3F7OA

Crystal structure of cuticle-degrading protease from paecilomyces lilacinus (pl646)
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
284
structure length
284
Chain Sequence
AYTQQPGAPWGLGRISHRSKGSTTYEYDTSGGSGTCAYVIDTGVEASHPEFEGRASQIKSFISGQNTDGNGHGTHCAGTIGSKTYGVAKKTKIYGVKVLDNSGSGSYSGIISGMDFAVQDSKSRSCPKGVVANMSLGGGKAQSVNDGAAAMIRAGVFLAVAAGNDNANAANYSPASEPTVCTVGATTSSDARSSFSNYGNLVDIFAPGSNILSTWIGGTTNTISGTSMATPHIVGLGAYLAGLEGFPGAQALCKRIQTLSTKNVLTGIPSGTVNYLAFNGNPSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Serine protease
publication title The crystal structures of two cuticle-degrading proteases from nematophagous fungi and their contribution to infection against nematodes.
pubmed doi rcsb
total genus 105
structure length 284
sequence length 284
chains with identical sequence B
ec nomenclature ec 3.4.21.-:
pdb deposition date 2008-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3f7oA00
3GCWA 1Y3DE 1TM3E 3AFGA 1SIOA 1A2QA 1SBCA 4GI3A 1DUIA 3SQOA 4DJ5X 3GT3A 2W2MA 3VYVA 2XRMA 2SBTA 3QTLA 3DE5X 1EGQA 4BWGA 3LXUX 2PWBA 1OYOA 4C3UA 2PWAA 1PEKE 1AV7A 1GA6A 3P5BA 4HX2A 3VV3A 1C9JA 3Q40A 5I9SA 1TECE 1PTKA 1ST3A 2W2PA 1TM5E 4KPGA 1AU9A 1AVTA 1SUPA 1THMA 1SH7A 3VSBA 2HPZA 2PQ2A 1Q5PA 4K8RB 2SECE 5B1EA 1GT91 5ARDA 5AQEA 3AJ9A 1AQNA 3BX1A 1TM4E 4CFZA 1Y1KE 1YJAA 1Y3FE 3ZXYA 1TO2E 1C9NA 2IXTA 2W2QA 4OMDA 3DE7X 1ZVKA 3OSZA 1Y3BE 3DW3X 3DE2X 1SCJA 1KE1A 1Y4AE 4NE7A 5CW1A 2Z2ZA 1CNMA 4WOBA 3CNQS 1BJRE 2QTWB 3F7OA 1SIBE 5JMOA 3EE6A 1S02A 2Z58A 4CG0A 1R0RE 4NE9A 4NMXB 3DE0X 2PKCA 1IAVA 1XF1A 4LVOA 4RYDA 2PYZA 3LPDA 2ZWOA 1AH2A 4OV6B 1BE8A 3I37X 1UBNA 1Y34E 2TECE 3AJ8A 3DDZX 2Z2YA 5JXGA 3DVQX 1SBNE 5ARCA 2PMWB 1TK2A 4H6VA 1YJCA 3WIVA 3EIFA 3DWEX 3TI7A 1P7VA 1Y3CE 1WMFA 1WVMA 1R64A 4LVNA 1MPTA 2ZWPA 1NDUA 1SBHA 3DE4X 4C3VA 4FONA 3VV2A 4HVLA 1KDVA 3TECE 1GTG1 2XTJA 3ZXXA 5FAXA 2HD4A 1P8JA 2WUWE 1SBIA 3DE1X 1BH6A 4ZARA 1AF4A 1SCAA 3LPCA 4I0WB 1CSEE 2ST1A 2ZRQA 3QFHA 2WV7A 1PFGA 1KE2A 3DYBA 3VTAA 2PRKA 2Z56A 2DQKA 3DVSX 1V6CA 5K7SA 3GCXA 1GTJ1 2ID8A 3A3NA 5AVKA 1SN7A 1SUCA 1BE6A 5B1DA 5JXIA 3EDYA 1GTL1 4YN3A 1C3LA 2V8BA 2GKOA 2WUVA 1SUAA 3PTLA 1GNSA 1YU6A 1T1GA 2ID4A 2IY9A 3HJRA 5ARBA 2Z2XA 2W2NA 3DE3X 1DBIA 1SPBS 5SICE 2B6NA 1Y48E 3WIUA 3BPSA 4B5LA 2Z30A 3QMPA 1V5IA 1YJBA 1WMEA 1TO1E 2E1PA 3DVRX 4OMCA 3DW1X 3I2YX 1SCNE 1KDZA 3UNXA 3A3PA 4MZDA 2P4EA 2SICE 1NLUA 1T1IA 1GA4A 4AKSA 1AK9A 1OT5A 1SVNA 5JXJA 3WQBA 1WMDA 1SIUA 1SELA 2SNIE 3I30X 1R6VA 3BGOS 4H6XA 4CFYA 3H42B 3SICE 3F7MA 2DUJA 3WHIA 3T41A 1S2NA 1JEAA 2X8JB 1GNVA 4KB5A 3VHQA 1EA7A 4H6WA 1BFKA 1SBTA 4WOCA 1PJ8A 2G4VA 1OYVA 4Z2AA 1T1EA 1Y4DE 1HT3A 3Q5GA 4J94A 3CO0S 1BFUA 1SUDA 4DWWA 2Z57A 4KG7A 3I34X 1S01A 5AMXA 1ZVJA 3A3OA 3LPAA 1WSDA 1IC6A 3DE6X 1GA1A 3D43A 5FFNA 4AKTA 4DZTA 1SUEA 4ZOQI 1TM7E 1NDQA 1C9MA 1MEEA 3TI9A 2X8JA 2W2OA 3GT4A 3D9QX 2DP4E 5JXHA 1GCIA 1SCDA 3F49S 3PRKE 1Y33E 1P7WA 1SUBA 1TMGE 4M1ZA 4JP8A 1ST2A 1VSBA 1Y9ZA 1KDYA 1SCBA 5AVJA 5FBZA 1LW6E 2WWTA 3L1KA 1TM1E
chains in the Genus database with same CATH superfamily
1ZJZA 5ESXA 2WWVD 3BDIA 5AICA 4TRMA 4REQA 2FEWB 2PTGA 4P7BA 5I9IA 1XJCA 3TLJA 1SIOA 2EGUA 2G5TA 3A14A 1HPLA 1C3JA 2OCXA 1Q83A 1IDN1 2O57A 2WE7A 1NPYA 1DUIA 2RK3A 2ZTVA 3CB4A 3E05A 4PCLA 5DTEA 4B17A 1E7MA 5C7OO 3L1HA 1ZJJA 3F7NA 4UD6A 5KHOC 2KJQA 3EFOA 1G21E 1PEAA 2QG6A 2RHWA 3F9IA 4H31A 2GSDA 2J87A 3PXAA 4XEHA 1QIMA 3RYCB 1J2YA 4Z4GA 1C7RA 4RZ2A 4JYZA 1BROA 3P0RA 4HPXB 1RC0A 2MR5A 5DJ5A 3M9XA 3RFXA 5FYDA 1HZZC 3JZFA 2Z95A 1F2VA 3NWJA 4X6UA 1EX7A 4GKJB 5C8YF 5PGMA 3GXBA 4O59O 5M29A 3PUJA 1QWOA 1CZLA 2XTNA 3QFRA 4PYKA 1G8MA 1MB4A 1SVOA 2OB2A 2OV3A 2PGOA 3D6JA 3DHNA 4Q1AA 3LT2A 1AOXA 1A9PA 3KRTA 1Z5VA 2QRHA 3RIHA 1CUJA 2CXUA 4BY9E 1RRPA 2C9YA 2H1FA 3Q7SA 4UBJA 2BHSA 2Y1LA 2HK6A 4DIBA 1BSVA 3H9CA 2E4UA 3HM2A 3PJFA 1Q1ZA 4CLOA 1R8XA 2A5DA 4II3A 4TKZA 1K6EA 1PR3A 3LCJA 3R5TA 1P2UA 3RJ9A 3ND6A 2H1IA 3V8EA 4WKCA 2YFYA 4LV8B 1SU7A 4ZO6A 2Q49A 4N5HX 1NONA 1ST3A 4ZXFA 1JV2B 1QONA 1VKZA 4HKTA 5CCDA 4AICA 5JAZA 1ODJA 3T7JA 4F12A 3IIEA 1XCMA 3I09A 2BWJA 2BDTA 4XVUA 3FUCA 1Q0TA 4X84A 1OI7A 4P3PA 3VJKA 1AU9A 4TV9B 3ZTYA 1QP0A 2M2IA 3PRHA 5D5HA 3RUIA 1RCUA 1H1LA 1FUKA 4HMQA 1Z8DA 4ILKA 2HPVA 4WK2B 4E1AA 5EJ6A 1L4YA 2BP7A 3BD9A 3U1VA 1XHFA 4PGAA 4CV3A 5FWYA 4Z1MA 1U1IA 4LE0A 1CR6A 2JFWA 2RIRA 4K8RB 3V7UA 3ZV7A 4RTLA 2NX2A 5ITWA 1FRFS 1O6ZA 2VDPB 5KWJA 3RT9A 2X1VA 3TSCA 1LLCA 3I5MA 4OF4A 4LRUA 1BXRA 4KK4A 4D82A 1UC5B 3L7JA 1KEKA 2QSZA 2EZ4A 1A3CA 4KTVE 5BV7A 5DPMA 3QX8A 4OYRA 4D56A 1SUFA 1DWQA 2HMAA 2V5UA 2FK8A 1XPOA 3D8UA 1O96A 1QNLA 2YQ5A 4RVSA 4W7IA 1Q15A 3HN2A 3NHBA 5DXFA 5EWLA 4MS1B 5MN6A 1G38A 2OHVA 3DCYA 1VMAA 2ZUUA 2X4LA 2F4NA 1BXGB 1D2EA 1UC9A 4H4DA 3ILYA 4TSFA 4YHHB 3RS7A 2OFWA 4M0KA 4QO8A 3VNAA 4UTRA 1SWWA 3DF7A 3OT1B 2QRPA 4EDHA 3PV0A 1P2GA 1V41E 4O2BB 4I9GA 4JENA 4YDSA 2WSLA 3Q12A 3DHEA 3LHDA 1E92A 5TQ0A 1XMPA 4E88A 3OSZA 2NU9A 3F3YA 3CFYA 3OY7A 4LISA 2VRCA 4C2TA 2F6RA 5D84A 4BBAA 3DE2X 1M6NA 1SCJA 4NYMR 5FFFA 4HVCA 3L5OA 2VK2A 1E9EA 3CF4G 3Q0IA 4I14A 4Q7EA 2I4LA 4MW2A 2IU3A 1PHRA 3KJGA 1JIKA 2EQBA 2XUZA 