3F7OA

Crystal structure of cuticle-degrading protease from paecilomyces lilacinus (pl646)
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
284
structure length
284
Chain Sequence
AYTQQPGAPWGLGRISHRSKGSTTYEYDTSGGSGTCAYVIDTGVEASHPEFEGRASQIKSFISGQNTDGNGHGTHCAGTIGSKTYGVAKKTKIYGVKVLDNSGSGSYSGIISGMDFAVQDSKSRSCPKGVVANMSLGGGKAQSVNDGAAAMIRAGVFLAVAAGNDNANAANYSPASEPTVCTVGATTSSDARSSFSNYGNLVDIFAPGSNILSTWIGGTTNTISGTSMATPHIVGLGAYLAGLEGFPGAQALCKRIQTLSTKNVLTGIPSGTVNYLAFNGNPSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structures of two cuticle-degrading proteases from nematophagous fungi and their contribution to infection against nematodes.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Serine protease
total genus 105
structure length 284
sequence length 284
chains with identical sequence B
ec nomenclature ec 3.4.21.-:
pdb deposition date 2008-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3f7oA00
2HPZA 4M1ZA 1LW6E 1S01A 1KDZA 3TI7A 3VSBA 1SN7A 1Y3CE 1Y3BE 3VHQA 3TI9A 3DE2X 4H6WA 4HX2A 2Z57A 2ZWOA 1WMFA 1PEKE 2P4EA 1V5IA 2PKCA 1GA1A 1SCDA 4GI3A 2X8JA 2PRKA 1SIOA 5CW1A 3TECE 1SUAA 5SICE 1P7VA 2IXTA 3DWEX 2DUJA 4NMXB 4BWGA 5B1EA 5K7SA 2ZWPA 3WQBA 1SUDA 4J94A 4OV6B 3QFHA 4ZOQI 5JXHA 1Y9ZA 1YJCA 1SBCA 1WVMA 1ZVJA 1Y3DE 2WUVA 1PFGA 3GCWA 4KPGA 3VV2A 4NE7A 3DE5X 1YJAA 2W2NA 5ARCA 3DVRX 4HVLA 1T1EA 3GCXA 1HT3A 1GA6A 4LVNA 5JXGA 3F49S 1Y34E 1C9NA 1TO1E 1SBNE 2SICE 3H42B 2WUWE 2ZRQA 2Z2XA 4B5LA 2X8JB 2PMWB 3DW1X 3Q40A 3EDYA 3LPAA 1MEEA 3AJ9A 1SUPA 2Z2ZA 3L1KA 1WMEA 1OT5A 3A3PA 2SNIE 4OMCA 5FFNA 3A3NA 3VTAA 2V8BA 1NDUA 1THMA 1AH2A 1WSDA 4YN3A 1R6VA 5JXIA 3I37X 1YU6A 4I0WB 3DE3X 4AKTA 1SELA 2PWBA 1BJRE 1TMGE 1UBNA 1SVNA 5AVJA 1R0RE 1TECE 5I9SA 1T1IA 3P5BA 3DE7X 1AVTA 2G4VA 2SBTA 2W2PA 2WV7A 3F7OA 1EGQA 1ST3A 5FAXA 1KDVA 3UNXA 1EA7A 3VV3A 3DW3X 3DDZX 1KE1A 2DQKA 1Y4DE 2E1PA 3DE6X 4DZTA 3AFGA 1DBIA 1SIUA 1SPBS 2GKOA 4OMDA 5AMXA 2W2MA 1C3LA 1A2QA 1Y48E 2Z2YA 1GA4A 1SBTA 1Y1KE 3WIUA 3PTLA 3GT3A 2DP4E 3DE0X 4NE9A 1BH6A 3EIFA 1Y3FE 5AQEA 5JMOA 1ST2A 1YJBA 1TM4E 2ID4A 2PYZA 1GCIA 3BX1A 5JXJA 3WIVA 1SCAA 1TM7E 3F7MA 2ST1A 2Z56A 4C3VA 1TM1E 1AF4A 3VYVA 4MZDA 3DYBA 1AQNA 2Z30A 1P7WA 2PQ2A 3D43A 1SBHA 2SECE 1SCBA 3GT4A 3SICE 2QTWB 1SCNE 1C9MA 4FONA 3EE6A 1SUEA 2W2OA 4H6XA 4KB5A 1S02A 2Z58A 2XRMA 3I34X 1XF1A 4JP8A 3ZXXA 1GNSA 3I2YX 1DUIA 1SUBA 1SBIA 1SUCA 1TM5E 3T41A 1Y4AE 2XTJA 2IY9A 3LXUX 1GT91 3OSZA 1KDYA 1MPTA 4LVOA 1IAVA 1OYVA 1SIBE 2HD4A 1S2NA 5FBZA 3CO0S 2ID8A 1AV7A 5B1DA 1BFUA 1GTG1 2B6NA 1NDQA 3SQOA 4WOCA 3DVQX 4AKSA 1PTKA 3DE4X 1TO2E 1V6CA 3LPDA 4H6VA 1BE8A 1JEAA 4KG7A 3ZXYA 3CNQS 5ARBA 2PWAA 1BFKA 3DVSX 3Q5GA 2W2QA 1AK9A 4CFZA 4DWWA 4CFYA 3BGOS 1SCJA 1ZVKA 1AU9A 1BE6A 2WWTA 4K8RB 1OYOA 3AJ8A 5AVKA 1GTL1 3I30X 1Y33E 2TECE 3A3OA 1TK2A 4RYDA 4DJ5X 3WHIA 1C9JA 1CNMA 1T1GA 1NLUA 1IC6A 4ZARA 4CG0A 3QTLA 1PJ8A 1TM3E 1VSBA 3D9QX 3QMPA 1Q5PA 1R64A 3DE1X 3LPCA 1P8JA 1WMDA 5ARDA 1KE2A 1GTJ1 1SH7A 4WOBA 3PRKE 4C3UA 3HJRA 1GNVA 4Z2AA 1CSEE 3BPSA
chains in the Genus database with same CATH superfamily
2D5LA 2XX3A 3NALA 1ISRA 1PQUA 1P1FA 1M3SA 1WS6A 3DXXA 4RD1A 4LSGA 3SWWA 5KYYB 1GT6A 3WGQA 3K5HA 1TA4A 5G0TA 2EBWA 3IRUA 1RMTA 5BSVA 1JKJB 1P17A 3PA8A 2NQTA 3MOIA 2AT1A 4ARCA 1TPZA 13PKA 1Y1TA 2B2NA 2H4YA 3GUCA 2CV0A 1YHYA 3NUZA 3H11B 4AXBA 4Y98A 2VYNA 2C2MA 2C7VA 4NFHA 1U3GA 5C3UA 3CLRC 1L5RA 2WU0A 3VPDA 4D9NA 2D6FA 5DGDA 3ZK8A 1WSAA 1O5OA 2FX2A 2I6UA 3QEJA 1T43A 1WXXA 1P61B 2Y0EA 4GM1A 2WTUA 2V6GA 3G0HA 2E4XA 2YCLA 3S2SA 3THXB 2DM6A 1I4OA 3GX1A 1CFJA 4K3UA 5IZCC 1N0WA 3JQEA 4BP8A 1XTBA 4QEKA 2X0FA 5B6IA 1IBRA 2O8BA 4WOJA 3DV0B 2ONKA 4PINA 3DTNA 3RS2A 2EJWA 4MVWA 2QDXA 2D1YA 1QRUA 1IIRA 3EEBA 4FIZA 4D9GA 4GOMD 4INPA 3H87A 4KAAA 4E4RA 1T4DA 1QAQA 2F3UA 2ZAIA 4PIMA 1L2TA 2F6RA 2ON6A 1ZICA 4WLVA 3GEGA 1T26A 4C4YA 3P9KA 1MAAA 4DPLA 2OD2A 4R83A 1E5LA 1NUSA 1GPJA 3UOAB 5FTLA 4FDUA 2JFPA 3OQOA 1V7PC 4DLXA 5MN4A 3ONVA 1JNYA 1XCJA 2F90A 2HHJA 1GXSB 1ST3A 2OZPA 4GPAA 5JI2E 1KYYA 3B3QA 1L9XA 1OXMA 2NXNA 2WZCA 4PAWA 3HKEA 2C5LA 4X85A 5F1OA 3VU3A 1DKUA 5KQMA 1MDFA 1ZA1A 3HY4A 1P9NA 1U9IC 2ZIAA 3HABA 2X2FA 1L5OA 2PXCA 4O4HA 5DCWA 3SCZA 3VU0A 2CZGA 3SU8A 3E2IA 3VO2A 3X2EA 4YPOA 1QRTA 1VPWA 2M6KA 5C34B 3MMXA 4EBFA 2LR0A 5ADHA 1QO7A 1ZHHA 1N7GA 1E9CA 1M34B 2MR5A 3KKLA 1HFEL 4K6FA 1IM2A 1QTNA 2ZIXB 4LXIA 1HPLA 3D2AA 2PSHA 2Y4NA 1DKQA 3T5GA 4RVUA 3ZX5A 4BX0A 1RZRD 1TYCA 4A3SA 1EWVA 1MVNA 1O5IA 1D2AA 4M46A 1N0VC 4DIFA 3A6GA 4PZAA 5T4FA 4IKEA 3E48A 2VJKA 5F1PA 3VJKA 3BWMA 5B1SA 4B81A 4KR0A 4HN4B 3I9OA 2WPDD 2WAYA 1JXAA 3QH4A 3OZDA 3I6QA 2PWPA 1BQ3A 1CRZA 4J1QA 4P08A 2XZTA 5GM1A 1NHGA 4RU1A 2WM3A 3L5OA 4KV9A 5B1DA 3OLYA 1AKNA 1N6NA 3KAJA 3DVQX 4XWYA 3TDMA 3PYLA 5FRDA 4DR4B 1TJNA 2AOXA 4ZO8A 4NENA 2RONA 1F8GA 1VHWA 4Z1MD 1NV8A 1RPAA 3NKFA 1BG6A 5KOHA 1TCAA 1SUIA 3UBMA 2GO1A 4RGYA 5E8JA 5B1HA 4PZDA 1QO0A 1KI6A 4U9HS 3O2NA 1TMKA 4RMIA 4X3OA 1UBGA 1UMKA 2X5KO 1MJFA 3DO8A 4QPCA 1AIPA 2XW6A 4ND8B 4URUR 3GLIE 4DMUB 4MHOA 3WAGA 4M1EA 1XZQA 4MUBA 4JYCA 4JS0A 1O95C 2Q99A 2XQIA 1ORWA 3PU6A 1BX1A 3W5CA 1R9MA 3E6AA 1L4YA 4OG2A 