3A58B

Crystal structure of sec3p - rho1p complex from saccharomyces cerevisiae
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
178
structure length
178
Chain Sequence
b'SIRRKLVIVGDGACGKTCLLIVNSKGQFPEVYVPTVFENYVADVEVDGRRVELALWDTAGQEDYDRLRPLSYPDSNVVLICFSIDLPDSLENVQEKWIAEVLHFCQGVPIILVGCKVDLRNDPQTIEQLRQEGQQPVTSQEGQSVADQIGATGYYECSAKTGYGVREVFEAATRASLM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exocyst complex component SEC3
publication title Structural basis for the Rho- and phosphoinositide-dependent localization of the exocyst subunit Sec3
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport/exocytosis
total genus 58
structure length 178
sequence length 178
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2009-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3a58B00
1G8PA 1SHZA 2ZQ5A 4PSVA 1KSJA 5FTNA 5G3ZA 3WHKA 3CH4B 4JL5A 4ZI2A 4TMXA 5DO9A 2WMOB 4GSYA 1G8YA 1MABA 1Z2CA 5HCNA 2ZJOA 1MO4A 3ETLA 2PX0A 2HXSA 5EP4A 4W5WA 4NYIR 1LW7A 1XU4A 4JZKA 3PUWA 1G9XA 5CB8A 3K09A 4KSBA 4CEJB 1IN5A 3EC2A 2AKAB 3CWZA 1XMIA 4AG6A 4KFUA 2CNWA 3BH6A 4E09A 1WXQA 3W3ZB 1E9BA 2WAXA 4HZUA 1OE0A 1I4TD 2JIZA 5H8WA 1W7AA 2FFQA 2G1KA 1W2HA 5EP2A 3TSWA 4C7OA 1M1YE 3VR3A 4HLDA 3AF0A 1G3QA 5FOSA 5KYKA 2HXYA 1LNZA 3DVLA 2RGCA 4OK6A 2O8BA 4RKEA 1L8QA 2JLSA 1FPMA 3AF2A 3BRWD 4FXPA 4MQBA 1JALA 2DPXA 1GRQA 1BO6A 3AVQA 4JLDA 4KFSA 4Q18A 2NMVA 4D0NA 3GJXC 4M22A 4B3CA 3WMFA 3FMIA 3UG7A 3R9XA 2RGAA 1DE0A 1YKSA 3HYTA 4LPKA 2GJ9A 3MLEA 2V54A 1Z0JA 2Q3HA 521PA 3CX7A 1ZUNB 1W5SA 3ZIAD 3UMFA 3OEHD 3BS4A 1E2FA 5LB4A 3ZZUA 421PA 1PUIA 2JJ2D 2GAAA 4HB0A 2UKDA 4TZ0A 2QTHA 1OXVA 2UVQA 2O8CB 3GLHE 3HYRA 1TF7A 5FPTA 4RZ2A 4KCGA 2QM7A 1P75A 2RGEA 1VG1A 2E1RA 3DM9B 1UFQA 1OKKD 2V8OA 3LW8A 3MD0A 4H1UA 4TN1A 3KFXA 3QG1A 4OI2A 2FFHA 4EPXA 4MGKR 1FQKA 4Q7MB 2BBSA 2L0XA 2GK6A 4LK2A 1XJQA 3RANA 3I61A 5FOVA 1M8PA 1Q12A 2OEPA 4JBWA 2ZJ8A 2K5UA 2KE5A 4GDFA 3I5XA 4TYNA 3U5ZB 1DAMA 3AP1A 3DPUA 4OHVA 3HDTA 3RRMA 5C46F 1UM8A 2OM2A 4R9UC 1HV8A 3UMSA 1U8AA 2XSZA 3I5YA 4URWR 4GPTA 3GFPA 3Q9LA 4HLUC 3PG5A 4MYCA 5DI9A 2R6GA 1E2EA 3LQRA 5DGXA 5H68A 4KV9A 3CPEA 3PEWA 5KHOC 2GKSA 1U0JA 2WWIA 1JPJA 2VYFA 2VHQA 5CIQA 1VYUA 3FFAA 3IQXA 3PENA 4M2LA 2ECKA 1OFHA 4IJMA 2GVZC 1E99A 2A2ZA 1WBBA 2GEVA 2WM9B 2YYZA 3Q5DA 3THXB 3OIVA 2BC9A 4CEHA 1MRSA 5TY0A 1OB2A 1NIPA 3T5GA 3QKSB 3UMRA 3TR5A 3U3RA 1T5LA 4C0SA 1HQYE 4AY2A 4MKIA 2WAYA 4DWJA 1NN0A 3ECCA 1R5BA 4GBMA 4A0RA 3NH9A 4PC1A 3HWSA 4Q9KA 1TUIA 1NKSA 3U7EB 2AXNA 2DHRA 1Z47A 4Z51A 3NHAA 3CB4A 5JCPA 3TRFA 4FWIB 4I1OA 1ETUA 3WYFA 1VKJA 4B2PA 1OIVA 1SKYB 1L4UA 1L7VC 1NVVQ 1XZPA 2Z4SA 2ZS7A 4WW0A 2IX3A 3ZYCA 4HUTA 1GKYA 1KNQA 2V7QA 3DMNA 2ZR7A 2GEDA 4P32A 2O0HA 1K5GA 3AGPA 2ZI7A 3S1AA 2DR3A 1NN3A 1OXSC 1K5DA 3OESA 4EPYA 2JJ1D 4PR0A 1Z6GA 3CH5A 3FFBA 2OSBA 3HR7A 2EYUA 1JEEA 2QY9A 4MRVA 1PZNA 2Q9AA 2QP3A 4GMDA 3NTUA 1G16A 1D9XA 1EFCA 1NRJB 4B47A 4LHZA 3EIEA 2ZPTX 4BFXA 1GVNB 1XEWX 2GZAA 5IK2A 3N70A 1XMVA 5KNBA 2DWPA 3SJBA 3IGFA 4BFSA 4Q9JA 2ZRMA 5DNYB 3W3AA 2XNSA 4BRUA 1KY3A 3CPHA 2XOKD 2W0SA 2V3CC 1G4AE 3WP0A 5CM9C 4I1SA 2FEMA 3PUXA 4PPFA 2AN9A 1E2MA 1CJVC 4QC2A 4WIAA 1IQPA 5FPYA 3W5IA 4UKDA 1ZNZA 2DFKB 2FV8A 2PCLA 4WAUA 4GFDA 4B43A 4DVGA 3AVUA 2ZE5A 1E9DA 2WZQA 4K46A 1CU1A 2OLJA 4NZYA 1F48A 4P33A 1PLLA 5P21A 3BE4A 2ZI9A 4BE7B 1GKIA 1CJKC 5C4MA 1RYFA 1XD2A 1AS3A 3BD9A 5UKDA 4BPBA 4Q5IA 3DZDA 3AVXA 5FTMA 1NLFA 4ESVA 1DPFA 1U9IC 1WB9A 2YNMA 3KQLA 1U0HC 4IOJA 5B58C 2FJUA 2QM8A 2KJQA 2Z43A 1RJ9B 2YINC 1F2TB 1MR3F 2YOGA 4RSGA 3RS5A 4LZZA 3U6KA 4A0HA 3PEVA 2VHUA 3DOFA 2GVDC 3BERA 2YC4C 2XGJA 4NP6A 2P65A 1TTTA 5L3QA 2VQSA 2EFGA 4P31A 4Q1FA 4QGHA 4L8GA 3N2IA 1D9ZA 2CMKA 1QRAA 4ZCMA 3VKGA 3AP2A 3PUZA 5EZ5A 3UK6A 1NNEA 1OSNA 3B5JA 2C9YA 4WXRA 1XFAA 4ZV4A 1M7HA 2GXQA 1E9EA 1P60A 1AIPA 4JYBA 4PPNA 5G3YA 1Z8FA 3CONA 3UWOA 4K81B 1A4RA 1BYIA 4JLVA 4OK5A 5AJVB 4Q9HA 1JR3E 1JR6A 2AWNA 3ND9A 4CIDA 2Z0MA 3HPQA 1LTQA 4JLPA 3OHMA 1N6HA 1VCIA 4NBSA 4OJQA 4YDHB 1KJYA 2FMXA 4YQFA 5F98A 2VHTA 4DIEA 2ZTSA 1EK0A 5LBIA 4AIIA 2VA8A 3B9PA 1KZ7B 2GNOA 1CR4A 4OI4A 4TL8A 4DLZA 1VPLA 4CEIB 2HYDA 1ZU5A 3EG5A 1G64A 4BLOA 2YOFA 1XD9A 2AX4A 2B92A 4JLBA 5KSYA 1KKLA 3SI7A 3BK7A 5JWRA 3BB4A 4TLCA 2GCOB 3M6AA 3W8RA 3UIEA 621PA 1L4YA 3RSLA 1II8B 4ZKDA 2Q21A 4LYJA 2GEUA 2RH5A 3RS3A 4ZI3A 4PTLA 4RKFA 3X1DA 2IWHA 4S2EA 4DT1A 2CCGA 1OH8A 1EFRA 2F3TA 1WBDA 2IXEA 1YZUA 5CYPA 2GESA 1N6PA 1GNPA 4IFBA 4TT3A 1GNQA 1NBMD 3GJ0A 1O3YA 4BGDA 1YJ5A 4CRWB 3TGPA 3A6PC 5FI1B 5CK4A 1Z0IA 3EPKA 2WJGA 4TL7A 2EYQA 4CW7A 2ONKA 4M9QA 4TWZA 5FBQB 1N6OA 2VH5R 2JLQA 1DAHA 1E98A 3JVUA 3L0SA 4DSTA 2ZJBA 3WY9A 1MH1A 3I72A 4US2R 2IYXA 1XEXB 2ZM5A 3VTKA 3Q3JB 2H7VA 3L0PA 3VR2A 3EZ2A 2ERYA 4M9XA 3BH7A 2CHGA 2D62A 1UDWA 4NYJR 2ZRGA 2QAGA 1CLUA 1HT2E 4O0MA 1P9WA 1W48A 3IIJA 4K8OA 2ORIA 4OI1A 5HZHA 1LV7A 2YOHA 3P20A 4Q9LA 3CO5A 4TQUS 3K70D 5IDVA 3L8YA 2AXPA 4HLQB 2ODEA 2QP9X 1DG1G 2J7PA 2HJGA 3AQ4A 5LD2B 2IUUA 2FWRA 1N2CE 2GF0A 2HJVA 2IYSA 3KKOA 1KO8A 5BQ5A 2XNDD 2FDCA 4LDJA 2R6AA 1FUKA 5FBVB 1F2UB 5J40A 3KQUA 1I4DD 5EE3A 2QSYA 3B6EA 1SXJA 4BLTA 3MWKA 