4QGGA

Tmk in complex with compound 46, 2-(3-chlorophenoxy)-3-fluoro-4-{(1r)-3-methyl-1-[(3s)-3-(5-methyl-2,4-dioxo-3,4-dihydropyrimidin-1(2h)-yl)piperidin-1-yl]butyl}benzoic acid
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
204
structure length
193
Chain Sequence
b'SAFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEIRKIVLEGNDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERDQEDLKFHEKVIEGYQEIIHNESQRFKSVNADQPLENVVEDTYQTIIKYLEKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate kinase
molecule tags Transferase/transferase inhibitor
source organism Staphylococcus aureus subsp. aureus
publication title Antibacterial inhibitors of gram-positive thymidylate kinase: structure-activity relationships and chiral preference of a new hydrophobic binding region.
pubmed doi rcsb
total genus 81
structure length 193
sequence length 204
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2014-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4qggA00
2ORIA 4IFBA 4DXAA 3MG9A 1KMHA 2CVFA 1B23P 1HQCA 2IT1A 2C9CA 2VA8A 2PLFA 3FHOA 2REBA 1W0KA 3TVDA 1Q1EA 4KU4A 1FX0A 4A8JB 1G3IA 4PHGA 3GLFE 1VHTA 2D7CA 1SVSA 2ZETA 3KB2A 4NPHA 2ZRHA 3DEFA 2GEDA 2FZ4A 1SQ5A 5G40A 2FZLA 2GTPA 4A82A 1DAFA 3P1JA 3A1TA 1JI0A 2IK8A 1WE2A 3A37A 1BMFA 4ACAA 5JZVA 1Z6AA 1J2JA 4R2IA 4UKDA 2QP9X 3RAPR 2X8AA 4Q66C 1SKYB 4TMTA 5FOTA 4YMTA 1NN1A 2CJWB 2RGAA 1AN0A 1G16A 1L4YA 5GJWC 3WP0A 4XSGA 2ZYVX 1XDBA 2BMEA 4NMMA 1TNDA 1KZGB 4Q7JB 4KSBA 1G3UA 2OESA 2CHQA 5CYPA 1TADA 3MLEA 4AK9A 2IS4A 2NMVA 1Q3HA 3N5CA 1XJ0A 2KB0A 1S8FA 4IVPA 1GM5A 1YE8A 5JI2E 1XD8A 1F3OA 1XX6A 2WWXA 2VP9A 3ND8A 2ZQ5A 5J4VA 5ELXA 4KCGA 3BAFA 4C0QC 5GVSA 4ERNA 4NYMQ 1NVUQ 1NN5A 1JECA 2QN6A 5BN5A 3BB3A 1E2KA 1KDOA 2VP5A 4LV8B 2F55A 1K8RA 2HJGA 4OI4A 1A82A 3VR2A 3CWQA 3D7MA 2X1VA 4ARZB 2GZHA 1E2LA 1NMYA 1VCOA 1OSNA 3NG1A 2RGDA 3BORA 1G64A 1ZIPA 4TLDA 2GAAA 4FXPA 2DWOA 5JEDA 5LD2C 2W0MA 1EXMA 3QJYA 1XMVA 1MT0A 3W5JA 3K0AA 4GT1A 3IO5A 3CRW1 4FIDA 1SXJB 2W58A 2G83A 1P3JA 5AUPB 4AKHA 3SR0A 1MRNA 1XBTA 4EFNA 1LS1A 3GFPA 2J0UB 5LB2A 3TBKA 1CJTC 2IUTA 2WWFA 3PENA 2FA9A 4Q4HA 2ZRAA 1GL6A 3EPKA 1PUJA 1RVDA 2FGKA 3AVQA 3M0EA 3T12A 4U02A 1TQ4A 3AKEA 2GILA 5EXPA 2IA5A 3QI2A 2YOGA 2HJVA 4Z1MA 4QHYA 2BBSA 4QHSA 2V7QD 4TYNA 5B2ZA 3AVXA 2OLKA 3I5YA 2MSDB 3LX8A 2GAOA 4TMKA 1FUUA 3IEUA 5E7JA 3V4FA 3IIMA 4ESVA 3CRQA 4KLNA 1C1YA 5L8VA 4Q19A 1HH4A 3BH0A 1NVVQ 4TL8A 3IQWA 4HUQA 4LUCA 1T3LA 2ZE7A 1ZW6A 1CULC 1II8A 3BXZA 2DFKB 3TE6A 1DAIA 2YJTD 4L15A 1F2TB 1TUEA 5F2EA 1P5ZB 1Z6YA 2JASA 3SFVA 3QNUA 1YZKA 3KQNA 1FFHA 4GOXA 4YDHB 3ICEA 1IBRA 1Z28A 2HCBA 3W34A 1XRJA 3LXRA 1W0KD 1AZTA 3LLUA 4RD0A 2Z43A 2JLZA 5JS7A 3W8RA 1OPXA 4IJMA 4M9ZA 2WKQA 2ZS9A 3TLXA 2AD1A 3S1AB 1G8FA 1SXJC 2JDIA 4GRAA 1N5KA 3GLGA 1CJVC 5FBLB 2VF7A 5FUXA 4D4JA 2W6JA 3AF2A 4DDVA 5FPTA 4QBIA 1FW6A 4GNKA 4TSFA 3I1FA 2REXB 4N0EA 1QHHB 4FMCB 4HDOB 4MYHA 1NNEA 4B2PA 4A36A 1E3MA 1U98A 4KFUA 1VPLA 5ANRB 4C2UA 5DHAA 1TEXA 5DYIA 3KQLA 4IW3B 2WSSA 4Z54A 1OIWA 3EPJA 1A7JA 2W2VA 4DLRA 3X2SA 1OHHD 4JLVA 4HDCA 1DAHA 1NLYA 1OE0A 2O0JA 1E79A 3GQBA 5FBVB 1GWNA 2YVUA 4NYIQ 2WWWA 4EQ6B 3QOFA 1OXUA 3SQWA 1TUIA 5CYOA 3QIAA 3B9PA 4MGIR 1XPOA 1U0LA 1M6NA 1LFDB 2B8TA 2GF0A 1ZM2A 5BN4A 3K0EA 1HA3A 1N3BA 1YHNA 3DVLA 4V02A 1FQJA 4NDZA 3TQFA 1YR6A 3PJRA 2K5UA 2DY1A 5FFMA 2EFDB 1V5WA 1G8HA 3R20A 2Q3HA 3LO5A 3RWOA 3CLVA 2FX3A 4UJ5A 3DO6A 1JAHA 5JBQA 3GJ7A 1Z47A 2QTHA 1AM4D 2ZJ2A 2GXUA 1QDEA 5JRZA 4Z8XA 4JS0A 4UXHA 1Z3IX 2IXEA 2XJ9A 2F3TA 4CF7A 3TR5A 5BXQC 5IF9A 3W90A 3TH5A 3NH9A 4BFTA 3NDPA 4CEJA 2FWRA 1Q21A 