1GSIA

Crystal structure of mycobacterium tuberculosis thymidylate kinase complexed with thymidine monophosphate (tmp)
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
208
structure length
208
Chain Sequence
b'MLIAIEGVDGAGKRTLVEKLSGAFRAAGRSVATLAFPRYGQSVAADIAAEALHGEHGDLASSVYAMATLFALDRAGAVHTIQGLCRGYDVVILDRYVASNAAYSAARLHENAAGKAAAWVQRIEFARLGLPKPDWQVLLAVSAELAGERSRGRAQRDPGRARDNYERDAELQQRTGAVYAELAAQGWGGRWLVVGADVDPGRLAATLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THYMIDYLATE KINASE
publication title Cryophotolysis of Caged Compounds: A Technique for Trapping Intermediate States in Protein Crystals
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 81
structure length 208
sequence length 208
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2002-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1gsiA00
1N5JA 4TT3D 2CMKA 1XD9A 3KFXA 3GJ8A 4DDWA 5B58C 2QPOA 1Z08A 2H5EA 1SKYE 2CE7A 3RS0A 1PLKA 5D3QA 4IRUB 5CJ2A 5KPJA 3QEJA 1CULC 1N6HA 4X8MA 1E2KA 3TSZA 1RRGA 2WWYA 5EP2A 8OHMA 4LZZA 3RS4A 1OH5A 2G0TA 1Q1EA 3AGQA 2Z0MA 1GZSA 5EZ6B 1K5DA 3GMTA 2LWIA 2A30A 4FCVA 1E9EA 4JJKA 5EJEA 1XRJA 3DDCA 4KJZA 3LAWA 3B1WA 421PA 1GAJA 2HCBA 3W5IA 1U0JA 4AY2A 1COWD 1Q20A 1BYUA 1W0JD 1JEDA 3I73A 2VL7A 3LNCA 3I5XA 1W2GA 5EQTA 3BFXA 3U6KA 2X2FA 2PH1A 3IBGA 3IHWA 3PENA 2J7PA 1QHYA 3NH9A 4IDQA 1G9XA 4MKFA 4B33A 3G0HA 2P3SA 3B6EA 1UEIA 4MA4A 4OQNA 4FI3C 4HAZA 1KO5A 1FQKA 3AF1A 3ECCA 5F9FA 3KX2A 4M4SA 3OE7D 4MUBA 3ONWA 3RS2A 1UPTA 1Z0JA 4OHZA 1Y63A 2R6FA 2QBYA 4DSTA 3KJGA 4OHWA 2B21A 2W2VA 3AVQA 4DCSA 1FFHA 2GVDC 1Z0DA 2ZVPX 4BFUA 4EDHA 1E96A 3QQ5A 4E22A 4NCJA 1W5TA 1KO1A 1E0SA 1F60A 2H92A 3NC0C 2IA5A 4LBYA 1R4AA 2F1RA 1D9XA 1CP2A 3C5CA 2SHKA 3NTUA 4UNQA 1R8QA 5JI2E 3K0CC 3GLHA 2R65A 4DSOA 2CL6X 1EFUA 2EFGA 1XTIA 3P20A 4OHVA 4Q9LA 3T1QA 1SKQA 3TBKA 1YZUA 2FH5B 4M1MA 1HQCA 1V5WA 2OBNA 4WZAE 2Z4RA 3VR5A 4R9UC 3ZIAA 1DEKA 1FW6A 4R2HA 1JR3E 4IHQA 2XZLA 2C9CA 4LV8B 1G8YA 3LV8A 5J4YA 1ZMXA 4XD7D 5KNCA 1DG3A 3PUWA 2XXAA 1VG9B 1BMFA 2VHTA 1E32A 2VF7A 4DC9A 4PPGA 1JBKA 3EIQA 1G6HA 2JEOA 4B3DA 2VP2A 3U7HB 1JPJA 1XPRA 3BB4A 2CVHA 4DUGA 2RCNA 1II9A 4DB2A 1RIFA 5FTMA 4JBYA 5K8IA 2ATVA 5EXPA 1VIAA 3SN6A 5FPHA 4ERNA 3ZD6A 4QHTA 3UMFA 3R9XA 1SHKA 2XTMA 4DHEA 2ONJA 1HY3A 4QL3A 5EXTA 1VPLA 5L3RA 5FPKA 2BBWA 2QSYA 4M1KA 3ZZ0A 4GZMA 1TQ6A 2OBMA 1T3HA 2FNAA 2QM7A 3A4LA 1H8HD 3W9YA 5L3QA 5C4GB 1T91A 1C1YA 3PG5A 1SXJE 1JQJC 3DPUA 4NHOA 4TTPA 5AJVB 4C2TA 2P0EA 2CEAA 4FMCB 1B23P 6Q21A 2C9YA 2IUSA 2PEZA 4GDFA 2R2AA 3AV0B 1KI9A 4V02A 4DCTA 4RD3A 3HU3A 2TMKA 5KDOA 2KB0A 1CJVC 1TL7C 2GBLA 2FX3A 1XB2A 2GHIA 2HT6A 3KQHA 4QHYA 4K8OA 3LWNA 2ZJ5A 3HWSA 4TLBA 3AKCA 1RPZA 3VR1A 1CR4A 3QF4B 3ZS9A 4P4SA 1PZNA 3TH5A 4KAXA 3TNFA 1EESA 3SR0A 1AGRA 2D7DA 3RYTC 4EUNA 4EIWA 1ZW6A 4C0AC 3O8RA 3S1AB 4HATA 4AYXA 2JIZD 4B75A 1HE8B 4MITA 1D2EA 1UKYA 3VKWA 4P0TA 4OI1A 4G5GA 1SVIA 4ZPXA 3R7WB 2IS4A 2O8FB 3BERA 1JJVA 2GJAA 2YOFA 2WKQA 2I4IA 4AG6A 2J5XA 1MKYA 1WDTA 2QP3A 2KWIA 4MUAA 3SBEA 3UXMA 4F7WA 2D06A 5SZKB 1P72A 3DOFA 2XNSA 1IXSB 2QQEA 2HEIA 3FFBA 2YWEA 4B3FX 2OXCA 3OAAD 4LHWA 1LF0A 3G5UA 1XEWX 4FCWA 4JMPA 2Q9CA 3D7MA 4ZKEA 1NN5A 1WBDA 4DJTA 1H65A 1HEIA 2CCGA 2OCAA 1T4GA 3HPQA 1XTSA 2W6JA 121PA 3I72A 2GXAA 2Q3FA 4LV6A 1N25A 1M74A 1E2NA 4YMTA 2OZEA 5FL7D 5B30A 5JZVA 1DO2A 3W34A 5KUTA 4IDPA 1US8B 3SQXA 4CEIA 2ZRIA 3WNBA 2ZI5A 3WYGA 3HYRA 5B2ZA 3TLXA 4DVGA 1IHUA 1G5RA 2ZR9A 2E9SA 3I61A 1XCGB 4JT4A 2JDIA 2F43A 3GLIA 4JYBA 1KNQA 1IONA 5FBQB 3SHFA 1KK1A 2V54A 2RGNA 2ZREA 3VKGA 2GBLC 3CX6A 4HDCA 2BJVA 4M9SA 3ZZTA 2QGZA 1Z3IX 2IYYA 2BIFA 2FDCA 2VSFA 2BC9A 3JZMA 2F1IA 4LC0A 1S1CA 5EXSA 4D0NA 5GVSA 4TL6A 3EPJA 1UM8A 4Q03A 3W6OA 4AKGA 1IAQA 1FTNA 1BYIA 2A9KA 4V0NA 3B7GA 1S3SA 3VQTA 4Q7LA 2K5UA 1F48A 3TIFA 4CDGA 4CEJB 4BZPA 1ETUA 2FA9A 4MYUA 2JCSA 3P4YA 2ZI6A 5JRJA 3THYA 2CLSA 2P6NA 2J7KA 1RJ9A 3GP8A 1ZIPA 4R98A 4NMMA 2ECKA 2WMOB 1QG2A 4G1UC 4LV5B 3CIOA 2V7QA 3OFNA 2NQ2C 4PSVA 5JMTA 1GNPA 2IEYA 5DI9A 3C14C 2QP9X 3V4FA 1YVDA 4Q4LA 1KK3A 1MH1A 5JECA 2HYDA 3RRYA 1T5IA 2ZRGA 3WRYC 4Y0VA 3AF2A 3KXIA 4B71A 1AZSC 4XSGA 1RC8A 3EWSA 4V03A 4FCTA 4TMWA 4HZUB 5EZ5A 2DBYA 3HU2A 4DXAA 4XVUA 2OAQ1 1FNNA 1YZKA 3BB1A 1A2BA 2AWOA 4D0LB 1UFQA 3CNNA 3LBIA 1JR6A 4LGMA 2FWRA 1TADA 4Q4JA 1E9RA 1J2JA 4YXWD 1VIYA 4JLPA 1XXHA 1OB5A 1E1RA 4GBMA 4Q9IA 2HXYA 4EPXA 1OFTA 4TZ6A 1MO5A 5DHAA 3PJRA 4V0MA 1JEEA 5FOVA 3B1VA 4O3MA 1YR8A 5JEDA 1Q22A 2ZRLA 1ZBDA 1ZD9A 2RGNC 5JFGA 1FNMA 2IYWA 3L2OB 4JSYA 3K0AB 2QMOA 2Q9AA 5HKKA 5DYIA 1XMIA 2Q21A 2WWWA 3SE0A 2QT0A 3CNOA 1S9HA 2AKAB 2ZJBA 4WXPA 4DLVA 5C4MA 1DS6A 1OHHA 1AN0A 2QTHA 3H0KA 1S8FA 2WAYA 4A2PA 3IQWA 1EFRA 4OHXA 4QJ3A 4OHYA 1UKZA 4PO8A 4BLSA 3LDAA 4ZO4A 1XDBA 4WW0A 1XMVA 1YHNA 4Q7JB 2HXSA 1HYQA 1GUAA 3GJ7A 1EWQA 5M04A 1P9WA 4PC3A 4TLEA 1O3YA 3CPJB 5JLJA 5J40A 4TL7A 4EPRA 4NH0A 2Z6VA 1IN8A 2EFDB 2FMXA 1G4AE 5UKDA 2WTUA 1XTRA 4MRPA 4DWJA 1NG9A 3NBZC 2ORVA 4A2QA 2V6JA 3QUSA 4PAOA 3HJNA 1LB1B 1TTTA 4IFEA 5FBRB 4D4MA 5EE3A 5E7IA 1N0WA 4KHZA 5EE1A 1MR3F 4DUGD 5HE8A 4XWKA 2RGGA 3LBHA 5E95A 4D4KA 2VHJA 4C0LA 2A5JA 2IHYA 2JJ2D 