4QGGA

Tmk in complex with compound 46, 2-(3-chlorophenoxy)-3-fluoro-4-{(1r)-3-methyl-1-[(3s)-3-(5-methyl-2,4-dioxo-3,4-dihydropyrimidin-1(2h)-yl)piperidin-1-yl]butyl}benzoic acid
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
204
structure length
193
Chain Sequence
SAFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEIRKIVLEGNDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERDQEDLKFHEKVIEGYQEIIHNESQRFKSVNADQPLENVVEDTYQTIIKYLEKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Thymidylate kinase
publication title Antibacterial inhibitors of gram-positive thymidylate kinase: structure-activity relationships and chiral preference of a new hydrophobic binding region.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
total genus 81
structure length 193
sequence length 204
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2014-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4qggA00
3RS3A 1XEXA 1E99A 2ZUDA 1X8JA 1GL7A 1XCPA 3BK7A 4ABYA 3PEUA 2WWGA 3GLIA 1KKLA 4KJZA 2NO1A 4URXR 2ZSBA 2JIZD 4QKQA 2ZJ5A 4IOJA 3CW2A 3KUDA 4JYCA 1KI9A 3TAUA 3U3KA 3K0FA 2CJWB 4TMZA 2ZRKA 4GP6A 3FFBA 1BOFA 2ZU6A 2F43B 3I8SA 3DOFA 3KJGA 1NMYA 4JVNA 5FTJA 1XEWY 4LJ6A 3B78A 3THXB 2LCFA 4P4TA 5DI9A 2ZJAA 1KO8A 3W6NA 1K5GA 3AVPA 4K46A 8OHMA 4RCYA 3LX5A 2FE4A 4YMUA 5CM9C 2CVFA 5BYKA 5J4VA 2CHQA 4FMDF 1A1VA 2VP9A 4M1SA 4TT3A 3DDCA 4PC6A 1U8ZA 5L8VA 2OFOA 2HXYA 1VHLA 3FMIA 4IW3B 5DH9A 1G3RA 2JLXA 1ZD9A 2XZOA 3EC2A 1UKEA 1G64A 2ZJ8A 1XXHB 2W0SA 3TK1A 1E1RA 3TMKA 1XD2B 3QVUA 3ADKA 4EPTA 5LB4A 3QKRB 1G1MA 3GLHB 1IONA 4IHQA 1VPLA 1RRCA 5FBRB 3SYLA 5JI2E 4LHVA 4D0NA 4GT1A 4B2IA 1XU4A 2NO6A 1GNQA 2ZJZA 2D7DA 1E0KA 3Q3JB 1T3HA 3F0TA 3RLFA 3BFVA 1KYIA 2Q21A 2GTPA 2ZE7A 3LW8A 3AVXA 4Q01A 2O8BA 1LFDB 3ND8A 4PAMA 4LY6A 4NDZA 1FZQA 2G88A 1J90A 1F60A 3L8ZA 2RGGA 2RH5A 3OFND 3PUVA 5AR1A 2QAGC 1KO1A 2AK3A 4Y0AA 2ODBA 1A4RA 1QHGA 2NOAA 4POAA 5FPTA 4HAYA 2WIBA 4LYFA 5BN5A 2EW1A 2VH5R 3GLGA 3PVSA 2IYYA 1W46A 1VYTA 1ZVQA 4DCSA 5GJBA 5L3RA 1BMFD 2P2LA 4DLZA 3TSOA 4M1MA 1OT3A 1LTQA 3U7HB 1OE0A 2KSQA 3CNLA 3SJZA 2FV8A 4XTRA 3I61A 1JNYA 1K8RA 3GLFA 2FEMA 2A7QA 3K9GA 1YZQA 2HXSA 3MFYA 3NH6A 1Q20A 3SR0A 2CBZA 5KU1A 3FKQA 3QUSA 4C7OB 3ADBA 2XNSA 4V0OA 3NC0C 1UBGA 4DCUA 1D2EA 1T8UA 5JBQA 3KQUA 2IYUA 3AVUA 4I1SA 4ILEA 2C8VA 3CPEA 2BMFA 2HF9A 2DFTA 3VKHA 3NBFA 3X1DA 3DL0A 5JCPA 2W83A 2AL7A 1DADA 3LDAA 1FNMA 2WMNB 2CMKA 5J5CA 3EPLA 3D7MA 3F8TA 3GJ4A 4L5BA 4TZ6A 1HQCA 2ASEA 1US8A 4Z54A 4RFSA 3C14C 2V8OA 2HF8A 1XRJA 3T15A 2JDIA 2QE7A 1QHSA 1E0JA 3G0HA 3L8YA 2YNMA 2NPIA 2ORVA 4A6PA 5SZJA 3FMFA 4XSGA 4ZKEA 3MJRA 1WBBA 1Q21A 1T5IA 1PV4A 3MWYW 2ZRDA 2Q9BA 1NY5A 2H57A 2IWHA 2QZ4A 2BM1A 3VX4A 1FUUA 2BEJA 3A58B 5FL3A 2RKOA 1VIYA 3LXRA 1A2KC 1U81A 1IOZA 1SKQA 3E1SA 3HP1A 4LPKA 2H16A 3BFKA 3CKLA 3CX7A 2WKRA 2GK6A 2ZI6A 4Q9LA 3FKSD 2ZI3A 4ZCLA 4GMXA 2I3BA 2QGZA 2IF0A 3ASZA 4CEIB 1YZTA 3QPUA 3KDSE 5JEDA 1ANKA 2H8KA 1ZUNB 1S96A 1U0HC 5FPKA 2OAP1 2ZITA 3R9XA 1JALA 1X86B 2OLJA 4BLOA 4PZZA 3BH6A 2KI5A 3CLVA 4X8LA 3OF5A 4Q4HA 5KSYA 2FMXA 2GF0A 4D82A 3LLMA 2YOGA 2WWYA 1ZCBA 2FWRA 3B13B 3EG5A 4S35A 5DSZA 4KVGA 4KU4A 5A5GA 1Q3HA 1ZM4A 4RD0A 4YDSA 2QM7A 3CH4B 2IUSA 3UANA 5GADl 3K0AA 3P4YA 3U4QA 1MH1A 1KDPA 5LD2C 1T4GA 2EWWA 2C5LA 2FFQA 2FPKA 4YXWA 4QOSA 5JHGB 3T5GA 2FX3A 4DLVA 3BC1A 5JJKA 1G291 1XDBA 4OK5A 1F6BA 1S0UA 1OFHA 3HWSA 5AWFC 1OB5A 5E7JA 4EJSC 1GL9B 1QHIA 5K8LA 1JQLB 3PUWA 1NNEA 2O8EA 2ZPTX 3OIYA 4ZDIA 3PEWA 4HAWA 1G9XA 1KY3A 4JLDA 1XF9A 2YJTD 1HY3A 4HAVA 1YZUA 5AK0A 3A1WA 5E3HA 1E6CA 4C3ZA 3VTKA 4CEJA 1JI0A 3ETLA 1T0JB 1II9A 1SVIA 3VAAA 4TL6A 1GL6A 4F4CA 4I4LA 1TF2A 2QNRA 2A9KA 3A8TA 3SI7A 2VF8A 3SN6A 1F3OA 1SXJB 2VYFA 2ZRAA 4OQMA 5FI0B 2ZRPA 3ADCA 2B8WA 1NIJA 2ZRHA 1Z22A 1SXJD 1TL7C 4MDFA 4FN5A 1K6MA 3VR3A 3B7GA 3B8HA 2FGKA 1E96A 4FMCB 4G1UC 1WBDA 4JYBA 2VBCA 4QM7A 4ZCMA 4M53A 3SU8A 4EPRA 4TTPA 4WIAA 1XTKA 2ZREA 3FHCB 5B2ZA 1IM2A 2A5YB 4MYTA 4O2LA 4JVMA 5H8WA 4LV5B 1QHHB 4TYNA 3L0OA 4ESVA 4FI3C 2FGJA 3NBZC 1E1QD 4KCGA 3SYNA 3WHKA 2VQSA 4Q9IA 3K09C 2ZRIA 4D81A 1KOFA 2JA1A 2X1VA 1OH6A 4OK3A 3QSYA 1U2RA 4MH0R 3R7WB 1E4VA 5C1BA 3AV0B 1WF3A 2EFCB 1E0SA 1IBRA 4PPFA 1R5OA 2HT1A 1UBEA 2ZAOA 4A8JA 2JLVA 3WNCA 3LV8A 2IYWA 3SE0A 5CB6A 1IN6A 4DHEA 4CYMA 3GLGE 5BN4A 3ZZTA 5JSZA 3BBPA 5EXTA 4ZIRA 3NBXX 3DMNA 1TPZA 1E2HA 1ZJ6A 2DYKA 1MO4A 4ZDWA 3UKDA 1OIWA 4JLKA 2D7CA 2PZFA 2PZEA 3RSLA 3T34A 2ZS9A 3VR4A 1JQJC 3CF0A 1Z28A 2KJQA 2YYZA 3BS4A 3LNCA 1W0JA 4G0NA 3CO5A 5JWHA 5JFGA 1E9RA 4F92B 2QPOA 1S3GA 4M1OA 3PV0A 4IOMA 4F4IA 2E87A 1ZBDA 2V6IA 3GP8A 4CGZA 4QHTA 3NKVA 3PIRA 4URUR 3KKNA 4CZ2A 5EXXA 4QGAA 5JS8A 4B43A 4G5QA 4QGGA 2QMHA 4Q18A 2KBFA 2QP3A 1E9BA 3C16C 2ZSFA 2GAAA 4MRSA 1YRAA 4DWJA 1O87A 2OCBA 1GWNA 4MKHA 4D80A 3CRW1 4FMBB 4HB3A 2GA8A 4IVPA 4XWKA 1ZUIA 1CRPA 3EASA 1TQDA 3LFUA 1CJMA 2HCBA 1W48A 1XNJA 2OCYC 4GMDA 4F7WA 2DWOA 1UAAA 3NBYC 1P2UA 1T3SA 3CH5A 3QXCA 1XZPA 2DB3A 4JLJA 4LBVA 3WMFA 2YC4C 2HUPA 3EX7C 2CNWA 2GXQA 2Q0HA 3HU3A 4BFVA 5GJWC 2RGEA 3Q9LA 1S9HA 4LBZA 2D4HA 1QBKC 2FZ4A 4MKFA 5EZ6B 1ZM9A 3OESA 1E9EA 5GVSA 4TTQA 4DZZA 