YS2X 2XB6A 3DYIA 2Y1KA 3KWFA 5JD5A 4WFIA 2OPHA 3OURA 1TCCA 4P92A 4AMYA 1MJ5A 5K3FB 4IO0A 4Y7DA 2CUTA 2PUHA 4DMFA 4KE9A 3C43A 4U2BA 5LKRA 1YASA 5CH3A 3UUEA 4OCZA 5AM2A 4BE9A 5ALFA 1IZ8A 2XUPA 4BATA 1J07A 3FLAA 5AO9A 5E4YA 2I78A 1FJ2A 4DNFA 4NZZA 4K6KA 3FYUC 3I6ZA 3AILA 4M0EA 3V48A 1NU8A 1F0NA 5ALTA 2GBCA 3IA2A 4H18A 4XX1A 2HA0A 2C0QA 3RARA 2D5LA 2AJDA 4WFKA 3TJMA 1GKKA 1ZICA 5AIBA 1ZJ4A 2C5FA 5LLSA 2VEOA 5A7GA 1K8QA 4OD0A 3B12A 1MAAA 5FXMA 1TK3A 3GA7A 4Y2TA 4E11A 3F8SA 4EY7A 4D9JA 4N5IX 4QZVA 2G5TA 4Y2VA 4K2AA 5JD4A 4BE4A 4CCYA 2QMQA 5A6VA 3W05A 4HS9A 3F67A 3STTA 4QLOA 2QJWA 1YB6A 3BXPA 2PBLA 2H7XA 5ALDA 4KE7A 3E1GA 3CN7A 1XZCA 2WHQA 3O4IA 1N5RA 3FWHA 2XI4A 1X2BA 2XUDA 5CBKA 5F4ZA 2QXTA 3CN9A 3EIOA 3RKSA 5EI5A 1WB6A 5D6OA 4X00A 1CUBA 3AZPA 5AP9A 3WA6A 1QGED 1LPSA 1WPXA 4WCVA 1NX9A 4GWLA 3C5WP 4CCYB 3F98A 4WY8A 1ZIYA 5CT5A 2B20A 3HABA 3TEJA 5LYYA 1VXRA 1TIBA 2PL5A 3V1KA 4U2EA 4Z49A 2JGJA 4MWSA 2V96A 2XUOA 4Y2UA 4B0OA 3KXPA 1EDEA 3C45A 3V1LA 2HA4A 3DCNA 4GDMA 1H23A 4B80A 3QPAA 3HEAA 4L3WA 5FP0A 4AZ3A 4AB1A 4BP8A 1SOMA 3BIWA 3QITA 1GGVA 3DJYA 3RLIA 4DNOA 1LZKA 5JALA 1MX5A 4J0GA 4RPCA 5AI4A 4ZREA 1E5TA 1AX9A 5ALKA 2ZYHA 3PI6A 2JGLA 2AJ8A 2PKYX 1IUOA 2BGNA 5AH0A 2QOEA 5C81A 2BKLA 3C6ZA 5T4HA 5HFAA 3MGAA 1EB8A 4BC0A 4CFSA 4P93A 4Y9SA 5JARA 3D5EA 3JWEA 4HAIA 1EDBA 3OOSA 4N5HX 4Y2RA 1Z68A 3AZOA 1XRLA 3WKAA 5ALVA 4YK7A 2RAUA 2HHAA 3H0CA 3ESDA 1E89A 2I3DA 5ALXA 4I19A 3D4LA 3FBWA 3BIXA 5DTJA 5AK4A 2HDWA 2Z3WA 1C7IA 2BCEA 2C58A 2WG0A 1OXMA 2PSJA 5HFNA 3I2IA 1O6GA 3IDAA 4MJ3A 1CUUA 4FLFA 2XUJA 3MVEA 2EDCA 1AC5A 1CUVA 4EY6A 2ZSIA 2YYSA 4C6HA 4CIAA 4OB6A 5BOVA 2WKWA 4XVCA 2HIHA 4OU5A 3PE6A 2WIGA 3WZMA 3WWCA 2RGUA 1E8NA 4UHFA 2JGFA 4L9AA 5D3KA 2HA3A 2VAVA 3S2ZA 1NU6A 1UZAA 4PQEA 1XZMA 1QZ3A 2ACKA 3BF8A 4BAGA 4B9AA 5HZGA 1QE3A 1ODCA 4NMWA 3ZPXA 4MWTA 3HJUA 4UUQA 4A16A 5A2GA 1CFJA 3DEAA 2OQVA 4LXIA 2J4CA 4C88A 3D59A 4J0DA 5IKXA 4X6XA 3AJAA 1UT6A 1R88A 3O95A 1X70A 2JEZA 1CUJA 4L72A 3STVA 4CG1A 3FAKA 5JADA 2OCGA 5IVHA 1PV1A 2C5GA 4LYDA 4UBOA 4BAZA 3D2AA 2G5PA 4A5SA 1HPLA 5YASA 4BC1A 1GXSA 4BCBA 4BRZA 3FOBA 3ANSA 3QMWA 1W76A 1K4YA 4BYMA 5K5EA 4INZA 1GKLA 4UFOA 7YASA 4GW3A 4K5QA 4OB8A 2J3DA 4C4ZA 3U1TA 5T4BA 2QZPA 3GFFA 3UMJA 3STYA 1IVYA 2ES4A 3H2KA 2ZSHA 4BTLA 5AOBA 1OILA 2YH2A 1UWCA 4A23A 1CV2A 1UK7A 5LZ2A 2R8BA 1W75A 3H2HA 1QFSA 3L1IA 5ALIA 1AQLA 1QOZA 1A8QA 4I3FA 5AKJA 5CW2A 3VJMA 4M0MA 3HZOA 2XE4A 2WLSA 3AIKA 2WQZA 1QIMA 4E15A 5ALEA 4RGYA 2WIJA 3I1IA 2I3ZA 1EHYA 2C0PA 1CUDA 4UHBA 4ZV9A 4TPKA 3IULA 5HF5A 1ZD5A 5CH5A 4UHHA 1R4ZA 5EIEA 5EHQA 3MUOA 3FLEA 1PFQA 1J1IA 3C70A 1HDEA 3G7NA 1DX4A 4CI9A 4NVRA 3M82A 5EHXA 4B7ZA 1OCEA 4Y2XA 4ZI5A 1C7JA 2HA2A 3LIPA 2AJBA 1WHSA 4K6GA 1VZ3A 2AXEA 3EBLA 2WJ3A 2WG1A 4HTAA 1XZLA 4LIPD 2RHWA 4KRYA 3I1YA 3C6BA 5KWJA 4J0KA 1CUIA 4W1PA 5ALWA 2HA7A 1XRQA 3P2MA 3GZJA 1XZDA 2CJPA 3BDVA 1KU0A 3G0CA 1CR6A 3WKBA 4ZRDA 5SYMA 1JJBA 3DLTA 3E3AA 4IH4A 4V2IA 1XROA 2GZSA 2HA6A 5ESRA 3PF9A 1ZD4A 3O4HA 5DNUA 2WJ6A 3A2LA 4J0HA 3HSSA 1T2NA 2WU4A 1BS9A 4G8DA 5HF8A 1AZWA 4FFWA 4AN0A 4C4YA 4X3CA 3AZQA 2W22A 3H17A 2JGMA 1XZKA 3O0DA 3TGLA 3NGMA 3ESAA 3WJ1A 1TCAA 3C8DA
chains in the Genus database with same CATH superfamily
2PGJA 3VOSA 3BPSA 5HCNA 5DM70 1R8JA 2EARA 2VYVA 5DDIP 2O2IA 2XKJE 4Q7KA 4G5XA 5FOSA 4G9BA 2QTVA 2H2FA 3OTIA 4MA5A 4GKBA 4E22A 4TMYA 4D4KA 1QJCA 3D2CA 1GNVA 4BMZA 5JXGA 4I2VA 3THWA 1C4XA 2HQ1A 1UJBA 1G8AA 2P79A 1R0BA 4Q7MB 4QXRA 3ZXYA 5C7OO 2WSLA 4PRKA 4HKTA 1PR5A 2BKEA 1LDGA 2E82A 2QKYA 2ZBQA 3K16A 4H6VA 3QQPA 4NMLA 4RDIA 3SFVA 3IQZA 4O4LF 4OXKA 3HZZA 1QG2A 1G5RA 3D4NA 1TT5B 1QKJA 1G6Q1 2F1RA 1Z8NA 4WADA 5CEJA 1MPTA 2HRRA 1IUKA 4YT2A 1YAHA 1RJFA 1S4QA 1P9NA 1WXWA 3OETA 1P8JA 3LUJA 4G36A 4N39A 4WZBE 1Q11A 2OFFA 4BLPA 1ZOSA 4DIFA 3NDBB 2A6PA 1OFVA 3GJ8A 4DA7A 5CFOA 1V0JA 2QVBA 3EGIA 3F96A 5AM4A 3CW8X 4BB9A 4NXMB 3FTPA 1Z0ZA 1Q0TA 4GM4A 3JXEA 2ODEA 5EIAA 3IKMB 4BNHA 4D98A 4AZSA 2B2NA 1W1IA 2JJ1D 2EIHA 1XZGA 3ASYA 4DQXA 2D8AA 4C14A 4KGZA 1L5SA 6ADHA 2QYTA 2VQEB 3CX4A 7REQA 1CPYA 2PRSA 1BJTA 2W00A 3O8NA 1EX1A 