1GSIA

Crystal structure of mycobacterium tuberculosis thymidylate kinase complexed with thymidine monophosphate (tmp)
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
208
structure length
208
Chain Sequence
MLIAIEGVDGAGKRTLVEKLSGAFRAAGRSVATLAFPRYGQSVAADIAAEALHGEHGDLASSVYAMATLFALDRAGAVHTIQGLCRGYDVVILDRYVASNAAYSAARLHENAAGKAAAWVQRIEFARLGLPKPDWQVLLAVSAELAGERSRGRAQRDPGRARDNYERDAELQQRTGAVYAELAAQGWGGRWLVVGADVDPGRLAATLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords THYMIDYLATE KINASE
publication title Cryophotolysis of Caged Compounds: A Technique for Trapping Intermediate States in Protein Crystals
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 81
structure length 208
sequence length 208
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2002-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1gsiA00
2BEJA 2J45A 1IN8A 5FOSA 2XSZA 5EE9A 2YINC 4P4TA 3PEWA 2CLDX 2RGGA 2XZPA 1GRQA 4URXR 1NIJA 1T4GA 3KB1A 1R0XA 4LV6A 4N3NA 5JI3E 1E9FA 1VG0B 1KSFX 2GJ8A 3SQWA 4QNRA 2WSSD 4XWOA 1G20E 1SXJE 4KCGA 4BLRA 4MUAA 3AF1A 1ODFA 5KDDA 2ORIA 4Q48A 1E3MA 1BMFD 4GSYA 1G41A 4WAUA 5B58C 1E9RA 2F43A 1GKIA 2GCPA 4D0LB 3A6PC 3SI7A 1LB1B 3DZDA 1NBMA 3MCAA 4G5QA 1CLUA 3LBIA 2NZJA 4FI3C 1EFUA 3TE6A 2OCYC 2GDJA 3D31A 4NYJR 5GJCA 1Q0UA 2HT1A 1GP2A 1MO3A 4RZUA 1EK0A 4Q1CA 3K70C 3KTAB 5DI3B 4H1UA 3PUZA 2KI5A 5JRJA 1OYWA 3VR3A 1DO0A 4PPFA 4M1TA 2ODBA 1LY1A 3WHKA 5AJYA 4M1MA 3E70C 1S9HA 4XD7A 4Z1MD 4B6EA 4OQFA 3R8FA 2CJWA 3HR7A 5KSZA 2P65A 2Z83A 5BYKA 3W3AA 2F43B 1E1QD 4K8OA 1RE0A 4MKFA 2HDNB 2I4IA 2ZRGA 3RABA 1SZPA 2JLVA 2JLUA 1U0JA 3FYHA 2ECKA 4TTPA 3VHLB 5GJBA 4H1VA 2ZEJA 1YKSA 3VR4A 2QGZA 5CLQA 1OXVA 1T8TA 3CNLA 3GFOA 3LDAA 4Q19A 5JS8A 3B82A 4O2LA 3SJAA 3QENA 5TARA 1YR7A 2ZR7A 2ZSAA 4WVFA 4WW0A 1ZRHA 4F4IA 4JVSB 1BIFA 2J9RA 4UNSA 1IJFA 2GK6A 3EPHA 4L4UA 1DEKA 2R9VA 3K09C 2C5LA 2XOKD 3B8HA 3AQ4A 4IXNA 2CJWB 4CZ2A 1XTIA 2IWHA 4GRAA 1OW3B 4TLAA 2EFDB 3TQFA 3LFUA 2JJ2A 2CK3A 4U5XA 3GJ3A 5EZ5A 3TQCA 1G4AE 1W0JA 2VSFA 2O0JA 3RRNA 3T1OA 5LD2B 1F2UB 5DSZA 2BKUA 3AF4A 3RS5A 4M9QA 3FGNA 1R0YA 5E7IA 5JFGA 4DT1A 1Z0IA 2NPIA 5FBRB 4M0LA 4NE2A 2IXGA 2VLIA 4DDUA 5A4JA 2WSMA 2WJJA 2GHIA 3EA0A 4JLJA 4QHSA 1NLFA 5UKDA 4PANA 4DLTA 3AVXA 1XPUA 1KOFA 4KFTA 4QM6A 2YVUA 2A5JA 1U94A 3QG5A 4Z51A 1Q3HA 4C0KA 1NIPA 2ZSEA 1G16A 4IVRA 1KI1A 3GJ4A 1NG1A 2VHUA 5DE3A 3OIUA 2J7PD 1S4QA 5HTKA 2WJYA 1YR8A 1NLZA 4URYR 4QL3A 1KAOA 3U4QA 5KNDA 2GILA 2C95A 2KBEA 3C41J 4HLDA 4MUBA 3THYB 3AP2A 2BVNA 3HPRA 4KU4A 1EFTA 1VMAA 2JDID 1WBBA 1E2LA 2W6IA 1TX4B 5TB5A 1ZAKA 4X8HA 4BECA 2EWWA 4NMMA 2ANCA 1Z29A 4HB4A 1F6BA 1VCOA 2ZRBA 2QTHA 4QGGA 2WV9A 4ACAA 2HUPA 4HAZA 2OE2A 4HUTA 3K0CC 2ZQ5A 5BN4A 4V0ME 5LD2C 3RS7A 2IF0A 3WNDA 1E4VA 2EYQA 1XPOA 1Y63A 2J0UB 3WYGA 4Q7LA 3B1XA 1E79D 1YZLA 4DCVA 1OLOA 4J0QA 4PPQA 5DN6A 1CTQA 5JHGB 1G1MA 1ZUNB 3IHLA 3QUSA 2FSGA 2O8EB 2ZJZA 1P62B 1G7CA 1W46A 1UEJA 1L4UA 3AKYA 4RFSA 1GSIA 2IL1A 2ZE7A 2ZRMA 4HATA 1N6NA 4NP6A 1E69A 2QE7A 4BEBA 2QU8A 2VP9A 3K0AB 4LYHA 3CZPA 1CEEA 4AYTA 2V3CC 3T61A 1AIPA 3K0FA 1K8RA 3FFAA 5AJXA 2GXSA 3B5JA 4YMVA 2AR7A 3IHWA 2OG2A 4FMDB 3CONA 3LV8A 2ZJYA 2BM1A 5CITA 1US8A 5DHAA 4F4CA 3GLHE 4YDSA 4JLBA 4QHYA 3PXGA 3WRXC 5J4KA 3QXCA 4M22A 1UKZA 4Q9HA 1RKBA 4PPGA 1IY0A 2BMJA 3HP1A 2AD5A 1YRAA 1CJVC 4RSGA 4OI2A 2JJ8A 4CEIA 1QVRA 4Q9LA 3B6EA 2ZRJA 4LJYA 3A4NA 3QNUA 4PX9A 4EDHA 3PVSA 1JAHA 4HUQB 4G5GA 1OB2A 2OV2A 4C7OB 3GP8A 1KK0A 3K0EA 1O3YA 2ZRFA 1N6PA 5L3QB 3B1YA 3TAHA 3RVBA 4TZ6A 2H7VA 3CR8A 3CKLA 1E2QA 1BH2A 2AD1A 3GLIA 3H86A 4C0JA 3R8CA 3V9PA 1YVDA 5FBVB 2FV8A 1Z6TA 5KUTA 4QM7A 1SVKA 4CRWB 4Q4AB 4JYCA 3TH5A 5KTYA 2ZI3A 1UBCA 2QGNA 3A58B 3MWKA 4IFEA 5BWMA 2FA9A 5LDDC 4M1KA 1OFIA 2OFOA 4R2HA 4V0LA 2Y8EA 4PC1A 4DVGA 2F1JA 2IC5A 4B74A 5LBIA 3Q9LA 1OIWA 1IQPA 2QBYA 1OH7A 1G17A 2G6BA 4B3GA 2NQ2C 1OXUA 1G64A 3WNBA 2IYXA 4HDOB 2WPDD 3RDPA 1M7HA 1Z0DA 3ASYA 2G0TA 2CL7X 5D3MA 2H1LA 2ZE5A 1G5TA 2D4HA 3HR8A 4ABYA 1U8YA 2XXAA 1GL9B 4KYIB 2WWFA 2CHVA 4DZZA 1KSJA 4Q1BA 4ESHA 3EZ7A 4IVPA 5KSYA 2XZOA 1UF9A 2WWGA 2A5FA 5HE9A 3X1XA 2GZHA 1X1SA 4PO1A 2BMEA 2FZ4A 4M1SA 2PLRA 2AXNA 4OKSA 5DIFA 1RVDA 3ZQJA 1XEWX 2OILA 1AS0A 2AFIE 2BC9A 4IHQA 2D2EA 1XTKA 2QSYA 5FPTA 1S96A 2VA8A 3MWLA 3BORA 4JT4A 4MYTA 2YOGA 1JQJC 4JKYA 1FPMA 4YC7A 4X8MA 4A0RA 2P6RA 4CEJB 2MSDB 1M74A 2GZDA 2WICA 2PEYA 1II9A 3AVYA 3PUVA 4DUGD 3FB4A 4QGFA 421PA 4ZI3A 3NBXX 4FIDA 1P61B 5E7MA 5TV2A 2YYZA 1ZD9A 1T3SA 4MA4A 3ZLJA 5K8UA 5B2ZA 3MUFA 3G5UA 4HI0E 3MGCA 1XP8A 4DLXA 4AG6A 4LJ7A 3T34A 1NG9A 1E9SA 2WMNB 5FPYA 3AKCA 2Q3HA 3CRQA 5A5GA 1E2MA 3EC1A 4A15A 4KJZA 4UXHA 3TRFA 4POAA 3VAAA 3KJIA 1CJUC 1C1YA 3ZS9A 4BLOA 1KI6A 1R8SA 4RD3A 1E0JA 4OK3A 1ZM7A 5HCNA 4UKDA 4MKHA 1ZCAA 4LC0A 2KE5A 2CNWD 1BKDR 2IYLD 2CLSA 2VP0A 3FMPB 1KK3A 4A36A 4LOAA 2I1VB 4FD2A 1TL7C 5G3YA 1XXHA 3CRMA 4KLNA 1Q57A 4M2LA 3W5IA 1KDPA 3Q85A 4DXAA 3IQWA 2GEDA 3KFVA 2A3RA 1LW7A 2C9CA 3RS4A 3QEJA 2CHGA 1MABB 3OE7D 2P67A 4JLAA 3BE4A 1PVOA 5JRZA 1HEIA 1QHIA 2AFHE 4YONB 2IUSA 1RJ9B 1UKYA 4OHWA 1CR1A 1KNQA 5KU1A 3SYLA 3F5FA 3ZIAA 1OB5A 3VMFA 4C2TA 2ZSDA 3QBTA 4IKEA 