4QGGA

Tmk in complex with compound 46, 2-(3-chlorophenoxy)-3-fluoro-4-{(1r)-3-methyl-1-[(3s)-3-(5-methyl-2,4-dioxo-3,4-dihydropyrimidin-1(2h)-yl)piperidin-1-yl]butyl}benzoic acid
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
204
structure length
193
Chain Sequence
SAFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEIRKIVLEGNDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERDQEDLKFHEKVIEGYQEIIHNESQRFKSVNADQPLENVVEDTYQTIIKYLEKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Antibacterial inhibitors of gram-positive thymidylate kinase: structure-activity relationships and chiral preference of a new hydrophobic binding region.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Transferase/transferase inhibitor
molecule keywords Thymidylate kinase
total genus 81
structure length 193
sequence length 204
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2014-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4qggA00
4LY6A 3P1JA 3CRMA 1II8A 2OUKA 2V9PA 1V43A 3MGCA 2PZEA 2R44A 3DMDA 1D5CA 1G18A 4LPSA 4BFUA 2IEYA 4URUR 4G5SA 1G6HA 2GJ9A 1VKJA 2A5DA 2ZRJA 4Q00A 2OT3B 4GRAA 4JBWA 3WYFA 5CK4A 4M21A 4ARZA 1NMZA 4LYJA 4ZCMA 4XH9B 4TYNA 1Z06A 4TLAA 4Q9LA 3W5JA 2OM2A 3QPVA 2XXAB 3L0SA 3F5FA 5KNBA 4BFTA 2ZSDA 4Q02A 4LC1A 1TQDA 2ZVPX 2ODNA 5EXSA 3TR5A 4A8JB 1CR0A 2YKGA 3KDSE 1ZINA 2HT1A 2IWRA 3PEUA 4NYJR 1P4SA 4MQBA 4MGKR 2YOGA 1SULA 1ZD8A 1Q1BA 1BMFA 3ZVNA 4UNPA 2ZSEA 1P9RA 1UADA 4GNKA 4DIDA 1ZIOA 1XTJA 4WVFA 4GT1A 4LJ4A 4HAZA 5TDHA 4TYYA 5JJKA 1NLYA 2ZRBA 4EJSC 1CEEA 4HLCA 4QBIA 2JDID 3U6KA 3ZIAA 1NMXA 2VSOA 3AVWA 2R65A 1Z6XA 3CPJB 4D82A 2D7DA 2ZETA 2GXSA 4GOKA 1HTWA 2PT7A 1CP2A 1E9CA 1Q1EA 1S2MA 1X3SA 3KB1A 5D3MA 4EPVA 3TVDA 2BBOA 1M2OB 4TQ9A 4ZCLA 5L3SA 1RFLA 4D81A 4RY2A 2FOLA 4FMCB 2RGCA 4HAWA 3MUFA 4NZYA 5FUXA 5AUNB 1LNZA 2EWVA 2MSDB 3Q9LA 3W5IA 2A2ZA 1F2TB 2CK3A 1N5KA 4QGGA 3RS0A 4DCVA 1ESMA 2QUZA 3THXA 3SJAA 3H4MA 2OLKA 4YMUA 4J0QA 3KXKA 4ABYA 3CF6R 4AURA 4IFEA 2BMJA 2RMKA 1P9WA 1KDPA 3BXZA 3IQXA 1IQPA 1AQUA 3TVTA 2A30A 2OXRA 3KKNA 4LV5B 2QMOA 5IDVA 2G0NA 3PQCA 1QHSA 1EX7A 2P3SA 1NLFA 1KI8A 2IT1A 2ZQ5A 1TUIA 4KODA 5FTNA 1KGDA 4UJ5A 2E1RA 1G5PA 2BVNA 3F0TA 5FI1B 3UMSA 4JYCA 2Z4SA 2ZREA 1UDXA 2ZE8A 4MDEA 4DVGA 3FWYA 4KAXA 4EPWA 1H65A 1GL7A 3FVQA 2GDJA 3Q7PA 4ZIRA 1PV4A 3H86A 1XPUA 3WY9A 4EPTA 3A4MA 5FPTA 3KKQA 1GP2A 3AVTA 2QL6A 3MWKA 4ESVA 4ASUA 3AVOA 2REBA 2ZJ5A 3IBYA 2J0VA 3THYA 4KLNA 1QVAA 5EUQB 2ZRIA 1GSIA 1KSFX 2QAJA 2FPKA 1F5NA 4XSGA 1LB1B 4WZ6A 1OIVA 4DJTA 1G64A 4EAQA 2WAYA 4FCVA 2G6BA 5DIFA 2O8DB 5FBRB 3GLHA 4BWYA 2CNWD 2VF8A 2GILA 4TSFA 1FX0A 4JBYA 4PQYA 3LBNA 3MSXA 4G5QA 5A0FA 2C2HA 4CEJA 4A4DA 3DVLA 4DZZA 2ZROA 3FFBA 4JLNA 2FFQA 1QHHA 1RRCA 4Q7MB 4JLPA 1FP7A 3HP1A 1WQ1R 4QGFA 1AA9A 1KI2A 2D74A 3AGPA 2DFTA 1BOFA 4B75A 1Z63A 4W9MC 1AGRA 2OILA 3K0CA 1G8PA 2WPDD 3WNCA 2H8KA 2A5YB 4ILEA 2VP0A 3OEED 4B2IA 2G83A 3K0FA 1P72A 3QKSB 3PR1A 3X2SA 3AVVA 4PC6A 4E5UA 2QRNA 3T06B 2R9VA 1W44A 2RGAA 4LJ7A 4B32A 2IUSA 2IYYA 3KXIA 3OEEA 4CW7A 4N0DA 5EE3A 3KUDA 3REFA 4HZUB 3CR7A 4GP7A 1OH5A 2AKYA 1S1MA 2FE4A 4K8OA 1E9SA 4MH0R 5CIQA 4C0LA 121PA 1XEWY 2PJZA 3DEFA 3VTKA 2JLUA 2IW3A 2WJVA 2QZ4A 1N5LA 2AHOA 2RGXA 2QORA 5BN3A 4D6PA 1Q3TA 4MRNA 1XTKA 3GP8A 4CEHA 2F1HA 2QM7A 4IDNA 4JVLA 3B1VA 1EXMA 2NOAA 4KJZA 4LHYA 2XXAA 1E2PA 2HEIA 2QI9C 3H0KA 3ZVLA 4EJSA 4Q1CA 5KO2A 4B3GA 1X6VA 3FFAA 1KSGA 1T9HA 4PHGA 2EFDB 4BQSA 1SVKA 3AP1A 2QMUA 2HV8A 1NY6A 3PCRB 3BFKA 3TSWA 2C03A 1XJ0A 2A5JA 1QRAA 3UWOA 2IYSA 4NDZA 2BM1A 3IPXA 3LVRE 1WE2A 4FINA 3FGNA 1JJ7A 2ZRLA 4TQUS 3GMTA 2XJ9A 2OCYC 1KSJA 2E87A 1Z5ZA 4UNSA 2ZAMA 2GK6A 1QG4A 2ZJYA 5CITA 4V02A 1TF5A 2PCJA 5CJ2A 4YXWD 4POAA 4PXAA 4JLVA 3W6NA 2PCLA 1Q1ZA 5JECA 2ONJA 4KFUA 4Q5IA 1RVDA 4WAUA 4XD7A 2G0TA 3KQKA 1AJEA 3WYGA 1G3UA 2W6JD 1W2GA 1NKSA 1SVMA 5AUPB 2RGBA 2RGEA 2RB4A 2DBYA 3U7HB 1OFTA 1W48A 2XTMA 4XOIA 3UWKA 1ZU4A 1OSNA 1IM2A 2EWWA 1VDZA 2BBSA 4LDJA 2QGNA 3CWQA 1R2QA 1ELOA 2GZHA 2DCUA 4LBZA 2HCJB 5J40A 1E2LA 4TZ0A 3ZS9A 1E9FA 3I3SR 4MUAA 5EZ5A 1DEKA 3VR2A 2FFAA 1XD2B 2QN6A 4GL2A 4HSEA 3OIYA 3PEYA 3V00A 4ZI3A 2ZVQX 2CNWA 5EZ6B 1SVOA 1R7RA 4DEYA 1RW4A 2WM9B 3K53A 2FV8A 2GJAA 1F60A 3E2IA 4FMBB 4OHVA 3LX8A 1CJVC 3U7FB 4M1SA 3BS4A 1Z83A 2V6IA 3AGQA 3QSYA 1G3RA 3WHKA 4DB4A 5DYIA 1DG1G 2ZRHA 2W83A 3O8DA 4P3YA 4RVCA 1GAJA 3B60A 1YE8A 2OO7A 4M0LA 5GVSA 3CX8A 2QA5A 1L4YA 3CF0A 1KDOA 3S1AA 3K9LA 4TMVA 3ND8A 1I2MA 2O0JA 4GBMA 4IXMA 4TMZA 1GL6A 2GTPA 2CCJA 1ZM2A 5AJXA 2QG6A 3QF7A 5CYPA 1XZPA 2J7PD 3K70B 3IO3A 1VYUA 4DRZA 4Z8XA 1U98A 3GJ6A 2ZI9A 2ZI3A 2ZRFA 3C4JA 3X1XA 2EQBA 4DLZA 5FH9A 2ZRMA 1CU1A 1U2RA 2WICA 4QNRA 1PLJA 3FE2A 2YINC 1GFIA 2H5EA 4IRUB 3VHLB 1E1QD 1A4RA 1ZC3A 4GP6A 3GLFA 3Q5EA 4CZ2A 5TMPA 1E2MA 1FQJA 2VP4A 2YC4C 4FD2A 1VECA 5KSOA 2NQ2C 3BJIC 4LRWA 3EPJA 4Q48A 5CM8B 1E4YA 1KI4A 1ZVQA 4DXAA 5SZJA 3QXSA 1OHHD 2DWOA 2PLRA 4JVMA 1PZNA 2ZEJA 3MLEA 3OIUA 4OI0A 2IA5A 2Q21A 4KXFB 1N6RA 3BRWD 2D2EA 5DO9A 2X2EA 4MKIA 2RGDA 3EZ7A 1XTRA 2JIZA 1VG8A 4L9SA 2CBZA 2WWXA 2BCJQ 4MUBA 1NIPA 1N6OA 5SZIA 4C0JA 2G3YA 4CEHB 3EZ9A 4OQMA 1Y63A 3TKLA 4NBSA 