4QGGA

Tmk in complex with compound 46, 2-(3-chlorophenoxy)-3-fluoro-4-{(1r)-3-methyl-1-[(3s)-3-(5-methyl-2,4-dioxo-3,4-dihydropyrimidin-1(2h)-yl)piperidin-1-yl]butyl}benzoic acid
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
204
structure length
193
Chain Sequence
SAFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEIRKIVLEGNDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERDQEDLKFHEKVIEGYQEIIHNESQRFKSVNADQPLENVVEDTYQTIIKYLEKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate kinase
publication title Antibacterial inhibitors of gram-positive thymidylate kinase: structure-activity relationships and chiral preference of a new hydrophobic binding region.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Transferase/transferase inhibitor
total genus 81
structure length 193
sequence length 204
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2014-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4qggA00
1GL7A 4DHEA 1EFRD 4EIWA 4KVGA 5CLLA 2XGJA 4RZ3A 2GTPA 3FPAA 4Z1MD 1DAHA 4Z51A 5CB8A 2OBLA 1G5RA 2O0HA 3JZMA 4DCVA 3ZVNA 4LCBA 4C3ZA 2Q3HA 2A5JA 1J8YF 2A30A 2ZE8A 1BS1A 3P20A 1KKLA 3BS4A 4IDHA 1XEWX 2ZE6A 1ESMA 2C9OA 3THYB 4FMDB 2NO9A 1XJCA 1CJTC 1E2QA 3T15A 3EIQA 4P4SB 1JECA 4JLPA 2WWGA 5CYOA 4HAVA 4AY2A 1KDPA 1YZGA 4WZBE 4KBGA 5JRJA 3L8ZA 4GPTA 4M1YA 4NP6A 1Z6TA 1XU4A 3CH4B 1AJEA 4WOPA 2IEYA 1TX4B 2GESA 3KKMA 2E87A 3SI7A 2XNSA 3SS8A 4IOJA 3K8YA 1PZNA 4A1FA 4B47A 5EZ6B 4HDOB 4IVPA 4EJSB 4A9AA 1HEIA 4I4LA 5JWHA 1XMIA 1G18A 1I4LD 1DADA 2NGRA 1ZJ6A 3DKVA 4FI3C 2C95A 1R4AA 3Q72A 1G291 4M1OA 3W6PA 3W34A 2O8CB 3RHFA 4C4PA 1NY6A 1D9ZA 3IO5A 3EPKA 4ASUA 3NKVA 2QAGA 5CDFA 4LYHA 4US1R 4XH9B 4I99A 3GD7A 2WWFA 3GLFB 3AVUA 4WXRA 5HKKA 2C8VA 3GJ5A 3T5DA 3ZVMA 1F2TA 2D7DA 5CIQA 1WB9A 2KE5A 3QF4B 4DSNA 4F93B 1GAJA 1L2TA 2QSYA 3PUVA 2ZRPA 4CEHB 4AKHA 3ZS8A 1P72A 1MO4A 2R6CA 3QG1A 3QVVA 5FTJA 2IYLD 3RDPA 2PL3A 3GLHE 1KO4A 3BFVA 1N5LA 2Q9AA 1DPFA 4OI0A 3A4NA 4AYWA 5C4MA 3DL0A 1R7RA 3L0SA 3RS0A 1GITA 3X1WA 4LHVA 4GBMA 4W5JA 1PLLA 2HYDA 1A82A 1E2DA 1N25A 2ORVA 4K46A 3FWYA 4X8HA 1ZD8A 3KUDA 3QSYA 3QG5A 4LJ4A 1KAOA 2WJJA 3A1SA 3GPLA 2CBZA 2JIZD 1Z6AA 2GF9A 5BYKA 1IN5A 1TEXA 1WE2A 3P32A 2ZR9A 3TR0A 2WWXA 1E2GA 1JR3D 1Z22A 1MV5A 4JT4A 4WVFA 2GZDA 2WWWA 3PIRA 3TJZA 4PSVA 1T8UA 5AR1A 3VR4A 1JJ7A 2FU5C 1GP2A 2X8AA 1QHSA 2YOHA 2P0EA 3GQBA 4TMXA 2J0UB 4DCNA 2QY9A 2ZJ8A 5LPNA 4DT1A 1TF5A 1G5PA 4MKGA 3QPWA 2GAOA 5GJCA 4BRUA 4ARZA 1HQYE 1OSNA 3ND8A 3KB1A 3EWAA 2ZRDA 4FXPA 5HE9A 1ZUNB 1HUQA 2Q6TA 2UZIR 4OJKA 5LD2B 1G6OA 4KFSA 4PXAA 2FSHA 4QG7A 3DHWC 3TSWA 3KUCA 4IVQA 4WXPA 3R9WA 3ZVRA 3T35A 4AKIA 3MRSA 2FE4A 4MRNA 1RYFA 2O0KA 3CZPA 2PEZA 3AKDA 3BE4A 1E2PA 3KJIA 1OYWA 2E1RA 2KI5A 4TMVA 3SQXA 3WY9A 3TH5A 4EJSC 4C0LA 1KK0A 4LC0A 1Z0FA 4NDZA 2CHGA 3AV0B 3UWKA 2ERXA 2C03A 2W6ID 3JZAA 4M9XA 2RGCA 2J0VA 4BECA 3QIAA 2CL6X 2YNMA 3CR8A 3SJCA 1RZ3A 2KB0A 3H0KA 4FINA 1UBGA 4Z1MA 4O0MA 821PA 1DG1G 4DCUA 2PLRA 4ZDJA 4A15A 1K5GA 1U2RA 1IY0A 5EE3A 1GOTA 2C96A 4BFUA 1S4QA 2VP5A 4P31A 2ANBA 2C99A 3EWSA 4GOXA 2D4HA 3ZH9B 4B33A 2ZI3A 2FPLA 3TUIC 5A0FA 2ZREA 4BLPA 2Q21A 1JQLB 3UXMA 2OFXA 3CPJB 4TN1A 1SHZA 5SZJA 4Q4HA 1C4OA 3ADKA 4Q66C 2ZRLA 1O3YA 2XJ4A 5EXTA 2AD1A 5DHAA 1BIFA 4WZAE 5DYIA 1ANKA 2O8BA 4LPSA 4FD2A 4JJZA 1MABA 3R7WB 4AWXA 1F3OA 4II7A 3FHCB 1HE1C 1WF3A 2CE2X 1HYQA 4NH0A 3GLIB 2HT1A 1EWRA 4JLJA 2J9RA 1A7JA 3K1JA 4YDSA 3TLXA 3ICEA 4G5SA 3AUYA 2G88A 2ZJ5A 5KHOC 2O8FA 1JAIA 2F1RA 1GRQA 3DKPA 4KV9A 3I8XA 1K8RA 1GNPA 4URUR 1CR4A 2ZRAA 3WHLA 1BYIA 4QOSA 5JMTA 1G41A 3NTUA 5HPYB 5C46F 4NL4H 1TAGA 2R6AA 3NC1C 1TQDA 5CDFE 4NU0A 3BB1A 5H1YA 2WAXA 3ZGXA 1Z63A 1W49A 1N5JA 1XDBA 3IILA 4LC1A 4GT1A 2W2XA 3HU2A 5FI1B 1ZNXA 1UKYA 2QE7D 3LRPA 4PAOA 4YQFA 4TYQA 3CW2A 2X2EA 3RNLA 4AI6A 1T3LA 1P6XA 121PA 4QBHA 5JEEA 1KI3A 2IS6A 2CDNA 2GDJA 4R2HA 1NNEA 1G8PA 4P3YA 1NP6A 3AVWA 2F43A 2GXAA 1KY3A 4LYFA 5LD2C 4DWJA 1IXRC 4PPGA 5AUQA 1KSJA 2ODBA 721PA 2VA8A 4FN5A 4XOIA 5FBQB 2A78A 3T61A 3U3MA 1SVKA 3HR7A 3ICQB 1Z6GA 2B92A 1NMYA 3QKUA 2OO7A 2QGZA 2C5LA 4UXHA 2ZE5A 3MLEA 4FWIB 3HWSA 1AIPA 1XB2A 4HAUA 5KSPA 2WMNB 2A7QA 3EZ7A 4XVQA 1XMVA 2JIZA 5DIFA 4EAQA 3I3SR 2ZUDA 2DWOA 4LY6A 3LVRE 3UK6A 1JR3A 3MG9A 1VYTA 4KSBA 1N6NA 2JJ2D 2QP3A 1Q22A 3CX8A 1I4DD 1E9BA 2AD5A 1YZKA 5KDOA 1E99A 1GG2A 4OYHA 1VCOA 1QHNA 2P65A 1R2QA 2BJWA 1E9AA 3B13B 2OXRA 2ZPTX 1F48A 4UXIA 1A5TA 1G6HA 1IN8A 4DLTA 3CIOA 1P5ZB 1II8A 1MO3A 4MUAA 3FB4A 3QXXA 3NHBA 3VKWA 4TYPA 3WMEA 5KYKA 4HB0A 2F1IA 2V1UA 2D7CA 1SVMA 3HPRA 2YOGA 1CJKC 4LBWA 5JHHB 1H8ED 2YC2C 3AM1A 3RWMB 2QPTA 2BEJA 2BMEA 4TTRA 4HUQB 4E03A 1CRPA 4M1SA 2VQSA 3FVQA 4PO9A 4Q48A 1GKUB 4LSGA 2JLSA 3NEYA 3VX3A 3I1FA 1KDOA 3ZJYA 3K70D 5JEDA 4BZXA 2FV8A 3WYFA 4JKYA 1Z29A 1UJ2A 1N6HA 1W4CA 4A6XA 4GMXA 2J0SA 3KXLA 4DCSA 2ZAMA 4G5OA 5TVKA 5K8IA 1J99A 1E9RA 1V5WA 4V0KA 1TNDA 4U00A 4M8NE 5FFMA 1CR1A 1Z3IX 5BN4A 3AF3A 5JFGA 1U8YA 5F9HA 4Q9KA 1OXSC 1U0HC 3CX6A 3H1TA 4CW7A 3JVVA 5JCZA 4CEIB 3L8YA 1W36B 3CRVA 1W4AA 4V0MA 2YINC 3IPXA 2ZYWX 3A8TA 1EX6A 2IYTA 2QMEA 5UKDA 2C78A 1WDTA 3AKCA 2C9YA 3LWNA 1KMQA 1EXMA 