2OXCA 2ZR0A 2CDNA 2KBFA 2YC4C 1CBUA 2IYSA 2MSEB 2OM2A 3P1JA 4TT3A 3ECCA 1XMVA 1UBEA 2H16A 4EPWA 1AQUA 3LWNA 4JLMA 4HYYA 4GOXA 4JL8A 3LA6A 4AKGA 2CEAA 2QUZA 5C4MA 3TW8B 3VFDA 1P9RA 2AKAB 2OFXA 2DWQA 3CM0A 1VYUA 3QXSA 5GVSA 1KMHA 4B43A 1YZTA 1DO2A 4YDHB 2O0KA 3OESA 3ZDQA 3KJEA 4CEHA 3QKSA 3K53A 2N1BA 2GZAA 3NBZC 1NMZA 2IW3A 1VDZA 2RCNA 3I1FA 3QKUA 4WOPA 4LPSA 1QHHB 2A78A 4DIDA 5CDFA 1KSHA 3U3JA 3SBDA 3V00A 2G9NA 3QJYA 3L0PA 5EUMA 2JLXA 4C2UA 2RB4A 1AZTA 4BZPA 1ZC3A 3IKJA 4O0MA 1W36D 2JLRA 5CK4A 3OEHA 3MJRA 3VQTA 2JA1A 2ZAMA 3EZ6A 5F3WB 4ZIRA 3U6BA 1JR3D 2YNMA 1N6OA 1W5SA 4OHVA 4V0KA 3AUYA 4A2QA 2VSXA 1EX6A 1DAKA 3LD9A 4RD4A 4GOKA 3KXLA 3SDZA 5LPNA 2WWYA 1DAEA 3ADKA 4U02A 4DLVA 4I99A 4IJMA 5KYKA 5AWFC 1W5TA 1C9KA 1YJ5A 4N0DA 4W7SA 3VR1A 3ZJYA 5F9FA 4G5RA 3TKLA 2G1KA 4PZYA 3B78A 1ZMXA 1OIXA 4I1VA 4A0HA 2IS2A 1AZSC 1FFHA 1VIYA 3O8DA 1ZINA 2FZLA 2PEZA 3L82B 1TPZA 2QL6A 4ZDKA 5HCIA 1H8HD 2B7CA 4LGMA 2J46A 1M34E 1Z6YA 2OT3B 4RZ2A 3TR5A 4AKIA 4NPHA 5CYPA 3WHLA 2BWJA 4IFBA 3WNCA 1GNRA 4D26A 1Z28A 4EJSA 3DMDA 1GKYA 4RZ3A 1K6MA 1KTVA 2JASA 2PX3A 1DG3A 1DAIA 1A5TA 3QIAA 4PSKA 5H68A 1A7JA 3THWA 2YWHA 2FFQA 4YQFA 2XB2A 3TGPA 3VU9B 5BW8A 4LSGA 1T0HB 1XTSA 1VCIA 3IBYA 4I1SA 4QRHA 3WBKA 1TF7A 1WXQA 3BOSA 4EPYA 1LFDB 3NVAA 3RS2A 2VP2A 3OFND 4M1WA 3WMEA 2HXYA 3UIEA 4US2R 2O8BB 3RWMB 4DJTA 4JLPA 1AJEA 4YXWD 3ZYCA 3T1VA 1ANKA 2FPMA 2QNRA 1P5ZB 1AN0A 2RGCA 1GVNB 2NO1A 2CXXA 4RKFA 1A82A 2W83A 2QTFA 4ZV4A 2IBMA 4H9GA 1CRPA 2BCGY 2FMXA 1FZQA 1B23P 1QG4A 3CRVA 4B75A 1R10A 5EP4A 4MGZR 3DM5A 4HZUB 1E2EA 1ETUA 1SHKA 1R6BX 2NG1A 2QMHA 3R7WA 3SJZA 4D81A 4YMUA 2QQ0A 1VYTA 4P31A 1OHHD 3U44A 3BFXA 3VX4A 3IEUA 1Z07A 4K81B 4PAOA 3G82C 1KI7A 4U7DA 2VHCA 1IXSB 2A5GA 2R6FA 3UMRA 2Q0HA 1YE8A 1G3QA 3U3KA 2FJUA 2ZU0C 3M4YA 4RD1A 1FP6A 2EW1A 5J4LA 1J7KA 3U61B 2GJSA 4DLYA 1G8FA 2IXFA 3KKPA 3R9IA 3B60A 1I4LD 1Z6AA 3B13B 4OYHA 3BXZA 1D9ZA 3TW4A 1PJRA 3I61A 3N70A 2PJZA 1Z08A 5FOTA 5BN5A 4BRUA 3U60B 3DHWC 1XRJA 2IS1A 1OF1A 1BO6A 2O8CB 1BMFA 4JIMA 3SZRA 2ZTSA 3TVTA 3NWJA 3CX7A 1VG9B 2HLDD 2WKPA 1VPLA 1QBKC 5BN3A 1GNPA 3BGWA 3A1TA 2EFGA 1NSFA 2IS4A 1E2IA 2VHTA 1H65A 4TWZA 5FUYA 3SBEA 3AVVA 4LHYA 4ZO4A 4XIGS 5FR2A 5FTMA 3WP1B 3NTUA 3BBPA 4JZKA 4E03A 1KY3A 3TK1A 1GKUB 3GLGA 1NMXA 2JCSA 1I4TD 4AKEA 3V4RA 1KY2A 3NH6A 2WWXA 4JT2A 3RSOA 2V4ZA 1WA5A 4CYMA 3T06B 3GPLA 2OCAA 1R5OA 5J4YA 2AN9A 3UG6A 1MRNA 2C9OA 1TF2A 1GOTA 1A2BA 2FPLA 3C5HA 2RHMA 3MMPA 2YV5A 4KFUA 4ZKEA 4M9SA 4C0LA 2ZSFA 4M21A 5EXXA 3NG1A 4NBSA 1F48A 3IPXA 2O0HA 5DO9A 2WJVA 3ADDA 4JMPA 1SKYE 3W9YA 4O3MA 3AVOA 2HF8A 3GJ0A 1XZPA 4GFDA 2GAOA 1FTSA 1FNNA 4PZZA 3CPEA 1DADA 3IO3A 4LCBA 1JBKA 4ZCIA 1KZGB 1KGDA 1S8FA 3A1VA 4PHGA 1XTRA 2FN4A 2JIZD 4Q9KA 3SC3A 5HKKA 5K8LA 2XOKA 1LVGA 3VTKA 1ONBA 2GESA 3GFTA 3HDTA 3U3OA 1WMSA 3I8SA 3QXHA 1XMJA 2QMOA 1GUAA 3K09A 4OK5A 1II0A 3B9PA 4C0QC 2ZU6A 1CJKC 4P4SB 3PITA 4MH0R 4NYJQ 2FEMA 1OH5A 2ZRCA 4TLBA 5CIQA 3SJBA 1G7TA 1J90A 2H5EA 4KHZA 1E9BA 2FEOA 4PAMA 4LY6A 3TSWA 4LYFA 1V5WA 3RRYA 3L8ZA 4A8JB 4RY2A 3LBHA 3QG1A 2ZUDA 3CW2A 1E6CA 2Q9AA 4PHHA 3BAFA 4TYYA 4LHVA 4Z8YA 1VG1A 3EPJA 3KTAA 3LVQE 5DI3A 5E95A 1XD9A 3BD9A 2EVWX 2OESA 2WOOA 4PTLA 2LKCA 1XCPA 2Q3MA 2EQBA 2V7QD 4D6PA 1XD2A 2HT6A 3VR2A 1F3OA 1IN4A 2GXQA 4TMKA 1SXJB 1N0UA 4M8NE 4JVMA 2VH5R 3UK6A 4PSAA 4HLQB 2QPTA 2R6AA 2GJKA 2ZAOA 4HLUA 3RRZA 1N6HA 3SHFA 2DFLA 4D82A 2JJ1D 3SJCA 1ZM4A 2OSBA 3UKDA 2JDIA 2H57A 2V1UA 4EFMA 1P9WA 1P2UA 3C5CA 4JKIA 3PENA 5KNBA 2WM9B 3ICQB 1EWQA 2QORA 2IYUA 4PHTA 2GVDC 3K9GA 4UNRA 1Z22A 2KJQA 1D2MA 1TUIA 1G5PA 1EWRA 1II8B 1HE8B 2H92A 1RZ3A 1XD2B 1GDDA 4PC7A 1V43A 5JMTA 4BQSA 1E9AA 1GIAA 5DI9A 2ZUBA 3T35A 3CWZA 5SZIA 3IIKA 3RYTC 4FMCB 3K0CA 4V0OA 1DTSA 5EXSA 3K0SA 4LYAA 1HQYE 2H17A 1E79A 1N5IA 2IXEA 4WXPA 1VCNA 2DFNA 2VRWA 1F2UA 4XTRA 3V4FA 1NMYA 2E87A 3CF6R 1R0WA 4A8JC 1T3HA 3QVVA 4TL6A 1ZIPA 5FL7D 2NPFA 1CS4C 2ZE6A 4E22A 1ZUIA 1KO4A 2PCLA 3QY0A 2KSQA 4GI7A 4KBFA 1H8ED 3GJ6A 3MJHA 4GP6A 4KYUA 4JL5A 4D4JA 4PQYA 4XWKA 4I1OA 2AK3A 4Q1EA 5JWHA 2IF2A 4BFYA 3LXXA 2ZXUA 4JL6A 1GWNA 5G40A 1NN3A 1IM2A 1NJFA 2C03A 4TYQA 2FSHA 3W90A 3C7KA 4LWZA 2OEPA 4BFTA 1W4CA 2BCJQ 3GEHA 4RCYA 1DAGA 1PUIA 2E9SA 1SXJD 1G291 3HPQA 4P3YA 2B8TA 3LNCA 4US0R 3FOZA 3RSLA 2QY9A 4JSTA 2DFKB 2LWIA 2CVHA 3THYA 4Z8XA 2DR3A 5KPDA 3KJHA 2GVZC 2PBRA 1E9CA 3SFVA 3QE0A 1UDWA 2A5YB 3N2EA 3HU2A 1TQ2A 3P4XA 3WP0A 4ARZA 1RPZA 4CF7A 4TMTA 4DLSA 3SOPA 4CT4B 3VR6A 2FF7A 4Q4JB 3RWOA 3TIFA 4AY2A 3NIBA 4ZCMA 4HLUC 2IUUA 3PCRB 1ZJ6A 1E0AA 3W3ZB 3TAUA 4OHZA 2C98A 3DZ8A 2DBYA 4Y0VA 3VNUA 3LVRE 1P9NA 3QF7A 1W0KD 2FFAA 4QGAA 3AVPA 4LHXA 1UJ2A 4BLTA 4TN1A 3TSOA 2DFTA 2J0UA 2VF8A 4B71A 3FFBA 2BMDA 3CZQA 1EX7A 1M1YE 4B2IA 1EG7A 1JNYA 4NTZA 2HJVA 4IOLA 4XVRA 5IK2D 2ATXA 2ODNA 5AJVB 2PZGA 1U8AA 4D4MA 2O8EA 4ARZB 2ZIAA 2ZRHA 4PC3A 2XTNA 1IOZA 4N0EA 4ZKDA 1Q20A 2Z4RA 1XCMA 4QJ3A 2WPDA 4DRZA 4FMCF 1Q1QA 1G4UR 1IHUA 5EP3A 3KXIA 3K0AA 1IN7A 3AVQA 1FL9A 2R8RA 3ND8A 4CT5A 3W6NA 3GLFE 2D3WA 1N5JA 2XJ9A 4B2PA 1EXMA 2ANBA 3O8RA 3AF2A 2JEOA 4I1UA 4ZDJA 3DPUA 4KO8A 1RYHA 1QHNA 2RH5A 4B73A 4BRWA 3EG5A 4QBFA 5DYIA 4Q02A 