1GPUA

Transketolase complex with reaction intermediate
Total Genus 250
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
250
sequence length
678
structure length
678
Chain Sequence
QFTDIDKLAVSTIRILAVDTVSKANSGHPGAPLGMAPAAHVLWSQMRMNPTNPDWINRDRFVLSNGHAVALLYSMLHLTGYDLSIEDLKQFRQLGSRTPGHPEFELPGVEVTTGPLGQGISNAVGMAMAQANLAATYNKPGFTLSDNYTYVFLGDGCLQEGISSEASSLAGHLKLGNLIAIYDDNKITIDGATSISFDEDVAKRYEAYGWEVLYVENGNEDLAGIAKAIAQAKLSKDKPTLIKMTTTIGYGSLHAGSHSVHGAPLKADDVKQLKSKFGFNPDKSFVVPQEVYDHYQKTILKPGVEANNKWNKLFSEYQKKFPELGAELARRLSGQLPANWESKLPTYTAKDSAVATRKLSETVLEDVYNQLPELIGGSADLTPSNLTRWKEALDFQPPSSGSGNYSGRYIRYGIREHAMGAIMNGISAFGANYKPYGGTFLNFVSYAAGAVRLSALSGHPVIWVATHDSIGVGEDGPTHQPIETLAHFRSLPNIQVWRPADGNEVSAAYKNSLESKHTPSIIALSRQNLPQLEGSSIESASKGGYVLQDVANPDIILVATGSEVSLSVEAAKTLAAKNIKARVVSLPDFFTFDKQPLEYRLSVLPDNVPIMSVEVLATTCWGKYAHQSFGIDRFGASGKAPEVFKFFGFTPEGVAERAQKTIAFYKGDKLISPLKKAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords TRANSKETOLASE 1
publication title Snapshot of a Key Intermediate in Enzymatic Thiamin Catalysis: Crystal Structure of the Alpha-Carbanion of (Alpha,Beta-Dihydroxyethyl)-Thiamin Diphosphate in the Active Site of Transketolase from Saccharomyces Cerevisiae.
pubmed doi rcsb
total genus 250
structure length 678
sequence length 678
chains with identical sequence B
ec nomenclature ec 2.2.1.1: Transketolase.
pdb deposition date 2001-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00456 Transketolase_N Transketolase, thiamine diphosphate binding domain
A PF02779 Transket_pyr Transketolase, pyrimidine binding domain
A PF02780 Transketolase_C Transketolase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.920 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1gpuA03
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1gpuA02
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1gpuA01
4GP9A 4XEUA 1W88B 1W88A 4GG1A 1TKBA 1UPCA 2WVGA 1V1RB 4C7XA 1V1RA 3FSJX 2BEWB 2BEWA 1UPBA 4K9PA 2Y0PA 3EXIB 3EXIA 1YI1A 4D5GA 3LQ4A 3HWWA 1R9JA 5HYVA 1TRKA 4MQ5A 4K9MA 2J9FB 2O1XA 2J9FA 3AHHA 3LQ2A 2EZTA 1OLSB 1OLSA 2C31A 1Y9DA 4KXYA 1PYDA 5EJ7A 2Q27A 5ERYA 1GPUA 5EJMA 4GM4A 4JUCA 4K9KA 2YICA 3OOYA 1V5EA 4MPPA 1X7WB 1X7WA 3F6EX 3LQ1A 2G67A 2YIDA 1B0PA 3UPTA 3EXEB 3EXEA 3IAFA 2OZLB 2OZLA 2VBIA 5DEIA 1YNOA 4K9QA 1TKCA 2XT6A 1UPAA 2JI8A 3AI7A 3E9YA 2X7JA 5DGDA 1U5BB 4RJKA 1U5BA 3ZHUA 3ZHTA 1DTWB 2BFCB 2BFCA 3M34A 1QPBA 3AHGA 2C3OA 2AG1A 1OZFA 2BFFB 4D5EA 2BFFA 2QTCA 1TKAA 4GPEA 1UMBB 4JUFA 1UMCB 1UMBA 1UMCA 5ERXA 5EJ5A 1Q6ZA 1PO7A 1AY0A 3EXG2 5HHTA 1X7XB 1X7XA 4JU9A 3JU3A 5C4IA 3IAEA 2VK4A 2QTAA 3FLMA 4RJIA 5HGXA 3AHIA 1MCZA 1X7YB 2VBGA 1X7YA 5EJ8A 2VJYA 2G25A 3M49A 3M7IA 2JLAA 5I51A 1Z8NA 2BFEB 4C7VA 1V5FA 2BFEA 2IHVA 3RIMA 3AHEA 5HJEA 1POWA 1V1MB 1OLUB 1V1MA 1OLUA 1IK6A 2NXWA 1PI3A 5K3SA 4KGDA 2EZUA 3FZNA 4QQ8A 2AG0A 1X80B 5IMSA 2BEUB 1X80A 2BEUA 4K9LA 1RP7A 3EYAA 5FEMA 4KXUA 4JUDX 2UZAA 1OZGA 2C3UA 1V11B 1V11A 3DV0B 3MOSA 3DV0A 1T9DA 4QELA 2EZ8A 2VBFA 2C3MA 4MZXA 2FWNA 1T9BA 1ZPDA 2Q5OA 1YD7A 2VK8A 4K9NA 5EJ4A 2E6KA 4KXVA 4GM1A 4K9OA 1OZHA 5AHKA 3L84A 4FEGA 2PGNA 1ITZA 1YBHA 2JGDB 2FN3A 2JGDA 2XTAA 4ZP1A 2VK1A 4MPRA 3AHJA 5EXDA 1POXA 1NI4B 2Q5JA 1NI4A 1L8AA 3DUFA 3ZHQA 1BFDA 5I5GA 2IHTA 2BEVB 2BEVA 2DJIA 5I5EA 2JI7A 4MPJA 4WBXC 1V5GA 3LPLA 5EJ6A 5I4IA 1QGDA 5K6RA 5K2OA 4JUBA 3AHFA 2C42A 2R8OA 1T9AA 5K6TA 2XT9A 3AHCA 2C3YA 1YI0A 3KOMA 3EA4A 4JU8A 4Q9DA 2W93A 5ESDA 5EJ9A 3EXFB 2Q5LA 3EXFA 2IHUA 2Q29A 4COKA 1V16B 2PGOA 1NGSA 1V16A 2V3WA 1UM9B 1UM9A 2R8PA 4FEEA 3ZHSA 3AHDA 1PVDA 1UMDB 1UMDA 3ZHVA 2JI6A 2BP7B 3DVAB 1YHYA 2BP7A 4JUAA 3DVAA 1W85B 1W85A 2JLCA 2WVHA 1QS0B 4JD5A 1QS0A 2PDAA 2UZ1B 2UZ1A 2G28A 2BFBB 2BFBA 3M6LA 3HYLA 3EXHC 1OVMA 3EXG1 3ZHRA 2C3PA 2PANA 3HWX1 1WCIB 2JI9A 3EXHB 1WCIA 3EXHA 4KXXA 1X7ZB 1X7ZA 2O1SA 1OLXB 2JIBA 1OLXA 3OE1A 1JSCA 2EZ4A 3DUFB 2WVAA 3F6BX 4KXWA 2Q28A 1DTWA 1YHZA 4GM0A 2BFDB 2BFDA 5EJAA 5EXEA 3EY9A 3D7KA 4RJJA 4QPZA 3UK1A 5DGTA 2IEAA 2R5NA 1T9CA 1KEKA 2EZ9A 1N0HA 2Q5QA
chains in the Genus database with same CATH superfamily
5EJEA 1FNMA 5IMBA 1VHJA 4GDFA 4BO2A 1EP9A 2R97A 5DX1A 4WACA 4ZGGA 3FTPA 1QZTA 2IDKA 3U1VA 1OX6A 4IGIA 4G67A 4R7TA 1SXIA 3DS8A 4EHLA 4TQGA 2FPGB 5EWMB 1SCQA 3WGMA 2BKEA 4D4MA 3JPYA 1FNNA 3A3YA 1WL8A 3INTA 1EUDA 4OP3A 5E6SA 2I65A 3GDHA 3CVXA 5IBCA 2XBLA 1U7ZA 2WLTA 2WNIA 3PJFA 4YHHB 4B4UA 1RP1A 3EIWA 4QDJA 2KHZA 1T5SA 1RPAA 1JDVA 1WD7A 2GMWA 3MJRA 4C4RA 1ZG3A 3D1LA 3IE2A 4UVIA 3RTAA 5DN6D 1SGWA 4MWEA 1PSDA 3GCXA 3P0HA 4YJDA 3F4LA 1QV6A 3K2IA 1IH8A 1REQB 4LXHA 1YBFA 1FFXB 1OWOA 4TYQA 3ZY3A 2ZIFA 1HG1A 1W44A 1H2YA 5LXTB 2JKVA 1ZK1A 1XL0A 2DHCA 3AO0B 2LNDA 1V96A 2A6PA 4BAGA 1E20A 1AK2A 5CLJA 3ZVKA 1XTUA 1O4VA 1IL0A 2OCXA 2C2ZA 1RCTE 4JLMA 2QMHA 3S99A 3PFBA 5KDLA 3SGLA 1ZN2A 3CXRA 4D02A 1YHNA 4XIYA 1SCUA 4R69A 4B3RB 1TC1A 2H4FA 3DL2A 5DHUA 3AHHA 3X44A 1Q44A 3FBWA 4BDSA 4DR2B 1DTEA 1HBJA 2VF7A 1VZ2A 5JOQA 1KJIA 5LMUB 3DZDA 3M6FA 2JDIA 3RAPR 1Z9BA 1O8CA 2LIPA 1PYDA 3B6KA 3I92A 3VPDA 2IHJA 3P9ZA 3Q7TA 5FNZA 1LBEA 2RHRA 2VNHA 4CM8A 3BHNA 3PPYA 1GPUA 1KO5A 2HTEA 4YRTA 2IL1A 4KQCA 1OYOA 3GP5A 4HP8A 4Z8YA 3VAZA 3GG2A 3IVGA 1GG2A 4EG7A 2KPOA 1N7HA 1PLKA 4ZOBA 2JKYA 