1EFCA 4BZQA 2EQBA 3SS8A 1HT1E 2IYVA 4F4JA 1N6LA 2P6UA 4YC7A 3X1YA 3U6BA 2GXUA 1G19A 4Q48A 2WJYA 4YMVA 1W2GA 4I1UA 2VSXA 4QFMA 1ZC3A 2VP6A 1LS1A 1HE8B 1V5WA 3RRNA 4NYIQ 2ONKA 3KKMA 4M22A 1JECA 1NRJB 2A5FA 4RD1A 3THYB 2O5VA 3RAPR 4EQ6B 1KMHA 2CLSA 5FUWA 2D06A 2LWIA 2AHOA 3C5CA 4Z8YA 5KDLA 1OFTA 2NTYC 4P4UA 1P6XA 1DAGA 4BQSA 2QMEA 1NJFA 2ZQ5A 4RFVA 2WJVA 4Z51A 2B21A 2QTFA 3L0PA 4G5GA 4OQXA 4ASUA 4R2IA 4B3DA 4H1VA 5B64A 1KI4A 1DAEA 3V9PA 3KJHA 2VRWA 1E3MA 4XWAA 1G3MA 1OLOA 5DN6D 1SULA 3I32A 3U3JA 2QSYA 4DSTA 4MKIA 4TLBA 4H1UA 3B1WA 2GVDC 4GZMA 3B9PA 1UFQA 3EA5A 1Q1QA 3HDTA 2JJ1D 1OKKD 4ZCIA 3Q8XB 4LYJA 1UPTA 1P72A 1XTRA 2WJIA 4JJZA 4OI4A 3REFA 4CDGA 4DEXA 2F9LA 5IHPA 4FWIB 2RGNC 1UBCA 3N2IA 4B48A 4W5HA 5DI3A 3GFPA 1KTVA 4LPSA 1JR6A 2IBMA 2ZI7A 3LWNA 4DJTA 2J0UB 2N46A 1QRAA 2R8RA 2IYQA 5CK4A 4TQ9A 1R6BX 4DVGA 1XEXB 2IYLD 4MGZR 1NBME 3QEOA 3ZGXA 2C98A 3FVQA 4HLQB 4U00A 2GHIA 1P4SA 4N0DA 3GLIB 4N0EA 4TL8A 2FEOA 4IXMA 3U2QA 4AKGA 4BECA 1IN4A 4HAUA 4B47A 1KI2A 1NG9A 2GJSA 4OHVA 5EZ5A 3ONWA 4LHYA 2WVJA 3K0FB 4LJ9A 3G82C 4QM6A 4XWOA 2QBYA 1Z07A 4A0FA 3DHWC 2J0SA 4TYWA 1OXVA 4GPTA 5TARA 1KY2A 1XEWX 4LZZA 1AIPA 2ERXA 2JJ2A 1B23P 3EWAA 2BKUA 2C77A 3IUYA 4TZ0A 3W5JA 1TAGA 1XTJA 1SVKA 2H92A 1KZ7B 3BWDD 4MUBA 3VKGA 4L9WA 3SYKA 2ZRGA 1FNNA 4MRPA 2FOLA 2RGXA 3K1JA 4FMCF 2BIFA 1SQ5A 2C04A 3KQHA 1EFRA 1Z8FA 1EXMA 3EPKA 2QUZA 4TLCA 3QNUA 3FWYA 2DFNA 3LBHA 4KFUA 5EE0A 1I4DD 3PG5A 2QAGA 5H70A 1CP2A 1E9CA 1KJZA 1GNPA 1UKZA 4G5RA 3BB3A 1E69A 3DVLA 4BFSA 1RRFA 2XAUA 5FR1A 3QENA 3T1OA 3I8XA 3H1TA 1R0WA 3ZD6A 4HZUA 4L4UA 1UF9A 4NCNA 1COWA 1FFHA 2G1JA 1XTSA 1Q3TA 4URVR 3NTUA 2QMOA 4BEBA 2BBTA 1DAIA 1GRQA 1HYQA 1NKTA 4JL5A 3THOA 4C9BA 3U44A 3A6PC 2ZRBA 3RSOA 4B73A 4DCNA 3AVQA 3EZ6A 4PR0A 2V1UA 2ZRJA 1E79A 1II8A 2WBLC 2BOVA 2CEAA 2Q6TA 4QGHA 4HUQA 1GM5A 1AGPA 4TL7A 4A92A 4Q00A 5JRJA 1TQ4A 1ZD1A 1ZM7A 721PA 2ZI9A 1RYHA 2O8BB 2QTHA 3RANA 1GKUB 1RPZA 3BB4A 5FL7D 2VF7A 3ZH9B 1IQPA 1L8QA 2CCGA 3EAQA 4TMKA 4A8JC 2YKGA 1S8FA 2EFDB 3WRXC 3U6KA 4R71A 2WPDA 5A4JA 1W36B 3CNNA 3EZ2A 2GZDA 1ZUHA 2QY9A 2QSZA 4D2IA 4D26A 5B30A 3GLGB 1X3SA 4PHGA 4H9GA 4LJ4A 3ZS9A 5EXPA 1W36D 3MWKA 3TIFA 3J81k 4AY2A 2EFGA 2VIIA 1DG3A 421PA 2EU8A 5EQTA 4FINA 5DGXA 2REXB 3DEFA 1E2LA 4TLDA 4ACBA 1UKYA 4D4JA 4KAXA 2E1RA 3Q5DA 1Z0KA 1RYFA 3GLFB 1S4QA 5A0FA 1D6JA 1KK2A 2QG6A 3BGWA 1VHTA 3IIMA 3L0SA 4RCZA 3CIOA 3ECCA 4DCVA 4C0QC 4TYQA 3ZJYA 2QI9C 2F3TA 1P62B 2XTNA 2FFAA 4EIWA 3O8CA 2BJWA 3LLUA 3WMGA 4JT4A 4PXAA 1GSIA 2O0KA 1F5NA 3RHFA 5JECA 3X1XA 3JZAA 2BCGY 4PHTA 1U0JA 4C2TA 3PITA 2D2FA 2DWQA 3HYRA 1US8B 4RFSB 4HUTA 1TU4A 1OSNA 3MJHA 1TUEA 4RKEA 5F9FA 2R2AA 1ONBA 3OEHD 1XPOA 1Z0JA 2PLFA 3ZD7A 3KX2A 4U7DA 1I4LD 3TNFA 1G20E 4HZIA 4OI1A 2ZSAA 1VCMA 2CCKA 1W4BA 1JJ7A 2C78A 1D9XA 1ELOA 4D0GA 2CK3A 1G8FA 4Q03A 3UG7A 2FPMA 2P5SA 2IXFA 4Q7JB 2RGCA 3IQWA 2JLSA 4LJAA 2PMKA 4FCWA 4P4SA 3B2EA 2HLDA 1G17A 3QEJA 3P26A 1DAMA 2P67A 1U94A 2JCSA 4AKIA 3Q5EA 2DBYA 3UMRA 4ESHA 4OHXA 5JWOA 2J5XA 3CX8A 3EIQA 2X2FA 2HEIA 2QP4A 4EJSA 4A2WA 3HYTA 3AF4A 1L2TA 2PCLA 4ZO4A 3A1VA 4OI2A 3SEAA 3ZIAA 4BFWA 3E70C 1MRSA 2OXCA 4QNRA 1XWIA 4AYTA 2IS4A 4KSCA 4M9ZA 2A3RA 2WTUA 1ZMXA 3GPLA 1XCMA 1IY2A 3R8CA 1ZIOA 5CIWA 4IJMA 1ZU4A 3EWSA 4Q4HB 1IXZA 5D3QA 4JKIA 5BW8A 1GNRA 4XIGS 3R9WA 1AZSC 2WKQA 4XD7A 1DO2A 1EWQA 4QC2A 2Q3MA 4LWZA 4IXNA 4YMSA 4Q4JA 2QL6A 1YQTA 1UEJA 3KKQA 3I5YA 1ZC4A 2BBSA 4UNNA 1Z29A 3WNDA 4IVQA 4B71A 3LA6A 2F7SA 1JR3E 1D8TA 2OG2A 4BFYA 4G01B 3X2SA 4XJXA 3KJEA 3ZYCA 4EPXA 1DPFA 3T1QA 4I1OA 1TF5A 4QL3A 4Q7KA 1ETUA 5HKKD 3FMOB 1YR6A 3REGA 5F98A 3HR8A 3G5UA 2DWPA 2QTVB 3K09A 2GF9A 4OQLA 3NXSA 2WJGA 4PFSA 2ANBA 2IWRA 4PQYA 1Z0AA 2G3YA 4URWR 3W8NA 2GEVA 2GXSA 4QNMA 5F9HA 2ZANA 5B58C 2ZJBA 4CEJB 2NO7A 1ZNYA 1G7CA 1CF4A 4HLUC 1SVMA 3PENA 5EUQB 1IN5A 5FUYA 1M6NA 4RY2A 1A5TA 3DM5A 3MAAC 3PEYA 2A2ZA 3AKYA 3KQNA 2GBLC 2ORIA 5KPJA 3AKEA 3MD0A 2Z4SA 1E9DA 2WAYA 1H8HA 5EP3A 4DEYA 3QPWA 1HURA 1N6OA 3QKSA 2W0MA 1OXSC 1Z6AA 3IGFA 5ANRB 2QROA 3QXSA 1FL9A 4LSGA 3CUEF 4ZI3A 2O0HA 3PJRA 1YZKA 1M1YE 2F1JA 3CF6R 1E9AA 221PA 2WWXA 3CNOA 2I4IA 5KNDA 3TVDA 5G53C 2JEOA 2ZXUA 3K70B 3MG9A 4A2PA 1W4AA 1FW6A 2OO7A 1FX0A 3B5JA 3ADDA 3C41J 4E07A 4GZLA 1G3IA 3W5IA 4TMTA 3VNUA 1R10A 4Y0VA 4WVFA 1KJYA 1FTSA 1WXQA 3SOPA 4KYIB 4PHHA 4XVRA 1AQUA 4HLCA 1Y3AA 3RWMB 4LJYA 2JLQA 1N6KA 2XITA 4B44A 1OFUX 3DPUA 3ZZUA 5JSZB 4Q1CA 1ZU5A 3O8RA 3T5DA 4DRZA 1BS1A 2CCJA 2DFKB 4RZUA 4DDUA 1DARA 4HDQB 1ZIPA 2BBOA 4OYHA 3THWA 1NJGA 3IKJA 3U7FB 3S1AA 1FMJA 3BFXA 4P33A 3FGNA 1IHUA 2AKAB 2KWIA 4ITRC 2GZAA 4Q66C 3KJIA 3BXZA 4Z1MA 3KQKA 2F55A 5FOXA 4OI0A 5FI1B 2PT7A 2ZSDA 1W0JD 4IDHA 3QBVA 3UMSA 4KLNA 2RMKA 1GVNB 2MSDB 1E0AA 4DLXA 3RC8A 1NVXQ 4DLWA 3OIUA 2SHKA 1NL3A 3VNVA 4NCHA 2W6JA 3M0EA 4PC1A 1OJLA 4CT5A 4HSEA 3IEVA 5FBWB 1HQYE 2VHUA 2VL7A 2DY1A 1E2DA 3AUYA 1HUQA 1NLYA 4DLUA 1JBKA 3BERA 4XH9B 4B75A 2EFEB 3D6TB 1AA9A 4GFDA 4DDTA 1W4CA 2QP9X 4E03A 3TAHA 1L7VC 2IUTA 3SQWA 4UNQA 4TSFD 1OHHA 2JASA 3FB4A 2RCNA 1W2HA 2VA8A 3EA0A 1P2SA 4WZBE 1E2IA 2XTMA 1Q1EA 5FTMA 3AP1A 4KI0A 2VTKA 1AQYA 4K8OA 4CIDA 1FQKA 2AKYA 3IBGA 2V4ZA 2CNWD 