1UEJA 4HDOB 3KJHA 1OXSC 2F9LA 2QENA 1TAGA 3GJ6A 1ZIOA 1TEXA 3QXJA 4GOJA 2N46A 2ZIAA 1AZTA 4RJLA 4RZUA 1GITA 2DHRA 2EVWX 3NHBA 3QKSA 5G40A 3D8BA 3N2EA 1G3QA 1WP9A 4QBHA 1W44A 1FPMA 1DADA 4Q9HA 3EW9A 3FHOA 5J4LA 5IK2A 1G21E 2FGKA 1NRJB 2NO7A 3BBPA 5JWOA 3QXHA 4UNPA 2C8VA 2H17A 3Q72A 4DSNA 3W8NA 1T3LA 3A1VA 1E1QD 5BW8A 2ZSEA 1ANKA 3B1YA 1J99A 2YOGA 4DIEA 2D74A 1N6IA 2BVNA 1P4SA 2IYTA 4A2WA 2QSZA 4FMCF 2Q3MA 2GDJA 2FE4A 1U0LA 3REGA 5G3ZA 3EC2A 3K70B 3AGPA 3ZQ6A 5FTNA 4URVR 4LYJA 2A2ZA 4WAUA 1R7RA 3CZQA 3KUDA 2AXPA 3F3YA 4X8HA 3GEEA 3K0SA 2CBZA 3GLFA 1J90A 2DB3A 3RS7A 2IC5A 4MRNA 4JLJA 2FZLA 5GJWC 2ORIA 2DR3A 1W49A 3PV0A 2RGEA 1GOTA 3CH5A 1M7GA 4JVLA 2HT1A 1XD8A 1EX7A 3LLUA 4LJ7A 3EASA 1WA5A 5TVKA 3GCGA 4GMXA 3JZAA 2MSEB 4ZCIA 3THXB 2V6IA 4URZR 2ZEJA 5EE9A 4O2LA 2H16A 2V4ZA 3FMIA 4RZXA 3NDBB 5DIFA 1CR1A 1XEXB 1M2OB 3KTAA 4PANA 1GNQA 2KJQA 5BXQC 1W36B 5KNDA 2ZRJA 2RGAA 2X2EA 1FOEB 2A5GA 2AWNA 1T8UA 3K9LA 1EXMA 3Q7PA 4HB2A 3SYKA 4C7OB 1W0KA 3O8CA 3QKRA 1W4CA 1SVOA 1II0A 2XNDD 3GLGA 4BZQA 4A4DA 3P4XA 3RRMA 4A15A 1XMJA 2VP0A 1XZQA 4DKXA 1DAEA 1F2TA 3LQQA 1U99A 2IYVA 4PFSA 3THOA 1BOFA 3W8RA 3QOFA 3AP3A 2JLUA 1G5TA 1GRNA 4RZ3A 1PVOA 2YYZA 3SJBA 3E1SA 3LBNA 3EPHA 3T1TA 1LW7A 2WAXA 2WJHA 2F55A 1N5KA 5JJLA 2PZEA 5DN6A 1QHGA 4HB3A 3D6TB 1AS3A 2JLWA 2V1XA 3MCAA 3SYNA 4GP6A 1FL9A 1G17A 2ZS8A 2L0XA 4MGIR 3A8TA 4UNNA 4MDEA 2VEDA 5E3HA 1KJZA 1TU4A 2NO0A 3ND9A 2YV5A 3NEYA 3GJ5A 4KI0A 3LX5A 1U2RA 1ZM2A 2ODNA 4N0EA 5P21A 4PHFA 1ZD1A 4UNSA 1UDWA 3FVQA 4HLCA 3A37A 1WQ1R 3GJ3A 4IEEA 2CHVA 3TMKA 3EPLA 2B6HA 2HLDD 2QAGB 2ZVQX 3FMOB 4BFXA 1P73A 2J1LA 3U4QA 1KKLA 4Z8XA 2QP4A 1XFAA 5A4JA 5AR1A 5GJCA 2WSMA 2OO7A 3GFOA 3IILA 3TW8B 1ZRHA 3SZRA 4NYJQ 1DELA 4CYMA 3I62A 1G3IA 4LDJA 4B2LA 4PSAA 2J0UA 2GK7A 4EPVA 5JRZA 1NY5A 2ZE5A 2PL3A 1IN4A 1CKEA 4L8GA 3NKVA 3RC3A 2D2FA 2OESA 1Q21A 3AVVA 1R0WA 2REBA 2EW1A 1OH7A 4LUCA 3CWQA 2QEQA 1RE0A 1X8KA 4JL5A 3BH6A 3RVBA 2FG5A 3DM5A 1W5SA 4ARZB 3B9QA 3ZVLA 1Z06A 4BFZA 2JLYA 1OYWA 3EA5A 3BS4A 4NTZA 1JPNA 4QG7A 2G1JA 1AKEA 4ZIRB 4LPSA 2XSZD 4UKDA 1DOAA 4NBSA 4F92B 3A58B 4JLOA 4JVSB 4C9BA 2EYQA 4TQ9A 3BH7A 3GLGB 2X77A 3HU1A 3U7FB 2VHUA 2WHXA 1KTVA 4KSCA 2ZROA 1P2TA 2HJVA 3MWKA 1WB9A 5L3SB 4OQLA 1KNXA 1S0UA 2OFWA 4B3XA 1WCV1 4D4JA 4HEJA 3QNUA 1PUIA 2AK2A 4OI0A 1PV4A 1G7RA 1E1RD 3AP1A 4HLUA 5KPDA 4HB0A 3L82B 1V43A 3NEJA 3UWKA 3VFDA 1KSGA 1ONBA 2VP6A 2RGCA 3PXGA 4URYR 5DO9A 1YRBA 1ZC4A 2HF8A 2C99A 3VHXA 4C30A 3P32A 4KBGA 4M1OA 3H2YA 3V4RA 5IHPA 4C0SA 3B1ZA 3PCRB 3R8FA 2MMGA 5G3YA 1XTQA 2YWGA 3C7KA 3LVRE 4BQSA 2FF7A 2N1BA 3BIFA 4W5JA 4EFNA 3AM1A 3SBDA 2GCPA 3KB2A 1M7HA 1E3MA 2PX3A 2F7SA 5BN3A 4XTRA 3RAPR 4B3CA 3I92A 5AWFC 1NBMA 4TTRA 3U3KA 4LPKA 5EP3A 2XITA 3QKUA 4Z1MD 2CLDX 1N6PA 1VCMA 4WXRA 3ND8A 1LTQA 4R71A 2DFLA 2QZ4A 2W0SA 2OLKA 4ZKDA 3QENA 2GEDA 2IYUA 1OB2A 1VCNA 4WA7A 4Q02A 4BLPA 4C0JA 3H4MA 4RY2A 2JJ1D 4UJ3A 4IEIA 2ZRNA 4LX0A 4A0HA 1OFHA 2ZJOA 3U61B 1QHXA 3DMDA 3FYHA 1WE2A 2W2XA 2BM0A 5D3MB 3TR5A 4XJXA 4A92A 3CRQA 5LB2A 4KODA 4BRUA 5JSZB 3GQBA 5FTJA 5BQ5A 5FBVB 2XAUA 4RFVA 4DDTA 4NDZA 1DAFA 1JQLB 4HUQB 4R7ZA 2H57A 3ZLJA 4LJYA 4B44A 3EC1A 1K6MA 1N6RA 3IPXA 5F9HA 3UANA 3C15C 3BRWD 4B76A 4LYHA 5IK2D 1KK2A 3CRW1 4D81A 1CLUA 1GL7A 1IXRC 2ZJYA 1Y3AA 4TL8A 4HLUC 2R6AA 1HTWA 2FPKA 5DGXA 3I1FA 4Q9JA 1LVGA 3PIRA 1ZNYA 1OH8A 3SU8A 2Z4SA 3KQKA 1P3JA 5IDVA 2AKYA 1N5LA 2VHQA 5AUNB 3NIBA 4CZ2A 3K0EA 1CS4C 3EXAA 4OKSA 4JIMA 4Z51A 1QRAA 2KE5A 3AH8A 5FUXA 2ZSFA 2XOKA 3PFIA 3KQUA 4S2EA 2W00A 3LO5A 4DSUA 3AUXA 2P5TB 4E03A 1Q1BA 1E0KA 2XX3A 3K0FA 1YQTA 3KKMA 4JL6A 2GAOA 4Q19A 1GL6A 3QF4A 4HDQB 3B13B 3RHFA 1IXZA 2OHFA 1KDRA 1NVXQ 1Q3HA 1JJ7A 1UBGA 2FZ4A 2W6IA 5CDFE 3IEVA 2WWFA 4JBWA 4KBFA 1KDOA 3S1AA 4BUJA 5GADl 3AVOA 4BEBA 3DVLA 2GCNA 5AJWA 4EQ6B 4F91B 2XZPA 3R7WA 2O8FA 1EFTA 1JR3A 1MABB 2ZAOA 4KVGA 4V0KA 2GJKA 4AWXA 1NSTA 5BN4A 4Q5IA 1W0KD 3R9IA 2C03A 4Q7KA 2OE2A 3BORA 3AF4A 1T8TA 3T1OA 3C5HA 4B48A 5FTLA 4URWR 1KY2A 2BMFA 5FR2A 1G20E 521PA 3OEEA 4A0GA 5HR5A 4Q1FA 4AURA 4PTLA 1CTQA 3RRZA 3B60A 1SKYB 2WJVA 3F8TA 4M9ZA 4IVQA 2ASEA 3J81k 1E6CA 1GL9B 5FBLB 4HYYA 3ZS8A 3ZVRA 3THWB 4W5HA 4TMKA 3MSXA 4LJ4A 3MFYA 3ZDQA 1W4RA 1DO0A 1YZLA 2ANBA 2QQ0A 4TMZA 2ZRPA 2D3WA 3OHMA 1QVRA 1US8A 5HE9A 5DN6D 5KNBA 4BASA 1UBFA 2OCYC 5SZIA 1F5NA 1XD2B 2RHMA 4W5WA 3SFZA 2ZR0A 4N1AA 1AQYA 2Z5FA 3CPEA 4TLAA 2JAQA 2BBSA 4LI0A 2QRZA 3ASZA 3MUFA 3NWJA 3IO3A 4KYIB 4YDHB 4CW7A 3SI7A 3BD9A 3B8HA 5HPYB 4ZCMA 5GJVC 2ZI7A 1R0YA 1GIAA 3KXLA 1Z28A 1GM5A 2JATA 3K8YA 1KKMA 3BC1A 2GA8A 3AVXA 2QGNA 4TSFA 2WWGA 1P5ZB 2ZRFA 5FI0B 3TE6A 2AXNA 4CEJA 2FFAA 4TL9A 1UBEA 3SC3A 2VP5A 1RYHA 1Z0FA 2B7CA 1RRCA 2V3CC 2CK3A 4MKIA 3LA6A 3WNDA 4DLXA 1MRSA 1TF5A 1GDDA 3NC1C 4H9GA 2G88A 3SJZA 4FW9A 1Q1ZA 2JLZA 3KQLA 2GESA 2NTYC 2CHQA 1S96A 4NCKA 3C4JA 3K09A 3MG9A 4XVQA 1KY3A 3K0FB 1N6NA 3FKSD 4NYMQ 1S3GA 1MO3A 1QZXA 5KTYA 1DPFA 3LXRA 4W9MC 2ZM5A 2WJJA 4XH9B 3DO6A 3EZ7A 2ZSDA 3DMNA 3TKLA 3UPUA 1U81A 2B7BA 4TZ0A 2IEZA 1E2IA 2NZ8A 2ODWA 3VU9B 4DCNA 1ODFA 4DIDA 3TVDA 1CXZA 1NKTA 2Z83A 5EE5B 5FUYA 1TUEA 2NO9A 5FUWA 1NVVR 4GP7A 4HZUA 5KHOC 3WP1B 