3A58B

Crystal structure of sec3p - rho1p complex from saccharomyces cerevisiae
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
178
structure length
178
Chain Sequence
SIRRKLVIVGDGACGKTCLLIVNSKGQFPEVYVPTVFENYVADVEVDGRRVELALWDTAGQEDYDRLRPLSYPDSNVVLICFSIDLPDSLENVQEKWIAEVLHFCQGVPIILVGCKVDLRNDPQTIEQLRQEGQQPVTSQEGQSVADQIGATGYYECSAKTGYGVREVFEAATRASLM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport/exocytosis
molecule keywords Exocyst complex component SEC3
publication title Structural basis for the Rho- and phosphoinositide-dependent localization of the exocyst subunit Sec3
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 58
structure length 178
sequence length 178
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2009-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3a58B00
3IGFA 3EPJA 5JWOA 1W5TA 3PEYA 3TJZA 5LDDC 5J4VA 2KI5A 5HZHA 1M8PA 1CJMA 1IXZA 1ZIPA 3QKTA 4HAVA 2JGNA 1IN8A 3ZLJA 3M4YA 1OFUX 1YZUA 2V55B 1A4RA 2PT5A 4MKIA 4P0TA 4JMPA 4ASUD 2IWHA 5C46F 1XCMA 3UANA 2R6FA 2VP9A 1GRRA 4A8JC 4D2IA 2J0UA 1AGRA 3UWOA 5F9FA 3RWOA 1JXMA 2IXEA 4LHZA 3JZAA 4MRNA 1ZM4A 1BKDR 4DLVA 1X8KA 1T3HA 1HA3A 1WB9A 1MOZA 2OCBA 2FGKA 2WKRA 1RC8A 2JIZD 1TF2A 3T12A 4PX9A 3P27A 2Q9BA 2C2HA 3ZS8A 3QG5A 1MO6A 2VF8A 2J5XA 1VYVA 2W2VA 3QEJA 4JLKA 2D2FA 3LX5A 4II7A 1XPRA 1TQ4A 1US8B 3IUYA 4BLTA 2OAP1 2BOVA 4W5JA 3MWKA 4Q4AB 5LBIA 3EC2A 4B34A 3GFPA 1CR4A 4XTRA 3LW8A 2OBNA 1E69A 2VPPA 1Z6GA 1VIYA 1JEDA 1M7GA 1N6HA 1VMAA 2N42A 2QRNA 2QRZA 4M9XA 4XD7D 3X1XA 4KCGA 2CCGA 3GEIA 1RVDA 3GLIB 1TAGA 1W1WA 3LRPA 1UEJA 2HEIA 4L4UA 1UKEA 2HT6A 4LHWA 5JLJA 4D80A 1RRCA 4XIGS 4Q03A 3FDIA 2WJYA 3C7KA 4B2LA 3KJHA 4TYPA 4Q9LA 3VHLB 5EE5B 3OAAD 4PHGA 4E07A 1PVOA 4FCTA 3WY9A 3T1QA 2FEMA 1E9FA 1GAJA 1KJZA 2E1RA 3NBFA 3WMEA 4TLAA 3HPQA 4FN5A 1NVXQ 6Q21A 3U7GA 3H86A 1U9IC 3U6KA 3NDBB 4FCWA 2XXAA 4P4SB 4DCUA 4M1MA 2PLFA 3T34A 3EIQA 3QF7A 1MV5A 3T1VA 3NG1A 1II0A 2J0UB 4URWR 4OHVA 2GJ8A 3TBKA 1WRBA 4KU4A 4PSAA 2D06A 4I1OA 2ASEA 1CR0A 1HE8B 4TL8A 3TQFA 3W6NA 3EPHA 4LJ7A 2VSOA 3BBPA 3NC0C 4RZUA 3RRMA 1W4BA 4A36A 1JR3D 3LV8A 4D0NA 3B82A 5JHGB 1GRNA 1XEWY 4LCBA 3UIEA 1R0WA 2F3RA 4ZIRA 3VR6A 3IEVA 2ZYWX 5L3RA 3K09C 2V9PA 4TYYA 4KVAA 4M22A 3ZIAA 4O2RA 4QNMA 4V0MA 3KKPA 3AVWA 2HCBA 2MMCA 2ODBA 1G41A 3B1WA 1Q12A 4KFRA 2FFBA 2ZS8A 3OE7D 4UNSA 4D81A 1YRBA 5AUNB 3T1TA 3KFXA 4M21A 4B2PA 4BZQA 4EFNA 4F38A 5G53C 4B3BA 4XSHA 3KFVA 4PC7A 3ND9A 3LXXA 4BLSA 4GI7A 3F8TA 1Q57A 1T4GA 1X1RA 4FD2A 2ZRBA 4QJ4A 2W83A 3EWAA 4PHHA 2NG1A 1RKBA 3E2IA 1XD9A 4P4UA 1KI6B 5GJWC 1U0HC 3ECCA 4B3FX 2RGDA 3GJ6A 1TMKA 2F43A 4BE7B 3K0AA 1Q22A 3EASA 4TSFD 5H68A 3IIKA 5AR1A 2XXAB 5L3SB 4WZBE 1Q3TA 5J47A 1YR7A 1E96A 2OLJA 3VHXA 1KDTA 3HWSA 4HUQB 3THYA 2N1BA 4DSNA 4C0KA 1ANKA 1M34E 2DFTA 1QZXA 5EE1A 4QNRA 4KJZA 3PR1A 2J46A 3RLFA 3AF3A 1UDXA 2AFIE 4E5UA 4Q48A 4NYMR 3VU9A 5LB2A 5JCZA 4XVQA 3DPUA 2ZI7A 2R6CA 3UATA 1I4DD 2ZIAA 2ZITA 1YZLA 4ZV4A 3PEWA 2V1XA 2IYSA 1DEKA 1G6OA 2PJRA 4IFBA 4ZIRB 4IJMA 2JLSA 2XITA 4FMCB 1VPLA 1XXHA 1KYIA 2XSZD 1Z6YA 4BPBA 2IYVA 3QXJA 4LJYA 4N0EA 5BN5A 4HI0E 2CVHA 1FZQA 1ZYUA 1YZQA 2OILA 3QY0A 3K0FB 5EP4A 4DDTA 4ZCLA 3AVVA 4TMTA 4Q1DA 3QXCA 2HF9A 1KI4A 3KB1A 5K8TA 4CT5A 5J4LA 2YJTD 3UG6A 5L8VA 2GTPA 2ZJYA 2QGNA 3LQRA 1N0UA 1QHGA 1Z83A 5L3VA 2BMEA 1CBUA 4WZAE 3B9PA 1OFIA 3DEFA 1R5NA 1Z22A 3FFBA 1G7CA 1I2MA 1SXJA 2REBA 2VL7A 2WSMA 4GMDA 1M7HA 1OB2A 3QXSA 4OBEA 2QNRA 3GJ5A 3GLIE 4C0BA 3R9IA 3KXLA 4QBFA 5JEDA 4CEHA 4OJKA 1E6CA 2F43B 4HB0A 2GJAA 1A7JA 5GJBA 3OESA 3UG7A 2QMHA 3EZ2A 2ZAOA 1KK0A 3TRFA 4TYWA 4V0KA 2ZYVX 4QHSA 1U81A 1XJQA 1OW3B 5BN4A 1E2HA 2V3CC 4GNKA 4LOAA 4MGYR 4TLDA 4XWOA 4ESVA 4YLGA 2C78A 1AQYA 5JZVA 5FOWA 3A4MA 2NGRA 3O8CA 4IOKA 1D9XA 3AP2A 3GFOA 1SVKA 4URVR 4KLZA 2IK8A 3L2OB 1F2UA 2F9LA 1KY2A 4CF7A 5HZKA 1XZPA 2B8TA 2EFDB 3VR3A 5BXQC 3CR7A 4FINA 2OHFA 1RIFA 3A4NA 2P3SA 2NOAA 4UNPA 3SEAA 1J70A 2CLSA 4M9QA 1G18A 4B44A 2RAPA 2ZRIA 1KNXA 1T6NA 1VCMA 1N5KA 1Z3IX 1NVVQ 1E1RD 2YWHA 2ZRAA 3D8BA 2WJHA 2ZI3A 4IDNA 4LV5B 3DZ8A 1ODFA 3CONA 4YMUA 5DYGA 2JLYA 4JLDA 2GJSA 4DT1A 1J90A 2WWYA 2O0JA 1AA9A 1Q1ZA 3AP3A 1W47A 4MRSA 2H57A 3AEZA 5CB8A 1DVRA 2IBMA 4IVQA 2CHGA 3U4QA 1R7RA 3SI7A 2AXPA 5HE9A 1Z6TA 4OK3A 1SXJB 4TL9A 5G41A 4DJTA 2BC9A 2IC5A 2V7QA 3CKLA 3FVQA 3AV0B 5F9HA 4JL8A 3UMRA 5HR5A 5KSYA 1B0UA 1IN6A 4C0LA 2G1KA 4ERNA 4JLMA 3VR1A 4QBIA 4KYUA 4JBWA 2GDJA 2GZHA 5LD2C 2W0SA 3T1OA 4Q66C 2VLIA 5EXTA 4TMWA 1HT1E 4NCJA 2ECKA 2XZLA 2WJJA 4RD6A 1Z0FA 2HXYA 4LGMA 3DMDA 3KTAB 3GJ3A 3SJAA 2GXQA 3W8RA 4ASUA 1KDOA 1T3SA 1VIAA 2AK3A 2O8BA 3GMTA 3SJBA 2A78A 4MKFA 4Y0AA 4MUBA 1F2UB 2WSSA 1F60A 5E7MA 4CT4B 1G17A 1YJ5A 1K6MA 3FKSA 2JIZA 4GMXA 1WP9A 4C9BA 2BEKA 2KBEA 3B13B 3B1VA 3I1FA 1KJWA 5JS7A 4UJ5A 2IHBA 5F2EA 3RC8A 1JI0A 3U2QA 1KOFA 3CIOA 3BGWA 1IM2A 2ZR7A 3PITA 4HATA 2Z4SA 3FKQA 4HZUA 2ZRGA 2VP6A 3FPAA 4Q7LA 4DT1B 5D3QA 3A1WA 2BMFA 2GZAA 5CJ2A 1GL7A 3VNVA 3ADKA 3U7FB 4A1FA 5AUOB 5BYJA 2J59A 2ZE8A 2RGCA 4BFUA 4YMVA 5DGXA 1DAFA 5HCNA 2ZROA 4BASA 2H1LA 5DI9A 3RRYA 3ND8A 1PZNA 2RGXA 2FA9A 1TF7A 1BS1A 1JQLB 3TVTA 3AH8A 1K5DA 