1OH8A 4IDOA 2L0XA 3LLUA 1G7TA 1NN3A 3VHLB 1P2VA 3SC3A 2V6JA 1XP8A 1EFHA 4QNMA 1SVLA 4HATA 1NSFA 4C2TA 2OBNA 1IOZA 2XXAB 2G0TA 2P2LA 1FUUA 1U90A 4G5RA 4GOKA 3SQWA 3KL4A 1FX0B 1Q1QA 3Q8XB 1XXHA 2W58A 1ZNWA 3UMFA 1W0KA 5K8UA 1G3IA 3A1TA 4DDUA 1YQTA 4PC2A 1KK1A 3HU1A 1NN1A 3K0CC 4DUGD 5B30A 3AVTA 1MOZA 5EP2A 4X8OA 4UNRA 2P5SA 3WP0A 2Q3MA 3PEWA 4JIMA 1Z0JA 3BAFA 2CCGA 1J8MF 3OHMA 2WOOA 1G8GA 3BBPA 4JL6A 4HB4A 4V03A 3SDZA 4RZUA 2WJIA 3LBHA 4PZZA 3B1VA 2H16A 3CPEA 5HZHA 1E9EA 2BMDA 2F9MA 3I62A 5L3SA 3DM9B 1I4TD 2R2AA 2CVHA 1KI2A 1P4SA 4C0KA 4B34A 1DEKA 3GEHA 3MSXA 3ADDA 2QPOA 2D74A 3IKJA 3UIEA 3FMFA 1IXZA 2JDID 2KJQA 2W83A 3F5FA 1Z2CA 5AUNB 5CK4A 4TLAA 2OESA 4DLXA 4TTQA 1MO5A 2XEXA 3FE2A 3Q5EA 2XZLA 5KTYA 1LY1A 2FA9A 3ONWA 4P32A 2JJ2A 4ZKDA 1EWQA 2IUSA 1JR3E 1RRCA 2O8DB 2IXEA 4KYIB 4QBFA 2PZFA 2BJVA 1DELA 2WZQA 2OCBA 3THYA 4S2EA 2Q0HA 4A2WA 4CF7A 4LJ9A 1TUIA 2HXYA 4IW3B 2VHJA 4B3XA 4P4SA 4BLOA 2J87A 3FFBA 2WJVA 1TADA 3ECCA 1QHXA 2ODEA 2G1KA 2R6GA 3A1WA 4CEJB 3GJ8A 3CBQA 4I81A 1GRRA 4HLUC 3RABA 4TMKA 1DAKA 2VSXA 1T8TA 1OIXA 2OLJA 4I1UA 4MH0R 1W36C 1G4UR 5EE0A 1GSIA 3N70A 2ERYA 2OCAA 3V9PA 2D2EA 4JVMA 1QVRA 2BBSA 3UMRA 4EJSA 2DFTA 2J45A 3GEEA 1XRJA 3AF4A 3WRXC 2X19A 2BM1A 1IBRA 5J4LA 2ZJZA 2JLXA 1U8AA 4QC2A 4TYNA 3GLGB 2IYQA 3H4MA 2O8CA 3IDQA 2HJGA 1Z47A 1G5TA 1R0YA 2BBWA 2XSZD 2YWFA 4IOLA 4LHXA 2BMFA 4Q4AB 3TK1A 3W8RA 3HYTA 1TF7A 2MMGA 3IBYA 2ZSDA 2H7VA 3A1VA 3E1SA 3V00A 1NG1A 4CVNA 3KQKA 2ZETA 3GLFA 5FI0B 4GZLA 3ZYCA 1JALA 1WP9A 2ZXUA 3U7FB 3GFTA 2ZU0C 1ZUHA 1X8JA 1YR6A 2EWWA 3QF4A 2GZHA 3BD9A 1A1VA 4X8LA 4IOMA 4CEHA 1Z83A 3HU3A 1AGRA 3A37A 4OHWA 2PBRA 1R8QA 1ZP6A 2RGBA 4Q7LA 5JRZA 3FYHA 1N6OA 3TUJC 5TXGA 1OXXK 2P6RA 4PTLA 2HYIC 3DPUA 1AZSC 4OKSA 3J81k 3QBVA 5DE3A 1P75A 1NJGA 4V0ME 1W46A 1E6CA 5K8TA 3LQRA 1QF9A 1UFQA 4OHZA 3V4FA 2NMVA 2WSSA 1QVAA 1E2LA 4CYMA 2XZOA 3QBTA 3N5CA 2JGNA 4E22A 1YVDA 3P26A 4MITA 2C9CA 1NLZA 3LVQE 2R6DA 2P67A 4PAQA 4B3BA 5KNBA 3VMFA 5FPTA 3PEUA 5IHPA 3CRQA 1E1RA 1DAIA 2DYKA 1YZNA 4PSKA 3RRNA 2ATVA 3KKQA 2ZI9A 2BKUA 4EPTA 4PAMA 3TW8B 2GAAA 4GFDA 2FOLA 2ZI6A 3QPUA 2RH5A 1OLOA 4R7ZA 3TE6A 4Q47A 1XXHE 2FFQA 3PJRA 2IYUA 2J0UA 2QROA 3HJNA 3O8RA 4DUGA 5IT5A 3QVUA 3GJ0A 5IF9A 4HDQB 4V02A 1QHIA 4QGHA 2IC5A 5DNYB 3DZDA 3UG7A 1DBSA 4RSGA 1ZVQA 4YLGA 1JEDA 2J1LA 1PVOA 3G5UA 3L0OA 4GDFA 1FNNA 5E4FA 4E07A 5E7MA 5C18A 3EA5A 3X1XA 1BKDR 4YC7A 3IPYA 1W2HA 5IK2A 1G17A 3ASZA 3B82A 5DO9A 1KAGA 3HDTA 3VQTA 4DLSA 4BFYA 1XMJA 4PHTA 3ADCA 1IXSB 4RKEA 1SKYB 4TT3A 4L16A 3MAAC 1QZXA 4HAXA 5FL3A 3AF1A 1NSTA 1ODFA 1W5TA 1SHKA 1DTSA 5JJKA 3QEOA 3OAAD 3NBXX 5JI3E 4N3NA 3DO6A 3OEHA 2XTMA 3IO3A 1AK2A 1Q1BA 2VTKA 2N1BA 2GWHA 2X77A 3AP2A 2PH1A 3E2IA 2ONJA 4Q03A 1OB2A 2ZANA 4WA7A 1KKMA 1KY2A 1YZLA 4PO8A 1R5NA 2V4ZA 3OZXA 2OZEA 2PX0A 3V4RA 5GJVC 1K6MA 4K81B 3VR2A 3IEVA 1RKBA 1AM4D 4DIDA 3AF2A 3R7WA 3BH6A 3U44B 4DVGA 1Q1EA 2RMKA 3DMNA 3GLIA 2B8WA 4MDFA 4C0HA 3A6PC 3OFND 1TEVA 2ZRMA 3FMOB 5FPHA 3MCAA 4M9ZA 4BLTA 4LHZA 3WHKA 1G3UA 2WKPA 3ZD7A 1S9DA 1NN5A 2CLSA 2QMHA 5AUOB 1GUAA 2HUPA 2WIBA 3W90A 2BMJA 2BC9A 3G82C 1PUIA 4Y0AA 3CZQA 5FL7A 5FOVA 1OV4A 3W3ZB 1M7HA 5J4VA 5FTLA 4AC9A 2J0QA 2QP4A 2VEDA 1N0UA 5FOWA 3RRMA 2EQBA 4FW9A 3AVOA 4JLNA 4NBSA 3L2OB 2C77A 4LDJA 4NCKA 1WMSA 4BFVA 3REFA 4NCNA 2I4IA 4OBEA 1U9IC 3UWOA 1FTNA 4V0NA 4JL5A 4EPXA 1PLKA 3IIKA 4LJ5A 1ZU5A 1J2JA 2WMOB 2WWHA 2ZE7A 1E9FA 2ZYUX 4HSEA 3LV8A 3SBEA 2VP0A 4GSYA 5J40A 2IHBA 5LDDC 3VKGA 2KBEA 5AJVB 1FPMA 4Y0VA 2JA1A 4JZKA 2ZJAA 3MJRA 5LB2A 1ZD9A 4JSYA 1W5SA 2WOJA 5CK5A 3W3AA 3R8FA 1FOEB 4MGZR 3EW9A 1D5CA 4LYAA 3B8HA 2HXSA 2YZ2A 1M6NA 3LAWA 1P9NA 3CF0A 3IIJA 1CR2A 4UNQA 4DXAA 3LY5A 4LV8B 221PA 3TBKA 1VG1A 5KSZA 4MRVA 1II0A 3KKNA 2LKDA 2BEKA 1U8ZA 4V0OA 1WXQA 5KPJA 2OFWA 5ELXA 3LLMA 2ZJOA 2LWIA 4C7OB 1QHHB 3SYKA 4BFSA 2FFBA 2ZR0A 4PC3A 3UANA 3K0CA 5FPYA 4IDPA 1E96A 2A9KA 3BB3A 4IXMA 3H84A 1FW6A 2YVUA 1LFDB 1A2BA 1T9HA 3GFPA 4URXR 1IJEA 4US2R 3C41J 2JLYA 2HF9A 3I5XA 1FMJA 1X6VA 4JJKA 2ZITA 3K9NA 4KVAA 2IS2A 4BQSA 3EAQA 5DYGA 5GJWC 3DM5A 3QKTA 3CRW1 1D2NA 1P9WA 3BOSA 4Q1BA 1VIYA 2VIIA 2YOFA 2RHDA 2A2ZA 3QKSB 1AS0A 4WAUA 2DR3A 2EFEB 4QHYA 1KDTA 4HUQA 4C0BA 1SGWA 4HLDA 3E5HA 3ZQJA 1P73A 3B1ZA 3KXIA 4C0QC 1E9CA 4OQLA 3TKLA 1ELOA 4DBLC 1DO0A 2CJWB 3B5JA 3LQQA 1IM2A 3OAAA 2IW3A 4OHVA 1G1MA 1S3GA 4OI1A 2AFIE 1E9SA 4IFBA 4KAXA 2HDNB 2QP9X 2XOKA 3GJXC 2QM7A 1VHTA 5BWMA 1YR7A 3VR1A 3CX7A 4MYUA 1FL9A 3TNFA 2D3WA 1KTVA 3VNUA 4HLUA 2R65A 2Z6VA 4KYUA 1ZYUA 4CEIA 2IF0A 2FGJA 1CJVC 3TRFA 3W5IA 5C2JB 4ERNA 3NDBB 5DHFA 3U4QB 1PV4A 1WRBA 4LZZA 4QXAA 1R10A 4PHFA 2RGNC 5JJIA 4DLYA 5SZKB 1GKYA 5GVRA 2O52A 3OFNA 4QGFA 2OM2A 1CULC 3EC2A 1EESA 2C2HA 2JLWA 4W7SA 3A1UA 1XPRA 2DY1A 3ZDQA 1H65A 3PUWA 2EFDB 3VKHA 2OSBA 2XXAA 2ZJYA 1XCGB 1GNRA 1AN0A 1EGAA 2NO6A 4UNNA 1UBCA 2FNAA 2REOA 1FX0A 1US8B 3BERA 1GWNA 1CJMA 4QRHA 3LX8A 4Q00A 5G3ZA 2QU8A 5EP1A 2PEYA 2ZRKA 3KKOA 4TLBA 1BMFD 1Z07A 4TSFA 4MKIA 1NN0A 3RVBA 2OT3B 5E7JA 4W5WA 2ZR7A 3DZ8A 3ZD6A 3CF6R 3D7MA 4QNRA 2OV2A 1NJFA 2V8OA 1EK0A 2J7KA 1XX6A 2QRZA 4Q9JA 2N46A 2ZSEA 4WIAA 1VPLA 5CLQA 4CT5A 5ANRB 4Q01A 1L4YA 1ZCBA 