3K6KA

Crystal structure at 2.2 angstrom of hsl-homolog este7 from a metagenome library
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
297
structure length
297
Chain Sequence
DTKMDPRDFLQLLKINAEKAEKNLPLDQKRAGMEALCERFPRAEGVELTLTDLGGVPCIRQATDGAGAAHILYFHGGGYISGSPSTHLVLTTQLAKQSSATLWSLDYRLAPENPFPAAVDDCVAAYRALLKTAGSADRIIIAGDSAGGGLTTASMLKAKEDGLPMPAGLVMLSPFVDLTLSRWSNSNLADRDFLAEPDTLGEMSELYVGGEDRKNPLISPVYADLSGLPEMLIHVGSEEALLSDSTTLAERAGAAGVSVELKIWPDMPHVFQMYGKFVNAADISIKEICHWISARIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Esterase/lipase
publication title Biochemical and structural analysis of hormone-sensitive lipase homolog EstE7; Insight into the stabilized dimerization of HSL-homolog proteins
rcsb
source organism Uncultured bacterium
total genus 98
structure length 297
sequence length 297
chains with identical sequence B, C, D
ec nomenclature ec 3.1.1.-:
pdb deposition date 2009-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3k6kA00
3DOIA 5LIPA 1CQZA 5CT5A 3V1MA 4MWTA 1P0PA 1PJAA 3FNBA 5A6VA 3D3NA 4H77A 2XMDA 2I03A 1H2XA 1UZAA 3V9AA 4J0DA 2J3QA 2C58A 4QDUA 1YS2X 5AK4A 2OCIA 2HA0A 4FDMA 2HA6A 1Q84A 1R9MA 4X93A 5J3JA 4GEGA 2V98A 3BF7A 4J03A 1G5FA 1SC9A 1ZD3A 4P92A 5A7FA 4OPMA 4ARAA 3T52A 1E8NA 4UBLA 1QIMA 4AX4A 3AZPA 4PW0A 3DQZA 4Q3LA 1JJBA 1LPNA 3QPAA 5ALSA 2R8BA 2XB6A 2WHPB 4DMKA 2WIDA 2PX6A 4B83A 5AKLA 4KRXA 2D0DA 3PE6A 4BZWA 1DQZA 4C4XA 1MNAA 3ANSA 1E8MA 2CEKA 3EQ9A 1FFCA 3C6YA 1VZ3A 1FFBA 1G66A 3MUOA 1HBJA 3TEJA 1CIJA 1UK9A 2C7BA 1QIGA 1N8SA 1EX9A 3VJMA 3Q0TA 4WFKA 2VT7A 1DT5A 4E46A 2B20A 4UBJA 4WY5A 2Y6VA 4Y9SA 3ESAA 3EF3A 3I28A 4AMYA 1HKHA 5HCUA 5DYWA 1VJ5A 5JD6A 4Y2YA 3M83A 2XMBA 3OG9A 3SWWA 4X97A 4KEAA 1Y7IA 3QH4A 5LZ4A 4CCYB 4H7HA 3RLIA 4FMPA 3FLBA 1VA4A 1MPXA 4LYDA 1EB9A 4Q34A 5HF9A 3H04A 4KE6A 4WFIA 3G0CA 3FBWA 1MAHA 5K3FB 4C4YA 4B85A 1GKKA 4X00A 2GBIA 3R3YA 3R41A 3H1AA 4ZWNA 2QS9A 2OAGA 2DCMA 5ALQA 1IUNA 3W05A 4B81A 1JJFA 4WDRA 4UBOA 4DTCA 4QDZA 5K5EA 5BOVA 4Y2RA 2QXUA 2XUKA 1ISPA 2ZYIA 4W1RA 3RM3A 3SC2A 3KSRA 1YAJA 4BCBA 5AM3A 3PF8A 4Y2PA 4X91A 2VAVA 2WHQA 4MJ3A 2Y2VA 3WZMA 1TKRA 5HFAA 2WTMA 2E3JA 3G02A 1QIKA 1BU8A 4B0OA 4QE3A 1OCEA 1QTRA 1UFOA 1BEZA 1XQWA 4FOLA 2X76A 5AKIA 1XZAA 3OTQA 1XQVA 5AI8A 4KJXA 1YS1X 6YASA 1CUUA 5HKBA 1DWOA 4U2CA 2JF0A 2V96A 4HZGA 3P2MA 5ESRA 3WLAA 4JYMA 3FVTA 5LLSA 5CRIA 4Q3OA 2WSLA 4P08A 2V9ZA 5JZBA 1CUXA 3DL4A 1HPLA 1BS9A 2XLBA 3QPCA 2ACEA 5D6OA 4KAFA 4RGYA 3STTA 4EBBA 3WK7A 1RP1A 1EINA 2OG1A 3ZLTA 2GZRA 1E66A 2WILA 1ZD2P 2X8BA 3WK8A 4CIAA 4FFVA 3BIXA 3HYSA 1QIDA 4FNMA 2OCLA 4KYVA 2WHPA 2DHCA 2WU4A 3B12A 3C6BA 1VKHA 3R3UA 1ACLA 3W9UA 4AQDA 4K2AA 4J0IA 1GPKA 4BRZA 4OYYA 3Q8WA 3MGAA 4XX1A 5AM5A 4BE4A 1UKAA 1QO9A 4RE5A 4BBZA 4DNFA 4ETWA 5CBKA 2YH2A 2WIGA 3WYDA 4Q05A 4X92A 4DMCA 2GBFA 4K6KA 4Z49A 4DNPA 3GROA 2XMSA 4QA9A 1QIJA 3ZPXA 2UZ0A 5BV7A 1JFRA 2W22A 2Q0XA 3X3HA 3FYUB 3HRHA 4PSDA 1JMYA 3D59A 1J2EA 1YA4A 3AZQA 4CCYA 5HF6A 2AJ8A 3BL8A 5CT4A 3G9ZA 4BCCA 1XZIA 2V97A 5BWCA 5EGNA 4X90A 1Y37A 3B3QA 5F4ZA 1VOTA 5JIBA 1EXWA 1QZ3A 3W9BA 1ZI9A 4H7IA 4PO3X 3PICA 4Y2JA 5K3FA 3R3ZA 4H18A 4F0JA 4Y2UA 5LZ8A 4W63A 2I3DA 2OGTA 5SYNA 5ALMA 4C4ZA 5IVDA 3O4GA 4QLOA 2HM7A 1L7QA 2H1IA 1JT2A 4X7BA 4MYDA 3E4DA 5D7BA 1X2EA 2H7XA 2QMQA 3O9MA 2CBGA 5E2IA 3STVA 2HHAA 2Z3ZA 4Y2SA 4TPKA 2VTVA 2OQIA 7YASA 1CLEA 4U2FA 5SYMA 1NU6A 2ZYRA 3ZLUA 4J7AA 2HRRA 2QM0A 4G8DA 1YB6A 3G9XA 5HF8A 2WUFA 2ONCA 5AKJA 4B0PA 2VJCA 1IVYA 3E0XA 2GYUA 5LP1A 3EBLA 4DSZA 1DINA 3BXPA 4BC0A 2HA2A 3G0GA 3DYVA 1LPMA 3HABA 5IVHA 4G8CA 1CUCA 2PUJA 4UUQA 4ZGBA 1UOQA 4N8SA 4JEIA 2VAXA 2YXPX 4BVKA 2XDWA 5D3ZA 4MEAA 3DL7A 3L1IA 4Y2XA 1BCSA 2RHTA 1KU0A 4X71A 1DWQA 1TCAA 5DLPA 2PM8A 1THGA 1AKNA 4BDTA 2CJPA 2YYSA 2XLCA 1FFDA 2QUAA 5JZ9A 5LZ2A 3WWDA 1USWA 4DNQA 4L9AA 4LYEA 1WHTA 3QMWA 2RGUA 4BVJA 1N5RA 4U2EA 3WQHA 2ES4A 1E8DA 2RONA 5IKXA 5C8XA 1XLUA 2XUPA 1CEXA 2WJ4A 5CH3A 5ALGA 1XLWA 2QXTA 2OQVA 1XZLA 2BAGA 1QIHA 1SCIA 4UBNA 5AI6A 2OAEA 4AO8A 4FBLA 4WFJA 3DNMA 3FYUA 5AHXA 4KE7A 3AUKA 3G7NA 4ZREA 1AGYA 4UHCA 3DYIA 1LPBB 5AOAA 3O95A 3WA7A 3VDXA 1O6GA 3FCYA 5ALKA 4E15A 5LKAA 2BFNA 4E14A 1CRLA 1FFEA 1J06A 1VZ2A 3ED1A 1YR2A 3WKDA 1QTIA 3WL5A 4J0CA 4OB7A 1CUJA 3VISA 4H7FA 1ORVA 1UWCA 1N5MA 3DCNA 3O9VA 1YSCA 2VSQA 4HRXA 2WUEA 1K6EA 4G9GA 3WWOA 4Q82A 1K4YA 1CUZA 2BGRA 3JWEA 3O4JA 5FV4A 4PV7A 5JAUA 3AZOA 4FNGA 2QJWA 2XUJA 2J3DA 4Y2QA 5C7YA 3C8DA 3IULA 1QOZA 3RK4A 3HI4A 1XQYA 3STUA 4PNZA 5ALUA 4DMFA 1JJIA 4YX9A 1AURA 2XMGA 2Z8XA 3ESBA 4BRSA 2EDCA 5JD4A 3VKFA 3QPDA 3CCCA 1IZ8A 3ZWQA 5AKKA 1MX1A 4RE6A 5FPQA 3I6YA 1OILA 4WDQA 3VJKA 4UFPA 1FSSA 4HS9A 1VE6A 4J0GA 3I2JA 5K3AA 1YAHA 3WL7A 3G9UA 3A2LA 2HA4A 3ESCA 4L3WA 2DSNA 3AILA 2CMFA 4OSEA 4QEKA 3HXKA 5KBYA 1VE7A 1VA5A 3FSGA 1CUYA 2JEZA 3EQ8A 1D07A 5ALYA 3QITA 2J4FA 1F0NA 2H7YA 3OC0A 5HF5A 3E3AA 2JGKA 1GZ7A 5HK8A 4AO7A 5C8ZA 3ICVA 4WY8A 1WB4A 2QZPA 2VF2A 1SOMA 4UPDA 4YPVA 1MNQA 3KD2A 3I6MA 3H2KA 2QOEA 2I3ZA 1P0QA 3IUJA 4L72A 3WIBA 1QFSA 3D0KA 3T4UA 2DQYA 2GYVA 1XZBA 4GBGA 3U0VA 2B61A 1WHSA 3WKEA 3UUFA 4N8DA 1K5PA 4FLMA 4DGQA 4EY6A 2IX9A 1SCQA 3F9CA 1AX9A 5ALOA 