3I32A 4NYIQ 1OKKD 2GJSA 1T9HA 4IKEA 5CYOA 1E79D 2O8EB 3PEUA 4O25A 3HR7A 4TLCA 2YVUA 2R6CA 2W2TA 3EX7C 1FX0B 1KAOA 3MAAC 3U3OA 3T06B 1Z22A 3A1UA 4LOAA 2N42A 1GVNB 1XMSA 3MMPA 3HDTA 1U0HC 3CB4A 5TXGA 5BN5A 2AR7A 2HUPA 4QBFA 5JWHA 2IYSA 3WMGA 3WHLA 4QGAA 3OIYA 3IO5A 4PXAA 4G0NA 3IHLA 2PCLA 3KDSE 4I99A 2PLRA 4Y0AA 3FMFA 3FWYA 4JLNA 3ETLA 3R8CA 3CRRA 3K0AA 2ZJ8A 1VTKA 4A9AA 1OIVA 1VKJA 5CYPA 4WBSA 1W1WA 1IM2A 2W83A 4P31A 5KOYA 3A1TA 4F93B 4X8OA 2RGDA 2XTNA 1FTSA 3NBYC 2RGBA 2ZSBA 1RRFA 1N0UA 4IXNA 4UQOA 4B6FA 2DWPA 1SXJB 1F6BA 1XEFA 1LS1A 2GJ8A 5DSZA 2Q0HA 4PQFA 5JI3E 2BM1A 4LWZA 1KIMA 1W46A 1ZUIA 4LJ8A 1EX6A 4BFWA 4G5RA 4QC2A 1NBMD 3FB4A 3K09C 5IRCD 3WYAA 3AVUA 1E2MA 2BV3A 3WXMA 2IYRA 4NCIA 1A5TA 2KSQA 3IEUA 4MGYR 1WF3A 1KYIA 3W90A 4MRSA 4DLUA 5J47A 3L8YA 4LJ6A 4DCVA 1H8ED 4W7SA 5ELXA 5K8UA 4TYPA 1O87A 4L16A 2BEKA 3QY0A 4MYTA 5L3VA 2GF9A 5G41A 4Z8YA 1DAIA 3P26A 1KGDA 3IGFA 3AB3A 2OV2A 3TW4A 4RFSB 4NZYA 2ZITA 3EG5A 4I1OA 1KDPA 1Z5ZA 3IIJA 4ZI3A 3P27A 5B64A 4JKIA 2YOHA 1Z47A 1XEWY 4YQFA 5TV2A 4GOKA 3VR2A 3X1YA 1EFHA 3MWYW 5JS7A 1KSHA 1TF7A 3FPAA 1M1YE 2ZS9A 3TRFA 2QY9A 5KU1A 3CKLA 2J46A 4QM7A 2O0HA 3IIMA 3UKDA 2ONKA 2GILA 2P65A 3BJIC 2O5VA 2I1VB 4BGDA 3C16C 1ZINA 5HZKA 3KKOA 1MT0A 2P6RA 2GEVA 3W3ZB 3PUYA 5F2EA 2QU8A 2O8CB 2G83A 1FMJA 2ZU0C 2C95A 2VO1A 1R2QA 3SJCA 1SVLA 1U8AA 2J7PD 4DLTA 1MV5A 4QJ5A 4QRHA 3EPKA 2YNMA 5KSOA 1KHTA 3SFVA 2CNWA 2VQSA 2VH5R 3Q5DA 1NSFA 1E4YA 2IW3A 2WPDA 4OI2A 3NBFA 3U3MA 4Q1AA 1LY1A 1N5IA 1YJ5A 4B3GA 4DLZA 1D6JA 5FOSA 1XNJA 1FUUA 3A4NA 3THXA 5HZHA 1BH2A 1M34E 1NL3A 3EZ9A 4HAYA 1G7CA 2AN9A 4DRZA 3GPLA 3WYFA 1RKBA 4PC2A 1A7JA 2PT5A 4MKHA 2IF2A 1E9CA 3SHWA 1XPOA 1XEXA 3Q5EA 3A36A 4PHHA 4B32A 2CVFA 2ZRHA 1KZ7B 1KZGB 3GJXC 4C7OA 4GI7A 3KFVA 4WZ6A 2PZGA 2QE7A 3BXZA 2REOA 1AK2A 2GVZC 4HLDA 4KVAA 1SULA 1XTKA 5CB8A 4LC1A 3QSYA 3CONA 2F3TA 4PC1A 3PUZA 4LBWA 3ZIAD 2ORWA 1UKEA 1FQJA 1P2VA 1CJTC 2P6UA 1KO8A 3AP2A 5AJYA 3DOEA 4J0QA 1RRPA 1XU4A 221PA 4MDFA 4ITRC 4PPNA 4JLKA 5H8WA 4KITB 1HV8A 1BMFD 3OF5A 4QBGB 2WIBA 3BFVA 3AVPA 2BBOA 3T1VA 4C0QC 5DYGA 3W6PA 2IF0A 3PR1A 4PSKA 5TDHA 4B3BA 3AKEA 1OLOA 1OXTA 4LRWA 2WWIA 4DT1B 4PAMA 3ASYA 3KQNA 1F2UB 1SVWA 3X2SA 5LB4A 1IBRA 1UDXA 1ZU5A 4CIDA 4PPQA 4PQRA 2ZJAA 1P62B 2IXGA 3K70C 5J4HA 2O0KA 4TT3A 1DAMA 3WBKA 2YJTD 4E5UA 4BZXA 4FWIB 4RVCA 3A4MA 4Q4HB 2YZ2A 4NP6A 4PC6A 5J4KA 4Q66C 4Q4AB 4M9QA 1OSNA 5FPSA 4QKQA 2QAGA 3C41J 1E2PA 4BFSA 4I1VA 1KI6B 3CR7A 3QKTA 2O8BB 1VDZA 3OEHA 3UWOA 3O47A 2MSDB 2FFBA 4LHXA 4LK2A 1QDEA 3KZ1E 1W4BA 2PCJA 3AUYA 5LPNA 1ZM7A 4ABYA 4GSYA 1E2JA 3EIHA 1E9BA 3H84A 2KI5A 2C77A 2E87A 3UG6A 2ZE6A 4M9XA 1N6KA 1W36C 2GZAA 2QROA 4HI0E 3D31A 4PZLA 2PX0A 2GRJA 2F6RA 4C0KA 3SQWA 5F98A 1W0JA 1GILA 5G53C 1N0VC 1BO6A 4JLDA 1DARA 2BJWA 5DISB 2IX3A 4BPBA 1YZTA 1G3RA 3PEVA 4ARZA 4CF7A 5A5GA 1ZVQA 1DAKA 2VSOA 3CRVA 4OQFA 4QGHA 3T35A 1M6NA 3QG1A 1AGPA 3U7EB 2WICA 1KI1A 2D4HA 2ZR7A 3OE7A 1PLLA 4Q7MB 4ZIRA 3SDZA 2F3RA 3TVTA 1TQDA 1M7BA 2GXSA 1NKSA 2P5SA 1DAHA 1II8B 2P2LA 3ZJYA 4MRVA 3Q7QA 4YLGA 1VCOA 3ADKA 3BAFA 3L0IB 1NMYA 2OG2A 3BE4A 2ZUCA 4B2IA 5L3SA 3TGPA 1L4UA 3GLFE 1LFDB 1OJLA 3OIVA 4JVNA 4URXR 1EK0A 1I4DD 1G291 1NJFA 1KSFX 1XZPA 1YE8A 1OFIA 4RCYA 4TYWA 3AVWA 2B92A 2WJYA 1QF9A 2R8RA 1OE0A 3GEIA 4LCBA 2ZI3A 2QMUA 3TAHA 2W6JD 3A1SA 3KB1A 2F1JA 3CH4B 3HPRA 3TAUA 4D80A 3FKQA 2ZAMA 3ZH9B 2NG1A 1YZQA 4M1TA 4FMDF 3QBTA 1KO7A 1L2TA 2IK8A 4LBVA 4MKGA 5CJPA 2Q6TA 3RWMB 2ZRBA 4NKRA 1BS1A 2FFQA 4Q1BA 2ERYA 2HDNB 5DNYB 1HQYE 2QAGC 3CX8A 4JBXA 1T6NA 5AK0A 2EYUA 2ANCA 1ZUNB 4XD7A 1G8FA 2C5LA 2R44A 3W3AA 1G1MA 2QA5A 4HZIA 1QHIA 2JDID 4A0RA 2BBTA 4DLSA 3MJRA 2AHOA 2CJWB 1T0JB 4NCHA 3GJ4A 2H18A 3LW8A 3FMPB 4OK3A 1KI4A 4MH0R 4URUR 2CL0X 3A1WA 5TB5A 3AKYA 3LH5A 4MQBA 2ODBA 3FOZA 2J45A 4D6PA 3LVQE 3HP1A 1IQPA 3V00A 3I8SA 1P2SA 4A36A 2JLXA 4TMTA 1EWRA 4JL8A 3MJHA 4KSBA 2AK3A 4U7DA 1A1VA 1TF2A 2F9MA 2FN4A 5C1BA 1OXVA 3RS5A 2ZRAA 1S1MA 1TNDA 1H8HA 4GNKA 1Q0UA 3BB3A 1KMHB 3NH6A 5D3MA 5F3WB 3EARA 2E1RA 1CU1A 1DBSA 3OIUA 5JSZA 2AL7A 2MMCA 2V7QD 3OFND 3VNUA 3AEZA 2GCOB 3G82C 4MYHA 4P4TA 5FPYA 5JS8A 1XCPA 4HUQA 4PO9A 4UNRA 4QFMA 2PJRA 2W0MA 4CEHB 2C78A 4NE2A 2C98A 4Q1EA 2IT1A 3FGNA 1R8SA 1G3MA 1QHSA 2X8AA 4LYFA 2OM2A 2F1HA 4YONB 4PR0A 4H1VA 3ZQJA 5FFMA 4M1YA 1VG0B 3SEAA 2KBEA 2QORA 1JXMA 5AUQA 4FD2A 1OPXA 1N6LA 1W2HA 4XSHA 2BMEA 2HCJB 2WIAA 4DLWA 3R9WA 1E9AA 1IOZA 2LKDA 3X1ZA 4ASUA 4L5BA 1WBBA 1TMKA 2XJ4A 3TQCA 2JIZA 2HF9A 4OK6A 3K70D 4K81B 1KI7A 3EZ6A 2BKUA 4A0FA 4YMVA 2B8TA 2WMNB 2ZE7A 1YRAA 1XPUA 1K5GA 4BFYA 1NVVQ 3EIEA 5DI3B 2XGJA 4Q00A 2PT7A 3L43A 1WXQA 4RD2A 2VRWA 5FTKA 5IT5A 4FWTA 4HLQB 3PQCA 2A78A 4EAQA 2WWHA 4UXHA 1Z83A 1NI3A 1GRQA 4ILEA 3CPHA 2FPLA 2WZQA 5FOUA 2R6DA 1IN7A 1GTVA 1E2HA 2BWJA 5CK4A 5HKKD 4RD4A 3NXSA 1E69A 1CIPA 4EQ6A 1I2MA 2ZJZA 4TYNA 2QNRA 1OHHD 2WSSA 3H1TA 2GETA 3MGCA 1MABA 2AFIE 3CO5A 1UJ2A 1I2DA 2IHBA 1EFRD 1VYUA 1JECA 4MGZR 2ZU6A 1KI2A 5AJZA 3QXCA 1G6OA 5C2JB 1U94A 1E9SA 4DDUA 1ZM9A 2ZQ5A 4N0DA 3U7GA 2A5YB 1L8QA 1SQ5A 2QTFA 1HA3A 1X6VA 5FBWB 3GD7A 4OK5A 2ZSAA 4PX9A 2C96A 3QE0A 2QMHA 1NMXA 2IYQA 2P67A 1X8JA 