1GSIA

Crystal structure of mycobacterium tuberculosis thymidylate kinase complexed with thymidine monophosphate (tmp)
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
208
structure length
208
Chain Sequence
MLIAIEGVDGAGKRTLVEKLSGAFRAAGRSVATLAFPRYGQSVAADIAAEALHGEHGDLASSVYAMATLFALDRAGAVHTIQGLCRGYDVVILDRYVASNAAYSAARLHENAAGKAAAWVQRIEFARLGLPKPDWQVLLAVSAELAGERSRGRAQRDPGRARDNYERDAELQQRTGAVYAELAAQGWGGRWLVVGADVDPGRLAATLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THYMIDYLATE KINASE
publication title Cryophotolysis of Caged Compounds: A Technique for Trapping Intermediate States in Protein Crystals
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 81
structure length 208
sequence length 208
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2002-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1gsiA00
2QORA 2O8DB 1DAMA 1KI6A 3T1OA 3IO3A 2E1RA 3LQQA 4OQFA 4HYYA 1GNPA 3TR5A 2CBZA 4L9WA 5KNCA 3AM1A 3WHKA 2X19A 4LY6A 1JI0A 4PHFA 3EZFA 4EPWA 4HUTA 4UNQA 5CLLA 1GRNA 5CIQA 3TJZA 3KJHA 4EQ6B 3TW4A 2DYKA 3KXKA 1A2BA 3DMNA 4EFLA 4QHSA 1FNMA 1II8A 1W36B 1JPNA 5AJZA 4G5OA 5AWFC 4YQFA 4P4SA 1Q1BA 6Q21A 1XD8A 1SGWA 1GRQA 2I4IA 1CIPA 3I92A 3A4MA 2R65A 4IFEA 1OFHA 1E9BA 2A78A 4K8OA 3SBEA 3ZJYA 1E2LA 2V3CC 1P61B 3A58B 2VF7A 4TMWA 3OIYA 2D74A 4IXNA 2FOLA 4Y0AA 1OH5A 4BLPA 5K8IA 2ZS7A 3IHWA 1US8A 4M1MA 1X3SA 4M9XA 3EWSA 1LS6A 1VMAA 3LO5A 5JI3E 4JSYA 1XTSA 3GLGB 3VR3A 2GXAA 5EXXA 3NVAA 2UVQA 2OO7A 2JLZA 1N5IA 1JPJA 4NCNA 5FFMA 3UG7A 3K0CC 4A2WA 3O8CA 2J0UA 2ZPTX 5CJPA 2OE2A 4RFSB 3I61A 4PPFA 2ASEA 1GL6A 5AR1A 2JJ8A 4W7SA 1EK0A 2BMDA 3HYTA 1Z22A 4BQSA 4GZLA 5CK4A 1XPRA 4A36A 4JLOA 4CW7A 1CRPA 4LSGA 3IEUA 2X8AA 3CF2A 3PIRA 2QAGC 1J2JA 4U00A 4EPTA 4ZPXA 4RY2A 5TV2A 3GLIB 4AYWA 3G0HA 2C9YA 5DYIA 3HR8A 4B3DA 4DLZA 1EWQA 1IN5A 1O3YA 4O3MA 1UEJA 5EJEA 2GF9A 1Q1EA 1SQ5A 1WBDA 1GL7A 2JDIA 4PC1A 4BLQA 5CIWA 4DCNA 3VQTA 1CU1A 4LCBA 5G40A 1ZINA 3AKCA 4JLBA 2QL6A 2VHTA 3PR1A 2G9NA 4DEXA 5DIFA 3KB1A 1DADA 2QROA 3T1VA 3A4NA 4JKYA 4DDWA 1Q1QA 3PG5A 3T61A 2PZGA 1ZUIA 1E0SA 2PMKA 1G7TA 2JA1A 4JVMA 3LA6A 3SFVA 4BZXA 3EA5A 1AKEA 3HDTA 4GMDA 4IOMA 2ZAOA 4GI7A 3PCRB 5KO2A 1DAKA 1XXHB 1RIFA 3R7WB 3WBKA 1FMJA 1PJRA 1RW4A 4Q9KA 4OQXA 2GF0A 2G83A 2FJUA 4B2PA 2GAOA 1DVRA 4DLTA 1E0JA 4GOKA 1P4SA 2YOHA 1IXSB 5FOXA 4MKIA 1KO8A 1VHTA 3ZQ6A 4XVUA 2C04A 1XTIA 2ZRGA 2ZAMA 2W6JD 4Y0VA 4JLVA 1G20E 4B3FX 3PEUA 2YNMA 2ZR7A 1KI3A 1U0HC 3GJ3A 4XJXA 4TSFD 3REGA 3H2YA 4Q19A 3C8UA 2CCGA 1G3MA 3BC1A 2VIIA 4B48A 2YWFA 2QPAA 3EA0A 4OBEA 4DLXA 1D8TA 4JLNA 3TK1A 3S1AB 1UDXA 3K9NA 3CRW1 3A8TA 3L0IB 4YMSA 1YZTA 4NBSA 3BIFA 2A3RA 2V6JA 1ZCBA 4RD4A 1PUJA 3AP3A 4QHYA 2CK3D 1E1QA 1DAGA 2ZRDA 4OL0A 1OPXA 4ZI3A 4MKFA 1SXJC 4PZYA 2V4ZA 2VSXA 5DNYB 3M4YA 2NO9A 4X8OA 2NTYC 1U9IC 4LJAA 4BWYA 3AUYA 5LB4A 3VTKA 2RGDA 5KPDA 3EPJA 1F48A 4I99A 4OK5A 2BM1A 2NPIA 2ZSDA 4P33A 5SZIA 3FDIA 3Q7PA 4A0HA 2ODWA 5KNBA 1NN0A 2ORIA 5HZHA 2LCFA 4XIGS 1SVKA 5FPYA 3AF1A 3RWOA 4S35A 1AS0A 2XNDA 1IY2A 1IJEA 2QRNA 4Q9LA 1PLLA 4AD8A 1Z0FA 4TYNA 1KY3A 3CM0A 3C4JA 3WYGA 1M34E 2ZRCA 4Q1FA 1P5ZB 4CEJB 1NIPA 3U44A 4RSGA 2J3EA 3K8YA 2CNWA 4IEIA 5JJLA 3RS7A 2FF7A 4NYJQ 1JAIA 1W2HA 2GZDA 3L82B 4TLBA 4PPQA 2P6UA 2Z43A 2GEVA 2EWVA 2JCSA 4CF7A 1T0HB 3IQWA 4LC0A 2VHCA 2Q3MA 3C7KA 3PQCA 3SQWA 2IYSA 1YZNA 5BN5A 3Q72A 3V4RA 2IK8A 2BC9A 1OIVA 1BOFA 5HE8A 3WNBA 1S9DA 4QJ5A 3PEYA 3GFTA 1W36D 1TNDA 1CR2A 4A1FA 2HT1A 5JLJA 1BMFA 4XTCS 2BV3A 1CJUC 2CE7A 4RD6A 4DC9A 4CEHA 3OIUA 2NGRA 1SULA 3MWJA 1Z0DA 4L8GA 1QBKC 3QXCA 4TZ0A 1E2KA 3Q5EA 4FMDF 2IEYA 1Z07A 1NKSA 1Q21A 1XEWX 3CR7A 1XZPA 3K70B 2IYRA 5E7IA 2MMCA 1ZUHA 1A4RA 1JR3A 3HPRA 1GKYA 3AV0B 4D80A 3FKSD 4YMUA 1NY5A 3SOPA 2WWIA 2PZEA 5CB6A 4B74A 1YR9A 3KFXA 1SHKA 4URYR 1HUQA 1KDPA 2AWNA 1E4YA 4FMCF 3W6PA 1F2UA 5FPSA 2QBYA 1BO6A 1GOTA 5BN3A 3B78A 2ZSAA 1G6HA 1TU3A 3I1FA 3LFUA 5G41A 3FMOB 5F3WB 4JL5A 4HAUA 2YOFA 4URVR 2H92A 2RGNA 3IILA 2ZJZA 4NYJR 4LBYA 4B71A 5AJWA 4RD1A 3VU9B 5G3ZA 4P32A 1ZM7A 1QRAA 1XMIA 2QA5A 3K9HA 1MO5A 1S2MA 2V1UA 721PA 5L3SA 3BK7A 5TDHA 1VYVA 1XBTA 3W90A 4XSGA 4QJ3A 1UKYA 5EP2A 2R2AA 5KSOA 1DEKA 3L43A 3NHAA 1M2OB 4NTZA 3QVVA 2ZRIA 3W5JA 5BYJA 1MABA 2XXAB 2ZRPA 2ZEJA 1NLZA 4LK2A 4DB2A 1TPZA 4M1KA 4RKFA 3AVOA 2O8FB 1OE0A 2C9OA 4M1OA 3QVUA 4M9QA 1W4RA 1Z28A 4Q01A 5FR1A 3GLFA 1Z47A 4X8LA 3RVBA 1GAJA 4JJZA 1GWNA 1KJYA 2NQ2C 3A4LA 4ZKEA 2YKGA 3JZMA 4N0EA 1T0JB 3LX8A 1ZAKA 5DH9A 3LLUA 4HUQB 4TMVA 2XZLA 1Q3HA 1M74A 3KUCA 4RCYA 5C2JB 1YQTA 3LBHA 3ZS8A 4AYTA 2WAXA 2OAQ1 4ZI2A 1OF1A 2FPMA 1D9XA 3OIWA 3CR8A 3L0OA 3THYB 2OSBA 4FWTA 2BCJQ 3IQXA 4Q47A 1EWRA 2Q9BA 4OQMA 4BFTA 1W4BA 4DDTA 1FPMA 1W0KA 2W83A 4LHZA 3AVXA 4C0LA 5SZJA 2GXUA 3EC1A 3M0EA 4BUJA 4OQNA 4JJKA 1DTSA 2GZHA 4D26A 4QM6A 1BH2A 3BE4A 2ZRNA 4IKEA 4ITRC 2GA8A 3P27A 5AUQA 1DO0A 3RHFA 4D81A 1SZPA 4GDFA 1P6XA 2BMJA 1NLFA 4IDQA 3UWOA 4TZ6A 2ZJYA 2XTNA 1KK3A 1G4AE 3GJXC 4P3YA 4EDHA 1II9A 5HKKD 1NBME 2ZE7A 2ZVQX 5IF9A 2WKQA 2EYQA 1IN7A 2VL7A 3C16C 4B33A 4E22A 4FXPA 4Q03A 4UNRA 2Q3HA 4TT3D 3IIKA 4KBFA 2IF0A 2FFBA 4B2IA 2OZEA 5TY0A 2WJHA 3OESA 5FBQB 4NYIQ 4C9BA 