3L43A 5IT5A 2W6IA 5GVRA 3CWZA 5G3ZA 2XGJA 1XFAA 3W34A 4NP6A 2LKCA 3BH0A 1TNDA 2GJKA 3CX6A 2ZSEA 1NIPA 2R6FA 2CL0X 1NN1A 4MRRA 2AX4A 2GJ9A 1J70A 3KTAB 2O8FA 4BWYA 4DB4A 4AI6A 3K9HA 3OEEA 4PO8A 2XZPA 1OH5A 1O3YA 3A36A 3ZQJA 2QORA 1VECA 1KMHB 3K9LA 2RGNA 2CHVA 5CYPA 1QF9A 5JJIA 2YWFA 2F9MA 4TL9A 2H18A 4LHXA 3FPAA 1PLLA 4B32A 2BVNA 2AN9A 2HCJB 2W58A 1AJEA 5AJVB 1SKYB 1DAKA 1BYUA 4YONB 4A4DA 1XBTA 4NCKA 4U02A 3N5CA 5LBIA 3ZVLA 4PQFA 4BZXA 4GP7A 1KO7A 1XCGB 2IC5A 3FDIA 2WJHA 4ASUD 1RW4A 2IA5A 1PLJA 1OV4A 4JLMA 3PXGA 1E2EA 1II0A 3UPUA 5CITA 4US2R 3TH5A 3VR6A 1KI6B 1WB9A 3E5HA 3AF0A 4XOIA 2BV3A 1F2UA 3KXLA 4LI0A 2FJUA 1IXRC 2JIZA 4BFZA 2ZJ2A 1ZM3A 1BIFA 3NG1A 1PVOA 2FU5C 3QIAA 5D3MA 5SZKB 1G7RA 2EFHB 5DI3B 4NU0A 1MKYA 4IFBA 1D2NA 1KSHA 2CL7X 4M1WA 3RS5A 4B3XA 4C0SA 1T3LA 2ZVQX 2WOJA 5FFMA 4NL4H 3D3QA 4Q1EA 1IXSB 4TTRA 1RE0A 3HU2A 2IYZA 1E2NA 1XMIA 1MR3F 1NBMA 2VSFA 1P60A 1E2QA 1F2TA 2RB4A 3WYFA 2BMDA 2O8CA 1D9ZA 3TKLA 4PZLA 4TMVA 621PA 2J59A 1NN5A 3QXXA 2ZYWX 4EPWA 4JLAA 4KYUA 1KI3A 3IPYA 5DHFA 1N0WA 3ZDQA 5AUOB 1G7SA 2QBYB 3X1WA 2G77B 1NG1A 3D31A 1LS6A 1M7HA 1KKMA 2WWFA 2R6AA 4LOAA 4WXRA 4ZDJA 3HU1A 2JLRA 5L3QA 1UDWA 2OBLA 2OV2A 2JJ2D 2ZI4A 2O8DA 3ZLJA 2AXPA 5CDFE 4RVCA 4UNSA 4A0HA 2OM2A 5TB5A 3BOSA 3CZQA 5HTKA 1R0XA 1EX7A 3EW9A 2WWHA 1OXXK 2HDNB 3PR1A 1WE2A 2V54A 3OE7D 3P4XA 2QAGB 3PEVA 1EFRD 3AH8A 4JSYA 2ZI5A 3UXMA 4IEEA 1CXZA 3KZ1E 3VQTA 2AR7A 1PLKA 4HZUB 4QGFA 4B35A 3T06B 1AKEA 1SVSA 3K0SA 4M1YA 4EAQA 1W5SA 1CKEA 1GUAA 1NVVR 2ORWA 3DO6A 3FFAA 1GDDA 1N6HA 4GRAA 3VR2A 1COWD 3U44B 2J0VA 2YV5A 4MRVA 5HPYB 3MLEA 1XEFA 4WBSA 5SZIA 2PMDA 2WM9B 2YC2C 4DLYA 1GITA 2PEYA 1G5TA 1S1CA 1II8B 1BMFA 4NBSA 1GKYA 3GJ5A 2ZE6A 1M7GA 4HUQB 3VFDA 4C0AC 1AGRA 3RVBA 1U8AA 121PA 1E79D 1Q1BA 1NP6A 2J46A 2D62A 5TV2A 3SHFA 5DYGA 2YWHA 4Q7LA 4Q1DA 3TRFA 2BEKA 5E95A 3SZRA 1E2JA 1YR7A 4Q1AA 1CJVC 2B92A 2C9OA 2BKEA 1X6VA 3LXXA 3P20A 1G3UA 3DMDA 3W3ZB 1KHTA 3FHOA 2VHJA 3JZMA 5DLQC 2WPDD 1Z0FA 3LW7A 1QDEA 5F3WB 4URYR 3N2EA 2G9NA 1PZNA 2J1LA 1WP9A 4QRHA 2OE2A 2VP2A 3RC3A 4AG6A 5J47A 4B2PA 1RKBA 1N6RA 2FF7A 2GDJA 3CRRA 2WZQA 2YOFA 821PA 2N42A 5G3YA 2NZJA 2NIPA 1ZP6A 4URZR 1KI7A 4CF7A 2YINC 4I81A 5J40A 2ZE8A 3H84A 4HDCA 4NKRA 5FOWA 2E9SA 2NGRA 1NSTA 4PPNA 4IDOA 1N5LA 1TMKA 2AD1A 5AJZA 2WWIA 1EFTA 4US1R 2ZETA 2WSSA 3U3OA 3KB2A 3GJ7A 4NYJR 2ZIAA 4UNRA 5HE9A 1KDTA 1R0ZA 2O52A 2PJRA 3O47A 4CVNA 2QT1A 5K8TA 1SHKA 1XMSA 4OQFA 1EESA 1XTQA 1SGWA 4TN1A 3FYHA 3VR1A 4G3XA 4AK9A 1KGDA 2IYTA 1G8YA 5TY0A 1G7TA 1NSFA 4BZPA 4DLRA 1BYIA 5JHHB 4DUGA 1LW7A 4FXPA 1YRBA 3C7KA 4D25A 1W1WA 2G0TA 3A4MA 1U8YA 1XD8A 3IO5A 3IDQA 4LX0A 1WMSA 2AFHE 5DIFA 3CM0A 2C03A 5LD2B 4PX9A 1E2MA 1RJ9B 1TEVA 1TUIA 3DOEA 3QG1A 1FTNA 5LDDC 1AM4D 5IK2A 1G4UR 2HLDD 1Q1ZA 2IL1A 4JVLA 4KFSA 1CJKC 5CB8A 3SJAA 5IDVA 5C46F 2QQEA 1E98A 2R65A 3B6EA 2OZEA 2ZRCA 3UATA 3PUXA 4EJSB 2V7QD 3WBKA 5KDOA 2MSEB 3TVTA 5DHAA 4WOPA 3IQXA 2G83A 2J0QA 4BUJA 4LC1A 1P73A 4QJ4A 2XEXA 3RS2A 1BO6A 3AP2A 4HLUA 4OHWA 2IXGA 1GFIA 4F91B 3UK6A 1NVUQ 4DT1A 4BRWA 1CEEA 1KMQA 2FSGA 3H86A 5L3SA 3SQXA 2IYSA 4BLRA 2JLWA 2W00A 4Q4JB 2GBLA 2K5UA 3ND9A 2ODNA 3DKVA 2Z83A 4XD7D 4BPBA 2NO0A 1XP8A 2PCJA 3CR7A 1CULC 5HE8A 4B3CA 4OBEA 4Q9HA 3WYAA 4L8GA 5DO9A 2D3WA 3ZVMA 1JR3A 4CEHA 4NH0A 4II7A 5C2JB 1XXHE 4KV9A 1GRNA 5AJXA 1FP7A 3ZZ0A 1J8YF 4S2EA 2XXAA 2WV9A 3C8UA 4R2HA 1N0UA 1R5BA 3IILA 4M2LA 4FMDB 4M9SA 5CYOA 2R6DA 1N5IA 1XJQA 4AURA 2IX3A 3ICQB 2REBA 2DFLA 1LF5A 1XMVA 4HYYA 4TT3D 1E1QA 2CVHA 5CLQA 1RC8A 4DDWA 4LJ7A 2Y8EA 1AN0A 4MRNA 3AVVA 1TU3A 2VEDA 1VG1A 1D2MA 2PX0A 3TJZA 4BE7B 1QHXA 4YMTA 1CLUA 1KI8A 1XMJA 4QXAA 1E32A 4TWZA 2J45A 4WZAE 1Z6XA 1HT2E 3QF4A 1QHNA 1E1RD 2P5TB 3WXMA 4ACAA 4C4PA 2YHSA 2DPXA 2GCOA 3RRMA 1OH7A 3UWOA 3QKSB 2P65A 4FWTA 3LD9A 1YU9A 4LK2A 5FTNA 1OYWA 1WQ1R 2EYUA 3EC1A 1W44A 5EE9A 1QZXA 1W5TA 2ONJA 1ODFA 3OIVA 2GESA 3QG5A 3ASYA 4TQUS 1RIFA 1L4UA 2OCPA 2C95A 3T35A 4BEJA 4BGDA 1R8SA 4IRUB 3MWLA 4RD3A 4XSHA 5KSPA 2XNDA 5EUMA 2FFBA 3M6AA 3TSWA 2A5JA 2BJVA 4LGMA 3QKTA 2VLIA 1VTKA 6Q21A 1A82A 5ELXA 3Q85A 1H8EA 2FN4A 2IYRA 1CU1A 4JBXA 2OFXA 1P9RA 4JMPA 4E5UA 5FUXA 1YJ5A 4JSTA 1AKYA 2G0NA 3CZPA 4QJ5A 4CW7A 4EKDA 1VMAA 1WA5A 2OUKA 1EG7A 3FE2A 2NQ2C 1CIPA 3LQRA 4WA7A 4PQRA 4UJ3A 4LYAA 2IK8A 3Q7PA 4O0MA 1CS4C 4FD2A 1LF0A 4RKFA 5EP2A 2REOA 5TVKA 2IEYA 1JXOA 2XX3A 4DDVA 4OHYA 2VO1A 1KIMA 3A1TA 2ZYTX 4NCIA 2ODWA 3THWB 1AS3A 2PX3A 2Z4RA 4UJ5A 3S1AB 4BASA 1R8QA 5KO2A 3IBYA 1N5KA 3GD7A 1YHNA 5FUVA 2ZR7A 1XJ0A 3M4YA 4GBMA 3BIFA 4PC7A 2XZLA 2X77A 4UKDA 3B1XA 4EFNA 4Z1MD 2CHGA 2AD5A 1U98A 2IS6A 4NZYA 1IJFA 5G40A 5KYKA 4QHSA 2OESA 1BKDR 3C5HA 3U3MA 1J2JA 3IIJA 4WW0A 3O8DA 3B1ZA 3Q72A 4Q4LA 3I5XA 2F1IA 1OYYA 3RYTC 2W6JD 1MOZA 5DISB 4JLBA 3B1VA 2FG5A 3QJYA 2J7PA 4IDNA 2ZUCA 1SVOA 1NKSA 3TR0A 1MO6A 3MSXA 3W9YA 4KLZA 2JDID 2QE7D 3LVQE 4W9MC 3FMPB 1VG0B 4GOJA 4MGKR 5C4MA 4A15A 2J41A 1I2MA 1MO5A 4GSYA 3WMEA 1TEXA 2AXNA 1QG4A 2DCUA 4PANA 4LCBA 3SFZA 5HZKA 1N25A 4NYMR 1N5JA 5G41A 5JCZA 4IOKA 3VR5A 2EYQA 3AVYA 1EWRA 3EIHA 4C0KA 2ZRNA 1Z2AA 2NG1A 4A0GA 1NY6A 5F2EA 2R62A 3QKUA 3OHMA 3I1FA 1DTSA 3BD9A 3K9NA 