1LZLA 2JGFA 3NGMA 5CTAA 3AINA 3IIIA 5H3HA 4OU5A 1UOOA 2JGJA 1QGED 2WUDA 3FOBA 1XRMA 4YASA 4V2IA 2HFKA 2JIDA 3GBSA 4NS4A 4MQLA 2RIPA 4BAZA 1BE0A 4WCVA 3PF9A 5FPPA 1NU8A 2PVSA 5EIEA 3O4IA 4TGLA 5K3CA 5AM0A 2DHDA 3H2HA 4KRYA 5ALEA 2HADA 5DJ5A 1LPSA 2O2GA 5FUMA 2ECFA 1G4HA 3WJ1A 3WWEA 5DNWA 3WL8A 3GFFA 2NW6A 4XJVA 5AKEA 3D7RA 2XMRA 2JGMA 4HTAA 1ETHA 5AM1A 3FAKA 1MTZA 3DDUA 3AJAA 5T4EA 5ALFA 1K63A 1ZI8A 3QM1A 4U2DA 1CQWA 4W1SA 3D2CA 2GYWA 5LZ5A 1T2NA 1XZKA 3A6ZA 3BWXA 4BDSA 4FFWA 4NVRA 4S0XA 2WM2A 4CCWA 1XQXA 2AJBA 4U2GA 1C7JA 3DJYA 1ZOIA 4LXHA 5AKZA 1YCDA 4OB8A 3G0IA 4H0CA 5DYYA 1QFMA 5IVKA 1HLGA 2CKMA 4HXEB 2PSDA 5HZGA 1R1DA 3QYJA 4UFNA 1CPYA 1XZEA 1MN6A 1ZGBA 1PV1A 2PUHA 1GQRA 3C5VA 3RKSA 4Q3KA 1XRRA 2EDAA 2XMZA 3WKAA 3PFCA 1TRHA 4GHWA 1C7IA 3AFIA 4C01A 1EHYA 2C0QA 5AK5A 3A2MA 1BRTA 1DX4A 3GUUA 4KR0A 1R9NA 1DX6A 1UKBA 1G42A 1LLFA 4MXDA 1H23A 4KAAA 3STWA 3R3WA 4Y2TA 3M82A 4F5ZA 1EI9A 4X6UA 3MUNA 3FLEA 2EEPA 3HC7A 2AJCA 1GKLA 5AM2A 2D5LA 3H18A 1FFAA 4I4CA 4GECA 4G9EA 1UK8A 4UBMA 2XUDA 4FTWA 5HQ3B 5EHXA 3L1JA 3BDVA 3FCXA 1KEZA 5JAOA 4KE8A 3ICWA 4GW3A 4KAJA 5CT8A 1A8SA 5FKJA 5AIBA 4JUIA 5AOCA 1QE3A 5AJHA 1SFRA 5JAHA 2XE4A 2PU5A 1H2YA 3WIOA 2BKLA 2XQIA 5AI0A 3OPMA 4C6HA 1J07A 1QJ4A 3FWHA 3D2BA 2VA9A 3WWCA 4GDMA 1ZIXA 1Q0ZA 1EA5A 2OCGA 2WHRA 2K2QB 1UK7A 1QONA 5A62A 3QMVA 2HA7A 5JATA 3D2AA 2OGZA 4C88A 4C87A 1MX9A 5BWBA 3BDIA 5T4HA 1F8UA 2Z5GA 3N0TA 3ZV7A 3WK6A 2I78A 4FHZA 1E3QA 4RNCA 3B5EA 5D3KA 4X6YA 5A2GA 1TAHA 2ZSIA 3SK0A 4QNNA 5ALRA 5CW2A 4BP9A 2ZJ7A 2XUFA 4DYHA 4G4GA 2AJLI 2G63A 2WJ6A 1DU4A 3L1HA 1LBTA 1N1MA 4B80A 1GXSA 1TCBA 3VVLA 5AH0A 1R4ZA 5JZSA 1X2BA 1MX5A 2IITA 1ACJA 4ZV9A 4JH0A 2JGLA 2C4HA 1X70A 4A23A 5I7UA 1CUBA 3I2HA 4P9NA 2XI4A 1WPXA 3PFBA 3CN7A 2GBCA 2OLEA 2WFLB 1WM1A 3IB3A 3H17A 3N2ZB 3OM8A 1W1IA 3WYNA 1CVLA 1ZD5A 1XZJA 5HFNA 3DLTA 1P0MA 4K5QA 3V1KA 3FYTA 5EIHA 4HVTA 3BJMA 1ODCA 2DHEA 3C8HA 5ALTA 2WTNA 1AZWA 4KACA 3DEAA 3LS2A 3GZJA 4CG3A 2JGIA 3HEAA 1UXOA 2B9VA 3A2NA 3STXA 5FDFA 1E89A 2WIKA 4EHBA 4E11A 1WB6A 3SX4A 1ODTC 2WG2A 4FLFA 3H2JA 3V1NA 5HQ3A 1LPAB 5K3EA 1XLVA 5ALNA 5JANA 2XUOA 4G5XA 4XWGA 2H7CA 3HACA 1CV2A 3ANTA 2ZVDA 2C5FA 4EA6A 4BZZA 5CXXA 1LZKA 2JEYA 3PDCA 4QWWA 4CI9A 5K3DA 3QVMA 2AJDA 4QLAA 2FUKA 1SCKA 1C4XA 3YASA 3AIMA 4P93A 5AI4A 2RHWA 5DNUA 4X85A 4XIIA 1DQYA 2OPHA 3C45A 1GGVA 2QVBA 3ESDA 1A8UA 1Z68A 1F0PA 2GBGA 4IH4A 5AP9A 3S2ZA 3LLCA 5YASA 4LXIA 1XROA 3WMRA 4ZXFA 1QLWA 3R40A 1QIIA 3G0DA 1EH5A 2XUHA 2Y1KA 4PF1A 1BCRA 4AB1A 2WU3A 1B41A 4X6XA 1S8OA 3VJLA 2RI6A 4M0EA 5EHNA 1WB5A 3C5WP 1XRPA 4UFOA 3I1IA 2R11A 2IIVA 4XVCA 2HU8A 1EDBA 1LPPA 2VQ6A 4H7JA 2HA5A 3I2GA 2O7VA 3WKCA 4EY4A 3G0BA 2GZSA 1W75A 3DS8A 1FJ2A 1EK2A 5CMLA 3AIOA 4ZRDA 3KWFA 1ZD4A 2WFLA 4BP8A 3TJMA 1JMKC 1XKTA 5KWJA 4Y2VA 2PPLA 4NZZA 4B84A 2OCKA 4HAIA 1QIFA 5ALLA 2PSFA 4UHBA 2ZJFA 1CUFA 2QJRA 2WFZA 2JGEA 2PSEA 4X95A 1GPLA 3VXKA 1K8QA 3C87A 1QIEA 1WOMA 4FWBA 3WI7A 5LYYA 4EY5A 2DR0A 3H1BA 4DMHA 3QBJA 1J1IA 1WPRA 1AQLA 2XUAA 1UKCA 3NWOA 2WFMA 4W9RA 2PSJA 3DKRA 4AN1A 2BJHA 1E5TA 3R0VA 1A7UA 4B82A 1RYYA 2XUIA 1DTEA 3R3VA 4UHEA 4INZA 1DWPA 2C5GA 2VEOA 1GT6A 1TQHA 2WG1A 5CT6A 1EB8A 4M0MA 4N5HX 1L7AA 2ZYSA 3WK5A 2XQJA 1Y7HA 2O2HA 1H2ZA 4EY7A 2WKWA 2Z8ZA 2VJBA 1UK6A 4UHDA 3LIIA 4M0FA 5CXUA 2FJPA 2BUCA 4WJLA 4A5SA 1VXOA 1U8EA 5A7HA 5EIAA 4BB0A 2PBLA 2VT6A 1A8QA 1W52X 3MVEA 4HXFB 4BATA 5CH8A 4JYPA 3ZI7A 4UHHA 1XRLA 3V48A 2G4LA 4UBIA 1L7RA 3O4HA 1IMJA 3TRDA 4AN0A 5AK6A 4ZI5A 1LGYA 1GQSA 2JBWA 4TVKA 3IBTA 5I8PA 5AKXA 3IVMA 4FLEA 5ALXA 5ALHA 1CUGA 3VVMA 1GPNA 1ZGCA 2B4KA 2G5TA 3FLAA 5AKYA 3WK9A 1CUWA 5AM4A 5FP0A 1XZFA 3IUMA 4EB0A 1TIBA 3OURA 1B6GA 4IH9A 2OXEA 2FJ0A 4OU4A 3R3XA 3C70A 4BVLA 5JALA 1CUDA 1U4NA 1LBSA 3RARA 4OUKX 1UOPA 3LP5A 2CUTA 4H7DA 3CXUA 4BYMA 4QDTA 4B9EA 2ZSHA 2QRUA 4EZIA 3BIWA 5EHZA 1W76A 1EDDA 5CH5A 2OGSA 3GA7A 5E4TA 4DLNA 4BAUA 4F21A 2AXEA 1EVQA 4OB6A 5LKRA 4CG1A 5HK9A 2WLSA 3I2IA 4C89A 5IH7A 2Z3WA 1T4MA 3WKBA 4LHEA 5ALIA 4IH1A 2HFJA 5E4YA 1OXMA 3A70A 2XQKA 4FKBA 4FBMA 4BE9A 4OYLA 3EQ7A 4BTVA 4PSUA 2WIFA 5HKAA 3F97A 3JYHA 5ALZA 4EY8A 2PKYX 1YA8A 4K6GA 2QTBA 5AKGA 1M33A 4G4IA 4AXBA 5FRDA 3WL6A 5JYCA 4UHFA 5EHQA 1CUSA 4NMWA 3IA2A 4K6HA 3WWPA 3KXPA 2LIPA 4J0HA 1CUVA 4IHAA 3CN9A 4Q1VA 4BCDA 2WQZA 2XUQA 3O0DA 4MEBA 2ACKA 1IUPA 4AMZA 5A71A 4PQEA 3BF8A 3W2TA 4RPCA 1WCYA 5JADA 2O2IA 5JAPA 5A7GA 3C6ZA 4JNCA 4QDOA 2XMQA 5C81A 3I6ZA 4BAGA 1W6RA 2VATA 3I1YA 1A88A 4A16A 1R88A 2VJAA 3V1LA 3K2IA 3H2IA 3LCRA 5ALVA 3HLKA 1HQDA 2XT0A 5FOQA 1MT3A 4AZ3A 4OD0A 3FYUC 3H2GA 4YK7A 3DOHA 1XZGA 5T4BA 4I19A 5AI5A 3PUHA 4GI1A 1JU4A 1XRQA 5DTIA 1TK3A 2HA3A 1NX9A 3NOXA 4BC1A 3DKKA 1ZICA 2ZYHA 3F98A 1F6WA 3HJUA 3IUNA 3W06A 2W6CX 4LIPD 3PUIA 3WA6A 3BE8A 3IURA 1R3DA 1YB7A 1BN7A 3D5EA 5AO9A 5KWIA 5AKHA 4KE9A 3WK4A 4BTLA 2XQGA 4ROTA 2QKYA 3KWJA 3BJRA 2G5PA 1AMNA 1BN6A 4UBKA 1DT3A 3G8YA 1VLQA 5LZ7A 3KOOA 4IO0A 1HL7A 5AICA 3F8SA 4F60A 1LPOA 1IUOA 1I6WA 2O7RA 4IQ4A 1H2WA 3K6KA 4G1FA 1JKMA 5ALWA 4GWLA 4MYSA 5LZ9A 5I9IA 1P0IA 3UUEA 5ALJA 2H9YA 4J0JA 3STYA 4G4JA 4B6GA 2BGNA 3IDAA 5DWDA 5KREA 5K3BA 2WJ3A 4EUSA 4J0KA 4B7ZA 3FSGD 