1DAHA 3U7HB 1WF3A 3U2QA 4FCVA 1GRRA 3RHFA 2FFBA 5F2EA 1U90A 3DOFA 4HB0A 4XD7D 1F2TB 1KI8A 4JLNA 4WZ6A 4KITB 2WAXA 4WA7A 3L0IB 1E2HA 1VG8A 1TTTA 2OLJA 1Z6XA 4PHFA 1Q1ZA 3CWQA 4HUQA 4C7OA 5AR1A 2ZREA 4B3CA 1OH6A 2XITA 4FINA 4KSCA 1I2DA 1SVSA 2CLCX 1NP6A 2QEQA 2R62A 4URWR 2FX3A 5L3QA 3ICEA 3GJ5A 1SVMA 4HB2A 4M1OA 3G0HA 4AKHA 1GFIA 3PEUA 2GTPA 3NEYA 3GLHB 2HYIC 1AKEA 2HV8A 1CJMA 4JYBA 3AVUA 3BWDD 4GT1A 1J2JA 4KSBA 5KPJA 4Q4AA 2IS6A 4LV8B 1YR6A 1IY2A 3ZD7A 4QOSA 4B33A 1GNQA 4S35A 1W44A 3B7GA 5SZJA 2JLZA 5H70A 1D8TA 2ZPTX 4QBIA 3AVWA 4XH9B 3KUCA 3MAAC 3UMFA 3K9LA 1E94E 3FDIA 2JJ2D 2B7BA 3WMFA 1GG2A 2ZETA 1UBFA 1XTJA 4M53A 5ELXA 1W0JD 3AGQA 2CNWA 3ZGXA 1NLYA 3LRPA 4BE7B 4A2WA 5EUQB 4JVNA 3OF5A 4RVCA 4TMWA 4EUNA 5JWRA 3NHAA 4B3FX 1MO5A 4ZPXA 5FTNA 2WWWA 2GCOB 2DWOA 2XNDD 4Q4HB 3REGA 3RC8A 1ZCBA 2AWOA 2QP9X 5FBLB 5B64A 3OE7A 3QQ5A 4AK9A 2IEZA 2IEYA 4FCTA 3OEED 1E2FA 3AF0A 3R9WA 1CKEA 3A1UA 1JPNA 3AKEA 4MGYR 2HCBA 3EW9A 4EQ6B 1WRBA 1NKSA 3PUYA 3LLMA 4LK2A 3R20A 4AYXA 1K5DA 3RANA 3SEAA 4ZDWA 3A4LA 3E5HA 4LBYA 4UJ5A 4B32A 1SVOA 3TUZC 1X8LA 5CM8B 3LX5A 5EXPA 4TQUS 4L16A 1E2GA 4CEJA 2GKSA 3P4YA 2J3EA 3BK7A 1WDTA 5DGXA 1KJYA 1S9DA 4FN5A 3BH0A 3KDSE 3SYKA 3THXB 4NYMR 1YHNA 5J4VA 2AXPA 2EFHB 5E3HA 2UVQA 4PO8A 3TR0A 3ZVNA 3QEOA 3DL0A 2CL0X 1TEXA 5EE5B 3GLIE 3A1WA 3I8XA 4Q1AA 1S3GA 2NMVA 5L3VA 3FHOA 1OIVA 2BKEA 1SHZA 2W58A 1HV8A 2NZ8A 1U2RA 2IUTA 3OIVA 4Y0AA 2ZVPX 3H4MA 2IK8A 4NCHA 4B3DA 2G83A 1OFTA 1X3SA 4OJQA 2REOA 1M8PA 4L9WA 5JLJA 1E4YA 5DN6D 4US1R 3ZVMA 3AM1A 3ADCA 2C77A 1MV5A 3ASZA 3FMFA 2WZQA 2A30A 2GAAA 2CMKA 1KO1A 3W5JA 2V6IA 4B34A 4UNNA 1YZKA 2QQEA 3C14C 2NO7A 3TUIC 4CVNA 1RW4A 3W6OA 3I92A 4TL7A 2V8OA 4IDPA 1DG1G 3E1SA 1JR3A 1YR9A 2J0VA 221PA 2ZJ5A 4EIWA 1KI3A 1W49A 1J99A 2CCGA 3BH6A 4FCWA 4G1UC 1W4RA 4IRUB 5JBQA 4DB4A 4XTCS 5TDHA 1MABA 2JGNA 2OHFA 1N6RA 4GDFA 1YRBA 1XJCA 2FE4A 3OAAA 1N0WA 4TSFA 1RJ9A 5AJWA 2RGNA 1P2TA 3NBFA 1UM8A 3RNLA 1CR0A 2G0NA 1G19A 2FSFA 5HR5A 3BRWD 1Q3TA 2QROA 4HLCA 4LRWA 4IW3B 1PV4A 1W36B 2Q9BA 4B3XA 1NL3A 1FMLA 5FBWB 2BJVA 4URVR 2BBOA 5K8IA 3GQBA 1UADA 4BZQA 1LNZA 1LTQA 3KQUA 1RFLA 2Z5FA 3AUXA 2FGJA 2O5VA 3KKQA 4LV5B 2N42A 4JSYA 2YWFA 2GJ9A 3NEJA 1DELA 4AWXA 2RHDA 4PPNA 1HA3A 1MO4A 1Z2CA 3L8YA 2NOAA 3GEEA 4GPTA 5FPKA 1ZU5A 1CF4A 1G7SA 3J81k 3HU1A 1TAGA 2F9MA 1XBTA 2AHOA 5GJVC 4C0BA 3B1VA 1Q1BA 1XDBA 3ZZTA 4ZI2A 1QHHA 2J1LA 2PX0A 4NCKA 1JR6A 4LBVA 3LQRA 1LV7A 3TJZA 2ZI9A 1DS6A 2ZITA 5FOXA 3H2YA 4TLCA 2ZRLA 5FFMA 4Q03A 5P21A 2WKRA 3P26A 4ESVA 2IYTA 1HUQA 5AJZA 3SFZA 1Z6GA 3CNOA 4L15A 1TQ6A 4YMSA 4G5SA 2Q6TA 5KDOA 2VBCA 2OZEA 3B9QA 1XXHE 3MD0A 3QXXA 2WKQA 1N6LA 1G5RA 3FKSA 1ZNZA 2W0SA 2GBLA 1JECA 2QG6A 3KKOA 4X8OA 1W36C 2ZE8A 3QSYA 1OHHA 1ZC4A 4AD8A 1HQCA 2CVFA 1G8GA 4JLVA 4LJ8A 2ZJ8A 4OJKA 5K8TA 1ZM2A 3I5XA 2IYQA 2QI9C 2H18A 1X8KA 1L4YA 1M7GA 4HDCA 4MRPA 4JLKA 1XJ0A 1SGWA 4OQXA 4URZR 1YZQA 4JJKA 5IDVA 3SNHA 1NKTA 2ZROA 4HAYA 3VNVA 1OKKA 2PLFA 4I81A 1XMSA 4A4DA 3T12A 5EXTA 2RGNC 1KKLA 1KNXA 1ZBDA 2ZRDA 1SULA 4ZCLA 1ZVQA 3RAPR 1N0VC 5FR1A 5KO2A 1OH8A 521PA 4NDZA 1TQDA 3N2IA 1AK2A 5IRCD 1NVWQ 3B1WA 2Q3FA 2W2TA 5AUNB 2J0SA 4KVAA 4AYWA 3NC0C 4NU0A 2J7KA 4N1AA 4NYIR 2HLDA 4HDQB 3VU9A 5AK0A 1IN5A 4A2PA 1K5GA 5E4FA 3O8BA 4PFSA 1CR4A 4A92A 2P0EA 4DLUA 4LPKA 4PC6A 4GMXA 2PJRA 1VCMA 2R6CA 3CX8A 1XB2A 3PR1A 3EAQA 2O8BA 2BDTA 3S1AB 1G21E 5CDFE 5C1BA 4W9MC 2HJGA 4D4LA 2BBSA 1OYYA 4XWAA 4HZIA 3CF2A 4NHOA 1KO7A 5D3QA 1FTNA 2YHSA 4ASUD 4B48A 2GETA 4RZXA 3EZ2A 2O8FA 4IDNA 1E0SA 4P4UA 1PZNA 4DSUA 2FWRA 2ZS7A 4EPXA 2JATA 2FU5C 1N2CE 3EIEA 3M0EA 2QT1A 3MLEA 1PUJA 1GILA 2F1IA 2CHQA 2QPAA 2NO0A 4HZUA 2JLYA 4P33A 2IYWA 2BV3A 3QI2A 2VP5A 5DNYB 3KQHA 1E98A 1OXTA 1ZM3A 2A7QA 1U9IC 2BOVA 3L2OB 4PQRA 2GXAA 1NI3A 4TMZA 721PA 4TQAA 3BS4A 4MGKR 3O8CA 1QHSA 1Z8FA 3VR5A 1P7CA 2JIZA 3BB1A 4QHTA 2O8FB 4Q21A 4BEJA 2GBLC 4KLZA 4QJ5A 3EPKA 1UDXA 1KI2A 3L0OA 3RC3A 1HY3A 2BM0A 3WMGA 3TMKA 2LCFA 3GJ8A 1T0JB 3EZ9A 3HYRA 5EE1A 1HT1E 1X1RA 1JB1A 3KFXA 1DAFA 4ON9A 1AQYA 5JJIA 2KB0A 4KVGA 1GAJA 4IDQA 5FUXA 2AX4A 621PA 2D62A 4DSOA 3ZQ6A 4BFWA 8OHMA 5TXGA 2VEDA 5KSOA 4GNKA 2O8CA 4JLDA 1COWD 3QKRA 2XTMA 2UZIR 2WHXA 2ZYVX 1Z5ZA 2X2EA 1IONA 4ZDIA 3EXAA 3SN6A 1S1CA 3CUEF 4TZ0A 1MOZA 1BYUA 1FOEB 1DVRA 5J5CA 1RRFA 2ZR9A 2ZSBA 2G1JA 4Z54A 1P3JA 4LDJA 2FFHA 3BH7A 4CGZA 1SKQA 1TQ4A 2XJ4A 4DSTA 1HH4A 2GK7A 3T1QA 1DPFA 2WSSA 2ZANA 4AC9A 2P3SA 4D80A 1EGAA 2ZRIA 3QKRB 3HU3A 3D6TB 2CL6X 4G01B 1IN6A 2JJ1A 3Q8XB 1XCGB 2J87A 5FOUA 2W6JD 3ZH9B 3ZS8A 1G7RA 4DC9A 4NKRA 1JEEA 1GL6A 3KXKA 2KWIA 5FL3A 1IAQA 3SR0A 4GL2A 2V9PA 1NRJB 3MSXA 3HJNA 5EZ6B 3BJIC 3GMTA 3IILA 3QBVA 1A2KC 1ZYUA 2IA5A 3MG9A 4JJZA 2F7SA 1A1VA 3QF4B 3KUDA 3QXJA 2FOLA 3ZVLA 4Z1MA 3CX6A 3K1JA 2FH5B 3VKHA 1B0UA 1MH1A 3EZFA 1MO6A 4D2IA 2NIPA 3EARA 1E1QA 3ADBA 1TEVA 2ERXA 4G5OA 3B1ZA 5C18A 1IJEA 4II7A 4WBSA 1W4BA 4P4SA 1N5LA 2F1HA 4KFSA 2FPKA 5KDLA 2C9YA 4XVUA 1VECA 1Y3AA 5FL7A 3DEFA 4LUCA 1SKYB 5AUQA 3I62A 4B3BA 4A8JA 1FQJA 5FI0B 1W4AA 5HZHA 1KDOA 2OXRA 2D74A 1EESA 3PUXA 3IO5A 4OBEA 3SQXA 1OSNA 5J47A 2QRZA 4UQOA 4CW7A 4KODA 3MRSA 2ODEA 3DVLA 2YOFA 2XB4A 1E99A 