4M0LA 1C4OA 1GNRA 4FD2A 2OBMA 1X1SA 3TJZA 4M9XA 5HE9A 1WCV1 5DE3A 1GSIA 3IUYA 1XCMA 2OZEA 1Z0KA 1YJ5A 3RRYA 2CVHA 2JAQA 1ZD1A 2ZPTX 1AIPA 1G8GA 4G0NA 4PPGA 5IK2A 3GP8A 3OIYA 4MDEA 5FI1B 1GG2A 4RD1A 4TT3A 4WZ6A 1XEWX 1E94E 1G6OA 2FPLA 4QBGB 1VKJA 2O5VA 4QJ3A 2WWHA 5TXGA 3T5GA 4D26A 1SXJE 2VP0A 1DADA 4AY2A 4ACBA 5FR2A 1M2OB 2MMCA 3DKPA 2GESA 4PX9A 4C2TA 3EZ6A 3KX2A 2WOOA 3A4NA 3C15C 3E1SA 3T1TA 4BFYA 2OFOA 2P67A 3E70C 2RKOA 3DOEA 1MABB 4PZZA 4NZYA 1U0HC 4A0HA 1HQYE 1YKSA 2DWPA 1YVDA 4DDWA 3DKVA 3OF5A 2J3EA 2VYFA 2ORVA 2XZPA 1NKTA 4TTRA 2GXAA 2QE7D 2J45A 4C0LA 1W1WA 3OE7A 1LF5A 3KZ1E 721PA 1JQLB 1OIXA 1U8ZA 4LYJA 1BS1A 1SVLA 2IYTA 1QG4A 4EPWA 2VEDA 2GZAA 5G3ZA 1H65A 4Y0VA 5DYGA 3NTUA 1XTJA 2NOAA 1UBGA 2KSQA 4B33A 1KO4A 4QM6A 3LFUA 2ZE6A 4LPKA 1OKKD 4FI3C 4GFDA 1HY3A 2ZI6A 4OK5A 5E7MA 4AG5A 2F7SA 1E2GA 4QHTA 5JSZA 4MDFA 3AB3A 3AVYA 1ZCBA 3BFXA 5FUYA 4M8NE 4ZDIA 5DSZA 2C04A 4JLOA 5EP3A 3JVVA 2VRWA 1MV5A 3AUYA 1YR8A 3DM5A 5CIQA 1Z29A 2C95A 3ZGXA 2QENA 3MJRA 3GLFA 2BCGY 4WA7A 4E09A 4RD4A 4RZUA 4GL2A 2UZ3A 4F4CA 1AS0A 3ADKA 2HLDD 3K9NA 4BLRA 1JALA 1ZYUA 3R8FA 4ZCLA 4KFRA 4YC7A 4LWZA 4HZUB 5AK0A 2AL7A 1LW7A 1FNMA 3SN6A 1IM2A 3CRRA 4GMXA 3WNCA 3G82C 3D31A 1YU9A 2HCJB 1N6IA 2GEUA 5TV2A 3VHXA 1KZ7B 3KUCA 3CUEF 3KXLA 4OQXA 4Q7LA 3NXSA 5HKKD 4HLQB 3M1IA 1P72A 1VCIA 2A5GA 1T5IA 2GVZC 5CDFE 3EPHA 4LHZA 4W5JA 3W6NA 3V9PA 1ZP6A 3ZVMA 1IY1A 3VHLB 3AKYA 4FMCF 3IPYA 3B1YA 1FP6A 2QT0A 4CVNA 2CE2X 3PUXA 4GOJA 2J9RA 2WJJA 3AKDA 2VSXA 2ZTSA 2C9YA 1KSHA 1R5BA 1MO3A 2GRJA 3QF4A 3VKWA 4PR0A 2I1VB 3N2IA 4X8HA 1GZSA 2F9MA 1XZQA 4HSEA 4PAMA 2ZRIA 5KPJA 1K5GA 1ONBA 4RCYA 3GPLA 3QPWA 1KI3A 1EFTA 4Q4LA 3SEAA 4TYYA 3EWSA 1R0XA 2QRZA 2FJUA 4NYJQ 1UEJA 2QAGC 2ERYA 1OT3A 1E69A 4YDSA 1PV4A 3IILA 1OH6A 3FMIA 3GLGB 4FMBB 3U2QA 1NF3A 3ZZ0A 1E1RA 1KY3A 1RIFA 5AUQA 1E2MA 1HE8B 3PEVA 1N5IA 2R6FA 2N1BA 4BGDA 4NYJR 3CF6R 3EA0A 1UBEA 4HB0A 3OEHA 2D3WA 5TDHA 2XX3A 3CH4B 4L9SA 4IDHA 2OAQ1 3KB1A 4KITB 3PITA 4WIAA 421PA 3CH5A 4LI0A 3IHWA 2QE7A 2ZJBA 1G7TA 5KNBA 3JVUA 2BKEA 3UXMA 3ICQB 1NSFA 1FTNA 4AC9A 4LV5B 2ZJ5A 1LS6A 3B9QA 2PX0A 2FFAA 3B1ZA 1E6CA 3ZZTA 4DLZA 2CHGA 2FV8A 4F7WA 4FCTA 3GLHE 2P5TB 3MJHA 5H68A 4URUR 3WXMA 2JLXA 5AJWA 1D6JA 1A4RA 5P21A 1YZLA 3KQUA 4UQOA 1RYFA 1WBBA 4HAZA 4LJ8A 3R9WA 2C8VA 3RWMB 3CZPA 2PJZA 3NBXX 2PCLA 1QHYA 5EUMA 4EAQA 2X2EA 1KJYA 3EXAA 4Q03A 2FSFA 1X3SA 5DN6A 2O8FA 4JKIA 5JEEA 2NO1A 4ZDJA 4DDTA 3EA5A 3WRYC 2B8WA 4DIDA 2BBWA 4FW9A 3MGCA 2UVQA 5DGXA 1AGRA 2XOKA 3IDQA 1KSGA 3AF4A 4C7OB 1KO1A 4OQLA 3S1AA 4ABYA 3GFOA 1JEEA 1GKUB 1NLZA 2YOHA 2RGGA 4B48A 1W5TA 4B76A 2QROA 4UNSA 3ADBA 1NBME 2RGXA 4LHVA 2D7DA 3I62A 3BD9A 4WZAE 3EG5A 2OG2A 2JCSA 4QGFA 3CWZA 4Q9JA 2CEAA 2ZJOA 2KI5A 4BFWA 1AKEA 2GCPA 4LV6A 1YQTA 3LH5A 4PPFA 3T1OA 1IXZA 2V55B 4DIEA 1QHGA 2ZRDA 2DFLA 4H9GA 4ILEA 2FFQA 1WRBA 4CEIB 1W4BA 2J7PD 2W00A 1GNQA 2XXAB 2GKSA 4JLKA 4V0MA 1M7HA 5EXSA 5C4MA 1NSTA 1S9DA 2JLSA 5JFGA 1VMAA 2NIPA 3LX5A 1CJMA 3PVSA 4BRUA 2ZJZA 5FUWA 3LA6A 4U00A 5FPSA 1KMHB 1EFCA 1C9KA 3EZ2A 2DCUA 3LBNA 2GK7A 4POAA 3A36A 2GXSA 1E2IA 1ZM4A 3VU9B 3CRMA 2QSZA 3KJIA 4NP6A 5SZIA 3BFVA 2HF9A 2DFNA 3D8BA 2VHCA 1DAMA 4S35A 1LY1A 5FH9A 4W5WA 3P32A 1F60A 2JLVA 4Q7MB 2CJWA 1JR3E 4Q02A 3NBYC 5F9HA 4IDPA 4HAXA 4B3DA 4N1AA 4DLYA 1J8YF 2JEOA 1Q44A 3IQXA 5B58C 3UWOA 2G9NA 1J7KA 4DSOA 5BYJA 4QGGA 2FSGA 5E4FA 5AUNB 1ZRHA 1GP2A 5EJEA 3R9XA 3DMNA 4LJ7A 5KUTA 3QVVA 2ZRCA 2ZYUX 4A6XA 1DPFA 2BC9A 2F1JA 2NPFA 4YQFA 2GVDC 1ODFA 1N25A 1YR9A 2CDNA 2CK3A 4O0MA 4QJ5A 821PA 3RS4A 3U7EB 1XJQA 1R10A 4P32A 3QENA 2A5JA 2J87A 3K8YA 1JR6A 5JLJA 2IYVA 