3F7OA

Crystal structure of cuticle-degrading protease from paecilomyces lilacinus (pl646)
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
284
structure length
284
Chain Sequence
AYTQQPGAPWGLGRISHRSKGSTTYEYDTSGGSGTCAYVIDTGVEASHPEFEGRASQIKSFISGQNTDGNGHGTHCAGTIGSKTYGVAKKTKIYGVKVLDNSGSGSYSGIISGMDFAVQDSKSRSCPKGVVANMSLGGGKAQSVNDGAAAMIRAGVFLAVAAGNDNANAANYSPASEPTVCTVGATTSSDARSSFSNYGNLVDIFAPGSNILSTWIGGTTNTISGTSMATPHIVGLGAYLAGLEGFPGAQALCKRIQTLSTKNVLTGIPSGTVNYLAFNGNPSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine protease
publication title The crystal structures of two cuticle-degrading proteases from nematophagous fungi and their contribution to infection against nematodes.
pubmed doi rcsb
molecule tags Hydrolase
total genus 105
structure length 284
sequence length 284
chains with identical sequence B
ec nomenclature ec 3.4.21.-:
pdb deposition date 2008-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3f7oA00
1Y48E 1ST2A 3ZXYA 1MPTA 4C3VA 1PJ8A 3DWEX 1SN7A 4RYDA 1JEAA 1Y4AE 2XTJA 5B1EA 1LW6E 5FAXA 3F7MA 2TECE 3BGOS 4KPGA 1SIBE 1GTG1 3HJRA 3DE0X 1SBCA 2WUVA 3LXUX 4LVOA 5JXGA 4C3UA 4WOCA 2WUWE 4K8RB 2DQKA 1P8JA 1Y3BE 1A2QA 3DE4X 3DE2X 1SCAA 1UBNA 1TM3E 1SBHA 3I2YX 3WQBA 3PTLA 1SBIA 1YJAA 1SUBA 2IY9A 2ST1A 1NDUA 3VSBA 1KE1A 3PRKE 1VSBA 2PWAA 3QFHA 3A3PA 5JMOA 1OYOA 1GCIA 1YJBA 1Y1KE 2DUJA 3VV3A 2PYZA 3GT3A 5K7SA 1BE8A 1KDZA 1EA7A 1GA4A 5AVJA 3VHQA 3T41A 4ZARA 4LVNA 5CW1A 1TO1E 4H6WA 2ID8A 3DVSX 1NLUA 3A3NA 1GT91 1AH2A 1Y33E 1SPBS 3DE3X 1TM4E 4ZOQI 3DE7X 2PRKA 3DW1X 1XF1A 3GT4A 1CNMA 1GTL1 3AJ9A 2ID4A 3TI9A 4OMDA 1SCDA 3AJ8A 1TO2E 1KE2A 3P5BA 1P7WA 1AV7A 4CFYA 1Y3DE 2Z2ZA 1MEEA 2WV7A 1IC6A 3VTAA 3ZXXA 2P4EA 1BJRE 4OMCA 2PWBA 3DE5X 1AF4A 1TM7E 3A3OA 4HVLA 4FONA 5ARBA 1SCJA 1SUDA 1Y34E 2XRMA 2Z2XA 3D9QX 1OT5A 4KB5A 2PKCA 3BX1A 3I34X 3DDZX 1YU6A 1T1GA 1KDVA 1AVTA 2GKOA 4AKTA 4CFZA 4Z2AA 1AQNA 1WMEA 1WVMA 5ARCA 3BPSA 1PFGA 3I30X 1Y9ZA 2PMWB 2W2QA 1Y3CE 1BE6A 1S2NA 1WMFA 3LPCA 1OYVA 2PQ2A 1NDQA 2ZWOA 4DWWA 1S02A 3VYVA 2QTWB 1SIOA 3CO0S 4NE7A 2W2MA 2E1PA 1THMA 3GCWA 4B5LA 3DVQX 2SBTA 2Z58A 3DE1X 1AK9A 1ZVJA 1SUEA 5FBZA 3Q40A 1ZVKA 2HD4A 1KDYA 3D43A 1GTJ1 1TMGE 4OV6B 2Z30A 1T1IA 4DJ5X 3WIUA 5B1DA 2W2PA 5AMXA 5FFNA 1SIUA 1IAVA 5AQEA 3CNQS 1C3LA 2Z2YA 3LPDA 1Y4DE 1BH6A 1R6VA 3QTLA 1YJCA 4GI3A 5AVKA 3EDYA 2Z57A 1CSEE 4AKSA 1R0RE 1S01A 5JXIA 2B6NA 5ARDA 2SECE 3AFGA 3WHIA 5JXJA 2G4VA 1C9JA 3I37X 4BWGA 1SELA 3DE6X 4WOBA 1DBIA 4H6XA 3DW3X 2ZWPA 1V5IA 1PEKE 2Z56A 4YN3A 4J94A 3H42B 1C9NA 1BFUA 3VV2A 4JP8A 3Q5GA 1TM1E 3QMPA 1DUIA 1ST3A 1SBNE 4M1ZA 1SH7A 3OSZA 2V8BA 2SNIE 1T1EA 1P7VA 1SUCA 1SUPA 3DYBA 1AU9A 2IXTA 1GNSA 1EGQA 1WMDA 1R64A 1SVNA 1SCNE 1Q5PA 1HT3A 3EIFA 4KG7A 1C9MA 3EE6A 1GA1A 5I9SA 3GCXA 4NMXB 3TI7A 3SICE 4NE9A 3TECE 3LPAA 5SICE 4I0WB 3WIVA 2W2NA 1TK2A 2HPZA 2DP4E 2W2OA 4CG0A 1GNVA 1PTKA 2ZRQA 3SQOA 3L1KA 2SICE 1WSDA 3F7OA 5JXHA 2WWTA 1BFKA 2X8JB 1SCBA 1Y3FE 4MZDA 4DZTA 1TECE 3DVRX 1SBTA 1V6CA 3UNXA 1SUAA 4HX2A 1TM5E 1GA6A 3F49S 2X8JA 4H6VA
chains in the Genus database with same CATH superfamily
4KUHA 3RC2A 5ICMA 1L5LA 1FXSA 2C2GA 2E89A 2GCOB 1HG0A 4OYRA 5EQFA 3PUZA 1N6NA 2R4QA 1KS9A 2PZMA 2AXQA 3BB4A 4GMKA 1FDSA 2JHFA 3L49A 3QFFA 4FYXA 1EFDN 4HF7A 2PZLA 5HKKA 1NBWB 2OT3B 3EPRA 4G84A 3SAJA 5IF3A 1N5IA 2GPSA 3BJEA 2H63A 3BN3A 1YCFA 3WMEA 3SZUA 1ZIPA 1NDHA 1SK9A 5G53C 2F8SA 3QVKA 1V5WA 2AFVA 4RTPA 4U8GA 3MXTA 1YZYA 1NP6A 1Z88A 4UHFA 2UZ0A 4V0MA 1HRKA 2YUIA 4WFKA 2CF5A 4Z9FA 3RS5A 1BN7A 1T6BY 3DHEA 4DDMA 3BGVA 2H7YA 2HPAA 5AJWA 3GDGA 3QFSA 1X7DA 3H9EO 5EZYA 3ZNOA 4KMOA 4A27A 3IULA 3IT0A 4U8HA 3GX1A 3LX5A 1ZK1A 2WSLA 3AHCA 3PU6A 4LUCA 4OO3A 5KTSA 2G70A 3V7FA 4UOEA 5SYNA 5CG2A 1VLMA 3G1WA 1Z06A 5L7YA 4DHWA 1JF8A 1WNTA 2B99A 5I7FA 3K70C 1JILA 4D1YA 1QDUA 1RHMA 1FSSA 3RKRA 3KL2A 2XLCA 1ZVQA 3LG2A 4INJA 1CFJA 1SVUA 2R47A 3ILSA 3M9LA 4UBJA 4HLQB 2G9VA 5GV8A 1OXSC 3PD0A 4IEFB 2WNSA 4E08A 5KOYA 4LHSA 4DF3A 1J7JA 1SD2A 1DT5A 2EW1A 5KNDH 4L02A 3IOMA 4LI0A 4F1WA 3FR7A 3A4NA 1LS1A 4V3CA 9ATCA 2JIZD 1KQPA 2WIKA 3WTBA 4CR6A 3MBKA 3R3UA 1YS6A 1TM3E 5A3SA 4EPYA 5TT1A 1RLTA 4GR4A 2V0GA 3KYDB 1NR1A 1YFZA 3CRVA 2TMDA 3WQBA 4D57A 3PTLA 3FPAA 1B0UA 5TB5A 4E1VA 3U4MA 5K6RA 3TM5A 1KWKA 1UQUA 1MJGA 2Z5GA 3OF3A 2OYCA 5IHXA 2WSBA 4CKYA 1L7DA 4IDGA 3SF0A 5CURA 3CW9A 3DL0A 3MCVA 1Q21A 1FRQA 3DVAA 3PYXA 2DOKA 2IPAB 3HNPA 1DRVA 1U8YA 2B5VA 2W93A 3OESA 4KO1S 2R1UA 1LPAB 4EO7A 2I8AA 2RHJA 5J4KA 3EQ6A 4CKWB 1P44A 1NNSA 2HA3A 2QL7A 1WCV1 1JMKC 4KVZA 3CC8A 3OQHA 4K9NA 1B42A 4W5JA 4X8MA 5H3LA 2GNPA 3ZHOA 4EJSC 4RY9A 3KKEA 2I76A 2ZR9A 3WYFA 1GVNB 1DEAA 5KWIA 6Q21A 1NC3A 3K8OE 1VL5A 4ZAXA 2A7QA 3D6TB 1X80A 4EVQA 2YHIB 4LF4B 3CZPA 1QANA 1T0HB 1YDHA 1EHCA 1VXRA 2Q1YA 4BLQA 4ARCA 4YI5A 1G19A 5JIBA 3WWDA 2HW8A 2XUJA 3L0DA 4L5YA 3L4EA 2V9CA 3ORYA 3AF3A 3TRKA 3E9RA 1RQNA 5EQJB 1SOMA 5AJHA 3DJYA 1KZGB 2WWFA 2HJGA 1ZHFA 3I0MA 3QEJA 4Q12A 5C31A 5KTMA 5M2QA 2BWJA 4DLLA 2VT6A 1ECCA 3V1UA 4DRYA 3HFRA 2P3QA 1NVWQ 3TL6A 3TZCA 2AX4A 4EARA 3PQDA 1SU6A 5B6IA 3X2SA 4R71A 1NN1A 2RBKA 3T5DA 1PL8A 3E7PA 4H6WA 4O4IB 3DAGA 1ZI8A 4TKZA 