2AKYA 2P2LA 3U5ZB 2HF9A 1CXZA 1RRGA 1FQKA 4RKEA 3GLGE 1E2KA 1SXJA 1EFRD 2C99A 2GNOA 2AK2A 4BLQA 1ZD8A 821PA 3K70B 4C0HA 4GMDA 2UKDA 1KO5A 5JSZB 1LS6A 1UBGA 1VHTA 3M6AA 1T6NA 4B44A 1HE1C 3CH4B 1PLLA 1M2OB 4R2IA 4TTQA 4A6XA 4Q18A 1SVWA 2HXSA 1NVVR 2IHBA 1E2PA 1G9XA 5CYOA 1NVUQ 1EFCA 2RGBA 1I2MA 4IDOA 5BYJA 1R0ZA 3U3MA 5DYGA 1II8A 1XJQA 2AWNA 2SHKA 4AURA 5EJEA 1G8YA 2Z0MA 2FDCA 1FNMA 1Z06A 4UXJA 2J7PA 2QTVB 2ZI7A 4F92B 3EPLA 1QZXA 3OHMA 2PH1A 2XX3A 3WXMA 4BGDA 1ZUHA 2P5SA 2DHRA 2FG5A 2DCUA 1AGRA 5IT5A 5L3SB 4WZBE 3LXRA 1UKVY 2GF9A 5B30A 1U0LA 2ORVA 1WE2A 1FX0B 3CR7A 5IK2A 2EU8A 2YOHA 2B92A 4HAWA 4TL8A 3LBNA 3PJRA 2Z43A 1U0HC 4TQ9A 5F9HA 4OK6A 1NF3A 1AM4D 5KOYA 5EP2A 3GD7A 2WIBA 3EIQA 1KDRA 4LJAA 5FUWA 3AKDA 1AA9A 4RD0A 4OQMA 2ZRNA 1Z83A 5CB6A 3FMIA 2VHQA 4FXPA 1HT2E 2QMEA 4YMTA 2QMUA 3F8TA 5TVKA 4BWYA 1XPRA 4Q7MB 4JLOA 1G3RA 3JZMA 1AS3A 3FE2A 4LYJA 5JZVA 2VSOA 4QGHA 3AH8A 4JBYA 1NSTA 4HAVA 3K70D 3BC1A 3LO5A 3FMOB 4E5UA 1D5CA 4V03A 2GA8A 3Q7QA 3UXMA 3U6KA 1DAMA 2F3TA 1DARA 4Q9JA 1NBME 2OCPA 1E1RD 2E1RA 4OQNA 1QVAA 3EA5A 4GP7A 4Q4JA 1SXJC 4V02A 3L43A 2J0QA 1KI4A 1NN1A 3PEVA 2YZ2A 3KQNA 3UMSA 4KV9A 3Q5DA 3DO6A 2QN6A 2ASEA 2D2FA 4LJ5A 4W5JA 1W2HA 2BBTA 3OZXA 4GBMA 4LJ4A 4UXIA 3MWYW 2CE7A 4NL4H 2OBLA 4EPVA 3KJGA 2JLQA 1S3SA 2RMKA 2TMKA 3WRYC 5HKKD 2QP3A 1YZNA 2ZUCA 4ERNA 1KO8A 2Q21A 3NDBB 2WTUA 2OAQ1 3LW8A 1FUKA 2XAUA 3X2SA 1XF9A 1T8UA 3QVUA 4BFXA 2DWPA 2ZJOA 2BIFA 4R98A 3CB4A 5JECA 4DLRA 2JAQA 4D4KA 3KQLA 1RYFA 3EIHA 4LX0A 1L2TA 2YKGA 2QA5A 3UWOA 4Q1FA 2PMDA 2R6DA 3DOEA 2XNDA 1T5LA 1IBRA 2XSZD 4GZLA 3NC1C 1P72A 4V0MA 4DCSA 5FPSA 5C4GB 4EAQA 1IY1A 3GLFA 4FWTA 5H8WA 4TLEA 2J41A 2WWIA 4F7WA 1R5NA 3OEEA 4LJ9A 5GJWC 3HYTA 3EWAA 2XGJA 2OLKA 4L8GA 1E9EA 1Q22A 1Z0AA 4AIIA 4AG5A 2ONJA 2G3YA 1PLJA 2CBZA 2QP4A 2WMOB 1E2JA 4LJ6A 1P4SA 4MDFA 3F0TA 3C16C 1F2TA 1JXMA 2PZEA 3UWKA 1X86B 2GCNA 4DT1B 5KNCA 1F5NA 1XU4A 2W0MA 4QNMA 4OHYA 4PC2A 1T91A 1NBMD 1G8HA 4R71A 5FH9A 5JCZA 4GOJA 3X1YA 3KL4A 4PXAA 3W34A 3WY9A 3GLFB 4G0NA 1TNDA 2VP6A 3WYAA 2IHYA 5HZKA 3AP3A 3GLHA 1W48A 4Q47A 5L3RA 3B85A 3Q7PA 4MRNA 5FBQB 2GF0A 3CBQA 5C2JB 4Q66C 4TL9A 5JWOA 2X19A 4IOKA 2P6NA 3AV0B 2V6JA 3RS0A 1D2EA 4BPBA 4LHWA 3X1WA 4QXAA 5JEDA 2NGRA 1YZGA 3AEZA 3U4QB 4B47A 2W2XA 5GADl 5CM9C 5FTLA 2VTKA 3KZ1E 3AB3A 2AL7A 4D0NA 3FKQA 2C04A 1YU9A 1E0KA 1Z0FA 1N25A 4MRSA 4DUGA 2B6HA 4IOMA 3BB4A 3KKMA 1E2DA 4V0NA 1M6NA 1CIPA 3Q5EA 3TNFA 1S2MA 2OBMA 3BERA 1KK1A 5J4HA 2VL7A 1KJWA 4QFMA 1E32A 2OAP1 3D3QA 5CLLA 1XWIA 2GCOA 2VHJA 2ZM5A 1G3UA 1N6KA 4DCNA 3B2EA 2X2FA 1P73A 3D7MA 4KXFB 4NCNA 2LKDA 4Q4HA 5LB4A 1FW6A 4RCZA 3A37A 2OCBA 3ND9A 4F91B 4DDWA 2CCKA 4ITRC 1CU1A 4WIAA 4XVQA 4A1FA 2QAJA 2GWHA 2FSIA 2UZ3A 2ZRAA 3IGFA 1U8ZA 4URUR 1MT0A 4LI0A 3MWJA 1JJVA 2CK3D 4JBWA 4BZXA 5B57C 4PO9A 4EQ6A 3DKVA 2I3BA 3CPJB 4TMXA 5SZHB 3U7GA 2DY1A 2WOJA 1MRSA 1Q44A 5F98A 3NBYC 1JI0A 4KAXA 1PLKA 4MQBA 4NYMQ 4RFSB 5J40A 1WQ1R 1QG2A 2X1VA 3R9XA 2R2AA 1C4OA 1UFQA 1NY5A 1YQTA 2WJGA 2RKOA 4LHZA 2OFWA 1ESNA 1N3BA 4F4JA 3EX7C 3THXA 1KKMA 3K0FB 3I32A 1X8JA 1KHTA 4M1YA 4UJ3A 4E09A 2I1QA 3CF0A 3D8BA 2D7DA 1E96A 1JEDA 2R6GA 2R44A 3JVVA 1US8B 2QSZA 1XEXA 4DLZA 4MKGA 4TYWA 4OI0A 4OL0A 4RD6A 2WBLC 3OIWA 2REXB 1P60A 1TU3A 3VKWA 1KK2A 1JALA 4C30A 2ZI6A 4A0FA 3NXSA 4NCIA 2VF7A 1KAGA 4DHEA 1Z2AA 1NNEA 5FTJA 5CB8A 1UEIA 4ILEA 4CEIB 4NZYA 3CNNA 5LB2A 2W6ID 3VHXA 4BFSA 3I4LA 5JEEA 2NO9A 1TADA 3CLVA 2EWVA 1OFUX 2FGKA 1VYVA 1XEWY 1A4RA 2DB3A 2G77B 1J8MF 1KYIA 1XEXB 2OO7A 2QZ4A 3FTQA 3GLIB 4DCTA 1UPTA 3GJ7A 1F60A 2F9LA 5A0FA 2C2HA 5G3ZA 1LF5A 1WCV1 1GTVA 3ETLA 4HEJA 3FHCB 2VP4A 1L7VC 1KJZA 1WB9A 3IDQA 5DISB 4DDTA 121PA 1P75A 3TUJC 3IBGA 3GJXC 3NDPA 3BIFA 4KBGA 2ZI5A 4OI4A 4B2LA 1EFHA 2D06A 2RAPA 3ONWA 4Q5IA 2QBYB 2OUKA 1IXZA 1J8YF 4R7ZA 4XSHA 1GITA 1QF9A 2EFEB 1MKYA 4OHXA 2YWGA 2OBNA 4B35A 2QE7D 3FPAA 5GVRA 4L5BA 4FMDF 5D3MB 3HWSA 4UNQA 5HPYB 2D7CA 4F93B 5JCPA 2RGEA 3KX2A 4MYUA 1N6IA 3SE0A 1GZSA 4DKXA 3I73A 2XXAB 1D2NA 2C96A 3FWYA 2PCJA 2VPPA 1FUUA 1VIAA 4R9UC 1BYIA 1GRNA 4XSGA 1GL7A 1XNJA 3F3YA 5JI2E 3IUYA 5BQ5A 4QBHA 3C8UA 1VHLA 5FI1B 4PSVA 1SVLA 3H84A 3O47A 3NH9A 4RD2A 4WXRA 4KFRA 1H8HA 3VKGA 1JXOA 1G6OA 1GM5A 3DM9B 2GEVA 3H0KA 1BOFA 5SZKB 3CIOA 3ZZUA 3U7FB 2GXUA 4M9ZA 2WVJA 3I5YA 1P2VA 3EWSA 4Q7KA 4DEXA 4A0GA 4ASUA 5CJPA 2GEUA 5FUVA 3FHTA 3TBKA 1XD8A 2X77A 3QKTA 4B76A 3UPUA 3Q3JB 4PZLA 4RJLA 1OPXA 4BFZA 4MDEA 5HE8A 1JR3E 1KI9A 2IWRA 2B8WA 2ATVA 2P6UA 4DCUA 5JS7A 3U7EB 3E2IA 1MR3F 3GEIA 3IPYA 5L8VA 1NN5A 3OFNA 5FTKA 2QT0A 4F38A 3CRRA 4P32A 2VYFA 1D9XA 1DE0A 2HEIA 1KI6B 4YXWA 2QM8A 4BLSA 4U00A 1OT3A 2VIIA 2G88A 4OI1A 2Z4SA 3QOFA 1U9IA 2W00A 5TMPA 3BFVA 4P0TA 1R7RA 3GCGA 3X1ZA 1QRAA 2RGDA 2ZYTX 3TLXA 5M04A 1Z47A 4PQFA 1J70A 2K5UA 2PL3A 4NYIQ 2GJAA 2N46A 1G3IA 1XXHB 1CP2A 4M4SA 5JHHB 4O2RA 1DOAA 2IYZA 1ZNWA 3K9HA 1Q1EA 2RGAA 1Z3IX 2QPOA 2HYDA 4BUJA 3PIRA 4JBXA 4EKDA 4UNPA 2A2ZA 5TY0A 2IYRA 5E7JA 1COWA 2MSCB 4BASA 1ZD1A 1KDTA 2PT5A 4IXMA 1ZM9A 2BMFA 3AP1A 4MITA 5IF9A 2EFCB 3C4JA 4L9SA 4DBLC 2NTYC 3P20A 2PMKA 4BFUA 1T9HA 2CCJA 1TMKA 3AGPA 5EQTA 1W7AA 2W2VA 4PR0A 4A6PA 3TSZA 