2QT0A 3GLHB 3SJCA 3QKUA 1QHNA 1YRBA 1TAGA 2NPIA 4G5QA 4GOKA 4V0ME 5FOUA 5JWOA 5E7IA 3R7WB 3SC3A 1RKBA 3A4NA 3X1WA 2ZI3A 3AH8A 1NP6A 4G0NA 2O8FA 2W83A 2W6IA 2IW3A 2WKQA 2WPDA 5FOTA 1QHHB 1XTJA 4PAOA 2DB3A 1X1RA 2H5EA 2ZUCA 1RRFA 1HY3A 4PZZA 5FUYA 4IFEA 5BWMA 4HB2A 2VEDA 1AGRA 4UJ5A 1KI3A 2J87A 4A92A 4Q4JB 4RY2A 1C1YA 2IUSA 3ZLJA 2ZUDA 2F1RA 1SGWA 5CLQA 3ZJYA 1CEEA 3B1ZA 4I81A 2GAOA 3AF4A 3Q7QA 2C9CA 2VHJA 4LJ8A 2GCNA 4DC9A 1T0HB 4LY6A 1ZM9A 4HAXA 3WXMA 4C30A 4B74A 5C4GB 1R7RA 2WIBA 3QPUA 5CLLA 1Z22A 4ZIRA 4IOKA 1BMFA 1R6BX 4YMUA 4X8LA 4BEBA 2VO1A 4TLEA 3BC1A 4IW3B 2P6UA 1E2JA 1OYWA 3IHLA 1IHUA 2W2TA 2IHYA 4TL6A 5TB5A 4XSGA 4EUNA 4MUAA 1A7JA 1NVXQ 2RGXA 1US8A 2CEAA 4PHTA 1G7CA 4UXIA 4NYMR 2E9SA 3CR7A 4OHZA 1M74A 1DBSA 3WP1B 1U2RA 4YMWA 2ZJAA 1KK3A 2RGNC 2V1XA 4I1VA 3F5FA 1J8MF 2EU8A 3GMTA 8OHMA 3NHBA 1J70A 2ZRAA 4V02A 4LBVA 2QAJA 1TU3A 4XIGS 1P2TA 1E2IA 4PC7A 1ZM3A 2BEJA 3D7MA 5FPKA 4MKGA 3W34A 1E1RA 4MRPA 221PA 3U7GA 2FE4A 4M4SA 4PX9A 2FPKA 1SQ5A 2P67A 4JLOA 4C2UA 4D26A 3WRYC 3FKQA 2V6IA 3QF4A 1G20E 5BN4A 1OH5A 1XBTA 4HAZA 4JKYA 2PZGA 4BLQA 2CCJA 1EFUA 1G8GA 2W2XA 5C18A 2VF8A 4JLMA 4D0LB 1WMSA 1J7KA 4XVQA 4IXNA 4NCHA 4DLTA 4EFLA 4D2IA 1BH2A 1QHIA 3K70C 1C9KA 2CL7X 4MITA 3D3QA 2GXAA 3B13B 4UJ3A 4DCVA 4PO8A 3REFA 5JLJA 2HYIC 1J90A 4M1TA 1N6IA 3QKRA 5HTKA 2VHCA 3Q72A 1CULC 1RYHA 2OHFA 2WJVA 2OILA 2PL3A 4EFMA 5JWHA 2EWWA 1W44A 3WRXC 3VR4A 5IT5A 2B21A 3IPYA 2AK3A 1XTKA 2ZU6A 2D2FA 1QG4A 4AKIA 3T61A 3TR0A 3MFYA 1DARA 3M0EA 2CE7A 2W6ID 4W5JA 4Q4HB 2NO7A 4ITRC 3TUJC 3V4FA 2J41A 3OF5A 1P2VA 2HF8A 1F60A 1VG0B 2F6RA 1NVUQ 2GETA 2UZIR 4TMTA 3RWMB 1RFLA 3F3YA 4NKRA 1D2EA 3KZ1E 4OQNA 4PSAA 2QE7A 3LQQA 5EE1A 5M04A 1B23P 2XB4A 3I73A 5F3WB 3KTAA 1KJWA 1A1VA 2QSZA 3NBYC 4ERNA 2ONJA 4OHWA 3THWA 4BUJA 2VP6A 1GL6A 1U94A 1ZJ6A 2J0UB 4BLRA 5CDFE 4XTRA 1GUAA 3GJ7A 3LW7A 2IYTA 4I4LA 1R2QA 4ZPXA 1W36C 1M2OB 3H86A 4DLUA 2ZRPA 4DDWA 3KUCA 1AKYA 1X8JA 3H4MA 3CR8A 3GPLA 2CVFA 1NF3A 2XAUA 3IDQA 3T1VA 4CZ2A 1CJMA 3AV0B 1G8FA 4B32A 5A4JA 3U44B 2FGKA 5FTJA 3T12A 5AR1A 2GILA 3B60A 4OL0A 3AKEA 4NPHA 1QBKC 3KKPA 4QG7A 2D7CA 2IC5A 5AK0A 4NYIQ 3TNFA 3LXXA 4LYFA 2W00A 2OCYC 3L2OB 3AUYA 2VIIA 1KI8A 4TMKA 3KXIA 1D2NA 1VHTA 2IYQA 2WSSD 3D6TB 3I92A 3RC8A 1YR9A 1G6HA 3QBTA 3AUXA 1XF9A 2DCUA 1NY6A 1E2PA 4B3XA 2OUKA 2OG2A 2QPTA 4A15A 4GOXA 5BW8A 4LHXA 2MSEB 1DELA 2QQ0A 2RHMA 2REOA 4HUQA 5JRZA 5JHHB 3DL0A 2FA9A 2G1JA 4OYHA 5HE8A 2QTFA 3KB2A 3A1TA 4XWOA 1OLOA 4LOAA 5HZKA 3ICEA 2XTMA 4C0QC 5KOYA 4NE2A 4E07A 2OZEA 2B7CA 2ZSDA 3SJZA 1UDXA 2HUPA 3PXGA 2KBFA 4QBFA 3EXAA 2CLDX 1A82A 5D3MB 3TVDA 4KXFB 4Z1MD 1XPRA 4S35A 1U98A 1XD8A 1ZU4A 1TQ6A 1DAGA 2XJ4A 4KBFA 1Q44A 2V4ZA 3NWJA 4Q21A 3EW9A 2NZ8A 2ODBA 4FMDF 1N0WA 5EXSA 2JLYA 1EG7A 1V43A 3ZGXA 3ZVLA 3FYHA 2O8DB 3FKSD 3ZIAA 5SZIA 4RFVA 4M1WA 1VCNA 1ZIPA 3OEHA 4M9SA 4Q4AB 1N6RA 1NN1A 4N0EA 5JJKA 1J8YF 1AA9A 4U5XA 4HDQB 2JJ2A 3RRYA 1SXJC 2FPMA 2FNAA 2OAQ1 3MWJA 3PCRB 3ICQB 2QROA 2V6JA 3A36A 4MH0R 5JI3E 3FWYA 2H16A 1OKKA 4M53A 1P2SA 3Q5EA 4Q1DA 4TMWA 4Z8YA 4IXMA 4EJSB 3CNOA 1N6KA 2WWFA 2A5DA 3ADBA 4GI7A 1S1MA 5K8UA 1FMLA 2BCJQ 4G5SA 1U9IA 1V5WA 3NKVA 1E9RA 2J1LA 4PPQA 2NTYC 1KGDA 4MKHA 1P72A 4C0HA 3J81k 2DY1A 2GTPA 5FR2A 1S96A 3KUDA 3LX8A 3MGCA 4KITB 4YXWD 2QEQA 3SR0A 1JEDA 3V9PA 5HKKD 2N42A 4M0LA 3KXLA 3CLVA 5J4VA 4HYYA 5DI3A 4OI0A 1KI6B 3EZ6A 3OIWA 5G40A 4EPRA 6Q21A 2BM0A 2F7SA 2JGNA 4IOMA 3VKHA 2EFDB 1E94E 4BFVA 3QXSA 5E7JA 1YU9A 3A4LA 5KDLA 3KL4A 2SHKA 4WZ6A 2A5FA 3C16C 3QPWA 4DLSA 3P4YA 2W58A 4DB4A 3NBZC 1IN4A 1I4LD 2QMEA 2VTKA 3CIOA 3O8RA 5L3VA 3PR1A 4AYXA 1HE8B 2Y8EA 5JEEA 1VG8A 3LLUA 3EZ9A 3FTQA 721PA 3ZH9B 3BH0A 1IM2A 4JBYA 4BECA 4QXAA 1Z63A 4LJ5A 4V0OA 3AF1A 3TH5A 4A0FA 2ZU0C 1Y63A 4ACBA 4LHWA 1IJEA 2Z83A 1ZP6A 2GDJA 4Z54A 2ZYUX 4A6XA 2R8RA 2PZEA 4ZKEA 3SBEA 5DN6D 2JJ1A 5JSZB 2C99A 5CK5A 3Q7PA 1SVWA 2A5GA 3OE7D 1FTNA 1KK0A 1OFIA 2V1UA 3IIKA 2GA8A 2HV8A 5J47A 1AS2A 4G5OA 2O5VA 1SULA 1S3SA 2CK3D 3FPAA 2C04A 4Z8XA 4NCJA 2ZJYA 3E1SA 4EPVA 5G53C 1P9RA 4B71A 2QENA 2XOKA 3U61B 2ZSEA 2OLKA 3KJIA 1E1QD 1GDDA 4NDZA 4Y0VA 5CB6A 1YVDA 2QORA 3K0FA 3K1JA 4EAQA 3SEAA 1KTVA 1KO1A 1Z83A 2Z5FA 4FI3C 5AJZA 1SVOA 1H8ED 2J46A 5KU1A 1KMQA 2WWXA 4JVLA 1FZQA 1WF3A 3LBNA 5EE9A 4Q7JB 4B6FA 3BFKA 1Z08A 3IBGA 4R71A 1M7GA 5IF9A 2GWHA 4URUR 2OBMA 3QOFA 2ZRBA 4FMDB 5DH9A 3U6BA 1K6MA 1FP7A 1IJFA 2QG6A 2QMOA 3TE6A 4AC9A 5EXPA 1HEIA 2KBEA 1OFTA 5FL7D 2HEIA 5DYIA 2BJVA 1AGPA 3UPUA 1N5IA 1FUUA 2ORVA 2G6BA 4ACAA 1CS4C 2C03A 1Q1EA 3R8CA 2QBYB 3U4QB 4RCZA 4JL8A 4URZR 5FUXA 4XVRA 1Z6AA 3WYAA 1IXSB 2REBA 1ZC4A 1Z28A 1NMXA 4DEXA 1N6LA 3LVRE 4ESHA 1XXHB 1G6OA 2QI9C 3TAUA 1NSFA 1DAFA 2ZRCA 3B1XA 1XMJA 1WCV1 4KLNA 3T15A 1YQTA 3TBKA 1ZC3A 2IYVA 3WMGA 4UQOA 1JBKA 3BORA 4MYUA 4RZUA 4NCNA 1AK2A 1CKEA 3FDIA 3BGWA 3TLXA 3CKLA 2XEXA 3SZRA 2DFTA 3AVOA 2ZR0A 2GBLC 2KI5A 1RVDA 1GP2A 1E9SA 1MABB 2HDNB 3IUYA 1KSHA 2ZITA 2OFOA 5K8IA 2OCBA 3SYKA 4X8HA 2WWGA 1SVKA 1UBEA 5H1YA 2BDTA 4QHSA 3SYLA 4IVQA 4ZDWA 4B76A 4KFTA 4QGAA 3ZVMA 2WOJA 5LPNA 1HQCA 2FZ4A 3DKVA 2CE2X 3VMFA 1AZSC 4XOIA 4PZLA 821PA 2ANBA 2QMHA 4AKGA 3N2EA 