4QGGA

Tmk in complex with compound 46, 2-(3-chlorophenoxy)-3-fluoro-4-{(1r)-3-methyl-1-[(3s)-3-(5-methyl-2,4-dioxo-3,4-dihydropyrimidin-1(2h)-yl)piperidin-1-yl]butyl}benzoic acid
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
204
structure length
193
Chain Sequence
SAFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEIRKIVLEGNDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERDQEDLKFHEKVIEGYQEIIHNESQRFKSVNADQPLENVVEDTYQTIIKYLEKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate kinase
publication title Antibacterial inhibitors of gram-positive thymidylate kinase: structure-activity relationships and chiral preference of a new hydrophobic binding region.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Transferase/transferase inhibitor
total genus 81
structure length 193
sequence length 204
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2014-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4qggA00
4IOMA 4M1YA 1SVLA 2V55B 4LI0A 4PC6A 4B6FA 4TYQA 3QXJA 2ZE5A 2WICA 1CLUA 3BFXA 3TH5A 2ERXA 4TT3D 4V0MA 5JRZA 4E03A 4UNSA 4I81A 2EVWX 4C0SA 1MABB 3QPWA 2FPMA 1CBUA 4LDJA 3O8CA 4JT2A 1CJVC 1WE2A 2WVJA 1N5IA 3AVXA 3FMIA 4L5BA 1RZ3A 1E2HA 3NEYA 4AURA 4DC9A 2MSDB 3GLHB 5GJWC 4MRPA 1XJ0A 3K9GA 1XZPA 2WZQA 1D2MA 1TUIA 1W44A 1IOZA 2H16A 3ZH9B 4OJQA 5HE8A 2VHTA 4IW3B 5H1YA 4HUTA 2CXXA 2F1JA 4I99A 2F43B 3U3JA 4HDCA 3K09A 1II0A 3MJHA 1E2NA 2QT0A 1MOZA 1S9HA 1W49A 4LYJA 2HV8A 2JEOA 3CZPA 3QXXA 5UKDA 5KSOA 3KQLA 1NSFA 3R20A 3RRMA 5FBRB 2RHDA 2BOVA 1F2UB 1FUUA 2CVFA 2QROA 2GDJA 3QPUA 3A1SA 2W0MA 2VF7A 2PCLA 4DSNA 3GFPA 4CT5A 3PEWA 4URUR 3GJ3A 3QXSA 1EFHA 3QKSA 2GTPA 1EFRD 4BZQA 3WXMA 2J45A 4HAVA 1NJGA 1HE1C 1TEVA 2QRNA 3B82A 4YXWD 4C7OA 3K0SA 5GJVC 5E7MA 4GL2A 1GNPA 1GKUB 1VTKA 3TNFA 4FXPA 4Q4AA 1FUKA 2VSXA 3KJEA 1F5NA 5C46F 5L3QB 4BUJA 4JSTA 3HPQA 1FOEB 1WMSA 2A5YB 4LHYA 1XWIA 2OBNA 2R44A 3MSXA 4DWJA 1E2QA 4KFSA 4QJ3A 4F4IA 1KK2A 5DNYB 1GVNB 4TMTA 3NBFA 4JL6A 1NF3A 4D4KA 3T15A 3OIWA 4Q19A 2GBLC 3UMSA 5JFGA 4IFBA 3EPLA 2VP5A 4LV8B 2ZRMA 2ZR0A 5KNDA 4Q03A 4ZV4A 2OAP1 3AGQA 3EZ2A 2AXNA 2QMUA 4ILEA 5E7JA 3TAUA 2PMKA 1AIPA 2OLJA 3EZ9A 3VR1A 1PZNA 2JDIA 2ORVA 4HZIA 1VIAA 3TW8B 3P4YA 1GP2A 1RYFA 3SYLA 1JR3D 1G20E 1XTRA 3VKGA 3U3MA 1SGWA 2GCNA 2HCBA 4RD2A 1WXQA 3TVDA 4Z1MA 3SN6A 1ODFA 4EDHA 3ADDA 4FIDA 2BBOA 1OPXA 2Z4SA 4OJKA 5LD2B 1DELA 1M8PA 1XPUA 2X2FA 721PA 3U61B 3W9YA 4C0LA 2O0JA 5BN4A 3RRYA 1NY5A 1OYYA 3FGNA 1G7TA 3HYRA 3K9HA 3OE7A 4YLGA 4JYCA 4PFSA 2C95A 4BLOA 4BZPA 2QP3A 3CH5A 1TU4A 2HXYA 1YQTA 4B3DA 3K70B 3VNVA 2G1KA 4D82A 2L0XA 4RD3A 4Z51A 2IEZA 4HLDA 5H68A 5AJYA 1XD8A 1Z6TA 4LPKA 4ESVA 3W3ZB 3ZQJA 1AA9A 2D4HA 4V0OA 3PXGA 1Z0KA 1Q1QA 5EE3A 3QENA 1W4AA 2G83A 2C96A 3OAAA 1W2GA 1XCGB 4NH0A 2WMOB 3KFVA 2GETA 4PPNA 3SS8A 2CDNA 1US8A 4WVFA 1COWA 3C15C 4CVNA 2I1VB 1Z0IA 1W4BA 3BWDD 1K8RA 1N5JA 3DO6A 3IEUA 4DZZA 2BJWA 3L8ZA 3THXA 1P2UA 5JWHA 1QHSA 1DBSA 3GJ8A 4TYNA 1Z0JA 4P4TA 3TKLA 4M53A 5ELXA 1YKSA 4D26A 4DCNA 1M1YE 1FTNA 5EZ5A 4JKIA 3PJRA 3BBPA 2FA9A 4X8LA 1E1RA 4OI2A 4QBHA 2O5VA 1KO8A 4BLRA 4HUQA 4J0QA 3K70C 1S2MA 4MDEA 4R98A 1IAQA 2H7VA 3E1SA 1DARA 4QGAA 2N46A 3ECCA 4RZUA 2YC4C 2EFHB 3GJXC 4PHTA 4P0TA 5AUQA 1KSGA 2CCKA 3QUSA 5J4HA 4LC1A 3RWOA 2J9RA 3KUDA 4B2LA 4AI6A 2Q3MA 1XP8A 5E4FA 4NKRA 1JPNA 1XMIA 2JJ2D 2NPIA 3RRNA 2ZVQX 4CEHA 1ZAKA 3JVVA 1JECA 2QPOA 2GRJA 1RJ9B 5F2EA 3RS4A 3GJ6A 2C04A 4P32A 3LLUA 3FYHA 4CW7A 1IBRA 3S1AA 2OFWA 2R2AA 2O52A 3CPEA 3T06B 3U44B 4DKXA 4NONA 1Z22A 3KKOA 4BQSA 5GADl 3GEHA 3NDPA 1G7CA 1KY3A 4XVQA 3VX4A 2ODNA 1J7KA 3KJHA 4V02A 2PT7A 2GA8A 3UWKA 4TQ9A 4Q00A 3CW2A 3MWYW 1FNNA 1YZTA 1E6CA 1T9HA 5FI0B 4RCYA 1XMJA 4DT1B 3KQUA 1D6JA 3VX3A 1SVSA 1U9IA 1U2RA 4D4MA 1VG0B 1ZM2A 2IX3A 4M9ZA 2V9PA 1D9ZA 1RE0A 1SZPA 1R7RA 4NYJQ 4TL7A 2GVZC 5EE5B 1MRNA 1OKKA 1TQ4A 4URVR 2GJAA 2KB0A 2NO9A 2RGEA 1JAIA 1GDDA 5FR1A 2DPXA 5L8VA 5JEDA 3A8TA 3EAQA 1II8B 3OE7D 3B13B 4KVGA 1WRBA 3FHTA 3AF1A 2XGJA 2QT1A 3K0FB 1O87A 2ZRBA 1RC8A 1NRJB 4KCGA 4KSBA 4A0FA 4Q4JA 1QHXA 4DCVA 3VKHA 1NJFA 5BXQC 5GJBA 1YR7A 2ZYVX 2W2VA 2F43A 3NC1C 4JZKA 1VCMA 3Q7PA 4C2UA 2WWYA 2RGXA 3LBIA 1DAEA 2GBLA 4E07A 3LNCA 2ZI7A 4C3ZA 4PSVA 5E3HA 1G291 1MO5A 4Q1FA 3OAAD 521PA 1F2UA 3PEUA 2D2EA 4JLVA 1NBMD 1COWD 1IHUA 2HF9A 1NIJA 2XJ4A 4OQXA 1N6LA 3PVSA 1F3OA 4OYHA 5CYPA 4DDWA 3NXSA 3VAAA 1OXXK 1VIYA 2VEDA 3SDZA 4DDTA 1N5LA 1W4CA 4ERNA 5FUYA 2WBLC 3DMNA 3GLFB 1F48A 1NMZA 1T3LA 1XD9A 1KO5A 2R6DA 2IYUA 3BERA 5CB6A 2AKAB 1E94E 2DHRA 2QGZA 3RC8A 4D4LA 3U6BA 1IXZA 2BBWA 4OBEA 2AKYA 2XOKA 4YMSA 3CRVA 1NG9A 2GXSA 4HZUB 2IYWA 3O47A 3L0SA 1ZM9A 3C7KA 3A37A 4ZDKA 1ZD1A 2WJJA 4TMXA 3GLGA 1M7BA 1S1CA 3B78A 4P3YA 2IYVA 4B34A 1KDTA 2ZRAA 4I1SA 1KJYA 4NDZA 3T5GA 4QL3A 1BYIA 4DCUA 4US2R 5HPYB 4PZYA 1Y63A 5CM8B 4RCZA 5KSYA 1VYTA 3IHLA 5JJKA 2XB4A 1BO6A 3WP0A 4QM6A 1P72A 3FDIA 1E2IA 5JEEA 1SVWA 3CPJB 2J1LA 3TUIC 3L0PA 5CIQA 4UNRA 2ZJBA 1NKSA 2IT1A 1QBKC 3THWB 1GL7A 2FF7A 4TQAA 4TLCA 1OH6A 2C9OA 3REFA 4WZBE 3H0KA 1GM5A 1TUEA 1HV8A 3CX8A 1KAOA 4XVRA 1KDOA 5HCIA 5SZKB 4ABYA 4AG6A 3U5ZB 2QQ0A 2HUPA 4Q7LA 2MMGA 1Z0FA 