1XE3A 3PV0A 2VVTA 1UC5B 5JPDA 5IRCD 4DS3A 3C3KA 3K16A 5A62A 4QUEA 4YUXA 4BTVA 1EQUA 2PD4A 2PR7A 3PTAA 1M33A 4L57A 4A91A 2GO1A 2OHIA 3HH8A 1Z0KA 4KV7A 1KTVA 3RBZA 4OYLA 2D5IA 4Q3NA 1UKBA 1SIOA 2QR5A 3EH1A 1M2OB 1FSSA 4MI3A 2DERA 2FG5A 3VYTB 2ODAA 4F6RB 3WJ2A 2PBFA 4GRIA 3KZKA 2NU6A 4TN5A 4E32A 1T35A 1YNOA 2PO5A 1PW7A 5BR7A 4R1MA 4JBYA 1F60A 3D3KA 4MUGA 4HGZA 4BAUA 1VRCA 3RKSA 2C0PA 2ZI6A 5I3ZA 1JWAB 2UYOA 3TZCA 4R81A 4EY7A 3D1VA 1NT4A 4KN8A 4AKSA 1BN7A 3U6KA 4KX3A 2GJ8A 1LFAA 2PH7A 3JSAA 5CDGA 2JFFA 4H6WA 5DE3A 2JJ1A 4KHZA 3VSCA 1T3HA 4DR5B 3GC6A 5EN4A 3T6KA 2VPZA 5BUSA 1JFFB 3NI2A 1LVHA 5EMNA 4US2R 5KYKA 5KSZA 1JNXX 4FDLA 2AJ8A 4M8KA 4TS3A 1X15A 1YQEA 2QUZA 1KFJB 2P2DA 2H1WA 3LXRA 2ZB3A 4ACBA 3L1HA 2UDPA 1LJ8A 3ETNA 4MR8A 4XASA 4QTTB 1JFLA 5AM4A 3R23A 2DPMA 1UBSB 4GQAA 4QFMA 4FMCF 3D7SA 4C6TB 2C07A 5DH9A 3GP8A 3PR1A 4EHDA 2XCQA 2OT3B 4Y1GA 1YFJA 4YA6A 4R5MA 1NVWQ 3O21A 1PHRA 1PDOA 1XK7A 5FUBA 2E4WA 3WYGA 1AKUA 1LBSA 3FB1A 5EJ5A 1JHOA 2WLSA 4D8TA 2H17A 1RQPA 1EFKA 4K6CA 3K8YA 2Z2IA 3CN7A 2Q6TA 3E3AA 4LQ4A 2QBYA 3NV9A 5LZ7A 1GP2A 1TDJA 2ORYA 3O1LA 2DHRA 2HDOA 1GRRA 2X2PA 1Y3DE 3IVMA 5FPSA 3PUHA 1TYZA 2JA2A 4KACA 3SDZA 4S1VA 3C6QA 5KC9A 3B1JA 3DCNA 1XDSA 3HSYA 4FGJA 4X8MA 3BCRA 3TVYA 4FFBB 4MNTA 1C0LA 3ELBA 1SOMA 1KEZA 4RE5A 4TS9A 4LGYA 3GR6A 4UEOA 5JYEA 2ANCA 1GGVA 3OZDA 1QONA 2WIAA 3P1JA 3K96A 5AKKA 2CKMA 2OOSA 4ZAWA 1WA5A 2KBEA 2M1XA 5JDIC 3SX4A 3GDGA 2H48A 3ZEAA 4B7AA 1MT3A 3T1QA 1GGJA 3ADPA 1HOTA 2C9CA 2COUA 2FVYA 3UUWA 1G38A 2ONYA 3OLZA 2YN0A 4YPFA 2NP6A 2GYYA 2YY5A 3UGKA 4KW7A 4KUHA 3W6ZA 3E7WA 1SG9A 4WBSA 2Q3JA 3TXAA 2WKQA 1EZZA 2AD5A 1Q74A 2R8EA 1ST2A 4JP2A 4ARBA 3IMKA 3V9AA 3HTXA 3GMIA 3LDUA 3SZGA 4CR6A 4GXNA 3GVCA 4OLJA 1MG5A 1FDWA 5IZ4A 1XTSA 4KWTA 4AVYA 2BCJQ 2X1MA 2ZIEA 4FS8A 5AQ1A 3RYCA 4CLDA 1SKYE 3GLRA 3MCAA 1UDXA 1H2RS 5F51A 3ZNNA 1XCLA 2HO4A 2J33A 2G06A 4D4GA 4MVJG 1HFJA 2F3PA 2HPZA 2LW7A 3MGAA 1EE2A 4IW3B 1UFQA 4B6SA 5E9JA 3W6OA 2HRQA 3VI4B 5E7MA 3T7IA 1FXSA 3IOEA 2F8TA 5G3ZA 2O54A 3JS5A 1OXMA 3MCZA 4J07A 2YVQA 2I66A 5C52B 1AGXA 2PZFA 2IH2A 3SVTA 5G4KB 3HKDB 3HCBA 2IZ7A 3UCFA 2A57A 2UUCB 2HHCA 4X9XA 2OHXA 2WG0A 2UVPA 3NEJA 4OIMA 4OLBA 3AM5A 4IWXA 2ZYRA 3DZHA 4COOA 1HNWB 3UWMA 2VRBA 3ZDBA 4EQ6A 5EWJB 4ZYZA 5LP6F 2BEUA 2YR0A 3L01A 2XXBA 4DSOA 1II0A 4IIDA 1CF9A 1JI0A 4NENB 3O1JC 3JQAD 4ZVPA 1AKEA 1JIQA 5B37A 4HTFB 5HQ3B 2I7CA 3MTIA 2ECKA 1XPJA 1BMTA 1QK4A 4KQKA 4QXAA 5J5CA 4H16A 2EQBA 1R4AA 3FTQA 3R76A 4MGZR 3WHIA 3ZWKA 4GU5A 5HF5A 2ZUVA 2BUAA 2XB2A 3GJ5A 1BKYA 4TLEA 4N76A 1M1YA 1U8EA 3ZZ1A 1G59A 4Q7MB 3IJEB 1L4FA 2F6RA 1BCSB 3I73A 2PCLA 3CRNA 1HE4A 4I8IA 5CX4A 4CMEA 2HHHB 3QWHA 2G3YA 3DW1X 4D98A 4UTOA 2JJYA 2GZDA 1HORA 4B81A 4J1QA 1G8PA 4PPQA 1E59A 1URPA 2W4IA 3AV3A 4YLYA 4CETA 1EXVA 3BVPA 3FF1A 5JEEA 4DUYB 3HMKA 3HY4A 4WLOA 1ZVVA 3PQCA 1YD7A 4CR7A 4CGZA 2E85A 1WZUA 4BX2A 1X1EA 2HAEA 1T5LA 1WPXA 3NYQA 2R7LA 4PGFA 5TE9A 4ONEA 1I32A 4BFLA 3ADDA 5IBQA 1EP3B 1G41A 1MAWA 3MM4A 1G18A 2FPLA 2CXNA 4LPKA 5DTMA 2ATCA 3ASZA 4PXAA 4Y2SA 4WV3A 3QKSA 4BU0A 4CM7A 3AJ9A 3JQFC 4KE6A 1KKUA 1IHUA 1DRJA 1KVSA 3BFXA 1S8OA 2FMXA 4HDSA 4OP1A 2F4VB 1HDOA 3LOQA 4XDYA 1H0SA 1RXEA 4RWZA 1GZVA 2ZTSA 1VIYA 2HQ1A 3AVOA 3KE8A 5E9WA 2NTJA 5TXGA 4HBZA 3QOXA 4RQUA 5KX5B 5BSGA 9MHTA 1J9ZA 1J42A 1LQTA 1T0BA 1HLDA 3ETGA 1DO2A 1FP1D 1P2FA 3R0VA 2CLOB 4H1TA 3U80A 3UG6A 3UBTA 3MMZA 1FZTA 1Z68A 2NSHA 1CLUA 3OZTA 3PEVA 4D9BA 1JR3A 2WA1A 4M3NA 3QUBA 4E1AA 4F5DA 3PGVA 3X1WA 3OM8A 1WE2A 3ZHQA 4BEBA 1LH0A 1KP2A 3GWGA 4UUMA 1C9NA 3NAQA 1S3SA 4S2EA 4EB6A 1NXVA 4W8OA 5THXA 3PEFA 1RI1A 3S4YA 5SY6A 4F1JA 2NMVA 2OK7A 1H2EA 3I9V1 1PTKA 2A9VA 3PXEA 1WSDA 2EP7A 2Y4NA 1WKCA 1WB4A 4HGNA 3ICCA 2ZT5A 4PLVA 4CLOB 2BV3A 4WZAA 4WKGA 4C3ZA 5BWMA 5EZYF 2BONA 3FAKA 1Z6QA 1DG3A 1XTBA 4UFPA 1RRFA 5BSRA 4MV3A 5I4IA 2G5PA 3DT6A 3DLTA 2C4MA 2Y6UA 5K2OA 4A82A 2CBXA 2WQ6A 4DJTA 4OGKA 4KUEA 3BDIA 2E37A 1HXHA 1HZJA 3KNZA 1NJSA 3N2NA 4ZVQA 2WWIA 4D44A 4R98A 1KDYA 4FLEA 1EXWA 5KSOA 2O3QA 3HM9A 4D6YA 4XW2A 1Y4UA 1E2GA 3UJ6A 2VUUA 3ZE7A 3IDAA 3WL5A 1ZRMA 3EVCA 1R1DA 1FF9A 5FJIA 1SXJB 1T1GA 1IZ7A 3IBTA 4FKZA 3MPOA 4L85A 4U7HA 5ARCA 4AY3A 1HQCA 4BFTA 3M4XA 3TCNA 2HC9A 1WUYA 3D2AA 3PJGA 2HQSA 1VKRA 2W2KB 3GHHA 3L49A 2BI7A 2W6ID 3PHIA 2XCTB 2FWRA 1TVCA 4PF1A 5DRTA 1IULA 3ZWAA 2Z1NA 5EHIA 2P1DA 3X1DA 5JBQA 1GRVA 1DAFA 1OBVA 5U1PA 1C3VA 1EFTA 2DQ4A 5FOVA 2UUPA 3H04A 2HW8A 1DELA 2GDZA 3K09C 4LOJA 4X94A 3EMVA 3HKCA 3TQIA 4JLSA 3RKRA 2PLFA 3VR0A 3VM6A 2VDUE 4JT2A 1FU8A 4M0LA 1NMSA 1OAOC 1JHDA 1JQAA 2BJHA 2F64A 2QRMA 2X4GA 1HFEL 2C7GA 4ZQFA 2I76A 1EAYA 1U2EA 1UFKA 4ZOLB 4X84A 1D1TA 1P18A 2BP7B 2J32A 3A3NA 1RYFA 3PC7A 3DVAA 4LJYA 4TT8A 4DCGA 5CXUA 2ZK7A 3C16C 2X6TA 4EUEA 2NVUB 5E0OA 4RTKA 1QRAA 3BMOB 4B84A 1ZBQA 1DV1A 4W5HA 5PGMA 3WDMA 3ZCRA 4JK3A 5HS6A 3ITEA 3OZSA 4W9MC 3PCXA 4ZAZA 1NVTA 1SEPA 4FYPA 1EXDA 1EUZA 1QS0A 3FYUA 4KVGA 4M37A 4X7BA 5FV4A 5KDOA 1P0PA 2VQDA 3CISA 3D1JA 3U4HA 5BWCA 4NLLA 5AI8A 3VPCA 4O8CA 3RK0A 5FD8A 5JC8A 1G21E 3NTLA 1G8JA 2ILVA 3GEIA 2RAPA 5AM3A 2FN4A 1UBKS 4YO7A 1MOSA 1MAVA 1G3MA 1XZNA 1K89A 2BFBB 3E1SA 5LYYA 4YFVA 3UPUA 1N2CE 3M81A 4XVUA 3KG2A 4GSYA 2AVDA 1YOVB 1P62B 1JT2A 1A76A 1EWKA 1GYQA 1T2UA 2VWQA 2DFTA 2GBIA 2QX8A 3DZGA 