1AJEA 3CBQA 2JJ8A 3K53A 821PA 2REXB 5KO2A 4EJSB 2BHRA 4AKEA 3HR8A 2ZXUA 2ZYUX 2CL7X 1XX6A 2NO1A 4U02A 3THWA 4POAA 4YMUA 5TY0A 1E2DA 2JLSA 3T61A 2IYXA 3ADBA 3B82A 4KCGA 4LBZA 4RCZA 1E2LA 1AA9A 4P3YA 4UXIA 3FHCB 4XIGS 1XD2A 2GAAA 2GK6A 2OAP1 3QPUA 4A82A 5KSZA 2O0JA 3SOPA 4ASUD 3LXXA 5J4VA 1IY2A 2C9OA 4M8NE 4B47A 721PA 5K8TA 5AUPB 1AIPA 1NBME 3GFTA 1J70A 4RKEA 2IS1A 5CLLA 5A0FA 2AX4A 2IWRA 4BLOA 3AF3A 2J59A 2FU5C 3M6AA 2FGJA 4I4LA 3U44B 5KSYA 4IW3B 3U3RA 2PBRA 4F4JA 4A8JB 1P9RA 3Q3JB 3VR3A 4LSGA 4EPYA 4AIIA 4P4UA 3E5HA 3V9PA 1G7SA 2XEXA 3OEHD 1KJYA 2OSBA 3WRXC 3JVVA 1U90A 2BOVA 1UF9A 4KYUA 3RRNA 1G3UA 5H70A 2WKRA 1JI0A 3U3JA 4PZYA 5LD2B 1FZQA 2IYLD 3RDPA 1T0HB 1Z0AA 2FEMA 2QUZA 2YC2C 3AF0A 4JKYA 4M1SA 3CLVA 1X1SA 2ZTSA 4HAVA 5CDFA 5B57C 5JHHB 1Z2CA 1AKYA 1S4QA 5SZHB 3T5DA 3FFAA 1C9KA 1I4TD 2ZI9A 1OT3A 4QJ4A 4US0R 2QI9C 4BLQA 3CF6R 1OFUX 1R5BA 4HSEA 2IWHA 1UAAA 5GJBA 4RZ2A 2X1VA 4F38A 2JLVA 2V55B 1P6XA 4L9SA 3VU9A 4YXWA 2AD1A 5LDDC 4N3NA 4PPFA 4IOMA 1Z8FA 2LCFA 2OCBA 5JBQA 1AS2A 1L4YA 4JZKA 2DFTA 4R2IA 1W7AA 2O8EA 2YKGA 3U6BA 2PLFA 1EFCA 1ZM3A 3I3SR 1NMZA 1FX0A 2DWOA 3PUXA 4LHZA 1IN5A 1YZNA 4DZZA 4Z54A 1ZNWA 2VF8A 4JYCA 1E2QA 1PJRA 2FJUA 3BH0A 4EFLA 1EG7A 2GEUA 4TLDA 3BWDD 2CCJA 2FPMA 4JLMA 4D25A 2G0NA 2ZS7A 1ELOA 1K8RA 3MRSA 3VX3A 4RD1A 2YC4C 4AI6A 1NJGA 1RW4A 3NG1A 4B35A 5FPTA 2RKOA 3GEHA 1W4AA 4KLZA 4XTCS 3GLHE 3KKQA 1RVDA 1ESMA 4AG5A 4QGFA 3C8UA 5FUVA 1HT1E 1Q57A 3ICQB 2QL6A 4DCUA 1XF9A 4GPTA 5J5CA 3LLMA 1SXJA 1TX4B 1ZCAA 2CDNA 2IXFA 2YINC 2O8DB 2J41A 4LJAA 1KJWA 1UKVY 4PAQA 2NOAA 1CJKC 4BLTA 1G8HA 4BWYA 3VKHA 1E2GA 1G5PA 2PMKA 4AKIA 2OILA 2WOOA 4LY6A 1TPZA 2I1QA 2JJ2A 2RB4A 3ZZUA 2DWQA 3T5GA 3WHKA 5K8LA 2NPIA 3MLEA 4G5SA 4IOKA 1U8YA 3NBXX 2O52A 3QEOA 4L9WA 5BYJA 1RZ3A 1VHTA 2EFCB 4NYJR 3IPYA 3QF7A 4ON9A 1P2UA 3K9NA 1CF4A 1U9IA 2IL1A 3L0PA 1G18A 1OIXA 1TQ4A 2OFXA 3IQXA 1GKYA 2GZHA 1MRNA 5JCZA 1E1QA 2C2HA 4I1UA 2BCJQ 4KV9A 3NVAA 2ZUBA 3GFPA 3U5ZB 4V0LA 2OCPA 3T15A 3R20A 2WOJA 4RFSA 4FMBB 3MWLA 2IS6A 2WWXA 3CNLA 4M21A 1Z63A 1VHLA 4KFTA 4IOJA 3QVUA 2WM9B 4EKDA 3U4QB 4RD0A 5E4FA 1E4VA 3BK7A 1TEVA 4WVFA 1E94E 3CW2A 3N2IA 1L7VC 3IDQA 2GWHA 2Q9BA 1E99A 1E98A 3PVSA 4P32A 5JJKA 1NLFA 1J8YF 3Q8XB 4QNMA 4IOLA 1ZAKA 2ZE8A 2EQBA 3Q9LA 4TYQA 4UXJA 2GZDA 1NP6A 4IVPA 1LF5A 2QBYB 2PZFA 4BFTA 3TSWA 2RAPA 2O8CA 1LV7A 2IXEA 2R9VA 4M53A 2XZOA 3QXXA 1QG4A 4IDOA 4ZI2A 2X19A 3KUCA 4CRWB 4LJ9A 1N6OA 2OXRA 1CEEA 2CXXA 1NVUQ 3GLHB 4RSGA 1IY0A 2ZI4A 4TQAA 3UMRA 1SXJC 3KJEA 5BWMA 1J8MF 1E2EA 2V8OA 1XJ0A 2NGRA 2XNDA 4FIDA 2V9PA 4FMDB 4TMXA 4M1WA 4D82A 4LJ5A 2WVJA 4QBIA 3TUJC 1GSIA 1ZCBA 4GL2A 4HUTA 3LRPA 5FH9A 3ZVNA 4XWOA 2WJGA 2HYIC 3FDIA 2JGNA 1E0AA 2RMKA 1NG1A 3RWOA 3E70C 2RHDA 4EPTA 4Q48A 4DEXA 1TUIA 4Q18A 1SVKA 5CM8B 2GJ9A 5FI1B 2IUTA 2QRNA 5FL3A 2XTZA 3QBVA 5LBIA 2XXAB 2WSSD 2EWWA 2GKSA 2RGXA 4H1UA 1HH4A 1JALA 4CGZA 1U9IC 1Z6GA 3OIWA 2EU8A 3CF0A 3RNLA 5FOTA 4O2RA 4QHSA 4BEJA 1E9DA 1GFIA 2ZYTX 5CK5A 2R6GA 4MYCA 2FSGA 3B1XA 3QI2A 3I8XA 3QIAA 1P7CA 2DCUA 4ZDWA 1ZUHA 2W58A 2GNOA 5E7JA 3SJAA 1R5NA 1KI8A 2WV9A 1W48A 2OUKA 2UZ3A 3ZYCA 3WMEA 5C46F 2Q3HA 4KXFB 2PEYA 3SYLA 1DAGA 4GMDA 1T5LA 4ACAA 3K1JA 3VHLB 2BDTA 1XJQA 2HLDA 4OJKA 5L3QB 3MWJA 4DT1A 1Z0IA 3CWZA 3GLIE 1NLZA 5FOXA 1F2UA 2OEPA 2ZYVX 3KJIA 4ZCLA 5DLQC 3F5FA 3B9PA 2ZRMA 2YWHA 4NCNA 2FOLA 3H86A 4OQXA 3AVTA 4D26A 3AQ4A 3CR8A 4Q4HA 2Y8EA 1DG1G 4Q4AA 2VA8A 3CZPA 4PQYA 1XWIA 5CM9C 2ZJ2A 1GKIA 1KI6A 2O8BA 2ZETA 3KKNA 5FR1A 4CT4B 5HCIA 4P4SB 4DEYA 3I5YA 1CR0A 1BIFA 1QHHA 2J0VA 4JLVA 3U2QA 3FTQA 5KDDA 2C04A 3AVYA 1IY1A 3EAQA 5EXXA 3LD9A 2ZRCA 5EE0A 2PJZA 1N2CE 4IVRA 5CIWA 2J9RA 1HE1C 2XB4A 2IYZA 2XSZA 4XVRA 1Q44A 2A5FA 2IUUA 4B34A 4C3ZA 2XOKD 3EA0A 3OESA 2MSCB 2QMEA 4HAXA 1NY6A 1PUJA 1X86B 2G6BA 1VG8A 1NIJA 2VHCA 1SGWA 3EZ2A 3DKPA 3WP0A 1S2MA 2W6ID 1E9FA 3OZXA 3UATA 1Q3TA 1G8PA 1YR9A 2HJGA 1VYVA 4RD6A 4AKHA 4OJQA 3PEWA 1MOZA 4DBLC 5JWRA 3DEFA 2DPXA 1KK0A 4JVMA 4AD8A 1JB1A 1ZM4A 1JR3D 1II8A 3NHAA 3M1IA 1OXXK 1NF3A 3LFUA 4KFSA 1SHZA 4A6XA 3DHWC 3L0SA 1PLJA 1XXHE 1SZPA 1VCIA 1Z6TA 4OI4A 1NLYA 5HCNA 1Z07A 3QPVA 3W6NA 4CEIB 1GG2A 4NONA 3OEED 1KDTA 4V0ME 1KO4A 2BCGY 3LX8A 2JASA 4EPWA 1JAIA 4PHGA 3SNHA 4FINA 4ACBA 4OYHA 2JA1A 5JCPA 1QBKC 3ZGXA 1F3OA 2F43B 4U00A 1GRRA 1NVWQ 2B8WA 2D2EA 4YDSA 4E07A 3GLIB 5JJIA 1XBTA 1OV4A 4AYTA 2J0QA 3N70A 1DTSA 1YZGA 2G3YA 1BKDR 4Z1MA 1YR6A 5GVRA 1IJEA 3TQFA 4QGGA 3PEYA 2G1KA 4B73A 1EGAA 2GTPA 2AD5A 5TMPA 3RLFA 4JJZA 3P1JA 1X1RA 3UMSA 3EZFA 3X1DA 5IF9A 2R62A 2JJ1A 3W5JA 4II7A 3THYB 1SXJD 3DL0A 5ANRB 1FP6A 1I4LD 3MD0A 5HTKA 1ZJ6A 3CM0A 4WOPA 3SS8A 1RJ9B 2IBMA 2CJWA 1G8GA 3M4YA 1R6BX 2G77B 3TUZC 3QJYA 3N5CA 1ZYUA 1JNYA 2NIPA 3K9GA 1KAGA 4IJMA 2RH5A 4HB4A 3DKVA 4TSFD 1M8PA 4BFVA 1G19A 1QHHB 3RSOA 1KOFA 3QVVA 1GWNA 3UK6A 2CK3D 3L0OA 1KSJA 5KYKA 4PZZA 2BMDA 4BE7B 1CR2A 4HAWA 4DLYA 4MRRA 3VMFA 1UBCA 5SZJA 3WNCA 2HV8A 2VPPA 4JLBA 4LYAA 3B2EA 4KO8A 4OL0A 4PC7A 2QTVB 3NDPA 1KMHA 3ADDA 4TN1A 4JSTA 4B2PA 1COWA 4NU0A 4NYMR 1S9DA 5H68A 2H8KA 4D2IA 3EWAA 4OQMA 2GCOA 2UKDA 1WMSA 2NZJA 2UZIR 4TWZA 1X8LA 5CITA 4CEHA 4G5QA 1OXUA 4JLAA 