4JJZA 3B85A 4HZUB 3A1VA 1U0LA 2N1BA 4XJXA 3RWOA 4BFWA 4C7OB 2XX3A 3VU9A 4KYUA 3SYNA 2XZOA 1KJZA 3K0EA 4DCUA 4YMSA 4WA7A 3TSZA 2O8BB 1KAOA 1SVLA 3MCAA 4KJZA 1COWD 4LSGA 4JLJA 3RLFA 1E2HA 1VHLA 4NMMA 2GK7A 1AN0A 1KMHA 4C4PA 1KI7A 1UJ2A 2Q0HA 2C96A 3VR6A 2WV9A 1KDOA 2RGNA 5CIWA 5KSPA 1JXOA 1HYQA 1NBMA 3H0KA 3K9HA 4U00A 2ERXA 1YR7A 1GSIA 1KDTA 3OFND 1TQ4A 4CYMA 5EZ6B 2QT1A 4FMBB 4F4IA 2B7BA 3L8ZA 1G5RA 3UXMA 3MMPA 2FOLA 3GJ5A 1DO2A 5DLQC 1GIAA 2DFNA 3I3SR 2ZJ2A 2X19A 3BAFA 4ABYA 3FMPB 3AKDA 1W0KD 4DUGD 4TYWA 2OCAA 1OXUA 1SXJE 2CVHA 2J7KA 1NY5A 4HSEA 4O2RA 5AUPB 1P61B 4B3GA 5D3QA 3H84A 3PVSA 3T06B 3I1FA 3KX2A 5EP1A 1UF9A 1AJEA 4PC6A 2C95A 5JBQA 3FVQA 3QXJA 5GJVC 3ADKA 2VL7A 4QJ5A 3ZQ6A 1F5NA 5IHPA 4MRNA 2EFCB 2XNDA 3R20A 4EDHA 4DLWA 2CHQA 1FFHA 5K8TA 3QKTA 4L9SA 2H18A 3X1YA 1NLYA 2O8EA 3T35A 1P7CA 2IYYA 3KJGA 4URVR 4AD8A 3VR1A 1R0WA 4RZXA 2Q9CA 3QI2A 2NG1A 2VP2A 5A0FA 4Q03A 3MUFA 4MUBA 4M1MA 3OZXA 1I2MA 1XCGB 3WNDA 2IS6A 5DISB 3W6PA 2A3RA 1PUJA 1GFIA 1II9A 4CEHB 4P4UA 1Z5ZA 4B44A 1NN5A 3LV8A 3RAPR 1EXMA 2ZRDA 2C77A 2O52A 4UXHA 3R8FA 2ZE8A 1U90A 5JZVA 1QHGA 1GITA 1GM5A 3T1QA 4IOLA 4OQXA 1OXTA 4BASA 3U2QA 5JMTA 2CLSA 1PLJA 2DFLA 4KAXA 3B78A 2ASEA 4LX0A 2VSFA 4AYWA 5F9HA 3EA0A 1MOZA 3F0TA 2R65A 2XXAA 5DIFA 4US1R 3H1TA 5AJXA 5A5GA 2A78A 3S1AB 3QEJA 2IBMA 1UEJA 2RMKA 3A1UA 4G01B 4RZ3A 1QHSA 4W7SA 3BJIC 2DWQA 4KVGA 3IKJA 4MRSA 2KWIA 3KXKA 2O0JA 4JIMA 1NJFA 3B1WA 1MO6A 4LBWA 1AM4D 3MJHA 1KI1A 2ZRNA 4UNQA 2PBRA 1E3MA 2RKOA 1GRRA 1R5OA 2C2HA 5L8VA 3TAHA 4DXAA 4KYIB 4F4JA 4HI0E 2F1JA 3NXSA 1OT3A 1FP6A 3IQWA 4F93B 1NVVR 2PZFA 1CXZA 2D3WA 2AD5A 5SZJA 1H65A 4XWKA 4RFSA 5L3RA 5KDDA 2ZRIA 1XEWY 3PITA 4QBIA 2EQBA 2ZRKA 5LB2A 1CR2A 3VX3A 3ADCA 3CRVA 1S9HA 4B3BA 3RVBA 2WOOA 2A9KA 2YWGA 4DIDA 4JMPA 1Q1ZA 2OE2A 2OCPA 1XJCA 3B9QA 3EARA 4A82A 1BOFA 4A1FA 1XD2B 2F9MA 1UBCA 3SQXA 1VDZA 2IT1A 2F43A 3QJYA 3B1YA 4C0LA 2OESA 3SBDA 2B6HA 3K9NA 1OH6A 1GG2A 2CJWA 3C5HA 3UATA 3LXRA 2BWJA 3B1VA 3LAWA 5KDOA 1R8SA 1Z6YA 2FN4A 2ZRJA 2OXCA 4E22A 2NPFA 3GLGA 1N6NA 2FU5C 4II7A 4OK3A 5FR1A 3Q85A 3UG6A 1W4RA 2JCSA 2FEOA 1O87A 4MRRA 4M21A 4D82A 2P5TB 4KBGA 3I62A 5L3QB 1XMSA 3K0CA 4D4LA 2P2LA 4URXR 3EWAA 1ELOA 4LI0A 2DBYA 5FI0B 3VQTA 1E4VA 5KSZA 2FF7A 5DHAA 5CM8B 3CX8A 3GP8A 4EPTA 4B6EA 1SVIA 1E2KA 2AWOA 2D4HA 3GFOA 4LCBA 4C0AC 1CRQA 3NH6A 1Z0KA 2W2VA 2IS1A 2H92A 3WNCA 5GJBA 3GEEA 2J45A 3NBFA 1Q3HA 4ZO4A 1GNRA 2UZ3A 2XITA 2JASA 4GT1A 4BZPA 3ZQJA 1XP8A 1M34E 4B48A 5DYGA 3U3OA 4D0GA 3DOEA 1N5LA 2IEZA 2QU8A 3NC1C 3SN6A 1FW6A 2AHOA 3DO6A 4BWYA 4P4SA 3NVAA 1W36B 2CLCX 1MO5A 2IF2A 1W2GA 2WICA 4DB2A 1MV5A 1E69A 1NI3A 3ZZ0A 3EWSA 5HR5A 1VIAA 4TZ6A 5SZKB 3EA5A 4D25A 4PHHA 2ZUBA 4EIWA 2BJWA 1Z06A 1WP9A 3TUZC 4JSTA 3ADDA 3SHWA 2WHXA 1Z07A 3FMFA 3QQ5A 4ON9A 2ZJ5A 5DE3A 4A0GA 2JLXA 1TEXA 2NO1A 3C41J 3TVTA 3UWKA 4O25A 1L2TA 1MRNA 3F8TA 4KO8A 2O0KA 2WSSA 2OBNA 4PO9A 2CBZA 3QNUA 3WBKA 5EE0A 5FFMA 4Q7LA 4FWTA 3CBQA 1YZQA 2H57A 1X1SA 2GJAA 2ZREA 3GJ3A 4DT1B 5FBLB 2OXRA 4BFYA 2R2AA 1S3GA 4TYQA 3ZD6A 2YWEA 2FGJA 3W6OA 4CDGA 1ZINA 1KY2A 1ZIOA 1KI4A 3EAQA 3ZVRA 3FE2A 1KK1A 4DLYA 2YHSA 2PT7A 3GLIA 5J4LA 5F2EA 1IY1A 3SQWA 1KHTA 1H8HD 1XX6A 4PQRA 3QENA 1E79D 1KI9A 1EX7A 4DLXA 5C1BA 4MGYR 1G3IA 1R5NA 4Z1MA 1XNJA 2ANCA 2J0VA 3X1ZA 1S1CA 4F4CA 1ANKA 4ARZA 2HF9A 2ZSAA 1HE1C 1Q1QA 2QAGB 3C7KA 3EPLA 4WOPA 1CR0A 5JFGA 1G17A 1W1WA 4DRZA 1OIWA 1TADA 3K0AA 4KU4A 1UPTA 3FKSA 2D2EA 3IBYA 4TSFD 4TYPA 1JJVA 4Q4LA 3IO3A 1Y3AA 4L9WA 1KIMA 3KKNA 1Z6TA 3RSOA 2W6JD 5TVKA 2LKDA 1A2KC 121PA 1N5KA 2OFXA 2C9OA 5KSOA 3R9WA 4QBGB 2OO7A 3I4LA 1SXJB 1ZMXA 2QZ4A 3BB3A 4KVAA 3KQNA 5LD2C 4M8NE 3RC3A 1PV4A 1OYYA 2IYLD 5KNCA 5FL3A 4WXPA 1XPOA 4Q19A 2RGGA 2O8FB 1GWNA 1OPXA 1FX0A 1W49A 3G82C 1D2MA 4M1KA 1SVSA 1XXHE 4WZBE 5KPDA 4V03A 5BXQC 2JLUA 1T3LA 3BOSA 1WA5A 2GF9A 1J2JA 2MMCA 1G18A 4TMZA 3PUYA 4TLAA 5E7MA 4YXWA 5JI2E 5AWFC 5FOXA 1VECA 4OQLA 4BQSA 4MKFA 4C0KA 5L3SA 1IN7A 5HKKA 2IYUA 4PHFA 4BLPA 2IL1A 1KSFX 3PV0A 4FMCF 4RD1A 3LDAA 3V00A 1VCMA 3TKLA 4EQ6A 4ZIRB 2BBWA 4LHYA 2D06A 3B7GA 3THYA 3SU8A 1KO5A 2JLVA 2YKGA 3K53A 1YZGA 5JJIA 2OV2A 3CF2A 2H17A 4HDCA 3TW8B 4QJ3A 2C78A 4YMVA 2IK8A 1TL7C 1ZRHA 3LA6A 2XTZA 2BMFA 3M4YA 4P3YA 4IEIA 3GLFA 3LX5A 2CXXA 3SHFA 2F9LA 2GBLA 2BBTA 5C2JB 1US8B 2LCFA 2F1IA 4DSNA 4F92B 1IONA 2YV5A 3BXZA 2QQEA 3VR5A 2ZXUA 3IPXA 1T9HA 3T34A 4D81A 1G291 1TF5A 3TUIC 4MA4A 4AG5A 1GZSA 1LY1A 3DHWC 1JR3D 4PFSA 4D80A 2QPOA 1Q3TA 4F38A 3ZS9A 4O2LA 4F7WA 3RDPA 3D8BA 4A2PA 1XTRA 2ZEJA 5DN6A 3SFZA 1W4BA 1JAHA 1YE8A 1QVRA 1G41A 4CEJA 1N25A 4UNPA 1KO7A 4G3XA 2FG5A 3OE7A 3NC0C 4ASUD 3OEED 2Q9BA 4CF7A 4TQ9A 1SZPA 1UEIA 2RB4A 3FHCB 3QF4B 1N5JA 4LWZA 5JHGB 3OAAD 4OBEA 2F1HA 1D8TA 4R7ZA 5JCZA 2ZI4A 2CK3A 2ZJZA 2ZRHA 3GEIA 2GJSA 2GJ8A 1I2DA 1UKEA 2G3YA 2MSDB 3EX7C 1HT1E 5G41A 1E1QA 5B30A 2RGBA 3GJ8A 1FQJA 3QKRB 3HP1A 4NHOA 3KDSE 2XZPA 3CWQA 3QXHA 4L4UA 4XH9B 1H8EA 3AEZA 2DYKA 3LNCA 4GP6A 4DDUA 3HU2A 3LO5A 3K0CC 4DCNA 2WJIA 4OJKA 1LF0A 2P6RA 1E0JA 4JLNA 4RVCA 4XTCS 1OV4A 2BKEA 4TTQA 3QY0A 4NTZA 3VHXA 1LFDB 4AI6A 1JXMA 2BBOA 3QXCA 1FMJA 1DADA 1ZNYA 1T91A 3O8CA 