3GJ0A 3PUZA 1C9KA 4G1UC 1FZQA 1K5GA 3P4XA 2WWFA 4MYHA 1BIFA 4LI0A 3SI7A 1QF9A 1RJ9B 2XTNA 3OIVA 1U0LA 1IOZA 3K0AA 2NPFA 2XAUA 4X8LA 3WYAA 1JAHA 3ONWA 4URYR 2H16A 1CTQA 1Q20A 2GVDC 2GBLA 1VG9B 2DB3A 1VIAA 3PITA 2EU8A 3W9YA 5J47A 2GEDA 3CM0A 1W49A 1NIJA 2ZRCA 1XCGB 2QAGB 2B6HA 3L0PA 2VEDA 1XJCA 2G1JA 4TWZA 2AK3A 3TQFA 2LCFA 2C9YA 4DLUA 5EP3A 1TQ4A 2QMEA 3RS3A 4BE7B 3VQTA 3TLXA 1MR3F 5FOWA 4HDQB 2JEOA 5B57C 1AN0A 1BYIA 1OHHA 2LWIA 2YJTD 4HLDA 4LHVA 5FFMA 1W47A 1Z2CA 3CH5A 3SYLA 4CVNA 4NH0A 2WVJA 3FHCB 2CLDX 4ZO4A 2ZE6A 4NMMA 1X1SA 4TMTA 5LB4A 1YR6A 1BS1A 5FL7A 1ZJ6A 1KDRA 2DPXA 2JJ1A 1MO5A 4UJ3A 2PJRA 4JLBA 2DFNA 2XB4A 2ZRKA 5J5CA 4NTZA 2HT6A 521PA 2G1KA 2F9MA 3QKRB 2DWQA 4R9UC 1TL7C 4M1MA 1KYIA 1TU4A 3KJIA 1W5SA 3LA6A 1R6BX 4GI7A 2HLDD 3IEVA 2WOJA 4BPBA 4O2LA 4QKQA 2CDNA 1DG3A 2QQ0A 3CX6A 4ZV4A 1N0WA 3UK6A 1E99A 4FMDF 4NYIR 5G40A 3R9XA 2SHKA 2C77A 1XMIA 1KSHA 2J3EA 3EC1A 2BHRA 5J4VA 2O8BB 2D3WA 2W0MA 3LRPA 1M8PA 1E2GA 2BWJA 3B1XA 4KBFA 4TQAA 5LD2C 2F3RA 4M53A 1MRNA 5D3QA 4MYUA 4W5WA 2V55B 1OB5A 1LY1A 1YR7A 4YXWA 3OIWA 1Z8FA 4C0HA 1P73A 4NCJA 1A7JA 1KJZA 2AKAB 2FU5C 4HB3A 5CDFE 4IOKA 4EFLA 5FPKA 3OESA 1CR2A 1KK2A 5EXPA 4KYIB 1W0JA 2W2VA 4A2PA 2BM0A 4KYUA 2QT1A 2NPIA 3KZ1E 4Q19A 1P61B 2NO6A 1RRPA 2OHFA 5B30A 4P31A 5HE8A 3R9IA 1VYTA 5P21A 4MYCA 4O25A 3QE0A 1P2SA 1JR3A 1N6LA 1P7CA 5IK2D 2W58A 3S1AB 3ZGXA 2CHQA 1Q22A 2HUPA 3IDQA 3JZAA 4QG7A 2V1UA 4BLRA 2FSFA 2QTVB 1WCV1 3MJRA 4QM6A 1ZC4A 3SFVA 5FOVA 4EQ6A 3EASA 3AV0B 3B9PA 1G7CA 1PUIA 4P4SA 1AIPA 2FEMA 2W2TA 4M1KA 1JQLB 2ERXA 3QXCA 2IYWA 2O0KA 4I1OA 3JVUA 1YZQA 1E2EA 2HF9A 3M1IA 1AZTA 2R6FA 3U3KA 2BDTA 3QENA 3RHFA 2ZE7A 2VH5R 3E5HA 1EWQA 1NLZA 2J59A 2QM8A 5BWMA 1AKEA 1CJKC 1DAIA 2V54A 1GG2A 2IS1A 4XTRA 1OF1A 3EAQA 1ZRHA 4RFSB 3QJYA 4YONB 2VLIA 4DT1B 1QHYA 4YMVA 1HEIA 1GRQA 2CVHA 4A0RA 3TGPA 2QE7A 2GJSA 3U3JA 3UMFA 2YNMA 1YZLA 2FFHA 4LJYA 1CRQA 3I8XA 4PQRA 4OK3A 4DLXA 4EDHA 4A36A 2JATA 3SQXA 2PBRA 3E1SA 4MYTA 3DPUA 1RE0A 2QNRA 3M4YA 2GESA 1I4LD 2YOFA 5JRJA 2ZR7A 5HZHA 1QHNA 4ZDJA 1W46A 4QOSA 4RKEA 4TZ6A 4PZYA 5K8TA 2GZAA 1S3SA 2V1XA 4B76A 4D80A 1P2VA 3T1TA 2IS4A 1OXTA 3VMFA 1SVIA 621PA 4MKHA 4OHWA 1KI6A 3IIMA 4LJ6A 5GADl 1OH8A 1F2UA 1RYHA 4Q7LA 5FOXA 1NSFA 2QE7D 3IHLA 4ASUD 3BH0A 1MV5A 3BFXA 4XSHA 2QROA 3R7WB 3LNCA 2VP5A 2ZANA 4IJMA 5JBQA 2AK2A 4IXNA 1KI3A 3LH5A 4LHZA 4PHTA 1NG1A 4LUCA 2PT5A 2CLCX 2ZI6A 3IILA 5HE9A 1FTNA 5F9FA 1GZSA 4JJZA 2QAGA 3CKLA 2GCNA 1QZXA 1H8ED 4F4IA 5KOYA 4AY2A 4JSTA 1WDTA 2OFWA 4B47A 4JMPA 3NC1C 2Q9BA 2YYZA 1NVVQ 1GOTA 3KQUA 1T0HB 4Q4LA 1E0KA 2WZQA 4C0BA 4V0LA 1W2HA 2IHYA 2OFOA 3LXRA 1C1YA 3K9HA 1OXSC 3W8RA 1UAAA 4FWTA 1ZNYA 1QHXA 3H84A 2RKOA 1IY2A 1D9ZA 1EFCA 4JLAA 4DLRA 4BLSA 1M7HA 3D6TB 4RD0A 1FUUA 3VR6A 2ASEA 3U2QA 1UEJA 3U60B 1G5TA 3THWA 3LLMA 4G5OA 3ZQJA 2R6DA 4DSOA 5L3SB 1E79D 3U7GA 1E9AA 4BFSA 4HUTA 2VHQA 3U4QB 4AG6A 5H68A 2FG5A 4DUGD 5CJPA 4D4KA 3NBXX 4A15A 1F2TA 4ZCIA 1GNPA 1T91A 2A7QA 1T4GA 2GNOA 2L0XA 2VPPA 3B82A 2GBLC 3THXB 4KFTA 1CIPA 3MRSA 3GQBA 1LW7A 2F3TA 2GKSA 3R8FA 2GXQA 2R2AA 4X8HA 5D3MB 3EWAA 3HU3A 1IJEA 2C9CA 1RRGA 3VNUA 2AD1A 3K70D 3QXHA 2VIIA 4EUNA 1ZBDA 3PUVA 4JVNA 1AM4D 1F6BA 1R0XA 2CCKA 2YZ2A 2ZSFA 2XGJA 2MMCA 1AKYA 4LOAA 2J9RA 5UKDA 1VIYA 2OV2A 5IT5A 3E70C 2X1VA 4B73A 1E9BA 4S2EA 3NIBA 4QBFA 3RC8A 1XZQA 4LGMA 1LS1A 3D3QA 4FXPA 3EZ6A 5JI3E 4ZIRB 3SS8A 5C46F 5FOUA 1TX4B 2EYUA 2YC2C 1EX6A 2BMEA 1WRBA 2GCPA 2BBWA 3P20A 4S35A 4NL4H 5E7IA 1EWRA 4IOLA 1RYFA 4QL3A 4LZZA 2IXEA 3D8BA 2CJWA 4D0LB 4PZZA 4AYWA 4Q66C 2J0SA 3GLHE 5F3WB 2F1RA 5FOSA 4DDTA 4PQFA 4IVQA 4OHZA 2HJVA 4AYXA 3C7KA 4EQ6B 3O8RA 3GEHA 2D06A 1E2HA 2IXFA 1PLKA 2KE5A 4PAQA 3W90A 2N42A 3AH8A 1CS4C 4RD4A 3C41J 3CBQA 2A5FA 1EFHA 1COWA 3AKDA 1FP6A 1AZSC 2OESA 3IQWA 5AJYA 1GITA 3I72A 3AKYA 2UKDA 3FKQA 2IWHA 1EGAA 1Q21A 3CZPA 2GA8A 2ECKA 5L3RA 2CK3D 3MWJA 5HZKA 1GTVA 2CL6X 1Z3IX 1E94E 3PV0A 2ZUDA 4N0EA 3T5GA 2ZE5A 4PAOA 2JJ1D 4IEEA 2CVFA 4C9BA 3DZDA 5FL3A 4DCSA 1XTSA 1KI1A 1UDWA 1FX0B 1OE0A 4ITRC 4LHXA 3MMPA 3SQWA 1E0SA 5J4KA 3AVPA 4L16A 2IK8A 1OFHA 3KKOA 3U6BA 4P32A 1U90A 4N1AA 4EPRA 2W00A 4DLYA 3T1OA 4OI2A 2Z5FA 1XP8A 3SE0A 1E2QA 2WJJA 1KI9A 5EQTA 2PZFA 4OQLA 1VHTA 2WV9A 1WF3A 5CM9C 1QHGA 4OQFA 2ORIA 2QENA 2IF0A 3A4NA 4RFVA 2NO9A 4URZR 3SYNA 3VR5A 2WJYA 3WNBA 1WB9A 1NJGA 4TLDA 4B3DA 5CK5A 3AF4A 3I73A 1KI6B 3NTUA 3DDCA 2ZM5A 4LV6A 1HT2E 2CMKA 3T5DA 1SQ5A 2VYFA 3QVUA 2IYUA 1I4DD 2W6ID 2WWGA 3NKVA 1Q0UA 3AF2A 5DNYB 3IKJA 1YU9A 1E2KA 1G7RA 1SKQA 4JIMA 3R7WA 1HH4A 3OZXA 1WP9A 2JCSA 3ZVRA 4EJSB 2N1BA 1J2JA 1V5WA 2UZIR 1G5RA 2AL7A 1VCIA 1GL9B 5KSPA 4AKHA 2FNAA 4Q21A 2JASA 1Z29A 2ZI7A 4MRVA 3GLIA 3CNNA 4R2HA 1AQYA 1CR1A 4Q9KA 2IX3A 2DWPA 5HTKA 2Q9CA 1JNYA 3KKMA 3QEJA 4RCYA 2HF8A 4JSYA 1NN0A 1OKKD 4QC2A 4GPTA 1RRFA 5KSYA 5FUVA 1MOZA 4F4JA 1W36C 1ZYUA 1MABB 4BRWA 2WKQA 2NO0A 3WP0A 1FFHA 3BB1A 2PEZA 3CNOA 3GEEA 3U7EB 4MGYR 4NYMR 2QSYA 3PJRA 4BEJA 2CCGA 1OLOA 3PUXA 1P2TA 1NBMD 3EPHA 3ASZA 2NO1A 5G3ZA 2BEKA 2KSQA 2W6IA 4MKFA 1QHHB 1XMVA 4KCGA 5JZVA 3U44A 4ZKDA 1OXVA 3CO5A 2FA9A 1E1QA 1T5LA 4QBGB 3U4QA 2H1LA 3IIKA 4DSTA 2JA1A 5KPDA 1NVWQ 2GZDA 