4FN5A 2H1LA 4OBEA 4PHTA 2JLRA 4TYYA 1TQ2A 4Q4JB 2A3RA 4L15A 5L8VA 1XXHB 3LQRA 4AC9A 4PO1A 4C2UA 3CX7A 4NYIR 1IJFA 3RABA 4Q9KA 1C4OA 2ATXA 3B5JA 3Q85A 2OFOA 3ZVMA 4F4IA 2DFKB 2QN6A 4A6PA 2NMVA 1WRBA 4K46A 1Z6YA 1HT2E 5CB6A 1CBUA 4NL4H 1R0XA 3IKJA 1DVRA 1JAHA 1TU3A 4Q01A 1D9ZA 1T3SA 1Z2AA 1SVSA 4BRWA 4IDHA 2J0SA 4GOXA 3VR6A 1R5OA 5DH9A 1NNEA 5DI3A 1FMLA 2ZUDA 3HYTA 2A7QA 1XTJA 2I3BA 1G4UR 3RSLA 4US2R 3PITA 2CLCX 2ODEA 5AJXA 2FSFA 1ZNZA 1R0ZA 2QT1A 1OH6A 1R10A 1P75A 4V0OA 3A6PC 4B74A 3WMFA 1IN6A 1KMQA 2EFHB 1U8ZA 4IFBA 2LKCA 3L8ZA 5CIQA 4F4CA 1LNZA 3GLGE 4L4UA 1ZU4A 2QPTA 4G5OA 4Q1DA 3RANA 2FSIA 1D2MA 1XJCA 4DDVA 3CRMA 2EFEB 1Z6XA 4KU4A 5EUMA 4C4PA 1D8TA 1OIWA 1FP7A 1Z0KA 3BOSA 3K9HA 3PUVA 1VG1A 4G01B 2BKEA 4M2LA 4B43A 1CRQA 4YC7A 3VR4A 4FXPA 2CHGA 2OLJA 4C0BA 4IDNA 3LY5A 1A4RA 2VYFA 4B6EA 3GJ0A 2WBLC 3M0EA 3QKSB 1YU9A 2IS2A 2NO6A 1U98A 4EJSA 1SVMA 3E2IA 1XP8A 4Q1CA 2DY1A 4QNRA 3TK1A 4BECA 2J87A 2JLQA 4E09A 1ESNA 1ZC3A 3O8BA 3ICEA 1GKUB 2G9NA 4ESHA 5BYKA 4ESVA 3AKDA 3BGWA 1ZNXA 3B85A 5EUQB 2FEOA 4C0HA 4P33A 3T12A 3WBJA 3QPWA 3QXSA 1NN1A 1CJUC 4CT5A 3X1XA 1Z29A 3CUEF 4M0LA 4U5XA 1GP2A 4KFRA 2CE2X 4D0GA 2DYKA 4EFMA 1P9NA 4I1SA 2OT3B 1MO4A 1LS6A 3F0TA 1NN3A 3IIKA 4GT1A 3KKPA 2ZANA 4ZDKA 1A2KC 3DZ8A 5KSPA 3GLFB 3T34A 3TR0A 3FHTA 5FOWA 3U44A 1G7TA 3FE2A 4XOIA 1NIPA 3DM9B 1G64A 3FKSA 4A8JA 2FV8A 4QOSA 4TQUS 1D2NA 2GXUA 4JT2A 4DLRA 3RC8A 4IXMA 1VYTA 1P60A 3VTKA 3TUIC 1CRPA 4G3XA 3BFKA 4JS0A 5EP1A 4Q47A 1OW3B 3VX4A 1UADA 2UVQA 2ERXA 3IBYA 5EP4A 1D5CA 1AQUA 3UIEA 2KBFA 4MGKR 1CJMA 2J3EA 3I4LA 1NN0A 4O0MA 2ZYWX 2BMJA 2QAJA 3KTAB 1DE0A 5JHGB 3O8DA 1AM4D 1OKKA 4D4LA 2CNWD 4ZDIA 2ZRKA 1E79A 2FSHA 1RFLA 2QG6A 1XCMA 4YMSA 3U60B 2WPDD 1HURA 2AFHE 1YKSA 2VP9A 4A1FA 3QKRB 4I81A 5E7MA 1AS0A 1JXOA 4CVNA 3JVUA 4Q21A 4GFDA 1E0JA 5AUOB 3OAAA 1FUKA 1QHNA 2FFHA 4WIAA 1F2TB 1KI3A 4BLRA 3UG7A 4TTQA 2VBCA 1RYFA 5CLQA 2XB2A 621PA 4UJ5A 3CF2A 4GZLA 3TJZA 3X1WA 4AYWA 3B78A 5DHFA 2VIIA 2ZRDA 4AK9A 2ZPTX 4X8LA 1B0UA 3ADCA 5C18A 1ZP6A 4EJSC 1W36D 3VAAA 1G41A 1G16A 2A5DA 5FL7A 2QE7D 3IUYA 4KFUA 2NPFA 1HUQA 2H7VA 2PMDA 1GNRA 2QPAA 3REFA 1OYYA 1VMAA 3ZD7A 5H1YA 1VECA 4ZDJA 4DB4A 4LHYA 2D7CA 5KDLA 1ZD8A 2YWFA 2VSXA 1QVAA 2EWVA 2V1UA 4RKFA 1N3BA 2DFNA 2VLIA 2XJ9A 3VNVA 1W47A 4XWAA 4YMWA 2D62A 1A82A 4NPHA 3QG5A 1Q12A 4GRAA 4KLNA 2Z43A 3DZDA 1E2FA 4HAUA 3WY9A 1J7KA 5TARA 3D3QA 4LHVA 4QXAA 1Q1QA 4ZV4A 1OF1A 3LW7A 5DE3A 3TSOA 2WJIA 4A8JC 4M22A 4US1R 1P61B 2GXQA 1X3SA 2QM8A 2WKPA 3K0CA 3KL4A 3RS3A 5JEEA 1MO6A 2OBLA 2YHSA 4TMVA 1YR7A 2CCKA 2O8DA 1H8EA 1Z6AA 2VTKA 4QM6A 2GF0A 2BEJA 4WZBE 2VP4A 2J0UB 4S35A 5LD2C 3KXKA
chains in the Genus database with same CATH superfamily
1I9CA 1Z4NA 3L49A 4TT3D 2QD4A 5TX7A 2QPOA 1X9IA 5ALMA 3BQNB 3RS0A 2ZCUA 1LBQA 1PLKA 2NT3A 3D0KA 3TQIA 4NEGA 5ALUA 3QEJA 3W8DA 1ZXBA 1RYBA 1BVUA 1O95A 2IPXA 4KX5A 3S7TA 4OA5A 3VO2A 1N36B 3ZGVA 4YV2A 4C6HA 2WWYA 3NBAA 1ZKDA 4CKEB 1UWKA 2YHBA 4J0KA 4BO7A 2BFPA 4XASA 4G0UA 3GLUA 3WLJA 4EYOA 2OQVA 1ZISA 3TPCA 3P45A 2R87A 1GLGA 4PFJA 1K5DA 4TRJA 4FCVA 4YYZA 1P4JA 2W43A 4WD3A 2P69A 2J9YB 3LAWA 3B1WA 2PU7A 3W5IA 3ZE6A 1EXNA 2Q6LA 3OJEA 1COWD 1Q20A 2VYVA 3CCCA 1WVGA 3MTDA 1JJAA 2IZOA 4PGHA 2OORC 2YWRA 2VL7A 3H1EA 3LNCA 2ECOA 5BOSB 1KJQA 1L8XA 2AFIB 3I5XA 1G98A 2PRYA 2XE6A 1RTKA 3BFXA 4HWOA 1TM7E 2PH1A 3IHWA 3PNVA 1JSZA 1O9GA 1EDBA 1ODJA 2AOTA 1XK7A 4IDQA 4JP2A 3M6LA 1GZVA 3IV6A 4IIFA 4M55A 3B6EA 4WKCA 4C87A 1UEIA 3G0HA 4CFSA 8MHTA 3OM9A 2BR5A 4FI3C 2UYHA 3U3XA 5F9FA 4GYYA 3TL2A 3F8SA 4OH1A 3RS2A 1K9VF 3OZ7A 1JHDA 1Z0JA 4OHZA 1O8BA 1N7IA 4FEGA 4PM4A 4UUMA 5BNIA 3EEBA 3QWAA 3RUEA 4DM4A 5E3IA 4CM8B 4O4HA 3UUEA 2VQ3A 1OU0A 2CLEB 2H52A 3AIMA 3NBUA 1SURA 3T99A 1E96A 1JE0A 3WXBA 4YJ2A 1ZRNA 5DW0A 1E0SA 2H92A 3GO4A 3NC0C 4LBYA 4MS3A 1UXOA 3DMRA 2CY0A 7ABPA 1I6LA 4R05A 5JDIA 5K6AC 5A4IS 4KHPB 4XWTA 5JI2E 2HFJA 5EUCA 4JD5A 2EQ5A 1UBUS 1F6WA 4XCQA 1FE8A 1UMKA 1Z5OA 1Q0SA 1MAAA 3KQTA 1WU7A 4II3A 4DADA 3MT9A 4NFLA 4Q9LA 3VZCA 4QDTA 4CL2A 4CM7A 1JU9A 4J6EA 3RAEC 4MWDA 1JR4A 2XF2A 4HXEB 5AHKA 2F90A 3QWIA 2OBNA 1XZCA 4W7IA 3VR5A 1VB3A 4EUSA 1AG9A 1T2FA 2H2WA 3IJRA 3PHBE 3QLVC 3DHEA 3AB7A 2CB0A 4P7KA 2XZLA 4X71A 1E3WB 3BVPA 1G8YA 3KSBC 4E51A 3ZE9A 4XD7D 3WK4A 3ZWQA 1YB5A 3N3BC 3JQFA 1NJ1A 2M6KA 3OSUA 3W78A 3E84A 3VO1A 3BD6A 1D1QA 4DQ0A 1J20A 3BA6A 2VP2A 3HCCA 4BNGA 3U7HB 3BB4A 1O94C 3RIMA 4EHBA 4HQ0A 1VSTA 1II9A 4UHKA 4DB2A 4KXMA 3G9ZA 4FBMA 1RQXA 4ZTBA 1ADCA 1GKKA 5IVIA 1AQNA 1PZHA 1BHSA 3KIPA 5JS1A 1NR5A 1VLMA 2G4VA 1NURA 5FPHA 4MP3A 5ECDA 5ARCA 1U0NA 3JYQA 2R11A 3OBBA 4IUDS 4QHTA 4TM8A 1ZUD1 5JPIA 5LP1A 1OLUB 1U7UA 3K8QA 3OTWA 4UUPA 2FMHA 1HY3A 3IH5A 3V6LA 1N7JA 4QL3A 1E4EA 2NUAA 3A1FA 5DTMA 3QA3E 3UAVA 1TUGA 5FPKA 3OPMA 5GQSA 3TX2A 3V8VA 3ZIUA 1NZDA 2GN8A 2P2SA 3EFEA 2JK1A 4J1TC 4EBFA 1ESEA 4XIFA 5L3QA 4MSUA 3E9YA 3OA0A 3UPDA 1JQJC 3NAZA 5K20A 3QY9A 5AJVB 4C2TA 1B23P 1TVCA 4DR2B 1TIKA 1PQ4A 4BO5A 2O54A 4GDFA 3O4IA 2DSTA 5LZ2A 2R2AA 4RF2A 2WUGA 1KI9A 1MF7A 4V02A 4DCTA 3G59A 4ZODA 1E3LA 3HU3A 4IWYA 5KDOA 3VAZA 3EW7A 2DOKA 1QX4A 3L6RA 3R5FA 4UREA 1OAKA 4UCXA 3CLKA 3IR5A 