4P32A 3K9HA 4KAXA 5P21A 1NMYA 2AWOA 4QBGB 2IUTA 3EA5A 4I1VA 4Q1EA 1UM8A 2CDNA 3TKLA 1G8GA 5H1YA 3C15C 1D6JA 2VSFA 1DPFA 4N1AA 3AUYA 1VHTA 2A9KA 3ADDA 5FL7D 5HPYB 3C8UA 1H8HD 1MR3F 4GZLA 4DCTA 4EQ6A 4PR0A 1EFUA 4EJSA 2G9NA 2F3TA 1LS6A 3K53A 2O8BB 3BC1A 3QKUA 3RANA 2GJKA 3NH9A 2CMKA 3BD9A 4MRVA 3VNUA 1E0KA 3IBYA 4UXJA 4LWZA 2QMOA 1G291 3FHCB 2X1VA 5IHPA 1ZINA 1ZVQA 3EIHA 3OHMA 2IYXA 4ABYA 4HLUA 4DLYA 2C77A 2QEQA 2JA1A 1Z0JA 2GETA 1EFTA 4EPWA 4HDQB 5EP2A 3CZQA 4RCYA 4Q1BA 1JAHA 1QG2A 4WIAA 2QGZA 2XZOA 4IOLA 3KUDA 1Z0AA 1WBBA 1G5PA 2ZI5A 3GEEA 2C8VA 4PXAA 1CR1A 4BRWA 2BBTA 2ZRKA 2C96A 1ESNA 1EK0A 5FBQB 3AVOA 5JJLA 1NN0A 2XAUA 2YZ2A 3FHTA 3KQLA 2O5VA 5KSOA 3BFVA 2YWFA 4XWKA 2W00A 4KITB 4ZKEA 4JSTA 3A8TA 4HSEA 1K8RA 4M9ZA 3ICQB 1TQDA 1G16A 3BERA 5JHHB 1E2JA 2IL1A 4HAWA 5A4JA 2J41A 1SXJE 1TL7C 3B7GA 3TAUA 4HB4A 4K81B 4CIDA 1E1QA 5IK2D 2E9SA 4LV8B 3MJHA 3WHLA 1S9DA 1XD2A 4PAQA 2KSQA 1QG4A 2FPMA 1D5CA 2P5TB 1E2QA 2GK6A 2VP4A 2WKQA 3MMPA 3EZFA 2QTHA 2VTKA 1E2KA 4PZZA 3D3QA 4JKYA 4WVFA 1T0HB 3OIWA 4EJSB 2DFNA 2ERXA 4LUCA 1KO7A 5JRJA 5TB5A 2YINC 2OG2A 3UK6A 2G77B 2FU5C 4A0HA 3CB4A 4RD3A 1S3GA 2BDTA 2PMDA 1FW6A 1OKKD 2ATVA 3REFA 1KKMA 1HQYE 1KSHA 1NVWQ 2IYRA 1OH5A 4W7SA 3QE0A 2XJ4A 1AGPA 3LWNA 2QZ4A 2PZGA 2GJ9A 3AF1A 3VQTA 1ZUHA 5EXXA 8OHMA 2J7KA 1UJ2A 2XSZA 4A9AA 2NPIA 1GKUB 1W46A 2X2EA 5F3WB 3AB3A 1T5IA 4RY2A 2VRWA 2H5EA 1RPZA 1G64A 2BBSA 2BWJA 1OFTA 4UJ3A 2NO0A 4OI2A 2GXAA 1YRAA 4MQBA 2AHOA 2PZEA 4A2PA 3EC1A 3RDPA 4OQNA 2LCFA 4AC9A 1LTQA 4K46A 2EFHB 5CDFA 2YOFA 1KTVA 4Z1MD 1HE1C 2JJ1D 2QG6A 1GFIA 3UXMA 4B76A 4KXFB 2KJQA 3GLFB 1X6VA 4DLZA 1ELOA 4GFDA 3QOFA 4XSGA 3PQCA 2F1IA 1O87A 4UKDA 1XD2B 2PT7A 1NLZA 3IEUA 2WWGA 5JJKA 4ARZA 2OSBA 4F4JA 4QJ3A 2ODNA 4TTQA 2OM2A 4LJ4A 4WW0A 3A1UA 4L5BA 2GCPA 3W90A 1ESMA 1X8LA 1U99A 1Z08A 1XTQA 3PJRA 1ZNYA 2FDCA 1ZNZA 1AQUA 3MFYA 1OH6A 3VKWA 4P31A 3CX6A 3LW7A 4F4IA 1J8MF 1QRAA 3Q5EA 1YE8A 3QXHA 2BEJA 4IW3B 3CRQA 1A82A 1FQJA 3DKPA 4TQ9A 1R10A 3BH6A 3QKSA 5AJWA 5TXGA 1KDRA 2EYQA 2YWEA 4DLTA 2X2FA 4YXWD 3IHWA 1P9NA 1E32A 4N0DA 4OI0A 3KQUA 2EFGA 2FSFA 2XB4A 3PCRB 4F4CA 4QGAA 4AG5A 2PX3A 2FZ4A 3LA6A 5CLQA 5HTKA 2G1JA 4PC6A 3ETLA 3KB2A 2GK7A 1K5GA 1RW4A 1J2JA 3VR5A 2YYZA 1W5SA 2CK3D 3TIFA 1C9KA 1OIXA 4FWTA 2H18A 3THOA 3AVTA 2OFWA 3QNUA 4AKEA 1E9EA 4MKHA 3KZ1E 3L8YA 2O8CA 3F0TA 2A3RA 2O0KA 5BW8A 1P60A 2OCYC 2CL7X 3ZD6A 1U0LA 3AGPA 4BZPA 4Q4LA 5JEEA 3LBNA 2IWRA 3GLGB 1JPNA 1RRFA 4EFMA 4OQFA 2ORWA 2NO6A 3I62A 1XDBA 2WOOA 4H9GA 2FX3A 3MG9A 2W6JD 3DDCA 2EFEB 1XEFA 4KFSA 4ARZB 1SVMA 4M1OA 1XTRA 1UBCA 4ACBA 2QPAA 4U00A 3KQHA 3BRWD 1JJVA 5KSPA 3BXZA 4NYJQ 2X19A 2CLCX 3LD9A 4QJ5A 4NH0A 3IDQA 3NDPA 2BVNA 2REXB 2ZUBA 3CNLA 2WWWA 1RFLA 1LFDB 1V43A 3I3SR 4Q9IA 3IHLA 2WAYA 3L82B 1UFQA 3V00A 2BJVA 4R2HA 1NNEA 4XVUA 4C7OA 4TLBA 1ZU4A 4EDHA 2B6HA 3IIMA 3HYRA 2Q3HA 2AN9A 2R44A 3LBHA 2V6JA 3QKRA 2AD5A 3QKSB 1CTQA 3AVXA 2J0QA 2W6ID 2GCOA 3BOSA 1CRQA 3SFVA 1JR3E 4EKDA 1UKZA 2DYKA 2EWWA 2IEYA 3BFXA 3ZQ6A 4ZDJA 3WP1B 521PA 3FB4A 1E2MA 4P4SA 4ACAA 1OSNA 4IKEA 4KYIB 4C30A 4B3CA 1T8UA 2GRJA 4QRHA 4IDQA 2QT1A 4MDEA 2JDID 4P3YA 3DL0A 2ZEJA 3EIEA 3NC1C 4RKEA 2UKDA 4YC7A 3TSWA 4C0SA 3KQNA 3QUSA 4NPHA 1GDDA 1CXZA 3VFDA 2P2LA 1DAEA 3CX8A 2QPOA 4JLNA 5GVSA 2K5UA 4QM6A 4NU0A 5JI3E 3OIYA 4UQOA 1EG7A 2O8CB 1MO3A 1QHYA 5IF9A 3U7HB 3QPWA 3AF0A 3MCAA 1JEEA 4YDSA 5GADl 2DFLA 3IPXA 4PAMA 2R62A 3SYNA 4JLPA 4NYIR 4Q7JB 1E2FA 4TMVA 2ZE5A 3ADCA 2XZPA 2NQ2C 4EIWA 2XGJA 5B64A 3GLFE 1JXOA 3WNDA 2RGAA 5FL7A 4DDVA 2CNWA 1H8HA 5C1BA 1QBKC 1TADA 3TW4A 1W4RA 2GNOA 2J87A 5FTLA 1R5OA 1XPOA 1YZKA 4LJ5A 4GOJA 1OIVA 3SR0A 5EZ5A 2WKPA 3VTKA 3ZVNA 2C99A 3K70D 2ZQ5A 1LW7A 1QVAA 5DI3B 1GIAA 2VH5R 4C7OB 4AKHA 1MRNA 2CE7A 3CRW1 3A1TA 4NONA 1G7RA 2BBOA 1KI6A 1A2BA 3N70A 4NCKA 4NKRA 3QKRB 1U2RA 4O2LA 1E79D 1N6OA 2GCOB 3B8HA 1CR2A 4L15A 1E2DA 4GT1A 5FOUA 5J5CA 4G5SA 1N5IA 1IY2A 2HDNB 4A0GA 1MT0A 4M1TA 1WMSA 4PPQA 1XMVA 1YVDA 1UPTA 2O0HA 1P62B 2QQEA 4XH9B 3WYAA 5L3SA 4HYYA 1AIPA 2L0XA 4NL4H 2QP4A 3BS4A 2NO9A 4HUQA 1N6RA 4DWJA 821PA 1P6XA 4LJ6A 5KU1A 2P6RA 4RVCA 1QF9A 5AK0A 2J1LA 5J4HA 3A58B 1QHXA 4B35A 3CX7A 3I4LA 2CCJA 3ONWA 2DR3A 2F9MA 4CRWB 5FBLB 1OIWA 4GRAA 4X8OA 5D3MA 2R65A 2GHIA 1KSJA 2RGNA 1N0VC 2ZYTX 5CM9C 3WYFA 5CDFE 2FF7A 4RCZA 1X86B 4HB2A 2Z4RA 3KL4A 4Q21A 1LS1A 5IK2A 1W0JD 2VF7A 2GBLA 3N2EA 3TR0A 3GLGE 1NKTA 1XEXA 3T35A 4BEJA 2RGGA 1OLOA 3K0FA 4BFTA 4LBWA 1B23P 4ZCMA 1P75A 4EJSC 1U0JA 3TQCA 3FMOB 1E2GA 2FG5A 1N3BA 3R8FA 3QVVA 1DG1G 4B71A 2OFOA 3CM0A 1G8YA 1IQPA 4TYQA 3X1YA 4DIEA 2FOLA 1VG1A 3GP8A 2XNDA 4UNQA 1IXSB 3G82C 1DAGA 4QKQA 4E03A 3RS0A 3WNCA 5BQ5A 2XNSA 3EZ9A 4LI0A 3R8CA 4HLUC 5GJCA 3PEVA 4HB3A 3EA0A 3LXRA 1TEXA 2AFHE 3CPJB 1S1CA 3KJEA 1F5NA 2IF2A 3SHWA 1M74A 3CNNA 1GKIA 4Q9KA 1GKYA 1FTNA 1TQ6A 2AX4A 4HAYA 4LYAA 5DHFA 1W2HA 1R5BA 3PV0A 4V03A 4FCVA 3EPLA 1A1VA 2D7CA 3LX8A 4TLCA 2VBCA 4ZDIA 1AZSC 1RJ9B 4JYCA 3KKMA 1DADA 3QSYA 2VHTA 3AKCA 4US2R 3IO5A 4CDGA 4IFEA 4NTZA 1EFRA 2PJZA 1XZQA 3DM9B 3PUYA 2FGJA 4TT3A 4B74A 5DN6D 5FBVB 4M2LA 3HU2A 2QORA 1Z47A 3U3JA 2JJ1A 2BJWA 2MSEB 4MRRA 1TQ2A 2HCJB 