1ORHA 3JYNA 4XIYA 1Z8NA 4DSAA 4OLBA 4J6FA 4GOLD 3OCXA 4EZIA 2H7YA 1KFCB 5KX5A 1VIVA 1YUMA 3T7TA 5A1JA 3SSNA 2B8JA 5BUSA 1J49A 1ORIA 3F7OA 3TL2A 4ZOEA 2EHDA 1ZK1A 3VH3A 1HNZB 2CFSA 1D2GA 4G25A 4MQBA 2Q7OE 3C3YA 2QTLA 2FZLA 3F7TA 2WT8A 1EM8B 3PE4A 4EY6A 4BTLA 1HTBA 1PR9A 4AJIA 2YYZA 4ZZ2A 2ILTA 2QT0A 2WAAA 1P1JA 2WFLA 1R0RE 2NU7A 2ZJ5A 3GMSA 3OOJA 1IK6A 4RLHA 1A72A 3JX9A 4EA8A 3LLVA 2DHRA 1U0JA 4GLLA 3PX2A 4IBOA 5K99A 1QTRA 3ESXA 1KEZA 5K3EA 5BV0A 1I4LD 2F43B 4HLCA 4OGGA 4QELA 4RPKA 1L5QA 1JTVA 1FRVA 3UFBA 1A2BA 1CQPA 3HL0A 1NULA 3GP5A 4TTSA 3HZZA 5KNBH 4R98A 3E70C 3JXEA 1JDBC 2FWIA 1J0CA 2NZVG 2ONYA 2PT9A 3W6UA 2RH8A 1RQLA 2B92A 3T06B 3B89A 4PG8A 4JFAA 1L5LA 3QPCA 3W2HA 4Z1MD 3PNMA 4PX3A 2D2FA 3QYAA 1B43A 2QUAA 1L5OA 3KB1A 4INZA 3SGLA 2CXNA 1J21A 4F38A 4ENPA 4B45A 1HFEL 1JR4A 1USUA 2DLDA 2BAGA 2AMFA 3G1UA 1IRIA 1VLLA 2ZT8A 1W9HA 3JYHA 3LHSA 3NBQA 4AT1A 5FWDA 3V8NA 2H1SA 2BHNA 4BP3A 1VB5A 1QRAA 4RADA 4YWJA 3R09A 1HKUA 4TKUA 1XL1A 5HKBA 3ABQB 1TK2A 2I2XB 1WW2A 1KRHA 1V43A 1RI5A 2AK2A 4WNCA 5DEOA 5DNVA 6PFKA 3O2NA 1DDIA 2CVZA 4M55A 1BZYA 3FCEA 3QI7A 1V5WA 2JCGA 2PIAA 3JQPA 1PFUA 2ZSKA 3Q7RA 3ZE0B 4G5SA 3B3JA 4NL4H 4PCUA 4I66A 3A9WA 5A62A 1H2ZA 3LK7A 3SYLA 2JLUA 4WESA 1X94A 3OLXA 1V9LA 3L6RA 1KOFA 1JJAA 5DBFA 4L6AA 4FJ1A 1NDUA 4PSKA 1UJNA 5IK2A 3L7CA 2ZQZA 3ZIAD 4C3VA 3CWQA 3FNFA 1ZGAA 3LIIA 2D1SA 4FONA 4OXKA 1T4MA 4EYQA 1XR3A 2OY0A 3U4GA 1E0SA 3AG5A 3KKNA 3AVVA 3O8RA 1G8GA 4HLUA 3M6AA 4O4JA 1FX1A 1PUXA 1P29A 4OHYA 1AKQA 2VJAA 4ZEWA 3PD0A 5EWMB 3AJAA 3CHYA 1M2OA 1XVLA 4IDBA 3AL2A 1XK6A 1Z6PA 3OCWA 3OCJA 3OWHA 1OXTA 4JKIA 2PY6A 1ISHA 4LYHA 4DHWA 1GG8A 1NBWB 3VR6H 4A6DA 3DBIA 1CFZA 2V97A 1QZUA 3GT0A 3R0QA 1P77A 2ZJ8A 3Q88A 4FD2A 4IWYA 3VR2D 4ZHSA 2YWCA 3QE4A 1SCAA 3HWRA 2NV6A 2AUTA 3OZEA 4I0WB 4PLFA 4RK0A 3ND5A 3TFQA 1PEDA 1MDFA 2ST1A 3CBQA 4HD8A 1OFTA 5DN6A 2FKAA 3K1YA 4N3CA 3DZBA 4R8LA 4TMXA 1H2RS 1VE1A 2B0JA 4RVNA 4A0GA 2VK8A 1G0NA 3SHOA 1DC4A 2Z56A 1HDZA 1YDFA 1FJGB 2G0AA 4L2IB 4JELA 2D6FA 2AVNA 5ILGA 1AN9A 2GPWA 5BV1A 3C7CB 2A57A 3DWGA 4RHEA 1B93A 4RA6A 4RH1A 2Y05A 1GTJ1 3HY3A 4HLQB 4KU4A 5JZOA 1X1RA 5DLDA 2W6MA 1FYDA 3ROPA 5DDIP 3FFTA 3A06A 3CJQA 4I4NA 4PQEA 5JXIA 1O0CA 3EISA 2WHPB 2XVZA 1SMKA 1U02A 4OHMA 2GCOA 2Q46A 4K05A 4WKNA 5EERA 4AURA 2V0CA 4GC9A 4Y30A 4L78A 1UP7A 2V8BA 2VHZA 1NE7A 2ZVJA 1HA3A 3KFXA 1KJZA 3TTSA 2HY7A 2XMGA 1JHZA 2DOKA 1AK1A 4UVGA 4Q7MB 4DT1A 1EHCA 4JT8A 3WYEA 2P75A 4UUNA 4CEIB 3UAYA 4AWBA 2EBWA 2V96A 3ZS9A 1GNSA 3TK1A 3RUEA 4YCMA 2ID4A 1VSUA 3UAOA 3ER8A 4JLBA 2O2YA 1BMDA 4NCJA 4BNNA 3OM8A 2Z2XA 4NZOA 1JA0A 2ZR8A 3KJQA 1N6KA 1N5OX 1RJDA 2FDRA 4WL0A 1TJ5A 1MIOB 5H3HA 3UH0A 2UYCA 1DBIA 3RLIA 1N7JA 3MXOA 1HSZA 2OBLA 1NBHA 1IPEA 2NUPB 3AERA 3OM1A 3BVPA 5KIAA 4BFTA 3FA2A 4NEHB 4O02B 3FDZA 1REQB 3RRJA 2JKYA 2C5HA 2CWDA 2IZ7A 5AI5A 5HK8A 5KUTA 4KO8A 1UMCA 2RHMA 2Y1KA 1RWBA 3MMNA 2C3MA 4BAGA 1P61B 4N9WA 1U4NA 2BH9A 1MBZA 3R5HA 5IANA 3WZMA 2FSIA 4JLVA 3OLVA 4D98A 3ECCA 1RLJA 3AR7A 1XZEA 4X8LA 2FSFA 1L8QA 3ZDYB 3UVEA 2D7JA 3HYNA 3ZK9A 4FFVA 3RE1A 3SSMA 4CKWA 2JFBA 4ARUA 3GEGA 1TCBA 4O8ZA 4MVJM 1TQ6A 3WLHA 1D07A 2DC1A 1RWOA 2R00C 1BW9A 1A97A 2AOUB 2HMWA 3KLOA 3SX0A 2CLKB 4WVLA 5DN6D 2JBWA 2XWJI 4FLEA 2Z9DA 2PX4A 5CK4A 1AKTA 1SOAA 1FSZA 5CBPA 1QYWA 4ZKEA 2RJOA 5EJMA 2XW6A 5ICCA 1CEXA 5F3DA 2Y1OA 4G5XA 4YBZA 4UJ5A 3HYLA 4J0JA 4TKVB 4BEVA 4AKEA 1QX4A 1QCCA 2HJWA 4YRMA 1RRMA 4BAUA 3OQMA 1I94B 1W8DA 3C4QA 3EQ2A 3QK7A 1E5VA 3PK0A 4GOND 1QFJA 3WQBA 4EG5A 1HGXA 2QMOA 1TEZA 1YS9A 1A8HA 1ONSA 3MC1A 3W5CA 3OBBA 4J3NA 1YKGA 2A14A 4WA7A 3PZBA 4N6GA 5HZKA 1A8UA 3IQEA 1L5MA 2GTHA 4C4PA 2I55A 1UXIA 1UBCA 3G0GA 5CNJA 3QSYA 2O6HA 3CRRA 2ZOSA 3GFFA 4NICA 5A7GA 2XA1A 5L53A 4CM4B 4DOMA 5BWMA 4XGNA 1UP4A 3LT1A 4EB3A 2HU2A 3ULKA 1UXHA 1H2YA 3H0KA 1TQ2A 2Q3LA 2DULA 2Y0BA 3JSXA 4B34A 4BX8A 3THXB 3L0IB 1FFBA 4AG3A 2NYRA 5CFNA 4EUEA 4RKFA 4GXQA 3SJCA 5A4KA 2XCSB 1ZM9A 4PPGA 4DA6A 1IBRA 2CXRA 2I34A 4I9UA 2A5YB 2GAJA 1RXUA 4CGYA 4B6GA 1DWPA 1IWPB 4IQ4A 3L0OA 4DSNA 1I5EA 1ODCA 4RF4A 3MD0A 1VOTA 1KI6B 1OXXK 1I6WA 1OWNA 1S3IA 1RLIA 1X39A 1LQTA 2OD2A 3KOMA 1N2SA 4RQUA 4Y6OA 4D74A 2G1PA 5CDFA 3NKLA 3GJ6A 1DOHA 2GEVA 3I04M 2QQ0A 3I01A 2ZDQA 1T1EA 4R16A 3LRPA 3D3KA 2NUAB 3LCMA 2G6TA 3M4NA 3AETB 2ZE5A 2VPPA 1FX0B 3SC2A 5KQLA 2BMAA 4G0ZA 3T5DA 3FFXA 2AJCA 4MIYA 3BD8A 2F9MA 3KVYA 1K7CA 1HRKA 1IHUA 3CF2A 1SIWA 2OFXA 3CKKA 5FULA 2WJIA 4N5LA 3U7JA 1NVVR 3CZCA 1S01A 3V2HA 4H7JA 2ZIXA 4G4GA 5K3SA 3IV6A 1QIHA 3RBXA 1BQ4A 3H3FA 3WMFA 1KZ6A 2R8RA 2ZU6A 4TXJA 5G4KA 3TRFA 3VA7A 5HA5A 3F96A 4PIVA 3V00A 2XD9A 3CVVA 3MHTA 1SHLA 3TTWA 1IC6A 2W93A 4N3GA 1TCUA 4TUYA 2RKOA 1R0LA 1TTTA 4MYRA 2C8VA 3DL4A 2XUDA 1WMBA 4I9NA 2V9ZA 1UQTA 2X42A 2W7TA 1P4SA 3FRJA 4NCIA 1XVAA 1XKLA 5F2KA 2AQKA 4HUQA 4WGGA 1Z5ZA 3WGHA 1G9SA 5KCZA 2QORA 4LJSA 2V7WA 2I7XA 3LO5A 4B33A 2QD5A 1MJGM 2OBNA 4EYKA 1H42A 4EG8A 1X1CA 4PX5A 1JSRA 5ER9A 6CHYA 4YPOA 1ZKDA 3B6ZA 1T8WA 1VKRA 5DVZA 4TMZA 1E1YA 4GHWA 4L8GA 4MV7A 5EIEA 3O8CA 3VKHA 1IQUA 4NV3A 2YN2A 4D3FA 5CFMA 4LZLA 3GFOA 4F45A 3RSLA 1TD1A 2FEMA 3CT4A 1NYRA 2IRWA 4QBTA 2PT5A 2W2OA 2HXSA 1QGED 2RH5A 