3A58B

Crystal structure of sec3p - rho1p complex from saccharomyces cerevisiae
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
178
structure length
178
Chain Sequence
SIRRKLVIVGDGACGKTCLLIVNSKGQFPEVYVPTVFENYVADVEVDGRRVELALWDTAGQEDYDRLRPLSYPDSNVVLICFSIDLPDSLENVQEKWIAEVLHFCQGVPIILVGCKVDLRNDPQTIEQLRQEGQQPVTSQEGQSVADQIGATGYYECSAKTGYGVREVFEAATRASLM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exocyst complex component SEC3
publication title Structural basis for the Rho- and phosphoinositide-dependent localization of the exocyst subunit Sec3
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport/exocytosis
total genus 58
structure length 178
sequence length 178
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2009-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3a58B00
1M6NA 2V1UA 4XD7D 3REGA 3BB4A 3SJCA 4IJMA 2CLSA 4JLMA 5DH9A 3SYLA 4PAOA 1KO1A 5IK2A 4UNQA 2DFLA 5EUMA 1N0VC 4M1YA 3SJZA 1VHLA 1LY1A 2AHOA 2D4HA 4BFTA 5IK2D 3WMGA 3NH9A 1M8PA 2WPDA 5AUNB 3IQXA 5EXTA 3B9QA 1NI3A 4BZPA 4TZ0A 5JS7A 2WPDD 3KB2A 2QA5A 1XEXB 5DI3B 2VF7A 2QMEA 3MWLA 3Q3JB 5G3ZA 1F2TB 3SHWA 1PUIA 3UWOA 1OFHA 3KJEA 3AVUA 4AYXA 4V0OA 4BLTA 2ZRBA 2HT1A 3B9PA 2W0MA 5GVRA 4TZ6A 3RS3A 5BN4A 1XTJA 2GJSA 4B3GA 3SDZA 4RCZA 3BC1A 5CYPA 4D6PA 4M53A 3O47A 1GL6A 2ZRNA 4EAQA 2XTZA 2OXCA 2D62A 721PA 3CNLA 3FHCB 5G41A 1HE1C 4DLYA 4DCVA 3Q7PA 2J5XA 3THYA 1UKZA 1K8RA 1ZYUA 3KZ1E 2RGEA 1U8AA 2F6RA 3ZZTA 3DHWC 3SOPA 3CKLA 5CK5A 4UXHA 1S2MA 2OAQ1 2D7DA 4A0RA 2RHDA 4AD8A 3TW4A 1CJMA 2NTYC 1XZQA 3N2IA 3QPUA 1BIFA 1Q1EA 5LD2C 4JT4A 3H84A 3O8BA 3QF4B 5EXPA 2QL6A 4Q4AB 4EPYA 3MMPA 1NG1A 2FWRA 2JLUA 2YOGA 2QTVB 3HDTA 1IN6A 3OAAA 1KAGA 3RS7A 4C0QC 2ZYWX 3OEHA 4LC1A 1AJEA 1SKYE 3LQRA 3OAAD 4QJ5A 2A5FA 3AGQA 3OEHD 1YJ5A 1N6NA 2RHMA 5EP3A 4BEJA 1KSHA 1QHXA 3LVRE 1WBBA 4U7DA 3ICQB 4C0HA 4K46A 4D26A 4BRWA 3GCGA 4LJ9A 2H57A 1SVWA 2H16A 4DWJA 4KFSA 2GJ9A 1KAOA 2PLFA 2WM9B 4WAUA 2OEPA 4M21A 1ZP6A 1G8PA 4W7SA 3GJ7A 1GTVA 5CK4A 2IUUA 2NO6A 3ZD6A 1NN5A 2OBNA 2P3SA 1XPUA 4A82A 4M2LA 5KOYA 1CJKC 5A5GA 2ZJYA 4NBSA 4TLDA 4EJSB 1GOTA 1XFAA 2QM8A 4HLUC 3LX5A 4WZ6A 4ON9A 2FE4A 2O5VA 1OJLA 3B60A 4A8JB 3ZVLA 2P2LA 4WIAA 4URZR 3DM9B 1XMJA 4JVLA 5DISB 2FG5A 3LXXA 2NOAA 4QBIA 4ITRC 5DYIA 1NBMA 2BCJQ 3DPUA 1U99A 3GMTA 4JS0A 4LY6A 3FOZA 4XH9B 4F91B 3QXCA 1N6RA 1NBMD 2FSFA 3OIWA 2D3WA 4OQFA 1BO6A 3LNCA 3HR8A 4RD2A 4B44A 1PZNA 1FX0B 3AP2A 1G5PA 3TQFA 1UEIA 2R44A 3U4QA 2OM2A 4PSVA 2DB3A 2IHYA 1Q3HA 3LAWA 4DEXA 3BH7A 3BS4A 2IYLD 4EFLA 2PX0A 1P2TA 3TAHA 1OV4A 1W2GA 5JSZB 3P27A 1DO2A 1PJRA 4F7WA 1KYIA 1N3BA 1NVXQ 3AVOA 2EFEB 3FE2A 3U7HB 2O0KA 4LOAA 1T5LA 2VTKA 1IY0A 5L3SB 1WRBA 4AG5A 2XXAA 2NO7A 4ZO4A 3AVQA 2QAJA 2ZS9A 3PXGA 2O0JA 1G3UA 1KMQA 2GVZC 4A0HA 4AIIA 5DLQC 1J99A 1EESA 1GILA 2WJYA 2YC2C 1CR4A 3NKVA 3IPYA 4ZDWA 3P4XA 1XDBA 3EWSA 2VP4A 1G3IA 1UBCA 2X19A 1N6HA 4YONB 4LYFA 1AS2A 3A1UA 2ZRDA 3A58B 3QKRA 4S2EA 2WJJA 3QQ5A 2IS4A 4IHQA 3QENA 5B64A 2JLXA 2OE2A 1E4YA 1NY5A 2GK6A 1OPXA 1UKVY 2A5YB 3PUYA 3EX7C 3X1XA 4QC2A 1E2EA 2FPKA 4NYMR 4NP6A 2DFTA 2FZ4A 1NL3A 2ZRJA 1G16A 4UNRA 1J2JA 1PLKA 2ORWA 1NJGA 1W0KD 2ZE7A 4I1UA 3KQUA 5F3WB 4JL5A 4XVRA 2AWOA 4CEJA 3AH8A 3QKUA 5FR2A 4OI1A 2FH5B 221PA 2CLDX 4LX0A 4DLRA 3THWA 4PZLA 1KI8A 3C5HA 4G0NA 3TUIC 3SJAA 4GSYA 1J7KA 2IEYA 2PCLA 3CRVA 4I99A 3RRYA 4PPNA 2VP9A 3NBFA 1XTKA 4RFSB 5KDLA 4BECA 3NXSA 3WMFA 1QHHA 1ZCAA 1GKYA 3BE4A 2VHQA 4Q7LA 4XSGA 1U9IC 3ASZA 3SC3A 4AWXA 1XEFA 1C4OA 3TSZA 3A36A 3VAAA 1E79A 1ZIOA 4EUNA 4JBXA 3KKPA 1D2EA 5FPHA 3AM1A 1BS1A 1A2BA 4D2IA 3SFZA 1E79D 3W34A 1DOAA 3KL4A 3W3AA 2JLRA 1X8LA 4KHZA 1LFDB 2CK3A 2ATXA 2GEDA 4RZ3A 1DARA 2B7CA 2CK3D 1KK2A 2JLWA 2QENA 3B1WA 4H1VA 1KJYA 1VTKA 1X8KA 1JBKA 1NF3A 3WBKA 1YZUA 4LBYA 3ZH9B 2QMHA 1KNXA 1VKJA 2FGKA 1RYHA 3K09C 4GMXA 1G7CA 4EQ6A 4A6XA 2GAOA 3VR2A 1B23P 1T9HA 2FFQA 3GQBA 4BFVA 1KMHA 1YHNA 2DFNA 4PQRA 1E94E 1NVVR 3B82A 2BV3A 3LW8A 3AF0A 3QE0A 1MOZA 4KO8A 3THXB 2PJRA 2WSSA 3AEZA 3KDSE 2WHXA 3P26A 4A36A 2QP4A 3PJRA 4NCHA 2HJVA 2VL7A 4XIGS 2WSSD 1E9EA 4PHTA 5DNYB 4JJKA 5CDFA 1KI7A 3AB3A 3BXZA 2ECKA 5H8WA 2WJIA 3EIQA 1OB5A 5FI1B 3KQHA 4GBMA 1E2HA 1N6IA 3Q5EA 1G5TA 3RRNA 2JEOA 3N70A 4JYBA 1U9IA 4P4SA 3AVVA 1MO3A 1UBEA 2C8VA 1HV8A 3PEVA 3K0FB 5AJYA 4LYJA 2OT3B 4IKEA 4LHZA 3ZLJA 2PJZA 3IEUA 3A8TA 2NO9A 4DDWA 5KSZA 3NWJA 3VNUA 4MGIR 4FCVA 4N3NA 5B2ZA 4LJYA 1GNQA 4LYAA 4IOJA 5AJVB 2DWPA 3QKSB 4LUCA 1RC8A 2AWNA 4CT4B 4JMPA 1CEEA 2F1RA 2QQEA 3ZQJA 4FN5A 2ZYUX 3W5JA 1NNEA 1IXZA 4OHYA 3GJ6A 1RRCA 4D81A 3K09A 1ONBA 2ZE5A 4JBWA 5E7MA 3R9IA 4LGMA 3EZ2A 4TTPA 2A5GA 1E4VA 1GZSA 4WW0A 1E0JA 1IM2A 2ODWA 4JSTA 3VU9A 5KSPA 2RGAA 5SZKB 1N0WA 2IUTA 4XJXA 4TYNA 1XEXA 2YOFA 5DI3A 5L8VA 4EPVA 4GL2A 2IYTA 3QXJA 3GEHA 5K8UA 1LV7A 4M1OA 1W46A 3T15A 4AKIA 1GP2A 2NG1A 5C1BA 1JNYA 3T34A 4Z51A 4QFMA 3AP3A 4JLJA 2XB2A 3UANA 1P4SA 1XJ0A 2OILA 4QKQA 3SE0A 2N42A 4MGKR 4R7ZA 1Z0AA 3CZPA 1FQKA 4DZZA 3RWMB 5SZHB 3K1JA 4DB4A 4KODA 2CLCX 4HLQB 1M74A 4QGFA 3K70C 4TMZA 2J3EA 1GUAA 4EPTA 4UQOA 2ZVPX 4HZIA 4JLDA 3MWJA 5FTKA 3TSWA 3CRQA 3R8CA 3U60B 1E1RA 1OH8A 4B48A 