2NO0A 4B2PA 3Q8XB 1R5NA 4QGGA 3EPKA 4RY2A 2BCJQ 2F1HA 4QBIA 4LPSA 2RGDA 2GF0A 3Q3JB 1E2DA 4KVAA 4GOJA 1P62B 3EIHA 4TMZA 3NH6A 4F92B 1D9XA 1JQLB 2RMKA 3CNNA 5C4MA 1AQUA 1XBTA 1Z3IX 4B3FX 4M1OA 4HLQB 4F7WA 2OFOA 1KSHA 3PV0A 2CE7A 4A8JB 3N2EA 3DDCA 3MRSA 5D3QA 2JCSA 1VG9B 4D80A 4GZLA 5P21A 2OHFA 4H1VA 1G9XA 2V4ZA 1KK1A 3OIYA 2W83A 2R6AA 3IQWA 3PENA 2CLSA 4A9AA 2FEOA 1HE8B 2BJVA 4EPVA 3EG5A 2QU8A 2WWWA 3A1WA 3B7GA 4O0MA 3RWMB 4HB3A 1SULA 3QF4B 4HLUC 2H1LA 3U2QA 4HAWA 4Q66C 5GVRA 1E69A 2JLXA 1W0KD 1NLFA 3MUFA 4Q1CA 2WSMA 3RS7A 4B73A 4JL8A 3QVUA 1KI8A 4AK9A 3Q72A 3X1DA 1ZM3A 3C4JA 5CK5A 2QSYA 1H8EA 1R0YA 1T8UA 3LBNA 3C5HA 4OI0A 1DG1G 1ZM7A 2ZSDA 2ZI4A 4R2IA 4TLDA 3VFDA 2KBFA 2PJZA 3KQNA 3BGWA 5BQ5A 1NLZA 5L3SA 2GAOA 5AUNB 2MMCA 3CRRA 2P3SA 5FPKA 4V0LA 2QTHA 3ZGXA 1HEIA 3X1XA 2REOA 1RKBA 2FSHA 3KB1A 4GRAA 4PQYA 4A8JC 1TNDA 4M1TA 2RH5A 1P2SA 2ZANA 2Q0HA 4EJSC 4M9SA 4S2EA 1II9A 3IHWA 1R4AA 3OIUA 3THYB 4WXRA 2EW1A 2QQEA 4FWIB 4TYPA 2XZLA 2XOKD 4QXAA 1DG3A 4MYTA 4PHHA 1CJMA 3E2IA 3BIFA 2A7QA 3DL0A 1L4YA 3K0CC 5IK2A 1WDTA 2C99A 4A6PA 5JSZA 3GJ0A 4I1VA 1LF0A 4Q48A 3CF0A 4RFVA 1B23P 4IRUB 1VCNA 2D7DA 1ZU5A 5FOTA 3ZIAD 5DGXA 3UG6A 4XSHA 1T4GA 1TQ6A 2VSOA 5AJXA 1MR3F 4Q7MB 2WHXA 2ZUBA 2AHOA 1NVWQ 2ZS8A 4C0AC 2AFHE 4DIDA 2CVHA 2ZJZA 4E22A 5F9HA 4LY6A 5DSZA 1CF4A 4IKEA 3A4MA 4WZAE 4QHSA 4OKSA 3RAPR 3MWJA 1N6KA 2GJ9A 2O8CA 1R5OA 2ZE7A 4GZMA 3IPYA 3GJ7A 3KKPA 2W00A 2W2TA 4US0R 1K6MA 1ESMA 3KDSE 3F5FA 1C9KA 4KBGA 3A36A 1XFAA 4QNRA 4A0GA 3AF0A 3RDPA 2J87A 4F38A 4TLEA 2FV8A 3O8BA 5FUVA 2NIPA 3TR5A 4DT1A 2FH5B 3BAFA 3V9PA 4E5UA 4TZ6A 4POAA 1CXZA 2G3YA 2G0TA 4RKEA 4I1UA 2F3RA 4UXJA 2BIFA 5FR2A 3KJIA 4KAXA 4IOKA 1C1YA 1IM2A 1U0LA 2C9YA 4JBYA 3SYKA 2FEMA 3EASA 4DLWA 4AKHA 3TUJC 2O8BB 3OESA 1II8A 2EYUA 4XWOA 1W0JA 3O8RA 2QBYA 4KJZA 2V7QA 1PUJA 2BMFA 4BPBA 1NSTA 3K0FA 1FP6A 5C2JB 1N6RA 3VTKA 3O8DA 1Z07A 5KPDA 2ZETA 4QKQA 4DEXA 3FHOA 2Z83A 2WJYA 3AEZA 2OT3B 3VQTA 4PX9A 4A82A 3GLFE 3KQHA 1KJWA 2ORIA 4NCKA 1E9EA 2JA1A 3MAAC 2J46A 1RPZA 3NBYC 4XD7A 3ZVLA 3GPLA 1GKIA 1IN5A 5EE0A 1R8QA 2VL7A 3PG5A 2IUTA 2ODEA 3C41J 121PA 5CDFE 1RRPA 2CCGA 3ETLA 5J47A 4B74A 1OH8A 4DRZA 1H8ED 1A4RA 1OSNA 4C0KA 4LHWA 4DHEA 4U02A 4Q7JB 4RZ2A 1SQ5A 1Z47A 3AF2A 3RS0A 1RYHA 3R8FA 5JHHB 3M4YA 2J0QA 3BFKA 1UFQA 3GLFA 4E09A 1NG1A 3EIEA 3RVBA 3HP1A 3QBTA 4TSFD 5HKKD 5FTKA 2C98A 4CT4B 3I32A 2WM9B 3HR8A 1QZXA 3KUCA 5KSZA 1P6XA 2ZJOA 4DEYA 5EUMA 2F9LA 5JI3E 4QHTA 1G18A 4HZUA 1E9DA 2JLZA 2OILA 2EQBA 5CDFA 4Z8YA 2QNRA 3CR8A 2H5EA 1G7RA 4K81B 3A4NA 4RD4A 4BFTA 1DAIA 1I4TD 5EXPA 1IN8A 1U8AA 3KTAB 4URXR 2IWHA 2VRWA 3WP1B 2PCJA 4B3BA 2O8EB 4GP7A 1GOTA 2NG1A 4D81A 1OXSC 5DHAA 2ZSFA 2WTUA 4Z54A 1OHHA 5LB4A 4EFMA 2GXAA 1P7CA 1Z29A 4OHXA 2A78A 4IVQA 3T34A 1ETUA 4HB2A 3TJZA 3THWA 1EFUA 2YHSA 3IUYA 2O8DA 4HLUA 1UPTA 1NKTA 3ZLJA 3NBXX 1CJKC 4N0EA 4M1SA 4M1KA 4EPXA 3LLMA 2CL6X 3SFVA 1Z0DA 1OFTA 2ORWA 3AB3A 1W36D 2XB2A 3OZXA 2Q6TA 3EZ6A 4DCTA 1XU4A 2CCJA 2Y8EA 4Q21A 2QAJA 3D3QA 1I2DA 5TMPA 2NQ2C 2CJWB 2RKOA 3GJ5A 3K53A 1XEWY 1QHNA 4LJ9A 2CLDX 2VP0A 3UMRA 5H8WA 2F1IA 4IJMA 2HXSA 3I5XA 4A15A 3X1YA 4BLQA 2Z5FA 5A4JA 5KHOC 1JEDA 4A8JA 3WHKA 1HYQA 1Z6XA 1F2TA 3B1YA 3LAWA 1YR6A 1Z83A 2G88A 3CIOA 3MG9A 1WB9A 3SBDA 3IQXA 4Y0AA 1OF1A 4A0RA 3GCGA 1W0JD 2XJ9A 4UQOA 1A1VA 3SBEA 2V7QD 4LBVA 4XSGA 1I4LD 1OV4A 2OM2A 4DBLC 3AVVA 1XEXB 4S35A 2XXAB 2FNAA 2J0VA 3QF4A 3GEIA 3W8RA 4OHVA 4B71A 3WBJA 1E0AA 1KI2A 4W5HA 1YR9A 3VNUA 1OLOA 2LKDA 4GOKA 4GDFA 5KDLA 3SJBA 4GMDA 3QBVA 1LB1B 3ADBA 4MGYR 4FMBB 2QZ4A 1HY3A 1N6PA 4MGKR 4XD7D 4Q9JA 3SI7A 3PUYA 2J7PD 4LV5B 2ZREA 2EFEB 3E70C 4M9QA 1P3JA 2Q3FA 1R0WA 2QL6A 2REXB 3SHFA 4Q7KA 4PXAA 5BN3A 1W46A 1M74A 1XJQA 1KGDA 1XXHB 2W6JD 3B9QA 4IFEA 1KKMA 4PO9A 1SXJB 4DSOA 3LD9A 3TSOA 5KDDA 4QM7A 2ERYA 3TQCA 2KWIA 2RB4A 3OEEA 3BS4A 2BVNA 4KI0A 4PO1A 1XNJA 1KI9A 3ONWA 4M2LA 1AKEA 4MGZR 5KDOA 5TDHA 4U7DA 5J4LA 2W6IA 4EQ6A 1Y3AA 1ZUHA 1Z6AA 1W4RA 3W8NA 3THYA 1G8FA 4OK6A 4MKHA 2CL0X 1OFIA 4B33A 8OHMA 4BEBA 2IS4A 2VYFA 3R9XA 4GSYA 1S3GA 3AKYA 1OH5A 2P65A 3SJZA 4BLPA 2QN6A 4QHYA 3NEJA 4URYR 5FTNA 4L16A 2BBSA 4TMKA 1L2TA 3QG1A 4OI4A 1ZNXA 1CTQA 3C8UA 3SEAA 4MYCA 1SHZA 1DTSA 2DWOA 2A5GA 2FSGA 5E95A 4LWZA 4IVPA 3BJIC 4NYJR 1FFHA 4BFVA 1Z2CA 4EPRA 1G8PA 4CEJB 4Q4HA 3JZMA 4CF7A 2KJQA 1G7SA 3EIQA 1QRAA 1MV5A 5LPNA 2IHBA 1VMAA 1OHHD 3CONA 4G5GA 1J90A 1X8KA 2C5LA 4JLOA 4F4JA 3F0TA 4HLCA 4XH9B 1MO6A 3I92A 2ZTSA 1TX4B 1SXJC 3EA0A 2R65A 1DO2A 2FOLA 4JIMA 2G0NA 1XEFA 1N0WA 5FOUA 4UXHA 3MWLA 4G0NA 1KK0A 1V43A 2BV3A 5JZVA 2PLFA 1U8YA 2ZRFA 2IWRA 3FKSA 1O3YA 3DPUA 2GCPA 2DR3A 2G9NA 4RZ3A 4UNQA 1IY0A 1C4OA 2B8WA 4NYIQ 3AP3A 3TBKA 4Q9HA 2WJHA 1ZRHA 1P73A 2QTVB 3FKQA 2PT5A 1H8HA 3LWNA 1QHHB 3VU9B 1OXUA 3MLEA 4TL8A 1QG4A 1Q22A 3G0HA 2O8BA 1OJLA 4QNMA 2QUZA 1A2KC 2CK3A 1KMHB 2FFBA 3RS3A 4BFWA 2ZXUA 2A2ZA 3GMTA 1G1MA 1OYWA 4ZPXA 1KZGB 1HT2E 3CH4B 1UBFA 1JXMA 3Q5DA 4R71A 2EWWA 1JAHA 1UF9A 4M9XA 1XTIA 4EFLA 2ZRKA 2OG2A 3R9IA 2BEJA 4CRWB 4Q9KA 1ZD9A 3FMFA 4BFZA 4C9BA 2V1XA 4MKGA 4V0NA 2DYKA 1FQJA 2OUKA 1BOFA 1KI3A 2FMXA 3I61A 1JBKA 3LQQA 3IO5A 1EGAA 1R10A 2IYTA 4Q1AA 1GWNA 