4XSGA 1S96A 3BB4A 2ECKA 3GEIA 2AN9A 4NKRA 4OQNA 3U3RA 4DIEA 3AKYA 2ZRHA 4HZUB 5FPKA 2AX4A 3MGCA 4UNPA 2GJ9A 1NF3A 3TSZA 5GJBA 5F2EA 2AKAB 4UJ5A 3KKPA 1N6KA 1GIAA 2ATXA 1LW7A 4BZQA 2REXB 3CLVA 1XCPA 2OHFA 4OQXA 1A4RA 4QL3A 4XTCS 4F38A 1AGPA 4PPQA 5KPDA 4FCTA 3TIFA 1LB1B 4C0SA 5CIWA 4B73A 2O8EB 1CS4C 4O25A 3NWJA 4JS0A 1OKKA 2QT1A 3ZZTA 3EPHA 2FFAA 3AQ4A 3EXAA 4HLQB 4C30A 8OHMA 4D0NA 4OHXA 2O8DA 4DB2A 3C8UA 1S8FA 3GJ4A 1XF9A 2ZI7A 4A8JB 3TW4A 4US0R 2ORWA 2RGEA 2B7CA 4LX0A 3VR3A 2ZUBA 1JXOA 3WNCA 1KOFA 2JAQA 3PENA 3I8SA 2RAPA 1NI3A 4D2IA 1TPZA 2FPMA 4YXWD 2I1QA 2V54A 4ZDWA 2NZ8A 4RD3A 3RS3A 1VIAA 2A5FA 1W0KD 4CEJA 5KSYA 2NG1A 2GJAA 3H86A 1JBKA 2ZS8A 1IY2A 1CKEA 1KI8A 1Z0DA 1HQCA 1GDDA 5L3VA 2GRJA 2YYZA 4BEJA 2RGXA 1JXMA 4D26A 1W47A 1ZD1A 1KO1A 4NYJR 1IN6A 4HB2A 5CM9C 2RGAA 1HT2E 2FEOA 1GTVA 3GLGA 1OHHA 3VX4A 2WJYA 2QL6A 4NHOA 5B58C 4Q4AA 1E0JA 2GVDC 2QPAA 3LW8A 2ZSAA 2NPIA 4D81A 4NYIR 2VRWA 1X8KA 3B85A 1HV8A 2FN4A 1XEXB 1P7CA 3PUXA 2H18A 2NPFA 4ZPXA 5F9FA 1NRJB 3I72A 3SEAA 1II9A 3FKSA 2XJ9A 2Z4RA 2JCSA 2EWVA 2QN6A 2UVQA 2QORA 4TWZA 4BLSA 4BEBA 2QTHA 2YHSA 2ZI4A 1HT1E 4IEIA 3QE0A 4Q9HA 3UPUA 1IN4A 2PMKA 2QGNA 1OT3A 3WYGA 5JWOA 3AB3A 3KDSE 3D6TB 4HUTA 1E1QA 4YDHB 1R5BA 2CK3D 4BUJA 1CIPA 5JJLA 5EXSA 1ZMXA 4WW0A 1U0LA 5CJ2A 4BFTA 3AUXA 3IUYA 4E5UA 3VTKA 5TARA 3B1YA 1DG3A 1ZRHA 4B2PA 5K8LA 1ZM4A 1VECA 2DB3A 3LBIA 1S9HA 4OK6A 1XTJA 1G64A 3FOZA 4DC9A 2AK3A 4M2LA 3EASA 5DGXA 4ZV4A 2BIFA 3U6KA 3K0AB 4ZIRB 2V1XA 2FMXA 4BLQA 4Q9IA 2Z4SA 2CL0X 4AD8A 4EPRA 2CVFA 1U9IA 5JSZB 4NCJA 3KB2A 1TL7C 1BMFA 1Q57A 3O47A 4G5GA 4D0LB 4POAA 2V6IA 2CEAA 4Q9LA 2PZGA 4XIGS 1W4RA 4A8JC 2BBTA 5BN5A 3U2QA 2G83A 2QI9C 3OIYA 1ZINA 2CLCX 4MGYR 4OL0A 2E9SA 3T06B 4EPYA 1G7SA 3REGA 4ESHA 2HCJB 2WAYA 4Q1DA 4B71A 2NO0A 5E3HA 2CE7A 3M6AA 5J4HA 4A92A 1ESNA 3OF5A 4QJ5A 2RGGA 4G3XA 3WP1B 1N3BA 2VBCA 1E0AA 3C5CA 1YR8A 2IX3A 1UADA 5P21A 1ONBA 4O2LA 1NG9A 1XJQA 2ZSBA 3M0EA 3TSOA 3FTQA 5FUXA 5BN3A 1G7CA 3RC3A 2GETA 1UAAA 2JJ8A 2A3RA 1ZNYA 2WVJA 2G6BA 4ACAA 4J0QA 2IYRA 1HA3A 1SXJB 3THOA 2CCKA 2EYUA 4F4CA 1NVVR 3UMSA 4Q4LA 2QQ0A 1GFIA 1U0JA 2IWRA 5EE9A 1Z06A 2WSSD 1NMXA 2Z43A 2WM9B 3FGNA 4BWYA 4D6PA 2FDCA 2OXCA 2A5GA 3KJGA 2J7PD 2CHQA 3LFUA 4JYCA 4IHQA 2W0SA 3PCRB 1E1RD 3EIEA 3QXHA 1XTKA 4LHWA 1QHGA 1DVRA 1MH1A 4YXWA 2FX3A 1YRAA 2ZTSA 1G8HA 3MMPA 2HJVA 2NZJA 3LXRA 4JT2A 4LV5B 4L9SA 4URZR 1YRBA 4TMWA 4PZLA 1KZ7B 3GMTA 2ZROA 3Q5DA 4Z8YA 1E2NA 4EDHA 1HE8B 1VMAA 2MSEB 3U44A 3A58B 1XCMA 2W0MA 2J3EA 2QBYB 2Q9BA 2Q9CA 3LW7A 4RZXA 4XD7A 1TQ4A 2C04A 5JI2E 4MRSA 4GNKA 3KQHA 3ZLJA 3GFOA 2H8KA 3GLGE 5CM8B 3CF2A 1MRSA 1VHLA 3MWYW 2IUTA 4A0RA 1F60A 5E7IA 5IK2D 3OE7A 3C14C 2ZIAA 5L8VA 1CJUC 4KJZA 1GRNA 4Q5IA 3CONA 4TT3D 1KSFX 2V7QD 1ETUA 5EP4A 2FSIA 1KSHA 4RD4A 4LJ7A 3AP1A 3TQFA 1JNYA 1L8QA 4XWOA 1E2MA 2ZQ5A 1SVWA 3AGQA 3THXB 1XTIA 5LBIA 1GNQA 3SJAA 2ZS7A 4PPFA 2G1JA 2LCFA 2RGDA 4Q1FA 3OEHD 1Z2AA 1M34E 4MGIR 2RGNA 3A36A 2CK3A 3PV0A 4KXFB 2DHRA 2DFKB 1LVGA 2IYXA 1IQPA 1G20E 3BC1A 4YMVA 3EPLA 1UEJA 5EUMA 1OIWA 2EFGA 3DVLA 3NH6A 1XD2B 2OLKA 4A0FA 1DAEA 3VAAA 4LJYA 1E2KA 1HURA 4HEJA 3U3KA 3L0IB 3K53A 3Q85A 3X1DA 4DLZA 2W00A 2JLZA 3D3QA 1SXJC 2ZRIA 3QXSA 4PC7A 3SZRA 1QHHA 3CRRA 4R9UC 5JECA 1TU3A 4C7OA 1UF9A 1WCV1 2QMOA 1JQJC 3GCGA 3TVDA 5B64A 4DJTA 3BK7A 4G0NA 3S1AB 4W5HA 3TMKA 4EFLA 5KNCA 4KITB 4OQFA 1G3MA 5G40A 1NBMD 3EARA 5KO2A 5FL7D 1RJ9B 3ETLA 3QJYA 1CRQA 2XTNA 4MYHA 3P27A 3PVSA 1YU9A 4LK2A 2J46A 4RD1A 4GI7A 2BDTA 3T1VA 5FBLB 1N6LA 2F9LA 1KNQA 2OFOA 4A82A 1RPZA 2Z83A 1S0UA 2JLRA 2ANCA 4A2QA 5M04A 2XZPA 4IDNA 3AEZA 4M22A 3QKSA 2FZ4A 3C15C 3HP1A 2WWYA 1B0UA 3LO5A 1I2DA 2XTZA 2OAP1 1R6BX 1RFLA 2B21A 1M8PA 1TTTA 1KJYA 4KHZA 5DH9A 2CMKA 1VCIA 2CJWA 2CHVA 3DDCA 3ZZUA 4B48A 1W0JA 1YKSA 3B60A 2QSZA 4LWZA 3RS5A 4U5XA 3RS7A 1OYYA 3QUSA 1XD8A 4JBYA 4TTPA 2J7PA 4B44A 2PJZA 4EKDA 2YC4C 3AGPA 5FPSA 1NIPA 3BH7A 5D3MB 5BXQC 2V3CC 1D9XA 1A2KC 4PQYA 4AG5A 4Q21A 3QKRB 4M1TA 2IXFA 3MFYA 3NDPA 4B3CA 4URVR 1R0ZA 1CXZA 2GILA 3SR0A 2EU8A 4ZCMA 5L3RA 2QRNA 1IN7A 4QM7A 2QM8A 2FZLA 3U4QA 1KO7A 2BVNA 2FEMA 4EPWA 3EC1A 2FH5B 4B76A 1JJVA 2CNWA 5EQTA 3SE0A 4JMPA 1NLFA 4QM6A 3LNCA 4LPKA 4AIIA 4I1OA 5CB6A 1JEEA 1P2SA 2R9VA 4MQBA 3U3OA 1U94A 2XNDD 4B3DA 1KDRA 3EG5A 4ZI3A 4LJ8A 3CNOA 4M1MA 4B6EA 4F91B 1VYUA 2DWQA 1N5KA 3MWLA 1NL3A 1US8A 2R8RA 3EA0A 1UDWA 4XVUA 3P4YA 2GEDA 3I4LA 3P1JA 2IXGA 1C9KA 4D4JA 3NXSA 2V7QA 3CR7A 2VSOA 1N0WA 5HR5A 1KK2A 1QG4A 2WICA 4LUCA 1YZUA 4ZI2A 4H1UA 5H68A 1LS1A 4TQUS 5JS8A 1FNMA 2D2FA 3I5YA 1G8YA 2PJRA 4UKDA 4O2RA 4QKQA 1U98A 2BM0A 1TQ6A 1Q3HA 2HV8A 2XOKD 2Z5FA 4TL9A 1XNJA 4D4MA 4HZUA 2XB2A 3BWDD 1AQUA 4AK9A 1IONA 1SVOA 3B7GA 4G01B 3NHAA 3RANA 1J7KA 1RW4A 5AUPB 1SZPA 1KMHB 4M0LA 1KI1A 3F0TA 2ODWA 2RKOA 4JLAA 1G9XA 3R8CA 3RSLA 3I73A 1UDXA 4KFTA 4M53A 3AVVA 4EQ6B 1W36D 3FHTA 5DSZA 1Q21A 2ORIA 4RFVA 5DN6A 2ZS9A 4TL6A 3B2EA 5TB5A 4QJ3A 5JHGB 1CU1A 2O8EA 3U7HB 1ZCAA 1W2GA 5KOYA 3K9LA 3AVYA 2CCJA 1ZAKA 3WMGA 2ZVPX 4CDGA 5JZVA 2VLIA 1GILA 1U81A 4A8JA 1NKTA 1JPNA 1XZPA 3SNHA 1Q20A 1CBUA 2QAJA 1NBMA 4KLNA 2JASA 3AF0A 3KX2A 1OW3B 1CTQA 3MJHA 3QI2A 4ZCIA 1E79D 