1CR1A 1Z2CA 4BLSA 2O8FB 3EARA 5EE3A 4MYHA 2ZRLA 3MRSA 3PUYA 1MABA 3KB1A 1RRPA 4XTCS 5DN6A 3SJCA 2XOKA 4BLPA 5EE5B 1KNXA 2FDCA 2H5EA 2F3RA 3U5ZB 4LHZA 4ZV4A 1DEKA 1XD9A 4IFEA 4DIDA 1MO3A 1ESNA 2JJ1A 2RGAA 4Q5IA 1HA3A 4F38A 2ZVPX 4U5XA 2ZRFA 1C9KA 2YVUA 2B7BA 1DG1G 1OB2A 3K0AB 3U4QB 2JJ8A 4EUNA 5FTLA 3C4JA 3NEYA 1QG2A 1CJTC 5FOSA 2J0UA 4HB4A 2ZROA 1T6NA 2GCPA 3TW8B 4AYXA 1P9NA 3EPHA 4YXWD 3EZ7A 4D0LB 1UM8A 5E7MA 1JJVA 3O8BA 1F2UB 4GNKA 1P2VA 1R0YA 1SXJE 4YMWA 1U90A 4JBWA 2UVQA 4FCVA 1R5NA 1JPJA 3A4LA 2O8EB 4R98A 3NEJA 2XB2A 5KPDA 1NI3A 1YZGA 5D3MB 2OEPA 3BORA 1KSFX 5K8IA 4ERNA 1X8KA 2X2EA 4B34A 1S9DA 4Q7MB 3KQLA 4LBWA 1EX6A 1P75A 2GZHA 4IKEA 1OH8A 4A0RA 3MGCA 2G1KA 4JS0A 2A5DA 4NPHA 2OLKA 4HB0A 3DZDA 1OIXA 1YE8A 3MWJA 1F2TB 1ZAKA 2JAQA 3N70A 4UXJA 2O8CB 3SBDA 4NYMQ 3A37A 1NBMD 1SVWA 3NH9A 1WCV1 2B7CA 5CK5A 3CB4A 1E2FA 2H1LA 3GJ0A 3OIWA 1FP6A 1M34E 4GL2A 2WIAA 4W5JA 5KDDA 2BCJQ 5JRZA 2L0XA 3UWKA 1X1SA 5AUNB 3QPVA 2ANCA 1QVAA 2C9CA 4MA4A 5L3QB 1SXJC 2GNOA 2YOHA 3AB3A 1ZD8A 2BMJA 3PFIA 1VIAA 1CR0A 1VYVA 2ZAMA 5IRCD 1MRNA 2O8DB 1DVRA 2V55B 4NE2A 4PSAA 4O25A 1KJWA 5TMPA 5CDFA 1N6NA 2XJ4A 3K70D 2VHCA 3L2OB 4C0JA 1G6OA 2AWNA 3AGPA 5KSZA 4A8JB 4CRWB 1G18A 3I62A 1GKIA 1FOEB 5BN3A 1R2QA 3BH7A 4PHFA 2Q3FA 4QBGB 1P5ZB 2QM8A 3AM1A 3W8RA 1KK3A 2XJ9A 4JKYA 3T12A 2D74A 5L3VA 4ZIRB 1YZNA 4KODA 1XPUA 4G5SA 3JVVA 4B3FX 5KNCA 3VU9A 5FL7A 5FTKA 1M74A 4D4MA 4US0R 3I4LA 3VX3A 4OK6A 1KDRA 4Q02A 1UEIA 1W49A 4ZDKA 4ZI2A 5J4HA 5FOTA 2X19A 4HATA 5DE3A 2HJVA 1Q57A 3I92A 1B0UA 1RZ3A 2XSZA 1P61B 4Q1BA 3ZQ6A 1CR4A 1JXMA 4PO1A 1E2KA 4MYUA 4G5OA 2W2TA 2V6JA 2GRJA 2IS1A 1SVLA 3ZVRA 1GZSA 1P7CA 3LY5A 2YZ2A 3IO3A 5JLJA 1GIAA 2CXXA 2RHDA 3KUCA 2ZJYA 4MDEA 1W0KA 2Q9CA 3DZ8A 1F48A 4BRUA 1J99A 1Z6YA 1ZW6A 1A2BA 4OKSA 2FNAA 3AGQA 2FSIA 4AYWA 3TGPA 3AVOA 1JPNA 2C99A 2JLZA 1FQJA 4OJQA 4PSVA 4ARZA 5EXSA 1IN7A 2IEZA 2LKDA 2BDTA 4M8NE 3EZ9A 5BWMA 4HDOB 4OJKA 5EE1A 4W7SA 4ON9A 4N3NA 2DHRA 5CLLA 1LY1A 1V43A 2ATXA 1AZTA 2ZU0C 3GEHA 5GJVC 1VKJA 4A6XA 3PQCA 5CIQA 4QBFA 4R9UC 3T61A 3OEHA 2G6BA 3RS0A 3SBEA 2GEUA 4B2LA 2X8AA 2W2VA 4UXIA 4PSKA 4QBHA 1I2DA 4V0ME 2WSMA 1NN3A 3SDZA 4RD4A 5C18A 4MQBA 3W90A 1KO5A 2ZJOA 4TLAA 1Z63A 2F1RA 3TQFA 5FOVA 5AJWA 1G8PA 1UDXA 2WSSD 1ZCAA 2ZR0A 3B1YA 5C4GB 2OBMA 5DYIA 3OAAA 1VDZA 2WMOB 2RGDA 1GOTA 4KBGA 1ZNZA 1Z6GA 4JLPA 5HR5A 3NDBB 4OQNA 4GI7A 2HYIC 1DOAA 2OBNA 3QOFA 2AK2A 3CONA 4XVUA 3MUFA 3RS7A 1EFUA 2QA5A 1DO0A 2B6HA 4MGYR 3LO5A 4WXPA 1S3SA 4RZ3A 1UBFA 4DUGD 4Q4AA 4DC9A 2Q9AA 4MKGA 4EFMA 2BMEA 2VP0A 3BRWD 2VHQA 1XTIA 3RS4A 4DBLC 1E9SA 3WHLA 4GOKA 3W6PA 4PC2A 5FBLB 2FSHA 2WAXA 4AKEA 2GJAA 5J4LA 1E2GA 2BBWA 3KKOA 4DLSA 4Q47A 3LAWA 2QEQA 2CDNA 5LPNA 3QQ5A 3GLIE 3CR8A 5IK2D 3I72A 2NMVA 5P21A 1Y63A 4RJLA 3IPXA 2IHBA 2R9VA 1U9IC 2HYDA 2OAQ1 4Q9KA 2HV8A 4LHWA 4HAZA 4ZPXA 2VP5A 4AIIA 4BFUA 4C0LA 1LNZA 4EPYA 2MSCB 2CJWA 4E22A 2I1VB 5HKKA 5KTYA 2XB4A 3B60A 2FSFA 2Z5FA 2BWJA 1LV7A 2F43A 4PPGA 2OSBA 2C96A 2D2EA 4IDQA 3THXA 4LBYA 3B85A 3GEEA 4DT1B 2YWGA 1EGAA 3WNBA 1OFIA 4IVRA 4P3YA 5L3SB 3GEIA 4AD8A 3MCAA 2H17A 5HZHA 4TYYA 4IOLA 1DBSA 3NIBA 1E4YA 2FPLA 2R44A 3H2YA 3CF2A 4WZ6A 2KE5A 2ERYA 3K0CC 3I3SR 4TQAA 1KI1A 5JS7A 5EP4A 4CEHB 2GETA 2PEZA 3HPRA 1GILA 3K8YA 4B3GA 4TLEA 1UJ2A 3HPQA 4B74A 1KNQA 3AKDA 1JR3D 4HLDA 2OCAA 1KO4A 1XXHA 3WBJA 1DELA 1T9HA 2QPTA 5JEEA 2IT1A 1P2TA 1VYUA 4O2RA 1XD2A 2XXAB 3D8BA 4QG7A 3AUXA 1HV8A 2KB0A 3P27A 3QKRA 4I1VA 4RD2A 3GLHA 3UMFA 1RVDA 2RAPA 1S2MA 4QJ3A 4KO8A 2RGBA 1G41A 1YR9A 3W6OA 5E7IA 1Z5ZA 4FW9A 2GAOA 2IUUA 1Z47A 1J8MF 2B8TA 1X1RA 3TUIC 5CJ2A 1N2CE 1R4AA 3TE6A 5FPHA 3B9QA 3SJBA 1CR2A 4M1KA 2OHFA 3SC3A 3QF4B 4L16A 2FH5B 3OFNA 2ECKA 2GCOB 3CWQA 3GFTA 1YKSA 1HH4A 3LH5A 3GJ3A 1SHZA 2P6RA 1OPXA 2FA9A 4M21A 4P31A 1S1MA 4M1TA 3ICEA 3GMTA 3L0IB 1NN0A 2VSOA 4NYIR 5J4KA 2J7KA 2QMUA 4DSUA 4OHZA 1OF1A 1VG9B 4HB2A 1N6IA 3V4FA 4YQFA 5BXQC 5K8UA 2NPFA 1LB1B 4AC9A 4BLQA 3V00A 4A1FA 1G3QA 1L4YA 2MMGA 4JLVA 4XVQA 1T8TA 1NVWQ 3NWJA 4HEJA 2V3CC 4KFTA 4Q1FA 1NLZA 2XNDD 3LBIA 4LYHA 1FPMA 3QF7A 3TQCA 2IS2A 1PUJA 3QI2A 1QHYA 1N6PA 2WJJA 3GLFE 4JVSB 1JEDA 1Q44A 4FCTA 1OXUA 1H8ED 4LRWA 4L15A 2ZR9A 2JATA 3NVAA 3CBQA 3NDPA 3VMFA 5DNYB 3AVWA 5FBQB 3PCRB 3LBNA 2IF2A 2JGNA 4F93B 4LJ5A 1CRQA 5LB2A 4C7OA 1Q22A 3NHBA 2QN6A 2VPPA 4WAUA 1VG8A 3TR5A 3DKPA 1IN8A 4HI0E 1G4AE 2QU8A 3BJIC 4PZYA 2FZLA 3QXJA 1X8LA 1W36C 4PAOA 4DB2A 4C0HA 3CRQA 4DXAA 1KSJA 1ZRHA 5IF9A 4KVAA 4J0QA 5SZHB 2ODEA 4TSFA 4LDJA 5FR2A 3WP1B 2FFHA 1N3BA 3EPJA 3L82B 5UKDA 1AS2A 4TMWA 3QVVA 4A2QA 3T1TA 2OT3B 2ZS8A 1GTVA 5HCNA 3EXAA 1OXTA 2ZEJA 1DAHA 3WRYC 4B33A 3U60B 1BH2A 1DS6A 2A5GA 3TUZC 2ZE5A 4C2UA 2KBEA 4R7ZA 3K53A 2BHRA 3RNLA 4D6PA 1ZM2A 4DSNA 3FKSA 2J7PD 4NCJA 4PTLA 2HT6A 3HR7A 1NVVQ 4NTZA 1Z0DA 1WRBA 3P1JA 4X8HA 5FOUA 4CT4B 3V4RA 3RDPA 4C30A 4HAXA 2A30A 2P3SA 5TXGA 1JEEA 2V1XA 1DE0A 1XJCA 1C1YA 3KTAA 3GCGA 4CEIA 1NMXA 4E09A 1T5LA 4Q9JA 2CK3D 4P4SB 4P32A 1IAQA 5FH9A 1MV5A 5FBVB 1RRGA 3A4NA 1TTTA 5BYJA 1UKVY 4V0LA 3TLXA 1KZGB 3AQ4A 4UNPA 3KKPA 4LJ8A 4AKHA 3RRZA 2R6CA 2PBRA 2V9PA 4JL8A 4NONA 3DM9B 4BFXA 1AK2A 3B82A 5CJPA 4NMMA 2N1BA 