3HUFA 2L18A 5FX2A 5BOVA 4WXMA 2I3GA 3OMWA 4MPPA 3ZS9A 1HSOA 3TH5A 3TZLA 2O19A 2VWQA 4KAXA 3HJBA 4GLOA 3TNFA 2I6QA 1EESA 3SR0A 1P9OA 3I9NA 3EZNA 2HFKA 3RYTC 4JB8A 4EIWA 1PYOA 4X7PA 2VJBA 4C0AC 5EIEA 4HATA 3MYYA 1BVRA 3VYUB 3A9SA 3QEMB 1CETA 4MITA 4YRRA 1UKYA 3HEAA 4FFSA 2FXIA 4ZU3A 2LD4A 1ZMOA 4HGPA 1NDQA 2YOFA 4JR2A 3GR6A 1PYDA 5D5QA 1HOTA 2AMYA 4BU0A 1MKYA 3RVDA 1KH3A 4EL0A 3KSMA 4YRTA 3IS3A 2X1MA 3ZNOA 1CUIA 4F7WA 3GFBA 4QX6A 2NUTA 3O2QB 2Z4TA 1P72A 3DOFA 5CT9A 1QLJA 2YWEA 3ILXA 3OAAD 4J4BA 3WIOA 4LHWA 1XZ8A 4MIYA 5JXWA 1JG2A 1XEWX 5DMXA 3D7MA 1ULTA 4JVOA 4ZKEA 1X7HA 2ZBQA 1WDMA 2PRSA 4DJTA 1H65A 2OCLA 5IYZA 2OCAA 2CF6A 3L7LA 2B4TO 4C01A 4CGYA 4YRNA 4LDRA 1XTSA 5DNCA 5I5EA 3RS8A 3GAZA 3OLVA 3SC6A 3HKEB 3MJFA 4MUIA 1VP9A 3KEOA 1L4GA 3A6FA 1JEJA 3UFXB 2F59A 3WI7A 5A9SA 2PU5A 4Z5XA 5JZVA 3GGSA 5KS2A 5KUTA 1H1LA 1O1YA 1W9HA 5JATA 3CHYA 1US8B 1L5ZA 2DLNA 1Y8CA 2MR5A 3ESZA 4MS4B 4CEIA 2ID9A 4JWKA 3G2KA 2CMHA 2PUAA 2NZXA 4DVGA 1I7PA 1GQYA 5J2TB 2ZYRA 3FGOA 1FDSA 1YE3A 3KAJA 3LBFA 4GRIA 4ZEXA 1OZHA 1XCGB 5T3YA 2F43A 4HG2A 5EPUA 4JYBA 1CSEE 5IUNC 4AQYB 4OHKA 4FKZA 5FBQB 3D2BA 1MP0A 4P58A 1B8VA 2E7ZA 3H2KA 3BM5A 5L6LB 3J80A 2FZGA 3DAPA 3L0YA 4M9SA 3ROZA 2IYYA 3RC2A 1M1YA 1P18A 2VSFA 3JZMA 3KOZA 3NPAA 1HT0A 3QGMA 3RBAA 2FDCA 1UXGA 2BGRA 2OYCA 3S29A 4Q03A 1CF2O 3RIXA 2UZ4A 1F38A 5AI6A 1PFVA 3M6IA 1PWEA 4Q7LA 3VQTA 5TVGA 5LMCA 3IUSA 2HSDA 4LMPA 5MN5A 4MYUA 1U31A 3ZNPA 1D2GA 3INYA 5EJ9A 2XWSA 3IFSA 1RXSA 3SLKA 2C2BA 5G02A 1CZLA 4R98A 2VK1A 2GPNA 4LA4A 1JXQA 3ZLBA 2WMOB 5ALOA 5LQUA 1NFFA 1PT8A 4KXWA 4DPLA 4ZQEA 3UV6A 1GNPA 4WNYA 4BE9A 4ABTA 2QP9X 4K9SA 4YI5A 5F2OA 1TEZA 2I7TA 5C5DA 5JECA 3D4PA 3MBIA 3SXUA 1RLTA 1V5EA 4KSYA 1T5IA 3WRYC 3ZW9A 1TGVA 2DCMA 5DHPA 5MGBA 4XSGA 1RC8A 3DYBA 4FOPA 4D4GA 3T5PA 1M34A 4NOKA 1AUXA 3UCEA 3H19A 3UUGA 2QTVA 2VN8A 1WQ3A 1NYLA 3VTAA 1GZ7A 5EZ5A 1X1DA 1CQZA 3ACCA 1I5OA 1JS1X 2OGUA 3HU2A 1P7YA 4HH1A 2CFTA 2OAQ1 1LDEA 1FNNA 4OGKA 4ALMA 4JDUA 1FS4A 3VC7A 1VE7A 4I5DA 5EKSA 1XTVA 1NUTA 2YZNA 3B3JA 3EQ6A 4Z4HA 4DF3A 4E14A 2F1KA 4EY4A 4ZI7A 3CNNA 3LBIA 5F5LA 4DYVA 2UVPB 2FWRA 2ZJ1A 3KJQA 4L3OA 3ZE7A 5I7WA 3ANTA 3ROPA 1ADYA 3RAGA 4S1VA 4Q4JA 1E9RA 1J2JA 2B30A 5I7VA 1VIYA 2NZVG 1QCCA 4BB9A 1ZITA 2EG5A 3GWGA 4Q9IA 1GD1O 1MX5A 4ER0A 5DNWA 1XQ1A 4EPXA 3IOYA 1MO5A 2JGFA 4TOIA 1RJEA 2B1JA 4NZ9A 4GXQA 4ZT2A 4V0MA 3B1VA 4KPFC 5K03A 1MIOA 4R8RA 1Q22A 1IHDA 1ZD9A 2Q45A 2RGNC 2WU0A 4DCJA 3E2PA 3NATA 4X24A 1CE8A 5JFGA 4JSYA 3K0AB 2QMOA 1KDZA 4KREA 2IY9A 5ERGB 4BN4A 4ZYWA 2IOFK 3NHLA 4K03A 3SE0A 1RXUA 1Z15A 2JLCA 1A69A 4AX8A 1Y6RA 1AN0A 1X7WA 1IPEA 1VHWA 3H0KA 4J75A 1PJCA 5AVWA 4BX9A 2FJ0A 2RKWA 2EZ4A 1P1BA 4RANA 4OHXA 3LZ6A 3VR4H 4BKPA 4RGBA 4QJ3A 2IBSA 3KR9A 5BNZA 3GXBA 4IFTA 3CS3A 1LNSA 4I36A 2W2OA 2YL2A 1PEAA 3JQGB 4ZO4A 5FI3A 4ZWNA 5LQAA 4I1IA 3TPFA 5KHLB 1GNLA 1OX6A 2VNAA 3UT5A 2HA4A 2YFYA 3STVA 4Q7JB 3H05A 1GUAA 4BXOA 5GAJA 2YBDA 3QUQA 1PT6A 4KKXB 4LHEA 4PC3A 5D1NA 3B3FA 4JCOA 5LJLA 1O3YA 3BMCA 2RGRA 1I5EA 1E3TA 3CPJB 4LZLA 1FB5A 4NMLA 3B1FA 4TL7A 4N8DA 2VJCA 4OIFA 2DEUA 1LQUA 3VC2A 1XTRA 4MRPA 1I1NA 3OZWA 5K01A 5PNTA 4TTVA 3PA6A 3E9QA 3DT8A 3NBZC 1LKZA 4BRZA 1CC1S 3JD0A 1LB1B 1DIRA 1LC0A 2X0IA 1TTTA 4L5CA 2X4IA 1KQGA 2J9XB 1H23A 1I36A 1AUOA 1Z2DA 3G17A 5EE1A 4D3ZA 4DUGD 5AD1A 2RGGA 3WB1A 3LBHA 5E95A 4D4KA 2D2IA 4G1EB 1PV2A 2IHYA 3FCOA 2JJ2D 3KJHA 2WRZA 4ZZIA 2OSVA 3DT9A 3OMXA 1ZIOA 4GOJA 4ASUA 4JI8B 3FNIA 4KO4S 1QTQA 4RZUA 3NHBA 4M37A 4K0KB 3OZTA 3FBTA 3N2EA 1E6EA 2PLNA 3BZBA 4O02B 3ZHZA 1FSPA 3IQGX 4EHIA 4DMRA 2ICAA 1GCAA 4CDMA 3EQ2A 4YS6A 3E15A 1G21E 1NRJB 2NO7A 3PRHA 5JWOA 4HQFA 4G6ZA 2C8VA 2G07A 4DSNA 5LXTB 2QKYA 2G76A 3A1VA 4UZEA 5BW8A 1J21A 1TRKA 3EH1A 1JDVA 4RHTA 1J99A 2YOGA 4RH3A 4UAGA 3RHTA 4DIEA 1AA6A 1N6IA 3PNMA 3ROFA 3H9QA 1S6YA 1X3LA 2BMVA 3OPQA 4FMCF 4OFWA 2FE4A 3GRZA 1RCFA 1EXVA 4N54A 4OXNA 5G3ZA 2XA1A 3LBAA 3TNYA 3WL8A 2BFNA 1V48A 3MIIA 3ZQ6A 3JXEA 3PL1A 5FTNA 4URVR 2A2ZA 4CQMA 4ZQGA 1QCZA 3CZQA 3KUDA 3OU6A 1HM5A 1SD2A 3GEEA 3R41A 4MIKA 5C8VA 3GLFA 1JSRA 2IU4A 4MRNA 3RS7A 5GJWC 1V7CA 4NLLA 4DJFC 1VMIA 3HY4A 4YJ3A 3ZY3A 4KPYA 5EMLA 5AKIA 3DL2A 4H1TA 5ESXA 3MS4A 1YB7A 2CDAA 1EX7A 2CSXA 2WAOA 3EG9A 3REQB 2XKKA 2QX4A 1QP8A 3EMKA 3N74A 1KMMA 4ZCIA 1E4OA 4FFRA 2ZEJA 3PE6A 5EE9A 5CX1A 1XAGA 5IAJA 5BQXA 4RMGA 3W77A 4D9GA 1V8FA 2FPWA 2XYGA 4JUBA 3OX4A 2QRKA 2WJAA 1PGOA 4H2DA 1DUIA 1M2OB 3K2QA 4I5FA 1GNQA 4DPMA 1VMKA 5KNDA 1NNI1 1M8FA 2A5GA 2X2EA 3K9LA 4LI3X 4Y2UA 4HV4A 4RL6A 1JAZA 1W0KA 4JJAA 4YJKA 2UUAB 4HDRB 3TOZA 2WVHA 1WXEA 1BAPA 1QK4A 1SVOA 4LFCB 4R0VA 1VL0A 4PR3A 3AR2A 3MIZA 1GQSA 2DKNA 4DKXA 1H4TA 1QTIA 2Z6AA 1J1ZA 2JA2A 1FNCA 1U99A 1Z45A 2YIVX 2BUBA 1B41A 4W82A 1EDDA 1IG0A 1UWVA 3KQPA 5J2UB 3AP3A 3F4BA 3C3XA 4RZ3A 2YYZA 1ZCJA 2SBTA 1MDFA 3EPHA 5JDCC 3MJCA 2B1GA 4PO3X 3AI7A 3TBFA 4KWIA 2JRLA 2ZUSA 3NIFB 3QYPA 2HQRA 4N5MA 3ZDCA 4W6ZA 3RYIB 4YCMA 5CCDA 2OBFA 4FHFA 5DN6A 1GUZA 1QHGA 2HK8A 3D6TB 3DEHA 1DEHA 3NHYA 1AS3A 4Y18A 5CB4A 1ZIDA 2V1XA 4I1PA 2P4EA 4JSRA 4QYSA 5A9RA 3PQ7A 2V6GA 4GP6A 3NNDA 3AG5A 3MB8A 2L0XA 2P2DA 4RLQA 4MGIR 3A8TA 4MDEA 1KEZA 