1XDBA 4BRWA 3V4RA 4PC2A 4DLRA 3CF6R 5JRJA 4TL9A 4V0LA 5FL7A 3RS0A 2VP0A 3VHLB 1JI0A 4PO1A 1JAIA 3FB4A 3KTAB 4MGZR 5SZHB 1X8KA 1NIJA 3THWB 1E4YA 4MGIR 2QNRA 2BMJA 3DMDA 3NBXX 1GILA 4A8JC 2X8AA 4QHTA 1AS0A 5JS7A 3REGA 2HCJB 4Y0AA 3EPJA 1R0YA 3W90A 3HU1A 3DZ8A 4BZXA 4TLBA 2OFWA 3IEUA 3I8XA 3QXXA 4JJKA 1PLKA 2ATVA 2GCPA 1XZQA 2J3EA 3E2IA 3VNUA 1XCPA 3B82A 1KDRA 4LJ6A 5JECA 2P3SA 2ZSFA 3O8BA 4I99A 3K8YA 1FNMA 2IYZA 2IUTA 1NL3A 1S8FA 3SDZA 2N46A 3HR8A 2ZE7A 2ZAMA 1KZGB 4DZZA 2IF0A 4FMCB 2ZVPX 1RW4A 3THXA 5AUQA 1E2NA 3W9YA 4DBLC 1CRPA 1DEKA 1G1MA 2I1QA 3BFVA 3E5HA 2B8WA 5ANRB 3QKSA 4YC7A 1NBME 4LJYA 4R2IA 4HUQB 5ELXA 4BZQA 5CDFA 3RRNA 2C8VA 1OHHD 5KNDA 3LH5A 1BYUA 3W5JA 1CTQA 1EFHA 1Z3IX 2I3BA 2ZI5A 5DHFA 3CZQA 1N0UA 2JDID 2HLDD 1BIFA 4GRAA 1AQUA 1COWA 1P5ZB 2W0MA 3CNNA 1G7TA 4Q9IA 4B75A 1IXZA 4LHVA 3AM1A 2QPAA 3LRPA 4L5BA 1QHXA 3IO5A 4M1YA 4KLZA 1DS6A 1ZM2A 3FHOA 4GNKA 4H9GA 3RNLA 2YWFA 1OXXK 3H2YA 1EGAA 2REXB 3OFNA 2YZ2A 3LVQE 1BS1A 1JB1A 1E32A 2MSCB 4HZIA 3VFDA 1KNXA 2NGRA 3MG9A 2EWVA 1U8YA 4P4TA 4C0BA 5LDDC 2RAPA 3G0HA 3R9IA 2A7QA 4AURA 1W0KA 2PX3A 4DUGA 4FINA 1G8HA 3RS7A 4TLDA 4UNNA 2WIAA 4X8MA 2QA5A 2R6CA 1Q21A 1Q1BA 3A1SA 2PT5A 2G83A 4Q1EA 4RCYA 2EVWX 2H1LA 4DDTA 4ZDIA 2KSQA 3NIBA 1OW3B 2IS2A 3KFVA 2AD1A 4LBZA 1GTVA 2Q3MA 3VAAA 3GFTA 1YR6A 4OQFA 2AKYA 2BV3A 2JLZA 2ZETA 4EJSC 3RYTC 3TK1A 4LJ4A 2IYWA 1XJ0A 1VTKA 3DEFA 1P9NA 3WNBA 1LF5A 1NSTA 2PLRA 2VSOA 5J4YA 2PLFA 4Q01A 3L0OA 4LV5B 4JVNA 5DI3B 1T6NA 3L43A 1RJ9A 3UKDA 1ZNXA 3AGQA 5E3HA 1F2TA 5JS8A 1XPUA 4H1VA 4AK9A 1VYVA 3GCGA 1ZD8A 2JEOA 3U7FB 1W0JD 4IDQA 4A6PA 1G7RA 2A5YB 2WJJA 3THOA 3WBJA 1DTSA 1E6CA 3WHLA 1RE0A 1E2LA 5AJWA 2VP5A 4TQAA 2QRZA 4D4KA 2RCNA 1IOZA 1T3SA 2J9RA 3DM5A 3KKQA 4OQMA 1TU4A 2ZYTX 4RD2A 4IVRA 3SOPA 1ZYUA 2C5LA 3ONWA 2G88A 4R2HA 4XD7D 1MO3A 1F3OA 1NG1A 4A4DA 4Q00A 1ZVQA 4MDEA 5JJLA 5HE9A 4PPGA 1OJLA 3T5DA 2FSHA 4FCWA 1PVOA 1DOAA 1ZW6A 1RZ3A 3CW2A 2J59A 1JQJC 3C4JA 2ZYVX 5FBRB 4JT2A 1S0UA 1QHYA 5AUNB 4MYHA 1RC8A 1UKZA 4CEIA 4FW9A 5B57C 1E2DA 2XB2A 1XRJA 2NIPA 1N0VC 2CNWD 1U99A 1GOTA 1HH4A 3E70C 3VNVA 2JIZD 3EZ7A 3PUVA 4BFZA 1RIFA 1AQYA 4C2TA 2A30A 2GCOA 2Q6TA 5AUOB 4YONB 2AFIE 4N1AA 2RHDA 3ZD7A 1II8A 4LC0A 5KTYA 5CITA 4NYJQ 1NVWQ 1YHNA 4XVUA 3CUEF 4TTPA 3GLGE 3EIQA 4R98A 5KO2A 3K0FB 4C9BA 2Q3FA 3AVYA 4JBXA 2WWHA 3AVVA 3L82B 1NLZA 1G5PA 4B3FX 4A2WA 4Q1BA 2FSGA 2R6DA 4ZDKA 2CHVA 3KJEA 5JEDA 2FX3A 1E9AA 2A5JA 1T5IA 5EE5B 2IYRA 1X86B 5K8LA 1Q22A 3CRQA 1YZTA 4BFUA 4KI0A 5FTKA 1XEXA 4NCKA 3WMEA 1FNNA 1W4CA 1G4UR 2WKPA 2WJYA 4JVSB 4NH0A 4OKSA 2G77B 1DAEA 4TMVA 4HLCA 2EFHB 5BYKA 1QZXA 3B2EA 3P32A 2ZS9A 3A37A 1VMAA 3D31A 1S4QA 2QN6A 3ASZA 1XEFA 1M6NA 4L15A 1CP2A 1Q20A 1QVAA 1GRNA 3SNHA 3ZS8A 1WE2A 4HAYA 4UNRA 5GJWC 3UANA 1LS1A 1E9CA 4QJ4A 3FOZA 3O47A 3EIHA 2BM1A 2IS4A 3RS4A 3IEVA 1F2UA 3PIRA 3HU3A 4I1UA 3JVVA 1M7BA 4U02A 1TQ2A 2XSZD 5BN5A 5GADl 1S9DA 3GLHA 4AKEA 3GD7A 4B2IA 2JAQA 4QGGA 4X8OA 1WQ1R 3R7WA 2PMKA 1E0SA 1XB2A 3HJNA 3MWLA 3RS2A 1WDTA 3CRMA 3BWDD 2WWYA 1QHHA 1WRBA 2JLWA 5HPYB 3QVUA 3SJAA 2P5SA 4LGMA 4XWAA 1EX6A 3I32A 2B8TA 1CF4A 3N5CA 3Q8XB 3QG5A 3QUSA 2QL6A 4Q4JA 4RJLA 1DAKA 1ESNA 4DHEA 3OIUA 3LBHA 1TUEA 4QL3A 5EXXA 1XTSA 1SVMA 1SKQA 5TXGA 3RABA 1MKYA 2CCKA 4F91B 4LJ9A 4NYMQ 4WVFA 2WTUA 2VRWA 5EXTA 5TDHA 1IAQA 3MRSA 1E9FA 3VU9B 3K09C 2IXFA 3GLIE 5EJEA 1W47A 1ZCBA 1ZD1A 3B8HA 5EUQB 3TQCA 4Q1AA 1ZCAA 3LWNA 2NO6A 4B3DA 5GJCA 2MMGA 3AVTA 2Z6VA 3LFUA 1QDEA 2V7QD 3KQKA 4A2QA 1E0AA 1KMHB 3A1WA 2FFAA 3L0IB 4QM6A 2OBLA 2AL7A 3ND8A 4HB4A 2HT6A 4NONA 2IWRA 2P6NA 1UAAA 1XTQA 1GKUB 1YZNA 2IHBA 3W8NA 2Z4RA 1E2QA 2ZE6A 1W5TA 4B34A 1VG9B 1IY2A 1KAGA 4GL2A 1ZUIA 4US0R 4P0TA 1H8HA 1EWQA 1E79A 3SS8A 2FZLA 1KDPA 3C14C 4M1OA 2PJZA 4G5RA 4POAA 3PQCA 5IK2D 1Z0AA 1CJTC 2JLRA 2BIFA 1LVGA 4V0NA 4DCSA 2FH5B 5AJYA 2CL6X 2C98A 3I8SA 4G1UC 1VIYA 2ZVQX 3WYGA 3BFXA 4UXJA 4LYHA 3K70B 1N3BA 4EPWA 4BFTA 4QNMA 3SFVA 2VLIA 1FTSA 1BKDR 2ZYWX 4JVMA 4IEEA 4LJ7A 4Q7KA 4TSFA 4B73A 2QUZA 4PZYA 2GXSA 2ZR9A 2VP4A 1A5TA 4AKHA 2W6JA 1S2MA 4TTRA 1KSGA 3LD9A 3PFIA 5B64A 4GMXA 2ZRLA 4LYAA 2O8EB 3QE0A 4PAMA 1T0JB 1IY0A 2E87A 1HTWA 1R10A 1JPNA 2X2FA 1DAIA 1Q57A 1VYTA 4CGZA 1OF1A 1KKMA 1G7SA 3GJ4A 2YWHA 5GVSA 4O3MA 2V55B 1NKTA 3EZFA 3ZDQA 3CRRA 3HPRA 1A2BA 1T3HA 4KFRA 3FHTA 2BCGY 1ZM7A 4W9MC 3U3MA 5J4HA 1NMYA 3P27A 4QRHA 3KQHA 4M1SA 3QSYA 4HEJA 4Q4HA 4UNSA 4DLVA 3GLFE 3IILA 3KJHA 1U8ZA 3KB1A 4A36A 3GQBA 4QKQA 4A8JA 3MJRA 1YRAA 2G0TA 3CRW1 3P4XA 2FFBA 4ZDJA 4W5HA 1Z2AA 1P3JA 1P6XA 2WJHA 1R8QA 2P0EA 1T4GA 4JYCA 4JT4A 1OB5A 2PEZA 3A4MA 4PQYA 3SE0A 1OFUX 2LWIA 2GJKA 2J0UA 2VSXA 2KB0A 4QNRA 1II0A 1HURA 3FGNA 4QGFA 1YR8A 4KODA 3ZVNA 2XXAB 1HUQA 2JATA 1W36D 1W4AA 3QVVA 2X77A 1GAJA 2PMDA 3EC1A 4HAVA 3QEOA 3U44A 3U7HB 2LKCA 2AFHE 1UBFA 4AWXA 2XTNA 2GRJA 1ODFA 4GP7A 4C3ZA 2OAP1 1DO0A 1JR3A 5H70A 4OHYA 1XCMA 4DJTA 2PH1A 1ZM4A 1TQDA 1AZTA 3U3JA 1OH7A 2WMNB 3U60B 5FOWA 1ONBA 3BIFA 4RFSB 2F55A 1Q0UA 4MDFA 4HAUA 1IN8A 3P26A 3X1XA 3JZAA 4RD0A 5FBWB 4NCIA 1CIPA 2CL0X 4MYTA 1NG9A 1EFRD 3C8UA 4ASUA 4G5GA 1TMKA 2H8KA 3A58B 3KKMA 3OEEA 4DEYA 2QGZA 4RD6A 2FSIA 4GOJA 