3ILYA 5BNIA 2W90A 3NETA 4BS9A 2ICAA 4MROA 5ADWA 5KWVA 1W96A 2FP4B 1HK7A 1N2IA 1UBGA 5J58A 3GLQA 2AD1A 3QNMA 4O29A 3DKPA 3IQGX 4FYYA 1AMUA 4Y2PA 5ANRB 4NENA 5DM2A 4GLOA 4LRUA 4Z0TA 5GONA 3W2GA 4D42A 3P27A 4RENA 4YQFA 1F2DA 5E2AA 3FPAA 3KYCA 1GCUA 1VRVA 1X80A 3F6YA 3SX2A 3W04A 4BV2A 3TSZA 3VGPA 5KTMA 2EKZA 3DOHA 2R1VB 4KW7A 3K5PA 4QEDA 2FPGA 2X1LA 1RLTA 3THXA 4XX0B 3VR0A 2QL7A 4Y2QA 3GFQA 1DIBA 5E7MA 1NW8A 1JLMA 1WXHA 4M7RA 3EWNA 1CD5A 4ETWA 5ESDA 1F5SA 1Z6TA 1J2EA 2CDBA 2Z2KA 2B2XA 4KC0A 1G98A 2WW8A 3PNSA 3NJ8A 5DNAA 4JR1A 1KRWA 3K5HA 3BSSA 1JJIA 3V6MA 1JB1A 4KQ9A 4FX5A 2FQQA 4DKJA 1GYPA 1MD9A 2QRPA 4ZJPA 3DCYA 3USZA 1NG1A 5TVGA 3PEFA 1N9ZA 2GEFA 3ANYB 2G17A 3KKOA 3E7DA 3DR3A 4HATA 3VAYA 1ZW6A 2X76A 3MINB 4F1WA 1L5VA 4P4NA 4CKCB 3G5LA 4D8TA 5E2IA 2E4ZA 2AYXA 3BHMA 4LXUA 5B3JC 4YJFA 3HNPA 4L4RA 4U6QA 5JNTA 4OF4A 5K0SA 4P7KA 1GU0A 1B7GO 1Z4PX 4CTMA 3E3OA 2FUCA 5IT0A 4CNBA 5BQOA 4Q9NA 2JLRA 1ZISA 3OFVA 1J20A 1S2IA 2WSSA 3KSDO 1B3BA 5CYFA 4EKNB 2HU2A 5AW8A 3SC4A 2BDUA 1PG2A 1QO9A 3G17A 4QBKA 5DULA 1ZCJA 4A10A 3EC2A 1SKYB 2QUAA 3H42B 3V4PB 4HPXB 2BZSA 3DEZA 3T5AA 5LXTB 2ZJ6A 1K66A 4MV8A 5REQB 4NBKA 4PINA 1Z33A 3KOUA 4ZVLA 2CCKA 1JG2A 3TNDA 2F3TA 1L4FA 1YC5A 2AG5A 2AOTA 4KAFA 3EPPA 2OCPA 1K08A 4PLVA 1SURA 1VTKA 2O05A 3C14C 4V3CA 1TU3A 4FKBA 4Z9BA 3WMEA 2O9JA 3MQFA 1KWGA 3MS2A 3NTOA 1R8YA 1F8FA 1L2TA 4I1SA 1COZA 2OD7A 3ZH9B 4YJ2B 2WV7A 4B8YA 5F2NA 2F43B 3WTCA 5KTNA 1GG2A 2I80A 3ELUA 1JAXA 1QYCA 2MDTA 1C3EA 4EJFA 1P29A 4L16A 2V1XA 3HVUA 1L5KA 1FFBA 2FFAA 4M8SA 1RJ9A 2HSWA 4MWCA 3RWOA 4H7FA 1GCGA 2Q1SA 1FF9A 1OLOA 3JS5A 3QEMB 5ALPA 2IRWA 2OENG 4F91B 1NN0A 1QHHB 1SKYE 1ZJJA 1V5EA 3MG9A 1J90A 4MITA 2B78A 3DBLB 2A1TS 5CUQA 2H2WA 5D5HA 3AFHA 3TINA 3S1AA 1KRXA 1W35A 3FCOA 1EFUA 5I5EA 3UJPA 2C99A 3WSWA 5DK6A 1LGYA 2XV1A 2ZJ2A 4I5DA 1P2TA 1A82A 3GAFA 1N7GA 1XCJA 2NU6A 1VMKA 3KZCA 4QVGA 5K8LA 3TUZC 2CNOA 1B16A 1HYHA 4LKRA 1OBOA 4W5QA 4L2IA 1FXSA 1JH8A 3TO5A 2KLBA 4ALLA 5K0EA 3N8GA 3R6TA 4C7KA 3EXHC 4HLNA 2FQYA 1DU4A 3MTBA 5KX5A 1PD0A 2HWUA 2FJUA 2ZIVB 1Z88A 2H1IA 3HYTA 3OEWA 5KC9A 1B15A 1T1RA 4I1VA 5JSZA 1NC3A 3L1JA 4KR6A 5TT0A 5EZYB 3W9UA 3W1EA 3E82A 3TNJA 2E3JA 1L4EA 1LPPA 2HL6A 1G4HA 5L4SA 3NWEA 3FKSA 5E9AA 3CPEA 1WB9A 4EBBA 1NW7A 3K73O 1NHWA 1U9IA 1ZI9A 1JI3A 2W2LD 4HWOA 1OH6A 2OO7A 2WABA 1KERA 3FCYA 3DYBA 3N87A 5IMSA 2GXAA 1XYYA 3FDFA 1N0HA 3RWBA 3GJ5A 4HGZA 3QLJA 1AA6A 5DEOA 4N5MA 2MU1A 1RXYA 2Q3CA 8LDHA 2RH4A 2WFLB 4NE9A 1F0PA 4IV0A 4B17A 1S8OA 1Z06A 1EIWA 1BDIA 3F97A 1X38A 4HZUA 4C5AA 1C9YA 4O4HB 1RXUA 1YGYA 1O4WA 4Q48A 3RC1A 3UNXA 5JDIA 1C30A 5K4AA 1VCOA 1S6YA 2GJAA 1UMDB 3AR5A 4N12A 4EF6A 3OQNA 1M76A 4EW6A 3PCXA 4RZSA 2WD7B 3K20A 5DE3A 4Z4CA 5CD1A 3V4RA 3TLYA 1KJ8A 1NN5A 3WADA 3WGUA 1A7UA 1YUMA 3H1BA 4NAVA 3JQ9A 2HU7A 2Q41A 1E9EA 5LXTF 3K0AB 4TKUB 2O1WA 4IZOA 4MQFB 2BGMA 4TMKA 2Y1OA 3NEYA 5DTIA 1KMCA 1X7HA 1Z8HA 2YN0A 4KR9A 1B23P 4CTNA 3I62A 1X6VA 1DWPA 2P8JA 4XD7D 4AF8A 1AHHA 3SX0A 1RXCA 3VNSA 2QTWB 1JAHA 1KIAA 2PA3A 1GPBA 2QM8A 3R5HA 1AZLA 1BFDA 1QFZA 5EIHA 2UZ4A 4P4TA 1L5HA 1RI3A 5M04A 1AJEA 3Q8XB 1M33A 3B9PA 1YJ8A 3TK1A 4CG0A 1E8DA 4YJ2F 1DUSA 1OPXA 4L9SA 1ZDMA 1NJ1A 1EQUA 4HYTA 4URVR 1IOLA 1E5XA 3I5AA 3EH1A 4V38A 5HUQA 3D9QX 1P0PA 1WEKA 2X5KO 3CZAA 3NHJA 2IX9A 4WK0B 4WNAB 1G64A 3VR2A 2F1JA 3VR4D 2QRJA 3FCCA 1WXQA 3R41A 4HLQB 4P2GA 1YR7A 5DW0A 1OZAA 2Q0HA 4NEHB 5IZCC 1TM7E 3H86A 3WYDA 1KBZA 2R84A 3LPDA 1ZXBA 1E2PA 4I99A 4IJMA 4KDCA 2FG5A 5FL7A 3TSYA 5CDFE 3WP1B 3KVNA 4M0DA 1QX4A 3AMVA 4NBTA 3WKCA 1KQGA 2Q4BA 5FTLA 4RGBA 4MPJA 2OV1A 3RIYA 2AXNA 2J3EA 2P30A 5KC8A 5IJ9B 1KYIA 5IJ0A 3B1WA 4AZ3B 4B82A 3BE4A 5IK2A 2I7XA 3MWEB 4MV0A 3M3PA 2TMYA 3DNPA 1UM8A 2ESRA 2IWHA 3G9ZA 2HLNA 5AFSA 2VDPB 4ZQEA 5JRZA 3ONWA 1T5BA 4DQ0A 3GLIA 1Y8ZA 3VISA 1QZUA 3A3OA 4PX2A 3WHKA 2UZ1A 4BO2A 1C3XA 1O96B 4I66A 5EZYF 1JN0A 1HE8B 2GO7A 3HKDB 1U3WA 1UOQA 1QP8A 2K2WA 3R7DA 4PZ0A 1G66A 4X24A 4DA6A 1PFWA 1XVUA 2XYQA 4BP9A 2C7RA 2IT1A 2RG1A 4IXWA 4QTXA 1XVAA 2FB9A 1NKSA 4WI1A 4QASA 4JR0A 1OIVA 3ZCPA 2XDAA 5CJ2A 2AR9A 5GQSA 3H4IA 5AHXA 3ZY4A 2WOJA 