4HYTA 5E3HA 1KJZA 1LWNA 4RSMA 2DFPA 3N7TA 4TZTA 2Z2KA 2JGDB 4UCWA 1ST2A 4J3JA 4KI0A 3LX5A 1U2RA 4O29A 4C5AA 2FZEA 4TTTS 2J5RA 3E82A 2H8GA 4DCOA 2BFBA 1AO3A 3FVQA 4HLCA 3GPCA 1A7KA 1OI7A 1AKTA 1UK6A 2VYND 4PIPA 4X9XA 2PUGA 1NAIA 2IUYA 2CHVA 3P5BA 2B6HA 2HLDD 1O6BA 5CX4A 4RLSA 5EYPA 1D3AA 2ZVQX 5FBKA 2V0NA 2C8JA 4ESOA 4I4TA 1T8WA 1KKLA 2DTEA 2XGMA 2QP4A 3TW0A 4F2WA 5DNEA 2EP7A 5M5BA 2OO7A 3IILA 4R1SA 4X1KB 3RVJA 1U8TA 4HNAA 3TW8B 1XMXA 2VQEB 4NYJQ 1QV7A 3P2MA 4RDHA 2HU5A 4N49A 3T7TA 4H3HB 4P1ZA 2W48A 4TXLA 1X74A 2O9JA 4X63A 2AOUA 5JRZA 4KRFA 1V1RA 3G2JA 2Y93A 3ICPA 1CKEA 1CNMA 2AMLA 2XUFA 3BRCA 3KKLA 3ONNA 4U9UA 3RC3A 2OESA 2GPWA 3G0IA 5AK6A 1EWKA 4TLMB 3WGHA 2DRIA 3DONA 4G4SP 5DGHA 4BVFA 1SU7A 2HIGA 3CWQA 1I10A 1RE0A 2VDPB 4UAVA 3WLOA 2ZP1A 2N3ZA 1GYRA 3WDSA 4JL5A 1W5SA 1QGZA 1BC5A 2IYFA 3DWGA 3ZVLA 5AW7A 1XTTA 2GM3A 3GFSA 3SYRA 1K6EA 1DJOA 5CUQA 4BV8A 4V1CI 4L7QA 4XVCA 1JPNA 1QVVA 1SNYA 5DBOA 2D4AA 3NLLA 3RC1A 3FBWA 1K8YB 4F92B 3I9JA 3IJEB 2VT3A 1X7YB 3GLGB 4Z9BA 5A6VA 5CVUA 2VHUA 3U7FB 1KC1A 1PEKE 4KSCA 3UJNA 3A9UA 4WNAB 3OHPA 4ZVSA 3MWKA 2NVUB 3EQ8A 1RRKA 1K92A 1S0UA 2OFWA 3M3HA 4HX2A 4IJ5A 4JUIA 4RLHA 4MIEA 3ZUGA 4B6PA 4CBVA 3ETGA 4CQJA 1KZ1A 1WCV1 4I6GA 1WLSA 4GKKB 4YALA 2RG1A 3L9WA 3GZ4A 1V3UA 2AK2A 2J48A 1TZ2A 3P2EA 4G1FA 4XFJA 3I0ZA 1YQQA 1B4DA 4M8IA 1OU4A 2AJCA 2B4AA 2RK3A 3FIJA 1G5QA 1U11A 1K4KA 4ZCSA 2D1FA 1GJRA 3BD8A 5CU7A 5DO9A 5KB3A 1Z4QA 3OCUA 4N6GA 2LIPA 3INNA 2C99A 4W1SA 1TJPB 1Y5LA 3A1NA 1E92A 5IASA 1IOVA 1QH1B 3II6X 1DLIA 4KBGA 4QVIA 4MB0A 4QECA 3V4RA 1XQXA 2C0CA 4C0SA 2I80A 4GH5A 1L5LA 2YWGA 2HDWA 3OTHA 2FF7A 2N1BA 4R1QA 4W5JA 1V5GA 3HACA 3OJWA 4HVTA 4JWTA 1JQAA 4EFNA 5KJ1A 3AM1A 2FZCA 2QTMA 4K5QA 3SBDA 2R6ZA 2GCPA 4K28A 1QUEA 1SM4A 5JH7A 1L7DA 2LRHA 3YASA 1JEQB 3MJDA 5JSUA 3UKJA 4J3FA 1QPZA 2OUIA 2PX3A 4XTRA 2PKEA 2O4CA 1ECBA 4I7EA 3I92A 3SPXA 2CLMB 4HXYA 4F6RA 5AWFC 1U5BB 4FYKA 4GMKA 4KMSA 3U3KA 5EP3A 2XITA 3VKWA 2XZTA 2PZLA 2DY0A 1N6PA 5C5CA 1BFKA 4Y6PA 3GDOA 1WHSB 4M7RA 3A3OA 2QZ4A 2W0SA 4AZWA 1KPIA 3L9XA 3QE2A 1NGSA 2IYUA 1D04A 3WKBA 4BLPA 4Q02A 1CDZA 3FSGD 4OHFA 4C0JA 5C1DA 1ZGGA 1QQBA 1P4HA 2W98A 3U61B 2HBRA 1WE2A 3RG8A 2IDMA 5I01A 2Y2VA 4K3UA 3KWMA 3RFXA 2YR0A 3O8OA 4ZQHA 4EEKA 2RJNA 2POQX 4A92A 3W5CA 3CRQA 3UNXA 4R8MA 1RLIA 1EX1A 4F4DA 5ILGA 4OHCA 4AJIA 2V65A 1S2GA 5EMKA 5I6DA 2BFDA 5BN1A 2R60A 1DAFA 4XEUA 2V7WA 2H57A 3CPSA 4PLCA 2ZT5A 3JVEA 2YJ3A 3IPXA 4F8JA 3JRWA 4R8KA 3K94A 4B76A 3QBJA 1LUAA 5HA5A 3C6KA 2P1DA 1KGSA 4KUEA 4B7AA 4DMKA 5EHZA 1AK9A 1CLUA 1DCFA 3ZE8A 3OZFA 3SQDA 3TTTA 4BP3A 3A0RB 2AT1A 2Z4SA 1S8AA 1JMKC 3U4CA 2FRVA 3LTEA 1P3JA 2FMUA 3E7DA 1LCIA 2WJ4A 4V3BA 3K0EA 1CS4C 3I28A 1HL3A 4KN5A 5BO5A 1N5RA 3GAFA 4OFBA 4JIMA 4KE9A 2VHXA 4OIMA 1AMUA 4EYQA 1NJ2A 4LKRA 2EP8A 2ZSFA 4OBXA 1MAUA 1DJPA 2EZ9A 4L22A 4QTTB 3SAJA 3U4GA 2B1RA 4MNTA 2PKCA 5AKHA 2Q4TA 1Q1BA 1SXIA 4AO7A 3TZQA 2XX3A 3G9UA 1C0IA 1PTJC 1S8OA 2QM0A 4HNSA 3OURA 3LHSA 4L5JA 2GAOA 1L4BA 2MINB 2A9OA 3NOXA 3RASA 3B13B 5ENDA 1OXKB 1U3WA 3HDVA 3K0KA 1F8GA 3OP1A 3VHXB 5K51A 2F1OA 2XRMA 1RXVA 3HMKA 1JJ7A 2XT0A 4HS4A 1VKRA 3BZWA 3IPAA 3OPYB 4HDKB 3SZ3A 4CN8A 1H0HA 1BJRE 3D7KA 3OLCX 3S1AA 3FWZA 4BUJA 1UP6A 3EDMA 3ZBUA 5GADl 5IZCC 4U7JA 4N6OA 3EVEA 4F96A 1Y4SA 3VR6D 1MORA 4BFLA 2V58A 3D4BA 4JP3A 4MDHA 4TWAA 2ZAOA 1MABB 4KVGA 3ZZMA 1BDHA 3B7PA 4M0FA 1NSTA 2LVBA 1HDYA 4QGSA 3WHPA 3HKBA 3IEMA 2KW5A 4Q5IA 1MTOA 2BFFB 3PPIA 5DM2A 3D5TA 3F5SA 4Q7KA 3UKOA 1ND5A 3M83A 4PXSA 4WFJA 3UOWA 3AF4A 1UBSB 1QFMA 1EUZA 3JS5A 5FTLA 4URWR 4RDIA 1Q1GA 4EYKA 5FR2A 5HR5A 1N2IA 3IDFA 3OKFA 4YECA 3ZGZA 4AURA 4PTLA 3ZE1B 4YT5A 1UKAA 3PHGA 4RMNA 3BXOA 2C61A 2YMMA 5FLKA 4M9ZA 3E0QA 2P0YA 2X5XA 3LPLA 4HYYA 4OPMA 3SZMA 3ZS8A 2Q5HA 5EZYB 1BWPA 4K6KA 2JNWA 3ZVRA 4W5HA 5FEMA 3X44A 2VYCA 4UOQA 4A27A 1WPGA 4RNCA 3MUEA 1UK7A 2PPVA 3TRIA 1OFGA 1P0CA 2ZYHA 3CJTA 3QEKA 4BASA 3KEFA 5JSFA 3I1YA 1UBFA 2OCYC 4BBPA 5G0SA 1XD2B 3L7BA 4W5WA 5J5AA 3SFZA 1JZQA 4N1AA 2Q27A 1AQYA 5ALHA 1HETA 3RV3A 1Q7GA 1M33A 4FKBA 4TLAA 5DWDA 4BEVA 4DV5B 4K26A 1JVBA 1MN6A 5BMVA 4CKYA 1RHQA 4O2AF 2QRZA 1HLDA 3G79A 5ALQA 2VS1A 5T5QA 1QAMA 3HO1A 4EKIA 2SICE 1T5HX 2K4MA 3DZBA 3A04A 1E1KA 3VISA 3SI7A 1Y4DE 3BD9A 3WGKA 2VTBB 4ZCMA 2ZI7A 2XMBA 1R0YA 1RXEA 3KXLA 5J43A 1ZIYA 4Q3CA 3SQOA 2JATA 4QOIA 3K8YA 3MWEA 1EH5A 2A6PA 4D9NA 1RP1A 2GA8A 2P7IA 2R79A 4YCAA 3AVXA 2QTBA 2HIMA 4CEJA 3SC3A 1UBEA 3JATB 2GI4A 1GPJA 5B3AA 3T5CA 2JIOA 3LA6A 4H3SA 3P5SA 1VHJA 1TF5A 1ZCFA 2XD9A 2HK9A 3T9CA 4Q7QA 4S04A 5LMUB 3B53X 1C3XA 4LWPA 2JLZA 3PNOA 5L7YA 3KQLA 1J09A 4QDUA 2V5UA 2ZT6A 3DCIA 5ALTA 2BGUA 1C9JA 2CD9A 1PGNA 1JHPA 3C4JA 3K09A 3S81A 1WABA 2OY0A 3DMGA 3K9WA 2ATEA 2JZOA 4YLYA 1SIUA 3BN3A 4RU1A 2AZXA 5JZOA 4EJMA 3H2HA 4O08A 5EN4A 1VLHA 3RE1A 1QZXA 3T9BA 5KTYA 1HE5A 3HVIA 4G41A 4ONEA 4BB6A 5K3CA 1ZGHA 2ZM5A 3TKLA 5HFNA 1VLLA 1JFFB 1ZOIA 3LCJA 3MQ2A 2NZ8A 2ODWA 4N47A 3VU9B 2JPDA 5BSMA 4E3WA 5GM2A 4ZJYA 3F9RA 3HGMA 2KYRA 1SCUA 1CXZA 1NKTA 5KQSA 5AM4A 2YY6A 2NO9A 1ZK4A 2Z2ZA 3GEBA 3QLJA 2IH2A 1YQEA 2WG2A 2X15A 2EFYA 3VC1A 1QDUA 5CYOA 4L4SA 1ODSA 2LW7A 1CRZA 4RWEA 2O8EB 