5DB4A 1JLLB 3E7FA 1EP9A 2IVZA 1YR3A 2BHNA 3B3FA 3H9GA 2J5QA 4LXIA 2YC4C 5ALZA 4KZPA 2DTDA 3CA8A 1E63A 2AL7A 4A0RA 5B7NA 4M1EA 3N8KA 5DT9A 4IQFA 1U65A 1JI3A 4HMOA 1GFWA 5FF9A 1Q3HA 3Q15C 3BE8A 3RIYA 1SXGA 1Z38A 5ULLA 2FPIB 3LP5A 4EVIA 1LI5A 4BBPA 3VU0A 4PR0A 5TEWA 2CXQA 3EPJA 4J2HA 1UK8A 2A3NA 2BM9A 2JFUA 5DW0A 5A9SA 4EG3A 1XF1A 4TS3A 1AX9A 1R4MB 2X5NA 4JBNA 5C5CA 5F23A 1JVNA 1R12A 4NJEA 4JH0A 4LE2A 4BGIA 1UOEA 4A3SA 1MOZA 1WXHA 2ID4A 3TI9A 1K63A 3H5RA 1XMOB 1XLTC 1T5LA 1X92A 4QLBA 1TADA 3KUXA 4NABA 4CLHA 4LSZA 3EGXA 3E9DA 2BVNA 2V7PA 1LK7A 4BRUA 3H97A 4KGZA 4CFSA 4F56A 1HDRA 2HK7A 3GCDA 5EE3A 3W1WA 5KQSA 1KO7A 2WWWA 3D1VA 3U4GA 3QHQA 4LYJA 4TXHA 1T4MA 3GOQA 1XZDA 3P5BA 4RS4A 4MGKR 3A6JA 4XM1A 3I0ZA 3C97A 2G1PA 2DLDA 3GO4A 4JJKA 3ND5A 3O74A 5AUOB 1AV7A 4F8YA 4G5OA 3OD5A 1P1BA 1DIRA 1YR1A 2FLVA 4IV0A 1P81A 5D6NA 2ANBA 2OXRA 4D9MA 1ECFA 4O4HF 4F8EA 4QVIA 1CJUC 2DUUA 1A9XA 4FDAA 3EQ7A 4U5XA 2ACEA 3ROTA 3JXEA 4HWKA 4NBRA 3EC7A 1GTVA 2IUFA 2YY5A 1HE8B 1IHUA 2XKAA 3K3PA 3Q85A 4YJ2A 1K2VN 1UXKA 3QPWA 1W2HA 4I1PA 4TOIA 1ZJ6A 1T2AA 4YALA 3W2EA 2IDJA 4DMGA 1NTOA 4EB6A 1KOLA 5DOZA 3PNOA 1H8ED 1SUIA 1T9GR 3KKMA 5FWDA 4IUBS 4L75A 2ACKA 3AUJB 5FI3A 2X9VA 3DDNA 3T7RA 3HKBB 2H1RA 3FVWA 4OHYA 3RSSA 4RIIA 1CP3A 1UP4A 1NV8A 4Q02A 4AZWA 2HGSA 3RVDA 5K6AA 4ZV9A 1WCIA 521PA 2XBUA 1T8TA 1EXWA 1RAHA 3QZUA 4P4SB 2DCMA 2O7RA 2LXNA 4D96A 3D9QX 1GTRA 1T6NA 3NORA 1CJTC 2QRKA 3C3AA 5JD5A 1NPYA 1E92A 1HDCA 4RTSA 2EP8A 2CL5A 3AMVA 4KNVA 4C7OB 4QXMA 2LD4A 1UEIA 2C4NA 4AU1A 2HJVA 2MYNA 4QC2A 3V46A 1DJPA 5IF9A 5L7WA 3NB0A 1BU8A 1YU6A 1X0VA 2X58A 2ZB8A 3C4VA 3ZI4A 1PJQA 1I2DA 1W29A 2W2LA 2MOKA 3I62A 1J8YF 2FN8A 2JAWA 2P9FA 1AVTA 1ZITA 1UDRA 4CFZA 1VCNA 4JBHA 4PF1A 1QGUA 1G3MA 4KLZA 3FKSD 1JG4A 2JPDA 4LOLA 4ILEA 3K1YA 4JKOA 1QIEA 5CLQA 3EVZA 3LFTA 4EA9A 4KPYA 4XUDA 3EVTA 4DADA 2ZTVA 4TTAA 1E79A 2PRJA 2DQSA 2QX9A 3LCCA 4Q4LA 4AMUA 1AKWA 1Y9ZA 1JFLA 2N75A 1N2SA 1FU8A 2WKRA 1WU7A 3MM4A 3NRCA 4HLUA 3W2TA 2R5FA 3SYRA 4XW2A 5K4AA 3I4CA 1KEPA 3H1GA 3IPLA 3N0RA 4TMKA 3VDNB 1BE6A 2HCBA 4X1YA 2XDWA 3HYRA 4ZT7A 3RU7A 3UXYA 2VSOA 3LPCA 4XB1A 3IAS6 3MGGA 4KRFA 4O2BB 3FYUA 1P75A 1PDOA 2R66A 3PL5A 2JCXA 1IQPA 3AUXA 1I7QB 2ZWOA 5ITVA 5JAIA 1EDDA 4Q6WA 1TLFA 4BO2A 1ENPA 1G5TA 1XZAA 1YTLA 1JR3D 1KH2A 1V9SA 4KQJA 2RGEA 3CSUA 5DNDA 2Z04A 5L51A 1QHYA 1KY4A 2QTCA 1E9CA 2XKJE 3B7WA 1NM5A 1YH3A 1FYXA 3NONA 2R1VA 2B37A 3VPDA 3V7NA 3WLRA 1SC6A 1ENZA 4NBKA 3V8RA 4BVHA 2FW7A 6LDHA 3LJKA 1GTSA 2ZB2A 2ODAA 2JLUA 4MUMA 1W44A 1OR8A 3F78A 4YRNA 2GAFA 4DC9A 2GN2A 1L5RA 4MW5A 1KZYC 4GX2A 4LJKA 5TS3A 5T8KC 4TVKA 4AQDA 4D9GA 3JWIA 4H27A 1SUEA 2RHLA 4LV8B 4AC9A 1UMBA 1A8HA 3ZQUA 3FZNA 1U5AA 5A7GA 1U1FA 4BGVA 4QNNA 4QQNA 1QO0A 5EE5B 2RB5A 1SUFA 3K71B 3Q2OA 4C5AA 2FN9A 5FUQA 1M72A 1E2DA 4TSKA 4F45A 3I42A 3S68A 1G17A 1K7SN 2PN1A 5KI6A 3X1MA 2J3KA 2ISCA 3MZ0A 5L3QA 3KS9A 2BBTA 3HEAA 4UFOA 4XWYA 1RVDA 2H2AA 3K09C 1E1LA 1V8DA 1FUEA 2R87A 3DDWA 1QAOA 4MRVA 3NXKA 4Z5XA 5JRDS 1MW9X 3G2KA 4JI7B 2NSHA 3ZN2A 1TZKA 2CJWB 5EJAA 2AA3A 1QBGA 2H8GA 1GGHA 2H4YA 1NG9A 2UYGA 4QASA 3R3XA 4QYWA 4UJ3A 5JADA 4IAOA 1W85A 3HGTA 3GLIB 3CYFA 1Q0UA 2BDTA 4LHVA 2JC3A 1EJ0A 4FGJA 3ZWQA 1YZNA 2WD8A 4W7IA 4TUYF 3HY4A 1N0WA 2M9MA 2WZBA 4LGVA 1N2CB 2OA0A 5LMUB 3PUHA 4E5VA 1SVLA 5BV2P 4JZYA 4LMRA 1ULHA 2X2FA 2VCHA 1MAAA 3WIBA 1QKKA 4XA8A 4F3RA 1T36A 3IHTA 4NNOA 1H0HA 4C5BA 3IVXA 2FG6C 4RIHA 5B6PA 5JCOC 2BPOA 3AFGA 3OTQA 4MS3A 4CQNA 2YYAA 1SR8A 3F8SA 1A2KC 3LQRA 1Z22A 3NHRA 4P3YA 1FP1D 1KVTA 1D1TA 2PGIA 3M6LA 4DT1A 1VZ2A 1IFXA 3RLIA 3V2GA 1BWSA 2A4MA 1GL3A 2H5LA 3HWWA 4PYOA 5LP1A 1VG1A 3L9WA 4Y2UA 4ZJUA 4BPBA 1G5FA 2B9EA 3EARA 3N8HA 2EX4A 3N6VA 5DN6D 3KL4A 1M83A 1YB7A 1PEKE 3TXYA 1QZXA 3WSTA 2EIXA 2H9AA 4Q7QA 4LPSA 4QA9A 1Q50A 1MTZA 1E3DA 2MJLA 2VT2A 3EVDA 5DLPA 5BMVB 3THRA 3BORA 2WE7A 4HZUA 7REQA 3LXXA 2QB5A 4DCVA 4MRAA 3A1VA 2IV3A 2BELA 4P0PB 3BM5A 2A5JA 3W5SA 2DVMA 2CD9A 3VV2A 4E2YA 1GL6A 3GBSA 2G04A 3KVNA 4AY2A 1EFAA 1DAHA 1W48A 3FTNA 3PD1A 1CUYA 4GVXA 2GXUA 2YCLA 2F00A 3GVXA 4W82A 3BILA 3KR1A 5DHFA 4RM3A 3GGDA 1PV4A 2POQX 3JQEA 4H1UA 2D1QA 2J3QA 1JBQA 1MORA 2EJBA 3OBBA 1RJ9B 4QATA 4DMKA 3GNTA 1OI3A 1Z74A 2BGNA 1IPFA 1R0SA 3BZWA 4HMPA 4L2IB 4MPPA 1O9GA 4K9SA 1Y1LA 2FLWA 1RT9A 1IBSA 2ZBGA 3H5NA 3M49A 4G1VA 1LF0A 4DNQA 4LBYA 3ZKWB 3UAOA 1SUCA 5HKKD 2VDLB 2H48A 4MQEB 4B3CA 3GY0A 3HCWA 5ERXA 5H80A 1NAHA 3KPJA 2B20A 4PLGA 4RHXA 4ZZ2A 1K9SA 3OT1A 4RW0A 4AUEA 3B8HA 3G6KA 1IK6A 3FF1A 4YAWA 1Z12A 4PZEA 1OU0A 3LVRE 4WCFA 1L4YA 2FN4A 3QVTA 4F60A 4HGNA 4ZCPA 1HT3A 2D6FA 1SUWA 4II7A 2DEUA 3GMIA 4GPIB 5EUCA 1OAOC 1NFRA 1TXGA 1Z5PA 2VG8A 2WVJA 1DELA 1JPNA 1RS0A 2PXCA 4FMPA 4M8SA 1YRQA 5LP6A 3TTYA 4DWJA 4LZAA 2AWOA 2CDRA 3DTVA 4XJXA 1BXGA 1D1PA 3TTWA 5G3YA 3L1UA 4OHFA 2J0SA 4BNVA 4X3OA 3K6KA 2AJ8A 5FNZA 2IX3A 4BS9A 1JDBC 1FVOA 1WJGA 3WAGA 3WLEA 1U9ZA 5D01A 3UN1A 4MGZR 3JASB 3MWKA 4RH3A 2GBFA 4V0KA 4DM4A 3QSYA 2XYRA 2IPLA 5EP4A 3NAGA 4Y6QA 3T4XA 3GPLA 1ZD9A 2DFPA 4INAA 4DG8A 2OSBA 4P5EA 3SFTA 3ZJYA 1HV8A 4N3NA 4B47A 4DCMA 1O0SA 4ZQHA 2Y1DA 3GLHA 3ZD9A 2O8FB 3M3DA 3GH3A 3BERA 3N74A 4QUKA 1Y4ZA 2PZAA 