1GPUA

Transketolase complex with reaction intermediate
Total Genus 250
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
250
sequence length
678
structure length
678
Chain Sequence
b'QFTDIDKLAVSTIRILAVDTVSKANSGHPGAPLGMAPAAHVLWSQMRMNPTNPDWINRDRFVLSNGHAVALLYSMLHLTGYDLSIEDLKQFRQLGSRTPGHPEFELPGVEVTTGPLGQGISNAVGMAMAQANLAATYNKPGFTLSDNYTYVFLGDGCLQEGISSEASSLAGHLKLGNLIAIYDDNKITIDGATSISFDEDVAKRYEAYGWEVLYVENGNEDLAGIAKAIAQAKLSKDKPTLIKMTTTIGYGSLHAGSHSVHGAPLKADDVKQLKSKFGFNPDKSFVVPQEVYDHYQKTILKPGVEANNKWNKLFSEYQKKFPELGAELARRLSGQLPANWESKLPTYTAKDSAVATRKLSETVLEDVYNQLPELIGGSADLTPSNLTRWKEALDFQPPSSGSGNYSGRYIRYGIREHAMGAIMNGISAFGANYKPYGGTFLNFVSYAAGAVRLSALSGHPVIWVATHDSIGVGEDGPTHQPIETLAHFRSLPNIQVWRPADGNEVSAAYKNSLESKHTPSIIALSRQNLPQLEGSSIESASKGGYVLQDVANPDIILVATGSEVSLSVEAAKTLAAKNIKARVVSLPDFFTFDKQPLEYRLSVLPDNVPIMSVEVLATTCWGKYAHQSFGIDRFGASGKAPEVFKFFGFTPEGVAERAQKTIAFYKGDKLISPLKKAF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TRANSKETOLASE 1
molecule tags Transferase
publication title Snapshot of a Key Intermediate in Enzymatic Thiamin Catalysis: Crystal Structure of the Alpha-Carbanion of (Alpha,Beta-Dihydroxyethyl)-Thiamin Diphosphate in the Active Site of Transketolase from Saccharomyces Cerevisiae.
pubmed doi rcsb
total genus 250
structure length 678
sequence length 678
chains with identical sequence B
ec nomenclature ec 2.2.1.1: Transketolase.
pdb deposition date 2001-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00456 Transketolase_N Transketolase, thiamine diphosphate binding domain
A PF02779 Transket_pyr Transketolase, pyrimidine binding domain
A PF02780 Transketolase_C Transketolase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.920 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1gpuA03
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1gpuA02
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1gpuA01
5HHTA 1UMBA 1DTWB 1OLUA 2Q28A 1IK6A 4MZXA 4RJKA 5C4IA 1OLXB 3AHDA 2XTAA 1U5BA 3IAEA 2EZ8A 2PGNA 1V1RB 3JU3A 3KOMA 4RJJA 3AHHA 2G28A 1UMDA 1L8AA 5DGTA 5AHKA 2VBGA 2VJYA 1X7WB 3FLMA 2C3OA 3EXEB 3DUFB 2FWNA 2IHUA 1BFDA 3F6BX 2BEUB 1YBHA 3LQ1A 4K9QA 3LQ2A 3OOYA 1T9CA 2BFDA 5EXDA 4JD5A 1TKAA 4MQ5A 1UM9A 4ZP1A 2YIDA 2BFBB 1V11B 1YI1A 2X7JA 5DGDA 1PO7A 1Y9DA 2WVHA 3RIMA 2BEUA 1RP7A 1YNOA 2EZTA 1X7YA 2VBFA 1T9BA 1W85B 4KGDA 3AHGA 5HGXA 5EJ6A 1T9AA 4Q9DA 1AY0A 2EZ4A 3HWX1 3HYLA 2Q5OA 2W93A 2JIBA 4KXYA 2R8PA 4FEEA 3EXFA 2C3UA 1OLSB 2J9FB 1PVDA 2AG1A 2BEWA 1V1MB 3EA4A 3UPTA 1X7XB 4MPPA 5FEMA 1OVMA 4QELA 2FN3A 1YI0A 2VK4A 3EXIB 3EYAA 1POXA 2V3WA 4GM1A 4GPEA 1PI3A 1TRKA 1W88B 2BFCB 3AHIA 1OLSA 2JI9A 5EJ7A 1POWA 1V5FA 4JUFA 2JI8A 4K9KA 5EJ5A 2PDAA 2OZLB 5EJMA 2BP7A 1UMCA 4QQ8A 4KXVA 1NI4A 2BEVA 5EXEA 5ESDA 4D5EA 4COKA 2C31A 2JI6A 2VK1A 1ITZA 3ZHSA 1GPUA 2Q27A 2Q5LA 3AHEA 3EY9A 3AI7A 3LQ4A 4KXXA 1UMCB 3DVAA 1QPBA 2Q5QA 5K3SA 2O1SA 3HWWA 2YICA 1W88A 2R8OA 3M34A 2BFCA 2Y0PA 1V1RA 2PANA 1X80B 3EXG2 2JLCA 1V5GA 3OE1A 4FEGA 3ZHUA 2BFFB 3EXHB 2UZ1A 1UMBB 5ERYA 1TKBA 2C3PA 1PYDA 1U5BB 5I5EA 1OLXA 3AHCA 5I5GA 5ERXA 2C42A 2BFEB 2EZ9A 2BFDB 4C7XA 3DV0A 4JUDX 1UM9B 5I4IA 1Q6ZA 4KXUA 1T9DA 3DVAB 2NXWA 1R9JA 5HYVA 5I51A 1V11A 2G67A 2VK8A 3F6EX 4JU8A 4JUAA 4K9OA 4K9PA 2Q29A 2XT9A 3ZHTA 4GP9A 1W85A 1X7YB 3DV0B 2BFEA 3DUFA 2C3YA 2IHTA 3UK1A 3ZHQA 2EZUA 2JI7A 3IAFA 3LPLA 1WCIB 1X7ZB 2Q5JA 2G25A 2O1XA 2BFBA 4MPJA 2BFFA 2JGDB 4C7VA 3EXHA 1OZGA 5EJ8A 5EJAA 2E6KA 1TKCA 4K9NA 1V5EA 3EXIA 5EJ4A 5K2OA 1JSCA 1NGSA 2QTAA 3AHJA 2R5NA 2C3MA 2DJIA 4D5GA 5K6RA 3EXFB 4QPZA 5EJ9A 4GG1A 2XT6A 3FSJX 1QGDA 2BEWB 3M7IA 1X7XA 1YD7A 4XEUA 1V1MA 2J9FA 1N0HA 3M49A 3M6LA 1V16A 3FZNA 4WBXC 1OLUB 1DTWA 4K9MA 3MOSA 2BEVB 1B0PA 4JUCA 3ZHRA 5IMSA 1WCIA 2IEAA 1X7ZA 1Z8NA 1UPBA 1QS0B 3L84A 2JGDA 3AHFA 2VBIA 2WVGA 1UPAA 1YHZA 2UZAA 1YHYA 5K6TA 4JUBA 4MPRA 2OZLA 1NI4B 2QTCA 2IHVA 2BP7B 1OZHA 1OZFA 4K9LA 2JLAA 2PGOA 3E9YA 1X7WA 3EXEA 1QS0A 5DEIA 5HJEA 3D7KA 1UPCA 2WVAA 1ZPDA 4JU9A 2AG0A 1X80A 1MCZA 1KEKA 3EXHC 3EXG1 4GM4A 4GM0A 4KXWA 4RJIA 3ZHVA 1UMDB 1V16B 2UZ1B
chains in the Genus database with same CATH superfamily
4Z0PA 3CGWA 2HFJA 4AVYA 4OH7A 3PXBA 3WIDA 4XTCS 3GEDA 5JUWA 2H48A 5HCNA 4HNVA 1ZI8A 4CQMA 2CXSA 1EHIA 1RBMA 4RTMA 3DCYA 5JANA 2WTMA 3IMCA 4S05A 2C82A 1CXZA 2BCEA 3A25A 3NKFA 2ZJ4A 4B34A 1SB8A 2IHUA 1NY5A 3ENNA 2D8AA 3ZGLA 1NXXA 3KALA 3HV0A 5EJEA 4G1BA 1RP1A 2BE9A 2E4ZA 3H1AA 3UKOA 2F55A 1PYOA 5A3SA 2PRSA 1W73A 2QR2A 3MUEA 4H4DA 1LSSA 2C8JA 4ZK2A 4IZOA 3VSCA 2B6NA 3QU5A 1N3YA 2I71A 4X1IA 5JO9A 1FNSA 3HWX1 3SM3A 1XRJA 4W5HA 1MPTA 1O8CA 1A9PA 2OK8A 1T2FA 3GNQA 4HDKA 3KPUA 3BHJA 4MYCA 3B7GA 3PVZA 3FRIA 4RAOA 1A2KC 4Z9BA 1QYCA 1ORHA 2VXOA 2VYQA 3ETJA 4LRXA 4HQ0A 1A9SA 3FVWA 1QYVA 3V7FA 4GDFA 5E1DA 1SC1A 4NCAA 3RIXA 3R3WA 4D1YA 5AQ1A 3AKZA 3UW3A 2RGRA 1CUBA 2DR0A 3LF1A 4RELA 4AY6A 1Z2EA 5BV2P 4FYIA 3W6OA 2OHIA 4GVPA 1GPUA 3DA8A 4Z4CA 1Y3AA 3I83A 3P96A 4Q9JA 3NYIA 3BPSA 4J3NA 4KXXA 2EKQA 4I2VA 5J63A 1JUDA 4EP1A 1RADA 2AC2A 2ETVA 5KJ6A 3N39C 1H2EA 3LUPA 3TTWA 4BLQA 5BNWA 4YH1A 3D4OA 1VCIA 5CT5A 1Q1EA 1V1RA 2EBHX 2C95A 4OXNA 5KOJB 2ZR7A 4IJWA 1RMTA 4E5VA 8GPBA 5CUQA 3HA2A 3HBMA 1KS2A 3IE2A 3ER9A 5EIAA 1RLTA 1ZJ4A 4BO3A 3C4VA 4QTYA 1T6BY 