4Q1DA 1W46A 1Q22A 2BBWA 1DOAA 2ZTSA 4PO8A 4GSYA 1G41A 4LHXA 1NY6A 4LWZA 3RRZA 5JCPA 5G53C 4Q4AB 1NN3A 3EC2A 1RFLA 2AFIE 4HZUA 1S1MA 5C4GB 1ZRHA 2LWIA 2X2FA 3U3RA 2WWXA 1KAGA 5BQ5A 2OFOA 1U0JA 4PC3A 1GTVA 4ON9A 5P21A 4C2UA 5LD2B 4A8JB 2NIPA 4RD0A 2R6FA 2ZI3A 1KOFA 2IC5A 3F3YA 1AGRA 1G5PA 5FTLA 1NJGA 2ZE5A 3U61B 4LUCA 2BEJA 1ZC4A 3KFVA 1OW3B 2OCAA 1OKKA 3BS4A 2Q6TA 3IUYA 2RAPA 2X1VA 4QBFA 3EASA 3CNNA 4PX9A 3AVVA 4EPXA 5JECA 3VKWA 1JECA 3GMTA 1WQ1R 4LV8B 4U02A 4OHVA 4TWZA 4LHYA 3BORA 2MSEB 3B1VA 4CRWB 2FH5B 5FI1B 2PJRA 1MO4A 1R4AA 1U90A 1ZNWA 3I73A 3QXJA 1D5CA 3CUEF 2IUUA 1R0XA 3TNFA 1SKYE 3AUXA 2QP4A 3QKSB 3ONWA 4ZCLA 1N6LA 1SVSA 2QU8A 4LYHA 5FTMA 3DEFA 1XCMA 1K5GA 2F7SA 3SN6A 2JATA 4G5SA 4MRPA 2ZUDA 1CRQA 4B6EA 2ZRFA 1VCOA 1OFIA 2O8EA 3BGWA 4NZYA 3K0CA 4KYUA 2OFXA 3PUYA 5H70A 2IA5A 5GADl 4Q7JB 4S2EA 1GKUB 1IM2A 1OV4A 1MO6A 3ASYA 4QG7A 4QGHA 3SC3A 4B43A 2XOKD 1QHIA 3ZZUA 4KSBA 2QAGA 2ZI7A 4ZV4A 1TQ4A 2CHGA 2IF2A 2OBLA 2VLIA 2A9KA 3B1YA 3HU2A 4V0ME 3DOFA 1S8FA 4OQLA 3RS3A 5J5CA 2NO1A 3T5DA 5TVKA 5F2EA 1NVVQ 3T1TA 4NP6A 3CRRA 1GM5A 2Q9AA 1BIFA 1XDBA 1QG4A 3WXMA 4O25A 1XNJA 3GLGE 1ZC3A 4F4JA 4HSEA 2HEIA 2BOVA 2P3SA 1Z83A 2XTZA 1N0UA 3AVPA 5BYKA 2VP9A 4OJQA 4DT1B 4E5UA 1VCMA 3O8BA 2FG5A 1ZW6A 4ERNA 4AY2A 1DG1G 3R8CA 1XPOA 4JSTA 1G7SA 2VBCA 1UM8A 3VHXA 3BB1A 5GJCA 2H16A 1BS1A 2R6CA 3MRSA 2O8BB 2V54A 2OXCA 3JZAA 3PFIA 3ZVRA 5FTNA 3GLIE 1IHUA 5FPTA 3TSOA 1OXSC 2Y8EA 4UKDA 4JL8A 4YXWD 2IS4A 1JEDA 1OIXA 4EPVA 4XWOA 1KIMA 3CF0A 4OHZA 5FOUA 2IX3A 3TUJC 1X8LA 2QM8A 3HU3A 4URUR 4F93B 1AQYA 4LJ8A 1LTQA 3SJBA 2VP2A 1KJZA 2JLRA 4UXHA 1TEXA 3MMPA 1KI6B 1ODFA 3NWJA 4F92B 2CMKA 1KAOA 4WZ6A 1OJLA 2RGNC 4V0KA 1E69A 4JIMA 2DFLA 4WXPA 5KDLA 4D82A 1RKBA 2FNAA 3T5GA 1H8HD 1KO4A 1CF4A 1YE8A 1Z08A 3SU8A 5HR5A 3AVQA 4FMCB 4IHQA 1XCPA 5CDFE 1XXHE 1SXJA 2D3WA 1NMZA 1II8B 1N6RA 1VIYA 4Q1BA 2WMOB 1HQCA 4P4SB 2WSSD 3CPEA 4C0SA 4DCUA 4EJSC 1FUUA 4X8MA 1U9IA 4B3GA 4LGMA 4KVGA 3TRFA 2GZAA 4ARZA 2WBLC 1WCV1 1XD9A 3I4LA 3NC1C 1YRAA 3L8YA 1IAQA 1P60A 2P2LA 1B23P 1US8B 1NG1A 2RMKA 5DE3A 3A1VA 2QZ4A 2IYVA 1JJVA 4FINA 1IN4A 4UJ5A 2JGNA 4A2QA 1RJ9A 5AUOB 2BKEA 2WPDD 5A5GA 1RRGA 1HURA 1R7RA 1YJ5A 3K0AA 2CL7X 3MJRA 4TL8A 1T4GA 4YC7A 1EFRA 1P2UA 2HCJB 4BPBA 2WWFA 1KHTA 4TMXA 3PJRA 2GBLC 2J0UB 4BLSA 1HQYE 3RRMA 5C18A 3EX7C 1D9ZA 5L3RA 2H18A 3TAHA 3FMPB 2N46A 3RS0A 2REOA 2ZU0C 1ZBDA 3AKYA 3KKQA 4C7OB 1W5SA 2D2FA 2VRWA 2GDJA 2IUTA 2K5UA 2ZUBA 4PAOA 1X86B 1QVAA 3B60A 3AP2A 4GT1A 1E2DA 2C03A 2OT3B 2WKPA 1DS6A 1N5LA 5EE1A 5FL7D 5FTKA 4PSVA 3GJ7A 4D0GA 2V8OA 5JRJA 1XTQA 1FOEB 4GP6A 4C0KA 3GEEA 3NTUA 4KBGA 4XH9B 2PJZA 1N0WA 3ETLA 3GP8A 1S3GA 4Q1AA 2QE7D 5LDDC 2GWHA 1SVLA 3LBNA 3UXMA 2OCYC 1OYWA 2JJ2A 4LC1A 3QI2A 3NDBB 1RYHA 2F1HA 3HWSA 1DPFA 3AP1A 4BLOA 3NG1A 1MKYA 1COWA 3MSXA 2XTMA 2FWRA 4M53A 5FTJA 2ANBA 3QF4A 2ZE6A 5HCIA 4XSHA 121PA 1E9RA 4YMTA 5TB5A 2HXSA 2GRJA 4RCZA 5DGXA 2JJ1A 2OUKA 1KDTA 1GIAA 5J4HA 2AR7A 3LVQE 3QG5A 4BEJA 1IOZA 1YZLA 4D4KA 1CEEA 4B3CA 3A1TA 2KB0A 5H8WA 4PTLA 5KUTA 3GFPA 5AUNB 2CCJA 4ASUD 1P72A 1ZVQA 1EFHA 5JSZA 3L8ZA 3QSYA 1PLJA 2J87A 1RRPA 2BBOA 3E2IA 4M1WA 5DHFA 2FMXA 3EZ6A 1E1RA 2WSMA 4XOIA 3KKMA 3SFZA 1R0YA 2A5GA 2N42A 5C1BA 2ZSFA 4AKGA 2H1LA 4Q4LA 1DBSA 2J7KA 1QF9A 3WRYC 2FU5C 2WJVA 2NZJA 4QM7A 1JAHA 3KUDA 1E9CA 4Q02A 3U6BA 3FB4A 2J7PD 4F4IA 4U5XA 4Q21A 2PH1A 3VR2A 4Q4JA 5FUXA 2PBRA 2ZYTX 2FN4A 1DG3A 1OFUX 4A0RA 2BJVA 3GLHA 4DLSA 2P65A 2GCNA 3CKLA 3CX6A 1EFCA 2HV8A 1E2FA 3TVTA 5F9FA 1ZM4A 4MUBA 2IYUA 4C3ZA 4AURA 1CLUA 1VG8A 3W5IA 2DR3A 1G17A 4RZ2A 3U44B 1F2TA 5FR2A 4TL7A 4LI0A 1EX6A 4LV6A 3UPUA 3B85A 5A4JA 3CIOA 4HLDA 5J4LA 5JBQA 2WOJA 1NBMA 2C78A 1AZTA 2VO1A 3DOEA 2XJ4A 1AA9A 1G4UR 1E2EA 4HDCA 4LOAA 2AKYA 2J9RA 1J99A 3B8HA 1F5NA 3LQRA 3LW7A 4B75A 3UK6A 2CVFA 2QPOA 4GBMA 2ONJA 1NVWQ 2NO7A 4PHTA 1XJCA 2QSYA 1QHXA 1S9HA 1TF7A 4Q18A 3U7EB 5D3QA 1FFHA 3X1ZA 5KDDA 4ZDKA 3QEJA 2C98A 4JLKA 4IVQA 1NSTA 4CEHB 4BZPA 4URZR 4D2IA 1DE0A 3SYKA 1KMQA 4PC6A 1VYUA 1KYIA 2QN6A 4PAQA 3HPQA 3B5JA 2OLKA 4WXRA 1NG9A 3RANA 4DSNA 4C2TA 2FSIA 2QQEA 4L9SA 5EP4A 2CLSA 2DWPA 2FFQA 4OI4A 5AJVB 2GJKA 3GCGA 5J4YA 3QPVA 3ADBA 3AVWA 1CULC 5TXGA 4PSKA 1KSFX 4W5JA 1PVOA 4HLUC 2WMNB 2AD1A 4GOXA 5GVSA 3GD7A 5ANRB 5FPHA 3VR4A 3AGPA 1YR8A 1GP2A 2C95A 5E7MA 4TN1A 5UKDA 1F2UB 1I2DA 5DHAA 2QBYB 2OG2A 1YZQA 3RS2A 1ZU4A 2H57A 3ASZA 1M6NA 4AIIA 4UNNA 4MGIR 3UG6A 2XSZA 2KJQA 1E4VA 5J40A 4ILEA 1AN0A 1E94E 1NLYA 1H8EA 2UZ3A 3LBIA 1ANKA 4M0LA 1OHHA 3OAAA 3D8BA 2REXB 1K5DA 3ZZTA 2F43A 2WIBA 1ZD1A 4MGKR 4CT4B 3AF3A 5HPYB 5L3SB 2JDID 1ZU5A 3ADDA 2C8VA 3O47A 2ZJOA 3NC0C 4BE7B 3QBVA 1FTNA 4HB3A 2HLDA 2HT6A 4MA4A 1MABB 3FFBA 3TUZC 1EGAA 1LF0A 2EFEB 2WM9B 4TL9A 4ZCIA 1R2QA 3GLFB 2QT1A 3EPLA 5IRCD 1PLKA 1ETUA 3I8XA 3QENA 3SS8A 2DFNA 1GDDA 1RRCA 4KSCA 4A6PA 1NI3A 2O0JA 5JZVA 1VTKA 5DN6A 2JIZA 1U99A 3A6PC 1VPLA 4O0MA 4Z1MA 2AWOA 3TUIC 3BFVA 3ICEA 4WAUA 4RVCA 4FW9A 2JLVA 2NZ8A 1TQDA 3QXSA 4V0MA 5JS8A 3CRQA 4QXAA 1P9NA 2Z6VA 1LS1A 3REFA 1QVRA 2WWGA 2DWQA 3F8TA 1Z06A 3GQBA 4DB4A 2IYYA 2PEYA 1FP6A 1DELA 2IUSA 4W9MC 1TUEA 3QIAA 3GPLA 3L2OB 3MWKA 4BFZA 