1NNEA 3ZE2B 4PPFA 1Y1PA 1G8FA 1U7TA 2AI2A 4GICA 1SHJA 2VUHB 5EMHA 3F3MA 3G49A 4JIGA 3SD7A 3U48A 1E1QD 5LBUA 5I48A 2QV0A 2JHGA 2WJGA 3QMWA 3UMBA 4BY9E 3BXOA 3OKAA 4H7FA 4MI1A 4RA9B 3VVLA 4DHWA 3M6AA 3U3KA 3B7PA 2G0NA 2O0HA 5I01A 1T4CB 5D51S 1CJSA 4UJ5A 3HHPA 3QHQA 3LW8A 2FPIA 1HZZA 2HMVA 2CDCA 4CKWA 1YKSA 3B5EA 3CGWA 3N2GA 4EFDA 1A5BB 2PHZA 3ZNOA 4KXXA 3WJAA 2JK0A 4CQLB 1PHPA 4IG4A 4EMSA 2Q3HA 2YWGA 3CG4A 3DV2A 2C7PA 3S1AB 5E1DA 3HU3A 5B1DA 3N74A 3TINA 5ISMA 2I4LA 1YJQA 4M9CA 3ZCXA 1JHQA 1D0IA 2A9JA 4KFRA 4OHZA 4G4SO 1XDUA 1KK0A 1SOUA 2PBZA 1S3IA 4HDRA 2R68A 1A69A 3DZJA 3Q5DA 5DX0A 3LLVA 4QLAA 1Q50A 2H4HA 1QAMA 4JASB 3WO0A 2ENWA 4N3NA 3BXZA 4Q4CA 3H2KA 2LR0A 4BPBA 1HQDA 2HWWA 1JB1A 1XMQB 1PR4A 3SFTA 4AS1A 3GNTA 3PNMA 2ERXA 2XCOA 1E9DA 3C70A 3OTHA 3SE0A 4DIUA 4YMGA 2X22A 3R9KA 1WXGA 1NKSA 3UENA 1ZUNA 3Q3VA 1Y1KE 3ZG6A 3A6GA 5A4FS 3D54D 3JR7A 3VSEA 3LDGA 4LVCA 5LMCA 2ZTLA 2BDTA 1OI4A 1Q0RA 2H1LA 1JDSA 2ZB8A 1QG6A 1CDDA 3Q72A 4LYFA 4N6GA 4YQZA 1FTYA 4ALMA 2IEYA 3THYA 4NQZA 4LNUA 4QPZA 3DDOA 5EY5B 4B34A 3OY7A 5LNK6 2FSVC 2I2DA 2NO0A 3TI7A 3HMQA 5KNBH 4GDMA 1NMZA 3Q8XB 2O06A 4I5GA 2XNDD 5KQMA 3D3EA 1GFSA 4CL0A 1YQUA 2H1RA 2XD9A 3NU1A 3PNOA 1QCDA 1D09A 4X93A 4XIJA 1B23P 1GAXA 4IUCS 4CF3A 4HF7A 2OV2A 1GQSA 2C4UA 2I55A 2WJPA 5JRJA 3L43A 4WVFA 2EFHB 1Q0LA 1T36B 2WOOA 2AEMA 4N0MA 4WJKB 1G42A 1LTKA 3EF1A 4UDOA 1CY1A 2Q5QA 1ZICA 1YVDA 3KSRA 5ULLA 3MBIA 4ZHQA 4QJ5A 5JZ9A 1H42A 3MW8A 4FK8A 5AJUA 2Y1CA 1K8QA 5TQJA 4ZEWA 2JAHA 3RT9A 3WIOA 1VKOA 3BGIA 1YH3A 1Z0DA 4OAPA 4NNJA 4N03A 4NHOA 2FSFA 1WUIS 2ZBRA 5ES3A 5B4TA 1V1RB 2C1ZA 4YALA 2MHCA 4AJNA 1B8PA 1L0BA 1OT5A 3HUTA 4GXRA 1XIVA 2CL0X 4ON9A 4ZMBA 2FCRA 2IIVA 2NU9A 4AO8A 1TA4A 1N5IA 3BZBA 4L4XA 3IR5A 5AWFC 1SEVA 4G0MA 2HNBA 3COPA 2JRLA 1UKCA 2DH5A 2OGZA 1C1XA 2PVCA 4I3FA 1VMKA 5ICEA 1K8XB 2G83A 1YZUA 1U5CA 2LWIA 3JQGB 2WQZA 3IELA 4BO9A 4DLLA 3AK4A 2VC2B 1VLHA 2DQKA 3ISTA 4GFDA 1U6KA 2CE2X 4F86A 5AM1A 1C9MA 4K0RA 1WXQA 4LBYA 4WEOA 4HEA1 4WLFA 1ZNYA 3SZ3A 4YJ2A 3PDWA 4AZTA 4CM4B 1NRWA 1QTIA 4QSHA 3SFZA 4ES6A 1XZMA 3FCOA 1HLFA 4U63A 3GLGB 5CFPA 3KKMA 1Z4OA 1UP6A 2FOIA 3OOHA 5FL7D 3VR3D 2I78A 2Y93A 5DMHA 4POOA 5KYWB 1ILEA 2RAFA 4IVPA 4YLEA 1F2UB 1JQKA 4ASUA 5IAKA 3L9WA 5H81A 2WVJA 5J40A 4EA6A 2M98A 3FMPB 2HBYA 3Q6NA 1NI3A 4G9BA 4HGPA 4Q3OA 1PZNA 3PFWO 4OHBA 4BAZA 3NDBB 3FDFA 1SUCA 4TYPA 4S04A 3ND5A 2LIVA 3F47A 5FOQA 3P27A 5EJMA 1KYYA 2W2LA 2CVFA 3OTGA 2EFGA 3NYWA 4IFBA 3OOJA 4J0DA 3VBCA 5BSWA 4O1IA 4FU0A 2REBA 2NO6A 2YNMD 2VJMB 4JKYA 4ER5A 2Z6QA 3ROXA 1WG8A 3AUXA 1ESCA 4Q3DA 1Q14A 1YE3A 2I8LA 2QU8A 5A0VA 4K6GA 1OGIA 2IPOA 3FHTA 3R3XA 2JIPA 1VL1A 1EJBA 2PZGA 2YIVX 3H2IA 4JOSA 5CUQA 3WWEA 2R6GA 1MPTA 1NY6A 4MVJF 2QP3A 1KIFA 2DXIA 2ES4A 1KEKA 4XB6B 3EXEA 1FIUA 1XTPA 4JT4A 1BE8A 2I4TA 3DE4X 3K8QA 2O07A 3RVMA 2OZLB 2Q1TA 1U1EA 5SYNA 1RZRA 3A4LA 5IVKA 4KLRA 4TT3A 4OHWA 5C80A 1PEYA 3E22A 4YMLA 2Q5IA 4LRUA 2DP4E 3QXXA 2ZJ4A 1KR5A 2JLRA 5LLSA 1GQRA 2PL5A 2Q8QA 5BN5B 1E7QA 1K6EA 1WLSA 3DTYA 4YJ3A 3RT1A 3E9YA 5SZHB 3RHTA 3TRIA 4D9JA 2C84A 3SF0A 2P5YA 2CC2A 2PUJA 4W7IA 4WFIA 2ZE6A 4ZICA 1IPEA 5CBKA 5LPNA 3V4ZA 2IYWA 2BEKA 1YQ9A 2HHJA 1RFGE 3I01A 2Q6LA 1HDCA 1U4OA 4AAYA 1YB7A 3DMYA 1IHYA 1XTZA 2WIBA 2QEQA 3GJ0A 3GQVA 5JD6A 3BAFA 2O7RA 4YUYA 2BFCA 5AVXA 2A86A 3HLKA 4YY3B 4NXMB 1O6CA 2EX0A 4WIAA 2J3KA 2VTDA 2I5PO 3EF3A 1PD1A 1YCFA 4DBLC 4FEYA 4ZMSA 1U7DA 4ND3A 4YV2A 3LRXA 3WTBA 3Q7SA 3E05A 1ADJA 3DMRA 1H2HA 1EGVB 1O6ZA 3OWXA 4J0EA 5CVJA 3D7LA 3INRA 1UMBA 4WCFB 1KYZA 3MIIA 5M29A 2AJBA 3OLWA 2EAUA 4RGQA 4WMLA 4ARSA 3CLTC 1MO3A 3WYEA 4JYZA 6YASA 1PO7A 3IUSA 1CDZA 3C1TA 4RIEA 4JQCA 4HNTA 2HYDA 3HSSA 3TPZA 1C7QA 1QSGA 4FLFA 3TM4A 1GAQA 3ZXXA 4CLEA 3M5DA 3O8BA 4HDNB 3SYLA 5HHTA 5FBHA 16PKA 1IB0A 3VPFA 3EZ2A 2CLCX 1LTQA 1BFKA 3ZU4A 2XYQA 1XMJA 2V55B 4QBGB 1TIPA 1UFOA 2JAUA 3A1DA 2C2MA 2QVZX 4RVCA 3INNA 1T4MA 3VVBA 1Y6FA 2QMQA 4WAUA 2L42A 2H06A 3SLKA 1KF0A 3VH1A 4C7OB 1PJLA 2XOEA 3KPUA 3DXXA 1FXUA 4C0JA 5ALPA 3PG5A 4EA7A 2AE1A 1JG6A 1VXRA 5EYPB 1K6MA 4ALKA 1M8GA 4D4LA 4N82A 3FW1A 4LY9A 3OQBA 3KJEA 5F9MA 1JIVA 2R751 2WY2D 3JQRA 2G09A 1SZCA 3S40A 2FW8A 4P33A 3I5AA 2DSTA 3O74A 1EIWA 4EG0A 4TX1A 5K6AC 2BHTA 4CDMA 3NNNA 3RODA 3VR6D 5KB3A 3OD1A 3DOOA 4E46A 4XRGA 3OPYI 1EFHA 1B1CA 1AKYA 4NYIQ 3KQLA 4M7PA 1AMUA 2DQYA 1QG0A 2H9YA 3ZE6A 5AUOB 3EHEA 2CXTA 4YRNA 2C82A 1XJWA 1IOWA 1OLUB 1R3UA 1TGVA 1IJBA 1U0LA 4CF5A 1YZNA 5JAIA 5TRTA 1FC0A 3GUZA 4CHTA 1QYCA 2VNKA 3KJFA 2RB4A 2FEOA 1GHTA 3QX9A 4JY7A 1V47A 2WJ6A 3DVRX 4HT3B 2PRJA 3H1EA 4G1VA 4AJKA 1PVOA 2FZKA 3CA8A 3QLEA 5BSKA 4Y8VA 2ODEA 3GU3A 1EXMA 3EH2A 5BMVB 5IT5A 4EJFA 3F5MA 1UJCA 4JB2A 5K8TA 1OA0A 2I6SA 5CIQA 3KU1A 5FLEX 2AFIE 3WQQA 3NDPA 4FFRA 3BTOA 4LGMA 1Y9ZA 5KQRA 3OJEA 2OFPA 1SUSA 3GRPA 5FPQA 2BW0A 3OE7A 2QTHA 4V2IA 2GZ2A 121PA 1ZH4A 5FOUA 5JXJA 4IM7A 1SVMA 3W3ZB 3I5UA 2HQBA 2JLZA 4AF6A 4TYYA 4M1QA 4NBWA 5JZBA 2LP4Y 3VNVA 4RPCA 5IUKC 3CEHA 3I0NA 5KINB 1T9KA 1QIGA 2L82A 3DV0A 1EE9A 2QTVB 1VBMA 3KFVA 1NXWA 2V97A 4FR5A 4TXNA 1OBCA 3CM0A 3V1NA 4AUMA 1RWPA 2G7MC 5LYJB 2WUFA 3PX2A 2Q6OA 1E64A 4KQEA 1T5IA 3OPXA 4PC3A 2VPXA 2ZT7A 2P3SA 2YFKA 3PKJA 4IINA 2ZRPA 5SV2A 3SXJA 1HDRA 2VA8A 2AN9A 2C3MA 4M38A 5FPYA 1OAAA 3RWOA 5ITVA 4UUQA 1UJNA 1WBDA 