1JLSA 3GJRA 3U9TA 4DLAA 5EJFA 3BL6A 1FA9A 3JASA 2Q8PA 2QAGC 1ICEA 4B3DA 1RC8A 4R2JA 3RVRA 1NW6A 5C80A 4WLEA 3IUJA 4ZOLB 3U3JA 4XPIB 3ILXA 1WQ3A 4GP7A 4I3GA 3WA6A 4KN9S 3FGPA 3LDGA 4XIFA 2P1RA 1Z2AA 2CFIA 4IMPA 4HVTA 4Q4HB 4CKBB 2QL9A 4RK6A 2XBLA 1SUBA 1EK5A 4X45A 4RVHA 4JSTA 3WOVA 4P53A 3UJBA 4DV7B 5BPFA 3HDTA 1PR0A 1ST2A 2XRFA 4X65B 1ZHOA 4J7AA 3BF8A 2XZOA 3AU9A 4ZQBA 1EZ4A 1ADGA 5H3LA 3LDUA 2BTQA 3TQRA 2Y71A 1AHIA 5ESWA 5JECA 2C9MA 3NUZA 4EVIA 5LU8A 1EIZA 3C45A 3CSSA 1XQ6A 5HGJA 3VAYA 2PS9A 3TXAA 2FQQA 3O47A 3MTQA 3VPFA 3PCXA 4AQDA 4P3OA 3G2KA 2Y92A 3OAAA 2ACEA 4FEYA 4DGSA 3I64A 3PTAA 3H16A 1MX3A 1XT6A 5FL7A 3L8HA 4TYYA 1CJTC 1G64A 1JKFA 2F7SA 3R9XB 2NP6A 4E51A 2NZXA 2P2GA 5LQSA 3HCWA 2CNNA 4DSUA 5SY4A 4BU0A 3N6RA 4WKPA 4RTRA 3VPBA 4Q00A 5IJZA 4JLMA 1QOPB 1TCAA 4KQJA 1UMBB 5TQ2B 3FLBA 3FZNA 3IDZA 3KPJA 1IYZA 3C5WP 3M6MD 3QUQA 4PGHA 4IMRA 4U2DA 4JWKA 4QXRA 1ODTC 2NUTB 3QOFA 4ZRMA 2PQMA 2Y4NA 4JVNA 3WNCA 4B3RB 1T4DA 4L0QA 4NYJQ 2WU4A 3HKDA 1VJ5A 3SHVA 4DDWA 1Y6JA 1AE1A 1D3AA 1G6Q1 1VL0A 1ZUWA 2QY9A 4PRLA 3TVYA 3HXPA 3RNLA 5IUKC 4RDHA 1ODLA 3QU9A 2GAFA 5B1SA 4DA4A 4MVJD 5LZ4A 2QLNA 4M7PA 3OU2A 4M8KA 3EAFA 221PA 1T9CA 3T7DA 1ZVMA 5JAUA 2PJZA 4QUGA 3TLAA 1V9CA 4L5JA 3ZOKA 3CY6A 5CDGA 1CJKC 1HFKA 1TD9A 1EAYA 5BY2A 5KNLA 2X4IA 4PC6A 2PVSA 1OH6A 3OJ0A 1KYXA 2WLSA 5ADHA 2BH2A 1SKYE 5I9SA 2FFQA 5K0BA 1JFFB 1Q17A 2XE7A 2B2XA 2HF9A 4XGRA 3ROGA 2HQRA 1WBJB 3J7AC 2Q1UA 4KTTE 2RKWA 5CLHA 1I14A 1DIRA 4ZU6X 4Z0TA 3J81A 2IHUA 2QTAA 1ILEA 4ZYLA 4IVPA 4EELA 2P30A 2AX3A 2OK8A 3QLUA 5BUCA 1AXRA 3PNVA 3IE1A 3LT5A 4LYGA 4ZI5A 5TV2A 4M9QA 5HKKA 4XOUA 2AEFA 3DBVO 3KNZA 1VCOA 2D8AA 2WNSA 3PEEA 1RAAA 2O8BB 2QHXA 2IOYA 1JKMA 3OBIA 4OU5A 4PPQA 3VDXA 5JTTA 1K9VF 2JDID 4RSGA 2WG0A 3K73O 3VSBA 3HUDA 1NQTA 1E8DA 2ZVPX 4IEFB 4WOJA 5J58A 2SECE 4DA0A 1TA9A 1GT91 2IIBA 2ORIA 3CVXA 5DASA 2WTUA 4RHTA 1J5PA 5JDCC 4JLSA 2CDCA 1SFRA 1U1GA 3LP6A 3R75A 2FUG1 2VYVD 3LZDA 4R9SA 2MOKA 5LM3A 2W48A 3V46A 3TKAA 4L3VA 1FSFA 3PWTA 4O3MA 1WKCA 3C7TA 1JTFA 3MTDA 4WDRA 4I5DA 1BXKA 2WWIA 5JR3A 1VLJA 3T7IA 2VTBA 1DKPA 3P9CA 4EPTA 3U17A 4MP6A 2IXTA 3DVAB 2H5EA 3ZE7A 1EBBA 4PX2A 1W581 3HY6A 5FPHA 3B2NA 3C4VA 3DE7X 3RFCA 1MR3F 1FK8A 3TZBA 1ZD1A 4ZVOA 1D9XA 4C5AA 4O4JF 3PEUA 4DXAA 4DPMA 3NJ8A 3RYFB 1Y89A 2F9LA 4FS3A 3TQOA 3C6YA 5DYNA 1L6IA 1A9XB 3CJRA 2OV2A 3OCUA 4FCCA 5HJ7A 1IN1A 5K2OA 1V1RB 1YR9A 2ZWAA 2VDJA 1MRSA 4S04A 1JLHA 1A8QA 1CERA 1I1HA 2P4HX 3JQQA 3Q4GA 5ULLA 4CL2A 4P7GA 4XLTA 1J33A 2XKBA 4MUFA 2H1LA 1XWIA 1DTWA 3EASA 3JWEA 2BSXA 3KBBA 4GYKA 1EG7A 1LV7A 1YQEA 3AEQB 4Q3AA 4UE6A 2EX1A 4YXWA 1R0SA 3IALA 3TQSA 3E9NA 3FSGD 1KEEA 2Y0DA 1WCIB 3KEMA 5K9ZA 4AUMA 3Q7QA 4Z4IA 2J33A 2ZUFA 3VBEA 5ESRA 4PZPA 2XUQA 3R5FA 4TRNA 3S1AA 2OZKA 4P31A 4F2HA 5F1YA 1B6SA 4IDPA 4CNQA 4GNKA 3H1AA 3T7KA 1DRVA 2IY7A 1GCOA 1XA0A 3H2IA 1ZU4A 1ODKA 4NARA 2BFAA 4FB4A 4M60A 4KE8A 2PKCA 2WOOA 1O0SA 3H2BA 4KV7A 3U19A 2A5JA 1VYUA 5F33A 3WS7A 4XR9A 3DM5A 2F2TA 3FX2A 3CVWA 2V1XA 3NO4A 2ECFA 1W8IA 4W5HA 2P90A 3AXSA 1FUYB 3S8MA 1KNQA 2JFGA 3GEMA 2IITA 4OAOA 4HF7A 2GZ2A 3C5CA 5HZMA 3LUPA 3EG9A 1GV1A 3I37X 1CLUA 3BFKA 4EHKA 2NZYA 2DEUA 1X15A 4YT5A 2GESA 4MHTA 1GQYA 1P18A 2OQRA 4CM9A 2EJBA 5A06A 3SF8A 2AF4C 2JHPA 3SBOA 4A5OA 2CF5A 4DRZA 5HW0A 2XNDA 3ZHOA 3PXBA 4Z7NB 3NVKI 3A1CA 1IJFA 4C0KA 1GL3A 5I7OA 2NZWA 3IEKA 3Q2KA 4PBRA 1E1LA 4D9EA 4JU9A 5L6LB 5K8LA 3DOIA 1TUGA 3TQFA 5FHQA 5JQGF 2GPSA 1ZGHA 1VL5A 3M2PA 1GAQA 3WRVA 4ZVQA 3DEJA 4HDQB 1P7VA 4K9SA 4LCJA 4ICIA 2REXB 1T9GR 2XB4A 5HHTA 4I3FA 1H05A 5CP8A 4URUR 4GI1A 1NR1A 5UKDA 3LQ1A 3G7UA 4XVRA 4GOJA 3EIXA 1TU0A 5BSTA 5FOQA 1PGOA 1RHKA 4HG2A 3ICOA 4OJNA 3TR6A 3PF9A 1U9CA 3JW8A 4RTQA 4FHZA 4D3SA 2G07A 1ZISA 1FMTA 4OQEA 5FNVB 1YO6A 3NMUF 1KMIY 3KALA 2DY0A 6GPBA 4GXTA 3P7MA 3ZD9A 1M67A 1G3IA 1K5PA 4GH5A 4KQXA 2R6ZA 4R81A 5JYCA 4Y1RB 5INTA 2J31A 2XTJA 3OZFA 4I46A 1E2BA 2A35A 3V8QA 2A9RA 3A58B 4W5NA 1P6QA 3WGVA 1RTTA 1Z0UA 5GIPE 4B0PA 2YFHA 2OYCA 3VR0A 1N5RA 4Q3CA 4HYYA 2H2FA 2AFIA 2PLAA 3EGEA 2VH1A 1KI7A 2P3OA 3PDIB 2GETA 4EOGA 5JFOA 1OH5A 1A76A 1UEJA 4IDEA 1G66A 2GHIA 5I8ZA 3TX6A 1Q7RA 3AB7A 5JSZB 1F2UB 3TTVA 1YMQA 3PGMA 3UMJA 1RAGA 4BO7A 1WUKS 3U44A 2G72A 2AW3A 3AEZA 4U7HA 1J07A 4AKIA 1UKEA 4H7KA 2ZWVA 3BICA 4HP8A 4DJFC 5KBYA 1OXVA 1Z8FA 1RHRA 2BF7A 4UMFA 1GWNA 5DHRA 3NI2A 1QCDA 3HRKA 2VDRB 3DBLB 1TW2A 3ITNA 4DQLA 4DA9A 1YI0A 1Z2OX 4R68A 3OF2A 3OZUA 4UXIA 1K86A 1JQLB 1QIJA 3R3YA 2C88A 4BFUA 1S6YA 2GZ1A 1R0YA 3COYA 3IUSA 4CM9D 3KR9A 5KYXA 3TGPA 3AG6A 1NTOA 2HJSA 4XSHA 2PX6A 3KJNA 4HAYA 3KEOA 4TT8A 3SKYA 4AF7A 4ALMA 3AU8A 2NTEA 2Y0CA 3F5MA 4D0RA 1HNXB 2HCRA 2IYQA 1V4BA 5F7JA 3PTLA 3DMHA 5AW4A 2C57A 2CKMA 1QFYA 3CEMA 4PGGA 4TOIA 2P6NA 4UEOA 1JKIA 2BHTA 5EKSA 1F60A 1WLYA 2O2SA 5AXBA 4DIUA 3BK7A 3CIOA 2MHCA 3DCNA 3UIEA 3W8EA 2D0IA 2GZDA 4C3ZA 5ARBA 3HA7A 1X1AA 2CY0A 1TEHA 1IM5A 2WYUA 4H3VA 4OA8A 1ISIA 1NAHA 3QQ5A 1ACLA 3QVLA 3KO8A 4WZAE 4U9UA 4YQYA 1JPJA 1NLZA 2NXNA 4BHTA 4G97A 5C8VA 2VDMB 1QRTA 4I1UA 5F64A 1GNTA 1SQSA 4UKDA 3U3XA 1ZW1A 4YRDA 3TIXB 2AZXA 2A1UA 4ND3A 5E4TA 1YFJA 3F46A 4MZXA 3PE3A 2FB9A 1HUQA 2Y0PA 3DEKA 