5AUPB 3QFFA 1L4NA 2QN1A 4Q19A 5CRIA 5C31A 2QYHA 4MS1A 4DDKA 2IKQA 4R9RA 5K6TA 1UBFA 1VMAA 4B6OA 1MW8X 4N40A 1FMFA 2P4QA 1W4AA 4B79A 1QHSA 4G8JA 3DB2A 4J07A 4CM1A 1PGNA 1Q7EA 3OZUA 1E2LA 2DWOA 4JJ7A 4JNCA 1PFGA 2WSSD 1BVUA 2E48A 2F3RA 3COYA 4HWTA 2WNSA 4RETA 4WEQA 4AY5A 3ADCA 1X0VA 2PY6A 4TXNA 2VF4X 3BGIA 4MW1A 1XTQA 1P0IA 1MP0A 2XF8A 4HB4A 4KO4S 3ZKAA 4BNVA 1V39A 3B9BA 5LB2A 5MN6A 4C6SA 2QYSA 5HNKA 3B1YA 3WYEA 4TYWA 1S2DA 5KSPA 2CF6A 4BLRA 1N8TA 5LU8A 2R1VB 2CMKA 3TTWA 1QBGA 4YRZA 4YRQA 2Y0CA 2W2XA 4FFOA 2BH9A 4KKVA 1ZGJA 4I6EA 1KH1A 2CFSA 2PKEA 3BE5A 3EXFA 1ORTA 4RPLA 1ONOA 3OQIA 2CLHB 3BMNA 4DLRA 1JL3A 3SHFA 2Z4SA 1ONPA 2J5RA 3UWKA 3TRKA 1S2OA 3WHKA 4AJ4A 1BE1A 1DV1A 1KSHA 4HH1A 1YXMA 3LG2A 4OPMA 1Z5OA 2Q49A 4X1KA 4OP3A 3ESYA 2K7FA 4IP0A 1XNQB 4OBEA 1PFUA 4FYVA 4B3JA 4V03A 1XZBA 4P4GA 1R8YA 1C3OB 1FQOA 3BH6A 3NM4A 4DKXA 3AIKA 3AFGA 3LAWA 4IXDA 2H5JA 3IRVA 3PK0A 2CNKA 1YVDA 3Q3IA 3PEFA 5J63A 4ZVTA 1XZKA 3LD9A 4F6LA 4DC9A 1OBOA 3LX5A 4I1VA 8GPBA 2ZYHA 2FZKA 3EJ6A 3RRXA 1I3CA 3JVDA 3H6KA 1OU0A 3CR8A 3H1FA 5H7XA 2A0YA 3CU5A 5BN3B 1LRLA 1KHTA 3P9CA 1ZSVA 1PQPA 2EQBA 4MVCA 4ZO4A 1JMVA 1XWIA 1NVDA 4F9FA 2UXDB 2X3YA 2I3BA 1X7YB 3LT5A 1XN4A 3FKJA 4RXTA 3QWFA 4LKRA 4AJ9A 3J7AC 1SBIA 2BI4A 2Z5FA 2Q6VA 3B5JA 3VGPA 1MJHA 4IFBA 1OWLA 4H15A 4LAFA 4OCZA 2ECPA 4MWSA 2XZDA 4JQCA 5F12A 5ED4A 3K8YA 1IZZA 3LYAA 2XCLA 4ZT4A 1XKTA 2WJYA 2FGJA 4CIBA 1UZMA 4MKZA 3IV7A 2A1TR 1AK9A 1YRWA 1H2XA 2BM1A 1VSUA 3IVGA 2NNWB 2OYCA 3KYIB 3DVAA 4AWXA 4BZWA 4RYDA 1CR1A 1NBIA 2FHPA 2E6KA 5FUMA 2AN4A 1E9DA 2VDJA 4JV5B 2XR1A 5DHAA 1Q50A 2Q0QA 4UCXA 3NQ41 4XR4A 1NJ5A 2GEBA 5LP6B 1WXFA 3B38A 1RP1A 1ZZGA 2FAXA 2WU4A 3MBIA 2ZWOA 1YASA 4HMQA 3GVXA 4KQEA 4LYEA 4ZEOA 2OCXA 3D4BA 2ZBRA 2R5WA 5EIHA 3KVYA 3TZQA 1FVOA 1PQ4A 3NYIA 1YJQA 1A8HA 4OSOA 3AVOA 3AHGA 4FBMA 4ZVNA 3ZE6A 2UXCB 1HKHA 2Z83A 4RKFA 1L6RA 3ILSA 5KAPA 3FPAA 1RHMA 5FNVB 4BO4A 4CU5A 4Y6QA 3GW8A 3KL2A 1MB9A 2AEEA 4RQAA 1COWA 2ANCA 2C8JA 5BQPA 3SIRA 2YKGA 2XUFA 5FWAA 1K98A 4X6XA 1T6BY 2C4WA 3UW3A 3T1NA 4MQEB 5EJGA 4V3BA 3V8EA 4WBNA 4H59A 2QT9A 2ANBA 4GU5A 2C0QA 1KFEB 4EDFA 1Z2EA 3HQ4O 3EYWA 4LGMA 4OGGA 3LCUA 3L7DA 3H17A 1Y7HA 2UKDA 2CBXA 2ZAYA 1U0HC 5J9FA 3WWEA 3Q0IA 4BGEA 2CYAA 2PGOA 4QUGA 5BR4A 2QYOA 3F5DA 4PYMA 1GO2A 1CR0A 4NQRA 1XJ5A 1KP3A 3AL3A 4MUNA 2DXIA 2I4MA 2Y67A 2A5LA 1P3JA 3TTSA 1RQRA 4DNFA 4OQ4A 2UUPA 1RXIA 2XYPA 3AR5A 4RFVA 2QNBA 1FYVA 2ZOSA 4OQNA 3I2GA 1W76A 2SKCA 3A70A 5CBKA 1LPOA 4FGLA 1ZUWA 2IPXA 5AW9A 2XNCA 1DBWA 3RLFA 3JALA 1J49A 4CKWB 1JT9A 3G5AA 4GBJA 2VVTA 2W43A 4G5QA 2P9GA 4JD5A 3NAGA 4OQYA 4F4UA 4MKRA 1LK0A 2FPWA 2JFWA 4MUGA 2J7PD 7YASA 4L51A 1AUQA 4B3TB 1XVTA 1ZUD1 1T6XA 5KKAA 3RHSA 1KY3A 3WGKA 3R9XB 2PZ8A 1ZVMA 3TQQA 1P9OA 3HFJA 4FT2A 2D0IA 2FW1A 2VQDA 2C2GA 3OZXA 3RVLA 3F2IA 3FMIA 1UFQA 2CK3A 4M6WA 4R6XA 4DADA 5ECWA 2IZ0A 4YA6A 3DGFC 3GPBA 1FNMA 3DM5A 1LRJA 3X1WA 4KFCA 4E5MA 3T95A 1XZEA 3O95A 1OLXB 3MC1A 2HO5A 3QXSA 4I2VA 5H3LA 3H11A 1IU9A 3C5VA 2WIAA 3ITKA 3M1IA 4QU8A 1R4MB 1Y98A 4FGJA 5D6OA 3AQ4A 3FYUA 2XUGA 2P9QA 2P78A 3Q4GA 4V38A 3UIEA 4ZTUB 1JF8A 1GZ4A 3AVYA 4GKAA 1EGVB 5EHQA 3L0ZA 2Y6VA 4AYWA 2B4KA 3IX7A 1O03A 2YNMC 1H6BA 1BXRB 1A9TA 3ZU6A 1MJNA 1V26A 2TYSB 4KZPA 4AQDA 4LXYA 2KJQA 1KS9A 2JANA 3DEHA 4RDCA 2G71A 5CA1F 3U56A 5TJHA 2JJ2A 3EDMA 3H2JA 4YLEA 4CZ2A 4J7UA 4ZMBA 4Y0AA 3WBJA 1BX0A 2DPXA 3AETA 3GWGA 3HDYA 5D3MA 3KB6A 4DBLC 1SXPA 3A36A 4N5NA 5TQ2B 3Q8KA 1VHDA 1DX4A 4WXPA 1LV7A 2E0IA 3KEGA 5EZYB 5HG0A 4R9VA 3TKLA 2Q9UA 3ZW7A 4N12A 4JT9A 1XL1A 2NN3C 4U2FA 3PWTA 4EY5A 3KKPA 4R84A 1B6TA 3UMJA 2YHBA 4LWZA 1D8TA 1T1RA 2NSHA 3AR2A 4EKEA 2HCTA 3IFSA 2P2DA 3RREA 3QNWA 4DANA 3SR0A 1G7TA 3THWB 1P9RA 1W46A 3UICA 3C24A 1P62B 2Y93A 3GUVA 3RJTA 3ZDFA 4D9FA 5JADA 1EXVA 3TECE 1KOGA 4G8BA 1Z34A 2PZAA 3N6XA 3WL3A 4TSFA 3IBTA 3QLEA 3SZMA 5FH9A 2BGUA 4AROA 1KOFA 1SVMA 2NZUG 1H9AA 1KK3A 1KS2A 4LFAB 2G5GX 3PFKA 4EKYA 1PGPA 4Z0HO 1DTWA 4X6YA 4ES6A 5A6SA 2WUGA 2V54A 2OTCA 3R40A 2EEPA 3DMRA 2QXUA 3PGKA 1SUDA 2J5BA 2HCFA 8MHTA 2YICA 2FFJA 4D81A 1OHHD 5HVNA 3PE4A 2BZSA 2EWMA 3VQTA 1NRXA 4LRQA 3GLTA 1P9WA 3T35A 4Q4CA 3PA6A 2UYHA 3CJRA 4UTNA 1A3CA 2PLFA 4IFTA 1NW4A 3AOEA 4Q34A 4IW3B 3QYFA 3OT1B 2J8ZA 4HO1X 3QNUA 5JS2A 7REQB 2WVGA 3FFTA 3GEBA 4FI3C 4BVAA 3NATA 3B20A 2G1KA 5EWJA 5TGDA 1M75A 2A9FA 3H2BA 5CLQA 1HM5A 1UXOA 4G5OA 3TTVA 1X13A 4HQ0A 4M1KA 1FTYA 4YJKA 4CUKA 1G19A 2BFPA 2LCIA 4A7PA 3V8MA 1G60A 4TTVA 1Z74A 2ZAGA 4KBGA 1H6CA 3D3WA 4KQ2A 1A9RA 1YC5A 2C04A 5E1DA 4UNRA 3B9PA 3AUKA 1ZD3A 1E5TA 2FMIA 1CS4C 5FWDA 3BRWD 2YHIA 4GVLA 4OB6A 4EJ6A 5LP6F 1U4OA 2CCGA 3LRTA 4ZOLA 4LZOA 1G8YA 2QM3A 1MABA 3THOA 2GPSA 3M6MD 5IM4F 1NZJA 3QFRA 2FB9A 4FZRA 4Y9SA 4A8JC 3UHPA 1K8YB 2WOOA 4N7JA 4QBGB 5IAJA 4C89A 2O7QA 3CF0A 3O8DA 5DN9A 4ZV4A 2CLIB 3OFKA 2F43A 1ZPDA 5AYVA 2B69A 3RVSA 1OLSB 4UJ5A 2YUIA 4NJEA 1SB9A 3HC7A 5AMXA 4I46A 4YREA 1E3QA 2F3SA 3BMCA 3QTTA 1BMQA 5DLDA 3MILA 1CK4A 4QYSA 5FBHA 5J40A 1OX6A 3GWZA 4DM4A 2ZUUA 4HLQB 3GT3A 4LDRA 4L78A 4G0ZA 4HRVA 4QFDA 3PGVA 1JU4A 2AUNA 2C4UA 2I2CA 4CLXA 2E5LB 3C7AA 1BRMA 3RUPA 2PH7A 1GG5A 3L0IB 3UAGA 1TQHA 3V8PA 2DQSA 4RZUA 