2CZGA 1L5MA 5M3BA 3K6JA 3RUFA 4C14A 2PNFA 4CKCB 4GOLD 4DIBA 2J59A 4C7JA 3V33A 1PJTA 1P81A 1L1EA 4DDUA 4M1TA 3TLXA 4G63A 4BNVA 3ADOA 1YBHA 2OUIA 3GLKA 3R7WA 1V0JA 3TZQA 4L72A 5HR5A 4MYSA 3S2GA 5B1HA 3VKWA 3EQZA 4QX6A 4MUXA 3ZE9A 4WOCA 3T34A 1LPSA 4HC4A 4XGKA 5T64A 4P82A 1KSGA 1J23A 2AL7A 2Q1XA 2YZ2A 3BERA 3UWOA 1F2TA 1XEXB 2FTKE 3ROEA 2XRFA 5F1YA 3T3IA 2ID8A 5GWXA 1XEWY 3OX1A 1XYYA 1I2ZA 3BRWD 4J3JA 1EK6A 1CUZA 2QIOA 3ZJYA 4ZK2A 3DDWA 3W3AD 4M54A 3QSGA 4A2WA 1LDNA 1TFUA 4FCCA 5LZ9A 4RVOA 4B2LA 3L1JA 2WTNA 1Z6GA 3QVVA 1RXIA 4W82A 3OT1A 1JJVA 4ZI2A 1ZAKA 1H4TA 3D7NA 3EAFA 3BZUA 4PTLA 3DWGA 3LHSA 4LJ8A 4NJMA 1GJRA 2KSQA 1NR7A 3BCHA 1N9KA 3SPXA 3P2OA 5JVDB 1AOXA 4GI3A 1W6RA 3PA6A 1XAGA 5KTSA 2PJDA 1ADFA 3HR8A 4G1BA 1OPRA 2G7ZA 2MR6A 4YRZA 5CD1A 1JHRA 3FFXA 2PVPA 4BCDA 3VR1A 5FULA 4ENVA 1HETA 1PJSA 2CMFA 1E9CA 4TMKA 5HZHA 5IUNC 1DO0A 1E6LA 3E8XA 1L7BA 3DC7A 3K8ZA 4IY1A 1WUTA 4U7GA 3SYNA 3UY4A 3ES9A 3UA4A 4DBVO 4HQLA 4GW3A 4DA4A 2W83A 1WEKA 3U7EB 3PT9A 3DDUA 2PKCA 4RS4A 4JSTA 1O5TA 3V8PA 2G80A 4CQJA 2MINA 2WU4A 3GAFA 3O8QB 1NXQA 2WWGA 2YWXA 3CNEA 3LD9A 3RFCA 2V7PA 3M4NA 4PYQA 2ZUSA 4UW9A 1Y7PA 4DCPA 3ZXUB 3CW9A 2W6MA 4UHKA 3AI2A 1GPAA 4L2IB 2A0UA 1AUOA 2XX3A 3EOBI 3EXFA 4BU1A 4HDAA 4ZJPA 4UHBA 3AR9A 1F14A 3GMDA 1CY6A 1EVJA 4ZVRA 3C3BA 1JMVA 4YAEA 4RTJA 3ZCUA 2D2IA 4WFJA 3R3HA 5CFNA 3DMHA 2ZWVA 4JDUA 2D1SA 4N9QA 3UWKA 5C8VA 1EEHA 3G8YA 1KFKB 3ELUA 4X45A 2HX1A 4N40A 4B47A 3AF3A 3FIJA 4JODA 2YW9A 2VL7A 3IQGX 3PNKA 5J2UA 2WKPA 3P52A 4PC2A 1MTOA 2QVBA 3OKPA 4B8WA 2HK7A 3KOOA 3JZDA 2C9DA 3EBPA 1RAAA 1FZQA 2JFBA 1M6NA 1ZD4A 3EEQA 2OB1A 2VP6A 3NOVA 4PZUA 5AJXA 3W5UA 5JW6A 3ESZA 1R0LA 2VNSA 2C5LA 4FP9A 4IVNA 4B87A 4HZUA 3ZW7A 3GP3A 2EHDA 3EC1A 1UBOS 1KZ1A 3LMKA 3UB4A 4AJ1A 3DNFA 5KNLA 3H5OA 4PLCA 5I7VA 4HXYA 1O97C 1D2MA 1ZUIA 3AIKA 4QAQA 1GNRA 4KQHA 2DBVO 2UYYA 3GW8A 4URHA 3TZKA 3IIJA 1IFXA 3WHPA 3VUEA 4HYTA 4OI1A 5BORA 1SB8A 2X0NA 1B76A 5GJVC 2O2IA 3P0JA 4LF4B 3BZWA 2O7SA 3NCTA 4G01B 3ZIAA 2QUHA 3TLZA 1H9AA 3LNCA 2AR7A 2FGKA 1EK1A 1YZ3A 4ABTA 1EWRA 2HA4A 2IEIA 1KVUA 3TZLA 4BUJA 1NIJA 1ABEA 2Q5CA 3ORHA 1N2SA 1DVRA 4ND2A 5KNBA 4BLVA 2CLHB 1S0UA 1B8OA 3H8SA 3W5JA 1VMAA 3TQSA 4NK4A 4IIXA 4EHKA 3U3MA 1W4ZA 5A1TA 4E4RA 4IIFA 4C0HA 4F7DA 1NN5A 2VDQB 4L76A 1PJQA 3I62A 3VC7A 2NW6A 1U1FA 2ZYIA 4LXYA 1MV8A 3B9BA 3Q2KA 1DXHA 1MQAA 1OMOA 2J8ZA 2X13A 2FZLA 3HJGA 4QHSA 1TMYA 4XVQA 3MJVA 1A4UA 2BGLA 3F67A 2QLNA 5FCDA 4BNHA 3PUZA 4GKAA 4YPOA 5H4GA 3RSLA 5FLXA 3ONVA 1PWXA 2GCIA 3CMCO 4V0RA 4RZIA 5C32A 2NQ8A 1QHFA 4BXOA 3G5MA 1FB5A 4KGZA 5GONA 1BCRB 5KJFA 4DC0A 1ESNA 1B6TA 4HDSB 4XE5A 4LMRA 3NPMA 5LDHA 1IN8A 3I6QA 3COYA 3M1YA 2A2ZA 1IDOA 2FR1A 3FWHA 3L4KA 1R6UA 1W0JA 1X9HA 2R48A 1WXFA 2CHVA 4LXXA 3FRHA 3HBFA 1D5CA 3MT0A 4E3WA 4FBGA 4IVRA 4CEIB 1EA5A 2O1SA 2H1HA 3K0EA 4E7OA 3ZXYA 2O2SA 4CN9A 1EB9A 1Z0IA 2D13A 1Z5NA 4DNOA 1VL2A 1UANA 1GWNA 4J0KA 3K0CA 4TZKA 1YQDA 3PGXA 4BNTA 2HCFA 3CUSA 5JDCA 1E9VA 3AT1A 5EIFA 3QENA 4I1PA 3IP3A 4EFLA 3SSAA 1SXQA 3SQOA 3U81A 1P60A 5JMPA 3TVDA 3CO0S 4F6CA 5CFOA 4C4SA 2JGJA 3QLUC 2HOQA 2LRHA 4ZT6A 1NXTA 3CE9A 1KK1A 3IAS1 3O4FA 1J09A 1KQOA 4KVAA 2ZLBA 5CHEA 1COWD 3KCQA 5J4VA 5JPCA 4BJHB 2XIJA 5JROA 2FJUA 3UFXA 1DRKA 3D7KA 3GEMA 1W9HA 4XCQA 3ONEA 3STYA 4PZPA 1GKUB 5CDYA 2VHTA 1QBGA 3H7AA 2ZYTX 5H59A 4M2LA 3LUJA 3KCNA 3NC0C 5IZCC 1OH8A 4L4YA 2G4LA 3RYHB 4R2MA 1XTIA 4XD7D 1QF6A 1ZGBA 1USIA 2XODA 1ZUD1 4XWOA 2PAFA 4GPTA 4CKEB 1Y82A 3AEQB 2QQEA 3UIEA 5C8DA 2OILA 3DBHB 1BRTA 4YCLA 1MQ8B 3UJ7A 1ISIA 1KO7A 3Q5EA 1PVVA 4KG7A 2J5RA 4ZYWA 1CUFA 2I6QA 1HSZA 5D7BA 4DV7B 1E1NA 4ZU3A 5TDHA 3HK2A 2ICAA 3ASUA 4WK2B 3TLYA 1K3UB 1VDMA 1E0KA 5E3IA 1GUZA 1QOQB 4G0NA 2AZMA 1F3OA 2V8BA 3SS7X 3D4OA 4ECEA 3JARA 3CRZA 1L5VA 2EEPA 3E35A 1HNNA 3KE9A 5A6SB 3ZGVA 5IT0A 4WXRA 1C0KA 1AZTA 2C4HA 2F43A 1DBIA 4XYBA 3OPQA 4C7XA 1Z4QA 1Z29A 3ZWXA 3OUUA 2YFYA 3ZIUA 1AM4D 4MRMA 4MI9A 3KEMA 3CZ4A 1Y3AA 1T8SA 3KEQA 1GTMA 5EEGA 5K09A 1LDGA 3O4JA 3TSOA 1YU6A 2R1UA 2IIQA 2W22A 3I0MA 4IAOA 4TWZA 1T8PA 3A7EA 2QTRA 4TYWA 4YMWA 4CCAA 4PSCA 1WPQA 4GX5A 5HRUA 4CM9D 1N3LA 4PX9A 1RJFA 2QVLA 1T3LA 2ZR9A 3HCCA 3K5IA 3QUTA 2NAPA 3R0XA 4DIOA 3W9UA 4FKBA 1E7MA 3KSAC 3ENQA 1Y5LA 1I2MA 2RC5A 1GYPA 3AJAA 4H18A 2IUTA 1W73A 2NUBA 4IMJB 5CR9A 4YWJA 3K70C 1OUMA 5EVCA 3MMPA 4PHHA 2R6R1 5EKSA 4AWBA 3UC9A 2NUPA 1EFDN 4TRRA 4TLMB 2ATVA 1YUBA 2GZRA 2J9FB 3IQXA 4R8MA 1Z2EA 4MS4B 4OJTA 1SCIA 4YRSA 2YMPA 1VE5A 2ZUCA 4MUIA 3W1VA 1J21A 2PQMA 5HZGA 1P6XA 1Z7BA 2PFSA 2OWEA 1EFPB 3A9WA 3RU9A 1N8SA 3AOEA 3L8EA 4AG6A 5I9TA 3HG7A 4INOA 1IQRA 1GPYA 1JHXA 5EJ7A 2WSSD 4HGQA 4WDRA 1KK2A 2VK2A 1EDEA 5A2QA 2OBBA 4NNPA 2HTFA 3IAM6 1JLLA 3QU9A 1DWQA 3ZDCA 2RHBA 5L3RA 4V1CA 4F97A 5H70A 1ECFA 1Z13A 5F4ZA 3BCSA 2XUIA 3ZGYA 1OJLA 2JASA 2EOAA 4YRQA 1YDHA 3K1YA 5CYGA 4XWYA 1O9GA 3KK0A 5GAJA 4B0PA 3SJZA 1KARA 3D4BA 1E2JA 2C54A 3HJFA 3UT6A 1YRYE 3VC2A 3I12A 1V8DA 4O08A 5U9CA 1BXZA 1TF7A 1QGYA 1THTA 3L0YA 4KDEA 1DP4A 1S4QA 5D8DA 4YPVA 3NOOA 1KFCB 2Q99A 3GUYA 3V1TC 2PWBA 4EI7A 1WW2A 3I2KA 1HYHA 2H2DA 2OV6A 2FPIB 3E9EA 1HE1C 3IEMA 1MRSA 1N3YA 3HI6A 4U9IS 3BMNB 3ENVA 5FBKA 3N8DA 3CRVA 3LOPA 3ZU2A 1BGVA 4FQ5A 3NRCA 3R7LA 4ZALA 1JHZA 3H3FA 2XI4A 3MD0A 4ARVA 2X14A 3AXSA 2ALJA 3GQBA 3KIPA 4BCCA 