1Q83A 1QO7A 4D9JA 1U65A 5T4FA 3I2KA 4QZVA 3LIPA 5ALPA 2P8SA 4ITVA 1RWQA 1XKLA 3AIKA 2ZJ6A 3QZUA 3HZOA 3M81A 5FLKA 4G8BA 1H22A 1BEEA 1VXRA 5AK3A 2WUGA 3FVRA 3ZLVA 3F67A 1U2EA 2DQZA 3EIOA 5JARA 4DSAA 1ZJ4A 3OOSA 3G9TA 4J3JA 1ODSA 2ROQA 1CR6A 4HRYA 3I2FA 3HSSA 3DD5A 3F96A 5C8VA 4GLBA 1EDEA 3GELA 4AZ0A 5IVIA 2QR5A 4U2BA 2VJDA 1AC5A 1XFDA 4CG2A 4GXNA 1YASA 5DYTA 2PSHA 2XMCA 3ILSA 5AOBA 4W1QA 2HRQA 1R50A 1CUEA 1CUIA 5EFZA 1XZCA 2CZQA 2HU5A 5AIAA 4H7EA 3U1TA 2WIJA 1HDEA 3K9BA 4O08A 2HU7A 1CFJA 2HDWA 2PL5A 1LNSA 1TCCA 5DTJA 4L0CA 4ZV7A 1JI3A 4DM7A 2YASA 2WG0A 4OCZA 1ORWA 4Y7DA 4AO6A 4LKOA 3H0CA 1ZIYA 1XRNA 2PU7A 4LXGA 1KU6A 3C43A 1Q0RA 2J4CA 2RAUA 5E4JA 4DNOA 2X5XA 4HXGA 2BCEA 1MAAA 1CUHA 5CT9A 4H7KA 4MWSA 5CURA 1THTA 2QT9A 3WJ2A 4W1PA 3PI6A 3IUQA 3D4LA 3S8YA 1XZHA 2CB9A 1JU3A 5JD5A 5DNVA 3QMMA 4QWMA 5ALDA 1ZI6A 1IZ7A 2XQFA 3JW8A 1W4LA 3UMJA 1O6FA 1PFQA 4CFSA 3CCBA 4X3CA 3W04A 4QDXA 5ISMA 2Y6UA 4PSCA 5JASA 3C6XA 1EK1A 4I3FA 5EI5A 4B9AA 5AI9A 2Y2UA 4CIBA 1EVEA 3KDAA 1AUOA 4ARBA 4MQMA 4N8EA 3H19A 1CUAA 1MU0A 3TGLA 1XZDA 1UT6A 2HIHA 2C0PA 1BROA 3WZLA 1MO2A 2BUBA 2DFPA 1MJ5A 1XZMA 3NUZA 2HL6A 2XUGA 3E1GA 4H35A 3M3DA 4DIUA 2FX5A 2QUBA 2BUAA 1ZJ5A 2ORYA 4N5IX 4X94A 5FXMA
chains in the Genus database with same CATH superfamily
1NQVA 5ITWA 4GNRA 4QASA 2IA5A 3OOWA 1VMIA 4AUMA 1CQZA 1RCTE 4YJGA 2DFLA 4L27A 2Z58A 3PI7A 1JIKA 4PZLA 5CT5A 1VIVA 4DIMA 5HRUA 1VSVA 5HDQA 5J23A 4YRPA 2BFEB 5K6RA 4D5GA 2M6KA 3ESQA 1UWVA 5B57C 3QK7A 3UHOA 3K9FC 1FXSA 1NRIA 2LP4Y 1V2GA 3A4VA 4RLHA 4CLDA 4C05A 3I62A 1QV9A 4J0DA 1DC5A 1J8QA 1DBIA 3WSVA 1OA1A 1NBMD 1IOVA 4B3DA 4ESVA 2X9VA 2IYQA 2POCA 4UULA 5IFKA 1X3SA 4JB2A 2GEFA 1UXJA 5IN5A 3T5PA 5EXXA 1BVRA 4KQ6A 2O8VA 1GSAA 1R4AA 3FZNA 1R0XA 3KEQA 4KN9S 2CDCA 4ZO6A 2X2OA 4FDMA 3LX5A 1Q84A 1J5EB 4JD5A 2F00A 1G21E 4H1WA 1UWLA 3ILVA 3AHDA 4X93A 5J3JA 2VG8A 4MKZA 1CEQA 2FDCA 3OY7A 3BF7A 3CLSD 2QVXX 3M34A 3AETA 4I50A 1SC9A 1QGUA 1UKZA 4QFDA 4ETIA 1WU8A 1P2FA 4BMSA 1W4AA 2WT8A 4GC9A 3NCTA 3IHTA 4RZIA 1X7XB 1WUHS 4XIGS 3TNYA 1FDOA 1Z6XA 3VTKA 3NRBA 2GB4A 2W6QA 4WXEA 1CZUA 2VXOA 3DGFC 4LTNA 4P92A 4MVCA 4Z4HA 1E2BA 2QY6A 3RVBA 1NJFA 3O1LA 4PGGA 1E8NA 3C3BA 3VSCA 1JSRA 4QFMA 2FSPA 1F4VA 3COJA 1W25A 4DNXA 4U7FA 1YJ5A 2ZR0A 1UIRA 1OX4A 3G2QA 1UAYA 3OBBA 3DQZA 1JHOA 4JL8A 2G40A 4QTTB 5CX4A 2AGVA 2BGUA 2NO5A 5F7OA 3RYHA 4KLCA 3S1AA 1N5DA 3TX6A 4BO9A 2WHPB 3QWFA 5IDVA 4YEDA 2P9EA 3OU2A 3HEBA 4AJPA 4CJXA 4FHEA 1T3SA 4YNBA 4DDUA 1IHPA 5KX5B 2LTAA 1EJ0A 3OQ1A 3PENA 1H2HA 2R84A 3B13B 4CDRA 5LMUB 4HVAA 5FWDA 4KRXA 3A6HA 2D0DA 3WMXA 4JT2A 1MQAA 3M6AA 4GYWA 4B75A 1MH1A 1HEYA 3AR5A 1DQZA 5HP4A 2TMGA 3TIVA 3ANSA 2QBYB 5C5CA 2PXAA 2VCHA 4G0MA 2CLKB 2WOOA 3B2NA 4GZMA 5CFMA 5ITVA 3OTWA 4IQ0A 4OAQA 2NXWA 3KSDO 5KOJA 3KFXA 1BFKA 3IBFA 5IHPA 4WACA 1ISGA 3B2EA 4D74A 1Z6ZA 2NV6A 3LHSA 3SZRA 4XWOA 3FHOA 1X77A 2AMJA 2C7BA 4R5MA 1QIGA 2WDZA 1N8SA 1EP1B 3AB7A 1L8AA 4GSLA 2HQSA 4GP9A 3Q0TA 3TK1A 2B2XA 1D0VA 5TGTA 4L5AA 1K8XB 2VT7A 1DT5A 1UBRS 1U9IA 1QV7A 1WUJS 4UBJA 4GOMD 3DR5A 2JVKA 3ESAA 1YBAA 2JFYA 5EZ6B 1HMYA 1VJGA 2F59A 3UUWA 3C7TA 1W5FA 1CJMA 1M1YA 2JAWA 5FH9A 2Q6LA 3EF3A 3ZHVA 4N3CA 5I8ZA 3B60A 4AMYA 3LQKA 1K88A 4EEXA 1JQLB 5HCUA 1ZRHA 2G36A 3ASUA 3B51X 3LE8A 3Q7IA 3S5JA 2Z2KA 4BQNA 3QKUA 4F12A 5JD6A 4ZO8A 3MJRA 4Y2YA 2FN8A 5IKOA 3ANNA 2XMBA 4UPEA 2FSIA 2ZT8A 4L2IB 4DJEC 1D6SA 1DCKA 3NEAA 4KEAA 1NWCA 4DAEA 3RVKA 4CF5A 4ARUA 1GAQA 1YR1A 4O1IA 1WVGA 5CU7A 3NPMA 1OFVA 5AK0A 1S0UA 5HG0A 5JWOA 1RQLA 1IWBB 2G80A 3EGDB 1I13A 5KOYA 1VCMA 4IL5A 4X64B 2AWNA 3RAGA 3DCIA 5BSKA 5CLFA 1SU8A 1JILA 2P78A 3KQWA 4H1TA 3WV5A 3F3MA 1PE0A 1R6UA 1KEEB 3TR5A 4LYDA 4MR8B 4N1AA 3N0WA 4BO6A 5HF9A 4C0QC 1X9GA 1CY2A 3OAAA 1P1CA 3JYOA 4ZYLA 3H04A 4MUKA 4LJSA 1Z5GA 5DEIA 5FOXA 3ZWYA 4ECEA 3T3HA 1GCIA 3W8RA 1YMVA 3V8NA 5F9MA 4D8WA 1CJBA 2MTBA 3FBWA 1Z63A 2CLFB 4AJ9A 4B2IA 4BEVA 4I36A 2ZQYA 2XJ4A 4B85A 4NZNA 1C0IA 2PTGA 1ZAKA 3R3YA 1Z2NX 3VR5H 1RPTA 4B6EA 3IAS1 5BO5A 3VHXA 4RJTA 3E3OA 2VQSA 2VNJA 1JLHA 4FSDA 4I3HA 3BWYA 3URKA 2YWJA 4EG1A 1EDOA 1KO5A 1FRZA 1Z75A 3AV0B 1SH7A 3UUGA 3U9LA 2XJ9A 2ZXUA 1TCUA 4QDZA 3N58A 2VDQB 1EX6A 3PHCA 2G67A 3A31A 5F33A 4PINA 3SMVA 4I55A 5FCDA 3QNMA 1ISPA 2HJVA 1QGZA 4AG3A 4R8SA 1G8MA 4OM7A 2V0GA 4Q9LA 3PF8A 3FOCA 1WXEA 4LVUA 4I1PA 2ANBA 3UENA 3N74A 4CIXA 1MZPA 1SC1A 1T6NA 4YRRA 1S3GA 4C3VA 1VI5A 3KT3A 5KNDH 2J87A 2FRXA 2R7MA 1V9CA 4S1OA 1TD1A 2AUTA 3IP5A 4LNHA 1N8TA 3ADCA 4TUYA 1JJAA 4MQEA 1UBOS 1N3YA 2PWBA 4QE3A 5JLJA 4XDHA 3PUZA 4KFCA 4LF9B 3TIFA 2IP2A 4WFQA 1QTRA 2G5GX 1VIYA 2AC2A 3L1KA 2YOGA 3DBIA 3G6WA 3S27A 3UAYA 3HXMA 3EUAA 4HLUA 1EE1A 2PKEA 2X76A 5AI8A 5GAJA 5AUNB 4UD2A 1RHKA 4K0RA 4Q03A 4U5QA 2P9ZA 5FPKA 4P4SA 3KZKA 1M0SA 4IDOA 1DWOA 3AY7A 3GEGA 3RK0A 5FWYA 4GF5A 5H82A 1Z74A 3GUYA 3EVAA 1DJNA 3OM9A 4RPGA 1L4BA 2MR6A 1N0UA 4HUQB 5HTKA 1RXIA 1FVOA 2JK0A 3DXXA 4R8RA 2V96A 2W6PA 4HZGA 4BFUA 4UNQA 3WLAA 5IS2A 2PY6A 4YJ2A 3VR5D 3GCXA 1F0KA 3PL1A 4IUBS 3TLKA 4RK7A 4EAAA 4YI5A 1TTPB 3EWAA 5HTOA 1G6OA 1CERA 2PSSA 2YWCA 3EGVA 3AFHA 3L0CA 3NWEA 4ZDIA 2XY4A 3X1ZA 3T94A 4B3TB 4JI6B 1KFBB 3I8SA 3ZDZB 2PRKA 1CUXA 