2OFWA 4DLTA 3BAFA 1E1RD 3KQLA 3EWAA 4P3YA 4PHGA 2YWHA 4Q9JA 4FMDF 4TYYA 1UM8A 3I92A 4PTLA 4TMVA 5G53C 3ZZUA 3VNVA 3SYKA 2XZLA 3QF4A 1KK3A 2EFHB 3KTAA 3SZRA 2ZI3A 4Q4AA 1Z6YA 2RGXA 2VH5R 3KJGA 2FSGA 3U7EB 3SBDA 4V0KA 5BN5A 1M2OB 3NVAA 4FI3C 3UMFA 1RRPA 3VR4A 4B3CA 1SVSA 2KSQA 2BEKA 2WKQA 4G1UC 4X8OA 1G41A 2F9MA 1P61B 1GM5A 4PR0A 3FYHA 4KSCA 4KCGA 2VP2A 2YNMA 1E0SA 4N1AA 5FPYA 2J59A 1SHZA 3T5DA 1OFTA 1IN7A 1NLZA 2CXXA 4Q19A 2ZE8A 1HURA 4BLSA 2JLSA 5EP2A 1S8FA 1X6VA 3V4RA 2PT5A 3C16C 5EXSA 2CEAA 2EWWA 4M1SA 1G7RA 2O8DB 1QG2A 3KX2A 5B30A 2XB4A 4GMDA 3KKNA 4LJ8A 4QGGA 3GFTA 3A4NA 4Q5IA 5JWRA 1P5ZB 4DVGA 5KO2A 4CT5A 3I62A 3IQWA 5C46F 3CR7A 3KQKA 2CBZA 4EJSA 5KUTA 1HE8B 3PQCA 1G19A 4OHXA 1OYYA 2CMKA 2G1JA 1UDWA 2ZAMA 3K70D 2FFHA 3B1VA 3SR0A 4MUBA 4Q9LA 5HCIA 2OESA 5LD2B 3NH6A 4A8JA 5CJPA 3NHAA 3P32A 2F1HA 1SKYB 4LI0A 2WIBA 3U5ZB 1I2MA 2OXRA 4DB2A 3VTKA 1FP6A 2OFOA 1Q3TA 4V03A 3BFVA 4BFZA 2NZJA 2GNOA 1Z28A 3PG5A 2ZRIA 4CVNA 1OIVA 1FX0A 4MA4A 2ZM5A 1OYWA 1R6BX 4TMWA 1OW3B 2GEVA 2RMKA 4PHFA 2WAYA 4BFUA 1JAIA 1J70A 5DGXA 4MUAA 3BD9A 1G7SA 4DUGA 1U2RA 2GA8A 4LPKA 4OI2A 2R65A 2QZ4A 3QG5A 4GP6A 4DUGD 2Q3FA 3K0AB 3PITA 2JIZA 4ZIRB 4OI0A 5JCZA 2E87A 4E22A 4Y0AA 4WZBE 2YC4C 2JIZD 4RFVA 1GL9B 1P9NA 2QI9C 4WA7A 4K8OA 4PSKA 2VPPA 4K81B 3KJIA 2P6UA 4MKFA 1XBTA 2XZOA 1Q1ZA 3GFPA 3VMFA 4W5WA 1E99A 3U44B 1NMZA 4DSNA 1G18A 3QXXA 4QG7A 4NYMQ 1YZQA 1W4BA 2GWHA 1UFQA 2WICA 2A2ZA 3CNOA 3RC3A 1YKSA 3CR8A 4C0KA 2A5JA 4X8MA 4A4DA 1HT1E 4HZUB 3OIYA 1PLLA 5HZHA 5FI0B 5J4YA 3WXMA 4DDTA 5EE1A 1YZNA 4PXAA 4E09A 3TUJC 5GJCA 2WVJA 3A1SA 1HTWA 4I1OA 3PV0A 4B34A 1MABB 2EYQA 5SZIA 3R9XA 1R8QA 1IBRA 3DOEA 2YV5A 1XTIA 5TDHA 4UKDA 4BRUA 1IY2A 1ZM7A 3LDAA 1JEEA 1Q1QA 3O8CA 3AKDA 2WWWA 3U7GA 4Z8XA 4W5JA 4B75A 4TLBA 3SI7A 1N6PA 2HCJB 3OHMA 2XJ4A 1OIXA 3UG7A 1DAFA 1AGRA 1LW7A 4DSOA 1UDXA 2X2EA 2FEMA 3PEUA 4RFSA 2FOLA 4LJ4A 2IC5A 1PVOA 1KI2A 1RPZA 2QROA 4FMCF 4DLUA 2F1IA 4TMTA 4QJ3A 3I1FA 1G5RA 3RRZA 2W6IA 4US1R 3HYTA 4B71A 1CRQA 1KDTA 3EZFA 5TMPA 4PAMA 6Q21A 4TQ9A 1UAAA 4OHWA 3GP8A 3PVSA 1CS4C 1ZCBA 4D4MA 3GFOA 2C2HA 3CH4B 2W6JA 2YVUA 5J5CA 1Q44A 2R6FA 1CLUA 1XD9A 2GRJA 2P67A 2W6JD 3L8ZA 2JDIA 3IHWA 2CE7A 4O25A 1PLJA 2WKRA 1MV5A 1LNZA 1E2FA 1ZNYA 4GI7A 1E96A 4C0BA 4ZDIA 2JDID 1NVVQ 2RGNA 2WWGA 2XJ9A 1G9XA 4HAYA 4FCTA 1VG0B 2J0UB 2ZYVX 5CIQA 3B7GA 3JVVA 2SHKA 2K5UA 2REOA 4LHXA 4Q7MB 2GKSA 2V54A 3VR1A 2H7VA 4PFSA 1VYUA 2ZJ8A 3H1TA 4KBGA 4OKSA 4UXIA 4CW7A 3JVUA 3C4JA 1YZTA 1KI1A 1HUQA 2G88A 3QBVA 3THXA 4L9SA 3CRRA 1M34E 4B6EA 4Q1EA 3AUYA 2H92A 2Z4SA 1YZGA 4UXJA 1AQUA 1G291 3R7WB 2X1VA 2ZJBA 1XXHE 1YR9A 1T3SA 1QVAA 4I4LA 1ZVQA 3NEJA 1EWRA 1FNNA 4AY2A 5FBWB 5JEDA 5GVSA 2CHQA 2C9YA 3AP1A 3UMRA 4B2IA 1IXSB 3AV0B 2AKAB 3ZQ6A 3AKCA 1NMXA 3P20A 3SS8A 1FQJA 2AXNA 3TVTA 3K0FA 3BB3A 3LX8A 5FPTA 4JJZA 1M7HA 1R5NA 4G01B 4FD2A 2PLRA 4XWAA 3GLGE 3H2YA 4PQYA 4Q9IA 4WBSA 3K0CC 1HYQA 2NGRA 2Y8EA 3J81k 1F3OA 4V0NA 3THOA 1IN8A 4F92B 3DL0A 1XU4A 2NIPA 1P9WA 4Q48A 3QKSA 4C3ZA 3KUDA 4FMCB 1LF0A 2QGZA 3PFIA 3ZYCA 4AKEA 4GOJA 4D4JA 4C7OA 2JJ2A 1NKSA 1T8TA 3VU9B 3CF2A 4DHEA 1Z5ZA 4JKYA 3GEIA 4AI6A 4Q1AA 2R62A 2JJ2D 2IXGA 4UNNA 3VR3A 2RGDA 2HEIA 1ELOA 2QTHA 2AX4A 1OH6A 1HEIA 1EWQA 2C77A 1IHUA 4JLAA 1WXQA 3PIRA 2ZRMA 2D74A 4WZAE 2V9PA 5DHAA 3T12A 2ZS7A 3CX8A 3ETLA 5FTJA 1XMSA 4M1TA 2C95A 2GETA 2IA5A 5D3MB 2AK3A 4BFWA 2QY9A 1UKYA 1M1YE 3VQTA 1JPNA 1OXXK 4EFMA 1UJ2A 1L4UA 5JBQA 4UNPA 3IEVA 1H8HA 1CU1A 4PZZA 4NONA 5K8LA 4AKGA 2CJWB 4P0TA 3DMNA 1FTNA 3MD0A 1KSGA 5HKKA 1US8B 4EPRA 4JVSB 3CRMA 1KO7A 2IT1A 2ORVA 5HKKD 3P4YA 3FFBA 2J87A 4KYIB 4M1KA 4B73A 4G5OA 4H9GA 1QVRA 2WKPA 4LWZA 1IAQA 3VR5A 2GAAA 3A6PC 2OCBA 1T5IA 4HLCA 2Q3MA 2GILA 1T3HA 4YMSA 4JVNA 2QPOA 3AF2A 2ZAOA 4AKHA 2HXSA 3X1WA 1VYTA 2OHFA 4GZMA 4Q01A 1NG9A 2OG2A 1XEWY 5F98A 4IFBA 3W8RA 1J90A 3KTAB 1WF3A 4KU4A 4ACAA 4B3DA 2QU8A 1NN0A 5JCPA 3IBYA 1K6MA 1E32A 4KLNA 1AKYA 1KJWA 1IJEA 1NRJB 4MRRA 4DSUA 5FPSA 3U2QA 1Q0UA 3NEYA 1VG8A 5F9FA 2VP0A 3SJBA 3KXLA 1C1YA 2DWQA 5KNDA 4LV8B 2PH1A 3OIVA 2P65A 2ZUCA 3MCAA 2DHRA 3GJ3A 1ZNXA 1NVUQ 1GSIA 5B57C 4FCWA 4LHYA 5FBVB 1HT2E 4QM6A 1Y3AA 1TEXA 4J0QA 2REXB 3GLFE 3T5GA 1TEVA 1JECA 3Q72A 4PAQA 1CR0A 4TTQA 3ECCA 1W7AA 5CM8B 1W1WA 3U3RA 1G17A 4TYPA 1VCMA 4HDQB 2C03A 1EX7A 3AVXA 2QEQA 2CL0X 3SU8A 1GRNA 1KY3A 5LPNA 2XNDA 1TMKA 4NYJQ 3NTUA 1WE2A 3BGWA 1AS3A 1D9ZA 1V43A 2Q21A 4OYHA 5EXXA 3T61A 2GHIA 3ZDQA 4BFYA 4EDHA 8OHMA 3RS5A 3K70B 1TNDA 1W44A 4G3XA 1VDZA 2O8DA 3E5HA 1XEWX 2PCJA 4P4TA 4C9BA 2ZREA 5BWMA 3B1XA 1UADA 2GTPA 2QUZA 3AVYA 2ZSEA 4IDQA 3VHLB 1ZC3A 2DPXA 5ELXA 3KB1A 3QBTA 3Q8XB 2WJHA 1Z0FA 2QE7A 3PUXA 3WYAA 2J7KA 4LV6A 4OK3A 2QE7D 3AGPA 3RSLA 4CYMA 1KK1A 4URWR 1N6KA 1P72A 3LRPA 2KBEA 1CULC 3NBYC 4V0ME 1C9KA 4C30A 2QAGC 2F55A 2ZI9A 2JATA 4Q4HA 4EIWA 3EASA 1BKDR 5JHGB 2ZE6A 2W0SA 2BC9A 2ODBA 2X8AA 4FWIB 2IBMA 4EPWA 3AUXA 4GT1A 4AG6A 3B2EA 3R8FA 4PC7A 1LVGA 1R0WA 2B92A 2BWJA 2Q9BA 2IS1A 5DHFA 1IN4A 1GITA 2CVFA 3DOFA 1OKKA 2ZI7A 4ZKEA 4B76A 1OKKD 2NO1A 1Z22A 3MSXA 4DT1B 5LBIA 1RW4A 3I73A 2F1JA 4HUQB 4CF7A 4LK2A 5DSZA 4OI4A 1KI9A 4ZIRA 1ANKA 1II9A 