5D3MB 5DH9A 1WCV1 3PUVA 2GEVA 5CB6A 4GL2A 1SHZA 2FFAA 5K8LA 1OXVA 4RFSB 4KVGA 2QM8A 4NYIQ 3WBKA 5JI2E 4RZXA 4KFUA 4Q4HA 4OQLA 1F48A 4LJAA 3EXAA 5SZJA 1W36C 1Q3HA 1BYUA 1UKYA 2WHXA 2XEXA 5C4GB 1TTTA 5CK4A 5JJIA 1ZBDA 1TUEA 1XEXB 1NRJB 3L43A 3IILA 4DLRA 4AKGA 2VO1A 2JJ2A 1P9WA 4EPVA 1NIJA 4IXMA 5GJVC 2HV8A 2ANCA 2IYLD 2F55A 1G8HA 1SVWA 3EG5A 1XMIA 3WP0A 2GEDA 3RRZA 2RKOA 1VTKA 2BV3A 2XOKA 4RZ3A 4QM7A 1N5JA 1GNPA 2ZRJA 4X8HA 2QAGA 3GPLA 1NSFA 1P2VA 4NZYA 1XTSA 2CE2X 4A15A 1PV4A 4US0R 3PVSA 3VKHA 2HYIC 2QL6A 3WRYC 3P4YA 1CLUA 1SVOA 2EWVA 3M0EA 1AJEA 2IW3A 5DISB 2ANBA 1G3UA 4YXWA 4C2UA 4V0NA 1LB1B 2OESA 4L16A 1Z8FA 5KDLA 4DKXA 1P3JA 2H17A 1SULA 4YMSA 2ZRLA 2ZTSA 1E2LA 1GRQA 3Q3JB 1ZM9A 4QG7A 1E9BA 4CEIA 3X1ZA 3KTAA 2CL6X 4NP6A 4OK5A 4QL3A 4TZ0A 2YNMA 2N46A 2WTUA 2ORVA 1FUUA 3CPHA 1E99A 1T3LA 1VG0B 1ZM2A 2VEDA 3FFAA 1CKEA 1E9DA 1NI3A 2WV9A 1TF5A 1COWA 1AN0A 3A36A 2EU8A 1XMSA 3ASZA 1OYWA 4CZ2A 1W0KA 2KE5A 4XOIA 4HLQB 4DUGD 4JYBA 2VQSA 4I81A 4D82A 2HLDA 3LFUA 1R8SA 3BFKA 3Q5DA 4KSCA 1MO4A 4Q4HB 3RWMB 2ZR9A 4KBGA 1Z63A 2GXSA 2HT1A 5J4KA 2FSHA 5KDDA 3ZVLA 4E09A 4ESHA 3THXA 2D3WA 4DVGA 4B48A 5ELXA 1KMHB 2CCKA 1JBKA 1S9HA 2QM7A 2OEPA 4TZ6A 4CEJB 3NHAA 3UKDA 4MGKR 2ZRCA 3SFZA 4PQYA 2ZJZA 2D62A 1JAIA 1QHIA 3C5CA 4IXNA 2H92A 2QAGB 1DAKA 1Y63A 4W9MC 2RH5A 2J7PA 4NCNA 5E7JA 3H4MA 4ILEA 2RGBA 2FPKA 3KKNA 3LDAA 4PPNA 1KZ7B 4MH0R 1OPXA 1C4OA 3QJYA 4YMTA 4PO8A 1N25A 4MDFA 2ZANA 1HUQA 2ZRNA 5A0FA 3CW2A 2UZIR 5E7IA 3F5FA 4JJZA 3NH6A 4A0RA 3R7WA 4F7WA 2ZPTX 4DLUA 5TVKA 2ZSFA 3PENA 5FTMA 5KSZA 2YVUA 4CEIB 1D2EA 1XCPA 3LLMA 1OT3A 2ZI6A 1KSFX 2DFKB 4YONB 4NYMQ 5E3HA 3MSXA 2WIBA 4FW9A 2NO1A 2WZQA 2JLUA 4ZDWA 1G5TA 2ZETA 1R6BX 3WHKA 2KWIA 4DSOA 2JLRA 3P26A 2QMUA 5B57C 4KFTA 3TK1A 4DB2A 4O25A 2F1HA 4R98A 1E0SA 1D9ZA 3X1DA 1Z07A 1ZW6A 2QSYA 3OEHD 3I5YA 4AURA 1FP7A 2JCSA 1OJLA 1YZGA 4OKSA 4PQRA 4GOXA 4C0JA 2GF0A 1VCOA 2QMEA 2IA5A 2QT0A 1IHUA 2RHMA 4TMXA 3QEOA 3THXB 3SJZA 3AVQA 4Z51A 1G9XA 3TNFA 2A5GA 721PA 3OEED 1P2UA 3NXSA 4C4PA 4TTPA 3BORA 5FPSA 2F7SA 1IN4A 2JAQA 1XB2A 2REOA 4FI3C 3TSOA 4Y0VA 1PLKA 3E1SA 3W6PA 4G3XA 4XD7A 4JSYA 3VKGA 4LBYA 3CWZA 1FPMA 1G3IA 5GVRA 1E4VA 2ZYUX 3RHFA 3GJXC 1N6PA 4OJQA 1G4UR 2XJ9A 3O8DA 4Q00A 5AWFC 1DAHA 3ZYCA 3OAAA 2NTYC 2OAQ1 4LDJA 5FOTA 2ZS9A 1DAMA 2CLDX 5FUXA 3MJRA 4JLJA 4IDPA 4B3XA 4C3ZA 1E3MA 1HT2E 1ETUA 4D4MA 4Q19A 4LHYA 2HYDA 4R9UC 3R7WB 2KBFA 3SN6A 3UWKA 1RZ3A 2RB4A 3QBTA 3PIRA 4IDHA 2VHQA 2OBMA 1R0YA 1P5ZB 2FMXA 2XTMA 1KO4A 1XTJA 3UMFA 4F91B 2QA5A 1LY1A 3C14C 1N6IA 1NP6A 1IY1A 3ZZ0A 3TH5A 3PXGA 4KBFA 1W7AA 3RYTC 4QFMA 2Q9AA 4U5XA 1CEEA 5TY0A 1KI1A 3K8YA 1JR3A 4IVRA 2HJVA 3HU1A 2GILA 4FWIB 1T0JB 1JB1A 4DHEA 5JSZA 4OHWA 3VR2A 4PPFA 3P4XA 2XTNA 1M7BA 1CS4C 1ZAKA 4Q18A 3U44A 1NJFA 3BJIC 3OE7A 5B30A 1GUAA 4D25A 1BIFA 1RYFA 2G83A 1DS6A 3EAQA 1IAQA 2FZLA 1L4YA 2P6NA 1BMFD 3K70B 1KK1A 5FPHA 4Q9HA 1CF4A 4URUR 4L9SA 4FMCF 3CBQA 4PHTA 4OI1A 4KO8A 4Q01A 2LKCA 3LVQE 4WXPA 1NN1A 2Z6VA 1E9AA 1AKYA 2QUZA 4AWXA 2AK2A 5JS8A 1UAAA 5CJPA 1HEIA 1OXSC 1JPJA 4PZYA 3SDZA 5FBWB 3GLFA 3W9YA 2W2TA 1W44A 3KKQA 3CWQA 3E5HA 4TSFA 5EJEA 3FTQA 3I8XA 2IYZA 2A30A 1F6BA 3MWJA 221PA 2IX3A 5G40A 5J4YA 3TUZC 4IEIA 1EWQA 4QGFA 4GPTA 5DLQC 4B6EA 1HQCA 4ZI2A 4NE2A 5TARA 4BFYA 2VP5A 3TUJC 3CF0A 3BB3A 4BRUA 3Q7QA 1Z2CA 1XBTA 3KJIA 1LF5A 1S1MA 2R8RA 2WJGA 3NTUA 3SZRA 2ZRMA 3I92A 3ZVMA 5DN6A 4BLQA 4XJXA 4DDWA 4S35A 4DCVA 4QOSA 2JATA 2ZM5A 2RGNC 1H8ED 4UXIA 3DO6A 1XP8A 2CL0X 4TMZA 5CYOA 4BGDA 3N2IA 4OHZA 1ZP6A 2B7CA 3NIBA 5JSZB 5KO2A 1OV4A 2ATXA 1Z2AA 4HDOB 1ZCAA 2GBLC 4X8LA 4DCSA 2BMDA 2QY9A 3BB4A 2BIFA 4IHQA 1ZRHA 2ODWA 4F92B 3U44B 3PFIA 5AUQA 4MGZR 3BH0A 2G0TA 1ZD1A 1CULC 3SBEA 2WJIA 3ZD7A 1D8TA 2V6IA 4ZCIA 1LVGA 2J0SA 4ITRC 1OH8A 2EVWX 3F3YA 2RHDA 3B1XA 4PANA 1DOAA 1Z6AA 3U3MA 1M2OB 4M53A 2Q21A 4JKIA 3GJ4A 1TEVA 2NZJA 5FOVA 4LYHA 1S0UA 4LJ9A 3U61B 2BHRA 5HE8A 5H8WA 2IUSA 2O52A 2IYWA 3GLHE 1KI9A 3GLGA 5FPTA 3AKYA 1WE2A 3CPEA 1EWRA 2AR7A 4LY6A 2VSXA 4KI0A 5C2JB 1Q1QA 4GBMA 1EXMA 4G5RA 3OF5A 3AQ4A 2PL3A 4HLDA 1SHKA 3L0PA 3EZ6A 1XPUA 3C16C 2QE7D 3HR8A 4Q4JA 3FOZA 3AGQA 3HPRA 3L0OA 3HR7A 1MH1A 4LPKA 2Q3FA 2Q3MA 3O47A 421PA 1UADA 2PLRA 3KX2A 3EZ7A 3H0KA 3W8NA 2O8FB 3W3AA 2G6BA 3N5CA 2Z0MA 1KNQA 4BUJA 4DUGA 3I61A 4PTLA 4JIMA 4KV9A 1E2PA 3AF4A 4DZZA 1NF3A 2C5LA 2WWXA 5CK5A 1KSGA 1YHNA 1ZUIA 4B73A 4OL0A 4G0NA 1Q0UA 2VA8A 1E1RA 1XNJA 3RVBA 4AK9A 4DCNA 1P4SA 1J99A 4CW7A 1NN3A 3BIFA 4Q1AA 4ZI3A 5FTJA 2B8WA 3R9WA 2V4ZA 5JRZA 1G8FA 2OCPA 2Q0HA 3JVUA 3QQ5A 5EE9A 1IJEA 3AP1A 2DY1A 3K0CA 4Q02A 5L3QA 1M6NA 5BN3A 1SXJC 4DBLC 1R4AA 4P4TA 1UBGA 3KDSE 5IDVA 3NHBA 4C0QC 4TQAA 1XTIA 4QHYA 4MYCA 1G20E 2QENA 1SGWA 4GZMA 4LSGA 3TW8B 4TTRA 4DSUA 2DHRA 4WBSA 2J45A 1CJVC 1FTSA 2ZRPA 4V02A 1KMQA 1G5RA 3T61A 1P2SA 2QQ0A 4URYR 4YQFA 1NVUQ 5CM8B 4JZKA 3QI2A 2C9OA 2QP3A 4S2EA 1D2NA 1NBMD 5FUYA 4C0AC 4Q4JB 4B2IA 1NMZA 1V5WA 3OIUA 2X77A 3LQQA 4LJ8A 3MD0A 4W5HA 4MA4A 1XF9A 3QIAA 2OZEA 2ZJBA 3Q7PA 5DI3A 2ORIA 3HYTA 1U90A 4RJLA 1XJCA 2F1JA 4J0QA 4BFWA 4LPSA 5KPDA 2ZRFA 1T5LA 4IVPA 4PPGA 1GTVA 3TUIC 4A0FA 3TVDA 2R2AA 5CITA 5C4MA 2ONJA 