4JVLA 3I73A 2DY1A 1WQ1R 3ZD7A 1D2EA 2AD5A 1ZIPA 1IN7A 3AVPA 3EC2A 4HAUA 1S0UA 1E9RA 4FCWA 5EXSA 3E5HA 4G01B 1AZTA 1E2JA 2F9MA 4W9MC 2UZIR 2OCPA 2KE5A 1VG8A 1JB1A 1CIPA 4NYMR 4DSUA 4IEEA 3EX7C 4JVSB 5HZHA 4P4SA 5FPHA 3OEED 2FGKA 5K8LA 4OQNA 2PEYA 2BKUA 2Q9CA 1Q44A 3K0AB 4WAUA 3ZZ0A 2GESA 2V6IA 3RSLA 1X8JA 1XB2A 1K5GA 2CNWA 2ZRJA 2VTKA 2ZU6A 3AUXA 2W6ID 4QG7A 4Q9LA 2YKGA 1TU3A 3EPJA 4DLSA 1JNYA 4KU4A 4A4DA 1ZC4A 4RFSB 3QY0A 1FQKA 1P2VA 1YVDA 1P5ZB 1JEEA 2JIZA 3WMGA 1GTVA 4KLZA 2VQSA 3GFOA 4AKGA 3DKPA 5CLQA 5FFMA 4LHXA 1ESNA 1ZC3A 2O8EA 1D5CA 4YDSA 2WWIA 5BYJA 5DIFA 4K46A 1YHNA 2QA5A 2R62A 2ONJA 4HYYA 3BE4A 2GCOB 3EZFA 5FI1B 3TR0A 1BYUA 3K8YA 4QRHA 1OH7A 5KO2A 1XMVA 1CRQA 2C78A 4TL6A 2WJVA 2AD1A 1ZW6A 2EFDB 1GFIA 3I62A 5JRJA 2JLSA 1RRGA 2P6RA 3WMEA 2JDID 4N3NA 3AVTA 1Z6GA 1NI3A 1GZSA 3TAHA 1KI6B 5FBVB 3BRWD 3KJGA 3BH7A 1VDZA 3G82C 3PFIA 1GITA 4L4UA 4LJ8A 4PPGA 3GLHE 4Z1MD 4JL5A 2RGGA 3F3YA 3U3OA 3LXRA 2IF2A 2DFNA 2QMHA 3FVQA 1FW6A 2GF9A 3IIMA 3FKSD 3OHMA 5EZ6B 1T5IA 2ZUDA 3BC1A 1TF5A 3W3AA 1NN5A 2CHVA 1MABA 4LZZA 2Z0MA 2IK8A 2DFTA 4LJ4A 2BM0A 1Z08A 2I1QA 3ZVNA 2NGRA 2FDCA 1E2KA 4AIIA 4TMVA 1KO1A 3IIKA 1H8HD 4LBWA 3CRQA 1CR1A 2BMDA 3GLHA 3JVUA 3HU3A 3IBGA 3EXAA 2CK3D 3T5DA 1XXHE 1U99A 3QKTA 2HT6A 3OEHA 3WNCA 1KY2A 3B60A 4PSKA 3CO5A 1AS2A 3KXLA 2GZAA 3LA6A 1DVRA 2A30A 2OEPA 3ZVRA 5AJWA 1KNQA 2OFXA 4D25A 1CP2A 5KOYA 5B2ZA 2WKRA 2YWEA 4UJ3A 3V4RA 1XTKA 4AYWA 4MKIA 1H65A 5FBWB 4JBXA 3GD7A 2MSEB 4TN1A 4BASA 2P6UA 1XCMA 4BFYA 1OXTA 4Q1EA 2IEYA 4G5QA 3CB4A 2PX0A 3QKRB 4G3XA 4NBSA 2NZ8A 1UKYA 4M1WA 1XCPA 1XXHA 3SU8A 2ATVA 3P4XA 3TW4A 4BWYA 4CIDA 3VR6A 1NNEA 1TEXA 1IN4A 4X8OA 3GEEA 5GJCA 4L9WA 2GZHA 1Q20A 2WWFA 3VR5A 1M6NA 1E0KA 4G5RA 3UWOA 2G6BA 1TF7A 3B9PA 4P31A 3QKUA 4JLDA 1E1RD 4C2TA 5L3QA 1E96A 4WXPA 5G53C 5JBQA 3QQ5A 4JLJA 2P6NA 4ZI3A 2BMEA 1ZUIA 2HJGA 4FMDF 3IGFA 4FWTA 2QPTA 2CNWD 1UEJA 4CEIB 1T0HB 1NN0A 4B3XA 4WZ6A 5DYGA 4B2IA 5EJEA 5TVKA 2EYQA 4LHZA 2QORA 4DDUA 4M22A 4PO8A 2ZJYA 3W34A 2IYYA 2D62A 2JIZD 4UJ5A 2FE4A 3FOZA 1UJ2A 1GL9B 2FPKA 3THOA 4IHQA 1Q12A 4CEJA 1EX7A 821PA 3BFVA 2BKEA 3ADCA 3U7EB 3PEVA 2W0SA 1NVVR 5K8UA 2FJUA 3AVUA 4OK5A 1XX6A 3U3KA 1E32A 1ZYUA 5CM9C 3BH0A 1T3SA 3TGPA 4TYYA 1SHKA 2GKSA 2VHQA 3ZQ6A 4GOXA 2PZGA 3NIBA 2LWIA 2XNDA 1QF9A 3AGPA 5JMTA 2WWHA 2ZPTX 1S96A 1Z0AA 2X2EA 4OHWA 4NZYA 1GG2A 3ZVMA 4DLRA 3IKJA 4HATA 4DUGA 2DWPA 1AS0A 1TL7C 2ZRGA 4LYAA 4D0LB 4OK3A 1DE0A 1NP6A 1YZKA 3FHCB 4DLUA 1CR0A 4OQMA 5D3MB 1L8QA 2Q9AA 2VBCA 2DCUA 5B58C 1G4UR 1T91A 2YINC 2HF8A 1N25A 2YOGA 4US1R 1G17A 4EIWA 4D2IA 3MCAA 1OKKD 1QHHA 2YWFA 1G8HA 1NVXQ 4A1FA 4EJSB 3H2YA 1KO7A 2ZRNA 1UBEA 2W58A 1CJTC 1YZNA 2ZU0C 3A58B 2OV2A 2QM7A 3FMOB 3FPAA 3CF6R 1KMHA 2ZS9A 4BEJA 2OBMA 4PPFA 1BKDR 2O0HA 4AG5A 2CL7X 2GNOA 1RW4A 5K8TA 4AY2A 2WPDA 3KKNA 3RS2A 1XTSA 4ACBA 3HJNA 2YVUA 1E2MA 4JLNA 4JYBA 2JJ1A 1UKVY 4LRWA 3SOPA 5FOSA 3CF2A 4PC1A 2NZJA 4CDGA 4DIEA 3KXKA 4HI0E 2IYLD 2QE7A 4TLBA 1Z63A 2CEAA 4MRSA 1DAHA 2PEZA 4ON9A 2XSZA 2YWHA 2GJ8A 5C1BA 1ZNYA 5HTKA 3SJAA 5IRCD 4JJZA 2KBEA 1LVGA 2OO7A 5J4YA 1E79A 2C77A 4M4SA 5B30A 1VKJA 4TZ0A 3Q7QA 3HWSA 5DN6A 1NMXA 2ZM5A 4KITB 3F8TA 3PUZA 4A0HA 1KO4A 1U0JA 1CJUC 1EG7A 1FL9A 1LV7A 2B7BA 1R6BX 2CE2X 4LSGA 4PZZA 3I72A 4HB4A 3AVYA 4ZKEA 1DOAA 421PA 4U5XA 3UMFA 1N2CE 1QHIA 3NHAA 4HAYA 1EFCA 3UK6A 3AQ4A 2R6FA 1DAKA 2PMDA 3FWYA 2PBRA 5AWFC 2ANBA 1KAGA 3B5JA 1OB2A 1R2QA 3K0AA 1W7AA 4MA4A 5DI3B 3BB4A 3QKSB 1ELOA 2QGNA 4HSEA 4NE2A 2Z6VA 3T1OA 2VHUA 4EPWA 1P2TA 1XF9A 4YMWA 2HEIA 5IT5A 3U7FB 1G8YA 4HDOB 2JASA 3RSOA 4C7OB 1ZU4A 3NWJA 1G3UA 3C14C 4ASUA 4Q4AB 4JKYA 4EFNA 1E2EA 1HUQA 3ZD6A 3HPRA 1KHTA 1RJ9A 4TL9A 5DLQC 1XZQA 4PAQA 2GCOA 1G3MA 1YRBA 2AK3A 2ZJ2A 2DWQA 2OCBA 4B3GA 3U44A 1EWQA 4IDOA 1VPLA 2IL1A 1TQDA 4BRUA 2GK6A 3WBKA 4NTZA 3LO5A 1X1SA 3IPXA 4NCIA 2WAYA 3K09C 1DPFA 4NCJA 5AJVB 3DM9B 4BGDA 1N0UA 2HCJB 5KSPA 1IY1A 2XITA 1ZNZA 2QTFA 3QG5A 4PAOA 4EPYA 4FMDB 4ZI2A 4R7ZA 4B75A 3AP1A 5IDVA 2P67A 5J5CA 4FI3C 2DBYA 2ZYUX 1W47A 3TMKA 1JQJC 2WKQA 3T1QA 3K0EA 5EE9A 2F1RA 4RSGA 4KV9A 4KO8A 2ZSEA 1CULC 4NHOA 1BS1A 5FTJA 2CLCX 5DH9A 5CITA 2WV9A 5J4VA 1U81A 2BCGY 4Q47A 4QFMA 3DHWC 5KTYA 3CBQA 1QVAA 2IS2A 3KL4A 2YWGA 2FZLA 5G41A 1YE8A 2E9SA 2GWHA 2G1JA 4A2WA 4EPTA 5IHPA 2GXQA 2J3EA 5EP4A 1M7HA 5JECA 3K70D 3GLIB 2NO7A 2C9CA 1U0HC 2NMVA 2F7SA 1XJCA 3CKLA 2FGJA 2ZYTX 1T3HA 3LX8A 3IEVA 1IXSB 2F3TA 4LUCA 5AJZA 5EUQB 1ZVQA 2D3WA 5HCNA 2E87A 5BN5A 2VPPA 2XTZA 1VYVA 2BBTA 3BD9A 4NL4H 1K5DA 2XZPA 3FB4A 2QG6A 3CM0A 2GK7A 2ZIAA 4TTQA 3LW7A 3B1XA 2QE7D 4GI7A 4F93B 3U4QB 2XSZD 4TQUS 1RIFA 2OCYC 1TMKA 2HDNB 3D6TB 5GVSA 4IDHA 1E79D 4KLNA 5DHFA 1U98A 1EXMA 5DN6D 2B21A 2F6RA 4YDHB 1E2GA 1T8TA 1FMJA 3X2SA 4DB4A 3B1VA 3AUYA 1GIAA 1US8B 2AR7A 4JLAA 4NP6A 4PR0A 4F4CA 1AM4D 3DOEA 1OB5A 1W48A 3LFUA 1LW7A 1G6OA 4V0KA 3ZDQA 3THXB 3V00A 1XEWX 4LJAA 4ACAA 2OLKA 4IXMA 3TUZC 4LJYA 2AX4A 3KKMA 3HU1A 3T61A 2Q9BA 3UXMA 2JLYA 1Z6YA 1OIVA 1G3RA 2QMEA 1E98A 3W6OA 5EE1A 3TE6A 3A4LA 1Z5ZA 3EZ7A 4C0JA 3R9WA 5IK2D 1X3SA 5IF9A 2NOAA 4KXFB 2HT1A 3UIEA 5EP1A 4CYMA 4NYIR 3WHLA 3A6PC 2IS6A 4HAZA 3Q85A 1EESA 3RYTC 2JGNA 