4TT3D 1NJGA 2QRNA 4PQFA 5FPSA 4DSOA 4DKXA 3OAAA 4JSYA 1X8LA 4FIDA 4GZMA 3EPHA 3U3KA 2WBLC 2HCBA 2NZJA 3CZPA 3LLMA 3AP3A 4PSKA 2NOAA 5EUMA 2IEYA 2F43B 2YC2C 1DVRA 1F6BA 1W46A 4OHXA 3NDPA 4LRWA 5FUVA 2ZIAA 5D3MA 2CJWB 5FTLA 1UKYA 1FL9A 2R9VA 3GLGB 4PHGA 1Z0FA 1G21E 1VCOA 4LC1A 2XJ9A 1KI2A 2F3RA 3MAAC 2J0QA 3TMKA 1E0KA 4IDHA 3VKWA 4B33A 2ORWA 1KOFA 1RRCA 3AVWA 2O8DA 2VBCA 5EP3A 3O8DA 1K8RA 2J7PD 2RGDA 3K9GA 4Q4AA 4E03A 2FSFA 4LV6A 4JL6A 2QMUA 4LUCA 5DSZA 3K0SA 2BKUA 1SHKA 1U81A 1RRGA 4DCTA 4PC3A 4TYYA 4QHYA 1MT0A 2R44A 2AK2A 3TQFA 4NU0A 1J99A 1SXJD 2J5XA 4EFNA 2NQ2C 1JECA 4IRUB 4C0JA 4EJSA 1RRPA 2QP4A 4Q47A 1G19A 1LB1B 2ODNA 3QF7A 2WPDD 4QM7A 1YZKA 3AVPA 4IDPA 1XWIA 3CPJB 5KPJA 4A8JB 4PXAA 4DSUA 2GZDA 2DWOA 3G5UA 2JA1A 4P4SB 5FUWA 4DDVA 2BMEA 1JJ7A 3RRZA 1HA3A 1D5CA 1UKVY 3EASA 3ASYA 4IDNA 3X2SA 1ZUHA 4LPSA 5J4KA 3AKCA 5CJPA 1UADA 1JNYA 1G3MA 4HATA 3W6NA 1TEVA 1CJUC 4KHZA 4NL4H 4Q02A 4V0MA 4E5UA 4HDOB 1IBRA 1GL9B 1TX4B 1KI6A 1P62B 2ZAOA 4HLUA 2IXGA 1BMFD 1SKYE 2EW1A 4ILEA 2GHIA 4BLSA 3AKYA 4FN5A 5FH9A 2PEYA 2I1VB 3K9LA 4KSCA 1E2GA 1P4SA 4XSHA 3NDBB 3BB1A 4V0KA 4YMTA 1G3RA 1CBUA 4RD3A 5FPHA 5GVRA 2ZSBA 2G9NA 1ZBDA 4L16A 1AKEA 2BOVA 4LBYA 4CT5A 3NG1A 4FCTA 4A9AA 2ZROA 4Q1CA 1E96A 4JLAA 1OHHA 2CDNA 1EFTA 5CJ2A 3NEYA 2HT1A 3BBPA 5J5CA 5KUTA 2X2EA 2JDIA 2GZHA 2HLDA 1QF9A 3GLIB 4FCVA 1R0ZA 4J0QA 3C15C 1B0UA 2ZRFA 3TJZA 4QOSA 3ZZTA 5BN3A 4CVNA 5EQTA 2AR7A 3VX4A 1IXRC 4ARZB 4PANA 4QFMA 5JSZA 4M9ZA 1TPZA 2VF7A 3GJ6A 4GZLA 2R6FA 5E95A 1YZLA 3TIFA 1DG3A 1E1RD 2D7DA 2WKRA 4Q48A 2FPLA 1P73A 1ZAKA 3CF0A 3K0AB 2JJ8A 3M1IA 3MWYW 4RD4A 4LV8B 2ZI6A 4WZAE 4YDSA 5TV2A 5IRCD 3JZMA 1XTIA 1Z0DA 2OT3B 1CR1A 3C5CA 4HAWA 4JKIA 1X6VA 2QAGC 1GL7A 1LS6A 1ZNWA 5F9FA 4D4JA 3TW4A 4URYR 1EESA 5HCIA 3P1JA 2D74A 1G5TA 4ZCLA 1FOEB 1EWRA 1R0XA 1TNDA 2ATXA 2WVJA 3T1OA 3IHWA 3RHFA 4IKEA 1KYIA 1IN6A 3QPVA 4LJAA 5BYJA 3NEJA 2VPPA 1Z29A 1FX0B 1NMZA 3PEYA 4ZCIA 2O8CA 2V9PA 1ESMA 2WSMA 2ODWA 4AYTA 2R62A 4EKDA 4WBSA 2GXUA 2YVUA 2BMDA 1D6JA 1UBGA 3DDCA 3LY5A 4N3NA 2ZS8A 5E4FA 4CT4B 1JQLB 1QG2A 3OIYA 4IHQA 2BVNA 3TSOA 4IDOA 2BEKA 3PEUA 4BEJA 2WWWA 5CYOA 3DKPA 3LBIA 2J0SA 3AF3A 2BHRA 4Q66C 5B2ZA 5L3SB 3PJRA 1OIXA 1R4AA 4FD2A 2VP9A 4B2LA 3CNLA 2PJRA 2QE7D 1C4OA 4PAQA 2IA5A 4N0DA 4EQ6B 1G3UA 3CX6A 2ZANA 2XZLA 3THYB 1KK2A 3IIMA 3QBVA 3A8TA 2X1VA 4JS0A 1KO4A 1W0JA 3AB3A 5TMPA 1T8TA 2YJTD 5TARA 4D6PA 2QBYA 3MSXA 2TMKA 3U4QA 2QGNA 3GEHA 4D4MA 1ZD9A 1X3SA 4IVPA 3GLFB 2NO0A 1P2UA 1TF2A 3T1TA 1PJRA 3QIAA 2EFEB 4U7DA 1T8UA 3FMOB 4HB3A 2NO9A 4QBHA 1RPZA 4YLGA 1XXHA 1Z6XA 3CM0A 2PCJA 2QTVB 4JLKA 4B35A 4XD7A 2I4IA 2G0NA
chains in the Genus database with same CATH superfamily
3AG5A 3MEQA 3GI1A 2VF5X 1G8PA 1SHZA 2ARKA 4IP0A 1Z2DA 5G3ZA 3GFVA 4JL5A 3HCBA 3BVPA 4DIKA 1CF2O 5CDYA 2WMOB 1G8YA 1KC3A 1MGPA 1Z2CA 4QRDA 2HWXA 4BTVA 1MO4A 2WKWA 3ZZNA 1UZAA 5KOHB 3ETLA 1QFSA 1WSWA 1FXWF 1LSSA 1SVNA 2HXSA 2PX0A 3R75A 2FWPA 4BQPA 1LW7A 1XU4A 3D5QA 2P3LA 5HIAA 1MQSA 3HJFA 2ACEA 1U7UA 4N76A 1IN5A 4HF7A 3EG9A 1MEEA 2X0NA 4HN9A 1SNYA 2AKAB 4YNBA 3ZY2A 3CWZA 5IJZA 3TLGB 4YREA 4KFUA 4EKEA 3ZX5A 4JJ6A 1V2GA 2X2OA 3SZUA 2W90A 3PT5A 3R7FA 1GYQA 1F8FA 1W2HA 2G63A 3IQDB 2Z3ZA 2PZ8A 4HLDA 4AG3A 3AR6A 3H6GA 4F96A 2XMRA 5FOSA 3QU9A 4JB8A 2I2FA 2Q46A 3ZIUA 4KH1A 4JT9A 4OK6A 3IMFA 4YJ3F 5DNDA 1BA2A 4RORA 4JI4B 2JLSA 5C1OA 3ZIDA 1BXKA 2X9LA 1KVQA 4JLDA 4KFSA 3KWFA 1I01A 3LIPA 5B2FA 3OVMA 3WMFA 2QJFA 2I76A 2NUTA 1HDRA 3O4FA 4TRRA 1YKSA 3HYTA 4LW8A 1G66A 5IJWA 4ND3A 2FZKA 2A88A 2PWPA 4KLAA 3Q2KA 1X74A 5CYFA 4DXDA 5C8ZA 2ZT5A 4PSUA 2NP7A 2P91A 3OEHD 5E2IA 1E2FA 4XIYA 1DXHA 3ZZUA 3D6VA 3VHXB 3RYCB 3K1ZA 3W5UA 4RKQA 1YVUA 3UV3A 3ZE8A 2DFVA 4RH0A 5C35A 7YASA 4TZ0A 1FFBA 1M2WA 4MI9A 2QTHA 2VHEA 2ZYIA 3RT1A 1EQUA 1TF7A 4RZ2A 4KCGA 4WINA 4LWOA 3MD0A 3ZHSA 1UFQA 3LW8A 1O08A 4A5SA 1RAIA 2CDAA 4M49A 4OSPA 3VMMA 3WNZA 5JDCA 2R79A 2QRUA 2HA6A 2K87A 4Q7MB 3PE3A 3U0BA 1PJ8A 3AUUA 2J0EA 2OAGA 5T5QA 1M83A 4MVXA 2PPLA 1Y48E 1OXKB 2K5UA 1Y4DE 2ALJA 3F5DA 3CG0A 3FI0A 3FPLA 4GDFA 4FVTA 3TZEA 3F7OA 1L5MA 4FYXA 2Q5QA 3DPUA 2XD9A 3HDTA 4GWKA 4OHVA 3RRMA 3WJAA 1WZ2A 3SC2B 3H2JA 1HV8A 4R9UC 4REMA 5CURA 1U8AA 3U39A 4OPMA 4DA8A 1ICEA 2TMYA 3CRZA 2W2PA 4UCWA 2ZLBA 3OQBA 3ODGA 5TQ0A 2NZ2A 3H3FA 1O89A 2FR0A 4NNJA 5GV7A 5DI9A 3RYFB 3UMBA 1NR5A 1PV2A 3AJEA 4JFAA 3UHPA 4KMSA 5E9WA 3MFQA 4YQYA 3F47A 5FUMA 2J32A 1FFDA 3FFAA 1P4AA 2XIQA 4QDXA 1UBNA 3UCEA 3W8DA 2PYZA 2I6FA 2IEIA 3HRIA 3Q0EA 4L74A 2WUDA 4M36A 4QTXA 5CW2A 5L6LB 1WBBA 4IIJF 1DX4A 3EXEB 4DWOA 4E14A 5JADA 3OIVA 2BC9A 4LE0A 1KL7A 1OX4A 1H2ZA 2GN1A 4WV3A 2GH1A 5TY0A 1NIPA 5A2GA 3QKSB 4KGVA 5BMVB 4LKRA 3U3RA 1T5LA 3FX2A 4HFMA 3T5MA 3KNZA 2BZ1A 2E4ZA 2WAYA 1DHRA 1R5BA 4A0RA 4Y6PA 4N3BA 1TUIA 4Q9KA 4EW6A 4U2EA 2DHRA 1DT5A 5HG0A 3TTWA 3CB4A 2AGVA 3B48A 4F71A 2C3OA 4FYIA 3L01A 2WUFA 4I1OA 1ETUA 2V7UA 5J5AA 3LCRA 1SC6A 3WYFA 4BO9A 1DQRA 1NVVQ 1LV8A 2PSJA 2QVLA 2ZS7A 4NBTA 2B1QA 4JIGA 1DQSA 3JAWB 1GKYA 1T34A 1F17A 2ZR7A 3LYLA 1X38A 6GPBA 3L7CA 2F17A 3RVDA 2N0SA 4C03A 4EPYA 3IB6A 2ACKA 1U1FA 1XJWA 4OQDA 1ZH8A 1AQ6A 2FEKA 1AUXA 3LF1A 1LX6A 