2OV2A 2PMDA 3SBEA 1WP9A 1ZMXA 1AZSC 2WJHA 3TRFA 1E96A 2CMKA 3AP2A 4MKGA 4OK3A 2NPIA 1TQDA 2HUPA 3EX7C 5KYKA 2LCFA 1G41A 3LDAA 2CL7X 2YC4C 4A0GA 4UXIA 2ZRKA 1L7VC 2QAGB 3U7HB 1AQYA 5CJPA 2IYZA 5CM8B 4HLCA 4LJ4A 2JJ1A 4PSAA 1XXHB 4LBWA 1TEVA 2DWQA 1T5LA 3W6OA 4S2EA 1W36C 5F98A 1ZU4A 1XEWY 3BS4A 2X2FA 4F4IA 2V7QA 5L3SA 3LBIA 2IS6A 4G3XA 5SZHB 2VSOA 3M6AA 5CB6A 4KJZA 4DSTA 1CTQA 2ZE5A 5EE1A 621PA 2Z4SA 4Q9KA 3CM0A 3QF7A 4NCIA 5FBQB 1KI1A 2F9LA 2TMKA 2GJ8A 4JVLA 3LY5A 2IHYA 2V1UA 3OAAD 2V3CC 4M1KA 3VQTA 1VTKA 3A6PC 3SDZA 1PJRA 1MKYA 2O8CA 4AKIA 5EE9A 1AA9A 4GSYA 1O3YA 1SGWA 4BLQA 1N6LA 2P2LA 3EAQA 4XD7D 5HCNA 3U4QA 1X86B 2OLJA 1E98A 2VSFA 4HB2A 1JQJC 1NVVR 2REOA 4UNPA 5FOVA 4URVR 4G5QA 4ZCMA 5K8LA 4ON9A 3BK7A 2CE7A 2ZITA 4B3XA 1D2NA 1XD2A 3A1WA 4QBHA 1LF0A 3UATA 1EWRA 5FTNA 1XU4A 1XXHA 5IT5A 4EPRA 1FOEB 2QP3A 2GWHA 4NCHA 2GNOA 1G20E 2PT5A 2WBLC 3T06B 2ZSBA 5FPYA 1KSFX 4KHZA 4OYHA 3NBZC 4RFSB 2XNSA 2ZI5A 4RVCA 4D0LB 2PJRA 5AJVB 2JLYA 1EFUA 2FSHA 3SE0A 4KODA 4JVNA 4BFZA 2PL3A 1DE0A 1R0ZA 5GJVC 1GKYA 4TWZA 1W36B 2QBYB 4X8OA 1IQPA 4YMSA 3K53A 4MRNA 4Q4JB 4LYHA 1XPRA 3QG5A 2G1JA 1S96A 2XJ4A 1G7CA 4HAWA 2XB2A 4LCBA 2FG5A 2J59A 3T61A 3P27A 3Q8XB 2ATVA 1T91A 4IEEA 1OFTA 1ZM3A 1HURA 4JLJA 3THOA 4XWOA 1E0JA 4PO9A 3LV8A 1Z0JA 4XVRA 1CRPA 1CP2A 3RRMA 5JWRA 2XOKD 3D3QA 3NC1C 1BMFD 5J4KA 2W2TA 2P3SA 3I61A 3E5HA 2QTVB 6Q21A 1FQKA 2SHKA 2WKPA 1P75A 2Z6VA 3CNLA 2WICA 1Q3TA 5HZKA 3MWKA 4E03A 4MITA 4M9QA 5GJBA 3T1QA 2WWIA 1WBDA 1UEIA 4QJ4A 5IRCD 4EQ6A 2G1KA 4D81A 5F3WB 2ZXUA 1NMZA 1OLOA 5HCIA 1EX7A 1G8PA 3OZXA 3VU9A 2QQEA 4PZLA 2P0EA 3BH6A 2OHFA 3UG7A 4I1SA 3V00A 2W6ID 1OFIA 3O8CA 1IN7A 4Q47A 4PC1A 1DG3A 3SYNA 3ZDQA 3SJAA 2H8KA 3ZZUA 3MAAC 4CZ2A 3QKSB 5JHHB 1KDRA 1OYYA 3BRWD 4A92A 4CDGA 1P2TA 5FUVA 3AGPA 5H1YA 1RW4A 2YHSA 4B74A 2Q9AA 3I92A 1Q22A 4BPBA 1EFRA 3QKUA 4RZ3A 2IWHA 4LYFA 4BFVA 4YMUA 4B32A 4A15A 4I1UA 1G19A 3B60A 5BQ5A 1ZINA 3FVQA 3REFA 5L3RA 4F92B 1XF9A 3FB4A 3PEUA 3T34A 1U2RA 1FUKA 1NBMA 1TMKA 3NC0C 5SZJA 2QGNA 1KI8A 2JJ1D 1D2EA 4A4DA 1V43A 4PHFA 2A5FA 1JBKA 1H8HD 4LJ5A 3WHKA 5EUQB 1E2DA 1ZCAA 5JJKA 2V6IA 4XD7A 4N0DA 4E22A 3B78A 2O8EA 1IOZA 4TMVA 1LVGA 1E4YA 3FKSD 1S3GA 3L0SA 1GRQA 2OXCA 3UMFA 2H5EA 4F93B 3LVRE 4EPVA 3OAAA 2AK3A 4KBGA 3KTAA 5E7IA 2EU8A 1M74A 1QG2A 2QMUA 1XP8A 3P20A 4DB2A 4BECA 2WAYA 3OHMA 2YNMA 5FR1A 1Q20A 3GJ8A 2R2AA 3FMFA 4L9WA 2ZROA 3H0KA 2DFTA 1Z07A 3Q9LA 3W6PA 5DLQC 5L3QB 2IL1A 4MRSA 3B7GA 4IOMA 2GJSA 3LBHA 3ONWA 4DB4A 1TF5A 1G9XA 2ZR0A 1W5SA 1P2SA 2P65A 2OO7A 4IOKA 1DAKA 1KO5A 2VHQA 4ASUA 3TQCA 4CW7A 3NEYA 3GCGA 2R8RA 2O0KA 3OEED 5KSOA 1R8QA 4DVGA 4TZ6A 4AYXA 4IVRA 4WVFA 1XCPA 1IN6A 4JT2A 1F48A 1U0JA 1HV8A 4CT5A 3EC2A 1IY2A 2VTKA 2WMNB 1BIFA 3CPJB 2O0HA 3PIRA 5FBWB 5FPKA 1HEIA 3Q5EA 4HZIA 1IXSB 3GJXC 3SYKA 1H8HA 1ESNA 4JJKA 5EQTA 3P26A 3PUVA 4I1VA 3KL4A 2DBYA 1UDWA 2H17A 5AJZA 4XWAA 3SOPA 3X1XA 4O2LA 3VKHA 3SQXA 1VIYA 3CONA 3LXXA 4KVAA 5GVRA 5FTJA 1KNQA 2E87A 3QKTA 4XVUA 4M2LA 1E2FA 1EWQA 3BC1A 3F3YA 4JJZA 4FCWA 4BFUA 1II8B 4B3FX 1OXXK 2ZR7A 3RHFA 2BMJA 2FPMA 2ODBA 4FINA 2XTMA 1U90A 2ONKA 1GAJA 3I72A 1OW3B 1MO6A 4QGAA 4DUGA 3O8DA 1KI4A 3KTAB 5FL3A 1P9RA 2CLCX 4FWIB 4Q4HB 2A9KA 3CB4A 4ZI3A 2Y8EA 2OILA 3TNFA 1OB5A 1OB2A 2XGJA 1E1QA 4IVQA 1E9AA 2CCKA 2FU5C 4DRZA 3U6KA 1S0UA 3KFXA 5JWHA 4OHXA 5AJXA 2BVNA 4MUBA 2WWGA 2ZS8A 2ZS7A 3UKDA 2LKDA 3DOFA 2IUSA 4DHEA 3CKLA 4M53A 1OIVA 3EIEA 2XNDA 3PV0A 2O8CB 1CU1A 3AV0B 1ZJ6A 2EYUA 5GADl 4R98A 3ZS8A 3TMKA 3WMFA 1SVIA 1SKQA 2N46A 4M9SA 2D74A 1W46A 3RS3A 1IN4A 4IDQA 3L0IB 2WIAA 1F2UB 3C8UA 4B34A 2PCJA 2IF2A 4AYTA 5FBRB 