1Q21A 2ASEA 2IUSA 3I1FA 4QBGB 3RC3A 4ZCLA 3AKEA 2SHKA 3QEOA 3U7HB 3EWAA 1JR3E 2REBA 2R9VA 2KI5A 2FFAA 4HDQB 2C8VA 1E99A 4KFUA 4RD6A 3EWSA 1KK3A 2GVDC 2ZRPA 4KODA 4QBFA 2BMJA 4UNNA 1G6HA 4EKDA 4GMXA 1YJ5A 2RAPA 5TARA 4CEHB 1UDXA 3B1WA 3UATA 4LYFA 5KYKA 5JS7A 3C5CA 4FCVA 3CX7A 5F98A 4IOLA 3SQXA 1PVOA 2ZI9A 1OIXA 2VA8A 1JR3A 4L15A 4TWZA 4L8GA 4TYWA 1VECA 4PANA 2RGAA 1DS6A 5D3MA 3W6NA 1G41A 4RD0A 3QOFA 3RNLA 3VHLB 3U3RA 3TSZA 3K1JA 2OCAA 4FD2A 4C0HA 1LTQA 3FE2A 2BC9A 5EXTA 2RHMA 4PTLA 1UBCA 3CPHA 2H57A 4EJSA 5FBQB 4B47A 2ZI5A 3RANA 3MFYA 3T1VA 3ND8A 2IYXA 2YOHA 1W2HA 3PITA 2VO1A 2QAGB 3ZZUA 4D4JA 2QENA 3K0CA 4AD8A 2ODWA 3KFXA 2JATA 1XRJA 4A6XA 1AGRA 1VCIA 1KYIA 2J41A 4DDVA 2H92A 1G21E 2CMKA 3AP2A 3PR1A 4Q01A 4W5JA 1HQCA 1Z2AA 4X8MA 2QI9C 4XVUA 3T1TA 1LFDB 1DO0A 1KDRA 3DMDA 4Q4JB 1KMQA 4XJXA 1HH4A 3DKVA 3RLFA 3UKDA 1OIWA 1LS1A 5F3WB 1FPMA 1RVDA 2GEDA 3AV0B 4JSYA 1BIFA 3TVTA 3AVWA 3GJ4A 1S8FA 4LBYA 1W1WA 2V6JA 4JJKA 1TQ2A 2ONKA 1UKEA 3WNDA 1AK2A 4ITRC 1AQYA 1VCOA 2WJIA 3NVAA 1W5SA 2B7CA 3FMPB 1E4YA 4PHGA 2QP4A 4YONB 1Q1EA 3B1ZA 4XWAA 4EUNA 1KTVA 3SFZA 2RGBA 4YMVA 1U9IC 2FZ4A 2X1VA 5G3ZA 1KI1A 1WA5A 2PX3A 5DI3A 1UADA 1YR8A 2A3RA 4LV6A 2WKPA 3VMFA 2IXFA 2QAGC 2OSBA 1VHTA 2PZEA 2ZAOA 5A0FA 3WRXC 5JWRA 4PQRA 1X8LA 3DM5A 3LRPA 4MUAA 1MO4A 2OZEA 1UEIA 4ESHA 4RJLA 1XTJA 1P75A 2XZOA 3ADKA 4RD1A 1T5LA 2DB3A 5G40A 2ODBA 1S1MA 1F6BA 1DAFA 3H4MA 3B8HA 3HYTA 3B2EA 5B64A 3GLGB 4JBWA 4LJ7A 2YNMA 1LNZA 2ZRHA 3QIAA 1Q1BA 4ZIRB 2QPAA 3N5CA 4KHZA 3VR2A 1U94A 4PHFA 2AXPA 2JJ2A 2VHJA 4IEIA 5FOVA 2OXRA 2OESA 2C2HA 3SYNA 2O8FB 4D6PA 4I4LA 1G16A 1E2FA 4W5WA 3UG7A 3Q5EA 4GNKA 4WIAA 3D8BA 3SHWA 2WWGA 3KXIA 3TK1A 4C0BA 1MO3A 1J8MF 3GLIE 3PEYA 1SVMA 3ASZA 2TMKA 4H9GA 1AJEA 2JLRA 4ZDWA 1A7JA 2ZR7A 4MKFA 4Q1DA 5HE9A 5JJIA 2GEUA 5K8IA 3DOFA 4YC7A 3WMFA 2ZJ5A 4Z8XA 3GP8A 2RGNC 3ICQB 2FWRA 2IUUA 3CNOA 1VHLA 2XAUA 2V54A 1YU9A 5TXGA 3ICEA 4AKIA 1YZQA 4DLTA 4FMCF 3ZZTA 5J4KA 5TY0A 4MRNA 4BECA 1ZCBA 1WBBA 1HTWA 3GLIA 2CHQA 4JMPA 5KNBA 2EFCB 1KI7A 1PUIA 4D0NA 1FX0B 1D8TA 3LVRE 3MGCA 5G3YA 3CWQA 2ZROA 1NBME 1OT3A 2CHGA 3PCRB 1IN6A 2XEXA 3BB1A 3MMPA 1F60A 2ZRDA 1A82A 1QHGA 1G19A 3X1ZA 1GILA 4MRVA 1E9BA 2VSFA 2ZJ8A 4JLMA 3QE0A 1N3BA 2IYQA 3PUVA 2B8TA 3BH6A 5C4GB 5AR1A 3U4QA 4KFRA 4C0QC 1TAGA 5DYIA 3L2OB 3OIVA 1EX6A 2FG5A 1QVRA 4UXIA 2BHRA 3P20A 3WRYC 3KZ1E 3WYAA 1JI0A 3I5YA 1RFLA 4K8OA 5FPYA 1PLLA 1E1QA 4KFTA 4DJTA 1G4AE 5KUTA 2B92A 1NBMA 1ZJ6A 2A5JA 1Q3TA 4GPTA 5FOXA 5DO9A 1YZGA 2HYIC 5F9FA 1GNQA 1ZP6A 3B85A 2IS1A 2PL3A 1R0ZA 3CLVA 5LD2C 3LV8A 5KNCA 1J99A 4OQFA 3IO3A 2NPFA 3KQKA 2V1UA 5L3SB 4DSTA 3EARA 4Q02A 1AGPA 3W90A 2OBLA 2ZYWX 621PA 1CEEA 5JHGB 4DXAA 3X1WA 1FZQA 3LQRA 2X19A 2X77A 4OL0A 5SZJA 1KSFX 3KTAA 5CLLA 3CZQA 1G64A 1GNRA 5FBLB 3SE0A 2WOJA 2AWOA 1JPJA 2YOFA 2PLRA 1TPZA 1ZBDA 3FTQA 2D7CA 2GJSA 1G5PA 4GFDA 1EK0A 2F55A 2IHYA 2PJRA 4R2HA 1QHYA 2VP9A 2ZS7A 5ANRB 1E9AA 4C4PA 2FU5C 5EQTA 2DFKB 5JSZB 1YRAA 1XD2B 4KSCA 1TF2A 3C16C 1P9NA 4B35A 4KYIB 1IJFA 3BXZA 1P9RA 1JR6A 1PJRA 2NO6A 1OFUX 2A9KA 2V3CC 1KKLA 5CIWA 1CRPA 2IF0A 4LGMA 3NH9A 2R8RA 2WJGA 2CJWA 2ZE6A 1E9SA 2AWNA 2I4IA 3CUEF 4LCBA 1TTTA 1QDEA 2WIBA 4LJ5A 2A5DA 1MRSA 1U90A 2G77B 2PH1A 4NCHA 1UKZA 2O8CB 2N42A 2FSIA 1YZUA 3BB3A 1Q57A 1R5BA 2O0KA 2VF8A 3NTUA 3PUXA 1W36B 1CR4A 1T6NA 2WIAA 4TMWA 3R7WB 3DZ8A 1D2NA 3NG1A 4LX0A 2P5TB 1J2JA 3CR7A 1PV4A 2AFIE 1I2MA 1WF3A 4QJ5A 1P9WA 4HAXA 4L9SA 4FINA 2IYZA 4ZDJA 1NL3A 3H84A 4JLBA 2ZRCA 1RRCA 1NN1A 1UDWA 2JAQA 2QY9A 4XIGS 2J0SA 2C03A 2VP6A 4A36A 1GL6A 2QAGA 4DLXA 1SXJE 4URZR 1XEXA 5BW8A 1L4UA 5H70A 2XXAA 2ZI3A 4URWR 5AUOB 3Q9LA 1GRNA 1N6HA 1ZUNB 1KSJA 3SZRA 3L43A 3M0EA 4FN5A 2WSSA 2VP4A 2QBYB 4KBFA 3CRMA 4GBMA 1GSIA 2QSZA 2FFHA 2FX3A 4H1UA 4DLZA 4B3CA 4LBZA 2NO1A 2ZSAA 1W0KA 4PC7A 4PPQA 2ZJAA 3UANA 4KYUA 1N0VC 3MWKA 2H18A 1SXJA 3OFNA 4DLYA 2WOOA 1W36C 2ZEJA 2J5XA 3BORA 2FPLA 2IC5A 4NU0A 1G3IA 2ZI6A 1UBGA 1FP7A 3LW8A 4LYHA 1MT0A 1Q0UA 4DVGA 4MDFA 2X8AA 3DVLA 1E1QD 2J59A 3TSWA 4FMCB 4MITA 2XTMA 1BMFA 1NVUQ 3NKVA 4Q18A 1IJEA 4UKDA 3N2IA 3NDBB 3ASYA 3GLGE 1N6OA 4AKEA 3BK7A 3N70A 2YC2C 4DCSA 2JJ8A 2IBMA 1CKEA 1XDBA 3CX6A 1OW3B 1XTQA 2Q3HA 1E4VA 2J0UB 2GHIA 3CWZA 4W7SA 2ZR9A 4NCNA 3AKCA 5JJLA 2QM8A 2RGNA 2LCFA 3LX5A 4MGIR 1VYUA 1GRRA 1G3QA 3AH8A 3AVQA 4BLTA 5FOWA 1JALA 1LS6A 2QMOA 3B6EA 5FH9A 2ZSBA 4LJ6A 1PLJA 4BE7B 2GXUA 1E2PA 2ZRLA 4N0DA 3LBHA 1E9FA 2GAAA 2KSQA 3I4LA 3K9LA 2MSCB 1N6NA 4QC2A 4WW0A 1OFHA 3ZIAA 3TRFA 1MH1A 4A2PA 4ZIRA 1VG1A 5DISB 2JLQA 1GKYA 3ZS9A 1CR2A 4LK2A 1ANKA 5DE3A 2O8FA 4ARZB 3TQFA 4PAMA 1P60A 5CJPA 2HJVA 2IYSA 5JCZA 3D7MA 3VR3A 5HR5A 4RZXA 2ZITA 4FW9A 4B43A 4NYMQ 4JVMA 4B44A 2P2LA 2IXEA 5CJ2A 4B32A 2O8DB 2QEQA 2E1RA 1BH2A 2A5FA 1SKYB 4A92A 4RVCA 1WP9A 3VKWA 4JVNA 2IA5A 1WCV1 1SVKA 4V03A 5FL3A 2HYDA 1X6VA 2ATXA 4TTRA 3VU9A 3A1TA 2IW3A 5B57C 2EU8A 1GAJA 5FL7A 3IILA 1HQYE 4XOIA 1OE0A 1IY2A 6Q21A 4Q1BA 3QSYA 5CB8A 3LY5A 4RKFA 1R0XA 1UM8A 2ECKA 1IQPA 1G8GA 1XMSA 3QJYA 4Q5IA 5L3VA 4YMTA 2YYZA 1IXRC 3U6KA 1LF5A 1SVOA 2FN4A 1FX0A 1WBDA 1KOFA 3OEHD 1HA3A 2Z43A 1CU1A 1F2TB 1NMYA 3BOSA 3IIJA 4PC3A 3KB2A 2AK2A 5M04A 