3WGZA 1FFSA 1QKJA 4DLTA 1G8SA 4QU5A 3RDPA 5L3QA 2G07A 2F3QA 3GLHB 5FOWA 1V16B 2IWRA 3C3PA 1VHLA 2DKFA 1C8BA 2PXAA 3FVRA 1ACMA 4TWJA 2HV9A 2IE8A 5K3SA 3KJEA 4WBNF 5C1IA 3IT0A 4HQOA 4FHFA 3T1QA 3ZGLA 1NVMB 3UJ8A 2HK8A 5ALVA 4MJ7A 5ECGC 4JDPA 1QKIA 5EZ6B 1Q20A 3S5UA 3IUSA 3NNSA 4IZ6A 2O8BB 2HK7A 2IZZA 2IIVA 3H5WA 4WN9B 4RGBA 4ARBA 2QTFA 3O4RA 2VSOA 5FPHA 3HPQA 4JB0A 1S8AA 4AO8A 1DC8A 1PJ4A 3T8YA 3U16A 5BSKA 4O3MA 3NO4A 4X44A 4I55B 5KWEA 3ZQKA 2XT6A 3BRCA 4B73A 4BP9A 1WCV1 3M5DA 4OQFA 4QUHA 4EHIA 4FCVA 2HPZA 3AU8A 3O47A 2YX1A 3GY0A 4PTLA 2AQ8A 3AR3A 3LGXA 5EJ7A 1TC2A 3PFHA 3GR6A 1IEWA 5EMKA 3VR6H 5IH3A 5BWOA 1OKKA 1ZBQA 3C43A 3D2LA 1IPFA 4XQCA 3SS7X 3VR3A 3RD5A 2WYWA 1I5OA 3ISTA 2PSSA 4KL8S 1LXCA 1XDUA 1DEKA 3NHUA 1X3SA 4GE3A 4BKOA 1J42A 2QT0A 3MTIA 3W6OA 4X62B 1YB7A 1Q57A 2I7TA 1K4KA 3EVZA 4KDRA 2X0JA 2CYCA 5KOHB 2GM4A 4IAOA 5L45A 3KQVA 4BQRA 3F73A 1LKZA 3O91A 1RVV1 2BMDA 2N1MA 4N0PA 2XVMA 2RIPA 4MARA 4Z9YA 1UBOS 5M04A 1RLMA 5B12A 2GN8A 4RYLA 5IT4A 1YQWA 3KQLA 3ZDEA 1D04A 3ZIAD 3ACBA 5SYMA 3WL7A 3A0UA 4HDQB 5K3AA 1ZKMA 1ZOSA 2BGRA 2EIXA 2H1LA 2DB3A 1O94C 4RPGA 4MW7A 3OUTA 2V7GA 2CFTA 4QYTA 3SQWA 2I4OA 4RA6A 5CJ2A 1NOJA 4ZJUA 2YVAA 1UBTS 1MHPA 3VHXB 3PI7A 1JXQA 3VJMA 1L4BA 4MIKA 1CEEA 3DDCA 5H83A 1CUUA 2G0TA 3OOEA 4AC9A 1ODSA 2G9VA 2HWUA 4P6VF 5K03A 3PTAA 4WLFA 2HPAA 3G9QA 1KTIA 2K5UA 2XH8A 2Z2IA 2JGDB 1ZMXA 4Q3DA 2EFCB 3MSCA 4TKVB 2NUPB 4Y2HA 2F62A 4KXXA 2UZ1B 5JNRA 3V7YA 5JWOA 1Y9JA 5LKAA 3TMYA 5LQAA 1BYUA 3JQ9C 4ITUA 1KAOA 2JCSA 3IEUA 3DEJA 3IXMA 1CY4A 1D2NA 3P4YA 1PR1A 4GHWA 2D13A 3DBHB 4H4DA 4PXYA 4F3TA 2RGWA 1YL5A 1C3LA 4BFCA 5F2OA 3PT9A 1D1SA 1R0YA 4GXTA 4LX8A 5ADUS 1KFJB 1OV6A 4NZ9A 4JLOA 5CH8A 1F8YA 4MV8A 2HHCA 3W6PA 1VMDA 1XDZA 4IIJB 3KQYA 3OC6A 3DZIA 3N2KB 5A4MS 4Z3DA 4TKVA 2QAGA 3V8BA 1HORA 3SAJA 5FJJA 1GQSA 3OLCX 2GRUA 1QRSA 3W8DA 2CLFB 1KZ7B 2EJVA 2SECE 3F78A 1G1AA 1MX5A 3EG9A 2O2ZA 3QA3E 5AJXA 4TGLA 2HMSA 4JHXA 5EPOA 5AM3A 2PSFA 5FDFA 1NG9A 1LPAB 1NVWQ 5KWVA 2DWUA 4XGIA 1U90A 4PFKA 4QUAA 4S1PA 2ZR8A 4PG6A 3OICA 5CPBA 5CVEA 3ZY5A 4CI9A 4D8YA 3GLGA 3OMLA 5ICFA 3RJZA 3CUVA 5DW3A 2C9OA 2ICAA 1QG6A 1K0UA 4HH0A 5DK6A 5FBZA 3AR6A 3I04M 3HYTA 1Z2PX 4FYIA 2C54A 2QTVB 4B8YA 2C2KA 1KC3A 3DCNA 5GJBA 3IPCA 3E53A 5ER6A 2O2CA 4LFBB 4XPIB 2VPQA 2ZK7A 4XWKA 3JAWA 4KKXB 3F3SA 1ULAA 4OSPA 4RA9B 1GKKA 5DYNA 4D8WA 1DQRA 3B52X 4OHYA 1SKQA 4HXYA 2CDCA 1SG6A 1P0MA 2QENA 1T1GA 3DA8A 5A71A 3LK7A 4Q4JB 4Y7DA 1VSBA 4WL0A 3C3YA 2Y0PA 5GONB 1Y6JA 3AFHA 5D51S 2RGGA 5CD1A 1EK2A 3IMFA 1M8GA 4W63A 4ALMA 1YRQA 3OQVA 1E1KA 1JH8A 1HT1E 1NVAA 4MCHA 4X91A 1G21A 4N76A 1NQTA 3AU9A 1AZTA 4IV0A 1EE1A 1WHTB 2OV6A 1OLUA 1QIFA 2G72A 4LJ7A 4N0DA 3FSJX 1V5EA 1MNQA 4PG7A 4UE3S 5CX1B 4Q3KA 3N2EA 5JNUA 1V7QA 3I32A 1QH1A 4PLTA 3CNOA 2G0AA 5FTJA 1LEHA 1AHIA 3U7GA 4IKPA 4ZMSA 1UJ2A 3F71A 2OCGA 4ACBA 5LQUA 1GCGA 3PGA1 4F12A 1OC4A 1SC4A 1ZD2P 3M82A 4K9RA 4GOLD 4X95A 4HFRA 1UK8A 1LS6A 2EDCA 2JFZA 2ZQYA 1CF9A 1S3FA 3QENA 5D7BA 2F8SA 3JTEA 3LHKA 4XB1A 5B64A 1XXLA 1KKUA 2EKLA 2RCNA 4MQ5A 4WVFA 3H5TA 3UHFA 1QQ6A 3CRNA 4IQFA 1EX9A 3BXHA 4YUYA 2IXEA 4GD3Q 3L82B 1K3FA 3DJYA 3H42B 4V2IA 2P9CA 2OEPA 4AULA 1BTOA 3WWYA 1NXOA 3LP5A 1E1QD 3I45A 2FSVA 3AX6A 4HKTA 4TTAA 3E27A 4HTFB 2I7CA 1WMEA 2NUAB 1KO5A 1I13A 2SNIE 5KNDA 5HRAA 1Z68A 3RTGA 1NDUA 4F8JA 2I67A 3G0BA 3OFNA 3T5MA 5EPEA 4EYOA 2OXEA 4EF6A 1H2YA 4FWIB 1ELOA 2MJLA 4LY6A 3EX7C 3DMTA 5DCYA 1KKLA 1OT3A 1SVOA 2IHTA 3MINB 3Q9UA 5T57A 5H8WA 1RYHA 2FSHA 3PGLA 3KVOA 1TE2A 4NZZA 2PYDA 3T99A 2BF4A 1IY1A 3HRHA 3W2EA 2TRSB 3GDOA 1SPBS 5C18A 1FFXA 1TKBA 3RFXA 4RMGA 2KHZA 3UHOA 3VVBA 4DG5A 2JI9A 2NQ8A 5K1ZA 1X74A 1BN6A 5CDHA 4D25A 4WZZA 1NQAO 4UVGA 2XB9A 3BTUA 2UUBB 3OO1A 2WEKA 1VPLA 2YXLA 4A2PA 4C78A 3U4QB 3S99A 4ZOCA 1ZI9A 3OTHA 4OHCA 1KI2A 4P4SB 2XTZA 3GYGA 1T13A 3GA5A 4Z4EA 5I51A 1F6BA 1T0JB 3K72B 1XDBA 1S6YA 3FOEC 2QZPA 2B83A 4K9NA 1GPNA 4W1PA 5IAGA 5HKKD 1QHIA 3GJ0A 2UVPB 3KIPA 5DNYB 3GGGA 5CXXA 1WOMA 5THQA 3RTEA 3WRYA 2PRJA 1LW7A 4EYQA 1FS6A 1XVVA 3N1UA 4GEKA 5CVVA 3ZNQA 4GX1A 2NO6A 4I81A 2AMLA 4IX1A 4LHWA 5HKLA 4KRFA 1NBWB 1CUZA 1NDQA 3BE8A 4KQIA 3RAEC 4J9UE 4ZEVA 1MO3A 4OJKA 4DFDA 3MT8A 2CVPA 1JMYA 2JGRA 2XRYA 1KZ9A 5M29A 4YGYA 4MAAA 4I9NA 1J97A 2CHUA 2H8KA 3DZDA 4JVOA 5CDFA 2QRNA 4CODB 1I10A 3CURA 4FZ5A 3K9CA 4OL9A 4UU1A 5EP1A 2HO4A 4I3GA 4PPNA 2QV7A 1NHWA 2HLNA 2GPBA 4MWEA 5BVGA 3W1WA 3UJ6A 3CH4B 2J0SA 4HNTA 4BWYA 1OXKB 2BMJA 4NDAA 1KYWA 3AZPA 4A6DA 1WMDA 5DP2A 3DUFA 4LNAA 3DTVB 3GUZA 3OM8A 1EQ2A 2ZPUA 4II7A 4M9UA 1ECCA 3F6CA 2QKYA 1RQXA 2IW3A 2LUOA 2VC2B 4DJDC 1OLSA 2VZEA 4KLZA 3UEOA 2AS0A 4JX9A 4JVMA 3DFFA 3UH0A 4C4TA 1I6MA 1TVEA 1JSXA 2FZEA 5FIUA 3R9XA 1SZJG 2NTEA 3DO5A 1VBNA 2X86A 5B1EA 4Q9HA 1R12A 3PFBA 4UNQA 6ADHA 1ADBA 3JZIA 3LCMA 5K05A 4NFSA 3A7EA 4AW9A 1MIOB 4M1QA 1U0TA 1XA4A 2PO5A 4LV8B 4C6TA 1NN1A 1TI7A 4E94A 1ISSA 1DB3A 3R20A 1M8KA 3LCJA 2YFYA 4RVFA 4GR9A 2VPXA 5A0VA 4XASA 5JS6A 1J7JA 2VDWB 5B6JA 2O2EA 2RDMA 3E03A 3KR1A 1A82A 2D5CA 3E7DA 3RQSA 2IE0A 4TT3D 4JOBA 2Q3EA 1WZEA 3BMQA 4YJFB 2QMZA 1LY1A 3G79A 4D74A 1Y5LA 1MIOA 3DOJA 3KKOA 5BWMA 1GTRA 1CUFA 4DRXB 3OQJA 3UA4A 