4NP6A 5HQ3B 1U65A 5IHXA 4KNYA 2QN2A 1SZDA 1V37A 3FWNA 2PSJA 4AWAA 1V3VA 4NJEB 4ZCQA 1E99A 2REOA 2OHXA 1KO5A 3V34A 3H86A 2VWHA 5EJAA 2HMTA 2PKXA 3JALB 3VR5H 1UWCA 1ZXBA 4TUYF 2M1ZA 3TVTA 2FMXA 3TOVA 1MJFA 4KUHA 1HV8A 4R6WA 1THZA 3PWSA 4JLJA 4B7CA 4LQLA 3UAZA 4UTVA 4Z4CA 2PS3A 3T5PA 4BV8A 5IS2A 3FPGA 1PZFA 4K9DA 2UUAB 1SXHA 2TMYA 2E48A 4D9NA 4RK4A 3DDHA 2BEWB 2ZI3A 5JEDA 2Q6TA 1UJ5A 4E94A 3KBOA 4FZ3A 3GN2A 2X9LA 2YMPA 1XEAA 1YR3A 4UM9D 2GA8A 4U7GA 1AQJA 1EE9A 1Q0RA 3TAHA 4W1PA 1CDDA 1G5PA 1ANKA 1M2VB 1E1CB 5AI4A 1SIUA 3G9UA 4UUAA 4I1VA 4ERXA 4MPRA 3BTSA 3U6KA 2IUSA 3STHA 3FVRA 1JHQA 1YVPA 2HL6A 3H8JA 2O2JA 3I30X 3CN7A 3QV2A 4HB4A 4U4AA 1U6JA 2JBAB 3G0OA 4RVOA 5FI3A 3MJCA 3QE0A 2BFEA 1XTRA 1C0LA 3DP7A 4DR7B 4H6PA 1KC1A 3K7EA 4P54A 2VTEA 2CN1A 2E5FA 3LVFO 5CVCA 5HBRA 3WYDA 4C0BA 2PV7A 4N8SA 2TSYB 4A8JB 5IBPA 2QTTA 4K86A 3KWMA 1FLNA 2GJ8A 2PT7A 3QTTA 1P3Y1 4B74A 2BFBA 4TVOA 4XVCA 2JEYA 3HJGA 3OM0A 3MCTA 1V1JA 4R51A 4IIJA 5JZ9A 1L4EA 1LX7A 3KS9A 3GAZA 4HK4A 4JI0B 1R0CA 2ZS8A 2CK3D 2X8JB 2B8EA 4NBKA 4UOQA 2QQEA 4WZBA 5DN9A 1WZEA 3R8CA 2GAOA 4BP9A 1G2PA 2R84A 4PM4A 1NW8A 2CZCA 5ILQA 3OKAA 2HA2A 3G9XA 4K2HA 1NQVA 1U0LA 4KBFA 4EHIA 4LQ4A 3P9XA 5F2OA 1MHPA 4OXXA 3B9QA 3GJTA 3UOGA 2V9PA 3QIVA 3VFDA 3QWBA 5JUWA 1OX4A 3DLCA 1NR7A 4XVQA 2RB4A 1JEQA 4Q1CA 5AOBA 2GHQA 4C05A 1VP9A 1A5TA 3K9WA 1PWHA 2HC9A 2PZBA 2DVMA 3HA2A 3MUEA 4M9RA 4EJSC 4AUKA 4E7OA 1ULAA 1PQPA 3BULA 3Q5GA 3R41A 4RFSA 2A1TR 4OL9A 4YJ2F 1Y63A 5EE3A 2BIFA 4MYSA 1BDHA 1JQDA 2VL7A 1GUYA 5JY6A 2F17A 4E3WA 4JNCA 3FLAA 3STVA 1PYGA 1PP4A 2OO5C 4PNEA 1UADA 3W0LB 1DIBA 2HCFA 2JD2A 4M99A 2XCUA 4A6XA 2AE2A 2AJBA 3LBAA 4V2IA 3AOEC 3W78A 2FQXA 5DULA 4URXR 1SURA 3I05A 1M34A 3G13A 4Z53A 1WSDA 3N8NA 4DREA 5B3AA 3I39X 3Q3CA 1O6BA 1Q0QA 4KR9A 2YWEA 3P9RA 4W8OA 3SYNA 2B9VA 1GVHA 4E5DA 2OQVA 2IGBA 4OCZA 1KOLA 1FP7A 4IAOA 1Z33A 2GBLC 2ZUBA 5FL3A 1I13A 1J20A 1XRMA 3AK4A 3K92A 1W0JA 2R9VA 4RDXA 4EY8A 3IP3A 3GJ8A 2B4YA 4BV2A 1VECA 4O4IA 4F9TA 3NVAA 3G1TA 1ZI9A 1PL8A 4RA9B 3O5AA 4N4AA 4EBFA 3IVCA 1CB7A 1YMUA 4J6EA 4NBRA 1NLFA 1QGAA 5C32A 3DMTA 1NHGA 2YW2A 2E2WA 1Q0ZA 3OIWA 1P0QA 1G5FA 4GE3A 1XO1A 3VJLA 1I9GA 3U7IA 4D5GA 2J9ZB 2PGNA 1QU3A 4PWZA 2AG8A 1E7RA 3LRXA 5F5XA 5A9RA 3O4IA 3TW4A 4RO0A 4P4SA 3LX6A 1P31A 3I72A 1PL0A 3USES 2R4QA 2C2XA 2QP4A 4JBHA 4Z9YA 3ETLA 5FQNA 5GPBA 4B2IA 3I6IA 2WB2A 3F90A 4M0DA 5HF6A 4Q4JB 4EGCB 3HBMA 5JZBA 4X63A 2FJPA 3PPVA 1AUOA 2GX6A 2YCLA 3U4AA 3U7QA 1RWKA 3C3EA 3MZ0A 2XGSA 4HOYA 5K2MA 1Z34A 2VHVA 3PRYA 3SVTA 4JP8A 5C5DA 4RLFA 5SV2A 1KJ9A 1Y9ZA 5HILA 1PVVA 1ZC4A 3S5JA 3JWGA 5DHFA 4MCHA 3IP8A 3G2MA 1EJ2A 1B16A 2Y27A 1QM5A 4JBIA 5IP5A 5ITVA 1JJVA 1DJQA 1ZZGA 2GK4A 3BHMA 5I5EA 2VDKB 5CDYA 4HBGA 3LX5A 3LV8A 1XCPA 2WD7B 3T3GA 1VJCA 1WS6A 3IMKA 4MYHA 2AMVA 2WSBA 1A9RA 2JLBA 1XNRB 4NOMA 2EXXA 1A2QA 1DTEA 2E18A 3FPKA 1FZQA 4W9MC 4OJMX 3P19A 2JJ1A 3ZHRA 4BLWA 4X1IA 4DJ5X 4QJ3A 1NVEA 4GPZA 4AYXA 1X7WB 3KD3A 4Q7KA 4ZQGA 3AEKA 4KMOA 5A6SB 3VKVA 2X6QA 4OQXA 2PH3A 4B76A 2Q3CA 2H4YA 3ISTA 4CCAA 4GNRA 4R2MA 4ARBA 4JGIA 3E9RA 3O7WA 3BS4A 3B1ZA 2ODEA 1T3TA 4WE3A 3GAMA 3ICEA 1YBMA 3HVJA 1ZN8A 5HEKA 1K63A 4ISCA 1HE5A 2IV2X 2ZBVA 3UHJA 3A9UA 3QLJA 2JD0A 1COWA 2C7VA 3AF1A 3BBPA 4MWDA 1KPIA 1RXEA 1D8AA 1ZEJA 1NFRA 3SBEA 1YQXA 1E2IA 3VOTA 3ZE8A 5H3CA 2BCJQ 2CLFB 1ZM7A 1L4HA 1W0JD 3IAXA 1E9RA 1ADJA 4OI4A 4RE6A 1K92A 3TSZA 4BRSA 4LOJA 5DMHA 5D6NA 2FLVA 4IDHA 5JZSA 2XXAB 4EGAA 1DJOA 2X3YA 4JL5A 4PLHA 1ZGZA 2RGDA 4XDZA 4EMSA 2RGNA 2YOGA 3L7YA 2QSYA 4KYIB 4OYHA 4HX2A 3ZYZA 4COOA 1PR1A 5NULA 3DGFC 3V4PB 4BO5A 1UEXC 4KXVA 1RYYA 2O8DA 1E6WA 2G08A 2JH3A 3KOZA 4QYXA 3TDMA 3IDSA 1D04A 4WUVA 4NAUA 4XD7A 2R79A 3T4PA 2FPGA 3DCJA 3K0AB 3PQ2A 5HM8A 1TYAE 1Z63A 2B78A 5CM9C 1YL6A 5HS6A 1L5GB 1JDZA 2OE2A 2UZ0A 4BO9A 5I3CA 1KH1A 3L40A 3QPUA 3VR3A 3U60B 3OC0A 3DQQA 4ZQCB 5B37A 2ERCA 1E98A 3ZHYA 1M1YE 4MV1A 3BSWA 4WCDA 5BSGA 1N0WA 2NVUA 4JLWA 4YJHA 3CV3A 4F2WA 1Q7GA 3VVCA 5K0GA 5GAJA 3L93A 4M88A 1KJYA 4C06A 5B1EA 1GYQA 1ZRSA 5D01A 4Y6SA 1XTKA 2OT3B 3OZTA 1BS2A 4FR0A 3PC3A 4EW1A 1NUUA 3KQUA 5EIFA 4I1SA 1V16A 1CQZA 3SN6A 1JQ5A 3ZZTA 3WGKA 4NMHA 4CQMA 2WM8A 1LF5A 2EATA 4Y0VA 3BEDA 4DCTA 3TMYA 1G7CA 4ZREA 2N1BA 2QSJA 3A2MA 3C3CA 4MR8B 3VH1A 2OGTA 2XLBA 4KWIA 1Q1GA 3T3EA 3VZDA 3THWB 1CJBA 2PKRA 1PG5A 1TO2E 2AMJA 3SZGA 1FBTA 3PIIA 4BNDB 1INLA 3VH4A 4P86A 4AJLA 3ENZA 3HVHA 1PJ3A 5K3AA 3AKZA 3LL7A 1U8EA 4LMPA 1L4FA 1W2HA 2XQJA 1ES9A 2C3UA 4NAHA 4WWHA 1COWD 1D4FA 4IFIA 2IS2A 3CQ9A 2C4TA 3IUNA 2HIMA 4NPAA 4MKIA 3EF1A 4WY5A 4AZ0B 1F8GA 1XUOA 1EH5A 2WZCA 2O20A 5JJ5A 5KPJA 3DEHA 1Y4AE 4KAJA 3G2JA 4YAGA 3L9WA 3RODA 5BVGA 2E9SA 4J07A 1DJMA 4NOKA 4BN4A 3LD9A 4ZAFA 1CF4A 3VZPA 4F1JA 2V7VA 2WUFA 4G56A 5AJZA 3CNLA 4EW2A 1OZHA 3O8BA 4XGQA 3N87A 3WLNA 2BI8A 2Q27A 2W9XA 2HCTA 2W2TA 1KAOA 4J2OA 4O2AB 1JEEA 2OBBA 1Z06A 2P9HA 3HJUA 4QFCA 2Z5GA 5CB0A 4JI2B 3H9GA 2M6LA 2WMYA 4IGIA 5JG7A 3O3NB 3UWMA 5IVKA 2XOXA 1H2FA 4LF6B 3EZNA 3PKIA 4IJWA 4LW8A 1VI5A 4XD7D 1E7YA 1OHHA 2JF0A 2Z1NA 5EVCA 3TOSA 2BMVA 3C5HA 1XVIA 1MAHA 3TLZA 3IUBA 5KMGA 3ZNOA 1AQUA 5BW4A 3VR3D 4NPCA 3ZWAA 1ZOSA 2QNBA 1CP3A 1RJ9B 