1AM4D 4MYHA 2F6RA 3ZS9A 4H1VA 1DO0A 5K8UA 1ZM7A 4HAUA 3U60B 4D4KA 3OEEA 4WZ6A 4ON9A 2NPFA 1ZIOA 4OYHA 1S4QA 4M1SA 1MABA 4NDZA 3JZMA 4PC2A 2OE2A 5FBRB 1R0ZA 2W2XA 4PO9A 4US1R 5L3QB 3QPUA 3MRSA 4JBYA 3ZZUA 1KK3A 121PA 2ZSEA 1CU1A 4RFVA 3B2EA 3PG5A 5CYPA 3RS3A 5LD2B 3L0SA 1FX0B 1GL6A 4K8OA 1FNMA 4BECA 2WMNB 1P2TA 2WPDD 4DLSA 2GESA 3P32A 5B58C 5DYIA 1T91A 2A5DA 3KKOA 2ZI9A 2C9YA 2CJWA 4M1KA 3B5JA 3NBXX 3IQWA 4OQXA 1Z0DA 2VYFA 4ZPXA 4BQSA 2GF9A 3NKVA 1ZM3A 4QBHA 3QVUA 3LNCA 3LBIA 3ZZTA 1SQ5A 2YOHA 2WSSD 3PUZA 3R20A 3UMSA 5UKDA 4LYFA 3U3OA 2AXNA 2EFCB 3FKSD 2IS6A 1CJUC 2C9CA 4BLOA 2PZFA 4DSTA 1CP2A 1OHHD 2LWIA 2ZI4A 1YQTA 3RS2A 4FMBB 3I8SA 3ZJYA 2IEZA 5BWMA 4V0LA 1NY6A 5JFGA 2NZ8A 1Q20A 4URZR 2IS1A 2PMKA 4WAUA 3PEUA 2PH1A 5HKKD 1NY5A 3GQBA 1G3QA 4A6PA 2AWNA 4BLPA 1G3RA 4Z8XA 2OUKA 3RSLA 2C95A 3OFND 5KDOA 1A5TA 4L9WA 4ZKDA 3L8ZA 5EUMA 1GVNB 2QI9C 1RJ9A 2C03A 2Z5FA 4TLEA 1U8YA 2YOGA 2WWFA 1S3SA 3K70C 1IN7A 1MABB 4BZXA 4TMKA 1BMFA 5AJZA 3AF2A 3C4JA 1E4YA 1PLLA 1RRGA 2FPLA 2D74A 4B3DA 1U8AA 4HLCA 4MUAA 5HCIA 5J40A 1NG1A 2GAAA 2FH5B 3V4FA 1N0WA 3HJNA 4JVNA 1XD8A 3RRNA 1SKYB 3SYLA 1WDTA 2A7QA 2HUPA 1L4UA 4RFSA 5EZ6B 2MSDB 3H2YA 3DOEA 4BFZA 1NL3A 1TU4A 1G1MA 3SNHA 3RS7A 3AKDA 2CJWB 2KB0A 3T5DA 4HAZA 4RD2A 1IN5A 3QBVA 2PBRA 2FSGA 4JT2A 2JEOA 3Q8XB 3O8RA 4HAXA 4QXAA 1W4AA 3PUWA 2ZVPX 1FL9A 4D6PA 1VCNA 4IOMA 2EYUA 1IBRA 3U6BA 2VP0A 2BCJQ 3B1ZA 3QENA 1ZD8A 5M04A 1OKKA 2ODEA 1KI7A 2OT3B 1VHLA 5JBQA 4JLBA 1H8EA 3NWJA 4JT4A 4KODA 1VCIA 3TR5A 2P5SA 3C41J 3SYKA 1WBDA 3QF4A 4NCIA 1S8FA 5G3ZA 1AS2A 2CXXA 4L8GA 3VAAA 2QTVB 2D4HA 1AS3A 1JECA 1NVVR 1S96A 1HTWA 5TDHA 3PUXA 3AVYA 1E0JA 4P33A 1KIMA 4PQFA 3R9XA 2QBYA 1GNQA 4GOKA 4O0MA 2AL7A 2OO7A 1X3SA 2ZJ5A 1NMXA 4YDHB 5KNBA 3GD7A 1VG9B 2UZ3A 2XTZA 2WMOB 2UVQA 3KJGA 2BM0A 1GITA 3QXXA 2P67A 2H7VA 1IONA 2B21A 5EQTA 1IJFA 5FOSA 4Z1MA 3SE0A 1E1QD 1N6KA 5FUVA 1VDZA 1W4CA 2IYYA 2PCLA 5JWRA 3FHOA 3GJ7A 1W36D 1AKEA 2VHJA 2YV5A 2IS2A 1NLYA 1NSTA 3NEJA 2YC2C 1S2MA 3FMFA 4BLRA 4IDOA 1OF1A 1UDWA 3IIJA 3I5XA 1YR6A 1I2DA 4HDCA 1U8ZA 1KGDA 5DO9A 4U7DA 4A4DA 2IHYA 1H65A 1KMHA 3K9LA 3TGPA 3K9GA 3SS8A 1KHTA 1G6HA 1G3MA 2ZRDA 1TX4B 4MYUA 4EPTA 4CEJA 5FH9A 2QE7A 1KAOA 4JJKA 4ZDKA 4D4LA 3GEHA 3WYGA 3CRRA 1EX6A 2J9RA 2WBLC 3A6PC 1TNDA 3Q72A 2J3EA 1NIPA 1PLJA 5KHOC 5JCPA 3B78A 1TPZA 3QF4B 4CGZA 4RD1A 1GSIA 2YC4C 4QC2A 3BWDD 2IT1A 3T15A 1Q21A 1N5LA 1BO6A 3T5GA 4AYWA 3CH5A 1F3OA 1U98A 2QN6A 4LC1A 2Y8EA 4A2WA 3THWA 2QBYB 4TN1A 4TQUS 1W49A 2BKEA 1D2MA 2I4IA 1X8JA 4DC9A 3LY5A 4M1YA 1Q1BA 4KHZA 2AD1A 1JJ7A 1E2NA 1GZSA 1WF3A 4PC3A 2GZDA 3NEYA 4I1SA 5TV2A 2CK3A 4JLAA 3W34A 5EP1A 3K1JA 1ZNXA 3I73A 3K0AB 4LV6A 1NJGA 4R2IA 1AS0A 1QDEA 5EP3A 4M9SA 2A5FA 1ZCBA 4GDFA 1FOEB 4DLXA 1KI8A 1GG2A 1XX6A 2CHQA 4DIDA 1KI2A 1XTKA 1KO8A 2ZJOA 3TE6A 3DVLA 3U7EB 3THYB 2AKAB 3SJCA 2QROA 4A82A 1SKYE 2W6JA 2NMVA 4CYMA 1W48A 3OIVA 1F2TA 2JJ8A 1OE0A 3SHFA 2HXSA 3B85A 3VU9B 3VX3A 3WMGA 3CF2A 1NBMA 2I1QA 5CIWA 4NHOA 1KAGA 5FUWA 4Q9JA 5KUTA 1E2IA 3LLUA 1E9RA 1ZMXA 4TWZA 3BAFA 1RRPA 3V9PA 4HZIA 4NMMA 4BFVA 2WICA 2ZAMA 4CVNA 3A1VA 3TAHA 1UBEA 1A2KC 3TLXA 1XXHB 3GLHA 4YMWA 3T06B 1JALA 3DKVA 1OB5A 3W5JA 1EX7A 5SZHB 1Z06A 1LF0A 2D7DA 2GXUA 2V54A 2WWHA 4QGGA 2W6IA 1M1YE 3X1WA 3KQKA 1HH4A 2OLKA 2QPTA 3AM1A 2NIPA 3GFTA 4OI4A 4F93B 1QVRA 2FNAA 2H8KA 4FXPA 3M1IA 4TL6A 1OH7A 4Q47A 2OFXA 2G88A 2HF8A 3THWB 2CHVA 2ZRHA 2OBLA 2VIIA 1IOZA 1Z5ZA 2JLQA 4A8JA 3QG1A 5FR2A 1DTSA 1KK2A 2FJUA 4AYXA 4PSVA 4IOJA 2JLZA 4OHXA 2IXFA 3NVAA 4M1WA 3WXMA 4OHYA 2JDIA 3KXIA 4NBSA 4LYJA 3K0CC 3D7MA 1I4TD 4G5QA 4JL5A 4CEHB 3CZPA 4N3NA 4D4JA 1EFHA 2EQBA 4KLNA 2CVFA 4M8NE 2IXGA 2OV2A 3HP1A 4FMDB 5AUPB 1T9HA 1KO1A 4AKIA 2ZUDA 4M4SA 4BWYA 1P72A 3B1YA 1FMJA 5AJVB 5SZKB 1KI3A 3P20A 5H70A 4E22A 2BM1A 2P6UA 4D0LB 2P65A 2WPDA 1QHSA 2O8EA 2H16A 2ONKA 1E9SA 2MSCB 4PC1A 4WXRA 4G01B 1L7VC 1ZJ6A 4MITA 1GWNA 1WA5A 1Z0IA 4BFSA 2CEAA 3BB1A 1F2TB 2IYUA 4LX0A 5FL3A 1VKJA 2ZVQX 3REGA 2WM9B 1HYQA 2ZJAA 2QSZA 3GJ0A 2YWGA 1C1YA 1II8A 2OXRA 3FWYA 4TL7A 4UNNA 4EFLA 1ONBA 2IF0A 5IT5A 2F1RA 3HDTA 1VYTA 1G4AE 1GP2A 4JVSB 4JVMA 3VR4A 2JLWA 1IY0A 3H84A 4H1UA 3RS4A 4DEXA 5AJYA 2LKDA 3HU3A 1CIPA 5FFMA 3GLHB 1OHHA 4A6XA 3U5ZB 1L2TA 1OYYA 4LC0A 5JWHA 3U3RA 2ZJ2A 5EE3A 3QPVA 2DBYA 3CUEF 4I1UA 3LO5A 2B92A 1SVIA 1E79A 1Z6XA 1ZC3A 1U9IA 5HKKA 3WMFA 621PA 3K0EA 2Q9CA 1PUJA 1OXUA 5K8IA 3AVUA 2QP9X 4V0ME 1ZD9A 1KDPA 2Z83A 5B2ZA 1TU3A 5FI1B 5E4FA 1XFAA 3U4QB 4A8JB 3P1JA 1DE0A 5LPNA 3OFNA 2WWIA 2IUUA 3CF6R 2WIAA 1T8TA 4AD8A 4DXAA 4POAA 2O8DA 1YKSA 3TMKA 1VG8A 3EW9A 2BBWA 2PCJA 3EWSA 1AK2A 3W3ZB 2PX0A 3CRVA 1JR6A 2IYQA 1DELA 3MWLA 2DCUA 1G8PA 2X8AA 2I1VB 2IS4A 3FYHA 4W5WA 1Z0KA 4DEYA 3M6AA 3K09A 4PHFA 4DLWA 1QHHA 4WA7A 2FSIA 3K9NA 3RAPR 5LB4A 3RNLA 2VHUA 2O8EB 1GL9B 5CLLA 2CNWD 4XTCS 5ANRB 1W2GA 5G3YA 1N6NA 3C5HA 2A5YB 2RMKA 1FP6A 1W0JA 2GAOA 3BE4A 2A2ZA 1JNYA 4BFXA 1DARA 3TSZA 2G0NA 1YU9A 5JMTA 1GILA 1ZC4A 3S1AA 1OXXK 3LVRE 2FFQA 2QTFA 4R71A 3AKEA 4PO1A 1II8B 2V8OA 4C0HA 3SOPA 1ZUNB 2DWQA 2JASA 2JLXA 1KJYA 1E0AA 2W0MA 4IRUB 3WRXC 1O3YA 4LRWA 1NN5A 2QAJA 1JQJC 1N2CE 3ZDQA 