2XNJA 1DL5A 1IPEA 1JPVA 2J08A 3G2HA 4YP6A 1WXFA 2VTBA 4OXXA 4NQZA 2ACEA 2HF9A 5D6OA 3RTAA 3U31A 3VPDA 4XCXA 4LDAA 1GYRA 4EJSC 2WFAA 4LSWA 3STTA 1LK7A 3QBEA 4EB3A 3RR2A 1EINA 1VMDA 3L8EA 2GI4A 3TR0A 4EPTA 2E48A 3LYHA 4H59A 3UJPA 5KNDD 4NV3A 4O2BA 5E6RA 1SJ9A 3PC2A 3HYSA 4LF5B 5CFRA 3S3TA 3R0JA 4M55A 3R7NA 4C1NA 2DHCA 2OOKA 3B12A 1WMBA 3GD7A 4CG0A 3JR3A 2X5JO 4KDCA 5C1BA 3NEJA 4L22A 4RFVA 3V3KA 1JQJC 3CEHA 4L76A 1MV5A 4IXMA 4QSMA 4XLZA 3AVWA 2H1RA 4HWRA 1JFVA 2EVWX 3HKEB 2G07A 3E5RA 4MA4A 2H2WA 3VNQA 3KB1A 4UVDA 2FCAA 1I6LA 3N8DA 3SZLA 4Y6SA 4B43A 4ZYWA 3ZJVA 1OI4A 4F3NA 2D1QA 3ET5A 4XX1A 3ND7A 4MRRA 4EO9A 2PGNA 2CWWA 5FA5A 8LDHA 2BY4A 2OP1A 3PSHA 4MUBA 5DT2A 3CTMA 2ZI6A 3BHIA 4KQJA 4AJHA 1E0AA 3BQMB 4CWAA 5ER9A 5ETJA 4FVTA 1QO9A 3CH4B 3F6CA 3UVEA 1LKZA 4RE5A 4BX2A 2ZJ8A 4OHFA 4S3MA 3ML1A 2PYIA 4DNFA 3GP8A 4HSEA 3D8SA 2QJFA 3QHPA 5BW6B 4L5JA 3TTXA 3QLUA 2YWDA 1L5OA 4K9DA 5F1PA 1N3BA 3O8QA 4EUFA 1TYCA 4K6KA 3OQOA 1C9KA 1UODA 1COZA 4HH1A 4DNPA 3FZGA 3ZN2A 2CEAA 1G8KA 3KL4A 3PCXA 4NYJR 3DLHA 4JS0A 1VDMA 3RADC 3GPLA 5A6SB 5BV7A 4ZO4A 2ID9A 2W22A 1VPLA 3OOYA 2Q0XA 4HAZA 1WE2A 4DY4A 3BT7A 4U5XA 3DEFA 4R81A 1Z8DA 2FF5A 3K94A 2G28A 2M32A 3D59A 4LZJA 1J2EA 2FSVC 5HYVA 5HF6A 5DWVA 1LQUA 3SD7A 3BL8A 1KP9A 4OREX 1ONBA 1VRCA 4RGBA 1FDTA 2WTXA 3UICA 3W90A 3UJCA 1XZIA 2P3QA 4KVGA 1PX2A 3V2HA 2V97A 4GZLA 4I5DA 5EGNA 1MOQA 3E9RA 4PLGA 4WXMA 4MICA 4X90A 1RC8A 4QOFA 1LI5A 5C51B 5F4ZA 4MKHA 1QH9A 4ALNA 2G4CA 2WT4A 3Q40A 5CLLA 4C4RA 4JUCA 1GQFA 1ZR4A 1ZI9A 3KXIA 4PSAA 1PL7A 4MYCA 3PICA 5CK5A 4GUAA 1P0FA 2YMPA 3WJAA 1NVDA 1DFHA 3SHFA 4QM6A 2CL0X 3QVXA 3W5JA 3C7CB 1RHJA 3IIJA 2V45A 5LZ8A 4PC3A 2YOFA 2AL7A 3CS3A 4W63A 4OH1A 3SNKA 4RTRA 1J21A 2GF9A 4RIIA 9ABPA 5SYNA 3FCOA 3OZGA 3SZMA 4J43A 3OQ6A 3VYWA 1QDUA 1Z0DA 3AL2A 1FDWA 4BJ1A 3CMCO 2EZUA 4HPJB 2VHWA 1GTL1 3BQ9A 4FEYA 4QLOA 2YJ5A 1XYGA 3MTGA 3D6HA 2HM7A 1OYOA 3BK1A 1L7QA 4TQAA 1SHZA 3DE5X 2R68A 5KNLA 4XR4A 1F14A 5CLIA 3TB4A 4LS3A 4X60A 4B4DA 2ODEA 2FXIA 2WSSA 1NFFA 1F17A 4QQKA 1XCPA 3VSAA 1BH2A 1UEIA 4J4HA 1DBPA 3O9MA 3P0HA 4ZC8A 3V8PA 3STVA 3RGGA 2Z3ZA 4NEGA 1E3TA 2B7CA 3HCFA 2J9RA 2ZIFA 1LDNA 5EWLA 3RAJA 5ARCA 4JBWA 2J07A 1S8NA 3UJBA 2QAJA 4Q3NA 4FQ5A 1RXYA 1Y82A 3LQRA 3SSMA 2QQFA 3IAUA 4OHXA 1NU6A 1Q3HA 5SYMA 3N2EA 4X6LA 2ZYRA 2O8CA 1B3BA 1J70A 4AKHA 5HUQA 2DM6A 4LCJA 1E3EA 3NHUA 2QM0A 4YCDA 3U2QA 1BRMA 1LB1B 3G8BA 4N4AA 3R6DA 4XB2A 1ESMA 1DO8A 3AP1A 1JRLA 1YB6A 3G9XA 4W5JA 2DWCA 4M53A 1RKQA 3P2JA 4HCJA 4IINA 4NNOA 2Q5CA 3ZZMA 2HSEA 1DBSA 2VJLA 3RIMA 4B0PA 5LYJB 2VJCA 3ZS9A 1PR6A 2KI5A 3ACDA 5IJ0B 4YMIA 4D80A 5A02A 3E0XA 3ZKWB 1KETA 2DFKB 3QA3E 1AVTA 2CYCA 1FSPA 2NYAA 3KYIB 1C29B 2J3HA 3O4VA 4N03A 1T0UA 4PFJA 5C8YF 4O4LF 2JL1A 1DINA 5FUBA 4F38A 5LQCA 4W5OA 4I9HA 4BC0A 4P7FA 3GEDA 3B38A 2V7VA 1AS0A 3K2EA 5IMSA 1Q1NA 3DYVA 1LPMA 3BKWA 4Q6BA 3HABA 4UNRA 2EF0A 4ZGBA 4GXQA 1EFPB 2LRHA 3CV3A 3LT4A 2J48A 3KG2A 5C3UA 5D3ZA 4QECA 5A3VA 1GKIA 2HZ7A 4MEAA 3CF0A 1Y8AA 1T9AA 3UPUA 2RC6A 3DL7A 2ALJA 3L1IA 3D0OA 4UARA 5CDTA 3H7IA 1BCSA 2RHTA 2W93A 2FZEA 3LNCA 1YRHA 1PYOA 1SBIA 3ORQA 1BKSB 4ND7A 1KU0A 3VPAA 2EJBA 4X71A 1L4UA 2IZ1A 4ZK6A 5HJEA 2UYHA 4H31A 4D56A 3PHIA 3OZSA 1EUCA 2XWQA 5BW5A 4RTPA 1TCAA 4TMTA 5A4MS 4DLKA 4FYJA 5L7YA 4GKKB 1THGA 3TKAA 3LCCA 4HBZA 3GWGA 4RGVA 3SIWA 8ABPA 1Y5NA 5EZYA 2PPVA 3GOHA 4XFJA 1IEVA 4RIEA 4D8XA 4Q93A 4BDTA 2F6RA 4M8NE 1OROA 4E2ZA 2C1ZA 4IVRA 1BXKA 4NC9A 1FVFA 4W8HA 2XLCA 3TLCA 2GZAA 2BTEA 2WLTA 5JZ9A 2B1JA 1VPEA 5LZ2A 1U7OA 4L9AA 5KQSA 1TJ3A 1H2BA 2GK4A 2WJYA 1R6TA 1WHTA 2RGUA 1JNYA 1KL7A 4C04A 2PT7A 5FBRB 2AMLA 2X0IA 3BRSA 4NYMR 5H9WA 3M1YA 5IAGA 3OE4A 3F7TA 3HGQA 4YJHA 2MSLA 4QJIA 3ASZA 2BEUB 3ROMA 3FFTA 4OBWA 2KQUA 1E5QA 1OLUB 4Q9HA 2Y4OA 1A4UA 3BCSA 4WSOA 4TS4A 1DAOA 1RT9A 2C61A 3L07A 1EWQA 3VZCA 2AK3A 5C8XA 2F2TA 3KP1A 3O8NA 4CMEC 2I2BA 1NJGA 5JV5A 5E1DA 1ST2A 1T3GA 1KI8A 3OTHA 5ALGA 3GH1A 3LLUA 4UEKA 1HTWA 3O8OB 2JGNA 3VR4A 3HKCA 4FFBB 2HPAA 5F2NA 2C78A 2QD5A 4JP8A 4G0ZA 1L5GB 1AK9A 3OU7A 1NNI1 1OXKB 3WYGA 4DJTA 1QK3A 3PTZA 3AB3A 1UKVY 1ABEA 1H0RA 2G83A 2FTKE 3MOGA 3DE3X 4R2MA 4REQB 5TJ9A 4JP3A 2VWPA 2ZSFA 1PR9A 3UHFA 1DLJA 5FULA 4UHCA 4KN8A 421PA 5DH9A 5DV9A 3TI7A 1A9ZA 4AUNA 3A1TA 3BX1A 2WSMA 4Y1FA 4DZRA 1Q7GA 2HW8A 4NV1A 2YY7A 1JFTA 2RCNA 4Z6KA 3O95A 2EP5A 4WN3A 2RGGA 3ND6A 1SVWA 3CZ4A 1XVUA 3W7AA 2DWQA 1LVHA 2IU6A 1CRQA 1N2CA 2JANA 1R6AA 4M22A 1RYNA 3FCYA 3OJOA 4E15A 1ZHOA 3SYTA 5TXGA 3UWDA 4U39A 2O1SA 4E14A 4XJTA 3MSCA 2SCUA 1KYTA 4WKBA 4KTTE 1BYUA 4DQ0A 4D82A 4DB2A 4AW9A 5E0OA 4Z4EA 3DNFA 2G1UA 3L8FA 3OIYA 3ED1A 3RG2A 5BP7A 3PCTA 1G6Q1 3CHYA 3HCPA 4BQRA 3RUHA 5JS8A 4EVRA 4ZQGA 3PZBA 2ZLBA 4A15A 2I9KA 2Q2WA 3CX3A 1QTIA 1A9RA 3ADKA 4KAXA 1X0VA 4RF4A 3WL5A 3ZQJA 1WMAA 2DQSA 2IYAA 3HB5X 3VISA 1DKQA 1SELA 3FIUA 5MN5A 1CP3A 4H7FA 1U98A 1OI3A 1XVTA 2QI9C 4GGPA 3N59A 4WK6A 4OQQA 2HSDA 4ZVSA 2GAIA 2GZHA 2VBFA 3O9VA 3RVLA 4U6QA 2WBLC 2XNKA 3M5PA 3HO1A 2J59A 5JYBA 1HZZA 2R79A 3GNSA 4FHFA 1XZPA 2OT3B 3SJBA 1SB8A 2BGRA 3JWEA 4JC5A 4R1UA 4D0LB 521PA 1GV1A 1M10A 1RCUA 5BVHB 6NULA 2Q1XA 1P33A 1BQ4A 3M6IA 4FNGA 1SEVA 4IDGA 1RPNA 