1IIRA 4YFYA 4XB1A 2P6MA 1D7AA 2FPOA 2R6CA 2PDAA 2ZKIA 4TXMA 2ZB3A 5AESA 2DWCA 1KAOA 3MAAC 3LXUX 3U3OA 1V6SA 3UICA 3FPBA 2V98A 4R83A 2N42A 5ED4A 1O9HA 5DBEX 5K99A 4B9AA 2Q07A 4DDHA 4ZZ0A 5TXGA 3NP9A 4GZ3A 4KNVA 3RUHA 5JVDF 4JT8A 1ZDMA 2XVYA 4G8DA 3WA6A 1T5OA 2IYSA 3PA8A 3WMGA 4C7JA 4O1IA 4C1BA 1QE3A 3K32A 5KTRA 2AUTA 4NAHA 2CZCA 4YQZA 1QOPB 4RA9A 2DFDA 5ILQA 5COAA 4ZYLA 2PGJA 3SEZA 2PCLA 2PLRA 1RU3A 4Y0AA 1XKTA 3VJLA 4AKIA 1VJTA 3ETLA 4IY1A 3HR4A 3KUXA 3JVIA 1ZVKA 3N3AC 1P2DA 3PR2B 1OIVA 1NVAA 1Q5PA 2R8EA 3GUVA 3R7NA 3FAZA 1R66A 4PX2A 1W1WA 1IM2A 2QJWA 2W83A 3LHDA 1P3DA 4P31A 5CTJA 4C05A 4RTSA 4X8OA 2XTNA 1Z73A 5GM1A 3SEQA 5JNSA 4EGCB 1RRFA 3HFGA 3AW9A 1WLYA 1HDRA 2GX6A 3F7TA 4G9EA 4HNRA 1V16B 5EIWA 4Z49A 3HSKA 5DMHA 1LS1A 2R6HA 3G5TA 2NU6A 7GPBA 4EB6B 2HO4A 1Y3BE 2PXCA 3AW8A 3D4IA 4TRMA 5L4LA 2BM1A 1CQJB 1XNRB 1L8LA 5ELMA 3ABIA 4G5RA 3WDLA 1K27A 1LBEA 2F3QA 5KYUA 3A28A 3DZHA 2GFHA 2XPCA 4RS3A 1BWRA 3MEQA 4Z7OB 3IEUA 3S8EA 4MGYR 4BTLA 4XE5A 1NXSA 1EA7A 1Y98A 2YZ7A 4MRSA 2J9ZB 5FNVB 1H2WA 4W7SA 5ELXA 1QP7A 4FK8A 3QPDA 1VM6A 1UPAA 3AERB 3IMEA 2DBRA 2QT9A 5JCOA 2ZXEA 2NYVA 1YS4A 3DVAA 1DZ3A 1XDGA 2DKFA 2PAAA 3V4LA 1SCBA 4MWGA 5FV7A 1MQ9A 4L76A 1BFUA 4KMOA 2D8MA 1Q14A 5K8JB 3OMLA 3H3JA 1ZSNA 2YN2A 4ER3A 1Z5ZA 2J6IA 3IIJA 4IWNA 1ENPA 3P27A 3MMNA 4JUAA 1CUVA 3ND7A 4JKIA 1CQIB 1XEWY 1ZQ1A 4YQFA 4MR9B 2Q5FA 4IO1A 5BVHA 1TF7A 3KZMA 1PS8A 1O94D 4WFIA 3W05A 2ECPA 3JW8A 1XK6A 2XAAA 2Q3LA 3DZJA 3HU5A 5KU1A 1KBQA 4QEKA 1MEEA 1GPDG 4BQQA 2I6UA 1A5AB 2PR2A 1W581 2RGYA 2W8BB 3G2QA 4MX8A 3BJIC 3DA8A 4PE5B 4PPYA 5ALEA 2JH9A 3KR0A 2A8YA 3G7SA 1ZHFA 3ZI7A 3TFOA 1H2BA 1JW9B 1ZK0A 2V7BA 3ELUA 2ZWVA 1MT0A 3KKOA 3O74A 2BEUA 3FROA 3O31A 4OG2A 2QU8A 5BUCA 3UF0A 1FNBA 3FKJA 2C95A 4JHLA 5LMZA 1R2QA 4OM7A 4NX2A 3PVZA 2C4UA 3IAXA 4QU8A 1TZCA 2J7PD 3RIHA 3ZX4A 4OMFG 2BKXA 1MV5A 4ARCA 1VFNA 2YNMA 1M10A 2RI6A 5KSOA 1KHTA 4YJGB 2BFMA 2A0WA 2QZJA 3RUAA 3RYHB 3VPGA 3G0CA 2WLSA 5FUMA 1NSFA 2W4MA 4HFRA 2QVLA 2WPDA 3IAAA 3U3MA 1KFJB 2XRZA 2F8MA 1HDXA 1LY1A 4U7HA 5A4DA 2Z04A 3BT7A 3RSFA 1YJ5A 3PHJA 4B3GA 1EHYA 1UKBA 4FYMA 3R3ZA 4O4JF 1B8PA 1VL2A 2Q28A 2PD6A 1X80B 4MKXA 4A8TA 3THXA 5IABA 3EZ9A 4KAJA 3ICVA 3FOZA 2AN9A 4DRZA 3WYFA 2Q6VA 2PT5A 3IRUA 2IF2A 3QVTA 3ZHCA 2VF4X 1Z5GA 3Q5EA 4XYBA 3LCCA 3EXHB 1DTWB 1KZGB 2FFRA 5KYGA 4BN0A 3KFVA 4WZ6A 1GTMA 2P4QA 4WDRA 4BNXA 5BW4A 3IAUA 1Z39A 2REOA 3NZEA 5L7WA 5J1SB 1GUYA 1MG0A 2O5CA 1Y8QA 1ZD4A 1XVIA 1XTKA 3H1GA 4K6HA 4OATA 5TLSA 1VKHA 3C1TA 1P0IA 3QSYA 4RF3A 4PC1A 2C83A 5CDTA 2YRWA 1APBA 3C24A 3QTBA 3UXEA 2DHEA 1AQJA 4QYTA 4GQIA 1Y81A 4YJHA 3DOEA 4FI3F 2TYSB 3KT0A 4K86A 4ITRC 4PPNA 3WLAA 3IT1A 1NXVA 3DMTA 1R8XA 1SA0B 1BVYF 2H1IA 1NMQA 2JK0A 2YCLA 1KXJA 2XI4A 2GRAA 3ENZA 3F97A 3ICOA 2ZYSA 1XOIA 3WFZA 4EJ0A 1T1EA 4FNAA 5FDFA 4MKZA 2L42A 1JKJB 4OSPA 4QYXA 2AZTA 4EP1A 3PUKA 3R74A 3W6PA 3ITKA 1E1CA 1XA3A 3P7MA 2CLOB 4LRWA 1HKHA 3KAPA 3JSXA 1QNFA 1VQ1A 4DABA 3ASYA 1JFTA 1PFWA 3KQNA 4PQGA 3RS9A 4M6WA 1SVWA 2XEDA 3QFSA 4YN3A 3X2SA 1JT2A 4QJBA 1UDXA 1YDEA 1ZU5A 2VDWA 3TZCA 3OX3A 4PPQA 4CIDA 1P5HA 3AHDA 3H97A 3GN2A 3RT9A 3I83A 1YDGA 4M76B 2BF4A 4BQEA 3K70C 1GFSA 2WE8A 3CB2A 2O0KA 4TT3A 1DAMA 4YJFB 5T57A 5ITVA 1GZHB 4XJVA 3GJQA 1NNUA 2ZIEA 4LE1A 5CVDA 1V47A 2WUEA 1LDNA 5ICGA 4NP6A 4PC6A 1N2XA 2ZB8A 2JFBA 1MJNA 1XE3A 3RT1A 3A05A 4J7AA 3F6BX 4BWFB 2WT8A 4I2NA 1Q83A 3BCHA 1N75A 3OEHA 3OH8A 1DUSA 2OD7A 2MSDB 3O47A 4PZAA 5E4JA 5J58A 2W2LA 4LHXA 3UGJA 3KZ1E 3HJUA 3C7DB 3HYNA 1C3EA 1ZEJA 3L1UA 1DFGA 1RBQA 1Z7GA 5F21A 3AUYA 4GUAA 4YPFA 5MFPA 3DTVA 3O1LA 4GSYA 1X77A 3SLGA 3W2TA 3PHLA 3D6JA 5F51A 2WKSA 4TV8F 1NYQA 2E87A 4TSRA 2VCHA 2ZE6A 5B6PA 9ABPA 2VUTA 1JDTA 3QQPA 3QTLA 4MWZA 1HQKA 4HRXA 2GZAA 4KIWA 3AESA 4PZLA 4ZMBA 2XA2A 4MCJA 2GRJA 4NPAA 1G6Q1 5KOHA 1ENZA 1U0FA 1N0VC 3ZWPA 1BO6A 2UXDB 3PR3A 4ZMRA 4X45A 1NQAO 4EG0A 3CUTA 1G3RA 2EHJA 1M6VA 2Q5LA 1WV0A 1QRRA 3A3KA 3DOIA 3IP7A 4ARZA 5A5GA 1ZVQA 3CRVA 4FB5A 2O7SA 2PX5A 1M6NA 4MPTA 6LDHA 2VYQA 2WICA 1KI1A 2ZR7A 4Q7MB 5LL6P 2P3OA 1JZSA 4IX1A 2I55A 4N76A 3H42B 3QVWA 1IJBA 3GDFA 1M7BA 1V4NA 2GXSA 3IHTA 3LDGA 1DAHA 2P2LA 4M87A 3ZJYA 1CDDA 1FFXB 1JPUA 1OWOA 1SQ6A 2CWWA 3Q7QA 4ZZ2A 4CMIB 1LDMA 1VCOA 4CCYB 1QJ4A 3E7FA 5JH7B 1XI2A 3L0IB 3GJZA 4CIVA 4FNMA 3L04A 2VUHB 3LT2A 5T4HA 4EBBA 1YCGA 1AKVA 1XYYA 1G291 1NULA 1TTPB 3C85A 1XZPA 5AVUA 3O2SB 4TYWA 1HFJA 3DKIA 2G17A 4J1SA 1G8JA 1QGUB 5DCYA 3J81A 5K4GA 3TG8A 4BMNA 3NEPX 1PN3A 4PRLA 4YMHA 4DV2B 4ALJA 3I9OA 2Q0QA 2QMUA 1YIAA 2OBXA 2WIGA 3KB1A 4R9SA 5IDWA 2F1JA 2V4UA 3VJKA 3LZDA 5CFLA 4EHDA 4Y8VA 3TAUA 4CM9A 4D80A 2C4WA 4ER5A 1XTZA 3ZU5A 1IHOA 4FONA 5GONF 1JSLA 1L2TA 4MKGA 1WZEA 4IMJB 5CJPA 1JHZA 1A8QA 2GR9A 2XQJA 2FFQA 4ZO6A 2QAGC 3HRKA 2F62A 3FZQA 3EF0A 4J0CA 1BZYA 1EFVB 4AF8A 4XD7A 1ZUNB 1OAOC 3E61A 4TVKA 3UY4A 2II6A 2VJNA 3H1PA 4IIJB 2OQRA 1QHIA 5LOVB 3PCTA 2DTDA 5CNMA 1VHDA 3DTTA 4B4KA 2J9FA 1XJWA 4K9OA 2DR2A 3DE3X 4NCHA 1MENA 5F2NA 5BNFA 4V2IA 1RDFA 3LW8A 3FMPB 4FFVA 1CZHA 1KI4A 4MH0R 2CL0X 4ETIA 3A1WA 1IJKA 2FLKA 5K7SA 1XA4A 2RH4A 1B42A 1H0SA 4LZNA 3EZYA 4NVRA 1A5ZA 1Y6JA 2ODBA 2F8LA 5BSG