2RHDA 3KL4A 3U60B 2YV5A 3GJ4A 3Q3JB 2JEOA 1HA3A 2JLSA 1MR3F 3FWYA 5E4FA 1N5KA 2G1JA 3OAAD 1G7RA 1NMXA 4B2LA 1UPTA 3TBKA 3BWDD 2CHQA 5EZ5A 1E79A 4BFWA 1KSJA 2PEZA 5CYOA 1I4LD 3WRXC 1FNNA 2XB4A 1WMSA 1Z0AA 3U3MA 2HJVA 3QPUA 4US0R 2F1RA 1W49A 1ONBA 5JHHB 4I81A 1W47A 3THWA 1RZ3A 2KI5A 1E1QD 3TSZA 4DJTA 5JJKA 2X77A 2ZM5A 2H8KA 4LJ5A 4XD7A 1WP9A 2HDNB 3T06B 1FZQA 2IYWA 2BM0A 3OF5A 1NL3A 2Z5FA 4OI2A 5HZKA 1WB9A 4LZZA 1YZGA 2WKRA 1D6JA 4I1VA 3IIJA 3W3ZB 2NMVA 3AB3A 1LF5A 1YZUA 4Q7MB 4HLQB 4QOSA 5BWMA 3I62A 2G3YA 4NONA 2I1QA 3FMFA 4IDNA 2OHFA 4LBWA 1XTJA 1KNQA 3BERA 1N25A 2J1LA 1SHZA 3AVYA 2A2ZA 4DCVA 1IONA 4HEJA 3BH6A 4J0QA 4Z54A 1W7AA 1L2TA 4HB2A 3I5YA 3CX8A 4IRUB 2XNDD 4HZUB 3O8DA 3KKNA 2EFCB 2IYQA 1G8YA 221PA 4L5BA 1U98A 3ADKA 1JNYA 4V03A 3BFKA 1T3SA 4F7WA 4IFBA 1GNQA 4KVAA 2CNWD 2GJ9A 3OFNA 1UBCA 1NRJB 5DI9A 1G19A 5B30A 3KZ1E 4FCWA 3MJHA 4TQAA 1KDOA 4TLAA 4OI1A 2IYZA 1W48A 3U5ZB 2MSCB 3KB2A 4GFDA 4A82A 2XGJA 4TTQA 3QOFA 4L16A 4N1AA 2XB2A 2O8CA 3EZ2A 4N3NA 2C5LA 4KJZA 3MGCA 1UF9A 1W2GA 3EPKA 2ZI9A 2RGEA 3VX4A 3QKUA 4EJSA 1N6IA 3FHCB 1BMFD 2ZRBA 4JBWA 1SVWA 3RRYA 3QXHA 3CH4B 4M21A 3LRPA 5EE9A 2HCBA 1Z63A 1KMHB 1E96A 1P9WA 1TUIA 2BIFA 3DKVA 2ZRJA 4FN5A 1G5RA 3ND9A 1LW7A 3KJGA 4JVSB 4Q00A 1KSGA 4TLDA 4ACAA 4Q1EA 4MGYR 1KI4A 3D6TB 2QTHA 1C1YA 2PT7A 1OXXK 2R44A 1JR3D 5J4KA 2EFHB 3QY0A 1Z3IX 4O2LA 2OLJA 1AQUA 1A5TA 1EXMA 1W0JA 4BASA 4HAVA 2BMEA 4YONB 1XEFA 3RYTC 2O8EB 2ZS8A 3R9IA 3R8FA 2JLWA 2Z4RA 3UKDA 4A92A 3DKPA 1QG2A 4R98A 2GBLA 3LNCA 3CNOA 3ZLJA 2BWJA 2ODEA 1M7BA 3FOZA 1N3BA 3C5CA 4JZKA 1E9AA 4Q9IA 4LJ9A 2QAGB 1ZM3A 3WYFA 2W6IA 4CVNA 4Q9HA 1OH7A 3DHWC 2C9CA 2YINC 2B21A 4MH0R 2GNOA 3QF7A 4MITA 1D2MA 2P0EA 1HE1C 4KLZA 1CR0A 2H7VA 2GJAA 4CEJA 1JEEA 2VSFA 5CJ2A 3ZD7A 4ACBA 3DM9B 2GXSA 1UBGA 3VR6A 2IT1A 2FSGA 2ZIAA 4KFSA 4N0DA 4HAYA 1ZM9A 2ANCA 2REBA 2ZI6A 4Q48A 4KHZA 3PEWA 2ZRKA 4GL2A 1LVGA 1W1WA 3OEHA 5EE5B 4BRUA 4RFVA 4H9GA 3BD9A 4KV9A 2NOAA 3VKGA 4DIDA 4BRWA 2WZQA 1Y63A 2R6DA 4R71A 3PENA 2R8RA 4WBSA 3CWQA 2FFAA 3VR1A 4DSTA 2AK3A 1HT2E 2JAQA 1S3SA 2E9SA 1D2NA 4OHYA 3KTAA 1FQJA 3I8SA 1T3HA 3AEZA 3EIEA 3T1QA 1G8FA 3D7MA 1VG1A 5FOWA 3ZVMA 3LDAA 4C0BA 2P6NA 4A0FA 1GZSA 4LYAA 2I1VB 3WMGA 3C41J 3ZYCA 3U7HB 1W0KD 2RGBA 4D4JA 4NCKA 3W3AA 3FYHA 4B32A 2PMDA 3G82C 4A0GA 3KQHA 4XVQA 2VH5R 4G5GA 4A15A 3KJEA 4II7A 1OLOA 5JWRA 2GETA 2BJWA 4PSAA 3WYAA 4I1UA 3NDPA 3TVDA 2CEAA 5J4VA 2DB3A 3PUWA 1IY0A 2IBMA 2ODNA 3X1XA 5L3QA 1SXJB 4OHXA 3WNDA 3BAFA 4D6PA 3LXXA 1S0UA 4OK3A 3SBDA 3KQKA 1GVNB 2FSHA 3UANA 3ZVNA 1G3UA 1DARA 2DFKB 4ARZB 3QBTA 3M1IA 1NJFA 1E9FA 1JXMA 1T6NA 2WJYA 3BJIC 3QE0A 1VG0B 1I2MA 2QM7A 4TYWA 1R5NA 1KO1A 1KKLA 4QJ4A 2ZRLA 1CS4C 2J0SA 2E87A 2GK6A 2R6AA 1RJ9B 4MYTA 1XD2A 1NF3A 2RCNA 3Q9LA 3K0AB 4Q7LA 1W36C 2WWHA 2ZRHA 5H68A 3A37A 4KAXA 4UXJA 3AVTA 3FKQA 4TTPA 3DMDA 3BH0A 3W34A 2GEUA 1YU9A 2HYIC 3MUFA 1Z0IA 3Q5DA 2QSZA 1E3MA 2J46A 4C0JA 2YWHA 2RGGA 3I3SR 1R5BA 2RKOA 2ZJAA 1C4OA 1X8JA 5GJBA 1QHSA 3OE7A 4LX0A 4G0NA 1OKKD 2R62A 5DO9A 2CLDX 3SR0A 1RYFA 1NVXQ 2QT0A 2Z4SA 4BFXA 4PQFA 1P7CA 4EPRA 2CVHA 2OILA 4KCGA 1UJ2A 4YMVA 3X1DA 5FL3A 4K46A 4W5WA 4PQRA 4F91B 1QHHA 2DHRA 4NU0A 5L8VA 2QMHA 4BLTA 1P73A 2ZROA 1I4TD 3NEJA 4JBXA 5EUQB 3UMRA 1XPUA 1Q44A 3IHLA 4LJ6A 1T8TA 4ZDWA 2P67A 1XMJA 4QFMA 3CLVA 2VEDA 3OEEA 3QF4B 2W2XA 3BOSA 4HLUA 4PFSA 3T12A 5C4MA 4DIEA 4A9AA 1GITA 1KI2A 4R7ZA 4DLYA 1N6PA 2CDNA 2TMKA 3LW8A 5KYKA 3G5UA 1NN1A 2IYTA 4G1UC 4OHWA 3U3OA 3VNVA 4LV5B 4AKEA 2W0SA 2V7QA 4LYJA 1G3QA 4JVNA 3GJ5A 3V00A 5FUWA 3LY5A 4KU4A 4MRSA 1I4DD 1JALA 1YHNA 1OXVA 4FMDB 2GCOA 3GJ8A 2BBSA 1E99A 1F6BA 1NVUQ 1SVMA 3AH8A 1Z5ZA 4D0LB 2CJWA 4OYHA 5JSZB 3ND8A 1AK2A 2IYLD 3PEVA 4CDGA 2IS2A 5EE0A 4GP7A 1OXUA 4GMXA 1CJMA 3OIVA 2QP9X 4MRNA 5FOVA 4NCHA 2D62A 4UNPA 1G64A 4CEIA 1JR3E 2W00A 2Q0HA 4YLGA 4QBIA 4JT2A 1HV8A 5B2ZA 3FFAA 1LNZA 1EESA 1NSFA 4A8JA 4NL4H 1TF5A 2QNRA 1WDTA 4E07A 1TEVA 1EG7A 3TQCA 1G8HA 3KKOA 1UBEA 1EFUA 5IK2A 4BFVA 4PHHA 2JLUA 2G6BA 1CJVC 1E32A 2XITA 3MCAA 1P3JA 1CKEA 1G291 3TKLA 1UDWA 1DO2A 3B1XA 4DLWA 4B35A 1R6BX 1OYYA 2HYDA 2QPTA 3HR7A 1PUIA 4Q4JB 4DDVA 1IQPA 3C14C 1IXZA 1KZGB 2F55A 1Q1ZA 3VR5A 1E6CA 2DY1A 1XF9A 1X6VA 3CO5A 4PC2A 1II0A 4DKXA 4MGZR 2WVJA 2EWWA 3GLHB 4PPGA 1OSNA 1N0VC 2RGCA 4RZXA 4A6XA 3UWKA 4BLRA 1Q57A 3PUZA 4B3BA 5L3VA 3EZ9A 4OK6A 3W6NA 1N6OA 2ZI4A 2IS6A 3GFOA 821PA 2YVUA 1Z2CA 5FBRB 5CLQA 3H1TA 1F2TB 4TYYA 3JVVA 3CB4A 1U0LA 4Q5IA 5C46F 4NYMR 4CGZA 4M22A 3RAPR 4URXR 4NCIA 4M9ZA 3KDSE 1XX6A 4L15A 4DUGA 1DAIA 4HZIA 3A1UA 2Z0MA 3QKRA 4OI0A 3DM5A 3GLFE 2D06A 4MYCA 4FWIB 5CITA 4O2RA 3LVRE 3U2QA 2QP3A 2OV2A 1SXJD 1ZNZA 2VP6A 3EIHA 3K0EA 4BECA 3CWZA 2EW1A 5JWOA 3FTQA 1CBUA 4G3XA 1AZSC 1UKZA 2R9VA 4US1R 4AI6A 2ZU6A 1UKEA 1VG9B 1ZIPA 4PZZA 4HB0A 5D3MA 4POAA 1X1RA 3L0SA 1XEXA 1LV7A 1S4QA 4I1SA 2OFWA 2H5EA 2CLCX 3WBJA 1XTKA 2OAP1 2OBMA 2BCGY 2KSQA 5FBLB 4BFYA 5E95A 2YYZA 3CPHA 4TYPA 5B57C 1KZ7B 3NH9A 1ELOA 4L4UA 1EFRD 4Q4HA 2WHXA 5JEDA 2HUPA 1TQ6A 1U94A 4QKQA 1T91A 2GVDC 2KBEA 2CCKA 1G3RA 1WE2A 2ZYWX 4ZCMA 2NG1A 4TLCA 3K70C 1Z6YA 1TL7C 3H0KA 4DDUA 1Z0KA 4B44A 3H4MA 4NH0A 2EFGA 