2CJWB 3SBEA 3N70A 4OB6A 4ZTUB 1FFDA 5E2AA 5FLKA 1QH8B 1EFAA 3ZQJA 4JYMA 3RRBA 2EYQA 5J47A 1P33A 3BREA 3T52A 2JH8A 1B14A 4WFIA 1ODIA 4PN7A 3R0ZA 5JFOA 1UBMS 3GAZA 2XYQA 3JD2A 3PRKE 3M33A 2NGRA 1I9GA 1IVNA 5FI5A 4ZVRA 4P86A 4Z54A 5BSEA 5HCUA 2PQ2A 3ZV5A 2AC7A 1NUHA 2P2ZA 3THYA 2HHLA 1KF0A 1YAJA 3VYTB 1NV9A 3ZDQA 4Q4LA 5F98A 2H65A 2WU1A 4GNRA 2X40A 1KMHA 1QMPA 3PFIA 1R10A 4J7AA 4JH0A 4Y1RB 5ALQA 3A1DA 3E9CA 3JQRA 1NATA 1NKSA 2WABA 5G1NA 5CBPB 5KYWB 3FHLA 3FFBA 1J97A 2BEVB 2OCLA 3LC0A 2QM8A 2F4NA 3M3PA 1HMYA 4HCJA 1CZKA 1VBMA 1GN8A 5E2BA 5FB3A 4XIJA 1YR7A 5HRUA 2ILTA 1MVOA 2CNBA 3OWOA 4AJJA 4PC2A 4QZVA 3ETEA 3PE4A 4QRHA 3E7FA 3AF5A 1KU6A 5I3ZA 4B3GA 5EKSA 3TL2A 4ALKA 1JVSA 2AV6A 1NN5A 4HDQB 3ZBPA 1CUUA 3EW7A 4GGPA 3CIFA 3WQHA 1PEDA 3EXG1 1Q84A 1VZ2A 2A2ZA 2A59A 4KXWA 3W7BA 2HZ7A 5A9SB 4PGMA 4ETIA 4PLCA 1MX9A 1CB0A 2G9NA 4R0VA 4DN6A 5KQMA 5B64A 3NOVA 2XOEA 3MGCA 3IKLA 3GL9A 3M1LA 4CHGA 1XLTC 1P9RA 2A94A 3F8SA 1NNEA 3I9JA 4GYYA 5K8CA 2WMOB 3NPMA 1RRFA 4MQFA 4CGZA 2XYVA 4IG4A 4M46A 3O82A 1VSTA 2OV6A 2ZUDA 5CH5A 2ZAOA 1JQKA 3MAAC 3IP9A 1E3EA 2ZT6A 5CK5A 1YUNA 4ZXFA 5LIPA 3O3CA 5AUPB 5B1YA 1A2BA 1R3UA 3H8VA 1CUAA 2DFDA 3N7UA 2C9BA 3OZEA 3O3MB 4J0FA 4RSHA 4MVWA 3Q9LA 4E13A 2MCFA 2UU9B 1FJGB 5JSZB 3PR2B 3ZXUB 2XRMA 1YK0A 1ND5A 1OWNA 2HRRA 2J3QA 2GVDC 2ZUUA 3KQVA 4FWTA 4F38A 3B1FA 4X6LA 5FOQA 4DLLA 1IHUA 3IXLA 3UJ8A 3W2IA 4D8TA 1X1BA 1LI7A 2QMYA 3OIFA 3JCZA 4B87A 3MHTA 1ODLA 1CPYA 2JCXA 5JXWA 4PO3X 1MA0A 3FVRA 4HLCA 2HPAA 2HMVA 4FK8A 1VHDA 2RHWA 3C0KA 4TLBA 5HIJA 3BQNB 1X1CA 3TX6A 1H42A 5KSYA 2QNBA 2PZAA 2P6PA 1MG0A 1XTJA 1AGRA 1SXJD 3R6TA 2ZXFA 5AHWA 4A0HA 2I54A 1PZMA 1OTXA 4PO1A 4DVGA 5CDTA 2NOAA 4O6VA 4HLDA 3F67A 4L8VA 7GPBA 3A14A 5K8UA 4AUEA 4TV9F 4EG6A 1HDOA 2ZBDA 2QGFA 1TGYA 2B6HA 2HSWA 2LIVA 1S8NA 2RHDA 2YBEA 3CZPA 2BFFB 4H7DA 4ZQCB 1DAHA 4QBTA 3GLSA 3AVPA 1L4YA 4YAWA 1Z6PA 1HLFA 1S8FA 1GHTA 3ZCPA 5I7VA 3HXOA 1K6IA 1WHTA 3IQGX 5IH7A 4O4JB 2GDJA 2D7DA 3QI2A 5BVGA 3INRA 1D6JA 1EWVA 2GD6A 5LZ8A 1X7YB 3BF8A 1FUEA 1BTOA 4N8DA 2EZUA 1DC8A 3LG2A 2IS2A 1S6YA 1S1MA 3O84A 4G97A 5SV2A 5BQXA 3U09A 4JR2A 1RZRD 1E5VA 2HSEA 5ITSA 3BB4A 3H9QA 3PNMA 4O4JF 4CM3A 1B16A 1ISHA 2PX0A 3BL8A 3K09A 1ETUA 2B1GA 1BNCA 2A0FA 2G9QA 2WZBA 3I2IA 4FW8A 5DHRA 3BZBA 1YR2A 1P2GA 4U0JA 4FVTA 1ZESA 2FMFA 2VVTA 3S70A 5A02A 2YY5A 1JLLB 2J45A 4ZYXA 3C7AA 3QF7A 1EZZA 2P5YA 4DDTA 1W29A 3B1KA 3W9UA 4PX2A 4EUKA 1B0PA 2Q62A 2O07A 3SEQA 1QFJA 1FZTA 5D3MA 1PVVA 1PJTA 1JAHA 1NRXA 4R1NA 2F9FA 4MS4B 2EGUA 3KKKA 3ZHBA 4YRBA 2CSXA 4B85A 1HTWA 3SYKA 1DADA 2QTCA 5K3CA 1OZHA 2KI5A 3IAM1 3B9RA 3OT1B 3VYVA 1U0BB 1ADFA 4ZYTA 1FYEA 4P08A 5HJEA 5IJZA 4J76A 1X80A 2QPTA 1D2EA 2QX8A 3FDZB 3JWHA 4BXOB 1M0SA 2XTAA 1U1IA 3MUFA 4C4OA 1NQ5A 5LP6F 1NU8A 1GFWA 2QPAA 4AY3A 4BAUA 4FLEA 3TUIC 3AHHA 2E18A 2RGUA 1DBSA 1QFMA 1L7DA 5MN4A 4P53A 4G4IA 3LBYA 2FWAA 3F3YA 1YONA 4C0KA 1BEUB 4JEMA 4E08A 1G5QA 4K9SA 3TVDA 2WE7A 3DBVO 1AS2A 4ZQIA 5L95A 1K1EA 3L1UA 5LNK1 3TQRA 4X3OA 3TK1A 3TIXB 4PQYA 5JVDB 1WUJS 1Y9AA 2H5JA 3Q4GA 2RD2A 1WQ1R 4QEKA 3QJ5A 1ZQ1A 2J08A 3VR5A 4LPKA 1N8TA 5IYZB 1SUCA 3BBLA 2VHWA 3NR2A 1PV4A 3IP5A 5F9MA 4QQFA 3DAPA 1YBAA 4PXYA 4B9AA 1RXSA 4HNTA 3K7EA 1H9BA 2X6TA 2WF6A 3IPYA 2OUIA 4OHRA 3ZBUA 5FPYA 5IAGA 5LP6C 3A3PA 4WKCA 4HAUA 3OKPA 1CFJA 1Z7BA 3MWEA 3QKRA 4O2BA 5B2EA 3I2YX 3KSMA 4W9MC 1E64A 4JCOA 1TCCA 4TTQA 1R6DA 2YJTD 3H2BA 2P91A 3L8ZA 4IGFA 4PAGA 5DSTA 3IIKA 4ZGBA 1CC1S 4BX9A 1J4AA 3I04A 3K4QA 4WCVA 4ZI5A 4CTNA 1JKMA 2R1VB 2GCEA 4GPBA 3PHGA 1ZH2A 4WX2B 5EE3A 1BN6A 1N5JA 1BN7A 3RW9A 2DERA 2O3QA 3OU7A 2BCJQ 2IU4A 5REQB 5CDYA 1AXEA 2JCGA 4HWTA 3O4VA 5CM2Z 2QAGC 2NYRA 1UIRA 4HFNA 2J3DA 4OOEA 5DI3B 1FPMA 5L4SA 3JQBA 3L6DA 2WUFA 2V59A 2OHXA 3WMXA 4D0LB 4YGXB 4UUOA 5JCJD 1OH7A 3CPEA 2J09A 4X1KB 4U02A 3DEAA 1ZISA 2FFBA 3JZAA 3NBQA 5CXUA 5IANA 5T8KA 3HVHA 4EYEA 3T5CA 2VNKA 4UTRA 2WSLA 1BX1A 1Z4OA 2Y8EA 1PG2A 4J0HA 2A9FA 3JQAD 2HO4A 2GTHA 3JQFA 3UK2A 2HA4A 3LMKA 4M1KA 3DXXA 2RK6A 5CYPA 3SLRA 2O0JA 4JK3A 3IS3A 1Q83A 5C8YF 3F47A 3WL8A 3RASA 2CD9A 1BEZA 1TKCA 3X1MA 4DMFA 1GLGA 1QNLA 1UPFA 2P2CA 1H2ZA 2EDCA 3B51X 3IBTA 3RWOA 4C43A 3EQ8A 4TWBA 3COPA 3JX9A 2QTMA 3Q7IA 4NVRA 2FWJA 4U5XA 5JNTA 3C5WP 3PNQA 1D2NA 2XT6A 3LPDA 5J5VA 3OZRA 4IH1A 1VRVA 4ZRDA 2C9ZA 3PQEA 3OTGA 4PCUA 4UVEA 4EKDA 5H3LA 3GFBA 4JB3A 4M9ZA 3RHZA 1AQJA 4Q4JB 1O4VA 3TW6A 1QTNA 1JDNA 5K4GA 2BDUA 5FOVA 3KL2A 3VH1A 5B1SA 3K9FC 3K30A 3W8FA 1G3IA 3C3WA 2VWGA 2PZMA 2RH8A 1OU4A 3IB6A 3WLLA 1DEHA 5SYMA 4KLCA 1NI3A 1BD3A 1OAOA 1VA5A 3NHMA 3TM5A 1KHTA 3WJAA 5FTNA 5B1IA 2IX3A 2NZYA 1JHDA 1Q0QA 3IESA 4GBED 1KQOA 1ZPDA 3KUUA 3HJAA 4HGYA 1ZI9A 1KEKA 4C7KA 3KU4A 3OLVA 2G70A 5AT1A 3INYA 2EDAA 2F9LA 3VPAA 4YV0A 4FFNA 1R8QA 4WLUA 4HX9A 3RUAA 2DFTA 1SBNE 2AE1A 3OH8A 2HJSA 1SVIA 4R1SA 1TA0A 4D98A 1AGYA 3RQIA 1WAMA 1NHGA 5KYYA 2MIIA 2O14A 1OB2A 3NP7A 2ZS9A 5B7NA 1RWVA 2PG3A 4Z9XA 1E2BA 2IHYA 5D85A 1Z0JA 5K0NA 5TF0A 4F4UA 2UZIR 5ELXA 4AI6A 4L8WB 1TJ3A 1XHEA 4CDRA 1FZQA 3CFYA 2GEKA 4B74A 1PT9A 3WSVA 1D4FA 2YNMD 2ZI3A 4EQ6B 5F52A 3KSBC 1MOQA 2WHPB 1JF8A 2ZYAA 3QJGA 4KTVE 3NBYC 1AUPA 3GD5A 4M8KA 3DKPA 4OK3A 4BV9A 1I2AA 1KYWA 4UJ5A 3NH9A 4DR5B 4GQBA 4P33A 2O2ZA 4CDGA 4Y7CA 3ANNA 1OA1A 2PGJA 3J81k 2F17A 2OD2A 3WLTA 2HW8A 2RCNA 