3JVVA 1DG3A 4GP7A 1MRSA 4JVLA 1VECA 3MWYW 1R0XA 4G5GA 2BMJA 4Q5IA 1TUIA 1R8QA 1FUKA 3CNOA 4HZUB 1EFCA 3EPKA 1XXHE 4GP6A 1DAIA 3SQXA 3I72A 1XJ0A 4LBVA 3IKJA 1RYHA 4ZO4A 4EPRA 2ZXUA 4EPXA 2O8DB 4B43A 1Z29A 4AYTA 5BYKA 2EW1A 1SVLA 1UBFA 1HY3A 5FTNA 3ADBA 1P9RA 1DO2A 4Z54A 4JL6A 1J8YF 2FWRA 2C98A 3CH4B 1BOFA 2TMKA 1BH2A 3O8BA 4Z8YA 4D26A 2XB2A 3MAAC 1MO5A 3MGCA 3NBZC 4FIDA 4UNRA 2FFHA 3RSOA 2O8FA 1WQ1R 3RS5A 1KKLA 5KOYA 3ZIAD 2YKGA 2IYTA 3B6EA 5CIQA 1OXTA 1L8QA 1QHHB 3KXKA 3ASYA 4MRPA 1XRJA 5DHAA 5FOXA 3B60A 2D2EA 4DRZA 4B32A 1YZTA 4EPYA 4EQ6B 2NO7A 4Q7KA 2SHKA 1GM5A 1KZGB 3IQXA 5DE3A 2DB3A 4QHTA 1Y3AA 3ZQJA 2ZSAA 4RD0A 2ZU0C 3SQWA 3S1AB 1XU4A 4NYJR 5EUQB 2R6DA 4DB4A 2VHCA 4AI6A 1BYIA 1E94E 3W5IA 1J7KA 1YR8A 4C2TA 2WVJA 1G21E 4V0OA 2XNDD 2W58A 4HEJA 2G3YA 2OCAA 4AG6A 1VYUA 1FQKA 5KTYA 3ICEA 3L0IB 1NBME 2YHSA 5F98A 1YZNA 4EAQA 3BK7A 4LBZA 1LV7A 2WAXA 2MMGA 1FMLA 2Q6TA 3DMNA 3IBGA 3A1SA 4BEBA 3MUFA 4HUTA 2XX3A 2QU8A 4G5OA 1CRPA 3FGNA 2ZS7A 4B3GA 1RE0A 3SBDA 1UEIA 3H1TA 5KNCA 4O3MA 3CO5A 4JLOA 2GA8A 1NG9A 3FMPB 1EFRD 3ZGXA 3GJ8A 4Q1CA 5SZIA 4TT3D 1X1SA 2ZU6A 3IPYA 4B33A 1P61B 3DOFA 2C04A 4R7ZA 3EARA 3ZVRA 2ZE7A 4URXR 2B7BA 3D6TB 5DNYB 3CLVA 2R9VA 2DWOA 4RZ2A 3EX7C 1E9CA 1ZU5A 1II9A 2ZR0A 4TYNA 4Q1FA 2FN4A 1FNNA 3IO3A 3U3KA 1LNZA 4AY2A 1XWIA 5AJXA 1KY3A 3E70C 2J0VA 1W36B 4LZZA 1IXRC 1ZNWA 2BKUA 4EUNA 1XCGB 2GWHA 1E98A 1Z28A 2JJ2D 3WNBA 2ZUCA 2VP2A 3RC3A 3W6OA 5FI0B 1CJTC 2BCGY 5FTKA 4RD4A 1YR9A 4QGHA 3MLEA 3RABA 3Q9LA 5IRCD 2HJGA 2XOKD 3AUXA 4B75A 1OFHA 3D31A 1SKQA 4FMDF 1EGAA 4PAOA 1AZTA 5E95A 4LHVA 4OK6A 4X8MA 4G1UC 3WBJA 2GVDC 4RSGA 1HURA 1KO5A 2R6AA 1SXJD 4I4LA 2A5JA 3LH5A 1P7CA 3I32A 2QAGC 1HV8A 4WOPA 1QHNA 4KSBA 5JECA 5TMPA 3K0SA 2DWPA 5FR1A 3FMIA 2GEUA 1WXQA 4AIIA 2OXCA 3DHWC 1CJKC 1SZPA 3SC3A 4UXHA 2PEYA 4IEEA 3X2SA 4MKGA 1GNRA 2PEZA 1FX0A 1Q44A 2FE4A 3CRMA 4U02A 3LAWA 4RKFA 4I99A 1P73A 2ERYA 4XVRA 2GVZC 2FEOA 2WOJA 3GCGA 1G7SA 4MGIR 4LK2A 3V4RA 5KNDA 3AVPA 3B9QA 1COWD 2ZSBA 4JS0A 1DBSA 5EXSA 3A4LA 1W0KD 3Q85A 2GKSA 2Z43A 4JBXA 3SU8A 3J81k 3VX4A 5EE0A 1SVSA 4LHXA 3FE2A 4PSKA 4PFSA 4D0GA 2JLVA 2WJVA 2HLDD 1E2EA 3DM5A 3G5UA 3NBYC 3G0HA 2CBZA 1G19A 3ZH9B 5FPKA 1XEWX 5KPJA 3OEHA 1MKYA 5DIFA 1US8A 2DPXA 2ZSDA 3KUCA 4XWAA 4Q4AA 4DDUA 4B47A 1R2QA 1I4LD 4JLVA 4A2QA 2ZREA 5A5GA 3UPUA 1XMJA 3CR8A 1Q1EA 1UF9A 2FV8A 2R6GA 1N6LA 3BH7A 3DZDA 2AKYA 1G7TA 1EESA 3OZXA 2GCNA 2E87A 4MYTA 4A92A 1UKVY 4B6FA 5FPYA 3GLIA 2RCNA 2ZJ8A 4PZLA 5KYKA 2J7PD 5DSZA 5EXPA 2V1UA 4M0LA 4Q7MB 2RGEA 2I3BA 4NCHA 3VMFA 1NLFA 1NKSA 1FFHA 2ZE6A 4GSYA 4OQMA 1GOTA 1U94A 5C18A 2V7QD 2P0EA 1PUIA 1PJRA 3A37A
chains in the Genus database with same CATH superfamily
1AHIA 2EXXA 2RHJA 3HLYA 1IMOA 4HDMB 4YIKA 1EDEA 1QH1A 3CXRA 3U3DA 1W5TA 3U4GA 5LQDA 3EAGA 2KI5A 3HWX1 3OF2A 5LM3A 1CJMA 3QKTA 2JGNA 5DEOA 3ZLJA 1DRUA 3V1UA 5LJLA 1BKSB 4ZV7A 1SC9A 1P4HA 2AFIB 2PPVA 1PWEA 2PT5A 2E18A 4FLMA 4P0TA 1G0OA 4JMPA 2IEGA 1OFGA 4KX3A 1XCMA 1ENZA 5C46F 3TG2A 1GRRA 3JWIA 4D2IA 4DXDA 5IN5A 3I5UA 3NTXA 3K6JA 3NOOA 2VPIA 2F3QA 1Y3BE 1QH8A 1ZMTA 1KKUA 5AJUA 2H29A 4E12A 1WZNA 4BNZA 4JOQA 3OP4A 1ZM4A 2VXCA 1MOQA 3N86A 5CB0A 3F78A 5PGMA 4OTZA 2OCBA 4YAKA 2WKRA 3JD2A 2QV7A 5C4IA 2PT6A 3ITEA 1PJAA 4NMLA 3T12A 3A6DA 3S2UA 3P27A 1M8FA 1E1NA 3IR5A 1F38A 3ZS8A 3QG5A 4H3SA 4RTOA 1QGDA 2J5XA 3GLQA 3SQNA 3QIVA 3ASVA 2PLWA 3HKCA 1VYVA 5EKUA 1T1RA 3EF1A 3TIGA 1NPDA 3JAKA 1G38A 1W5EA 4CM4B 1US8B 3RFVA 4IO0A 2PO5A 4FILA 4X63A 4BLTA 1QGUA 4J0CA 1YQEA 4Q4AB 4WKBA 4G0QA 3TQQA 3AY3A 3NIFB 3OQIA 3A6GA 3PZBA 4KMRA 2Z8YM 5CDTA 3Q9UA 3ZE0B 5LUAA 1MJFA 3IV6A 1NR5A 5JC8A 2GZSA 3LW8A 3PGXA 4WK0B 2XVMA 1E69A 2EJWA 3S5UA 2P9EA 1N36B 2PU5A 4BQOA 2QRZA 1QM5A 2N42A 1JVSA 3X1XA 1MU0A 2CCGA 5ALLA 5ETJA 4ZEOA 4BVBA 2O2ZA 4N5NA 2VDVE 3LRPA 1UEJA 1RJWA 2HEIA 1PK7A 4IJWA 3PQDA 4F8JA 5K7SA 3AUTA 2OWEA 2ZBDA 4E0BA 3H1BA 1NC3A 3TM5A 4B2LA 4LF5B 2CMFA 1SO8A 5DWDA 2LCQA 1PJ4A 1EM8A 1GPMA 2OD2A 1O8CA 4GXRA 4IZIA 4MQ5A 5CVCA 3VHLB 4CMJA 1E9FA 1CZOA 1QH1B 3C3YA 2WYVA 5EERA 3NBFA 3WMEA 3I4CA 4G23A 4ZJPA 2HREA 3TLKA 3D7RA 4MQEA 2YJ4A 3C6MA 3NATA 4RGYA 3NDBB 2VNJA 3DE3X 2OWDA 4QATA 3TQHA 2GBGA 3K73O 4KLAA 4W7IA 4M1MA 5AIAA 3QF7A 1C9JA 1MV5A 3NG1A 4H1TA 3COJA 2FMIA 4HWGA 1VXRA 1W35A 4I55F 2OL4A 3QMVA 1PJCA 2JGRA 1JWAB 4LA4A 1BXRB 3UWDA 4G0UA 4OHVA 1Z82A 4W5QA 2D06A 4Y2HA 5TC4A 1Y9JA 1AKWA 2ASEA 1CR0A 4XSVA 1AQIA 1HBJA 4U2GA 1UBLS 5DFAA 3PGA1 3SQLA 4EI7A 5F76A 5HFAA 3TZEA 1NXQA 2I2DA 1OI3A 2AS0A 4DWVA 4GZ6A 5FP0A 2XIJA 4ZIRA 4TYMA 3EVBA 3HKCB 4FN4A 4F2PA 3VR2D 1XRNA 4BNIA 4B3IA 4M22A 1U8EA 1GYRA 4WT7A 3S8MA 4QNMA 4ETWA 2J32A 3GV0A 4RY0A 1U4OA 4UUPA 1K86A 3A6LA 2J3KA 3ZHSA 1WZ2A 3AVWA 1Q12A 3OQIB 2FFBA 1WDMA 2ZS8A 4D81A 1YRBA 2QYOA 3CCCA 1EEHA 4P0PB 4JI0B 4F38A 1IHYA 2OYSA 1ML3A 3IPRA 1IQRA 5G53C 4OYYA 1ZCJA 1ZZEA 2WIJA 4I19A 4BLSA 1Q57A 1T4GA 1X1RA 5JUWA 1Z4QA 4OB8A 2IZ0A 4ZYZA 4GBGA 2KLHA 5JT1A 3DOCA 2W83A 4OVKA 5HHTA 2EGHA 4BX8A 1UKCA 5B2EA 3V4VB 3KQTA 1ADCA 3E2IA 1EM8B 1U0OC 3FTNA 1F5SA 1UBRS 5GJWC 1IQ0A 1Z62A 1CJBA 1O95A 3PQFA 4R1MA 4B3FX 4C20A 4FW8A 1QZUA 3GGCA 1ZN2A 2LDBA 