4FMCB 5AJZA 4B75A 4N1AA 3ZIAA 1OB5A 3LXXA 3GLFE 3Q7QA 4DDTA 4TSFD 4JYBA 3VR5A 1RVDA 3AKEA 4IOKA 3KFXA 2WJHA 2WKRA 3IEUA 4NTZA 4BFWA 5FH9A 4D80A 1XBTA 1MRNA 2Q3FA 4KU4A 5TV2A 1RRFA 4GOJA 2ZUCA 1NY5A 1CP2A 4JLVA 4F4IA 4PQFA 1EFUA 1OPXA 2GNOA 1AZTA 1VCNA 4PQRA 1X1RA 4WZ6A 1B23P 1ZIOA 1VTKA 2BV3A 2AXPA 3FKQA 3TGPA 4BASA 2AFHE 2CLDX 1XFAA 4YMSA 1XEXA 5J47A 1E4VA 5DI3B 1K5DA 2ZRJA 2IL1A 2IEZA 2LKCA 2ZVQX 2B7BA 2BBOA 4XWAA 1OH7A 5J4KA 1MR3F 2IYYA 4NPHA 2VH5R 1VG9B 3IBGA 5LB4A 3ADBA 4Q4JB 3QPVA 421PA 4B74A 4BFZA 4BLRA 4DLVA 1KO8A 3AVPA 4XSHA 4GRAA 4QGAA 5IDVA 1KSGA 2QMUA 4D0GA 4U7DA 1OKKD 3LBNA 5GADl 1COWD 1YZTA 3ZQ6A 2QQEA 3W6OA 4HB3A 1Y63A 4KSCA 5EXPA 2SHKA 4F4JA 3Q3JB 4GP6A 3LH5A 1P3JA 4QHTA 1V43A 3SFZA 5AJXA 4XWKA 1P9RA 1VG8A 4NCHA 2GHIA 3E70C 4NYMR 3X1YA 5FTNA 4A4DA 5HTKA 621PA 5TMPA 1XTRA 3M1IA 2GEVA 4NMMA 3C4JA 2BHRA 3I61A 3VU9B 2XNDA 3WMFA 2G0NA 3BFXA 4V0LA 3A4LA 1N5IA 3K0AA 2QT0A 4ZIRA 2F55A 4OK5A 4QBIA 1N2CE 1S1MA 3K70B 2OAQ1 4JLBA 1W44A 1XD9A 1D6JA 2RHMA 2IWHA 3R20A 5JSZA 1DARA 4ZDKA 5H8WA 3KTAB 1OHHD 1ZM2A 3W5JA 1X1SA 5EP3A 2OILA 4XVRA 3RRZA 2AK2A 3HYRA 4CT4B 2P6NA 2WKQA 4A2PA 1HH4A 1KYIA 4AURA 2YKGA 1ZNZA 2OCYC 4JVNA 3L43A 1Q0UA 4PC1A 1AS3A 2EW1A 1RC8A 4ILEA 3PG5A 3SBDA 1UKVY 4JLOA 3FKSD 3QY0A 1XPUA 4CIDA 1OFIA 4MYCA 2WWIA 3C5HA 2PCJA 3F8TA 3IQWA 5G53C 1W48A 3PEYA 4P33A 5KUTA 3O8BA 1M74A 3T5GA 1OFUX 1QDEA 1G8FA 4KFUA 4P0TA 3ZVLA 2R44A 1T3HA 4TYWA 2HCBA 1NVUQ 2IYSA 3WBJA 1KGDA 2GKSA 1XEWY 1E1QD 3U7EB 5GVSA 3VHXA 2W2TA 1SXJA 1S1CA 2F3TA 2C98A 1YHNA 4AYTA 3CNNA 4JLKA 4NYJQ 2A5YB 2VYFA 3KJHA 3GLIE 1BYUA 4LJ6A 1AQYA 4TLCA 1E0KA 4L5BA 5FR1A 1DAMA 2GCOB 4HYYA 4NYIQ 1EFCA 1E32A 2CL7X 2H92A 3BORA 3THWB 3X2SA 4QGGA 4L4UA 5EZ5A 1E9DA 2YWEA 3BJIC 1N6RA 2GJSA 3MWJA 4FWTA 4P4UA 1NBME 2WPDD 2NOAA 4Q1CA 3W9YA 1E79A 3C16C 3OIVA 4IJMA 1P62B 1NMZA 1P2TA 1T91A 4MKFA 5IRCD 1E69A 3T1OA 2YJTD 3FMIA 3K09C 3PR1A 4RJLA 2QBYA 4ABYA 1G19A 4HDCA 5L3QB 4KFRA 2ZSFA 3AP3A 4M1KA 4MA4A 1WBBA 1IAQA 1KI7A 3RC8A 4YMWA 4DB4A 2XB4A 4N0DA 4KLZA 1LTQA 3GLHB 1D8TA 2QTFA 3MWKA 3QF7A 3TR5A 5EUQB 2GEUA 2VHQA 4C0JA 1E2HA 2NIPA 1VG0B 2BCGY 2EFHB 2ZI5A 1WA5A 4UJ3A 5D3QA 1YZQA 4LBZA 3HPQA 2VF8A 4MYTA 2ZRBA 4ON9A 3TQCA 5AWFC 2FSGA 4OHYA 5FUYA 2ZJBA 1EFRA 3JVUA 2FFHA 4TQAA 4UXJA 1SULA 1T6NA 2WV9A 4FCVA 3K70C 2AXNA 3BXZA 1KK3A 4JKIA 4PSAA 2RB4A 3K0FB 3K9GA 4RY2A 3EX7C 1GL9B 1VDZA 4LI0A 1S2MA 3THXA 5E95A 3KFVA 3O8DA 2FG5A 1IHUA 2DPXA 1FP7A 4Q02A 3TAHA 1COWA 2O5VA 2X1VA 2ZJ2A 2GCNA 1CF4A 2GXSA 4HZIA 4Q1AA 1KI6B 1XTSA 2H57A 3NVAA 4TMZA 4RFSB 4I1VA 2G77B 1WBDA 3Q9LA 4BGDA 5FOTA 1KHTA 4B35A 2HEIA 2F1HA 1JR6A 2EFCB 2GVZC 1YJ5A 1OIVA 4R98A 3R9IA 2P5TB 2VHTA 4KI0A 1HY3A 1AA9A 2FF7A 1XD2A 3RS4A 4A6PA 2AWNA 1IY1A 1TQ2A 4JLMA 4OI4A 1KI9A 5F3WB 1CEEA 2DFNA 3B1XA 3DMDA 3NBZC 2NQ2C 4TLEA 3HR8A 5DI9A 3NH9A 5HZKA 4D25A 4BFXA 2GJKA 4DLRA 2GXQA 2REBA 2YWGA 5EE1A 3OIUA 2PLFA 3T34A 2BOVA 3QOFA 1J70A 3U3JA 4M9QA 4XD7D 4CGZA 5JLJA 1M1YE 4NONA 5SZIA 1OH5A 1UKZA 3WRYC 1NVVQ 1UBFA 2WTUA 3S1AA 2JJ1D 1TUEA 1F2UB 3PEVA 1T4GA 4CZ2A 1XZQA 1X86B 3I92A 1G21E 1RJ9A 3B1WA 1FZQA 1X3SA 3OE7D 1AS2A 1TU4A 5CYPA 1OFHA 5JS7A 4ZKEA 1P61B 1ZM7A 4KCGA 2QENA 3CKLA 5FOSA 4FMBB 4FIDA 4O3MA 1EG7A 1R8SA 1W1WA 5JBQA 4D4KA 3EZFA 3LX5A 2IYWA 2OUKA 4PX9A 1CLUA 3QXCA 4G1UC 1Z28A 1KJZA 1EX7A 4R2IA 5FTKA 4QFMA 4DSUA 2AWOA 1OE0A 2MSCB 1KI4A 2F3RA 4JBWA 1JI0A 3ND9A 5FUVA 1SXJE 5DISB 2W6JD 1R5OA 1ZC3A 4B3FX 1RYHA 5KDDA 4DDWA 4ZCLA 3CWZA 3K0SA 4FMCF 2Z0MA 4L15A 1GM5A 4BZPA 3UATA 2QG6A 1EFTA 2FGKA 2WHXA 1D2MA 5CJPA 1XMSA 2ZAOA 2F1JA 3TAUA 4DLUA 4I1SA 5D3MA 2HF8A 3CH5A 4Z54A 2ZYVX 3QKRA 4HAZA 4C9BA 2WPDA 1E94E 1E0SA 4JLDA 4C0AC 1C1YA 3KZ1E 1JPJA 4IDQA 2VP4A 4EFMA 2JLVA 2OG2A 2QAGB 4PZYA 1SQ5A 1G3RA 5HCNA 3R9XA 4BPBA 3B6EA 3KQUA 4MRPA 1XWIA 1E2EA 1FMLA 1I2MA 2KWIA 2P3SA 3PUYA 1F5NA 1G3QA 5H70A 3D8BA 1KNXA 4QJ4A 2VSFA 1F2TB 2D06A 5C4GB 4DSOA 1IJFA 5AK0A 3FFAA 1AKEA 2H1LA 3UG6A 1BOFA 1GL6A 4OQMA 1FTSA 1FQKA 4BRWA 2G3YA 4D82A 4R71A 1Q1ZA 3IIMA 2OE2A 1NVWQ 1N0VC 4ZO4A 2B6HA 4LHYA 4RD6A 2ZEJA 3U7GA 1Z08A 3FHOA 4LBVA 5FR2A 5FBWB 1T5IA 1QG2A 1RRPA 3GJ6A 1W4BA 2W6IA 2BKEA 4ESVA 3Q7PA 2WSMA 2DBYA 4FMDF 3RWOA 4Q7MB 5DLQC 5JWRA 2G9NA 1F6BA 4PANA 1O87A 3LD9A 3NBFA 4A0HA 4C2UA 4M9SA 1G4AE 4KBFA 4IEEA 1W0JD 2H5EA 2A5DA 3OEED 1S3SA 1PLJA 2AR7A 2VHCA 4PR0A 4HI0E 4IRUB 2DWPA 1R0XA 1E2IA 2TMKA 2GBLC 1E98A 4Q1EA 1OH6A 3EIHA 3X1ZA 2P6UA 4MUBA 2QEQA 3O8CA 1DS6A 4G5QA 3DEFA 1T5LA 2UKDA 4MKHA 5AJYA 4A0GA 2PMDA 3NG1A 1L7VC 3CO5A 1H8HD 3T12A 1KMHA 1X8LA 3CRMA 4TMTA 4GMDA 4RVCA 4DT1B 3KXKA 3RSOA 4EQ6A 1DE0A 3U5ZB 2EVWX 2NO7A 4ARZB 5TDHA 4DZZA 1RE0A 2VL7A 2IUUA 3RS2A 3NBYC 3QQ5A 2CNWD 4Z8XA 1SVIA 5FBVB 4TQ9A 2QUZA 2UZ3A 1QBKC 3B9QA 5EE5B 4DDVA 3RAPR 1Z6XA 4TYYA 3VNVA 2FWRA 1U99A 1GZSA 5G3YA 1RRGA 5JCPA 3T1QA 4L8GA 3EPJA 3WNDA 2ZRGA 2JJ1A 4TZ0A 4IKEA 2GXUA 4M21A 3RYTC 5B57C 5KSOA 2QZ4A 1FP6A 3OESA 4GZMA 1FUKA 2AHOA 1MO6A 2ZRFA 5HCIA 4CRWB 2MSDB 4H9GA 5C1BA 3NIBA 3VR6A 4TL7A 2QE7A 1PJRA 2PT7A 3KQLA 2N42A 1FQJA 3F3YA 1XPOA 2PT5A 2AL7A 1ZIPA 2XITA 2GK6A 4OK3A 2QAGC 3GJ3A 2YWHA 1OF1A 4JL8A 4LGMA 3BGWA 1DOAA 3SHWA 