5E8RA 4HWOA 1XCBA 2VO1A 5BN4B 4F8EA 1TAUA 4NESA 4M7OA 3I42A 5E3HA 4TTTS 5A3QA 3RRMA 1MVOA 1THTA 3KQYA 4HAUA 2MDTA 3G1WA 1XXHA 3CH7A 1RAFA 1PZHA 3GRUA 3FMOB 4M1TA 4EBBA 4XW2A 3OEYA 5H70A 2ZVDA 4DWOA 1QU2A 1NIJA 3O3MB 1UDBA 3LKBA 2EFDB 4XLLA 2AEMA 3CMMA 2LKDA 4A03A 1ZOIA 1Z08A 2BE9A 2HF8A 1T5BA 2B4RO 3OURA 4CIVA 4RTKA 4DAEA 3WIOA 3WJ7A 3O83A 1XPRA 3PL1A 2R5NA 4QWMA 1WUHS 4PZZA 4BB9A 1ZH0A 1W9MA 1RQGA 5JCXA 2IP2A 5EMLA 1B42A 1JG1A 1P3DA 4P0TA 5E6RB 5AHRA 4Q16A 3V8PA 2INGX 3ASZA 3DWEX 1EDBA 3TI7A 1FUUA 4EYSA 3TBFA 3S4YA 1HOTA 4EZEA 3FOFC 2DERA 1UF9A 2EBFX 4WLVA 4XLZA 3V1TC 3DFIA 1QH9A 1CVLA 3GFTA 1QRUA 1M2HA 3CX3A 3LOUA 4L22A 2KMLA 3SLKA 3V2UA 5J4VA 2AFRA 3B85A 4RKYA 3H5WA 1XEWY 1OFGA 2VCYA 4BQSA 5JTUA 1A8IA 2G9VA 4KQCA 5A5DA 1NHWA 1OZFA 1HTTA 1DGQA 1M1NB 3V97A 1RQPA 2DFLA 4FLMA 4C21A 3RF7A 4H1WA 3GFVA 2JLWA 3W2TA 3G49A 3WKAA 3L07A 2BEVB 3FB4A 4FFNA 2XXBA 2QA5A 1IHOA 5CEJA 1C7ZA 3EXIA 5M5BA 3I0ZA 3MPUA 3VHXB 3BFVA 3JD3A 4C43A 1AF4A 1E0JA 2Y1GA 1GUFA 4H15A 3G9QA 5EZSA 1ECFA 1RZUA 5JS7A 3EG5A 4JZKA 4DCSA 2GASA 2AC4A 2JGEA 3QFHA 4DQ0A 4E31A 4FOSA 3DULA 2YIDA 2MYTA 1YQUA 4Q7LA 1KYIA 4GKBA 3RHSA 2QB5A 2DQKA 3JWPA 2FRXA 5FR2A 3TM4A 4W5JA 2J6HA 3Q0EA 1ZO8A 1DKNA 3EDRA 4X71A 5CTJA 1NMSA 4F4HA 3IMEA 2DJ5A 3ECSA 5IULC 3PE6A 1P0IA 3N76A 3USZA 4OSPA 3DEAA 4HAWA 2QROA 3D6NB 3FTNA 3QEOA 4TL6A 1Z0KA 4KO1S 4PIPA 2MCFA 2B0CA 1WXGA 3I9KA 5E1OA 5AVKA 2J08A 4L3WA 3VVBA 5LLTA 1I6KA 1JUDA 2IYFA 3QUAA 3BHJA 4MMZB 1FP1D 2LXNA 2P0YA 1BE6A 4U9IS 3MGAA 5DM2A 4YMWA 5JCOA 5JD6A 3AR3A 4IIJF 2A88A 3BTUA 4L4XA 1WTAA 3OZRA 4X94A 3ZNQA 1PQ4A 3GGDA 1O1YA 3E7WA 3G2HA 3EH1A 4NI5A 4E46A 5FWXB 1V1MA 4DCNA 4AX4A 1WO8A 2OA0A 3A1WA 3DMRA 2C2BA 4J0FA 4DIFA 3P26A 3DMDA 4N39A 4Y2UA 4IEIA 4UBNA 3HP1A 2Y66A 2AFVA 1MB9A 2E4AA 2QYHA 4EDFA 1N7IA 1T2VA 4XB2A 4ZJYA 8GPBA 5JRZA 3OKCA 4MR9A 2ICAA 1XU4A 3IPYA 2AIRA 2WW8A 1E6LA 5DNCA 1QKJA 3I2FA 3M33A 3GQBA 1KYTA 2R86A 3R3ZA 3E18A 3W5VA 1JQAA 2W2NA 5BSUA 3X2FA 9LDBA 5EIHA 1RKBA 5LOVA 1CY8A 1MHTA 4HB3A 4DLYA 2XUFA 3HDJA 1H9CA 1W4BA 1XZIA 1YRQA 2CZGA 4DXHA 3CRQA 1Y8QA 5KSPA 4F96A 3UWPA 4COKA 4R2KA 1JAYA 2XPCA 4FVTA 2C4WA 4ECEA 2H4WA 2FAXA 1ZSVA 2XH8A 1D5WA 3FPBA 4PC7A 3Q7EA 1XI2A 1E3DA 4MLCA 2PUTA 4K9RA 4U00A 1BIFA 1Y7PA 2O7VA 3VDMA 4E5UA 3ANMA 5CR9A 1DG9A 2GZRA 2I03A 1B6GA 3EWNA 1D5CA 1QZTA 2CXTA 4KGXA 4J3JA 1F48A 1U3GA 4NZYA 1KNXA 2BDUA 5EZ5A 2VNAA 5JFTA 2C4HA 2DSNA 1PGJA 3HPRA 1GVNB 1R8SA 2ADMA 1Y7LA 2F00A 2KPOA 3DUWA 4OOFA 3OHMA 3NIBA 3TBKA 4RF5A 2HA6A 1R5BA 5GJBA 2NU6B 1L4UA 1G1MA 2ZBFA 3IE0A 4HGQA 3U9SA 5JSYA 1TQDA 1DLJA 1NQUA 2CLMB 1Z4OA 3V4LA 1XD2A 1E6CA 2XQIA 4MKXA 1VLMA 2XCIA 4IXTA 4QYIB 1M8PA 3R9IA 2WHXA 3DDOA 1SUIA 4N49A 4RQAA 3B1XA 4MV5A 4RGBA 5E9QA 5HQJA 4O4IF 1P73A 4QXAA 1FFYA 4H4CA 1HTWA 3EMKA 3JQAB 3RVLA 1CG6A 2I62A 2Z0MA 4DLSA 1VYTA 1H93A 4JC0A 1ZCFA 2RGRA 3PT9A 3GRFA 3LGSA 2QPAA 2L19A 4MUIA 1GRCA 3OEWA 2Y1FA 3ZQKA 1UMKA 2FOXA 3ZZUA 2OLKA 4CM8A 4NATA 3O1IC 3QVJA 5EE0A 3R74A 3H42B 4W82A 4M87A 3N75A 2C2GA 5LP6F 1N1MA 2PFKA 2R8PA 4MDEA 5TEWA 2A9JA 2L18A 4U39A 2OFFA 5I51A 2CHUA 2OV1A 1R8YA 1LBQA 2F3PA 1EKXA 1TRHA 3IUQA 4I5FA 3HFRA 1DZIA 4WNAB 3VYWA 4FIZA 1B15A 1ZDMA 3RS3A 3HUEA 4HQFA 5T5QA 4P0PB 2VNIA 2QTMA 4XD2A 4UAJA 1W94A 2PRJA 1VIYA 1D1SA 3ZE2B 5ALYA 2CGEA 3HVRA 1I30A 2QV7A 1X0XA 3GFQA 4Y7DA 2QU7A 2A0YA 1Y1SA 1DV1A 3DO8A 2O52A 4CV0A 1UZNA 5IJAA 4ESVA 1LPAB 4L8YA 4GMGA 2NO1A 2BFDB 5DW3A 5L3VA 4XB1A 4FWTA 2P2DA 4RF2A 2O8CB 3CVJA 3IEIA 1P39A 4NV0A 2I6XA 4ZQEA 1BX3A 1N6IA 4K9OA 3ZNNA 1GQFA 4OYYA 1UOEA 1UC8A 3C70A 5BUQA 4UU1A 2BJHA 4AJ2A 4CQMD 4A2QA 5FEUA 3EEIA 1P80A 2Z1MA 3T1OA 4BNKA 4LZAA 2N42A 4DNOA 1HY3A 2R48A 2WTNA 3UA4A 4O4LB 3N0RA 5DHQA 1UM9B 5JCPA 421PA 2H5LA 2I9PA 2ZI9A 4MTLA 1E2KA 1WZ2A 2PQ0A 3NHZA 3W9BA 1N25A 2C9BA 2PZFA 2Z57A 1T8YA 2WAOA 4R3UC 4CU5A 1UPUA 1VHDA 1KARA 1NNI1 2CL5A 4YDQA 1XLWA 1GLGA 2PDAA 1UCFA 3VNUA 3E84A 1CS4C 4WX2B 1YQDA 3N7AA 1L4MA 1HQYE 3PX7A 4YP5A 2P8SA 2IZ5A 1OTXA 4A16A 5HNKA 2NU8B 2ODWA 1J9EA 3OZVA 4KQ6A 2XTZA 2CE7A 3P71T 4PZAA 3RU2A 4F5ZA 5B7NA 4FNAA 4OXYA 1N4AA 1GZSA 5EP3A 4CHTA 1PZMA 2PL5A 1HI9A 5TT1A 4WKGA 5JAPA 3ANSA 4ER0A 1QAOA 3LWNA 1NW9B 4DLZA 1B2RA 2Y6VA 5JSKA 5AQ1A 4U2BA 3LA8A 4ZRDA 3EA4A 2Q5IA 2ZR7A 4GGMX 4E32A 5AIAA 1YWGO 3AUAA 1QYIA 2XQGA 2ZUEA 4GVLA 3TS1A 1T9GS 1U04A 2WTBA 2BCEA 5AR1A 3OLCX 5DO9A 4AQ7A 1KP2A 4PHFA 3GFSA 2IXBA 1YK0A 4PX9A 4RKRA 4E4TA 4W5OA 2C3YA 4OHKA 5GP1A 4A15A 3D6FA 2C0QA 5G53C 1C4XA 2VWPA 1DG1G 4WXYB 2JFFA 3FH0A 1SU8A 5FPQA 3R3XA 2OC9A 1KJWA 3B1VA 1GCIA 2BFWA 3QH4A 5BQXA 3D6VA 1QRRA 3T38A 4HDRB 4CLEA 5IZCA 1KYZA 1T9AA 2VNJA 3CX6A 2Z5FA 2AI1A 4CF4A 1QIGA 4HNAA 4RZQA 1XZCA 2ACWA 1IEXA 1MU0A 3QG5A 4WCFB 1N92A 1G19A 3W5DA 2Q0QA 3QM1A 2E4VA 4XUCA 2B98A 2GYWA 4P36A 2VBIA 4KJZA 1LVGA 1O4VA 3RAJA 1XZQA 1NN0A 3DR5A 1NUPA 3GR6A 3ROQA 4N41A 3INGA 2ZI7A 2IS6A 4V0LA 3GLHB 1E5XA 2C0CA 3K96A 3IP1A 2AKAB 3O4GA 1DQNA 3DVLA 1PNTA 5DCWA 1NW3A 4MVJA 1G6HA 4YI3A 5IC5A 2FR0A 3DXXA 4HAZA 4EA6A 5IJ0B 1IN4A 3BMOB 2O3UA 3ICVA 1E9FA 2QTFA 3KDSE 4U0KA 4OBWA 3R7SA 1E2GA 2FN3A 2HADA 4V24A 4F11A 5FO1A 1SCUB 3NHJA 1FYEA 1BU8A 3EX7C 3T1HB 