1LS1A 1W2GA 1SQ5A 3A36A 3S1AA 3T5DA 4K46A 3T15A 1JAIA 2VQSA 1Z0KA 2DYKA 3DDCA 4HSEA 1XTQA 3ZZ0A 4LBZA 1VTKA 3JZAA 1I4DD 2IYYA 2ZJAA 1JPJA 1XFAA 4ACBA 4LC1A 2ONKA 3REFA 2ZJBA 4DWJA 4C4PA 2XEXA 1M7BA 4PAQA 2V1XA 3H1TA 1KMHB 1D6JA 2XNSA 2W6JA 5FOWA 1R8QA 2BJWA 4IOJA 4CIDA 4CDGA 1QHGA 4CEHB 4Q01A 3K9NA 1P2SA 3QKSB 4MRRA 5FPHA 4MYHA 4EPRA 1AS2A 1N5KA 1TF5A 3I3SR 1S0UA 1G18A 1Q12A 3KQKA 2R65A 1CR2A 1YZUA 4TSFD 3OAAD 4A82A 1HTWA 1U98A 4IEIA 3PG5A 5BXQC 3JVUA 4EFNA 3NHBA 2ZRKA 1G8PA 4NONA 3SS8A 2F55A 1NY6A 1OXSC 3GFPA 4M9XA 3U3RA 3MFYA 1TU4A 1UKEA 1JJ7A 3BFKA 2WIAA 2P5TB 4YMWA 3UANA 2IYVA 4C3ZA 2MMCA 4ZIRB 1T5IA 4BLPA 1ELOA 2REBA 4QKQA 1OE0A 2B21A 2BBWA 3IIMA 4DB2A 2QAGA 4DLWA 3RLFA 1FMJA 2JLSA 4G3XA 2ODWA 3W8RA 4HB3A 1FP7A 2F3RA 2WWHA 3A4MA 5FOVA 1KZ7B 1S1MA 2L0XA 1W47A 1W1WA 2J59A 4Q4LA 4O25A 2VO1A 1NVXQ 2YWEA 1NJGA 1P6XA 3IIJA 2V55B 3ZIAD 3ZD6A 4TYNA 5EP1A 2Q9CA 1CULC 1U99A 1WP9A 1XX6A 4HAXA 4TT3D 1QDEA 2V54A 5AUOB 1G3MA 1UAAA 5CK5A 1Q21A 2QAGB 2C8VA 2O8DA 5G41A 3THOA 1EFRA 4EJSB 1O87A 3M1IA 4C9BA 4NCJA 1G6HA 2RGXA 1OFHA 4FWIB 5AUPB 3THWB 1R5BA 3Q72A 3WYFA 1R4AA 3ZVRA 5JJLA 4RFVA 3FKSD 1AGPA 3SHWA 6Q21A 3CH5A 3PQCA 4LZZA 3A1SA 1ZU4A 3K8YA 3PUWA 2ZYWX 2ZJ2A 2A5DA 1E2NA 3P27A 3X1DA 3SU8A 1X6VA 2V7QA 4QBGB 3EC2A 1ZIOA 3QF4A 1IXRC 2X8AA 1KSGA 3W6PA 4EPTA 4DDVA 2O8DB 3A8TA 1SVIA 2BEKA 1QHYA 4LBWA 4QC2A 4Q7JB 3SYNA 4A9AA 5JJKA 1L8QA 3LW7A 3OEHD 4WZAE 1WBDA 3W8NA 2MMGA 3KB2A 2A9KA 1U81A 4E07A 1ZNYA 1OKKD 1ZW6A 4C0SA 1HYQA 3I72A 5EE0A 3RS3A 1RRCA 2ZRPA 4MYCA 1RC8A 3EASA 4Q00A 2PZFA 4D25A 3R7WB 2HCJB 2PT7A 4JS0A 2QM7A 3U44B 1XMIA 1XZQA 1BS1A 4DSNA 3LLUA 1TUEA 4XOIA 4DEYA 3TVDA 3N5CA 3LY5A 1RRPA 2ZS9A 2QAGC 2NO6A 4GZMA 3QPWA 2Z6VA 3PEYA 1KIMA 2QRNA 4TYPA 4TMVA 5KSPA 4EJSC 1CJTC 2BHRA 1ESMA 3QPUA 2ORWA 4D0GA 5EE3A 4EFLA 1LF0A 4Q9IA 4JVLA 3T5GA 3DMNA 3PFIA 3LAWA 2XZLA 3IEVA 2IX3A 1ZP6A 3IQXA 5C46F 2JLWA 1QHXA 1NVVQ 3WBJA 2WJHA 1VKJA 4IEEA 3RRMA 3L0SA 5KHOC 5JSZA 2F6RA 3DKPA 3QPVA 1HURA 2O52A 4I4LA 4S2EA 4OQLA 1Z0JA 3LQQA 1H8EA 4QJ4A 5CJ2A 1E9DA 4MGIR 3T1TA 2WAYA 4AI6A 1KMQA 4QG7A 2EYUA 1XEFA 1OJLA 2J5XA 1E1RA 4XJXA 5DHFA 4FMBB 4B6FA 1DBSA 1T3LA 3UG7A 1AKYA 4FW9A 3LX8A 3AF3A 1R2QA 3FVQA 4YLGA 2GRJA 3P32A 5G53C 2YJTD 1RIFA 5H1YA 3AVTA 3PV0A 3BB3A 3C15C 2ERYA 4Q1DA 3UATA 4MKIA 2IT1A 2CE2X 2F1RA 2C78A 2H8KA 3GLGB 5DH9A 4TTRA 2FNAA 3CO5A 2ZS8A 5CIWA 3LH5A 2YC2C 4DIEA 5L3SA 3KKNA 1Z63A 4C0AC 1OXXK 1FX0A 4X8LA 2ZVQX 1ZNXA 3OIYA 1OV4A 5IHPA 4IVQA 1CRQA 4MRVA 3CPHA 4IDHA 4HAUA 3NKVA 4NH0A 4KI0A 3VX3A 4BFVA 2ZI4A 2XTZA 1JQLB 2DPXA 4W5HA 4W5WA 5ANRB 5DLQC 1NN0A 2QENA 1W0KA 2WJIA 3CRW1 2ZYUX 4TLDA
chains in the Genus database with same CATH superfamily
1CX9B 3JCZA 2J45A 1JAYA 1PT5A 3K72B 1XLUA 4GXNA 5IEBA 4UTVA 5EE9A 1UQUA 3ZR4B 1RQGA 1AKQA 4TVKA 1PZMA 3HHEA 2VLBA 2XZPA 5J2TF 1YMQA 2F3UA 5JYCA 2H07A 4URXR 3S3TA 1T4GA 1HX7A 3KB1A 1R0XA 4N3NA 5DTRA 4DLBA 1VG0B 4WFKA 1Y6FA 3GCZA 4ZGBA 5IG2A 8MHTA 2I7DA 2C2XA 1XQVA 4KCGA 3RVLA 4KQCA 4OTZA 3HVUA 5KDDA 4Q48A 4P8RA 1T5BA 1YK0A 2F43A 3LUCA 3LM8A 1JDBB 1H4TA 2TMDA 3GRYA 3HGTA 3NHLA 4C4ZA 4G5QA 1NBMA 3K32A 4CM3A 5A5FA 1CLUA 1YZFA 2NZJA 2VYND 4FI3C 4MQ6A 4FU0A 2FTKE 3SVZA 3L5OA 4P5PA 3LNTA 3D31A 3E15A 2X5KO 1NF9A 1PS9A 4PTYA 1Q0UA 2HT1A 1OD6A 1GP2A 1H9BA 1RQLA 2XRFA 4Q1CA 5D1HA 3KTAB 1GGVA 3ZU2A 4C0WA 5LP6B 4IS3A 3DCJA 4ITUA 1FUIA 4L76A 1NUSA 2I4TA 2WJPA 5I7FA 1DO0A 3M6VA 5KJFA 5KJ6A 3WHKA 3K1ZA 4IHJA 2DFVA 1JIQA 3C3EA 3CNBA 3GEDA 2QRQA 4BDSA 4LXYA 2QQGA 4XD7A 1D09A 1OUMA 1SIOA 4EOGA 2EBHX 3L49A 4UQLA 4HFNA 1UWVA 4YHBA 1N5MA 3AHJA 2QZZA 2WTAA 1SKMA 3W3AA 3QKIA 1HC7A 1E1QD 2F43B 5KX5F 2POCA 1RE0A 3NOXA 5FHQA 1YI1A 3FZGA 4KV7A 1PR4A 3MS2A 3ZHBA 1H2BA 4OB6A 2I4IA 2Z3ZA 5G1NA 4O4HB 1LDBA 4CLRB 1SZPA 1UT6A 3VOBA 3QFTA 4TTPA 2BEVB 4C88A 2ZEJA 4LG1A 2X41A 1VJGA 1A0OA 2O2HA 3LDAA 4AQDA 2Q1TA 2ZR7A 1MH9A 1D3AA 1OY1A 3EW7A 3GNSA 4JVSB 5C8DA 1N2ZA 2EJCA 2J9RA 2I9KA 3RQIA 2GK6A 3MA0A 4ZO6A 1TGYA 2EG5A 3S0JA 2XOKD 1H1DA 3ICOA 2L2QA 4L72A 2EZUA 3MPOA 5EZYA 4YRDA 3ZWBA 4C3OB 3DTYA 3LLSA 3N86A 4K6HA 7YASA 3GJ3A 2GSWA 2HA3A 5LP1A 2VSFA 4OMUA 3T1OA 1OLUA 2X0KA 3DEJA 3MRTA 3FSEA 3QU4A 2QJOA 5DSZA 5E2AA 4RVOA 4E2ZA 5JATA 3O91A 3VYWA 1JHDA 5AVTA 4DIKA 4E4YA 5E7IA 5BW6B 3U16A 2UUPA 2BMVA 4TKVB 1Q16A 2VDJA 2AEJA 2OGWA 2V9ZA 4O08A 5I5GA 3TQRA 5CBPA 1NA5A 1K5PA 1BNCA 4HVTA 2OORC 1BQ3A 1O08A 2ZOSA 4XQ0A 2VJKA 5A4JA 1U3DA 2C3OA 4PYOA 2WJJA 4TUYA 4IH9A 5EZYB 2PWAA 4FDMA 5UKDA 4ZOLF 1ADYA 4ZVQA 1FS6A 4QM6A 2XMCA 5AQ1A 5KI6A 1MZPA 3BUSA 4XUGB 4CKWA 1PF7E 3N8GA 1Z18A 1WSAA 1NUQA 2A5JA 1Q3HA 1X1EA 2XCIA 4C0KA 5A9RA 1OLUB 4QE3A 1UPFA 1LDGA 1NG1A 3EUAA 3SQDA 1CNMA 3OIUA 2J7PD 3OIFA 5CVTA 1VHJA 5AK3A 4M0FA 1L4NA 2WJYA 1IEVA 3KE8A 3I39X 4J9UE 5LQAA 2WEKA 3K31A 3R6WA 4XB1A 5CBPB 5EPEA 4P34A 1JHXA 2GILA 2KBEA 4HLDA 3THYB 2OPBA 3FDZA 3DS8A 2DLNA 4P86A 1E3TA 3DTVB 4ITVA 1IZ9A 3ANYB 3ULKA 1UC4B 4IM7A 4C08A 2JDID 2CNNA 4U2KA 1MA3A 2C0CA 3HLYA 4BRSA 1R9JA 3GCDA 2GLUA 4OYRA 2IEGA 5K45A 2EL7A 1UBHS 1IK6A 2B1QA 1Z29A 1JQ5A 3CW8X 3H5LA 2PX4A 3IVMA 1YB4A 4HB4A 2FSVA 3C7AA 4O4JA 3OP1A 3K71B 1WETA 