1R16A 3P9RA 4QUAA 3TN7A 4F2PA 5FBVB 3OJCA 3NYIA 4KU4A 4IJVA 4NDNE 4OX9B 3VR1A 4Z2YA 3UOWA 3TW8A 4IUYA 3CVXA 3EWNA 4QPCA 2TMKA 5JBNA 3BL6A 3REFA 1B1AA 4N0PA 3U40A 3ADBA 1JXOA 4BUJA 1SZDA 2JBAB 1ECFA 1LK0A 3GR6A 3IMCA 5E6UA 4IM7A 3GQBA 4O59O 1NVAA 4O2AA 1D2GA 4GOXA 5K2MA 5DM60 2QLTA 1WBDA 4YX9A 1AURA 1PWZA 1M6EX 4HDMB 2Z8XA 1F4LA 3BFPA 2FN7A 3ESBA 1PG5A 5JECA 3PA8A 2O59A 3PXEA 2RH8A 5DCYA 3PIIA 2BGMA 5JD4A 2JLYA 3CUWA 5EP3A 3VKFA 4UTNA 4Z3DA 1BGVA 4MI9A 2B36A 5DISB 4JL6A 1X1AA 4I2NA 1T5TA 4CV0A 4PSKA 2OO5A 4EW3A 3BGOS 4GVLA 5B3JC 2JA1A 1FL9A 5FX2A 4DBLC 4HNRA 2BMWA 3QF7A 1N9KA 4BFZA 1YHNA 3BULA 4TV9B 2HF7A 4O4IB 5AQEA 1YRQA 4A82A 4XGRA 3ZWQA 5AKKA 2VBGA 3FKSD 1OGJA 2EEZA 3L4KA 4GPD1 4ZDJA 2IF2A 1E9CA 1OILA 4WDQA 2A4KA 2A5GA 3KYCA 5ENVA 2XKAA 2F1JA 1AQUA 1YL6A 1TECE 2Q2NA 2RC5A 4G8JA 3VJKA 2ZP1A 1VE6A 1T5IA 1EWVA 2DWUA 2I7XA 3SSAA 4Q37A 1Q6YA 1Y9DA 4QATA 4RVCA 3U4DA 4CQJA 2VLIA 2HMYB 3G9UA 5CDYA 1QORA 3KPJA 1AH2A 3UJ8A 3ESCA 4L3WA 3OOJA 1EM8A 4IDPA 4OP2A 5ENDA 3RRBA 2QTAA 3HXKA 1ZM3A 1RVV1 2CXXA 3DOEA 4FZJA 3K4HA 5BW8A 5CA0F 3O8DA 1SNYA 2DFNA 1QHNA 4W5RA 3OPYA 4QICA 1Z7WA 4E22A 1Q1ZA 1Z6YA 2ADFA 1VA5A 1O6BA 4IF4A 4K1XA 2EBFX 2YNMC 4R8KA 2XMPA 1SKBA 1TM5E 1XU7A 1IATA 4MLZA 1OV6A 1D07A 4O5OA 1NVEA 1Q12A 2EX4A 3QITA 3H5TA 4G5OA 1JH8A 2HQRA 3D8RA 1F0NA 3KE9A 4IG9A 2CXUA 2IKQA 1KQNA 2NXEA 3U3KA 3WBBA 4DYDA 5K6TA 4DCUA 4DEYA 2IEAA 3E3AA 3DHVA 3FR7A 3B52X 4MEJA 4NKRA 1KY3A 1LRJA 1NMSA 3I8OA 3RWOA 4DT1A 3HN7A 4O8CA 1TADA 1ARZA 1PVDA 4HDSB 4HMOA 1EPUA 4B7CA 1I3MA 5C8ZA 2O8FA 2YV1A 2Q5FA 5GONF 3ETCA 4HDKB 4WY8A 4JUAA 1N7JA 4NAUA 1IAQA 2IU3A 1CR2A 2OHGA 1YZTA 2QZPA 2VF2A 1WVIA 4TRMA 1SOMA 1HSZA 2I33A 1EK0A 3P2KA 2FPPA 4YPVA 1PL6A 4Q4JA 4WBSA 1MNQA 5FPTA 2CT8A 1V8ZA 1JA1A 1B00A 3KD2A 2JLQA 3K31A 4N7BA 5ELLA 5LOVB 3G3EA 1GPYA 1MXFA 1SVUA 4F2GA 3LY9A 2ZDHA 2BF4A 5LR6A 2QOEA 2P2LA 2I3ZA 1NVMB 4FD3A 4IGAA 2JIZA 4WADA 5CITA 2X42A 5EJAA 2WSIA 5KVQA 4XVHA 2IV3A 4RXTA 2F1KA 1P0QA 3MFQA 4J75A 2DRIA 2X14A 4NXMB 1G4UR 1U0TA 4L72A 1IN8A 4YWJA 1QFSA 4UTVA 2V3VA 3LI2A 3ZE9A 2BP7A 1LXCA 1WW3A 2FWMX 3JYNA 1PSDA 5BNTA 4BNKA 2F3UA 2YWEA 1P19A 2RH9B 4KQEA 1XNJA 1VP9A 2B61A 3W79A 3KZ1E 1A9QA 3UUFA 3WKEA 4KQ1A 3S8EA 2AOTB 1JMVA 2Q5LA 2IP4A 1PSZA 2H8KA 2FAXA 4FIZA 3N05A 4N8DA 2FSFA 1T2AA 2IGBA 2ABWA 1DXHA 3JZIA 4P0QB 1SCQA 5KVAA 1HOXA 4YRQA 3PHBE 5AFSA 1Z5NA 3F9CA 3QKTA 4IMIB 4UJ3A 5ALOA 5I3ZA 1MW9X 2J3IA 1C3OA 2E37A 2NYVA 5A2QA 5K2OA 3FFXA 1A9XB 1ADFA 4PS1A 6Q21A 2JGFA 3BB4A 4MI6A 3ONNA 2ZPTX 3AINA 3F2VA 4QT0A 2CVPA 4OU5A 3P4UA 4NBTA 4NYJQ 5DHSA 4G25A 2CHGA 2NU7A 1KDRA 4XQ9A 5TB5A 4DMLA 5CB8A 1K5GA 4K3UA 2XVYA 4ED9A 3EPLA 2ZRGA 4IAOA 3S70A 1RYFA 2HFKA 4LY9A 3ZWNA 4NS4A 1M74A 4MQLA 1XMVA 1T5HX 3HA5A 2HNKA 3PQCA 4ZAWA 3SKXA 4B8YA 4CF3A 5KTNA 1AUXA 1JAYA 1NYLA 2I54A 1LH0A 4TS9A 1TF2A 3OPNA 1Z73A 5DBFA 4DR6B 4WCVA 3OLCX 3PF9A 5FPPA 4C4PA 1QRSA 4BNWA 3U3DA 1QK5A 2PVSA 2XVZA 1BX1A 3R0ZA 4FNAA 4KXUA 2V7QD 5JEDA 3GRFA 1D03A 4WTOA 5K3CA 4EL5A 1DXOA 4KMOA 5EZ5A 4EELA 4TT8A 4EGSA 3HL4A 2JI4A 3JQFC 3RYFB 5HJ7A 2NZVG 2CVOA 2JFGA 1QHFA 4AQ7A 1CS4C 5LJLA 5FUMA 2MINB 1R4MA 2ECFA 1R0SA 1G4HA 2LDBA 4IBOA 3WJ1A 4OJYA 1TJYA 4J4TA 5DLDA 1RQRA 3HPRA 3AEXA 4OVKA 4B2YA 5CB4F 4KQXA 4XJSA 1FBTA 4G1CA 4MW9A 3VPXA 2WB2A 3GN2A 3RFVA 1G3RA 4I5GA 1LTHR 3SBDA 4DARA 1FDIA 1ZMXA 4WZAE 5LPNA 5WRFA 4CCAA 3IHKA 5AJTA 1JIVA 3D7RA 5AVTA 4EFDA 2Z8YM 3L84A 1Z12A 2VHTA 4LHXA 5ESRA 1ETHA 5AM1A 4GOLD 9MHTA 4J94A 4LBWA 1VBKA 2QWXA 4O4JB 1DKPA 5DDIP 3DV0A 3O2JA 4KMSA 3QXGA 5FYQA 1C9NA 3RIEA 2KSQA 4ALJA 2C3YA 4RABA 3N8KA 4RKWA 4BP3A 5T4EA 1KR5A 3O47A 3G0OA 2AW3A 2QMOA 1PDVA 5ALFA 2OK8A 1K63A 2Y0DA 3QM1A 1AF7A 3T95A 1CQWA 1QB8A 1L7VC 3EVGA 3A9SA 2OHIA 1UBGA 1FRVA 2CNWD 4M76B 1T2NA 3H42B 4XSGA 4GKJB 1IK6A 4G9BA 2D1TA 3HFGA 3ZGVA 5C1PA 2B8NA 2XCSB 4KIJA 4K26A 2JZCA 4RCZA 3RC7A 2K87A 2OORA 2Q6OA 5M7EA 1JYFA 2O2DA 5EIWA 2FKNA 1A76A 4S0XA 5FTLA 3CNEA 4D9EA 1TOAA 2GF0A 1YKSA 2OECA 3F6SA 3JQPA 3Q5DA 2G72A 1NQXA 1O9HA 2G9VA 4MUNA 3HXTA 2Y76A 2VPWA 3P9QA 3DJYA 1NBOA 1HI9A 4IIJF 4LXHA 5AKZA 2NMVA 1I80A 1YCDA 2FWNA 2JIOA 4NL4H 4V0MA 2M9MA 2EZTA 2C96A 1SUDA 4EMBA 2FY8A 3GH3A 4RVOA 4DR2B 1TVMA 2Y1GA 4JGBA 3CW2A 3MWDA 4B6FA 1FX1A 3TI9A 4CYMA 3BIOA 5DYYA 3QVGB 4DA9A 4WESB 4BEWA 1JBEA 1MPTA 2CKMA 2O6LA 2P5UA 3PXDA 2XSZD 4HXEB 1SPBS 1EVJA 2AFIB 4X41A 2X6RA 1KQGA 5HZGA 3X2EA 4HAVA 5B12A 1R1DA 3A9CA 1CPYA 1XZEA 1XCMA 1SXJD 1TGYA 4NU0A 4F04A 5KYYB 5CIYA 2IBSA 1PV1A 4RDCA 2DUUA 2A0XA 1A2BA 3DDSA 2XOEA 2WA1A 3RS8A 2R96A 4HKTA 1M8JA 1OLSB 1U1CA 2EIHA 1Z17A 4ZODA 3RVRA 4TT3A 1CIPA 3U7FB 1A1VA 3DZJA 2BSXA 1B26A 3BSWA 4LMBA 2R65A 4ZJPA 2B0JA 2G0NA 1MGOA 3WKAA 3FHLA 4BX9A 4DGSA 3H1EA 4EEKA 1VPWA 1UFKA 2NAFA 3SICE 1FVXA 2YYYA 3NTUA 4HYTA 1D4FA 2NYRA 2HBRA 3FPCA 4J16C 2YTZA 2PHZA 1BFDA 2DUNA 2X5KO 3FMGA 5F3DA 4XM0A 1JHQA 4LCBA 3RE1A 4DJDC 3ABRB 2C0QA 1E2EA 2DTXA 2P4UA 4MA0A 3OF3A 5AK5A 1NBIA 5TNXA 3IUYA 1M1XB 1RLOA 4JI8B 2R00C 4KR0A 7MHTA 2BR3A 2WT9A 2CDAA 2UUBB 1E2KA 1XK6A 3NWBA 2Q46A 3B48A 1H23A 3F4BA 3L0ZA 3STWA 4BKMA 3CGGA 5GOTA 1UDRA 1YDHA 4D3YA 1YU9A 2P5TB 5IJWA 5KYUA 4BUCA 3HC7A 1J2UA 