4FHGA 5DHFA 3REFA 5CM9C 1P5FA 2RMKA 5I9MA 2XGOA 3WLAA 3SNKA 2OZLB 1PL8A 1XL0A 1SY7A 4TZ6A 4N3CA 3D6AA 3ESXA 1AXRA 2W0SA 1CUHA 5FWDA 2XMRA 3I9MA 3KZMA 2VCHA 4HQRA 5EP1A 3NT4A 2VG8A 5JW6A 1IM2A 2ZWOA 3D2LA 4HYYA 3KVVA 4PNPA 2B3TA 5CIWA 5TPZD 1Y42X 3ADOA 3GLKA 5HFAA 3I62A 1ANKA 1VE1A 1VYHA 1L4FA 2HCJB 1FNMA 2QVYX 4N6NA 4C7OA 2GARA 4DLKA 5LKAA 4P6VF 1Y3DE 1EVEA 3HBFA 3RG2A 4ZI7F 3CPJB 1TK2A 3FPJA 3PIDA 5AKHA 1YC2A 4LWQA 5IVKA 4N3BA 2IPMA 1EFDN 3E2PA 3PDIA 1V7QA 4RA9A 3RJTA 4E5UA 1RJ9A 2VHVA 2NO5A 3L0OA 4FHCA 4UTXA 5EZQA 1JJ7A 3UJBA 4D81A 1J8YF 2GAJA 5JSFA 3FFTA 1L9KA 4BBJA 2Q29A 3JQ8B 4GP9A 5DK4A 4OXXA 3M6WA 4GR4A 1ISFA 4K8RB 3TBKA 3WL7A 3PQ4A 3GGSA 4UDOA 2M32A 5C18A 3W5SA 1J8FA 3FGZA 4CKCB 1T0HB 2Y0BA 4B33A 1PFQA 1SK9A 3KOZA 3QXHA 2XNDD 2YUIA 4JS0A 4KR7A 4ZIRB 1Z75A 4CUKA 1A9XA 4DSNA 3MYYA 2R97A 2CF5A 5ALRA 4ASUD 2XIJA 4RTPA 4AQYB 4KO8A 1VBKA 4L6IA 4MUYA 4DF3A 5KUTA 2BEWB 4ABTA 3D2BA 3PQCA 2IA5A 4XFDA 5KINB 2C8VA 2WSSA 4M83A 1TU0A 3PF8A 1DEAA 2W70A 1QIFA 2VP0A 4UCXA 2Z8ZA 2AJTA 5KNDH 1RPJA 3ZWPA 1P1RA 4BLRA 3STXA 4KMOA 5KTMA 3EX7C 3ESZA 5TEVA 4C78A 1WTAA 2HF9A 3GA5A 3KLPX 1HK7A 1UFKA 2A9JA 2GS9A 3C5HA 2XPCA 3L49A 4XDGA 5F78A 5FPKA 1FW6A 4CYMA 1QGZA 1W19A 2AG0A 1HKUA 1BE6A 3LBFA 2HMSA 4RDCA 1GUZA 4H1WA 1JFVA 4YO8A 4PG5A 3IJRA 3NS7A 3UA4A 2C54A 3BX1A 1MC4A 2PZLA 4GP7A 4RCYA 1E0DA 5F73A 1VKRA 3C3AA 4ND6A 4LXQA 1M8PA 1XTRA 2VT7A 1NWHA 2JEYA 3CZ4A 2JASA 4IOKA 4JL5A 5F3DA 1XVLA 3X3HA 4PONA 3ZQUA 4YDQA 4R01A 1VSVA 2F8TA 3U13A 4GWGA 2IUUA 4RDHA 3OOYA 3N0WA 2ZYRA 1OYVA 1H2WA 5KOHA 4EHLA 1JVBA 2MT9A 2QW8A 4RQBA 2DYKA 4JP8A 3V8BA 4BGEA 2FXVA 4UUNA 4GE0A 1CZUA 1AHIA 1CLUA 2WUGA 3AHGA 1F8UA 4JB0A 5JCZA 1QNFA 4AF7A 4XGIA 1HTBA 2FUCA 2R85A 2XOKA 3UT0A 1NVWQ 2HI0A 3DB1A 4LI3X 4JHLA 4BQIA 3KZOA 4X6UA 3OFVA 4Q01A 4HGOA 3U3XA 3AESB 4GS5A 1Y8ZA 3I6IA 5DX8A 4CKEA 2IPOA 4E3ZA 2WYUA 2C4UA 4NESA 1FK8A 1KO7A 1DQSA 4BKMA 3IALA 1B73A 1A7AA 2CDAA 4IQ4A 1PS8A 3JAWA 4EHHA 2EJWA 4EEKA 4F5YA 4JBXA 4Q9LA 1G5PA 1SUFA 3KAPA 1C8KA 2P2DA 2DPYA 1BS1A 4HPXB 5T4HA 1QC5B 5EEHA 3S1AA 4UBIA 3RC7A 1H85A 2WIJA 4XCXA 4N3GA 5AJVB 2GEFA 1QH1A 4WK2B 4KXLA 1EUYA 1EHYA 1G18A 1II8B 1U28C 3Q7TA 2ISSD 2LV8A 4CQMB 4R41A 3TQFA 1DUVG 4HRXA 1WP9A 3JQFC 3ZH9B 3EQ2A 2ZITA 3TQIA 3ZU3A 2Z58A 3ZDDA 1E3SA 1MG5A 1TAGA 2QV0A 1N6IA 3AHCA 1IZ9A 3ABSB 3HU2A 5EIBD 5HKAA 5JJBA 1DAKA 1FU7A 1UBCA 1Y48E 2BV3A 2LE0A 2DU8A 1O3YA 2PYDA 2W2TA 3F5MA 2OGSA 1PV2A 4KMMA 4XKJA 3RHFA 2V4UA 4Z49A 1EFHA 1WKBA 4FC6A 1YKFA 4D9MA 1EWQA 2VYNA 5L3SB 3QHPA 4MUFA 2KS6A 3I30X 1BDBA 3ZHQA 1AT1A 1NU6A 1OHHA 1Q92A 1UAGA 3NBKA 4L27A 4Y2YA 5DRTA 1U7ZA 2QN1A 4BRZA 4TKLA 3Q5GA 5THQA 3KYCA 3I73A 1GFZA 3JWPA 4DLZA 4IXMA 1S3FA 2DX7A 2J3LA 2X4LA 3L40A 4XLLA 1QZTA 4JLDA 1Q1BA 1XXHB 4J91A 2EQAA 3Q7PA 1K92A 3BTSA 4G84A 2XZTA 1WXWA 4EZBA 5AW0A 2XKKA 1TVEA 1W2GA 2J48A 3CRVA 3IKVA 2KB0A 3ICPA 4U7JA 2HEGA 1DJNA 4FJ2A 4IZIA 4EHAA 3M5CA 5DBFA 4EKNB 1ZN2A 5K20A 3LGSA 2FWIA 4YIHA 1XI2A 2MYNA 2WOJA 1QP8A 1UBGA 3N3AC 5DLDA 4LYAA 3ZXXA 1ML3A 3PFWO 2I2DA 1VIMA 3IUMA 4ZQGA 2VJMB 2R2GA 3GDHA 3UJAA 4DM4A 2J0VA 3ES9A 4O1MA 5TGZA 1R5OA 2CVQA 2X1MA 4HS9A 4IIYA 4EOGA 2VNJA 1ZU4A 2QV7A 1PS9A 2C5AA 5TQ0A 4RMJA 1HBJA 3EFOB 3EEBA 5AMXA 4YAFA 3F73A 2YYZA 2FGKA 5KU7A 2FA9A 2FMXA 5JT1A 3SHFA 4X61A 3TVTA 1HEIA 1X74A 1FDIA 1NP7A 1I51A 4TM7A 5REQA 1JHVA 1KZ1A 3EFEA 7REQA 2IZOA 2WILA 1RD4A 4LJ8A 2QRZA 4W8HA 2PKEA 3MINB 2PY6A 2QMEA 1JA1A 4GWLA 4WIAA 5ES4B 4I4TA 5EIBC 4DCMA 4MV1A 4Y8VA 2ZOSA 2QX6A 3FX2A 3QLTA 3B6EA 4QREA 4DIFA 2DQYA 3E15A 1NJGA 1AKUA 5DO9A 3DMGA 3GJ7A 5TS3A 5L3QA 3WB1A 5EKXA 4UPEA 4DNQA 4OXRA 1YXMA 5AKJA 4IO0A 2VZ9A 4XSGA 3KHSA 1Z4LA 5E8RA 3SEAA 3MTAA 4CODB 1VFNA 2EP8A 4IX9A 2BTEA 3GPCA 2VQ3A 3OIVA 2AZTA 3HCBA 4B7CA 4FCWA 3G0IA 4RGQA 1P62B 4HXEB 4F4DA 3VJRA 1TVKB 2HDHA 3QWFA 5CVUA 1OR8A 1X9HA 4YN3A 2INGX 3GRYA 1E79A 3KPYA 4JUFA 4ZKEA 1YFZA 3IHWA 4QULA 4MKIA 1G16A 3VZBA 1RPAA 2AQIA 1E9DA 4KK3A 5DB4A 2A78A 2E37A 3ORSA 3FOWA 4R2IA 3P0FA 2W11A 3I3OA 4OHUA 4DIUA 1QLJA 3CZQA 3HGMA 4JKYA 2VNIA 2Q1SA 4JI1B 5CDFA 3R1IA 3OAAA 4DLRA 1PWZA 3TRJA 2JS7A 3UXHA 1RZ3A 2GZHA 3O2QB 4AD8A 4E2XA 2QPLA 2VF8A 4JHXA 1ONOA 2OYRA 2ALJA 3GH3A 2AVDA 1IBMB 1YI8A 1MAHA 2R6JA 1Q15A 3HCPA 2A57A 2VEOA 3ODGA 3GPLA 1E77A 2WFLB 1OY1A 4W9NA 3CBQA 1O6CA 3HLYA 3RYCB 5KYUB 1MTZA 1NL3A 4H35A 2BGNA 4EGJA 3SBOA 1Z25A 2WF9A 2BFEA 1AQLA 1RI1A 2FY8A 2H9AA 2JFWA 4HYEA 4XJVA 1QG0A 4MJLA 4Y2PA 5DNEA 2LD4A 2N1MA 1IQUA 3WGGA 3E8MA 4XAQA 3U4DA 4A16A 1WABA 1GKIA 1DWOA 2L2QA 2R6DA 2FPSA 4HNRA 1PWEA 5GIOE 3QPVA 1KPGA 5THXA 3FOEC 3QA9A 3FTPA 3QM1A 4I9UA 4P4GA 1XDZA 4Q7EA 2BL4A 3P2KA 3U80A 5I9LA 4EUHA 3SWWA 3I09A 1SC9A 4WAUA 1OFUA 3ABOB 3UBTA 4GLLA 4TSFA 2ANCA 4WACA 5HQ3B 2X14A 1M2OA 4D9JA 4EA8A 4YPVA 3FPEA 3HVUA 2O06A 1C14A 3D1VA 2FKNA 1ECFA 1BJKA 2FPUA 2R0QC 1QG4A 4GMGA 4L78A 5KO2A 1JSXA 4D56A 2XNKA 1RWQA 1YDHA 3F8WA 3DMPA 5JNWA 4DLNA 2AJ8A 3O6VA 3ZPXA 5HKBA 3R3VA 4HL6A 4DG8A 5K2OA 3TKAA 1OJ7A 3I5MA 2XMDA 5FQOA 3D7KA 1UPCA 4E2YA 1SNYA 1W6RA 3ROQA 5AKZA 3GT0A 3UYKA 1I7SB 1A96A 1EP1B 5EFOA 2CCKA 2DZDA 1ZU5A 2WDPA 5IUJC 3CZCA 3Q1LA 4OHVA 5IW8A 5AW2A 1ID1A 1IBLB 3BMOA 2QN9A 1XO1A 1W35A 5C53B 1S3IA 2ESRA 2GPBA 3THRA 2O48X 1DMRA 2PWZA 1JKXA 1W30A 5M34A 2PX2A 1AKMA 2X19A 