1HEIA 2WOOA 4TMXA 1MABB 4AWXA 4I99A 4D4LA 3K0EA 3Q7QA 1N0VC 5E4FA 2IHYA 4AG5A 2BM0A 3QBTA 4GDFA 5HCIA 3ZIAD 4KHZA 2XOKD 1G5PA 2ZYVX 4LC0A 4YDHB 5KHOC 3NC1C 4MGIR 3KFVA 4JIMA 2Z0MA 1KI6A 521PA 2QENA 1IY0A 4KSBA 1PJRA 3CRVA 1U99A 1KAOA 1W7AA 2QPAA 3AEZA 1TADA 3C15C 1TQ6A 4DLTA 2GXAA 1ESMA 1GG2A 3JVUA 4RD6A 2PZGA 2ZUBA 1GRRA 1T0HB 1G8HA 1JAIA 4Z8XA 2UKDA 3SFVA 3GJ8A 1XX6A 1Z6TA 3EIEA 4EFLA 1CBUA 1Q0UA 4NHOA 4KXFB 4LV6A 2J9RA 1ZINA 2ZTSA 4GOXA 3TUJC 1UADA 4NYJQ 4DCTA 2CLDX 4KBFA 3TBKA 1SXJA 1U0LA 2YWEA 4BLTA 3RABA 4K81B 2R6GA 4JL6A 2J3EA 4M0LA 3HJNA 2AWOA 4DIEA 4V03A 5AUPB 2ATVA 5TDHA 3GLHE 2GCNA 1Z06A 1W4RA 1NF3A 3ZS8A 4PAQA 2GJ8A 3T1VA 4B6EA 2QAJA 3QE0A 2BC9A 2QQ0A 4LV8B 4MITA 2ZYUX 5JZVA 5JJLA 1QHHA 5AUQA 5FPYA 1A7JA 3TW4A 5H1YA 4JZKA 2PLRA 2WHXA 2GKSA 3F5FA 4M9QA 1FUKA 3KXKA 4L9SA 5AJYA 2PH1A 2NO9A 3UIEA 3CPJB 1JAHA 5EJEA 1YVDA 3U7GA 2JLUA 3R7WA 3X1ZA 1CJUC 3VHLB 3OE7A 4JT2A 1H8HD 2OXRA 2EVWX 2MMCA 2RHMA 1P9WA 3KFXA 1K5DA 4M9XA 3R20A 5H68A 3A1UA 3H0KA 5JMTA 5BQ5A 2F1HA 3AVTA 1HTWA 4W5WA 4KFRA 3LRPA 1FX0B 1TX4B 3H4MA 4M4SA 1VCIA 4B6FA 3FOZA 1LVGA 4QBIA 2OFWA 2QGNA 2QRNA 3I73A 4X8OA 1FMLA 1H65A 1M2OB 2GEDA 1Z83A 4Q19A 3ZVNA 1RFLA 2P0EA 1VCNA 3IEUA 3AKCA 4IEIA 1P3JA 4FIDA 3AF3A 3BB1A 2Z43A 1D5CA 4OL0A 4A9AA 1E94E 3K70C 4Q21A 4UXHA 1SZPA 3VU9B 1XB2A 1NMZA 3BAFA 3GJXC 2O0JA 2CL6X 1HE1C 2J87A 4X8MA 3R9IA 3U61B 3IIKA 2ZRMA 1R7RA 3U7EB 1YR8A 1M8PA 1Q12A 1Z0IA 2UZ3A 2VP4A 3A1SA 3LVRE 5EP1A 2DR3A 2QT0A 4JBYA 3BE4A 4PPQA 3WY9A 2IW3A 1E9FA 1T91A 2PJZA 1TQ2A 4ZKDA 2P6NA 2GWHA 2UZIR 1IJEA 4MUAA 4V02A 3E2IA 3F3YA 1KAGA 2C9YA 2XSZD 3EZFA 4PC3A 4JLNA 1PUIA 1J7KA 1GP2A 1KDOA 4O3MA 2A78A 4TYPA 5KSOA 3UG6A 1W47A 2AFIE 1WDTA 1ZNXA 1C4OA 2PL3A 1OIVA 3GQBA 3OZXA 5J4YA 4N1AA 3WP0A 1XZQA 2C2HA 3U3RA 4C0BA 4RZ2A 3RWOA 4B76A 1EFHA 1W0KD 1OW3B 3QY0A 5FPSA 1DAFA 1G21E 3AF1A 3KXIA 3WYGA 1JB1A 4ARZB 4KITB 4A36A 3VHXA 1MT0A 1QVRA 5B57C 2Q3HA 3AF2A 5KNBA 3LX8A 1VCOA 2CLCX 1G5RA 1G6HA 3TSZA 4DSOA 1OHHD 1M7BA 3LQQA 2H7VA 2GK7A 1IY1A 3IHWA 4PO9A 4RZXA 4EDHA 2TMKA 2XTZA 2NZ8A 4BFTA 4V0NA 3FHTA 3SHWA 1XPRA 3THYA 4EQ6A 2IYXA 3AP3A 4UQOA 1KK0A 5M04A 1ZYUA 2CE7A 5GJCA 4YLGA 2W6ID 2F6RA 1Z08A 1EK0A 3GJ6A 4V0MA 1SKYE 2CE2X 2EWVA 4JJKA 4P0TA 3CPHA 1CTQA 1AS0A 3RRYA 2HJGA 5JI3E 1G16A 3PUZA 4V0KA 1NLFA 4JLOA 1U9IA 3W3AA 1KSGA 4DKXA 4LUCA 3OEED 2Z6VA 3QXHA 3MMPA 2WKPA 2ZS7A 4A82A 5KOYA 1RJ9A 3R8FA 1TF7A 2OILA 5JWRA 1Z3IX 3OAAD 2PT5A 1OKKA 2W2XA 5CM8B 4D4KA 2V7QA 4MYCA 3NHAA 2VHTA 3VKWA 3SNHA 2WWWA 5KUTA 1G8GA 1E2PA 1GAJA 3GFOA 2WICA 4Q4AB 2I1QA 3M1IA 1KK1A 2ZM5A 3FTQA 3KL4A 4RSGA 3CRMA 2QRZA 2IXEA 2JLYA 3P32A 1I4TD 3IHLA 4B3BA 1ZNWA 4IDPA 1YZLA 4EPVA 2GVZC 3K0CA 2GILA 4QHYA
chains in the Genus database with same CATH superfamily
4XGKA 3VVLA 3WVNA 4BNDA 2HIAA 3PSAA 1CDZA 2ZUDA 2QLLA 1X8JA 3ABRB 3IDOA 3IOMA 3BK7A 2JFGA 4XB6B 4YMLA 2WYVA 2ACWA 4ZCPA 2X22A 1VGRA 2NO1A 1QF6A 2OXFA 3PQ7A 2JIZD 1IB6A 4UM7A 1S89A 3OH8A 3JSAA 3KSMA 1V4BA 3BJRA 3CW2A 3KFLA 4WKPA 3TAUA 2DR0A 3DYVA 2X76A 4ZOAA 1RLOA 3PJFA 2ZRKA 3NVDA 1Z4IA 3FFBA 3KJGA 4J9UE 2NVWA 4UCQA 2A9FA 5LYYA 5KQLA 3W6UA 1SVNA 1NYTA 3B78A 2EZ4A 2LCFA 2Q6KA 1RNLA 2RC5A 3EH2A 1X9IA 3QV1A 1KO8A 1GVHA 2QN2A 1EUDA 4MWCA 5EIBD 5TVGA 3WBFA 2AVDA 5EMHA 3K4PA 4RCYA 5JNTA 1QQ7A 1SEVA 3PX7A 5KQGA 1F0KA 2FE4A 3EOZA 1XZAA 2ODTX 2O0LA 3KHTA 1PNQA 4X7RA 3EXG1 4TS4A 4ZT4A 1WTAA 5CM9C 2CVFA 2FSSA 4P34A 5J4VA 1BWSA 2B8JA 1FSGA 2VP9A 3G2KA 4TT3A 3D59A 4E1AA 3OM8A 3DDCA 4PC6A 5DXAA 1U8ZA 2DZDA 4UZSA 4F8YA 3FMIA 1BOOA 3M3PA 4IW3B 5B2FA 5KVSA 4EUFA 1G3RA 2XZOA 1TRHA 4BAGA 1J0CA 3GGGA 4N76A 1VGVA 2W43A 1UKEA 2B4YA 2W6NA 1ZD5A 2GEBA 5EVJA 1G64A 2QTGA 1XXHB 3C48A 4WESB 5LOVF 3I53A 1NQ5A 2FZVA 3PPXA 2P40A 1SWVA 2RG7A 4HWRA 3IJ5A 2L2QA 4EZEA 2PKYX 2QNBA 1E5LA 1R0CA 2AIRA 4IQ8A 1JKMA 2AG5A 3QKRB 1M2GA 3H6HA 4JP2A 5ELLA 5I9IA 3IVRA 3CTMA 1IHOA 2VG8A 3H99A 1V9CA 1RRCA 4GSKA 5A9TA 4EM6A 5JI2E 1AQLA 5C35A 1Z2OX 4G1FA 4DJDC 1POXA 1U5AA 3AEQB 3KC2A 3H5OA 2FUG1 3D43A 3AHGA 4QZVA 2D7DA 3BULA 1JSLA 3D1VA 1ZOIA 4RK1A 4QYIB 5J58A 5G0TA 1FJXA 3BFVA 4OB8A 1NBWB 1PQUA 3ONNA 3F71A 2Q21A 4QQNA 3AVXA 3AR7A 1DMSA 1LFDB 3ND8A 3JW8A 3NV7A 1H3EA 1Z39A 4LY6A 1FZQA 2G88A 1NPDA 1JE1A 4PO3X 2M98A 3FBWA 1F60A 3L8ZA 4YRIA 1T0PA 3PZBA 2YH2A 1ISPA 2ODBA 3H75A 3DBIA 4POAA 5CH3A 1O97C 1DQZA 2WIBA 1JJIA 1ZN7A 4L27A 4Z9YA 5IUKC 5IW8A 4C76A 4AX4A 5BN5A 4XWTA 4CDMA 1W46A 1TM4E 3D3NA 2GDZA 4HGRA 5FAKA 2PBFA 4S12A 4JVOA 4BKPA 1V25A 4QFDA 2ZVDA 3EWNA 1U0OC 3NETA 1OE0A 5KAMA 2FV8A 1U0GA 4U39A 3Q3EA 4XTRA 2JH9A 4H6PA 3H1AA 1F20A 3MIZA 2RCYA 3OUUA 1BS2A 3G2LA 2O3SA 2PRZA 4EARA 4CM9D 1Q20A 2R86A 2WM8A 3CXUA 3FJ1A 1Q5PA 1R6AA 2YS7A 1VBKA 4R3UC 2NPOA 3FKQA 4EG3A 4C7OB 1ZUD1 2XNSA 1FPQA 4JCCA 4KXMA 3U49A 3R2JA 3W06A 4DCUA 5CAEA 3AVUA 2IYUA 4XWYA 1DLIA 1ZMBA 2C8VA 4KTTE 2Q1SA 2WRZA 2HF9A 3BXFA 3CPEA 3TFQA 3NBFA 5ABPA 3DL0A 1V39A 3TCNA 2IHTA 2AL7A 1DADA 3LDAA 2CMKA 5F3DA 1XRPA 1L8AA 5ADHA 1HQCA 1IUNA 1DEAA 2FW9A 2VJAA 3KHSA 4MRMA 4RFSA 3RTGA 3WGJA 2UYQA 5BMVB 2RGRA 1B16A 1GN9A 5B1EA 2QS9A 1XG5A 2ZTLA 2CXRA 3GGOA 1XRJA 3JZFA 3P96A 2IVFA 2DP4E 1QHSA 3G2OA 