4WBSA 5JWOA 5KPJA 2WSSD 1JXOA 1I4DD 2OXCA 2BEKA 1E0JA 5TV2A 4B6EA 4II7A 4BFUA 2D74A 4ZCMA 3QEJA 1P61B 3WYFA 4ZCIA 4P4UA 3NC0C 1SXJD 4QGFA 3IBYA 3OFND 4LHVA 4ZO4A 3RS5A 4BFXA 5FPSA 3DEFA 4XWKA 2IXGA 3WYGA 3A1UA 5JS8A 1FNMA 5LBIA 3D31A 1DAMA 1ZINA 1XPOA 1Z06A 1G5TA 1S9DA 2BDTA 1FTSA 2R6CA 3AF4A 3AM1A 1EFTA 1PLKA 4Q9IA 2D2FA 1BMFD 1X86B 4IDNA 221PA 5BYKA 2XTNA 4PQFA 2P0EA 1CS4C 2ZUCA 4TSFA 4RFSA 5HKKA 2QRZA 2HLDA 1A5TA 4BLSA 5TB5A 5AK0A 1S3SA 2VIIA 2JLVA 5AUPB 5EXXA 5JI2E 1KJZA 3SC3A 4WOPA 1AKYA 2CBZA 1SKQA 4OQLA 5E7IA 4B48A 1M2OB 4EQ6B 1DEKA 4LC0A 2OE2A 5JLJA 2UVQA 3AKDA 3P27A 5FPTA 5FUXA 1E0SA 2AN9A 2ZQ5A 3L0OA 3MD0A 4IOJA 3RRZA 4F91B 1KI4A 1OXVA 3SNHA 2ZRIA 4TLAA 2Z4RA 4OHYA 2ANCA 2GZDA 1XD2A 4UNPA 2XNSA 2YZ2A 3KX2A 3TIFA 1KI6A 1FMLA 5CYOA 1AN0A 4PC2A 4MH0R 4BZXA 1M34E 4JLPA 2FSFA 1M7GA 2GEVA 2H17A 1KIMA 2P5SA 4Q4HB 3KKQA 5FTMA 1NLYA 1A2BA 5SZHB 4M1MA 2XNDD 2EWVA 3P26A 4G1UC 3ZYCA 1R8SA 3AF3A 3VR4A 5C18A 3OF5A 3CRW1 3DZDA 4XTCS 5L3RA 4AWXA 4ZDIA 3J81k 4DUGD 4I1OA 3U7GA 3V4FA 1GUAA 3ND9A 2I3BA 1UAAA 3R7WA 1KZ7B 3NBZC 4QGHA 3NHBA 4NMMA 3W5IA 1ZD8A 1DAGA 2WAXA 3MJRA 4LOAA 4TT3A 4AYTA 4IVRA 2PZFA 2RCNA 3GFTA 3P32A 4M0LA 3EA5A 2RGCA 5FL7D 4AYXA 2JLUA 4BFSA 2IYRA 1HURA 4A2QA 2GILA 3EPHA 1G5RA 5SZIA 4G5SA 3W6PA 3H1TA 4P33A 1S4QA 5JCPA 3CNLA 2R6GA 3P1JA 4OHZA 1RRFA 2WPDD 4U00A 2JLWA 3HDTA 3PQCA 5J40A 3VHXA 1IONA 3QPVA 4IDPA 3W5JA 4DB2A 3I8XA 2EFGA 3LVQE 1P4SA 1EWRA 4FCTA 2JJ1D 1TADA 2DFLA 3L0IB 4JLKA 5DI9A 1NVVQ 4C30A 4IDQA 3RABA 1ZCAA 3QXHA 4O2RA 5LDDC 3I8SA 4O3MA 3LH5A 5BWMA 3QXCA 4MQBA 1V5WA 4R9UC 5FUWA 4O25A 3T35A 1GRQA 3QKRA 4OI1A 3AVOA 1JJVA 4BRWA 4Q4LA 3ZS8A 3FFBA 3TLXA 2ZVPX 3EW9A 3LDAA 4QJ4A 1LY1A 1KNXA 3EC1A 1J70A 4DLVA 2J7PA 1JJ7A 3GQBA 1AS3A 5EP2A 2VP2A 1Q1ZA 2K5UA 2NTYC 2W6JA 2B6HA 1EFRA 2OAQ1 5EP3A 1W5TA 2FFQA 2D06A 4D0GA 2UKDA 3H86A 1ZMXA 2J7KA 1E9CA 4PZLA 3RHFA 4MYUA 5HZKA 1B0UA 4WA7A 2VHCA 3M6AA 4YXWA 1AZSC 4CEIA 4CZ2A 1KDPA 3K9NA 2J0UA 2YV5A 4NPHA 2QP9X 1ZIOA 2BM1A 3ZJYA 4P4SB 1E3MA 4EAQA 2HLDD 2WMNB 3HR7A 3WY9A 1ONBA 1DADA 3M1IA 1L7VC 1NN3A 2N1BA 1ZNWA 3L8YA 4X8HA 1NIPA 4HUQB 3UPUA 4N1AA 4YQFA 1SVIA 2LKCA 3HU2A 2VH5R 4ASUD 4YMUA 4MRRA 3PIRA 2H8KA 1SKYE 1T0JB 3QNUA 3SR0A 3PUWA 5A5GA 4GP6A 2GJKA 4GT1A 2XX3A 3FFAA 4O2LA 5CK4A 1HT1E 1NY6A 2VLIA 4IXNA 4M21A 1XPRA 2AL7A 4HB0A 3A1VA 3QVVA 1Q3HA 1YZLA 4ZKDA 4M8NE 2W2XA 4MYHA 3SQWA 4ARZA 1MKYA 4G5OA 4QOSA 1Z8FA 2YJTD 4XTRA 3L82B 1U8ZA 4MUBA 5LB2A 1N5KA 4V0ME 1Z28A 3S1AB 2UZ3A 3SJCA 2V8OA 4JT4A 3R8CA 1E2LA 4Y0VA 2WWXA 4HEJA 3REGA 1N6IA 1J8YF 4JS0A 5FTLA 3JZAA 3I3SR 4TTPA 4PSAA 2ZE8A 3QF7A 3QI2A 5KU1A 1ZM4A 4B76A 3U60B 1X1RA 4CGZA 4AC9A 2ZAMA 3T12A 3IDQA 3WNBA 2BWJA 3G5UA 1QG2A 3LXXA 2Q21A
chains in the Genus database with same CATH superfamily
1JQDA 3V1LA 4F1WA 2V55B 1LDYA 1U2DC 2HK9A 2MHCA 2Z95A 4PC6A 1BE0A 4HO1X 2ZE5A 4TYQA 2WICA 3T9BA 2PX2A 4F7DA 2JGIA 4HGPA 3TH5A 3VH2A 3AF5A 5IF3A 5ABPA 3D4BA 1X87A 3IMKA 4UNSA 4I81A 4PINA 1V6AA 1KJQA 3ESDA 4HDMB 2FPMA 1HBJA 1CBUA 2DLNA 3B12A 5LP6A 1WE2A 1N5IA 3FMIA 2AJBA 4IIYA 2ZCUA 5AM3A 1M2JA 3BJZA 5GZ6A 2HA0A 1A69A 1YRHA 1I3CA 3RIGA 1GPLA 5DGHA 5DF1A 2CBGA 1E2BA 3U4GA 1E61A 4DC9A 1NQXA 2YZKA 4ITUA 5JBNA 2Z9BA 3GLHB 3NTRA 2ZWIA 4YV0A 3V1MA 1XZPA 1DXOA 3MB8A 2NU7A 1TUIA 3OBIA 1IOZA 2O1EA 4K6KA 3OFVA 3PRHA 5CHYA 3ZH9B 2A3NA 3HBMA 4RH0A 4IW3B 5H1YA 5BNWA 2EKDA 3HCWA 3TQRA 1F2DA 3SEZA 3ZY4A 2O19A 1TYAE 3DHYA 1IWBB 4IG4A 4ZK2A 4TS9A 3K09A 1J9ZA 1II0A 1E2NA 4K6FA 1W49A 2FDRA 2HV8A 5KSOA 4DA4A 3WLOA 3VA7A 4DJDC 4X90A 1GZ7A 3PXXA 4OY3A 2C3YA 4X5OA 1F2UB 3TIVA 2I4LA 2GQ0A 1N9KA 2CVFA 3K35A 3QPUA 4RYLA 1PT6A 1KU6A 3GT0A 3JQBA 3BIWA 3ZU5A 4AMUA 2VF7A 1MFZA 2CXHA 1LLQA 1NPYA 2PCLA 4BQRA 3GRPA 3OX4A 4CT5A 4DSNA 4URUR 3UMMA 3PEWA 1WLYA 1EFHA 3M6XA 2Q5IA 2HU8A 5K2MA 3WXMA 2VSNA 2J45A 5T4BA 3BKXA 4F12A 1ML3A 3LZ6A 2HHLA 3D3WB 3K8QA 4S1WA 5AFSA 1SO8A 4HWGA 1WXDA 2NT3A 4B45A 1OWNA 2KX7A 5DTQA 1RPNA 4YR7A 4WXHA 4TXHA 4B0OA 5J2TA 2ENWA 4AO8A 4NAVA 5BVHA 4DABA 5TJHA 4GL2A 1VTKA 1EIZA 5EIXA 2ADFA 4ND7A 3CUYA 1F5NA 3HNOA 2XZDA 2PJDA 2L2QA 1FOEB 1DRJA 2C0PA 2A5YB 4B2YA 5IJ0A 2OBNA 3ZHQA 2CC2A 1HNZB 2I87A 1HX7A 1ORTA 1XRLA 3OH8A 3D8NA 4DWJA 1BHSA 1ZIXA 3EIWA 4CLHA 1N33B 1KL7A 1JL3A 2RC5A 3VI3B 1KRHA 4ZRMA 4JL6A 5JNVA 1W85A 5JTUA 2VR1A 3ROTA 1LNSA 3CW9A 3GIWA 5JCJD 4Q19A 3UMSA 1EE2A 1ADJA 3PSAA 3QV2A 1PX0A 3TEMA 3EPLA 4PSDA 5E6SA 3LMKA 3DDUA 1R8YA 3N8NA 4UUQA 2Q9UA 3EZ2A 3HEAA 3SHQA 2W6MA 3AJDA 3D6UA 3EGIA 1AIPA 2OLJA 4DAEA 1AU9A 2PKQO 4P53A 2BGTA 5TMEA 4MKZA 4FN4A 1GNTA 5LOVA 3AEUB 2HW8A 4EA8A 4HQKA 4FOTA 3LRXA 1J97A 3VH4A 1JR3D 4ARBA 1IZ0A 3GAFA 1T36B 3A1NA 1IZ7A 3DE4X 1NWHA 3HA3A 3U3MA 4AT1A 3OCCA 3RIMA 4Z1MA 1ODFA 2VP3A 1NOKA 4FIDA 1OPXA 2Z4SA 3V2IA 4B3JA 4BEVA 4AMGA 4OGLA 2O3TA 2AQHA 3KLPX 4GYYA 4RA9A 2PKRA 2YMMA 3UJ8A 4C0LA 5BN4A 4IPTA 8ABPA 2O6HA 4NNPA 2PANA 1NY5A 3HSSA 2C4KA 4QUBA 4AVYA 5AKJA 3ZW9A 4IGFA 2BKLA 3K9HA 4TWJA 1V5FA 2REQB 1ZG3A 4O0LA 1GCAA 2CF5A 4FE3A 5CDTA 4E2ZA 2O5CA 1XYYA 3JAKB 2ZIFA 1RBMA 2HXYA 3HR4A 4NV3A 4B3DA 1P1FA 4C07A 4YJGA 4RD3A 4F06A 2W2MA 2J5BA 1RXEA 3DCIA 3NAQA 1L1FA 1G66A 2P4HX 