2JGDB 5IMBA 4QGGA 4NNOA 3K0CC 2TYSB 2B4RO 2AXQA 2CXRA 2H0QA 3JARB 4KE9A 3THSA 1BG6A 3BD6A 4MMYB 4QZVA 2ZQ5A 4M8LA 3OQJA 4V0ME 2YV4A 4B79A 4H16A 5LD2C 1EFVA 1Y63A 3FGOA 3WYGA 1HR0B 1ZJJA 2Y05A 1Z7WA 3NP9A 3W4JA 4AROA 1YZLA 3SX0A 1OLOA 4QRIA 3AEYA 3GIWA 1B3RA 1JJFA 4I36A 1QLJA 2YR0A 4GDMA 3IHLA 4D56A 1QE0A 1RAIA 2WHPA 2ZJZA 4IFTA 1P62B 1RT9A 4D9NA 4EB8A 1W46A 1KEPA 2BZ1A 3G8BA 3EGCA 3AKYA 3IHKA 3ITKA 2Y0EA 5CVEA 5B1YA 4HATA 4O4JB 5BWNA 3I30X 4D3DA 2JI8A 5AW7A 2QYSA 5M34A 3F7OA 1M2EA 3LPAA 5AJHA 3VTAA 4TSRA 3K0AB 4IDEA 4BO7A 4AYTA 2V3CC 1CEEA 3A6KA 1Y5MA 3JD2A 3ROKA 3UAZA 3ZV3A 4TS9A 3K0FA 3E8SA 5T4BA 1F9EA 3B5JA 1C80A 1TJPB 3IHWA 1KMNA 1OXBB 2I7XA 3A04A 2XRMA 3JWHA 4FMDB 2MTBA 5CEFA 4JJ6A 1QGAA 1Z75A 4HDRA 3GLHE 1J5PA 4BNIA 2ISCA 5ENDA 1U65A 2HRDA 4M22A 1NOIA 4W7IA 5EGNA 3T5PA 4ISCA 4Q9HA 4PPGA 2F1OA 1U1GA 3RUFA 4XDZA 4HYQA 1ZR2A 5BMVB 2DPGA 4YLEA 5TLSA 4TYMA 3S2FA 2G1UA 1YRAA 1CJVC 3TR6A 5IXSA 3BEOA 4IJQA 2Z08A 3J7AC 1YBAA 1FIUA 2GA9A 4C7MA 4ZO9A 4CEIA 2X8LA 2JFOA 5IN5A 1QVRA 4B80A 2HIMA 4BQEA 2PUCA 4D9JA 4LJYA 1EM6A 4NK4A 4QICA 4A8PA 1OB2A 4C7OB 2AQ8A 3GP8A 3H5AA 2HMWA 4EECA 4DRXB 2ZRFA 3N7AA 3AM5A 4FFVA 5L4LA 3S7ZA 3B1YA 1U9CA 5L3QB 4JP2A 2NM0A 3LVBA 2O57A 5EEGA 1STOA 3KQSA 2J08A 2W4MA 3CKLA 3K35A 3RI3A 1IQ0A 2QDXA 1TYZA 5H3LA 4CHTA 3GLIA 3ES9A 3TOCA 4F3KA 4TLDA 2H5IA 3L8DA 4UOZA 2EEZA 1HSOA 4A7PA 5B7PA 4RQBA 3E82A 5IAKA 1Y89A 4YYZA 4LQCA 13PKA 2FWBA 4IMPA 2WD9A 4UAJA 4CJXA 3J81A 1H2YA 3MWKA 3R0VA 4IFEA 2WIKA 4LXQA 1JG7A 1SUEA 4N65A 3IELA 4HJXA 3ROPA 3HKBA 5LDDC 4M1KA 1OFIA 2OFOA 2FSVC 5DLDA 1AUQA 2IC5A 2C7VA 5IKOA 1IC6A 5WRFA 4B74A 1AUPA 1OIWA 1H2ZA 2PYZA 4WK2B 2E5FA 3BVPA 1EQ2A 3O4IA 1HT0A 1XOIA 2E21A 2NTNA 5HKLA 5KKCA 4B3GA 3R7SA 2WTBA 3N6XA 1Z2PX 3V8QA 4K7JA 4QYIA 4Y1EA 1ODCA 2CHEA 3EGDA 3JSAA 4Y2VA 4YIKA 1Z0DA 5SICE 2UVDA 4II2A 3FAKA 5D3MA 4L51A 4AN1A 4WH0A 1Q0LA 4OY3A 2OGUA 1E6KA 2D4HA 3HR8A 4MDYA 4RTOA 4HFRA 1QGUA 2L19A 2YV2A 2I1WA 2CHVA 2V3VA 1J0DA 3KD3A 3L7YA 4ESHA 4IVPA 2XZOA 4JX8A 2HMYB 4PLTA 1ADFA 4YASA 3B8EA 3LGXA 4RIFA 3LG2A 5HE9A 3HYNA 5L9AA 3G7SA 2ZTHA 3M9XA 4AWAA 1EUDB 3BJMA 5E1MA 2FZ4A 3NONA 5E0OA 5JYBA 1ST2A 2IU6A 2YJZA 4BXOB 5DIFA 2I99A 1AS0A 2D2EA 3OSUA 1EDEA 5B4TA 1I36A 2DBZA 2YUIA 3EGDB 3WV5A 4RLQA 3AHHA 1GFZA 3AR8A 1WZIA 5EL0A 3GFVA 3CUTA 5HG0A 5TX7A 4JKYA 1T29A 1GQSA 2PMWB 4NWIA 3W7BA 3MD9A 4YC7A 4DNOA 1Q19A 2RHRA 4R3WA 2Y4NA 3EMDA 5AOVA 3AVYA 3IEKA 4DUGD 4KFCA 2E1PA 4IY1A 1AXEA 5LZ9A 3FB4A 3N0VA 1JKMA 3GB9A 1TM5E 1S8AA 3NBXX 1FFDA 1Y4ZA 4N7JA 5TV2A 1T3SA 3WYEA 3ZLJA 1ZWLA 5COBA 5B2ZA 1J07A 1XP8A 2VZLA 1A50B 2XD4A 3EGOA 3ZXYA 1DBPA 1I5EA 3ETDA 2IZOA 3LKDA 4F9EA 1E2MA 1BQ4A 1FU8A 1TC2A 4KJZA 5LM3A 1SVNA 4POAA 3BULA 3KJIA 3IUBA 2WY2D 1AHHA 3VSDA 3JALA 2ZBRA 3ICPA 3FIJA 3DMHA 3SIXA 5HCNA 1Q7TA 1ZH8A 4CUKA 5BNIA 3T1HB 2C5SA 3VUEA 2QTNA 2IYLD 5GM1A 1JAXA 1Z8HA 2R66A 3EQ8A 4N0MA 4LOAA 4NEHB 3VPHA 3IVGA 5LWQA 5G3YA 3U5TA 1XXHA 4F5DA 2FUG1 2G72A 2ZIUB 3CRMA 4KLNA 4C6HA 2VK1A 3DZBA 2OFPA 4G1MB 3RUCA 3Q85A 4DXAA 2WFMA 3FSJX 3IQWA 1HNZB 5JOQA 2EKZA 2GT1A 2XMRA 2BGMA 3U3ZA 2C9CA 2NPOA 2QTLA 1NMEA 2VBGA 3RS4A 2R6ZA 3HB1A 3KQTA 4KZKA 4EF4A 1M8JA 1SEVA 3TECE 2P67A 5CFRA 1PVOA 4V2UA 1I32A 2XUAA 5DDIP 4AICA 2VDWB 2AFHE 4YONB 3SGLA 5KTPA 2C82A 2FDRA 2HREA 3DGEC 4IXTA 2VZEA 5BWBA 2EIXA 5KU1A 5AO9A 4I1PA 1BEUB 2CD7A 3L6DA 5MFPA 1VPWA 4JBGA 3VMFA 5I6DA 2GFHA 2ZSDA 4IKEA 3PEEA 2MSEB 2OM2A 2OP1A 4PRYA 3D4LA 4TT3A 2E49A 5FJJA 4BB0A 2CDRA 2CFOA 3DZFA 2H16A 4O4LA 4U1RA 2FW6A 1A9TA 1J42A 2I6GA 1USUA 3MIIA 1GTG1 4JL8A 2P2YA 3LA6A 3AONB 2FSSA 2QRUA 2PX5A 2CZCA 2GH1A 3ILYA 4HDKA 1NRIA 2AKAB 2UV8A 2AN3A 2DWQA 3QXSA 2NW6A 4LMRA 2IPLA 5H81A 1MQSA 1B42A 3CTMA 5E9AA 1G0NA 1IUNA 1GCUA 3KJEA 3L18A 3RKSA 4N41A 4CEHA 3UKJA 3R7AA 3QKSA 4RHUA 3OZWA 3R0XA 1XQ6A 4ENUA 1ZGAA 3PGLA 2AYZA 3NBZC 3MTQA 1NYTA 3WSVA 2G07A 3NAMA 4NLLA 3PF9A 3NHJA 1JLLB 1BEEA 2QXYA 4IX9A 4RV4A 4WCVA 5IBRA 3ZU4A 4PZPA 2A78A 3PNQA 1S3IA 2IGTA 4DIDA 2PGJA 5CDFA 4BNXA 4HXFB 4U0JA 1YC5A 3SBDA 2PL1A 5JSKA 2GASA 1FPQA 2LTAA 1XEAA 3NQ41 3A6DA 2OV6A 1PNTA 3WFIA 5IH7A 4OP3A 2BELA 2AI3A 2WTMA 3H5VA 3HDQA 4O0MA 4BZPA 2JLRA 4CLEA 5CK4A 3FOEC 3OEHA 5FLKA 5AQEA 4N3GA 4DQLA 4HDKB 4RKWA 1RQRA 1Z5PA 2ZAMA 5F3WB 1RWMA 2E82A 3GAMA 4FFWA 1N2CA 4OQZA 1CZUA 1AQJA 5TQVA 4IG4A 1E5VA 4C5AA 2YNMA 3A6GA 4V0KA 1NQVA 4TMYA 4P7KA 3QPCA 4ZRNA 1EYZA 2VSXA 1ZOOA 4RD4A 1XYVA 4HK4A 3SDZA 5BSWA 3LL4A 1DAEA 4IWNA 3T3EA 1LDMA 4AW9A 3VOSA 2W4QA 5EI5A 3BWEA 1VI6A 3I9JA 3N7UA 4G5RA 1IXYA 4FHCA 1LLDA 1ZMTA 3E1GA 4I1VA 4IF4A 3AFHA 2WP0A 4EY8A 1AU9A 4JNKA 3EVCA 5F76A 3WWZA 1SCUA 2G8LA 1VIYA 1EINA 1SEPA 2V5VA 1XDUA 1J0AA 4U7JA 4D43A 2AMVA 4FFBA 5B1HA 2G82A 2A0UA 2J46A 1M34E 3BRCA 4PCVA 3KR9A 3TR5A 4M49A 5COAA 1OA0A 2G9RA 1VRCA 3HR4A 1VE5A 4IFBA 1NVFA 1T4CA 1V47A 2B8NA 2A33A 3UMJA 3TOZA 1GKYA 4RZ3A 2WKWA 5ILOA 2JASA 4RMIA 4PSKA 1L7QA 1SUCA 3THWA 2ZWIA 1RC1A 2FFQA 3PWZA 4YQFA 1QF7A 1OA1A 1L5HA 1L4BA 3KEGA 2GGSA 3EMKA 5AOCA 4RDCA 3CLTD 5AM2A 1XMQB 1SKAA 1EGHA 3F96A 4LSGA 1J25A 3GR6A 5DU2A 5YASA 3OM9A 1VCIA 4QRHA 5CA1A 4RTNA 1ZBQA 1WXQA 1BGWA 2B4KA 1WG8A 