3K0AA 3K9HA 2XNSA 4M9SA 4M1MA 3LFUA 3WY9A 4XSHA 5FTLA 2F9LA 2VRWA 5L3RA 1EFCA 4JKIA 4QXAA 3CPEA 1JR6A 1XTQA 4HLUA 3DDCA 3A1VA 1W5TA 2ZJ5A 3MFYA 3U44A 1RFLA 4IDPA 4ABYA 3RYTC 5FPKA 2FSHA 4R98A 2I1VB 3M1IA 3CF6R 2WWFA 3H0KA 4OQLA 1CIPA 4L8GA 1EFTA 1E69A 2G1KA 4TWZA 4L15A 3FMIA 4HZUA 4D0NA 1QHSA 3Q85A 3FMPB 2V6JA 2VP5A 4RCYA 5LB2A 2VHJA 5TARA 2ZYTX 2IF2A 2QAGA 3B5JA 2WWHA 1KGDA 1MABA 2MMGA 2JJ8A 3OE7A 2UZ3A 4BASA 3CH5A 3RSOA 3OE7D 1CJTC 1SQ5A 3M4YA 1JJVA 3CM0A 3PUVA 4MRNA 4Q7JB 2RCNA 1ZIPA 2BBOA 3BBPA 1J8MF 3AF1A 2ERXA 4NTZA 1GKUB 3G0HA 2O8BB 2KJQA 3AF4A 2GJ8A 4TL9A 1AA9A 5AUOB 4AK9A 4URVR 4A92A 3BIFA 4QNRA 1SZPA 4R71A 1Q22A 2ZRCA 1CKEA 3NBXX 2WWIA 4BZXA 3SN6A 1CXZA 5JS8A 2CNWA 3D6TB 3WRXC 4AC9A 1P6XA 3M0EA 2IYUA 3GD7A 1Z3IX 1IOZA 2CNWD 5FOTA 3X2SA 1OIWA 1DPFA 2RAPA 2LCFA 5EE3A 1G20E 1X3SA 5AK0A 4WXRA 1RKBA 1QHIA 1CF4A 5CLQA 1Z0IA 4DIDA 1J8YF 5H68A 2JJ1A 2Q9CA 1BOFA 5L3QB 5J4KA 4C0AC 1R5OA 4Q9KA 4GP7A 2JJ1D 3OF5A 4BFXA 3DVLA 5JECA 5DIFA 3ASYA 1AZSC 1G8GA 2YHSA 2W00A 2J0UA 5KHOC 1SXJE 2GXAA 2Z0MA 3GJ4A 1CJVC 3KFXA 1OXTA 2H5EA 3K53A 2AL7A 4Q9HA 5FUVA 1GVNB 4Q03A 2QP9X 1A2KC 3L0IB 2G0NA 1G6HA 1DAEA 1FPMA 1TUEA 1YRBA 2RGCA 2JGNA 3CWQA 4IOKA 1VIYA 4Q47A 5EE9A 4D4KA 5DYGA 4KI0A 3EC2A 3NG1A 1B0UA 3QXHA 3X1YA 3P1JA 2QNRA 3RABA 3LD9A 4QGHA 3TBKA 5KSYA 3ZVNA 4IEEA 1E9DA 3R7WA 2HLDA 1ZW6A 1II8B 2P5SA 3HU2A 2QRNA 4TMXA 2C99A 2HXYA 2HLDD 1AZTA 2I1QA 3EZ7A 3G82C 1JI0A 1EK0A 3C41J 4P32A 2LWIA 2IYSA 4MITA 2LKDA 4L4UA 5EE0A 2C5LA 2DFKB 3SHFA 1S3GA 3U6KA 4A2QA 1BYIA 1ZNZA 1KSJA 2Q0HA 4GDFA 1Z0JA 4C7OB 2AFHE 2AD5A 2QSYA 3U3JA 1SVLA 4TTRA 1CBUA 4KBFA 4NZYA 1MRSA 3GLHE 3VKHA 4US0R 4LPSA 2ODNA 1OXVA 1U98A 2BMJA 2J41A 1NSFA 2OO7A 4RKEA 4MRPA 1YR7A 1HA3A 1W49A 5EJEA 1XXHB 3FMFA 1YQTA 3B13B 2CDNA 4EPXA 3LQQA 3BB1A 4B3FX 2GEUA 2ZUDA 4RZ2A 4BGDA 2RGBA 3QSYA 1VCIA 1LS1A 2YZ2A 2ZU0C 4LRWA 1XF9A 4ERNA 1GG2A 4LZZA 521PA 1R8SA 3KKQA 3MJRA 4C4PA 2BM1A 2BMFA 5D3MA 2ZJ2A 3DEFA 4MQBA 5IHPA 4A9AA 5IDVA 3KFVA 3GLGB 3KUCA 1UBFA 4F38A 4B47A 2Q6TA 2CJWA 2J0QA 5TXGA 3RHFA 1OFIA 3OEEA 2PMKA 1R0YA 1US8A 5FL7A 4II7A 5KTYA 2ANBA 2VSOA 1DAIA 3CZQA 3OEED 4GRAA 2VEDA 4BLQA 2QPTA 5FL7D 4CDGA 1XJQA 3GLHA 3N5CA 2IYVA 2C9CA 1LF5A 3Q9LA 5ANRB 3EPKA 3BFKA 3R20A 2ONKA 1MRNA 4XTRA 1RE0A 2ZI5A 3L8YA 4Q1CA 3ZGXA 1P2SA 4DLXA 4PC3A 2J45A 4DCTA 4DDVA 4ZCIA 3FVQA 3QNUA 4BUJA 5IF9A 1Z0KA 2JASA 4KVAA 1F5NA 4MYCA 2FJUA 1DEKA 5BXQC 1Z07A 5J47A 1QF9A 5CLLA 3W3ZB 3TKLA 2D7CA 1KI6B 4PO9A 3A1WA 3AKYA 4D80A 1NIJA 1U0LA 1E9BA 2J9RA 4V02A 4LSGA 3FTQA 3TSOA 2DBYA 2XGJA 3WHKA 4HDCA 2EFDB 4YXWA 5E3HA 5AJXA 3FKSA 1Z83A 1Z6AA 2ORIA 4YXWD 1GNPA 2AKYA 3V9PA 3FKSD 5EE5B 2C9OA 1VIAA 3T1OA 4ACBA 1QG4A 1WP9A 2NPIA 4UJ5A 3A1TA 4LBVA 2IWHA 3W90A 3VR6A 1Q1BA 1OH5A 1KI4A 1W5SA 1ZUNB 3SNHA 1GL7A 1T3LA 1FMLA 2R6CA 4E07A 3I72A 1PV4A 2ODEA 3EW9A 1D6JA 3DKVA 4C0SA 4AYTA 1NLYA 4HAXA 3MWKA 4YMUA 4NYJR 1XJCA 2IXEA 2GBLC 2QQ0A 1SVOA 3TIFA 3LWNA 1EX6A 3CX7A 4IXNA 3QOFA 2BOVA 1VYVA 3MRSA 3EC1A 3B6EA 2XTNA 4TYWA 1R2QA 2IS2A 3HPRA 4X8LA 3FKQA 1KDOA 5HE9A 1YE8A 1T0JB 2IWRA 2CL7X 1ZD9A 4JIMA 4Q4JB 4Q4HB 4JYCA 3L43A 5GJVC 3GLFB 4WVFA 2OCYC 4LJ6A 3AVPA 3I4LA 1MT0A 1X8JA 3L82B 2OUKA 4I1VA 1WA5A 2VBCA 1D2MA 2ZRLA 2A5DA 3TW8B 2P0EA 4OQMA 1G3RA 1UEJA 4G5RA 1LB1B 4M22A 2WOJA 2IK8A 4NL4H 4BLOA 4JLPA 3FGNA 2OAP1 2AD1A 2B8TA 1XCPA 4ZV4A 2C78A 1G8YA 4QJ4A 1F2UB 1AIPA 4TL6A 2W2XA 4TMKA 1IN5A 3TLXA 2QGNA 1VHTA 4DT1A 5JI3E 3HP1A 2VHUA 3PCRB 3HPQA 3V00A 5KNBA 2G9NA 4IDOA 2IYYA 1A4RA 4HUQA 5CJ2A 4LBZA 3ND9A 4G5SA 2WSMA 1JR3E 5FH9A 1QHYA 2GBLA 3QEJA 2BBWA 4M9ZA 3DZ8A 4IW3B 4OQXA 3UXMA 2XX3A 5KU1A 5AJZA 4HSEA 4Q02A 1OXUA 3RWOA 2FGJA 3ADBA 2OCAA 4G5QA 3HJNA 2J0SA 1KIMA 2QAGB 3PEWA 2YWEA 3VHXA 1NMYA 4BWYA 3TUZC 1JPJA 1CR1A 1FOEB 4RJLA 121PA 3TH5A 1XP8A 5FOVA 2F7SA 1TX4B 4Y0VA 3AVWA 4C0LA 1GDDA 4BEBA 4OHVA 3HWSA 4KFUA 1KJZA 2PZEA 4HAZA 4PQFA 3TQCA 3PR1A 1ODFA 3GPLA 1IXRC 1P73A 1TU4A 2OBMA 4P4UA 2KWIA 1YR6A 4JT2A 4RD4A 4A2PA 2Q3HA 5B58C 4M1WA 1AK2A 3PUWA 5DE3A 4A2WA 2O8BA 4D25A 3WMEA 1SGWA 4HI0E 3WNDA 2ZANA 2ZRAA 4A15A 2AN9A 4MKIA 1COWA 3RVBA 2G6BA 4B33A 3O8RA 3I61A 2EW1A 4OJKA 1U90A 2W6ID 2ZSAA 1QZXA 3I8SA 1COWD 2WJVA 4PSAA 1X86B 3IIJA 2RKOA 2LKCA 3LBNA 5FUXA 1U0HC 1MR3F 5JWHA 4PC2A 5GJWC 2IX3A 3CB4A 4L9WA 3CIOA 3KKOA 5G40A 4DKXA 5FTMA 3HU3A 4F93B 3RLFA 3LW7A 1ZD1A 1GAJA 4RD1A 5JHHB 2JA1A 2WJGA 3CPHA 4OBEA 1Y63A 3WNBA 3L0PA 2ZRHA 421PA 1ZM3A 4BLPA 5L3QA 4HATA 1A82A 1P62B 2DYKA 3NDPA 5A0FA 5IRCD 1ZU4A 5TVKA 3TMKA 1P2VA 3SBEA 1WCV1 5BYKA 2HCBA 2FNAA 2FSIA 4RZUA 4URXR 4A6PA 4JL8A 2REBA 1TAGA 1Q12A 4NKRA 4WOPA 3UATA 2GCOB 1AM4D 1VCNA 3C8UA 4QM7A 2XSZA 2QG6A 1E2MA 1AQYA 2XSZD 1GRRA 2L0XA 1T91A 2D2EA 1S3SA 2Q9AA 1XCGB 2H1LA 2ZR9A 3NC1C 4URYR 3RNLA 1E2NA 1CJUC 4D0LB 4PC6A 3N2EA 4ZI2A 3R9WA 2UVQA 2HUPA 4GNKA 4HB2A 3UMSA 1II8A 3ZVRA 1NN1A 2FMXA 3BOSA 4LJAA 4MKGA 3CW2A 3VX4A 2ZRGA 1W2HA 1NN3A 1ZUHA 3CF0A 3T1VA 4PPQA 1YR8A 1LS6A 2FA9A 2ZJZA 1W0JA 4ZCLA 1SXJB 2ZJAA 3DO6A 1E0KA 4Z54A 1RJ9B 1W0JD 3IHLA 1FL9A 5FOSA 1KZ7B 3WP0A 1ESNA 2YWGA 2N1BA 3JZAA 3RS4A 2QBYB 4JLVA 1XMIA 3B78A 3TRFA 3BH6A 2ZEJA 3WBJA 