3TGPA 1QZXA 2GJ8A 3DDCA 2Q9CA 2QGNA 1AS3A 1J70A 4RD2A 2W0MA 4QBGB 1QHGA 2QY9A 2F43B 3P4XA 3MWYW 2RB4A 3WY9A 1T5IA 1FX0A 3D31A 1ZD8A 1SKYB 2OCPA 4UQOA 4JBYA 3RRNA 4EFMA 2YJTD 1WXQA 4QGGA 4JLAA 3RS4A 2FPKA 2X2EA 1WA5A 4TMZA 1R10A 3X1WA 1N6NA 2FGKA 3C15C 1YKSA 4DLRA 3AF4A 2EFDB 3FMIA 1U8YA 1W44A 2VP0A 3J81k 2JJ2D 3THXA 3ICQB 1XB2A 2KBFA 2WJJA 1XRJA 4EKDA 1U81A 5E7JA 1COWD 4D4MA 1TQ2A 4LBVA 2AXPA 5JCZA 1A82A 1XU4A 3NXSA 1G9XA 4PXAA 1N6HA 1WRBA 1G5TA 5DI3A 3SEAA 1G8GA 1IN8A 3TMKA 4QGFA 2JJ1D 1V5WA 2QMUA 4R2IA 3SNHA 2B7CA 5FOSA 4RD3A 2FZLA 2PX0A 3EWAA 4XWKA 4JKIA 5DISB 1S96A 2XEXA 4DRZA 5B64A 1A2KC 2QRZA 4JYBA 3VFDA 3ZS9A 3EIQA 4DXAA 4ZKDA 5G3YA 3LD9A 3RSLA 4ESHA 4R2HA 4MDFA 1G6OA 4C0AC 2JASA 4C0QC 3K0FA 1G1MA 3P4YA 1CXZA 1VIAA 3ZDQA 4KODA 4K81B 1R5OA 2CE2X 3WP0A 2LKDA 1E2GA 1Q3TA 1E1RD 1UKVY 3OZXA 3M6AA 4LJ7A 3LH5A 3I32A 2W6JA 1Q0UA 3N2IA 2OM2A 1KSHA 3WNCA 2ODBA 2CL6X 2RH5A 4D0NA 1XZQA 4PO1A 5JWHA 2GHIA 3THWB 3K1JA 4TSFA 3W8RA 4G5QA 4H1VA 1XWIA 4BFSA 2HXYA 4C7OA 2C99A 2ZSEA 2V55B 3W6OA 1Z6GA 4FI3C 4G01B 1Z6XA 4PANA 4R9UC 4DCTA 2J59A 3NBXX 1OXTA 3GJ6A 1LFDB 2PLRA 1AIPA 3QNUA 4DSOA 4A2PA 3E70C 2CK3A 1AS2A 3FGNA 2RGAA 2WTUA 3R9XA 4DHEA 1HH4A 3GEHA 3ZIAA 2O0HA 2DFTA 5A0FA 1GL9B 3E1SA 4DLVA 3RC3A 3RABA 1T5LA 3KJIA 1QHYA 2JLXA 2F3TA 1UFQA 4KITB 4KI0A 5DYGA 3U4QA 3L0PA 2ZI5A 4GRAA 1FL9A 2JLQA 4XTRA 3SYLA 1OB2A 2ZJBA 1HE8B 4JLJA 2D7CA 8OHMA 1NBMD 4HAZA 4ZIRA 4NPHA 4DBLC 4M2LA 1O87A 5GVRA 3SHFA 5CK5A 1JB1A 5HE9A 5EXSA 2GJSA 1KDRA 4TLEA 2O8CB 2C96A 1M8PA 3DZ8A 4JLPA 2NO0A 1KI1A 1MRNA 2VYFA 4Q1CA 2XZPA 1NP6A 1VKJA 2O8DA 1MT0A 3KQUA 4G5RA 4EJSB 5JFGA 4HDOB 5FOTA 2V9PA 4B6FA 1W4CA 5LD2C 5IT5A 3CF6R 4A8JC 1VDZA 1JR6A 2OEPA 1FQKA 1X1SA 2OBNA 1Q20A 1T9HA 1XTRA 1Q12A 4AC9A 5M04A 3K09C 3X2SA 2YOGA 3B2EA 4EQ6A 2YC4C 1OH6A 2AD5A 3RLFA 3BXZA 1E2NA 3F5FA 4IOLA 4IDPA 1AM4D 1Z8FA 4LYFA 4PPNA 4AWXA 1J8MF 2QAJA 1E2MA 1KO5A 3HP1A 3ZIAD 3QG1A 5J47A 3BB3A 5GJVC 1AGPA 1KY2A 3TR0A 1E2QA 2YC2C 1GILA 4XWAA 2VTKA 5EP3A 4IDHA 2XSZD 1SXJE 2ONKA 2NO6A 3ZD6A 4QGAA 1H8ED 4YMWA 3FKSA 3GLGA 4I4LA 1KK2A 1OHHD 2RGXA 3BRWD 3MFYA 3H84A 2J41A 1M7GA 4MYUA 4P31A 4RZUA 1MRSA 3HJNA 1OH8A 3A1SA 1E2IA 5B58C 4A4DA 2IXGA 2ZR0A 5KSPA 4FMBB 3IIMA 1IXRC 3B6EA 4RFSA 3TW8B 1JJ7A 4B34A 5HTKA 1KK1A 1GRRA 3IEVA 1ZD9A 2HLDD 2F9LA 4MRRA 3QQ5A 4TQ9A 2OESA 4JL6A 5F98A 1KI8A 4JVLA 3GLIA 1KJWA 2FX3A 2WIAA 4HI0E 3RNLA 4FIDA 3EW9A 3VNUA 2FA9A 2ZQ5A 1Z6AA 3D3QA 4CZ2A 5FBVB 3U3KA 4KLNA 1KTVA 3PXGA 1G3IA 1MOZA 4NCJA 4RJLA 4OKSA 4WVFA 5K8TA 3BFXA 2VHQA 2XNSA 4IVRA 4NHOA 1UEIA 2JIZD 2GILA 4WA7A 4Z1MD 5DN6D 4DEYA 3RSOA 1TU4A 2L0XA 3Q85A 1XEWY 4QL3A 5AJXA 1UBFA 3KTAB 4IOJA 5AUPB 1TMKA 1E0AA 1IN6A 3VX3A 4ZO4A 4KFUA 2YHSA 3HU1A 4HDQB 4M9SA 3LXRA 2F1IA 3IDQA 3MG9A 1EX7A 4XVRA 1U2RA 5F9HA 2PL3A 2HF8A 4YDSA 4AG5A 2DCUA 4HAXA 4EFNA 3FHOA 3UMSA 2BMFA 2AHOA 2QTFA 4M1YA 5CDFA 1KI7A 3DO6A 1XXHA 3R7WA 5KPJA 3BBPA 3I72A 2VSOA 3UIEA 1JBKA 3NHBA 3SZRA 1ZJ6A 2DPXA 2VP4A 3B7GA 3CZQA 1ESNA 1R0WA 2FV8A 2FSFA 3TE6A 1E79D 3B1ZA 1B0UA 2NPFA 3R20A 2Z83A 1ZUNB 1U8AA 1GKIA 1Y3AA 4X8HA 3SE0A 3VHLB 5IHPA 5JRZA 4TYQA 2A30A 3GJ0A 4V0OA 1OIWA 4MKHA 3LV8A 5L3QB 2HJGA 4DVGA 1FUKA 2ORWA 4XD7D 3B82A 3WP1B 1NN5A 1V43A 1R0ZA 3P32A 1JQLB 2VQSA 3THOA 2QTVB 5EUMA 3K9GA 5SZHB 2D4HA 4RZ3A 3LWNA 1M1YE 2J5XA 2CL0X 4FCTA 1IJFA 1RPZA 1S1CA 4I1OA 3S1AA 3UATA 3DZDA 3TIFA 4TMTA 3IBGA 5JS7A 1ZP6A 1VHLA 2QG6A 4WZBE 2PCJA 2O0KA 5H1YA 4C0HA 3R9WA 1DAFA 1FTSA 2G77B 5HKKA 1E98A 4P4UA 2W2VA 1F60A 2W58A 1XD2B 5KTYA 3NBYC 3U6KA 3AF0A 4PR0A 2XZOA 2GESA 4AKHA 2ORVA 1CJTC 4JYCA 1OFTA 4TT3A 3FVQA 1FP7A 2Q21A 4Z8YA 1T8UA 3CRMA 5JEEA 2P6RA 4LHWA 5AJYA 1L8QA 3P20A 2CHVA 2AN9A 4TQUS 4B3XA 4RKEA 2VF8A 4DLUA 4JT4A 2BVNA 5BW8A 2G0NA 3OFND 4PHGA 2F3RA 4MYHA 4Q7KA 4EIWA 2XAUA 2EU8A 3MAAC 5FPKA 3ECCA 2IS1A 3SI7A 1FMLA 2QMEA 4HB4A 5ELXA 4C4PA 4MUAA 4V0LA 4FD2A 4TMKA 4EPYA 1A1VA 3DVLA 3QXXA 1VCNA 3A1WA 5EQTA 2PX3A 1G7CA 1PZNA 3CRVA 3JVUA 3T15A 3ZGXA 3ZQJA 4AYXA 3B9PA 4IXMA 2ECKA 2IEZA 4QNMA 4D4LA 3SJZA 3K53A 4URWR 1G8PA 1NKTA 1SVIA 4OJKA 1TADA 3I5XA 2FGJA 3B9QA 3GLHE 5EXTA 1G18A 4LDJA 3AKDA 5SZKB 4US2R 1QHHB 4LRWA 2FDCA 3AF2A 3HYRA 4IJMA 2WV9A 3RWMB 3TQFA 2N1BA 3KX2A 4EAQA 2A7QA 5JHGB 1KKMA 4PC7A 2IXFA 2JLYA 3CPJB 4UJ3A 2IWRA 1GFIA 3EAQA 1W0JD 2BEKA 1MV5A 2J45A 4LBZA 2QENA 4Z51A 4AKIA 1BYUA 5CYPA 2G88A 3N2EA 3W9YA 2DWOA 5FI0B 1P2TA 1E9EA 2GEDA 3MD0A 1YR6A 2R6GA 3U3JA 3MWLA 4PQYA 4DSUA 2B6HA 1WF3A 2YZ2A 5KNDA 3CZPA 2EQBA 2GCOB 3IGFA 3FE2A 4YDHB 2CJWB 2B8WA 2W6ID 2BKUA 4TL6A 2XJ9A 2DBYA 5KHOC 1YZKA 2ZRMA 1H65A 2FE4A 4DCSA 3FPAA 2GTPA 4JS0A 2IWHA 4Q9JA 4BGDA 3KKPA 2ZYUX 2O5VA 3PUVA 3U7FB 4F38A 3Q8XB 1ESMA 4NKRA 4UXIA 5EP1A 4CEIB 2XOKA 1AJEA 1YRBA 2ZJ8A 4MRVA 1LB1B 4P0TA 5KOYA 3IO5A 2GXQA 1LY1A 4GNKA 1GG2A 3N5CA 1L7VC 3CH5A 3VU9A 5KSYA 2IW3A 2ZREA 1SVOA 2PLFA 3PV0A 3VAAA 1RC8A 3QUSA 3OEHD 3EPHA 2MMGA 1IY1A 5BN4A 2A5JA 2ZVPX 4QC2A 1JXOA 3BB4A 5E3HA 2GAAA 2IHBA 1DAHA 1U8ZA 2GK7A 5TARA 3EG5A 1GUAA 2VPPA 2AFHE 3FHTA 2C77A 2GKSA 3N70A 4QRHA 4TTRA 3CX7A 4E03A 4JLDA 3CONA 1MH1A 1X8KA 5EE3A 2XXAA 421PA 3PUXA 4HAWA 4WIAA 2ZRAA 