1GZ3A 1PW5A 3RFXA 3UJNA 4R3NA 3CB4A 4UQPA 1S7CA 2PNJA 2WTUA 1XDWA 2I66A 2SCUA 2Z2KA 4FLMA 1XTBA 5KJCA 1HZZC 1M1YB 2IHVA 4ETWA 3PXAA 4KHZA 3G5MA 4BQQA 3IXLA 3AFIA 4HWTA 2ZB4A 4PN7A 1RADA 1D09A 2RGWA 3W9YA 3EIWA 2BDEA 1MX9A 1CUDA 1ZD2P 3IAM1 1LLFA 3E82A 4QJ3A 2IYFA 5EJFA 5JS7A 4RO0A 1A4RA 5L7TA 4IFBA 1SQGA 2E1RA 3M5PA 4NIMA 4BUCA 3A26A 1TECE 4K88A 3KSRA 2IGBA 4QE3A 2VF7A 1K0FA 4YR7A 1Q1QA 2O7QA 3ZIDA 4IZ6A 421PA 3PIIA 4ZYYA 4JB3A 4J3NA 3T3MB 1FY2A 1FA9A 4HC4A 3T4UA 5CB4F 4K6MA 1P74A 4AY6A 1JHMA 4MJXA 1P1HA 1IVYA 3WKAA 1DC6A 4MKRA 1TAUA 1IJEA 1W25A 5L40A 2HO5A 3FYCA 4MA0A 4AVYA 4DTCA 4LGCA 2BI7A 3DUWA 4Z7NB 3UJPA 3ZCPA 3R8FA 3AVYA 1G9SA 2Y2UA 5EZYB 4ETIA 5FHQA 3T3DA 5K0EA 3M1LA 2KJQA 1ZO8A 5DYWA 5KQPA 3DDCA 3O1IC 4PYKA 4YV2A 3DWEX 3QI2A 4N8EA 2VK4A 2X0IA 1SN7A 4WZ6A 4DDWA 2H1LA 1EGVB 4MYHA 5KOIA 3GQBA 3MHTA 4YO7A 4MWBA 2Y1WA 4HB4A 3FJ1A 1CJBA 4FB5A 1E6KA 2QLBA 2WF5A 4EPTA 1K4KA 1NN3A 2R2AA 3CBQA 3F7MA 4KX3A 3GAFA 3MJDA 1TQ8A 3NTUA 3FPGA 3VDQA 5BW8A 1O97D 3R2JA 4DIOA 2Y9MB 4KXXA 5BW6B 1ZKMA 2VDNB 5DNCA 5JBIA 1T3ZA 1WX1A 1ZAKA 2WILA 3EBLA 1V7ZA 2GCNA 2HDHA 1P3DA 3V4LA 1R9NA 3OTGA 2ZWMA 3TW0A 3HSKA 3ZUPA 4AMGA 5A5EA 3EDCA 3STWA 1ZK0A 2CT8A 4TLEA 1OROA 5BUCA 3DVAB 4L0MA 2BI4A 3OZGA 2DAPA 4HZGA 1ZMRA 5GIOE 3C3WA 1OBVA 4KO3S 5ISMA 4HV4A 2MSWA 3JALA 3FHLA 5ELLA 2XJ9A 2EGGA 2ZDQA 4MO2A 5JZMA 1DMSA 4L6AA 4CI0B 1IN5A 1XZEA 2A94A 1UINA 2FK7A 5EKXA 3I2YX 2OC4A 2Z0MA 3E61A 2DFKB 4DFDA 1IHOA 5H82A 1VJ1A 1X80B 4EO9A 3Q6IA 2CXXA 1G21E 2HXSA 2QX6A 3FB1A 4R8VA 4XEUA 3VPXA 4R1PA 1XJWA 2J3EA 5MGBA 4JLOA 3RVJA 4M87A 2P4QA 5K99A 4ARBA 1Q1GA 5H02A 3TEMA 4BJHB 2GXAA 2O1SA 2GK3A 3NMUF 1K8ZB 1PRYA 4AYTA 3N3BC 4GBMA 1KIFA 2KBFA 4DXDA 2AK2A 3ND8A 1LPBB 3EULA 1SXJC 4G2NA 4F3TA 4DIFA 4U00A 3A58B 4G67A 4JQZA 2BDUA 1WSBA 4JK3A 4LWOA 5EJGA 4C0KA 4B82A 2DUJA 3SIPA 4BGUA 2DGDA 1BHO1 2HC9A 5K0TA 1XZLA 4V0RA 3ZYCA 1BEZA 2HLDA 1ZY2A 4JYBA 1D7OA 4DR7B 1ZW6A 2VQSA 3FM9A 3UVEA 1VCHA 2EP5A 4M53A 1LBQA 2Z6VA 3FLBA 2O8EA 1PS0A 1MIHA 3GYBA 4IHQA 5TQ0A 3MLAA 4NHEA 2VBGA 3VHQA 1J1IA 4TVSA 4DLRA 4NYIQ 3TVTA 2A59A 1P73A 5J5AA 3OO0A 1WNFA 1ISGA 1I4LD 3BG5A 5SYAA 1YV9A 5A9SB 5LXTA 5IVIA 2YJTD 2AZTA 4B43A 1ZXXA 5L4NA 1JKXA 4F0JA 1ZVVA 1IZZA 3QJGA 4LOJA 4KIGA 4NJEB 2W2LD 4NG5A 5CGQB 5WRFA 1IQ0A 5AK6A 3LC7O 3DEFA 2I8CA 3DFKA 4OLAA 4IKPA 2D2EA 4GQBA 5DTQA 3UQYS 4Z4EA 1T0IA 2AGVA 2XMGA 3EGXB 1VMKA 2C3MA 1CR0A 3IEIA 1H2XA 1CNFA 2QGZA 3PGKA 4G0WA 2EZ4A 3ZU2A 1EWVA 4C07A 3ES9A 2WG0A 3ZCRA 1PGJA 4V2IA 4ZQIA 1FSFA 4OHUA 5ALPA 4UUOA 1U2DC 5FO0A 4E2FA 4B8YA 3B7PA 4MMXB 1T9ZA 1AZLA 3P9XA 2X7JA 2P6UA 3AF1A 1UC9A 3N8DA 1NBHA 1SULA 1KS2A 3HBFA 2O5RA 3RJZA 3MD0A 1B16A 4XX1A 1VA4A 2D5LA 5THQA 4M1MA 1SOVA 3VGPA 4YP1A 3ZDAA 2WZDA 1D5WA 3WMXA 3GA0A 4L6CA 3V7UA 1A9XB 2BI8A 4NHOA 3W3ZB 5A4JA 5AYVA 3WAJA 4KQGA 4C2BA 3L1JA 4CODB 2IY7A 4MUXA 2GPYA 4E70A 1GNPA 3EB9A 2G5PA 3CO5A 2RJ3A 4YJ2B 3HZZA 3LYUA 3QXSA 3BRCA 1CVLA 3K0BA 4URWR 4F7WA 5HTKA 2QTBA 1ISRA 1N0HA 2PO7A 3JRXA 3ET5A 3KQMA 3TBKA 4EB6B 2PUDA 4JI2B 4PSVA 4NLLA 2RJNA 2IOFA 1HYHA 3LFUA 2NO9A 3NP9A 2XGGA 3P2IA 5KWSA 5SZIA 4MUAA 1P33A 1S2LA 1XZQA 1L7QA 3HUEA 4RQAA 5DTMA 1U0EA 5JH7F 1KBOA 1WCIB 2XY4A 3IIKA 4GP7A 3LL4A 3K5PA 3BWMA 1IJFA 3ZV7A 2QUHA 1SCQA 4LJYA 1J99A 3FVVA 3OOJA 1FFBA 1UIMA 4GEKA 4CNQA 2PWPA 1W4RA 1ZEMA 4J43A 2VPQA 1C8KA 2GYWA 3U0VA 2G40A 1QO0D 1YR9A 3KK0A 4NPAA 3DOFA 3WK4A 5BWLA 4UJ5A 2TMKA 2QAJA 4ZT6A 1AZSC 1SHZA 2GN9A 4YIKA 3CCCA 4LNUA 2OQIA 4ND1A 2CXUA 4WXRA 3IFSA 1PGPA 4Y2XA 2B2XA 1PL0A 1MRSA 1QGUB 5DNWA 2Q2VA 3KVRA 3TD2A 5AVRA 3FOEC 1PJCA 1ZYUA 3RGWS 2YWJA 2Z2IA 4ES6A 4A82A 1G8FA 1QV6A 3SXPA 4GT1A 5TSDA 3V00A 2C1EA 4UCQA 4JLJA 3JQ6A 1YIAA 1Z0KA 3SBXA 4EJSA 2ZJ0A 4NEGA 3UZUA 4CTOA 2HQRA 3NNNA 4ZGGA 3IEMA 1TYZA 3DDZX 1OFGA 3THYA 4BVLA 4I4LA 2HDNB 3E22A 3V1TC 1JEQA 4FSXA 1W35A 1W75A 4MDYA 2J9GA 4RF2A 1E5QA 5BPHA 1R8QA 4X1YB 3IVAA 4HBGA 1LI4A 4I66A 3FYUB 2JCSA 1DKUA 2C84A 1WVMA 4D3YA 1W9HA 4PG5A 4PLZA 1Y6GA 4OBWA 3TKYA 1LS6A 3BL5A 3G1TA 2VH1A 4JNKA 3BXEA 1TUEA 2NU7A 1PYGA 2CEKA 4TT3A 3SQXA 2JAXA 5BW5A 2UXCB 2R1VB 1JG2A 3LX6A 3C6MA 3FOBA 1XAGA 2AN9A 3EZYA 6YASA 5LNK6 3SZRA 1CUVA 3ABIA 3ZVNA 1F6DA 1ACJA 3ST7A 4DLZA 2OHVA 3BFPA 1N7HA 5HK9A 3EEBA 3P0JA 3CZ9A 3D1JA 3JQ8A 3ZWKA 1I3MA 1TEVA 3B82A 4HNAA 2HWXA 3BH7A 3NT5A 2Y0BA 4RZ3A 4WDQA 2BL4A 3HLTA 3K1JA 4Y2GA 5GPBA 1E59A 1FP7A 3VU3A 4H1WA 4S1WA 2ZIVB 5JSQA 2XWJI 3H8WA 3A8TA 3HB7A 1UMBB 3R75A 2PT5A 1E8DA 2GJAA 4LKOA 1H4VB 5LB2A 1JLSA 3WDSA 5D3ZA 2BGMA 1P4RA 3ZK9A 4DIDA 1T0JB 5L3QB 2FZLA 3O9MA 5JNTA 5ECWA 4FW8A 1V0JA 4NFLA 1WTAA 3TL2A 3VC1A 3RV4A 2GFHA 3G2PA 3UUEA 5ADVA 1FJXA 1XLTA 2YL2A 4KFSA 1OBCA 4QHSA 4WY5A 2SBTA 4AS2A 5HMLA 1B6TA 2JLYA 1E3TA 2DHCA 2HU8A 4PVDA 3TIIA 5IWAB 1W85B 1NQAO 2QT1A 1Z4PX 2I7TA 4FYMA 4GPD1 3UKJA 2ZG6A 4PAOA 1T13A 3G49A 3GUHA 4QUDA 1N0VC 1MT0A 2V7GA 3H5IA 1GPH1 2FOIA 3N1UA 2VHJA 3KOWA 2BM1A 1M34E 2M32A 4IX9A 1EHIA 2DR3A 3O03A 4KAFA 4ZVMA 1QHSA 1OUMA 2AEEA 3AM3A 1CJVC 1IH8A 2P4UA 2VHTA 4EDHA 1T36B 4OHBA 3HXQA 1A2BA 3HCPA 2ZI7A 3PWKA 4MS3B 1B1CA 1PJ4A 2VYND 3G0GA 3TTXA 4JCCA 3UMYA 2ZYGA 1ZUWA 2X2EA 3QE4A 4IZIA 5A0FA 