2HN9A 3AEQB 2B3DA 5C9ZA 4Z8YA 4PG7A 2IZ6A 5FAXA 3NW9A 3LFUA 1NW4A 3DLBA 1GNPA 4HWSA 4TRRA 1H42A 4NYMQ 3DMTC 3QKWA 5ADUS 4IIHA 1PS0A 3MZ0A 5CW1A 1V7ZA 1I0ZA 4WOPA 1FFAA 4P38A 3SZ3A 4JEUA 4UXHA 4X8LA 5GQSA 4JP5A 3FUWA 2UVPB 3DZIA 5CLGA 4BO8A 3Q12A 2PYZA 1ZUIA 1IULA 1V2HE 4PQYA 2DECA 4G9EA 3TTYA 2A4MA 4ITUA 5KSPA 3HA3A 4UBMA 2CXSA 4DR1B 2RHDA 4C03A 3LL7A 4BWYA 5EHXA 2GCOB 5AW5A 5HW0A 3CEMA 2OC9A 1VB5A 3Q7PA 4B47A 2JFUA 1D2AA 1PK7A 3JVIA 1KVQA 1H8HA 3P9CA 2IQIA 4GW3A 3ZW8A 2DBQA 1M6VA 1UH5A 2Z1MA 7ABPA 1P9WA 3QELA 4CMHA 4NAHA 3H1FA 1XHEA 4L73A 1FLVA 2M6LA 1ZAYA 1NDHA 3EUWA 1ZD9A 3CE9A 1R8QA 3CRNA 2ZAIA 1QSGA 5EKDA 2OV2A 3H9CA 1TL7C 2CK3D 1NR7A 4JT9A 3D6VA 4E5YA 2O57A 4ZYVA 1LW7A 2M6RA 1LX6A 1SBQA 3FUUA 1D7OA 4QYXA 3LW8A 4JUIA 4ONEA 5AIBA 7ADHA 1SFRA 4R1TA 4YRFA 4C4OA 2V6MA 1DRVA 1XJ5A 2B4TO 5BN4A 5IXSA 1NE7A 2CFCA 3A6LA 4GLJA 1KE2A 2XE4A 3A6GA 3VH1A 4BNDA 4EK9A 3K30A 5JAQA 3WIOA 5AI0A 2JFVA 1KMHA 4JJFA 5KPJA 4PY2A 4LJAA 3GGJA 1U5BA 3C8MA 3VU8A 3DAPA 3U3ZA 3RC9A 1YVPA 3IT2A 1QJ4A 1FTYA 3HU1A 1AHHA 1EZ1A 3LCMA 3EA0A 3FWHA 4OFBA 4YHBA 3G23A 4PICA 4Q66C 1FLDA 3TVYA 4BLOA 4RHYA 5EJ9A 2AKYA 4TSKA 3WYAA 3IP3A 4G09A 1DDOA 1XMOB 221PA 1V6SA 4Y1GA 5BVGA 3ZGYA 1ZIXA 3GJSA 1EA5A 3UJ3X 8AT1A 2K2QB 3OZBA 3IAFA 3FI0A 3GLFA 2VRCA 2AFHE 4C3UA 3ZOKA 3OQJA 3OQBA 2CLCX 3E03A 3KYDA 3LYAA 4AP5A 4AZTA 4HYYA 3AVXA 1EGHA 4M87A 4OQ4A 1CJCA 1AV7A 2GCEA 4PG8A 3PJRA 3L8GA 4ZMSA 3FUCA 2WV9A 4GVXA 4YFVA 2L82A 3UWMA 3NORA 4XPIA 1FFHA 1ZKMA 2GXUA 1MRSA 5CR9A 4AKEA 4MUMA 2HMSA 1E9FA 1JHAA 1L0BA 1E18A 1QH8A 2VT3A 3AQIA 3D2AA 3I12A 3UC9A 1FSZA 2QRHA 5BURA 2OGZA 4G41A 4N01A 4C78A 4DJFC 1EM6A 2XGSA 1ZKDA 3NUGA 4ZEVA 1ISJA 2J0UA 4JZKA 3ECAA 4OXQA 4YACA 1I7NA 2WWYA 5T4HA 2OD2A 2X2PA 4AVYA 4YRIA 3SF0A 4W6QA 2C9OA 2R6FA 1JTFA 3D1VA 1H85A 3QEOA 4HQ0A 1JKJA 4BNMA 1FNMA 4HVCA 1GTSA 2FEKA 2XDAA 4NULA 3W34A 2W0SA 2MSDB 1QGDA 2H1VA 4WH0A 4QGSA 4B7UA 4HWKA 1M72A 1NSFA 3LWNA 3LX4A 1U0LA 4ACAA 4UM9D 1L4YA 4KQMA 2GPSA 1U0JA 1OX6A 3WLLA 4Q1EA 3EW7A 4G0OA 2J3MA 2MSCB 4U7HA 4DG8A 2C7GA 2V54A 2ZSIA 3PGJA 4H27A 1M1UA 3T9AA 3H5NA 4D45A 4Z7JA 1O54A 1GDTA 4ERXA 5ALRA 4YYEA 1JB9A 4PWYA 2R7AA 2H16A 1ZD8A 2V3WA 3HHEA 3O38A 1KJYA 3SQWA 3I76A 2GSWA 3ACBA 2G63A 1IXYA 2ZRMA 3HYNA 2HY7A 4P34A 4ACBA 4U8GA 3N6VA 1DU4A 4B80A 3FPKA 4CM4B 4ESEA 1WU7A 4I99A 4CW7A 3H0EA 1IN1A 1EESA 3EHEA 5KKAA 1W59A 3DKIA 5AH0A 3TVDA 4R6WA 3W3AD 2H51A 1C1HA 3GEHA 1C5KA 2XEDA 2OQVA 1DNPA 1Y5RA 3B3FA 4KWTA 4PPQA 1Y4SA 2JGLA 3C3AA 2PMKA 3L7MA 1CK4A 4UU1A 3SY8A 2QV0A 3FVQA 1ESZA 2C9CA 1K7FB 3GD5A 3CUKA 3KELA 4TVBA 5EE1A 1QAMA 4P9NA 1AO0A 4HNAB 1SKQA 3PFBA 4Q16A 3RFCA 3EPPA 3ZXYA 3DWFA 4DVJA 2GK7A 4XRRA 1HDOA 1E3JA 5DIZA 3FETA 4L4UA 2IYLD 2O8DB 3WYNA 1W96A 2O8EA 4YRNA 3RBXA 2PL9A 1K98A 1XZJA 1ZN7A 1MJFA 3F74A 4QEZA 3V1TC 1Q1BA 1I4WA 3TQRA 5IJ9A 1PSWA 1P0MA 1OFHA 4IEFB 1T2VA 2B30A 2DFTA 2E85A 1Y6QA 4JLDA 3KTAB 4DOMA 1Y8QA 4XPZA 3OH8A 3AR3A 5EIHA 1NGSA 2JLWA 2Z2JA 4FPXA 1DS6A 4L1KA 4OQPA 5IG2A 1DO2A 2DHEA 2IUEA 1EJ2A 5ALTA 1XEWY 1DIGA 3C3EA 4US2R 1U4SA 1U7PA 3ABIA 4KACA 3OOEA 4AYWA 3C39A 1X7WB 5JNRA 2OBYA 4XIFA 3VI3B 4C5CA 2TYSB 3X1MA 3K0SA 4AFNA 5AT1A 2JGIA 4CLHA 1NI3A 5BQ3A 1GYQA 1NJ8A 2NTVA 3IMKA 4PAQA 3LBIA 1ZVMA 5ANRB 3TDNA 4D8UA 1U8FO 4G84A 2AD5A 4CMCA 2QGFA 4AF8A 3ZEIA 5FR1A 4DUYB 4ASUA 4R2IA 1XTZA 5HKKA 4UU0A 2EKDA 4NECA 3DOOA 1OMOA 5IT9A 5C18A 3MUEA 5IU6A 4F06A 1EX7A 2F67A 2OG2A 1MEJA 1UMBB 2OESA 3P19A 2PFKA 4TWRA 1JSCA 4P5EA 3WB0A 1PGNA 3DTNA 1K3UB 4UNPA 2OGWA 4LK3A 2Q1UA 4XCVA 3VYRB 4JN6B 2EARA 4B45A 5ICGA 4I1OA 9GPBA 4FDUA 4W9NC 5BRAA 3KDPA 3V1NA 4F96A 8ADHA 3KXDA 1LPAB 4L3VA 5AVVA 4WCFC 5HQ3A 3K73O 1TE2A 3NIGB 1S1MA 2OPBA 1OT5A 3RRMA 5KNCA 1KO4A 5ALNA 2R62A 2P77A 3SJCA 1ZVVA 3D31A 3AR2A 1JG4A 4G5XA 4XWGA 3HACA 4LZZA 1NW5A 1DOZA 1FMJA 4LDJA 4IIGA 3FWNA 4P31A 4JJEA 3PUYA 1XCLA 4BZZA 4C4TA 1PJRA 1CDDA 2R60A 2BBTA 5KI6A 4UMDA 2FE4A 1SBYA 3V2IA 1A9OA 1YQUA 3FA2A 4G0QA 1ICIA 3ZDRA 3HKBB 4MV5A 4QWWA 3RT1A 3ZBQA 3QVMA 3QFTA 4NMHA 5DI3B 4EW1A 2FUKA 5FL7A 1OB2A 3CLKA 4JGGA 1AN9A 4C06A 4CL0A 5JSUA 4BNTA 2HIMA 4QYSA 4CKZA 3F8WA 4GR5A 5BUSA 4M9XA 3NHKA 3O7MA 1Z38A 5JQGA 5JSZB 4P93A 4WJKB 2J5QA 3GEEA 3ELUA 5A1JA 2OHFA 1ITZA 1DFIA 4O3FA 3QI7A 3U7EB 5BSHA 3ENQA 1C9EA 3M6FA 2OPHA 5HXAA 1G0NA 2A5DA 5IKEA 3HB0A 5GIPE 2ZITA 2EJTA 3T3NA 3T0FA 2DJIA 5FOVA 1GGVA 1GGHA 3DTVB 3G2IA 1P6QA 3L4JA 4WLFA 2J0VA 4HK4A 1Q11A 1A8UA 2V7BA 1IN6A 2LIVA 1F0PA 5DTRA 1NNLA 1TYEB 2EGHA 4Z9FA 3ZU6A 1NXOA 1EDZA 1TAQA 3GMIA 3HZRA 3PPXA 5AP9A 1PD1A 2J6BA 3JSAA 5EXSA 2XTNA 3S2ZA 1JDNA 4FUTA 5HZMA 4ENUA 2QNRA 4U6SA 5ULLA 2FYTA 2J0EA 4LXIA 1BAPA 1CJTC 4A0SA 4E5KA 3EXIB 4ZI7B 3L40A 4NHEA 2W2KA 1GPMA 3FJYA 1TTQB 2ZOSA 5CNIA 3SQLA 3G7UA 5G1OA 3P9XA 5LLDA 3VTZA 2CGEA 3V7NA 1QLWA 1ZL0A 4TMXA 5DK4A 1N4AA 1QIIA 1Y8RA 1EH5A 1WNTA 3G0DA 3K9CA 3WQBA 3ZV3A 5IYZB 1BHQ1 3IOYA 1ICEA 2BFAA 2W42A 3LHFA 2TS1A 3SYKA 1XNRB 3B5JA 2Y1KA 2QYSA 4ENSA 3R44A 3V55A 1MIHA 4PF1A 4RHEA 2NO7A 3O1JC 2WMYA 3BJIC 2H54A 5ARDA 1PJ8A 2R6CA 1FXWA 4QX6A 3UOGA 1YUNA 2AG6A 2VO1A 4I2VA 1IK4A 3TQOA 2RI6A 4E07A 4NCAA 3AF3A 1JU9A 1WB5A 3T3OA 3C5WP 3DZHA 3IOCA 