4C0JA 1NL3A 4QBFA 1KJWA 3SS8A 1S2MA 4RZ2A 2BM1A 3SNHA 1O87A 4HUQB 3WNDA 2B6HA 4C0HA 5KOYA 1JPJA 3FMOB 1CJUC 4K46A 1SHKA 4LHXA 1NKSA 1WQ1R 1GDDA 2CNWD 1DBSA 1KMQA 2JJ8A 2QT1A 2RGBA 2ZI9A 4KSCA 4ZPXA 3W8NA 5J40A 2V6JA 3U3JA 1W0JD 2G6BA 2F43A 2R6AA 4JZKA 4II7A 1ZM7A 3EIQA 2OE2A 3UIEA 2D4HA 4W9MC 4IOLA 5CJ2A 3IHLA 5A5GA 4B73A 3ZS9A 2IYUA 1AS2A 4YMVA 4JL8A 2DB3A 2NO9A 3ZQJA 1E1RD 4PXAA 1YZUA 1XTRA 1XFAA 2OBNA 2ORWA 3IKJA 4GP6A 4A0RA 3GLGE 1EFHA 4LJAA 4P4UA 2MMGA 2QORA 3U6BA 1E2PA 1NIPA 4IFEA 1OXSC 2XSZA 4MKIA 3K0SA 3MRSA 4QRHA 1M8PA 4MYTA 4D80A 2ZEJA 1CR2A 1BO6A 2EFCB 4V0NA 4F4JA 4JVSB 4L16A 5HPYB 2ZRMA 2Q21A 1KSJA 2EFEB 2ZYTX 1E0SA 4OBEA 4RD3A 3T35A 2BEKA 3H2YA 3T5DA 4A8JC 5CITA 3WMEA 3BH7A 1GL7A 3NH6A 2IYQA 3TW8B 4JKYA 2EYQA 4JVMA 5EXTA 4PANA 4B44A 3CR8A 4Q18A 4JL5A 1RKBA 2X77A 4G5OA 1ZNWA 2KJQA 4TSFD 1XCGB 5M04A 2Q9BA 1R6BX 2R9VA 3LWNA 3HPRA 4BLTA 3GFTA 1GILA 4US1R 4GI7A 3QSYA 2WVJA 2J0VA 1L4UA 5HKKA 2FMXA 1L2TA 3C4JA 3THYA 2HXSA 4TMXA 4U5XA 2PEYA 2YYZA 1MOZA 2LKCA 4US0R 2OAP1 2RCNA 4OHVA 4Q48A 3A58B 2JIZA 4LSGA 2J0UA 4DT1B 4AKGA 1P9WA 3TR0A 2NO7A 1ZD8A 1SXJA 3EZ9A 4TQUS 2BM0A 3WYFA 2PX3A 2PZEA 3SBDA 4ZIRA 3GEHA 2N42A 4C0BA 3FYHA 2O8BA 2C9OA 4TMZA 5AJYA 4OHYA 2RGCA 2YWFA 3AF1A 4Q9LA 4NBSA 4PO8A 4E07A 2ZU6A 4G01B 1E9DA 2W0SA 3MFYA 3HR7A 3JZAA 5J4HA 4B43A 1Z6XA 1E2JA 2V1XA 3AM1A 4OI2A 1UFQA 1U94A 3WNBA 1EX6A 1XMSA 1R8SA 4IOJA 4JSTA 3W3AA 2XZOA 1BYIA 3BOSA 2G0TA 2VBCA 1X8JA 2C03A 2IXFA 4PSKA 2C96A 2NO0A 2R62A 4G1UC 3L8YA 1X8LA 4MRVA 1W36D 4L4UA 2FPKA 4TYQA 4M1TA 3BB4A 1IN8A 4KVGA 5EE0A 2WPDA 3I4LA 1T8TA 3K0FA 3W5IA 2IYRA 2HLDA 4JYBA 4NL4H 3WHLA 4V0ME 3TK1A 1RC8A 1K5DA 3QE0A 1KOFA 5BYKA 2AN9A 4DLTA 3U61B 4JSYA 3RC8A 3TSZA 1SVKA 2JLRA 3RC3A 1NLFA 2IS2A 1NN0A 3HYTA 1P9NA 3Q3JB 1ZIOA 4X8MA 1VG9B 2QTFA 1R0YA 2IBMA 1Z06A 2JJ2D 4Q4AB 4KBFA 2GBLC 4LHYA 2F3RA 2ZJYA 4BFSA 3U5ZB 3Q72A 3BERA 1Q0UA 3GEEA 3AF3A 2J7PA 1KK0A 1KIMA 4QFMA 1YR7A 4PQFA 1P61B 4RJLA 2OT3B 1CBUA 4C30A 1VHLA 1P62B 2B92A 4UNNA 5EE5B 4EDHA 1Z83A 4JMPA 1SVMA 1FTSA 2VP6A 3K0CA 3QBTA 2FE4A 3HPQA 4Q9IA 4ARZA 4PC7A 4P3YA 2ZRNA 4URXR 3OE7D 3PUZA 4PO1A 4RFVA 4R9UC 1TX4B 1W7AA 4F38A 1TF2A 2WKRA 2F43B 1GTVA 2H92A 1W49A 4Q21A 2FEOA 1H8ED 5K8IA 5C46F 2VHTA 4D6PA 3C14C 1CF4A 3WY9A 4FWTA 4B71A 3A1UA 1XEFA 2IEZA 3AVTA 3TVTA 5K8TA 4L5BA 1L8QA 4LBYA 4YMWA 4WW0A 3FOZA 1OF1A 5FI0B 3F5FA 3U4QB 1LNZA 2Z83A 3TW4A 2QQ0A 3Q7PA 4AG6A 1DS6A 1M7GA 3SC3A 2RH5A 3IEVA 1Y3AA 1JXOA 4BQSA 4CGZA 1TAGA 1U99A 1N2CE 3AF0A 2JGNA 1KKMA 3MWYW 4LC0A 3VR1A 5IK2D 5CDFA 3X1DA 4Q4AA 2EW1A 1SKYE 3ZD6A 4QGHA 4Z8YA 4EFMA 3O8RA 3PQCA 4DZZA 4D0GA 3RS0A 2A3RA 2LWIA 2ZRGA 1QHXA 1YZTA 2NGRA 4N3NA 4Q5IA 3AH8A 4ZKEA 1QHSA 3NKVA 4HUTA 3I73A 4G5RA 3SJZA 4NKRA 2OUKA 5JS8A 2WSSD 5GJCA 5BN3A 1KO8A 3I3SR 1T3SA 4OK6A 3UK6A 1VYTA 3VX4A 2VF8A 4EKDA 5D3MB 1JB1A 2ZI4A 4G5SA 5CB8A 1ZUIA 4GMDA 5IHPA 2WOJA 3AQ4A 1I2MA 1ZUNB 4ZDKA 3TSOA 2F6RA 2ZRJA 2QAGA 4A6PA 3CBQA 4LPSA 3FHCB 1HUQA 2IW3A 4HB3A 2CLSA 2W6JD 3O8BA 4M1WA 1G4AE 4PQYA 4TTQA 1QZXA 3FE2A 5FTKA 1DEKA 4BUJA 1XEXB 1KI7A 2O8DA 1QF9A 1DG1G 3AKCA 3K1JA 1WF3A 1TQ2A 2BOVA 4TLCA 3W9YA 4BZPA 4D4KA 4FMDF 4H1VA 2X19A 3VR3A 3GD7A 3EZ7A 1Z08A 4M22A 1WXQA 3FPAA 1KI6A 1KKLA 2AKAB 4GZLA 4KYIB 5DI3A 1UADA 2WWYA 3MD0A 2WV9A 2ZVQX 3NDBB 4JBYA 3K09A 2IYYA 1JNYA 1G5PA 3QY0A 2QEQA 3QXSA 4HLUC 1ANKA 3B2EA 4DLWA 2Z5FA 2J41A 3HR8A 3RDPA 4R71A 4US2R 3L8ZA 2ZANA 3B8HA 4L8GA 2XAUA 2FOLA 3ZVRA 2ZSFA 5SZKB 3PCRB 1GL9B 4OI0A 3X1WA 4A1FA 4BWYA 3ZVLA 1CS4C 1J90A 3ZYCA 1IAQA 4D82A 4BEJA 2V8OA 1BOFA 1TU3A 4BE7B 1LTQA 4TL9A 4AWXA 4DWJA 2QNRA 4QNMA 1E0KA 