3WP1B 2EWVA 3TNFA 4JZKA 1ZUIA 3HU1A 1IQPA 3X1DA 4AYWA 1XMVA 1SVKA 4S35A 2I4IA 1OSNA 5CYOA 4GOXA 1WMSA 3ZIAA 4KFRA 1YRAA 1G3MA 3DMDA 1DG1G 1XXHA 4TQAA 3ZIAD 2G83A 1NKTA 4BFSA 2O8FB 1D2NA 1TQ2A 3F3YA 3T35A 1FFHA 5C2JB 3PEYA 1DAGA 1UPTA 2FF7A 4CRWB 1D5CA 1NY6A 1ZRHA 4RZXA 1H8HD 2GF9A 2VLIA 1W36B 2JAQA 4MYTA 2IL1A 2VP6A 4G5GA 4NHOA 4IEIA 5EUQB 5A4JA 3GLGA 1F6BA 3KJHA 3GLHB 2AK2A 3TR5A 1DVRA 1QHGA 1O87A 1M7GA 1KDPA 1GNRA 2JLZA 2PBRA 4XOIA 1BH2A 1X1RA 2IHBA 3X1ZA 4B3XA 1N5LA 1Z06A 2QMUA 4M0LA 4YMVA 3LLMA 4YLGA 2X77A 1NJFA 3LH5A 1S9HA 3K9LA 3K0CA 1RYFA 1T6NA 3IGFA 3BFXA 1XTRA 1N5JA 2QT1A 1RIFA 5TB5A 1TTTA 2BHRA 3L2OB 1Z08A 1MO6A 2OCPA 1Z2CA 3K9NA 3HYRA 3NC0C 1GRQA 4URUR 1L7VC 2QTFA 5FBLB 1KZGB 1Z29A 2WWYA 1U94A 1KO5A 2QRZA 3D3QA 4B2LA 2A78A 2EVWX 4NCIA 4IVRA 1IJFA 3RRMA 1KI6A 2P5TB 2ZS8A 5J40A 5JJLA 2V3CC 4MRSA 5EZ6B 1OF1A 1VMAA 3F8TA 2KI5A 3D7MA 1KNQA 5TV2A 4ILEA 2FZLA 1FZQA 1ZMXA 2VO1A 4D0GA 5BW8A 5KDDA 3H86A 4HAUA 1G4UR 2BKEA 1XPOA 3AVTA 1QHNA 2BJWA 2Z6VA 1NBME 3QXSA 1DO0A 5DN6A 1VECA 1P9RA 2CHGA 5FL3A 3W6NA 4QOSA 1T8UA 2BDTA 2P6NA 4DLVA 4DRZA 3EPJA 2AFIE 2GDJA 2YOHA 2G3YA 5DN6D 1I4LD 4Q7KA 3WRYC 3LBIA 3C15C 1DAHA 4HB0A 2XNDD 3B85A 1A5TA 5FFMA 2ERYA 4O3MA 3LLUA 1XTSA 2C04A 4A0GA 4GZLA 2ZR0A 4NCKA 4YMWA 2FPMA 5JMTA 2ZXUA 5DI9A 1NSTA 2F43B 1KI3A 3UKDA 4CIDA 1R7RA 2ZRPA 2I3BA 4LJ7A 3LXRA 4R2IA 3EA0A 5IT5A 1JXMA 4DXAA 3CO5A 1H8EA 2O8CB 2GZAA 4QHYA 1CP2A 2WMOB 4AURA 1KKMA 1H8ED 4UNSA 3A4MA 5FBRB 1SVIA 3QG1A 3D8BA 1M7BA 1E2DA 4UJ3A 4N0EA 5CM9C 4YC7A 4Q4JA 1P75A 2X2FA 4NYIQ 2WBLC 4TYQA 1DG3A 4TN1A 4KAXA 3GLFA 4DCUA 2BEJA 1N6LA 1XPRA 3U3MA 3ADKA 3LA6A 5AUQA 1N0UA 1SULA 2NPFA 1E1QA 4IRUB 2WIAA 2YINC 3BH0A 5HZKA 1E2QA 1MH1A 2EYUA 4W5HA 1E1QD 3VKGA 1U8ZA 2G0TA 4FXPA 1Q20A 2YYZA 1N2CE 1AKEA 1S1CA 4P31A 3WNCA 4B43A 2XITA 4CGZA 1P7CA 1JQLB 1S9DA 3EA5A 1KO8A 4R2HA 1F2UA 3QIAA 2HV8A 1RRFA 4DLZA 5KPDA 3EARA 3HR7A 5HE8A 4CEHB 4HYYA 2ZSFA 1YVDA 2CL6X 1XX6A 4KJZA 4DEYA 5EP4A 4Q00A 3QVVA 2IS6A 4XTCS 5JWOA 2DY1A 3FDIA 2GXSA 5K8TA 2DWOA 4OK5A 2NO0A 3ZVMA 4V0MA 1XWIA 1W47A 1MKYA 2IW3A 3EZ9A 1Z63A 2ZPTX 1F48A 2KBFA 4DSTA 3FMOB 2ZJOA 3JZMA 3MGCA 4IOMA 5F2EA 1E0AA 5C4MA 3GLIE 1HQYE 1W4RA 3EZ6A 1E2JA 1E9AA 3REFA 1U0JA 2RH5A 4QNMA 5HTKA 4QHSA 3ZZ0A 1G7TA 1OE0A 4BZQA 2AR7A 4JL6A 1DAMA 4I1SA 1U81A 3K0SA 1ZC4A 4Q66C 1GIAA 4TLEA 4NU0A 1DBSA 1KHTA 4NPHA 2W83A 1E2LA 1W0KA 5P21A 1KO4A 5JFGA 1OH7A 2N46A 1RRGA 4HB3A 3L0OA 2OV2A 1TADA 2F3RA 4HUTA 4DCSA 5G3YA 2FFBA 2IUSA 3I8XA 4E03A 5CB6A 1FUUA 2OLJA 1GKIA 1YU9A 2UKDA 4KSBA 3RS2A 1WDTA 1WQ1R 2W2VA 4KFTA 1IONA 5KYKA 2V55B 5AUPB 2C98A 3QUSA 4KYUA 3W6OA 2R6AA 5J4VA 2KB0A 4RD3A 2YKGA 4JLNA 3RANA 4Q4LA 3AKEA 4FIDA 4EKDA 4LHWA 4OL0A 2IYQA 3S1AB 3NDBB 5FOWA 3QJYA 2EFCB 4MDFA 3EAQA 2WMNB 3GLIA 2VA8A 2VYFA 3G5UA 1QDEA 4O2RA 1SXJC 3IDQA 1EFRA 5CDFE 3RC8A 2GCNA 2ZITA 1E2GA 4YMTA 2O8EB 5CB8A 2GJAA 1EFRD 4KLZA 3B1YA 4F4CA 5HPYB 1OFUX 5EP1A 1G64A 1E9SA 3ZD7A 1JB1A 5JEEA 2BMEA 1YZKA 3C5CA 1ZINA 1P3JA 2QPAA 1N6OA 1P2UA 2C96A 1ZAKA 2R2AA 2JLQA 1EFUA 1L2TA 2QSZA 2Z5FA 1K5DA 4CEIB 2R6DA 3BJIC 1D9XA 4QGAA 1CR2A 3I32A 1DTSA 3I3SR 1G1MA 1NIPA 5D3QA 2GZDA 3RAPR 3CONA 4YDHB 1OT3A 3OFNA 4TQUS 2O52A 2HDNB 3EIEA 4OJQA 4ARZA 2CCJA 2PZFA 1KOFA 3OFND 5E7JA 5C18A 4OHZA 1WB9A 3BK7A 2B6HA 3F5FA 4NCNA 5BYJA 2VSFA 2W2TA 2ZVQX 2GCOA 3QPVA 2CCGA 1L8QA 4D82A 3OZXA 1JXOA 1W36C 3QI2A 1Q21A 2P6RA 2Z43A 4DC9A 2B21A 2EFGA 2DCUA 2FN4A 2UZIR 1WBDA 2WZQA 4XVUA 1A7JA 2VHTA 1X1SA 3V4FA 4RY2A 1FMJA 1G8HA 1E2PA 1Z2AA 1NVWQ 4Q21A 3A4LA 2A7QA 1T0HB 4FWTA 3GJ8A 1R0XA 1ZD8A 1XD2B 2VSXA 1JALA 5J4LA 3QPWA 4BPBA 4TL7A 4MDEA 4ZKDA 2A3RA 2BVNA 1ESMA 1HH4A 1FW6A 3M6AA 3U3OA 1SXJA 2YWFA 5FBQB 3AQ4A 4B35A 1Q57A 1RJ9A 4JVMA 1SXJD 4DJTA 1U8YA 2ATVA 2QBYA 1JAHA 5H1YA 5J4HA 3U3KA 1AS0A 3FHOA 3K8YA 4TLAA 3ZJYA 3T1QA 2ZU6A 4MYUA 1TQ6A 1N5KA 3U61B 1LTQA 1HQCA 1TU3A 2V1XA 2FPLA 2XOKA 3E70C 4IVQA 4QBHA 3CRW1 4RVCA 2VF8A 1EXMA 3IILA 2XOKD 3Q5DA 3SEAA 2WTUA 5FUWA 2J1LA 5C4GB 1E3MA 4TLCA 5JJKA 1ZNWA 3K0EA 4Q1BA 2CE2X 3U6BA 2PL3A 3T06B 5FUYA 3O8DA 5JRZA 2ZR7A 2O8FA 4MGYR 3MWYW 4NH0A 3SFVA 1UBGA 2V6IA 2PX3A 1BYUA 1NP6A 4EFNA 1G6OA 4C2UA 1XNJA 4IVPA 5CITA 1VG9B 2F3TA 1TQ4A 2R9VA 1F2TA 1W36D 4P33A 4HB4A 3BERA 3C7KA 4LC0A 2BBTA 3ND8A 3GJ5A 4Z8YA 1S4QA 3TAUA 2V8OA 4NE2A 1A1VA 5E4FA 3EPLA 5TY0A 4DCNA 1W48A 2XZPA 1XCMA 2ZROA 5H70A 4NMMA 4IFEA 1KY2A 2XAUA 2BKUA 2D06A 3DZDA 1Z6TA 5FOXA 5BQ5A 3TR0A 4E5UA 3THYB 2A9KA 3CWZA 2H8KA 4OK6A 4Q18A 3W8NA 3KQNA 5JRJA 3ADCA 4NDZA 3IPXA 3EPHA 3VKWA 2W58A 2AXPA 2IYWA 4MKHA 4EJSC 2IXFA 3EIHA 1DELA 1TF7A 4QBGB 4XWKA 2QP3A 1KDRA 1K5GA 1KSFX 2EU8A 3B8HA 1CTQA 4RSGA 4A8JC 1TPZA 3BWDD 4Q1FA 4FW9A 3PENA 2GXQA 5DO9A 5E7IA 1AN0A 5EZ5A 1Z8FA 5HCNA 1ZM4A 3IUYA 5K8IA 1E6CA 3LO5A 2HF9A 1S96A 4JLOA 3WYFA 1MO4A 2D2FA 2R6GA 4IDNA 3QKTA 4U02A 4DLSA 1PUJA 3QVUA 4RD6A 4RD0A 2GXUA 2ZRFA 2ONJA 4B3BA 2QORA 3K9GA 1D8TA 1EG7A 4M8NE 4YQFA 3I5YA 3ICEA 4HAWA 3MAAC 5FOUA 5CIWA 1XD8A 4TL8A 4H1UA 1E9RA 3NIBA 4DIEA 4LBWA 4MRVA 2ZSBA 4QHTA 3DM5A 1VCOA 2ZUBA 1E98A 4OQNA 4ASUA 1R4AA 4L16A 3Q7QA 5JZVA 2BCGY 2KE5A 2V4ZA 2F43A 5AR1A 