3FFBA 4PGMA 2CF6A 4WLOA 2UUPA 1JEEA 1XDWA 2QP3A 5J2UA 3AR4A 1G16A 4WOCA 1D9XA 2XXJA 3NW9A 4Y2VA 2JARA 1NRJB 1SWVA 4MPDA 4UCFA 3GBPA 1GVNB 3I04M 3U1BA 1ATIA 3N70A 3VPBA 2YL2A 3IAM1 3IGFA 1KWGA 1AE1A 4W1QA 1J4AA 1JMYA 3I9KA 1CERA 1V1MB 1SK8A 5PNTA 2W0SA 3QVWA 5I8WA 1L1RA 1QH0A 1H6BA 4KUHA 4YRTA 5E1DA 3LQ4A 1X2EA 5CVJA 3W5IA 4WIAA 4BO3A 5I5GA 5CVTA 4C43A 2FV8A 4WAUA 4YJ3B 4DVGA 2HBYA 4G1FA 4FLFA 4FS8A 2KLHA 1UMKA 2ZE5A 3PC7A 1KOGA 2NYRA 4JZYA 4P33A 4PZCA 4QO7A 3GGGA 3BE4A 4CN9A 1RLOA 4RQAA 1GKIA 1VFNA 2J9XB 3V1MA 3LT0A 1UK6A 1BE0A 1BJRE 1KDZA 4BPBA 2GM9A 2R8YA 4YGYA 2PU7A 3GG2A 4CF4A 4G1VA 5ITWA 1FU4A 1SHLA 4OQEA 4KDRA 1U9IC 1P2GA 4R8KA 4JJ4A 5TNXA 1U0HC 5F3DA 1VJ0A 3BQMB 1RBZA 3PDCA 3LPAA 2ZG6A 4KC0A 2Z43A 2I80A 2YINC 4RSGA 3RS5A 4PLZA 4Z9FA 4CKZA 2VT7A 3L40A 1L5VA 1RCUA 4UAJA 3U6KA 4ZXPA 1GTSA 2GVDC 3JQAD 3IJRA 3CX4A 3WRXA 1E8NA 1KP3A 5DWVA 4G0UA 2CMKA 1QRAA 5E6RA 3VKGA 3G8BA 5T6MA 1EK5A 5IKXA 2OGUA 2RONA 3PUZA 4RTKA 3BULA 1OSNA 2BF4A 3B5JA 2Y1DA 1XFAA 3N2LA 4WXRA 4HBGA 3I34X 3L7NA 3ZCVA 1M7HA 4P0PB 3ETGA 3QY9A 4QEKA 2I7VA 2Z09A 4JYBA 4PPNA 4U6NA 1AIPA 4YP9A 2ADOA 4TV9F 2BISA 3A2MA 2J09A 3HO8A 3TRKA 1Z8FA 2C5FA 4DBLE 4RWEA 4J2HA 3UJ9A 1BYIA 1P7YA 1E8MA 1RHKA 4ZHQA 1M8FA 2J3IA 3LRXA 4JBHA 2AN3A 3TRHA 3TECE 1XZHA 2W6OA 1VL1A 3DXYA 4JXZA 1H9CA 1FS4A 3QHPA 3RI3A 1R0BA 4ZAGA 1T4BA 1LTQA 4BP3A 1YF3A 1N6HA 1NQVA 1VCIA 1K88A 4XFDA 1TT7A 3KKKA 4MVWA 1KS2A 1FZTA 3BQ9A 2FMXA 4GE3A 1YJBA 4MI1A 4PGGA 2PSEA 2OGTA 1ZXXA 3FDXA 3JQBA 2ZTSA 3FUWA 5C31A 1J2UA 5LBIA 3D7RA 1KZ7B 2GNOA 2QVGA 2VSYA 1VPLA 4H7HA 5AW4A 3GIDA 4FOPA 1PTJC 3EG5A 3RC1A 2HADA 3H75A 1JHRA 4IIJB 5EQDA 3WQRA 4CG0A 1XD9A 4YY3B 1BXZA 4XUDA 2ZJ4A 2AX4A 5L6MB 4PLYA 1W59A 3IAS1 5JJBA 2GHTA 2HTEA 5KSYA 1O0SA 2IP1A 3GVXA 7ADHA 3BK7A 2GT1A 5IKMA 1NC3A 1RYYA 1ZDMA 3IUPA 1JNXX 1JEYA 2XVYA 3HV0A 4CLOB 3K5IA 1II8B 4ZKDA 4KR9A 1JZQA 2GD0A 4LYJA 3RS3A 2R60A 3BICA 2RHJA 1G2QA 2XE6A 4EVSA 1KXJA 4FYHA 2CCGA 1OH8A 5EPUA 2VEOA 3KQMA 1DKOA 1RYDA 3FKJA 5HQJA 2XNHA 2VOJA 4G86A 5AI9A 3DFUA 2BFBA 3HCAA 3A6PC 1YJ5A 1SCIA 2AOUB 5FI1B 3OZDA 4HZGA 2V5UA 4RHYA 4IYJA 4WASA 5LZ8A 4YJFB 3WB9A 5HW0A 5JQWA 2FQQA 4B9AA 2UV8A 3HZHA 4TWZA 1EMDA 1U2GA 2JLQA 4I8IA 3WJ1A 5C8YF 4NBKA 1J5EB 2DERA 2Q28A 3VHRA 1A95A 2BONA 1VB3A 1WOMA 2H7VA 3L0PA 2B4TO 4K9NA 2AMJA 2G9RA 3ABSB 1L8OA 4M9XA 1BTOA 1RM3A 5JDCC 5D8DA 2D62A 1UDWA 1GPWB 2AV6A 4JC8A 4DJFC 1ZGJA 2QAGA 2ZRGA 1HT2E 2R8XA 1P9WA 3ZDEA 3ED1A 1HR0B 3IT1A 3IIJA 4QPCA 1VRWA 1ZONA 2ORIA 3HNOA 4OX9B 2YVLA 1LV7A 1UBHS 2YOHA 3EVEA 4IBOA 4RF4A 3CO5A 3UAYA 4ZYLA 2NYAA 3NFRA 4AFNA 1AKNA 3NIFB 3ELDA 4HLQB 4PLGA 3BDIA 3WLHA 4WNAB 5NULA 4PN3A 2HJVA 1C80A 1JEOA 1U02A 4E7PA 1Z7GA 2AI2A 3C8ZA 3GFGA 2XNDD 4GI5A 2O1XA 1Q0HA 2X5NA 4QYMA 3NO4A 3VZSA 2WE7A 1LPAB 4I6GA 1KGSA 5J40A 5BN5B 1RFGE 3KQUA 1I4DD 3I6QA 5EE3A 1SBZA 2VRNA 2ZIFA 2VDMB 3E7WA 3MWKA 3GLHB 5DM2A 3V7NA 4BLTA 3SJCA 3CBGA 1QHNA 3KUXA 5I7VA 5IF3A 4LJLA 5FOUA 4PSDA 3GN1A 4GX2A 5K3FA 1RKBA 3X1WA 4QZVA 2ZI3A 3AH8A 4RO0A 3DAFA 2GASA 2W6IA 4FP9A 4DLLA 4OFWA 2I3AA 1IRIA 2C00A 4PAOA 4XIJA 1X1RA 4GR9A 2VPXA 4O4JF 3MAGA 1WULS 1WMEA 2HMAA 4HB2A 1G2OA 1KYZA 2EQAA 4DN6A 2HRDA 3TNLA 2IGTA 4UJ5A 2CHFA 5LMZA 2J87A 1MD9A 3HXPA 3ZHBA 3K71B 1S2NA 1UQUA 2F1RA 1SGWA 1T9ZA 2WDPA 3B70A 3R5HA 5KNCH 1CEEA 4ZWNA 4WCDA 4ZAZA 3R44A 2F8TA 3MILA 1XMPA 3QWHA 4B74A 4D46A 4C7XA 3QPUA 4FT4A 1Z22A 1QDUA 1ILEA 2HN9A 4C78A 2BFFB 3O0DA 2XWBF 4JR0A 3W4IA 4DAOA 4OFZA 3S2UA 2IPOA 4J7XA 3U31A 3ZXUB 3NBKA 3TIGA 4X8LA 4YMUA 3N2KB 4HUJA 1J49A 5I47A 3M4NA 4N41A 3BC1A 1F2DA 4Z86A 3IEIA 1O96B 4LF5B 1WBJB 3ND7A 3NYRA 4TV9B 1Q2UA 1A7UA 2SKCA 4BNYA 4EHFA 2R0QC 5TB5A 3OU2A 1EK2A 1DBQA 1W25A 2XGGA 3MB8A 2UXCB 3AEQA 3P94A 1WU8A 4MUAA 1A7JA 1JTFA 5LP1A 2RGXA 4PLFA 1TM7E 4UOQA 4PYLA 3EQZA 3WFJA 4DQUA 2PWAA 1KARA 2RDMA 3ESQA 1NUQA 2L17A 4UREA 4MCJA 1A2OA 1P2DA 2J6HA 4AJLA 1PJQA 4LY3A 4M8IA 3PXBA 3G23A 2NTJA 1MB4A 2LDXA 1XCLA 4LJKA 5BV7A 2Q3EA 1IN1A 3WL4A 1ZGAA 4NJMA 4BN5A 1FE8A 2VK1A 2ZRAA 3C3BA 2DHCA 2HIHA 5EZQA 1HEYA 3DOOA 4XIGS 5HUQA 3I4FA 1DHTA 5FPKA 5KTPA 3ACCA 3SICE 1P0QA 2DJ5A 2I6GA 4P5DA 1AN9A 3CLHA 3S70A 2BI8A 4BEVA 5DM70 2REQA 1U7WA 4HO1X 4KRGA 1Q15A 1SQ5A 2P67A 3BQNB 4RJJA 4C2UA 3MXOA 1D7AA 2V6IA 1G20E 2XF8A 1XBTA 1EXVA 4JKYA 3O92A 2P2SA 4MQEA 2CCJA 1EFUA 1FVFA 1G8GA 4BLQA 4ESOA 1XP5A 3FTNA 3TQRA 2VCYA 2IHUA 1N7HA 2WAAA 3DONA 4DLTA 5LLDA 1QKIA 4RADA 4R7GA 3D3QA 1NTOA 2QRPA 1ZQ9A 3JZIA 3LHKA 3REFA 2NQ8A 1KJ9A 1R16A 3JQ7B 4OGLA 4L27A 1N6IA 5HBRA 3F4KA 3NWPA 3QKRA 1ZJZA 2DWUA 2JK0A 3WWCA 3Q72A 5THXA 2MSWA 6YASA 4OL9A 2OILA 1VIDA 1Y1QA 2PL3A 5C8YB 2EWWA 1DT3A 3I1IA 4FJ2A 3WRXC 5HNKA 4COKA 3DXXA 1XTKA 3S2SA 2BR3A 3F6YA 4IIHA 3EXHB 2D2FA 4R8MA 3Q8MA 4AIRA 3BWEA 2OAEA 1K66A 1F38A 3GVPA 3S1AA 1SO8A 1B6GA 2QZZA 2NO7A 4U0KA 4UBNA 1XCJA 3TUJC 4ZOBA 3WV4A 3OF5A 3ESRA 4ZHSA 5KYUB 3RUHA 3TBHA 3PHIA 5CDHA 5I3CA 4RTJA 1I7NA 3MTBA 4PSAA 4EOGA 4MP8A 3FFXA 4JGBA 1U6KA 2QE7A 3KZOA 3LQQA 3I9V1 1PKEA 4MI6A 5AI5A 3EVAA 5M04A 1B23P 3D3WA 2XB4A 4HRYA 2CLFB 4J76A 4MUMA 4OB6A 1DKQA 2Q29A 4AF7A 3WGVA 4I14A 3C0KA 3PWZA 1HNXB 3F98A 