1KMHA 4IW3B 2O8FA 3O8RA 4ABYA 2UKDA 2ZXUA 2AL7A 2P5TB 1W4AA 2G0TA 1CR4A 4CYMA 2QUZA 1ZYUA 4NYIR 3K70D 1HT1E 4QBHA 3QJYA 2OXRA 4CIDA 3SQXA 4PAMA 2FEOA 5JJIA 3OHMA 1IBRA 2YWEA 1HYQA 1N2CE 4ESVA 5KSZA 4LHVA 4D25A 1KI9A 2ZSBA 3QEOA 1TAGA 4KXFB 1EFTA 3V4FA 4HUQA 4M1SA 1N6KA 2F9MA 2Q3FA 5FBWB 1YVDA 2I3BA 3TH5A 4YXWA 2J0QA 3NBZC 1K8RA 5CM9C 1E0KA 1CP2A 2IHYA 3QKRB 1SKQA 5CM8B 5IDVA 1F3OA 1Z0JA 1HTWA 1XCGB 5TMPA 4M4SA 4V02A 1YR7A 3DL0A 3NEYA 2IXEA 3QPWA 2ATXA 3THYA 2EYUA 2PT5A 3IPXA 1C9KA 1L4UA 3H86A 1E9SA 1QDEA 1K6MA 1CR1A 521PA 1RRFA 2ERYA 4UNSA 1XMVA 2ATVA 1J8YF 2IL1A 3KXIA 1G21E 2QMOA 4Q66C 1HEIA 1TX4B 1PV4A 3V9PA 2OCBA 2KE5A 3IPYA 4BFUA 1A7JA 2LKCA 3TSWA 1H8HA 4NMMA 5D3MB 1BKDR 4DZZA 1XP8A 3CW2A 4QHTA 1XEXB 2AKAB 3F0TA 4GOJA 1UAAA 3NH6A 4ZDIA 3RC8A 1GSIA 2A5DA 5K8LA 3VKHA 2ERXA 2SHKA 1L4YA 4Z8XA 2B8TA 4GZMA 4JLMA 2AK2A 4NDZA 1J90A 3NKVA 5DLQC 2WSSA 1KK0A 1WBBA 1ZMXA 1P62B 2J0VA 5DSZA 1FW6A 1NNEA 3SJAA 2ZJ2A 4Q4HB 3CBQA 1XJQA 4W5HA 3AVUA 2B92A 3WMFA 2UZIR 3NIBA 1ZNYA 4NYMQ 2C2HA 1TTTA 2P5SA 1UADA 3WHLA 3T34A 2WPDA 3PITA 4Q4AA 3OE7D 3TLXA 4QNRA 2O52A 2AXNA 2PZFA 5LPNA 2BBTA 1OB5A 3IBYA 4AK9A 4B47A 1FX0B 1J7KA 4U7DA 4JMPA 4E09A 5KDOA 3CNLA 1RVDA 2HF9A 3NBFA 4IVPA 3EXAA 1ZNXA 1ZM2A 2WJIA 5FUVA 4CT5A 2H17A 3KQLA 4M8NE 2ZETA 2G1KA 2F6RA 2ZYVX 2F1JA 5BXQC 2QQ0A 2WOOA 3K09A 4WW0A 2A5YB 1G16A 4BEBA 3THXB 3A36A 1N5JA 4B76A 1ZCAA 2VHUA 3P1JA 4IDOA 5FL7A 1NVVR 3WMEA 3VMFA 4DWJA 4WOPA 4MKGA 3B1WA 1HY3A 5FUYA 4LJYA 2A5FA 1AKYA 3EZ7A 4M1TA 3UMFA 3P26A 3OEED 1TF2A 5EZ6B 1E2HA 5JI2E 2V1XA 4LJ4A 5DI3B 2QE7A 5GJWC 3RS5A 4KFRA 1VYTA 1W5TA 2ZJ5A 2AX4A 3B13B 2KWIA 2D7DA 3ZVLA 2V6IA 2FPLA 2MSDB 2V7QD 3QKSA 1M7HA 2B7BA 4IOKA 3C5HA 1ZIOA 2QEQA 1T3LA 4FCVA 1VCIA 1XMSA 4V0NA 1NIJA 1Z29A 3AQ4A 4HLCA 1CJKC 5HCNA 2RHMA 4ZDJA 3E5HA 4LPSA 2ZE8A 1NMYA 2ZS9A 3K0FB 3AKEA 2WWWA 3LX5A 3SDZA 1OT3A 2BDTA 3DPUA 5JMTA 1XFAA 1BYIA 1KO7A 1P2SA 1QHNA 2QGZA 5KU1A 3GEIA 3SJCA 1P75A 1Z2AA 2ZUCA 4F4CA 2W2TA 3EARA 4GPTA 4KO8A 3KQNA 1CTQA 2XX3A 1MO3A 2IYXA 4PZLA 4ASUA 1D2EA 1DAEA 3T35A 3KXLA 2WWYA 3PVSA 3RDPA 2FEMA 5IK2D 2GVZC 5K8UA 4IEEA 1R8SA 3AGQA 3K0SA 2QI9C 3ZH9B 1Z6TA 3LAWA 5LB2A 5EXPA 4WZAE 4LPKA 2CXXA 4BZQA 3SHWA 3U7GA 1XJ0A 2VP5A 3BH7A 1JQJC 2FFHA 3TAUA 2VA8A 2BHRA 4B73A 1KNXA 621PA 4C30A 4DT1A 1RE0A 2FZ4A 4KYIB 3SYNA 2WICA 4AG6A 1GNRA 3X1YA 2ZANA 4HATA 4H1UA 1E2PA 4MDEA 1P9RA 3LLMA 2D2EA 2J7PA 5AK0A 4EUNA 2EVWX 2VHJA 2PCLA 1E2JA 3U4QB 2O8BA 5CB8A 1VECA 2GCPA 2ZR9A 1KGDA 2WJGA 3K9LA 4KFTA 3ZZ0A 5LBIA 3ADCA 4ZIRB 1R8QA 4P4TA 4DUGD 4NE2A 3IKJA 3W8NA 3Q7QA 2WAYA 2YWGA 1E9DA 1P2VA 3QKTA 5FH9A 4PO9A 4MQBA 3MLEA 2ZITA
chains in the Genus database with same CATH superfamily
2NU8B 1KI6A 4D3ZA 4J9VA 3EMVA 3I6ZA 3LLSA 2ZBPA 3LQQA 4M98A 4F3KA 1A96A 1RCTE 1APBA 3CNHA 3ZWVA 1NQAO 5KNCA 4OMUA 2RJOA 1RYZA 2IZ0A 4PHFA 3KE9A 2JIPA 1KE2A 3VZDA 5CLLA 3N07A 4HUTA 4CKEA 2P30A 5CIQA 1KQFA 3WB1A 4C7VA 3BVPA 4NNJA 4YXFA 2LIVA 2JANA 5DBFA 5B2FA 3SX2A 2C7OA 1A2BA 2BP7A 1II8A 4FHCA 1W36B 4YQFA 2DQYA 4G5OA 1VRWA 3RI3A 4P4SA 3S2YA 2ILTA 1EDDA 1P0CA 1VGRA 5K3CA 1XD8A 1D6MA 2JGRA 2NMVA 1LLDA 2WSIA 4LGCA 1ZJ5A 1CIPA 4M60A 5EMNA 2VJBA 3A4MA 3CO0S 4Y7DA 3VNQA 2A78A 3QTTA 4O1MA 3VPCA 3ZJYA 1IQUA 1E2LA 4RJTA 3ONFA 3ZWKA 1P61B 3BWYA 4Y0AA 4TMWA 3OIYA 3NNDA 4IXNA 4CV2A 5JANA 5EG5A 1JGTA 4DR7B 2ZS7A 3IHWA 2F4NA 3I37X 1GQ2A 1UXOA 4M1MA 5ESDA 4EJMA 3PDCA 5BW6B 1LS6A 1SCIA 4MIOA 3GLGB 1CUJA 2VTDA 3OZRA 5C5IA 4L51A 2E2WA 2Z5VA 3NVAA 5EXXA 3UC9A 2GXAA 4S24A 2JVKA 2OO7A 3L4KA 5LVAA 5K3DA 1N5IA 5TQ2B 3AM5A 4BNXA 4EW6A 2FF5A 5FFMA 3V32A 3PPXA 1DC4A 3T3PB 2ZPTX 5CJPA 3WNZA 3I61A 2QL9A 4MTLA 3NHUA 1LGYA 4HD8A 3CJTA 2EQAA 1EK0A 1XPRA 2XE6A 4GZLA 5CK4A 4A36A 3SM9A 3I42A 4L78A 4U6QA 1CRPA 1RJGA 3M8KA 3GN1A 3PIRA 3N2KB 4HDMB 4RY2A 5TV2A 4HTFA 4AYWA 1BGVA 4D9BA 5B2EA 2YQ4A 1O3YA 3L4SO 4M8KA 1UEJA 3JZFA 4LGVA 3N3AC 1SQ5A 4G84A 4KQ9A 1FVHA 1GL7A 1M75A 2JDIA 3H2JA 3QA3E 4GE0A 2P40A 4HWTA 4PC1A 3EXHB 1WXHA 3VQTA 4DCNA 1AF7A 4BAGA 4DIOA 2Q8QA 5G40A 3WFZA 4XQEA 4RHUA 1HDXA 1TO6A 2PQ6A 3RRBA 3SDSA 1N2SA 1TPYA 1S3IA 4JLBA 2QL6A 1TIKA 3PR1A 5ECWA 4RA9A 1NX6A 4ZC1A 3S70A 4DEXA 1NPDA 1YUNA 2UZ1A 3JQCA 4QRIA 5LDGA 4DCOA 2PBZA 2JLAA 2QRVB 2R0QC 3O84A 4YRTA 2FPSA 2O3JA 2PZGA 1PJAA 1E0SA 1N2HA 2GZ3A 3WHIA 1U4OA 3H1GA 3K2EA 4IIBA 4HYQA 2ZPUA 1MPTA 2FVXA 3DONA 3SFVA 4BZXA 1O96B 2PZMA 1AKEA 1SUFA 3RYHA 2AMLA 4QRDA 5JH7B 1DAKA 1XXHB 4LQ4A 3WBKA 4L3OA 3HABA 2G5TA 1Z75A 1PJRA 4Q9KA 4QTZA 4W8HA 2QSUA 1QO0A 2GEBA 5I8ZA 1ZRSA 1DVRA 1E1LA 3GR6A 4K2AA 3GRUA 4GPZA 2QHXA 1VFNA 4FDLA 1VHTA 4MKIA 1I94B 1NMEA 5AHRA 4CLOB 1IBMB 4EUFA 2ZAMA 4YV7A 1D4OA 1GA1A 5JAMA 1I3NA 5BUZA 3L06A 1K0UA 1Z34A 3PEUA 4DCJA 2ZR7A 1KI3A 1U0HC 3GJ3A 4XJXA 4TSFD 3REGA 5FWNA 2P2YA 2C2GA 2JFZA 3RVJA 1UQTA 3I05A 3U4CA 1SKMA 3TL6A 3EA0A 3QKWA 4P8RA 3VC7A 5BOSA 3VVLA 5CVJA 5E1OA 1UDXA 4IGEA 5AKHA 4XWWA 2J07A 5TQVA 3CRW1 1JEYB 4XYGA 3JD1A 4YMSA 2B98A 2HNBA 2V6JA 1T26A 4RABA 3TYXA 3UO8B 3H5OA 3C45A 4CKWA 2PE5A 3KCNA 1NOIA 2JLBA 2CK3D 1FP2A 3QKIA 4EY7A 4OL0A 1HZZC 4BO6A 1JDJA 4RMHA 4G1MB 1KJIA 5AW3A 3CA8A 2VTBB 4N18A 3UHOA 