1RJDA 3BL5A 2PWZA 3KQQA 3HXOA 1Z25A 5K0EA 1LK0A 4D96A 4DXAA 3HDVA 4J0JA 2ZPUA 3GNQA 3GLFE 1I7DA 1YS9A 1Z2AA 5I4KA 3SIPA 5L95A 2GLUA 3BMCA 4LZLA 4RF3A 1W5BA 2C5AA 1OGJA 1N2HA 2BFWA 2NLOA 1ZUNB 3FKJA 3I6IA 2X77A 2H59A 2PXXA 3FUCA 4KX5A 4CDNA 1GUFA 4XA8A 5AQEA 4UEJA 3B60A 1VHQA 2I0FA 3T1OA 4D0GA 4LNUB 2QYSA 3QOWA 5FWXA 4C4ZA 3WBFA 1C1DB 1RCFA 2C4WA 2VNJA 1QKJA 2EP5A 2I87A 4LZOA 3GCDA 1C80A 3FNGA 5DVZA 4ID9A 3QU2A 2QMZA 1S8FA 2ONKA 3NHSA 2M32A 1U8CB 2JBWA 1V1JA 5CDFA 3P45A 5TJ9A 3OO0A 4BGVA 3CX8A 2WUEA 5ITWA 3F7OA 1UIRA 1KS9A 3GFSA 5ESRA 1AHPA 2VJQA 4OUDB 3REFA 3T7DA 1RWXA 1AD2A 3NBQA 2WWXA 3NHRA 4WXPA 3FOFC 3B20A 4U6SA 2V5UA 1L5HB 1TQHA 1V25A 1OWLA 1YQXA 3PFKA 3S5JA 1YR2A 2XDAA 3BDVA 2JFNA 4QDTA 5HM6A 1CQIB 2QI9C 3KVNA 4YP0A 3OU6A 1CZOA 1UWCA 4IQ0A 2IX3A 2FP4A 3WYAA 1P80A 2P9YA 4G2NA 2BI4A 2H1CA 4N9WA 1U31A 4OXNA 3MJDA 2RD2A 1U4NA 4G4IA 4OOEA 4OXKA 2B82A 3THXB 1GL9B 3RUDA 3QQ5A 3SJ7A 4KZKA 3T7TA 3GV0A 2W6QA 3JZMA 4S1NA 2FEAA 3TI9A 3PFGA 4NDAA 1NJ8A 1EGQA 2VPPA 4OBWA 1V7ZA 1G98A 1Y6QA 3RBXA 4ZFNA 1D9XA 1GGNA 4IV8A 3WDSA 4CIVA 3W77A 5CHYA 3H2BA 4YP6A 5GVSA 4LHSA 4M0KA 4NFYA 1V8ZA 2IXTA 1VPWA 3UO8B 3AINA 5AFSA 1WKBA 1Z8NA 4BP1A 5KTPA 4DIMA 5C1PA 2B30A 1AN9A 1WWKA 2JIOA 4JSRA 1OT3A 3JATA 5F78A 1YRBA 5EIBD 2RBEA 1AXRA 2B5VA 2J7PD 1Q7GA 3HVJA 1CD5A 2A30A 3BKXA 4PRKA 2FOXA 4BX0A 1Q6YA 3HYCA 4GZ3A 1M2VB 1F8FA 1ILWA 1T26A 2DYKA 2ETXA 4FOLA 3EAGA 3LIIA 2AWOA 3VPSA 1F20A 5HJEA 1VPLA 3L77A 3TIGA 1EM6A 1H65A 1UWLA 2YJ3A 3H1BA 2I4OA 2QE7A 2MSWA 1CZRA 5CU7A 2P90A 1YVEI 1ZC4A 3DXFA 5JMTA 3F6RA 4LG1A 5E3JA 1OH6A 3SHWA 1S8NA 4TUYB 1C4XA 4MQ6A 4KGDA 4ALNA 4K86A 3DG9A 1JSZA 1Q2XA 3KTAA 1LK5A 1LLQA 3ZWPA 3GVIA 2RJ3A 2G1PA 3VDMA 4DWJA 1NP7A 2Q62A 4JR2A 2G70A 3VU1A 4HVAA 2J09A 1QVAA 1W5TA 4Q3EA 5K4GA 3HB9A 4KOAA 1MOPA 4MHOA 4WTOA 5E7IA 3OURA 4XARA 3WB9A 1OFTA 1CSEE 1RI3A 4MVJI 3VRHA 3O84A 4ALLA 2DECA 5AW0A 3ZJUA 4W7HA 1Y7IA 2V6BA 1T0PA 2X19A 1NX6A 1W29A 3B1VA 1TO1E 3B6EA 4TGLA 3JQAA 5ALRA 5FEMA 4BECA 1F0NA 4Q4LA 1XEFA 1XZAA 3L6EA 3TJRA 1EJ6A 2PTGA 4PPYA 3NIFB 4Q16A 1T9HA 3H1TA 4V0SA 2CV1A 1M8FA 1Y98A 3SXUB 4J0IA 3THWA 3QRWA 2HSDA 2PMCA 2ZRMA 2ZWPA 4F4HA 1KDVA 3T4UA 4W5JA 2ISCA 4IS2A 1HTBA 4IEEA 2WA2A 3GMTA 4UZSA 1MAUA 5B5SA 4N6NA 1P7CA 4RXUA 2IY8A 3DQQA 3P8ZA 5IAGA 2SCUB 4QUJA 2XJ9A 3E22B 4ATNA 1KAGA 2WWHA 1LWOA 3DFZA 3GN1A 3I9KA 4FI3F 4QGSA 2QRNA 3AB8A 4A73A 1SCAA 3CS3A 3ZHYA 2PLWA 3IYLW 1PQ4A 1MRZA 3T0GA 1T4DA 5GADl 2HK8A 3GEEA 4P32A 2POCA 4IKEA 3AFHA 1ZRHA 2BIFA 3VR6H 5AVRA 5LD2C 5FWNA 2X1VA 1T6BY 1P5FA 3HO6A 4D74A 3UWDA 4G8JA 3FGOA 2FRDA 3C7TA 3PUIA 3QU5A 4MYRA 5FNVA 3ZW8A 4BMOB 4EHBA 1K5DA 2VIIA 3G17A 5GIOE 3TRHA 1B43A 2XTAA 4R6WA 4DVGA 4KLZA 2MIIA 1M3SA 3ENZA 1G8YA 4NCKA 3DPIA 4GX0A 4HKTA 3B2QA 2VK1A 4O4IB 2CXXA 4F46A 3N8IA 3W5AA 3ESCA 1B6SA 3AKYA 4HLDA 3BXPA 2EYQA 3WLLA 5BURA 4FW9A 4KRXA 4N5MA 1KQGA 4FYMA 5FB3A 1Y1QA 5ITZB 3BPSA 3EIEA 4BMYA 3NM5A 3B5IA 3C2QA 3B7WA 1O1YA 3HVIA 4HH4A 4YQYA 4UPEA 5TPZD 5E6RA 1EX7A 1DEOA 3P96A 3I04A 1D1SA 4Y9RA 4WY2A 3RRYA 2AG8A 3AI3A 3DMNA 1DAOA 3NJRA 1O5OA 3KYCB 1UAYA 5K3AA 2QF7A 4F2HA 5DNUA 4E3ZA 3ZD6A 3QELA 4Q4AA 1U81A 2E82A 2X58A 5KKAA 3QPWA 4B3BA 1OD6A 3QVMA 5EUQB 3GLSA 4HGOA 4MR7A 4PAGA 1N2OA 1XRJA 3AF5A 1APBA 1G5FA 1IG0A 3WBBA 1TZJA 1D2NA 3QLTA 5A9SA 4P7BA 1G3QA 3D4NA 3LHFA 5DXAA 1Z0JA 1ND5A 2EU8A 2Y0DA 5B3JC 4AU1A 3L7AA 1EBFA 1CK4A 1GU1A 1YZVA 3I52A 4OPMA 3ITDA 2EGUA 3CF4A 2VYQA 2HUNA 4IFEA 3QVGB 1IQ0A 2MYUA 3CUKA 3RS4A 5A9RA 2ZE7A 3O03A 1QFJA 4WHMA 1MX5A 3OLQA 3GX1A 1K8RA 3MJ4A 2TYSB 3GLHA 2YYYA 4XTRA 2FEKA 2WJWA 4KSCA 3N87A 4ZU1X 1L1FA 2BM8A 5BN4A 1ZRNA 4DMKA 3VKGA 1QP7A 3KKPA 2IYVA 2XMBA 4HVTA 3IPXA 2CLEB 3VNRA 1TE2A 3ESQA 1FX0A 3KOMA 4TV8B 2XTMA 1N7GA 4TWAA 5ESDA 4IICA 4RPHA 3UHPA 4P38A 4D46A 5CYFA 3SG0A 1JLMA 3T15A 3TTXA 4TKVA 1ZW6A 1PNTA 4JJ8A 721PA 4MKHA 2ZRFA 2GR9A 1P9NA 1X8XA 4Z7JA 1DBSA 1JVBA 5A06A 1RVV1 2EBHX 2PGOA 3WL8A 3WS7A 3R8FA 2RH4A 2GCOA 4J6EA 5MFPA 3GH1A 2KBFA 4EGCB 4IDOA 2W6IA 3QEMA 4ZYUA 4DMHA 1C9EA 4JJEA 5AOAA 2CZCA 2WEKA 3PT5A 1BEZA 3H6KA 1M0TA 1T13A 3MCUA 4PO1A 1RFLA 4J2OA 4IKOA 5F2NA 2EKDA 3P4YA 3RSFA 1VPVA 1XHLA 1C14A 1ARZA 2CNWA 3U7IA 4INPA 3MWEB 3LG2A 4Q1FA 3C6YA 2VHZA 3KXKA 3TIFA 1WBJB 2N1MA 2OXRA 4IILA 4LISA 4HPJB 5HPYB 2M2IA 2BFAA 5IKOA 2FWMX 5C8ZA 4KWEA 5CH3A 5TC4A 5HXAA 2Z3VA 3MJTA 5FRDA 3OZXA 4Q7EA 3TLCA 1E8NA 2ZI7A 3IESA 3COSA 2W0MA 4X90A 3C8DA 1PX0A 2WVHA 1H5UA 1X2BA 3GIDA 1U8TA 4U2CA 4WY5A 1Q0HA 1N57A 2FR8C 2J0UA 3CLKA 4OXYA 4XGNA 4CHGA 4EUSA 3SNKA 2HWYA 3GEPA 1HE8B 3DAPA 3PC8A 4JZKA 3HA2A 4P86A 2ATEA 4YXWA 4ZKDA 3C15C 3MMNA 3L7NA 3PWSA 3TH5A 5A4AA 3V2UA 3OMXA 2ZVPX 3B7GA 5CITA 1XUOA 2P9HA 4B6OA 1U7XA 4I6JA 3MQFA 1L7VC 1DC7A 2HF7A 4LPSA 1Z7EA 2B1GA 5I7AA 4HDMA 5EZSA 3ADBA 3HYLA 5G4LA 2E7ZA 1ODFA 3QXJA 3VKFA 1ADGA 2CCKA 3KPYA 3TDKA 5EXSA 4GECA 2VP2A 1ORHA 3HADA 3KVOA 3G0HA 3CH5A 1RYMA 4KE8A 3EG9A 4LHYA 3RD5A 1TT7A 4D4KA 1JIKA 3MINA 4MLZA 1QHIA 2VUTA 3LTEA 4ZCPA 2X8JA 3AF1A 3C3PA 4YT5A 2R8RA 3KYJB 3ZHRA 4GIBA 3WGKA 4C7KA 3I09A 1E1QA 2B8NA 2H7XA 4I1OA 1IXKA 3DWIA 1TCUA 4BPRA 1E9SA 3WGUA 1BDMA 1CQZA 1DBPA 2JI9A 1DQSA 3H8WA 4FDTA 4GYJA 3NWBA 5A2GA 3N2EA 2ZUWA 3HP1A 1HRKA 2O2EA 2VJLA 3IODA 5LC1A 3ZUGA 4UNSA 3BGOS 3ZX4A 3EZYA 2FETA 