2JDID 4Z1MD 2GCOB 4BZXA 2ZUBA 5KSYA 3PEWA 2J46A 2ZSDA 2GJKA 3EZFA 1ZNZA 1NVWQ 2AX4A 2G88A 3DDCA 1B0UA 2G77B 2ODNA 1HT2E 3GLHA 1GRRA 5CM9C 1OJLA 1UAAA 5JI3E 5E95A 3NWJA 3FKSA 3QVUA 4LJ9A 3AGQA 4NCNA 1DARA 4XWKA 2QMEA 3VFDA 5JCPA 2JATA 3UWKA 4RKFA 2JLWA 3GLIB 5TY0A 4DCNA 5B57C 1JXMA 5L3VA 1E2NA 4WAUA 1W4RA 4DSNA 4WXPA 2EWVA 1T6NA 2G3YA 3UMRA 5HTKA 1LV7A 1VDZA 4EPYA 1E4VA 2QM8A 1S1MA 4PPNA 2AD5A 3C41J 1N0WA 2R44A 2XXAA 3BWDD 1XZPA 5UKDA 2FFHA 5LD2B 3ZQ6A 3TUIC 3WBJA 2ONJA 2O8BB 1G3MA 3X1YA 2ZSEA 1RFLA 2BHRA 2P6NA 5H70A 1M7BA 3B82A 4XTCS 3HYRA 3HU2A 2OCPA 4EPXA 3W3ZB 4TYPA 1XMIA 1G3QA 2RGNA 5EXXA 2GK6A 2PT7A 2H18A 3QXJA 4AI6A 2YC2C 1W0JA 3EIHA 4MGZR 2GF9A 5L3SB 3TGPA 4NE2A 2A30A 1NP6A 2VHUA 4JLPA 5A0FA 4XH9B 3SJBA 1Z0IA 4ZO4A 1RYHA 5C2JB 3K9HA 5J4YA 3K09C 4PHTA 5CK5A 3CNNA 3HWSA 4GPTA 3A4LA 4PC2A 4TQ9A 4M21A 1R2QA 1U8AA 4NU0A 1PLJA 1T4GA 4DLVA 4Q1FA 2WZQA 2PBRA 1JR3A 1S3SA 1MO5A 3R9IA 2QRNA 4B47A 3DZDA 1IONA 1NG9A 5FOSA 4JL6A 1G6HA 3TIFA 2NZJA 2KE5A 2PH1A 2VL7A 4QNRA 4U7DA 3ETLA 3UG6A 2OFWA 3FHTA 4LBZA 4CEJB 5KDLA 3KKNA 4JBXA 3KKOA 2PZFA 2XNDD 2KBFA 3THWA 2O8EB 3OFND 3U3RA 3F8TA 3GLIE 1Z5ZA 4MH0R 4TN1A 2WAXA 4JLMA 3X1ZA 2QY9A 4IKEA 1SVWA 4ZIRB 1UKYA 2HDNB 1P6XA 2GA8A 3PUWA 3ZIAD 1QHNA 1NJFA 5C18A 3QXCA 2AKYA 2J5XA 1VYVA 2MSEB 3LRPA 3THWB 2V9PA 2E1RA 2ZSAA 1KYIA 5CIWA 4GDFA 5HZHA 4EFLA 4J0QA 5E3HA 1G7SA 1T3HA 3KFVA 3DL0A 4Q4JA 5DI9A 1BH2A 5JJIA 4RD6A 4BZQA 2I1QA 2R6DA 1IN5A 2ANCA 2IYXA 2EFGA 1CR0A 3LQQA 3LW8A 3RS7A 4MGKR 2FSIA 2P6UA 4KV9A 4BLPA 5IDVA 2ZJ8A 1E32A 4JYCA 3SHWA 3CF2A 3THXA 2W83A 4ZKDA 3K9LA 2A2ZA 2OCAA 2RHMA 4OHZA 2H57A 4MQBA 3C5CA 5FL7D 1XD9A 3EWAA 3U60B 3GLHB 5FL7A 4NCKA 4RY2A 2IXGA 1E79D 3E2IA 4Q1DA 2WMOB 5LPNA 3ZVNA 1OHHA 2IEYA 2W2XA 2QUZA 1Z0AA 2OSBA 2QPOA 3FWYA 3HU1A 3LD9A 2P5SA 2QMHA 4PFSA 1KAOA 4RCZA 3HP1A 4ESHA 1CIPA 2GCNA 1Z0DA 4W5HA 1XPUA 3ZJYA 4GP7A 1N6PA 4ASUD 1PVOA 5KNCA 4OJQA 2CLDX 1E2EA 2PMKA 4IDNA 1XTIA 3ZLJA 2CL0X 2Q3MA 4D25A 1XMJA 3OIWA 4K8OA 3A1SA 2QI9C 3KKQA 3VNUA 2XB4A 3QXHA 4JIMA 4XJXA 4LZZA 5AUOB 5DHFA 2G0NA 1HYQA 5KU1A 3LNCA 4BRWA 1GOTA 1X8KA 2Q3FA 4P4SB 4UNRA 2QU8A 1SVOA 1W48A 5EP2A 3FFAA 3BJIC 3GLFB 3H4MA 4LDJA 1GVNB 4BLOA 3OIUA 2QPTA 2RGEA 3OESA 4NH0A 4HZUA 4KI0A 4PHHA 1ZU5A 2VH5R 4JBWA 2DYKA 1TL7C 2IX3A 4MGYR 3WMGA 1KK2A 2NTYC 3LQRA 2CCJA 3QEOA 3SZRA 3GMTA 2FDCA 2BJVA 3N2EA 1XJCA 4FN5A 4A2QA 4CRWB 2GETA 1FP7A 5C1BA 2HYIC 1RE0A 4P33A 1NN3A 1A2KC 2A5YB 5FOUA 2Q0HA 2FH5B 4TLEA 121PA 2R6CA 4IRUB 5JSZB 1UM8A 1G4UR 1ZBDA 1H8EA 2RGNC 2QMOA 2FNAA 2I3BA 3RRZA 1ZC4A 1Z6GA 1R7RA 3SYLA 3IGFA 5FPHA 1EFRD 3RRNA 3L0PA 4LHWA 5A4JA 4LRWA 2OCBA 1KDPA 3IBYA 3QG1A 1ZC3A 4ZI2A 1OFUX 3G0HA 1KGDA 4PC3A 3PG5A 4Q9HA 4TQAA 3WBKA 1DTSA 4C0KA 2J0SA 3KJEA 4W7SA 1E9SA 1W2GA 2AXPA 2L0XA 2HYDA 2WJIA 2NO6A 3SHFA 1E9EA 4X8LA 1QHIA 1E9BA 4AD8A 2F1IA 2JLUA 3AVVA 1TF7A 2JJ2A 1KDTA 2QG6A 2ASEA 3MMPA 4I4LA 3TSWA 5KNDA 1XEXA 4B35A 1F5NA 1IHUA 3MWLA 1OH7A 4PC6A 2CCGA 1DVRA 3B1VA 5CK4A 3GLIA 1TU4A 4B3GA 1CEEA 1Q1BA 2QL6A 3QQ5A 2CBZA 1OXVA 4FMDB 4OQFA 5JRJA 3A8TA 4HAYA 3QF4B 3QPUA 4TLBA 3WYAA 1XWIA 1GITA 3FTQA 4XIGS 1RJ9B 2FEMA 2CL6X 4LX0A 3THXB 4CEHA 1QHHA 4GOKA 1E2HA 2A78A 2ZI3A 3PXGA 5KHOC 4TL6A 2WPDD 1JJ7A 1UBFA 4DLSA 4I81A 1QRAA 1ELOA 2D2EA 1JJVA 4ITRC 1NRJB 3AVUA 2EWWA 3AVOA 2BV3A 5D3QA 1GUAA 3BE4A 3KXIA 4XOIA 4V03A 1NI3A 4D0NA 3IBGA 4TL7A 3I8SA 4RSGA 3U3KA 3VR4A 2QSYA 4DKXA 3U44A 1G5TA 1RRFA 1S1CA 4MKHA 3T15A 1UDXA 2ANBA 5EZ5A 3UANA 2D62A 5G41A 5B64A 3FMPB 4FCVA 3M4YA 1OH8A 4MYUA 1KI2A 1VIAA 3MCAA 4BLSA 4IEIA 1OV4A 221PA 4LOAA 3LVQE 3U7FB 2ZI7A 3QKSA 5DN6D 4RFSA 3G5UA 