1KI7A 1YB1A 5A4DA 1G8GA 5DHQA 3LUAA 4NS4A 5DLQC 5CFPA 1T2AA 4NQZA 4TTSA 2R8OA 1X1DA 4Q48A 2PDAA 1UL1X 4WGFA 6NULA 1YKGA 4UUOA 3JW8A 3F2VA 4AO6A 2V5VA 4HMOA 5J2UB 4JKOA 2XPCA 4Q9KA 3LUDA 3WDSA 1AMUA 1N6HA 1RE1A 1NF3A 2AR9A 2XMSA 3ND5A 1X92A 3B1JA 3IEKA 4MKGA 4D0GA 3GLFE 1B0ZA 3GLFB 1ENPA 2VDQB 5I7EA 5BNWA 4M0KA 3BIOA 4B74A 5LMZA 4FU0A 1IXYA 4YMSA 2FPSA 2MINB 3PXGA 3DYIA 4LV6A 4Q0MA 2XVZA 3K8ZA 2RJNA 4BO8A 3C14C 3MGKA 3RRBA 1ZGGA 4Q93A 1GPDG 2J9RA 2OAGA 3ICVA 3NGXA 2OCBA 3K16A 3T3EA 2GZMA 3ZPXA 4CTKA 4EEKA 1RLOA 1EHYA 3TAUA 4ZGWA 3Q8LA 1CB0A 1G3MA 2GCOA 4IJUA 1UUFA 1T8SA 3ONEA 4L7VA 4DV0B 1HDOA 3THYA 4DBVO 3ASUA 4JJ8A 3HKEB 2ZXUA 1EDOA 4F38A 1FL9A 3RFTA 5KOYA 1DU4A 1OZGA 1PGQA 3HU2A 3KKZA 3QV2A 2XE4A 1DL5A 1PYOA 3TZLA 2GOYA 1QP4A 5CLIA 3IXQA 5JDCC 3ZV7A 1AV7A 4FYPA 3SVLA 4QREA 4JQZA 2D2IA 4N1AA 3AI3A 3H5VA 1O6BA 3Q9LA 1SXJC 3X2SA 1DCFA 2JJ1D 3QVOA 1OX5A 5GGYA 3OD5A 1CNFA 1QR2A 1AB5A 5BNFA 5L51A 1PUXA 3AF2A 3LQYA 3VDNB 2X9GA 3TLYA 1U94A 2XGJA 1T9CA 4DSTA 5DM1A 2JGDA 4B8ZA 4DN6A 1TJ5A 2C83A 3OHPA 4IDAA 1A1VA 1ND5A 3ANMA 4IS2A 5D3KA 3O3MB 3OX4A 5L53A 4MRNA 5JAZA 2Y1LA 1QK3A 2IQIA 2YC2C 1Z39A 1VPEA 4HR7A 2QUAA 4ND6A 4ZVKA 4D79A 2AZXA 1GRVA 2AFIB 4HNAA 3GHYA 2II6A 4IF6A 4GI3A 2QXTA 4MDHA 3UC9A 3UJAA 3WKEA 1W88A 3TRIA 1Y81A 3O4VA 2PUJA 2X6RA 2FMFA 3HVRA 4W9MC 1WLSA 4YCNA 3PFFA 4MV4A 1J0AA 1NI3A 5AKLA 2JI6A 3I2IA 3ICEA 1A98A 3ZEIA 2D2FA 1UM8A 1EJ2A 5BUZA 1LCIA 1EP9A 4TS1A 1B7GO 3OQNA 4RMNA 3BQMB 4CEIB 2FW9A 3PNKA 5JPCA 1NMYA 1UOQA 3RRNA 1Y4SA 5FWYA 1YK1A 1WMBA 2FFBA 1N5OX 3C8UA 2ORIA 3V32A 3KVRA 3EFEA 4R7GA 2NUTA 3U9LA 4DQDA 4TN1A 2H5EA 4RTMA 2QQEA 2XLBA 4AS3A 1GN8A 4QAQA 4E7PA 2Z2XA 2KI5A 3SM9A 4DTCA 4LMBA 5K3EA 1CQXA 1JKIA 2GK4A 3IALA 3PUYA 1PYDA 4G25A 2OBNA 1C81A 2QMUA 2ZWMA 2VT2A 2DSTA 4QJ4A 3O83A 2J7KA 3HL0A 2IX9A 3JARA 4M89A 1JA0A 2ACKA 1M34E 2XWSA 2QSYA 4M8NE 4Q9JA 4RM2A 5JEDA 2DECA 2NT4A 2ZE7A 2AA3A 4X1KB 3L8FA 1MXHA 3L8ZA 1H2WA 2HLPA 4Y6GB 3KJHA 3H6HA 3ZE2B 1DS6A 2YV1A 4Z4HA 2IH5A 1RC8A 1X3LA 1JECA 2L69A 4KGVA 1AVTA 2W8ZA 1JBKA 2JZNA 4FFMA 4YVFA 5JD6A 3H2KA 3DDZX 2VQSA 4BNIA 3IQFA 2Z6UA 1A4XA 4PTYA 3KS9A 4YV1A 4IYRA 1P2GA 4RDHA 1SXIA 1D7AA 1Z29A 3KJXA 3E8XA 3B13B 3HHPA 3D1VA 3MCAA 4C1BA 3RYHB 2ET6A 4BFZA 2BEUB 4XIJA 5IS2A 2MSNA 4RAOA 4RPJA 1DLIA 1XTIA 2QW1A 3SC2B 1X9HA 4BQQA 5KUTA 1JP7A 1LA2A 5DVZA 3ESZA 4R41A 1QIGA 3EAQA 4FMDB 4DEXA 3EH2A 5LMCA 3RIYA 1TAUA 1XR3A 2PFSA 4EB6A 4LCJA 2W98A 3G2JA 1P2DA 1ODTC 1VYVA 3G9XA 2QRKA 1E69A 3C8MA 4Q7JB 4UBOA 5LA6A 1HOTA 3TZEA 3WX0A 1XELA 1B0PA 5JCXA 4KLRA 1KDYA 2JFQA 3JYOA 3VR2D 4G0UA 4ROSA 3L6CA 3CZMA 2BGGA 2P6RA 2X7JA 2QQFA 4G37A 3TF5A 4LFCB 3O4HA 4EGAA 1GTG1 2WAXA 4GLLA 1JG4A 5C9ZA 1PTKA 2I7XA 3QI7A 3KPYA 3RU7A 1CERA 1WPGA 1YQTA 3EJWA 3Q5EA 4TLMB 1ZR4A 3NANA 3IUNA 3EVAA 3UPTA 5GVRA 4YCSA 1MLDA 2XMGA 3LFTA 3MELA 5H9VA 4EB6B 3ROZA 1ULHA 1LPMA 2CDRA 5F1KA 4IIHA 2G17A 5FPTA 4GX2A 4ECAA 3DF9A 5J4KA 1FRVA 5CNIA 1OUMA 1HYGA 2WPNA 3ND7A 5JZVA 3DE1X 4ZYYA 1R4ZA 2WSMA 1M7GA 3JU3A 4ERXA 4C4RA 1T5BA 3GD5A 2HQBA 3AUAA 3MCUA 4JASB 5C37A 4EEXA 5K6AA 3NZEA 3DONA 1OXSC 3LCRA 3TI7A 4CIVA 2NYUA 4JT4A 3HUTA 4OQEA 1C1YA 2DRIA 2OMEA 4RKWA 3B48A 3TNDA 5KQLA 2WVHA 2FSSA 3WBFA 4JP2A 1TTPB 2J87A 3A32A 1FRFS 3EARA 3IKTA 2Q5HA 4CBVA 4M8SA 3NTVA 2JFOA 1PG2A 3EBLA 4BFTA 3GRYA 1OH8A 5CG1A 1Y89A 4Q9AA 3N59A 5TEVA 2WHYA 4MVYA 3SMQA 2D8AA 4G63A 3HFRA 3W2TA 4BLVA 1L7NA 2ZITA 3KEFA 4WADA 3EOBI 1SCUB 2X0EA 5I7VA 1BMFA 5IXSA 1ADGA 3EF0A 5JVDF 3WAJA 2C7OA 5HFNA 1EFPB 1WB6A 3T7RA 4FCWA 5TXGA 3QELB 3IEPA 1KARA 1RLJA 1N5RA 1GXSA 4LOKA 2P1DA 3S4YA 5G41A 2HYDA 1JHAA 1RRMA 4D41A 1E1LA 4PBSA 3UB4A 2C8KA 1LDMA 1ISJA 1X7WB 1VA4A 2VL7A 3PQFA 1DEXA 2E6UX 4OHFA 4EUEA 5FOQA 3M1AA 2QLMA 1DBPA 2J3HA 2QGNA 4O2AA 4TYQA 3ASZA 4ZU1X 4DB4A 2D7CA 2F17A 4CMIA 2JBWA 1AH2A 4EG4A 1C7FA 2KX7A 3I64A 5BOSB 1CZHA 2AJCA 5A0TA 1PTJC 5G0UA 1K4YA 5AM2A 2GPAA 5H5JA 4I8DA 4L6CA 1BWPA 3MCVA 3PWKA 4MZXA 5IHXA 3LUHA 3NYWA 3GPLA 1FNBA 3R8CA 1EGQA 3KR9A 1CEQA 4W1SA 3O8NA 4D9MA 1KI1A 2GEVA 1JIVA 1GL6A 1X7XA 3CE9A 4IO0A 5CHEA 5EP2A 5KSOA 1B43A 4UBIA 4E14A 2PJDA 1DKNA 1IJEA 3NDJA 3AUJB 4HNHA 4XYMA 2VA9A 3FG9A 5AW1A 2N3ZA 2AJ8A 1YVUA 4GVPA 3TO5A 4A4DA 2R9VA 4KOEC 3TL2A 3HN2A 1W36B 2EFYA 1TM7E 1Z6TA 3F7MA 4JAVC 4RK4A 4U2EA 3RIXA 3SHOA 2I8CA 4MWOA 5G1OA 4C0SA 4NABA 1DKMA 4KHZA 5IM5A 4PR3A 1X8XA 5EIFA 5CDUA 2WD7A 4CIYA 2PZLA 1UIRA 2WJZB 2XMBA 5T41A 4U9UA 4XX0A 4MWCA 3F46A 1CB7A 4JLAA 4IDPA 5ITWA 2VTBA 1R5OA 4UARA 1AQYA 1R8XA 4WN3A 4D8TA 1R7RA 5F4BA 1ZFNA 3OIVA 1E94E 1CZUA 4CFSA 5ICMA 1N2HA 3LOUA 2R5FA 1KRXA 1HT0A 1PL7A 2ATEA 3IPAA 4K6CA 3S2FA 4J7CA 2HJSA 1M72A 1TZMA 1IUNA 2QP4A 3HCCA 2A7XA 3GEHA 4KQWA 5E4FA 4TQ9A 2VBCA 4OAQA 2E4YA 4Q39A 1II8A 1UZUA 3E8MA 1ZKDA 2ZBGA 3HN7A 4DLUA 3E3AA 3K20A 4U00A 2HA5A 2BKEA 1Y33E 3RVMA 3TK1A 4D5GA 5JFOA 1MA0A 2GN4A 4S05A 3OP4A 1AKEA 1R0XA 2FZVA 5I9LA 2PR7A 4UAVA 5CNKA 3KZCA 2ZJ0A 1XD2B 1XXHA 2PKWA 3ONDA 4L85A 4PRZA 3WY9A 2JAQA 4U2GA 3L07A 3O7MA 5JH7B 4M55A 3KAQA 4OQXA 2OWDA 3NWBA 1DI0A 1LUAA 1ULUA 1Z8HA 3BJEA 3L7MA 4FSDA 4QXAA 5DSXA 2QNRA 5IH7A 1C9YA 4EI7A 1JSCA 2W70A 1OBVA 2I33A 3K0FA 