3IP8A 2WTAA 3ZUGA 3JVUA 3EIUA 3ZYZA 4DT1B 4G0PA 3NYRA 3DEZA 3R0VA 2C95A 4J7CA 2BFFA 2HCFA 2W6ZA 1CHNA 1P18A 2WW8A 3VNVA 1YJCA 4GLFA 3OOHA 1EK0A 2V03A 1F5NA 3SZ3A 3I5YA 1YKGA 1ACLA 1V37A 5EFOA 3OLWA 3TOSA 3HLKA 3EAGA 4I55F 3IMKA 5ESXA 5JC8A 7MHTA 4JR0A 5JSZA 2V45A 2C2BA 1A88A 2C77A 3L92A 1PFQA 3LQYA 4JI1B 4BLVA 5J58A 3GAMA 4TL8A 2CFIA 4HZUB 1DHTA 3R9IA 3HJHA 4B3DA 3OJ0A 7REQB 2RE8A 3M5DA 4NCBA 3PUKA 1BXRA 5KQLA 4EG8A 4MXDA 1JTEA 2R8ZA 2G4VA 3TPZA 5B55A 4TXMA 3U0BA 4JEUA 5JXJA 2RGRA 1ZH6A 4LZZA 3N75A 4NV0A 1Z6AA 4BFYA 4R2XA 4PINA 5MF6A 4H3KB 1CDZA 2GCEA 4GYWA 1IJKA 3LY9A 4R1QA 1G4HA 4FR2A 1G7RA 4XFKA 3UJ3X 1XYGA 2WOJA 1IVNA 1O94C 4P86A 5IN4A 2PX0A 3HUUA 2Z56A 5IKPA 1RSZA 1NE2A 4NQRA 3RQIA 5AM4A 5F9HA 4NYJQ 4QFMA 4OLFA 5DW3A 1ZIYA 3OCZA 5FNVA 1E7MA 1KQFA 3NP7A 1HYQA 3M89A 3OIYA 5ED4A 1IMJA 3ITNA 4FYHA 1EXMA 3W8DA 3BQNB 2XJ4A 3CIFA 3PWSA 4N3GA 3T3GA 3QYFA 4AIIA 5KNCA 2CUTA 4OHMA 1KEZA 1MC8A 4KW7A 2AHOA 2C61A 4OJMX 4CM3A 4US2R 1CB0A 4XTCS 1ZDMA 1VFNA 1VBFA 2A9QA 2X19A 2ZCUA 3LKDA 4F4JA 1K97A 1YRBA 4P7JA 2JFNA 3N2YA 1SQ0A 2GBCA 3OY7A 4IDQA 4D4JA 2JZCA 3C7AA 4M38A 1BX1A 1X8JA 1C50A 4WCFB 4D5EA 1X1BA 5C80A 1KO8A 2GAAA 5I6DA 1AB5A 3HYCA 1L5WA 2AC7A 2ZZKA 3Q3JB 1P0CA 4LHXA 3AILA 3L0SA 4PFJA 1RRPA 1Q16A 4ZAVA 4D8XA 2P27A 3DZFA 4TV8F 2I8LA 1MFZA 4IIHA 4IDHA 1PJZA 1MGOA 2IZ1A 4PRLA 4UBLA 5LP6B 4ND5A 3DTVB 4PXYA 1BXGB 1E8MA 5IJZA 2VNSA 1YQTA 5KHAA 1AG9A 1VE1A 1JFFA 1B8UA 3GJ6A 4LX0A 5I8WA 5E2IA 3RYIA 1JT2A 3A31A 4LQDA 3IP3A 4Q19A 4PO9A 4TLLB 1Z2NX 3K30A 1JRLA 1SVNA 5I7OA 4G81A 2NZWA 3HDQA 5DBFA 1SCNE 3ZHYA 4OA5A 2YVUA 1PT7A 1QORA 2QIPA 3CVJA 3EE6A 1I1OA 3GLHB 3VPGA 3GCGA 1ZD4A 3STTA 1LD3A 2BFWA 5T8KA 4CCSA 1YBFA 3K5IA 3HCDA 4I9NA 1J21A 1ZKDA 2ZEJA 4FEAA 3N0VA 3WWZA 4BP8A 3MN1A 5AOAA 2Z5FA 3B1JA 1E96A 2SCUB 2ZUCA 4NMWA 4QODA 4L4UA 5FEUA 1E1RD 1IXKA 1WHSA 5B4UA 1QOZA 1VIAA 3E7WA 1O6GA 2CNKA 3BIOA 1EX9A 1ZWLA 10MHA 4KR7A 1XJ5A 5E8RA 1Z6ZA 1NSYA 2NQ8A 5COBA 3KM0A 1RHRA 1FIUA 1U4SA 3OFSA 2G9RA 1TPZA 5LBUA 1NIPA 3CB2A 3CEJA 2OV1A 3VAZA 1JFSA 3K09A 5FBHA 1T5BA 4D82A 3V4RA 1L5MA 1GNVA 2YXDA 1ZD5A 3E27A 4R1UA 2QTZA 1PTKA 4EG6A 1REQA 2QT9A 2ZRQA 3IA2A 1B4DA 1ZSVA 4IGEA 5LB4A 2HHAA 4MULA 1EFUA 2V1XA 1MC4A 2GGSA 4ML3A 4KOAA 2OD2A 2XT9A 3NM5A 4ER0A 1E9AA 1T3SA 3KWJA 3RVPA 3W5UA 4J0FA 2O3RA 1ISFA 3CBGA 3NIGB 3K8YA 1ESZA 5LZ8A 1FJHA 1U8EA 3BH6A 3ZNPA 2J59A 2VHEA 1QHEA 3SX2A 1KJ9A 1XYYA 4HJXA 1GRCA 4NG4A 3OLVA 2FY8A 4ILKA 4ON9A 4N49A 2QPAA 4UHJA 4QSHA 3UBMA 2Q28A 2XD9A 1R37A 2R1TA 2F48A 1U3VA 4KL8S 3C14C 4M46A 4IIEA 4J2TA 1YVDA 1ZESA 3G0BA 1K98A 4XCQA 4CL2A 3C6QA 3C39A 1BQ4A 1Q0PA 5JCOA 1T9DA 4GPAA 2BD0A 1K27A 2ZU0C 3SK0A 4KHPB 1HQYE 3UWMA 4TMXA 3GQBB 4OQNA 3W5JA 4M60A 4B44A 4AO8A 2HLDD 4E21A 4F3CA 1ZGJA 2ADFA 3AR9A 3HCAA 5IVHA 4IDAA 4JDPA 4XD2A 1RI5A 4DMLA 4EGJA 1E3MA 3U9LA 4C20A 3N6RA 4EHDA 4UCXA 3THWA 1R6BX 2QVZX 2C4HA 4JI3B 4E31A 2I1VB 1U7HA 2VDJA 4NX2A 2ON6A 1MXHA 1GUDA 2CE2X 2XDAA 3PQ2A 1JZSA 2E37A 4M89A 4DV5B 1P6XA 4QPDA 2FPUA 2CWWA 2I6GA 3R7DA 1BVRA 2HO4A 1J0XO 3TX6A 4ALJA 5LOVF 1RLJA 1AO0A 1POXA 2ZAOA 5EP1A 5IFKA 5J3JA 3KZVA 5ECDA 2Q3CA 1X9HA 4C43A 4EFLA 2VJDA 1GAQA 4NZPA 1WPGA 1WMBA 1NE7A 5CK5A 3AL3A 5F77A 2GHQA 3HDYA 5ITSA 3ZDBA 3SGLA 2WTMA 1PEDA 2BMWA 1BN6A 1KWGA 3OZRA 3I2GA 1KEUA 3ECSA 3JALB 4LNHA 4C3OB 3G79A 2H00A 4JEHA 4ZRMA 5TRTA 2PMFA 2JAQA 1SG9A 1J24A 4F96A 4Y2JA 3ONDA 3UT5A 4MDFA 1TJNA 3TKLA 4HRAA 4TLDA 4QGAA 4DRXA 4UULA 5ALJA 4IVNA 4RAOA 4UBNA 5ALXA 4ZU3A 2EV9A 5JWOA 1M2VA 5LU8A 2A0XA 5KKNB 4CN9A 1VRWA 2E5LB 2WUWE 5AVUA 2Q0HA 2VRBA 5JVDA 1U11A 1RNLA 3E2PA 4HDMA 1RAAA 4Q4AA 4P08A 2R7NA 3VM6A 2P2SA 1AT1A 3DP7A 4P4UA 4YTEA 2ZROA 2QROA 2MIIA 2FHSA 1OAOA 3AINA 4DN6A 1PS9A 1MQ8B 4CU2A 3WB9A 4BCBA 5AW7A 1UXOA 1W4ZA 2IOFK 1XDBA 4IBOA 2J1LA 4RWEA 3H2HA 2QG4A 2XRZA 3NT4A 3K70D 1TQHA 5BW4A 2PGLA 2O8EB 2DQYA 5TQ0B 2AUNA 2RC5A 3PRKE 4M0FA 3GT0A 5IFLA 1NLFA 3VI4B 1LZKA 1BFDA 2ZIFA 1KU0A 3E6AA 2BGIA 2HA2A 1F12A 1HE2A 3BJIC 2JFFA 2A1UA 2B7CA 2FUEA 2GAJA 5JY6A 5HJ7A 3CEPB 3H05A 5K3AA 1L5KA 5LXTB 3SZOA 1XWWA 2XUPA 4GX0A 3WSVA 5GONA 3HY6A 3DBVO 3QKWA 2XZLA 2EZUA 1OH8A 1HZZA 1OX6A 3NUZA 5K7SA 2ZVQX 4PHHA 1LRKA 1YDMA 4JJIA 2ZI3A 1OWMA 1RYEA 5HX7A 1HE1C 3NBUA 3L02A 4AMZA 2O4UX 2PKYX 2Y67A 2O2XA 4JS0A 4YGYA 1XUOA 1ZM2A 4GD3Q 3ZQ4A 1U8TA 4X54A 2C5HA 3L6UA 2DG2A 4AIRA 3DR5A 4QOEA 3A1CA 2TYSB 4FKMA 3EWNA 5EPUA 3NX4A 5AR1A 2OBMA 4RMGA 1WXXA 2J8ZA 2H17A 2AYYA 1JE1A 1GP2A 2C3PA 3DEYX 2OAEA 2WU0A 3R0IA 4PQGA 3FMPB 1PFKA 2HSZA 2VWGA 1Y33E 4FE7A 4Q1AA 2ZJ3A 1XE3A 5KDDA 4PX3A 3B3AA 2PD6A 3JWGA 3QNUA 4N0EA 4D9NA 3FFWA 5EIWA 4LNAA 2OV2A 2PYIA 4NS4A 3SSOA 3M6FA 5DTIA 4RKYA 1IUKA 4K6HA 1CRQA 3CW8X 3EIQA 1U8ZA 4M0LA 2XUKA 4E09A 4HDRA 3QV1A 4A6EA 3IB6A 4OG2A 2X0DA 5EGNA 5CT4A 3GG2A 1BHQ1 1HEYA 2FF7A 2JJQA 3E4DA 1J25A 1UK7A 2WT8A 4MEBA 4ND3A 2P0AA 2XXJA 3I6ZA 2CNWA 4TT3D 4MV4A 1XMPA 3V80A 1ABEA 1VE7A 1KZ7B 2BZSA 4C0LA 3EODA 1W0JA 2QJTA 4NBWA 5BWOA 3K70B 2ZM5A 1DAKA 2RG7A 3GIDA 5ICGA 5IC5A 1MO3A 2C57A 3ZBPA 3ZDFA 2H2FA 4DZRA 5T57A 2C9MA 2VHWA 2ZSDA 4M0UA 3WGIA 4CIDA 2KWIA 3G2HA 3VOSA 5H3HA 2VHXA 1YDEA 1G7CA 4WY8A 2VRWA 3K96A 