2CJYA 4EPVA 1WG8A 3RPEA 4PV7A 2MSKA 2F59A 3P9KA 3BMQA 1CTQA 1YQQA 4KSBA 4UATA 1O0SA 5I3CA 3SZUA 4JNCA 2JKZA 3CJRA 2HMVA 3J7TA 4KWEA 4O4HF 4J90A 5DHSA 1G5IA 1XA0A 3QVLA 2NZ8A 3MZ0A 2A1UB 1B93A 1JNYA 1ZW1A 3AI2A 4YDHB 3ROXA 4EHIA 2YVQA 3B6IA 4UZSA 1T9HA 4OHYA 2FSSA 3AT1A 1JDJA 2AX4A 2WNHA 4ND5A 4YVFA 4MIKA 5EJMA 5LBTA 4OSEA 1V1MB 4MYHA 1IWOA 5FOUA 2EJWA 2J4FA 3ROKA 4D79A 1OXBB 1QF7A 3CURA 1RBQA 4EUEA 2O2DA 2CVZA 5DB4A 1P4GA 1E0JA 4D8VA 2QAJA 4O4JA 4W5NA 1NQTA 2QJOA 4PLHA 4FDMA 3DCJA 3O4JA 2LR0A 1KDOA 5HK9A 1WB4A 4HSEA 1EFAA 2PL9A 3GU3A 3U37A 4EO9A 4GU5A 2QPLA 4ESVA 1CUXA 3PUXA 1OAOC 1ETHA 3QTLA 1GKIA 3OZGA 3DD1A 3D3EA 4NBVA 4BQEA 1DOAA 1WMDA 4JBHA 1N5OX 3GCWA 5E3HA 4U2DA 4HNUA 3F6BX 3WL6A 1I2CA 1R1DA 4HAWA 5L40A 1JFSA 3JWGA 1YR2A 5DSZA 2W4MA 5FWDA 3JAKB 5AW6A 4MKRA 3ZIDA 1RCUA 1XU7A 1T6NA 2FYTA 3D3NA 3DZHA 5C80A 5IANA 5CM9C 5T6BA 4LF8B 1PEDA 3GGSA 3QY9A 2R6R1 3FGOA 1ZJYA 1QVWA 3D4IA 5JW6A 4RFLA 1V47A 2PU5A 1FNBA 3PHCA 2VP3A 3QSGA 4YASA 4BKOA 4CDRA 5ED4A 4F8YA 5B64A 4LJLA 2FUNB 2PYZA 3O84A 1A2OA 1QH1B 1JYEA 2W2NA 1E6MA 2JIRA 2EJBA 3FX2A 2CXRA 1A98A 4WBXC 5FBRB 2W7TA 3ROQA 2LCQA 4J2HA 4GR9A 2DT8A 2HEGA 4TWIA 2HHHB 4BIMA 1T4DA 4ND8B 4ZAGA 4ON9A 1J1UA 1JU4A 3E8MA 2WSBA 3PHLA 3E35A 1TLFA 5B3KA 1ZH2A 2ZXUA 1QZXA 4DLUA 1QP0A 3HRHA 4J7AA 4WOCA 1BA2A 2I03A 3IEPA 3HJRA 3CUYA 3U81A 3TZQA 1ODFA 2QXUA 1JKMA 2PR7A 3OCYA 1D2RA 1GU7A 1TJ5A 1NP3A 2BFDB 2WVJA 1JXOA 3DEKA 2ZS7A 4UEJA 1E96A 1BW9B 4FSXA 3TD6A 3D2LA 1EFVA 3CKMA 2XE7A 4J6FA 4KXLA 4R1SA 4J0FA 5TSDA 3VPCA 1S3FA 1WPGA 3TZBA 4N01A 4DCOA 1Y42X 3U7IA 5A5FA 5F1OA 4QDOA 1QFYA 2IY7A 5TQJA 2GM4A 1VLJA 2IXGA 3CR7A 1A5AB 3FZGA 2RAVA 1QYXA 3A37A 1BZYA 5KSZA 4B3MB 1AURA 1AN0A 4IJWA 4C1BA 2RHGB 4Z9YA 4DAEA 1EVZA 1YHZA 2XAAA 1U1IA 2C3OA 3GJXC 3BKWA 4RM3A 4NCNA 2ZAYA 3P2IA 2XNCA 3IBYA 1RC8A 2R47A 1PLJA 4HR7A 4MRAA 2J3HA 5DWVA 2V1UA 5H5JA 4PY2A 4EECA 1X14A 1I5EA 4MO2A 4W7IA 4CN8A 4MQMA 1TEXA 3KXKA 4L02A 1MO2A 4X64B 3LQ1A 1LJUA 1RWQA 2RE8A 3QY0A 1U3FA 3LIIA 3UH0A 1UFOA 5HP4A 3ANNA 3EDCA 3IPAA 1VJRA 5JAHA 2PZMA 5L4NA 1X9IA 2JLZA 2BMJA 2UKDA 2EW8A 3I4FA 3LLUA 4BCCA 4EUSA 4BP3A 5LQKA 1EUDB 1I4DD 3K6JA 3UPDA 1XMQB 3IYLW 1HF3A 1L7EA 1P2VA 3LQYA 1PWXA 4Q9DA 2DPLA 5CEFA 5CVTA 1SUFA 1WL8A 1RYFA 5KVAA 3OQMA 3LCVB 2P4UA 3BZWA 4B6PA 4C89A 5D3ZA 3SC2B 2W6CX 2IYXA 3HU1A 1VOTA 1QQTA 2PJDA 3GFRA 3VAAA 1X9GA 5HQ3B 5AR1A 1OE0A 2CC2A 2HJ9A 4BOYA 1F6BA 1QGYA 5A0VA 4KWHA 3RUHA 1E2QA 1OU4A 3WI7A 4JLVA 4BIIA 4UVEA 3HCRA 3RHZA 3A04A 5HQTA 1RHQA 1G8MA 3MRSA 1IDOA 3B6ZA 3KKNA 2JLQA 3AEYA 4CNQA 5AESA 4P80A 4DLXA 1XEAA 1GHTA 5IVKA 5FJJA 2CNBA 2WUDA 3IAXA 2YCLA 4HK4A 2J9FA 3U49A 2JCXA 1NBME 4JSYA 1EK2A 1SQSA 4EG8A 2ZG6A 3S3TA 1LB1B 3HL4A 1KQPA 1QGUB 2JI4A 1OTHA 1BH6A 2GH1A 4TX1A 5JI2E 2WNSA 2ZJBA 3ZD8A 1DKLA 3HWRA 4I50B 1JKXA 1E2KA 1B6GA 2JK1A 1BEEA 3QMVA 4HP8A 4KQHA 3SQDA 1P61B 2IWRA 1ISIA 5CITA 2IYEA 4MQLA 3RRYA 1IRXA 4ZK6A 1HNXB 5KVSA 4MUJA 5DNVA 3LH5A 4X20A 1I1NA 5CG1A 4MJ7A 1Z5PA 5L3QB 2KQUA 4RANA 1W5BA 1YU6A 4DLPA 4PO3X 2DETA 1DAGA 3MRTA 2I33A 4JIGA 2ODPA 3STUA 4PYQA 4NCBA 2BEWA 1HE5A 1IEWA 3U13A 2H06A 1POWA 1V11A 3HEMA 3WNZA 2H1HA 4C0QC 1XMVA 4BAUA 1RT9A 4WKCA 3V7UA 4ZP1A 1WXEA 3DVLA 2CUZA 2QE7A 4FGUA 4AJ2A 1RJEA 2A67A 4PYRA 2H5IA 3LPNA 1UJNA 1ZK4A 4MVJH 2CEKA 4CQLA 1PLLA 1KKUA 3ADDA 1W0CA 5CNMA 1IVNA 2QJTA 4MICA 4Q1VA 4R2LA 1SVOA 4WVLA 2EGUA 1XZPA 3OU2A 4ZODA 2P6PA 4PZYA 3O4RA 5SZKB 2R4UA 1T43A 1CF2O 1J9ZA 2D13A 4P7GA 1H3EA 2O7NA 3BTOA 1MB3A 1ECCA 1R0LA 1XXHA 3ZDQA 1P1RA 2FGJA 5CBPB 3OOHA 1H1TA 1E92A 2QSJA 5BQPA 1NA5A 2UZAA 2IBMA 1X7DA 2K87A 3LPLA 3STWA 2HGZA 3O3MB 5JMOA 1M0WA 2ROQA 4M6WA 4A91A 2GM9A 5G3YA 5I7EA 2H17A 4CM1A 3P9CA 4OHOA 1K75A 1PV4A 3P71T 4Z7NB 2BKAA 2WTAA 4R81A 3ZDAA 5FV7A 4W4TA 4DIMA 3L41A 1W29A 3DLHA 5LYJB 1J8FA 4YMSA 4NS4A 3EVNA 2HYDA 2Y66A 4RTMA 3JQFC 1P2DA 4H3KB 4JR2A 1HT3A 1ZD1A 3EXG2 3HRKA 3V7YA 4EW1A 1X7WA 3L4BC 3DDZX 4OGWA 1L4GA 1NPDA 2AYYA 2OORC 3RGGA 3U4AA 3RQSA 1J56A 3FSRA 2A0WA 3T9FA 1Z2NX 1HZZC 2E85A 5EE5B 2Z8YM 4L5IA 3SCZA 1N6NA 1WD5A 1TA0A 3I2GA 4EEXA 4DB4A 3HBAA 4NYJR 5A6SB 