4ASUD 1DADA 2CCKA 2GF0A 1TL7C 3CUEF 2GK7A 2H17A 2XEXA 4BE7B 1SKQA 821PA 2Z4RA 1BMFA 1VG1A 3LY5A 3FFAA 1Z47A 3E1SA 4YDSA 2ASEA 2O8CA 3UK6A 2A30A 4IXMA 1YZLA 2TMKA 1BMFD 4WXPA 4TSFA 1E2IA 2PMDA 4XWOA 2HYIC 1DAKA 4LV5B 3RDPA 2FX3A 4TSFD 5FR1A 1ZM2A 3B1ZA 2HJGA 1FUKA 2IYRA 1Z0DA 4IOLA 4F4JA 2WV9A 1Z6XA 4NYIR 3MG9A 4LYHA 4U5XA 4HAVA 1L4YA 3SQWA 2PT7A 4ZDJA 3TGPA 2ZQ5A 4PC1A 3QEOA 5L3VA 3GEEA 3U4QB 3IO3A 3W6PA 1TF5A 5UKDA 2HT6A 2GESA 3IIKA 1S0UA 4MGZR 5JI2E 3T1TA 2CHVA 3IIMA 4B32A 4PANA 1RZ3A 2GVDC 1H65A 3TE6A 4C0JA 1MO5A 1G8FA 2ZTSA 2OZEA 3UIEA 3W9YA 1G21E 4A1FA 1G3QA 1O3YA 4A0FA 3MUFA 3IBGA 3CX6A 4HEJA 2XXAB 4TT3A 4C2TA 3SQXA 4CEHA 3H4MA 1ZU5A 4GPTA 3KKMA 1OB2A 4TT3D 2HYDA 5JSZA 2E9SA 4FMDB 1NLFA 5AWFC 2WAXA 5KPJA 4LCBA 1ZM9A 5E95A 4PPFA 1XB2A 3GJ0A 3F0TA 2OSBA 1KTVA 5L3SA 1OLOA 3UPUA 3LV8A 4ZCMA 1TF2A 3FB4A 5KNCA 1I2DA 3VFDA 5KSOA 3ZS8A 4ESVA 4M9QA 1XZPA 3MJHA 2IF0A 3OIUA 3E2IA 3QKRB 4I81A 1E2KA 2ZRKA 2NMVA 2JCSA 3AF3A 1QBKC 3VX3A 1FP7A 2FFAA 3UG6A 5F9HA 4XVQA 2MMCA 3IO5A 2FDCA 3CNNA 1P60A 2MSCB 4GOKA 4KV9A 3EXAA 4DDUA 1DS6A 1R0ZA 2BJVA 5GJBA 5M04A 2ZSDA 2Z83A 2ANCA 2RGNC 4CEJB 3ADDA 2J0VA 2BM0A 4KVGA 4B74A 4PZYA 2IYXA 4PO8A 5GADl 2QN6A 2WWXA 4ZPXA 2QMOA 3THWB 1S1MA 3QY0A 1QRAA 1ZJ6A 1CRPA 1I4DD 4Z1MA 4PHHA 1N25A 2OLKA 3LBHA 2FU5C 3WYGA 1EFHA 4JLKA 1JR3A 4Z1MD 4QBFA 4FINA 2EQBA 1DE0A 1I4TD 3IKJA 4X8HA 1QHHB 3FHTA 1JR3D 3BRWD 3C14C 4V0LA 4D4LA 3TVDA 1HY3A 1XRJA 3I5XA 3U7FB 5AJWA 2FEOA 4F4IA 2JLYA 4O2LA 3GLIB 3L0SA 3ZS9A 1RVDA 2PZGA 4ZI3A 2GJKA 1TUIA 4HLDA 2B8WA 2B7BA 2MSDB 2OBLA 1SHKA 2ZI4A 3A37A 4JLBA 5JJIA 1KK0A 3W5IA 3EG5A 3CPJB 4QRHA 3S1AA 1IY1A 5JLJA 3TJZA 1FTSA 1N5IA 4B6FA 4ESHA 1T4GA 3FWYA 2HF8A 3BORA 2DR3A 4U00A 1UF9A 1UKEA 2ZIAA 4KXFB 3NHBA 4QL3A 2O8EA 1V5WA 2E1RA 3GJXC 3D31A 2VQSA 4JSYA 1GWNA 1W4CA 2WOOA 4CZ2A 4PO1A 5FTNA 1EGAA 5SZJA 4Q1DA 2XTMA 4O0MA 1JEDA 4EQ6B 2O0HA 3SYNA 3CLVA 1Z6GA 4ARZB 3OESA 3NBZC 1R5BA 1OHHA 1ETUA 4M9XA 2QT0A 2MSEB 1KMHB 4LJ5A 4IDHA 4CEIA 1JQJC 1FNMA 1OHHD 2R8RA 4DBLC 2RB4A 2VHCA 2PEZA 3KXKA 1F60A 2OFXA 4KITB 3PUZA 621PA 4BQSA 4LDJA 1TQDA 2RGGA 2YJTD 4LHVA 1GFIA 3UWKA 5BN3A 2BIFA 4BLRA 5EQTA 4JBYA 2NZ8A 1II0A 1AGPA 2IEZA 2QM7A 4R9UC 1ZBDA 2J46A 2GCPA 1JJ7A 1E9CA 1G4AE 1E9FA 2ZETA 5LB4A 4L5BA 1OXSC 4N0DA 2BMDA 4MH0R 2H18A 1R10A 3MLEA 4M4SA 4P4SB 4DLWA 2G77B 2VIIA 3ONWA 4ZDKA 4GFDA 1SVMA 4MYHA 4B2PA 2CVHA 3CBQA 1KKLA 1XD2A 2GZHA 5LDDC 2NQ2C 3LVQE 2ZI6A 4FMBB 3TK1A 3DKPA 4HDOB 1W4AA 2PEYA 2V7QA 3RS0A 5HR5A 4W9MC 3KXIA 3WHLA 2FV8A 2J7PA 1VPLA 2V7QD 4NCJA 4PPGA 2JLVA 2J7PD 5KDOA 2IYZA 4XD7A 4US2R 4PX9A 3FPAA 4RKFA 4POAA 2BBSA 3QF7A
chains in the Genus database with same CATH superfamily
5CD9A 4KRXA 1Z4LA 2PUVA 3G85A 3BB4A 3JYNA 4R8SA 4XD7D 1RTTA 4XE5A 3SJCA 3O74A 4K3UA 4HXYA 4MCIA 1WEKA 1X7DA 1MIHA 3LYUA 1T4BA 5DX8A 2ID7A 1I0IA 2YCBA 1OOEA 1Z26A 4H7PA 4UNQA 5EUMA 4YP6A 1L7XA 1QBGA 3G5TA 3U9TA 4PR3A 2D4HA 2L18A 2YXLA 3DQZA 5IBCA 3NH9A 4C4ZA 2DPHA 4IPTA 1C8BA 4N40A 3LYLA 3MJFA 5EXTA 2LTAA 3H75A 4HAOA 5LMNB 3HBLA 1NI3A 4PYIA 5D1NA 5JS7A 3TCKA 3KB2A 2ZT7A 1SCJA 2QA5A 1XEXB 3OZFA 2W6MA 4RPJA 4YT2A 1NPTO 3FOBA 2GKGA 5KVCA 1F2TB 4WCFB 3BIXA 3BXXA 2PS1A 1H6AA 3UWOA 1ZEMA 5CA1A 5DBGA 5EIBD 4L5IA 2PX6A 2ATCA 4V0OA 1M8JA 5BSEA 4UHEA 3L0YA 3A3YA 3B9PA 5GVRA 1EYZA 4KN9S 3RS3A 3C3WA 1XVLA 1CPYA 1Z2DA 1HOXA 5HCUA 2GJSA 4EW3A 1G9SA 2A9QA 3TDKA 1L3BA 3DTVB 5CYPA 4D6PA 4O59O 4B5LA 1GL6A 4P83A 4M0DA 2C5HA 2XTZA 2Y76A 3H83A 3O2JA 4HADA 2AR0A 1U4NA 3DQPA 1VQ1A 3CNLA 1XZLA 4RE5A 4HWTA 3L7JA 1XYVA 2UXCB 3Q7PA 3LPMA 1CUWA 1ZA2A 3MOGA 4ENVA 2IXTA 3KZ1E 2WZCA 2RGEA 3F98A 3FPSA 2FUCA 2F6RA 3HA2A 3NOXA 4Z0PA 1K6JA 1LQUA 3DHWC 2GK3A 3V42A 3ZZTA 3R3ZA 4Y7CA 5J47A 1S2MA 2C5SA 2AB0A 4B81A 3OP4A 1MB3A 2CXRA 4TUYA 3ZE8A 2IY8A 2ODPA 2JBWA 4ZANA 2GZRA 3QLVC 4RMJA 2NAPA 3OKAA 1NP3A 1AVTA 2M98A 5DCUA 5LD2C 5DNEA 1IB0A 3O8BA 2QX4A 3WB1A 3FBGA 3OTGA 3LF2A 1FRFS 3DWGA 1Y4AE 3FAZA 2ADFA 2R8XA 3PKZA 5ERGB 1PWZA 3DYVA 3H4VA 1JKJB 2V0NA 3PT9A 4YV2A 4HF7A 5CYGA 3P97A 4OA8A 1IN6A 4KMRA 3WL4A 1GPBA 3G2KA 5EI5A 1KAGA 2PL9A 4IKOA 4H3VA 3JWJA 5JY6A 1TW3A 1Z8HA 1AJEA 1QJ4A 2M1XA 2A5FA 2WG0A 3I2FA 2QRUA 3L40A 4LZAA 2ONCA 2ECFA 1KSHA 4QX6A 4R8RA 2EQ5A 3HN7A 2HPVA 4DJDC 4TV9B 4C7JA 3O83A 4LJ9A 4RPCA 1HTTA 2H16A 1PJ2A 4KFSA 1ODIA 5DLYA 4BNWA 1D2RA 4OSOA 4C1NA 1KAOA 3OSZA 2NYRA 1QIGA 2MSKA 1Y5LA 4WAUA 4DAEA 4B6RA 4LQLA 3BA6A 2YQ5A 1PJBA 4IMIB 4BEVA 2IX9A 4QUBA 1NN5A 2OBNA 2XUZA 3EGOA 1UBNA 1PT5A 4AJIA 4A82A 4FYKA 4QQ8A 4CIVA 4NBSA 2Q45A 5E6SA 3ABZA 4HPXB 1YV9A 1XFAA 4XM0A 5D6OA 5H3LA 4KQGA 3LX5A 4HGYA 3FYUB 4JN6B 5F35A 1OJLA 4DY6A 3RF6A 2JVIA 4HDNA 2P2LA 5CBPB 3FOAA 5JANA 2E5LB 2CJYA 3GJQA 4BV8A 3HCFA 4OQEA 4HDKB 2NOAA 4QBIA 5DYIA 4XIFA 3DPUA 2PGLA 1ZOIA 4LY6A 2XIQA 5JDIA 1E6KA 5CNIA 3OE1A 3FPJA 3B51X 2B6NA 2C1EA 3G9ZA 3SEFA 1J2EA 3DL7A 1QTNA 4MS1A 4XGKA 1KFKB 3GRZA 4DARA 1PX0A 3BYZA 3SD7A 2BGTA 5JYEA 4ETMA 3WNZA 1FX0B 1WDWB 1G5PA 4HX5A 3ZHXA 3OT5A 1YKGA 1KVRA 1YS9A 2R44A 3JALB 4TS4A 3U4QA 5GIOE 1IZ9A 2OM2A 1WXIA 3ROKA 4MJ7A 4EHBA 2KPOA 1WWKA 3O4JA 3BH7A 3BS4A 1Q7BA 1KAEA 2EGHA 3ELUA 4BNFA 