4PC6A 1E4YA 2ZRCA 4Q19A 3GP8A 4TL8A 4GP7A 4ITRC 3CPHA 5J4YA 5TY0A 4AKGA 3FMPB 4JVSB 2IHYA 1VCMA 3SJBA 4N0EA 4Q4HB 3SFVA 2ZRNA 2W6JA 1Z0KA 4LYJA 3OIWA 2WBLC 4YMTA 5F98A 1GKIA 4RD2A 5DI3A 3SYNA 2O8BB 2BWJA 1YE8A 1MABB 3IHWA 2R6FA 3GJ7A 1Y3AA 4EUNA 4BE7B 4AKEA 1QRAA 5DN6D 2DCUA 4Q4JA 2KSQA 4RKFA 1G7RA 4P4TA 3WBKA 2ZU6A 3EZ6A 4U02A 4Q7JB 3MD0A 5A4JA 2O8FB 2ZYTX 2R62A 1NKSA 4FCWA 4YONB 3SOPA 3K09A 4XTRA 2PZEA 4M4SA 1LV7A 3SU8A 2NTYC 3TUZC 1Q3TA 1ZU4A 4HAYA 5AJWA 3KJEA 4MRRA 1G16A 1AKYA 5FBRB 3W6NA 2JATA 2QTVB 4JBXA 4L9WA 2IK8A 4LJAA 4OI2A 2VF7A 3KQNA 3ZIAD 3IHLA 4B2LA 1N6IA 1UBEA 2HLDD 1H8EA 3VU9A 1M7GA 1OFTA 1NVXQ 2XAUA 4MDEA 3ZZ0A 4F7WA 3WNBA 1LS6A 1ZM3A 2KBFA 4LOAA 2F43B 2GF0A 2BCJQ 3B9PA 4DEXA 2V55B 3KTAA 1P2UA 1Q44A 3K0EA 2PX3A 5EXXA 4B2IA 3D31A 1M2OB 6Q21A 1SKYE 3SN6A 4RCYA 1FFHA 2GK7A 3PITA 4E09A 4IVRA 4XJXA 1UEIA 3BRWD 4A36A 4HAWA 4MGKR 2W2VA 1P60A 3OEEA 2D62A 3K9HA 3N2EA 4M1WA 3I32A 3BIFA 2J41A 4URYR 3VFDA 1UM8A 2WJGA 2DFLA 2OCPA 2I3BA 3N2IA 2GZAA 1H8HA 1ZBDA 3NEJA 4QBGB 2J59A 1M7BA 4EFNA 1UPTA 2VP9A 4WBSA 2ASEA 1BH2A 5KDLA 1QHYA 4LRWA 4URWR 1E2JA 1OXUA 5KU1A 5A5GA 4RCZA 2IYVA 1KIMA 2PCLA 2WIAA 1OXTA 2GA8A 3L82B 1SKQA 2FSFA 4GL2A 1T3SA 4NCIA 5FOUA 2IS1A 1II8B 2IT1A 2HT6A 4W9MC 1KJWA 4ZDIA 2B8TA 1ZM9A 2NO1A 3CM0A 4B32A 4NE2A 1R0WA 1HTWA 1TF2A 1TMKA 2QNRA 2EYQA 4KO8A 4YMUA 3ZS9A 4PHGA 2VO1A 1D2EA 2GCOA 3THWA 1RIFA 1ZW6A 2I1VB 2YV5A 3IQXA 3A4MA 4DLWA 2JEOA 2IF2A 4S35A 3SYLA 3PFIA 1J90A 3WXMA 5BW8A 5J5CA 4JVLA 4ACBA 4LV6A 4F92B 4ASUD 3MUFA 4DCTA 3DOFA 3FDIA 4TZ6A 1VKJA 3BH0A 4DSTA 3AVQA 5HKKD 4TLDA 3C7KA 2JLQA 1SVSA 2JLUA 2VPPA 3RLFA 3W8NA 4DEYA 4Q18A 1JB1A 5L3QA 3RRYA 3U60B 1W7AA 1Z8FA 4D4LA 1PUJA 3QEJA 1NIJA 4PPNA 5SZHB 1MKYA 3GLHA 4EPVA 5BQ5A 1T0JB 3LA6A 4QHSA 1LNZA 2GJ8A 3H2YA 4PFSA 2F6RA 4PHHA 3CWQA 4NYMQ 1T0HB 2J5XA 2V9PA 5KNDA 1LF5A 2IA5A 2ODNA 4DRZA 2JDIA 3PUZA 4B3GA 1KO5A 3P4XA 3PXGA 1YR9A 3G0HA 2O0JA 3PQCA 1E3MA 2H17A 3CUEF 4PO1A 1WQ1R 2IBMA 3AVXA 1SXJD 1CR0A 2FPKA 2MMCA 2GCPA 3EZ9A 3K0FA 4K8OA 2ZM5A 3QENA 3SHFA 2CXXA 3BFKA 2RCNA 1XTQA 3CNLA 1Z5ZA 4Q7KA 5FOXA 2VP6A 1ZC4A 1KI6A 4RD0A 2F7SA 4RFSA 2OBMA 3WYAA 1XJ0A 1Z0AA 4IFEA 1DAFA 2VP2A 4UQOA 1Q12A 1XXHB 3TVTA 521PA 2Y8EA 5FTMA 2OEPA 1OXVA 3L0PA 4IXNA 4JSTA 5B2ZA 1N6PA 2FJUA 2K5UA 4AG6A 2VHUA 4UNSA 1LF0A 3SJZA 3QXJA 3CB4A 1Z6YA 2HLDA 1XEFA 4H1VA 5EJEA 1KZGB 3DOEA 3IGFA 1GVNB 3M4YA 1DAGA 2X2FA 2QA5A 5FUWA 3NC0C 4RZ2A 3B78A 1L4UA 1ZUIA 3U6BA 2XSZA 4LBYA 2XX3A 3AH8A 1E2FA 1BO6A 3U61B 2IYZA 2ONKA 1VYVA 3T1TA 1Z0IA 4DKXA 1DO2A 4HLCA 4B43A 5L3SB 1NLYA 1F2UA 5BYJA 4OJQA 2IS4A 4AYXA 1JAHA 3ASYA 5HE8A 4B6FA 4X8MA 4KODA 3LDAA 3UKDA 1UKEA 4NZYA 1OJLA 5CITA 2GBLA 3EZ2A 3QNUA 5G41A 2AKYA 1MT0A
chains in the Genus database with same CATH superfamily
1GL7A 2XCOA 4DHEA 3AUKA 4GLJA 4KK3A 2YNMD 4L50A 1QUEA 3DD1A 2XGJA 3LT5A 3T7CA 1OC2A 1OAOA 3H1FA 2CLOB 3ZY4A 1OZHA 4D9HA 2GBFA 3T38A 1JEAA 2XVAA 1THGA 1KAQA 2QTGA 3JZMA 4N18A 4UDXX 4DCVA 4LCBA 1UQRA 3JARB 5KU7A 1AH2A 2ETVA 2A30A 3NHKA 3AU8A 4KV7A 2IEDA 5LLSA 4RL6A 5HIAA 3VO9A 4C4XA 1Q5PA 3AUJB 4MVXA 1KORA 1PQWA 4AJIA 1OTXA 1CJTC 3D0KA 4LDAA 3EIQA 1O8BA 4ZQEA 4CM8A 2JFZA 4P4SB 5K3AA 3UKOA 1JECA 5CYOA 5C32A 4LY3A 3L8ZA 4GPTA 1C7RA 2BT4A 3SJ7A 1VYHA 1Z6TA 4MLPA 1L5OA 1QH1B 1Y80A 5E1MA 1SUIA 3RFTA 3S2UA 5KVSA 1FMTA 2GESA 3A6FA 3G7UA 3KKMA 1R88A 3SI7A 3VKVA 4RX1A 4U9UA 4EHIA 1JU9A 4MVJE 3OU7A 2Z9CA 3O9MA 3N6RA 2G9RA 4IVPA 1PZEA 4R1TA 2G9UA 2HRCA 4YX9A 2NACA 4AMGA 3IQZA 4P3XA 3V6LA 3HDJA 4UZEA 1DADA 4FI3C 2FW6A 1ZA1A 3S44A 2C95A 3LO8A 2VS1A 3Q72A 3RKRA 1SCNE 3RHFA 4C4PA 2OHVA 2NU6B 3IO5A 2J85A 3FSJX 4R4JA 4FOLA 2TYSB 2QZJA 2QAGA 3M6MD 5ALHA 5CDFA 4LYHA 3L4KA 4Q12A 2I55A 3GD7A 5AVYA 1CUXA 1GA6A 1NF2A 3JQBC 1HYBA 1S2NA 2G6TA 1UBJS 3V1UA 3PFCA 3V8MA 5MFPA 3GJ5A 2WIFA 4KGVA 3WICA 4JUDX 5CA1F 2VUSA 2ACWA 3C7DB 4KO3S 4YT2A 5CIQA 3TL3A 4D41A 1WB9A 2KE5A 4F93B 4G5HA 1GAJA 3DDHA 2KYRA 3ZS8A 3QEMB 4UTNA 3PGXA 1PI3A 3EGVA 3QVVA 2QJWA 3ZG6A 1T6YA 1FBTA 2CLLB 4JUAA 2FEXA 4HYQA 1OAKA 2PL3A 3GLHE 5TPWA 1KO4A 3BFVA 5ERGB 3RDPA 4AB1A 4YECA 2XVZA 1UMCB 2E5FA 2PO5A 4TN5A 3QJ5A 1GQOA 2R5WA 3MCUA 4KVZA 3V3TA 2PUAA 2G70A 3RYHB 5AMXA 5C4MA 2R6HA 5SY9A 4XYEA 4XCVA 1B6RA 1R7RA 2QX9A 1JLLB 1QO9A 1JV2B 3L0SA 1GTRA 2Z6UA 3CLSC 2H31A 1KJQA 1QZTA 3JQDA 4HWPA 1U8UA 2ID9A 4PIPA 4W5OA 2HYDA 1A82A 1GZVA 4L76A 1GAWA 1NVGA 2NAFA 3ORHA 4L75A 1JE0A 3HWRA 4BMXA 3FWYA 5BWNA 1SNYA 3RYIB 1ZD8A 3KUDA 4MVCA 3T9DA 2H1SA 4LJ4A 3N2ZB 1YVUA 3OU2A 4B4DA 1V0JA 3QSYA 3QOXA 2W6QA 2JIZD 3MTEA 3MTAA 4KE7A 5AK4A 1KPGA 4PNEA 2CFSA 4B3JA 1D4AA 4AM8A 1MAUA 4UUOA 1E2GA 1JR3D 1SU4A 5DOVA 3SIPA 1B8VA 1MV5A 2FMHA 1C5KA 2C3UA 2HIHA 2X4LA 3F8SA 3TJZA 1T8UA 3WOVA 4F5YA 2YOHA 3R3JA 3GQBA 3AHCA 3JWEA 3TLZA 3N53A 4TKVA 2J0UB 3U4GA 1LSOA 1RACA 2FFJA 2X5OA 5LPNA 2DM6A 5EPOA 2F4NA 3D6VA 4MR8B 3DB1A 2A8YA 2ALJA 4ARZA 1HQYE 4QATA 5AM3A 1ISMA 3IUJA 4ZQHA 3SK0A 4R0VA 1EVEA 1MVLA 1ZONA 1OBOA 1ND5A 2LR0A 4U2DA 4QG7A 3DHWC 4BJHB 4X66B 4IVQA 4IL5A 2O5EA 3T3NA 2YWXA 2I03A 3C87A 1KRHA 5CH8A 1NYLA 1J0CA 1RYFA 3CF4G 4IINA 4J9VA 1QDUA 4QG3A 1C3EA 1H93A 5U4XA 4QDJA 1E2PA 4YCBA 