1CHNA 2HSJA 3V8VA 2LCFA 3H4TA 4M1OA 2AX3A 2CL6X 3OPYA 4ND1A 1UK9A 4HNHA 3RFCA 3TPCA 4GMFA 2E4AA 1EE1A 1UC9A 2JIDA 4V0SA 2O6HA 1F2TA 3VU9A 2IV3A 4BRSA 3DPIA 1N6PA 3RUCA 4DE5A 1ISPA 4OKSA 1V2GA 3OHMA 3CX7A 2ABWA 5EXEA 4QVIA 1ZVJA 3TUJC 4LWPA 4KLRA 4A8PA 3UV3A 4E4YA 2C4WA 2EX4A 4Y6SA 1M0EA 1QIEA 1W1UA 4Z4QA 3TW0A 3WB1A 3QVJA 3W5IA 4COOA 3TEFA 4ZDJA 2GHRA 2E4UA 3NPAA 2Y9PB 4I50F 3BL8A 4J03A 4LC1A 4R9UC 3ZJ5A 5KOJA 5EE1A 1KPHA 2ZGVA 1M8KA 3QPUA 2QD4A 3ZDZB 1WWKA 1SD5A 4F7WA 2KB0A 1H2WA 1KK3A 4G5RA 4HGNA 4HGYA 5DOZA 2AG6A 1ZCBA 3U80A 5C1BA 4QVKA 4TVKA 1KETA 3RRNA 5FO1A 3DTYA 1B41A 2NLOA 4I5FA 4GS5A 4ZCMA 1N5KA 1S4MA 2PK3A 2VHTA 2N3ZA 4HUQA 1XWIA 1VQ1A 3A3PA 3KC2A 3LHFA 1CUEA 4X1KB 5SY6A 2REXB 3OI7A 3QLEA 2X9LA 2AOWA 1DO8A 2V9CA 2FQ1A 3NB0A 1GUDA 4I4TB 4PLTA 3GCZA 5KNDH 1Q44A 1Q50A 1HE2A 1RWBA 1IB0A 1ZL0A 3QYJA 3KJZA 3LT4A 3R3XA 4N0EA 2GAFA 5KSWB 2GZ1A 4HDCA 3IQXA 3RIXA 5AUPB 1UUFA 2L19A 1VRCA 4BLTA 1DC6A 3IQDB 4POOA 1RJGA 2PPLA 5DLYA 2I8LA 2CWDA 3LY7A 1OPRA 4MUAA 3LU1A 1Q20A 2D4HA 4BMYA 4Y18A 1B1AA 5EUQB 3X2SA 2YFHA 1PHRA 3L7AA 3PHHA 2ZI6A 1UAYA 4KIFA 2WWVD 3BWYA 2BH9A 1LK7A 2VIIA 4ZAWA 1BHSA 5AW3A 2I6FA 1EJ6A 2PD6A 4YEDA 3GEGA 5BURA 1ORVA 2P35A 3DKKA 4L74A 5C8YB 4IWNA 1DJNA 3FPBA 5LYJF 3K30A 3UQYS 4P08A 2PX3A 4CIBA 2I6TA 5TY0A 3RIHA 4JGBA 5BV2P 2QV7A 4JUBA 1K6XA 2V0NA 1DNPA 1TMGE 1KQFA 2IKQA 4D3YA 3H2IA 2IZOA 5FOVA 5GTDA 2SKEA 3QF4B 1C1YA 5HS6A 3LYHA 4AO7A 3ZHRA 1ODJA 1J8YF 1U9YA 3GMSA 4JLMA 3S55A 2R48A 1G5HA 3MTIA 1KS2A 3PFCA 1UDRA 2ZULA 2NM0A 1JKJB 1VYVA 3CZPA 3JR3A 4G25A 2GXUA 3G02A 2BN4A 4H2DA 2HWYA 1NV8A 2WM9B 4NPCA 4C6TA 1IUNA 2Z8YA 3HPQA 3QX7A 4GP6A 4EFKA 5BWCA 1UOOA 1YR3A 2ZSAA 5JH7A 1GAWA 2FSIA 4LVCA 2AEEA 4PHCA 2I4MA 4YDRA 5BWLA 1R5BA 3AYXB 3CLRC 4B6FA 5GZ1A 2WSYB 5K03A 3THWB 1VJ0A 1TTPB 3B3JA 3P94A 4OFBA 3G8BA 1GSAA 4MDYA 4P84A 1W2WB 5C8VA 2HLPA 2X4LA 4UAGA 3RANA 2ZYVX 4JDUA 3D2BA 1F9EA 1J2UA 4H7KA 3IR6A 5KTRA 3S1SA 1VMDA 2W6JD 3OOJA 3L01A 1AA9A 3MJRA 3Q40A 4IJ6A 4M9UA 4Q1EA 3QVKA 4UNIA 1VI6A 1RKUA 1QNLA 3AHEA 3CZ9A 4Y6GB 2XXJA 5JANA 2H5LA 3ICWA 1QDLB 4KDFA 4EJMA 3ORFA 1G7RA 1RWXA 2Q6IA 1T3HA 5EZ5A 5SYNA 1H6AA 5GADl 3SXPA 1P3DA 4Z8XA 4H1VA 3GFGA 2XNJA 3TQRA 1JBQA 3Q9LA 3GRAA 1CUHA 3P97A 4DTCA 2Y4NA 4DIEA 4NCXA 1U0RA 4J49A 1SVNA 1W4BA 2Q5LA 3EA5A 4TTPA 2RHTA 4I4TF 2WWHA 2BDEA 3I3OA 4LGCA 4OQFA 2ZAMA 3KE9A 3RU2A 2EZ9A 1Z47A 1IJKA 1VGVA 1ZNZA 3I4CA 4NAHA 3HI4A 3G0DA 2RK6A 4WJLA 3G2HA 1MEOA 4L8LA 3TAUA 3B6EA 2WUWE 3I8SA 4IV8A 1W1WA 3S27A 3BJZA 1Y6QA 7REQB 4DPKA 5FUMA 2IEDA 3N2LA 4KAAA 2QN3A 2PZGA 5TMEA 4MKXA 2NPFA 5K2OA 2YNMD 4UM7A 2WAMA 1NRIA 5BOVA 4W5WA 3T3MB 2Z95A 3V80A 2IXTA 5KNLA 3BCUA 4TRNA 4BU0A 1QVAA 1UKZA 1XBTA 3HBLA 4YRDA 2DF8A 3BTSA 4GUDA 2XCIA 2QVXX 1XN4A 4WL0A 3IILA 4P81A 4Y30A 2WF6A 5J63A 3P9IA 1Y9EA 2YTZA 4HVTA 3OQPA 4JC5A 5K01A 4FT4A 3WKDA 1FRFS 5GONB 3SHQA 2Q5HA 5K4HA 2G80A 1QONA 3LOPA 4FUQA 3CZ4A 3I0MA 3DL4A 2CBXA 3KB1A 1QQ6A 2R66A 1Q2UA 2AMYA 2CLKB 4HYYA 5JVDB 2QTHA 1XLWA 2UV8A 1YRAA 3RS3A 3ZVRA 3WGVA 2FX2A 4MGIR 4EB3A 1WXIA 5DXAA 3THXB 4YFVA 2IU3A 4NDAA 1XTZA 3SK0A 5CM2Z 4QHTA 3A0UA 5IAOA 3CVWA 4WOBA 1IQPA 3SS8A 4JS0A 2YN2A 5JR3A 1FQJA 1UL1X 2ODBA 4AVYA 4JYMA 3KHKA 1LC3A 4OP1A 4RKQA 1SXPA 5K0CA 1T1IA 3SIWA 5LB4A 1GLVA 1CEYA 4FMCB 1Q5PA 3FR7A 2E4VA 4B3XA 1E62A 1GY8A 1FRZA 1NVWQ 2GWRA 3T5BA 3L1HA 4FMDB 1M8GA 3GELA 1Z6QA 4UMVA 3HHPA 3KQTA 4QJ3A 5K7SA 1ZUIA 3E5RA 4LYEA 2ZSFA 5EHIA 5FEMA 2GPTA 1A3CA 4RTNA 3B1ZA 1J1ZA 5JLJA 1CZOA 2PUBA 1O9BA 3U62A 4FLEA 5G2OA 4TWJA 4ML3A 4G0OA 4IDPA 5E95A 4PC1A 5B2EA 1K3UB 1XV5A 1YHYA 3BD6A 3AI3A 5J3JA 1E0DA 3GF4A 2HN9A 3BCHA 2OMEA 3DZ8A 3L93A 4ALNA 2GAJA 2PPVA 5FUVA 4PPQA 5EHZA 5HHTA 2CLDX 1NSFA 1LLDA 1V9CA 1ZC4A 1MO5A 1HKHA 2HSZA 2WWGA 1N6IA 1YB1A 1RC0A 2RIPA 2NO6A 1H8HD 1HDRA 4N6OA 4RX1A 3A4TA 4FT2A 4GSKA 3F90A 3JQAA 3C7TA 2HWXA 1D6SA 2XX3A 2VN8A 4GBGA 1A5ZA 5AVWA 2G5GX 1U2PA 2ZT5A 5H1YA 3SSOA 3EAQA 4L5YA 1RM4A 2AOTB 1HNWB 1RKBA 3C7DB 4ND3A 421PA 4UD6A 3DVSX 3PPYA 5FUYA 1I14A 4FOPA 4JASB 4Y0VA 4F84A 3CS3A 2O59A 4U7FA 3OLXA 1MC1A 1QRSA 2EEZA 4G0XA 1E1NA 1I4OA 