4LZOA 5GGYA 3OFKA 1J1UA 4IY1A 2ZJ0A 1CX9B 1LTHR 2OHIA 3P0RA 3U0VA 4AY4A 1QO0D 1D0VA 1Z37A 3UAVA 4F1KA 2QVBA 3FMFA 1DU4A 4KI7A 4ZKEA 4MR9B 1NPTO 1Q21A 1CUSA 2Y3IA 3T4XA 4WUVA 1PV4A 1YVUA 2ZRDA 1U0RA 4OUDA 1A9YA 4RACA 4ALJA 2Q9BA 3VISA 4KE9A 3AR9A 3CG0A 3PNVA 5A1TA 4LTNA 4C4ZA 1N1GA 1DIRA 4GBED 4ZAGA 5BRJA 3ESBA 3VX4A 3HJFA 3A58B 3C3MA 5FL3A 4MVJA 2RKOA 4ZVUA 1VIYA 3V4LA 1U81A 2YHUA 3D4BA 2HSGA 2ZWOA 3BFKA 4RY8A 5ED0A 2WKRA 4Q9LA 2ZI6A 4B6GA 2AW5A 2FPUA 4ZCLA 4GMXA 3D6HA 2WYWA 4EMBA 5CDYA 3ASZA 2OV6A 1YKFA 5NULA 1EK1A 4HL6A 1UMDB 3MTJA 4KOAA 3KEMA 3KDSE 3U1VA 5CEEA 2HNKA 1FYFA 3RVKA 3RODA 2W7TA 4J3NA 3WHPA 1QYCA 1W5AA 2ORYA 1S96A 2WTEA 1U0HC 5FPKA 5EZYB 2CF5A 4P3OA 6CHYA 4OVKA 1QDLB 3GVXA 4YVFA 3PKZA 3BWEA 3QFCA 2OLJA 2AOVA 3CLVA 3IOBA 1R9JA 4Q4HA 1YI0A 3DZFA 5AW9A 2UVDA 1ZHOA 3LQ2A 3F67A 1QH0A 2GF0A 3C8MA 5C5DA 1CYEA 3ACCA 1DIHA 1Z17A 2GLXA 2Y76A 3B13B 1PBTA 3ROXA 5KNCH 2XDAA 5GZ6A 4TS1A 1R6DA 4JYPA 1UZLA 4DR4B 1U63A 4C3UA 1MH1A 1XFDA 2AE1A 2CFTA 1T8YA 3D7LA 1T4GA 4MZXA 4F2GA 4WACA 1QP4A 3FNEA 3NHMA 2PX6A 3GEBA 3KU1A 4WN9B 3W1WA 5CBPA 2UUBB 3DWIA 5JJKA 1G291 2WABA 4X3PA 1XQ1A 1NP7A 3UQYS 4UNIA 1F4VA 1BQ4A 1T5BA 3ZJTA 3BIJA 1RABA 2PANA 2R751 1QHIA 4ZC8A 4ZI7F 5K8LA 2EGGA 5LWQA 2O8EA 4XLTA 4NC9A 4QVKA 3VH3A 3WB9A 1F51E 1Y7TA 4R0MA 2H1IA 5HX7A 4HAWA 1J2TA 1KY3A 1Z88A 2GCGA 3HBJA 3M3HA 3OFSA 4JLDA 3RKRA 3VBEA 4C87A 1FP4B 1SNYA 5AK0A 2FHSA 2A0UA 2JBWA 2YMLA 4CEJA 5A4KA 3VAAA 2PWAA 1FSFA 4JR1A 4WOBA 4XKJA 4F4CA 4U7TB 3AJAA 3EGXA 1P7YA 4FFPA 3A8TA 2EZ9A 5LLTA 1PJAA 3OPYA 2R00C 1EZ1A 1OX5A 4REQB 1QR2A 4R1QA 1NIJA 4EY4A 5DMXA 5IBPA 1SXJD 1TL7C 4MDFA 5KS2A 3VR3A 3DFFA 2MU1A 2VBCA 2B25A 5FTWA 4ZCMA 5IJZA 4MW5A 4W9NC 3SU8A 4DN6A 3KUKA 5B2ZA 4LGCA 2G17A 3F3SA 2FFRA 4JVMA 1KE2A 3ESRA 3L0OA 4TYNA 4HDRA 4FI3C 2FGJA 3LY9A 4WT7A 3UB2A 4Q9DA 3V34A 1KRXA 4R8MA 3QU5A 3SYNA 5JS6A 3CYFA 2PS1A 3K09C 2Q28A 3COYA 4M0UA 4BOYA 1KOFA 2DBQA 3BXOA 3HRKA 4ZRMA 3IE0A 3IXQA 1VDMA 3EH1A 3CE9A 4L9AA 4AJHA 4HD8A 1H5NA 3R7WB 5C1BA 3H9UA 4YK7A 4YDQA 3OWHA 5HTOA 1FFYA 3AV0B 1P0CA 1UJ6A 1WF3A 3HS3A 1AQNA 3LWZA 1E0SA 1R5OA 4GXQA 1UBEA 4EKYA 4A8JA 2E5FA 5HIAA 3O95A 3ZE2B 1ZO8A 3E18A 4J2OA 3LYLA 4MCAA 1TCCA 1X2BA 3FPJA 4QU9A 4Q3OA 5EXTA 1LPOA 1SBZA 5JSKA 1I0LA 5I5EA 2IU3A 1KY5A 5MF6A 3DMNA 2ZYRA 2B2NA 3EXEA 1E2HA 2YUTA 4GX2A 4M6WA 4ZDWA 1HL3A 1HLDA 3WGVA 1C7QA 1OIWA 3I2GA 4YP5A 1DRWA 2IYNA 3TQOA 4EW3A 3BEOA 4B85A 5AVYA 3LNCA 3BS4A 3CZCA 1PFWA 1W0JA 4DCOA 1E9RA 1S3GA 4F4IA 4J0KA 1ESEA 1ZGGA 4PBRA 2CSUA 2V6IA 1I1QB 5DCYA 2HDHA 2X6TA 5EXXA 5DBIA 2YR0A 3VR6H 2AXQA 4NPAA 1HYGA 2AYZA 3KJFA 2LTAA 2OFPA 3T3EA 4CQMD 1WPQA 3BRCA 4CQNA 4Q18A 3UN1A 3QVGB 2QP3A 1E9BA 1PJ4A 1ZRSA 3C16C 5EMKA 4MRSA 3V4OA 4DWJA 3A4VA 4UPEA 4XCVA 2CHEA 3OIFA 1GWNA 4MKHA 3GROA 3IT3A 4ZMRA 4JXXA 2OLEA 2R47A 1UC4B 4IVPA 4XWKA 2K6GA 3LFUA 3LG2A 2FPSA 4F7WA 2DWOA 2P2DA 1B00A 1E92A 1L5ZA 3DKKA 3NBYC 4IDDA 3DEZA 3UV3A 1GZ7A 4NAVA 3K1AB 1ZITA 3QXCA 5C52B 3R3SA 4RM2A 4E08A 2OY0A 3WMFA 5IHXA 4KKVA 1PZFA 3EX7C 3H9CA 4LC9A 3GQBB 5CCBA 2Q0HA 2ZLBA 4BB6A 16PKA 2DKFA 1UT8A 2C5EA 1DG9A 3Q9LA 5JYBA 2QR5A 3W8EA 2JFBA 5J9FA 1QBKC 1O89A 1UFOA 5EZ6B 3RSQA 5K7SA 3OESA 1E9EA 2VSQA 4TTQA 4OUKX 4IG4A 1EFCA 2OYRA 3RBZA 4BZQA 4DZZA 1Z26A 3LHDA 2EQBA 4EYSA 2D5AA 2IYVA 3N8GA 4JJ4A 2WMDA 3GEPA 3WK6A 3EA4A 2EKQA 4J76A 3UV6A 3WQRA 4DIOA 3NOVA 4NS1A 5DF1A 3ES9A 1S8NA 5FEUA 1W2GA 2J33A 5FORA 2VSXA 4QFMA 1J5PA 1ZC3A 1XALA 1HE8B 5L4LA 3NC4A 4KVZA 2ONKA 3KKMA 3WKDA 1JECA 1NRJB 1SG9A 4NABA 2EP5A 1UP4A 5KNBD 3GZJA 3QH4A 3A70A 4RD1A 2BGKA 2HA0A 3THYB 1PDWA 1MMFB 1WHTA 2YN4A 4UULA 1GU1A 1IUPA 3UFXB 5A9RA 3WNZA 4P81A 2LWIA 4BMDA 4RMIA 5AQ1A 5KOHB 1WCWA 1W8IA 2WM2A 3VR5D 5K8VA 3P9CA 4XWWA 1OFTA 4P4UA 3CCFA 5TR9A 5DNVA 1DAGA 3U4DA 2QMEA 1NJFA 3T7TA 3AY3A 2JFZA 1X7XB 2ZQ5A 3VPBA 4PU0A 1EK6A 2QTFA 1B1AA 1CLEA 3D6NB 1X74A 2I5PO 3EMBA 3BRWA 2OBXA 3M4NA 4Y2GA 1T4DA 4D9HA 9ABPA 1KI4A 1UC8A 1T34A 3IT0A 3HCNA 3OF3A 3ZHTA 3GGSA 2VRWA 5BOSB 5KNLA 4FSHA 4MIKA 5M2QA 3CH6A 5DN6D 1UMCA 4JB2A 4RE5A 4MKIA 2DTEA 4X7PA 4L5CA 2Z6AA 4Z49A 4Y3UA 1VMEA 4QPZA 4GSLA 3IB6A 3JQBC 1UR5A 3JQCA 4RSRA 2C4UA 3LBYA 4UARA 5CH8A 1NWHA 1QC5A 5GP1A 2P1RA 3Q8XB 3REFA 1GSHA 4F2PA 3RJ9A 4ZCIA 5IHPA 2AQKA 4DMHA 1SJ9A 2R87A 5JMOA 2F3QA 1VZ3A 1YC2A 3GFPA 4OJTA 1PFKA 3KBOA 4GZ5A 5FPPA 2IBMA 1JR6A 1GQYA 1NPYA 4XVHA 1P5JA 1WNTA 2J0UB 2N46A 4RVFA 1SK9A 1LDYA 5T67A 1QOPB 3WMWA 3FOEC 2IYQA 2NWQA 5AKZA 5JW6A 3OOWA 4DVGA 1J0DA 1XEXB 1ORIA 2QLTA 3QEOA 5TPWB 3QUTA 1DKUA 1VHJA 4HLQB 2W4MA 2B1RA 4HWOA 4F1JA 1Q0RA 1ZFNA 3F6CA 3KKEA 3OCXA 4J94A 4Z7QB 3HWWA 2QX8A 2FEOA 4TL8A 2FEPA 4IXMA 4DG8A 4BECA 1C1XA 1KPHA 1D6NA 5B4TA 3R0XA 4HAUA 4B47A 2JLAA 2OTCA 1KI2A 1V2HE 3GF4A 2NU6A 3GLTA 3IBFA 5EZ5A 3ECAA 1PRYA 1V1RA 3LYUA 1JHDA 3TI9A 1Z07A 3KDPA 3LTEA 2J0SA 1OXVA 5TARA 1NW7A 3B1JA 3ZHBA 1AIPA 2ERXA 2JJ2A 3ORSA 4AJNA 3GPBA 5HJ2A 3U40A 1X2EA 3IUYA 2HQSA 1D1SA 3PPIA 1TAGA 1XTJA 4JEHA 4B46A 4BV3A 1E89A 4MUBA 1W88B 5LZ5A 4F56A 3WDMA 1UMKA 1A2QA 2ADOA 2K87A 3B3JA 4MRPA 5BV7A 1T6XA 2ZWVA 1BJKA 2PLAA 3K1JA 3L7NA 3QOXA 5DEIA 4JI7B 4MKXA 1SQ5A 1FRNA 2C04A 3QLUC 