5ICSA 3KKZA 1K08A 2XKAA 5L3QB 5MDHA 3II6X 1F48A 3MGGA 5DM2A 2FWNA 2NP7A 4KBFA 1M2FA 4FYKA 5ALOA 1P39A 1T8WA 4IEIA 3R09A 4D9GA 3HNRA 4EBFA 4TVSA 4IIUA 4GPAA 2PFKA 2VI5A 2GMWA 1Q0RA 2O3UA 1CNMA 1JQEA 1SVLA 5HDQA 5HTKA 4BLVA 2C9DA 5JQWA 4IFIA 2XMZA 4GI3A 2VF4X 1WX1A 2J31A 4KGDA 2QUZA 5E0KB 3GMSA 1FTSA 1XA0A 3DKVA 4MUHA 4TMWA 4ZCSA 5DH9A 2CUTA 2FSFA 3RYHB 2W93A 4TKUA 2RGNC 1HYEA 1PTJC 2P2NA 3AEQB 1WUKS 1ILWA 1MT3A 3EC2A 3KSZO 5TB5A 3IVRA 4U00A 2IYFA 4ND3A 1J8QA 2FWMX 1UK6A 2IXDA 2J3JA 3U4MA 1K3TA 3EK2A 4Y6SA 4LF9B 3WQBA 2J3MA 3ANLA 1XRPA 2OGWA 3K6JA 3NRCA 1T3GA 3BGWA 1E9BA 3FR7A 1RQPA 1Z37A 3P2EA 1XJQA 4QQ8A 4X24A 3V6MA 3K4HA 1FQOA 2AMVA 2JJMA 3I72A 2P4QA 4HAZA 1E9FA 1KQNA 3T3PB 4Q6BA 4DUGD 5FUVA 3MTBA 1Y3BE 3M70A 5K3BA 1Q3TA 1VGRA 1XAIA 4G0WA 4YFVA 1Q2XA 1U0JA 5DBIA 2UYGA 3G2JA 1R5JA 4YUXA 2RCYA 5ICGA 3K9LA 2OAQ1 4NICA 2JHPA 4M7OA 2GDZA 1EXNA 3THSA 3CJTA 4GKVA 1QVVA 1BIFA 1LI5A 3OZAA 1H2YA 3RSFA 4MYSA 1G8MA 3EVCA 3QSGA 3PSAA 4Y9SA 1DKPA 2X7HA 2OBNA 1GGEA 3RFFA 3E7WA 2AMLA 2P4EA 3KJXA 6LDHA 10MHA 4HLUC 1GNQA 5F7OA 2FPIA 2IYOA 4WFKA 1L5MA 2V7TA 5JIBA 1O97C 1CUSA 4QGFA 1U9ZA 3FKQA 2ZFUA 3MB8A 1JX6A 2FFRA 1AKQA 2EJCA 2Q1TA 4YCNA 3I61A 4PN3A 3TIFA 1XCJA 2A58A 4RESA 5CFNA 4M2LA 1U80A 1V8BA 5ILOA 1JWBB 3B2QA 4MR9A 3AVQA 4MKZA 4RCVA 3OMLA 4RO0A 3RUDA 1LTKA 4RH3A 3EG5A 3OIGA 3DJFA 4FZJA 3SQOA 3ZNQA 4IVNA 4ZOQI 3QYAA 4HDSB 3WWZA 1XHFA 5CNJA 4E03A 4UBOA 2NU9B 4OREX 3AL0C 3Q7SA 2AZXA 1ZINA 4ALMA 5TPWB 1KFJB 3KJZA 3E9NA 1RWXA 3G9QA 2CXHA 1GUFA 3OPNA 2IOHA 3LVFO 3OWHA 3JYHA 5IBQA 4AAYA 1AO0A 1F7VA 4WXYB 2Y93A 1FSGA 3L3BA 3RC2A 3ZLUA 4CKXA 4PWYA 4GICA 2FV8A 1LLDA 2ZRNA 5C4GB 3SPXA 2ZBQA 1QS0A 4MV6A 1Z7GA 4C3ZA 2VQDA 3ZE0B 1GCUA 4Y9RA 2JGJA 3UH0A 3WMFA 2ZJ0A 3TL3A 2W43A 1SXPA 3QX3A 2C92A 1YTLA 2HQ1A 3OQPA 1Q1AA 2ORED 1XT6A 3PA8A 4RVFA 3V1YA 2PKQP 1NW8A 3MPOA 3LUAA 1QO0A 3WAGA 2JNWA 5KTSA 5JJLA 3QEMB 1R0YA 1VE9A 3CKKA 1YZVA 2P2YA 4LOHA 4XPZA 2PMFA 5CYOA 5I3CA 3SVLA 3TGLA 2C1ZA 3LQ2A 3OCZA 3FG9A 4JD5A 4JWTA 4B4DA 1HX7A 3PWTA 2B8WA 4R0MA 3O0TA 1C8BA 2RKOA 1E9SA 2PGAA 3AR2A 2H4HA 4UHEA 2GK6A 1ODKA 2ZTVA 3EMKA 4UMDA 2O7SA 2Y99A 7REQB 2GWRA 2R25B 3WWEA 3DBHB 4IJVA 4QO8A 3AIOA 5FTJA 2XE7A 1BOFA 3U4HA 4DCNA 2PMWB 6REQA 4KP7A 4NEGA 3DT8A 3JPYA 3I05A 3Q3IA 5BSHA 2DRIA 3QVVA 5PNTA 2MYUA 4OGGA 4NYIR 1G59A 5CTJA 3DEHA 3Q6NA 2CVZA 4RMIA 1D4ZA 1MAAA 2F43B 1WBBA 3D5TA 1BA3A 4JOBA 2GWHA 4QUDA 3S2UA 4IGAA 2RBEA 2Z95A 3FE2A 1RJFA 2ZS7A 3MB5A 4II2A 1O96A 1TDJA 1IXKA 3VVLA 2C1XA 2ODTX 5I7EA 1NKVA 3Q7RA 4CKYA 1CY7A 2Q0HA 3CEAA 1CUDA 1DARA 1QGUB 1NVAA 4IXWA 1O77A 5TARA 4QQKA 2HCRA 3NAQA 1LLUA 2X58A 5FTLA 1HRKA 4YALA 3D6HA 3H0KA 4HUQA 4JLJA 4WLOA 3V9PA 3WA7A 5BO5A 3RAEC 3GLIB 2ZRBA 3EG9B 5BVHB 5JYEA 3AY3A 4D6PA 4BMOB 1ZX1A 4DWJA 4NV3A 1HMPA 2WMNB 3U6BA 1FUIA 4R5MA 4WKPA 5CYGA 3ZLJA 4X84A 4U7TB 2FEKA 1HZZA 3IILA 2PM8A 1AZTA 3E4DA 4YMGA 4B44A 2QD2A 3W3AD 4QTZA 2WT4A 3KAQA 1NVVR 4B3CA 4KVFA 1P9OA 4XVRA 1U0OC 4DQKA 4N39A 4F86A 4M1MA 4F92B 4QGGA 2XHZA 3D6FA 1IVSA 1OQAA 3UGKA 2CN1A 1AIPA 1B6SA 1L6IA 2C04A 4OVKA 3PKZA 3Q41A 4PYMA 4R98A 4X7PA 1Q1NA 5D3KA 3AHJA 5F3RA 1V7CA 4PRKA 4JLAA 5JWHA 2PV7A 3PCRB 1FYVA 4HQFA 2YZNA 1N8SA 3QMMA 1MZPA 3OEHD 5DXJA 4E46A 3C97A 2HL6A 3L8MA 3VKHA 2AXEA 1JHPA 4DLWA 2ZATA 3IP6A 1LBSA 1T26A 2EERA 1U7UA 5LP6B 3NG1A 3VR5H 3VU9A 1LVHA 1XAHA 3AR5A 5A62A 4D80A 4U1RA 1XCGB 4F4JA 2FCRA 1XROA 1YJ8A 2IYXA 1IMOA 3OBBA 2D4HA 3QVTA 1IXSB 1LPAB 5J4YA 4BBPA 3Q7QA 1WUYA 2YWDA 4N5HX 4MKRA 1E79D 4OP3A 5SICE 1LRKA 2NPIA 5JSUA 3RDPA 2CMFA 3T4UA 1E62A 3A7DA 2VJLA 4GPTA 2UZ1B 3AILA 4MQFB 2QI9F 3FF1A 5LLDA 1J07A 4KQWA 3EGOA 2FG6C 3S8EA 3ANXA 5KOIA 1P0CA 4NHOA 2FPLA 2P78A 4LDJA 4PYOA 5JVDF 4F3TA 4F9TA 1IBKB 1K8RA 1C1HA 5A4FS 4RD0A 3SHQA 1D1PA 5AW1A 4NIMA 1T9GS 4AICA 1LWOA 2G3YA 2MOKA 3KZKA 1TJ5A 5EPEA 2IDKA 3ABIA 3BL6A 3GPDG 4JQOA 2BKVA 3RS8A 3RTCA 4MP3A 4JI6B 5JY1A 2LP4Y 2Z8XA 3ORFA 1K5DA 1MX5A 2DPHA 1HURA 2CHVA 3DE6X 2NT4A 4YO7A 3SC2A 5BR1A 4WK4B 3KR0A 3FNHA 1L5RA 4GXNA 1RHJA 3PSHA 1DPFA 1DX6A 1SC4A 1T9AA 2ZB2A 3QBTA 5CVJA 3LX4A 2ZRJA 4F71A 5CDFE 4DSTA 2AT1A 2PA3A 4BZQA 5DYGA 3UNXA 1EJ0A 3HZHA 3TBHA 1NZDA 3ET5A 2D0DA 1JEJA 5AJUA 1FUKA 4A1FA 5C37A 1GPNA 3KTOA 3F2VA 4PYJA 4R2LA 1H65A 4KQHA 3I37X 5F12A 1C3EA 2DUNA 4BC0A 2XNDA 3FNEA 3LA8A 3U7IA 3ZDZB 4NATA 4B7ZA 1TB4A 2O05A 3C39A 4ZEMA 4BWFB 5KNLA 1MJGM 1XEFA 4PIVA 4MWCA 2BLLA 2OLKA 3KE8A 2DHEA 5ED0A 3ZN2A 2X9NA 2GJ4A 4EEXA 2QRVA 2Q27A 3GJTA 4MS4A 5KEIA 3V8VA 4C0WA 5KWJA 1JBKA 1H2FA 5ER9A 2KQUA 4F0JA 3ABZA 3WHIA 2VYVD 3AUTA 2SKDA 3WFIA 2B5OA 1RCTE 4BB9A 5JZ9A 4JOQA 1XHLA 3UO8B 5CEFA 3AI3A 3VR2A 2Y1OA 2OCKA 2QMUA 3OZTA 4IX1A 1F60A 2PVCA 5G4KA 4I55F 3GCDA 2LIPA 5FV7A 2VT6A 1Q7TA 3VPGA 1PK8A 1TW3A 4S1TA 2VJDA 4IHJB 2O7VA 2YRWA 1TTTA 2F3PA 4OHMA 3RU7A 1G8KA 2DBQA 5AKGA 4QOGA 2I6SA 4M37A 3TOZA 3UMFA 1GPWB 3M1IA 4IJ6A 3ZWMA 3KQLA 2VFAA 1UWKA 4JKOA 1XQVA 2AFIA 3O9MA 4G8DA 3N74A 4JGGA 2W00A 5JHHB 2OY0A 4Q82A 2GN9A 4MULA 2BR3A 3WRWA 1DWPA 1G7CA 3IX7A 4ZOLA 4DSUA 5JH7B 2XQKA 3DB2A 1FLVA 3HLKA 4C29A 3GJ5A 3PQ2A 2PT6A 4F7DA 5CX4A 3HBAA 2IEGA 3A1VA 3V4FA 1EAYA 1N6OA 1P73A 4LVUA 2FEPA 2C3MA 2A0WA 1U1FA 1PQ4A 4OHXA 2BOVA 4FMDB 4DIEA 1G8GA 2PJZA 1ZKDA 2OBFA 4KXFB 3VKGA 2IZ1A 5HJ5A 3M6LA 3ZLVA 1F3OA 