3C98A 5TIIA 3NM6B 4XUCA 4ASUD 1K06A 1R9NA 1SIOA 5FOVA 1O95A 4L27A 2VJAA 3Q7QA 2FMXA 1VLMA 2JLZA 4CR7A 3SKXA 2VRWA 1PLKA 2X42A 3HKCA 1BOFA 1QM5A 3DWFA 3CZ5A 2J46A 3OKAA 4X66B 1WUJS 1Y8ZA 2J6BA 4R81A 3REOA 3SC4A 2RH8A 2P2NA 4BMVA 4MUIA 1HBJA 3ZY6A 2NP6A 4MPJA 3EMKA 1J20A 1QRDA 4Q9IA 3ZK7A 2WI8A 2GD6A 2D2VA 2RHMA 3I01M 3N8NA 4YACA 2AEJA 4JXJA 1KO8A 4JBNA 4BE4A 5DIFA 1T5OA 4BN0A 1I4LD 1ZH8A 4KR2A 3OBBA 3W9SA 3GA0A 1MX1A 1SUPA 4D3FA 4CMEC 4ICIA 3AG5A 5IK2D 4M21A 3PIRA 3KSBC 3SX4A 2CB0A 3ZHRA 2HRZA 3WKAA 2IEYA 3M5CA 1WPQA 4DR6B 4M49A 2JF0A 2WOJA 1CUYA 3ABRB 5J59A 3AVUA 5BQFA 2RK4A 3VH2A 3QPDA 2D1RA 3NRJA 1NONA 3FR7A 1D0IA 1CY6A 3MYRA 1IUOA 1KYQA 1BXKA 1NYLA 1YU9A 2WV7A 3D8NA 3BCUA 3EGDB 3PUVA 5DM0A 2PGAA 2RG7A 4LVCA 5KYXB 4P81A 5K0LA 1R5NA 4EVSA 4NPCA 2PKYX 2J6HA 4ZMRA 3ADDA 2I29A 3HGMA 2BUAA 1P4RA 2LTAA 1NBOA 2YBEA 4K1LA 3TD6A 4ZK6A 1ST2A 3RK4A 4ER6A 3BEOA 2QTTA 3PXEA 4MQFA 3PGMA 3IDOA 1A7JA 2BGMA 5LZ8A 5BR7A 3LUFA 5J4VA 1Q0TA 4Z4IA 3MMNA 2IFTA 1GIAA 3VPAA 1LDNA 1XBTA 4IUBS 3AI7A 5FPKA 3MQ2A 1KNXA 4OHMA 1N6IA 3T7SA 3D6NB 4KN8A 1DTEA 1SKBA 1R4NB 1YFKA 2FQQA 2HGSA 1TEXA 2NOAA 3C1OA 3IBSA 2FUG6 3IOEA 1IZYA 1GCOA 1ISPA 1P18A 4WESB 3BD9A 4EMUA 3ETHA 3LGSA 5KMGA 1YB6A 1Z4PX 2Z5GA 9GPBA 4UJ3A 2PAAA 1FP4A 1F2TB 2ZYWX 4G0OA 5H82A 1XJWA 1ML3A 3SYLA 4MV0A 1Y7LA 3AB7A 3UAZA 4PGGA 3X44A 2COKA 4N9WA 1N4AA 4V1CI 2PA3A 3FZEA 3L8HA 4AN4A 3KQOA 2CFRA 4OXXA 2FP4B 4YRGA 16PKA 2H07A 1E3EA 3BKWA 1A9YA 4G36A 2WY2D 1N92A 4UAUA 1SC1A 4G84A 4J7AA 1DUVG 2FUG1 4XWGA 4P84A 1M1YE 4KLNA 1LZKA 1JE0A 1QAMA 4PNHA 3UUFA 3FDZA 4X7PA 1YB2A 3TJZA 1H69A 3A9CA 1BE0A 2RGEA 1D2RA 3VC1A 1Z37A 3CX7A 3IESA 3BSWA 5E0KB 5ER9A 3W78A 3WKDA 4NZYA 4RCVA 1SN7A 3ZQJA 4N41A 3U2QA 2PT6A 4MW6A 5J4YA 3RPEA 1ZLYA 1MVOA 4A0RA 1US8A 1RHJA 5ALIA 4DMMA 4FNOA 4FEEA 3T5CA 3H2YA 5ENVA 5AOCA 1RWBA 1CF4A 2X23A 4RSHA 4QPDA 4J0DA 4Y6SA 4GP9A 5ALXA 1PWEA 8OHMA 1UFKA 5DB4A 2JGMA 1BFDA 4KPGA 1EZ1A 3V6MA 2XODA 3ZXIA 5BN3A 2MIIA 4P2GA 1ZM9A 3OT1A 4JEIA 4J43A 4KXNA 5B55A 7REQA 4QXRA 2DT8A 1IHUA 1YDWA 2XQVA 1PSZA 1CUGA 2QROA 5ABPA 5I6DA 1W5EA 3QU4A 5E4YA 3WHLA 3RYCB 4DDWA 1JX6A 1WUIS 4PPYA 1ZGHA 2VWPA 5DNWA 4QTUB 4ZVSA 4BQSA 3NDIA 2X6QA 3IILA 5BR8B 3I0NA 4IL5A 4PWYA 4QT4A 4U5QA 3DLAA 4TS3A 2CV2A 1D1QA 4ZI3A 3DL4A 2AUTA 3RS3A 3A3PA 1H3EA 4QUBA 1FS4A 1RAHA 1NJ8A 1VQ1A 1WU8A 3P20A 3CJTA 2PUWA 4FGKA 5A9SB 4GM0A 1PT8A 2ZZMA 3SSAA 4S2EA 2H2GA 1Q0UA 2FG6C 4S12A 4ARUA 1SBQA 1SU8A 1G2QA 1ZCFA 2O4UX 3EGOA 3N7UA 2PS1A 2WP0A 1KDVA 3UMYA 1KAMA 1EP2B 3VI4B 2ONZA 2GI4A 2DQ4A 3DTVD 4ZAXA 1WHTA 4ESHA 1OLUB 5FUWA 4CU2A 1ZQ9A 3IEVA 1DC7A 3BGDA 3UMMA 1KEUA 1I80A 4ZZ3A 4CKCB 1M7HA 2RKWA 1M1ZA 4G23A 1COZA 5HIIA 4AZ0A 6PFKA 3V2GA 5KYYA 3R7WA 3SZOA 1D2GA 4B84A 5G53C 1IQ0A 5BO5A 3DAYA 1JSRA 221PA 3QOYA 5K3FB 3SVTA 1I3LA 2W6OA 2VNAA 4IEFB 4V02A 5D3MB 1OW3B 1R9GA 1SK8A 3NOQA 1B8PA 1Y8RA 2HPHA 1PKEA 3HWSA 4OJQA 3SICE 1T2VA 2BFAA 1DQZA 3GLHA 3I2JA 4FZJA 2XB2A 2Q6LA 3WSTA 1R0WA 1QHFA 2C5AA 3T7JA 3RTBA 1IRXA 3P0FA 1KXJA 3T41A 3HGQA 1Y3AA 4RZ2A 1V47A 3OQPA 4ZCQA 3H1EA 2M98A 5T64A 3PGJA 2KW5A 5E9QA 4G5FA 4B7AA 4C07A 4EH1A 4F97A 1BN7A 9ATCA 1V9SA 2JKZA 3AFMA 1E96A 3JQ7B 2F1RA 3HVJA 4HCJA 1RQ7A 1L7XA 4D57A 1KKMA 1QRRA 1PJTA 3S0JA 1EWRA 4RUKA 1UKZA 3A4YA 2BFCB 4WX2B 2OY0A 2GEDA 2GSDA 5CFQA 4DJFC 4U7HA 1C3EA 4OREX 5ELLA 4RZSA 4ZU6X 2HMVA 4A8JA 3M6VA 4PGMA 5K3OA 5EE3A 3SHTA 3FTDA 4LRYA 2RMKA 3H0EA 1NN5A 1CTQA 2I2AA 3BK2A 2NLOA 3EUEA 4CTNA 5JTTA 5LYJB 4TV8B 3AESB 1QNLA 4E32A 3HUEA 3HJRA 2JAWA 2RC6A 2X0RA 1RWXA 2H5LA 4A8HA 1IK4A 2HK9A 2V58A 3V8VA 3BGVA 3PFWO 5ALGA 3DE2X 4I2NA 1J21A 4MGIR 3JX9A 1NNI1 3I92A 3ND8A 2F4NA 2QRVB 4GOND 2BFCA 4NBUA 3GL9A 4WEOA 4CHGA 1QLHA 2QN3A 4K5QA 4M3NA 4DBZA 2H1OA 3H19A 3JVUA 3M9XA 4E6PA 1VG8A 3GVPA 4PYLA 5BSWA 1ZZEA 3QE9Y 2VG8A 3KB1A 1VE6A 1Z0IA 2YMQA 1WQ1R 4RELA 4X20B 2X4LA 4DA7A 1J0XO 5GADl 3VZSA 1H65A 3W6ZA 2UZ1A 5J5AA 4R0NA 2A78A 5FUYA 3V7NA 4Z7OB 5BV0A 5DGHA 3PYXA 4MA0A 2FJPA 4ND4A 4PFSA 4IJVA 4DC1A 4QTXA 4OU5A 2PBZA 2VCYA 3DV2A 1DRUA 1N1DA 2H4HA 1LS1A 3JSXA 3M5PA 2YVKA 5ALQA 1KI9A 2Z04A 3W3ZB 1TYBE 1UPTA 2FW0A 2R7LA 4LWOA 1X1CA 4TT3A 3SDZA 3PFGA 3BA1A 3PITA 3OX3A 4DPMA 2V3CC 1E1NA 2YTZA 2GZ1A 2NZXA 2IUUA 4B4KA 3WB9A 3WISA 1CHNA 2WQZA 4HNRA 2AQIA 1W29A 2X9LA 5CT8A 1P4GA 3FDJA 1Q0LA 4I55F 2JGLA 2ZJ2A 2V7UA 3WQHA 1N2GA 5JT1A 2Q3HA 4B83A 3USZA 2DBRA 2FSPA 3UC5A 5B7PA 2B4AA 1R6XA 1GPH1 4NVRA 1MHTA 4AJLA 2YHSA 1NUAA 1WE2A 1M5TA 2H63A 4IWYA 1DX9A 3ANLA 4CI0B 1HR0B 4ZQGA 4ZKDA 1BGXT 3DW3X 1H9CA 1KJWA 3DZJA 1N5IA 3NBUA 1XG5A 4PQGA 3UJ7A 4CRWB 1FS5A 4YAOA 5DNAA 1ORIA 5F33A 5EJ8A 4YXFA 2W6CX 4UHHA 3WFIA 5JVDA 1UQRA 4KQJA 3IPRA 3HYCA 2CXNA 2FSUA 4LCBA 1PTJA 2AE2A 2XUZA 3OOWA 1SB8A 4OLJA 2ETXA 2VLBA 4WFKA 1SUFA 2XITA 4DUGD 4Q7LA 1G42A 3N7TA 1NUPA 1WV0A 1VIAA 3SEZA 4FILA 1HQYE 1SUEA 3ILHA 3RC9A 3GLGB 4YUVA 4OQZA 2O7NA 4ILKA 3UXEA 4BVLA 3BF7A 4N54A 4XZ3A 2NG1A 4D9KA 2XTJA 2NSYA 3R77A 2HF7A 4FVTA 2A9PA 3P9SA 4HPJB 3ZS9A 2YOFA 3QVWA 2OHIA 2QQ0A 1OXVA 3EXHC 3LKBA 2QK4A 3NM5A 2X2EA 3E9DA 4IVRA 1HZZC 5LIPA 5EYPB 4F7DA 3MCTA 4ZVUA 3LGAA 3O2SB 2BEVA 2VTDA 4GYJA 3OE1A 2BP7B 