1OIXA 4FWIB 3GJ7A 1JB1A 1FPMA 4A0HA 2C95A 3SNHA 1OH6A 3OAAD 4N3NA 4PFSA 5JJIA 1VTKA 1KIMA 4RD2A 2WKPA 3SJCA 1NMYA 1D2EA 3GJ5A 3GD7A 4KSCA 3LW7A 3RAPR 2QU8A 2YWFA 4YMTA 5DN6D 4YMWA 1UKVY 3B5JA 4QHTA 2FZLA 1D8TA 1KO8A 1TPZA 5E95A 1KY2A 3WBJA 2QTHA 1P5ZB 2XEXA 3RRZA 2IYRA 2CHVA 4PPFA 1ZIPA 1MO3A 4BEBA 1UM8A 3FPAA 3N5CA 3NDBB 5JFGA 2VSXA 3EARA 1X8KA 2ZRGA 4GOXA 2WSSD 4Q47A 1X1RA 4EFNA 2WTUA 3GJ3A 2GWHA 4QXAA 3SOPA 4XVQA 2F1IA 1R5NA 4LYAA 1OIWA 2FSIA 3NXSA 4CEIA 2VSFA 4D2IA 4NKRA 1Q3HA 3EZFA 3GJ8A 4BLOA 2BMDA 3KKPA 3CWZA 4P0TA 3RVBA 3SFZA 4F38A 5JI2E 2XNDA 2AR7A 4OJQA 2FN4A 3NC0C 8OHMA 3GLGA 4TYWA 3HDTA 3W3AA 3I92A 1SXJD 3K70C 1ESNA 1U9IA 2XZLA 1KO1A 1UF9A 1GNQA 3HPQA 4JYBA 1CXZA 4TMWA 2OAP1 3AVYA 4LJ8A 4BFWA 2XX3A 3BAFA 5FTMA 4YLGA 4L15A 5FPSA 5J4YA 4C7OB 1T0JB 4BASA 3TJZA 1N6PA 3MWYW 2ZS9A 3QY0A 1KMQA 2X2FA 4JLJA 3RNLA 3AM1A 4EIWA 4AIIA 2QP4A 2AFIE 4MGIR 2ZU6A 2BMFA 4OBEA 1AS3A 3CRRA 1T3HA 1DTSA 2P6UA 3HR8A 1RIFA 3ADCA 3W6PA 4HYYA 2QP9X 2YVUA 2GAAA 3M0EA 4IEIA 2AFHE 4O2RA 3ZZTA 3LX5A 5L3VA 5BN4A 3GFPA 1F48A 4B43A 2GCOB 1R5OA 2ZR0A 3I4LA 4NYJQ 1KMHA 3X1ZA 4Y0AA 5FTJA 4WXRA 1ZUHA 2BV3A 4CIDA 2OBLA 3FYHA 4KO8A 4LHWA 4XD7D 3U3MA 5AUQA 2IL1A 3VAAA 4NONA 2QPAA 1G291 3BWDD 4LBWA 4IDHA 4HLUC 3WHLA 5CLLA 3QBTA 1VMAA 2ORVA 3OE7A 1ZUIA 2O5VA 3L2OB 3WXMA 4DSUA 2WAXA 4NCIA 1XBTA 1NBME 3FKSD 4GMDA 4MRRA 4EPYA 2JLZA 1O87A 2LKDA 1UBEA 4RJLA 1DOAA 5FUWA 3WNDA 3RSLA 1VCOA 3IPYA 2BOVA 1NVUQ 2NZJA 4C3ZA 1GNRA 1GM5A 4EPXA 3GLIE 3DO6A 4KFRA 4AKGA 2J46A 2ZS8A 4DDUA 4W5JA 1IBRA 1E6CA 3B13B 4KI0A 3R8CA 1P60A 4JZKA 1XJQA 3UMRA 5GVRA 2J5XA 1YRAA 4B6EA 3SHWA 3TE6A 3K8YA 4YDSA 4WA7A 3CX7A 4LK2A 5JMTA 2IC5A 1KKLA 4LYHA 3V9PA 5FUYA 4RZXA 3T15A 3PG5A 3L8ZA 3TK1A 5TV2A 1SKYB 4DLTA 5C2JB 1XTQA 2IEZA 4BFXA 3WRXC 1KK3A 1SHKA 2FDCA 4DLWA 1AK2A 3B8HA 1E1RA 3KQHA 4A1FA 2WBLC 2JLXA 3RYTC 4ZI2A 3I5YA 1YZKA 2D2FA 2G77B 2OE2A 2OZEA 3NWJA 3SJBA 1YVDA 1XEWX 3UATA 3B7GA 1BKDR 4ACBA 3NHAA 3PVSA 2FF7A 1U9IC 3MFYA 1SVWA 4M8NE 5KSZA 1GVNB 2ONKA 4URXR 3U44B 1IY0A 2OAQ1 4PTLA 3FKSA 4NU0A 2GK7A 4QFMA 3PIRA 4V0MA 2IUUA 5KUTA 1TEVA 1OPXA 3WMEA 5H70A 1FW6A 4WBSA 3U61B 3CIOA 2J7KA 2ZSBA 3C14C 3U3OA 1T5IA 4GZMA 2VBCA 3K9NA 1YR8A 3NH6A 2NG1A 4I81A 1EFRA 2EFGA 1ODFA 4V0OA 4W7SA 1W0KA 4C4PA 4DSNA 1OXXK 4EKDA 2J0UA 3HWSA 1ETUA 4GFDA 4G5RA 1H8HA 2KI5A 4MDFA 1L8QA 5E7MA 4PC2A 3QEOA 1OT3A 3EA0A 2J45A 3CNLA 4QM7A 4RCZA 2ZJAA 2Q9AA 3RABA 5JLJA 4GZLA 3UG7A 2BKEA 3ZDQA 2QTFA 2B7CA 1U81A 1Z0DA 4RSGA 3W3ZB 4XWOA 3LFUA 2XZOA 1LTQA 4Y0VA 1KHTA 1L7VC 1BMFD 4CEIB 3A6PC 1TQ6A 2QBYA 2QP3A 5JRZA 3PEWA 4FCWA 4UNNA 1KTVA 4XTCS 3K0AB 3TAHA 3KXLA 3QPUA 4LCBA 3NBYC 2YWEA 3QG5A 1ZW6A 4M9SA 4Q9HA 3T34A 4Z1MA 1BYUA 3A1UA 2OCBA 1LF5A 4C7OA 3LVQE 4JBXA 3RWOA 1S3GA 1S9HA 5FPHA 4B74A 3DM5A 4R7ZA 1YZTA 3IUYA 5E4FA 1E2FA 5JCZA 2A9KA 2REOA 4DCUA 3I61A 4CYMA 3RRYA 3RRMA 5K8UA 2F1JA 2QY9A 1DBSA 3DKPA 1YQTA 2WHXA 2IYLD 3AQ4A 2DHRA 1L2TA 1P62B 1G16A 4U02A 1Z0FA 3THOA 4PC3A 2VRWA 4PPGA 2QQEA 2C99A 3BIFA 3T1QA 2C96A 2F43B 2IYXA 3L8YA 2GJ8A 1PLLA 3K0SA 2GCOA 4JLMA 2K5UA 3NBZC 1E96A 4Q4AA 3ICEA 4NCHA 1UPTA 3PUWA 4AD8A 3JZMA 3UANA 1A2BA 4IDOA 3ZVMA 2ODWA 3Q72A 3CB4A 2QEQA 1A5TA 1IN7A 4Q4JA 4AK9A 1TU3A 2NMVA 2XB2A 1II9A 3SHFA 3KL4A 2WMNB 1PJRA 3HU2A 3AF3A 3FOZA 3ZD7A 4B3BA 2PX0A 5E3HA 3A1TA 4KV9A 3QG1A 3QKUA 1E98A 3IIJA 1XU4A 1JXMA 2V8OA 4IFBA 3TMKA 1OYWA 2ZJZA 3FMPB 3ETLA 2O8BA 3B1ZA 2XNSA 4PANA 4M9XA 1US8B 3KTAB 4JT4A 1G4UR 4US1R 5DYGA 1XD9A 3N2EA 1NBMA 4RZUA 1RKBA 5JEDA 3K9GA 4YMSA 2UZ3A 4JLKA 3EXAA 3ZYCA 5BYJA 3K09A 1AS0A 4AI6A 4TTRA 3W6OA 4LX0A 1MKYA 1NF3A 5EE0A 2P5TB 3ADKA 4KITB 5SZHB 1W4BA 4LWZA 1G9XA 1Z0IA 1W36B 2WWHA 4DCTA 1FMLA 5SZKB 1Z6GA 3C15C 3MD0A 1B23P 1JI0A 5DLQC 4PZLA 1COWD 4LBYA 1Z08A 4I1UA 3PUYA 4JKIA 1CULC 2CLSA 4DB2A 2ZS7A 4L5BA 1J90A 3EIHA 2JAQA 1IONA 4M9ZA 2J7PA 1VCNA 4KVGA 5IF9A 2Y8EA 1CJTC 3EIQA 4A0GA 4NYIQ 3B78A 3HR7A 3TAUA 2ZSAA 4AG5A 1TAGA 4F91B 4WIAA 1TTTA 3T1VA 1HQCA 4HZIA 1G3QA 1P3JA 2Z0MA 4Q1FA 4CRWB 4GDFA 4DWJA 2AXNA 4B2LA 2PH1A 2WJHA 1XMJA 1D2NA 2C04A 4LV8B 5C4MA 1EG7A 3R20A 4H1VA 5CDFA 3THWB 3HYRA 3TR0A 3R9WA 2YWGA 5F9HA 4A2WA 3IBGA 2P0EA 1G7TA 4TL9A 2CHGA 3L82B 1VPLA 4LPKA 4OJKA 4V0KA 1P75A 3ZH9B 3U5ZB 1GRRA 1XWIA 3RLFA 3RSOA 5H1YA 5JWRA 5M04A 1Z28A 2C5LA 2AX4A 4XWKA 2RHDA 3LV8A 4NYMQ 2BCGY 3A1SA 1JPJA 1A82A 1TQ2A 2FGKA 4CT4B 3AUXA 2ZI5A 2DR3A 1IN6A 5C1BA 1E9DA 4DC9A 2VHCA 2RCNA 1DO0A 1IXRC 3AKEA 3Q8XB 4B35A 1K6MA 3DMNA 3VKHA 1GKUB 2ZJ2A 3QIAA 3H2YA 1UKZA 4HEJA 1F2UB 3VFDA 1JR3E 1EFTA 3KJHA 1G8FA 5BYKA 3N2IA 4FIDA 4DLSA 3RS4A 2OLJA 4QBHA 2ATXA 2ZJOA 3PFIA 3NH9A 1D9XA 1YR9A 3BB3A 5DI3B 1G19A 2MSCB 1KAGA 4Z1MD 4QNMA 4G01B 1IJFA 1N6HA 2YOHA 3RS5A 1ZNZA 3K0EA 5G53C 1MRSA 2FX3A 2Q0HA 4I1VA 3Q7QA 4URWR 3RWMB 3WMGA 4B48A 821PA 4HLQB 1JR6A 1XDBA 1N6KA 1R5BA 5K8IA 1M6NA 1T3LA 1H8EA 5B58C 1JBKA 4P33A 1KO4A 1ZCBA 3BFVA 3Q5DA 3LQQA 1G8YA 3QNUA 3FB4A 1E2DA 1U0JA 2ZYWX 3LAWA 4OYHA 2C8VA 1DE0A 2KJQA 3VNVA 4I99A 3OFND 2AN9A 1OV4A 1UKYA 2HXSA 5C4GB 3P26A 2JLVA 4IW3B 3TW8B 4AYTA 1CKEA 1N5JA 2CEAA 4JVSB 3TBKA 4D0NA 5L8VA 5KPJA 2ZYVX 1XNJA 1JQJC 1H8HD 3QOFA 4B6FA 3LO5A 