2OCGA 5TPZA 3FCEA 1TD1A 3IAS6 4WZBA 4EB0A 1HG1A 1N2HA 1D6MA 2XRYA 2ERYA 2JGDA 3WICA 4IDBA 1TL7C 5BUZA 5C81A 1FQWA 3EMBA 3U3ZA 3LJKA 3UMGA 1W4CA 1WY5A 3H6GA 1JKIA 1T3TA 4NABA 4I7EA 1N3BA 4AX8A 4O2AF 2YN0A 3OLWA 2BR4A 2IP2A 3D6JA 1XUOA 3SZUA 3ND9A 4LJLA 3Q0IA 5K05A 1ZCAA 2WT8A 2BI4A 3OZIA 3Q3JB 3KQHA 4TUYF 2B78A 3KQPA 3RB8A 3Q8KA 3GI1A 4PCAA 1VE5A 2X9QA 3I1IA 4F3RA 2B83A 1P2DA 2VJCA 3PQDA 4HAWA 4ZHQA 2H6EA 3QVJA 5A4IS 1WS6A 2EL9A 3N76A 3O8OA 4CM4B 2O0LA 5L40A 3AVVA 1MFPA 3OE5A 3VJLA 4BO8A 1L7RA 1XEAA 3ELBA 1XC7A 2QMOA 3IURA 4JLBA 1WVIA 1MIOB 1Y9DA 1OPRA 2XH8A 4CI0B 1DO2A 2VUIB 3GJ8A 3JRWA 4ODIA 3FHJA 1W94A 3TZEA 3CW8X 4D6XA 4MDFA 2I8CA 1LC3A 1PK7A 3ORQA 1RPNA 4M0LA 2J9FB 1HSZA 3ECSA 3NWPA 4NFHA 3K09C 1K8ZB 2Q0XA 5JS8A 3EPPA 1LA2A 1MH1A 1U04A 3DKKA 4IOLA 3U1VA 3DZFA 1RBYA 1W1WA 2AFHE 2XXAA 3ZIAD 1DC7A 1U7OA 3C45A 3QUAA 4J03A 2AHRA 3B12A 4BEJA 1DJMA 2J0UA 2XW6A 4OLBA 4KXVA 1XK6A 2VLBA 1Z16A 4GF5A 5DV9A 2DH5A 1AS0A 1ORWA 1Z5NA 2PEYA 2XGSA 5B58T 3BM5A 4MTCA 5DYWA 3PEVA 3BXPA 2QXYA 5AP9A 4ND5A 4AUNA 5CB0A 4JVOA 4RHXA 3HYTA 3E0QA 2XCUA 1RYZA 1D6NA 1JPUA 2OFWA 3AEKA 3C74A 3EIFA 1XMVA 3MRTA 3QEJA 1X1TA 4JQCA 2QSZA 4TKMA 4ZCIA 5ADWA 2QZSA 5CLLA 1T4BA 2VPYA 3UWMA 1M6YA 5CVDA 3L7KA 3ZJ4A 4GPD1 4JP1A 3P0JA 3PNPA 1P1BA 2E0IA 1JHRA 1PZHA 1TM2A 4G41A 5CPBA 5A71A 1OX5A 4B4VA 1KERA 3UAOA 1J1ZA 4L51A 1GSAA 2I22A 5SYNA 4KB5A 1EX1A 1PNVA 1U2GC 3AFMA 3OPYI 2HPZA 3PC4A 4WN9B 2BTQB 1JG6A 3AUXA 1SZCA 3DG9A 4C5CA 4WXEA 2NWQA 3P9XA 3CEPB 3ETDA 2XOKD 4PPFA 2VCEA 1PZXA 2R7KA 2XZDA 3KZCA 5KX5B 1UZLA 3DV0B 4JLMA 4WKBA 1WWKA 3B6ZA 4BMCA 3GOHA 4DILA 4ENWA 2H0AA 1QIHA 1DT5A 4CMIA 2XR1A 3UY4A 1RQNA 1DAPA 3R4VA 3ZW7A 2F3UA 2WAYA 3ILYA 3MIIA 2QRMA 5AVSA 1ZMRA 1M1ZA 5IKMA 2O8CA 4LE0A 3AEYA 4Z9AA 3TR5A 3OCCA 2GZ3A 3ZE1B 4F04A 3TO5A 4ZALA 2IYLD 5H83A 4A36A 3USES 1W9MA 1OAAA 3RS0A 1QOPB 3IDAA 1USVA 3FSJX 4H7JA 3ONNA 2Q5EA 4LZZA 1IWOA 2IY8A 3DZBA 3QHAA 1WQ3A 3KOOA 2PZBA 4EO9A 3COVA 4PZYA 3QE4A 3O74A 3I6ZA 1XVTA 3BE8A 3TDKA 4H7KA 4FDLA 5HJ7A 2EQ5A 1K8QA 3AONB 3HXMA 2DTXA 3ED5A 3SXPA 1Z2CA 5EMNA 2D3WA 4JDPA 2X0DA 4F60A 1N9GB 5FBLB 5E9WA 3FB4A 4IICA 2RG7A 4L16A 4XDZA 4UU0A 1UFRA 1E1LA 3E35A 2WV9A 3IVXA 4JC8A 4PFSA 3UKDA 3ZWYA 3DWIA 4H3VA 5HHTA 4Q4JA 1BE8A 2QLBA 3F6PA 3EGIA 4MRAA 5HUJA 5IBCA 5KIAA 1E3WA 1V4BA 2WYVA 3MD9A 2C2KA 2GT1A 4REQA 4H7PA 3E61A 4MINA 4Q3NA 4DZTA 1NLUA 3HDYA 1DCFA 3BDVA 4GE3A 1EFLA 3JQGA 4ZU1X 2XKJE 3EVFA 2H85A 4P83A 4RVSA 5I4KA 1KQGA 4BEBA 1MC5A 3DO8A 4DMLA 1XDDA 1P0IA 2EHDA 3LI2A 4P4SB 1IM8A 1RRKA 3AFOA 1RIFA 3HWRA 3NHPA 5K8JB 1NHWA 3WGVA 3A1SA 5DSXA 3T9AA 5KYUA 5H8WA 3G1UA 1NLYA 2NNWB 1O0CA 1RQXA 1OXTA 1NJ8A 5IAKA 1E98A 3G7NA 3BRCA 2C4KA 3HVJA 1CZRA 9LDTA 1T3ZA 1QCZA 3DVSX 3FNQA 4IJMA 3OZFA 4FFBB 4KLNA 5BW6B 4BRSA 4DJEC 4G67A 1ZH4A 4NX2A 2YV1A 3RKRA 3DV2A 3LP8A 2JIOA 4WZ6A 3WIUA 4XRRA 2CFRA 3B3FA 3S5UA 2PBFA 4IKPA 1L4MA 4OJTA 3K9BA 3RVPA 1Z7WA 1CIPA 1ORRA 2OAP1 1VLJA 4QEDA 1K4KA 1R88A 4K87A 1NDUA 2DT8A 3AKEA 2R7NA 3HC7A 5EWLB 1DIGA 1O9BA 4QE3A 4X6YA 4BNNA 2I1QA 3EY9A 4HGRA 2OXCA 1G8PA 4TSFD 2REQA 3VI4B 2ZIAA 5LNK6 3NU1A 3QV1A 1COWD 4ZVPA 1L5HA 1ESMA 4QLOA 4LTNA 1PSZA 3E22A 3SX0A 3NOQA 2BBWA 1RWBA 3LKVA 1MRZA 1N2OA 1QX4A 3THXA 1HQDA 4MH0R 4WN9A 4IMPA 3ZQ6A 2QL6A 1XELA 3M2TA 3O03A 2HU8A 3TPZA 4D4KA 4LXGA 4E88A 1MJ5A 4LSMA 1V6AA 4HTAA 2D00A 2JCYA 4RKYA 3TAUA 3CLKA 2IH4A 3UCEA 1K3UB 1JBEA 3AVTA 2RGDA 4DG5A 5HS4A 4FDAA 1F0PA 5I4IA 2NM0A 4M9CA 4L6AA 2D74A 3H0CA 3K5PA 2ZSEA 1EQ2A 1OYWA 3KHKA 4OA5A 5AKKA 1AA6A 2OGZA 2YHUA 4WVFA 1WHTB 2YMQA 2OHOA 2G25A 4J0GA 1I7QB 3LA6A 1NC1A 1KZ6A 4RF2A 5KKAA 4EUFA 2PYIA 3HFRA 2W2XA 4QXAA 5DHSA 1R9MA 1SELA 3CLTD 3E9MA 4ZO9A 4KR2A 1OC2A 1SBYA 3CEMA 2J0QA 1G5HA 2XSZA 1K8YB 2ZYSA 3L0YA 3WAJA 1A4UA 2CHFA 1TLLA 3LYAA 3FTEA 2FEXA 1XLTA 4G1UC 4YFYA 4Z4FA 4YAUA 3N5KA 4G36A 4RVUA 1IDN1 1ZUWA 4HX2A 2AFIB 3OM8A 4CE6A 1KYXA 3KKOA 4D25A 3WLHA 1THZA 5KI6A 5ADUS 1EUQA 1YHZA 2ECQA 1IU9A 3TL6A 4BASA 1G2PA 4R8VA 2ZI4A 3MMNA 1FLDA 2W2OA 5JYCA 4R6XA 4HXYA 5D3MB 5LB4A 2VF2A 4DLVA 5BSWA 4XX0A 5LMCA 1ADCA 4CMAA 2R9VA 4HNUA 2WUEA 1PUXA 4EF4A 1ZITA 4I5DA 1XALA 3KNZA 4DKJA 4PR0A 1B0UA 1DEOA 2A1TR 1GPLA 1YS6A 3Q8XB 5D6OA 5C4IA 1YE5A 4PR3A 5CLIA 3STHA 1YQDA 4S35A 1F14A 2A0UA 3E1KA 4L85A 4KJZA 4ER5A 1IBSA 2YVUA 2W4MA 1CUZA 3V8EA 3KBOA 4FR2A 1GZSA 1K5HA 4HGQA 2BKXA 4TTVA 2PIDA 3ZZNA 1WIWA 3A06A 2PLRA 3WGQA 2H7YA 5CB4F 1RRCA 1WQ4A 2QRJA 1LQ2A 5KSWB 3EWAA 2D1RA 4NU6A 5FWXA 3G9TA 1NXWA 2GK7A 3I4LA 3NDIA 4B4OA 2UUCB 1NJ1A 2PUJA 1SUBA 2CD7A 3LRXA 4H0FA 4YUWA 2WMYA 1I2BA 3C8HA 4QYIA 3VTKA 4AZVA 1ZZGA 5EP2A 2ZU0C 1CNEA 1V1MB 2C0CA 3PWZA 3WGLA 2FW6A 2FAXA 3S27A 5MGNA 3ACDA 2FX2A 4E5MA 3JVEA 4I9FA 2AC4A 3PD1A 2HHJA 2DSTA 2JBAB 4OQZA 4QFBA 4UHBA 3T95A 4YMUA 1ENPA 3R0IA 4ND4A 1IZ7A 1AH2A 3NHJA 1XQ1A 1KPIA 3R3UA 4M0MA 1LRJA 3BFXA 3IHTA 3P26A 4RSGA 5BXYA 5KYTA 2BZ1A 4FONA 4NDNE 4H7FA 4AW9A 3R9XB 2RI0A 1EU1A 1LDGA 2AI3A 3L8CA 4D57A 2JGMA 5E3JA 2IS1A 3RFCA 3RYIB 4K6CA 2QAGB 4LZLA 4PNHA 621PA 1BCRB 3S28A 4CUZA 3PJGA 4CEHA 1PLJA 1WXDA 2J87A 3N2ZB 3O47A 2RHLA 4Q1VA 3QKRB 2R1UA 4CLEA 3NWBA 2QT9A 4K46A 4OV6B 4CR6A 1A71A 1B0AA 3LECA 1IN7A 2VDPB 4KYIB 4B3BA 4UHJA 1XN4A 1D2HA 4WZZA 1LK0A 2FZCA 4IIJF 4K2HA 4Y98A 2G0TA 2GPTA 5HG0A 1P6UA 