5CNKA 2GD6A 3R0JA 5JD4A 2JLBA 3NKVA 3QYJA 4LI3X 4A8JA 1EWTA 1FYVA 2QOEA 4RM2A 2GYVA 2QRKA 3MGGA 5DHPA 1M2NA 4BWGA 5EJ4A 2QZ4A 1QDEA 4NEHB 4CMCA 1M34A 2HYIC 4HZIA 1MEEA 3K0FA 3KJIA 3LSYA 2Z5LA 1QF9A 1D9ZA 2IEDA 4WOJA 7REQA 2EL7A 3BTSA 4ZO8A 2I6XA 1Y33E 1J8QA 1SUEA 4M6WA 3K73O 3VOAA 4KPYA 4MW6A 2QN3A 4D9MA 3FYHA 3T1NA 2IP1A 3R0ZA 5T4EA 3V6MA 2ZM5A 5CT4A 3R5JA 3HVRA 1QC5A 2IUYA 3WV5A 2ZRAA 3E61A 3W79A 1TD9A 3P0IA 2NQTA 4UC0A 1CJKC 4C01A 4J7AA 1AZWA 2OORC 3A58B 4GPD1 2R5NA 3EWIA 5E4TA 2JFVA 3FPFA 3OWOA 2WU3A 3NJ8A 3ND7A 4V2UA 1KZ6A 2XNDA 4XB1A 3IJRA 1KDOA 3SZRA 3O8NA 4GNKA 3U7FB 4KE7A 4LJ9A 2H4XA 2HMTA 3LKZA 4E6PA 1G0OA 4H0NA 5B58T 1RACA 4ZD6A 1W36D 1E5LA 1BKSB 3JY6A 1GCOA 4YYZA 4CIBA 4J16C 4G84A 2QN7A 4EG4A 5DPMA 4EMUA 1U2DA 4DUPA 4EJSB 3OIVA 1R18A 4H7DA 4EM6A 2BBSA 5JNUA 3AVWA 2A7QA 4GWKA 1DCKA 1UBGA 2WAYA 4RHEA 2UU9B 3B3GA 3RVSA 5IULC 3WQHA 1ZOOA 3HJNA 2VZ8A 1ORTA 4BNLA 6ABPA 4G9GA 1CQJA 4NULA 2FH5B 5DSZA 2GBFA 3CZ9A 4Q4DA 2YJNA 1J8YF 2D7CA 1VG8A 2ZRIA 4D26A 3BIXA 4I4LA 1RQLA 1CFJA 5JCJD 1A4IA 3ILHA 4HFMA 3U2QA 4HEJA 4EJ6A 1ZW1A 1P4RA 1YOBA 2JHFA 1YI1A 4D5GA 4Y6LA 1QF7A 1UOQA 4WY8A 1Y4ZA 1Z18A 2PZLA 4RZHA 8ADHA 2M6KA 3AEYA 2JIMA 4FD3A 1KBZA 4PZ9A 5CURA 5T41A 5LIPA 4O4HB 2CMHA 3CF0A 3GJTA 3TFOA 5SZIA 2MTBA 3LC0A 4N65A 4DLRA 1E18A 1W2WB 4LGCA 3W90A 1GT6A 5HDBB 3A1TA 1FVFA 3T3OA 4DBLE 2HQOA 1NZFA 1WMFA 2DLCX 4Y9TA 1NF3A 5KAMA 2X9LA 5GM1A 2QLMA 2WUVA 2HPVA 4OIFA 1J2TA 1DC5A 2PV0A 4DQ0A 3GK3A 2X41A 4ZOCA 3KZXA 1MEOA 3CSDA 3NQ41 1MB2A 4HH0A 5GINE 3B8HA 1ZI6A 1MA0A 1N5LA 4J4HA 4YJFA 2CXUA 2OP1A 2ZBPA 3BWMA 3E9CA 5FL7A 4ZHQF 3HJTA 3QI7A 5CXQA 5AW4A 5CRIA 1F8UA 1TJNA 1VB3A 4LXGA 4RCZA 1JQLB 4RKYA 3ZWVA 1E98A 1V39A 1B73A 4PAWA 4TLDA 2ACVA 2W48A 3COVA 1KRWA 2ZB2A 3WBKA 6GPBA 1DNPA 3E9MA 3GA5A 3B9QA 5KVVA 1W5AA 2UZ4A 3F6CA 1EFRA 3NBZC 3WA7A 3AUKA 2NYRA 1VJ5A 3HZZA 3K3PA 3MAAC 1G20A 1Q0UA 3VZSA 4XPIA 2H1SA 1BTOA 3NORA 4DDKA 4QPCA 3L7MA 2HHLA 1WDMA 1A2KC 3GG9A 3Q8MA 4HEQA 3VGPA 1VL8A 3IP1A 2D2VA 3JWEA 1M8KA 3E1KA 3HKBA 3KQSA 3NBMA 3HP7A 5ARDA 3UVEA 4ESHA 3HEAA 4PFQA 4AQYB 2XRZA 1G8HA 4PHCA 5FOSA 5JO9A 1Z6TA 4UVDA 5CXXA 5BSTA 1P1KA 2OAQ1 5CX1B 1N5MA 1OV6A 3ZLVA 1WSAA 5KNCA 2J9XB 4NX2A 3TKYA 2E21A 3V7FA 3OZBA 3ZI4A 2RH5A 3FLBA 3VPHA 4AG5A 4ENRA 3N8NA 4I5EA 2NVBA 4YJ2F 2VSOA 1RAGA 3ZPXA 1S2OA 1CF2O 4IEIA 2YV2A 3OZCA 3TGLA 2P6PA 4B1FA 4YRKA 2CLMB 2TMDA 3I34X 1BEEA 1LPBB 3WB1A 2AHRA 4Z51A 3PYMA 2FUG6 1O54A 1WW3A 2V0CA 1JZQA 1F8YA 2H5JA 1U28C 1MC4A 2FPPA 1ONBA 2YC4C 2E0IA 3KDAA 5BNTA 5F23A 5I9BA 2RIRA 4X20B 2G9RA 3BL6A 3TVTA 5EPOA 4R5HA 3GUHA 3NOQA 1N2XA 1R0SA 1Q5PA 1S2LA 5ICCA 3ZVMA 2O19A 1A9SA 1C9YA 3H84A 2UXDB 4NU6A 3NKLA 2BFFA 2E55A 1YC5A 2WJ4A 4N0QA 4QVGA 4U6QA 4ABYA 3T12A 4DCNA 3WWYA 2H4JA 4OHUA 5BUQA 1WCXA 1PQWA 3MJCA 2VEOA 2MSCB 5I8PA 3T0FA 2PLNA 2ZYVX 1DQPA 4NCJA 1P29A 2YVLA 4BMVA 3KDSE 1K7XB 1WRBA 2AFHE 2G76A 3ZDRA 8ABPA 2ATXA 2HK6A 2EL9A 3HXTA 2V74B 2NZVG 4M83A 5DBGA 4EGFA 2ORIA 1V95A 1BIFA 1M54A 5T6BA 3RAGA 1UAGA 3EDRA 5HKKD 3JU3A 3P9XA 4U2EA 5C4IA 4CN8A 4OFBA 2J3QA 2VK4A 4XVHA 1FMTA 1VPEA 2C7BA 2XAUA 4BV2A 4ZZ3A 5B57C 2QG4A 1SIUA 1VM6A 3IIIA 4GD3Q 1OU0A 5EZQA 5BW5A 5TT1A 4YJ3F 4ZJYA 1ZD1A 2ZXEA 3I01M 2LGJA 3OP4A 4NPCA 4ND8B 1RLOA 1U8YA 4BFYA 1TADA 4J03A 4HYYA 4I08A 3RUIA 3PHGA 4JJ6A 2V1UA 3QE4A 4AULA 4ZDIA 2IZ6A 3DR3A 5CFMA 1DKLA 3AGPA 3IOCA 3CCCA 4RLFA 5DP1A 3AI1A 4HLCA 1K2WA 2W6CX 2MSNA 1HDEA 4DZTA 1ULZA 4BVGA 2O6LA 1XZJA 2PKQP 5K8IA 2C2OA 4I50A 1TKRA 5LJIA 1RI5A 2XA2A 3A4IA 2E5LB 1O96B 1YZLA 4N47A 2JB9A 1R5BA 2OGTA 1XNHA 2ZDQA 4DLKA 2HY7A 3VR6A 5LQMA 1CIJA 1KSJA 1PR6A 1NQVA 2JJ2D 3JQCA 3AEZA 5B4VA 3KSBC 3PGJA 4F5EA 4K05A 3WK5A 1FNCA 1CYDA 1G7CA 1N7JA 2YV3A 1JLRA 2GBLA 1R9NA 1SKBA 1LSJA 2FU5C 1AG9A 2E2WA 3AM4A 1BVUA 3HI4A 2CF6A 3LDFA 3OM0A 1BS2A 1R8JA 4NAHA 2V58A 5H9WA 3MCWA 1QLWA 1VG9B 2CFIA 3DAOA 3N3BC 4RD4A 3PNVA 1E3WA 3JD2A 2EZUA 3CZRA 4MA5A 4HWRA 5AM0A 1GM5A 2G4CA 5LU9A 5B12A 5ESWA 4OK5A 2R44A 4YREA 2CVHA 4AJHA 1D7AA 3LX6A 3QKUA 4KVFA 2WUDA 4BNDB 4M9XA 5KHLB 2I6FA 3M6UA 1ISFA 1BN6A 4O6VA 2NP7A 3A36A 4TTPA 4UMDA 4LQDA 4UQOA 3SVLA 1HDZA 4HAYA 1V35A 2YHUA 4PZYA 4YUAA 2O57A 3NW9A 4QGHA 4YV1A 1C41A 4L75A 5G1NA 3RSCA 3K0AB 3FWZA 1P72A 4E88A 5I47A 3ML1A 1N75A 1ZD2P 2FHPA 2JAQA 4ZV7A 2W6NA 4ZC8A 4JI5B 1TPYA 4ETNA 1TLTA 3HY6A 4XX0A 3O9ZA 2V7BA 4IDBA 2VR1A 1GYRA 1W52X 4O1MA 4V3CA 4NMXB 3OLVA 1P2UA 3WKEA 4I1VA 2ZJOA 3D64A 2NZ2A 2WIJA 3K05A 3ROMA 1QR6A 3UT0A 4YV7A 5AM2A 1A2BA 3B1FA 3NFRA 4G36A 1S89A 2Y1EA 1SUWA 4YV0A 1RM3A 4JJGA 4B6GA 3N0RA 2GCNA 1LNZA 2H0QA 1AJEA 3BTUA 5ALFA 1KMHA 4PG6A 3NC4A 5KI6A 4JJIA 4DMLA 2VK8A 3AKZA 5JAPA 4IUBS 4K2AA 1FDUA 1UADA 2FUNB 3L9XA 4QOJA 5F2EA 1GGMA 2VTKA 3PZBA 1DEAA 1A8SA 4P4SB 4GI2A 2E6KA 3B51X 1WZNA 3GJ4A 5IKXA 1NUPA 1OZHA 5HKLA 2UZ3A 1CS4C 1QGUA 4H3KB 3JQBA 3O82A 3AVQA 3DDCA 3DEYX 5DGXA 3ZGOA 5KJ6A 5F9FA 2R5WA 3E5MA 2XLCA 4L07A 3TDNA 3AP1A 4LBWA 3GF4A 3ST7A 2PPLA 3P19A 3L5OA 1CUGA 3QTTA 4DWVA 2BF7A 1QIFA 2XCIA 1ZSVA 5JNTA 5CB4B 4UHHA 4JBXA 4KR9A 2D62A 4NBKA 2YWCA 1POXA 2GEVA 2SECE 3L07A 1DQYA 4GI5A 2W9XA 1NUQA 3GJZA 3SDBA 4BNFA 5AUQA 2GD1O 2G72A 4J4BA 3BJZA 4BP8A 1AMNA 1NI4B 4R1OA 4JH0A 2CN1A 5CPFA 1B3BA 4U9HS 1L8AA 1ST3A 2GNPA 2GCPA 1SXHA 2BISA 2QK4A 2YW2A 2B8TA 