1BEEA 1U04A 1OYOA 5AW7A 3K0AA 3EASA 4CL2A 5CVJA 3T95A 5EIEA 2G5TA 4MQEB 2Y0DA 3HO6A 3I4FA 1FEZA 2WTNA 2PUAA 5J47A 5GPBA 3A7EA 5D1NA 3X2FA 4UOQA 3HFJA 4XJVA 2C42A 1BFKA 1XA4A 6GPBA 3DT6A 2DFTA 3X44A 5D7NA 1HT0A 1EA7A 4EH1A 2ZKLA 2ECQA 2AFIE 5BQPA 1NFFA 4E5UA 4EYSA 2BR3A 4Q48A 2Q41A 2FZVA 2UUOA 4UUAA 4W1QA 3VU9A 5LB2A 3QLJA 2Y0CA 4PIVA 2ZI7A 4AF8A 1VA5A 1ZSVA 3WK6A 1W25A 3UATA 1GAQA 1WWKA 3P52A 2ZITA 2ZIZA 2CBXA 3N8IA 2GD0A 3PEWA 1BRMA 1J8FA 4EP1A 2GGSA 3CLSD 4ZIRB 3VSEA 2ZIUB 5BR8B 1ZQ9A 2YW9A 2FPSA 1A88A 3RFFA 1VPLA 1XXHA 5BN5A 5KTYA 3NT5A 4HI0E 3H5LA 1FZQA 3DA8A 4DDTA 3AVVA 1PEKE 3TLJA 1Y5MA 2Y1LA 3GLKA 4Q1DA 3RNOA 4D5EA 1KI4A 4RVHA 5CT4A 4YWJA 5K8TA 3UG6A 4BLVA 5L8VA 1CRLA 2ZJYA 3AZOA 3LQRA 3OTHA 4IF4A 3K9QO 2FEPA 3OKPA 3H99A 3IV7A 3EXIA 5CCBA 1N0UA 1YBMA 4FLFA 4BMSA 4WZAE 1OFIA 1BROA 4ENSA 3FFBA 3GJYA 1FXUA 2BGUA 3R74A 2YY7A 1NUPA 3QKWA 3QFHA 1T5HX 1QIJA 4Y6GB 4OBEA 2ETVA 3GJ5A 2C4MA 3GLIE 4OP3A 4QBFA 4JOSA 4RHYA 1L6IA 3T4PA 4G5XA 1A7JA 3HTXA 1Q95A 5T8KC 3TEMA 4ESOA 5GJBA 1E60A 4PZCA 2ZAOA 1OZGA 2C97A 4V0KA 5IAEA 1HNXB 4TYWA 4QHSA 2DM6A 4KIFA 4GWGA 2NP7A 2X9NA 2GPWA 4WUVA 4NAVA 4C43A 2JZOA 1HE3A 2V3CC 3MRVA 4EW6A 3FSGD 4GUDA 4QARA 3NYRA 4P4GA 4XWOA 4K86A 3FAZA 4ESVA 4AO6A 4V1CI 3OICA 2Q0QA 3H3JA 4MQUA 1KPGA 3BMQA 3U40A 3EBPA 5AOVA 2NGRA 2ZXFA 4IOKA 1D9XA 3CUYA 2B4TO 2A33A 2E5WA 3P5BA 4OIMA 4QXPA 1CQXA 4N0QA 2IK8A 2Q4DA 3EBOA 4LXHA 1F2UA 5FPPA 5A9TA 1Z4JA 1KY2A 3QUAA 1FFYA 5HZKA 1Q2XA 2ZTVA 3D2AA 4D0SA 3OY2A 1ENYA 4I3FA 5BXQC 3KPWA 4BB0A 2ZVDA 1YDHA 1G8JA 3DC2A 3W8FA 5AVRA 3CCBA 3JWEA 4BVGA 4UOZA 5LZ7A 1EP3B 3HXOA 5EJFA 2C7VA 4WK6A 4ZAZA 5FNVA 3GBPA 3VBEA 3ZJVA 1GGVA 3OKFA 3GI1A 2QTMA 2A0XA 1KEPA 5BN5B 3D8BA 4E2XA 4LV5B 3HCCA 5AW6A 3N2KA 2ZI3A 4IUDS 3DUFA 2DPGA 4GXQA 1Q7TA 3FMGA 2JLYA 3EQZA 2GJSA 3HLKA 1DQPA 2FMKA 2OXFA 2R751 2XT6A 4G0PA 4KOAA 4MW0A 4QUDA 2O0JA 1AA9A 1Q1ZA 2YIMA 5BQ3A 3AW9A 1FFCA 3R24A 5EVCA 5ILGA 4CIVA 1L3BA 4CHGA 2IBMA 3BWXA 2CHGA 2EZ4A 1ZMBA 3I23A 1R7RA 4IV5A 5A3SA 2UVDA 3QE2A 3TLZA 3TQSA 2C84A 4OYLA 5HE9A 2C0CA 2BGTA 3PRJA 1CT9A 1B8UA 4S1TA 4TL9A 2QG4A 3K9CA 1UKBA 2XY4A 5G41A 3WA6A 5KWSA 1MB9A 1BOOA 4JITA 3E8SA 4QDKA 3PB3A 1ZZGA 3Q0IA 2C2WA 5KSYA 1Q74A 3HJCA 3I01M 3R7AA 5YASA 4ERNA 5EJIA 3PQ4A 5SYMA 4ZOLA 3KV3O 4Y6QA 3ZXSA 1MOSA 3INTA 4B8ZA 3V80A 5EXTA 1IXKA 3OHSX 4C6RA 1H69A 2IPAB 2ECKA 2QTWB 2WJJA 3LDFA 4HQLA 3FROA 3LP5A 1XCBA 4YJKA 1GN8A 2JD0A 4AMUA 4J03A 1Z5GA 3EN0A 3RC2A 4ASUA 4F2DA 5C8YB 1H85A 5EHQA 4X7BA 1Q16A 4DMRA 1WB6A 3E53A 3EFEA 4NMHA 3UM9A 5A02A 4WLNA 4I4CA 1B4DA 4G65A 1BFDA 4ZYLA 3ST7A 3IBSA 5CDUA 2RHLA 1F2UB 2GLUA 3DVSX 2WSSA 3ZCTA 8LDHA 5EN4A 3WLSA 2JAXA 4G8BA 5DOVA 3WGGA 3ZWAA 4H15A 5M34A 2JIZA 1C14A 1Y3IA 2XUGA 1WP9A 3IJEB 1PRYA 1FTWA 1I51A 1QR6A 2BEKA 2OOSA 3A6FA 3B13B 3F7NA 2AR0A 3FVVA 3IHKA 2XT9A 2VJDA 3VDMA 1GA4A 4DZRA 3GN2A 1FJGB 4OH7A 4X0EA 3ACCA 4RSRA 3U2QA 5U4XA 1CP3A 2A3NA 1UDAA 3DUFB 3BGWA 2ZXEA 1A8PA 2A1TR 1J5PA 1XAIA 3RHTA 1IHDA 1UM9B 3NCHA 4DQLA 4Q7LA 5I7EA 4NNPA 4C14A 3A1WA 4AXBA 5K05A 2BKAA 5EJ9A 4NK4A 1ETHA 1ORVA 2BZ1A 3VNVA 1ND5A 4MUIA 5AUOB 1HDEA 2M9MA 3M4JA 3HH8A 2FHSA 4CGYA 3BHIA 4YV1A 4EI2A 2RGCA 1EZ4A 2OBYA 1TD9A 3PFHA 4G36A 4UM9D 1YS4A 2NZWA 3FTEA 2OZLA 3OFSA 4KK4A 4XASA 3RRYA 4WBNF 2FA9A 4PG6A 4ZOLB 4Z4FA 5FAXA 5JYBA 2WJ3A 3ADOA 3EE6A 4L8FA 1NMYA 2AWOA 3U0BA 2IUTA 1B6TA 2AJCA 2CY0A 4AUMA 3F4LA 1JIKA 2WT8A 3F6RA 5GOTA 3JQEA 3OPYA 3AUYA 1N1DA 3CW8X 5A2GA 3ADDA 1KMIY 1BWQA 1XYYA 2DUNA 3E4DA 3OTGA 3TZCA 1B0AA 2DUWA 3GLTA 1DC4A 4LMAA 3FYCA 4NULA 4PLTA 4PR0A 1EFUA 1F12A 4N03A 4R8SA 1GXSA 4YRLA 3M9WA 2F3TA 2VRCA 3WHPA 3HE3A 3L4EA 2A9PA 3DDHA 3SG0A 3NIWA 2Z95A 1PYOA 2WZCA 3NH9A 4HX5A 4MRVA 3ED5A 3WKCA 3VNUA 1QDUA 1CHDA 4LOLA 2QMOA 3O3CA 3AR9A 3JV7A 2JHAA 3QRWA 2WTXA 1F4VA 1ZPDA 3V8VA 5LOVA 1N2SA 1WVMA 1ZVQA 4PXYA 1IB6A 2JCGA 4ABYA 4HLUA 1G8MA 1FP4B 2JA1A 2Z08A 4KHPB 4O4IF 5C1DA 1RWNA 1Z0JA 1EFTA 4TROA 3MHTA 4HVLA 4D3DA 1RBQA 4RF5A 1IY8A 2PRJA 3AERA 2G67A 1JAHA 1QG2A 4WIAA 3T9EA 2QGZA 3IEMA 4IOLA 1Z0AA 3KHUA 4DV2B 5ALYA 2KMLA 3Q2KA 3BMCA 1SA0A 3U81A 5T67A 1EFVA 4PXAA 1QV7A 2EZUA 3OZ7A 4J4TA 1K9VF 4INZA 4N0PA 2ZRKA 3FZYA 3CTMA 2B98A 5F7XA 3MOGA 5IYZA 1YFJA 1Y7TA 3I1IA 2UVPA 1U1GA 1IPHA 1Z5OA 1NN0A 5JJLA 1TLTA 2AEFA 3ROGA 2DETA 3EQ8A 3KZXA 4D3YA 1SCUB 2H52A 3VOBA 4BC1A 1ORDA 1YSCA 2OZLB 3KNZA 2HSDA 5F3DA 4ZKEA 4M9ZA 3VVMA 4M8KA 2D5AA 1U6KA 1Z18A 2QLMA 4RE5A 1ULBA 4DBLE 1TL7C 5MF6A 1QMPA 1AKRA 1E1QA 2E9SA 1C0PA 3MPOA 4LV8B 1OD6A 1TMOA 2PVSA 4KR3A 3F8WA 3WHLA 3H6GA 2WWTA 3B52X 3OPYB 1N7JA 4L5IA 3V97A 3M4ZA 1T2UA 1NBWB 1UQTA 3OX1A 4OGWA 1BXGA 2WTEA 1E2KA 3F5QA 4JKYA 1T0HB 3OIWA 1GXSB 1X42A 2ERXA 4LUCA 1KO7A 3JWJA 2CXSA 1J25A 1GUYA 2OG2A 1WZIA 2FYTA 2WIFA 3N7TA 5D01A 4A0HA 2BDTA 3TSCA 1JU4A 5HS4A 1TJ3A 2PSHA 4YEDA 1NLUA 3IXLA 3M8KA 4Y1EA 5K2MA 1NVWQ 2X13A 4CKZA 1A9SA 2FXIA 3JQAD 4KREA 1ZGHA 2EDCA 4HPWA 5EIBD 4DIBA 4W7SA 2V9ZA 2XJ4A 3P5SA 2PM8A 4U2DA 4UTXA 3OQMA 2HMYB 2R1VA 3G9QA 4D56A 1P2DA 2DEUA 2IZ1A 2QGFA 2D6FA 2QL9A 3ENZA 2J7KA 1R64A 4O59O 2XSZA 2BGMA 3LXUX 4IKOA 3CN9A 4RZIA 5DBOA 3U7QA 4C5CA 2HLHA 3AYXB 2FW8A 