3UWSA 2QSZA 3NBYC 3WWYA 4ERNA 4B85A 1RWVA 3THWA 2W2KA 3ZR4B 4BUJA 4ZFNA 2XQGA 4NG5A 1U94A 2AC7A 5C9ZA 1W1IA 2QN1A 4I4LA 4TKVA 3B20A 4EY7A 3S28A 4J2TA 4Y9TA 3H86A 4DDWA 1AKYA 1X8JA 3NV9A 4CFZA 1DLIA 4R6XA 4BVKA 3JQBC 2YWBA 4QQNA 5FP0A 4F5ZA 5KYWB 1U5BB 1Z74A 2X9NA 1CEYA 2XAUA 3SSOA 4KNWA 4QUKA 1G59A 2BY4A 2VJDA 1JDJA 3AV0B 9LDTA 4O4JB 1K2VN 3EGXA 1Z4KA 1D0SA 4MWDA 1U8TA 4YJKA 5HMMA 3VOBA 1N78A 3T7JA 4UUBA 1EFAA 1E3TA 3AHDA 4OL0A 5LMCA 3WKCA 4NPHA 4JI6B 3KELA 1RWNA 4NYIQ 2CXOA 4HG2A 3LXXA 5DOVA 1DEHA 1ZA2A 1XMOB 1SB9A 1RADA 1SJ9A 2A92A 2VT2A 3GGOA 1LTHR 3QM1A 5BQPA 4YAJA 3V7UA 1VHTA 2IYQA 3D6TB 4PYIA 3HDYA 1BE1A 4N82A 5GMOA 3RC8A 3HO6A 4CG2A 5AKHA 4I4TA 3B1KA 1L5LA 3NASA 2FEPA 3MCZA 3QBJA 1RAAA 2H1IA 1I1OA 3O3OB 4DIMA 2OG2A 1YCGA 2Z5LA 5BW8A 3RJZA 5JRZA 2B8NA 2REOA 3AI1A 4AMVA 5JHHB 3EIUA 3DL0A 2G1JA 2DTXA 3SX2A 2Z58A 3DKIA 1K4KA 1U2GC 1FUEA 4L08A 4M8KA 2RH4A 4ZVUA 2CV2A 1BXGB 1UBMS 5HFAA 5E4TA 2PX2A 3LHSA 3GHYA 1JYSA 4PLHA 1PZMA 3RUIA 1W8IA 3WISA 2HDOA 2ZBGA 5JFTA 1KPHA 1UDXA 1UK8A 5CAEA 4JQOA 1K7XB 5HJEA 1EI9A 3U3XA 2CLDX 1LKZA 1QOPB 2TS1A 4Z1MD 5ADHA 5IAAA 2G08A 1IUPA 1P1JA 1XD8A 3HEAA 4S35A 1TQ6A 1DAGA 3HBMA 3E9ZA 3I4CA 1Z45A 3CPSA 1DFIA 2PV0A 2CGEA 3AR2A 3LKZA 3L8EA 4FMDF 3G5TA 1B6TA 1VHJA 3EGDA 1EG7A 3ZVLA 3D3JA 3ETDA 1M1NA 1AD2A 4EB3A 1H2RS 2WVGA 3ZIAA 2BUBA 2EF0A 1XO1A 1HZZA 3PZBA 3EDRA 4BGUA 1K4MA 2PSFA 3O2SB 3LVBA 1NN1A 2XMCA 5AKIA 1QXSA 4CM1A 4LTMA 4U5XA 3SYTA 4HDQB 1AY0A 2JJ2A 3ML1A 3RBAA 2FPMA 4JYAB 5KOJA 1U0NA 4FFPA 3MJFA 3Q5GA 2QROA 3UJHA 3A36A 4EHAA 2DAPA 5L7YA 3FWYA 2H16A 2ZBPA 4ZT2A 3GZ4A 4HEHA 2ZWAA 2C84A 2HA7A 1WKVA 4WERA 2OECA 1VI6A 2BELA 4YV7A 3WAGA 4IXMA 4B4OA 1L1FA 3W79A 3EAGA 1LPOA 3OOWA 3AF6A 1E9VA 3SBOA 1W9MA 1P74A 1SPBS 2FW0A 3OFVA 5TPWA 5K8UA 4KO2S 2BCJQ 4G5SA 3CLRD 2PAAA 5HIMA 3DWIA 4RPGA 3SVLA 3L05A 2RGYA 3BUSA 1KGDA 1MJGM 1N2CB 2H65A 2JKYA 4WNYA 2RKBA 4IV0A 4NF2A 5AHOA 3I23A 2CNOA 3ZOZA 1CQIB 3KUDA 3LX8A 3MGCA 4NJEB 2UVPB 2Z08A 3EDCA 4HYQA 4YXWD 3GV0A 4UMEA 2H9AA 4PCAA 3AIOA 3AONB 3L7BA 1YVEI 1JEDA 3NIDB 4C7BA 3U0VA 2P6PA 4M0LA 3CLVA 5DN9A 5J4VA 4BRZA 1PX2A 4HYYA 3FTDA 1DXYA 3GOHA 5JCJD 1HNZB 3E8XA 2E1PA 3AC0A 4YN3A 1PS0A 3EZ6A 2CYAA 3R7NA 3ABOB 5J1SB 4HGYA 4XQCA 2CDBA 2H1HA 1WMDA 2OUIA 4Z3OA 3IA7A 1BEUB 3W9UA 4PYRA 4WZBA 1FBTA 4UFOA 5L3ZA 4FLEA 1WW8A 4BFVA 1JV2B 4CODB 4X91A 5KDLA 3RAGA 4YRMA 3I28A 5JZVA 3RVQA 2O7NA 5CYGA 4DLSA 3VOAA 1N2OA 3NBZC 2VSNA 4DB4A 2ID8A 2QMEA 3LA8A 5H16A 2R96A 1FP4B 3KIPA 4OFBA 3UAGA 2BMWA 4OXRA 5CP8A 3TTVA 5CFRA 2CW5A 1EZ1A 5JEEA 1BKYA 1QB7A 1ZG3A 3L4JA 3EZ9A 1M34B 2QLLA 5ERGB 3E5RA 3BH0A 1F0NA 2R97A 4JBYA 4QXAA 3URKA 1Z63A 3COWA 4LJ5A 1PNOA 3AF1A 3VZBA 4E3ZA 1PT7A 1SU7A 3RK4A 3ETCA 2M6SA 1PD0A 4ACBA 4LHWA 2Z83A 1YZ3A 5A0TA 2OP1A 5BN3B 4DV6B 3RIXA 4Z54A 1F0KA 3O90A 1JEQB 2IYEA 3K6RA 3LFHA 1F9AA 1ZITA 2P35A 1Q6YA 4QOEA 2R8RA 4U0JA 6NULA 5B4TA 1FNCA 2QIPA 3IUJA 2HQOA 5JSZB 2JJ1A 4CCWA 1QYRA 5DT9A 5CK5A 3FPCA 2ILTA 3WYCA 4HR7A 2V7GA 5CFMA 3FM9A 5C81A 3OZEA 1ZCJA 4O59O 2A5GA 2ACVA 5JZ9A 1CZKA 4KXYA 3CEJA 1U0FA 4QREA 4WKNA 5BMOA 1XMQB 1LC3A 1EB8A 1HLPA 4NFYA 5SYMA 1XCOA 1XRQA 4E11A 1V8ZA 3HHPA 2O5VA 1SULA 1VP3A 2V65A 1JQEA 3RTGA 1TTHA 1LPBB 2IYNA 4HL6A 3OX2A 2YCBA 3I76A 3ZDBA 2WSLA 1QVZA 2A58A 2QENA 2VPIA 1SHJA 2XOKA 4AM8A 2YMQA 2UXDB 3F5MA 3H05A 3HUUA 3DTVD 1GDDA 3PRYA 2E4VA 1YVDA 2QORA 5LLTA 4MR7B 3ICOA 3MBIA 3ROKA 3SEAA 2OXEA 1YFJA 4H7PA 4AJEA 2FJPA 2J30A 2ZKLA 1WQ4A 4MUYA 3INRA 2WWXA 3RJMA 3H13A 4L95C 1SEVA 3EMKA 1XAIA 1U2ZA 1QIKA 1WF3A 4L0CA 2UUBB 3IBGA 2VA9A 1M7GA 5IF9A 3RASA 2QUKA 3QOFA 4IV5A 3TXAA 3GELA 3T7DA 2GFHA 2C4TA 3UICA 5EIOA 4FMDB 3N8KA 2C7RA 3K8OE 1X1BA 2WIFA 5LZ2A 2IH4A 3A4YA 4XYLA 3TE6A 1FP7A 1IJFA 4F97A 1R64A 4AC9A 1N0HA 5EG5A 2Y9PB 1OFTA 5FL7D 4CM4A 2HEIA 5DYIA 2DPMA 3MPUA 4HQFA 2XMPA 4LQDA 4NQZA 4Y6GB 1KRHA 3V8BA 2ORVA 1A27A 4I3HA 3KQYA 3TMYA 2C1EA 4ACAA 4PU0A 5IJ9A 1CS4C 5ECDA 2C03A 1OWMA 3TOSA 4ZYUA 3R8CA 1FDVA 1VRCA 3G0BA 4CE6A 3U4QB 3GPDG 4WCVA 4HTFB 2C94A 4UMVA 3TSAA 2HWKA 2QX7A 4KLRA 3VJRA 3LLVA 1Z6AA 3WYAA 2REBA 2F3UA 2NXWA 1T4CA 1EJBA 1YRHA 2FJ0A 3DOCA 2C1XA 3QPAA 4TTAA 3BFJA 1G6OA 3RG8A 3KL2A 2XT6A 5C1DA 3FJ1A 5K01A 4G5XA 1O5IA 1ZC3A 1JQ5A 2QD2A 4CKBB 4MYUA 3TLXA 1UOOA 1CKEA 2HDHA 2XVZA 3PT9A 2XEXA 3SZRA 3QTLA 4KDEA 3AVOA 3U37A 3VVMA 5C7LO 2KI5A 1RPNA 3AJRA 4B6OA 3AETB 4BJHB 1RVDA 1GP2A 1O58A 1SC4A 1MABB 3IUYA 3NM6B 3OHSX 3R74A 1KSHA 2ZITA 1PSZA 2OFOA 4X63A 4N4AA 3DLCA 4BYMA 4X8HA 5CNIA 3W1EA 1A9QA 1SVKA 5H1YA 4TTTS 1Y6FA 3W2GA 4QHSA 5ENVA 4IVQA 3ANNA 4B4KA 3K92A 4X71A 4EA8A 4KFTA 1PWYE 2JVKA 2FMIA 2Z9BA 2CXTA 3C2QA 1SUFA 3O95A 1A2QA 5HUHA 3VYTB 1U3TA 1BWQA 4RL4A 3BM5A 4AKGA 1U2DA 1OA1A 4KREA 1V47A 3IBSA 4KI7A 5KIAA 1JUDA 1R9NA 1PJTA 4NFSA 1M5RA 2N1BA 4XJXA 3RWOA 4FFNA 4IGFA 3UOAB 2OHOA 5DU2A 4DC0A 4KYUA 1MNAA 2HA5A 4GQBA 1BE8A 3G1UA 2Y3IA 3UJDA 4YMSA 1H4VB 2HPZA 3EA4A 4L7VA 3MCAA 5J2TF 2O8BB 3V7YA 4TVSA 4LSGA 4JLJA 4MLZA 3PE4A 2EFYA 4EB0A 1AU9A 4Y1RB 1JDBC 1GU0A 4KEAA 1AN0A 1EUDA 1UJ2A 3VR6A 4ZCTA 3U62A 1U0RA 4MWOA 5CIWA 5KSPA 1GTJ1 2ZWIA 2G28A 4YMGA 5JPIA 5I9NA 1KPIA 2GWRA 