1U5BB 5K8IA 1QJCA 4WE3A 4NE9A 1Y5MA 3CNLA 1NJ2A 5TT1A 4NE2A 3URKA 1R0XA 1HKHA 2YVLA 1YQXA 3HSYA 1AMOA 4WHMA 4J16A 1RQGA 1AK1A 2FSHA 3LUHA 2Q8PA 2FK8A 5C8ZA 3G0CA 1NTOA 2WBLC 4MV0A 1W36B 1A4RA 3ZK9A 4CU2A 3L5OA 4DIBA 5I7SA 1DJLA 1NVVQ 5C5EA 3QHQA 3BZWA 1CSEE 1FRQA 1A82A 2HXYA 4MKFA 4XWAA 5DU2A 5HKLA 1FVFA 3S2IA 3O8CA 2JIZD 4TYPA 2CFSA 3MRXA 1B41A 2AR0A 4MGEA 2WD9A 4U0KA 2QTWB 2J9FA 1A9QA 2QTTA 5D1HA 1DINA 1ZI6A 4UU8A 3FN4A 4XRGA 4E5SA 4L8FA 1A98A 2JGEA 2XNHA 2VWQA 5BUQA 5H02A 1HORA 3VDNB 2E4YA 2JGAA 4QRDA 3UW1A 2YXDA 4OHFA 4IIBA 1BXGB 3MT0A 1C3VA 2O8NA 3O1JC 4OGKA 4FIDA 2BP7B 4YAKA 4WLVA 5ITVA 5FTMA 4J90A 4U2DA 3UHJA 5EVJA 3ZIAA 5DEOA 3A58B 2IBMA 4BMVA 2ZRKA 3DDNA 4R1UA 4QRIA 4KR9A 3GMIA 2H57A 3T06B 3V4VB 5HUHA 2Z5LA 1K7YA 1VL6A 4IYRA 2FZKA 4CQLA 1P2UA 4WOBA 4BFYA 1D6SA 1HQYE 3UJDA 5G4LA 4Q9HA 4CFYA 1H8EA 1NUAA 3GMTA 3HDHA 2IY9A 4RHFA 4WNAB 1USGA 3KP1A 1RM4A 2YY7A 3GUYA 2VHXA 4FBLA 4IH9A 2WU3A 2Q7DA 4BKPA 3SF0A 2VSNA 5IJ9B 3AXSA 3RSHA 1M1UA 3C2QA 3EJ6A 1BYUA 4J49A 2QX9A 4GOND 3FSRA 2EJTA 2GVZC 1ZL0A 1V9CA 1VTKA 2P35A 4YACA 5ES3A 3PZRA 3CA8A 1E99A 3ZH2A 3UN1A 1G19A 4K3VA 4B84A 5AIBA 2IC5A 1VCNA 4AIRA 1V8ZA 2R7MA 5DJ5A 4J75A 4RENA 4FD3A 1QHYA 3IVAA 2XE4A 4WRRA 1OVMA 3LF2A 1II9A 3AYXB 3L8DA 3PB3A 2VTVA 3BGIA 4RSRA 4NPCA 5FNVA 1SHJA 2Q1XA 3AIIA 4NHEA 3SK0A 3OUZA 4DIDA 1C8LA 2X15A 3QPCA 2G17A 1YMVA 4W4TA 1XRSB 2REOA 2BEVA 1L2TA 2MHCA 1VCHA 4YBRA 4ER6A 2I91A 4WSOA 4YJFB 3CXUA 1PNTA 3AJ8A 3DEKA 1G6HA 3FKJA 3LFTA 2C5LA 4RFSB 4NZPA 4IHJA 5JFTA 3KVOA 4JP2A 3OX4A 3GX1A 2JGRA 3I39X 2D3TA 3CX3A 3KBBA 1WDMA 2HQBA 5FHRA 5HZKA 3P0IA 3GNLA 2Q3LA 5KSZA 5ANRB 2A5LA 2ONYA 3AT1A 1ESNA 5M04A 4RV9A 3LQQA 4TN1A 2PX8A 5KNBA 3E82A 2IIPA 4GSLA 5GINE 5FBWB 3N0VA 1QAMA 2P9JA 4FFDA 2AOTA 5EESA 1N77A 3I2JA 4KXUA 3F6EX 2NPFA 4G8BA 1MAWA 4FUQA 1NW5A 1I9CA 1O08A 2ZJFA 1Y6FA 1M3SA 4YQFA 4WZAA 2A4KA 2FPRA 1KZ9A 2BFBA 3HCEA 1RYHA 2PJRA 2V1XA 2ACEA 4E30A 1X9GA 1HZJA 2R3SA 4MUGA 3WNCA 2PSHA 3E9QA 2QRHA 2O5EA 1QB7A 3ZU4A 4XGNA 2HOQA 2IEIA 4US2R 1M1YE 2AB0A 3CUYA 1SUIA 3ML1A 2TSYB 3QE3A 3NWEA 2Y1KA 5D86A 2V7QD 3EGVA 5LIRA 3A6DA 3EWNA 4HEA6 4IP0A 4HS4A 4MYHA 4WLFA 5P21A 3U3MA 4LXYA 1SQGA 5LQCA 1BVUA 3FR8A 4FZ5A 1QC5A 2Y68A 3KHTA 1JHQA 1U6KA 2WFZA 2ZIWB 4L72A 1O6ZA 2NU7B 1SB9A 3KJQA 2AEEA 3NW9A 2QZJA 4LJ9A 4OBXA 3PVCA 1PKEA 5AKLA 2H5LA 3HU3A 2WWRA 3RAFC 4O4HA 2YWRA 4K6OA 3GGCA 3E5MA 5DPMA 2Q2QA 3L04A 1ZAYA 3EZGA 3RUFA 4H0NA 4YP1A 3BRWD 3CF0A 2POCA 5CFQA 4B40A 2CFOA 2ZRPA 3LIPA 4CRWB 1LBIA 1KO5A 1JLHA 4DIKA 4Z86A 4C6HA 1T8PA 1M9NA 1HE2A 1LQTA 3A4IA 1YACA 4K9QA 1KVRA 2TYSB 3FYDA 4O0MA 3ULKA 1JSRA 4ZQHA 4YHHB 2Y1DA 3IB3A 4PSDA 4L9AA 2VJKA 4QTTB 3HXPA 2GUGA 3MMXA 4JJEA 1TYBE 2DHDA 4JLKA 1JXAA 1J0CA 2FWRA 2W6QA 2X9GA 3BG5A 1NVMB 4LQDA 4BRUA 3QKSB 1TECE 1XLWA 5BSFA 3LY5A 3P9ZA 4DCJA 3EA4A 4LRYA 2JPDA 3GUUA 4WGGA 3ZIUA 1H3FA 1U9CA 4KZPA 1GFIA 3WV4A 4DDWA 1RHQA 3MSXA 2A7QA 1XJ0A 2XWBF 3ZCQA 1OLSA 1PQYA 4AZWA 4CT5A 3NDRA 5B3KA 2BMVA 5KPDA 1ESZA 4BYMA 2PDAA 5E1OA 4MGZR 1WB5A 2RAPA 1SXGA 4A8HA 4FDTA 4XQ9A 1T2DA 4CV0A 3BZUA 3PXXA 2OR3A 3F7OA 4GBGA 4E11A 4QDXA 4QHSA 2B5VA 2EBFX 3DVAA 1Z5UA 4Y7DA 2X8WA 3W5DA 1VECA 2IYSA 4WNYA 2EGGA 3HB9A 2Z5GA 1ISIA 3U3DA 4ZFNA 5IDQA 4RM3A 3E8XA 2J9XB 4JJAA 3TOCA 1A4IA 4UHFA 3AW9A 2V97A 3FJ1A 4MUMA 4O8ZA 3ZYZA 2HIMA 2C8KA 1CS0A 4R1PA 1VYVA 3P2JA 4YJFA 3AUUA 4WBNB 4IJKA 2HHHB 4AKIA 4ZVTA 4GIBA 3VAYA 1DKOA 3GJRA 3FYHA 1C7JA 3DF7A 4UTVA 2QTHA 2PD6A 4K9OA 4DYHA 4TLDA 1H6DA 3ROGA 2Y1EA 4E14A 4JLPA 2YHBA 2FW7A 4OJKA 2E4AA 1DRVA 4TSRA 4X8MA 5ALMA 3V7NA 1NYRA 2PS3A 4Z2AA 1Y33E 2TMYA 3DE1X 4TRJA 2VJQA 4C5AA 2GJ8A 1FF9A 4CL8A 5DHUA 3EZ7A 2VHYA 2Q6LA 1U90A 4RXUA 1EVIA 5C1OA 1N7IA 4ZO7A 3EBPA 4YROA 3KC2A 3NEAA 2GZSA 3WJ2A 1FP7A 2ZYWX 4PG7A 3H11A 1J7KA 2CUZA 5BSTA 3ZW8A 3E9ZA 4J3FA 3AI2A 2AX4A 4ZC1A 1CRWG 1TFRA 4X6XA 2HWUA 5T64A 2K87A 1U0LA 1W4LA 3OC6A 4F3YA 5J4KA 4PAMA 5JQGF 2ZZNA 1J0AA 2ERXA 2P67A 4J0QA 2CLKB 4O59O 3OKFA 1YHYA 5JSKA 2JA1A 5DTQA 4B6GA 4D8VA 3JQGB 1Z6ZA 2BDTA 4M9XA 2FUEA 2HCBA 4XARA 1EBUA 3SZOA 1B8UA 1O94A 2BMWA 5HILA 2FQXA 1A72A 3DP9A 4Y6GB 4L7QA 3RBVA 1XPRA 5JDIC 4A92A 1JL3A 3TTYA 1T8SA 3X2FA 2X77A 1KJ8A 1UMBA 3AJDA 5CLJA 1WETA 2O0HA 1VSBA 2VRNA 3GRKA 3MHPA 2CLIB 3PG5A 4MB0A 2CY0A 3DZJA 1JXMA 4C7OB 5KYXB 3I52A 5JNLA 4JVNA 1HYBA 3BWDD 2B30A 3ZDRA 1E6LA 5A06A 1RPZA 1FYWA 4ZN6A 1TZCA 2NZWA 2GHRA 3EVNA 2ZB4A 3OP4A 1H22A 5AHKA 4RETA 3JYNA 2P65A 2MR5A 3C1TA 1NUQA 2XUHA 3IEIA 4CV3A 1T9GR 2PZ8A 4INPA 4D7AA 4CCYA 1B00A 1X3SA 1M8KA 1SCQA 2H16A 4WZBE 5JCOC 1NQOA 1V7ZA 4TLEA 2WJZB 1ZL2A 5TLSA 3MJTA 1Z7YA 3W1WA 3TIIA 3ELYA 3SN6A 4JWKA 1M6WA 1J0XO 4Q12A 2GEJA 1F8GA 3RVSA 3DNFA 4MCHA 3VNQA 1XNQB 3P4YA 4ED9A 1RW4A 1CYEA 4PGHA 3Q0EA 3NHLA 1Z5GA 1AHNA 3FPFA 3EISA 3ENKA 3WLQA 2PX6A 1EMDA 2VHTA 3MTDA 2PO7A 3G0DA 3Q15C 4OB8A 3VTFA 3AU9A 2Q6TA 4CPDA 5H9WA 1M1NA 2RAFA 5K8LA 2EXXA 4NBKA 3GJQA 2JIZA 4Q4HB 1XLVA 5HA5A 5J23A 1ECPA 1JE0A 5DTJA 3L4KA 3E6AA 1SKUA 2PAFA 3I42A 3UMYA 1ZUNB 4YMWA 3PP8A 3IAM6 2CCGA 4KBGA 4G0VA 1YKSA 4GVXA 2ZBEA 2YASA 3KTFA 3LQ4A 1LU9A 3B52X 4HNSA 4TSKA 4W1SA 4F5EA 2V7XA 4N48A 2Q5QA 5K3SA 4EG5A 5JC8A 1EGMB 1ZK0A 3D64A 4YLYA 1GN9A 2A1IA 3GFVA 2NYVA 3QIVA 4YP7A 4N18A 4LY0A 3ROMA 4R69A 2ZLBA 4DQDA 4OUDA 2Z8YM 