2SKEA 4E5YA 4PX3A 5BSFA 2FRDA 1IZ9A 3M4YA 3F7NA 3ZWCA 1T0BA 4X8OA 5JPCA 4BMDA 4E6EA 1T1IA 1C4WA 3FDJA 2I55A 4PTYA 5LMCA 1MA0A 1EHCA 3K0HA 5GV8A 3HJGA 4PNEA 5C4IA 5C0OE 1F48A 2SKCA 4D7AA 4I99A 3EPJA 2BM1A 2RH9B 2ZSDA 3GNLA 5H3HA 5LBTA 3VBCA 1NXSA 1J09A 2WM3A 3BD8A 2ORIA 4FIZA 2N0SA 4M7PA 4EHIA 2UUBB 3UYKA 3CKKA 3ZJ5A 1ZFNA 4C76A 4C6TB 4S35A 2RH4A 2YHAA 4Q9LA 5COAA 3A2MA 4H17A 4AD8A 2BELA 1Z0FA 3QY9A 4CODB 2YIJA 3K2QA 3HB5X 3BQNB 1SCJA 3F74A 3HWX1 3WYGA 1WMBA 3H5LA 4F5DA 1IU9A 3DE1X 2JFOA 5ALFA 1P5ZB 4ZEVA 2FPGA 4RSGA 3F4BA 4YV0A 5DWVA 5FOQA 2CNWA 1XWWA 4IEIA 5D86A 5JJLA 1PI3A 3L7BA 2RSLA 4MVJF 2FR1A 1R4NB 2X40A 3LIIA 4HTAA 5EIBC 1JMYA 2A57A 2GZDA 4OA5A 3ZDEA 1R00A 3LUGA 1OVMA 4PPQA 5AKJA 5LQJA 2E4VA 2H9IA 4PLTA 2C8LA 2GEVA 2EWVA 3EODA 4NECA 4CF7A 1Y34E 5AVWA 4YAGA 1CNEA 2VHCA 3B3GA 3C7KA 1SU6A 4QXRA 2IUYA 2P8SA 2ZATA 3WYEA 3CVXA 4DIFA 2UYOA 1ECPA 1OILA 3I28A 2GMWA 2FSUA 4BDSA 3V4RA 3CSDA 3UT0A 1ST3A 5ITZA 5J1SB 3WNBA 1ECJA 2EWMA 3NIFB 1JVNA 3WKEA 3C7CB 4HG2A 1CR2A 3QJGA 4A1FA 2PPVA 1C4XA 4ZGGA 2BV3A 1EWTA 1XZMA 3OIUA 1P1BA 2OORC 1C1XB 2X7JA 4MVJM 2PQ2A 3MGAA 3H4IA 4UU1A 1SBIA 3QXCA 4TZ0A 3Q5EA 4HS4A 4IO0A 1S6YA 1Z4QA 3IEXA 2IYRA 4GRIA 3UZUA 3WL4A 2MMCA 1QP8A 3L79A 4C22A 1XPJA 1G0NA 4KG7A 3AV0B 4R2LA 4TOIA 1PG0A 4MO9A 1HE5A 3JD2A 2RGRA 4UUBA 2PZEA 2VKQA 2VUHB 2W71A 2HZ7A 5DYNA 4MUNA 2JNWA 2NYVA 4Y9DA 4B74A 4BO5A 1SY7A 3U56A 3B53X 1SHKA 2FZKA 3EGXA 3FNHA 3PRJA 1HUQA 1KDPA 3DFUA 4N03A 4YRJA 1RAEA 5BW5A 3AJDA 1G8KA 2IDMA 2QGFA 3HDJA 1DX4A 3W6PA 3SVTA 1F2UA 4G0WA 3OZCA 1SR8A 2VJLA 3ZDAA 5BN3A 1GN9A 4GRDA 1C7QA 3I1FA 4UVIA 1KMIY 3ZEAA 4E51A 2G0AA 2B2CA 2H92A 3HYCA 2EKLA 3IILA 3R8XA 5KOJB 1RACA 1SB9A 1QRRA 2DE0X 4LBYA 3I04A 2CYCA 2G09A 3PGJA 5A9SA 3MMSA 1QRAA 1XMIA 6GPBA 2A1IA 3A1CA 2Q1TA 3NHRA 2I6QA 3CJRA 2J5RA 1PHPA 4CU5A 3R76A 3T5BA 3T0IA 3IP1A 4JB8A 1LTKA 4XSGA 2QMZA 4OQDA 1U5AA 1LLUA 3DB2A 3VOAA 1DEKA 3A9RA 3NHAA 5IUKC 1K63A 1WKBA 2BI4A 1L7QA 3KYDB 1JHMA 3W5JA 1YUMA 2B37A 5TQ0A 1MABA 3SZUA 1TM4E 3GPCA 4CM4A 1RC0A 3BL8A 3WISA 4M1KA 3KL2A 2CUZA 2P6MA 3AVOA 3RUCA 4A0SA 2XNJA 1U3WA 2PYIA 3OOHA 4UM5A 3U1TA 4D8WA 4QBTA 2IDKA 2WVHA 1CCWA 3QVUA 4LDAA 5F7ZA 1OX5A 2FLVA 3N2YA 3RVBA 3GLFA 4ZI7A 5JS1A 4D8YA 1RBQA 3SLGA 1GWNA 1KJYA 1O89A 3A4LA 3A4YA 3QX9A 5HILA 2J08A 1TUGA 1CE8A 2YKGA 1AUPA 4TMFA 4I1RA 5COQA 1T0JB 1WHTB 2ZRQA 2PKCA 1A5ZA 3BGIA 3RFCA 5LQKA 4HUQB 2HHLA 1GV0A 5DGTA 1M74A 1THMA 3KUCA 3IP7A 3QVLA 4YCAA 1YQTA 3SS7X 2I4LA 2J32A 3EA4A 4NQZA 5FP0A 2HRCA 2WAXA 2C31A 4ZI2A 2OB1A 1JKJB 3KJFA 5FBKA 5T8KC 3T9AA 5CBKA 5CIYA 4ETNA 1OPRA 3L0OA 1CQIB 3K6SA 4EENA 3THYB 4UE3S 3A27A 4I50B 4ZAWA 4FWTA 1C8KA 3CFYA 2Q9BA 2YWRA 3IL2A 4DDTA 3FZYA 4BPRA 4QARA 2Q1XA 4LHZA 4DC0A 3C5WP 4C0LA 5JVDB 5SZJA 2GXUA 2QPLA 3EC1A 3M0EA 3LA8A 1PEAA 4JJKA 4O5AA 2GZHA 2CNOA 3UFXB 4IKEA 1UFVA 2ZRNA 4ITRC 4NMHA 1IVSA 1V3QE 2GA8A 1Q1NA 3P27A 1THZA 5IVIA 2QD1A 3T5CA 5M5BA 4TSKA 5ADVA 4QD3A 4TXLA 2DUMA 2PKWA 3K20A 1P6XA 3OQJA 1GYRA 1NLFA 1RPAA 3W2FA 3WLTA 1UKAA 4O29A 4WTOA 3CB2A 2XTNA 3TQOA 5CCBA 3E3NA 1G4AE 1II9A 3OFSA 1NBME 2ZVQX 3KT8A 1IDN1 2W98A 3D3WB 3Q0EA 2M6LA 4E13A 5LLTA 3HXQA 3KSUA 3LPLA 1X9IA 1KZ9A 2Y1CA 3RB8A 3KOZA 1J0DA 1UFOA 4I08A 4ENTA 3VKHA 2CMDA 2I66A 2OZEA 4N9WA 3WL8A 4BQQA 1UWVA 2VAXA 1PYGA 5CEFA 1R27A 4O33A 2J9FB 3OESA 4AKTA 3I2FA 2G9VA 3UH0A 4PY2A 3ZE1B 3H9BA 1OYVA 3F6YA 4RAOA 3V6MA 1DOAA 2J3IA 1EFLA 1K4YA 2NYUA 1SC6A 3FPCA 4IM7A 5J2UB 5A3VA 4AJOA 1ZY2A 1NY6A 3JRWA 4LWZA 3RRZA 5JCPA 3PTAA 3QNMA 5G53C 3VGJA 2WP0A 3VVMA 5DHRA 1RFLA 2N75A 4KUHA 4YAUA 2I4OA 1JDBC 3N8HA 5LZ5A 2D2VA 2B5VA 1JJFA 5CFNA 5CTAA 1OXKB 1VL8A 1LI7A 5BRNA 1ICIA 1JSCA 4FOTA 2R1TB 2XRFA 4A6EA 4EZBA 4G1CA 1CY0A 5FV7A 2J9GA 3F6SA 4XKJA 4HPXB 3TIXB 3WGKA 1XZHA 1GTVA 5L51A 1YBHA 3OBIA 4KN8A 3PPYA 4C2UA 4B7UA 3ZBPA 3LP5A 9GPBA 4HVAA 2IC5A 2BPOA 4U9IS 4PCAA 3KHUA 2W42A 4LUCA 1P74A 4B4WA 1M1NA 3EISA 5KVSA 3TFOA 1HMYA 2DP4E 2Q6TA 3WLFA 2RAPA 3WLSA 4FLMA 3VV2A 2HJ9A 3EASA 3RU9A 1NZDA 1Y6ZA 1AMOA 3RODA 3A9TA 1GDHA 1SBZA 4YTEA 4F5ZA 4WXMA 2ZFUA 3C3CA 4LV8B 1QE0A 3D43A 1PEDA 2O6HA 5HBRA 5HKLA 5JG7A 1JHYA 2MSEB 2Y1GA 3S2ZA 1AXEA 1REQA 2FH5B 1Y1QA 3GBSA 5FCDA 2RHWA 2PJRA 3CX4A 1Y1TA 3C7DB 4Z9AA 3GP8A 1R4AA 3IV9A 3QXJA 1QYDA 3EVEA 4ID9A 3CX3A 3CRNA 5J2TA 5HWSA 4IDCA 1TUBB 3TNFA 1ULSA 1V6SA 3GLKA 3U62A 4G1BA 4ZCLA 1N6LA 4LYHA 1GFSA 4OQYA 5DCYA 2EHJA 4L3VA 1AD2A 1B1AA 1R3DA 4ND3A 4NZ9A 4IJ6A 2XCUA 4R16A 1GCUA 4RPCA 5FTMA 3T1HB 2F7SA 3SN6A 1ZJYA 2JATA 1QTNA 1Y7TA 4MRPA 4REQA 2ZUDA 1VSBA 1E3SA 4Y2QA 4A1OA 2D0PB 1IZZA 2XQIA 1OFIA 2XUGA 1H1LA 1N5RA 3PXUA 3UV6A 4ZO6A 4TRNA 1U7TA 4UTVA 3VU3A 2E49A 2OFXA 4KYUA 3OX2A 4CDNA 2F8TA 3NNNA 5H70A 4JQYA 1H3EA 1NWHA 4RPHA 2P75A 5CEJA 2WI8A 1JILA 3ACDA 1M73E 2AQKA 2H2GA 2M6SA 5EKSA 1V8DA 3T7TA 2FUKA 1QHIA 2VUTA 2O07A 4MV0A 5LNK1 4CNQA 2QG4A 2W2KA 2C2ZA 5GM2A 4QVIA 2VLIA 4C4ZA 5EA2A 3B1YA 3PC3A 4MJ7A 1LLFA 1M54A 1JIVA 1RP1A 2GFIA 4RIIA 4TKUA 4V0ME 5E3JA 3SZ3A 4RTNA 4OQLA 1Z37A 1W8IA 1RWOA 2NO1A 3AEQA 3CEPB 3T5DA 5I7OA 2DZDA 1D7OA 1YQUA 1NVVQ 2R86A 3CRRA 1YMUA 4IAOA 2AI3A 5ICGA 4UATA 4FBLA 1BIFA 2GYVA 1ACJA 