3WFIA 3PNYA 3OCWA 1XROA 1YUBA 2CLMB 2IRWA 3WLSA 5JJLA 2IHBA 4RX1A 4MR9A 3MXOA 1OAKA 4LNUB 4D4LA 3I72A 4RCZA 3L7YA 1TD1A 5CFPA 1QC5A 4ZD6A 1QKIA 2HMSA 3OIGA 4EY5A 1XALA 5BRAA 4URFA 4BKUA 3LNTA 3ZDDA 1P5JA 4IM7A 3WGZA 4HN4B 3KR9A 3QITA 1NVVQ 2FN3A 1AF4A 1Y8CA 4EJSB 5K09A 2G77B 4Q5IA 2BSQA 1J2TA 1TM7E 2JGKA 2F2TA 3FCYA 2R44A 1E5DA 3CRMA 3NOQA 3OE1A 3OT5A 3HBLA 3HDVA 4R4JA 3THYB 1J56A 1FS4A 3EXG1 3HM2A 1ZH0A 3E22B 3OD1A 3O8QA 1JEQB 3TM4A 4IZHA 3TMAA 3RW9A 3VYRB 1TJYA 3TNJA 3UCXA 1LDMA 3ZCXA 2CF6A 4BVKA 4I4CA 5JV5A 1XLVA 1OBHA 2IYQA 3BEOA 1XZBA 2LDBA 3C8HA 3TEJA 4D4MA 3FSRA 4F91B 2QORA 5HBRA 3COWA 5HIIA 3ZE9A 1X1EA 5JRZA 3ZHRA 4PGMA 4ALLA 2ZJ2A 3VPSA 1JLMA 2NU7B 4EMTA 2AH5A 2CLCX 2OORC 3PFWO 3TUZC 1SXJA 4DZZA 1ND6A 1OZFA 2X3UA 1MB3A 2HB6A 4TROA 3T8YA 3WNCA 3JQAA 3Q8LA 4Q34A 2BJVA 3SC3A 2H1OA 3JQ8B 4DNXA 5LPNA 1LDYA 4HNAB 4RFSA 1AQNA 4GLBA 4HEHA 1V8BA 1Z0ZA 3DC7A 1YF3A 2Y0DA 2IE0A 2OXCA 1D7AA 2R65A 3AW9A 4HWPA 3EA0A 1JW9B 4KE6A 2YV1A 4DB4A 4OQXA 3UICA 2AT1A 3V4VB 1I3NA 3P27A 3PRHA 1PLJA 1KZ1A 4OQMA 2IP1A 3F6CA 2HF8A 3JRWA 2GBPA 2HI0A 5CDYA 1W36B 4WQMA 2IEDA 2VLBA 2AFRA 3ACDA 4KAAA 4MI3A 3ZVMA 2C7PA 3LLSA 1PAUA 2QZJA 3NNDA 4HX5A 2PSEA 3HN6A 3BCUA 5EQDA 1OYVA 3HJGA 2XTAA 2FMUA 1XCOA 3IUEA 1YE3A 1WVIA 2GPJA 2IEZA 5EMMA 1YOVA 3PRJA 4ZCTA 4YYEA 3QXCA 2FGKA 3VYVA 4L76A 5T64A 2BHTA 2QSUA 1EDBA 4C7JA 4M0DA 2KHZA 4L3VA 1DZIA 1IIBA 1U2DA 2ACWA 1OHHA 1H2ZA 2LNDA 3KALA 4I2NA 2V96A 1WPRA 5F2OA 5FT9A 2RHHA 5EJ6A 4OYLA 1RAIA 1YBAA 4AWAA 3ZHUA 4C0QC 4FM9A 3WBJA 3UQZA 3D5QA 4P7KA 4J6FA 1C9EA 1CYDA 5K4GA 2VTEA 4EF4A 3AOEC 3AR6A 3KWMA 4ARVA 4O08A 3KFVA 2FPGA 4B5LA 3E8SA 1VLHA 5FR1A 3T9FA 3ORFA 3RK4A 4GMFA 4KXNA 1M7HA 2AI2A 2IYPA 1FMLA 4LJ9A 3WGUA 3U3RA 4JOBA 3X43A 1E7SA 1E5XA 1KK3A 2XBMA 2BFFB 3LY8A 3PRYA 3EBPA 4V3BA 1CLEA 3K35A 2NTEA 2PMBA 5GZ3A 1R16A 1G66A 3MMZA 4LA4A 2WMOB 4P32A 3LVFO 2SKCA 5FWYA 1J06A 4CMCA 2G71A 2HH9A 2I33A 2ZE5A 5D5PA 1N32B 3G8BA 3C85A 4B4DA 5JSZB 4JJFA 5AOBA 1P0IA 1SWWA 2YRWA 2HX1A 3BWYA 1BA3A 5E4YA 5JXWA 3VVMA 5JNVA 2PU5A 2D06A 3FUTA 1SIUA 1VL6A 3CZ4A 2P6RA 2CHQA 1BXRB 1CRLA 1RE1A 2AZMA 2CFCA 2X0NA 3GRYA 3CNQS 2G6BA 3JVEA 3PD7A 3RRZA 4Y0NA 1SHKA 2HRRA 5ILOA 4R83A 1D0IA 2QJOA 2Z8ZA 3FRHA 1IU9A 3DDSA 3GP3A 1J1ZA 4I1YA 2IF0A 4HB3A 4GI3A 3JD4A 4P3PA 3D0OA 1XN1A 1FFHA 5DBHX 4QQRA 4DV6B 1CY2A 3HXMA 5LCXA 3O3OB 3UT6A 2Z57A 1ZA1A 3UA4A 4BMSA 2P2GA 5FNVB 1ZOSA 4PHFA 3U9TA 3IQXA 1YL6A 3WB0A 4BO7A 1M5RA 2H92A 2GVZC 3G88A 3V8PA 4F9EA 3KQUA 5B5SA 5E9WA 1R8XA 5MFZA 2C0CA 3HA7A 3U39A 3G2MA 3RFTA 3LUHA 2FZGA 4EQ6A 1TX4B 1HF3A 2K2WA 2QTNA 1NBMD 4JP1A 3CTMA 2YMQA 4MCIA 3FVQA 2IU6A 5ALRA 5K8VA 1T0PA 1EGMB 1IUNA 5BRJA 4PFQA 5K0SA 5G4LA 4QZVA 2ZE8A 3MSCA 1UR5A 5D51S 3I53A 4KX5A 3DAOA 1D6NA 3ENKA 1OD6A 3SC4A 3H04A 4HN9A 1DQRA 2PUBA 5I45A 4Q1FA 5IPFA 5I8ZA 3GFGA 3ZTTA 2X7XA 4Q1BA 4E5SA 5EUQB 1IYZA 1JWAB 4L5CA 1U2RA 1O4VA 2ZAGA 1EUQA 2OWEA 4DKJA 2Q4OA 2YZ7A 1N75A 2XNDA 3G68A 2D4AA 1JFFB 5ITZA 3V55A 3GLVA 2IYLD 4GXNA 4QDUA 4X45A 3RNOA 4BB6A 4B3FX 2WU8A 3RYIB 2Z5VA 1K89A 4I6EA 4QAJA 1F14A 5BY2A 3K0FA 1XZNA 2DF8A 3I3SR 2FNAA 3DONA 4MROA 3OZCA 2Q4RA 5FLKA 1VLLA 1RYHA 1RIFA 1TVEA 1GPJA 3NEPX 1LPNA 4WLUA 4Y6LA 9LDTA 2QN9A 4DARA 3RVBA 2NV6A 3S5JA 2BTQA 2NOAA 5E8JA 4BNUA 2OUKA 1X1QA 3D3KA 5JASA 3E3AA 3G2LA 4G9BA 1DXOA 3G6WA 1MBZA 1WUKS 4I4TA 2IHJA 1FFCA 4IGAA 3UAGA 1E2LA 3GDWA 1GRVA 5HJEA 5JAMA 3T5GA 1Y7HA 3Q6MA 3RCBA 1JKFA 5COAA 4EHHA 4RA6A 1II0A 2I4LA 3D59A 3IV6A 1OA1A 1WHSB 2CFRA 1BVUA 3D64A 2X14A 3F4BA 2AMJA 4EG1A 4K1XA 1ENOA 1EM8A 2X1VA 4KWEA 4DIKA 1BCRA 1I10A 4HG2A 5J1SB 1CY1A 4DJJA 2V8OA 2EATA 3IBTA 3PT9A 3TTTA 3UFXA 4PCLA 1Q5PA 3U19A 3C6XA 1FFSA 3D02A 3SFVA 1QVZA 4YPOA 4ZYWA 3CEMA 3SQWA 1REQB 3IR7A 3CTPA 3PQFA 4UOZA 5FI5A 3ICCA 5EXEA 1TC2A 3MJVA 4RK1A 1K7XB 2NPOA 3LKZA 5HQTA 4IIFA 5C8VA 3V8EA 4IMPA 4GIBA 1N1DA 1U7XA 3BTVA 4NYMR 5DHUA 1E61A 3SICE 2F3SA 1DXYA 2B4AA 3AIKA 5A0TA 1SC4A 5K3CA 2FPPA 1EYZA 3SHTA 1I7DA 4XVQA 3FDIA 2CXHA 5C7YA 3SYKA 2QN3A 3VH1A 1ZLXA 3I58A 2LTAA 2WJWA 5AWFC 1V6AA 1W49A 2ORVA 2W2OA 3EW7A 4RJKA 5I48A 2EWMA 2R1TB 2CVQA 4WTOA 2YVAA 5C1OA 4ZGWA 4UD2A 3L1KA 2QV0A 3HRHA 2CZGA 3KD3A 3ULKA 2FKAA 2EERA 1JDJA 3JZFA 2OXIA 1U0GA 4FWIB 1J8QA 1UMDA 4FFPA 4ARUA 1ZU5A 5FL7A 1WDLA 3ILXA 2ZYWX 3OKCA 1DT3A 1OLOA 2A0YA 3EWSA 4G01B 4ZKEA 2PLWA 1DKOA 4GBED 3INGA 1BW9A 2ZRGA 3AUUA 1ZBDA 3ZQ6A 1N5JA 4RK0A 5F1YA 3V6LA 3THWB 3WGMA 1I4WA 2UUOA 3PQ7A 3UHOA 5BOSA 4JYZA 3DVRX 4Z3OA 4RVGA 3WLHA 1E5VA 4L5AA 2VJAA 1M33A 4IGKA 4YHHB 5E38A 3WL7A 1W87A 3FROA 3L77A 3RS4A 3QU2A 4WOPA 3UH1A 2CV1A 1IWPB 2D7JA 1N6RA 2QY6A 3DMYA 3ILYA 4GQIA 2L42A 1NQUA 1WD5A 2FUCA 1RJEA 3GNLA 3E9QA 3OURA 3UJ8A 2X8JA 3WYBA 1PYOA 1UJMA 5FWAA 2MWMA 3OC6A 4X20A 4OXXA 5EWMA 5BNFA 2ZUBA 3JU3A 3AVWA 1WPXA 1O94A 3DKVA 5EJMA 1XKTA 2D2XA 2OLKA 1UBKS 1OWNA 5FFMA 3ND9A 5C34B 5AHKA 4UHCA 2H2WA 1CCWA 1Y42X 2GZRA 2O6LA 2I7XA 2R8EA 3UT5B 3LHDA 4I8DA 3VMFA 4DRXB 2JRCA 1QH0A 4KSYA 1UOPA 3IDZA 5TMDA 3ZHTA 3N2IA 2PDAA 4LFAB 4QRHA 2GM3A 1M2VB 3W8RA 5G0WA 3W9SA 1UDCA 1XWFA 1ZICA 3E15A 3I6IA 5JVDB 4HDMB 4Q4AB 2C9YA 3TGPA 2TECE 1YB2A 3LO8A 2C5LA 3HU5A 4PBTA 