3RIEA 2XVXA 2QWXA 2QA5A 4EY4A 2EJUA 2NSJA 4E12A 4YONB 3PUKA 1I7DA 2GYVA 1VBMA 1BMFA 4HBZA 3NC1C 4EZEA 5DLPA 1GPLA 4HDSA 2FPLA 1IEXA 4QQRA 2H4WA 2DX7A 4S1TA 4PZCA 1BWRA 1YZQA 2ZUCA 4FEGA 2PKEA 5BSHA 3GWGA 4BQFA 3ZZ0A 3BBPA 3W4KA 2QDXA 2LPMA 4NMMA 5BN4B 2ZRPA 4A73A 2DOKA 2HJHA 3ZE9A 3D02A 5C5CA 2RONA 2W11A 3HB4X 1ABEA 1JDBC 2WTMA 3ADKA 4MR9B 4Q21A 4TMFA 5DIZA 4ZVNA 2B0CA 3JPWA 5GONF 5K3BA 2B1RA 2W6IA 2YL2A 3IBCA 1OGYA 5TQ2B 3K0SA 2IYTA 3CINA 3I04M 4KPUB 4IKPA 2P11A 2R6ZA 4ZQHA 3SHVA 4V0RA 3SIPA 5JVDF 3JASA 4L2IB 3UWPA 1KFJB 3TL2A 2QNBA 2XE6A 4GAEA 3UOGA 2OM2A 2BW0A 2E0IA 3NI2A 1XDWA 5KX5B 5CXSA 2NUAA 2JI9A 4IUDS 4UMDA 4OX9Y 1KFEB 1JQDA 3RSSA 4EGJA 4EPRA 3K0KA 4ZJYA 1QC5A 4I4CA 5JSZB 5KZMB 1YR9A 1NQAO 3UCXA 4XGNA 5CT4A 1ULHA 1MQ9A 3LF2A 2JCVA 3DFMA 1I1OA 1ORIA 4K1XA 1VPTA 3KRTA 4GGOA 5FV4A 1HBJA 4OB7A 4FMCF 4ZQFA 5B1DA 4UJ5A 2OC9A 3QJ5A 1KGSA 5A5VA 3RTEA 4JYCA 5TQVA 2I3GA 5LZ9A 4IVQA 1G291 5CFPA 4RKWA 1T5IA 4AP5A 4B3JA 1ORWA 4WT7A 4G5QA 2YZGA 1NZDA 3L7NA 3QX9A 1KY3A 3UT5A 1F4PA 2P4EA 5B6IA 1SIOA 5SZIA 1ZHFA 3LY8A 3B48A 5KREA 4LYYA 2AWOA 2LKDA 2QZ4A 3B2NA 3WJ7A 5DYIA 1N2CA 3RAFC 1R0SA 1YZFA 3R9KA 3CVOA 3SEZA 3SHTA 1NBWB 1C30B 1O95D 4RH0A 1JG7A 2A8YA 2JGIA 4KFSA 4MGHA 4LJ4A 5HYVA 3EVEA 5LP6A 2ENUA 3EOBI 2QT0A 1FUEA 3CNQS 3ZZUA 3SMQA 2XMZA 3H97A 3W8RA 1U0SY 1N9GA 2O57A 1GZ5A 2RGEA 1P7CA 1KIFA 4Y1EA 3IO5A 4JHXA 3ZVMA 3UWDA 4FFRA 3LNTA 5DI9A 3IJEB 4Z1MA 2NAPA 2BMWA 4Q4JA 5B4TA 3OCUA 3TRFA 4YMUA 1F0YA 3GHYA 9LDBA 4BLWA 1GNSA 3PFKA 2EGGA 1MB4A 1NKTA 2BY4A 1LBTA 2AIRA 3VJRA 4Q3AA 3VRHA 4IHQA 5AW1A 3IIIA 3VR5A 1BFKA 3C8UA 3FD8A 4RHCA 3V3TA 3R7WA 1RLUA 1NWHA 2EW2A 2NO7A 4JP1A 4K3VA 2E89A 4YRIA 1VSBA 4MIYA 1DBVO 3D3QA 1MENA 2QZZA 3DNFA 3IDSA 2BEUA 1Q91A 3K2IA 1XD2A 1AD2A 4M0PA 4OXRA 3RFTA 5E0OA 2QP9X 4JSRA 3BRCA 5DWQA 1C5KA 1Q74A 3AHFA 3TD9A 2Y4OA 4DF3A 3NHUA 1P72A 1JEYA 4B79A 4R8MA 5C9ZA 1OT3A 1CZNA 4Z9FA 4XWKA 3VR1A 1EEXB 1XXLA 3WYGA 3X3HA 1T13A 2AB0A 2HDHA 1Y5MA 4JOSA 2OFWA 3ZDEA 4AMBA 4I1UA 1EGQA 4Y1FA 1K5PA 3DL7A 1N4DA 2A94A 3NWPA 4E5SA 5IJ0B 4NECA 2HYIC 1R7RA 4XGRA 3V8EA 3DE1X 3RS7A 4KVFA 1PZHA 3RW9A 3EFBA 3BHNA 4DR7B 1D07A 2M32A 3NFYA 3V34A 5B6JA 2A4MA 3BE8A 5KX5F 1BFUA 1LKZA 1W5TA 2VNIA 2KX7A 2HU5A 3I04A 5JXHA 1IK6A 1KQ3A 1Y8CA 2MT9A 2CFCA 2H4HA 2Q99A 2VLIA 2C1XA 3X2EA 4BVLA 2W2QA 3K0CC 3QVGB 4D9MA 1FJGB 4QBHA 2X13A 3TIFA 2QM3A 2JJMA 5DN6D 1J70A 3F3SA 1A4UA 1NQWA 1Y7PA 4EPYA 4NG5A 2N75A 4Q03A 3W1VA 3ICEA 1E0AA 1TIKA 4IDNA 5HMMA 2DYKA 2E7ZA 3ADOA 1V5WA 2POQX 1O5OA 2A9OA 1D8TA 1WMAA 3ODGA 3IGFA 3MOGA 4HEA1 3PC2A 1YFKA 1EFCA 1P6UA 3ZBQA 1H3FA 2QTBA 2FOLA 3G1WA 4A8JA 4B4KA 5LR6A 3GX1A 3RGWS 4F5WA 2QN8A 1QZZA 4NSNA 4DS3A 1ZH0A 2C78A 5BNWA 2RI1A 4MP8A 2V7WA 5EE0A 2VK1A 4RJ2A 3DDNA 3BOSA 3R7SA 4KMOA 3OUTA 1U1CA 5FUBA 5FTJA 2V5VA 3E4CA 3QA9A 3GARA 1PGJA 3ZR4B 4AKHA 5HPYB 2C4VA 2H65A 4E88A 1XPRA 4M38A 3V4LA 5EWLB 3PTAA 2RHDA 4QPNA 1FU4A 2F4VB 5FBZA 3AUTA 4DXHA 4HOYA 4BZZA 2FUEA 1LA2A 1JG3A 1OBVA 1RI4A 2CLLB 3HA7A 3V8RA 4IIJB 2PUAA 1L7DA 5FPQA 3GBSA 3RUEA 4EG7A 2G9RA 3SG0A 4OU4A 4RMHA 5C46F 2PJZA 1XCLA 3KD2A 1VGRA 3DQPA 1RKQA 2H08A 4WINA 3N2GA 4KV9A 1TI7A 3AUAA 4H7EA 4UREA 1A5SB 2VH2A 3IFSA 4NBLA 1SBNE 4ND2A 3TCKA 821PA 2RHRA 1DEOA 5MHTA 1YDFA 3KPJA 3G23A 1YJAA 3V2IA 4ETMA 1R15A 4R5HA 5M34A 3Q3GE 3GD5A 4F4CA 3A2KA 4C4TA 4Z51A 1E99A 4BX8A 5I47A 4MWGA 4FWIB 3B3AA 1Q2XA 1MHPA 3FMIA 4TYPA 1F8YA 3JARA 3VU1A 1PR3A 4ZEWA 4JOCA 3N2KA 4Q1CA 3OMWA 4EHBA 5PGMA 1NMYA 3N6XA 3THSA 1DHRA 5JATA 1WY5A 4TTRA 4NFSA 1Y6FA 3WMFA 2DKNA 1UXKA 1YFLA 3QUTA 5I8PA 2FMFA 4QOIA 3RS2A 1VC2A 4CG3A 2X0FA 1TKCA 1M2VB 1MAVA 3FOFC 3LUPA 1CUFA 5K3CA 1W7AA 2DHEA 3C39A 3GT0A 3A1CA 4GPZA 4EMSA 4EZIA 2FSFA 5I7WA 1L5NA 3N6VA 3YASA 4M60A 3P9RA 2BGGA 3RKUA 2L42A 2QLNA 3CBGA 1U28A 4EGFA 5KTPA 3VVMA 4OFXA 4UAVA 4PBRA 3FI9A 3DZGA 3TG2A 4IOKA 2GYYA 1UK8A 1U0EA 4A2PA 2QW8A 2ZTLA 3PT9A 3BXXA 3BDIA 1RWWA 3LC2O 3WMRA 3WV5A 5KDDA 2BMFA 1BSVA 1KMMA 1NMXA 4RWEA 5MN4A 4Y9DA 4UC0A 2C7BA 1T2VA 3GRRA 3M4YA 3VVCA 3C3CA 1IY1A 1JEOA 1YZYA 2HA5A 3PIIA 2HXSA 2D74A 4FBLA 4OGGA 3SYLA 4CMEA 