3BJRA 1A4XA 1ZC3A 4H3KB 4YPOA 3OU6A 4F4JA 1N2OA 3BL5A 1BHSA 3NATA 1XRNA 4JP5A 4CMHA 1Z83A 5CURA 2BEWA 2XTZA 1J25A 1YQDA 2X3YA 2Z1NA 1H6CA 3IP3A 3AVPA 4PCUA 4DMCA 2IITA 4OJQA 4E5UA 3JQ6A 3PHGA 1PKXA 4LYEA 1UJ4A 4GU5A 4RFLA 3R8CA 3R3UA 3UW3A 1L0BA 3QYFA 4N6OA 2HMWA 1T15A 2ZYSA 4KQWA 5GJCA 1QM5A 3ANSA 3RJTA 4MUHA 3H99A 2O8BB 3QLUA 3UB2A 1U5BB 2WIKA 4M89A 4IJ5A 2QTZA 2UXCB 4OTZA 4LF8B 5FTNA 4JIGA 3RTAA 2P9FA 1L4GA 1KY4A 1GYPA 5BV0A 1IHUA 5FPTA 1UXKA 4QU0A 4AUKA 2HH9A 1SOAA 2BAGA 4RSHA 3TLMA 1X7DA 1OIXA 2A0XA 2FSPA 2WTNA 5JNWA 1WZ2A 3OQPA 4RY8A 4ZAZA 4QOFA 3DMYA 5KMGA 5FNZA 5BR8B 2VG8A 1UZUA 4H31A 1AMNA 2C2OA 4EI7A 2E7ZA 1LWOA 2QVYX 3OHPA 3OUUA 1CUYA 4HDKA 2WT9A 3B6MA 1KI6B 1JHPA 2ISCA 4MR8A 1ODFA 5DTMA 4ZREA 5M7EA 3KJNA 4J9UE 4EG0A 2O1EA 3O2NA 4HBGA 4IYJA 3L8GA 4WZ6A 3HSKA 1OJLA 3L8MA 3NTRA 5FKJA 2RCYA 3WZMA 4I9GA 5DNAA 1I3KA 2DFLA 1V1RA 3PPIA 4JIMA 4OUDA 4WXPA 4WXHA 5A3SA 1EINA 3OCJA 2TMGA 1T8SA 3H5VA 4NEQA 4CKEB 2HA2A 4DNXA 3DHYA 3URMA 1EPUA 1VKOA 1X2EA 4FMCB 4IHQA 4RENA 1JTFA 4WVLA 2H1OA 3CY6A 1SXJA 2JFFA 4AJ9A 1XLTA 1II8B 4KXMA 2ZR8A 2FCRA 4ZGWA 4P4SB 2P9QA 2WSSD 1TOAA 3CPEA 4EL0A 3ZY2A 1FUUA 3KYBA 1I5EA 1U9IA 1N33B 3KIPA 4KVGA 4MA5A 4MROA 2GZAA 3TRFA 4BQIA 1DJMA 4X6LA 2WBLC 3C1UA 4P83A 1XGKA 2EL7A 4D9EA 1JFFB 1YRAA 3G0CA 1U1GA 3HLYA 2D8MA 4EG7A 3P5SA 1KS9A 1P60A 1XRMA 2XNCA 4JXXA 1QRDA 3D8SA 4QLAA 3VGPA 4KXXA 1B23P 4Y1RA 4RY0A 1PYOA 5DE3A 5LYYA 4YCDA 5LL6P 4RVHA 4F5WA 1JJVA 4C07A 2H5JA 4UJ5A 3DDWA 2JGNA 3P2KA 2X2OA 3WYDA 1V3UA 2BKEA 2HU5A 4IYRA 4XM1A 2WPDD 5AJVB 3TTTA 1E9VA 3KM0A 5BNIA 3K0AA 1O9HA 1EFRA 1GQOA 2PFGA 1KE1A 5KYXA 1MB3A 1RD4A 1G5IA 3BXXA 1USKA 1LK5A 3AHCA 3A1DA 4BLSA 5JFTA 2CKMA 3NYWA 4L5IA 2QQ5A 1D9ZA 3OC6A 1L6RA 1PGPA 3BGDA 5JTUA 4KHPB 5BO5A 5ENVA 2A1TR 3J7AC 2P9GA 3OFVA 1ZBDA 3KKQA 1LC3A 4M83A 4C7OB 1EI9A 2D2FA 5AK4A 3WXBA 7MHTA 5BQFA 5JARA 4HTFB 3DLHA 3G13A 4PAOA 4G24A 5ALMA 2O48X 2O4CA 4OQPA 5JADA 1E2DA 2C03A 3PC4A 4JU8A 1JDPA 2OT3B 4A5OA 5CFOA 3MZ0A 5EE1A 3QSYA 3WKCA 1RJDA 3RD5A 3X1JA 4G5FA 1DRUA 1V7PC 3RVOA 2V8OA 3L8CA 3SSOA 2H0AA 3T7KA 1T4DA 4C0KA 3ABQB 2XWJI 5DP1A 1VJDA 1FTGA 1UAGA 2XWPA 5P8WA 4ZJYA 3HYNA 4RA9B 4R1LA 2UZ1B 1G2OA 2P79A 4JT9A 4MVJA 3QP9A 5HFJA 2OAGA 3KAJA 1L5ZA 4TWIA 3LY7A 5ALGA 1H69A 2PSDA 3UXMA 4AFNA 3DO8A 1OYWA 3DMTA 2JJ2A 4F84A 5C8VA 4AWBA 4LC1A 3QI2A 1UZMA 5KQLA 5HGXA 4O4IF 3HWSA 1BXGA 5ED4A 2LR0A 3S5UA 5BR1A 1E66A 4HH3C 5ETJA 1B4DA 4CXMA 3B48A 3EDCA 5BUQA 3RYHB 1V4VA 4HFNA 2ANBA 5BPFA 2C5SA 4WCVA 2DLNA 2MSLA 2VXOA 2ATCA 1BG6A 4XSHA 5IU6A 1WUTA 1ZSVA 4AN4A 4EB6A 4YMTA 4IP0A 2GRJA 4JP2A 4RCZA 2OUKA 3X1MA 4F4FA 2XF2A 1UJMA 4G0VA 4M99A 2AEMA 2OYRA 5EJ5A 3LVQE 5IM4A 3DMRA 2AIRA 2P7IA 3RWBA 2GCEA 2KB0A 2XKJE 4AIRA 5H8WA 4DR6B 4UPVA 5ALDA 4E08A 5IF3A 3BTUA 1HF3A 5H80A 4ASUD 4YK7A 1USWA 2FPPA 3N59A 3OY2A 5JSZA 3L8ZA 1L7NA 4ME6A 4AMZA 2PKYX 5FPQA 3ZHOA 3L1HA 2V45A 2SCUA 1U0FA 3W2TA 5JNSA 5LQRA 2J87A 3LUDA 3A4IA 1DKLA 4PFJA 2DVMA 2FETA 3ZQKA 5BOSB 4KQKA 4BNFA 1UZNA 3OP1A 1DRJA 1QMGA 1U2GC 2R4TA 4M1WA 4BVJA 2FMXA 3R0ZA 1P1JA 3OQMA 2WSMA 3PU6A 4Y98A 4XOIA 3SFZA 4YP5A 1ODSA 3JQ9A 5IBCA 3INYA 1F6DA 1R0YA 4CKWB 1I3LA 1TJNA 2W2LA 1URPA 1BFUA 3D8NA 3T3MB 1G4HA 1GLVA 1OC4A 4H0CA 1BZYA 2QRMA 3KUUA 4NK5A 1DUIA 1DBSA 3F96A 4M8IA 4YCBA 3IAUA 1QO9A 2WJVA 4MVJD 1SOWA 1Q14A 2V7TA 4UCXA 1P0QA 2O7VA 2NO5A 2MR5A 2J31A 1JAHA 5LMNB 4OFWA 4JP3A 4IMIB 4BVHA 2XMDA 4RDIA 2XCOA 2I34A 5KNCH 5AI4A 4XRGA 4HWOA 2YHBA 1THTA 4QDOA 3SIPA 1TEHA 5LWQA 2FN4A 3TVYA 2I3GA 2HW8A 3C1OA 5A71A 1VLZA 3D4NA 2POCA 3DOIA 4YLYA 1S7GA 1OFUA 1Q83A 4J2HA 3EVBA 4RLHA 5EN4A 4X20A 9MHTA 3T54A 5E1BA 5BYBA 3M81A 2Y68A 4YRGA 3CLUC 4FHEA 9LDTA 4ESOA 5HOQA 1CLUA 4AJLA 3F1LA 3BCUA 3W5IA 4AY3A 1PTJA 2DR3A 3PQ8A 1GQSA 4LZAA 4RZ2A 1F2TA 2VUSA 1M6YA 2FPGB 4O63O 5DTQA 4OX9B 4PZ0A 1A98A 1E5VA 4LI0A 4NJOA 4TL7A 3WKBA 2ODPA 3FFXA 5A4JA 3K5PA 2WOJA 4XUEA 1H9BA 1RPNA 2H1WA 2C4VA 3PQDA 4R8SA 1X8XA 5SICE 1KMNA 3EF3A 1ZH0A 2XJ4A 3M5DA 4CKYA 3NUQA 2PKRA 4LOAA 4LE2A 1UJBA 1CUGA 3CF4A 1LH0A 3LQRA 1PR2A 1JQKA 4GS5A 3V3KA 4DMRA 4GBMA 4RS4A 2HU8A 5ITZB 3KQWA 2PWBA 2CXNA 1CZLA 1TF7A 3AJRA 1NLUA 5D3QA 1S2OA 2HRZA 2JJQA 3CLTC 3I58A 3SR4A 4NMXB 4RCVA 1QVZA 2IHVA 3PQ6A 3OJFA 4LZLA 2Q2OA 3STXA 3T7JA 4URZR 1UFKA 4D2IA 3FCEA 3GD5A 4W5NA 3TOZA 4JR2A 1Q91A 2ALJA 4JJGA 3QMWA 1QYIA 3JYQA 4PC6A 3CVOA 4YR9A 1A8IA 4H7DA 4LEIA 3MMZA 1JFSA 4I19A 3G2IA 2IBTA 1WABA 2HBZA 2QN6A 4RS3A 3HPQA 3VHRA 4I5EA 3IUQA 2XHEA 4C2TA 2QQEA 4K05A 1EHYA 1U3GA 3ZDBA 2KX7A 5CFRA 2BH9A 3MCUA 4LF9B 4PSKA 5F1KA 2Q9UA 1VJTA 4S1OA 5D87A 1WF6A 2Q2QA 4C7MA 3EGXB 2AD1A 5GVSA 5FPHA 3AGPA 1I14A 1IOLA 5UKDA 4BO9A 2QXYA 1F2UB 2DKOA 2ZSUA 3LFHA 5DHAA 4PG8A 1YZQA 2ZUUA 1CEYA 1NKVA 1P1IA 3ASZA 5DEIA 5BN3B 1B6SA 1M6NA 1WY7A 4MGIR 3ZWOA 1UPUA 1GR1A 1OX4A 4ZV9A 3UXHA 4FHZA 1NLYA 2Y0CA 2RK6A 4H7JA 3ZHTA 3C3XA 1I10A 3LCRA 4W82A 1MD9A 3BRWA 5A9SB 1L4HA 1XMOB 3D8BA 2D5LA 3GJTA 1UBRS 4FGKA 4CL2A 1CZNA 2XMRA 3WADA 3FOCA 1DC5A 2ZUTA 5BWCA 1QYVA 2GD0A 4QXOA 4X91A 2P2NA 4YLEA 2YXNA 3WDMA 4I8XA 4FONA 1LC0A 2PYZA 4ZFNA 2B30A 2C8VA 4QWWA 4JELA 3GB9A 4DBLE 4LJKA 4HB3A 4K5QA 