1JV2B 1G0OA 1LK5A 2R6GA 3LV8A 3Q0TA 4RXUA 5K3OA 1VKRA 1YXMA 2X9NA 2HRBA 2JIOA 2QR3A 4LSMA 4QT0A 2DWOA 3UJBA 3PKIA 1USIA 4MKGA 5HSGA 5IC6A 5EKDA 3UWSA 4C2UA 1EAYA 4E4YA 2OG2A 2CNWD 1N7IA 3CN7A 3EVGA 5ICSA 4ENTA 5AUQA 4IRXA 4ZCRA 1JDBB 2XB9A 4BNDA 1UMCA 4B7XA 1W0JD 5BR4A 1SU4A 4MRMA 4PU0A 3L0PA 2CLEB 1H3FA 2DQKA 4LZNA 1Y9DA 1Y3BE 4BIIA 1RM0A 3U4HA 4GHWA 2PZKA 3BDIA 1Q0TA 3ND7A 4G0YA 4D80A 3H8VA 5K3EA 1RQXA 3T3EA 2Z4TA 1C4XA 2EBUA 2WJVA 3WWCA 3GD7A 2A1UB 5TE9A 4TXJA 5K5EA 1X94A 1YJXA 1FU4A 2QP3A 1FJGB 4Y6RA 2B61A 5HW0A 4NOKA 4DCTA 5K8IA 2I71A 4UUAA 5GONB 3HM9A 2X4LA 4BDTA 2DUNA 3KQWA 1W36C 3HO1A 1V47A 2JBAA 1RWQA 3DT8A 3KO8A 4OP3A 1EBFA 2D54A 4S0XA 3T7AA 2WMYA 4M1KA 2VNIA 2GOYA 3HYTA 3L8ZA 1MQAA 4ZOCA 1ZD1A 4RTQA 2O3SA 4G5YA 5IAEA 5AESA 4HS4A 2RHGB 3H9BA 4RMIA 1AMUA 3S2ZA 3WQQA 5CU7A 3NTRA 4C4AA 2EWWA 2G6TA 3ADKA 4PG7A 1W94A 2GFIA 3VBEA 4D98A 4ZQFA 4CL0A 1O8CA 2X0EA 4AECA 3NS7A 4WZBE 2AJDA 1Y1KE 3G5UA 2A1TS 3NV9A 2DZDA 1EJ6A 1KEVA 3MMXA 1WF3A 4UZFA 2VPXA 4MYCA 2FP4A 1RHJA 3SKVA 4RJTA 3F5QA 2LVBA 2O3QA 2H7XA 3GLGE 1DWPA 3GT3A 3ZV6A 3P7MA 1HKHA 1WY7A 4D8YA 3ENVA 2B9VA 4JJEA 1A1VA 3DO8A 4EX6A 3PEYA 1GQOA 3RDPA 4F1KA 3M83A 3P4YA 1S2GA 4FWBA 4YH1A 4D42A 1WDMA 1ZGAA 3CV3A 3EY4A 3ZTWA 4ZVSA 1J8VA 3IAFA 3K5HA 4HEQA 2XW6A 4HDRB 4RXMA 5AM3A 1Z6YA 4RFSB 2EKQA 4PXAA 3TZ6A 1E4EA 1W96A 1BMTA 3NWEA 2R4UA 1SXJD 3FNIA 3LF2A 2WWXA 1YVUA 5DCLA 4CLEA 3GLFE 5CDGA 2OCKA 2JFWA 4C2TA 3JQAD 3FPFA 2YMPA 4D6YA 4W5HA 4CKZA 1FUIA 5IRCD 3UG7A 1YZHA 3BDVA 4ZDKA 5L45A 3HR8A 4CKEA 1Y8QA 4NCXA 2NUTA 1RJFA 5BN4A 1N36B 1DVRA 3MS7A 4EHAA 2WQ7A 2AQKA 4XOUA 3RVOA 5A4MS 1V96A 4BO9A 4GLOA 3M2PA 2FQWA 4BB0A 4FFVA 5IAAA 1RM5A 3OZUA 3P5SA 3W5VA 1P2BA 4F93B 1NJ6A 2O7VA 4LTMA 4EKDA 1NYRA 5JPDA 2P67A 1ISHA 5CA0A 1MDFA 1B1AA 1GTL1 3CLRC 3I1YA 3OZEA 3QOWA 4OBBA 4MR9B 4TTPA 4ZDIA 2JGJA 3QGMA 2H31A 2JLVA 1PZHA 4QJ5A 3DOUA 1QC5B 3IUJA 1WEHA 4L5JA 1SKUA 4WH0A 1S9HA 2QG6A 2FSPA 3OQPA 4K9MA 3QVGA 4O2AF 2B30A 1UM8A 3DDUA 1KE2A 3LT0A 3B1ZA 3D7KA 5EI5A 2IP2A 2W2XA 4BBZA 1C3JA 3LT2A 3RD5A 3W06A 1FF9A 4P92A 3CPSA 1DUSA 4RFVA 3BD8A 4FZRA 2VSNA 4XM2A 2VUTA 4DWOA 1VHLA 2GXSA 1FYFA 1K6EA 4G09A 2NAFA 2OGUA 2JJ8A 3R5JA 1OHHD 2R751 1RYDA 3O8QB 4DMCA 4B6OA 3OKFA 4JSRA 3ONNA 2RGAA 1Q12A 4KIJA 3BWVA 4V0OA 1KJZA 3M6UA 1PQWA 1LRJA 1YI1A 3LGAA 4DDTA 3LKVA 4YRCA 4ALIA 2AMLA 1H05A 5CDHA 3T5PA 4BLPA 4YRLA 5JC1A 3IEVA 4A8JC 3BOSA 4MWGA 1JTVA 3T4EA 3NI2A 2XB2A 1T6ZA 3K6SA 4JFAA 1KEKA 3FPHA 5ANRB 4MWOA 1IEXA 3RIXA 4CKCA 1WBJB 2PIAA 3ABOB 1B43A 1DAFA 2OECA 2Z1MA 1JUDA 3BHNA 2VCEA 3CR7A 3NYQA 4FFBA 1KO4A 4MCAA 2ZBEA 2BFAA 4N6GA 3HKDA 1SXJB 1G55A 2H5EA 3TJRA 2YX1A 4Y9UA 5A71A 2M6LA 3F46A 2IOYA 3KQTA 4PNPA 5I7WA 3UCFA 4NRDA 3ESAA 1P1CA 3JQAB 4N18A 4PGAA 2G4LA 2VZEA 5JR3A 1DC8A 1YBHA 3BD9A 3KEOA 1HNZB 1Y5RA 3EGIA 1XZFA 3I1FA 3CQ9A 2O2JA 3O8DA 3OOSA 1H8HA 3Q7SA 4GICA 2FUNB 5K3DA 5DK4A 4NSNA 4ZU1X 3UXEA 3B9PA 4DDHA 1ZK4A 1DBSA 4N8SA 4YUVA 4S2UA 4US1R 4ZYVA 4AUKA 1XGKA 2EP7A 3AKCA 5JTTA 1AA6A 2WVGA 4LCJA 1KYYA 4OXKA 3T9CA 3RHSA 4ZA2A 2NM0A 3F5FA 5H9VA 3A9RA 3QPBA 3IIJA 4KCGA 1E9VA 2Q3LA 2MR6A 1Y1TA 2YV5A 3D3NA 3FW1A 3WOVA 4Q4CA 2OTCA 2WINI 3V8NA 2ZT8A 1A8IA 1N78A 1NQVA 4H7KA 3WOHA 1OFHA 1XLWA 4Q3AA 5K8UA 3STYA 3DG9A 2GJ8A 1JDTA 3KZOA 3MTGA 3IVRA 3IXMA 1JE0A 4YQYA 5SZKB 3Q2KA 4HQ6A 4KYTA 3OJFA 5FDFA 2HMUA 5AH0A 1RYBA 2PXHA 5EG5A 1BX0A 4V38A 5LDDC 2XIJA 1PR2A 4XJTA 2JLWA 5KO2A 1YOVB 4LJLA 1GSAA 4NK5A 1RLOA 1E18A 1YIDA 5KTKA 5DM70 1SD5A 4RK7A 4B4WA 1NVMB 3JYOA 4K1LA 1FW6A 3FZGA 2AC2A 2Z4RA 3NUQA 4C22A 4M83A 3KCNA 2YNMC 4WWHA 5IK2A 3T3HA 1I4TD 2OZLA 3D1LA 4B0PA 3OVMA 1E3WA 1DOAA 4ZVNA 2KX7A 3AJAA 3BBPA 4G07A 3O4HA 4KQWA 5DM2A 4LDPA 4FIDA 2R97A 1JEJA 4KFTA 4ZEVA 3O1LA 4X63A 1SKMA 1WMFA 4IMIB 4JAVC 5JO9A 3IJRA 3QP9A 2ATVA 1XB2A 2FPGB 3GVCA 3HCFA 4XGIA 3R8XA 1RE0A 3LDHA 3QEOA 4YP0A 2GDJA 1DP4A 1IN8A 1MVOA 3FDJA 4PQEA 2W7TA 2GD0A 2EL9A 2O50A 2OO3A 1NNUA 3WMRA 4RVCA 2GM5A 2I65A 3IUYA 1CY0A 2XNDD 4URUR 5BSWA 3RADC 2EZ9A 4WZAE 3OKPA 2ECKA 2ZYHA 3FCXA 3AG6A 3HNOA 1CW2B 2IYUA 4XIGS 1SVOA 5FWYB 4GF5A 1YVRA 1ZL0A 2HF2A 4GGPA 4NARA 4OSEA 4C6RA 3TGWA 1I0LA 2NZVG 3DLIA 3WRVA 5BUSA 2YTZA 1L2TA 2VJOA 3PHGA 4AY4A 3DPUA 3D2LA 3G2JA 5JHHB 5F9MA 3FFXA 4BQRA 1ODLA 3F9IA 1UZNA 2XMSA 3FUXA 4RAQA 5EJIA 3EOZA 2Q41A 3KXDA 4LYEA 3DQQA 2ZIZA 2J6CA 1FUUA 4YCJA 3HS3A 1Y7LA 2OZVA 4XD7A 2GEVA 1Z63A 3E3OA 3SMVA 1T4DA 2D1FA 3V3KA 1IDN1 1MRNA 1WKBA 2YV2A 2ZT6A 4LISA 4PTZA 2B1RA 2NVUA 3I04A 4OJQA 2QL6A 3JWPA 3V3TA 3RANA 1ZN2A 3FCOA 3F67A 4MW7A 4RHCA 2B78A 2VL7A 1MCZA 1UFQA 4QTXA 2VK1A 1PR5A 1UBJS 2PXAA 8AT1A 5B1HA 3OZVA 5CD9A 2CMHA 4B7ZA 5JTUA 1E4YA 1Z17A 4S35A 3DF9A 1X70A 3IA7A 4YT2A 1VCMA 2IPMA 3VR3D 1ORTA 4B6FA 4B46A 2ZB3A 5AQEA 1F48A 3M34A 3EUEA 3KKOA 3H5LA 2WIFA 2LW7A 5KBYA 3H3FA 4EQ6B 1EVIA 1KI4A 1EXNA 1U1GA 1DIAA 4ZV4A 3AVQA 3CX3A 2IHNA 1K5DA 4FGKA 4TKUA 1KMIY 3CNNA 4ALNA 2BKUA 4HVAA 4Y2QA 3AY0A 2DBRA 2XQGA 4ZJZA 3DZGA 5JXIA 5HQJA 1ATIA 1OV4A 1Q0LA 2GZHA 4ICIA 3O8NA 3PUIA 2WHXA 4MVJF 4DDKA 3FYHA 4DSZA 4F71A 2R4TA 5FPPA 4KXUA 2ZUSA 3BGSA 3ELUA 4OHOA 3EVCA 4H9GA 3C1UA 5K0LA 3IAM6 2QMOA 3J7TA 3NDIA 3U1TA 