4URZR 5LBIA 3UPUA 3VAAA 4C0AC 1N6RA 3NVAA 1R5NA 2R6GA 1D5CA 2NZ8A 2GDJA 2OEPA 1XNJA 3KJGA 2JIZD 3PR1A 4KO8A 4NCJA 2YINC 4NHOA 1RRPA 3DMDA 1QVRA 1DOAA 3L82B 4B2LA 1KJZA 1ZNXA 1PLLA 2AXNA 3Q5DA 3SI7A 1EK0A 1FMJA 4D4LA 2IC5A 1G291 1P2VA 2HEIA 4EJSB 2RMKA 2ZIAA 1NIJA 4HATA 1SULA 2H16A 5DH9A 1Z2CA 4QL3A 2UKDA 3KKMA 3TUJC 1R4AA 2OCYC 2NG1A 1COWD 4F91B 2YWHA 2ZRBA 3IO3A 4B3CA 4DC9A 5TMPA 2DHRA 2FFBA 3VNVA 2ZM5A 1YRAA 1CKEA 3OEHD 4IHQA 4HI0E 2WSMA 2BJWA 4P4SA 1VYUA 1Z63A 4JLNA 2BIFA 2YOFA 1KHTA 1NVXQ 1II0A 1AGPA 1PZNA 3L0OA 521PA 2DPXA 1ZAKA 1G8YA 1XB2A 3CPHA 3RS2A 3K70C 4WOPA 3VMFA 2GJ9A 3C7KA 4I99A 3GJ4A 3QEJA 4DCUA 5J47A 4P4TA 2AWNA 4QM7A 5AR1A 2XSZD 4WXRA 3CZQA 1E0AA 3VR5A 4A8JA 2ODEA 3HJNA 1I2DA 2GJAA 3Q85A 4QXAA 4YXWD 4OQNA 1ZM9A 4RD2A 1YZGA 1A2BA 4XSHA 3P4XA 3RS5A 3MUFA 3ASZA 1P7CA 2BKUA 4HAUA 4H1UA 4AKEA 4OKSA 3RNLA 4OJKA 2EVWX 1UKEA 5CLQA 1VCNA 2O52A 2BCJQ 1R5OA 2WHXA 3GJ3A 3RSOA 2PZGA 4QKQA 3EC1A 4Q1AA 3Q7QA 1II9A 2Z0MA 3N70A 4PQRA 4WBSA 3ASYA 1I4DD 3EW9A 5EP4A 1EGAA 1CXZA 2RHDA 2VHJA 3PUYA 5HE8A 5DO9A 3RVBA 5J5CA 4WZBE 2D2FA 2CNWA 3CW2A 3CRVA 4PTLA 1Z6TA 4EIWA 2IYWA 4OI1A 2B21A 4GBMA 1GFIA 3K0CC 3BBPA 3QXXA 2HV8A 3GEIA 2XTNA 3AVPA 3CIOA 2C5LA 2E9SA 4B2IA 5JCZA 4LGMA 1W2HA 2VIIA 4Z51A 1P4SA 2HT6A 2I4IA 3KXKA 1XTSA 1Z22A 2VP4A 4HEJA 3WRXC 1A1VA 1ETUA 5BWMA 4O3MA 1P73A 2QP4A 4KXFB 4Q01A 3RSLA 2ZAMA 5AWFC 3A1VA 2YV5A 4BEBA 3QKRB 3GJ5A 4DCVA 3KQHA 1KI9A 2EFHB 3IIKA 2IYSA 1P2UA 1CLUA 3K9GA 1M1YE 3AP3A 3KKPA 4PAOA 3KUDA 1XTQA 1OXTA 2IHBA 4G5GA 2ODWA 4KYUA 2NQ2C 1YRBA 3THYB 1PUIA 3KDSE 4O2RA 3L43A 1KAGA 4IDOA 2JLQA 4Y0AA 3KQKA 2GXQA 1KK1A 2QM7A 1E1QD 3I5XA 3JZMA 2IF0A 3K0FB 5TB5A 2V54A 2AHOA 1S9HA 2P6RA 1E9FA 4CYMA 2ZYWX 1GNPA 5DISB 1DO0A 1XTKA 4V0OA 1FL9A 1UF9A 4M1SA 1WMSA 4DUGD 5C4GB 4O25A 1J8MF 1JPNA 2JA1A 4P0TA 3IPXA 2H7VA 3BB1A 5JECA 3SU8A 2GCOA 1UPTA 1X1RA 3NBFA 1ZNYA 4A2WA 3P4YA 1N6KA 2ZRPA 1DAEA 4IXNA 5JHGB 3BIFA 4HB4A 2ATXA 2VPPA 1TQ6A 3ECCA 1G5RA 1E2QA 1RRGA 4B6EA 1TPZA 1IJFA 2OM2A 8OHMA 2V4ZA 3QUSA 1US8A 1FX0B 1FZQA 1DAGA 2IS1A 4M1YA 2ZREA 5EZ6B 2GEVA 1CRQA 3B85A 2ERXA 4C7OA 5CLLA 4QG7A 2DR3A 4EJSC 1WB9A 2YZ2A 4QOSA 3PEYA 5TARA 1WDTA 3CPEA 1G18A 1ZVQA 1KK3A 3VKGA 1T8UA 1SXJD 1AS3A 2YWGA 4KAXA 2HXYA 4NONA 4V0KA 4B75A 4DCTA 3K70D 4Q7KA 3OEEA 4TT3D 1RPZA 4YXWA 4AYWA 5DI3B 3CX6A 5HR5A 5L3QA 3H86A 2Q6TA 5BW8A 4EJSA 1NMXA 2GBLA 2ZE8A 4LK2A 4OQMA 3DZ8A 2ZJAA 5EE3A 3ZH9B 2BDTA 2HT1A 1EG7A 3R7WB 2QAJA 2ZVPX 2CHVA 2WIBA 1J70A 2ZU0C 1W4CA 2WJGA 2Z4RA 2BWJA 3ZD7A 1JAIA 5KTYA 3H1TA 1N0VC 1XXHE 1F2UA 4YONB 2XITA 3NEJA 2XTZA 1I4LD 3J81k 3LLMA 4ZCIA 4LJ6A 1W47A 1N6HA 3H84A 4CEIA 5LB4A 2RB4A 1RZ3A 2B7CA 3HDTA 1HE1C 4RZXA 3EARA 2VQSA 2GHIA 4NTZA 1AK2A 2B7BA 5F9FA 4NYMR 1K6MA 2F1RA 2MSCB 1U8YA 5DIFA 1US8B 1Y63A 1ZUHA 4PAQA 3EPLA 2XZLA 3SJCA 3RANA 4Q00A 4ZDWA 3MSXA 1NBMD 1R0WA 2J7KA 2ZR9A 4TMWA 3DM9B 5LDDC 1F2TA 2C98A 4TZ0A 1G3RA 4MUAA 1HT1E 1D9XA 3IIJA 4C9BA 1KNXA 1MH1A 2ZRLA 2VLIA 4JLAA 5EP1A 1JEDA 4HDQB 1Q1ZA 1VCMA 2BEJA 2C78A 4BASA 4CEHB 4URWR 1S4QA 5KSZA 1T9HA 1RJ9A 3B1XA 3K70B 1G7RA 3AEZA 3RABA 1NY5A 3SFZA 3U7GA 1SZPA 1Q57A 3FKQA 1YZNA 1A5TA 5FTMA 1AJEA 1MRSA 1Z8FA 3CX8A 4CT4B 2AR7A 4HLUA 1FNNA 4UXJA 1Q1QA 2QPAA 2ZUCA 2D06A 5KSPA 3QPVA 5DNYB 3QBVA 3REGA 1QBKC 4OL0A 1W4AA 1T0JB 4LYAA 5B30A 3OFNA 4V0LA 5TVKA 5H8WA 5D3MA 1BYUA 1SHZA 3GJ6A 3T1VA 4AURA 2AK2A 3QKRA 5KPDA 1D9ZA 1DO2A 2OBLA 3BFKA 3ND9A 1E99A 1P60A 2OFXA 2AFIE 4Q1BA 4DSUA 5FOXA 4JT4A 3CR7A 3VTKA 4A0FA 1BKDR 4DBLC 4B3BA 4QC2A 3FDIA 2FGJA 2GZDA 1AKYA 1N5JA 3F0TA 2FN4A 3WYGA 4LY6A 3O47A 1E9CA 1KTVA 2OXRA 5KDOA 1D2MA 