2A9RA 2YV4A 3CX8A 1E2GA 1F20A 2GFHA 1Z18A 1GAWA 1Z2CA 2M6SA 3GEMA 5FO1A 2GJAA 4UCFA 3Q7TA 4XJXA 2C03A 3PRJA 3RKSA 1IC6A 4NFYA 3WLFA 1CVIA 1KIFA 1Q15A 2XBUA 3KQPA 1TAQA 1I32A 2JVJA 2P5TB 3CLTC 3E22A 4QQFA 4Y2JA 3V4LA 3Q2OA 1IXRC 5KTRA 1Q6YA 4FMCF 2VPYA 4J03A 1G21B 2Z1NA 3D0OA 3MF4A 2QA5A 4UATA 1G17A 4IIUA 2VTBB 2JEYA 4EO9A 1N2IA 3Q87B 5LP6A 3G2OA 5EJMA 4NCXA 2W11A 3AO0B 3LC1O 4B7XA 3CC8A 3WE7A 3OPVA 1FTGA 4DUYB 4KSYA 5H16A 2QRJA 2PV7A 1MO6A 1VYUA 5KJ6A 2A5JA 2XTNA 3BZUA 2XNJA 2XDAA 1HYBA 1B6RA 4N39A 4YGXB 1GLGA 4LNUB 4YJDA 3K0EA 4DMLA 4CM9A 5I7WA 3DHEA 4CM6A 3WZ2A 4UUNA 4KDCA 1XVIA 4WNYA 4UUPA 1OU4A 2NU7A 2OLEA 4KGDA 3FMVA 4ZVMA 2IV3A 1U8CB 1X38A 3FSRA 3K4PA 4JB2A 1JFSA 2D5BA 4CEHA 4LVNA 3AVVA 4UEJA 1B6GA 2WJ4A 4QYWA 1R00A 2BFEB 3Q7RA 3GZJA 5EIAA 4IH9A 4MUAA 1CYEA 1IEVA 5B4VA 4IMRA 1NN3A 1ZUNB 2OC4A 3CB4A 1YZUA 4TXJA 5D5PA 4CMHA 1CEXA 4DAOA 4PN3A 3USCS 3IP6A 1FW8A 2JRLA 3JXEA 4OA8A 1NW3A 5IJXA 1EWYA 2F9MA 2AXQA 2WRZA 1L8OA 4IXNA 3DCYA 4R8KA 3KTAA 4QX6A 2YIMA 4AZWA 2G77B 1RWOA 4M1TA 4UUMA 2R6GA 2IYTA 5AM5A 4KUGA 1UQUA 4TMVA 1PD0A 3AT1A 2G4VA 5G3ZA 3VISA 5A04A 1XDWA 2QRZA 2Q07A 3EVGA 1EA7A 4LV5B 1SQ5A 3QWHA 4JXZA 4L8LA 4ZQHA 1OXTA 3E35A 2NSDA 4RY2A 3C3DA 2G70A 3EXAA 3K9LA 4UM5A 3P8ZA 2VCHA 1PL0A 1ZOIA 2Z2YA 3FOAA 2CLMB 1T34A 1J7KA 3A31A 4GYKA 1XAHA 4XIYA 1SG0A 1LQTA 3FE2A 4XB2A 1OXBB 1Z45A 4RY0A 5HM8A 1OGIA 4REMA 3NIDB 3P2OA 1RRGA 1XHLA 4OAOA 5LDGA 4BVBA 5DI3B 1IOLA 3AM5A 4PM4A 3LC2O 3NEPX 3FH0A 2QTWB 4MYSA 4PAQA 5FR2A 2GEUA 1IY9A 5TB5A 1EJ0A 4NIMA 1QC5B 1SVKA 2X5JO 3NBZC 1Q3HA 5DN6A 1ESEA 1Z0JA 3CWZA 1YWGO 4H16A 2X8AA 1PFVA 2R84A 1JWLA 3CRZA 1GARA 4UBLA 4FWTA 1FF9A 4I1RA 4NRDA 5H68A 1ISHA 4H7EA 5E2IA 3EPRA 5CJJA 1VL2A 3SIXA 4B44A 1O87A 1V43A 3AEUA 2EU8A 4QG7A 3GVCA 1M83A 4II3A 3SY8A 3JSAA 1USWA 2QUIA 2O05A 4AJ2A 4UTZA 2B0CA 5ES4B 1LX6A 6CHYA 1R6TA 3WHIA 4N3CA 4UXIA 4FSHA 4S1WA 2Z5LA 3I72A 4DCOA 2R79A 3AF0A 4MVJD 4RKQA 2TS1A 5EWLA 5F4ZA 2HMTA 1N2EA 3PHIA 2V3VA 5CFZA 4WOBA 1DXQA 5BYAA 2XUDA 1ZH4A 4ZCTA 1PG5A 4CETA 1IBKB 3PE6A 2IY7A 4R1SA 1YNSA 2JGFA 3VHQA 3THWA 4E33A 2R6HA 3A1SA 1C50A 2VJMA 2Q5QA 3RVOA 1VTKA 2X41A 3G2NA 2R8XA 1B2RA 2PVSA 2QR3A 3EUFA 3TTTA 5ITZA 2JLWA 1B6SA 1II9A 2R3SA 4WFQA 4EX6A 4EJ2A 1UZNA 3H4VA 2R11A 1LLCA 2EL7A 2EZ4A 2PSEA 1RT9A 2QZ4A 3B1VA 3LKZA 3N87A 2L17A 3K1YA 4IIJA 5CLHA 5FHQA 1Y8RB 4OHWA 3UJPA 1A7UA 3EXIA 1JLLB 1E2JA 3FDFA 3UKJA 5JDCA 1URPA 4B82A 4BB6A 4BFYA 1V8DA 1CRQA 3GJYA 2Q4EA 5CDTA 3BFPA 5DNVA 1GUFA 1Z36A 1TLFA 2ARKA 1TQ2A 1S1MA 3BHJA 1GGEA 1N5JA 2MDTA 5KMGB 1LPBB 1R6UA 3H84A 1SHZA 1BJTA 1JIKA 4GFDA 4WKGA 2VUIB 2AMFA 3OVMA 3OZIA 4QM6A 2FKAA 3NEJA 1OJLA 4PWZA 2QN9A 5F23A 2JFBA 1D2HA 4CIXA 4MW2A 4E5UA 2FR0A 1ZYUA 4KPUA 4KMMA 3FWZA 3ELWA 3RVNA 4Y8VA 4NONA 3CA8A 4OJYA 2DUWA 1GSOA 3UK2A 4QDTA 4D02A 3AYZB 2JFXA 4DIMA 4Z4FA 4O4JB 5A5EA 5I7UA 2FPMA 2PN1A 3B9QA 3OAAA 1GZUA 4YQZA 4FFWA 2IPMA 4BLQA 1XTRA 3OIFA 1E62A 3RROA 4D82A 1UBRS 3IXLA 1PJLA 3KB2A 1BS1A 1DEAA 3Q6NA 1DADA 3GFQA 3N0RA 4LF4B 3ZHOA 3K6RA 2J48A 2CYBA 4IQGA 1GQ2A 4PZPA 1Y3FE 4KOAA 4AL4A 4CF5A 5A9RA 1Q44A 3A7DA 1AV6A 2ZDGA 2CWDA 4UEQA 1ESMA 2EP8A 1P1HA 4D3YA 4DDTA 2VH5R 1O97D 4XLZA 3FWPA 1KI8A 3ND9A 4TL6A 1UJMA 3Q7PA 3F6YA 4OM8A 1VMKA 2QYTA 1NNEA 4P82A 4MO2A 1XCLA 4W1QA 5A6VA 1P72A 4X94A 1HFJA 4BTVA 3BN3A 4HHEA 1B1AA 2H7CA 2IOFK 4H6XA 4LQLA 2VF5X 4B0PA 4Z6KA 3EPJA 1ZJWA 4WZBB 3T1VA 2ZRFA 1PR9A 3W1VA 1RKQA 2WTAA 4LF9B 1A8QA 1NMXA 1WZ2A 4CG2A 4U5XA 5D3ZA 1AUVA 3F9RA 3S2GA 3JQGA 3K4QA 1XCPA 1ETUA 4UM9D 4D45A 3WLRA 4EHHA 1WY7A 4ENPA 1TZCA 2V6FA 2PZGA 3A6ZA 3C45A 3ICOA 3CS3A 3V55A 4L28A 1S5PA 1QG2A 1PJZA 1UKYA 1XNGA 4UVEA 4DIBA 3RVPA 1PE0A 3DOFA 4JEHA 3ZD9A 3OY2A 5B2FA 4JFAA 5JS7A 1ECJA 4FDAA 1J56A 4R8SA 1GZ6A 3W05A 1N9GB 3MWEA 4NZNA 5DYWA 2E5WA 3I6YA 2WMNB 1OYYA 5DOVA 3KFVA 1NUUA 3IBGA 3W6UA 4LJYA 3MK31 4LJSA 2PZJA 4HRXA 2PGLA 2I6TA 3PUKA 1A77A 3QQPA 4IDFA 2IH4A 2H7XA 5H80A 4JI5B 2ZI3A 3KETA 4CN9A 3VNVA 2I8LA 5FBQB 3PX3A 4LNHA 3TI9A 1T5LA 5K2MA 1SXJD 4HEA1 1CY8A 2PZBA 4UDNA 5F5XA 1TZKA 5REQA 3WADA 3E5HA 3ZYCA 3B2NA 4CMKA 2L42A 5PNTA 2O2SA 1C1HA 2KLBA 1PVDA 1ICEA 1QDUA 5BUCA 4XD2A 3B82A 2RAPA 2IOHA 3L0CA 1YI1A 3QXCA 2GAOA 5AKZA 2J9YB 3PNQA 3SIWA 1ZVJA 3MUFA 3QXJA 2C7QA 5IANA 3OI7A 4MV9A 3JY6A 5T67A 3INYA 4KYTA 3RWBA 4S04A 4TTIA 1CUJA 2IKSA 3P0JA 5A03A 1EVQA 5C5CA 3UOGA 4OEHA 1FFBA 2E89A 3H2HA 2ZRJA 5AIAA 4DLWA 4YECA 4CQMA 1T4GA 3DXZA 2GXQA 4B5LA 2Z5VA 3Q15C 1X7ZB 4C76A 4C7KA 4HGZA 5B57C 5CA0B 4K3VA 4GSYA 1PK7A 2W2VA 3WK4A 3GJ6A 1CPYA 1U0BB 1QGZA 5JWRA 4WERA 4JBLA 4FFDA 3AVTA 3HI6A 1UWVA 1L4FA 4Q7KA 4TM8A 3W5JA 1N2ZA 4OHVA 3VR4H 3B6KA 5D87A 3GP5A 1A4RA 2GS9A 4YRSA 1UBNA 4FGSA 1I2AA 5LBTA 2ZIZA 1EWKA 2DVMA 1S2GA 1FMJA 2XDYA 4K6GA 3IHKA 5KVVA 3DE7X 4LJ4A 3VMFA 3ZDRA 5BVGB 3I9MA 4ZZ2A 1Z2DA 3MS2A 1C7JA 2RGRA 3SI7A 2JFFA 2R1TB 4ROTA 4RJLA 1NYRA 5SY6A 3GCGA 3DLIA 1J0BA 3LFHA 4Q02A 5T3UA 4D0NA 2JIZD 2ZXEA 3EBOA 1U0JA 3HJTA 4L5BA 1N8NA 4ER3A 4JYBA 1AURA 1EBFA 1G0NA 1MQ9A 1YAJA 2HK6A 5AQEA 3WLAA 3FSGD 4QM7A 3TGWA 5E6RB 3R09A 4G9GA 5J47A 2GXSA 3I5UA 2XVAA 3REQA 4ZA2A 3ER6A 4R1MA 5BPHA 4ZVLA 3EGIA 4JU9A 2P0AA 