2GTIA 3KQHA 5LA6B 3ESQA 5CX4A 1LPAB 2YXLA 1Q6YA 2DTXA 2QUZA 4GBGA 4HWGA 4UMFA 4A0SA 2OBYA 3H9JA 3L4KA 2IY9A 5H70A 1I4DD 3UKJA 3MLBA 4NK5A 4D9JA 4MI1A 1GNPA 4PWYA 2HQ1A 4G5RA 4UHKA 4DILA 3MC1A 1RADA 1HO3A 3KT8A 5HK8A 2DFPA 3BMOA 1SCNE 2WE8A 1GGJA 4HZUA 3PYXA 2O8NA 3FYUA 1MJGA 4KHPB 5A2GA 5IWCA 2ZTVA 3O75A 4A1OA 4AB1A 1R74A 1FFHA 3HWRA 5IUJC 4FQ8A 4C7BA 3NTUA 3A1NA 2I6QA 2VNIA 3GDGA 4ZCRA 1YBAA 1RHKA 4GDMA 1GRQA 1OXMA 1NKTA 1PFQA 4JL5A 1IVSA 3VV3A 1VSVA 2ZRBA 3T4UA 4OLHA 3COSA 4RJKA 4B73A 3PQDA 1SY7A 4HO1X 2E48A 3IPLA 4KAAA 4L9RA 1V4NA 4YRFA 5DULA 5KHAA 4F6RA 5J23A 2WBLC 2BOVA 3IQFA 1H6AA 4B6RA 3K9CA 4MV4A 4MTCA 4RIHA 4A92A 4Q00A 2B5OA 5TIIA 1L3CA 2ZI9A 2O8BB 4KXYA 2Y05A 5EJ6A 3AI7A 1DWQA 3BQNB 3OY7A 3V3KA 2IHKA 4DTCA 1X15A 2VF7A 1IQPA 1L8QA 2YKGA 5K0EA 2FN7A 3NWOA 1J1ZA 1G8AA 4LISA 4C0WA 1H23A 2GZDA 2Q07A 3UY4A 4RDXA 1DBPA 1NATA 3VKFA 3J81A 4PHGA 4LJ4A 3GLGB 2P77A 4EB0A 4AY2A 3CZAA 1J2EA 1RBYA 5DGXA 4NARA 1C30A 3AR2A 2Q5QA 4TLDA 5DPMA 4D4JA 3VKVA 4LJRA 1MVOA 4JB0A 3TJRA 4FLMA 3GAZA 1TGVA 3OLCX 1ECGA 4BO2A 2Y6UA 1JSZA 2FMIA 2QG6A 3EN0A 5M7EA 4GLLA 2G1AA 2ZBPA 2C2WA 3DVQX 5B6IA 1TAHA 2D1FA 1NW9B 1Z5GA 4PQGA 5DW3A 3RVLA 4TYQA 4DCVA 3TIIA 2QI9C 2F3TA 2XTNA 4ND8B 2H4WA 3TIVA 4J0HA 2PUFA 1DBVO 3LLUA 3P9YA 4UUQA 4PXAA 5IBQA 3WMGA 1K2WA 2O0KA 3VDQA 1NAIA 1U6IA 3ACBA 5JECA 1NUUA 3MCZA 2G9VA 5IVPA 4GZ3A 5C1IA 2W9XA 1UH5A 2FYTA 4FW8A 3I9JA 1E0AA 3HTXA 2NUAA 2CB9A 3JQGB 1US8B 1NJ6A 5FNVA 1W93A 2GHRA 4NV3A 4XGNA 1LLDA 1OSNA 1KVQA 3G0GA 3ITNA 1C0PA 1BVUA 1TYEB 2Z04A 4ZO7A 1ONBA 4AMYA 3H2ZA 5IVDA 4MQFA 5ITZA 4XM2A 1CNMA 2FR8C 2ETVA 1F8GA 1XRSB 3UW1A 4EHFA 2A7XA 3KR2A 4RLQA 1UJBA 1JJ7A 2JNWA 2C57A 4D0GA 2CK3A 1YS1X 2P9YA 2VJKA 2XT6A 4FFRA 4NJEB 4RO0A 4XYLA 4Q7JB 2IXFA 2RGCA 3V9AA 3BSWA 3NRJA 4CETA 3WGIA 1WBJB 2PMKA 4FCWA 4P4SA 3LDFA 1S3FA 5EWLB 1Z8NA 4BGVA 3C1OA 3JAMA 4L6CA 4CNBA 5B37A 3QEJA 4GWGA 5CYFA 3ZWWA 3H17A 4K40A 2KS6A 4N18A 2JIQA 3SR4A 2EJTA 4F3YA 5HQ3A 4P0PB 1H0RA 4AKIA 1KKUA 2DBYA 3UMRA 4ZVMA 1S7GA 2CXUA 2CW5A 2D2VA 2J5XA 2VWGA 1R0RE 5CX1A 4E2XA 4EJSA 1M1XB 4XGRA 1Q1NA 3HB4X 4TLLB 3NKFA 3HYTA 3TNDA 3UO8B 1NJ1A 3SEAA 3HKCA 2ZB2A 3UAXA 2OXCA 3E9MA 5K2MA 5HMLA 1XWIA 3PQFA 1XVUA 4GLJA 1A8HA 4R1PA 3WK5A 1BA3A 1DXHA 4AYTA 4Q6WA 2HADA 4LOIA 3VC3A 2A3RA 4B3MB 3UMBA 5K9ZA 1U0TA 3A28A 4IIBA 4CR7A 1I2CA 5T41A 1ZA2A 4WCVA 5F5XA 1PI3A 3R8CA 1XCJA 2HLHA 5LXTB 3R7AA 3GRPA 1PR2A 5KYXA 5JZMA 4YECA 4I50F 5IJ0B 2IUEA 4BKRA 4G85A 4AP6A 3R9WA 4XIGS 1KZ1A 4XD7A 2Z3WA 3FHLA 4PLZA 4YMSA 1Y98A 1GUBA 1NT4A 4MV7A 1DTEA 4OQQA 3LI2A 4IVQA 4B71A 3D64A 2F7SA 4MJ3A 2XIQA 2W2KB 2HZBA 2VAWA 2Z2IA 1I0IA 4K7JA 3A6EA 3T1QA 3G2JA 1TF5A 1N78A 4Q7KA 1DV2A 2H4FA 3K3PA 4G1CA 2HEGA 4G9GA 4JUFA 2XUIA 2PX8A 3REGA 2Q3JA 2QN1A 1C1DA 4R2LA 1N34B 4JBIA 1F8FA 2D2IA 2H8GA 2IP4A 4GHWA 5LU9A 2E3JA 2WJGA 1OGJA 3F4BA 3MJTA 4PFSA 5B3JA 3J80A 1B74A 1Z0AA 2G3YA 3TDKA 2GEVA 3QVJA 1GGVA 1QZTA 2O1XA 1R18A 5B58C 2G9QA 2NO7A 1ZNYA 3M5CA 4X1IB 1HTBA 2P9JA 3FD8A 3SC4A 4YUYA 3D7RA 4ZHQB 2V8BA 4C6TB 3K6JA 3JWPA 2V6FA 4JJ6A 3QEMA 3AR4A 1A8IA 4EJFA 3KQNA 2BSAA 3R5SA 2YHIB 5JD5A 2Z2XA 5SYAA 4Q24A 3AKEA 2APJA 3MD0A 3FXAA 4GXNA 6ADHA 2IXAA 3MVEA 4XPIA 4TRNA 2C58A 3I8OA 4XDGA 4D8YA 4DEYA 3B12A 4DQVA 3CCCA 5IZCC 1N6OA 3A9SA 4G65A 1JR4A 1UAYA 1HYBA 3OCJA 4L8VA 4EG4A 3DA8A 3IGFA 1RHUA 4UC0A 1PZGA 5AYVA 2NSHA 1BS9A 5EUBA 1E3QA 3PXCX 4ZI3A 1ORTA 1YZKA 4TS9A 1E9AA 2WWXA 1C7ZA 4H0CA 4HGYA 4II3A 2UZ4A 5GPBA 3K70B 3MG9A 3A32A 1Y81A 3RU3A 3EXFB 5IH7A 1N7GA 1E5TA 1RJWA 2FDXA 2XQKA 3B5JA 4EB8A 4ABTA 2ZB4A 3NIGB 1CCWA 4IJWA 4E07A 1S8AA 1W85A 2PT6A 4GZLA 1QTNA 4QQFA 3VNUA 1MJHA 2HSEA 2X1HA 1KF0A 2ZB7A 4HYEA 4N8DA 4Y0VA 4RV4A 2RHOA 5FPQA 2OK8A 4KYIB 4S2UA 5AKYA 1SG0A 1HMYA 3TZKA 5I9SA 5AHOA 3VPHA 2C4VA 4Z53A 1Y3AA 2YL2A 4LJYA 3WA7A 2VRCD 1TIKA 1I32A 2XITA 1JKJA 2QXTA 2WJZB 3DPUA 3MTIA 4L76A 4E32A 4AO8A 3CRNA 1H3NA 1BS1A 2ABWA 3NTRA 3WE7A 2C9BA 2DFKB 1ZN2A 3EEYA 4X66B 4AN4A 1EBFA 2BBOA 2HBYA 2QRMA 5EI5A 1CUGA 4YGYA 3THWA 3IKJA 4JBGA 3S1AA 4JN6B 1RQNA 1QRUA 4ISCA 4XSVA 3FNRA 1NE7A 3D2BA 3ETGA 2XWPA 1U0EA 1IEQA 4ZJPA 3GUUA 2GZAA 3GHYA 3T7JA 2BJHA 4ZGWA 2Z1NA 3ROGA 4OX9Y 1MN6A 3FB1A 1Z0SA 2PT7A 1TA9A 5AKEA 1K7CA 4KLNA 4BMZA 3MXOA 4RENA 3HGMA 1L1FA 5CDTA 1ADCA 3R3WA 4E11A 1DXYA 2W6JA 2EOAA 3M5PA 4YP6A 1AGXA 3OX2A 1FNBA 3EVTA 3L9WA 1K6EA 2QRVA 3JQFA 2R8PA 2VZEA 4FZRA 3LDHA 3P9SA 4XH9B 3SSNA 3BERA 1Y5LA 4IWXA 3UAGA 3D6TB 3JRXA 4UMVA 1AA6A 2RAVA 4LNUA 1EQ2A 2QZSA 5ERGB 1E77A 3UTDA 2G9ZA 2A92A 4HQ0A 1S2LA 4WNCA 3L84A 5KJEA 3MIIA 4TSFD 2JASA 5LL6P 2XCRB 1MZVA 2JVKA 4RKQA 3LCJA 5JBNA 2Z2ZA 1TJYA 4OSPA 1SBIA 2V7EA 1LX7A 2O05A 2C2YA 1P9OA 3SSAA 1OASA 3BCSA 4JNCA 4E0BA 1FQKA 1P80A 1MB2A 2CT8A 1LRJA 4Y6PA 2W6CX 1SB9A 2G8LA 1AZLA 1CZOA 3CWZA 3H5TA 1P7VA 4Y9TA 4X6YA 4QPNA 1HFKA 2A58A 2R5WA 2QLMA 2WA1A 1BX1A 3R5FA 1QJCA 5HJ7A 1Q84A 2JKZA 4V1CA 1FLVA 1TNDA 2GJKA 5ECDA 3FGZA 1ZH8A 2ZSEA 1Q1GA 3L8MA 5BSMA 5IKXA 2O20A 2MTBA 1T2NA 3KTAB 4OXIA 3QWAA 5B1IA 4QUDA 5ALLA 1UDBA 1T8RA 5ETJA 1E1KA 1HYEA 1JKIA 1SM4A 1YH3A 3QMVA 4OF4A 1VECA 3K9LA 2RGNA 2X5XA 3PQ8A 2V03A 4YRPA 4F9FA 2P90A 3I5AA 