2VHVA 1G20E 1BG6A 4JX9A 2NVUB 3HB4X 3CH7A 4D79A 4X45A 2MYUA 5TRTA 2C00A 1ZEJA 3NJRA 3I1IA 4PLZA 4FCWA 3UKOA 4F3YA 2F43A 2ZEJA 4X8HA 4IOJA 2ILVA 4RELA 4QGGA 1WWKA 2REQB 1B2RA 3EGXA 1JR2A 1X80A 2AZDA 3FG9A 2FUNB 4PONA 1NVXQ 1Y9ZA 1BVUA 4RD6A 1MB4A 4M1SA 1WEHA 3A4LA 1P5RA 4F3TA 3WLIA 1NW3A 4EZEA 4R1NA 5AW4A 5AHOA 5G0TA 4HYEA 1Q50A 1WMEA 1MOSA 1U5CA 4TV8A 4X44A 2DOKA 5TMPA 3AU9A 1U2GC 2Q7DA 1KP3A 5I7HA 4MVXA 3WWZA 2I1VB 3ZHZA 2C4UA 4URYR 5LP6B 3N2KB 1EK2A 3HBNA 2NPFA 1Z5PA 3AIOA 1M9NA 3ESXA 3TSZA 3KWFA 3I73A 3GBVA 4A27A 3FWYA 4XARA 4P35A 4RANA 3TJMA 2YNMD 3U17A 4BNZA 1XXHA 4BU0A 4BMVA 1EFRD 5KTYA 2AJTA 3CRMA 4MO9A 2I3AA 4KLZA 5B58T 4HHEA 3ZWVA 5KHLB 3SC2B 3PNYA 1IBKB 4A10A 2HMWA 4D3DA 2VYVD 1XTKA 5H16A 1KWGA 2CZCA 2PPLA 1YWGO 4YMWA 5FLEX 1J56A 4C3ZA 1NDQA 5JXWA 1T5OA 1RM3A 5LMZA 1I24A 2UKDA 3F3YA 3NWPA 4YAKA 2RGXA 3IBSA 1N33B 2ZIXB 2YINC 1RMYA 1CKEA 4KPUB 4CKBB 1OY1A 1T5LA 2TMYA 3MTBA 4OOEA 4YAIA 1VG8A 2IYXA 3VYVA 1AUQA 1I9CA 1R0YA 1CUFA 1KK2A 4KR2A 4R1PA 1GRRA 2QJRA 3FZEA 4XIYA 2Z3VA 2OR3A 5J4HA 1LD3A 1YMQA 1RI3A 4Q9DA 1GPLA 4MUYA 3U19A 3P9PA 5CVTA 5JNUA 3ZD9A 2H2AA 3C87A 5L3SA 1QM5A 5GZ6A 5LYYA 3K1TA 5SY4A 3ZY5A 1HV8A 2MSWA 3NHLA 4FYIA 4IGEA 4EY5A 4KWCA 4QIHA 5DYGA 3O93A 3DD1A 1WPGA 4OGKA 1GSOA 1Y4DE 3G1TA 5J2UA 1J1IA 4H1UA 3S6JA 4OXYA 4QBTA 4MV4A 1M66A 2X58A 1CEEA 2W4QA 5DBEX 3Q98A 3IO5A 3G59A 4FCTA 4OLBA 2UXCB 1CE8B 1WL8A 3PVSA 2BJHA 4GSYA 4AN1A 3R0VA 3OCYA 1A7UA 4PAGA 4ZMRA 1ZS9A 4UHEA 5KJFA 2PUTA 1F8GA 2VR1A 4MRMB 2KW5A 2Y1OA 3BXHA 1DBQA 3HJCA 2P6PA 3CZAA 4HB2A 5AVKA 1BJTA 3D3WA 1TT5B 4BP1A 4Z1OA 2BHRA 1SXPA 2K7ZA 1GPH1 2CJXA 5F51A 3UB4A 1SQ6A 4GX2A 1KAQA 1Y9EA 2GYYA 2HIGA 4UAJA 2GOYA 4MUXA 4R31A 5JNWA 1TT7A 5FUYA 1SHUX 1NW7A 1PR1A 3IDZA 1NI4A 4CM8A 3ZY2A 1P1HA 3H65A 3MXOA 3STHA 3Q10A 3KPWA 5BNWA 4Q4HA 1WZCA 1XNHA 2CDBA 1NVWQ 2XQJA 2X0EA 2BFFA 4EKGA 4EI2A 2VQDA 1XFAA 3K5HA 3UAWA 3T7IA 1H2ZA 1L5HB 3CRRA 3OE5A 3RSLA 1KS9A 3IEUA 4FKZA 4PRZA 3WLRA 3C3DA 3KDSE 5K45A 3Q11A 2VJBA 4CKCA 1B16A 3OEED 2FR0A 3HA2A 3S2GA 4NMXB 5TF4A 1R9GA 4UHDA 4ZU3A 4EJFA 4M0FA 3T35A 5CXUA 1ISHA 2N42A 4JL5A 1RLUA 2A0UA 4RZ3A 1XTSA 3PFKA 5LJIA 1YIAA 3ANLA 4OXKA 2YJ3A 4WJLA 3P27A 2QN2A 1IM2A 2QM8A 2UAGA 3FDIA 1G5HA 1XMJA 4CLRB 3DP7A 1WBJB 1XHLA 3GJ6A 3AESA 5A7HA 4ZK2A 3U5ZB 1GKUB 5ADHA 2V03A 1RQ7A 3WLJA 3OLZA 4WI1A 1ABFA 2PBLA 3GGDA 1QKJA 3KLNA 1N2EA 3L7DA 3R7WA 1A97A 1PJSA 1TUBA 3WLPA 1L7MA 2JAUA 1V25A 3HXPA 1VRVA 1PR4A 3SE0A 4JYPA 1ODKA 5CH8A 3W78A 3ZI7A 1XRLA 3CH6A 2G4LA 2QLFA 1QHEA 4HQRA 1G2IA 5FDFA 1VJRA 1FX0A 3DONA 3GVPA 5JFTA 2RAVA 2JDIA 1R8YA 1E3WB 3BH0A 3L43A 2B69A 1KYYA 4YRCA 1WUKS 3TRDA 4C0BA 4EGCB 1VIAA 1QC5B 2X3YA 3AP2A 4IDAA 5THQA 4HTFA 1PEDA 4RF2A 4XVQA 4MW7A 4E5MA 2Q41A 3NBYC 3TOZA 3ACCA 4EHFA 1LGYA 5ECGC 1Z22A 2X9QA 1O7JA 1GQSA 1FNCA 1LDYA 1IUKA 1R8XA 1V43A 2B2NA 2GVNA 2JBWA 3LBAA 2PT6A 3GLHE 3PGLA 1DG1G 3E82A 1UR5A 3OEHD 4OHUA 5I8PA 4RH0A 5AKXA 4QLBA 3CUUA 3EHDA 4OJKA 4DPMA 2DPHA 1V35A 3IPXA 4FLEA 3PBKA 3FGOA 3VVMA 3DW1X 3I23A 2XYVA 2B92A 1XV5A 4Q24A 1GP2A 5AKYA 5T3YA 4O1MA 5L53A 5E3IA 1IL0A 1C3VA 4LOJA 5AM4A 5BMVF 1V5WA 2GBPA 3T5CA 3CIOA 2O8NA 4F6LA 1Z25A 2O14A 3NHMA 1I7LA 3SHVA 3ZD7A 1E2DA 3D8HA 4BMZA 1RYBA 4R2JA 2FUEA 2HHCA 2OZVA 1U2TA 2EF1A 2KBEA 2V7WA 2YZKA 3IUMA 3PIRA 1KK0A 1TIBA 2OA0A 2PL1A 4JC0A 4KN5A 2V8BA 3OURA 1USUA 1V48A 3RS5A 1A72A 1WXDA 3HWX1 3NOQA 2ZRFA 4LRYA 3SI7A 4IUCS 1K4MA 2YJ6A 3DL2A 4QGFA 2P27A 4Q1AA 4BKOA 1II8B 2YN2A 5E1BA 3T54A 1QG6A 4Q48A 5EJ5A 4NPCA 3MBKA 4PXSA 1U4NA 4OHZA 3WGJA 4AIIA 4EHKA 3FNGA 5C5DA 3DAYA 3AVYA 4PXYA 3QXHA 3SBOA 5HDBB 1ZJYA 3DVSX 4JUDX 3MJVA 1OYYA 4DRZA 3PQDA 4QUEA 1UUFA 1Q92A 2X4IA 4YRMA 3LP5A 2OBMA 2WD9A 1J8FA 1DHTA 1EEHA 1VBMA 3KR2A 4V1CB 1U0OC 4LRUA 1QE0A 2WKRA 2XD9A 4QDTA 2EKBA 3FDJA 5DM0A 5FQOA 2PRJA 1FYXA 1M8KA 3NOVA 2ZYWX 3IKJA 3ZU4A 4EZIA 2QZ9A 3D6TB 4B3JA 5K0CA 1EDDA 3A37A 1TFUA 3KYBA 3V8RA 2VAWA 1KI6A 5TT0A 4N76A 1PNOA 2G8NA 3T3PB 3B36A 4BAUA 3FNIA 3F5QA 4F21A 5J5VA 3MM4A 3TMAA 1L1QA 1UKEA 2A84A 1CY1A 1E2QA 3T5DA 1SB9A 1SVSA 3ZWDA 4AJKA 1HLFA 3LT0A 1Y42X 4OUDA 4CG1A 3JASB 3F5MA 4KXMA 2FFBA 3ROFA 1S3FA 1SN7A 2O3SA 1OWOA 2PQ2A 1UC5B 2WLSA 1LBIA 2GNPA 2NUBA 1RQNA 2EJCA 4P58A 2CC2A 2FRVA 2APJA 2GDZA 3COWA 2ZXEA 1QQBA 4DLUA 3O8BA 4FGJA 3PSAA 3ONEA 3WGIA 5ALIA 2RGNA 5EESA 2XIQA 3P7MA 2GHQA 4OIFA 2JS7A 3H9UA 2R2GA 3BRQA 4JA0A 5JY1A 3T4XA 1Y7PA 4GPIB 4X1OA 5BOSA 4ZANA 1L3IA 5FADA 4AU1A 3OIUA 5AUOB 1EXNA 2ZS9A 3ZVMA 4FBMA 3UJ7A 2QQEA 4HV4A 3OFND 3ENWA 5DTMA 1DQSA 3FMVA 1HE3A 4MS4B 2WIFA 4S1NA 5IAJA 5JNLA 4ZVRA 4K03A 1JVBA 2NYUA 2ZI4A 1ZGJA 4XD7A 2HHJA 4P3YA 3JYHA 1G17A 2ODAA 5ALZA 3AUTA 3R7FA 1WKBA 2ODNA 3DAHA 3X1KA 2X15A 4EY8A 2W6OA 2VHUA 2VXYA 5JXIA 4LGMA 2IYNA 2FP4B 1OXXK 2OILA 2QTBA 3EA5A 3FTDA 4IJ6A 4KYTA 5AKGA 4B4UA 1E5VA 2FI1A 2IOFA 4FFSA 3O75A 4KWIA 3FTNA 1M33A 3OIVA 4J3FA 2D3WA 1G8JA 3PCRB 4JUFA 3RYIB 4C7MA 4CEJA 1KSGA 2RFLA 3P32A 4MKIA 5CHYA 4YJ3B 5C2JB 2BT4A 3WL6A 2OCDA 3CZ5A 2UYQA 3E4CA 4P36A 1E7RA 3E84A 1FLAA 3FCEA 4I1UA 4KDEA 2CLIB 2HMVA 5M29A 3EGOA 2D2FA 1ZWLA 4CF4A 4WKGA 4FCVA 2G3YA 3BMNA 4GOJA 4TXLA 1WDLA 4BPBA 1ESNA 2BYTA 