1JKXA 3UMRA 1UT8A 4GG1A 2I65A 4L2IB 4C21A 2DGDA 3U3XA 1P5FA 4R1QA 5CNJA 4QOJA 3TB4A 3LUJA 2W6QA 4PEVA 1DAOA 4C5BA 2FR8C 3OAAD 5F2EA 2ZJ3A 1XHEA 3FI0A 4H31A 2HF2A 2KM1A 2WJVA 4HAIA 4BV2A 2BKAA 1C7QA 1KZ6A 5CYPA 1G7SA 4BBZA 1H0SA 3CO0S 3FMGA 3AY0A 1Q12A 2NM0A 3UV7A 5M34A 1K1EA 3A1TA 3ESDA 2Q5LA 3GNLA 3S2YA 5C8YB 3BL5A 3KUKA 1K63A 3WLOA 3E9QA 4EFKA 2ONCA 1Z13A 2X1MA 5IUKC 3UB2A 4EPYA 4EEZA 2DHDA 2BZ1A 5H70A 2FWRA 4F91B 1YGYA 2CV1A 3HVKA 2J31A 4JVSB 1J9ZA 4BFSA 4ZXFA 4KRXA 1G6OA 3QTLA 2OFFA 3BB1A 3R3YA 7AT1A 4HLUC 3V2HA 3QXHA 2NVOA 3I2FA 1VRCA 2JIMA 4AIRA 2BBWA 1MO4A 4JKYA 2F9LA 3DKRA 3MGCA 4WXYB 3JYPA 1YQDA 1EFTA 4ZV9A 4B4OA 4YJ2A 1TEZA 1OYWA 4JJIA 2IPLA 3DKVA 3R7NA 4JBYA 4CUZA 4LOJA 2IYOA 3I1IA 3L01A 3LBAA 4N82A 1U5CA 4QDOA 5HA5A 2CE7A 4HRAA 2FPOA 5LYJF 1JZTA 4BRUA 4EJFA 1KDOA 5HF8A 3SKVA 2ZJ5A 2ZT5A 1DP4A 3WNVA 1JGTA 2MSCB 4TWZA 4JYMA 5CK5A 3VGJA 3NBKA 1GGJA 2YWCA 1TVMA 4CM9D 2HUPA 5FCDA 4QT0A 2H2DA 2XXJA 3K35A 3MMSA 3AERA 3MB8A 4XCQA 5ARCA 3TNJA 4Z51A 2O6LA 4HH4A 4HG2A 3B51X 1A9XA 2D54A 4C30A 3UV3A 3GG2A 5A06A 2IYXA 1UH5A 5EJ9A 5JAUA 4L0CA 3VXKA 1C4WA 5BXYA 1TQDA 2PZEA 2VYVA 3DXFA 3UAYA 2HTFA 3LWBA 4X6LA 2IBTA 4ZDWA 4Y1RA 1M7BA 3D0RA 3FVQA 5LOVB 3E9NA 4EPXA 2CDAA 4DMFA 1HGXA 2QN8A 2V8BA 2FR1A 4NHEA 3NP9A 3GAMA 2RB4A 4MJ3A 2VT7A 1JN0A 2QLLA 2Q21A 1G7CA 2HA6A 1M2WA 2VTEA 3AEQA 5DIZA 2Z4RA 5KQPA 2B5OA 4EAAA 1YKFA 1UBKS 4TTPA 1VL6A 4JBXA 4HT3B 2BFDA 4CMBA 2X3FA 4TVKA 1S2IA 3OU7A 2EJUA 4TXMA 4UVHA 2JLUA 3A1WA 1T8WA 2YZ2A 3TX2A 5B1IA 4HDKA 5JXIA 1TRKA 2JK0A 1OFHA 2Q41A 4JX8A 2O0KA 3IR6A 3N70A 4TSRA 5FO0A 1SXGA 3JQQA 3C3XA 2DFPA 4CGZA 5LXTF 4XW2A 4QVIA 2A92A 4P7GA 4BBJA 4YP0A 4B35A 2PEYA 2ZUSA 3TCKA 1DNPA 4C0HA 4EG3A 5ICEA 2NU6B 2REOA 4XR9A 2I7VA 2XCTB 3R7LA 3ZH2A 2IGBA 3HYNA 3THSA 4OIMA 1NX9A 3ZLBA 4C3VA 5C80A 3ADKA 2Q3CA 1B8NA 1FNNA 2IJGX 4MZDA 3VJRA 3I9LA 3I4CA 2C9CA 1PZXA 1HNZB 1KVQA 4YP7A 3GRCA 3PNPA 4R3UC 5ENDA 2ZQ5A 3B3FA 4KXWA 2GF9A 2YS6A 3IKLA 3JQCA 4PYKA 1MOSA 2H1IA 3H1AA 2CVOA 1Q92A 1HMYA 5C5EA 4QSHA 5BQ3A 1Q6ZA 4Z9XA 4ENSA 1NUTA 4P2BA 4RORA 2Q1WA 3RHZA 5HKOA 1PT5A 4ME6A 3ZBTA 5BSHA 4N5IX 4P3NA 4IHJF 1QMGA 5CCXA 1FJXA 3O9ZA 2VNJA 4JLSA 4LRSB 4Y0NA 1MTOA 3L6OO 4UBJA 3U44B 1NBMD 1PLLA 1TA9A 1TW2A 4LZLA 1BGVA 1XOIA 3BGOS 4GP7A 4X61A 4BQIA 1SBYA 2OENG 3QVKA 1NVFA 3EEYA 3OH8A 1VJCA 1ZITA 3LPLA 4BNJA 4F4CA 1F7VA 2DCMA 5IAAA 4BAUA 4UDOA 2VN8A 2YZGA 3EC1A 1W0JD 4UEKA 1S7CA 3O38A 3P4UA 4FCCA 3JQFA 3ZY3A 1G4UR 4TS4A 3UXHA 5F7OA 4HNQA 1Z15A 3DD1A 4IX9A 2C5GA 2RAUA 3Q9SA 3SE7A 3OWXA 1UDBA 4WNAB 5FKJA 4Q21A 3V4PB 2XBMA 4U8GA 2WIDA 4X65B 3L0OA 4FFBB 2ZKIA 1QQBA 3P71T 1X15A 3TFQA 1RLIA 3HUFA 4YCAA 1T1SA 1WMFA 2J0VA 3O4JA 4AXXA 1C3JA 2LGJA 2O8NA 3D3NA 2X2PA 4LXGA 4ILEA 1RMYA 2V7VA 5KDLA 3W9BA 1GOTA 4AN1A 3GD7A 3PDWA 4NI5A 4CV2A 4ZCIA 4N8DA 4BBPA 4G09A 1NVUQ 1O58A 3BB4A 3P2IA 1G6KA 1F38A 4Q4AB 1M1UA 1EYZA 2XYGA 4URHA 4PSDA 4X93A 3ZNPA 1WAMA 4WNAA 5FTNA 1N1MA 1ZGAA 2RHLA 4LVOA 4B3SB 1L7MA 3F98A 2K7ZA 4D8UA 1E6EA 1XFAA 1N1GA 4ZQCB 4CEIA 1IN6A 2AMVA 3BK1A 3O82A 5JZ9A 1GZDA 1KAEA 2IYFA 3JWEA 3WZLA 1GPBA 1OI2A 3A6EA 4WGGA 4W5NA 4QGGA 4CTJA 1E7YA 2ZREA 3O31A 2F55A 2R65A 2AFIE 3CGGA 1GQOA 1SCIA 2YRFA 1RCUA 3DOUA 3MHPA 4IIFA 5FHRA 1DARA 1R15A 1R0SA 3HCDA 2ZVDA 3O8QA 4PPQA 4PC7A 2QTNA 3ZBPA 3LYUA 3QBTA 4FW8A 3ZDZB 3N0WA 3JAKB 2CE2X 4EYEA 3UGKA 4PSKA 4CTMA 3I9V6 3WNDA 5BSEA 3RK1A 1EG2A 2WJ6A 4M9QA 2QL5A 1EK0A 2C84A 5DM70 1D4AA 1JG6A 3IR5A 3AJEA 3BA6A 1BCRB 3CB2A 4FHDA 2O7SA 4UTVA 4O5AA 3SYRA 3HCOA 1W25A 5DTMA 4I08A 1WJGA 1XQXA 5KWSA 1L1FA 2WTEA 2NV6A 1WD5A 1PW5A 5FL7D 4J16A 4BMSA 2HRDA 1N8SA 4OLHA 1QVWA 1ZOPA 3HSSA 3KUCA 2JATA 4X9XA 4JGBA 2CT8A 3ET4A 1FX1A 2P2GA 3ZWDA 3GEPA 3GAFA 4PCAA 3RFCA 1DAKA 3MQ4A 2RB5A 1NQ5A 3M33A 4P86A 4KAJA 3WXMA 4MUXA 1PDWA 2R87A 2V9ZA 3FNHA 1Z38A 4GUAA 1GCUA 2D7JA 4M1OA 4RGQA 2R1UA 5BYBA 2B92A 5TT1A 3RTCA 5ADVA 4W8OA 1E58A 2QD5A 3Q0EA 4UHCA 1BQ4A 2B2CA 3C6KA 3MFQA 4JLDA 4CWAA 5ESRA 2QVGA 3W0LB 3DZBA 1E2UA 4HDCA 4MI3A 3GXBA 5F77A 2AG1A 4DV6B 3VKHA 4EJSA 3M6AA 2Q9CA 1FBTA 4NATA 3PI6A 4NG4A 1UPUA 1G8FA 4BUCA 1FP4B 1Q7TA 5B6PA 2H06A 2HJWA 4MP6A 5HJEA 4IGEA 3FYTA 5CEJA 4H0FA 3ZIAA 1DQYA 3MTGA 3WQRA 4EITA 2MU1A 1B93A 3NCHA 2ATCA 4M60A 4I66A 3Q8MA 1ESCA 2BH2A 3CLSC 3T3PB 2A1UB 1IBCA 1TAHA 2YHAA 2PMCA 3G3EA 3ZWVA 5I9NA 2CHVA 1YFZA 5G0WA 4NV0A 3GCDA 5BSUA 1ORRA 5KC8A 2DWPA 1QSGA 2BEWA 2R25B 3RFVA 1G3IA 3DBLA 4ZKEA 4XIGS 4Y30A 4CG0A 1HH4A 4KTTE 4HUTA 1U9CA 1AA9A 2P9ZA 3N9IA 2YMLA 4YT5A 4B87A 1C4KA 1MW9X 1SA0A 3JQPA 1QQ7A 2Q3DA 4UQPA 4FB5A 5KYTA 3C7TA 3KM0A 2OPHA 4QELA 1N2JA 2YIDA 3IP7A 2ZSKA 3CFYA 1C0LA 2ZAMA 3EFOB 4TMYA 2R0QC 2D5IA 2HBRA 2HCJB 4I4TF 4XVHA 2XKKA 2YZNA 5ALMA 5SICE 1M0SA 3G0DA 4QSMA 4TUYF 1WEHA 3TR0A 5JMTA 2OO5A 1Z7BA 4NYMR 4B9EA 5KWIA 1A4UA 1E9SA 5FEMA 1HQCA 1ZW6A 2I2WA 1RM4A 4B17A 5EKDA 5EIEA 4YRBA 1JHYA 2YH2A 4ND7A 5IUNC 3RG8A 1KTVA 4E0BA 1AKVA 5E3IA 3BERA 4L3OA 1JIUA 1QGUB 3SXUB 1QO9A 5KNDH 3ZLJA 1M1NA 1XUOA 3VPHA 5KB3A 3BGWA 4OIFA 2CEAA 5LDHA 1EVJA 1NLMA 4CE6A 4Q9LA 1IWOA 2Q8NA 4DSOA 1HMPA 2ZPAA 4ZVRA 4BYGA 5DX0A 1FDSA 1KRWA 1AQ6A 5ENZA 2OZLA 1YQXA 4BO3A 1TT7A 