1OYWA 4RJ2A 4L8VA 3VZSA 1VL1A 3L93A 4EG0A 3SQXA 3JSAA 5CLHA 4TOIA 4LGYA 3SQOA 4C0LA 4LC0A 1F20A 1FCJA 2R7MA 3DE4X 3SD7A 4DEYA 2H1OA 1M33A 1P6UA 5H9WA 2VPQA 1IM5A 5JRDS 1K27A 1RZ3A 3H0KA 3LDFA 3MIZA 4FINA 1O5OA 3DW1X 1UBGA 3O83A 4ZT3A 4KTVE 4EKYA 1ADGA 2AFIB 3G2IA 4J7AA 2CZGA 1SK9A 1K5GA 5CFPA 5EE3A 1PJZA 2C96A 3H5RA 4K2HA 3X2EA 3D8UA 1L0BA 4ETWA 1U1EA 3A3YA 3OPYA 2ANBA 4P31A 4RLHA 2OCKA 2PPVA 2XMZA 4GOXA 4MK4A 3UV7A 3B53X 1ECLA 4B33A 3TI9A 3OH8A 2HJWA 4W6ZA 3RPEA 2WHEA 2OFXA 3CPJB 4GNRA 1SHZA 5SZJA 4QQNA 4Q4HA 1C4OA 4Q66C 5K3OA 5A03A 4MWTA 5I7FA 5FI3A 1NASA 3QE4A 5EXTA 2NO4A 4EW1A 4BKUA 4OIFA 4WZAE 2O8BA 2Q07A 1PE0A 3Q7IA 3ENWA 2P9EA 4J0GA 1EVIA 1GFZA 2EGUA 2EP7A 1ODKA 3FHCB 3KSZO 1B1AA 2HT1A 1EWRA 3K1JA 3TLXA 2AMFA 4KQXA 1VOTA 3AUYA 9GPBA 5FLYA 5JUWA 4EEZA 1RLOA 1ESEA 4LVUA 4OMUA 4JXJA 2XVYA 4ZV9A 3LCRA 1F8GA 1TQ8A 2MYTA 3OPYI 4M0UA 3EUFA 4KV9A 1XQXA 3I8XA 2IYOA 2BFMA 1T5TA 2C7VA 2GAJA 2WUFA 4L0MA 3WA6A 5J2UF 5JMTA 3QP9A 1S8OA 1E18A 1M75A 1RCUA 1RFGE 2RI0A 4QOHA 5HPYB 2REQA 3KQYA 3N5KA 5KWIA 2NT3A 2WG0A 2WAXA 3BA1A 1ABEA 3BB1A 3DZHA 3GQVA 4LDRA 1U7PA 4NABA 3ZGXA 1IXKA 2NP7A 3OF3A 2X86A 1E3SA 2R2GA 2ZBEA 3I6YA 5JYCA 1ZNXA 3T54A 4DM3A 3EEOA 3RSQA 1JRLA 2O4CA 1JDBC 3IB6A 4PAOA 1BRMA 3AHGA 2XNHA 1JBEA 2D0IA 3SYMA 2AN1A 2Q7XA 4AJLA 1ZWKA 1NQAO 1P8JA 1YHZA 4I5IA 3RNLA 1N7JA 3V8BA 4D9NA 121PA 3G9TA 3FA2A 5JEEA 2GDJA 2GARA 1NNEA 5TQ0A 1NVKA 4MGEA 1QNFA 3HI6A 5B3JA 1QS0A 5K0ZA 2PO7A 4PLVA 5F7ZA 3JY6A 3EXG2 1KY3A 4N12A 4ZRMA 3UN1A 3HS3A 4ND2A 2J6CA 5K0LA 1MLDA 1IXRC 1ISRA 1GPYA 1N7HA 2JCBA 2XT0A 3VKWA 3F5MA 3WGNA 4MCAA 721PA 2XZTA 1WG8A 3GCXA 4Z3KA 5G2OA 4GE0A 3OZFA 13PKA 2EZ8A 3T61A 3U3MA 4ZI7F 2F1KA 3KP1A 1Z6GA 2B92A 2P1RA 2QGZA 4INJA 4BQQA 3JQ9C 4DYDA 1JZQA 1AIPA 2C9ZA 4WN9B 4AAYA 1VLZA 1YQQA 3EZ7A 1I3CA 4Y6OA 4PBSA 1XMVA 3ROKA 3ROQA 3GYGA 4YP0A 4LY6A 3NFRA 3LVRE 2C94A 3RJMA 3WBBA 1ATZA 3FJYA 3H2IA 4KSBA 1N6NA 2J67A 2Q6OA 3MHTA 4O2BF 2AD5A 4TWJA 3AW8A 1E99A 3L4EA 3GWZA 2FZ5A 2G5CA 3LP6A 1G20A 1QHNA 1GPKA 2QRLA 2CF5A 1R2QA 2BRUA 3IAEA 2BJWA 4P80A 5GV8A 3WKDA 3T1HB 2QRMA 4P0QB 5BORA 3B13B 2OXRA 3TTSA 1CQWA 1CRWG 1F48A 1A5TA 1G6HA 2B6NA 3DFMA 3EHDA 3IP8A 3L7CA 4KMSA 3WRVA 4DC1A 2UYQA 4E6EA 5IFKA 1H42A 1SQ6A 1T9GS 1UANA 3TBHA 4V0RA 1MO3A 2RGWA 1AKWA 5AVWA 1Y33E 1YAHA 3HKEB 3NHBA 3IDSA 1RM5A 1Z9BA 4FUQA 4KAJA 4FKBA 4HB0A 5CT4A 4IUCS 2D7CA 1G5IA 2M98A 3LFTA 2V1UA 1CJKC 1DCFA 1R64A 2HDWA 2C2ZA 4JA2A 3N6VA 3G0OA 4H2DA 1LA2A 3GZTB 3ET5A 1T9DA 1P2BA 1ADCA 1P0FA 4M0KA 2O9JA 1UK8A 1VSVA 4EEKA 4JU9A 4JXZA 3NWPA 4CKBB 3KE9A 4FS8A 4P1ZA 4TTRA 4B3HA 4M1SA 3V7YA 1L7NA 2VQSA 1Y7IA 2GPJA 1UPUA 3FPSA 1GKUB 1KXJA 1IM8A 3R24A 4V1CA 1JH9A 1PL7A 1JKIA 5JEDA 1A7KA 2HIMA 1JLMA 4WCFB 3GZJA 2ZYAA 4HQ6A 3EUAA 4XM1A 4XARA 5DB4A 3EEFA 3DEAA 2XCIA 2FN7A 5TVGA 2ZAMA 1QGZA 2ZXEA 3T3PB 1YS2X 4Q1VA 3BQNB 2FG6C 3RASA 1E9RA 2ZM6B 3ENNA 4TXNA 3RYFA 2ETXA 3KVVA 4CIXA 1ZHFA 3C6MA 1FA9A 2Q1XA 1CR1A 3KPWA 4O4JA 5TJ9A 3TOZA 4EY3A 1LBHA 4M49A 1PJTA 1Z7EA 1FYEA 4W5QA 1QRUA 3LYHA 3UYKA 1V95A 2QSUA 1OXSC 1D6SA 4CW7A 4FFRA 3JVVA 5CVEA 1Y4AE 5C80A 1F9EA 1W36B 1PZHA 3MJEA 3EZLA 4CMJA 2CJFA 5IDWA 1LNQA 4V1CI 1SPXA 2YINC 3ZLUA 1CZUA 3GZ4A 1X39A 3KR1A 3DVSX 4JC4A 5UKDA 3I3OA 3Q6NA 4IQFA 1AXEA 1ZN9A 3AKCA 4C04A 5EIEA 2CNOA 3UAZA 4KYVA 1EXMA 1GL3A 3AEXA 2A9VA 2L0XA 5IBPA 1NN3A 4KN9S 4J75A 4UBLA 1H1LB 1P2VA 3GNQA 1EFHA 2AJDA 3WYBA 1E2BA 2XVXA 1BEUB 2XXAB 3JQBA 2FZKA 1FUUA 2Y92A 1GUDA 3JQGA 4LG1A 5KB3A 1BS2A 1WB5A 2PMEA 3AYZB 4MARA 3I23A 1ODCA 3GJTA 1NUSA 1A5SB 3KALA 3FSGA 3MXTA 3OCUA 3K92A 1P4RA 4IEFB 2QD2A 2L18A 2ZSKA 4G5XA 4NBVA 1DTEA 3B9BA 5K3SA 4X64B 2I6GA 3O3CA 4EJ0A 4ALLA 3ZV5A 3N07A 4PC2A 1AC5A 1KK1A 4HL6A 2GCIA 1GDHA 3K0CC 3DBHB 4L0CA 1N9ZA 2XE7A 3FHJA 1RADA 3UPDA 4ADSG 3VPFA 4M0FA 2IPOA 3BGDA 3DFIA 3WP0A 4FCCA 4JIMA 3K2EA 5JYEA 1J8MF 4HWGA 4N4AA 1QU3A 4HB4A 1H6DA 4RZUA 4BNHA 4EW6A 1KTIA 2WT8A 3LBHA 2IXAA 3PLNA 4NC9A 4P8RA 3ZE7A 2WD7A 2VBFA 2ZCUA 3HCBA 3B1VA 3LK7A 4OQYA 2X0DA 3WJAA 1LLFA 3C3KA 3FDZB 5D1NA 2E49A 3Q88A 2J5KA 2P75A 1QYIA 3D3NA 2P4HX 2FEWB 2R2AA 2PPLA 3LY7A 4S1VA 4ZOCA 4M7OA 1SZJG 4MWZA 3BZUA 1ID1A 2A3NA 1BGXT 1IZ0A 2V6BA 3ZXSA 2I76A 4B34A 3Q8WA 5CVCA 3DDZX 1V37A 1FNCA 2OOSA 4NULA 4F12A 5CAEA 1XCOA 2JDID 1YUBA 2WDZA 2H00A 4TLAA 2OESA 3EDYA 1MP0A 2C1ZA 2ZIWB 2VAVA 4HEA1 4Z0NA 4TTQA 2XEXA 3UT5A 1U5AA 5HZGA 1RAHA 5IT4A 2Y71A 3NGXA 3ICCA 1VIDA 5JNRA 4PEVA 4YCJA 3ONWA 5JXIA 1QFZA 4U7WA 1EWQA 5IYZF 3VVCA 4NG4A 5ICFA 1L9KA 1M54A 5GV7A 4QBFA 1EZ1A 1FXWA 2PWPA 1TZBA 3D0OA 4EUEA 3THYA 1R9MA 4CF7A 4UVEA 4RM3A 1FUEA 2OTCA 1TUIA 2HXYA 2QGFA 3EK2A 4LMRA 5CFMA 4HGRA 3TFQA 2FN8A 1LJLA 1QB8A 2LPMA 2V6MA 3FFBA 4WLOA 2FDRA 3T7AA 3TNYA 1QHXA 3K35A 1J39A 3S0JA 4CEJB 4FGLA 2VQFB 1G5FA 1GRRA 5AVRA 5EHQA 2DVMA 3EGDA 4QQRA 3H5OA 4MH0R 1T8TA 1OIXA 4HFJA 4TMKA 3WLSA 1E3IA 3H1EA 2G76A 3V9PA 2GA9A 1U0GA 4FDVA 5JY1A 1Y5MA 2J45A 5JS2A 3T3MB 5TQ2A 3KJXA 2O8VA 4IM7A 4KXNA 1XE3A 3Q7TA 1SB9A 3VI4B 1N0IA 3QEAZ 3GLGB 4CFYA 2IYQA 3H4MA 1O6FA 3IDQA 3LUCA 4XDGA 1Y4UA 2O8CA 1S89A 1Z2EA 1R0YA 3I01M 3PYLA 2IEBA 4L85A 3O2QB 3W8RA 4XWGA 3TK1A 4DIBA 3HYTA 1TF7A 