3EZYA 2J3JA 1B73A 4HQ0A 4YHBA 3AW8A 3ME5A 2VRWA 5L7YA 2H5EA 4LDAA 3BMCB 1SA0B 2BBSA 2GXAA 3THRA 2NO0A 1T2FA 3HJUA 2P8JA 4KDFA 1JLKA 1MEJA 2WA2A 4HUJA 4WJZA 5ARCA 4BGIA 2OHHA 5A4MS 1X80A 3AX6A 3O92A 3ZCVA 1SCDA 4PTYA 4V3BA 2MYUA 3RDPA 4A2PA 4ND6A 5IYZB 2ZB2A 2OZVA 3GFQA 4K46A 4D41A 3VNAA 1Z6QA 1FTGA 1NW8A 4Z1MD 1HDIA 1NATA 4NBTA 4DR5B 3UQZA 4KAAA 4H7PA 3SAJA 1O95C 2BUCA 1GFIA 2OORA 3ZCSA 4OOFA 4KXFB 1SUCA 4KXWA 2JFFA 4YRIA 3U19A 3BMXA 1JA9A 4JC8A 3PQCA 1NW3A 2R6ZA 1JDBB 3OSUA 4MPDA 2ZW9A 1NLZA 2C5FA 3IEUA 3Q7SA 4XB6B 5AVOA 1OBFO 3RHZA 2W6NA 4YRCA 3V7FA 4ARZA 4HGZA 4RTSA 2OV1A 4LJ4A 3A1UA 1BXGB 2GCPA 2ZULA 1KFEB 5HYVA 4HGOA 5D87A 1QORA 4P5DA 2ZWPA 1Z08A 4K6FA 5AP9A 3WL7A 1WETA 1XTQA 2ZBRA 3NYQA 4YRAA 3PJRA 1ZNYA 3DMHA 1T15A 3UB4A 4ID9A 2FDCA 1ZNZA 3EHDA 3HXMA 3T99A 2O8VA 3VOSA 2CLLB 2N47A 2QN3A 3EQ9A 4P31A 4PYIA 1MPXA 3ONNA 4RH1A 4QU0A 2XXBA 1QRAA 1TM1E 1WSWA 3IEKA 3N8NA 4GM4A 4IW3B 5DW0A 4EW3A 3CRQA 2VAVA 3U3ZA 3RIGA 5DXJA 3T3HA 2NXWA 2R1VB 3IIEA 1HK7A 1KQ3A 3ZHQA 5CA1F 3QKSA 3RARA 5AJWA 4JI3B 1ZK3A 4X91A 3WYBA 2YWEA 4DLTA 5C51B 2ZB4A 2FRDA 3R5HA 3OPNA 5MGBA 1E32A 2Y77A 3ED1A 3U7QB 4DMLA 3R3SA 2FSFA 3C3EA 3O2SB 3OZUA 1M34A 4EL0A 1F0NA 1L5QA 3F6SA 4RX1A 2D0OB 1VSVA 1QRTA 4LNUB 1W88A 1FTQA 3IP9A 4MRAA 4WADA 3WIEA 2G1JA 2QD1A 4PC6A 5LMNB 2GK7A 5K8JB 4X41A 1K5GA 2O50A 4HXFB 5E0OA 1AV7A 1ZXBA 1X80B 4INAA 5AI9A 1XZAA 2XGMA 3MGKA 1H22A 1LJ8A 2CK3D 5KVSA 1Y7IA 3RTCA 3V9AA 1QCZA 1EZ1A 2BTQA 1XYGA 2G9RA 1TO2E 1ZHFA 1RJFA 1OMOA 1Y4UA 1KJIA 2Q46A 3VA7A 5B6JA 1P60A 2JJQA 2QRLA 2CL7X 5IKXA 2BSAA 4L57A 4OQEA 3LBNA 4XUEA 5K0JA 3SR4A 3GLGB 1R6VA 2ORWA 1S2LA 4FFRA 3P45A 3BPSA 4U6SA 5ENVA 3H75A 5BWNA 4PPYA 2VT7A 5SICE 4NU6A 1FUIA 3V1TC 4ZYVA 2EFEB 5GONF 4ARZB 1SVMA 1U4SA 4GMFA 2FPPA 1M0WA 1I4OA 3ZWKA 4ND2A 3RSFA 2QPAA 4U00A 2O07A 4YI5A 4KE6A 3KQHA 3RFXA 3DV2A 1VSTA 1J9EA 4DTIA 4IIJB 4I1IA 2ZUBA 5LNK1 4WLEA 4YIHA 4XPIA 3CNLA 1ISGA 3FPEA 4DDMA 4DUZB 4FEEA 1LFDB 3GNLA 1PDOA 3IHLA 3L82B 4GIBA 2BJVA 2PL9A 1ZJ4A 4HXEB 4C7OA 3O31A 3WR5A 2B6HA 3SZOA 2VZ8A 1K08A 3SK0A 2Q3HA 3EZNA 1C3EA 4I8DA 4RADA 1SCNE 1ULTA 3QKSB 1CTQA 2PXCA 3EVDA 4JENA 5CVUA 4C21A 2GN8A 2P3QA 3BOSA 3EEYA 1JR3E 3W9SA 3MWEA 2O3SA 3UMMA 4H6VA 3VZRA 4ZGWA 1TOAA 3QMPA 1VHDA 5LXTF 1JKJA 2IEYA 3BFXA 1QIIA 2R25B 1X39A 4P38A 3HL4A 2B61A 3ZQ6A 2HNBA 2QPLA 1NXOA 3EOBI 2ACEA 4IDGA 1WU8A 2G0AA 1W88B 2H3EA 3H11B 3FB4A 3WP1B 4ZDJA 4LGVA 1OSNA 3QVTA 4IKEA 1SUPA 2GRJA 2NQTA 2CJXA 4IDQA 4CCYA 2WJWA 3RIYA 1NU8A 1OTYA 2JDID 4PYKA 1PL8A 2WNIA 4TUYF 4RKEA 1FXWA 3V3TA 3KQNA 4W5RA 1DUVG 2YV4A 1J2YA 1GDDA 1WXDA 2PWAA 4GBJA 1K7YA 1PO7A 1YDMA 3M83A 2H1OA 1J21A 4KXXA 2BTQB 2K5UA 4QYIA 3NBAA 2DVMA 1W9HA 3GVCA 2IOQA 4ZAGA 1MO3A 3TZQA 4HWPA 4Z7JA 5IF9A 2NUTA 4S05A 1TM4E 3ICPA 3JQQA 2PQ0A 4E51A 3CUTA 1MAVA 1LLUA 1AD2A 1UFKA 3OU6A 4DV7B 1VIMA 3AHJA 3JTMA 3X1MA 4NWIA 4PAMA 1DZ3A 3CZAA 1A2OA 1E2FA 3ADCA 2FPPB 2HK8A 3IT2A 4ENWA 5B64A 5AESA 3SS7X 1UJCA 1ZGBA 2IIBA 3T9CA 1O6CA 1XDWA 2WT9A 1TADA 2YV3A 3U17A 5HS6A 3WX0A 4YRGA 2VK4A 2YDYA 3H1FA 3TW4A 5IX8A 3D7KA 4MTLA 1RI2A 4BKOA 4LJ5A 4UDOA 1T4DA 1OIVA 4GOJA 4XPIB 1U7HA 3SR0A 3WSTA 3ZVNA 2B35A 1LW7A 2J3MA 5IUNC 1YTUA 1YAHA 1QVAA 5DI3B 1GIAA 4UEWA 4XYGA 5AQEA 1G2IA 4C7OB 2H7YA 3NNNA 3QGMA 4XB2A 1G7RA 1BTOA 2EFYA 1A2BA 1RMTA 2NV0A 3JPYA 4EK9A 1EPUA 4NZNA 4OJMX 1N2GA 1DWUA 1CR2A 5FOUA 1E2DA 1ZEJA 3DBOB 3MWEB 3PNSA 2Q1YA 5ALRA 1H3EA 2HW8A 4G5SA 1IY2A 5L40A 4MDHA 1N8SA 4ZEWA 3DMGA 5L3SA 1UPTA 3HWWA 3B5IA 2P6OA 2ID4A 2OKCA 1SQ6A 2L0XA 2QVXX 3JD4A 1S2OA 1N6RA 821PA 3QUBA 5KU1A 4X00A 4RVCA 1QF9A 2RG7A 3LUGA 2B8EA 3A58B 4GF5A 4H0NA 1Z39A 5LP6F 3X43A 1HDRA 3BCHA 3T5MA 1OWLA 3IDSA 5EHNA 3VR0A 4EY8A 5K45A 2DR3A 2B82A 4LY9A 5D84A 3RJZA 4X8OA 4EVSA 2NUTB 3CT6A 4AVYA 1KQPA 2GHIA 5C53B 3NAMA 1BDBA 4DV1B 5JVDF 4RJ2A 4Z99A 1TK9A 3C3XA 3TD6A 5I47A 1I94B 3DNPA 1LS1A 2O2GA 1HSZA 3D5EA 2VK8A 2FW0A 1P19A 3UT5A 3WJAA 4GXNA 3H83A 1ATIA 3ZLBA 3GLGE 3FBWA 4R5HA 4LDZA 3K0FA 2JBHA 4C7MA 5C5IA 2DQZA 2VBIA 4ZCMA 1BW9B 3M33A 4RMIA 5BSVA 5K0BA 2GX6A 3V46A 1NTRA 2HA6A 3DEIA 5AVKA 3U0VA 2ST1A 1P0IA 4RVSA 2AEEA 1K75A 1PNOA 1O54A 3ZHXA 5LWQA 2I4MA 1G8YA 3FCEA 4G6ZA 1QK5A 3FCCA 3TI7A 1LBQA 4MMZB 3OLXA 1U9YA 1GTZA 2XWPA 1NBOA 5E1BA 3PI6A 1Q0LA 5CXUA 4FQ5A 4L0QA 1IXSB 3WLOA 4WJLA 1GDTA 1DAGA 3N2ZB 1O97C 3CLTC 3RS0A 1DKPA 4HLUC 4E6EA 1MQAA 4BTEA 3LXRA 1EHIA 2FF5A 1R3DA 1RBZA 1TEXA 3Q3EA 1W581 3E0XA 3FRHA 4F5DA 2RC6A 3FUCA 4D5GA 1H6CA 3FOAA 2CHFA 4L4SA 1PT8A 4ZO7A 5KIAA 1GKYA 1TQ6A 1YJQA 5DHFA 1TC1A 3BKXA 2B9EA 1TW2A 1NQAO 4V03A 1ZDMA 1GSAA 3FW1A 1TGVA 4ED9A 1KBOA 2PH5A 3ZNOA 2VBCA 4ZDIA 2BPOA 3G3EA 3M34A 2PD3A 4O5OA 2PX8A 1DADA 3F9RA 3KKMA 3QSYA 2RGWA 1PSZA 3AKCA 3WIBA 1PDVA 4DJAA 1OFVA 3IO5A 2ROQA 2HSWA 4C05A 1SKAA 3SJUA 5CA0F 1TT7A 1XTUA 3W6UA 3EISA 3K9BA 3ZHOA 1JA0A 1KOJA 5FBVB 3AU9A 4UZSA 3BWEA 2IY9A 5I9TA 5I45A 2AX3A 4HWRA 5BOSA 1H2RS 3MJ4A 3MERA 4O4HF 2Q1XA 3M70A 3PUVA 2HUNA 1OXVA 2J33A 3NWPA 4RIHA 1Y80A 4E5YA 4RFSB 5A9RA 4W9NA 5LJIA 1NP3A 3DHYA 2P5YA 4F3NA 4HP8A 2ORED 5FAKA 1RCUA 1JDSA 2BFWA 4DADA 3EXAA 5SZJA 2KS6A 3UT5B 2XEXA 4G1BA 4JYZA 