4RL6A 5ITZB 1XZGA 1EFPA 2W42A 1C4OA 3Q8MA 1QM5A 3Q1LA 5FL7D 2OORA 4S1TA 3G7SA 4IWYA 4BEJA 1VG0B 1XTPA 3K0FB 4MWSA 1GRQA 2K7FA 4XWTA 3EXIA 5ALGA 4CIVA 4B4OA 1Y1RA 4MI6A 3UW3A 1R88A 1ZJWA 3BDAA 2IE8A 2WVHA 4HK4A 2QSZA 2IX9A 2BTQB 1VPEA 3BL8A 3JAKA 1WG8A 3OEYA 4WDRA 4YN3A 1A50B 1NJ8A 2NO1A 4TV9F 4OI1A 3GFSA 3RF6A 5KYKA 1I01A 5FOUA 3G2OA 1ITZA 4RMNA 4I4TB 1MFPA 3AONB 2RARA 2ZJAA 4LXTA 3N2LA 3PGMA 3UJAA 3A2MA 1Q1BA 1H0SA 2OBXA 3A6KA 1J0DA 2GH1A 2JCBA 1YRHA 5IEBA 2GERA 4GX1A 2BYTA 4MKFA 1JSLA 2OVFA 1SBNE 3F3SA 1P4JA 4P33A 1EM8B 3OZBA 4Q3OA 5IM5A 1BCRB 1DBVO 4DJEC 1ECJA 2DUWA 1Z7YA 4D44A 2P2DA 1EVKA 5KKAA 3UFXB 1HGXA 1HTWA 2BSXA 4I36A 2O2CA 2ZSKA 4JEMA 3R23A 3DOCA 2FEWB 4QGSA 5JLJA 4TYNA 2ZT5A 1XA0A 4LBWA 3OOWA 4I1RA 5IUJC 4KBGA 1VLJA 2AZ4A 2PEZA 4Y7CA 3RTAA 1UDXA 4CM5A 3LO5A 1ISMA 4DY6A 5BWBA 4PCAA 3W9BA 3UHPA 4F6CA 1LDEA 2P2CA 4C7VA 5KX5A 3ABZA 4I46A 5EKUA 3ADDA 1Y3IA 1Z8NA 4XLZA 1RJGA 2Q6TA 3HWSA 5CVEA 1KJ8A 1RRGA 2OENG 3GRCA 1Z0SA 2FPPB 4B0OA 1BWRA 1K88A 1UK6A 3GJZA 1PD0A 4IIUA 3T5MA 3ADOA 2FQ1A 5K0GA 1XZHA 2VYFA 2CDNA 2J08A 3DBHA 3A1DA 4LHEA 5BSTA 5LQNA 3OCXA 4CTJA 4E1BA 4P7GA 3AOEA 2I4NA 3FSGA 4ZCSA 2D13A 3BKXA 2WC1A 2JLXA 1CU1A 2NG1A 3L4JA 1M74A 2GRJA 3O3NB 4WECA 3SVZA 2OUIA 4OP1A 4QGBA 4Q03A 1YS4A 4IDCA 5I9TA 4F2WA 4IR7A 1NW3A 1NHGA 1J00A 1RC1A 5I9MA 1UMDB 3NO4A 4KQ2A 2VDPB 4ZQEA 3B48A 3OIUA 3Q12A 4NE9A 3OU6A 4R40A 1AKNA 3TN7A 3VVLA 5ALVA 4YIHA 3AI7A 3LPAA 4MIYA 1BW9B 3N8IA 1RWBA 1XD9A 3CLTC 1D2NA 2X15A 2OOKA 3D81A 1MABA 1NXTA 1P9NA 1U6IA 1JS1X 4G97A 4ISBA 1UC4B 4MS1A 2DP4E 5BOSB 1N0IA 3HR4A 4ZC1A 1L4HA 1H2WA 3PCTA 1YB4A 3FCUB 4RIEA 4UM8B 4C0WA 4F12A 3SFZA 1I4EB 1Z56C 2ZI9A 5ELMA 5JOQA 4EFNA 2FUKA 2MT9A 1A27A 1PZFA 1ZM3A 3RO7A 4W99A 3SVTA 2X1MA 4DUPA 2UXDB 3VTKA 3JX9A 4L3WA 3TW4A 4MKZA 3IYLW 3UMRA 3DR3A 4YMLA 1H69A 2J85A 4OA8A 5HWSA 1BFKA 2GZ2A 2X8JB 3IJPA 2WWHA 4ZAFA 5IG2A 5CA1A 2UZIR 1SCBA 4D43A 4X20B 1T25A 3C6KA 5EWMB 3T9EA 3DMNA 4UQLA 2H59A 5K3FA 1DRWA 1EUDA 1Y3FE 2A57A 1Q57A 1XO1A 4EFDA 4A0FA 2QSJA 2VRNA 4POAA 3EEFA 1X3SA 1RXIA 2CKMA 4HWOA 2ORIA 4XRGA 3PE6A 4MQMA 4NY1A 2VA9A 4RMJA 2XBLA 2ZE7A 4YCSA 1TM2A 1CQXA 4DR1B 2O48X 4YWHA 2B69A 5L3SA 2RCNA 3HU3A 3M4ZA 1U3GA 2PS1A 4DSOA 3BXFA 3MTIA 2V7QD 4QGGA 3PF8A 4UOQA 2PUWA 3EIOA 3VR0A 1KA9H 1PTJC 3F6RA 4S3MA 1GCGA 3BJRA 2EBWA 4ND6A 4D3DA 4D9EA 1G6Q1 3FPCA 3HK2A 4DR2B 5FYDA 3G9XA 4JLMA 4U7DA 2DYKA 3ANMA 1QZUA 4S04A 2OGTA 2FN7A 2EEZA 3CUVA 2DECA 4MGYR 4DLTA 2IC5A 3RGGA 1QK4A 2Q62A 1K8RA 1BAPA 1E9FA 1U94A 2AF4C 2CDCA 4JCOA 1TDJA 3IUNA 4E5MA 1DQYA 4XSVA 4BNDB 1UMCB 2DBZA 3EGVA 3NVMB 4LXUA 1XQWA 1JDVA 4MRMB 3GMTA 3GRZA 3T5CA 2FAXA 5HFNA 1V3TA 2KYRA 3X1XA 4ZK2A 6NULA 2VWQA 5M04A 1VPDA 2DKFA 3JWEA 5LD2C 1DKMA 2ZS7A 1FFWA 4WN3A 1X7YA 4UVDA 5EJ7A 4CHTA 4BX2A 1SZDA 4C2AA 2WSIA 4CGZA 5A3VA 4BMZA 5CLFA 4B6QA 1H42A 3IO5A 4LKRA 4JMLA 1I5EA 3BWEA 1CERA 4XQ0A 4CZ2A 2A9KA 4KE9A 2ZE6A 2P9BA 3CISA 5SY9A 1U5CA 1PZGA 3ELDA 4LDNA 1XAJA 2KPOA 3TLZA 1GNRA 5F7OA 5D7BA 2JBAB 1XAIA 4RJLA 5F1KA 4AZSA 4FB4A 3PEWA 3ESDA 2BHSA 4JLVA 4CF7A 4K8RB 1MVLA 1N6IA 3PQ3A 3ZLBA 4D0GA 4B09A 1C0LA 2RB4A 3JVIA 1UKAA 3UJ9A 2WY2D 2L82A 2OD9A 1Z4IA 2EG5A 2MSKA 4EG0A 1JVSA 2O0HA 2RIPA 3PITA 2HBYA 1Z62A 4R1SA 3WL3A 3ERCA 3PLNA 2Q0SA 4FR5A 4NULA 1DX6A 3O93A 3BGDA 5BORA 3KQLA 2WLSA 2ZYIA 2C9BA 3OPMA 2JD0A 4G1MB 1G3UA 1E0AA 3C3DA 4WKNA 1SKQA 3REGA 2XUZA 1OOEA 2WUEA 2VI5A 2F1JA 2FP4B 3R3VA 3SP1A 3OLQA 1N2EA 1P7YA 5AM1A 3GFQA 2NZYA 1US8A 2Z08A 5ALQA 1KQNA 1GZHB 1JQLB 2I7VA 1AA9A 5HIAA 1HKUA 2X3YA 4B6EA 2O14A 4KTTE 5I9IA 4EHNA 2XB8A 3IAEA 2QWXA 4UVGA 3C41J 4ZEXA 3GT7A 4D5GA 2EJUA 3PKJA 1NVUQ 4EEXA 4QTTB 2F1KA 4AQYB 3P2OA 3A0UA 2AS0A 1VPLA 1E4EB 2B2NA 2QZZA 5DI9A 3WR5A 3TAUA 4PV7A 5TJHA 1NBAA 1GPMA 1QGZA 3RSHA 1B8OA 3D0RA 1U99A 1VJ5A 4MQFA 1JG6A 3ZHSA 1FVXA 2H0RA 2PE5A 5I9LA 4IUDS 2BOVA 1G2OA 4CKEB 1Y8QB 2NUTB 4JGGA 5EZSA 5BN4B 3DC2A 4LWPA 2AOVA 1PJ3A 1H8HD 1V43A 2VDRB 1MOPA 2ZKLA 3IVGA 1GUFA 1KJWA 4IS2A 4OAQA 3SBDA 2VHQA 3K4HA 2HNBA 3UGQA 1XJ0A 4HYYA 5EERA 2ZJ1A 2GEFA 4LY0A 1RXYA 4C14A 4TQGA 2BH9A 1TW2A 3C3MA 2DE0X 5FXMA 5CA0B 1NJ1A 2ZVDA 2IZOA 4A1OA 3VNAA 4I1OA 1HXHA 2DH5A 1C2YA 3GJ5A 1GT91 2X42A 4B17A 4BAGA 4L78A 5M29A 1WP4A 4KIFA 1CPYA 3W90A 3B5IA 4PONA 3RUAA 6REQA 3QVGB 4ZO9A 3IOYA 2A0KA 4OVKA 4ESVA 4ZHSA 1LLQA 1XNGA 1JZQA 4DKXA 3C8UA 1UANA 1KETA 3HVJA 4IXNA 2YMLA 3DLTA 4FYJA 3TFQA 3T5BA 3TPFA 3TMKA 1XDDA 3CMMA 5C8DA 1Y98A 5KTPA 3M6MD 3GDOA 3GT4A 1XFAA 3VZDA 1GN8A 1CNMA 2H54A 1FX1A 3RTBA 5IZCA 4D0SA 5L3VA 4ZT5A 2RGNC 3B1VA 3BSYA 2FP3A 2YS7A 1SCDA 3ZGZA 1LB1B 1I0ZA 2ATIA 3T38A 3DKRA 3Q0IA 2Z8YA 2BGRA 3C1AA 1SBZA 2PTHA 1KNQA 1QDEA 2CHVA 2GQ0A 3DA8A 3QU9A 4NFSA 4OKSA 3REFA 4BMCA 3K6SB 3D7MA 5F78A 2QYHA 4J7AA 4KOEC 3WL5A 1FVFA 3BYZA 4O4HA 1QG2A 4CKCB 5IU6A 1JIVA 4DDVA 1DAEA 1NY5A 4FFBB 1VB3A 3SR3A 2H65A 4OOFA 1B8VA 1PJSA 4MUJA 3WLPA 3T0GA 4R0MA 3W8FA 4BC1A 1GKKA 4L27A 2C04A 4PLHA 3F3MA 3S44A 2RK6A 2IHZA 4GGOA 4I3GA 4RKRA 1JXQA 3EGCA 1J8MF 1K68A 3O4FA 4A03A 3TFOA 3ESBA 3FDFA 1H22A 3NDJA 4OJTA 4AP9A 4J49A 4NH4A 1QE3A 5NLLA 1CUUA 4RK4A 2XWQA 621PA 2XEDA 3KAJA 4LBVA 1RW4A 4YQEA 1G16A 