4I6GA 5LLSA 4AZ3A 3I1IA 4DQXA 3F7TA 2D4HA 2CNKA 3MTBA 1T4CB 2TSYB 3AY6A 5KYUA 4B8YA 2UU9B 3PXGA 4NU5A 2PXXA 5EE3A 3EK2A 4TVOA 2JH9A 3QTLA 3UK1A 2ISCA 2G83A 3S8MA 4LMBA 3GLKA 1VMEA 1RM5A 1XR3A 3HXTA 2GETA 1K3FA 4DMKA 1US8A 3AQIA 2ZIVB 3C15C 1GGNA 3T7CA 2I1VB 3A04A 1Y6QA 1Z0IA 3K9WA 3LX4A 4DZZA 4HAOA 1NQVA 1NHWA 2BJWA 4ZGWA 3O9VA 1E8NA 4H35A 3AWIA 4MVJH 4GE0A 5JWHA 3GJ8A 3EGDA 1L5NA 1Z0JA 2BONA 2CYAA 1Q2XA 4F2DA 3F49S 3KWFA 4DDHA 4EGAA 4H6XA 3FGZA 3L5KA 2A0KA 2QLLA 2Y3IA 4MVCA 3WAKA 4J0FA 2VRCD 1ORVA 2Q4EA 2YXNA 4R05A 1MZPA 3N86A 4NMWA 1FLAA 3WLIA 1DBPA 2CUNA 3MTJA 3ASVA 1QLHA 2O2SA 4OI2A 1HOTA 2G1PA 1WXWA 5CURA 3U7RA 3L8GA 3U3DA 2WM2A 4BLRA 3UJNA 4DWWA 1JEQB 4DCOA 3V8VA 2B83A 4FVTA 3VDXA 1S2MA 1KR2A 2OQIA 4AF8A 5IKPA 1YI1A 2X22A 4MDEA 3TQQA 5IYZB 1NVBA 2VF2A 1MJ5A 1YA8A 2ZG6A 5H5JA 5JNTA 3I2HA 3MCZA 4TKVB 2HJSA 1PGJA 3GJXC 4PHTA 3KQVA 4GZ5A 5AUQA 1PD1A 1IB0A 2CCKA 3TLAA 2WIGA 2GBIA 3ILXA 4LC1A 4R8MA 3TQSA 2RAFA 5J4HA 1XKQA 4IEFB 1M1YA 7MDHA 5C8YA 2Q3MA 5IDWA 1T5BA 4GKVA 2GYVA 1L4KA 3G8BA 3BL6A 1ZAKA 3DQQA 4NG5A 3JVVA 4QDUA 4UUPA 3KOYA 4Y2VA 3IAEA 3MW8A 2GRJA 5E1MA 5B3JA 2WF5A 2OV3A 1IIRA 3QJGA 3LLUA 3E9YA 1MOQA 1IBRA 4UBOA 3PDIB 1JN0A 2UVPA 2R2AA 2O52A 1K2VN 4DKXA 2BY4A 2DZDA 3DEJA 2Q8PA 3KKOA 3V4SA 5I5EA 5GADl 2ERCA 1NBAA 3KALA 4XVQA 3PRKE 2BI8A 2ODNA 3RIXA 4EYQA 3HN2A 1J7KA 1KYWA 5CCXA 1LXCA 1HKUA 1WKVA 2O3UA 3C24A 4N3BA 4DIFA 3I64A 4TQ9A 2DC1A 4Q00A 3MWYW 1GPUA 3P2MA 2SICE 1YZTA 1E6CA 1T9HA 1Z5OA 5FI0B 3S0JA 1XMJA 4PNHA 2OXIA 3WG9A 4TMYA 4DT1B 3ZQUA 4QDXA 1UPAA 1SVSA 2AFHB 3GLTA 2X9QA 4H08A 4ZANA 4CKEB 4MGHA 1JJBA 3F3MA 3U5TA 1PVVA 2AI2A 2X9VA 1ZM2A 1NRIA 4M9ZA 1DXQA 1RE0A 2V9PA 2VXBA 3EGXA 1T1EA 3HBNA 4GLFA 2QK4A 4PS0A 3HKBB 4MUKA 3SIXA 4NYJQ 1GQ2A 2AZ4A 4TL7A 3STHA 2GN4A 5F5LA 5ICCA 1C1HA 1W73A 1JHUA 1XDUA 2Q5HA 5JD3A 3R1IA 1EGMB 2HSDA 5CNJA 5J1TB 4G0XA 1JKMA 2RGEA 1GDDA 2WW8A 5H3LA 1CCWA 1B76A 1ICIA 1USUA 4FX5A 5JZVA 5L8VA 4G2TA 1FYEA 3C6KA 3TTXA 2MCFA 4U9IS 2BF7A 3OTIA 2DHCA 1KEEA 1YFJA 3ZJUA 2QT1A 1O87A 2J67A 2ZRBA 5CXSA 1IOWA 1LWNA 4A0FA 2EDAA 2CMHA 3E15A 3H04A 5FLYA 1K92A 1NJFA 5CJJA 2II6A 4QXOA 1YR7A 4WGFA 5FB3A 4L4RA 4HNQA 1ZJ4A 2F43A 2NYVA 1OREA 1R0RE 2PX5A 1ECCA 3Q7PA 3EVBA 1S8NA 2GBLA 3E2MA 4XWYA 3FZNA 4JQOA 3WMWA 2FN9A 1KVTA 3OAAD 1EP2B 4OGGA 2D2EA 3H11B 4JLVA 2K7ZA 1COWD 1M0WA 2X4GA 2E5FA 3OEYA 1Y1SA 1PKEA 1X1CA 4ZYXA 4IDBA 3CLUD 2EEZA 3MOIA 1L8OA 3JAWA 4JBIA 4DDTA 2NU6B 1W4CA 4WA8A 1WPGA 5FUYA 3DMNA 2D1YA 4OXKA 2HDWA 4ZO8A 1PWXA 3PXCX 3K6JA 3STTA 3UEOA 2DHRA 4QYWA 1LQUA 1K8YB 1WKCA 1D5WA 4O4HA 4BZWA 4D4LA 1T1JA 3NCHA 5JE8A 3TZBA 2C5SA 1LBTA 2DBVO 3QP9A 4G1MB 2DM6A 3CU5A 4I9HA 4PAGA 3Q7EA 4PIMA 3L92A 4RV4A 3WL7A 4HK4A 4B1FA 3C7KA 1DMRA 3QEMA 4MW6A 4X20A 2IPOA 1YCGA 2WVAA 4M9UA 2B1JA 4ZAYA 1ZD1A 2WJJA 4TMXA 3RHTA 2YKGA 4G56A 3IP7A 3ZJ4A 1PS8A 4BJ3A 2KYRA 1TJ5A 4P3YA 3DHNA 1VPTA 4WLVA 5JCOA 4B34A 5ITZB 2GEBA 1JIIA 5HPYB 5LR6A 4QL3A 1BYIA 4YRTA 2C7QA 1Y4AE 2XYRA 4PZYA 5LZ7A 1GR0A 2NXEA 1Q1AA 3RRBA 4A6EA 2ZUFA 1E8DA 2HX1A 4QEKA 3ADPA 1P72A 5ALGA 3TLKA 4G4SO 5JEEA 2IJGX 1SVWA 1YRLA 2ZBUA 5J59A 2VK1A 3ZCSA 5AVQA 2CLKB 2ZJBA 4UCWA 3RU9A 2IT1A 2A0FA 1OFVA 1QBKC 1TLFA 3IUMA 4TQAA 1NVAA 4Y6QA 5BV0A 1JZSA 2Q8QA 1GM5A 4MYRA 4UMVA 4A1OA 5KHAA 3U5ZB 3LHFA 3T41A 4H18A 4RSRA 5THKA 4AG6A 2PUBA 4CV1A 5JQGA 4B2PA 1Z0FA 2HADA 2ZIUB 3A6DA 4MS4B 4MWDA 1JGTA 3EPKA 4RY2A 2J08A 3L6RA 3RYIA 5THQA 1ZXLA 2D8AA 4LPSA 2AZXA 5AKHA 3T3HA 1BKSB 5LVAA 5ICEA 3QLUC 3E23A 3G2HA 4OOEA 1OJ7A 1E2DA 4PLHA 1PBNA 4BB0A 3NT5A 3P9YA 4YA6A 4BUCA 4G41A 2RE8A 4TMZA 2YWCA 5KX5B 2YIDA 3LK6A 1D9XA 1EX9A 2YFKA 4JXKA 1ONOA 2BHLA 5ICSA 4B3FX 2AQ8A 4HPXB 3OF2A 4M1OA 1ES9A 3Q3CA 2IYAA 1GXSA 4IDDA 1EVEA 4A8JB 2PAFA 2E6KA 5EJ7A 5D3QA 2JCSA 2FHSA 4OQQA 2FEPA 4GZLA 5P21A 2OHFA 2BHNA 3EVZA 2XDQA 1FP1D 1KK1A 1CWUA 3HUUA 4MIOA 1YR1A 4R1MA 2VCHA 5LNK1 1GUFA 2R6AA 1PQ4A 2WUGA 1RTKA 3GEGA 5AJHA 2CLSA 4GKJB 4A9AA 4TM8A 3LUFA 4DR1B 3NANA 1J8QA 4P92A 1YS7A 1SKUA 4HQ0A 4JB8A 3FGPA 4EG1A 3GC6A 2JVIA 3OLYA 3AM4A 2H1LA 2RKBA 3G9XA 1ZESA 3U2QA 3EZLA 4LRUA 1K3TA 4MX8A 2GZRA 2ST1A 4RIHA 4TRJA 1VPVA 4KO1S 4QGBA 3KEQA 2GPJA 4RQAA 2H1CA 4B73A 1Y6RA 1JHMA 3KQTA 4AK9A 2G72A 2QJRA 1GJRA 2BKAA 3D6JA 3C4JA 2NV0A 4RIIA 1V3QE 3GFQA 1QKJA 2NU9A 4WI1A 5TGDA 3STYA 3LBNA 4UDXX 3C5HA 1MAUA 1R50A 2I78A 3COYA 1P7YA 1QB7A 2V7BA 3GDHA 4Z3DA 2AIRA 2Q4DA 4LW8A 1T2CA 1BA3A 1DBRA 4ZZ0A 4YJFB 5BQ5A 2DULA 1OILA 1D6SA 5L3SA 1QU3A 4B17A 1SXHA 5AOVA 3TSAA 5BR8B 2YYAA 1U1IA 1ISMA 2B7LA 2MMCA 3DOHA 3BJRA 2VKQA 3G1WA 2M9MA 4MPPA 5IBRA 5JS2A 5FBKA 4V0LA 4ALNA 3MBOA 2JBAB 1U1DA 3V32A 1P1JA 3X1KA 2GEFA 5BMOA 2DH6A 1HEIA 2REOA 5ALMA 1NGSA 1QPGA 1I6MA 2FSHA 2UYOA 1NNUA 1TNDA 4A8JC 2RH5A 3DPIA 3ZCVA 1JG2A 3L0BA 2ZANA 3RROA 1FF9A 4K1XA 1PYOA 4M9SA 5A6SB 1GQRA 3QNWA 1X2BA 3SM9A 3THYB 4WXRA 4NULA 4BNYA 2XOKD 1FCJA 4IICA 4L74A 4P35A 2H65A 4HNSA 4ZVNA 2WA1A 1UQRA 3TW6A 2XRYA 4D9BA 4KZKA 4QZVA 2Q3DA 1C0LA 3E2IA 3DL0A 2A7QA 1KQOA 1F1BA 1FU7A 1NAHA 1PCXA 1Z34A 2C99A 1LNQA 3HKDA 3FYUA 3H9BA 4I1VA 4OB7A 2C4UA 1IBCA 4YFVA 4A6PA 4YAGA 3W2GA 3FZQA 2ZAIA 4MR7B 3ZIAD 2ZFUA 4R5HA 4Q7MB 