2BBOA 3V4RA 1JR3D 4BFXA 1IXRC 4DEXA 3EASA 2PLRA 4HLDA 4DT1A 4TTPA 3U3OA 2WJVA 1DELA 2F1HA 3I32A 2WJYA 1KI6B 4URYR 1GKIA 1NY6A 4E5UA 2J1LA 2A7QA 3CO5A 4PSVA 2EQBA 1G17A 3CF0A 1N0UA 1OKKA 1IY0A 1G21E 4DJTA 2QGZA 2IWRA 3GJ0A 4LBVA 3NIBA 4P31A 3AUXA 3B13B 4LJYA 4Q1CA 1CR1A 1VG1A 4UJ3A 2J0QA 3HU3A 3A4MA 3VX3A 4OHWA 3TAUA 4A2PA 1UBCA 2QA5A 5JMTA 3LW7A 2C99A 2KWIA 1KO7A 3UMSA 4D2IA 4JLDA 4DDUA 1XD2B 1QVAA 3B5JA 1N5LA 3TUZC 1ZD9A 2AFHE 1I4TD 1Q12A 4KFSA 2HF8A 3DHWC 2QZ4A 4M4SA 3K0AB 4EUNA 5FTLA 4M1MA 1W44A 4DCSA 1MABA 1CR4A 1Z0FA 1D8TA 3B6EA 4R7ZA 2IYLD 3WP1B 4RKEA 3U3MA 3ADDA 3DPUA 2CXXA 1RRCA 3FGNA 1EESA 3KJHA 1YZQA 4XVQA 1NJGA 3RYTC 4MKFA 1NG1A 5J4LA 3VR6A 4M1OA 1E9RA 3CX7A 3C16C 5KO2A 3AVWA 2O8DB 4GZMA 4YLGA 2PEZA 2C77A 1T0HB 1CJKC 3PFIA 1FPMA 2KBEA 4TYWA 3BGWA 1LB1B 4PZYA 2XEXA 5FOWA 5JWOA 3ADCA 2BMFA 2O8FB 4D4MA 1TTTA 4AIIA 4Q1EA 3D6TB 4HAVA 2VO1A 4UNQA 4CIDA 4EPTA 1MO4A 4DLXA 1X6VA 1N6NA 4C0SA 4ZV4A 4KLZA 2ZAOA 4K81B 2YKGA 4TLAA 1G1MA 3TAHA 2RAPA 3NHAA 4JLBA 1VG8A 3OIVA 1WA5A 2C2HA 2VP2A 5JJLA 1U81A 3MWJA 1VECA 2Q9CA 1Z2AA 3C5HA 4PPQA 4A9AA 3L2OB 4DLUA 2A5DA 2ECKA 1M34E 3I8XA 4DEYA 5K8UA 1FMLA 4KFTA 3U44B 1VG0B 3NHBA 1OYWA 5G53C 1OFHA 4HYYA 4B6FA 4NYIR 1HTWA 3FFBA 1F6BA 1MR3F 2CK3D 3R8CA 1IJEA 2BBTA 2H1LA 3RLFA 4LC1A 2QBYA 4MRPA 2BMDA 2YWEA 4I1OA 1GRNA 2UZIR 4C4PA 3AP1A 1PLKA 4MA4A 1AQUA 2ZRFA 2WTUA 4IXMA 1OH5A 5G3YA 1GIAA 3TKLA 1UKVY 1U9IA 3B1WA 1COWA 4MYCA 2AWOA 1KY2A 4XTRA 2ZUDA 4MRRA 2IUUA 2R65A 4C3ZA 5KDDA 1N6OA 2FF7A 4R2HA 2W6IA 1J99A 3CNOA 2WM9B 1UKZA 1UJ2A 3LAWA 1U9IC 3R7WA 1ESMA 3ZIAA
chains in the Genus database with same CATH superfamily
4NK5A 4CG0A 2C4HA 4IFBA 3HLTA 5C8YF 4DXAA 2AVNA 2CVFA 1TVKB 1M1NB 2IOQA 3BXPA 4M9CA 1XZEA 2VTDA 2ACVA 3V8BA 1B23P 3KHTA 4XQ9A 3AU9A 3NHWA 1OR8A 2Q5QA 1POXA 4MP6A 4A8JB 3MBOA 1KY5A 4UM5A 5C52B 4WK6A 3J81A 4C3UA 1VHTA 4W1SA 4B87A 1JSRA 1Q95A 1F2VA 1SVSA 3INYA 4J0DA 5FEMA 2ZETA 2IV7A 2AF3C 1AQ6A 5IPFA 4H4CA 2GRUA 3UWMA 3SYLA 3NRJA 4A82A 5CAEB 2XODA 3A1TA 1G0OA 1OTXA 5KYTA 4CV3A 3F2IA 1FLDA 1TIKA 2WQZA 1WE2A 2O2YA 3FCOA 4H7EA 4CLHA 3H9QA 4OUDB 3W4IA 1NYRA 4UAUA 3BMCB 1NNLA 2I8AA 5T4HA 3O3CA 1OZFA 3WA6A 1QV6A 1GU0A 3IA7A 5HKBA 4FUTA 4CCYB 4ZQCB 4YMTA 2CJWB 3VR4D 3CZ5A 3H2KA 5EIFA 3UWDA 1NLMA 3BSYA 1P19A 4XSGA 1SCUB 4OBXA 4NEHB 2OMKA 3LOPA 2YHIB 5F35A 5L4NA 3CX4A 4NMMA 4NBNA 4P7JA 3GV0A 4EECA 3MJTA 4MVJA 4FDLA 1UP7A 2YZNA 3K6KA 3L92A 1O94A 4KH0A 2CHQA 3D81A 5CYPA 1TADA 3MLEA 1ZXLA 4UM9B 2PK3A 2NMVA 1Q3HA 3BXOA 1XJ0A 3N5CA 3EEOA 4QVIA 4K2HA 3EQ8A 3ND8A 2VP9A 5I7RA 5J4VA 1Z0ZA 4UU0A 3HE3A 1LBHA 2CUNA 4CMEC 2OTCA 3CUSA 1Y6RA 2G40A 4HRXA 5I3CA 5KWJA 2QN6A 4MWZA 4O29A 3BB3A 4PLYA 1E2KA 1KDOA 2VP5A 3OTHA 1X70A 2PS0A 4WV3A 3NHKA 2HJGA 4OI4A 2O1WA 1XMQB 2FR8A 3VR2A 1PFWA 4L9AA 3D7MA 2IDJA 3I1IA 3A2LA 2VRBA 4Z86A 4Z3DA 2ECOA 1NMYA 1Q0ZA 5THQA 2VAXA 4IMRA 3LO8A 2RE8A 4KKVA 4J0FA 4LE0A 1U6IA 3OPMA 2GAAA 5AVQA 2DWOA 3QLTA 5LD2C 2W0MA 4QWWA 1EXMA 3C6BA 1NAHA 1XMVA 3M5CA 1MT0A 2YBDA 3K0AA 4GH5A 4GT1A 3V8RA 1X92A 1YGPA 3CRW1 3EVGA 1T5HX 3LRTA 2BGKA 4OHBA 5GOZA 2Q1WA 2W58A 5SV2A 4KGZA 3UH0A 4HEA6 1K86A 3SZOA 4AKHA 2FY8A 3ELYA 2ZB7A 2BH2A 1J2TA 3GUVA 4AJOA 3EUWA 3SLRA 1KR5A 1SM4A 2GBCA 3C6ZA 3IESA 4UUPA 5E3JA 4DTCA 4QUDA 1CVLA 3PGMA 5BPHA 4DNQA 1PUJA 1RVDA 2FGKA 3AVQA 3G0DA 3M0EA 1BDMA 1ZMTA 4R1SA 4D26A 1ESZA 3R24A 3AKEA 5J3JA 5EHGA 1Y6JA 5EXPA 2YOGA 4PYOA 1GZ3A 1CQIB 3VNRA 4YYZA 3WYEA 3H8WA 1YUMA 5AW1A 3AVXA 1P2GA 1DQPA 3CEJA 2XB2A 3IEUA 1V1MB 4ESVA 1DKPA 2A9JA 5LDGA 1U7WA 1R9NA 3BH0A 4TL8A 2MT9A 1YQQA 3IQWA 3JQPA 3KM0A 4HUQA 1EUQA 1B14A 