4OKIA 5KWVA 1L4FA 3HCRA 1OBOA 2R7LA 3DYIA 1MABB 5TQ0B 3U4IA 5KYGA 4RHCA 4J16C 3TLEA 3FFBA 3TUZC 2PH5A 4CM4B 3ELYA 1E89A 3VYWA 3CCBA 2WJAA 3OZIA 1JDTA 4IEFB 2YXDA 3GLFB 3EPLA 3O03A 5IRCD 4CG1A 4ZI7B 5L9AA 3PYLA 1GDDA 1GCIA 3EFOA 4KQ1A 4KSCA 3AR9A 4A6PA 2QQGA 3MTGA 2EJVA 1CE8B 1VTKA 2JIZA 3GX1A 3HQ4O 3ZI7A 4O0MA 1K08A 4FR2A 3BFVA 2QLTA 5AXBA 1HDZA 2QUKA 3DQQA 4FW9A 3T4PA 1L7RA 3FPSA 5A6SA 1C7EA 1N77A 2GDZA 5G0SA 3IBCA 4DJEC 3REFA 2WWGA 4QIHA 2DWQA 3Q3HA 3VSBA 2VJDA 1XDWA 3K6SB 1FP6A 3IVXA 3Q3VA 2IUSA 4DQKA 1TUEA 3QIAA 1O97C 3DVQX 5AD1A 1RQPA 2RHDA 1VMKA 3KWJA 2O2HA 1TVEA 5B1HA 4K2HA 5EHXA 2NV6A 3GJ4A 3DPSA 4FZJA 1HA3A 1PX2A 5JXHA 3JVEA 1ZZEA 3LOUA 2CXHA 1N5KA 2G1JA 2ZYIA 3O4GA 4GO1A 4L6CA 2D5IA 3INGA 5AW5A 5ILGA 1JN0A 1UPTA 4B2LA 2FZ5A 3AHJA 1CUXA 2XW6A 5EZ5A 1XMPA 2IEAA 5K2MA 1SN7A 5CCXA 3WRXC 1CVRA 1I4LD 2RI6A 2H2DA 4O5OA 1Z0AA 1YV9A 2J9XB 3QPUA 3U5TA 2YMQA 1I6LA 3EDQA 3JPYA 2Q4EA 4KDEA 2IKQA 2X9GA 1W47A 1OWPA 2ATEA 1RABA 4I81A 5DRYA 5IH7A 4YP1A 1FVOA 2VS1A 2APJA 3FRHA 4XD7A 1YK1A 2X8WA 1HOTA 4OI2A 3LLCA 5AK3A 5HZKA 5CFMA 1GPH1 2WKRA 4I1VA 3OPMA 1NNI1 1Z7BA 4IIYA 3WV4A 3KR2A 4JAVC 3C3BA 4Q7MB 4HLQB 5DHUA 5AKGA 2JIDA 2QN7A 3FMFA 4LBWA 3UVEA 4CF5A 1KNQA 3BERA 3D0QA 1JBQA 1K86A 2OGWA 3AVYA 2A94A 3CCCA 5KNBD 2IHUA 4J0QA 4KO1S 3OZVA 1D8AA 2LXNA 4N49A 1W7AA 2V96A 3IXLA 4Y8VA 5EKUA 1SWWA 3W7VA 1C9DB 3CX8A 4IRUB 3UEOA 1GARA 3AOGA 3DAOA 3O7WA 2XRMA 4BJHB 2XNDD 4WERA 3EXG2 4LSWA 3PFBA 2VDNB 3GEBA 3LBAA 1SH7A 2O2IA 2H1SA 4QUHA 5AVZA 1ML4A 4RQTA 2O7SA 3MS2A 3BFKA 4IFBA 1GNQA 2C29D 4KK3A 2GJ9A 3N7UA 3OFNA 4CN9A 3RVRA 2PWPA 3QFCA 1DWOA 1TVMA 1YI0A 2CXQA 4ZO7A 2LP4Y 4C3OB 4OYYA 5AKIA 4RVDA 5BWNA 2BMVA 1GPJA 2XUJA 1VXRA 3V4LA 2C7BA 4TQAA 3CKMA 4MHSA 2GVNA 4TLAA 2FPIA 1HYEA 3DTTA 2DUJA 1MQSA 3FNEA 3NOQA 1M1NB 1JE0A 1X3LA 3R77A 1Z56C 4IBOA 4A82A 1OZHA 3IVMA 3TZEA 1QGUA 3I76A 4JITA 4L16A 2O8CA 4CL0A 1MN6A 1SIOA 2R25B 1F8FA 2C5LA 2EXXA 3QEKA 2HLNA 4KJZA 4QTUB 1MZPA 4GNRA 2FAXA 4B17A 3EPKA 1R8XA 2RGEA 3LWBA 2FOIA 3BMOA 3WLRA 3QKUA 4EJSA 3HBJA 1E7WA 1REQB 4LC9A 3TRIA 3U1BA 4JBWA 4S1WA 2JAOA 2XYPA 9LDBA 1MEJA 3KB8A 3KPJA 4M21A 2HCBA 4OREX 3U3DA 2R60A 5J2TB 3JARA 4LRTB 4RTPA 2OCKA 4U39A 5IAKA 5JJIA 3BSFA 2G1AA 1XQXA 1ZOIA 1EU1A 3B52X 4MI6A 1TYCA 4TLDA 1UANA 3UJAA 2EARA 4WI1A 4ZVSA 2PN1A 3E4CA 5A5EA 3TZLA 2YBEA 3WMRA 3AHIA 5DNCA 1U0RA 2AEJA 3QY0A 4REQB 3DEYX 3N8KA 4WL0A 2C07A 2WU1A 3E7WA 3EBLA 5A9RA 5KVVA 1H1LB 1P5JA 2IOFK 2JLWA 3DS8A 3R8FA 3UKDA 3DKPA 1QG2A 2GBLA 5HMLA 2WTBA 3IJRA 1PFKA 1JA1A 1Z12A 2VJKA 2HTFA 2G72A 1JG6A 4JZKA 2NZVG 4F4HA 4M86A 4J6FA 1EEXB 3HY6A 3HDGA 4QGBA 3BE5A 4QO7A 4DCUA 1OV6A 2W2KB 1DRWA 3IPRA 4IR7A 3HCEA 3E3AA 1CQWA 2CZGA 4XFDA 1TCCA 4TKUB 4CMJA 3DHWC 1N7HA 3ZV3A 3S81A 3BZUA 2YINC 3RJMA 2JK1A 3AEQB 4OBBA 3M3HA 3QF7A 4MITA 2IGBA 4YAIA 5KQPA 2V9CA 4FSHA 4JJ7A 1L8OA 3ENQA 5DGIA 1NZJA 2AF4C 4DQVA 3VHQA 4NENA 1W9HA 3NJ8A 2X7XA 3PNOA 4OHBA 3UBMA 2HO4A 2PGDA 4CEJA 2NUAA 4ACBA 1KRHA 3DM9B 4M46A 3AI2A 4YJHA 1UBGA 2ZQYA 3RR2A 2ZIAA 4N0DA 3T3HA 3VU1A 4HAYA 1ZM9A 2BEWB 2BMWA 3ZCTA 10MHA 3RNOA 3PEWA 3C0KA 4IV8A 1EXNA 3ZWPA 1KU6A 1CUHA 2B83A 2BGUA 4KIUA 3HRKA 4RFVA 3ICCA 3N0VA 5LXTF 2NOAA 3WIUA 3RTBA 3JWPA 4BRWA 4OMDA 1Y63A 3IJ5A 4X94A 1GGNA 1PGOA 1V71A 2VHEA 3PENA 1UZAA 4JGGA 4WBSA 3LU1A 5ES3A 1F7UA 1A2OA 1V8OA 4D3FA 1HT2E 4KLAA 2E9SA 2EJBA 4B3MB 2V7GA 4X85A 1CQZA 1OTYA 2JCGA 3I8SA 3KR1A 4YJGA 5IEBA 3Q8LA 3Q88A 2YMPA 4Q3CA 3EH2A 1PGNA 2PWZA 3R44A 4MW9A 4QDUA 3VZCA 4EEXA 1XNRB 3AIMA 1OI2A 4LSZA 2GGSA 4GBED 4HDNA 5KMGB 3OTGA 2GD2A 1VKRA 4IZ6A 4YCMA 4KO2S 2JD1A 2IIQA 4C29A 2HBYA 3BJMA 4LISA 2X6QA 4P6VF 5JJCA 1Y48E 3DBLA 4HDKB 3G7UA 3RJ9A 1PUXA 2BGMA 4MR8B 4O4IA 3T7DA 3WMGA 3ZYCA 4CMGA 1WDLA 4EF4A 1W0KD 2WQZA 1H0HA 4D4JA 3PHIA 4NCKA 1YCHA 5IMSA 4P3NA 2ONYA 3MJDA 4YS6A 2PR7A 4B32A 3KQHA 1V1RB 4ITUA 4PG7A 2P2ZA 4Q16A 4XVQA 3II6X 1XZFA 3HEAA 1ZUNA 3I0ZA 1YBAA 5JWRA 1BU5A 1SG0A 1VPDA 3ENZA 4G25A 3WYAA 2JLCA 4RQBA 1NDUA 3EW7A 5IAGA 2G8NA 3TVDA 4DMGA 1ADFA 4FX5A 3X1XA 4W1QA 3KPWA 4WLEA 2OGUA 4RPGA 1SXJB 4KX5A 2LUOA 4OLFA 3AW9A 2J5BA 3BJEA 2O3QA 4GLBA 3WRYA 4B4UA 1SU8A 4Y2HA 1HEYA 4BBAA 1LK0A 3PQEA 2X15A 3GT4A 1C81A 2WF9A 1S0UA 2AVDA 3BWBA 4INOA 1GVNB 2FSHA 5KKCA 4K7JA 2LE0A 4RIEA 4EG1A 3QBTA 2JAWA 1NJFA 1E9FA 2PV0A 2PQ0A 3K9FC 3BJIC 4TS9A 3E8SA 3QE0A 4EELA 3NMUF 1EK1A 5CFZA 4V1CI 2QM7A 4IDGA 2YV2A 4TYWA 3TDNA 1KO1A 4Y1RB 3VNBA 1L8XA 4RL4A 1CS4C 4E3ZA 3QHAA 2J0SA 3N05A 4NAHA 4Y2PA 2E87A 1NJ6A 4LTMA 4OH7A 4WZZA 3OZUA 1NAHA 5EJ2A 5DXJA 3K8OE 1NF3A 4MWSA 4Q7LA 3EXFA 3K0AB 4J0HA 1Q0ZA 5HZGA 2H1IA 3ABZA 2HMYB 4ZHSA 4GLJA 4UXJA 3ETCA 5KYXB 3L7OA 1GA4A 3DMDA 1J22A 1YACA 2I91A 4CKCA 1U8UA 3FFWA 3RLIA 1R37A 1YU9A 3U0BA 7YASA 2HYIC 3E9NA 1Z0IA 3IMGA 2QSZA 5D85A 4LWOA 1OBCA 2J46A 1LSSA 3ZX4A 1I01A 3T4EA 5EPOA 3I3SR 3HHPA 5EZSA 3ZHZA 4R1PA 2GBPA 2VNIA 3OE7A 1Y4AE 1I6MA 2YR0A 4LX0A 4F3NA 2V5VA 4ARIA 3DCNA 3UF0A 5DO9A 3K1TA 3T52A 1K5PA 2HRDA 3SR0A 2J3LA 3ZNOA 4E7OA 2B20A 1KYWA 1B3BA 5JDIA 4PQFA 5ALKA 2ETXA 4BKPA 2C7RA 1ADGA 1PSWA 2RARA 3R0JA 3ZDZB 4UTNA 2R8XA 2VBFA 4QYMA 2OBXA 1CY2A 3X1DA 4WK4B 3L8HA<