1OTYA 5DBEX 4IFTA 1TUBA 4E22A 3BREA 2AFHE 2OUIA 2CVHA 2ZJZA 3G1TA 3OPMA 3QSGA 5DBIA 5DSZA 5CVVA 2JCVA 3L8FA 4P5PA 5KOHB 5F9HA 4PZCA 3DO5A 4IJKA 3PFFA 3ZHYA 3CG4A 1X13A 3O38A 3ZCUA 1O95D 4L02A 5EKDA 1Y3FE 2JD2A 4Y2GA 2C94A 4E2XA 4PYNA 4AM8A 2ZIGA 3KKPA 1BFDA 3KTDA 5BSFA 3DNPA 5B7PA 5DLEA 1NXSA 2CLOB 3O4RA 3F5FA 1ZH0A 4ROTA 5IT4A 4OHOA 4A0GA 4J2OA 1R1DA 3FJOA 4XWTA 3UFXA 1U8CB 2PUTA 4I19A 3PNBA 4TLEA 3W3AH 3EULA 4R1OA 2E48A 3KG2A 5EPUA 4POAA 4PNEA 5BVGB 3COWA 2CBXA 1NV8A 3NYIA 4EI8A 5IFKA 4UXJA 3H75A 3KJXA 3SZGA 4RF2A 4TPKA 3WK7A 3KJIA 3HFRA 2VDJA 4DV2B 3M1AA 1BXZA 1I32A 1U0LA 4G9BA 3SYKA 1JA1A 2P5UA 2OK7A 1XSEA 5AQ1A 4ND8B 1ZUNA 3OX2A 2OXEA 3H2IA 4RMGA 2GPNA 3E61A 3K15A 4URHA 4DJJA 1J56A 1ZD3A 3TTYA 3HGQA 2W4MA 5DSXA 1I5RA 2I33A 3L7BA 1ORRA 2F9FA 5KJ6A 2I76A 1X80B 1E9VA 3TLEA 1SCIA 1GGFA 3RTGA 2XWSA 4MJLA 3VTKA 3O8DA 4DY6A 2M32A 4JXJA 1ZK0A 1YZ3A 1U7DA 1AUQA 2EIHA 4PCUA 4XYBA 4B40A 4D6XA 5IKEA 1AY0A 3JQ7A 4MDYA 2YV4A 4A82A 3D6HA 1UOOA 4CHTA 2ORIA 4HMOA 3VPGA 1PGQA 4Y2XA 3AFOA 3CVWA 4TTAA 4X84A 4XD7A 1K68A 5BQOA 3D7SA 2VL7A 3OKFA 3PHGA 2HLHA 3JQEA 3L40A 4WK6A 1YR2A 3T1HB 1Z8HA 1NI5A 1CJBA 3HM2A 3VR6H 1NUPA 2P9GA 3GRCA 3V34A 1MZVA 1I7NA 4WEOA 1RRPA 2PH3A 1EFPA 3B3GA 3E8XA 4IQ8A 2IDMA 4WNIA 5IC5A 4FYVA 1OH8A 1A4RA 4CGYA 1CUJA 1YB5A 2X3YA 4MIYA 4Q7JB 3Q8LA 2WUFA 1Z47A 3AF2A 3RS0A 5AVTA 3R8FA 4WESB 1MMFB 3KYDB 3DC2A 5LYJB 1MEEA 5JCXA 3NJ8A 1DX6A 4I2VA 2WZCA 1L5WA 1NG1A 3DUWA 3RVBA 3HP1A 1MAWA 4KGXA 2APJA 3LTNC 4L2IA 4ZI5A 1BDIA 2C98A 3E48A 3I5AA 4CT4B 4ZMSA 5K0BA 2WM9B 4FFRA 5DN9A 4DUYB 2B69A 3KKKA 4DEYA 4EG4A 5FWNA 3BVPA 3DEIA 3QH4A 1IM8A 1X7YA 2F9LA 5JI3E 3H4TA 3RKSA 1W19A 1G18A 2JLZA 4B4DA 2OILA 5CDFA 2C5EA 3UAZA 5F2OA 3CR8A 2H5EA 1ZN8A 2EXXA 4RH3A 3R74A 3A4NA 1UOPA 1WWKA 1UMBB 4BFTA 3O1JC 3ONNA 1I4TD 1ICEA 1K7CA 1IN8A 3FI9A 1U8AA 3KTAB 4Y8VA 5JSQA 3BGSA 1UC5B 1W34A 1L7DA 2VRWA 3W2TA 1V7CA 3FW1A 3H6GA 3IXMA 2H06A 5EIBC 4EA9A 1GV0A 1GOTA 3N2KA 1R3UA 5DHAA 3I5UA 4D81A 3V80A 1EVJA 2TMGA 4GH5A 5JARA 2WTUA 2V3WA 4UFOA 4Z54A 1OHHA 3PE4A 4PRZA 1MA3A 1ORIA 4HJXA 4MUYA 3DBRA 1YDMA 2FSUA 3B1JA 3CZ9A 5F12A 1ETUA 2CB9A 3SK0A 4AJ4A 3ZW8A 3I3OA 4ZMBA 1BX1A 2O8DA 2PA3A 1BS9A 4KE7A 1PUXA 2AMYA 2QVBA 5CX1A 2Z6UA 4OA8A 3ZLJA 4RELA 4I2NA 2CDAA 5AVUA 3FZYA 1Y8RB 3E84A 3W7BA 3WX0A 4IVNA 3BQNB 3C48A 3SFVA 5I4IA 1PN3A 1OFTA 1W36D 5KYGA 3VDMA 3ZGZA 1XU4A 1L7MA 2CCJA 1VDMA 1VIMA 1JEAA 3NT4A 1A9SA 4BX2A 3RADC 1I2DA 2DBRA 2NQ2C 2EJWA 2RKOA 4PW0A 1QHNA 4LJ9A 4HDRA 4XUCA 1EGQA 2AJLI 3QFRA 4MZDA 3V2UA 1N5OX 1TCCA 1R37A 1XU9A 1P9OA 3M3DA 3UJHA 4A15A 2XW6A 4FBLA 2Z5FA 4MMYB 3J80A 1ECGA 4IIDA 3KVNA 1ZGZA 3K92A 5IC4A 3FH0A 3R23A 1QFMA 2IHTA 4U7GA 3WHKA 3I9KA 2GPTA 3B1YA 1HFEL 3NNDA 2JGLA 3LAWA 4MKRA 2I8AA 2G88A 4G63A 3NTQA 1ZVVA 1Z5GA 2PN1A 1WB9A 1R6UA 1XRSB 1VJ0A 1T8PA 3BGIA 1YC5A 3B6KA 5D6NA 2W70A 3DE3X 2XJ9A 4FYJA 4UQOA 2A4MA 2V7QD 3EZYA 4K2HA 1I4LD 1OV4A 2OM2A 1N7GA 1W59A 1XEXB 2V0NA 4S35A 3AVVA 3U44A 1TCAA 1REQA 2Q1XA 4DFDA 1ZQ9A 2O2JA 3E35A 3GEIA 3HWX1 1BW9B 1G0NA 4OHVA 2R1UA 1TKBA 4RXMA 3V4VB 5GONA 4BJ1A 1R0LA 3MC1A 1PR6A 3M49A 1OLOA 2LKDA 1EDZA 2YWBA 3BZUA 4IMPA 4OAOA 5D86A 3ULKA 3ZJ5A 4F4HA 2J9YB 3K8ZA 3ZLVA 4GMDA 1J2RA 4RJTA 4S2UA 4FMBB 4S1TA 3WNQA 5IVIA 5A4DA 2PFSA 2YL2A 3IEIA 5E0OA 4GRIA 1QQ5A 1TTPB 2EFEB 2ZREA 2Y77A 3CEJA 1P3JA 2REXB 3E05A 3E70C 2HB6A 3GJZA 4M9QA 4UEWA 5BN3A 1W46A 1XJQA 2HRCA 3E3OA 4EEZA 5JAUA 3M8KA 2WD9A 4QUIA 1U7ZA 1C7FA 1UBTS 3LD9A 1L7BA 1C30A 2OXTA 4DSOA 2ERYA 1NUSA 2KWIA 2RB4A 3O2SB 4BMYA 4EARA 3RSQA 1TVEA 4RK0A 1DHRA 4YUYA 1XZBA 3DZIA 3GO4A 4G9GA 4PO1A 4DVJA 1RLJA 1KI9A 2R60A 2PPVA 1V4NA 1XZMA 4MVJD 3Q6NA 2BZ1A 1PDVA 1AF7A 5DM0A 2OCDA 1P4RA 3COSA 1RQRA 4GEKA 1YL5A 4FYXA 3JU3A 4RX1A 2Q5OA 1JBEA 5H3CA 1KETA 5CCEA 3W8NA 1XZGA 1G8FA 4H0NA 3RSFA 2CL0X 4DDKA 1Y6ZA 1EWTA 1KFCB 3LLSA 4BEBA 2IS4A 3PCXA 4U4AA 1SEVA 2ZZMA 1VJ1A 2QN6A 3BXXA 3OOYA 1ECPA 1PW5A 2DVMA 1IBKB 3C8UA 1OZHA 3TD6A 2G07A 2DQYA 4HY3A 4LHSA 1XYGA 2G4LA 2OB1A 1J2YA 4IVPA 3NHYA 3QVTA 1OAAA 4D02A 2UYCA 5I01A 4MVXA 3CE6A 1N7JA 1WHSB 3P2OA 4QSHA 4BZZA 3ISTA 4EPRA 5LQAA 4G85A 3A0RB 2PUFA 3A9RA 3NHJA 2R79A 2KJQA 3VU0A 1QP7A 1HDGO 1KEPA 1MV5A 2JFGA 5HJ2A 3GMDA 1IK6A 1VMAA 2RJ3A 1X8KA 3D8SA 4Y6RA 5B4VA 4HLCA 1CDZA 4M0FA 3TLGA 4XCXA 1MO6A 2DT8A 1ULBA 1NUAA 4U2KA 3WO1A 1JDBB 1TX4B 3PDCA 2AVNA 3TKYA 4Z2AA 1FFXB 1SZJG 2JEYA 3EA0A 2FUCA 1B2LA 2R65A 1BHQ1 2FOLA 4L6AA 4N6NA 4JN6B 1NXVA 1L7QA 2JW5A 1ZKMA 1VL2A 4NBKA 4XJVA 4IINA 1D09A 4PE5B 3ENVA 4NJMA 2JS7A 4G0NA 1KK0A 1CQIB 1WQ3A 1CSEE 1GCOA 2BV3A 1V43A 3LVBA 1U8YA 3OKCA 1P0FA 1PHRA 3PX2A 1U8FO 1FJHA 4ZQCB 2IWRA 4C1BA 3L8DA 4YXFA 1O3YA 3DPUA 3OTQA 3T7JA 2MSWA 4RHFA 5FT9A 2G9NA 2ZZNA 3C3WA 3FR7A 1J2UA 3K1YA 4R8LA 2AN4A 5EWLB 1UIRA 4NYIQ 4Q37A 1Q5PA 4TVSA 5IT9A 1E6KA 2NZUG 1ZOIA 3JASA 3O92A 2G9UA 3M2PA 1P73A 4QIHA 3LWNA 1H8HA 1XRRA 1S01A 4HADA 1OXUA 5AW5A 1B0AA 4UATA 3VPSA 1N32B 1RYDA 3G0HA 3OA2A 1OJLA 1Y7TA 3BE6A 2QUZA 3G9QA 3GD5A 2PLNA 2CK3A 4AXXA 1NI4B 4FONA 5LWQA 1KMHB 1A9QA 1YULA 2FFBA 3LL4A 2AJ8A 2DTXA 1KYYA 3R5FA 4JLSA 1U0NA 3CT4A 5IVDA 3LC1O 1GTZA 1FEZA 1D1QA 1RWOA 1OYWA 1STOA 