3D7MA 4OI1A 4K81B 2QMHA 4PO1A 1ZM4A 4XJXA 1XF9A 1XEXB 4BFVA 3ZJYA 1T8UA 5L3QB 2WOOA 4M1OA 1S1CA 2KBFA 4RD6A 1DAEA 3SJZA 2OCAA 2ZRNA 1NN3A 4R71A 3RS7A 5CLQA 1E2JA 3ZZUA 4ZDIA 1EESA 1XXHA 5EE9A 1FNMA 4A6XA 5JCPA 2ZU0C 4O3MA 1S0UA 1N6IA 2D7CA 1DO2A 3SDZA 3AP2A 1E79A 4D4LA 2F55A 4P4TA 1UKEA 1E2NA 1GIAA 2X19A 4WZAE 2JLQA 3UKDA 4A2QA 3J81k 4IOJA 1IXSB 3AUYA 3EG5A 3FMFA 4BFYA 3T35A 2PX3A 5FBVB 1IHUA 4US2R 2FGJA 5KDOA 2YV5A 1OB2A 1W4RA 4TMKA 1N5IA 2IYQA 4JKYA 4KU4A 3SEAA 3DHWC 3F8TA 3P32A 1E1RD 1Z22A 5HR5A 4RD1A 4PX9A 1MH1A 4LJAA 1KO5A 1HYQA 2IYVA 3NVAA 5B64A 5AWFC 4XWAA 4C30A 1CR4A 1A2KC 2F9LA 4OK5A 4BECA 4TYQA 3OEHD 4URVR 4PHHA 5DHAA 2CJWB 2NO7A 1DELA 3IEUA 4JT2A 4OI4A 1XMSA 3FDIA 2X8AA 2Q6TA 4MRPA 3RRNA 2P67A 2O8EB 4HLUA 1KOFA 3AEZA 1HV8A 1Z6YA 2ZPTX 1N2CE 5AUOB 5LD2B 3DOFA 3PENA 4LSGA 1T8TA 2R8RA 1JR3D 5IK2A 4NP6A 4H1UA 2GRJA 3LQRA 3CLVA 2ATVA 3BD9A 3MCAA 2P2LA 5FR1A 3VU9A 2ZIAA 3WBKA 5CYOA 2V6JA 2WPDA 3AF0A 2FEOA 5F98A 1TMKA 2QSZA 4TLCA 1U8YA 4US0R 6Q21A 2WSSA 2HXYA 2GF0A 5LPNA 2WIBA 1IXZA 2QRZA 4PO9A 3K1JA 2B7BA 1UBCA 1DARA 2N46A 4K46A 1KZGB 5FTKA 1LVGA 1AGPA 2JJ8A 1XD8A 4ZPXA 1TF7A 2YWHA 2V4ZA 3CONA 3ADDA 3ZQ6A 4M9QA 4AKEA 1KJWA 2VTKA 1VG0B 3AVUA 3MWLA 3KQNA 4HAUA 4HDCA 3P4YA 4BZPA 2IYZA 4C0KA 2OSBA 2REXB 1RC8A 4G3XA 4IHQA 1S8FA 2IS2A 1X8JA 1LF0A 4QRHA 1SKYE 4W5HA 1U8ZA 3X1YA 3KX2A 5TVKA 3TUZC 3VX4A 1J99A 1M1YE 3B1WA 3WMFA 4Q4HB 3A58B 3ADBA 2J0QA 5E7JA 2H18A 2Q3MA 2XTZA 1U0HC 4AC9A 3TW4A 3AP3A 5GJBA 1MO4A 5CB8A 2XOKD 4LYFA 4Q1EA 1HA3A 2BJVA 1PUJA 2FZ4A 4Q18A 1NKTA 4D4JA 3C5CA 3UPUA 1N0UA 3GLIB 2XNDD 3AF1A 2GJKA 3L43A 3BH7A 1HT1E 4DCNA 4OK6A 3T12A 1ZM9A 3NG1A 1QBKC 4ARZB 3UXMA 2ZYTX 1XFAA 1DS6A 1R0YA 1TEXA 1M7GA 4FMCF 3ZS8A 2RGGA 5EUMA 3SYKA 3TUJC 3DKVA 4B34A 5CIWA 1QG2A 4M4SA 1MABA 3O47A 1Q44A 3QI2A 2AD5A 4A8JA 1DAKA 1XEFA 3THYB 4TL7A 1Z6AA 1SVLA 4P4UA 4NPHA 5DE3A 1N25A 2R6CA 4OL0A 1R8SA 3EC2A 3BBPA 5CB6A 3SU8A 3GLGB 2J1LA 4UNQA 3QBVA 3SR0A 3SZRA 1TNDA 4MA4A 2IXGA 3RC3A 3CRW1 1U99A 1W0JD 1UBFA 2XITA 1NSTA 1P9NA 1ZP6A 3EWSA 4CEJB 2B8TA 1G21E 3JVVA 3X1WA 3OE7D 3GLFE 4KFSA 3V4RA 1D2MA 3B85A 1II0A 3GFTA 1ZM3A 2IBMA 1XXHB 2GXUA 2JDIA 2OEPA 3B9QA 421PA 4OHYA 1QVRA 2Z6VA 2ZUBA 3DZ8A 4NE2A 2FSGA 2R6GA 4PO8A 3I32A 3UIEA 5C18A 2BBTA 2H17A 2RHMA 3O8CA 4TT3A 2XZPA 1KNQA 4MRSA 5DI9A 1CJUC 1DAHA 1DAFA 2HLDA 1OJLA 3CRVA 4CT5A 2A5GA 3LY5A 2FMXA 1E32A 1KY3A 2WKRA 2AWOA 4Z8YA 5IRCD 5BW8A 2KB0A 2HYDA 4O0MA 3I62A 5JWOA 3C8UA 2OBNA 5JEEA 4BRUA 3NEJA 4ZDWA 4CF7A 1JECA 1M74A 2B21A 2Z4RA 3ASYA 4PSAA 5EXTA 5FL7D 4B3XA 4IKEA 4C0AC 1XCMA 3A36A 2F6RA 3KB2A 3ZZ0A 1UEIA 4B71A 1SGWA 1GKYA 1KK0A 2B8WA 4Q1DA 4FMDB 1SVSA 4YQFA 1VYVA 4UXJA 5KHOC 4D0GA 2RH5A 3GJXC 5KTYA 1NJFA 1RZ3A 2NZ8A 4FW9A 4JLOA 4L9WA 2HJGA 2ZRPA 4X8MA 2GXAA 5DGXA 1U8AA 2GETA 3FHOA 2PL3A 1XPRA 2J87A 4TLEA 5EP4A 3KQLA 4HDOB 1YZUA 3G82C 2CL7X 2V7QD 4M22A 4RZ3A 3ZLJA 1R10A 2RAPA 3I8SA 2ANCA 2HDNB 3LW8A 4UKDA 1NVXQ 2Q3HA 3FMOB 5DH9A 3CF2A 5FTLA 2ZJ8A 1JEEA 1LS6A 2RGNA 2VF7A 4YC7A 1LV7A 3VHXA 5ELXA 4QJ4A 1FMJA 1T3SA 4B33A 1WBDA 1NVVR 3TRFA 1JALA 4KVAA 4L8GA 1XTIA 3KJEA 3GLHB 4GSYA 3LBIA 1R4AA 2VHTA 3KJGA 3KUCA 3CRQA 1CF4A 3CZQA 5AJWA 4BGDA 4JL6A 4JS0A 4C2TA 3BB4A 1KMHB 5DN6A 2JJ2A 5LDDC 1MO6A 1ZD9A 2P5SA 2DY1A 2ZXUA 4FCTA 3SN6A 1G3MA 2B92A 4C0QC 1GDDA 1EFUA 4PSKA 1XRJA 4ACAA 5B2ZA 4A6PA 1YZNA 2ZI4A 4HZUA 3DOEA 4MGZR 1SZPA 5JS8A 2H92A 5TARA 3LXXA 1I4TD 2J0UB 2HYIC 3VR3A 2X77A 3P27A 4QGHA 4WW0A 1ZUNB 4DDVA 4IVRA 1HE8B 4QHYA 2I1QA 2H57A 5A4JA 1Z0AA 4Q01A 5DHFA 1E0AA 2GVZC 3M6AA 3LWNA 3B2EA 4LJ5A 3FMIA 2JLSA 1FNNA 3Q85A 4L4UA 4E03A 2A3RA 3A37A 1Z2AA 4TTPA 1XPOA 4Q1BA 1LFDB 2BC9A 1CLUA 2P6NA 1VHLA 1JJVA 1Z0KA 4E22A 1G20E 1S4QA 4D25A 1YZGA 1SHZA 4DEXA 1OKKA 3BK7A 1K8RA 1KKMA 2PZGA 1NL3A 3QXJA 2BEJA 4QJ3A 3EPKA 5BN5A 2QPOA 1NP6A 2DYKA 1E9RA 2WJGA 1ZU5A 2BKUA 4Q9IA 3T61A 1FQKA 1HE1C 2PMDA 2VP9A 3HJNA 4WXPA 4KLZA 3BERA 5EE5B 3I5XA 2PEYA 2OBMA 1SXJB 3VR1A 4TL6A 1Z07A 3OHMA 1YRBA 2EFCB 2XOKA 4A92A 4Q1AA 3NHBA 1VCMA 4ON9A 1G7SA 1Y3AA 3D31A 4CDGA 1X8LA 5KDDA 5BQ5A 3MAAC 4F93B 4TT3D 2OCPA 5HKKD 4JL5A 4HB0A 4FN5A 3CH4B 5JS7A 4ZDKA 1EFRD 2Z83A 1GKIA 1WA5A 2ANBA 3VKWA 3ZD6A 2UVQA 3A8TA 3KFXA 5GJVC 4M1WA 1DAGA 3HU1A 1JEDA 5FI0B 1SXJC 3UG6A 1M7BA 1G17A 1WBBA 5LBIA 2OXCA 4HB4A 1XXHE 1E0JA 1QHIA 1UBGA 2DFKB 5TY0A 4A82A 4MKGA 2WJIA 3BC1A 2R6AA 4QGAA 5K8LA 1W0KD 1XD2A 2BJWA 3GLFB 5BXQC 1DADA 4Q7JB 3TUIC 5GJCA 2QPTA 3X1DA 2V3CC 3QKTA 4OHXA 3KFVA 5AK0A 3WP1B 1J8YF 1E2IA 3A4LA 2C78A 4BZXA 3G0HA 1N0VC 3GFOA 4BLQA 2Z43A 4DUGA 3RDPA 3KTAA 2VO1A 3SBDA 2P65A 3GLGE 2ERYA 4R2IA 4Q03A 4R98A 3VKGA 4Q4JB 2ZAOA 2D62A 1ZAKA 4Q9JA 5FBLB 2ODBA 3W8NA 2CE2X 1OXUA 4V0NA 5AJVB 4I4LA 1ZNXA 4QJ5A 1IAQA 2RGNC 3AVQA 2YHSA 4IOMA 1G1MA 2QBYB 5EXXA 2PMKA 4DIEA 1N6NA 2AXPA 3A1WA 3IGFA 3CR8A 4DDWA 2PLFA 2FSHA 4B2PA 5KU1A 3EPLA 4U5XA 4PC1A 3TIFA 1FTSA 4IDPA 4TSFD 2W0SA 3L0IB 3LDAA 2IS6A 3Q3JB 1XB2A 1GUAA 3NEYA 4U7DA 3FHTA 2O8FB 1DPFA 4A0FA 1OFIA 3RANA 2VQSA 2Q3FA 4WOPA 2ZYUX 3OEHA 4FI3C 5H8WA 3GEIA 3GJ4A 4M2LA 4AWXA 4KSBA 3QUSA 4KBGA 2KBEA 1W36D 1JAIA 2F7SA 2ZR9A 4A9AA 4YDHB 2ZJBA 4EFMA 4Z51A 1OFUX 