5G53C 3TLEA 4MS3A 5C5IA 3D0QA 3BRWA 1KOFA 3MBKA 4GPZA 1MX3A 4J91A 4JOQA 2FPKA 3IR6A 5H3HA 5JXHA 4RHFA 3QKTA 5KTRA 3RIHA 1B41A 1RQRA 3W3AA 4EABA 5CAEA 3IIMA 1UC4B 4AZVA 3MTGA 5FI5A 1T1SA 4W5OA 1H1LB 1S96A 4A6XA 3H87A 2H7YA 1SUFA 1SBHA 1WJGA 3CQ9A 4X1OA 2R7KA 4ZDJA 5H80A 1X1CA 3PHJA 2HDWA 1Z2PX 4FPXA 1SXJC 5B64A 5EWLB 2MDTA 4UREA 4JI2B 1KI4A 3AHFA 3G59A 4RCVA 3AC0A 3H19A 3N28A 4PSAA 3UTCA 1GQOA 4HPWA 3QFTA 4WNAB 4EVIA 4REQA 1IPHA 1MO4A 5CBPA 3H11A 5ADHA 3QXHA 4MUBA 2OQVA 3EPPA 2QAGB 4BL5A 3EZ6A 1F6DA 1ELOA 2DY0A 5F35A 4OQLA 5SY4A 3ZV6A 3MIZA 4AN4A 3FUTA 2P9ZA 2Y1LA 1D1PA 2FWBA 2HK9A 5CVCA 3GFPA 4YRJA 1VHTA 4V03A 4CBVA 3T0IA 1QX4A 2IYYA 4B3TB 5EJ9A 1MR3F 4BQPA 4LF6B 3JATB 3KFLA 2Q5LA 5DZSA 1EX1A 1ZJ4A 3FNEA 2O8EB 4DSUA 5MN6A 3N0XA 2F2TA 4FXPA 1ZMBA 3E03A 4Y9DA 3RUCA 5L3QB 1FYWA 3QW2A 5IXJA 1PS9A 3K5PA 2FF7A 5AO9A 1DDGA 4F4CA 4W5TA 3PFFA 3DQPA 1GZHB 3AB7A 1OF1A 1A8HA 2ZTUA 3NV7A 5HUQA 4NEQA 5E1MA 4ERNA 4K2HA 2QRHA 4KITB 4YR9A 3TL6A 2QIPA 1OX4B 4A6DA 2KMLA 1WZEA 1NG1A 2PUEA 1WP9A 3CIOA 1JKJB 2K7ZA 3QZUA 2WDPA 3FI0A 2OB2A 2PLRA 4G1UC 4PTZA 1A0OA 2OV8A 2F9LA 1P3Y1 2GUGA 4W5RA 2NVOA 5CCBA 4QATA 1E2DA 3KDPA 4KYVA 3UWSA 1NE2A 1A88A 1HE5A 1LDMA 1JDZA 1UZNA 2QHXA 3C8MA 4JBHA 4W1RA 5LZ8A 5FL3A 1D2CA 4Q3AA 1G2IA 5HOEA 2CZQA 1NG9A 2CVZA 4GOJA 5AOBA 4G5XA 4Z54A 3T1HB 1XVAA 4C78A 2P9EA 2ZEJA 4YUZA 3AR5A 1ORDA 3EGXB 2EYUA 2PX2A 1LXCA 1GSAA 5HCNA 3IAXA 2WZCA 3VOTA 2EGGA 4TVSA 2HLDD 6NULA 4MWOA 1JKXA 4HPXB 5A9TA 1NVKA 3S2SA 3WLRA 2XDQA 3DLIA 3LVFO 5D6OA 4QT0A 1JA9A 3UF0A 3SC2B 3NJ4A 3NTVA 1U0HC 3CXUA 4EUHA 1GXSA 4AY5A 1KMMA 4H6VA 4D9KA 1Z7WA 1S1MA 2J6CA 2I8CA 2QKYA 1JH8A 1UZLA 4Q6BA 2NV0A 4MQEB 2Q4TA 4WOKA 2XKKA 3E6AA 4EBBA 5SYAA 1I5RA 4E94A 2V6IA 5D1NA 3AB3A 5J2UF 3DBLB 5BRAA 1A2OA 4G09A 4EI8A 1F6BA 3F46A 3A7DA 3BK2A 5HQJA 1OWMA 1RABA 3Q1LA 4ZAVA 1RR6A 3ZE8A 2EERA 4XJTA 3BM5A 3ZTWA 4GOOD 3TW8B 4IIHA 3RH0A 3RRBA 1X1BA 4KMRA 1GVNB 3PEWA 2MWMA 4PR3A 1R7RA 3MN1A 1UFRA 5BYAA 2XD4A 2AMVA 2FPSA 3P0RA 4LV6A 4TM8A 4CE6A 1X7ZA 2ZSAA 3ESAA 4P9NA 3RUPA 1FTNA 2WF6A 4AJOA 1N78A 2XTZA 1THZA 4C2UA 1QFMA 2RGXA 3P9IA 1XL1A 3OE1A 4CIWA 2XXJA 4Z0HO 3SIWA 4GXQA 3F6BX 5DOZA 3WZ2A 1R0RE 5JSZB 3KOXA 1UXKA 2X15A 4F7WA 5KTMA 2AEFA 2Q4EA 3F9RA 2C2HA 3K4QA 4LGVA 5J63A 4AMZA 1N0WA 4RK0A 1Y48E 2H51A 2YJ6A 4KQWA 2WZDA 1QIDA 3RAFC 2FDCA 2AN3A 2IYUA 3LUCA 3K9GA 1HSOA 4A8TA 5I9LA 4IH1A 3IT2A 4QEDA 1LV7A 3GJ3A 3GL9A 2FQ1A 4Z9FA 4BLQA 1GU7A 1J7KA 1ZI8A 2JPDA 3G2QA 3HCWA 3HY3A 4NK5A 4OTZA 4XLLA 3QPCA 3S2YA 1VJTA 1I4WA 3DDHA 1J1IA 2ZKLA 3NHZA 4YS6A 1COWA 4PAQA 3T54A 3W2FA 5JYBA 3KQUA 1LDYA 1K92A 2VJKA 3BWVA 4HDKB 5BR1A 1CG6A 2KX7A 4BRZA 3GFFA 1CR2A 4LSMA 3ZY6A 4BFSA 1PU2A 1T24A 1D8AA 1NULA 4MTCA 4NPAA 1ZNZA 1W4LA 1MQ9A 1JDBB 1NRXA 1UXOA 3NH9A 4HFRA 5GONF 4XD7A 3V8NA 3GLHB 1ZYUA 3O2NA 3BWCA 1L9XA 5E95A 3U5TA 3FCXA 3BB1A 5TQ2A 1LSOA 5T7BA 1IN4A 3DLPX 5LA6A 3CF4G 5GV8A 2BZ1A 3GH3A 1KQNA 3WLTA 5BQXA 5FPTA 2WWTA 5BNWA 3R6TA 2A33A 2HXYA 4X62B 2R0QC 1K97A 4GG1A 3UMCA 1QO7A 2FFBA 3E58A 1XCGB 2QXTA 2WYWA 4LOLA 2PXHA 2R3SA 4QTZA 4Z0PA 3UTDA 3A2KA 2JGRA 2BWJA 2WM3A 4INAA 4QOGA 4KXLA 4QODA 1G21A 1V8PA 4UVGA 2WB2A 1GRQA 1J4AA 4I66A 2JEZA 3WE7A 5DJ5A 1I6WA 3DLHA 3DOHA 2B92A 2IUEA 4XJSA 1CC1S 3JALB 1W5SA 1ZFNA 2AV6A 3L4BA 4P80A 1N2CA 3G2LA 1PFUA 4K87A 4BJ6A 3GZ4A 3B48A 5H4HA 1DJPA 1V9LA 2JRCA 2VXOA 3TW4A 4IH4A 4DMMA 4LCJA 5IDWA 4YROA 1ZS9A 3SX0A 4UPVA 3WL6A 3ZV3A 3TG2A 1PFVA 3Q87B 2VDOB 3W1EA 3WK7A 1QHXA 3DMTC 4ZV9A 4CM9A 3CT4A 2DBYA 2P3QA 2AS0A 5CCEA 3MWYW 3NT2A 1X70A 4FWBA 1BH6A 2XOXA 3DZCA 1E8MA 3RG2A 2RGGA 4W1QA 4ZJZA 1Z62A 4MR9B 1SG0A 2V45A 2O1XA 4UM7A 3IPAA 3ZCTA 5IDQA 1LVUA 1GPWB 2B7CA 1Z4NA 4EF4A 5A5GA 2WFLA 3HCOA 1PT5A 4EDHA 2UKDA 2AKAB 3N59A 2DM6A 2XVMA 3AF2A 4RESA 1JJAA 1NOJA 5REQB 3C3WA 4JB0A 5T5QA 5LOVA 3OQIB 3R3VA 2YIJA 4ZWNA 3W5DA 2BGJA 1RW4A 1JQEA 1ZA2A 4HH3C 3RC2A 3F7MA 4NS4A 3WZLA 1DARA 3LCMA 4BN5A 4Z7QB 1E63A 1DRWA 1HT1E 2CMGA 3OEWA 1KNXA 2V7GA 2ZP1A 3BE4A 2EQAA 2WSSA 1RHJA 4NEGA 5E1BA 5LLDA 1GADO 5B1IA 2GAOA 4MWBA 3IBSA 4BE7B 1X7WA 3F6EX 1MVLA 3E15A 4M87A 5NLLA 4EFMA 2DT5A 3M3PA 4H59A 4PAOA 1FLDA 2KQUA 5EPUA 4B4KA 4LF7B 2MSDB 2PSSA 1FFWA 2Y1FA 2I9KA 4B2YA 3I8OA 2EKBA 4IXNA 1CXZA 2CHFA 2B20A 1MF7A 1T8TA 3QA9A 4NJOA 2K6GA 1W35A 1WX1A 1DAKA 3I2HA 5J23A 1IONA 3ZKWB 4DGQA 4G65A 1KP3A 2LUOA 1FE8A 3DKVA 1F12A 1GZUA 3C24A 3M89A 3UICA 3U6BA 2CCGA 2RGWA 4MUAA 3MJEA 1ZQ1A 3SSOA 4OM8A 4MQLA 4L8VA 1PNOA 4JGIA 1WIWA 4FDMA 5GY7A 1V8BA 3F90A 4I4TA 4R9SA 1CUUA 5IN5A 4IDDA 1VCNA 3X43A 2G5TA 3H6HA 4KSYA 3TXYA 2GN8A 4PY2A 3S1SA 1EDBA 3L0CA 1QH1A 4ZO6A 1ICEA 5K3DA 2E6UX 4F04A 1GEEA 4WLEA 3JYPA 1BAPA 1L1RA 4WCFC 4DJAA 1M34B 5FJJA 3O4IA 2B1JA 4RDIA 2IIPA 5CLGA 2ZAGA 4JVOA 4DJFC 1FYEA 5C4MA 2R6FA 4KXFB 2CWWA 4MVYA 4YASA 5LB4A 4DT1B 2XBMA 2WIDA 4UUNA 4CQMB 3VDQA 1N6PA 4GWGA 3V2IA 2HDHA 3NTUA 5FQOA 2YUIA 4MLPA 2AG1A 1VYTA 3HC7A 1NYLA 2P62A 4DVJA 3NHYA 1OI7A 5CJPA 5K5EA 1HTWA 2W2QA 4GAEA 4RDXA 4DZZA 4J90A 3KJXA 4MV8A 1QRTA 3SQLA 4E2YA 5AKJA 1E6EA 3JYLA 1YA6A 1UMCB 1OJ7A 3DWFA 1Z07A 1GRCA 3JD1A 5HW0A 5HRCA 2FOLA 3TCXB 5K8VA 4OXXA 3VSAA 3HB4X 1JEAA 4ADSG 2HMWA 4H15A 5ALNA 2OM2A 4XVRA 1FEZA 2WR8A 5AVJA 4AC9A 1EUYA 1MJFA 3DJYA 1I4DD 3IUJA 1YDGA 1X7XA 1PL8A 2OO5C 3PC6A 