2DBQA 4AMBA 3ZBTA 1UC8A 1O54A 1RKVA 4AZVA 1JXMA 3DMYA 3Q5DA 1CY4A 3LRTA 4R71A 4OLHA 5JXWA 1BHJA 5BR4A 4WKOA 1XTIA 3NMUF 2VA9A 4EFLA 4HS4A 3G89A 2BEJA 1JDBC 2OP0A 4C9BA 3D4OA 2EKPA 1EE1A 2YWXA 3L0YA 4I1RA 3SSAA 1ZGCA 2ZB3A 3CS3A 1CUYA 4HNAA 2W2NA 3OKPA 1ADYA 3PXBA 1Z5WA 5M3BA 4AJHA 2FMXA 2H29A 2Z4TA 3FJYA 4KWIA 5TT0A 1DC7A 4EHLA 4KK4A 2CWWA 3T94A 4UQLA 1G60A 3E53A 1EGAA 1MXHA 4CLOA 3NO4A 1L5MA 3L8HA 4QUKA 1Z18A 2GGSA 3BPSA 4JVLA 4LMRA 3TDNA 1WQ1R 3TG2A 1R9NA 1MB9A 3EC2A 3JXEA 4HAUA 4FCWA 2IITA 3U9SA 3E5HA 1NULA 5HIJA 3WLJA 1E3QA 1A88A 4DSUA 3MGAA 3DVAB 2XWPA 4R4JA 3EX7C 2IIBA 5HZHA 3KT3A 3SKXA 3L7CA 4PZEA 1A9OA 1D4FA 1U2DA 3RIEA 3WHIA 3ST7A 3A06A 4D8YA 4L5JA 2PEYA 1Q44A 5EY5B 4WAUA 3T4PA 2V6IA 3TW0A 3ZZ0A 3ZH2A 2O9JA 3AUXA 1P8JA 4EL0A 2OO3A 2W6ID 3OLWA 3T0FA 1VCHA 2O2DA 3DTVA 1VHJA 1QGUA 3Q7RA 1Z35A 1ZC4A 3LLVA 2WNHA 1Y8QA 1P5HA 4HYEA 1K6XA 3QY0A 1P5ZB 2PZLA 4YJ2B 3HJBA 4ZO6A 5I8ZA 5BORA 5D1NA 4U2GA 2JIZA 2ATIA 3WMGA 2QR3A 4KLZA 2A8YA 3BTVA 3GFOA 3DKPA 5CLQA 2PBLA 1N2CB 3EGOA 1O03A 2XUOA 2O8EA 4F2WA 4N47A 1D5CA 3GBSA 4GPAA 1TIPA 2EERA 2WWIA 3WTCA 3VJLA 2IDKA 5GGYA 1YHNA 1YQWA 2FSVC 1TCVA 4HYYA 4OB8A 3C3XA 5AOCA 5C35A 1RWBA 2BEVA 4X7RA 3K8YA 2PL1A 5A9SB 2WJVA 1I0ZA 1R6AA 2PSJA 4OAQA 2NZWA 5HZMA 2XUHA 7AT1A 2B3TA 2G9VA 1RRGA 2JLSA 2IYNA 4KQKA 4RVDA 3I62A 5K03A 1I7QB 1NI3A 4DZRA 1QRUA 3PPWA 4OLAA 4HNHA 1ONNA 5ALZA 1QU2A 3A3PA 1L1QA 1QGDA 1F0KA 5LP6F 1W5EA 1E1DA 2I4OA 3BRWD 4EYOA 5KSWB 1J0AA 4NOKA 4DR3B 2AR0A 1JDSA 3DPSA 3PFIA 3RVKA 3E3MA 2P40A 2EKBA 4KAAA 4L4UA 3TYXA 3UYKA 5JS6A 3W9SA 4JL5A 1WMFA 4UTZA 4QTYA 5EMHA 2UV8A 3O1IC 5ADVA 4K3VA 2FWBA 3C3MA 1FIUA 2M1ZA 2IUFA 1I6LA 2JBHA 3MLAA 5D84A 1TF5A 2Z1NA 5FLEX 1T8YA 3RTCA 3FBWA 4HDMA 2O14A 4LZZA 4YECA 4EJFA 4BB5A 4CNQA 3E18A 3KZXA 1P6UA 1MAHA 1M2VB 2DFTA 2R8BA 4LJ4A 5ESDA 3ZVNA 2EP7A 1XVVA 2Y66A 4AIIA 4EF6A 1FDWA 1KO1A 4P54A 3QU7A 3PD1A 2VLBA 2WKWA 1CT9A 2JGKA 4QE3A 4EJ6A 4LQ4A 5B4UA 1GUZA 2BMDA 3CTPA 3GLHA 1DBQA 4FS8A 3HU3A 2P90A 2PYIA 4WLEA 4V2IA 3T5DA 3IMEA 5CCDA 4E5NA 2HT6A 2TYSB 3LPLA 4Z7OB 2XE8A 1J23A 3LUJA 3DE5X 4GZ6A 2CUZA 3NBMA 4WY8A 1AS2A 4CKWB 3IBSA 4ZI7B 5JZSA 1E3MA 4JBGA 2GZAA 4BO1A 2JLAA 4NE9A 1V7QA 4NXMB 1KNQA 2YZNA 1LBQA 2LGJA 2OFXA 1QQ6A 3BIXA 4JT9A 1CP2A 5AKGA 3PWKA 3RTBA 5CA0B 1VBNA 4G24A 3WYDA 3V4RA 3SBXA 3DVSX 2YWDA 3BAZA 4HN9A 1NQUA 3VOAA 5FBWB 5BSVA 4TN1A 5J2TF 2K4MA 2MSEB 2PRKA 5JSFA 1B1CA 4QO8A 4I1PA 1CRWG 1OXTA 1CUHA 2CF6A 3WI7A 2QQFA 4G5QA 2W4IA 1ISIA 3CB4A 5LA6B 2X41A 1QG6A 1XCPA 4DV1B 3Q6MA 3SU8A 3TS1A 6ADHA 5DWQA 2OKGA 4CIDA 4GI3A 1LK5A 1U5CA 2C61A 3JWHA 5A3VA 4DA9A 3IR6A 1HR0B 2PQMA 5C31A 3VNRA 2PWBA 3TLBA 3UMJA 4H60A 2JKVA 4OFWA 4V1CI 2GZHA 1GTMA 3VGJA 2GNAA 4W4TA 3ZQKA 2Y1CA 3NRBA 3VR5A 5IAAA 1M6NA 3WGGA 4REQB 3PWTA 3B9PA 1TF7A 1E1RD 1ONSA 4H7HA 4I3GA 1N0IA 2VHVA 1V6CA 3OLXA 1XJ5A 2P6NA 3WTBA 1Z5PA 4OLBA 2BMEA 2QGFA 4AN1A 2DPLA 4Z5XA 2HKIA 2QPTA 1ZISA 4CEIB 2JFZA 3WS7A 3HFSA 1QJCA 5LOVF 5EJEA 2IEAA 1GGJA 1GEGA 3WGJA 4GL4A 1AZLA 2J9ZB 2VJPA 3IKMB 3QI7A 4JAVC 5MN4A 3MRXA 3UOGA 5IEBA 2BZSA 2IYYA 5LC1A 2P68A 2XCUA 3UGTA 4MVJM 1QOPB 2DR0A 1TM4E 4UVGA 4IHQA 1Q12A 2EARA 1JU4A 5CLGA 5H80A 3THOA 1DEXA 3KSDO 3LUKA 1K5PA 2QZJA 2IZ7A 2VPYA 2ZSUA 5ILOA 2GSDA 2EFYA 5COBA 4LSZA 2AI3A 3SR3A 3YASA 4Z86A 1FSFA 3DMTC 4F9EA 1TD9A 2FMHA 3RPEA 2HN9A 2V96A 1ISJA 2XQVA 3TTUA 4C3VA 2I6UA 1M6WA 1Q91A 2R751 3BH0A 2XIJA 3HY4A 4YBZA 4ZZIA 1CIJA 3TGPA 2IZZA 2UAGA 2IU4A 5CT5A 1N5DA 3DGEC 5GWXA 2C88A 2J33A 3LM8A 3CLTD 5BMVF 2ID4A 4BNNA 1YGPA 4C03A 2HWUA 4OLFA 5DMXA 3DMFA 1S96A 1Z0AA 3U56A 4NZYA 1QWOA 3ZVMA 1NW3A 2AOTA 2VAPA 1PO7A 3PVZA 2G7MC 5DDIP 3D6AA 1LX7A 5T6MA 1YJAA 2GARA 1PWHA 3IA7A 4JQZA 3HGMA 4INPA 4RANA 1DE0A 3SHVA 5I45A 1NP6A 3I83A 8MHTA 1AQ6A 1UL1X 2B1GA 1NXQA 2AMFA 1A9ZA 5D3MB 1YDEA 1K08A 3FROA 1U3DA 3K6KA 2J6BA 2O0MA 3DNMA 5B58C 2X3UA 4ZRDA 2ONYA 4G1FA 1MIOB 4X44A 2DX7A 3SBOA 4PV7A 4EKGA 2LDXA 3W3AD 3MCAA 2P9FA 3D6NB 1OKKD 1J0XO 2HK6A 2ZAGA 4JELA 1V25A 2YWFA 4KGZA 1YK1A 4A2CA 4A8PA 3H2YA 1WTAA 1UBEA 2W48A 4P7GA 4OOFA 4RSHA 1OUMA 1QTNA 4YRFA 3H9EO 3OP1A 2OV2A 3O4VA 5EMLA 2JF0A 3ZI4A 3FMOB 1JWAB 4HN2A 2AB0A 3T99A 5ALHA 4J1NA 2OCGA 4PPFA 5AT1A 1BKDR 3QE4A 1WVIA 2CL7X 2GNOA 3RUFA 4RTKA 3ENWA 1EUQA 1JDZA 1CUAA 3N07A 1T4CA 5I7EA 3Q2OA 2YVUA 4LOHA 4ZVLA 2DETA 4C01A 2JJ1A 2VT7A 5AOAA 3OPQA 1P17A 5FOSA 1ZCFA 3DUFB 4A6DA 1TDJA 4WBNA 2NZJA 1PR4A 3MT7A 1A71A 2IYLD 1TA9A 4MRSA 4S24A 4DKJA 2X42A 2EJTA 2YWHA 3WKDA 5C1BA 1P0MA 3G2IA 4XUGB 3M4ZA 1XZNA 3PGMA 4YRJA 1E3EA 4LG1A 1FUYB 2C77A 1GTSA 1IH8A 2QYTA 2LBPA 3AEQB 5DN6A 1NMXA 4LXUA 2GI4A 4KITB 4JD5A 2COKA 4R2MA 4RM3A 4RYDA 1R6BX 1N57A 4HH4A 1XYVA 3M34A 2VBIA 4QT0A 2BH2A 421PA 4RADA 1C0IA 1KS9A 1AUPA 1N2CE 3A14A 1DKOA 4OSPA 3DOJA 1C4KA 1NV9A 3MIIA 3UMFA 3VR6D 3ZK8A 2EZ9A 4LKRA 1DAKA 5A0VA 3D1JA 3EFHA 1JEQA 5BYAA 2MDTA 2I2XB 3B5JA 1OB2A 3PLNA 1RBZA 1U1FA 1J49A 2C5BA 2QYSA 3H6KA 1XDWA 2GBPA 2Y68A 3L93A 4LTNA 1ELOA 3EUAA 4IJQA 3VPDA 4B7UA 2FQQA 2VHUA 4TKVA 2IQIA 3BMQB 5B1HA 1U7XA 5A1TA 1ODIA 1XF9A 3BMOB 2YUTA 1RABA 1YH3A 2I66A 3BWBA 3ES9A 3EY9A 2HEIA 4Y6PA 2COUA 1U6IA 4HDOB 1R6DA 3RT1A