2F7SA 1M6NA 1WE2A 2KMLA 2X4GA 1YJQA 1WKVA 1ZIXA 3AY6A 4J8PA 5DHAA 4JUDX 4U9IS 2BMAA 2H1RA 4DCUA 1CU1A 3GJZA 1WU7A 4G5GA 4QX6A 2XKBA 1C7IA 4FHZA 1L4EA 3TBFA 1QGUA 5ECWA 1M8GA 1ZAKA 3HRIA 3ZHCA 4H1HA 3H42B 3OCWA 4DQLA 1Y6ZA 4YCSA 3V4LA 1OWOA 2VP2A 2ZCUA 5F2OA 4PLZA 3I64A 3L46A 4K26A 4OQDA 1ULBA 1Z2PX 1YZTA 2HLNA 3KZ1E 3VBCA 3NLLA 4LFBB 2PIAA 1SCBA 5F1OA 2AJDA 5EGSA 3NHKA 3GLRA 2P69A 2CFTA 2XRFA 2WKPA 5A0VA 1KY5A 1AA9A 1U1EA 4AURA 2AOTB 2FG5A 1J99A 3G89A 4ARZB 4K8OA 2HBQA 1E6EA 3IQEA 5CA1B 4N0DA 1FMLA 1HGXA 2BISA 1OLUB 2YWXA 3VR5D 5CNMA 1F2UA 1YFLA 1S9DA 2HJRA 3JQ9C 3ZDAA 4Q19A 2VPIA 4FFMA 4KQEA 3T3GA 4B79A 2I6QA 3NT2A 4Q05A 5A4JA 2HT6A 4KQMA 4C0HA 2OCPA 2IHVA 4ZEWA 1I4LD 3MYRA 1W34A 3CX8A 1A8UA 1KSGA 1B7GO 3LUCA 3PXAA 4NPHA 4ZT7A 3R9WA 3L8YA 2NSYA 1K6MA 1O6BA 4WTOA 4LQLA 3DLBA 1RJWA 4WZAE 4BLUA 2H54A 5LBUA 2PMKA 1IZYA 4I46A 1Y98A 1H2RS 2OM6A 3N07A 3CUKA 5ARCA 1N34B 4LWZA 3AJEA 5E95A 1ZQ9A 4IHKA 4KDRA 3WIVA 1OILA 4UAJA 3DONA 3E0XA 1W93A 3KJHA 4QXRA 4A0SA 3FUVA 3OO1A 3UBMA 2IDJA 2VZLA 1RKQA 1H5UA 3IHLA 2ZGVA 4L5CA 2GYVA 3ON5A 2IKQA 1QYWA 1C7EA 1YHNA 3PQ8A 2FMKA 2BHTA 4EELA 5IXSA 5KNBD 2XUQA 4OCZA 1WDWB 3FSEA 4HRYA 4NZMA 2P6RA 1U9YA 2CEKA 1CY4A 2YJGA 4H08A 4N5NA 4BX0A 4PHCA 1X38A 1BDIA 3I9V6 3G0GA 3HADA 5LPNA 2RFLA 1DCKA 1K3FA 3IMKA 4R9SA 4XPIB 4CLXA 3SIRA 5LXTB 3RD5A 3TE6A 1Y1PA 1DVRA 1Q95A 2V03A 4P3XA 4IDEA 5ECGC 2D2EA 2VPQA 3FIJA 3OJEA 3DKIA 4PEVA 5AJXA 5G40A 4BKQA 1GSOA 2GM3A 4TTPA 3X1XA 4BU1A 1SBTA 2PMBA 1PNRA 1GR1A 1X8LA 1SQSA 5GGXA 2W0MA 4P84A 4JGBA 4HAYA 1H8ED 2BI8A 1GTMA 1PHRA 4E3WA 1HYQA 5IJ0B 4BU0A 4GMFA 1DXHA 1VJDA 1W8DA 5B55A 2DLNA 3PFHA 1IZ8A 1F6DA 1SR8A 1KP3A 2DT5A 1L7VC 1N2ZA 2ROQA 1QYDA 4X41A 4A7PA 4CIDA 2KBEA 3U61B 4TZTA 1PR6A 3KQUA 2HV9A 2FXIA 1P1IA 1VLMA 3U7HB 3GBPA 1W5BA 2HWXA 4UBLA 3LVBA 4D3XA 5AJTA 5HRAA 4O4HB 2XCRB 5EIFA 5IC5A 1E3JA 4G0PA 3V7YA 4NQRA 4I4CA 3R8CA 2EZ9A 4Z9FA 2Q4RA 1RMYA 4Q9KA 1MB2A 4B7UA 1FTWA 4LJ6A 2LW7A 4PLPA 5HRCA 3RKUA 3QQPA 1T9HA 3ZNNA 4Y2SA 4DTIA 1NZFA 1F06A 3RAJA 5BSGA 1DLIA 2HPHA 2Q7OE 4D96A 3NHBA 2Q9CA 4NOKA 4B6PA 3GA0A 1M67A 4JJZA 1DAMA 5FAKA 2W2VA 1YTUA 1QIIA 2L17A 4FB5A 2C5HA 2PRJA 3P0RA 1ABBA 2BUBA 2OHVA 3TKYA 3PU6A 1U3WA 3FHOA 3L82B 4P34A 4WK0B 5K3DA 1VHQA 1NNLA 3RVRA 3VV2A 4D6YA 4YP0A 4YJ2F 2OFPA 1DMSA 3EPRA 4FGKA 4MOWA 3NGXA 1V16A 2KW5A 1A27A 3IDOA 5EE0A 5ENZA 4K6GA 1J9ZA 2OEPA 2WUWE 4TL8A 4IMRA 1MOSA 1DV2A 2DFNA 2ZXEA 3FPAA 1O87A 3BMCB 2X42A 2JD1A 3KPJA 2ZJ2A 4JNCA 3HK2A 1U8YA 5JPIA 1WXXA 1SVKA 2QAGA 1U4NA 2R7LA 4G4JA 4V0QA 4N5DA 5BQPA 2VTDA 3BC1A 1QHXA 3JAKA 4L8LA 1KEUA 3CLRD 4KR3A 1E1YA 2RAVA 2HU2A 1EE2A 4P9NA 2ZZKA 5ALJA 2OAGA 4EHFA 2H63A 3DW1X 4WCDA 1UBEA 2OO7A 4BNDA 1OLXB 1DFGA 1ESCA 2ZE6A 4G4GA 4KU4A 5SY9A 4X1YB 5AXAA 2GCOB 1Z6AA 3WK5A 4EW3A 2EYUA 1EVKA 3CUSA 2Q2WA 1E9VA 1F6BA 1YCGA 2OL4A 4G56A 5F5XA 3UK6A 3GCGA 1GZ5A 2GHQA 4IDQA 5JD4A 1QAQA 3VHLB 1CZNA 3IVGA 2J59A 2R86A 3N2GA 2I3GA 4EHDA 1V3QE 3LTEA 4IINA 3G2PA 3JWIA 3SVZA 3UMMA 1GWNA 3RUHA 2R8EA 2JVKA 1Z18A 4RORA 1YB1A 5EINA 4EY3A 1QP7A 1T1GA 2WG0A 1LSUA 1JQJC 2R8BA 2V7QA 3ASUA 3L92A 3WP0A 4C7BA 4W5WA 4LJRA 4MSUA 3SF8A 1Q11A 2OC9A 2DULA 4Q15A 4P81A 3IIEA 2I5PO 5HQ3A 2HQSA 4ESOA 4O1HA 1TPZA 2FQ1A 2NN3C 3B6JA 3A9CA 2ZIFA 1DKMA 4O2AB 1NSFA 2W22A 3TLJA 2AVNA 4DNFA 5BSKA 2H8KA 2JFXA 1N7HA 3UWKA 2HGSA 1ZRMA 4JI5B 3DNMA 3HH8A 4XCVA 4F3KA 3RBZA 5A3RA 2PD4A 2JBHA 2H3HA 5CDUA 1RC8A 3FBGA 1AZSC 3LHFA 4BFSA 4ZDWA 2OSVA 1S2DA 2MR6A 4N8SA 3WGOA 4OMFG 2FRVA 5B4VA 1CEEA 4TTSA 2GFQA 5JS1A 4EABA 1N2XA 1V3VA 3NHUA 1NNUA 3M8KA 4H17A 1AK2A 3LCUA 3ORHA 4LSGA 2XBUA 4QGBA 4Y2UA 3IDZA 2HBYA 5HOQA 1FUUA 3WYFA 3KYDB 3ITEA 5LCXA 4Y1FA 1VDZA 4V24A 1KEVA 1M0WA 1JECA 1JDZA 2SECE 3GR6A 4UM7A 1S9HA 3R5HA 3ZGXA 2QTRA 1U3UA 1CDOA 4EPRA 1O96B 1UXOA 1G2IA 1LS6A 2W2LA 3VNAA 1T9DA 2J3HA 4R9UC 1P5ZB 1Q21A 3EZ2A 1S96A 1WB4A 3USCS 5CK4A 1UOOA 1SRQA 3AVWA 1C3JA 4MRVA 4AJ2A 3V1TC 1S2NA 4D9EA 1OXSC 1DX4A 2FFAA 3VRHA 2DQSA 2ZTHA 5F5LA 4UOZA 2J85A 3BD8A 2PUBA 3ND8A 4UXJA 4BP1A 5BURA 5AM2A 5D3QA 2I6XA 1ODTC 1WV0A 5BMVB 3A3NA 1T5BA 3ZEAA 3MWDA 2Y1WA 6YASA 4FMCF 1UC5B 3TLBA 3P9CA 1CQPA 2XWSA 4ROTA 4XWKA 2V0GA 3ETHA 5T4FA 1L7XA 3I6MA 1KJIA 3GJYA 4FJ0A 3WJ1A 4UM9B 2W4IA 1AQIA 3E7DA 4RDXA 4W9NC 1CUCA 2B9VA 3ESYA 4NMLA 1EP3B 3ZUGA 1XLUA 5TRTA 1W6UA 3WX0A 2X22A 3B48A 2WPNA 3E9EA 3L6CA 4OBEA 5CW2A 2Q4OA 3WGIA 2C5FA 3AJ9A 4PX9A 5EQJB 4G09A 1G9XA 5C52B 4FE4A 1ONSA 1I4WA 3KXIA 2ZS8A 3AWDA 5KYVA 1Z0DA 5IBRA 1G6KA 1NAIA 3ADBA 3IC5A 1OLUA 4O4IA 1EGHA 3V2UA 3F0TA 3T5GA 2P4SA 1U4OA 2E89A 3G0OA 4W1RA 4ER7A 2FNAA 1EXVA 4US1R 4XQ0A 2HR1A 3DE7X 1Y7PA 2R60A 1UBOS 1SD2A 4MWSA 4BN4A 1JS1X 4AF6A 2Z83A 4YWHA 5LDDC 1C9JA 1AS3A 3GHHA 3K8QA 2CMKA 2ODAA 2QIOA 4N3NA 2ZIVB 1R15A 3PQ6A 4Y6QA 5EXSA 1ZNWA 3MD0A 3BXGA 4J07A 3TZBA 1R0ZA 1K6EA 4Y2QA 2C07A 3KLOA 5DGDA 3WYGA 2AD1A 1IXZA 1FYFA 1YAHA 2NO6A 4ZTZB 4G5QA 4HSGA 5ALNA 3KUXA 1X14A 3WLNA 5C5DA 2SCUA 1E2FA 3F4KA 2J3EA 2R1TB 1OREA 1BHSA 4OI4A 4WPGA 1JZQA 4D92A 3DE4X 4D79A 3IOBA 2C7BA 1M66A 3OUTA 3PR3A 4CLOB 2BEWA 2A5JA 2X9VA 3QRWA 4J16C 5IWAB 2GFIA 2FWBA 4X66B 2X2OA 1CTQA 1DPGA 2OYSA 2QQ0A 3WXBA 3KE9A 2WNSA 1HLDA 3CNHA 3WWOA 4EPTA 1E6KA 1U8TA 2EF1A 4DLSA 2XZOA 2X4DA 1NF8A 3GRUA 5JQGA 4POAA 3Q1KA 3PHCA 2YL2A 