1G4AE 1IN8A 1KJYA 1XCPA 3H1TA 1ONBA 1X86B 5DSZA 1P2UA 2VP6A 2F43A 5JWHA 1OYYA 4QHSA 1HQYE 1JPNA 3IHWA 3VR4A 4C2UA 2A78A 5TXGA 2ZTSA 1D6JA 2O0HA 3U3RA 2IYTA 4TYPA 1W5TA 5JJLA 3SBEA 4IDQA 2I4IA 4IVPA 4Q4AB 3NBFA 4GMXA 1CRPA 3AKCA 4V03A 1HUQA 1EK0A 3C16C 4HUQB 2O8CA 4X8OA 4D26A 4I1SA 1KAOA 4F4CA 5F2EA 5DISB 1NG9A 2P6RA 2FFBA 3N70A 5KNDA 2JGNA 3TSZA 1KDTA 1A1VA 1RPZA 5JSZB 4DHEA 2EYQA 2EW1A 1N3BA 3QF4B 1KO7A 1NNEA 2EFHB 2FPLA 2WWYA 4DBLC 3RS2A 2AWNA 1US8A 3I1FA 1T6NA 2ORWA 4A8JC 2J41A 1M34E 3F3YA 2FWRA 3TNFA 2QT0A 4ERNA 1FL9A 4OKSA 4BLTA 3GCGA 5KDLA 1O3YA 3QVVA 4HAYA 2G88A 4HI0E 2FH5B 1P6XA 4NCKA 1CJMA 5FOTA 4GOJA 3ZIAD 1Z47A 4BLPA 2I1VB 3CW2A 1II8B 1E4VA 1F3OA 1PVOA 2D4HA 1NI3A 3QPWA 4V0ME 4F7WA 2EFEB 2VL7A 2BIFA 3EIEA 5FR2A 2CL0X 3EA5A 2MMGA 1IN4A 5TB5A 4HB2A 5HKKA 3AB3A 5IHPA 1CBUA 3TSOA 4DKXA 2G9NA 4Z54A 1Q12A 4LC0A 4XVRA 1SXJA 4WZBE 5G41A 1RJ9A 1Z0JA 2VHJA 2JLRA 4UXIA 4PHFA 1G8HA 4KHZA 5EJEA 4JLDA 4BFZA 3PEVA 1J8MF 1ZD1A 2O52A 4ESHA 4CGZA 3OFNA 1FOEB 3DM9B 4B3CA 2HCBA 1SXJE 4RD3A 3ICQB 4TLBA 1JXOA 2NTYC 1R8QA 3BGWA 5EP1A 3CPEA 4E07A 5FBWB 5EP2A 4HATA 1KNXA 4LBVA 4F92B 2WIAA 1XEXA 3K0CC 5L3QA 3SC3A 4OQXA 1U94A 1AS2A 721PA 5JHGB 3ECCA 1J7KA 4G0NA 4LJ9A 4XIGS 1C4OA 2JLWA 4XVUA 5EE1A 3B6EA 4E09A 1Q1QA 5HCIA 2IUTA 4JL8A 2JLYA 3A1VA 5G3YA 4RFSA 4PPQA 4DT1A 1NN5A 5FBQB 2XJ4A 1KZ7B 2VP2A 3BE4A 5J4HA 1VG1A 4UQOA 3QKRA 2GEVA 2E9SA 4HAVA 2IF2A 2IHBA 4NCNA 5FPYA 5A5GA 3L0OA 1BH2A 2DFLA 1ZMXA 5KNCA 1IN5A 2XSZD 2GAOA 4C0SA 4OQNA 2NGRA 1NN1A 2C9OA 3DL0A 2W2XA 1QDEA 4BZQA 3CPHA 4PSVA 4U00A 1DAMA 3V4FA 4PR0A 1NRJB 1R0WA 1J70A 2QAGC 3PXGA 1OW3B 2TMKA 2ZRAA 3TQCA 1ZNWA 2VA8A 3BOSA 3G5UA 2QGZA 4TL8A 5DI3A 2VHUA 5GJWC 2ODEA 3QQ5A 3VX3A 2JJ2D 5HCNA 1GWNA 3GPLA 3HPRA 1OH7A 1FUKA 2GHIA 2NIPA 3EW9A 1IY1A 2O8FA 1YHNA 3LLUA 1UJ2A 1NY5A 2ZITA 2C98A 3EZ2A 5AR1A 1W7AA 3BORA 4PAMA 3EX7C 4P4SB 4II7A 4M1YA 4BUJA 1Q57A 1E3MA 2KWIA 5J4LA 3W34A 4RKFA 4D4MA 1GRNA 3ND9A 4TTQA 2ZRDA 2I3BA 3HYTA 3OF5A 1W1WA 1YKSA 4UNRA 2OG2A 3TH5A 5AJZA 5JHHB 2FJUA 1KI7A 2OFXA 2WWWA 4TMXA 1G3IA 2JIZD 2O8EA 1HY3A 4PC7A 3O8BA 4DLVA 2FPMA 3MJHA 1E9EA 4HAXA 4MITA 1TADA 2O8DA 3IO5A 1Z6TA 1ZM7A 3CUEF 1G6OA 1K5DA 1B0UA 4RZ2A 2EVWX 3AVXA 1R0ZA 1S96A 4HUQA 4TN1A 2O8CB 2WSMA 3REGA 2GF9A 1YJ5A 5HPYB 1E69A 3B1YA 1MT0A 3BH6A 3MG9A 3K09C 3OAAA 2H7VA 4B3FX 3VU9B 3WRYC 2CE7A 1W4CA 2LKCA 2GEUA 1GILA 1WXQA 3LD9A 4AKIA 5JSZA 3C5HA 1W4AA 1XX6A 2XSZA 4H9GA 3QF4A 4JJKA 2R62A 2ZUCA 2CXXA 3FTQA 4Q7KA 3LBHA 1ANKA 1S9DA 1L4UA 1TUEA 5KYKA 1ZCAA 3K0FB 3QKSA 1KK1A 1TF2A 221PA 2MSEB 4G5GA 4UXHA 2WWIA 5ANRB 4PPNA 4NHOA 3NDPA 1DVRA 3QXXA 2V7QA 1HURA 4Q4HA 1G8GA 1BO6A 4M1TA 2W6JA 4ZKEA 1G41A 2WMOB 4B44A 5LB2A 1WMSA 1UFQA 1I2DA
chains in the Genus database with same CATH superfamily
1EIZA 4D8YA 5L7TA 4QO7A 2H1OA 3WDKA 3WAKA 1RI4A 2OUKA 3FWPA 1I7DA 2R44A 1VCHA 1LSOA 3DMDA 2W7TA 4DIBA 5K6TA 3UW1A 2C1ZA 1XT6A 3VYVA 1MC5A 4MUJA 4CLHA 1O6ZA 3JQGB 5IDWA 1ABBA 1I3KA 3O4GA 5EPOA 2A5DA 4EGCB 4EGAA 3IULA 1IBSA 4OGKA 3FTNA 2CLOB 4RXUA 5C1OA 3WLSA 4KIFA 1N34B 2HHCA 4UQPA 4TLAA 2ALJA 1WW2A 4R6XA 4J1NA 3QPVA 4CTKA 4BWFB 2B5OA 4DMMA 2NU7A 1R6AA 1SZJG 3WDLA 1TQDA 1ST2A 3V2UA 1VMIA 2ODNA 4A8JB 4CQJA 3QX3A 2ZTHA 4JQZA 5KOJB 3D4IA 3HLYA 4PWZA 1EHCA 5FI3A 1Q14A 4TVBA 3SHQA 1B0AA 1PQWA 1L5GB 4LKRA 3OCXA 4YR7A 2V7EA 1YK0A 4AG3A 1B76A 1U8XX 2WNHA 2O3RA 1Z39A 1SULA 3I01M 1ZD8A 3O92A 3PXXA 2Q0SA 4DUYB 1BMFA 2APJA 4JU8A 3V7NA 4RVNA 1Z75A 3A0UA 3R5XA 2Q7DA 1K63A 4DIDA 4JX8A 4MVWA 3HZOA 5E8JA 3SJ7A 5JJKA 3HRIA 5BVGB 1JX6A 3SR3A 1EVEA 1EUQA 1LPBB 1KYYA 2AZDA 4H6WA 4NC9A 1QO7A 3U6KA 4C7OB 1CHNA 1TYZA 2EBUA 3CLUC 2ZT7A 3VBCA 2XWQA 1QPZA 2D7DA 3C7DB 2VF4X 3PPYA 1R0BA 1HDYA 1DXOA 2PT7A 5L7YA 4QIHA 1Q1EA 2VDPB 4EPVA 4RTMA 2JEZA 3WL8A 1GG8A 1JBQA 4Y9SA 1M2OB 4ZCLA 3U40A 1GTL1 4D81A 1C41A 2FOLA 2RGCA 3X1KA 4Q16A 1LNZA 2EWVA 3QVOA 3H5VA 3L05A 3WFIA 1KVRA 2Z2KA 3Q9LA 3W5IA 2HD4A 4DNXA 3BIOA 1F2TB 3RS0A 1N5KA 3WB0A 5A2QA 1XTBA 3KXKA 1PT7A 2PYDA 2NV6A 1KEUA 3EHDA 4PGHA 4U7TB 3A2KA 3R3WA 4IFEA 2BMJA 3JQ7A 1KRHA 2GEFA 1P9WA 1M54A 3BXZA 3IQXA 5DJ5A 5BOSB 1JH9A 1IQPA 4PYOA 1GNVA 2XD9A 5DASA 3TVTA 2A30A 3CZCA 2R66A 3HCBA 5IDVA 2G0NA 1E3EA 4J7UA 2A9VA 1EX7A 2CYBA 4HWPA 1NLFA 1KI8A 1Z74A 4Q3AA 3VSAA 3O91A 3PC8C 4BHTA 5C53B 4HCJA 4JEMA 1KGSA 2Q4RA 4UJ5A 1N33B 2D0PB 2E1RA 5FI1B 3EIUA 4CETA 2ZRQA 1O6FA 4FNOA 3EJ6A 4LXQA 5HS6A 2AEMA 1UDXA 1NI5A 3H2GA 4HMPA 4XJSA 3ZE7A 4MDEA 3K8QA 1XN4A 3I1IA 2OHHA 4IYRA 1H65A 3ER9A 1H93A 2GDJA 3N87A 4CUKA 2J9FA 1BDHA 3BSYA 2QX8A 1UT5A 2O5RA 5A62A 5FPTA 1M1NB 1ZN2A 4H7PA 3AVTA 1P8JA 2PGNA 4ESVA 3FNQA 4ASUA 2F2TA 3NYWA 1ICEA 3IBYA 2J0VA 3DZGA 3H1BA 1QVAA 1Y8QB 4RQUA 1I1NA 5FFNA 2I2BA 1T8YA 2GSWA 1D7OA 3STHA 4XSGA 2FPKA 5AVYA 1IEWA 1DJLA 1OIVA 4PM4A 2FZVA 4DJTA 5HUJA 1BXKA 5DIFA 2RI1A 1C8BA 4ALNA 2OHVA 4ZV7A 3G6WA 2XCQA 3GLHA 5H0IA 4J91A 2CNWD 4H6PA 1P1RA 3IEKA 1AHPA 2GD1O 1FX0A 3FCEA 4CL2A 2G17A 1GLVA 3UKJA 5JMOA 3KR9A 3MSXA 4G5QA 1IN1A 1JQ5A 1UWVA 3DVLA 3PDUA 1OU4A 1O94D 3Q0IA 4K9LA 4DM3A 2JH8A 1QHHA 2D5BA 3ZU6A 3H1EA 3BCSA 3L7AA 1B15A 1TJ5A 4Z4EA 1WQ1R 3J81A 4TKLA 4MW9A 3T9FA 