4TQGA 3OH8A 1I80A 3MRXA 2HMAA 4FFBB 4PQGA 5K0SA 4I46A 5K0TA 2HXYA 4JI5B 3UIEA 4US2R 2F00A 4FK8A 1TYAE 3GRPA 1VC2A 1IMJA 2BMAA 2FPMA 3PEFA 1J33A 2L42A 3TLGB 2RGCA 3Q5GA 3WMWA 1SCBA 2IE0A 1QCCA 1KC1A 1E4EA 2CXXA 2NO1A 3KYDB 1A82A 4I4TA 4RKFA 5F2OA 5CEEA 5IJ0B 1NWHA 5J23A 1A77A 4YACA 5IXJA 4U5QA 3OEWA 3NPAA 4ZD6A 1H69A 2YFHA 3KSAC 4JCOA 3CMCO 3NTQA 1GAWA 1B23P 2CYCA 4FGSA 3RYFA 3PXCX 3DM5A 4DPLA 1EXVA 1SHKA 4K05A 2G9ZA 1SBYA 1NXXA 2QMHA 2FMTA 4YMUA 5L4NA 1JH8A 2QQ0A 2XT0A 5KCMA 1IWPB 2A0XA 1C7FA 1OJ7A 3VX4A 3DFMA 1L5KA 2DUWA 1QRDA 2VSNA 4XLZA 2CDBA 3H04A 5DRYA 5TMDA 4DJEC 4KTTE 1IXSB 4CUZA 3UMRA 1G3QA 1NVTA 1L5LA 4YRSA 1FP6A 4EY3A 4II3A 2C1EA 2X0JA 1J7KA 2CZQA 1OXMA 2GJSA 3NDRA 2OWDA 3FLBA 4G36A 3DQZA 3KKPA 1TVKA 3OLXA 1I4LD 4HEHA 1RRKA 4G5XA 3DLAA 5F1OA 4B81A 5FLXA 4OYHA 2OK8A 1UBJS 3RYFB 1AGYA 3N70A 3EY9A 5DYYA 4EQZA 3I61A 1XK7A 1Z0SA 4YI3A 1ZOLA 3WZMA 4F3YA 2PA3A 4PX3A 2X14A 4BRUA 1SH7A 5J2TB 4Z6KA 1EBFA 3DHWC 5EIWA 1JHAA 3DDUA 1BO6A 3PRYA 3GAZA 3MINB 4NEGA 4AECA 1O0BA 1BMFA 3SZRA 2ZTSA 5A62A 1V3QE 3NWJA 4HDNA 4C89A 4B3SB 4C1NA 2QN3A 3DXYA 4OJYA 3TLKA 1C1DB 3L6EA 3H8JA 3ZCPA 5BN3A 2D0IA 3ZUPA 1ESDA 2O2SA 2IS4A 4EKYA 5M5BA 3JQEA 1E2IA 2VHTA 1H65A 3F90A 3RVMA 4QUDA 4CODB 1OR8A 1SHLA 3IYLW 4M55A 4XIGS 4R9NA 4P3KA 5FTMA 1GGNA 3WP1B 3BBPA 2HO4A 1E5TA 1KY3A 3F6SA 2JCSA 2OCLA 1I4TD 2C4WA 4FGLA 5F51A 2HNAA 4AKEA 4YRCA 4BJ5A 4Z0NA 1Q0TA 4MSUA 3VJLA 4G0XA 3FHJA 1QQTA 4IGFA 2EFJA 2FMIA 1R5OA 2OOKA 4CIVA 1G63A 2YCBA 4NV3A 4HDNB 1FTGA 3UG6A 4EGSA 1R18A 1NC1A 2Y67A 1GOTA 1WQ4A 3C5HA 5BN3B 4JFAA 4C0LA 4NULA 4M21A 4WOBA 5D86A 1F48A 1MTOA 3E9RA 5IWCA 3O8OA 4DANA 1O9GA 3A2NA 2NSLA 3INGA 5KX5B 3TE7A 4K2AA 3AESB 4JMPA 1L7DA 1QCDA 2OO5A 3GOHA 4D46A 5EQDA 2GAOA 1FYDA 3IKTA 3DEZA 2JC3A 3U4HA 2Q4EA 1DADA 4KXWA 3PWTA 1JBKA 3HKDA 1KGDA 5FV7A 4N82A 3LU1A 1XTRA 2ET6A 4IIEA 3RC2A 3SC3A 3T3OA 4JGGA 3OPYI 3ZCXA 1JRLA 4F0JA 1JVSA 2NNLD 3O75A 1N2SA 3C48A 3CX4A 3VTKA 5TGZA 3WK9A 3U3OA 3GFTA 2G5TA 1W88A 1T3TA 4WZBA 1Y8AA 2A9OA 3ZC3A 3QXHA 2ACVA 1KA9H 4PHCA 4XB6B 4CMAA 3K09A 5CDHA 3VBEA 1EFPA 1II0A 3SQOA 4C0QC 4Z49A 2W11A 4ZOLA 1CJKC 5A3JA 2QD3A 1YJCA 1PV1A 1VZ2A 3O8LA 4MH0R 3H9UA 2HIAA 1BD4A 4OOEA 1K6JA 3SJBA 1VSBA 3ER9A 2H5EA 4GUDA 2XDQB 1Q1AA 1QK5A 4D79A 4ZZ1A 2OY0A 2WM3A 2KMLA 4LY6A 3I9KA 4E33A 1SA0B 4L3WA 3IDZA 4KVZA 1Q6ZA 1SOMA 4ALIA 3BEDA 3L8ZA 3UT5B 1UOOA 5FO1A 3LBHA 3A31A 2PRSA 2C2OA 2ZUDA 3D3KA 3VO9A 3QEBZ 3V1TC 3EN0A 1PRYA 1HG0A 4X7BA 2Q99A 3AMVA 3DKIA 1WLYA 4NJEA 1X0XA 3P9NA 1WXDA 3WGOA 5DBHX 4L8VA 2P78A 1G42A 2QVYX 4P38A 1LPSA 4HFJA 4KXMA 2N75A 4BNYA 1H9AA 1IM8A 1W5AA 3MMNA 1E0DA 2Y6UA 5FJIA 3DOOA 4CG0A 1XD2A 4ZOLB 1C1HA 3VR2A 2WUWE 2EERA 2GXQA 5HIIA 1KYXA 1H4SA 2CMDA 4R6XA 4JVMA 2A3NA 4ZEVA 1U8UA 1TCAA 2CSXA 4FBLA 2GJKA 1HLDA 4BGVA 2FEPA 4WY8A 3VSCA 3I9FA 1EUZA 3IDSA 4XD2A 1WXFA 4CDRA 5AKKA 1J0CA 2WVGA 4NIMA 3T5CA 5A5VA 5KX5A 4E1VA 2H57A 3IODA 1OTHA 3P9KA 1P9WA 2AH5A 3G8DA 4KKXB 3PENA 1YA4A 4DV4B 5K6AA 2QE6A 2WM9B 4NJEB 4L5CA 5EPOA 4H6WA 5H5JA 1GXSA 2R7KA 3C6ZA 4BLUA 2GVDC 3P9ZA 4GICA 4EUSA 2FPGB 3I6IA 2H3HA 3PQFA 3OCYA 4I2NA 5JQGF 1WD7A 5IJZA 1XD2B 1WPQA 3OCZA 3DDNA 1EX9A 3PKJA 1E9AA 3AEQA 1X80B 1GPLA 5D6NA 2QN7A 5DI9A 3ZYZA 3CWZA 5SZIA 2WQZA 3IIKA 3QP9A 4BCCA 2QT9A 2L69A 1HQYE 7REQA 1D4ZA 1E79A 1FDSA 3DQPA 4BFLA 3Q1KA 3ZDDA 3EVGA 1F2UA 1DJMA 1K75A 2JANA 2X8WA 1R0WA 3FNRA 2PKRA 1T3HA 3HWRA 2OWEA 4PE5B 3T5TA 5C5IA 5KBYA 2VATA 1FX1A 3OT1A 3QVVA 2WFZA 4A9AA 4EYGA 1NE7A 2ZE6A 4NR0A 4E22A 1ZUIA 2PCLA 4R8LA 1G4HA 4CLOB 4GI7A 5B55A 1SAYA 4KBFA 3FOAA 1S2GA 1ZDMA 4INOA 4X45A 4XR9A 3MJHA 5MGNA 4GP6A 4AJ2A 4GMGA 3BMOA 3OBIA 5CCBA 1EVIA 3A1CA 3NORA 4TVOA 3Q8MA 2AK3A 1IUOA 5JWHA 4WJLA 3UK2A 1IBLB 3LXXA 3NNSA 4R05A 4DYHA 4W5TA 2M6RA 2H3EA 4ZYUA 1NJFA 4XVHA 1AQ6A 1ZK2A 1RI2A 1RJFA 3C8MA 3KU1A 3LUKA 4G89A 1S02A 2ECFA 4LWZA 4HTFB 5DEIA 4YAEA 3EVFA 3B6ZA 3THRA 5BNWA 4RCYA 1DAGA 2E9SA 3GRCA 2BJHA 1SXQA 2Q6KA 3HPQA 3OCXA 2B8TA 3FI0A 5EHZA 3FOZA 3RSLA 3HJTA 2XMGA 3DV9A 3BXHA 1RZRD 4N5HX 4N8DA 5TMBA 4FN4A 4LF8B 4Q3NA 1ZH6A 3COWA 3HCCA 1E9CA 4L22A 4QJBA 3SSNA 4DC0A 2ZKLA 2EZTA 1UMCB 3OIDA 3SFVA 3TRKA 3QE0A 5HM8A 1GA4A 5BUQA 4F72A 3L7CA 4W5QA 2NXNA 4P3OA 1JQKA 3HLKA 4CF7A 1T2VA 2ZDQA 1Z5GA 1RPZA 3IJEB 4YDRA 1DWUA 3SOPA 4CT4B 2UXCB 2C0QA 5B2FA 5B1SA 1WXGA 3D9QX 3WHPA 4OHRA 4CQLB 1UKCA 3CC8A 2I8AA 4OHZA 2O3RA 2A35A 2DBYA 4OB7A 4MGHA 3DE1X 3LVRE 5GMOA 1P9NA 4AJ9A 5JC1A 5JADA 3L6RA 3AVPA 1E3DA 1MC5A 4TN1A 3E3MA 5KHAA 5K6AC 2DFTA 2J0UA 2LIPA 2VF8A 2W22A 4IVNA 1XPUA 1EX7A 3LMKA 3MVEA 3LKZA 1GFSA 3MJEA 5IT4A 3W77A 4QXMA 3E18A 4PLPA 1Q77A 2ATXA 4WASA 2QVCA 4LS3A 2ZIAA 4PC3A 5JAQA 3AZPA 2XTNA 2CB0A 4P3NA 1JFLA 1QUEA 4DHWA 3GRAA 3K1AB 4EF6A 1NYRA 2ZZKA 2JK0A 4L07A 4RBNA 1ZVVA 4FMCF 4WTOA 5IAOA 1IHUA 4M37A 1GZ7A 5AK4A 2Q5EA 4ARVA 1X3LA 5EP3A 3IAAA 3KWJA 2X4GA 3OQIA 1AOXA 4HH4A 4XX1A 1GYRA 2DULA 3W6NA 1S3FA 3EXEB 2XJ9A 2JL1A 1OBOA 3EGIA 4L4SA 4U4AA 1A4UA 4I1UA 3KOZA 4MRMA 4JI6B 3UQZA 3DPUA 1RWWA 4JBIA 1WR8A 3N8HA 4KO8A 3U13A 4WVLA 4RH1A 3KP1A 3WE7A 2V0CA 4BRWA 4QBFA 1XZGA 3E0QA 4Q02A 4ZU6X 1DAHA 1KP2A 3HADA 3ZJ4A 5CT4A 