5KX5A 3KKLA 1SOAA 3MJVA 5KYGA 2W98A 4C4PA 3IDOA 1MC4A 2YFHA 3L7LA 1KYIA 1C9NA 1NVXQ 2EFEB 3FE2A 2B36A 2P3OA 5ITSA 1YI0A 2XPCA 4K9SA 5ESDA 2VTKA 5KYXB 3OM1A 5L3SB 3EUWA 3LU1A 3LPLA 3MBOA 4UMDA 5JJ5A 3TGWA 2ZS9A 2E49A 1G3UA 2O0JA 3U1BA 1KMQA 3C3MA 5KQGA 4PLFA 2QV0A 2A3NA 1KBZA 2E5FA 1V8FA 1TMYA 3D6HA 3O6VA 2Q29A 3DOJA 3R7FA 1EESA 1VRWA 3O8QB 2Q8NA 3IPYA 1I3OA 4AXBA 3G6KA 2L19A 5FPQA 1UBCA 4YONB 3ONNA 3PVCA 2XE8A 4ALJA 1AS2A 3A1UA 2G76A 3ZBUA 1QH1A 4RS4A 3SQMA 2H2WA 4OU4A 2Q6KA 2YMLA 3DZJA 2PKRA 3QENA 1ZZGA 1DC8A 3PIIA 3C3PA 3LWDA 3CTPA 2A5YB 1U2EA 3PUYA 2JAUA 3KELA 1Q7TA 2Q3EA 1YB4A 3X1XA 2G40A 2PL5A 4H18A 2X4IA 3DTNA 5TS3A 3ZJTA 2JCGA 3AJDA 2P0YA 1T6BY 4BQIA 5HFAA 4PGHA 1J2JA 2ORWA 3IE2A 3KQUA 5F3WB 4JDUA 2MR6A 4ZI7A 3CSSA 4CEJA 2AWOA 1O0BA 4J0EA 2RJOA 1PT7A 3AH8A 1BH6A 2R7MA 4OI1A 3WGJA 3R75A 4CUKA 4UPEA 2ECOA 1V1JA 2EBUA 4I6EA 4MW9A 4TWBA 1TA9A 4DLRA 3THWA 5BW6B 2IBTA 1E5QA 1YMQA 2QW1A 3ZPXA 1RXIA 3JQEA 3SJAA 3CRVA 3LT4A 1IJBA 4GE0A 3AV3A 3WIDA 1G8KA 2OCDA 2AMJA 4TRNA 4Y2TA 1U2TA 5G0SA 1Z56C 2VP9A 3H5OA 4RFSB 2RI0A 1MJFA 2VRCA 4UHFA 4BECA 1WXDA 2QYTA 1P2BA 1JIJA 2QVXX 4Z7OB 3BE4A 4KLRA 3TM4A 1JXQA 2B5VA 4Q7LA 1PIWA 1TO1E 2AJTA 3TQSA 4OHCA 1U9IC 3ASZA 3FF4A 1D09A 2P30A 2DUNA 2OD7A 1XV5A 3A36A 1XN4A 3C2QA 1ZIOA 1IRXA 3DHYA 3KKPA 5FPHA 2MT9A 4KXYA 3RU9A 1PR4A 4BO4A 3I05A 4DR7B 4NG5A 3W34A 3KL4A 2BSQA 1X8LA 1ZH6A 2P2SA 1UMCA 1C7ZA 4KHZA 3LECA 4GZ6A 1K4KA 4TV8B 4YDRA 4ZQBA 4J43A 1DHRA 2GEDA 3W3AD 1Y6RA 4L07A 3BMNA 4QYIB 1AKNA 5COBA 1EFDN 4LFCB 2ACEA 1Z7YA 5DHQA 4FHCA 5KCZA 3SGLA 3CLTC 2HFJA 1FJXA 2VXOA 4B85A 2XQJA 4H1VA 4EKEA 3TLEA 3ANMA 3MJSA 4OGWA 1JBKA 2ZW9A 1BA2A 1YRQA 1B0ZA 4LBYA 5G0WA 3GBVA 4RTSA 2UZ0A 1EAMA 3VDRA 3DD5A 2FGKA 1RYHA 3UHJA 1XZAA 5LBTA 4A6XA 4G0YA 3OQIB 3FKJA 4QYTA 1LCIA 2FFQA 2ZR8A 4MINA 3E9YA 4BFVA 1YHNA 2DFNA 3BMXA 3OPQA 1E94E 4KXUA 4PQRA 3FA2A 3GUCA 3B82A 5KMGA 4FLEA 3D4IA 4OG2A 3QE0A 2XDQA 1EM6A 4P7GA 5T4HA 3NT4A 2WHXA 2HRQA 1RBZA 2QP4A 1V37A 2Z9BA 3DT8A 3K5PA 3PJRA 1C29B 2WSSD 1UH5A 1U2SA 1FRZA 4BNTA 1V1RB 4L5CA 4YCJA 4XYLA 4PHTA 1R27A 1WV0A 2VT6A 2WF5A 4IG4A 4KVZA 1KI7A 1R4ZA 3AB3A 5J2TB 1BXKA 5IDWA 1OFUA 2Y66A 4KO4S 1OGYA 2FTKE 1E2HA 4BJ1A 2NUPB 3Q5EA 3RRNA 3S3TA 4JYBA 4FEAA 2UYGA 2PX5A 3NTRA 1MO3A 1A9PA 2REQA 2WNHA 2X14A 2ZSIA 4HN4B 2C9MA 3PEVA 5EWMA 2R1VB 3WK4A 2EARA 3K0FB 1EE9A 1H2AS 1JE1A 3NUGA 4O4LA 4BV2A 5AJYA 2P90A 3DC7A 4LYJA 4IUBS 3KOXA 2GLTA 4IKEA 5ERYA 4QEZA 3RIYA 3WHIA 4CM9A 3S81A 2PJZA 3IEUA 4R69A 3A8TA 4ZVPA 3JVEA 1DXOA 1I4OA 4PBRA 3WRWA 4CL3A 3CCBA 1M6WA 4FCVA 5JZBA 1Z39A 1PG0A 1O1YA 4IVNA 1YB5A 4RSRA 4QTXA 4RH1A 5CFLA 1UOEA 3UBTA 1LZKA 1TD9A 1JI3A 1DRKA 4KQ6A 4KOAA 3BQMB 2P2NA 4RGVA 4UU7A 1Z4IA 2XCIA 3PWSA 5AKKA 3N28A 1SBTA 4EFDA 4FN5A 1NNEA 5B4VA 1QP8A 5ALYA 4OHYA 4LKRA 4S1TA 4UARA 1NZJA 3WIBA 3STUA 1RRCA 2PSDA 2F2TA 2AOUA 1AUOA 3R9IA 4IUDS 4NE9A 4TTPA 2F1OA 4A23A 1KMMA 2A5GA 1SBIA 3WGNA 3ZY3A 3O75A 4WW0A 1NLMA 3GFBA 2PGXA 5KSPA 2JGIA 1SEPA 1D0IA 2RGAA 3E81A 2VJCA 1N0WA 2LE0A 3KYBA 1EA7A 4K26A 4Y98A 3T7EA 5CXQA 2IZ1A 2FDRA 3IVMA 1Q74A 1RCUA 3AUAA 3FHLA 2CJPA 3QXJA 3CMMA 4IYJA 1KFCB 4X7PA 2A7XA 2VNSA 3C3KA 3KLNA 1AV7A 4M1OA 2VSYA 3U4IA 1GYPA 1U1IA 1NTOA 2NG1A 3OLQA 1M6VA 4LDAA 3LQ2A 5LP1A 2AE1A 1WCWA 1Y8ZA 1YR3A 2J6BA 4FX5A 4QEKA 5EL0A 1W96A 3P9ZA 3CKYA 1RLMA 3L8FA 1QZUA 4DZZA 2OOKA 2O2SA 1YB1A 1ZPDA 4F1KA 3G0OA 3CZ9A 4JELA 1IZ8A 3VU8A 3LOPA 3OQPA 3OX4A 3X1KA 5CDYA 2CLCX 4N49A 2Q6OA 4O4HA 4QGFA 3FUWA 3FIUA 2FUKA 3T3PB 4CMJA 1Q11A 4D6YA 3OEWA 5FQOA 3RRFA 4E51A 4YJHA 4HZIA 1U8UA 4AXXA 2LNDA 3TSWA 3FYUC 3RRBA 3OCJA 3O4GA 5KVVA 1R9GA 3BWBA 1E1RA 2FQQA 2LBPA 4MXDA 5LA6A 4REQA 4B48A 1W87A 4DLTA 5T3UA 3BAFA 1O6CA 3EVTA 3KU4A 4ID3A 5I9IA 5JXIA 1IHDA 1K7CA 2YWHA 3ITNA 4PHGA 1IFXA 1GSAA 3HB4X 5E3IA 1ZD4A 4PTLA 3B70A 4ZOBA 3DWIA 4L4ZA 1N9GA 3V32A 3SYKA 3VNVA 3LRXA 3QF4A 2WQZA 4XIIA 3SZRA 1TT5B 2ZI3A 4G8CA 4WLEA 2Q8QA 3BCSA 4UHBA 4HDSA 1M2OB 4B3CA 3PLNA 1PNOA 4G1UC 3TQQA 3C5WP 4URYR 1G41A 1GRVA 1LPOA 2G9QA 1ZKDA 1P61B 3BMQB 4G5XA 4BMNA 2H1HA 4G5HA 4GPEA 4K6OA 4N41A 2I4TA 1E0SA 1CEXA 4FE3A 3MINA 5JUWA 3GMSA 1N2EA 4X61A 2YXDA 5EP2A 3CW9A 5EGNA 1S8FA 2P79A 2PT5A 3L3BA 4CE6A 4FFVA 4XD2A 4FU0A 1PFUA 4NMWA 1GPWB 1KMNA 5E6SB 1EQ2A 4BX9A 1QG2A 2R48A 2GQ0A 5DPMA 1JHDA 2BHTA 1O8CA 2EG9A 2XB4A 1Y6ZA 3L6EA 4GMDA 1EIZA 4PZDA 3KKNA 1YQXA 2J9FB 5JAMA 3QUQA 4U0KA 1PSDA 5HUQA 4OH7A 3CZMA 4ODIA 4RHUA 2QX9A 4LMPA 5FWXA 4LF4B 2FHSA 2I2AA 2CBZA 4MQ6A 3RKRA 3TLJA 1HE8B 4OHXA 4EJSA 4S3MA 1OYYA 1KAHA 3EVNA 3FRHA 4M89A 1F5SA 2Q5FA 2W4MA 5GONB 4P84A 2ZCJA 1B14A 3EMBA 3KLMX 4MUBA 1CFZA 4Q9LA 5HCIA 3SR0A 3CIFA 5CJPA 1CHNA 2NZXA 3UKOA 1ZO8A 2PSEA 1SKYB 1ZIYA 3OLYA 2PA3A 4X1IB 2WIBA 3G5MA 2Q41A 4U7GA 2YHUA 1ECPA 5K3FA 1KWKA 2ZVJA 2XMQA 3AR5A 4JVOA 1QV6A 3VMMA 5BVHA 2OXRA 3VTKA 1FMFA 1Q3TA 5CVUA 1Z28A 4J7XA 1DIBA 3PG5A 4FKZA 4DLNA 2R8YA 1A27A 2ZRIA 3RVPA 4P7JA 3ZNPA 2BF4A 4CVNA 2C9ZA 3IUJA 3IT3A 2PT6A 2X9VA 3K6RA 4G56A 1G8MA 2C2YA 2RMKA 4TMWA 4TZKA 4UUMA 4C08A 1B43A 3DMTA 3JSXA 4QDJA 5HDBB 1JAIA 1S6YA 4UDOA 5F2NA 2J6HA 3A9WA 5DEIA 4D98A 5K2OA 1MUUA 3RKSA 4N3AA 