1OTXA 3N07A 4KYVA 2HKIA 2OB2A 2OC9A 2WJGA 4JJ6A 2IH5A 3HXTA 2IZ0A 3G2QA 4RUKA 5LQAA 1JH9A 3JQ7A 4XD7D 4IV5A 2YWXA 3OIDA 1HQKA 4HB2A 2ERCA 5GINE 2PJDA 4FI3C 1SUDA 3VO2A 3WGLA 3T94A 4IQGA 3HH8A 3IERA 3FHCB 3PJFA 2VTKA 3K8QA 4V1CI 5T3UA 4BQOA 3KJGA 4Q21A 1KAMA 2H29A 4AKSA 4F9FA 5CITA 4Q48A 1AQ6A 4PS1A 2BGWA 2CV0A 3B1KA 3TE6A 4EHFA 5K45A 1RZVA 3PE3A 4CEIA 3SWWA 1G21A 2XSZA 4C87A 2LCIA 1XRSB 3QX7A 2QRQA 1PR9A 4NBUA 2FA9A 5AKGA 3LBAA 1Z0IA 3G17A 1ETHA 3V9AA 2XNSA 5E9QA 4DV2B 1EU1A 2YXNA 4HB0A 1PLKA 3P9QA 3VXKA 1QIMA 1TUIA 2OZLB 3E4CA 5DIFA 2QN7A 3G9UA 5EIFA 3RG2A 1UZMA 2V6JA 1TVCA 4IJQA 4P3XA 1DARA 2ESRA 3HZHA 1U3FA 3FMGA 1H3EA 4DWWA 1GUYA 3MRXA 2L18A 4OQLA 3ZWNA 3T9DA 2OBNA 1TA4A 2ANCA 2I6UA 2QLFA 3GFTA 4GI1A 2G28A 2B35A 3DAYA 1UXGA 4LC9A 4QWWA 1A8QA 1KZ6A 1KZ4A 5E1MA 5DSTA 5J9FA 3V1LA 1AQYA 2CMKA 1ZNYA 2A92A 1E7YA 3C70A 3OEED 4HWRA 3SX0A 1SC1A 1NYLA 2Z6UA 2XVZA 3BTUA 4P7BA 3FPLA 3IQFA 2ZUFA 1G6KA 4Y3UA 5E3JA 3ZS8A 3LA6A 1PFGA 2LPMA 2PGXA 3VKFA 3AHFA 5KPJA 2XUAA 2QMEA 3PJGA 2V59A 2X7HA 4B81A 4KJXA 3ZHVA 1Y6RA 3KEGA 4BIMA 3RVMA 3KCQA 1ULTA 1MTOA 1QUFA 2YJNA 3Q7TA 4R1NA 4D9CA 4A91A 1KR5A 3UMJA 5LA6A 1XCMA 2BCEA 2PJUA 2FH5B 4KPUA 2OCXA 3D5EA 3R6GA 3L40A 2VH2A 1YR8A 4CM7A 3DMTC 4O59O 1XQ6A 2BHLA 1W52X 1VSUA 3CEHA 1EQ2A 3P94A 2PLRA 5FB3A 2ICAA 3GA5A 4GRDA 3UWKA 1S4QA 4LN1A 1FDTA 4LJ7A 1D2HA 4BKPA 1A8SA 1BD3A 1PZNA 2XA2A 1EZ1A 4HNSA 2NVUB 4Y2TA 1Y5LA 2HRCA 2VJCA 4YV0A 5EXTA 3E3NA 2PMKA 3YASA 4XVCA 2R5NA 4S05A 1B14A 2PVSA 2HMWA 2YXLA 5B64A 1D1QA 1HL3A 4E15A 1ZRMA 4AWBA 3M1YA 2PIDA 1UPCA 2Q5FA 2GN6A 3IR5A 1Q7CA 1HDZA 2WUGA 2DLNA 2I2FA 2IPNA 3DE1X 3LYHA 4A2CA 4A0HA 5AJZA 1UBSB 4IG4A 3C6YA 4RHTA 4DQXA 1WB5A 4HTAA 4V1CA 3PR3A 5EIAA 1GYPA 1IZYA 4JL8A 2I6XA 1O77A 2H9YA 2ZRAA 1FBNA 1EP2B 2JJ2A 1EDZA 4KQCA 4TKUB 4DQ0A 3QX3A 3WDMA 2HBRA 3RASA 3TO5A 4ZTBA 4PLWA 2MCFA 1YJ5A 2Z30A 3BCSA 1M6VA 2G7ZA 4DOMA 4B6GA 1E32A 1RKXA 5LIPA 4GZMA 1ANKA 1GUAA 2WU4A 4O4IF 1KFBB 4NENA 5IULC 5K0JA 3U7HB 3SJCA 2CV2A 1VC2A 1VSVA 4AURA 3L7CA 4N7RA 4A8JA 4BLUA 2P2LA 1I3LA 3FSGD 1UWCA 1JEDA 4ROTA 4UREA 5G4KA 5H59A 4Q7EA 2ZPTX 3C43A 2Z2YA 1GWNA 5HXAA 4F06A 5BR1A 3EEYA 1NT2A 1PNVA 4L74A 3WP1B 1NJSA 2IXFA 4L8YA 1EFPB 1FP2A 2B0CA 3QTLA 3RIEA 2ZBVA 3H8JA 1M66A 2XCUA 4TPKA 3EXIB 1NF9A 3GROA 3NC1C 4QUJA 3IRVA 4QL3A 2QX7A 1NBEA 1NURA 2DBYA 3H5OA 1W8IA 5EHNA 3FTDA 3GFBA 3JAKB 4ARZB 1MH1A 5A06A 3NIBA 1E2QA 1EX7A 3QLUC 5IN5A 1V8FA 3WHIA 1N92A 1BS1A 4HFJA 4BMXA 721PA 4KQHA 2Y1FA 4R8MA 2AJTA 3MJHA 4MIOA 5HF8A 1SOAA 1I0IA 4L0QA 3KQSA 4WKBA 5T4BA 3NBFA 2YOHA 4U9HS 2ZYSA 3ZK7A 4U2GA 2HSWA 2JBHA 4HAWA 3RS2A 1ULUA 2H2GA 3RBXA 5A9RA 3UHFA 2ZRCA 4LBZA 3ZZMA 1KJYA 2OFFA 3STVA 3UMGA 5BN5A 1AXRA 1UC8A 1XNHA 4R5HA 4A2WA 3ECAA 1YDWA 2Q3DA 3OPNA 1TCBA 4HDNA 3CJRA 4K26A 3IT2A 1QIIA 1QRAA 1UKCA 1WM1A 1YBMA 5ADUS 3LI2A 2WF7A 2W58A 4ASUA 4N03A 1ZN8A 1OA0A 2VFAA 3L6BA 4TWBA 4FHFA 2ZJFA 4UKDA 1UCFA 1MX3A 2ZUUA 2J45A 5KVVA 3VVCA 2O7SA 5DMHA 4OF4A 5DWQA 3UA3A 2OHIA 1ULSA 3OFKA 4MW6A 1NP3A 3HDJA 3N9IA 4XZ3A 2EF0A 5B53A 3AESA 5KX5B 2P9HA 4I4NA 2C5SA 1N5OX 4UTNA 1QLWA 2YNMA 4TZTA 4NATA 4WBXC 1FYEA 2ZJZA 2YXBA 3H7IA 5TY0A 1SH7A 1DWUA 3D2BA 4JI5B 5I7EA 3DBHB 4KPFC 1L7NA 1V9CA 3GEGA 3OSZA 4XXHA 1PNOA 3ABRB 3KOXA 4IH1A 4S24A 4YAOA 4ZEOA 1XNRB 3IR6A 5HJ5A 1CQZA 3GGGA 4FNOA 5CVUA 1TYBE 5FA5A 5JNUA 1RPZA 4FHCA 4Z6KA 4M86A 1BJKA 1QVAA 1NQTA 3UWDA 3VC3A 2CHGA 1H5NA 3F8WA 3GLKA 1RKUA 3V48A 3LE8A 2QLNA 3F2IA 3H13A 4GOJA 1NU8A 4C0AC 4V03A 1CETA 4LRQA 4F8JA 1VJTA 3OX4A 1IUOA 3A05A 4RD0A 4URXR 1MABB 2DM6A 2EFEB 2JH3A 3ORQA 3DTNA 3GJXC 1UIRA 3AT1A 3FE2A 2Q2OA 3K9NA 4MS1B 3ZVLA 2RHDA 4D0NA 3AQIA 4ZYLA 4Q6BA 1LBHA 4DCNA 5DHPA 5K1ZA 2NZ2A 4AY5A 4ZJPA 3KSAC 2IS2A 5HNKA 3B78A 3DOJA 3MOIA 1T8UA 1YRWA 1Z5VA 3ESCA 5AI4A 3FTQA 3ZEAA 4A73A 3N0WA 2D3WA 2AOWA 4F92B 2JHPA 2XZOA 4FSDA 4EYGA 2I0FA 5CMLA 5CM9C 2Q9AA 3E81A 3I83A 3KJZA 2EKPA 2OK7A 2PZ8A 1ZXBA 4JT9A 5SICE 4DMUB 5CA1B 4QO7A 1JVBA 1HY3A 4DLYA 2BONA 5JWHA 5K3FB 1PK7A 1EUDB 3CKMA 1JALA 3KLOA 3PR2B 2HWKA 2HPZA 2YZMA 1QTQA 4UUPA 1ML4A 1ZOOA 4H16A 4R2IA 2W9XA 5H16A 1FYDA 4G0UA 1JDZA 4Y6PA 4AN4A 4JHXA 2AQHA 1M34A 3I5AA 3L0OA 3HSSA 1WB4A 4IPTA 3EDOA 5DZSA 1L7OA 4JVSB 5CYGA 1R9JA 1GKLA 3AW8A 4O2BF 5BT9A 4C7KA 3AU9A 1APBA 3NR2A 1AO3A 1GGNA 2WWTA 3Q9UA 4GOXA 4IRUB 5L3SB 1HK7A 1UZLA 4NU6A 9GPBA 5AKLA 3MWLA 4JN6B 1KERA 1MAVA 2DFLA 4IGFA 4M2LA 5HK8A 1R66A 2AG0A 4QXQA 1HRDA 5TQVA 1E0JA 3P32A 1IBLB 1PD1A 5KNDA 2ZATA 4H1HA 4HS9A 1NP7A 1D8AA 2X22A 1VE3A 2OZPA 3T7CA 3GIWA 2QNIA 3FDXA 2M98A 2YASA 1GZSA 3M70A 3PBKA 4I1VA 2CC2A 4UEWA 5EWJA 2HMTA 4LS3A 2YRFA 1IWBB 1V6CA 3JYQA 2BCJQ 5IP5A 4H17A 5F2EA 3DS8A 4U7JA 3IHWA 3RR2A 1W19A 4BNGA 1WBBA 2PX4A 3DM5A 2E49A 2IYTA 4O4LA 1HLGA 3E9ZA 3U81A 4AP6A 5I7HA 1L3IA 2PGNA 4WJLA 3KRTA 1QYRA 2WICA 3EF1A 1KYQA 5JYCA 1QPGA 2YC2C 5IBQA 3ZXYA 4H35A 4OHZA 4BN0A 3LHKA 4P80A 2O0JA 4H4DA 2VPTA 2VJKA 4CL3A 2AWNA 2BEWA 1D6SA 1V2HE 3VSAA 1ZJYA 1CDDA 2O8VA 3GXOA 5D8DA 1QHHA 3NHPA 5DMXA 3AO0B 1EFTA 4ZI7F 3O31A 1ULBA 2OQ2A 4RYDA 5D85A 1E3LA 4QM6A 1O54A 2OQVA 1VKNA 5EINA 3JRNA 2FMKA 1E2NA 2L0XA 4E5KA 1R6UA 4B6RA 4CDGA 1L5FA