4MLZA 3AV3A 3STVA 3R6DA 1YZUA 1YJXA 1S01A 1MGOA 1YSCA 3J7TA 4ISCA 1A3CA 2NNLD 4W6QA 3U3JA 1XP8A 2C31A 4JGIA 2DQ4A 2GN8A 4RWZA 3TSYA 5FI1B 2GZ2A 1S5PA 4N49A 1CFZA 3EPKA 3LS2A 1TIPA 1GQ2A 3AG5A 3DDWA 3GB9A 3UZUA 4MQUA 4E5YA 1QF9A 1C4KA 1KNQA 1KTVA 4KAJA 3K9HA 2QROA 1ZGAA 2XYPA 3CH6A 4JBNA 4B3FX 4DJFC 3RIHA 4AMVA 4D8XA 1VKZA 2GH1A 2VT3A 2W4QA 1JA0A 3L2OB 2OB1A 4MVYA 4RH1A 1SOUA 3VZQA 1SHKA 1FP6A 2ZROA 4CQJA 3M9XA 3ZGVA 4E22A 3IV7A 2WFMA 2LCQA 1EK6A 1VI6A 4G9EA 1E5XA 2IEZA 4H1UA 2WWVD 3OQ6A 2PPLA 4Z4EA 1BQEA 1IG0A 1N1DA 2FX5A 2JLSA 3D8UA 2MYTA 5EWMB 1L4KA 4LCJA 3SKXA 1UM9B 1KI6A 3EEQA 3K2BA 3OF5A 4XEHA 2XT9A 3ZTWA 1Q14A 2HIGA 1X1SA 4WY5A 4XUGB 3WBBA 1JILA 2NXJA 4ESEA 1QU3A 5E6SB 4KX3A 3GP8A 2YZ2A 2Q5JA 2JGLA 4HQKA 5HXAA 2L0XA 2VJNA 1XEWX 2DECA 3T9DA 1YV9A 3FHTA 3FVTA 5DLQC 2RONA 2Y9MB 2ZB3A 1P5RA 1JJBA 4F9EA 4KDFA 3JR7A 4IMJB 4JC0A 3ONVA 2Q41A 2FDRA 4PZPA 5M3BA 5J4VA 3HL4A 3WB2A 1A8PA 2B4AA 1N0WA 4TRRA 2G71A 5ADHA 2ICAA 2HWKA 2W2KB 2WIKA 3FMOB 3I58A 5A3JA 4S12A 4E4YA 5AVXA 1PL7A 1WVGA 4D9CA 3EUFA 1KJNA 1UODA 3L18A 3MPUA 1R5BA 2BR5A 3DOOA 1RJGA 5KYWA 1Z73A 1AUOA 2HY7A 1Y4SA 2HGZA 4Q9AA 2XUJA 3R9XA 2RJNA 4L4XA 2QSJA 5FL7A 1SZDA 4CIAA 3OY7A 4MMXB 3K0AA 1EQUA 1SXQA 3TDMA 1TFUA 2I6GA 1V16B 3I6QA 4EYOA 2JB9A 2L42A 1AKWA 4M76B 4ZHSA 3Q8MA 2ZJ7A 1XD8A 2CDCA 4GX5A 1ISJA 3U26A 3VO9A 1YOVA 2AOUA 3B6IA 3MMPA 3NC4A 2NIPA 3IQXA 2RDMA 4DDKA 4EGQA 2XAUA 1MKYA 2K2QB 3N59A 1OBHA 1QQ7A 3BAFA 4URXR 3O94A 4JJ4A 1E1CA 2JK0A 3STYA 3EAQA 3WNQA 4RTLA 1MO2A 3ELUA 1WSAA 4I5IA 3DLTA 1OE0A 3M6XA 2GCGA 1IRIA 4LZOA 4F8YA 3U9TA 2MYPA 3BJRA 3I9OA 5DLYA 1J2TA 1O6FA 2OAEA 3NGMA 5AD1A 3SI7A 4BC1A 3R5XA 1QVAA 1EVQA 4WOJA 1N36B 1PIWA 2IV2X 1XIVA 1VKHA 3QVUA 5IMBA 3RTDA 4KXYA 1QDLB 2C3UA 4P3PA 2GKOA 1K27A 1JDJA 1WXQA 1HDEA 3DTYA 1Y9JA 3TSCA 3TQHA 1MLDA 2VH1A 2HADA 3WKEA 1TNDA 3TNDA 1E58A 2HRBA 2VDOB 1QHSA 2YCBA 3LT2A 4JLVA 5EOVA 1E1RD 5BN3A 4IM7A 2AFHA 1Z63A 1MO4A 1HWYA 1L0BA 1P4AA 2AXQA 2HJWA 1C81A 2D1SA 2WJ3A 3A6JA 4PZLA 4R9RA 4YJ3F 2X1HA 4RYDA 5AI8A 4LDZA 1FYDA 4QBHA 4YREA 4D5EA 4L57A 2AZ4A 3HB1A 2GF2A 2CNKA 4XDYA 2YJ5A 3BRWA 2VATA 2UYQA 1CNFA 4H15A 4BNUA 3S99A 4XWWA 2I29A 4LOJA 3IP1A 4BWVA 4LXUA 2BGUA 2D06A 3G8CA 1CP2A 1L5WA 3IQFA 2X7XA 4PZZA 1MB3A 2FSVC 3IYLW 3OPYA 1X80B 1IWPB 3DT6A 4EJSC 1PDVA 3EXG2 2WJVA 1AQYA 2IE8A 2IV7A 2ZE5A 4KGVA 4G9BA 4PV7A 5DW3A 4OL0A 4ZCLA 1ENOA 2POQX 1NASA 2RARA 1L3IA 3H5TA 4JIMA 3DE2X 2IYWA 1WEHA 2J9GA 2YZKA 2WD8A 1V25A 3KD2A 3QLVA 5JMOA 2ZM5A 3TPCA 3ZHTA 4Y0VA 4C6SA 1K7FB 4R8SA 4OFBA 3AP3A 1R0CA 2ZKIA 2LDBA 1T5LA 4EDFA 5ALGA 4E51A 4YV2A 4ZDKA 4XQGA 3DO5A 1I1NA 4C88A 1YZKA 4LEIA 4FFSA 5I48A 1EBBA 1XD2B 3F3KA 4RD3A 4IHJF 4PZAA 5FR1A 5BPHA 4KV9A 1QRAA 1YNSA 3B9QA 3FCUB 3TFOA 1K2VN 1OBFO 5B7GA 1YQQA 1R8SA 4Z7JA 5K0JA 1QGDA 4LZWA 3N7TA 4BCDA 3CTPA 2C5SA 1SCIA 1T2VA 2ZUSA 4MW2A 3K35A 5A3QA 9ATCA 2R84A 5EE9A 3S2FA 2PUFA 1UPTA 3H4TA 3MMZA 3TZLA 5CA0F 4JUBA 1V5IA 2VQEB 4MPRA 3C6BA 2FPGA 5TR9A 4FHFA 1WMFA 3EVAA 1QV9A 3EGCA 1J49A 5CD9A 5HQTA 2YKGA 2XTJA 4UAVA 1LNZA 5HM6A 4JBYA 1GOTA 5AOVA 3B5JA 4BYGA 1ACMA 3U7QA 3C3MA 5JNVA 3QKIA 1UXIA 3CIOA 3GT4A 4RS4A 4HXGA 2RG1A 4YXWD 1O54A 3B2EA 5BNFA 1JQ5A 3R6LA 1WHSB 3KVNA 4H16A 4IIHA 4RA6A 5BYKA 2H7VA 3FGNA 4TN5A 3RUCA 4FM9A 3RVLA 1A1SA 1X0VA 3DFKA 1KXZA 1TIBA 1RXUA 1WXHA 1QYXA 2Z04A 2ATXA 4RD6A 5EXXA 2DCUA 5FFMA 4P5PA 1Z22A 3LHIA 4DUYB 2GVNA 2BFDA 4DGQA 1NW9B 2HCFA 3TRDA 4BMDA 2X0NA 1I2ZA 2PLAA 4J94A 4R71A 2YHIA 2B4QA 2PFGA 3TLYA 3W5IA 4BBAA 4OY3A 3C6MA 2NVUA 3I32A 3JD4A 1G5IA 1RIIA 4X8OA 5KREA 3B3GA 4I1SA 1EXMA 4IJQA 4I81A 4L8GA 3ZDBA 1I24A 3MWDB 3CR8A 4EBBA 5NLLA 3CGGA 4U63A 3B78A 3TLAA 1NUPA 1IZ0A 1JSZA 4RV4A 4U6QA 4F2DA 2V7GA 3NIWA 4CG3A 1A9XB 4WV3A 5E4FA 4OUKX 2QTGA 1B8PA 1PR2A 3RT9A 1P8JA 2C7RA 3JAMA 4DR3B 5ALUA 3S40A 1Q0UA 3LBNA 2Z6AA 3RO7A 1ZIOA 1RYFA 1MGPA 4HAVA 4OH1A 1FS5A 3C3DA 3DO6A 3EYWA 4TKVB 3E48A 5K01A 1TYEB 3RU9A 4IRMA 4ESHA 2EFYA 3AV0B 4WH0A 5EVCA 1OIVA 3G23A 3QUQA 5C8YA 5EHQA 4N5LA 3RS9A 2IPXA 1QLWA 1NW7A 4WOCA 1L8XA 1R0WA 2ZSIA 3JQ7B 4X95A 1Q0HA 5CFZA 4HQOA 3HKEA 3TXAA 3BA6A 4WA7A 2ZRFA 4A91A 2A35A 4CCSA 3NBFA 4HBGA 2BGJA 3EZ6A 2WZCA 4MA4A 2QM3A 3Q3CA 5FNZA 4MVJM 1MB4A 3A2KA 2G76A 3LQYA 1F6WA 5B1HA 2M6SA 2C94A 2AJLI 4HGNA 4N5MA 5TY0A 4F2HA 1A04A 3PHLA 5FPQA 1CF4A 3ZE7A 3BE5A 3BWCA 2WJPA 1HDXA 5ESWA 5FWXB 1QQBA 3RHSA 4BNLA 2IXAA 2NXWA 1Q7EA 1VXOA 4MPJA 3W6ZA 2ZXUA 2OZVA 1N0IA 4GDMA 1MHTA 2JANA 1RWKA 4DC1A 4Y6PA 2QLLA 3QLVC 3DH0A 1MAVA 4WASA 3MMSA 4DWVA 4CMHA 2IHBA 3PRHA 4RK7A 4HWSA 1NVKA 2IWRA 3HGTA 1N2CB 1LDBA 2ZSBA 2ZUBA 2QRPA 4R40A 1U1GA 3S2SA 1LK7A 2BF4A 3PPYA 2CL5A 1GDTA 5DTMA 3WHKA 2ZRDA 1W5AA 1FMCA 1CR4A 3CXRA 4IIVA 4HK4A 2XA2A 3SQMA 3ET4A 2R11A 3QYPA 1TZJA 1GPJA 1QV6A 4K9DA 2Z4RA 1QZXA 2ZJYA 4KN9S 4QUKA 1WNFA 2YRFA 2HMTA 5P8WA 3ZVKA 1Y7TA 4YRRA 5DM4A 4ZVMA 2QYTA 3K94A 1YO6A 4RKFA 1KIAA 1XVUA 3VYUB 1N4DA 1SCKA 2V98A 2WA2A 3N8HA 4LRSB 3WL4A 5HX7A 4NV1A 1H6BA 1NQTA 1V2GA 3CZRA 5EHXA 1U02A 5FUBA 4K7JA 2WTXA 1FBTA 1RNLA 2ZWMA 1G42A 5HP4A 3QP9A 5IH3A 1E3TA 1EK0A 2C7PA 3WGMA 5KHOC 5HGJA 4CM1A 5HIMA 1THMA 3UTCA 3UHOA 2H29A 4UFOA 1ZCZA 3GWGA 1U3FA 1JTFA 1NQWA 1QYIA 3R76A 3KOMA 4UREA 3VPDA 3T1HB 2GPWA 1G7RA 5CB4A 3DMDA 4LHVA 3NGLA 2QU7A 3MCVA 2UZ3A 2Q1U