1FFYA 1VIDA 4W9MC 3EEBA 4YIKA 2OILA 2QR3A 2WPDD 3MWDB 2A5YB 2HC9A 4EP1A 3HDYA 2RGRA 4B2IA 2FFJA 1V6CA 8MHTA 2HM7A 1KFBB 3QKSB 1H4QA 1NM5C 1B3RA 4E5UA 3CN7A 2O3SA 5DHUA 2JFWA 1BCRB 2R9VA 3C1AA 4JGBA 1U6IA 3T06B 1W44A 5AM2A 1QX3A 4B32A 1YQQA 1RWNA 2WB4A 2ZIUB 3KXIA 4OY3A 3OEEA 1SG0A 4N0DA 5D7NA 1ODCA 5EE3A 1UFOA 4QTTB 2GO7A 2Y0CA 2K4MA 5ESRA 2C54A 1C0LA 3RUFA 1NDHA 1F8UA 3V5NA 2BKVA 4MWCA 4MTCA 5HJ7A 2G4VA 2OB2A 5CIQA 5A3SA 4IDFA 1NAIA 121PA 2PJZA 3GT4A 4A1OA 1FK8A 2IW3A 2WJVA 3AR9A 2L2QA 1ADFA 1FB5A 1Z34A 2FJ0A 1BC5A 4JLWA 3U4IA 5KYTA 3JQGA 3SHOA 5KWJA 1YQ9A 5LMCA 1A3CA 1WZUA 2JJYA 3NNDA 5E1BA 1SUSA 4CEHA 4ZVNA 4BVBA 1IHYA 5D1NA 1QH8B 2CZGA 2ZVDA 3JR7A 3GJSA 1YQEA 3B1VA 3P2YA 1EXMA 4KJZA 4IG4A 1X80A 4AROA 5CXXA 2QX4A 4PN3A 5IUKC 3F7OA 1PJTA 4L8FA 1X6VA 1XDWA 3FFAA 5ALGA 3VYWA 1YWGO 1AMNA 2CNOA 4ZAGA 5THQA 1M10A 2BONA 2PD4A 3A6FA 3HCAA 3C43A 1E77A 2GN4A 3LK7A 3OM9A 4LVOA 4NBRA 4D9BA 4IQGA 2C03A 3UWOA 5FBZA 1NXVA 3FR8A 4MWOA 4NDZA 4NJEB 3S2EA 1JRLA 1CQPA 3M5WA 4AJLA 1P6QA 2JCVA 3Q7TA 1I30A 3LHIA 2NNLD 5BRNA 3KU4A 2OCYC 2WAMA 3A4YA 3GPCA 4UNSA 5LIRA 2KX7A 1ODTC 2XUPA 2FW7A 3D02A 3A04A 2YJ4A 3B20A 1WD5A 2ATCA 1YQUA 2ZJYA 3F8WA 3PUKA 3T7CA 3TRKA 4BQQA 5CCBA 5CJ2A 1Z5VA 5T3YA 3LUFA 3SIRA 4ZMRA 1ORDA 3CLHA 1CNFA 1TXGA 4N0QA 5IAGA 2PXCA 2ONJA 1WSWA 4KFUA 1NE2A 2H5IA 1U8CB 1YL7A 4Q5IA 1V1JA 4DZRA 1L1QA 2A9FA 2P9GA 3GR6A 3QYFA 4B7ZA 4IIJA 1G3UA 2R48A 1U7WA 3RTGA 1NKSA 3PWTA 3HZZA 4LZOA 2I29A 4BGIA 2RB4A 4WNAA 3UOWA 3IJ5A 3U7HB 1W48A 3ZBQA 5K0TA 3N0WA 2DCMA 3T5PA 2EWWA 3MCVA 2ZAIA 3HJTA 4OMUA 2PKXA 3UWDA 3ZD9A 3FNHA 1T2NA 3EQ2A 2AYYA 4LOLA 1U0BB 3PX3A 1CZOA 3CWQA 1HZJA 1KP2A 1R2QA 2GZHA 2DCUA 2NU6B 4LBZA 4MMZB 5J40A 4RANA 2UXDB 4DLKA 1E9FA 3I3SR 1J0AA 5CHYA 3ZNOA 1XD2B 2NYVA 1SOVA 2CNLA 4RHFA 2ZWAA 4P5PA 4NJMA 2OCIA 4F9GA 1Q50A 4KXNA 1UEXC 3OZRA 3OM0A 3QYPA 1KIAA 3U1VA 1RW4A 2WM9B 2WUDA 4Y67A 4RF5A 4BAZA 4YRGA 5HIKA 4H7EA 4H7JA 2D0OB 2FV8A 4OHKA 4EI7A 3E2IA 3GA7A 1YBAA 4XD2A 3OJEA 3P0RA 3PL1A 4OHVA 4COKA 1JTEA 1CJVC 3HBAA 2LBPA 4UAUA 4ZMSA 3AGQA 1G3RA 4ZXFA 3WHKA 1M1NA 4DB4A 2HY7A 2AB0A 1R0KA 1YDHA 3IAUA 3ZHBA 1V6AA 2QXYA 3K5PA 3O8DA 5B4VA 1GAJA 3UWPA 1Y8QA 3FYCA 1ORTA 2PL1A 4ZARA 3RAGA 2QA5A 1ZCFA 4OYYA 3CF0A 5CW1A 1GZVA 5IYZB 4OOFA 1BHQ1 2GPNA 1PN3A 2O0JA 3DXYA 3EPRA 1JQ3A 4GBMA 3ZW8A 2NQTA 4DDHA 5H3CA 2H1VA 3WIUA 5LNK6 2YWRA 2H00A 1TGVA 3A27A 3EH1A 3O3CA 3OO1A 1IQ0A 2YMPA 3DEKA 3IO3A 4RGYA 3K70B 3D8SA 1OWPA 4ZRNA 1X1QA 1XVAA 3RU9A 1VYUA 2BH9A 4G36A 1HORA 4FUQA 1EP9A 4NULA 1U98A 2J31A 3CZAA 4NCXA 3C4JA 3PNMA 5IVDA 5AVSA 2ZRMA 3K7EA 4HTFA 4W1PA 2BFCA 4X63A 3KWLA 5AKGA 4EHFA 4QNRA 1W85B 1YJAA 5KQLA 3PVCA 2TRSB 3R2JA 3I0ZA 5FV7A 3ZE9A 1DWUA 2EGUA 4IQFA 4JR2A 2C2GA 1JHOA 2CB9A 1WG8A 4M9UA 2GRAA 3SVZA 1YBFA 3AYZB 1QGUB 1U4SA 4HWKA 1GADO 4QOJA 4RDXA 1SK9A 2Q8NA 3GLFA 2JARA 3O73A 1VRVA 4PG7A 3PGKA 4R8SA 4OIMA 2YVKA 4FD2A 4Y1EA 3W8RA 5KSOA 1WCWA 1QFYA 3VNBA 3ZGZA 2WV7A 5IAAA 1T25A 2I80A 1P5RA 3I0MA 3YASA 4YRTA 3DEJA 1NULA 3I76A 1GR1A 4C04A 1KI4A 1ZVQA 3TS1A 4DXAA 1QH1A 5G2OA 3UJ8A 4UPVA 1QGYA 2BSQA 2X3YA 1GAWA 1PZNA 3G2IA 4FIZA 3UC9A 4OQDA 3JAWA 3VV2A 4OI0A 3NMUF 4OFBA 1DG9A 1FUEA 3O84A 2Q21A 3SF0A 2JPDA 3C3JA 5IEJA 2CLMB 5IM5A 4CQMA 4ZFNA 3O93A 3HKBB 3R6GA 1Q0ZA 4ZYYA 1I36A 1PS8A 2Z08A 2ZUVA 1G8MA 2AG8A 2BMVA 2I8AA 2V0NA 4OFZA 5FBKA 4RTLA 3OUZA 1NIPA 1N6OA 1U7TA 3EMDA 2BFDA 1MQ9A 3ORSA 5SZIA 4C0JA 2G3YA 4HXYA 4CEHB 5EIEA 1Y63A 3HL0A 4C22A 3GJ0A 3C1TA 4H16A 4UBNA 1C9JA 2CV2A 3WIVA 4UVGA 1FZQA 1E61A 1K5GA 5JMWA 1MEOA 2EKDA 2ET6A 2V6MA 1NVBA 2NVWA 4FGLA 3EVDA 2R8EA 2HJRA 1XEAA 1QE5A 2QZSA 3WYAA 3G02A 3E3NA 4DUPA 1Q20A 1DLJA 4S1VA 2VBGA 4LXHA 4Y2PA 2X5OA 3QVXA 4OUDA 2VPQA 5EIBD 3ZCVA 2VT3A 1Z35A 2PS0A 4RPLA 1X7GA 1O1YA 2D1TA 3PITA 1D0IA 2EU8A 3BXXA 3WNVA 4GPZA 3CM0A 5CYGA 3OKPA 4DDKA 1XZIA 2QD5A 4KNVA 5DHRA 5C7IO 2EF0A 3L0PA 1KFKB 1XALA 2C3YA 5TGZA 2G1JA 1LBSA 1RI3A 4TWZA 1MB2A 1RQGA 1VJ5A 4BE7B 1TQ4A 3Q9SA 3VQTA 3II6X 5JC1A 1QAOA 4G0UA 1MR3F 4MVJF 5FOWA 1NVTA 3JQ8A 3DYIA 1I0LA 1X3LA 3IL2A 4NXMB 3CIFA 2LWIA 3TEJA 2YJTD 2Y1GA 3CH5A 2AQKA 4NH0A 2I3AA 1BX3A 1YTLA 3HVIA 2YWXA 4ZO4A 1I3LA 2G9ZA 2I91A 3UICA 1DBIA 3VU1A 1WQ3A 2XCIA 1RXYA 3FPKA 3SBXA 3WGNA 3TM4A 3HXPA 3KPWA 5LB4A 1YR6A 2W8ZA 2CNNA 2XDWA 4I14A 1ZJ6A 3E84A 1KDRA 4ND3A 1A4IA 4OOEA 1X7ZA 2XB4A 4HDRA 1J07A 4UREA 4ND2A 3KB8A 2F9MA 3QKRB 3DO8A 1JKJB 2HMYB 3T99A 4LVNA 1KYIA 1TU4A 4IL5A 3T7RA 3KWMA 2B7LA 4QKQA 5G53C 1UC5B 1YAHA 1PE0A 4R1TA 4WINA 4NYIR 4ETMA 3R9XA 5LP6B 4D56A 5L3SA 2YJGA 5IJXA 2X5JO 3DE5X 4ZYXA 2FR8A 2ZBFA 3EC1A 1ZK1A 4WVLA 3DEIA 2D3WA 1WMEA 3EE6A 3AESA 4JENA 3VH3A 3KPYA 5K51A 2FP3A 2UYCA 4M53A 2HIAA 3HXMA 1USWA 2AZTA 2ZBDA 2WB2A 1QFJA 3G2PA 5AVJA 1LY1A 1KRWA 1T9ZA 1YR7A 1YT5A 3E9YA 5AXCA 4YXWA 3OIWA 1Z8FA 3RIMA 5ABPA 3H4TA 2Z95A 1CS0A 4GS5A 2FU5C 2POCA 3AIKA 3PTLA 2GD0A 2AI1A 2XMSA 3OESA 4UZEA 3RODA 4F72A 1T6YA 5FPKA 2DQZA 5TIIA 5JTUA 4KYIB 4BCCA 2WSYB 3IX7A 4DR7B 2ECQA 4L5CA 1O6GA 4Q12A 3D3NA 3IAS1 3WGHA 3L9XA 4HQRA 2NO6A 2OHFA 4RXMA 2F62A 3CINA 4PW0A 1VYTA 2CWWA 2EP8A 4RY9A 3OQ6A 3A6ZA 3TCKA 1VE6A 2PFSA 4ISBA 1P2SA 4BO3A 4ZMBA 1N6LA 