4YRGA 1HL7A 1UXGA 1DBIA 3HVRA 3TQHA 5TLSA 1SCDA 3GFBA 1E6WA 1VMEA 5IWAB 4JLBA 4YIHA 3C3YA 4CLOB 3UV6A 3PDCA 4IV5A 1GPDG 1W5FA 3MT0A 1Y37A 1IN5A 2X2FA 2I4IA 1VIMA 2H2GA 1WPRA 3QFTA 4JNKA 5U9CA 4G0QA 1NULA 1KVRA 3HS3A 3FGZA 1B76A 1ZGCA 4GG1A 2JFNA 2IA5A 2H3EA 5ISMA 5HF9A 1EXVA 3L5OA 2O19A 4GM1A 3MTQA 3QXGA 3VVLA 1PUJA 1VLQA 3WJ2A 4ZI3A 3C97A 2ZI9A 4PYKA 3ZVKA 4Z53A 5DGCA 2RKWA 2Q07A 1R9GA 3MGBA 5ER9A 4J1SA 4R1QA 3KZOA 3VDNB 2NZYA 1PNRA 1ONBA 4HEQA 1PT7A 3EWIA 3K9WA 4TM8A 4WDQA 2ISCA 2Y0DA 1LC0A 1DKMA 1MC4A 3A1WA 3PUIA 4IIJF 4O4JF 4QUAA 3TZHA 3B8EA 4LPKA 3ZCXA 3ZWMA 3R9XB 1ISRA 3NBYC 3PR3A 3VR4H 1E2GA 3ZY3A 5EXTA 4M99A 2C3MA 4RD3A 1GPMA 2RGXA 2O48X 3EC1A 4AM8A 3AB7A 3TIGA 4M1ZA 1YB2A 4B4OA 4E6EA 1E2EA 3E3LA 3KTOA 3LP5A 1PYDA 1E4VA 1YMVA 2EL9A 3B3GA 3O2NA 1O77A 2X2PA 4PU0A 5FI0B 2OBNA 3DOJA 3WL7A 5JS1A 2H2DA 1S3SA 4IIBA 4LHYA 3S7TA 4W9MC 4BVFA 4R1NA 5ALQA 1S3IA 4Q3OA 5IU6A 2VT6A 5ILQA 1UK6A 3SNKA 2QLJA 5EJ2A 3WIEA 4D6PA 3IUMA 2I91A 3OM0A 2J9FB 4EG6A 1PJ8A 3LUCA 1AQJA 2M6KA 3KLMX 1N5DA 1I3OA 3IAAA 1R16A 1ATZA 3K3PA 3GEBA 3TOXA 3GVCA 1MVLA 1M5RA 2ID7A 4ZHSA 4NOKA 2D1TA 3OX4A 4JLSA 1JPJA 4LJKA 3S2SA 3ESCA 1AKVA 4XR9A 3CF4G 4OH7A 5LQNA 3O8DA 4RPLA 2Z6AA 2ZYWX 4O08A 2DQ4A 2P0AA 1MT3A 3EGCA 3WWPA 1CS0A 3DAYA 1NIJA 4RE6A 2GZ2A 3I28A 1WTAA 2HZBA 3IKJA 3LPAA 3OCXA 4RVUA 2OHIA 3SXUB 3W6OA 1R9MA 3USES 4JAVC 1PZGA 1QM5A 4CF4A 3EVZA 3OKAA 2UUCB 2B37A 3B5EA 1ECGA 1ESEA 1P6XA 2NZXA 4PG5A 4OIFA 4U7TB 3ZGXA 1A77A 1KOJA 4D0LB 4DWWA 2I6SA 1ZK0A 4G86A 5JV5A 2BMAA 3AP3A 3AJ9A 1ST3A 3A2MA 5CURA 1T0UA 5ULLA 4NZYA 3TDMA 3TQOA 3UFXA 2PSFA 4DUZB 4R9SA 3OEYA 5EGNA 5JRDS 4DR4B 1H94A 3BVPA 5E7JA 4CQLB 2NUPB 4IWXA 2VZLA 1L5QA 5TF4A 3MCTA 4LN1A 2OHHA 3UT0A 4Y1GA 4NV1A 3BIOA 3DFUA 4KR0A 2FR8A 4YCDA 1E5VA 4DOMA 3VSAA 2BYTA 1SCKA 5IM4F 3ZCRA 5BV8A 1AVTA 1PGNA 1L4HA 5GIOE 5B7NA 1VIDA 1FBTA 1PZEA 1KAGA 3N8IA 4ISBA 1DBSA 1VJTA 1YUBA 3Q4GA 1H65A 4FMPA 4WASA 4K1LA 3JV7A 4OQNA 4QDZA 3VUFA 4G0PA 3NG1A 3QEOA 4O2AA 1E2MA 4G4GA 3GJQA 4H0CA 4M6WB 1N2OA 5BWOA 3UN1A 3WLAA 3G79A 2GUGA 3B38A 3H8SA 3HUDA 4YAEA 3WB0A 1W59A 4CFZA 1IE3A 1P2UA 3AM5A 3OKPA 1KDTA 2C61A 1D0VA 2VYND 4ER6A 3TJRA 3OIYA 2HMWA 2O2SA 3DXYA 3DMRA 5ALYA 4EX7A 5BW5A 1WVGA 3FJOA 1BCRB 3PDWA 3KOOA 4HXGA 4GLLA 1T36A 4NX2A 2O52A 1X7WB 2G83A 1LTQA 4KMRA 2VHQA 4ALJA 5DFAA 2HX1A 1A7JA 1Z4QA 3IH5A 3KQVA 1FSGA 1RYYA 4FFVA 5CLQA 2ZBEA 2QRQA 3DAFA 1SVSA 1U65A 1S89A 2FUG1 2EV9A 3H3XA 3L8HA 4ESEA 2LRHA 2EKLA 1DEHA 2O2CA 3NHAA 1UBSB 4O3FA 4UE6A 5DYTA 3GT7A 5CFLA 1LPNA 2JRLA 2V4ZA 3HI6A 3M70A 3RVPA 4B6RA 2AJCA 4BNKA 2O6LA 4ENWA 5K05A 1XXHE 2CCJA 4JEIA 1FFSA 2LBPA 2X8BA 2ZSDA 3AR4A 2QD5A 3G2JA 1XPUA 4E1VA 1RBYA 2HQRA 5FYDA 4HRXA 3VU9B 1WSWA 1R0CA 1Q16A 4JVLA 3KSZO 4TUYB 1YAJA 5LFAA 1TGVA 2V03A 4EA7A 1EXDA 2OPBA 2H4JA 2QSYA 1A8PA 1LQUA 3SYMA 3TRJA 1E64A 1YE3A 1ZFNA 3PXUA 3H11A 5KOJB 2XBUA 5CLIA 1B8VA 2JGRA 1R6UA 1F3LA 3MWGA 3NIGB 3EZGA 1SN7A 1TQHA 2MR5A 3B51X 5T3UA 1E18A 4FCCA 5FPSA 3NW9A 3DMNA 1P44A 4PQYA 4NULA 1QHIA 3ZV4A 1L1RA 4FGJA 3NBKA 4E32A 1NRWA 1GTMA 3BS4A 4FTWA 4NR0A 5DHPA 1IJBA 2HRCA 4H15A 4P7JA 1FTSA 4HUQB 2O2JA 5HZKA 4K9NA 3ZWXA 3CGWA 2A1IA 1QTIA 2UDPA 3L05A 1Z7YA 3A6HA 3OJ0A 5AKEA 2YXPX 3VX4A 4O59O 4Q18A 5IYZA 4RESA 4KUEA 3LQ2A 4P31A 4LY6A 4PZ9A 2AZ4A 4PZZA 5IVDA 3GUUA 1XEWX 2XGJA 4XFJA 4JUCA 4NBWA 4B43A 1BHQ1 2JVJA 1X15A 3CVJA 3O92A 5J2TA 2F3SA 4FFNA 3R44A 4PAGA 5AKIA 3PD0A 4EGSA 3TXXA 2IS2A 1RHRA 1VBKA 4CMHA 4DIBA 1ZN7A 5K3OA 3PPVA 1MV5A 4PR3A 4Q4AA 2G9NA 2XNHA 1U9CA 3NATA 1DO0A 3ZK9A 1SIWA 6REQB 4YBRA 3R5FA 4DEVA 4N0DA 1Y5IA 4EVRA 5T7BA 4MRPA 3U31A 2AMLA 3DV0A 4M8KA 3QVMA 1ONSA 4UVHA 2ZJZA 1K8RA 4HRYA 3E23A 5DHFA 3L0BA 4KWCA 2QGFA 1T3SA 2O3SA 3AIMA 1Z4MA 4IFEA 1QMGA 3D0KA 1DXYA 3UB3A 3O4VA 3PRHA 4KK4A 4Q3KA 2QAGB 4XDZA 2V55B 1EI9A 1D7OA 1RM5A 1Z5ZA 2QMHA 2XECA 2YIVX 3DTTA 3FPHA 2A59A 4LS3A 5KNBD 1CF4A 5D8DA 2REBA 2EZ4A 5CVEA 1TA4A 4ZVPA 4JI7B 3L07A 2ZTSA 2W42A 4QDTA 4OQYA 1K86A 4LF9B 2Q9AA 1YS2X 2W8BA 4IMRA 5EJFA 2XB6A 5BY2A 4X65B 1A95A 2Y1KA 3DB1A 5JD5A 4PFQA 4N76A 4RHXA 3SBOA 4K86A 5IBCA 3OURA 