2H1FA 1E92A 4ZT6A 3KQKA 4XEHA 5A3SA 4ZAVA 2CMDA 3NEAA 2C2MA 2PVPA 4ZQCB 1PDOA 1QYDA 2ZU0C 2ZVJA 1X8JA 1FS5A 1YR6A 2NLOA 3MERA 1GNTA 1RS0A 3G17A 2C3PA 4JB2A 4BP1A 4JR2A 2P2GA 4G0QA 5F1OA 2HK9A 1E3WA 1OA1A 3HU3A 1PX2A 2QT9A 2VHEA 3A37A 4TUYB 2PBRA 1ZP6A 2P9FA 5DM60 3FYHA 5DHPA 1K97A 4XWYA 2CGEA 9ATCA 1VRVA 1OXXK 4FXOA 3AUUA 2Z2IA 2PGXA 4LXTA 1HFKA 1EEXB 2DLNA 4CMKA 3A9VA 2Q62A 4DR3B 3EXHC 1R5JA 3EXFB 4TS3A 2Y2VA 1T2CA 3BG5A 2ODAA 2UZ0A 2VTBA 2NTJA 1E6CA 4ND7A 2F3QA 1R0KA 1GQQA 2Q4BA 3KB8A 5D3ZA 5L3ZA 1N2SA 1QVAA 2E1PA 1QK3A 3BJMA 3JV7A 2OHOA 4YO8A 5I7AA 2XZOA 3UUGA 4MW0A 1S3FA 1YVDA 1C7ZA 3P26A 1XJWA 4AW9A 1Y4SA 5JTTA 1AY0A 1FFWA 1CFZA 4PAQA 1IDN1 5DFAA 5AOCA 4B3BA 5LJLA 3PEUA 1K7EB 2I4NA 3CH6A 3RD5A 2DYKA 1VJRA 1XZ8A 4HPWA 3G0GA 1SC4A 1U7HA 4BJ3A 5DM2A 1E4OA 1GRCA 1YJ8A 4PSUA 2F8LA 1BXZA 3TW8B 4CV1A 4GFDA 2RH5A 3L7KA 4H16A 4R7ZA 3TE6A 5ADWA 5HW0A 1OY1A 2QM3A 4RANA 2FFQA 5DM1A 1GU1A 3PJRA 3UOWA 1IRIA 2GB4A 3NTLA 3UOAB 1ZOOA 1YSCA 1QGOA 4IPTA 4AF8A 3O8RA 5DM0A 2WB4A 3WO0A 3GJ0A 1A9TA 4C1NA 1N9GA 2HRBA 1DC4A 1TXGA 2O19A 3WWZA 1KU0A 2BYTA 4UD6A 4AMVA 1W59A 1NONA 1RWKA 2YHIB 3KSUA 1ZUNA 4YAEA 2N0SA 3LJKA 6YASA 5IXYA 1TT5B 1ZVQA 2WG2A 1JEDA 3OE1A 3SBOA 4DCGA 4XFJA 1PVOA 3G5UA 1MD9A 2AFVA 2NZXA 5A6SA 2Q4EA 2VNIA 1RAGA 5ALEA 1ZPDA 4EJMA 1ITZA 3PCXA 2E5LB 1CVRA 3KZMA 3X1XA 1UC8A 3AEQA 3AY0A 5L51A 2M1ZA 4YCSA 1DWUA 4NIMA 4KPUB 3FPFA 5IK2A 1BE0A 3HDTA 3JQ9A 4J0KA 3ZDYB 4CMGA 5MFZA 5BN3B 2VYND 4NAHA 4RKEA 1SKYB 4Y1GA 1IOLA 1GHTA 2WLTA 4RPKA 5FL3A 1QZXA 4HAXA 5LNK6 4JFRA 4QJBA 4L5JA 1ODFA 5LN1A 2Q6LA 4H27A 1SHKA 2P1ZA 1XK6A 3P52A 3TZKA 4L8FA 2XBLA 4UMFA 2B25A 4EWLA 1Q0RA 3RSGA 3JR7A 3OAAD 4M98A 5JI3E 4N3NA 1UINA 3DO6A 2C3YA 3CF4A 1KP9A 2OOKA 4HLNA 1RXYA 1RHRA 3SXUA 5IJ0B 2IPNA 1KVTA 1BFKA 2RBEA 4RVHA 2N1BA 2X77A 4Q03A 1WMBA 2H11A 1NF9A 2MR5A 3AHIA 2FQWA 1QP8A 3JQAA 2ZANA 4C87A 4F4FA 1KKMA 5KOJB 2FJ0A 4PO8A 2YX1A 5CURA 2YV2A 2AF4C 2OCGA 1LRJA 1K8ZB 1SG0A 2Q5JA 1J20A 2OZEA 4LDPA 5DCYA 2YVAA 3W7AA 1GGMA 3G2OA 3SCZA 1YB4A 5GJVC 4IXDA 4K81B 2FMTA 3VR2A 1HGXA 4UAGA 4DIDA 3PHIA 5GONA 1Q1EA 2RMKA 3GLIA 4EUKA 3GT0A 2AEMA 5FQOA 1KMCA 1KEUA 2CXQA 3OFND 3OLVA 1TEVA 4OH7A 4DWWA 1QP7A 1WPQA 2PWYA 3A3NA 4GD3Q 1RTTA 3MCAA 2X7HA 1I7QB 1Z4IA 1XMPA 2X0FA 3RIXA 4BLTA 2P2ZA 2WKPA 3CLTD 3VZPA 1S9DA 3KT8A 3KG2A 3C6XA 4J29A 1C0EA 4PZ9A 3Q8LA 2BMJA 2BC9A 3G82C 4K6FA 1I7NA 3L7YA 3CZQA 3OKCA 4MI6A 5FL7A 5K1ZA 3N7UA 3PJDA 2ZZMA 4QWMA 1C8KA 1SXIA 3D8SA 2VBIA 3BRQA 1PFUA 1P29A 2QP4A 4K9MA 4AC9A 4DTIA 2GO1A 3RRMA 1I01A 3AVOA 5JH7A 1RHQA 2GDZA 3L2OB 3K7EA 3KLMX 1WMSA 3DDUA 4GP9A 2DT5A 4HN2A 2DLDA 4NCKA 4FEGA 2JFGA 4RQAA 4OBEA 2VVTA 5ECWA 4HNVA 3DBRB 1VI6A 1T5SA 4V0NA 2DBQA 1PLKA 4MLCA 2ZZNA 1RJGA 2WWHA 4WXEA 2BPOA 3DDWA 3W0LB 3LV8A 2VP0A 4YRKA 2VQ3A 1NJSA 3F6SA 3N9IA 5I5GA 5LDDC 1ULZA 1VB3A 5DT2A 3TD9A 3P19A 1P19A 1APBA 3KQPA 4BKRA 3E23A 1I1OA 3BQ9A 1MU0A 4QIHA 1B74A 1FFXB 2B2CA 3G9XA 3GDWA 1X7WB 4W8OA 4AQDA 4BMNA 3FLAA 3R8FA 1D5CA 1JVBA 4Q4DA 5PGMA 5EKUA 2YZ2A 2UZ1B 1P9NA 3CF0A 3ICOA 3NHFA 2NSYA 2NVWA 1F38A 4UNQA 4WECA 3V1LA 4DXAA 3MAGA 3LVFO 5JASA 3O5AA 3TBKA 3H4VA 4N6NA 2AJLI 3CZ4A 4D4IA 4FOSA 4MRVA 5KTMA 2BEKA 4KDFA 1QAQA 3ZR4B 2OFWA 4BMYA 1LH0A 1UAYA 3EWNA 4XI9A 8LDHA 1KFEB 4KO1S 2EJUA 3FZGA 3LLMA 3ZHXA 2OCIA 2ZJOA 1ZJ5A 4FGKA 1XA0A 4NE7A 1L4LA 1QV9A 4M8KA 5E0OA 2FFBA 2ZR0A 4PC3A 3RI3A 5LUAA 5F4BA 1V4VA 3K0CA 1JIXA 3N87A 5EJ4A 1E96A 4HP8A 3X3HA 4IXMA 1HOXA 2SBTA 3VR3D 4IHAA 2CYCA 1XDZA 2Z04A 4ZT2A 2GH1A 2GLUA 2H9YA 5JALA 4X00A 2JLYA 2O06A 3GVIA 2ZBGA 2G1PA 3DD5A 3INGA 3T9EA 1X6VA 1YCGA 3KQSA 4JJKA 3V4OA 2AR9A 3HYLA 4KVAA 2ZIUB 1L4EA 3E9CA 3WISA 4RA6B 3VC2A 1A8QA 1BX1A 2EIXA 3DM5A 3NTOA 1H6AA 4L1KA 3CRW1 3CUUA 1USUA 1YVEI 5I7EA 3BGVA 5CDHA 1O9HA 1D4ZA 2RHDA 5AW4A 5DWVA 3FETA 3P5SA 4TS1A 1OI4A 3OFJA 1E89A 3QKSB 3FYTA 4Y1RA 5JQGA 3T0IA 4B4WA 2DXIA 4PYKA 4UW9A 4GLBA 4KXWA 1JG4A 4ZYZA 1KDTA 2MT9A 2YV3A 2JEZA 4HLDA 1T15A 2W2LA 4FWBA 2BEVB 3ENQA 2UDPA 4QULA 1L5FA 1PT5A 1N5OX 1DO0A 3DKKA 2CYAA 3QFHA 3LQQA 5TS2A 4M83A 2IW3A 3M5WA 1W87A 3E3MA 4YJ3A 1P18A 3COWA 4ZJZA 1W6RA 1V7ZA 1GZHB 1S01A 4KAXA 1QZUA 1TJ5A 3PJGA 4B85A 1RXIA 4KG7A 3FBTA 3B3JA 2BE7A 1BA3A 2H63A 1WM1A 3IAXA 3OZCA 5F5NA 4ZEVA 3CX7A 2ZG6A 2WLSA 3R3WA 1GQ2A 2D3WA 3OSUA 1KTVA 1T29A 3VNUA 5TSDA 1NQOA 2Z6VA 4KYUA 4KMRA 1X1EA 1ZYUA 4Q82A 4X44A 4H18A 3KKKA 2FGJA 1CJVC 3OBIA 5C2JB 4MR7B 1SQFA 1SD1A 3PPIA 5DHFA 2AOUB 3IEIA 1Y37A 4HNHA 5FYQA 3RFXA 4A03A 2ZJ1A 2R1TA 2GPSA 1YQ9A 4PHFA 3TEFA 5JJIA 2Q2OA 4DLYA 5LNK1 4DNQA 4INAA 2QMQA 3KQOA 3PQ8A 3T7TA 5IKEA 2OM2A 3AYXB 3DEZA 3AR8A 4ND8A 5M3BA 4MV1A 5C9ZA 1MW8X 4M99A 1B8OA 1EESA 2C2HA 2O23A 4DIUA 1Q0ZA 3K0KA 1XPRA 2DY1A 3R7BA 5IAEA 4PG7A 2JFFA 2VDVE 2QRJA 5A5FA 3VKHA 5IKPA 5LKRA 4O1HA 1AN0A 2H51A 3SQDA 1GPDG 1NTOA 1HL7A 2REOA 2ZB4A 3FTDA 3I2JA 1CJMA 2NXNA 4QRHA 5ILGA 3V2GA 4FDLA 2JGRA 2PMWB 3DL4A 2ZRKA 1RKQA 3DG9A 1HDIA 2A58A 2P9JA 3W2HA 4BNJA 4NJMA 1LRKA 5BV1A 3S55A 5G4LA 3DZ8A 1T4CA 4GPEA 3CF6R 4W4TA 4EITA 1XHLA 3O4HA 4FOPA 4C7KA 5KYTA 1XX6A 2P4QA 1RKVA 1H0SA 3ONDA 5DEIA 3V7UA 2N46A 2XMGA 3EXHA 1KYWA 5B36A 4YS6A 5CLQA 2GI4A 