5EUCA 3P4XA 1Y1LA 5ALZA 3P20A 2Y1XA 5D85A 3ZU6A 2NO4A 4RETA 4AJKA 2BKLA 4JLKA 4I1YA 1S2GA 5HIKA 3CLTD 3OOYA 4N7MA 3K9CA 5CA0B 1EUCB 2ZJ2A 4AECA 4GPBA 5G3ZA 4I1RA 3T61A 1A0OA 1CR1A 1G20E 4A1OA 2C2MA 3LXUX 2ZT6A 2BTOA 4I55B 5JY1A 1HDRA 1BHJA 1MQ8B 4UBKA 2VUSA 3A7DA 4FOTA 5T6MA 5HFAA 1DS6A 3R40A 3PR1A 2PWAA 5FCDA 1KSJA 2YJ3A 3ER6A 4LYFA 4OMUA 4D4LA 3ZJVA 1NUTA 4M0MA 3UHAA 2PXAA 4TQGA 2Q5JA 4C2UA 2B5OA 3PHCA 1IEWA 4LFAB 2I2BA 4BVKA 1T2DA 3CUYA 3QF7A 3MK31 3TNLA 4H3KB 3RS0A 2NQ2C 5HIMA 1QG4A 3OJFA 5DM1A 1OLUB 3S68A 5B3KA 1SU4A 3U4DA 5AVYA 3T1TA 5GTDA 1FUIA 1RXYA 3AVPA 4JP2A 3TEJA 3MTIA 2GVNA 1N32B 3KL2A 4EPXA 2FV8A 3ABSB 4P58A 2V45A 4OGFA 1I7QB 1NVDA 1UKBA 1OWOA 2CSXA 3M5PA 5TEVA 1CDZA 1UBOS 3QU2A 4H60A 1VMDA 4G9EA 3R76A 3WMRA 1AVTA 3UXYA 3I73A 4WBNA 4PCVA 3BM5A 1KZ4A 2BJVA 3GA5A 1NAIA 3BHNA 3F8TA 4C6TA 1OBHA 2IEAA 2G7MC 3I04A 3L7NA 4IILA 2KE5A 1U8TA 6REQB 1S8NA 1E6UA 3QNUA 2R1TB 4RLSA 2ZSEA 3RK0A 4NDAA 5KNCA 1TAQA 4LXXA 3U4QB 1DXYA 3EULA 4G0VA 2GDZA 1OQAA 1M0SA 4LNUA 3RVOA 2H06A 3PNPA 4WKBA 4ZCLA 1A9QA 3EPRA 4QLAA 5FBHA 1ODSA 3OLZA 2J5RA 1C3EA 4FE4A 1GADO 1XDWA 1QH0A 4JOBA 1TE2A 1Z5WA 2FR8A 2PSHA 4GWLA 2Q6IA 3AO0B 3OI7A 4R8SA 4UFOA 5LQRA 2W6JA 1XU9A 1IATA 2QDKA 2YW9A 1KH3A 3PNYA 3WDKA 3GLGA 2CVOA 4B81A 1EWVA 3TTTA 1VGRA 1DV2A 2W2QA 5B3JA 1DINA 3BHIA 3E0XA 4CG2A 3E4CA 4HH0A 5ALJA 1FNDA 1HL3A 4R7TA 5CLGA 1XQVA 3FYCA 2FG6C 3O3CA 4KN5A 3S55A 1Z3CA 1C8KA 5DHSA 2I6UA 4FEGA 4WFIA 4ED9A 7AT1A 4O2RA 2VDLB 3RTAA 3HYTA 1RJGA 1T8UA 3KQHA 5AOAA 4JHLA 1V35A 2HSZA 1U8XX 1MJGA 3A6GA 1Y3AA 1QTIA 1W73A 4FHGA 4L0CA 3AIKA 3PNSA 1ZLYA 4BZWA 1QAMA 5EJ8A 1LPMA 2VF5X 4R8RA 1F5NA 3BGIA 4Y2PA 4C5BA 6ABPA 1YUNA 2OV6A 4PYQA 3NASA 3QKTA 3PI6A 2BD0A 2GZHA 1S2OA 4TL8A 1BEZA 1FNBA 3AGPA 4YC7A 4RJJA 4U2KA 2YXDA 5I6DA 3ANYB 2CFCA 4X3PA 1U63A 2XWPA 2K2WA 4P82A 3C7KA 3PUYA 1JEJA 2A5GA 3PDHA 1R6UA 3FI9A 3IB6A 4MUXA 1OBCA 2FUNB 3BAFA 2Z6AA 3P4YA 3QKRB 1E4VA 1OA1A 1O3YA 3G2PA 2HTFA 3KTAB 3JD2A 1SPXA 2I4NA 2PA3A 3E2IA 3BD7A 1DUVG 1K4MA 1AZWA 4QDUA 4WZZA 1H1DA 4Y0AA 2O1EA 1AN0A 4D45A 4E2YA 5DNYB 4RTNA 1FS5A 3L8EA 1YACA 4K9QA 5E7QA 5JU6A 4R1SA 4UFNA 1UP6A 3FOCA 2GT1A 2A1TS 1LBEA 1YZYA 4IDNA 3EODA 1U9YA 4AMGA 1G59A 4IG4A 1P60A 2ZEJA 5KSZA 1PJLA 4UBOA 2IU4A 5JLJA 3ANLA 2JCVA 3I9FA 1N5DA 3BTVA 1IVSA 2AMYA 5F73A 2EJWA 2XEDA 4EATA 1T6NA 2VHTA 3QUBA 1D0IA 4J0QA 1SHTX 1RQXA 4UCXA 1H6CA 2CD9A 2ZRFA 2NW6A 3NHLA 3IBSA 3R7DA 4YCSA 1J9ZA 1EDDA 2OC4A 4E2ZA 5B64A 3PNKA 1CK4A 1T2EA 3NETA 4X44A 3RWOA 5LOVF 1T2CA 3LG2A 2P68A 4OJTA 2FQWA 5KQRA 3O84A 5M34A 3MSCA 3E48A 1LDGA 5JS2A 4MQMA 4OHOA 4UHBA 2VWGA 5FA8A 2XECA 3E1GA 1MAAA 4CEHA 1RP7A 5E9JA 4NBLA 3RBAA 1ODFA 1N2HA 4F3TA 3GPLA 4BMOB 4F84A 2EGGA 2C8LA 1QIKA 1LGYA 2E6KA 2FWBA 3FTDA 1IZZA 4QNRA 2IYXA 4NONA 3A32A 4R40A 4HDSB 3B53X 4PLPA 1RJWA 1OU4A 4Y8VA 5FA6A 5HSGA 1SBHA 1ZHFA 2RBEA 3FF1A 1L3CA 3SHQA 3CKYA 3FUWA 3DH0A 4L5BA 1DRWA 1I4TD 5AM4A 5BRNA 2F8LA 4RL4A 3UV6A 1JFSA 3NW9A 4IOKA 4ZT4A 2VUHB 3CMCO 1HBJA 3K30A 2AR9A 1EFVB 1GR1A 2PTHA 3MVEA 4HWTA 4YJ3B 3TECE 1OAAA 3NGXA 4TTVA 3P52A 2H52A 3ZE1B 3OJEA 1C1DB 4JJEA 2XCOA 821PA 2NPFA 3GLFA 3CCFA 1QDEA 1FFHA 5BYBA 3DE1X 1BH6A 2G77B 1YZTA 4A3SA 4EMBA 3ITEA 2I3GA 4JLNA 3W9YA 4EQ6B 1WCYA 4BXOA 1N0VC 4E09A 2ZYGA 3V4OA 1QDLB 2VT2A 1H0SA 4CETA 1E4OA 3EOZA 4K9PA 5KWEA 1T36A 2R1VB 1XRQA 3T0IA 3ZY6A 2O8NA 3V3TA 1QO0A 2JIDA 2FYTA 3DVSX 3P8ZA 4NJOA 1T9DA 1N4DA 2FRDC 2YJZA 5K7SA 1TNDA 1SGWA 1UK9A 4CMEC 3VYUB 1JG6A 4F2GA 5BORA 3OZIA 5JZMA 10MHA 2JCYA 1VZ2A 4EHAA 1VPDA 3MBIA 3C0KA 3EIHA 2WJZB 3KZOA 2JIPA 5AW2A 3ELYA 4M0UA 4N5MA 5GM1A 1Z0JA 3CX4A 2ZULA 3DL7A 4HGOA 4NCHA 5EYPA 1T10A 4A0FA 4R0NA 4ZDJA 1WR8A 1J6UA 4LTMA 3V2IA 4DLKA 1GTL1 1B00A 1JZSA 3BWDD 2E5WA 2Y2UA 3R3UA 4MMYB 2OYRA 3ZZNA 2BM9A 1K06A 4UVIA 1Z6QA 1KSGA 3A2KA 3COZA 5FLYA 3WE7A 1YKSA 2IIPA 4Q4LA 4MPPA 2J3MA 1DARA 2LPMA 5B12A 4HTFA 2K7FA 4HEA1 5AKGA 1JB1A 2ZBGA 2ZYAA 3QJYA 4FMBB 1N0HA 1VHLA 1HORA 1VSTA 3BIJA 3OF5A 1GILA 3GP3A 3I4FA 2BZGA 3PHIA 4KQEA 5KVQA 3T8YA 4CPDA 2VUTA 1H3FA 5AYVA 3E3LA 1PFKA 3EYWA 4U3JB 4IV5A 5AKHA 5JH7A 2IV7A 1NMZA 2W37A 3FZGA 1E2LA 4HBZA 3THRA 2PANA 1FW8A 1X8KA 1Q21A 5LA6B 3ZHXA 5A4DA 4N0PA 2P65A 4F56A 3ITDA 2OKGA 3WBBA 3I2JA 1TT5A 1U94A 4K6CA 4LI3X 3FDIA 3EBLA 1YZFA 2XUGA 1M7BA 4LNHA 3HXQA 1T43A 3L0BA 4ITVA 5CHEA 3UMGA 2V7UA 4A0SA 4ZMSA 1JEYB 3FCYA 1COZA 4BX3A 1PHPA 4B5LA 4B4UA 2X9NA 5G1PA 4ZOCA 2P4SA 4FYWA 4ZCMA 3D6AA 3H5TA 5CYFA 4QTYA 3ZDAA 4MYUA 3CZPA 4YRLA 3PGVA 4RV4A 3OQNA 4NMMA 1CUBA 3UA3A 1FYFA 1BMFA 2ZKIA 3ZCUA 5I7HA 3I5YA 3H5IA 3SBDA 3QJ5A 1GTVA 1C50A 1DO8A 5EHGA 2GRUA 1F6BA 1U0GA 1ZINA 4MZDA 6AT1A 4OB8A 1TVKB 4DLLA 4ENWA 3O8OB 2TMDA 4L0MA 5A3JA 5BVHA 3Q3HA 5AVOA 2CMFA 3JAKB 4XYLA 5LP6C 2NG1A 4WZAB 4EI2A 4JJ4A 4L85A 4KGZA 4AZVA 3IPAA 4L72A 4LE2A 4E14A 7ADHA 3IVMA 4QAQA 3PIRA 1H9BA 3EIUA 2ACVA 2ZRHA 4FR2A 5BNFA 4F1WA 1PTJA 1WMDA 3AR5A 2OENG 4KVGA 1EDOA 2HREA 2I33A 1JBQA 1JDSA 3CZQA 5CX1A 5EC8A 2H4FA 3H65A 2PG3A 3E7XA 3QKSB 2XI4A 1LDMA 1OFVA 4EF6A 3GJ5A 3H0CA 1G8HA 4MQEB 4H9GA 3VOAA 5A4MS 1G5HA 1AO3A 1M0WA 1TUBB 1X7GA 2Z5LA 1A5BB 1WDWB 1WSBA 2OMKA 2O2XA 3AMVA 