1Y7PA 1KWGA 4BB9A 1L9XA 4WV3A 4INJA 3ZGXA 3NBMA 2XV1A 5C7LO 2CHQA 3BUSA 1Q22A 4N5NA 2NMVA 3IDQA 4MUGA 2WE7A 4FX5A 3QHAA 3ZQUA 1I0ZA 2FSFA 2QTVB 2GYWA 5EESA 3E9NA 3UCEA 2CXTA 1NBHA 2A9JA 1QE3A 2QSJA 3C98A 4C5BA 1Z9BA 2O3UA 3FUTA 1B6TA 5FOVA 4EQ6A 4F84A 4XRGA 3B9PA 1XXLA 1QAMA 1Y3HA 3E61A 3V4ZA 3B52X 4KWIA 3I05A 1DKNA 4M1KA 1JQLB 4O4JA 5T6MA 1AA6A 4I1OA 3ENQA 2HF9A 3M1IA 4NV0A 2XGGA 3SICE 1GYRA 2UYOA 4YS6A 1X7XB 1FDIA 5CVJA 2O19A 3HYSA 1EWQA 2FLVA 2J59A 3DKKA 2OOKA 3OIGA 3TINA 2IS1A 5BSWA 1P9LA 4RFSB 2E37A 4EA8A 1NXPA 2VLIA 4MR7B 4A0SA 5IWCA 1HEIA 4ND7A 1GRQA 4YRRA 2SKEA 1OAAA 5JS2A 4A0RA 1VHWA 3PL5A 4PQRA 2VAXA 4DLXA 1LDYA 1NOIA 2JATA 1DMSA 3E1SA 3EQ8A 1B4DA 3VRHA 3S8YA 3OD5A 1G2QA 3KOZA 1A98A 2WM8A 1P2BA 4FYWA 4GYKA 4RKWA 3IERA 3GD5A 3JS5A 1P3DA 5KO2A 1TC1A 2E6UX 1M2FA 3E35A 3PICA 1QHNA 4ZDJA 3UFBA 1ZOIA 4AFNA 3E8MA 2GZAA 5I9TA 3RTEA 3TKYA 3TJRA 5C8VA 4M0DA 5CAEA 4B76A 2CUTA 1KJJA 2GRUA 2QJWA 2YDXA 2BT4A 1P2VA 3H6HA 2Y1FA 3M5DA 4D80A 5A06A 1K3TA 3VMFA 1SVIA 6ADHA 2XCOA 1D0VA 1YS2X 2C5SA 4Y9TA 4ZREA 4MR8A 5IN4A 3G9UA 3BDVA 1RYHA 1E1CB 4FILA 4IGAA 1C50A 3WNQA 3IHLA 1DJQA 4NZPA 3D8TA 2RJ3A 3UK1A 5IABA 4U39A 3AWDA 5K6AA 1D03A 4PLHA 1U5BA 2QROA 5KIAA 2J9XB 4RA6A 3R7WB 1Y5LA 2FJPA 2G40A 2R6ZA 4PCLA 1WABA 3WSTA 3W5HA 4JR0A 4ZO9A 1IK6A 2B4RO 3WDMA 1WPRA 3WLIA 4XJTA 3EDMA 1A4UA 4OUDB 1A72A 1PGQA 4DMLA 4LHZA 4PHTA 1QC5B 1M9NA 2M6RA 2P11A 3DMHA 3OPYB 5HE9A 4MJ7A 4RY8A 5DNAA 5F9FA 1P4RA 1GZSA 5DM2A 5FEMA 3B3GA 4H0FA 4JJZA 1SC6A 3MIZA 4XJVA 3CKLA 2RKWA 4R9VA 4AY2A 1C3JA 4RDHA 1OX4B 1WDTA 4N18A 3LMKA 4RPKA 3U3XA 1Z5UA 3VR4H 2YYZA 5JU6A 4R8VA 3KQUA 1T0HB 4Q4LA 5K3FA 3VYRB 4X85A 1GEEA 1JKMA 4K6KA 4C0BA 2YWBA 1J4AA 1LBEA 5K0CA 1W2HA 3MTDA 1OI4A 3S8EA 2XQVA 2IHYA 2OFOA 1GDHA 4IJKA 1R9JA 1OXSC 3K9HA 2PYZA 1NQTA 3BWEA 4WLFA 1AK9A 5DP2A 3SS7X 1GAXA 4FWTA 4ETWA 1PCXA 4LX8A 3PDIA 4JUBA 1D9ZA 4BIIA 1JEOA 3RU2A 3SS9X 1D07A 4JB8A 2E21A 3JTMA 3DZBA 3KZXA 3P9CA 2UDPA 4IH1A 2H5JA 4A0QA 4QZVA 1F0PA 1UEJA 3HP7A 1NJ5A 2NVOA 3PUHA 1VIMA 3HBNA 4G5OA 3ZQJA 3AHGA 3IXQA 3U3DA 4EHBA 5JNRA 5MGBA 1E79D 4BFSA 5B1YA 3HABA 1J2YA 1JTVA 3LC0A 4YUXA 4I1PA 3BWVA 4ALLA 1SXIA 2VYND 1DQZA 4HXEB 4X1YB 1HDIA 5CJPA 4DUGD 3PX2A 2QK4A 1BRTA 3V8NA 1BX0A 2A7QA 3VA7A 4ENRA 5K3EA 2GBLC 1XHLA 3THXB 3O90A 4IJWA 5ARDA 1JWLA 4G2TA 4IQ4A 3QM1A 1BGXT 2XUKA 3PYMA 2BEUB 2GXQA 4X8HA 1V5GA 2MINB 3NU1A 1O7JA 4ARUA 1H3FA 4HH3C 4HX5A 4LXXA 1DIAA 5KVQA 2EW2A 2F8TA 4JI0B 1T24A 3VNUA 2I4LA 2VIIA 3QLUC 1JSZA 3TTXA 3JD0A 4O5OA 5B36A 2JFZA 1AM4D 1F6BA 1ARZA 2XVAA 1WW3A 3VPDA 1V4NA 4F3YA 2MMCA 3C97A 3GEBA 1RI1A 2J9RA 1LC0A 1VIYA 3K5IA 2ZTLA 3O4FA 4B73A 3QVKA 1OWLA 1V3VA 2C9ZA 4F6RA 3NIBA 3RC8A 1EBFA 2PLAA 3H1PA 3D3QA 4J07A 5BWOA 2A0XA 3UV7A 2J4DA 1WW8A 2XLCA 4FZVA 3SS8A 3BZBA 1GGFA 3UCFA 3Q8WA 1WDMA 4GGPA 1EX6A 2HKIA 1WRBA 4F3NA 1NATA 2CT8A 2PUDA 2AUTA 2P4EA 3WLTA 4BNDA 3LYUA 2J6BA 3HXQA 1A0OA 4JASB 3NI2A 1Q5PA 3MJVA 3D43A 2KLBA 4KO1S 4KUHA 3GAFA 1VSTA 5JPIA 5U4XA 3M49A 4Q66C 1YB2A 4EYSA 1CE8A 4RQBA 2AMLA 3RI3A 3CNBA 3KS9A 2CXOA 3TYXA 5DNCA 4PNEA 4IVQA 2G5GX 2HJVA 1REQA 3EZLA 2D06A 3GIDA 4EW1A 3R3XA 2FX5A 3ET5A 4NZZA 2KE5A 3L04A 3R4VA 5D2CA 5JVDA 3NTXA 4LNAA 3W90A 4RD4A 1CS4C 1WTAA 1YR2A 4WBNA 1ES9A 4YEDA 1GITA 3DVSX 5DNVA 1A9TA 1U1FA 1VI2A 2VF2A 3AKYA 5K03A 4EG6A 1MPXA 4NABA 2ECKA 2C3PA 4ZQFA 1EFVA 3MWJA 5F33A 4UEKA 3ORRA 2CL6X 4R2LA 3RM3A 3UUFA 2WIJA 3AEXA 3WJ1A 4QU0A 2IE8A 1GA4A 4N0EA 4QULA 4RHYA 5ARCA 3T5GA 4BB5A 4AJ1A 3RT9A 4PAOA 2Z30A 3UM9A 4CLRB 3L7MA 4C9BA 3KC2A 4MXDA 5FL3A 1TCCA 4DCSA 1XTSA 1TZ2A 1V3TA 4EQZA 1FX0B 1OE0A 1VGVA 1G8KA 3MB8A 5HRAA 4DDMA 4RJKA 3RIHA 4WY8A 1ILEA 3SQWA 5J4KA 4QUBA 4E1AA 2CUNA 5DEIA 3WK9A 1F4PA 4L16A 4D97A 5CB4B 4XDGA 2NP7A 3T1OA 4OI2A 3PSAA 5CXSA 5JSFA 5CT9A 1K92A 1WPXA 4XIJA 4FSXA 1KI9A 4GEKA 5EQTA 4OQLA 1M66A 1WF3A 1ZHOA 1QHGA 2ORIA 3OTIA 2D0IA 2QTTA 4Q9DA 4WLVA 2XDQB 4DCMA 3EODA 3RTDA 2Y1EA 4L0QA 3G5MA 4TLDA 3X3HA 4B3DA 3BE8A 1TJ3A 3QUTA 2BHLA 3AF4A 2SECE 3EVTA 2DECA 3DDCA 2WT4A 3NTUA 3Q9UA 4QQNA 4U2FA 5IT0A 2ZM5A 4K0KB 1YOVB 1BHO1 5MN5A 4DMHA 2NX2A 5KTNA 3NKVA 1Q0UA 3KQVA 5DBFA 1U5BB 1RCFA 1FUIA 4JIMA 2JK0A 3TE7A 4EHNA 1XYVA 2XCSB 3L7KA 2IVZA 1WP9A 1U9JA 2ECPA 4UUMA 1IK4A 1G20B 3ZK7A 3C3YA 4YJ2F 1J2JA 5DPMA 2J9FB 2QTNA 2CBGA 3R7NA 3HLTA 4P3NA 2FG6C 4Q21A 2XWJI 3UTDA 3B70A 3C8MA 1VSBA 3LVFO 4MRVA 4AZ0B 5C5CA 1P1HA 3HJRA 5EI5A 3ZE8A 4NJEA 4RC9A 4LEIA 2R8OA 4EA7A 1M5RA 4MKZA 4MSUA 3HLKA 3HCPA 4PFJA 1Z26A 1PNQA 2NUBA 1NDUA 4GPTA 4QC2A 2HRZA 1QH9A 1RRFA 3CW8X 4GP9A 4K03A 2YXNA 5FUVA 1MOZA 1MABB 4CTJA 2WKQA 1L8LA 3ENVA 5JNSA 3W2HA 1SUEA 3U7EB 5JXJA 4K0RA 3B3FA 3WLNA 2QTRA 2HH9A 5IW8A 3PJRA 5ALNA 1OLOA 3KE8A 4I1YA 4WLUA 2AZ4A 2R8PA 4MGEA 3DC2A 1JDTA 2BEKA 3RT7A 3RVLA 3ZDDA 2I2XB 2W6IA 2P1DA 3DAHA 4BXOA 2JI6A 2VOJA 4KCGA 4GPD1 2EEZA 4JC5A 3QXGA 3CO5A 2FA9A 1TK2A 5H7XA 3OHPA 1I6MA 1UFRA 2H1LA 3HDGA 3DQZA 4DSTA 1NAHA 4OGLA 3VPHA 4TZKA 1OIXA 5CPFA 1PJSA 1K8QA 3IDSA 3Q7RA 1JB1A 4UCQA 1FPMA 2AOUA 2C95A 1U5CA 4QPPA 1Y7LA 1OH6A 1O08A 3DCNA 3PZBA 2Y05A 1ONOA 4L7QA 1EVIA 2DHEA 4H27A 3E9ZA 4RD2A 1V4VA 3IAXA 1HDGO 3WGLA 4V0QA 4ER7A 