4F8JA 1NVVQ 1TCCA 1R00A 2QXYA 4HNGA 4HEHA 4B3IA 4AMYA 1MJ5A 1VE9A 2O2EA 1QLHA 2PAAA 4U6SA 2CXQA 1GL7A 4IDOA 2Z9CA 1D8AA 1XU9A 2CXOA 3TEMA 3THRA 1UT5A 4NJEB 2CUTA 1YFZA 2PUHA 4BVAA 5JH7B 4N1AA 3UHJA 1KZGB 2OZLB 4ASUA 3IAHA 2GZ3A 4PS1A 4X1IB 1XALA 4TUYF 1T0PA 1Y7TA 4UDNA 1CJUC 3I53A 4PCUA 3FGNA 4P4UA 5C5DA 4OLBA 3ZG6A 4H60A 3ZTWA 3HP7A 4PRZA 4BATA 2EFHB 2EJTA 1JFFA 5AO9A 4ZVRA 2I78A 5CIYA 3K6RA 3FOEC 3I6ZA 4AZVA 3FF1A 1YBFA 4ENTA 3COPA 4O8ZA 1YBVA 3U26A 4I6EA 3X1JA 1H69A 1AV7A 1U2QA 3VO1A 2JLSA 5JNVA 4XX1A 2HA0A 4F4IA 4W5RA 2CHFA 2H5EA 3HU5A 3DAGA 3GIDA 3T1NA 3ZQUA 1N78A 4URWR 4OSPA 1CC1S 3PEYA 1EFRA 4W7HA 1ENPA 1KH2A 5FTWA 3ET5A 1U8AA 3M6WA 1SNYA 3UXMA 4FOSA 5DASA 5BQFA 1GKKA 4B32A 1HE3A 5AIBA 2X0RA 3RVSA 1JXMA 4U7JA 4GOND 2C5FA 5LLSA 1XMOB 2W58A 5A7GA 3EK2A 1P5HA 1RZ3A 3GNSA 1W34A 3AWDA 4GVPA 1DIHA 3T38A 3L4JA 3B12A 1MAAA 4D41A 1KO5A 2XIJA 2B82A 4LX8A 2O8CA 1W25A 1WDWB 3RI3A 3GY0A 1UANA 3DTVD 3IT2A 4OI4A 3F8SA 1G2QA 3KWLA 2AK3A 1THMA 3NLLA 1JQBA 1PL6A 4QZVA 1NNEA 4CVNA 3L6BA 4YLGA 4K2AA 4WTOA 4D4IA 3DUFA 5A2QA 4AS2A 4KKVA 3FVWA 4V0MA 5EPUA 2FNAA 2YWFA 4WZAB 1T6XA 1AKMA 4LRYA 4MW9A 3VDMA 3WBJA 4CCYA 2QMQA 5JNUA 2B35A 2QTCA 4BLRA 4D2IA 3DVQX 4U7HA 1YZVA 5I9SA 3UJNA 2QJWA 2WK1A 5ES3A 5EJAA 3OZRA 3SC3A 4DCJA 4ZZ1A 3BXPA 3T4EA 1Q0SA 1K9VF 1E94E 4LZJA 5ALDA 1DG1G 4KE7A 1QK4A 3E1GA 3ST7A 2HSEA 1MJGM 3MK31 3GIWA 3UF0A 2VTKA 2AR7A 3GNQA 1JTFA 8ADHA 2JHAA 3JWPA 1LRJA 1RLJA 1XZCA 5IFLA 3QBTA 2IOFA 4EW3A 1N5RA 3B20A 4DKXA 5BSMA 1CCWA 4MA4A 1G8PA 5BSKA 2HI0A 1ZIPA 2AC7A 2X4DA 3LHDA 1IEQA 3QOYA 3PS9A 2Z5VA 3CPSA 2XUDA 1HZJA 1X8JA 2Q3LA 3WYCA 4ZN6A 2E4WA 2QXTA 3H6HA 5B4VA 4HPWA 1N8TA 5EPEA 3HEBA 4B75A 5IJZA 4BU1A 1W8IA 2Q3BA 3SS9X 5D6OA 4R41A 3GLFB 4RV5A 4PXSA 3ZDYB 1KRHA 4CLRA 4X00A 4WZAE 1DFGA 2DBRA 2G9QA 3AZPA 3OPNA 5J2UA 4JOBA 3EIHA 1G18A 1GL9B 5FR2A 4LNAA 5JH7F 3MBOA 1QGED 4D5GA 2UUPA 1LPSA 5AK0A 2WF5A 3A6GA 1NQXA 4ETNA 2Q5CA 1HY3A 2P3QA 5E6SA 3SDBA 2AE2A 2BF4A 2IZ1A 2FSPA 4QU9A 2CD9A 4JY7A 4LMPA 1FXUA 1FLDA 1WV1A 3C5WP 3M8KA 1VG0B 1NN3A 1ZIYA 1U7WA 4IICA 1JVBA 2VXCA 4GOXA 4NZNA 4TOIA 3LBIA 3PCRB 1G3IA 3L0CA 4N03A 1L4MA 1Y4DE 3JQAB 1JIKA 1N9KA 3H2YA 1PQPA 4FDVA 2VJNA 1NNSA 1XCGB 3D8BA 4K9OA 3TEJA 5LYYA 4HQ0A 3K92A 1D0IA 1TIBA 1P33A 2PL5A 1YZHA 1NBEA 1B14A 2ODNA 3QI7A 4M7OA 4U2EA 4XB2A 4DMGA 2GFQA 3AF2A 4OQQA 3AUXA 3GLFE 3N1UA 2GT1A 1VLVA 2XUOA 4Y2UA 1T1SA 4IINA 3RJMA 4P35A 3E18A 2CV2A 1I3CA 2H59A 4LXYA 4B6EA 4EF5A 4QG3A 4HPJB 4Z9AA 3K96A 4XEUA 4UJ3A 3V1LA 2HA4A 1Z6PA 4IFTA 5EZ6B 3IS3A 1Y3FE 3ZE1B 4YFYA 4ZDWA 3U19A 4KBYA 2GOYA 2ZKLA 4LZPA 4MR7A 2C7PA 4C30A 1TF2A 3HEAA 3U4GA 3AONB 5BYKA 4FGWA 4L3WA 2E9SA 1YHNA 4YRNA 3LYUA 1V25A 3TOZA 1SOMA 2FGKA 3QITA 5A0TA 4XH9B 4F9FA 1GGVA 1SOAA 3DJYA 4IMJB 1WZCA 3JSAA 1W88A 2UYQA 4EYGA 4DNOA 1LZKA 3STHA 4UUBA 3BTVA 5JCZA 2BSQA 1KK2A 4H7PA 2VH1A 4I5IA 4KIUA 2V0GA 3WV4A 1UC4B 5AI4A 3WRYC 1UBFA 2D1FA 3L1KA 5CLJA 4Q4DA 1QGOA 4MQEA 5EUCA 1AKEA 3CHYA 3PR2B 2AJ8A 2XVYA 4AJ4A 1N25A 3FTEA 3O31A 1W0JD 2FPPB 1P77A 2O1XA 3CW2A 5AH0A 3PJEA 4JC4A 4OH1A 4ARUA 2NSHA 3AR9A 2JLUA 1RE0A 5C81A 3K2QA 1D2HA 2JIZA 2W0SA 1AB5A 5TB5A 2IPMA 5DKFA 4KOEC 2EFYA 5U1PA 5KKCA 1NNUA 2X0EA 2XGGA 2VHWA 2PX0A 3JWEA 4HAIA 3HB9A 3ND8A 1RI1A 5EUBA 3T8YA 1OREA 1RCFA 4G1CA 4JVOA 1ZH6A 1MJGA 1UPAA 4N5HX 3E9RA 1B73A 1ACMA 2O4UX 2ZQ5A 3Q11A 3OSUA 1XRLA 4FZRA 4BMOB 1GYRA 1T1GA 3QK7A 4HDRB 4PYNA 3W2EA 2ZS8A 4JUFA 3HCNA 1DZIA 4C76A 3NYRA 3HCDA 2ECKA 4AYTA 5JCJD 4HMOA 1E89A 4ALMA 2NT4A 2YINC 4FKZA 4AD8A 4MARA 2XTMA 3RS4A 2G1KA 5LDDC 3FBWA 2HJWA 4QU5A 4S12A 1F1JA 3WXMA 5AK4A 1O97D 3M6IA 4DEYA 4YY3B 1IHDA 2LV8A 4U7WA 3VR3D 1GTRA 2YQ4A 3OESA 5LMZA 4KO3S 4BFUA 1QE0A 1ZVVA 2NMVA 3I2IA 1NXWA 2H2IA 1HE1C 1JP7A 2ADFA 1ZA1A 2FVYA 1CUUA 2WMNB 2ZU0C 3KU4A 2XCOA 3KUKA 4HQLA 4C21A 4F6CA 1C1XA 3GRCA 2HBQA 2D7CA 4CLXA 1BS1A 1YL7A 4HNQA 3D64A 4IYRA 4Q66C 1FNNA 3I52A 1T1JA 4Q4JB 1KOLA 1CS4C 2DRIA 4ND6A 4Q4LA 4IPTA 1VP3A 4DV4B 4PFKA 3MHPA 1H66A 2I71A 1WP4A 5JT1A 3ZE8A 1JG4A 2ZSIA 1U4OA 5THKA 1OWNA 1E0KA 4FPXA 4IJKA 4JKOA 4I6GA 4JJGA 3P2YA 4GR5A 5F7ZA 