3CWQA 3MXTA 1N7GA 4IO1A 2ZUFA 4J76A 1V1MA 3FCSB 1N0WA 2QN6A 2VTDA 1HF3A 2QN1A 4HF7A 2UZAA 3UMVA 3WWPA 4YUYA 3KXPA 3RHZA 2WNSA 3WBJA 4EWLA 4EPWA 4YV1A 1E2UA 2FQWA 2HREA 2WJAA 1A5AB 3GRYA 4E33A 1O5OA 4X65B 2BEVB 4Q1VA 4QNRA 2HKIA 2V9PA 3GJRA 3TBFA 2CMKA 2ZKLA 2QD1A 2I7DA 2A5YB 3LYUA 3U13A 2QNIA 5DTQA 1XQ9A 2EFHB 3RF7A 5E2BA 1RZUA 3BH6A 4D6XA 2IYVA 1NY6A 5JRDS 1NN3A 3T5AA 2ZBDA 4CR7A 4PQEA 1TMOA 4CEHB 2IIBA 1R0CA 1KH1A 3IA7A 2FW8A 4M83A 4P5PA 3VVCA 3G88A 2CV0A 3GT4A 2X41A 1FJGB 1CDOA 2FFJA 3KHUA 4WKCA 1KQFA 1OAOA 2P8JA 1TJ4A 2DWPA 2WD7A 2QL6A 2XZDA 1S9HA 3M6VA 3BPSA 4PBRA 4QDOA 1I1NA 2VVTA 3UWKA 1TX4B 4BAGA 3V00A 1F6DA 3O6VA 3CR7A 4LVCA 3SFZA 2V55B 1IXRC 3I1YA 1QF9A 3U26A 1GQYA 3ER6A 3BDAA 2OXTA 2A14A 1YB1A 4CVNA 4MAAA 5B37A 3PRHA 2PRYA 1N6KA 3UQZA 1SC3A 1N2JA 4OEHA 1P7PA 1SO8A 1KKUA 5GVRA 5IT0A 1PUIA 2L42A 3LY7A 5B1HA 2HJSA 3W8DA 4WQMA 1NVTA 2ETVA 2C4KA 2ZUSA 4IEIA 4MZDA 4JLNA 3QTTA 3VKVA 2KS6A 1EZZA 1HQDA 2VRNA 4LZWA 5EVJA 1QHHA 3CX7A 5CIWA 5EZSA 1M2GA 4RLFA 2A7XA 3DWEX 5FOQA 3FYUC 2R6GA 3LVBA 1P61B 4RULA 1PDOA 4DDVA 2MOKA 1P2UA 1ZNWA 4PRKA 2NT4A 3R75A 2IHVA 5AVZA 5LU9A 2O8EB 1GCOA 1V3QE 2AFRA 4MVYA 3ZWBA 1WLSA 2Q0HA 2Z1DA 3GRZA 1E2IA 4GZ5A 1U3CA 4JGIA 4CEIB 3EDRA 3U4MA 4OA8A 3GUCA 2QD4A 1XVIA 1XRQA 3C48A 3BRCA 3TZEA 3UTDA 4KFRA 2JVIA 1GTZA 2HA3A 2QY9A 2JCXA 3I34X 3ONWA 2JLUA 3OKPA 2I2FA 3JQFA 4ZCRA 1P18A 3NCHA 4GQIA 5KDLA 5CDSA 3W1EA 1G38A 2BEWB 1YOVA 2ZYHA 2IS6A 3L5OA 1RLIA 1R37A 4OI1A 1GZ6A 1G1AA 2SHKA 3K6RA 4HLNA 5HA5A 3R8XA 1V6CA 2EHDA 1K4KA 4E7PA 4Z4CA 1QH1B 3D43A 3GLUA 3L79A 5EXEA 2QLLA 2X19A 4YAOA 2N3ZA 2ZJ5A 5BN5B 3BE8A 3J81k 3CA8A 1L7OA 2O1XA 2YZ7A 2FR8A 3E6AA 4QUGA 4WK2B 2OBXA 1YB7A 4DBZA 3BVPA 1C8KA 2YOHA 1Q5PA 3BMCB 4IVNA 2C59A 4YC7A 1NQTA 2PZLA 2PBRA 1NQOA 2Z5FA 3DJFA 1N7IA 3AK4A 3PD1A 5BNZA 2XNDD 5KWIA 4BTLA 1W30A 4L0QA 4I4TB 5L4SA 1Q0QA 3E7DA 3KWJA 4TQ9A 5CLHA 4KX5A 3ZH9B 5H7XA 1LJLA 1W4CA 2F3QA 4IUDS 2HWYA 2G5PA 1VJDA 1DAIA 3BD7A 3W2GA 1DT3A 3M5DA 3G8YA 3LXRA 1X19A 3LTNC 2BGKA 4EYGA 3M7IA 4CGYA 4YV0A 3FDZB 2CYAA 2PA0A 4KDFA 3UW3A 2HCRA 4RHCA 3A4TA 3NDPA 5HE8A 5LZ7A 2ZM6B 3IQDB 2ZETA 2E6KA 3P45A 4IO0A 4OXIA 1SKUA 5AOVA 1Y6JA 5KZMB 3E22A 1DEAA 1LPOA 2QE7D 3F5SA 3F8SA 5DSTA 3SU8A 4BGEA 4F60A 1RYHA 2SBTA 4FNOA 1ZXLA 4KWEA 1IEQA 3IDQA 3PXGA 4NU8X 5K03A 2W70A 1EFLA 1I6WA 1M1YE 4RH1A 1WZNA 1X7YB 2G82A 3HPQA 3OETA 1E79A 2ZTUA 2CBXA 5BSTA 1RM5A 4LNUB 1JKMA 2QRLA 4DRXB 4AY2A 3JATB 1RYZA 1VCNA 5G4KB 4PN7A 2CDNA 1QGYA 1YQEA 3UUEA 3IKTA 2BM8A 5HIJA 1YIOA 3I3OA 1RJ9A 3T9EA 3ZY4A 3RAEC 2DY0A 3FHJA 2FPMA 2J3JA 4U63A 2VUUA 3O31A 4HQNA 3F78A 3DUFA 5BSFA 1C8BA 2ZATA 2BGNA 2Q1SA 1LNZA 2YV2A 2X8AA 5K3BA 1KK1A 4EUSA 2IEIA 1BW9B 4L6CA 4DMMA 3WGKA 2Q5EA 4XX0B 4AS2A 4JI7B 3N8IA 1AG9A 4J0KA 4N6NA 4WMLA 4B7ZA 2AN5A 1IQUA 5JJLA 4Q01A 4O29A 2ETXA 5AHRA 4ND3A 3RU2A 1RI2A 1NUQA 1U65A 3I2KA 1P9NA 4Y8VA 3RI3A 4IPTA 4AP9A 1OWNA 4JJ4A 2R6AA 2Z83A 3WC4A 1NTOA 1DIRA 2NQ8A 2P9CA 3LIPA 3FPFA 5TF0A 4WBNB 1K7YA 4Z53A 3S44A 1OHHD 5EEGA 4IGKA 2JZNA 5EXTA 5CPBA 5KAPA 5BT9A 2I6GA 3FAZA 3IE0A 3DEZA 5FB3A 4MVJP 1Q95A 2ODTX 3DDHA 4QARA 3O5AA 5EWMA 3NHAA 5KTOA 3EODA 3BREA 1B6SA 2ZRAA 4UVHA 2LKCA 4HAUA 5I9BA 3WNQA 1WUYA 3N1UA 1XLTA 1XVLA 3HZOA 4RFLA 3V7YA 1XTBA 4KXQA 1URPA 1XJCA 3T0GA 1WRBA 3JV7A 3VR5A 3HRIA 4OQYA 4QRDA 4MV7A 1VXRA 2BPOA 1ORDA 3FVRA 4LQDA 1TKCA 2JRCA 2DETA 3Q7QA 2BFDA 3GG9A 2WF6A 4BN4A 4LGCA 4EENA 2QX8A 1ZJ4A 4YP0A 4N18A 4A2CA 4FX5A 4PTYA 5I7OA 3NHYA 4DC0A 4BPRA 5FBWB 4KQWA 1E0JA 1M7HA 1NI5A 2RI1A 5ABPA 1CR6A 1BMFA 1ZH8A 1FMLA 1YB2A 4HRYA 1RQXA 3I2FA 3GJQA 3NEYA 5JCOA 3VUEA 2OVFA 2WIBA 4JJGA 4LDNA 4MULA 5C8VA 3PU6A 5LWQA 3U80A 1T9DA 1UBFA 2IYSA 3HCAA 4JKYA 1PQWA 3AETB 1QS0A 3H0KA 4I50B 4LXQA 1S2MA 1GN8A 4QC2A 3DHWC 4YAJA 4AZ0A 2GS9A 4YRBA 2VN8A 2B99A 4KWHA 5BN3A 3DTTA 1I6MA 1H4TA 4QJBA 4WZBA 4MDFA 3GGCA 2CNBA 4QBIA 2QD3A 2QIOA 4CTKA 1UZNA 4E5PA 3EFOA 5IEJA 4MHTA 4RSMA 2R9VA 5EP4A 1VKOA 3QG1A 1OI2A 1R0WA 1YASA 4JQSA 1LTQA 1YS6A 2HK9A 1ZXBA 4MCHA 2WWFA 2PSHA 3N5KA 5E1OA 2XMCA 3ILSA 5AOBA 4D3FA 4W1QA 1KR2A 5J2TA 1Q22A 4HC4A 1IY2A 1Q7EA 2H5JA 2MDTA 2YIMA 1CUIA 3E7WA 3L7OA 1ZHHA 1C7RA 3RYHB 3S1AB 3V9PA 4X1KA 4QG3A 5I8WA 1I3KA 1KYQA 2PWPA 4U00A 3ES9A 5AIAA 5IF3A 1PYDA 4HDAA 5EPEA 5F1YA 2NACA 2AFVA 3M5CA 2YQ4A 3CEAA 1JJ7A 2AS0A 3CKLA 4H7EA 4ZQCB 2FN4A 4XXHA 4M7RA 4L0MA 4J29A 4YCBA 2C4NA 3R9XA 1T5BA 4HN2A 1G19A 4INOA 3AHGA 4M9UA 3W8EA 2VWGA 2HDWA 3QTLA 1UBCA 1G8AA 4TM8A 4EHJA 4EUNA 1Y1RA 2CFOA 4TKUA 5LIRA 1GA1A 3E2MA 1TCCA 4KXLA 3ND8A 1IAVA 3ISJA 1CRZA 5DTJA 4QJ5A 4EZBA 5KOJB 1THMA 2YASA 1RE1A 3GFRA 4G5HA 1KDZA 3W9SA 2ZULA 3ILYA 1SCNE 2PWAA 2N1MA 3TRIA 1ORWA 1ZU4A 4Y7DA 4ZAXA 3U49A 3S81A 3V33A 1J2JA 2WTAA 5CFOA 1NN5A 2O2JA 2ZSUA 2ACWA 4R2XA 3CR8A 3ZU5A 2F62A 2X7XA 4ZEOA 3L7YA 2A1TR 3NBQA 4LTDA 4DLPA 3ZVRA 5CYOA 3OTOB 1QBKC 4IWXA 2HX1A 4FN4A 2BOVA 2XKKA 2G1PA 2YHSA 3I42A 1INLA 1QQ7A 5D87A 1GL9B 1M1YB 2OV4A 1ECBA 2J4CA 2WUWE 2A9PA 3NTVA 5E4JA 1Z37A 2YVKA 4DNOA 2A7QA 1H5UA 1U0EA 4CMIA 4HNGA 4MWGA 2WD8A 4MDEA 1ZOSA 3EGCA 3WJ2A 3PYXA 1PZMA 3LFTA 2NVBA 1R0LA 4P3NA 5A4KA 1EP2B 3UMYA 4TTVA 2HHHB 4ISCA 4PGFA 1J7JA