1OWLA 3HRKA 2Z30A 4PGAA 1CCWA 1VLJA 5HUJA 1H22A 3MIZA 1W34A 1ULSA 1WD5A 2FWAA 1FFGA 2P11A 2YUIA 1F7VA 2YVAA 4LPKA 3R7SA 4O1MA 1HZZC 1VL5A 3GH1A 4GP6A 3HLKA 4LDZA 3PITA 2JIZA 4K5QA 4JOQA 4X3CA 4J9UE 2AEMA 2X7HA 4WZBE 1XQVA 4F12A 3L4BA 4I9FA 2QI9C 4PSKA 2WPNA 2QG4A 2VPPA 1JJBA 3NKLA 2P6UA 4MKFA 4F45A 4JC5A 2PMFA 3KJZA 1GQRA 1T2CA 2QMYA 5TQ0A 5L40A 5J2UF 1E1CA 2NUTA 1C8KA 4MCJA 1N1GA 2WICA 2FW8A 4K1XA 1A5ZA 2B94A 4H7KA 2XT9A 4X97A 2ZIVB 2A5JA 4OBEA 2PV0A 3BHNA 5CBKA 2H6EA 3A4YA 2I4LA 1PLLA 3QHAA 5HZHA 2VQFB 4AJPA 2Y4OA 5ADWA 1DT5A 3ZXSA 1YZNA 4E09A 2WVJA 1WF6A 1VL1A 3RFXA 3G8CA 1AHPA 5BSGA 3L8GA 4JP5A 5CDSA 1EFVA 3R9XA 1ENPA 1IBRA 4DIKA 2YV5A 3ORRA 2QTBA 4Z5XA 4UKDA 4BRUA 3USES 1ZM7A 4JC4A 4L4YA 4EO9A 5BW4A 3S8EA 3EPRA 2D0OB 1WZUA 2EX4A 7ADHA 1U8CB 3NHKA 4NF2A 2XMZA 4TLBA 3DBIA 4XAQA 4ROSA 2ZM6B 1SUDA 3EF1A 3GR6A 3JAWA 1G8AA 5K20A 2I87A 1YO6A 3T9DA 2W2KB 3IJ5A 5EESA 1AGRA 2CHFA 2QZSA 3K72B 2FOLA 4ZD6A 1EE1A 4IIGA 3U3DA 3W9SA 4FIZA 1OI7A 3EZGA 4QQNA 2F1IA 1JYFA 2YX1A 2QUJA 5ALDA 1UMCB 2QW8A 5AKJA 4EVIA 1FFYA 3RRZA 4MV1A 4URFA 1MAHA 2ZKLA 2HBYA 3EOZA 3GB9A 3IERA 4B83A 4MPDA 4B71A 1CRQA 4MNTA 3EZFA 3PXCX 4BOYA 4DG5A 3MTBA 3BJRA 1D4AA 1TM3E 1P1IA 3GP8A 3A1CA 4J49A 2C2KA 3JYLA 1U2ZA 2IHZA 3GELA 4WNCA 1CS4C 3JQCA 1M66A 3N39C 1WCYA 2CZCA 4OHPA 2X0KA 2W6JA 3EHEA 3R0XA 1CLUA 5K6AA 2ZTLA 2Z5LA 2P67A 3IHWA 2CE7A 1ZWKA 5AW2A 5HVNA 1MV5A 1PK8A 1ZNYA 1IAVA 2RJNA 3DMFA 4W5QA 3VVBA 3HA5A 1DJLA 4AZWA 4C0BA 2HPHA 2XJ9A 2WWGA 3UZUA 1TGVA 3EVDA 1VG0B 4BNDA 1A4XA 5CIQA 2CEKA 3B7GA 3QVOA 2XDQB 5DNWA 2SHKA 1DL5A 2K5UA 2REOA 3D2CA 3B3GA 1UT5A 3ZHSA 1Y1SA 2H7VA 4LHSA 2QLTA 2QNBA 5EJ5A 2ZIXA 2R1ZA 1N34B 1JTFA 4CW7A 2W6NA 3FXAA 1TRKA 3C4JA 3DG9A 3R5XA 3R76A 3ZWNA 1LNQA 4UHDA 4KGZA 1RWBA 2WF6A 3V2UA 2UZ4A 1V7QA 5ALJA 2BFDB 3E9EA 3IULA 3BBLA 3U39A 2FXVA 1IOVA 2AC4A 4LK3A 4MR8A 3R3VA 5TGZA 3VTAA 4EECA 2C61A 3JV7A 5DXJA 3I52A 3U3XA 2EKBA 2GZMA 2H92A 4L9AA 4W8OA 3IT1A 3SIRA 2LV8A 2ID9A 1V39A 2REQB 5A0FA 1XXHE 1T3SA 4UMFA 1RNLA 3D0QA 3FVVA 2KLBA 1ZVQA 2JIRA 3NIFB 3E48A 5B1IA 5A7HA 3S1LA 2H2GA 1R0SA 1U3WA 1KC3A 1QTRA 5FBWB 1MOPA 4F9TA 4OLFA 2HY7A 4Y30A 4I9GA 4CDRA 5TS2A 3CCCA 3Q87B 1FQJA 2AXNA 5TQJA 1MHTA 1VFNA 4JJZA 1R5NA 2VJLA 4FFDA 1CNEA 3I2HA 2UUCB 5AK4A 1GN9A 3GBPA 2FB9A 1ZSVA 4GEGA 2GYYA 5AKEA 3H2YA 3MA0A 4PQYA 2CLOB 1HYQA 2NGRA 5EJFA 1DEXA 1ORIA 3GUHA 3VYTB 1F3OA 4V0NA 5JS2A 2LW7A 3THOA 2CUZA 3C7TA 3I2GA 3ND6A 4Q48A 3L1HA 5C3UA 2I66A 4BVLA 1T26A 3KUDA 2QGZA 4FMCB 3ZYCA 1KGSA 4NZ9A 4UFNA 1R6UA 1ZRMA 3R8XA 2JJ2A 3IELA 4AKEA 4BN5A 1T8TA 3QWAA 1Z5ZA 5F2OA 3GEIA 3VSCA 2XB6A 4AI6A 4JFRA 2BELA 3EWNA 2RGDA 1K2WA 1K08A 1EUZA 3KM0A 1HEIA 4KK4A 4RESA 4PONA 1XVIA 3GCDA 3ID6C 3QELA 1Y82A 3PIRA 1PS9A 4YJ2B 2VPZA 5LBUA 3SJ7A 3OUTA 3M5PA 2ZRMA 4PZEA 3VDNB 3SM3A 5FTJA 1ZD3A 4K6HA 3WWYA 3VC7A 2GETA 2WB4A 1EUDA 1HRDA 4HH4A 5D3MB 4MIYA 1ZJZA 4YREA 3VSBA 5IJ9A 1X3LA 2DHDA 4KB5A 2WM2A 4WDQA 3TCXB 1L4UA 3TTXA 3S0JA 4ML3A 4U6QA 3IEVA 1H8HA 2HLHA 4ND3A 5KTKA 1M2NA 4MCHA 5C7OO 3CLSC 4P0TA 5CXXA 5LWQA 3DMNA 1FTNA 3KZVA 4XYBA 5DV9A 5FOQA 1APBA 3JZDA 3VU0A 1US8B 5JDCC 4GSKA 4JVSB 5H3CA 5HKKA 1AMNA 1W5BA 2VNIA 2W8ZA 4FZVA 1E1NA 2IT1A 2XGOA 1W9HA 2ORVA 5AHOA 2WU8A 3ROZA 2OLEA 4ZYXA 1TM4E 2W2LD 1A71A 2TSYB 4KYIB 2FMIA 4QUKA 4EEXA 2NUAB 3DLHA 4JI5B 3N7TA 5G0VA 4F3CA 1IAQA 2SKEA 3VR5A 6GPBA 3A6PC 3NYQA 4YXFA 3QVGB 1T5IA 3GRYA 4UTOA 2Q3MA 4HFJA 3AF2A 1ZH8A 4QYWA 3W7BA 4DMCA 4JUIA 1CT9A 2FKNA 4LYDA 2HDOA 3LC1O 3HHPA 4GZMA 5ITWA 1N9GB 4RM3A 1XEWY 4S1PA 4GLLA 1J90A 4RIIA 3UJ6A 1VSUA 1MQ8B 5G4KA 3HKBA 1NN0A 1RI4A 5DT9A 1A5SB 1OI4A 3JTEA 2Q2NA 4FWBA 2I2BA 1OPRA 4AJ2A 2Y67A 5B7QA 1NRJB 3W2FA 4DMHA 1X80B 3IAUA 3NEYA 1VG8A 1RADA 5CB0A 3WGOA 4YRJA 4XJTA 3ZU3A 4L2IA 2P65A 3MCAA 3O7MA 3IMCA 1L7DA 1DV2A 1QYCA 1WD7A 2EJCA 1ZNXA 4I66A 4J4TA 4W4TA 1JHVA 3KQYA 1RDFA 4YJ3B 3BE5A 5FBVB 4X20B 4ZCTA 5IP5A 5CFZA 1CUIA 1GUFA 1FFBA 4IR7A 4LDNA 1CS0A 1LLCA 2O6LA 1JECA 2PMCA 3Q72A 1CR0A 1ODJA 2O3RA 3S6JA 2C54A 1I3KA 3FBTA 1W1WA 4E3ZA 4TYPA 3PE4A 2Z9DA 4DYVA 3B6IA 4BP9A 1JHOA 1YZFA 2I55A 1PJQA 4JOSA 1UWLA 1KY3A 4FHDA 5I8PA 1YOVA 2XNDA 3AR3A 4RMGA 5KVAA 3WK5A 4W1SA 3V8QA 1GPUA 1WE2A 4GPBA 4QA9A 4YFVA 1D9ZA 1CHDA 1QYRA 4EDHA 4LEIA 1TIKA 3E3OA 3K70B 2JIQA 1TNDA 3MGKA 4G3XA 5ICGA 3MJ4A 1XEWX 2PCJA 4C9BA 3WV5A 2V7GA 3HCRA 1QO7A 3C24A 3N8IA 4XYMA 2C9BA 3ADPA 4OM7A 3U4HA 1UADA 2GTPA 2QUZA 1V11A 2SBTA 3COVA 4RKYA 4BKPA 3AVYA 1GPYA 4IDQA 7REQA 2FPOA 3GVCA 2DPXA 5BV8A 1Z36A 4HTFA 3KB1A 1Q1NA 2JH3A 4UULA 2H9YA 3VPBA 1RWWA 1ULZA 1CJBA 4MUMA 2G06A 3W79A 2C3OA 4B6GA 3BDIA 4FSHA 4LV6A 1DOZA 3BD7A 4IRXA 4NENB 3ND7A 3S2ZA 5BVHB 3QLVA 2V7WA 3D7LA 3OZWA 1X94A 3VV2A 4YUAA 4UAUA 4J1SA 4D9IA 1LBIA 3L0CA 2DQYA 3LRPA 1CULC 2HX1A 3IDFA 3NBYC 1KQPA 2QAGC 3F71A 1Y8AA 1PZGA 1CIVA 1RE1A 4NU6A 4UTVA 5AW9A 3GC6A 2PL1A 2J5BA 1UJ5A 3UAXA 4CI0B 4GXTA 3WLOA 1AX9A 1GFZA 4F2WA 5JHGB 5JARA 1EK1A 3SC6A 3R3YA 1QIIA 2ODBA 1XTPA 1IC6A 3T7SA 4F3NA 3B1JA 3I9MA 3E05A 1PR0A 4HQRA 1UBOS 2IS1A 3T9FA 4RZHA 1GITA 3F3KA 4QRIA 4I5GA 1FDVA 4G9EA 1GZ5A 4ZKEA 1QQ7A 1Z9BA 2B9EA 2P78A 2O4UX 1OKKD 1ZDMA 3KWJA 