2FMUA 4O4IB 4RV9A 5DT9A 1GTVA 2AZDA 2OCIA 3NLLA 1QYCA 3LIIA 4MV1A 2ZRLA 3L0SA 3ZWNA 4LQCA 2HJ9A 5KNDD 5IVDA 2PK3A 4M38A 1DWUA 1SU7A 3C3JA 4L0DA 5DYYA 5IDYA 3TLJA 5CB6A 5HIKA 2UU9B 4A0QA 4R6WA 2WU1A 2A1TS 3SJZA 3RJ9A 4YYZA 4X8MA 3RUIA 3LL4A 4YBRA 4G0NA 2FEWB 1UPFA 3OJXA 1MOQA 1S3SA 2JHGA 3UNXA 3VU1A 1G4AE 3N2IA 4BVHA 2A5FA 1YBAA 3SEAA 4TLLB 3IOYA 5IN5A 2P35A 1W5AA 1HE3A 3LQFA 1TKRA 1DKPA 3SYTA 2DY1A 5IJAA 4ZVPA 4ZYUA 1E2BA 4GPZA 3II6X 3F1KA 3WLJA 4R2IA 5KU1A 1NNSA 3M9WA 2FVXA 1UMBB 3P2KA 5KS2A 1FYDA 2G3YA 4C0LA 5KYWA 1RJ9B 1FNDA 2PT9A 3C6MA 1S4MA 3DFMA 3MGAA 1KVRA 1J70A 4HYYA 4UBMA 3H2ZA 3U4HA 1Y82A 2HZBA 5E6UA 2O5VA 4DQVA 2JLCA 3IKVA 3OCYA 2W48A 1ZCZA 3AONB 3G17A 3W5IA 1U63A 3BD8A 2HNBA 3UJDA 2XZLA 2FQWA 1OX4A 3CLKA 4LJAA 1AGNA 4RABA 1TB4A 3RBVA 4PYJA 1X19A 4DCCA 2EVWX 1K6IA 4EGCB 2HN9A 2ZGVA 3AI2A 4K46A 4XCXA 4CL0A 3TM5A 1S9DA 3OE4A 1PQYA 4A8JB 1FOEB 1RQPA 2VNIA 1WW3A 3CIOA 5A5GA 4Y2VA 4K7JA 3U4QA 1CNMA 4NEQA 1JB9A 1XZMA 3AUFA 3TE6A 4EI8A 4TN5A 2N47A 5DN6D 3PEYA 3HXKA 3LWNA 1CV2A 2RHRA 1EXMA 1NYQA 2C1XA 3OO0A 1QFJA 3M6UA 4PPGA 1KIMA 4YI3A 1RYBA 4CR8A 1M74A 1B15A 2HUNA 2DUMA 2D4AA 3MN1A 3MAJA 1Y3BE 3ZLTA 4EG7A 1Q1ZA 3G2HA 2X0DA 2ZYSA 2PD4A 5JE8A 1TIPA 3M1LA 3H5LA 2EGHA 4WK2B 2NUBA 2B0JA 1JVBA 1VP9A 1VL5A 3OE7A 2DPGA 3R5XA 5AHRA 1UDWA 3QA9A 1PSWA 1E9BA 3VR5H 4BFVA 4E5VA 2R6CA 2Q6KA 3BFJA 3A6DA 2OFOA 2Y66A 4OV6B 1HYQA 1ZHFA 3BXZA 3QJGA 4LHZA 4RADA 5DHSA 4I4IA 1OAAA 4URWR 1CLUA 1EHCA 1F4VA 3PEUA 4H3HB 4PS1A 1C7ZA 2MSLA 2XWQA 4WV3A 1Z6AA 1VC2A 2N75A 4QUEA 4CT5A 3AXSA 4EFLA 4EY4A 3T1HB 4P33A 1AXEA 1XD2A 2OV3A 3KBOA 2YVUA 4M0PA 3W6NA 1SC9A 5FNVA 3FGOA 1FFEA 4EZEA 2Z6QA 2AUMA 3CRMA 1WM1A 3N2GA 2R85A 3IQZA 3NBYC 1YR1A 1YR6A 4UHBA 2VHUA 4X1YA 5EA2A 4E07A 5EJEA 1NR5A 3T3OA 3ZC3A 1XJCA 1T91A 5SV2A 4JDUA 1Z2NX 2CMDA 1D5CA 4XEUA 1K9SA 2ZAOA 1XQ9A 1W73A 1U0GA 2BMVA 1YUBA 3Q7EA 1VGRA 3FOZA 4GR5A 1BW9B 1T5HX 4RZXA 4IZOA 4LEIA 4GECA 5IWAB 3TLKA 3VTFA 1MC4A 1XPUA 1R1DA 1GHTA 3S1AA 2AOUB 5LYJA 2PUDA 4BEBA 3SR4A 2A9KA 2BFFB 2JZCA 3JQAA 3M8KA 5HUHA 1BKDR 4HB3A 4PVDA 3NEYA 1BO6A 3T7AA 4DCPA 1NL3A 1DTWB 1GL9B 1LC3A 4GH5A 3FLMA 4Z0NA 4I3HA 1L5LA 3TE7A 3OPXA 4B4WA 1Z4OA 4EF5A 4EQ6B 2CXHA 3FYDA 5DNUA 3DE0X 2PANA 4L8VA 1R66A 4TVBA 4EO7A 1Z8NA 5A4IS 3L3BA 5K8TA 2I22A 1EGAA 1P4JA 2CVHA 3IMEA 1TZJA 3HHEA 5C46F 3FLEA 4KX3A 3UY4A 5IG2A 4D92A 4DV4B 3GVHA 2J1LA 3G2IA 2WTNA 4MICA 3LV8A 4ENRA 3MHTA 4I1UA 3W2HA 2ADOA 3FOFC 3WK6A 2ZUFA 4MDFA 1QPBA 4JI4B 1H94A 1ZI8A 2HSGA 3A37A 3NTQA 3OZTA 4LJRA 1AF7A 1H4VB 2FRDC 3MRSA 4IMJB 1VB5A 3CKLA 2FK7A 4KXYA 4KTVE 5JROA 5F7JA 4C01A 3KE9A 2D62A 1W93A 2K4MA 3LXUX 1NR7A 1E3LA 2DQYA 4BO6A 2D1TA 3AM3A 3GLIA 4OKNA 2R48A 3IC5A 5FFFA 3IVRA 4KUEA 4MGHA 5AKJA 4MAMA 3LUKA 2GN0A 1OGYA 4UOZA 2REQB 1GFIA 5BURA 4AFNA 1Z06A 3IQWA 5BWBA 4RCYA 3D8UA 5FV4A 3K0SA 3EZXA 5FFMA 1PS9A 4KN5A 1XEAA 3PTZA 1SC3A 2Y0DA 2OXRA 2W83A 3N76A 5EHGA 3DVAB 1YS9A 5GP1A 3SQNA 1WBDA 3EBPA 1J8MF 2ZYGA 4IEIA 3HBFA 4B6RA 1NKVA 3E7XA 2MSKA 4WY2A 1E4YA 2PS3A 1JEEA 3TXXA 1AM4D 1OH7A 3MG9A 1DINA 4I99A 1VJ1A 5JATA 4L4RA 4XTCS 1KDZA 1W5TA 3OECA 5C8ZA 1U8YA 4DA6A 1EVIA 2FPGB 4FGWA 3TNYA 2VDUE 5AQ1A 3C3KA 4AJOA 1TU0A 1E5QA 5TMPA 1I1NA 2YIJA 1Z26A 2HSDA 4JCOA 4M4SA 1FBNA 1YRYE 4QXOA 4YJ3A 2EZ9A 1FLDA 2Z8YA 4B6QA 4IGKA 1FLAA 3DYVA 1F4LA 1VSQA 3VR6A 1KWGA 3F47A 4AJKA 1NLFA 3I9JA 3NBAA 1N2XA 2OWEA 2NXJA 5TGTA 4PLHA 5BSRA 1E0KA 1RHQA 2XEXA 3UG7A 4MULA 3M81A 4YYEA 4DWVA 2QRGA 2AOVA 3HXMA 5K51A 1MD9A 4IIYA 1EQAA 2VRNA 4CW7A 1SXJA 3T1YB 5BN5B 1E79D 2XEDA 3JYNA 2PX6A 2IWHA 3DTTA 4ZT2A 2V7XA 4ISCA 3BWCA 3T3GA 3S55A 4X84A 5KIAA 1WHSA 2DTDA 2VP6A 3H5IA 2ZROA 3GUHA 3TR6A 3GG9A 1R0KA 4L6IA 3HA5A 1MO2A 2ERXA 4PYOA 1SURA 1IXSB 3WWDA 2P0YA 3S1SA 3N8IA 5A0FA 1KERA 3ESBA 3STXA 3RABA 3V46A 1FK8A 4G0MA 3W34A 1XT6A 2P9FA 5JBIA 1UWLA 1UC8A 4A5SA 1MBZA 3DKKA 3ESCA 3QBEA 1J25A 5ED0A 4EHAA 1CJKC 1JA1A 1QH8B 4HWKA 4OXIA 4V2UA 4E4TA 3F0TA 1K5GA 4FR2A 4QDXA 2VJPA 5GZ6A 1SQGA 1VKZA 1UDXA 1XKLA 3P9XA 3EQZA 3EC2A 3LVRE 1M76A 5C8XA 3L9WA 3LZCA 4BFXA 4R7TA 1CR6A 2QVZX 2ZRDA 1IG0A 4B3FX 1K0FA 4HWGA 2YNMD 2WD8A 2CKDA 3PCXA 2Q8QA 2ASVA 3GGPA 3HH8A 1ULTA 5CLFA 3BRSA 4R3WA 4KO8A 2WFMA 4PNZA 1IONA 1SBHA 1O54A 2BGLA 3IUPA 1U8EA 2IUSA 1HE4A 1CF2O 1SULA 3CZAA 4MLDA 4HGPA 4DAEA 2ZB7A 4F2HA 1QV7A 5JC1A 1QGUA 3JRWA 4TL8A 3SXUA 1GG2A 2WT9A 2ZE5A 4L5CA 4D98A 4W9RA 1KZYC 5CD9A 1CDDA 1SQFA 2UYQA 3OIDA 1Y8CA 4H1HA 1QIEA 5E1MA 3BULA 3U31A 5L7TA 5L3SB 3PJFA 4H77A 4H35A 2QG6A 4AQYB 4FZ3A 2LKCA 1D7OA 1QS0A 2C5SA 1S8OA 4R5MA 5IT5A 3QPWA 3GJXC 4KE9A 1L5SA 2PUEA 4TMFA 3DDWA 2PWAA 4G9EA 4IFEA 3R23A 3GZ4A 2CJYA 2WWTA 3L4SO 3ROMA 4C14A 2YWDA 2M9MA 3AGPA 3QF7A 4GOXA 2PGJA 3M4XA 5HF5A 3UJ3X 6GPBA 1JILA 2C2BA 5JFTA 2O2HA 2FCRA 2IODA 1U0RA 3B5EA 3QVGB 4QQKA 1BU5A 1B0UA 3ANNA 1PYGA 3L7NA 1J2JA 4TMTA 4EUHA 4Y2GA 4MDEA 1L7BA 4LGVA 3AESA 4PVCA 2ZLBA 3M70A 3HB0A 2H2FA 2GZ3A 5COBA 1G8KA 1YAHA 5ESDA 4JGIA 4ZJPA 2IBMA 4N5MA 1RFLA 5BSMA 1QZXA 5CW1A 4PIPA 1YRAA 2A0WA 1MEOA 2F3TA 2OD9A 4ETNA 4OI0A 3HEBA 2C5EA 3I12A 1ZNZA 2IXTA 3JQ7A 4FCTA 4QJ5A 3UHJA 3ROTA 1B73A 1NVVR 2R62A 3FM9A 2HJRA 3I6IA 4Z99A