1MG0A 5ICCA 1YDMA 2JFOA 1A04A 3LQKA 2EP5A 3R7WB 4LTNA 1XU4A 2NUBA 3IRVA 4RY8A 1CRQA 9ATCA 3IDZA 2VHXA 4PLPA 5BR1A 2BR5A 2FKNA 3ETGA 4IILA 4NONA 4O5AA 2XY4A 5EEGA 1KY2A 5GY7A 3QIAA 3TKYA 1RXVA 1I32A 3F9IA 1QBGA 1HM5A 1ADFA 4OU5A 4ZYLA 3WICA 4QOGA 2IVFA 1U5CA 4KP7A 3WWCA 1VLHA 2PR2A 1Y1LA 4H31A 1SZCA 2VHVA 1GRCA 4TS9A 5EVCA 2I99A 2WKQA 1OW3B 4BMSA 1CYDA 2FLKA 1Z74A 3ZW9A 2R7NA 1VI5A 4LDQA 2GNOA 1W5SA 1KYTA 3EGWA 4DPMA 2DEUA 1NUQA 2HA3A 2PKWA 3PU6A 1S9DA 2YFYA 4DJFC 4K40A 1G20B 2IUUA 4KQ1A 3R0IA 3LPMA 3M4XA 5AVUA 4GLJA 4YP1A 1E7YA 4TLAA 3GEDA 2D0IA 3NDRA 1ZA2A 2UZIR 3IQIX 4TTTS 4XASA 3L0SA 1Q19A 3PHBE 2VTBB 2RGRA 3C0KA 3I6QA 1F4LA 2HLDD 3NH6A 1R64A 3RT9A 3TOSA 3HJUA 2DVMA 4YCNA 4L3VA 5IBPA 3GA5A 2B0JA 3ZOKA 4OHUA 5TNXA 2J8ZA 4R9VA 5TE9A 2OQVA 2WU0A 3TTSA 3WYBA 1ZY2A 3ZV3A 1KDPA 2EZUA 1DC5A 1XHLA 1JEEA 1LX6A 2SKCA 5H9WA 2IEIA 4Q9AA 2I29A 4RFSB 3GGCA 4J0DA 3DXFA 4DCGA 4QYXA 5EIWA 4JB0A 1UT6A 4LY9A 4ZZ0A 2Q2OA 1Y5LA 5KOHB 2QZSA 1G20E 2HJRA 1X70A 4IIFA 4UPDA 2V7EA 2ZIXA 1XLTA 2IDMA 1VSQA 3DL0A 3FGPA 3K4QA 2ZFUA 3PSHA 1NR1A 4AIRA 4C1NA 1GZHB 2P4SA 3FHJA 2ETVA 1GEEA 5IWCA 3H2BA 1VHTA 2QG4A 4M0LA 5PNTA 2P27A 5LP6F 1GITA 3LWDA 3RYCA 5IVHA 6AT1A 4OG2A 4PFSA 1GVHA 1SC4A 2JLCA 2I1LA 1SPBS 2C5GA 2J08A 3DE5X 2HAEA 5CM8B 4KPGA 3CMMA 3UJAA 4B6JA 4BO9A 4ZCSA 3M4JA 5EIXA 2NYAA 5FOTA 3AI7A 3IXQA 3LO8A 1WTCA 4BCBA 4PCAA 4ENQA 1JSLA 4BRZA 4GQIA 3CF4A 3QMWA 5HJ5A 1K4YA 3BFKA 4CR6A 5HOQA 2UYGA 1HFJA 1BH2A 2HH9A 2PAFA 3OO0A 5JXJA 3ZGVA 4J1TA 2Y1CA 4LNUA 5HKOA 2IYFA 1UC8A 1Y81A 1FXWA 4I4LA 2YVAA 4HQOA 1KHHA 2JJ2A 2FWBA 1XB2A 2OG2A 4FJ2A 3NBAA 4GI5A 4JI8B 2BFCB 2FY8A 3WDSA 4B71A 5B53A 3F6RA 4UZFA 4DRZA 2JD1A 2W2VA 5D1HA 4KUGA 2IHTA 4FDAA 3GUHA 1OH7A 4LPSA 3HDVA 1OYVA 2G09A 3CF6R 4AL4A 1V3QE 2ERYA 4KXVA 3LP6A 2JA1A 3A1UA 5SYAA 2QZPA 4Q1BA 3WFZA 3H2SA 3UMJA 3OBBA 4YV2A 1FMLA 1IVYA 2C2XA 2GTHA 4W5JA 2RD2A 3KR0A 1F14A 3CLKA 5ER6A 2F00A 2JAWA 2QGNA 2ZSHA 2YN4A 3QTBA 3QWAA 3BH6A 4JBGA 1PF7E 3COZA 3V6LA 1CV2A 1Z28A 3VHXB 4YMLA 3HY4A 1I3MA 4QL3A 3L92A 1W75A 3CYFA 3C1OA 1QFSA 3SZLA 5JALA 3QNWA 5JAIA 3WAGA 1XELA 1ZRHA 2OO5A 2QF7A 4R71A 1QOZA 3AVYA 3EDMA 4HN9A 2P4HX 5EMNA 4CM8B 4E2XA 5JAZA 3DLAA 4RSGA 1A5BB 4OGFA 2ANBA 2TMDA 4JI4B 5BV1A 4I3FA 5AKJA 1KMHA 3LA8A 3AUJB 2AZMA 2PMCA 4S1OA 3ZZ1A 1C7EA 2O3RA 2G06A 4NOJA 5CW2A 2P6NA 4DA0A 3O7WA 4TTQA 3DT9A 1CR0A 2XE4A 1UBJS 4OYRA 3CJTA 2YJ6A 1FMCA 3BSYA 2NZUG 4G89A 2H9IA 4LSWA 2WINI 3VPGA 2O0HA 2WQZA 4UNNA 3KQHA 3N5CA 2VUUA 1ENZA 3FZNA 4L73A 3NBMA 3MN1A 1HLDA 3R6DA 2I34A 2MMCA 3OM9A 3R09A 4NU8X 2C9CA 2I3ZA 4ZAVA 4PHHA 1NFRA 2ECOA 4IRUB 4CFYA 4N7JA 4B3DA 2Q1UA 5D7NA 3DT6A 5HTOA 4RW0A 4ZCLA 1IZYA 4UHBA 1PX0A 4L08A 3WP0A 3T7CA 1UKEA 5CDUA 4D4JA 5BW4A 1WQ3A 5BOSA 5ITVA 1BVUA 4PGMA 3L3BA 3EGEA 3RR2A 3S28A 4EVIA 3T9CA 3H6KA 5TEWA 1YTLA 1V5IA 5JNLA 1PW7A 5JXIA 3ITNA 5AT1A 3RHFA 1J9EA 1EK6A 3KQLA 3ICQB 1QORA 3MUOA 3HA2A 5DBOA 1YKSA 3JSXA 3PGLA 4QODA 4D82A 1EZ1A 1QH0A 2NTNA 4LC0A 2PZJA 4F97A 3HN7A 1IXKA 5FULA 3QEAZ 1WP9A 3RUFA 1TE2A 4FOTA 4RHYA 4R9NA 4CCAA 1YBMA 3SOZA 4WLVA 1SIBE 3LQ4A 3M6XA 4ENSA 4ZOLA 2B7BA 4DV3B 3WMWA 5JSFA 2HMSA 3E9EA 4OSOA 1R6VA 4CI9A 3EPKA 2F55A 1EWQA 3WTBA 2G9ZA 3AW8A 4C3OB 3SAJA 3DONA 4HNVA 1U11A 2X2EA 1LDBA 4Q9KA 1HDYA 4ZI5A 1C7JA 1OC2A 4EJSB 3GN1A 1K9SA 1WHSA 2X0NA 3K2BA 3OTOB 4IJUA 1VFPA 3RADC 3CEPB 4TVOA 1VG8A 1TD1A 2QN2A 3IEXA 4MKHA 5LU9A 3PK0A 2QAGC 1K4KA 3FDZA 1JIJA 4NPHA 3D0RA 2Q8QA 4CIDA 5A4AA 1IOWA 5DT2A 4W5TA 3VMFA 4UUNA 2OMKA 4AS1A 1NVXQ 4HTAA 1UQTA 4OQXA 1HGXA 3HUEA 1XZLA 1Y80A 3L2OB 1JIIA 2IZ5A 4G5OA 4LJAA 1LJ8A 4TWAA 3C6BA 2Q4DA 3NORA 5C1DA 3L1UA 1WU7A 4WKOA 3R74A 1B0AA 3U7JA 1WMFA 3ZXXA 4KLAA 1CUIA 1MQSA 1R18A 4P5PA 1ZOOA 4PQGA 4RNDB 2WA2A 3Q6NA 4ZQIA 3IUYA 2FFRA 1Q95A 3B2QA 4ZQCB 2HCJB 2YYYA 3P2MA 3GZJA 3TSAA 2HJGA 5LMUB 1XZDA 4E46A 2CB0A 3PTZA 4FFPA 4M37A 3WYAA 4BEBA 1KU0A 1LI7A 3DFFA 3G0CA 3QBDA 4JMPA 4JU9A 1T4BA 4YJ3B 4TYMA 4MRRA 3NEPX 2G08A 3T7SA 1JJBA 1N0WA 3HXMA 1NVUQ 2NVWA 3DC7A 1E1KA 3DLTA 3COJA 4Q37A 4CCSA 2AUMA 1G8YA 1NFQA 3AUFA 1P45A 3UFXB 3DOUA 1PNVA 3CUEF 2WPNA