4DR2B 2CVZA 2Q4BA 3V33A 3DOFA 3R41A 1K92A 4WZ6A 1W76A 2WAXA 4LZNA 4WA7A 3IP3A 3FWHA 1TTTA 3OTQA 2P4HX 2MINB 1Z6XA 1QUFA 2ZWVA 4PHFA 2PBZA 5CH5A 1SC3A 4YAIA 3CWQA 4JHLA 3RT7A 1HQKA 1P33A 1OH6A 1DCMA 1GNSA 1WCXA 1SVSA 2H48A 1WULS 2QEQA 1L4FA 2R62A 2VAWA 3CINA 3GJ5A 2FWMX 1PSWA 3I04A 4M1OA 4XEHA 1GFIA 2BEUA 3QIVA 1W30A 2YX1A 3R3HA 4FHFA 4HQ6A 3WLIA 1I01A 2Z09A 2HYIC 1CUSA 1A69A 3EEQA 4P58A 2C2BA 1CJMA 4JYBA 3AVUA 2QZPA 3V32A 4HDMB 2IS6A 1I6WA 4Q4AA 3SM3A 1YR6A 3TOVA 2ORYA 3D7LA 3T3DA 1YA6A 2Q6LA 4QOSA 4B33A 3P0IA 4YT4A 3ESBA 2GOYA 2UYYA 4KWHA 2PJUA 3B7GA 2Q4DA 1WQ3A 3RUDA 5IYZF 3FNFA 2ZB4A 5H70A 2B9EA 3UAWA 2CJFA 4G5FA 3AVWA 1XVVA 5IX8A 4XH9B 1A8SA 3KUCA 1LRLA 5CAEB 2V6FA 1MNAA 3O21A 1L4KA 4CMGA 4EVSA 2FFJA 1L5FA 3FR8A 4BMYA 3OX1A 4GS5A 1FYWA 1C4KA 1GY8A 2ZETA 3NBKA 4EJ2A 3RAFC 3C45A 5KOJB 2J31A 1J56A 3LRPA 5CT8A 4EMSA 3PUHA 4JVNA 5EUQB 2YHUA 4EATA 4WBNB 4TMWA 4KO2S 1RYDA 3GVPA 3NHAA 1AA6A 4ZPXA 5FTNA 1SG0A 3NB0A 1GCAA 1RLMA 1T1SA 3QNMA 4CBVA 2DWOA 4PYJA 4FYWA 3REGA 1ONNA 3RSZA 2DGDA 3SBXA 4MA5A 3Q41A 3H18A 4JI4B 3E7XA 2AWOA 5JXHA 3I04M 3L0CA 4PGAA 4AK9A 2R5FA 2TMGA 2IEYA 4FCTA 4J0KA 2QUAA 3FR7A 5EHNA 3IUJA 3JQ9A 3LS2A 4W1QA 3BMQA 4HMQA 4Q16A 1E2FA 3AF0A 5CXSA 1VLQA 4EA7A 3A1UA 2DZDA 2X6QA 1QVZA 4EQ6B 2QN9A 3TLBA 1I0ZA 1NKSA 2MJLA 4KDEA 3QLVC 1UP4A 1O6ZA 2WSBA 3WJ7A 5EWLB 4GOMD 2YDYA 2Y1FA 4PZEA 4QOFA 1NYQA 3RANA 3SEAA 3SEFA 4RTMA 1YR3A 4UJ5A 3UGQA 5KNCD 1AV7A 4N54A 1X8LA 4TZTA 5CM8B 3RYIB 3L41A 3LX5A 3MK31 4JOCA 4Z4GA 4L16A 4WECA 1JHZA 2KLBA 2VUSA 2XYHA 3PXXA 3A2KA 4BO5A 4HNQA 1DC8A 1S9DA 3F6RA 2FR8A 4FN5A 4IIDA 1Y7HA 3OLQA 3CSSA 1RADA 2ZJ6A 5CH8A 5J4VA 1GQOA 3SIPA 3STWA 4F3TA 3C8ZA 4XM1A 1TEXA 1GAEO 5ES3A 2G4VA 3RGWS 3KLOA 1OT5A 1EIWA 2KX7A 1VJ1A 1DBVO 2RFLA 2WABA 1EXWA 1JFVA 4PR3A 4A23A 4DVJA 2AUMA 1HV8A 1EP3B 2AFIB 2VOJA 2Q45A 2IUTA 3HVRA 5CX1B 2FEKA 1HDCA 3OIVA 4LZOA 4Y0AA 4B3MB 1GU7A 5CVUA 4OG2A 3ROZA 2O7NA 4ZJUA 2ZUUA 4OAPA 4J3FA 3SFTA 1A7KA 2FPUA 3PGMA 4MVJE 3Q3VA 5FLEX 3SEZA 3JQ7A 2GAFA 3ET4A 3RIMA 5KTOA 3ZVMA 1GTSA 3ASZA 5ALVA 3FMFA 2EZ8A 1AHIA 4HLNA 3WFJA 1OZFA 2PXHA 3NHZA 2VJLA 1N5OX 3A4TA 4CVNA 1L5GB 3ZI7A 3TUIC 2GBCA 3I92A 3TDMA 5HBGA 4OXKA 3L5KA 2A6PA 1DG1G 1JR3A 2FETA 2CXPA 2J0VA 2ZJ5A 221PA 4G1FA 4ID3A 4MB0A 5K51A 5HK8A 2P90A 4G1UC 1AH2A 1SKUA 2XXJA 4UASA 2KM1A 1KOGA 4G4GA 5IFLA 2JGNA 5IMSA 1OFGA 2BEWB 1M2VB 4HF7A 3ZNQA 1XJCA 4KZPA 4AJKA 2AR0A 2Q5CA 2PLAA 3HMKA 4R9VA 2EEPA 3V5NA 4C03A 4W9NA 3AJDA 1KJIA 2XBUA 4GWGA 2YFKA 1W36B 1I2ZA 1XZMA 3DF9A 4HGOA 4QVGA 5JXWA 1V4BA 3GP3A 2ZQZA 3HWWA 2BJVA 5IT0A 1IDOA 2UYHA 2R1VA 5KOHB 1LTQA 4GO1A 1RFLA 2IIBA 2GHTA 2FGJA 2O5VA 3JQ9C 3K0HA 3PQDA 4LV5B 2N42A 3P2YA 3V8PA 5IABA 1TYEB 2YWFA 3GWGA 3EG9A 1PT6A 2NU9A 2CXSA 2B98A 3E9YA 5BV1A 4MS4A 4RZIA 5EXDA 3H42B 5ALXA 3H3FA 1JLRA 4K1LA 4CCYA 4DA9A 1YL5A 2DT5A 3L8YA 2CDAA 3OT5A 1W1IA 1ZU5A 3LYLA 1FLVA 4JDPA 4WESB 4ZO8A 4OFWA 1HFWA 3IKLA 1CF4A 3HU1A 3WK5A 1S89A 3UOAB 6REQB 3Q11A 3RYHA 4CM4A 3RFFA 5GJVC 1U2QA 4C0BA 4EG3A 1L1RA 1TA9A 3PGJA 3F49S 1Q1BA 2C7BA 3JPWA 3OQHA 1QHHA 4JT8A 3VC1A 2X1LA 2YYAA 1ZUD1 2FR8C 2R1VB 3CLHA 4F84A 1BSVA 4LBVA 4M88A 4J03A 2PH5A 4Q15A 3T5DA 2GHRA 2VAPA 1LV7A 2P68A 2JFHA 3F9IA 4G4SO 1YQUA 5MFZA 4RDIA 5FFMA 4R2KA 1MAHA 3AI7A 4R5MA 3PLNA 5T6BA 1WX1A 1JR2A 3SS9X 5D01A 2WKRA 2BFDB 3TOSA 3FMVA 1KYVA 2R97A 2J9GA 3L1IA 4OEHA 2DQSA 2Y2VA 3R9KA 3IUPA 1JYSA 4L15A 4DMHA 4YMSA 1CUIA 4HXEB 4BX2A 1G5FA 1CVIA 2QTTA 3HDHA 3PXEA 2VBCA 1XPJA 2OZEA 2PQMA 3CZRA 2HMVA 3MD0A 3QXXA 2D8MA 3FRHA 1CUDA 4WX2B 3RR2A 5EJ2A 4AFNA 4DBZA 2YWBA 1ZNZA 5JSUA 2ZWOA 4EKNB 1CPYA 4OMDA 3TF5A 3KPJA 2QG6A 4AMBA 3WL3A 4AS1A 1W36C 8LDHA 1X7XB 1WUYA 1U04A 1Y9EA 3QSYA 2Z3WA 3HP4A 3KZVA 4KYTA 5E8JA 3E9CA 2GPAA 2BGNA 4OJKA 2FPXA 3ORQA 3PC4A 4R0MA 5C5EA 1MG0A 1D4OA 5DCYA 1UXOA 1M7GA 4HNAB 4MRPA 4JLKA 1XJ0A 1PR6A 3LWBA 2J07A 2JGEA 4B6GA 4JGBA 4JJKA 4QSMA 3WR5A 1MGOA 3ECAA 3D0KA 1SCDA 4TTJA 1Z17A 3BD8A 3EDCA 1L4HA 3KLMX 4ZRDA 3T3IA 4PQEA 3HRHA 1ZI6A 2PUHA 3D2BA 3MGBA 3PDHA 2PWPA 3MBKA 1FP2A 4NOJA 3AHFA 2SCUB 4IRMA 5I3ZA 2ZRDA 4ZCLA 3VR0A 4W9NC 1N0VC 2HKIA 1C0PA 4LYDA 5CTJA 1CUWA 3IUSA 3NCHA 5FR1A 4B4KA 2O50A 1UPBA 1ZS9A 2Y6VA 3DGFC 1DX4A 3DNMA 2XZDA 2WILA 3N2IA 2XE4A 4KO4S 3HKEA 4M1QA 5KNCH 3DBLB 2Q3FA 1MG5A 3BREA 1XFDA 3RKUA 2J0SA 4AYWA 2J7KA 4N1AA 3G9UA 3NO4A 1A9YA 1MVLA 4FZRA 4HDQB 1R4NB 5IKPA 2DHDA 3IR7A 3QU9A 2O1SA 3T0IA 4A2PA 4BBPA 2W70A 4DIOA 5EKUA 1ULSA 3EY4A 4HH1A 5CLGA 4COKA 4DV3B 4FDTA 4LPKA 4PC6A 1VCMA 3KWFA 4EEZA 4C4RA 3CX8A 5AM3A 4R3UC 1F8GA 3JAMA 2BDTA 4DMLA 1I14A 1ONOA 1E66A 3N2KA 2BP7A 3R2JA 5EXEA 1QMGA 1VLHA 2BBSA 4XWAA 1P39A 2V6GA 2XWSA 3GNTA 4R41A 3KJFA 2YHSA 2WG1A 4ARCA 4B48A 3P2EA 4RZXA 3HKEB 2XXBA 1E0SA 3V6LA 2HHAA 4DSUA 5FT9A 2DBQA 1OLXA 2PTGA 1H05A 4EPXA 5KNLA 3NV7A 3UMMA 2QVXX 3IQZA 1EFLA 1ZUWA 3HABA 2QPAA 4JUBA 2NO0A 1XN1A 2I65A 3OMXA 4OLFA 4WFJA 2ZYDA 1R8YA 1TECE 1R0CA 2GARA 4OLBA 2TS1A 2IHJA 1JZSA 3KQHA 1E98A 2PKEA 3KCNA 1Z13A 1MOQA 3I83A 5HILA 1U9IC 1WY7A 2BOVA 3W79A 3AZOA 4BLVA 3OOJA 1UKBA 3KT6A 1BU5A 5T8KA 1E6WA 2ES4A 4FONA 3EK2A 3V1LA 1Z8FA 4WZAA 1W96A 2RGRA 2JIZA 1WH