1Y1RA 1T9GS 1RLIA 5AK5A 4AKGA 4V0QA 1BSVA 1P9WA 2DSTA 3EXHA 3QOWA 5F7OA 1EHYA 4HGRA 5JFTA 3W5DA 1J4AA 1DJNA 5TJHA 4QOJA 2YR0A 1IK6A 2JG3A 3EG5A 2JZCA 2P78A 3WP0A 1GQSA 2COKA 3DGFC 2RKOA 3PC7A 1RRVA 3N8HA 4XDHA 3CVJA 4UEOA 4C7XA 4W6QA 1I1NA 1PV4A 5FORA 4ND1A 3BIWA 4N9WA 1JFLA 3PVSA 2ODTX 3T3EA 3VKHA 2WJ4A 3IESA 4EF5A 2O57A 2OM6A 3GNQA 2HYIC 2QL6A 3MCVA 5K0ZA 4CKWA 1UAYA 3KVVA 1SVOA 1EEXB 2Z8YA 4H18A 4YMGA 2IW3A 2DKFA 4R9RA 4C6TA 4YXWA 3M2TA 3VZCA 2NSDA 3DPSA 3MJSA 1Z8FA 3ER6A 3Q41A 5KDLA 3ZDEA 1NI4B 4DKXA 5CT5A 4YMSA 3TTYA 4QG7A 2W71A 3E5MA 3FI9A 3OEYA 3X1ZA 5BVHA 3KTAA 1R6UA 3HHPA 4I4TA 3EFOA 4QL3A 5E2IA 5EIWA 1V7CA 2BEWA 2L2QA 3VSBA 2N46A 4TTVA 6REQB 2Y0BA 3OFKA 2WTUA 4JV5B 1EK2A 1VG0B 1VDMA 1ZM2A 4JJGA 5IS2A 1JFFB 1VJ1A 1UBUS 1VPDA 1YRQA 1GCUA 4J1TC 4L8WB 4P58A 2G6TA 2X42A 1TF5A 3D4BA 3OZFA 1NJ2A 4IFTA 3FTFA 1BVYF 1XMSA 8ADHA 1M6EX 1WUKS 2OORC 3MT7A 1BMDA 1W0KA 1J9ZA 1U63A 3JD1A 4RGBA 1ZVKA 4MV7A 4V0RA 4HLQB 1U3WA 1GTMA 4I81A 3OD5A 3NT2A 3QHQA 4MVJM 1FMFA 5C1IA 1B2LA 3H2KA 1J56A 4QTUB 4ZGBA 1MO4A 3HDVA 5FA8A 3VJMA 2ZR9A 1JQAA 1PW5A 5HMLA 3AMVA 1WXIA 2GXSA 2HT1A 2HPVA 1H1LA 2PWYA 5TJ9A 4ESHA 3NVDA 4MLCA 3VC3A 1VPEA 5HIKA 5DHSA 2BR5A 3LX4A 3ELYA 2WM3A 2QE6A 4BDSA 3LDGA 2EL9A 2QM7A 2YFHA 4Y6PA 3ESYA 4CIBA 5KSWB 2BGIA 2C2XA 4CEJB 3TPZA 1Y9ZA 1EDOA 3SPXA 2ZT8A 2VH2A 3CE9A 3H19A 2G8NA 4PZDA 5KYYA 3WWZA 3C5CA 4IXNA 3KM0A 1H4SA 4DMMA 3FNFA 3HKEA 3R3ZA 2JEZA 4GX5A 4NCNA 5BQOA 3QVGA 2P2ZA 2C3YA 1Q11A 5GOZA 2FPKA 1XMPA 3CNBA 1PKXA 2GPYA 1U6JA 2K6GA 3QX7A 1OPXA 4FK8A 4TXLA 4EARA 1AMUA 3JYNA 3L8CA 3LHSA 2C5BA 2FK8A 1TJPB 4AP5A 3LRXA 4C6TB 2FRDC 4IYRA 1P80A 2J8ZA 3IAXA 5EINA 1HUQA 2ZRNA 4U2FA 3UHJA 5IVKA 3FPJA 1JFRA 3CW2A 1SHJA 2F90A 4EATA 4WCFA 3NH6A 3ETJA 4R40A 2OMEA 2A14A 4AO7A 2XAAA 2ZPTX 5L4SA 3CEMA 5KSZA 3LWZA 3G1TA 2PKYX 3P94A 4XIJA 2YVUA 5CBPA 1D2EA 2AF4C 1XCPA 2XKJE 4ALIA 2QL5A 5BVHB 6LDHA 2ZI6A 1I01A 5DP1A 1YA8A 2YW2A 3N0RA 5E3HA 3MSXA 2OTCA 2WIBA 4BQQA 3C5VA 2NO1A 2WZQA 3TTVA 1K97A 3HVUA 3OX2A 1GQRA 2KWIA 2PKCA 3HL0A 3P26A 5KVAA 5MGNA 4R68A 1WM1A 5B1YA 1Z36A 3OTWA 2WI8A 1HR0B 3S4YA 4NZPA 3ILSA 3LPMA 1LDEA 2CEKA 4Y0NA 3X1DA 4E7PA 4IQ0A 2Y0EA 4JB0A 2V7GA 4XUDA 3I5YA 1UBHS 5CDSA 3RJ5A 4E3ZA 1Q15A 2GF0A 3FVWA 3C8MA 1PSDA 3KLPX 3W5BA 4ITUA 4TMXA 3PWTA 1H1LB 3SHTA 2R5FA 1V95A 1JKMA 4LZWA 1G9XA 4K2HA 1C30A 1P2UA 3GH3A 5ALOA 1GNLA 4OFZA 4TTPA 2NU6A 1OGJA 4QUIA 2ID8A 3C7TA 2EWMA 3LKZA 2REOA 4FI3C 2JFXA 1JYEA 3TSOA 4Y0VA 3W6PA 1CQPA 2B4AA 4XD7A 1HF3A 1EFAA 4IIEA 4F72A 2WHYA 3HKEB 3CWZA 4JX8A 5HF9A 2B5OA 3W78A 1G3IA 3QU5A 3QVGB 4Z9BA 3E7XA 1V9SA 1E4VA 4FQ8A 2I66A 1N6PA 2VOEA 4OJQA 3PRHA 3O8DA 4Q00A 1DKLA 2DE0X 2OAQ1 5MDHA 1G2OA 1KBZA 3L18A 4QPJC 5HNKA 1DAMA 2CLDX 4DPLA 2PGXA 5LLDA 4B3XA 4C3ZA 4ZQHA 3C3CA 3DKIA 4WCFB 4D4MA 1C4WA 4LHYA 1GDHA 1VKOA 1N0HA 2V59A 3ABQB 3UWKA 3MJFA 5IT4A 4B4KA 3MTIA 3GT7A 1C9MA 2RB4A 4IINA 3PIRA 4IDHA 4GBED 2F67A 5A05A 4FE3A 3EDOA 1Y6GA 2FMXA 1NXWA 1HZJA 3EEBA 5DYWA 1D2CA 1U5BA 3H2SA 2ZCJA 3R40A 2GDZA 5AYVA 1UPBA 4GH5A 2AQIA 3OF3A 1BQ4A 1B0PA 3EIUA 1M8KA 1N6IA 1NP6A 1IY1A 4QFCA 4WJKB 3TH5A 3ZZ0A 3FRIA 4DILA 1U3GA 2HZ7A 2IVZA 3RYTC 4U7WA 3RVSA 1O03A 4G4SP 4U5XA 3OPXA 1L7BA 2P4EA 3TRKA 4CQMD 1YFKA 2X3UA 3FDXA 2PSFA 1L5GB 3BE6A 3DLCA 2NPOA 1WXWA 2P69A 4G0MA 4S1OA 3KR0A 5IEJA 4QTXA 1C3VA 5KINB 1EAMA 2BMVA 5D6NA 2R7NA 3GRRA 3B6IA 1JB1A 4DHEA 4NAUA 3W06A 3SQOA 3D43A 3WFZA 4RXUA 4PYMA 2R8ZA 1M1XB 2JHFA 3FETA 4ZANA 1M7BA 1CS4C 3K5IA 5DRYA 1RABA 3U44A 1C30B 1D4ZA 2BFBA 2Y05A 3N0WA 3OURA 2NU6B 2IU3A 4NSNA 2OQ2A 3LPAA 4D25A 1UXOA 3ZVKA 3KD2A 1F8YA 4JC4A 2QTAA 1V9LA 3KHKA 2G83A 1DS6A 4AIRA 2C8JA 1L4YA 1V5GA 2DECA 2XVAA 1BMFD 5KQSA 4MHOA 3L93A 2I6FA 1Z35A 1VJDA 5HQ3A 1Y6RA 3B3AA 3OM1A 5DGHA 4FMCF 4BMOB 4D9EA 2WHEA 5BT8A 4OI1A 4KO8A 4XEUA 4Q01A 1JL3A 1K7EB 2J3QA 4UE2A 2XGGA 3V8BA 1N3LA 5L7TA 3ESXA 1KXZA 3WB9A 1AKYA 1UZUA 3I42A 4AWXA 2Q5OA 3O6VA 4ARIA 1HEIA 1VOTA 3SDZA 2Y1GA 1JXAA 3OOJA 3W9YA 3GLFA 1W44A 4N5LA 4PM4A 4YP9A 2FEKA 2P90A 1UJ6A 3ENWA 2O0MA 5DNEA 4E5KA 3M3PA 3VKVA 4E7OA 2N1MA 3AI1A 3Q9SA 3L3BA 2FZ5A 3L6CA 3MWJA 2VPYA 3NBMA 3OKAA 3O8OB 2EP5A 4XDGA 2G25A 1P2BA 1NAHA 1UK7A 3ORSA 4MEAA 4QGFA 3TJRA 2JGDA 1U5BB 3BTSA 5DLQC 4YUWA 4B6EA 3DS8A 4DV3B 4LZLA 4NE2A 2X0RA 2VP5A 4Z0NA 4BEWA 3B3FA 4X84A 4NZMA 3TUJC 3Q7QA 3KJIA 3SZRA 4BRUA 1U2TA 4PS1A 1KQNA 4CFYA 1FUEA 1RLTA 3I01A 1RHRA 4K28A 3WLQA 4CCAA 4XJXA 4DDWA 4HN2A 1KU0A 4S35A 1F17A 2YXNA 4DCVA 4RTMA 3RG2A 2JATA 3UTCA 2I55A 4MP6A 7GPBA 3MLBA 1XP8A 2CL0X 1NMQA 2ILVA 2IPXA 2P9QA 5BXYA 3VKUA 2A9VA 1ZP6A 1WR8A 3SOZA 5KVVA 2PV0A 2PUVA 4ZMRA 1OV4A 1UEXC 4YJ3F 5BPHA 1ZCAA 3KFLA 4J0KA 4NLLA 1ZLYA 4X8LA 5BMVA 1FFXA 1I3MA 3BCRA 2CXOA 3UJ8A 4PICA 1IHOA 2VNKA 5AKJA 5EJ2A 3Q9NA 3HO8A 3OPMA 3U44B 5HGJA 2BFBB 2DUMA 1TMYA 3BE8A 1S2DA 2HBZA 3BH0A 3BSSA 4FC7A 4MGZR 4OPMA 4B82A 3SBEA 4LRYA 5EKDA 3ZD7A 4UM5A 4J1SA 3LL7A 4ZCIA 2QZJA 1LVGA 3DTVD 4HAIA 1DGQA 4REQA 2F8SA 2WYWA 3SDBA 3B1XA 5CFOA 1N3IA 5LQSA 4I55B 1XNGA 5HQ3B 1DG9A 4HRVA 3ELUA 4Q1VA 2CD7A 4OY3A 1M2OB 2ZFUA 1XZLA 4GG1A 4JKIA 1S2NA 3GJ4A 5FV7A 4RTQA 1RQ2A 2HSGA 1S0UA 2AC2A