3U7QA 3GRYA 3NTQA 4Z7OB 2DWCA 5CTAA 2PX4A 1CV2A 3FETA 3ECCA 3FVQA 4U0JA 3OQMA 1Z47A 1QHYA 3CLTD 2N47A 2PGDA 1JXAA 1NR1A 2Q2WA 1L7OA 4FOOA 3OTOB 3A37A 3CCFA 4QUIA 3L0DA 2GRUA 2IKSA 2WBLC 2J31A 2X1HA 3ZLBA 4ZZ2A 1K88A 2ZTHA 4ARUA 2FWPA 5LZ4A 1J06A 3WMGA 3HJUA 2QV7A 5DHTA 5A4JA 2XUPA 1LW7A 3B3FA 3DXZA 4FX2A 4BLSA 4IHQA 4QOIA 3BSSA 1QYIA 2H2GA 2WOJA 4GC9A 3TN7A 4MW4A 5E3HA 1Z38A 4Q4HA 2WABA 3GZTB 1QX3A 1KPGA 1TQ8A 2PKEA 4D3YA 1AKNA 1P0MA 4L08A 5C7YA 1JV2B 5IEBA 3MTDA 2DGDA 1JFRA 3UB2A 3R7BA 2D7JA 3TL2A 3IS3A 4C6HA 1TLLA 2RGRA 1NN3A 2PT9A 1MC1A 3A6HA 4MB2A 1EJ2A 1T25A 3VYWA 4E6EA 3PBKA 3HGTA 3R9XA 1FP2A 1A1SA 1HOXA 2YDXA 3HU5A 1GA4A 2G04A 2J7PA 4EI9A 1P1RA 4EENA 2HFKA 2ZU0C 3MSCA 3IAAA 4OHMA 4TV9A 1AV7A 4F3RA 3TBKA 2OHFA 1YDEA 4AUEA 4JWKA 3VDRA 1KZ7B 1KL7A 3O3MB 4YAGA 4RD0A 3VHXA 1P9LA 3KQWA 1SCJA 3I37X 3T95A 4LFBB 4M89A 5LR6A 1VG0B 2HMYB 2V7XA 2ZRNA 4HB0A 4ZDWA 1G9TA 2AFVA 4FGSA 2IOHA 3N2YA 1IZ8A 1WD5A 1S7GA 2EWMA 4KO8A 4EUFA 2C03A 1JPJA 2P69A 1X80A 5D3MB 1YQQA 2BFOA 1O03A 5EA2A 3PP8A 4CM1A 10MHA 1KEPA 3A4MA 1RP7A 3T52A 1L5FA 4QPJC 3B1XA 5L4NA 3AIOA 1UJ2A 4E4TA 2WTXA 7ADHA 5A5VA 4FJ2A 1T8UA 2VP0A 4U7FA 5FPPA 4AP5A 1FJGB 2B4KA 3CX3A 4DCOA 2FPWA 4UBIA 3TKAA 2H9IA 3BA6A 3DBRA 5FA8A 1IJFA 3T9BA 1E7WA 1KRHA 3NX4A 1QGED 3DCYA 3EW9A 1NL3A 1Q1GA 1JEQB 3QKIA 4CMIB 3U61B 4UEWA 2NUTA 1TUBA 3RF7A 1J0AA 4BKUA 2OQ2A 3AJEA 3BB4A 4KLNA 4JKIA 3WYDA 3DCIA 3GT4A 3M5WA 4YBRA 4BNWA 3D31A 5LM3A 3WRYC 3G8CA 4K6MA 1QYXA 1ZLXA 2GLXA 2ZTMA 3M6IA 2ISQA 4O29A 1VSUA 4ILEA 5AHWA 2QTWB 1YR7A 4RM3A 2G36A 3ZLTA 2XMQA 1QOPB 4FDVA 1G3UA 2ODNA 3V4SA 3G0IA 4JCOA 3VMMA 1SD5A 3ANTA 4U4AA 1EU1A 1JR6A 4EKDA 3K0BA 2RHMA 2A4KA 3U4AA 1KPIA 3T3HA 5EPEA 5MN4A 1Q84A 3D6HA 3NASA 1EUCB 1LS1A 3UJ9A 4ZMRA 4H7JA 1BHQ1 1CX9B 1BHJA 2FX2A 4D3XA 1YCHA 2QN6A 4ZP1A 4QICA 3OF2A 3T5CA 1SXGA 2EF0A 3FGZA 4ANFA 3QMMA 4RPJA 5U4QA 5LQDA 2HIMA 3FOBA 1QU3A 2FZ5A 5M2QA 2BPOA 2GNAA 1NVXQ 1RT9A 2M6RA 1IY9A 2HXSA 4JJZA 3WOVA 3RBVA 4MMXB 5FEUA 1E92A 1GFWA 1BU5A 3CNLA 1W2HA 3PLNA 2GPWA 1RXSA 3IKLA 2H5EA 5CVVA 1SULA 2J5XA 1NSYA 3E9NA 3GZNB 4R9RA 5AYVA 4YAJA 5G0WA 4EYSA 4P7JA 2DETA 1A9QA 2FZWA 2GLTA 2NX2A 3AY6A 4OM7A 1NDUA 4FDUA 3LY8A 1OOEA 1BW9A 4UQLA 1RZ3A 4GEGA 2H31A 4O3MA 1FMCA 1T2EA 5TPWA 4OI4A 3TRKA 1NZDA 2JI7A 5IYZA 3GIWA 5TX7A 3MWDA 3ZOKA 2KI5A 4WBXC 2GYWA 1NPTO 4X44A 2E9SA 3T41A 5THKA 4BO8A 2QNBA 1AF7A 1KC3A 2YVAA 1GLNA 3F1LA 2CFCA 1XDWA 1ACJA 2KM1A 3HKEB 3C74A 3EW7A 3LPLA 4GMDA 1L8OA 3N70A 5A7FA 4FEAA 1H8ED 4FMPA 4IZOA 4NICA 5KTKA 1C7ZA 4LVNA 1XGKA 3PNPA 4IIJB 1CT9A 4CM3A 4BQNA 3W5IA 2BTQA 2N1BA 2Z2ZA 4NZ9A 4UE2A 5FR2A 5EJ2A 3PU6A 2IHNA 1I51A 2AFIA 2R8OA 5FNVF 3REGA 2C7VA 4ED9A 4RMIA 1Y1LA 1FPMA 3TTSA 5IJ0A 1Z12A 2E5FA 5BSHA 5EC8A 3B82A 5ED0A 1FLNA 2A5GA 3QE3A 1ZJ5A 3ERCA 2UYGA 2C3YA 2XY4A 4D81A 1BA2A 1NP3A 3EA4A 1DCTA 1CTQA 2HF9A 4JGGA 1V48A 3NAGA 5ESXA 5A4DA 5JZVA 4K81B 4O4JA 5D5PA 5KQLA 1UJBA 5LBIA 3SHQA 3KQPA 2XUKA 2O6HA 3IP9A 1TQ6A 3I04M 4HX2A 4IF4A 2R6HA 1DAMA 3FPEA 3IMCA 1PR0A 3K9HA 5HTOA 2CCJA 4IKPA 2WILA 4PV7A 4YJGB 2FLKA 2VHYA 4OGGA 5EUCA 5CDSA 3KU4A 3NDJA 3RT7A 2AR9A 1B0ZA 2HM7A 1T34A 2RH9B 3GGOA 1EVLA 2Q4DA 2ZJ2A 4FEEA 1QCCA 3CZAA 1LZKA 1EEXB 2C57A 1U3GA 4HQRA 1FJHA 1KC1A 1FFCA 2ZRDA 3UANA 2HQRA 5JJCA 3I5XA 1P4GA 1GKLA 2E4VA 3OPVA 3QVLA 5F5LA 4YGYA 3K94A 3DM9B 1XROA 1ZCFA 1ONOA 1UMDA 1JG2A 2WHPA 3ZHVA 5AUNB 1YIDA 3HXQA 4IQGA 3NB0A 3SI7A 1I4OA 4HXGA 2IRWA 4RKEA 2OKGA 1IBMB 3DBOB 3G88A 3FMGA 3OEHD 3LZCA 2P6MA 2B5OA 2YWHA 3RS7A 3FNRA 1N2GA 3VKHA 4P0QB 1E3QA 1VG1A 1Z6PA 4Q01A 4G8DA 2YNMC 5H82A 2A9PA 1X1AA 2BAGA 3I9JA 2ACKA 3QSYA 3BF8A 2GTHA 5K20A 1Z45A 1I01A 2FZCA 5IVDA 4DV6B 4MLCA 5JJ5A 3F78A 3GEGA 3CZ5A 4QYTA 3QLVC 2G9UA 4XUDA 4MWCA 5C1DA 3PJRA 1M6VA 2RONA 2W4QA 4ID3A 3L46A 4KLAA 1U2GA 2XE8A 2R65A 4RIFA 1BWQA 4X7RA 4UTVA 1ZH2A 4RGYA 2IPLA 2VDNB 4LY6A 4D7AA 4R8LA 3LNTA 1P2DA 5C3MA 1SK8A 2QQ0A 2B7LA 2N3ZA 3DTTA 4N8DA 2FGJA 1T5HX 1EJ0A 2Q3LA 3KZNA 1BYIA 4FMDB 4MMYB 4YQFA 5CA1A 1FMJA 3PIDA 1PGOA 5L40A 1OFIA 4BMDA 3MERA 3EXAA 1Y3CE 3K20A 4LJAA 4YCMA 3IQEA 4RF4A 4DQUA 2IODA 4MGYR 4IBOA 4O2BA 4QUDA 4EYKA 3WLFA 4LJSA 1P77A 2ENUA 2XWQA 1ZLYA 4DG9A 3UAVA 1ZD8A 3DNMA 4YP7A 4HATA 5EIOA 3JTMA 3T7AA 4CIXA 3UQYS 5L7WA 3V8QA 2QROA 4AO6A 4EL0A 4G4GA 4AD8A 3KSMA 4NYJR 4MW7A 1UC9A 1CEXA 4KR6A 3EVBA 4U2KA 3WFZA 4BRUA 4UM9B 4INZA 1RQGA 3O6VA 1E7SA 2ZR8A 4EY8A 1RBMA 3L04A 3LX5A 2GEBA 3M8KA 1E7YA 3ISJA 3PFIA 4OB6A 2ZPTX 4RTNA 2I7TA 1E32A 2WPDD 3HCAA 4MCJA 1US8B 2JHAA 4FNAA 4GVPA 1G4HA 4BJ3A 4CYMA 3KFXA 4UTRA 1R6DA 3C6KA 4FILA 1XELA 2MYPA 5I7EA 3F7NA 3LE8A 4AURA 1YTUA 3L0PA 4XFJA 4OHFA 4II7A 2DH6A 3WMRA 3PDIA 2GX6A 2VA9A 4YN3A 2HJWA 4RVUA 3ZW9A 2Y1XA 2H9AA 3AVUA 1DAPA 4XWKA 1T2NA 2XOKA 1IN1A 1A4RA 1ECJA 2ZSDA 1G5QA 1WUJS 3X2FA 2QMUA 3PRYA 3EVDA 3K1JA 1JEEA 3IQIX 2EF1A 4GBJA 1E2MA 5TVKA 1ML4A 4Y6PA 3REQA 1XDGA 3IUBA 3LUFA 5K9ZA 5L7YA 5AVOA 1KI8A 3K6SB 1J22A 3U7RA 3RRXA 5BW4A 3HB5X 1ZCBA 3OESA 1TJYA 4FGWA 4KXQA 2IXAA 4ZOEA 2IZ5A 4Q47A 4JC5A 1KVRA 1YVRA 1ULSA 4Q0MA 5CBPB 4L5YA 1NC3A 3IUMA 5HIJA 4CTOA 1E1CB 1I7SB 5C31A 2HREA 2HIAA 3SSNA 3UOWA 2B6HA 4HSGA 3OKFA 4KZPA 3HNPA 4Q21A 1ZNQO 5JBNA 2H7VA 4PLWA 2OWDA 2VJAA 5DYIA 4E08A 1A98A 3I58A 1U0FA 3EGCA 1W88B 3Q4GA 5E9QA 1F