1AXEA 2ERXA 3AR8A 3DE2X 4U00A 3ENVA 1WPGA 1F8UA 1Y1RA 1YR7A 1HZZC 1KDTA 2Q1UA 1PDOA 5AW7A 1BDHA 1MEJA 3NHUA 5BNFA 1E3JA 1MZVA 1UXJA 1Y4ZA 4RDIA 4BIIA 4BTEA 5DRYA 1OLSB 1U5CA 1CUBA 4PLPA 3A05A 1DO2A 3OSUA 3I3SR 3TLAA 1P0PA 2Q4BA 3UB3A 1W0KD 5F9MA 4TYWA 1AA6A 1OXUA 2CVHA 1XDUA 1A9OA 4WOJA 3M6MD 3U9LA 2VBFA 1SPXA 3EWIA 2PNFA 1GCOA 2Q62A 5DNVA 1S7CA 1NU8A 5D3QA 3H84A 3RREA 3P52A 2BW0A 3PVSA 5H3HA 3T06B 4B7UA 5CNJA 5CNKA 5I51A 3SKVA 1PG2A 2F8MA 4MA0A 5EP1A 1Y81A 2M1ZA 2XA1A 3ENNA 4OIFA 3QXJA 5COAA 1J0DA 5ALVA 5GJVC 3WB2A 3IEMA 3HZRA 4H4EA 2VL7A 4PGFA 3ZQ6A 2WF7A 3A3PA 5EPEA 3F78A 3TIVA 4Q9AA 3VBEA 3R20A 2E0IA 1DFGA 3AINA 4EDHA 4DLWA 3WIBA 4AZ3A 5K8TA 3V8RA 4YAEA 1D2CA 1Q84A 4L9SA 2H18A 1XQXA 5A9RA 2HH9A 3T7AA 5I4CA 5REQA 2D1YA 2IDZA 2G4CA 1FTGA 3K3PA 2DKFA 1P7CA 5ALNA 4Z3DA 1UQTA 4NU5A 3T35A 3TKAA 2OGSA 1VGQA 5LQMA 3CFYA 3OO0A 3JD1A 4MDEA 3TDNA 2JAOA 2IUEA 3CLKA 1KVUA 3C4QA 3EQ7A 4GSKA 2NUAB 4D45A 2X6QA 4TKZA 4V3BA 2LRHA 2Q8NA 2WYHA 5K8CA 2VP2A 4AJOA 4QLBA 4GM4A 5CVCA 1XKTA 1N1MA 4MUBA 2PRZA 4UBIA 5EKTA 2HU5A 2B9EA 3L8FA 5DISB 2YFQA 1JAZA 5AMXA 1O97C 5K0JA 3IPRA 2DKNA 1ZIDA 2WSBA 4YAIA 1NQWA 4MYSA 2J6IA 3WL5A 4EG4A 3D5EA 3DEYX 3EMVA 3G0CA 2IKSA 1Z5ZA 3GF4A 5EKUA 1NN5A 3K5HA 3RAPR 1EXMA 4PXYA 2ZRDA 2A1UA 2HQ1A 1U90A 2IYAA 2P4UA 3PNPA 4C4SA 4EG7A 4EY3A 1I30A 2JGKA 3AUAA 4KAFA 5IAOA 2X40A 4IOLA 2AQKA 3M82A 4RPJA 1E6LA 3U2QA 5JMTA 2CLSA 3EYWA 5DXJA 3PYMA 2APJA 2P1DA 3TOXA 3IOEA 5BT8A 4AJ2A 4RVSA 2VSFA 4ZTBA 1H42A 2NU8A 4AYWA 1ND5A 3BE8A 1MOZA 3OX3A 3PK0A 5F9HA 2XI4A 4E08A 1CNMA 3DWEX 1BXRA 1HSZA 2X6TA 1LLDA 3EZNA 3OA2A 3PUJA 1WKCA 1HE2A 1ZN7A 3BIXA 1VIMA 3EZLA 3H1TA 4XB6B 3VDMA 1QH9A 2A78A 1B6SA 5A5GA 1RVV1 1CC1S 1UEJA 2RMKA 4GVPA 3IEXA 4JU8A 1K06A 3BJIC 5BWLA 2R751 5B1YA 2KWIA 1L1QA 1W6RA 1ECCA 1NJFA 5BSRA 4PRZA 1HORA 1MO6A 4WXMA 4AJHA 2H9IA 1KI1A 1KOJA 2HO4A 2KPOA 1UJCA 1J56A 2OGZA 2PBRA 2ZRNA 3IP6A 4FE7A 1GRRA 1PGNA 3AM3A 4MKRA 4WUTA 5L8VA 4CIYA 4Z4IA 2HPHA 4FFWA 5IJXA 1FP6A 3IQWA 4BVHA 3BKWA 3KZMA 3F73A 4Z4GA 1BJKA 2FG7C 3I0ZA 4XRGA 1YA6A 2LXNA 3MJ4A 1QFZA 2QDXA 2ZRIA 4M9UA 1X1CA 3DE1X 5CVDA 3BEOA 2WDZA 4IJ5A 4KKXB 1UC5B 4IGEA 5E38A 4KQXA 1P4RA 4LXUA 4QYIB 5EWMB 4ZQEA 5D5QA 4EKNB 3CRVA 3FPEA 5MFPA 3ADCA 2HSGA 1A8QA 2WOOA 2YRFA 1P0FA 2JFYA 2ZYSA 5J2TB 2Q5HA 2AUMA 3O8OA 3E9QA 3A6DA 2JAPA 4O4IF 1U31A 1RHMA 1M73E 2DUWA 2NM0A 3ABIA 3HNPA 4PPYA 4X85A 1Q1ZA 2WQ6A 2OCPA 1G55A 2PKQO 3B9QA 4K6CA 5DWDA 3N7TA 3EARA 5FLKA 1YCDA 3I8OA 4A1FA 5H4GA 3KV3O 3GJRA 1WUHS 4XSVA 3AZPA 3ZYZA 2IT1A 1QM5A 4FSDA 3DEAA 2Q2WA 2BJHA 3QJYA 4M7PA 2OESA 1FQWA 2NPOA 2H7YA 1ONSA 2B6HA 3SBDA 1S8AA 2EFJA 2PIDA 1GPUA 3UATA 2BWJA 3ZDXB 4EFDA 2JBAB 1R8SA 2XQKA 4HWRA 2X1LA 1L7XA 1FLAA 4II7A 5FR1A 4FZVA 1V4NA 5IG2A 2HRRA 2SKEA 3Q85A 2HZBA 2JCSA 1IXYA 3O2JA 2DWCA 3X1JA 4MRRA 3K9CA 5EIBD 2OV8A 3Q3EA 3HVRA 3IPCA 4B82A 4D82A 5BRAA 3ABQB 1ZFNA 4EG6A 1Z35A 1XMSA 3GLVA 4FR0A 1EHYA 4P4NA 3GCZA 4P7FA 3ZCRA 1GNSA 5I4KA 3R3ZA 4P7BA 4URXR 3IR6A 5I7WA 1M2GA 4MCAA 4LI0A 1IG0A 1UXHA 3PNBA 3NAGA 3Q7SA 4J0IA 5FI0B 2WY2D 1X9HA 3SS9X 4DQXA 4E0BA 4CV0A 5CM8B 4IDDA 1U8UA 1E2UA 1XA0A 1MHTA 4B6EA 3MYRA 3TLMA 3PQ8A 3NH6A 2W2VA 4CM6A 3CLSC 3DBRA 4GLFA 1SELA 1WHSA 3KD2A 2BHSA 4IH9A 3R0IA 5I45A 4ZO4A 2JASA 1NNLA 2QUAA 1OU4A 1X7ZA 3H6HA 4BZPA 3N7UA 3RUEA 1NQTA 2CFCA 3E7FA 5LDHA 2PX6A 1CY2A 3OFJA 1SOWA 1C81A 1N5LA 1VMDA 3OTHA 3U3OA 4XA8A 3WLTA 4D0GA 1MTZA 1Q14A 4D8TA 4ZOLF 2DUJA 4LWQA 4BWYA 3DMPA 4J3FA 4ROSA 3NVAA 3GROA 5AM5A 2CT8A 4EVQA 1Z7WA 5EJMA 2VJPA 3EWSA 4YHHB 1KWKA 4WTOA 3RKUA 4B1FA 1VIAA 1CUWA 1JFFB 1JG6A 2ZDGA 3NS7A 4HX5A 4R1SA 1HYGA 1U2DC 2ZUBA 3GAMA 1XL0A 4EIWA 1WP9A 4A8TA 1C7JA 3DT8A 4H7JA 3ADDA 3KXDA 2WTNA 4ON9A 1FJ2A 3OM8A 2WP8J 4R51A 3DZJA 3P19A 1QLWA 2YZ7A 1ZJ5A 4UUPA 1BFKA 1LEHA 1L2TA 2DBVO 4QYSA 1SBCA 2GR9A 3F8TA 3GL9A 4EW2A 2OBNA 2EWMA 4PRLA 5IKEA 2FRXA 1JG7A 3TEFA 5FFMA 1SCDA 3FMGA 3BMXA 5JLAA 3INGA 4EMUA 3GAFA 4P2GA 1OC2A 2O9JA 1GFWA 3A1EA 1M54A 3CBQA 3ELUA 4MUJA 2YWXA 1GPBA 1T4DA 2O7SA 3B1JA 3GJ3A 2VJAA 3OJXA 3DA8A 3WQHA 1F8GA 4BQIA 3OQNA 5FWXA 2C4KA 4BFYA 4N6NA 2WE8A 1PSDA 3COPA 5ESWA 4EL0A 2YWEA 3M33A 2W71A 2FGJA 3W6OA 1A8IA 4Y1GA 2DULA 5HUJA 1E3EA 4MJLA 3FOFC 1HFKA 1K97A 2ZBVA 4YUVA 4FM9A 2FMHA 2R1UA 3EAQA 4PONA 2XMSA 2HHCA 3FE2A 3UVEA 1KK1A 4N47A 4DLYA 1MTOA 1XQVA 2H31A 3BF8A 2QN2A 4EF5A 2PUAA 3IUEA 3D6MA 1XMXA 3GOQA 2HMTA 1HYBA 1QVVA 3MJVA 3GLIA 1H0SA 1R18A 3LT5A 3T9DA 1XX6A 2HIMA 2VQ6A 1C8BA 1KI9A 1Y3IA 3K35A 2AYYA 5C1BA 1G3IA 3FLAA 2R86A 3NHFA 2PJUA 2C7GA 2J0VA 1S1CA 4ARZA 2HF9A 1JZSA 3C7KA 1H5NA 4LRXA 2G9UA 1BVRA 4R8RA 5JVDA 1T43A 1W1WA 4DRZA 3UMVA 3KJZA 3R4CA 5PGMA 1IEVA 1I6WA 3K0AA 3PL1A 2EIXA 1QC5A 1Y9EA 4M7OA 2LE0A 1I9GA 1P80A 1UKBA 2YUIA 3FKSA 3LK6A 1XA4A 5HFJA 5LC1A 2AFIB 3A04A 3MCUA 1IHYA 2B35A 2V7WA 4TSFD 4TYPA 4EQZA 3HFRA 1WXHA 3OWOA 4Z9XA 2PSHA 3SC6A 4MTLA 1MIOB 2IQ5A 3KQTA 3PYXA 1O7JA 4FBLA 1F9EA 1YFZA 3KCQA 3R9WA 5ESRA 1VI2A 1JJAA 4HFRA 4ZMRA 1TJ4A 4XX0A 5C8DA 1E5DA 3KVYA 5AVZA 1PV4A 1OYYA 2IYLD 5FL3A 1C4WA 4W7HA 5JSQA 1XVVA 4KG7A 2O8FB 1OPXA 5ILOA 1FX0A 3CKKA 1W49A 1D2MA 3T94A 4M1KA 3GMSA 3DF7A