5CM2Z 3V1TC 5BQ3A 1QF9A 4GM1A 4M49A 3G3EA 4TL9A 2ADMA 3R8XA 2Z4TA 4DLNA 2CMHA 2R8YA 1Q7TA 1PLLA 1SQFA 3SX4A 3V33A 1MXHA 2J07A 2W58A 3WGQA 4B32A 5BT8A 1GTSA 3H4IA 4WBNA 1XJ5A 1SKYB 1YONA 4HH0A 1EI9A 5IS2A 1D4FA 1WULS 2RSLA 3O1HB 1T3GA 3LYHA 4NCKA 1U2DA 4G5HA 4HNGA 4C0XA 2D5LA 4WOJA 5BMOA 4LQ4A 1XVIA 2ZW9A 4N5IX 4TTAA 4UAJA 1P29A 2IA5A 1B3BA 1Z8HA 2I6SA 4JLMA 1GHTA 2PYIA 1FX1A 2BLLA 2X2OA 4H4CA 1YB5A 3UPUA 2CLLB 4US2R 3V8QA 1PYDA 1VB3A 4HNQA 4Z3DA 1XZIA 2I29A 2I34A 4DAOA 1HZZC 1KI6B 3VU1A 2VHZA 4N5NA 3AF0A 2ZAYA 3IS3A 4HQNA 1R64A 2HRDA 4Q15A 4XOIA 5IYZA 3ZDYB 1ZJZA 3OMXA 3AM5A 4P7JA 3OU2A 4KREA 1Z0UA 1ZM3A 2VRNA 1MCZA 3QOYA 3BF8A 2FU5C 4GLFA 5B1HA 5KYTA 5TJHA 4G24A 1OAOC 5K8CA 5SZKB 2J3DA 2EFHB 3JALA 1FK8A 1STOA 4IQGA 2UUCB 1D2NA 2FRVA 2NXEA 3BTOA 3E03A 3KJZA 2RB5A 5CT4A 2PUDA 3LE8A 1AO0A 4HMOA 1VPWA 3ANTA 5A9SB 1QIEA 4NL4H 4Q1EA 1Z4MA 1N5DA 3QYJA 4C1NA 1WSBA 5K6RA 1E2NA 3NDIA 1NBMA 4U0JA 5TEVA 1DIBA 1E2QA 2DFVA 2VDUE 3W5AA 1H1LA 1P8AA 5KX5F 4CR6A 3O8QA 4AQ7A 3DAFA 3I6ZA 5KKNB 4PZLA 2ACVA 4TMVA 2ZWPA 5ESWA 2VXOA 4ZI5A 3WFJA 1NN5A 3DLPX 3SQNA 1CF9A 3D3KA 3KPJA 3D4LA 4I55B 2YW2A 1Z5WA 3DEIA 1IUOA 5DHFA 3RJTA 1D07A 5FO1A 4IJ5A 2PSJA 3D31A 1R6TA 3HCRA 1LS6A 2QZPA 1GEGA 4EA6A 1P18A 2R6AA 4LOAA 1EAMA 2JLRA 2XNHA 2X3FA 1TI7A 2QL5A 4HWSA 4RS3A 4XW2A 1KWKA 2ZI4A 5LR6A 4RHEA 1YFJA 5KI6A 3ZLJA 4TKZA 5CDFE 2H2IA 4A0HA 1EZZA 1Y82A 3UA3A 2OCIA 1B76A 4ISBA 5HTKA 1Z7EA 2WAMA 3ZQ4A 3MK31 2IE8A 3WGGA 1CUVA 3BSSA 4M8KA 2WWHA 2GF2A 2C94A 2LP4Y 3P4XA 2HBRA 2QAGB 5LBTA 4P7GA 3SC6A 3V2GA 1Z2EA 1JW9B 1V1JA 1YCFA 2I1LA 4DV5B 1EINA 4BVBA 4C5BA 1CUAA 4IEEA 5EIAA 4XX0B 1JV2B 5JPCA 4UCWA 1XR3A 4CMAA 4PBSA 3NTVA 3D6FA 4TN5A 1DJOA 4B35A 2EBFX 4RH1A 4BJ6A 1O97D 3FSRA 4B4UA 1DTWB 4O4JB 3K0SA 1GZHB 3C7DB 4EAQA 3VPSA 3LUHA 1W5SA 3Q7IA 2E82A 2Z5LA 3FFAA 3TL2A 1GDDA 3D6MA 1QRDA 2V5VA 3HNRA 4F3CA 2J0VA 3PE3A 5B7QA 5HPYB 1XPJA 5SZIA 3WLSA 3GUYA 2PMDA 1A97A 3R77A 4KDEA 5ED4A 3GMSA 4J7AA 1G5TA 2WUVA 3E1KA 3IR7A 4HUQB 1O0CA 1M7GA 3B1KA 2TMDA 3IV7A 3VFDA 3TRDA 3A4IA 3RYIB 3C7CB 4BUZA 1UBOS 3ZK8A 1NP6A 2D62A 1IULA 3DZBA 2QRQA 4GOOD 2X1LA 1IMJA 4FFOA 2NNWB 2GSWA 1U80A 3I76A 3EFBA 3SHVA 3SZRA 2B0CA 4IV5A 3MFQA 1CJVC 4Q1AA 1JI3A 2B92A 2C9OA 3MCVA 5DGHA 5AOBA 3ZCTA 4I9NA 3PQ6A 4HDKB 3ZNPA 3P20A 3IAXA 2IEIA 1BA2A 2PJDA 4E2YA 2JHGA 3FHOA 1MZPA 5DLQC 5A3RA 4DMFA 3LHIA 2VJPA 5F3WB 4URYR 3S2YA 5DTRA 1PZNA 1TYDE 4QRHA 2F8MA 4CCYA 3LZDA 1DQRA 1UPAA 4GPZA 3P2OA 5IAJA 1GUDA 2VUSA 5ALZA 5E6UB 4BMSA 3HZRA 1PL8A 3DV2A 4CM8A 2FF7A 2WPNA 1TM7E 1ZCJA 3B7WA 3MTAA 7REQA 1IATA 2LZ0A 3AW9A 3T3MB 2D1TA 2NZJA 2FK7A 3FIJA 3HEBA 3FTCA 4ZFNA 5BMVF 1P7WA 1ZP6A 2FPGB 5I7WA 3CINA 1EFDN 4I81A 4CKWB 2YVQA 5THQA 3C3WA 3FX2A 4LFCB 1L4NA 5A2QA 2HA3A 2SKDA 1HI9A 1ATZA 5FOWA 4F2DA 2ILVA 2NGRA 1Y5MA 4G89A 3PYMA 2CXNA 1YZ3A 4PPNA 2C4TA 2CDAA 1ECLA 1CZUA 5JDCC 4CWAA 1LD3A 2FOIA 3BZBA 5CT8A 5AJZA 3HUUA 2AJLI 1EFAA 3KB2A 1MT3A 4FKMA 4KXUA 4TPKA 1KFJB 2C3YA 3OZSA 4WZZA 4NYJR 4REMA 5HE9A 1KDTA 1YS2X 2QL9A 3W4JA 3UJ6A 1EUYA 3MZ0A 5I8PA 1YS4A 3ZE9A 1SQ0A 2QT1A 5AVQA 2IDKA 2RK4A 3JTMA 5K8TA 4MVJM 1XMSA 1VGQA 3RGWS 1I94B 4PZUA 5L4NA 1EESA 3VR1A 3FYHA 1NVFA 2Z9BA 1DBWA 4EHIA 3CLTD 5A6SA 3HXMA 1YB1A 5TY0A 2CKDA 1QK3A 5JD3A 3MS2A 4BZPA 5J5AA 1NZDA 1C9NA 3H2KA 3T5BA 1EXDA 2D1SA 1YRBA 3C7KA 4OPMA 5DTIA 3H5NA 1U65A 3GPCA 2M9MA 4RTNA 3A4MA 4AFNA 2R8EA 1U7WA 3IO5A 1FBNA 4KR7A 3COWA 4IG9A 5LZ8A 5DIFA 3COVA 4PCVA 5ALVA 2P2GA 4NLLA 5KOJB 1TUIA 1RJ9B 5EZYF 3S2EA 3W3AD 1YDMA 1C1HA 1PWZA 3DMRA 3PWZA 3E84A 5IK2A 4V39A 3E22B 1Z7WA 3QU4A 4M55A 1QNLA 1E7YA 3DOJA 4PNEA 1M0EA 1LGYA 2O6HA 3HUDA 2QQEA 3IBTA 2ROQA 1TA0A 3I9NA 3SN6A 5KDOA 5ITVA 5K4GA 3EEFA 1NWCA 4TT8A 4UM9D 2ESRA 3UWPA 3IJEB 2I67A 5KMGB 1WXFA 1Y80A 4ME6A 4CXMA 4UDNA 4KN8A 3E3OA 4WOPA 1O95C 3VMMA 1O6ZA 3FZQA 1EEHA 3KTDA 3WXBA 1J21A 1PT5A 4QJ4A 1MIOA 2XEXA 3RS2A 1I8TA 1BO6A 3LHKA 4WN9A 4OHWA 2BGTA 3JQ7A 1J09A 4MVJI 2FSGA 3H86A 3SQXA 1KH3A 1T8SA 1QGZA 1TK9A 2W00A 2RBEA 2GBLA 1FDVA 3AU9A 1ECBA 3LXMA 3IDZA 4WLOA 3NHPA 3D8TA 1GR0A 4PCAA 2ODNA 5F23A 4I46A 5FV7A 3CE6A 4AL4A 5HE8A 3HUFA 1B41A 2VYVD 4Q9HA 3WYAA 1Y7IA 1N5MA 3P5BA 2WYHA 4DDHA 3ZVMA 2ECQA 4GQAA 1HBJA 4J4HA 4LRSB 2W98A 1GPWB 5CEFA 2PWYA 3DDUA 3K2QA 3KT6A 3NCTA 4KV9A 4QLBA 3RYCA 1DBIA 4HX5A 3UXHA 1PO7A 2HZ7A 2GM4A 2B2XA 2QW0X 3OFJA 3SQMA 4DA4A 1J8YF 5LP6B 5I8ZA 5E8JA 2WV9A 4NF2A 4Y2XA 1R5BA 1QV9A 2XCUA 3TQIA 1TLFA 3GRRA 1Z2DA 4JBLA 3SICE 3AFHA 3B6ZA 3KXPA 1ADGA 1YVRA 3KT3A 3ICQB 1XNGA 1M1NA 2REBA 2DFLA 2EG5A 3F6EX 1GNTA 3EVZA 2HMAA 4G1BA 1Q2XA 5EKUA 4EHAA 4YCMA 2OC4A 2NSDA 5FUBA 3R76A 2ZSJA 4EY3A 3N6VA 3E3MA 4TVOA 3KKLA 1TU3A 2MOKA 3EZLA 3FDZA 1PGOA 1EVJA 1SPXA 1JA9A 2VEDA 3GW8A 3KG2A 3TJZA 4G0XA 1KI8A 4MW7A 1E32A 1U5BB 4TX1A 5H3CA 4AZVA 1Z6XA 1YQQA 4GO1A 3S7TA 3JTEA 1QHNA 4C4PA 2VYND 2YHSA 1MUUA 1XDZA 4PAWA 4AU1A 4LF7B 1QCCA 5EWMB 3QKSB 1PEAA 2J6IA 1ZH4A 4RQBA 3KSRA 1C8LA 2QRGA 4YPVA 4JGIA 4ENRA 4MEBA 4G1MB 3G9QA 3UAZA 4AN1A 3FLAA 1FZTA 3OIVA 3UMVA 2PMFA 3ASYA 3Q3VA 1RIFA 1L4UA 1M1YA 3DTVB 2OHVA 4TQUS 4X3OA 1R8SA 5FXMA 5I7EA 1KYQA 1RVV1 2C7VA 3G0OA 5EUMA 5M3BA 2FFBA 1I24A