1XQXA 3LFTA 1A4XA 4J0HA 3AR6A 4ZI7B 2UYHA 2OFOA 2N3ZA 2O4CA 1NPTO 3MQ2A 4JSRA 4JUCA 1ZS9A 3AFOA 2WWGA 4K46A 3WIEA 1UKVY 4BRWA 2ZB2A 2O19A 1YB7A 2K6GA 1EFCA 4C01A 4TMYA 3LYLA 2A8YA 5LYJB 4JXJA 1YZKA 2V7TA 4MV4A 3RVMA 3WHIA 1KFJB 4BNGA 4CLXA 1SD2A 4GMFA 1XDUA 4R0MA 4BO3A 3HBFA 1S3FA 5CT4A 1S96A 2AG6A 3AYZB 4BP1A 2VIIA 3EZ7A 5CAEA 4F4DA 2D2EA 1EINA 3SNHA 3L77A 4US1R 3UPUA 2CNWD 3TKLA 3DOCA 4X20A 1ZD4A 5JIBA 2YDXA 4HAVA 2O3SA 4R2LA 1SXGA 1PJ8A 2IPOA 1BGXT 3H84A 4O1MA 4D0NA 3AI2A 1G8PA 2G4VA 3B38A 3QNWA 4NX2A 3DBRB 4MVJF 5HS4A 2DPMA 1FL9A 3EF0A 3ZHTA 3VU9A 4YCLA 3L6BA 4E4RA 1LI7A 1ZCJA 3PYXA 2OG1A 2QR5A 3UENA 1ZMRA 1IBKB 2IHNA 3VKGA 4DEVA 2ZZNA 3GLIB 1PKEA 1KOGA 3RIGA 1J8DA 3DO6A 3GBSA 2PT6A 3GRYA 5AMXA 1PU2A 2V6FA 3EGCA 3PL5A 1PZEA 1GDTA 5ITSA 3W4JA 2H57A 1NXSA 5E4JA 3UJ6A 2GDJA 1DCTA 5BYJA 1DKQA 721PA 4LXQA 5K0FA 1R6XA 2QYTA 4HL6A 3A04A 1SXJA 1IWOA 1OREA 1PNVA 5LKAA 3LCUA 4YUZA 1OIXA 2ZT7A 4LY0A 4NNJA 3G6WA 3GBPA 2CXOA 3AC0A 3CBGA 2RDMA 4I99A 4OVKA 1KMMA 2QOEA 4H7DA 1YCFA 4DDTA 5HX7A 3N07A 2RGXA 2LR0A 3D43A 2C9DA 3F67A 2YVKA 1H6AA 4UZEA 3EAQA 3MG9A 4JI3B 3U3DA 5MFZA 3HH8A 2DPGA 3KR0A 2P9FA 1QHYA 2IYOA 3T1YB 1YDEA 2X13A 4M4SA 3BE4A 3EXG1 1LTQA 4NK4A 3P9ZA 2WU1A 3VSAA 1E2FA 4TM7A 5SY9A 3EMDA 3QLTA 3RSZA 1VBNA 4JA0A 2BGRA 5JD4A 2ZAIA 1PFQA 4FDVA 5EZYB 3L92A 1GZ6A 2GZSA 3KT6A 3UUWA 4EG3A 2ZJ3A 2IPMA 3D2CA 3L4BA 2FSSA 1V3QE 2XBUA 4MYDA 2DXIA 3IEVA 4MVXA 4A23A 1SK9A 5FBKA 1JHRA 3E9ZA 2ZAMA 2YMMA 4TKMA 3RWBA 4WBNF 4BX2A 1JPVA 3N2GB 3Q7PA 1P2VA 4Q19A 4XASA 1GL7A 1IU9A 1ZR4A 4NECA 4R1LA 1LU9A 1QIFA 5C52B 4WSOA 4B7AA 4I8DA 1P1CA 2VHUA 4B3MB 1TYBE 4R3NA 1IAQA 2PN1A 2P5YA 1WZCA 2H92A 4ZDKA 4EUHA 3GFPA 4G5QA 3TCKA 4OP2A 3BFPA 4YRTA 1TYDE 5HKOA 2IS1A 3IRVA 3IUMA 4D9FA 4ZYYA 2F8MA 2VPXA 5BR4A 2KQUA 1OU0A 3LT4A 4OHWA 2C95A 4KWCA 5CA1B 3IR6A 1G8KA 2P1ZA 3NCHA 1B8OA 4PZUA 4QXMA 2EX0A 1TM1E 3LLCA 3DTNA 1BA3A 1W88B 5SYAA 1A9ZA 1HKHA 3RVNA 1ZD8A 3BE8A 3TWOA 2Z04A 3KEGA 1EP9A 4X1OA 1RAEA 1V8FA 4IL5A 4ASUA 4C14A 4D3YA 4DLBA 3A6ZA 5ES3A 3QUSA 4ZCSA 2CDRA 4DIKA 1XBTA 1W47A 2QJTA 5JCJA 3ZU2A 8LDHA 2CCGA 5ICSA 2W2MA 3MTAA 1M2GA 1CTQA 5AK5A 3SIXA 2H1WA 1OPRA 2JIZA 3F4BA 4PLTA 2GLTA 4NYJR 5EMNA 3C39A 2H5IA 3LK6A 3VYVA 3HKEB 2OD9A 1SJ9A 4ZYXA 3G7SA 3D7SA 1WW8A 3IERA 1ETHA 3B7GA 5CT9A 4XTRA 2J5XA 3WGQA 2FSVA 1NMYA 3ZWNA 5IZ4A 2QYSA 2X77A 3OOHA 4Z9XA 4PLGA 3EFBA 1CX9B 1VPVA 2P2YA 4L5YA 2X2EA 4Y6LA 1NZDA 4E70A 3EYAA 2R62A 4IOJA 3S3TA 1F2TA 1L5YA 1A27A 3NBYC 2DUMA 3FWKA 4JEHA 3C3WA 2WF6A 4BQPA 3DAPA 5CD1A 3NTLA 3T9CA 1JPNA 5DX0A 4EEXA 3HJCA 3WAJA 1G3RA 1DIHA 3DTVD 2P62A 3ASVA 1A8PA 2QPLA 5ALPA 1CY1A 1ZH8A 2WFAA 1KYVA 4XQGA 5B5SA 4XJVA 1CPYA 5CB4B 1GZDA 1XMVA 1GPDG 4CCYA 2QTNA 1I10A 3CRNA 5CH8A 1BCSA 3OE5A 4V2UA 2V7QA 2FETA 1ENYA 2EOAA 4EFKA 1EPUA 1G7RA 4H0NA 5FD8A 1KAHA 3K9HA 4PN3A 7YASA 5KNDD 2HSGA 1XWWA 1SD1A 4F93B 3WGUA 1HE2A 3FNHA 1M9NA 1X7XB 1Y8CA 3PQ8A 1P19A 2JK0A 4KPGA 4BNZA 5BR1A 4XM1A 1JU3A 1YBVA 2X14A 5J4YA 3H1GA 1EESA 4B3HA 2P6OA 4FBLA 1JWAB 2A78A 3R7WA 2ZJFA 3PSAA 4M2LA 3INRA 4DV4B 2BFPA 4XWWA 4PZ9A 4ZEOA 4ZVLA 1J7JA 2HA7A 5D51S 3UK6A 3ZWXA 4YRGA 4QM6A 1PVOA 5HUQA 2ES4A 2IU0A 4R84A 3A36A 2IWRA 1IN8A 3R7FA 3ABIA 4S1VA 2BHLA 3ST7A 4YP7A 3ITKA 2I1VB 1G4UR 3RYIA 5B6JA 5ADVA 2LDXA 1Y42X 4KPYA 1YH3A 3SD7A 1YR8A 2ZSFA 4CKCB 1K88A 4P4TA 4GI5A 2FXIA 1K0UA 4ROTA 1QHXA 4H7FA 3SM3A 4ASUD 1F17A 2C5AA 4BMNA 2ZS9A 3CZRA 2H1HA 1K6MA 2OBXA 3KVNA 1RZVA 2GTPA 4ZO7A 2QM7A 5BQ3A 1RIIA 1DQPA 4NNOA 2RHLA 3EWSA 1C1XB 4OMDA 1K2VN 2X0DA 4JJIA 3ID6C 2PD3A 3D4PA 3E9EA 2J7PA 4GQAA 3F6EX 3CE6A 1P2BA 3IEMA 3IQZA 3ONWA 1H6BA 3N8HA 5EMMA 4Q05A 4KEAA 4GOOD 2CHVA 4L8FA 4BGDA 5B2FA 4I5EA 3ADCA 2PZKA 3A9RA 3VPSA 2C61A 3HEBA 2QT9A 5AW9A 2WJ6A 1C9DB 1XZKA 3E3MA 4P92A 1TB4A 1Q50A 4YAFA 5J2UB 4MS4B 5ELMA 4RTSA 3UKJA 3TOCA 2ID7A 3FMIA 3GOHA 5F9FA 4GLFA 1Q6YA 1FFWA 2FZCA 2QTVB 2W2LD 3KJZA 4O3FA 4BMDA 3BWCA 2ONZA 1CCWA 1LZLA 1SOUA 4R31A 2QMQA 2XDWA 3L7DA 5DIFA 1UDWA 3RHTA 1KY5A 1V3UA 1DKLA 2PKYX 2I4TA 2CLLB 5A03A 5HUJA 4UU7A 2J9FA 2N75A 4CQLA 1NFFA 2YYAA 4ZA2A 4LJLA 3H1TA 5IAJA 1T13A 3PHGA 4KBYA 2P9CA 1QJCA 3NB0A 2BI4A 3EUWA 4JYPA 4DLPA 3PXCX 2HCJB 3OQ1A 1WY7A 4F7WA 1EFPA 4NE9A 3SKXA 4PYMA 4S1PA 1R5OA 3PFKA 2M1XA 4LDQA 2QLJA 4MO2A 1FDUA 1BX0A 3C16C 1RRCA 2IH4A 1QHGA 2JCBA 3CR8A 1IAVA 3O9VA 1Q84A 3WISA 2WVAA 1R9NA 4ETWA 1HLDA 4M9ZA 4BNYA 1CUVA 1KETA 2GBGA 3RIXA 3LDHA 4GR9A 1KIFA 3DM9B 3FGOA 3GOQA 2QAGB 5HYVA 1JH8A 2B1QA 1R66A 3TW0A 3OO0A 3EVAA 3U16A 3KU1A 1PJTA 4GMKA 3MILA 5J2TA 2WP8J 1MG0A 4AC9A 1NU8A 1I6LA 4M0LA 5KKCA 5LIRA 1L2TA 4DQUA 1Y9AA 4XYBA 4LY3A 4DLNA 1DQRA 4D81A 3WGMA 2IZ6A 2F9FA 2WU0A 4TS1A 1Y0BA 4C5CA 1ONNA 2HO4A 2WB4A 4MQ5A 2ASVA 2BGJA 4INJA 4Y18A 1ULZA 1MD9A 1XAJA 5ELLA 3CRZA 4MS1A 1NVTA 1U1CA 5B2ZA 1TYZA 2FPPB 2GR9A 2MINB 4K03A 3B3AA 1GIAA 4FCTA 4R8MA 4IFTA 2AG1A 2EDAA 4YJDA 3ADKA 5B4TA 5DX8A 5KAPA 1ABEA 3OT1A 4DF3A 1NQ5A 2AYYA 2DR3A 2YV4A 4FN4A 2AJLI 1WVMA 1IBLB 1DB3A 4OLFA 4TTAA 5C8YB 1Z37A 5EIAA 1Z36A 5EJIA 3QA9A 2BFFA 4FWBA 1F9EA 5IC4A 1V6SA 2DBYA 2PBLA 4JR1A 3RVQA 5LQNA 3KQNA 2YY5A 2VT3A 5E95A 1V7CA 3JQDA 3B6IA 2ETVA 4BFLA 