4UU0A 2GCEA 1KC3A 3WGLA 3GLVA 3BB4A 3GEIA 4CKEB 4FYHA 2HA6A 4JJ4A 2BHSA 4RJKA 3RU9A 3IBCA 4TMYA 2HREA 1NF3A 3TSZA 4CE6A 4KPYA 2ZB7A 2AKAB 5C52B 3QFFA 2BDEA 2GM9A 2ZWIA 4RA9B 4QPCA 3TZ6A 1LW7A 5K9ZA 1BN6A 1EK6A 4N6OA 2XCTB 5L4LA 1OR8A 1PT9A 3M8KA 3NBUA 5DBHX 1A4RA 4QPJC 1YBAA 3GXBA 3ZGYA 4R9VA 4PYJA 1P77A 3JWHA 5DULA 3QNWA 1AGPA 2NT4A 4PPQA 5G1PA 4JI6B 3EISA 5ITZA 4E2WA 1RWPA 3NDBB 1DI0A 2GEJA 1LB1B 4EVRA 3KQMA 4HFNA 2PGLA 2XAAA 1FNDA 3JZIA 5B3AA 3NWJA 1OKKA 5C8YB 3EXAA 3AQ4A 4DUZB 2O2ZA 3ZBQA 4H1WA 1TB4A 5F98A 2GM3A 1Y6RA 1S8FA 5CLGA 4Z7OB 3TW4A 4US0R 4ZICA 2ODPA 2ORWA 4U1RA 4RK6A 2E4UA 3JQ7B 2Z3VA 1XPJA 3AZQA 4L27A 1XL1A 3PENA 2VDWA 3E15A 1LSSA 3GY0A 3KL2A 4D2IA 3WL8A 1UBLS 4CTMA 5IVIA 5A5DA 4LNAA 1DEXA 3D2CA 5E0KB 3RS3A 1VIAA 2OVBA 3I2IA 5IASA 4M60A 2X0JA 1QF7A 4ZN6A 1SOUA 3E4CA 3ELUA 3ZOKA 3GI1A 1Z74A 1V1RB 3RGWS 2A84A 2FZWA 1HQCA 4RWZA 1KOLA 7MDHA 5L3VA 4ER5A 2YYZA 4KNYA 4D26A 5D3KA 5DK6A 1FDOA 5DNUA 4IUDS 1KO1A 2WT4A 1TM1E 1PU2A 5JOQA 1P4HA 4NYJR 1IN6A 1T0UA 3QVXA 2JARA 1VLLA 2EKDA 4FKZA 4HB2A 1N34B 1KYXA 1TMOA 1H3EA 1L5GB 1CHNA 3OJXA 1YGPA 4TV9B 3ZVKA 4Q4AA 1JEQA 1D1TA 1RXWA 4ZVVA 3EULA 4KQ9A 4XAQA 3ROEA 5JT1A 4GM4A 4JB3A 2IYNA 3DAHA 1T0IA 1HV8A 2FN4A 1U2ZA 4YR9A 1P7CA 3OFSA 4ZVRA 4OY3A 2XIJA 3FLEA 4KJXA 4PS0A 2NPFA 4LYGA 3CH7A 5EA2A 3SEAA 4MB6A 1II9A 2WU1A 4K3VA 2JCSA 1RYYA 2QRVA 3TQTA 4ETIA 1W29A 2TSYB 3HP7A 2QORA 2I6QA 2VDMB 2I99A 1NLMA 2YHSA 2ZI4A 3PL5A 4IEIA 4MWBA 3T41A 3U48A 2HSWA 1MFZA 3QELB 1UBUS 4XGQA 1V96A 4K2AA 4H7PA 4J3JA 3HMKA 5JWOA 1SY7A 3KDSE 2P7HA 4FFVA 4TROA 3IFSA 1R5BA 3RF7A 1JIIA 4DA0A 1CIPA 2WF8A 5DCUA 2YUTA 2BEWA 2H6EA 2ZIVB 3I6QA 4LIPD 3VC3A 1ZMXA 4IO0A 2VJBA 2XECA 5T67A 1NW3A 3IE1A 2LDXA 3VTKA 1ORWA 3AX6A 1GCAA 2J3IA 3PHHA 1GT6A 1XCLA 3DJYA 4I6EA 3GFFA 4C22A 1QU2A 3PYMA 4OK6A 5T4BA 1XTJA 1L7QA 3QU4A 2DP4E 2ZDHA 2GPAA 5L7WA 5IAOA 1EIZA 2YRWA 3OVMA 4DC9A 1EJ0A 3EGXB 2A94A 4R2JA 4X61A 3U56A 1X9IA 4ZV4A 4KLRA 4G4GA 4MRMB 3T5MA 4DPLA 2G8NA 2D0OB 4BLQA 5KOIA 3ENKA 1IUKA 1BWPA 2R11A 4EPRA 3WLHA 2CVOA 4NCJA 4GL4A 1UL1X 2Z5LA 3MCTA 1T2VA 3LQ1A 4G5GA 1IRXA 3LPDA 2P3OA 5C8VA 1RQNA 4FFDA 4Q9LA 3HGMA 1DCMA 1W4RA 2WMDA 4XIGS 2BBTA 3ESQA 1V11B 2BTOA 4OH1A 3STUA 3U2QA 2YXNA 2QI9C 3WL5A 5A0TA 2CLCX 2O7NA 2TRSB 3CZ5A 4MGYR 4FD3A 4OL0A 4XUDA 1MX3A 1KL7A 3L4SO 4G0ZA 3REGA 3DBVO 5E3HA 1E7WA 4B71A 2EG5A 2NO0A 2AKEA 3DONA 2IY8A 2R8ZA 1JJFA 3ELBA 3NDIA 3LBYA 3OF5A 4QJ5A 2RGGA 4G3XA 4RV4A 5HCUA 1GGKA 1N3BA 5J2TF 1WB4A 5EGNA 3C5CA 1YR8A 1E6WA 1Q1AA 1N36B 5CA0A 2E4VA 4BQNA 4O2LA 2WI8A 1T25A 4F72A 1WS6A 2XUAA 2OGZA 3M0EA 4JVOA 3WV5A 5D00A 4M8LA 1L6RA 1YBHA 1G5QA 1EQUA 2EX0A 3QJGA 4RLSA 4D8VA 1L7DA 5FWYB 3S7ZA 2IYRA 3VHXB 1DOZA 2AOTB 1LBEA 2EYUA 4TKUA 3LE8A 3UMSA 2CT8A 1Q14A 1MEJA 3T3EA 4EHDA 4W5TA 1NMXA 2ENUA 4NCBA 1NJ6A 3LF2A 4WOBA 1Q7RA 1PNOA 2AMYA 4BWYA 4D6PA 4P5PA 4UDOA 4UE3S 4UCFA 2J7PD 1NYQA 1S8AA 1ISPA 1UK7A 2BFDB 2W2MA 4I4NA 4BO9A 1UXGA 1OFVA 4IYJA 4RK5A 4CCYA 2GZ1A 1DVRA 1JLSA 3G7NA 4F21A 3AY6A 1MH1A 4YXWA 5F35A 4GR5A 4D9FA 2ZTSA 1G8HA 3KT0A 4C14A 4MS4A 2NZJA 1KF0A 4LV5B 1K66A 1YRBA 3NEPX 1KZ7B 3FD8A 3DE3X 1FMFA 4Y6QA 2R8BA 3ZE0B 2HH9A 1N2OA 1CUIA 1JKFA 1QG0A 2MSEB 3U44A 1PNQA 3TEJA 1XCMA 2OECA 3FX2A 2POCA 3BDVA 4HQKA 3HP4A 1LPNA 3IV6A 1MJGM 1V9SA 4I4CA 3VDRA 4XD7A 1HDRA 3FZQA 4N76A 3BL6A 4NFHA 4EGJA 2B69A 3KQHA 3RBAA 4MW7A 3JTMA 2BKLA 5TMDA 2Q6VA 4LFCB 3D4LA 4U3JB 4BB0A 4NV0A 4P0PB 4RS4A 4G4JA 4UC0A 5HK8A 2QPLA 1VHLA 2JCXA 1ZI6A 3AM5A 5EJIA 4CKWB 1B3BA 1JIKA 2CZQA 2Q2NA 2NVUB 2JHFA 1F60A 1RABA 3QW2A 1LK5A 5LQNA 1M6WA 5LWHA 3ZDAA 3OE7A 2J9FB 3DNFA 1XV5A 2JCVA 3WWDA 1CJUC 3NP9A 4JJAA 4L5IA 1K86A 4AU1A 5DPMA 4ZO7A 5I9IA 1K8XB 2E4YA 4XDHA 5EP4A 2FSIA 3C8ZA 1RLJA 3E1KA 1C1DB 3AP1A 1L8QA 2G08A 1UXJA 1RMQA 1RXCA 3F6YA 4NICA 3DDSA 1SURA 4O4LF 1F2DA 2ZS7A 5TJHA 2LCFA 3WGJA 4OGLA 3A36A 3PV0A 3AJAA 1J25A 2YN4A 1J7JA 3IULA 2QRPA 1CQJA 5CT6A 3DUFB 1D03A 2IYXA 1B6SA 1IQPA 2C2YA 4O1MA 1DJNA 2QYOA 4Z7JA 2O0LA 1OIWA 4YCNA 3U9SA 2RI1A 1H22A 3PQFA 4BNLA 2EL7A 5L95A 3DVLA 2I3AA 1OQAA 4MXDA 4RXMA 5K7SA 1DAEA 4ETNA 4M46A 1E2KA 4YRZA 3AINA 3K53A 5DBEX 2J4FA 2VWHA 4MS3A 1P0IA 1TK9A 2CFCA 3FYCA 3Q7EA 1ZN7A 4YH1A 2ZRIA 3TX2A 2A9QA 2Q49A 3KOUA 1TU3A 4JBHA 5JECA 2PYZA 2VJOA 3S29A 3UMYA 3C6YA 1XU7A 1ZCJA 3JQFA 4L9AA 2AG8A 4TXHA 2OXFA 1TJYA 4G9EA 5AKGA 4P3OA 2Q3BA 3M70A 4QUGA 4RHEA 5DGTA 5DXFA 1MX9A 4G0NA 3SXJA 5T3UA 4MEBA 3DOCA 1GD1O 1VE7A 2JGDB 3CXUA 4GQBA 3DZFA 4HDKB 4R0MA 2QRQA 1SK8A 3NMUF 3HYNA 2XTNA 4B6QA 3KK0A 3RF6A 3M6UA 2G5GX 4DCMA 4MYHA 1EBFA 3P27A 4D42A 2CDBA 1KVRA 3D2BA 4GI7A 1ZK1A 2BDTA 3PD1A 4MVWA 2QLFA 1KNQA 1ML3A 1XMXA 2V98A 2JI9A 1V9LA 2Z83A 3JAMA 3O75A 1BAPA 2JVJA 4A2QA 2CFIA 3RUAA 3W5HA 4ZZ3A 1BXKA 2XZPA 5LA6F 1RU3A 4IDNA 1O4VA 3OG9A 5EFOA 4M22A 1SCUA 1KJIA 4ZAZA 2ZWAA 2E6KA 1Q15A 4H6PA 3WLMA 4YAIA 4MDHA 3LO5A 2PRSA 4CHGA 1O03A 5I9BA 1P1BA 2JIPA 3BIWA 3H0EA 2QS9A 2AT1A 2B21A 3EVTA 3GJZA 1GZ7A 1NNUA 1M8PA 4A8JC 5K4HA 4MVJM 2QI9F 5IUNC 2YXDA 4KHZA 5ITSA 3DDCA 3CZAA 3U4DA 2AI2A 3I01A 3W3AD 3P2MA 1F0YA 2FHPA 2NSLA 2OCXA 4L73A 4B48A 1EK1A 1AD2A 1QH9A 2W2OA 3H1AA 2JFYA 4AJJA 3R3XA