4KSCA 2O20A 3OKFA 4XQ0A 4Q4CA 4FYVA 1AV7A 4CKCB 4N3GA 1K1EA 5EN4A 3K8ZA 2EQAA 4P08A 3H4IA 4QHTA 2H1HA 2X5NA 2JAWA 1GL3A 2P2YA 2B9VA 3MELA 4S1OA 2XEXA 3HKEB 4QECA 3BE5A 1UM8A 4MV9A 3VUFA 4HQ0A 3AHIA 1YGYA 2JBAA 4MINA 4Z2YA 3WTBA 4DAOA 4FYPA 4D9EA 5I47A 3BN3A 4ZT5A 4L5JA 2CMHA 4L95C 3TIVA 2D00A 3ZV7A 1Z0UA 4MWZA 2BDEA 4Q47A 3V7FA 1X1RA 3ZU3A 5G4KA 3GJ3A 4ZO6A 4Z0PA 5T41A 4RLQA 3ZE6A 5CXQA 3NWEA 1T8SA 2P2ZA 2FSIA 3NXSA 3H99A 4UE6A 1UCFA 5IVIA 4HGQA 5I7AA 2BMDA 4DTCA 3FIUA 2AGVA 3CWZA 5JI2E 4GVXA 1X2BA 3RW9A 3ZLUA 1SM4A 3QV1A 4OA8A 2FN4A 8OHMA 4NFHA 1UQTA 5DHPA 3I92A 3SQMA 2NYAA 1PG5A 2H4WA 3F5SA 5LSAA 1UF9A 1GNQA 3HPQA 1E7RA 1S3IA 1RXUA 4JYBA 4NENB 4RM2A 2OAP1 2X1LA 3GRFA 4FGKA 4BFWA 4BBZA 2BTOA 5KNDH 4HT3B 3MM4A 4JU9A 3KALA 3Q0TA 5KYVA 1VLZA 3AEUB 1N6PA 3IOBA 5ALDA 3QVSA 2JS7A 3ZTTA 3TSAA 1P4AA 3FTFA 3OM1A 4K2AA 2X2FA 4IY1A 4EG3A 2X6RA 4DGSA 2WM3A 4DVJA 4ZVTA 5ESXA 4OBEA 3UJAA 3CRRA 1W85A 5K8CA 4ALMA 3HR8A 5BT8A 1RIFA 3PKJA 1S4MA 1Q0QA 3CFYA 3CEMA 3HB0A 3W6PA 3ADCA 2AOXA 2AFHE 4CLRA 4C6SA 3PC8A 2IY7A 4FZ5A 3MT8A 2DH5A 3HXTA 3RSQA 4Y0AA 3HUFA 4JYZA 4CUJA 4XDHA 1UT6A 1QAQA 2I67A 1ZUHA 1E6UA 3A11A 4CIDA 4XD7D 2X2OA 2YHBA 5AVOA 3C3XA 2ZYAA 3U4MA 3SLGA 5L4SA 1G291 3C24A 4BUZA 3BWDD 1N2EA 1FFDA 3AC0A 3GJZA 3OC0A 4IDHA 2PV0A 3AB7A 4HLUC 3WGUA 1ULZA 3UJBA 4CU5A 3DDHA 5CLLA 3V2GA 3ZWOA 3LHSA 2DKFA 3CLSC 3PZRA 3JQFC 4OB8A 4TZTA 5ERGB 4IXDA 3WG9A 3W79A 2IUEA 3DBIA 3U48A 4TWJA 1R18A 2IOHA 4YAEA 4N6NA 1FW8A 3OTHA 2R7AA 4KDFA 1O87A 1SBHA 1IM5A 1UBEA 4UDOA 3WNDA 4IJ6A 2BGTA 2O2EA 4KR7A 1VCOA 4EY8A 2BOVA 4P58A 1E3JA 6REQA 4C3ZA 1GNRA 2ZCUA 4S24A 4AQDA 3DO6A 4AKGA 2QUIA 4PY2A 1U3UA 2RHLA 3JAWB 1E9VA 1G20A 1U4OA 2WWRA 4FEAA 4IO0A 4OHPA 3CW9A 2Q27A 1E6CA 3B13B 1E8NA 4KI0A 3R75A 4B3MB 1VL6A 2DPGA 4ZT7A 4DMFA 4YAUA 2Z6QA 2HPZA 4JFAA 5HFNA 4OBXA 4L9RA 2IH5A 4R0MA 2QYHA 4YDSA 4IUDS 1RMYA 3MTBA 4LMAA 1N75A 4NS1A 3CX7A 4WA7A 3VOTA 4LYHA 1KKLA 1AUOA 5FUYA 2ISQA 3RVSA 1L5MA 3L8ZA 3TK1A 3GAZA 3F7MA 5JW6A 5TV2A 1GTJ1 1SKYB 2Q3JA 4LZLA 5C2JB 5SY6A 3F6BX 5CYFA 4F71A 2IEZA 1P9OA 1SUFA 2YFHA 4JC0A 2JGEA 4E6EA 1KK3A 1VKOA 4LHEA 2QMYA 2C2MA 2QM0A 2J3DA 5CVDA 3FR7A 3KQHA 3DBRB 1KYXA 2YX1A 2QUBA 4MVXA 1EEXB 4P8RA 4ZVUA 4ZC8A 3MD9A 1XUOA 4R1UA 1ND6A 3DEYX 4ZTUB 1YJXA 3JQ8B 4WXHA 3DLBA 3GGJA 3GRCA 2VEOA 1E8MA 2K2WA 5JPCA 1XEWX 2BE9A 1K8YB 3UATA 2HWKA 1PZMA 1BKDR 4UAVA 1CY8A 2CFOA 3GNSA 2FF7A 4CMHA 3MFYA 4EHAA 1OV6A 2HJWA 4OHOA 1AGXA 2Y0PA 2ABWA 2JHPA 1YB1A 2RBGA 3UWMA 4P35A 1RQLA 5ICFA 5JDCC 3PIRA 4HRYA 1GZHB 3LBAA 2Y0BA 5ILOA 2IQIA 2DHDA 5B58T 3A3PA 4RMIA 1Q83A 1KJNA 2V3WA 5JZMA 1FQWA 3GZ4A 2P91A 5H70A 1L7QA 3IOCA 2YV4A 3ZGLA 4DJ5X 2ZSBA 1I32A 1XLUA 5EPUA 5JNVA 4D9HA 3EHEA 1T5IA 5LA6A 3QBJA 1W35A 3D8UA 4ARBA 2Q6LA 2EFGA 1ODFA 1Q0SA 4J16C 3H2HA 1J0BA 2VJAA 2PO7A 3EW7A 4K9DA 2B98A 3MPOA 4ZTBA 5DBOA 2C4VA 4C01A 1JFTA 4AZTA 3VNRA 2KI5A 3F5MA 4P22A 5JLAA 4PC2A 2BFPA 4OGFA 5AW5A 1NQWA 2EAUA 3CNLA 3RFXA 5IBQA 5DIZA 2GT1A 4CV3A 1RAGA 1DTWA 2YRFA 3K2EA 1W19A 2H5LA 4MICA 4X20A 4BLWA 4BO9A 5CXUA 3I6IA 3OZEA 3OQJA 3GOHA 3H16A 3ZGOA 4XWOA 2XZOA 1LTQA 1BS9A 2VPIA 2WFZA 3G0OA 4Y0VA 2R97A 5ALWA 1T9GS 4CEIB 4BKPA 5K05A 2G9UA 2QTZA 4ND8B 5F1KA 3IA7A 1SHUX 7ABPA 1XRLA 3KB6A 2W4MA 3P9RA 3LJKA 4BE9A 3C6MA 5BNZA 2XMBA 4FCWA 3PEWA 4L78A 1RWVA 3PP8A 4MVCA 3LC7O 4PCUA 4UEQA 4G1CA 4XX1A 2HIGA 3KHTA 4G6ZA 4UM7A 5D5PA 5TS3A 3IMEA 3OG9A 4ENUA 3SKVA 1NW3A 4G1VA 4PZEA 2FP4A 4KREA 4BVAA 2WEKA 1ZW6A 3HUUA 4M9SA 1NYRA 1EQAA 1KYWA 3OUUA 5BN5B 2C7PA 4DMCA 2K7ZA 4NENA 1YJQA 1JN0A 2C59A 3N0RA 1T9AA 4M6WB 3QLUA 1E3WB 1VOTA 1X77A 4B74A 1S9HA 5GTDA 3DM5A 3NS7A 5DOZA 3B89A 2NP6A 3H3FA 3K9CA 4CI9A 3I61A 1E2FA 2GERA 2RC5A 3BRSA 1I9GA 1Z6ZA 4NNJA 4O4JB 1UOPA 4J0IA 1PBTA 2YNMC 3JVIA 3WR5A 3OZIA 3ZWKA 1IOLA 4DUZB 4J7CA 1GTRA 4NOMA 4PC3A 2VRWA 1I01A 3T1QA 2C96A 3PHCA 4GYYA 4BMSA 2ZTVA 3PNQA 4S1WA 1QKJA 3A05A 2YXLA 3L8FA 2DPHA 1M6EX 1EGVB 1NXOA 1SHLA 3OZAA 4NEHB 1VA4A 3NBZC 2FEKA 3KLNA 4Q6WA 1UWKA 4YJFB 4MV3A 3ICEA 1V8PA 5A9TA 1X7ZB 2ZGVA 3D3WB 1ORWA 2YXDA 3G9TA 2ODWA 4MA0A 2EZTA 1XVLA 2V7VA 3KQQA 3MMZA 4GZ5A 5KQRA 2WF8A 4QELA 1CRZA 3ZU2A 1N1DA 1A5TA 1YBHA 3I42A 1E4EB 1IIBA 2GNPA 4Q4JA 1X7XA 4ZVLA 4UM5A 1R4NB 2XMQA 3ZDCA 4J9VA 2J9YB 3SHFA 2V0GA 2YTZA 3G8BA 5B7PA 1JGTA 3FOZA 3T7DA 2B4TO 3DBLB 3QW2A 2GKGA 3QG1A 2BTEA 1XU4A 4IFBA 3TMKA 1OYWA 3DMTA 1G59A 2ZJZA 5IKXA 3M82A 3N8GA 1NPDA 1LBIA 3NV9A 4MUYA 4J1TA 4N5DA 3BMXA 1EFPB 3OQOA 1NW6A 3KTAB 4US1R 4C88A 4CM7A 5DYGA 3IE2A 3W1WA 2QVYX 1EUCA 2IKQA 3LIPA 4RAQA 4YMSA 2XNKA 3T4EA 2DBRA 3KLBA 3M7IA 5G4LA 2WD9A 5BR8B 3KYDA 5FOQA 4JLKA 1NE7A 1XZLA 4RA6B 1DBVO 3AM3A 3K0HA 5GY7A 3TDKA 4LX0A 2GBIA 5KQPA 3BPSA 1TA4A 2PSDA 1ITZA 4CN8A 4LWZA 3A1FA 2AYXA 3KLPX 1FMLA 2XT6A 1THTA 3P2IA 3MD0A 1TKBA 4WK2B 4MR8B 1TMGE 1COWD 1JLSA 1Z08A 5EVJA 4BNXA 4EEXA 3VZPA 2PJDA 1QIHA 1Z62A 4U2GA 5ALUA 2PGIA 5CB8A 2J5KA 2Z5GA 3V3KA 2ZS7A 3L0YA 4DB2A 1J90A 4M9ZA 1IONA 3HJHA 4Z99A 4Q4DA 2JZOA 3AERA 1GD1O 2OQRA 3BEDA 3IEPA 4BNYA 3HQ4O 5PGMA 4LOHA 3QLEA 2I1LA 3EIQA 3B2QA 4A0GA 5J2TF 3AINA 3ZHXA 3ZHTA 1M1ZA 1FJ2A 1UINA 1JT2A 2VDWB 2EIHA 4UUOA 1T34A 1WPGA