4F3RA 4MI3A 4ZJPA 5BN3B 2XCTB 4YCBA 1OI2A 3M4XA 4YT8A 4O4HF 3I9MA 4GDMA 3DEFA 2F59A 3N5CA 3T5GA 4ILEA 4C22A 1CUGA 2HMSA 2X5KO 3WAGA 2ZM6B 2HDWA 3HKCB 1JI0A 4MVWA 1BJKA 4BNLA 1B23P 4CF7A 5J4LA 1A50B 4E08A 1U0HC 3QHAA 4NEQA 4AXBA 1MW9X 1GZUA 2Q1SA 3JQRA 2D5IA 2GFIA 1G16A 1SBIA 2MWMA 2VF7A 3R77A 4MWBA 4XJTA 1EM8A 1WKVA 2YR0A 4O0LA 5KYWB 2K7ZA 4OKIA 5DP1A 5J5VA 2F1OA 1DIGA 1ZBDA 2JHAA 2XF8A 5CHYA 2B82A 2GPBA 1OZ0A 1PFYA 3FKSA 4P81A 3D4IA 3NHWA 2O3JA 3TLBA 1NSYA 1KQOA 3NP9A 3QVGB 4KMSA 4BJ1A 4CKXA 4ZZ1A 5KYNA 4KVFA 4PAGA 1Z38A 2ZSAA 2W42A 2ZTLA 3THSA 5BRJA 1GL6A 4XIJA 4QUHA 3NNDA 4B4KA 4Z7JA 1JFLA 1MZPA 4RANA 4TTIA 4AN0A 1L0BA 2V9CA 5KOHB 5LQUA 1I3MA 2DFVA 3E0QA 4BE9A 1XELA 2HM7A 4RHUA 2X7XA 5DOZA 1QQBA 1P2SA 2JKZA 4JFRA 2CLSA 3MAJA 1AGYA 1RPJA 3GT7A 1JDTA 1N5KA 1RRKA 3CVOA 4EJ2A 3VM6A 4R1QA 5E1DA 5EKXA 1L5HA 4KX3A 1VPEA 2QLTA 1UZLA 1SVKA 3K3PA 5A5VA 3UG6A 2E4YA 2ZB7A 3E15A 4EYGA 2GM4A 2PS1A 4RCZA 2QMYA 4DR4B 4OJQA 4R83A 5DE3A 1XHEA 4PNHA 3AHJA 1W7AA 3C6XA 2X5NA 1DAIA 4LRXA 1YS4A 1OGJA 3RRXA 5C4GB 1T1GA 4Q1FA 4NOLA 1ZD5A 1TKBA 1RBQA 3DHYA 3P2KA 4MTCA 2X3UA 3UAWA 1GNLA 1VYVA 4TN1A 2PJDA 2II6A 4LJ8A 2X0FA 4BBZA 3IC5A 3GRVA 5BSEA 1MC4A 4CTKA 4ABTA 3AVQA 1S0UA 1WXQA 3GGCA 5EJ2A 3ZGYA 2O0LA 1H2BA 2FSGA 4OK5A 4Q3LA 3G8YA 4URYR 5EJ5A 3A1TA 2A0WA 4LJ4A 2HHAA 2DZDA 3IOCA 5CCBA 4HH3C 3CLTC 3KYCB 4XI9A 2PMFA 3F5FA 4Z8YA 3OLQA 1T3LA 1LKZA 1T2FA 1CJMA 5EWMA 1OROA 5AW8A 1YS6A 4JYCA 3EPHA 4CBVA 2YRWA 2GKSA 3PICA 4BFWA 1QG6A 4OMCA 3QWFA 2NP7A 3DZJA 3I2YX 3ONEA 4PQFA 5KAMA 3RT7A 3U5ZB 1ISGA 4RJLA 4QXQA 5DTQA 3F8SA 5F1PA 5HRCA 4D41A 2E5LB 1G291 2PGJA 1Z2EA 4INOA 4J4TA 2W8BA 2Z1DA 3UNXA 2D5CA 3FFBA 1F5SA 4FYMA 9ABPA 3FKSD 4M1WA 2HRDA 1ONPA 1XFAA 3VUFA 3G02A 3ME5A 1L1RA 4QA9A 2A9KA 1Q0SA 2ZRLA 3TFOA 4DR3B 1N2BA 1RXIA 1XKXA 2WEKA 3CUSA 1XYGA 1KFBB 1D4AA 1OTHA 2ZGVA 2P79A 1H0KA 1GPMA 1PK7A 2XYVA 4IY1A 3WNDA 4G5OA 1U9ZA 1RWWA 1RWMA 1IRXA 2RK6A 4YLYA 3SWWA 1KY3A 3LUFA 1VFNA 2BTEA 2D3TA 3U56A 2BYTA 2DB3A 3ZHSA 1VRCA 3PC8A 5J47A 1W0KD 3KKLA 4FFPA 4H6XA 3IEPA 1BHSA 4OQLA 2QU8A 4PFSA 1GRQA 1O54A 1XTZA 5T3UA 3VR4H 4AWXA 1OBOA 1MEOA 3BMXA 2XUHA 3LWZA 1EBFA 4BQRA 1T34A 3EGXB 4H1HA 3A9TA 3ASYA 1R6BX 1KI9A 3EHDA 2GJAA 1ZOPA 2AGVA 3M83A 4IZHA 5I9TA 3PJEA 4BDSA 1E18A 4FI3C 5F35A 4HNVA 4BO0A 3L02A 4NHEA 1CF2O 1CJCA 5JW6A 3VDRA 1TUEA 1X7ZB 3BSFA 4PO9A 5JJKA 4M83A 2Q4RA 1GGFA 4F21A 1ZNQO 4LXIA 5G40A 2GD1O 1UJ6A 2NZJA 4OAQA 2D7DA 4YJGB 1EP3B 1MIOA 1ZKMA 2Q5EA 4EW3A 2VOJA 3OEEA 1N3YA 5LNK1 2ZTUA 5JS1A 3Q98A 2NNWB 3IOEA 4FW9A 4QYSA 3N3AC 3HB1A 4XX1A 1TW3A 2QQGA 3R0ZA 5HKLA 4ZJZA 5J5CA 3GP8A 3PHLA 5BW5A 2AN4A 1FFXB 1C1HA 1YE8A 3BXGA 3H11B 3MGBA 2ASEA 1F8YA 1QBGA 1ZWKA 4YB8A 4DQDA 3HDYA 3EDCA 5DYGA 3EMVA 3K9GA 2OCLA 4J94A 3UTCA 4DRXB 1ZIDA 3A11A 4AZSA 2HLDA 2OXTA 3OE1A 3W90A 3A2LA 4N82A 1GITA 1PLLA 2CDNA 2FWAA 2L0XA 1JU4A 2QJRA 3F5QA 3K0FA 2G04A 3F3SA 4CODB 3H83A 1QP7A 3NX4A 3HFJA 4MAFA 3WA7A 2J6BA 3AZQA 5C51B 2AOUA 4Z54A 1Z2CA 1T9BA 4LI0A 4OHBA 3ZV5A 2O3QA 4G4SP 4Q4CA 3UF0A 1JG4A 4RAQA 4YMGA 2IDZA 4BC1A 3LKVA 3Q3JB 4N5DA 5ALVA 3A28A 1R4NA 4CU2A 2QXTA 1JXOA 4UEQA 1H5UA 2IOFA 4Y2VA 5HIJA 5DISB 3DE6X 1QC5B 1S2MA 3R5XA 3GU3A 4CT4B 1FJHA 4OQMA 1OIVA 2WKPA 2QX8A 4IMJB 4OI1A 5AHXA 1ZHHA 2GBPA 2VF4X 3OWOA 4KIFA 1RYHA 2C4MA 1QQ7A 4PFQA 3ILHA 1V96A 4GW3A 3S2EA 5JARA 4NCNA 4Q02A 3O3OB 2AZ4A 2M32A 2ZTHA 5DBGA 3FRIA 4UNRA 1UPBA 4W9NC 1EX1A 1GXSA 2E82A 2PAFA 4OYLA 4ZPJA 5J5AA 1CUUA 3EZ6A 3SCZA 4L07A 1E2JA 1DAHA 2WWHA 2PMBA 4KHZA 3CH6A 4CM4A 5ECYA 3KTDA 2X0RA 2C42A 3HJHA 4HWGA 1CUZA 1QGUA 1TVEA 4LMRA 3QSGA 3THXA 4JWTA 3N5KA 1GL9B 1OXKB 2EG5A 1DQYA 3I1IA 4ND8A 1VXOA 3KKPA 4JZYA 3LE8A 1CR0A 1Q14A 1FNMA 3EZYA 2XQVA 4DANA 3KDAA 2PH7A 4CEJA 5C8XA 1NBAA 1DMRA 5ALUA 1F3OA 2N9UA 3HYRA 2ENWA 3W6NA 4IDOA 1EUZA 3BEOA 1FBNA 2KI5A 2Z3WA 3FYUA 1U28A 4HZGA 5HMMA 4OOEA 3TW8B 2REQB 5LN1A 4GYJA 4M6WB 2P6RA 1BRMA 1S8AA 4M9XA 1F6DA 2H1CA 3WNZA 3AY3A 1MG5A 4J43A 2CYBA 4JQYA 3WQQA 1P7WA 3X1ZA 3WK8A 1KBZA 2AD1A 1JAZA 3VOBA 1Q3TA 4L51A 5LZ9A 5J3JA 1CQJB 2W6PA 3MBKA 5T8KA 3GL9A 2B83A 1U1DA 2OBMA 3MWDA 3OIDA 3K0CA 4MV3A 5H16A 1HR0B 4R5MA 1CULC 3DD5A 4H1VA 1FX0A 1KIMA 4C9BA 4YXFA 1KSFX 1UJ2A 1J8VA 2ATCA 3IESA 4X91A 4NBTA 3L1JA 3HHPA 1LB1B 3GCWA 1VP3A 4ZT5A 2AXEA 3PDWA 2CMKA 1H0HA 2DX7A 2VH2A 3BN3A 4GYWA 4ZVSA 4C87A 3BWEA 3F9CA 5FBQB 1S4MA 3HUUA 5CM2Z 3BIWA 1X8LA 1PE0A 3UBMA 3KSUA 4B83A 4OBBA 3G8AA 3DB1A 3EA5A 4IINA 5ALRA 3ZKAA 3EPKA 1ZICA 2R1UA 4UM8B 3GMDA 3H2GA 2IYYA 5AHKA 4XH9B 3R44A 2QRUA 3O1HB 3THYA 3STUA 1A9YA 4QNMA 4DMRA 3DYIA 5KOYA 5E7JA 3AFNA 3FCOA 3AFIA 3DCIA 1RLTA 4YONB 2FUEA 2XRMA 4YREA 3RVDA 3N2IA 5AUPB 5JSUA 3UJNA 4W9RA 3DE5X 4Q3KA 3W9SA 4K88A 5JQWA 1TZJA 5DBHX 3FHTA 5HUHA 2LDBA 1CYDA 3QVSA 4TRRA 1J4AA 4IM7A 3QPWA 2Y1WA 3GLSA 4H3SA 3WQHA 4ZIRB 4D4HA 3HN6A 1OAOC 4IW3B 2RAPA 3T5AA 3HY4A 1EM6A 5HZGA 3CNBA 1G0OA 1R0BA 1CNEA 4GM1A 4U5XA 4PWYA 2YZGA 3NM5A 2I6TA 3P5BA 4U7TB 2VTDA 4LGVA 1K6JA 3PXUA 3MF4A 5D1NA 3W6OA 5I3ZA 1N2CB 2QQ5A 4R5HA 1JR6A 1MC5A 2PV0A 1VDZA 5ELXA 5T41A 5JAMA 3FIJA 1CWUA 1N6OA 3BJMA 3V1NA 1FVOA 1X8XA 3PIDA 4W1SA 2BGLA 5DW0A 3X1DA 2JJMA