3U1TA 3V2IA 3QH4A 1PFYA 4Y7DA 5FV4A 1P33A 3RG8A 4JITA 1HQKA 5HIAA 4UVEA 1MORA 1GA6A 2E7ZA 3I73A 3AEXA 2JFVA 4BC0A 4Z2AA 1GAEO 1DKNA 2WKWA 3QX7A 4UVHA 3TR6A 3AXSA 3EXEA 3K9HA 3NETA 4NBKA 2ZBRA 1ZK4A 5H02A 3I9KA 4M1MA 3VYVA 4ZHQF 3OIDA 4KQCA 3R7BA 3KOOA 2F9LA 3WVNA 3UICA 3KLOA 3L4KA 3CPEA 2A33A 1OC2A 4TXMA 3ZV6A 1S3IA 1EUCA 2P2GA 1FNCA 3A1VA 2ZJ5A 2QAIA 3ESQA 4TVKA 5KYVA 3ZIDA 5HILA 3U44A 4P38A 2D2IA 5KTNA 3WE7A 1XK6A 3RYTC 1E3DA 5FWDA 3OUUA 2WWFA 2P27A 1JSRA 1SUIA 3ZQKA 5LIRA 3P9YA 1YS4A 3U7JA 3WLEA 3FMIA 2OA0A 4D0NA 2D5LA 2RBEA 2V6JA 2Z04A 3MWDB 4CDMA 4LSMA 3DUWA 4FGJA 5TARA 3ZEAA 5FWYA 4JWTA 2PWAA 3C8DA 2D1RA 4ECAA 2WWHA 5FORA 4FSDA 2UUOA 3FI0A 2Y0EA 2PWBA 3OE7A 4C6HA 5I9LA 4NJOA 4TVBA 3IBTA 1FDWA 2C1ZA 4WFJA 3M3HA 5I9BA 2H9AA 3OO0A 4NJEA 1CJTC 1SQ5A 4ESVA 3ZHCA 3WB9A 2E4AA 4BJ5A 3BXFA 4MRNA 4Q7JB 2RCNA 4L51A 1TVEA 3S28A 1T8RA 4IAOA 3QV2A 1K0UA 1KRHA 1ONNA 5E1MA 1LTKA 4NTZA 3G0HA 1FTWA 3TZBA 1SIUA 2E18A 4BKOA 3MPOA 5ALOA 1R12A 3W8EA 3DAOA 4J16C 2MYTA 5BRJA 3VJRA 3MSCA 3ERCA 1KWGA 2LD4A 4TL9A 5A5DA 1CY4A 4QXRA 1FLDA 1SZPA 4MA5A 1Q22A 1EVJA 5INTA 4ZT5A 4KRFA 3NBXX 1FW8A 4BZXA 1WXGA 2VAWA 1JNXX 4NBLA 5C1IA 3SN6A 3RIGA 1B7GO 1SQGA 1P6XA 2VJAA 2WT8A 3AUTA 2I0FA 3E9CA 3M0EA 5FCDA 1Z75A 1WSWA 2FMFA 3I9NA 3N0XA 3X2SA 1OIWA 2Q27A 4Q7QA 1S8NA 3CZRA 3PPIA 5GIPE 1RYEA 1VPWA 3ZUPA 4PS1A 2C2GA 1G20E 4XVCA 5JD4A 1KYQA 2YYYA 1RKBA 4NS1A 1VA4A 3P9RA 1RXEA 5CLQA 4BNDB 1ZMRA 4DIDA 1BVHA 4HX9A 3LIPA 5E1DA 1BOFA 1FVOA 1C81A 3NTLA 4UQLA 3CZ5A 4H6PA 4C0AC 2JCVA 5EJ2A 2QRQA 3TF5A 3D4BA 3O4IA 3MQ4A 2JJ1D 4J1NA 2PFSA 4L28A 1KU6A 4IGEA 4YH1A 5DIFA 1U0RA 1GG8A 3G59A 3TFWA 2AIRA 3WKAA 2Q62A 4R0VA 2UYQA 1DXQA 5CCDA 1N1MA 2W00A 4Z4FA 2A1UA 2Q5LA 2J0UA 4R81A 5KHOC 4G0VA 2PNFA 4LOIA 3NAGA 1GGEA 4Q0MA 2Z0MA 3GJ4A 1CJVC 3AG5A 2EZ9A 4GRIA 1N2HA 1Z45A 1GGKA 2P0AA 3I6IA 3OX2A 3LPCA 2H5EA 4OOEA 3K53A 3QQPA 3LHDA 3G7UA 1HBJA 4Q9HA 4XCVA 5I3ZA 3SSNA 4ETNA 2VDOB 1S8AA 5GY7A 5C8VA 1S01A 4CM8A 1YRBA 1FPMA 3M6WA 3MRXA 4Q47A 5EE9A 1VIYA 3O0TA 1Q0ZA 3KFLA 5DYGA 2ZJ6A 3OZTA 3HJAA 1QU2A 2GPBA 2M1ZA 4DVJA 2D5BA 4CMCA 4I55F 5ALEA 4LW8A 3NBAA 3ZVNA 2ZBUA 2Q6LA 2LP4Y 1R16A 1ECBA 1IHYA 2B98A 3RUCA 1CUVA 2O2DA 1OBOA 4D5GA 4DM7A 3CE9A 4E6EA 1ZW6A 4FHFA 3BF7A 3NZEA 4JLUA 4P7BA 2UYHA 3VZCA 1SBYA 1U9JA 2CXOA 4TMXA 4AZVA 2I1QA 3H13A 4P32A 2IYSA 2DPGA 5D86A 4Q9NA 1A76A 3LUPA 4MITA 5YASA 5EE0A 3AEQA 2DFKB 1BU5A 4CMEC 1K89A 2VKQA 2JA2A 3SHFA 4QU5A 1S3GA 1X39A 1R4MA 4ND8A 3U6KA 1GCIA 1WW2A 1PFKA 1IOWA 1KSJA 4C7OB 1F8FA 2VHYA 2AD5A 1U0EA 3PGLA 4TTRA 3HBNA 4NZYA 3ISVA 5BNWA 4X7MA 4INZA 3VKHA 1Q7RA 5A4DA 4JI6B 1NM5C 2NUBA 4LPSA 2ODNA 5B4UA 3IR5A 1M34B 2PH5A 3FUVA 3HY4A 5IN4A 4IMJB 4OIMA 1G5HA 1GZUA 3ETNA 1JDZA 3ZI4A 2O2HA 3JQ7B 4EG7A 2IHJA 2M2IA 5EJEA 3EUFA 5J5VA 1C9YA 3FMFA 3RROA 5JV5A 3FTFA 1D1SA 2OAGA 4N0PA 3DVQX 5IJ9B 3BB1A 3E5NA 4B3FX 2ZUDA 1HDXA 4RZ2A 1FJHA 3QSYA 1S4MA 3EODA 4F04A 4R2JA 4ERNA 1T8PA 2GPYA 4P3PA 5CDHA 2C1XA 521PA 2ONYA 4JJ8A 4B0PA 3T0FA 1IEQA 1XL1A 2B8NA 4UD6A 3R5KA 2GPWA 5D5PA 5EMLA 2QYHA 3P9PA 3CJRA 1ATIA 3DEFA 1JZTA 3B20A 4M7OA 3FPCA 1HK7A 1E3LA 1Y98A 3PNOA 5CRIA 3JYPA 4DOMA 3DA8A 4L95C 4F38A 1RWOA 5DYWA 4E12A 3IXQA 4BVBA 5HM6A 2J0QA 5TXGA 1YVRA 1OFIA 2HLPA 4O4IF 2ZRQA 4AS1A 2JJYA 2PRIA 5CLFA 5KOHB 3CVWA 4M88A 1E18A 2ZTHA 1I0LA 2Y1FA 2YIMA 2V7XA 1QVVA 2AZ4A 4GRAA 4PRLA 2VEDA 2AI1A 3RTBA 3UJ8A 4RJTA 5FL7D 3LKVA 4QVIA 4KL8S 2YS6A 4BKRA 3GLHA 4UNIA 1M0TA 4Y0NA 2V96A 2CLMB 2V58A 3BFKA 4M8IA 4Y1RB 3TIGA 5A5FA 4HZGA 3HKBB 3KSRA 3X3HA 1WKVA 3OCWA 4PC3A 1ISFA 1H4QA 4JI4B 4QDZA 4CQLA 4ZCIA 3OZAA 1QP7A 3QNUA 2VUHB 5KYYB 1SC9A 3EGWA 4KVAA 4MYCA 2NZUG 3EG9A 3II6X 4KIWA 3OY2A 1DEKA 3LQKA 4O0LA 1HKUA 4L2IB 5JSHA 3TKLA 2D7CA 1KI6B 2QY6A 4DR5B 1RHJA 1QQBA 1NIJA 1CQIB 5TE9A 1J39A 1NATA 3LHKA 4KWEA 4WN3A 2JIPA 2ICAA 2PGOA 4LZLA 1NW6A 3MJEA 4LSGA 3T3EA 3TSOA 2G09A 3DONA 1SB8A 3PNYA 4L7QA 2JVKA 4HS4A 5KZMB 3QHPA 2EFDB 4J0FA 3V2HA 3R3JA 3REOA 4NY1A 4OREX 2ORIA 3QV1A 1X19A 4MW0A 2DFDA 3ETJA 2UXBB 2O1WA 2GARA 1H5UA 1QZZA 1JW9B 1M67A 1VIAA 3L7DA 3MS7A 4ZOLF 2CSXA 1HFWA 2D1TA 1YOVB 2PKXA 2NPIA 3GA7A 3EY4A 4EMTA 1Q2XA 4D43A 2NXWA 3PDWA 1OH5A 2Z3ZA 2VATA 1GL7A 1T3LA 1FMLA 4OO3A 2ZOSA 2PGJA 2A6PA 5AKGA 2BGJA 1TJYA 2PFKA 4OMCA 2P2YA 1S89A 3E6AA 3BSFA 4UBNA 1FXUA 3KLBA 4L74A 4R8MA 1U3VA 1R4NB 2JAPA 2VQ6A 4YMUA 4WMLA 1Q84A 7REQB 3ENNA 3R09A 2IXEA 4HTFB 1Z5UA 4EO4A 5CH5A 3ZWAA 3UJCA 2VYVA 3EC1A 4JGGA 3RS9A 3HXOA 4KPUA 2DJIA 3LCJA 1V7PC 4CN9A 4OAOA 4F86A 1GV1A 1QTQA 2W6QA 4BBZA 4DQUA 3IDAA 4NESA 4NLLA 1YE8A 3GEBA 5L6LB 4I5DA 5JCOA 4AZ0B 4E5MA 2QJFA 4NAHA 4JI3B 3V4SA 1P7PA 3GPCA 5B7NA 4KR6A 2H08A 1TC2A 3ZWWA 3SZOA 4AG3A 4U7WA 4YJFB 5ED4A 7MHTA 1UEXC 1UXIA 1MT0A 1RKUA 1SWVA 2VC2B 2O3JA 3B9RA 3E3LA 3H9UA 3QRWA 4I1IA 4OLJA 4Q37A 4I1VA 1Z4PX 4NBUA 4BNXA 2A5DA 5CGZA 4B6JA 4BWVA 2P0EA 3HCOA 1XR3A 2JEYA 3MQFA 1KJNA 5DNCA 3ZDAA 1U6KA 4PIPA 1NMEA 5AKZA 3O1IC 4MLPA 2WOJA 1SZDA 1CQZA 3AHGA 5DX1A 4A91A 2YW2A 3AUFA 3TLGA 2HMYB 4ZV4A 2O23A 1AD2A 4GBGA 4TKUB 5A9RA 1K0FA 4KQWA 4R41A 1AIPA 4WSOA 3EXEB 5U4XA 1FA9A 3S68A 3HLTA 3VO9A 2VTBB 2WR8A 1ZX1A