1W0CA 3V1YA 4Y18A 4C08A 1QF6A 1AE1A 5DGTA 2WTNA 4BJ3A 4QRIA 4YV0A 1II8A 2OORA 3AUSA 1V5GA 4RV9A 4CF3A 3ZI7A 1DAIA 4IJ6A 4PG5A 4IDAA 2XCIA 1D1QA 5F2EA 2JASA 1Z6YA 4OMUA 1GV1A 5D1HA 3KQNA 4GOXA 3ONFA 2OFFA 3VZCA 5K0SA 1Z28A 2HCBA 4WUVA 4M0CA 4D9GA 1XRJA 2QV0A 4BVLA 1CUEA 1OVMA 2GASA 3LXRA 3VSAA 1TZCA 1AZTA 1XZFA 1XC7A 3F47A 3LLUA 2Z43A 3PKZA 4OGFA 4IIHA 4RD0A 2JLZA 3WLNA 1OPXA 1HEUA 5DXFA 2ZS9A 4Q1VA 4RC9A 3RGWS 2XY4A 4R2WA 4MMYB 1SXJC 4TWIA 5LLSA 3TLXA 3SHOA 1TYAE 1N5OX 1U3CA 2BF7A 4FDMA 1N5KA 1E7YA 2O6LA 3L8CA 4CKBA 3UMYA 1Z8HA 2VF7A 4IXDA 1JT9A 1DJPA 1TKBA 2W6JA 2DUMA 1KFCB 4Z0HO 3H1AA 3RYHA 3R4VA 4WZAA 4DDVA 1J0CA 3MMXA 3PDCA 1RLUA 1YIOA 3I1FA 4GNKA 1K9SA 3GVHA 4N0EA 4OF4A 2IUFA 4WN3A 1NI4A 3R41A 3HV2A 1NNEA 4LFAB 3WQSB 1TVEA 1JPUA 3HRKA 4O4IF 3A6KA 4A36A 5AP9A 1CNFA 1VPLA 3GDOA 1TM4E 1R4MB 1M75A 2M6SA 4BO1A 1T2UA 1VDMA 1VPEA 1XA0A 2MWMA 1OIWA 2FG7C 3H0CA 3ESXA 4NMXB 2NV2B 2W2VA 4DLRA 2G72A 3OZWA 3EPJA 3II6X 4HAOA 1DAHA 3ZHOA 4XSVA 3LU1A 3SVLA 2O0JA 1E79A 3VXKA 1GWNA 3MINA 5CGZA 2PR7A 4TQGA 4MWOA 3QOFA 3ZOKA 3D4NA 1IIRA 3QIAA 3VVLA 4G36A 4NARA 4MGIR 1JHOA 2XB9A 3KYJB 3FNEA 3H7IA 4J16C 5DTMA 2B8TA 1AF7A 3ZHQA 1KZHA 3A2MA 2PPVA 4MPPA 4ABTA 1YHNA 2H1FA 4X44A 4CTJA 3TZ6A 4KOAA 1FQJA 4NDZA 3FJOA 5FFMA 1VBFA 3KL2A 5I8PA 1TYBE 1WO8A 1BROA 2PKWA 4OCZA 3CLVA 3RWOA 1IVSA 1C7EA 4H7JA 1AV7A 1YAHA 1JAHA 1ACJA 3TR6A 2QTHA 2VH2A 1AM4D 1RBZA 2P9HA 4IIGA 4DMUB 4ZAZA 3FTFA 2WHPA 1DMRA 1CUYA 2EX0A 2HQ1A 2O0LA 4JS0A 3DGEC 4UXHA 2I7DA 3TZHA 1CQPA 2F3TA 2C42A 2A0FA 2Q3JA 5C7OO 3COYA 5IF9A 3LDGA 1FP1D 3NDPA 5IC4A 4KPEC 2FWRA 1Q21A 2P69A 1L5ZA 3A9WA 3PC4A 4M0LA 3QW2A 1C4OA 4FD2A 1OREA 2OBMA 4FR0A 3TJZA 1N8NA 2YWCA 3ET5A 3IV7A 3F6YA 2JHPA 1YIDA 1Y5LA 3GARA 5DE3A 5K3SA 5JFTA 2OZEA 3PNLA 1Z0KA 2E5FA 4TV8F 2CVHA 1ICEA 2JAQA 1N33B 4G0NA 4PPGA 5DH9A 1YFLA 1Q7TA 4F5ZA 3IDSA 1GZ5A 1R3UA 1U9ZA 2IH5A 3GDGA 3OIYA 1L1QA 1GG2A 5BR8B 4MDEA 4TT3A 5C31A 1WXXA 4K7JA 1JLKA 1MJHA 3CT4A 2FPLA 4ZT2A 2TECE 2QU7A 2PH5A 2PA0A 1CZNA 2GZ1A 4FILA 4RMJA 2A92A 2I2CA 3DOUA 2Q3CA 3GAZA 5TXGA 3T5GA 3ZWVA 4F3KA 4W7HA 5KMGA 2RHHA 1LDNA 3ZV4A 1HFWA 4U6NA 4E5YA 3DKPA 1CPYA 3VU8A 4CQJA 5GZ3A 3EZ6A 2A1UB 2WOOA 2R3SA 3A4NA 3KXPA 3NOVA 1WY5A 5T5QA 4BFYA 4BNDA 2VXBA 4C4ZA 2EOAA 2EKQA 4CKBB 3WAKA 1U0HC 4EJFA 1HQYE 2DWPA 3U37A 1U5CA 3NHRA 5ALQA 4ZYTA 1TK9A 2WUWE 3W78A 2QS9A 4BYGA 2C83A 3CVYA 2VYFA 1U6KA 1QPZA 3T0IA 1K0FA 5CVVA 4PEVA 1LF5A 3PXEA 1BEUB 1PJ4A 4ZVVA 1N7JA 3DBOB 2A59A 5AVWA 4N5IX 2PGIA 4NDAA 1DX9A 3IH5A 4EPWA 1TLFA 2QJTA 3CQ9A 3PNQA 2GD0A 1FRQA 1NMEA 1PSWA 4KXYA 4M7RA 4NPAA 4Y0VA 1PE0A 1VBNA 1QFMA 1V45E 3FDZB 1RFGE 3IOMA 3LFUA 4QDOA 1OKKD 1N1MA 1YH3A 2Q28A 2ZTUA 1PQYA 4GFDA 5CT4A 1HY3A 2ZI6A 3TBFA 4H1HA 5IN5A 5FADA 2ISQA 3TKYA 1AC5A 7GPBA 3AB3A 4C76A 2FZWA 3M6XA 5FWXB 5FUYA 1L5RA 4KBYA 2YZ7A 3LE8A 1IMJA 4ZC1A 2C04A 4JLOA 4MVJH 2H6EA 2HU7A 2P7IA 1QUEA 4OHMA 3G0IA 4S1VA 4ZZ2A 1YC5A 1YR8A 3AUYA 2QZPA 3KB8A 1I2CA 2QENA 2GZRA 3CNEA 5A7HA 4V1CA 3COSA 3GL9A 5ALZA 1JFFA 5TF4A 2CXTA 1H2YA 4E09A 1X7WA 4L85A 4E2ZA 2P4QA 2PQ0A 2UZ3A 4ZT3A 3S2ZA 4F45A 1IUOA 3A3PA 4F1KA 1GA6A 4DG5A 5EVJA 2QW1A 3BXXA 4CV1A 1V4NA 1H5NA 2X5OA 4HZUB 4XQEA 5AK0A 2AL7A 3SYMA 3DO5A 1DUVG 4RGQA 1LW7A 4CLRA 3EQ7A 1FNMA 5JBNA 3SN6A 1IM2A 3QELB 3G82C 4LXHA 2ZSJA 4E7PA 3RSHA 2FEAA 2GYUA 3JR7A 2R1TA 3N0XA 3KUCA 3CUEF 1EAYA 3P0RA 4U7FA 1WV1A 2HK7A 1DLJA 3KXLA 4I50B 2Y2VA 4UCFA 4DV5B 1IVYA 4EGSA 3B20A 2Z6UA 3GUHA 3ZE0B 4OP1A 3HADA 1OU4A 2C2OA 5JAZA 3EPHA 3V9PA 1JSLA 2HAEA 4FMCF 3ESDA 4G5HA 1LW6E 4TKLA 1M6VA 2WSIA 3ZLVA 3LK7A 4GPEA 4IZIA 1FP6A 2QT0A 2WYWA 3D3NA 4XYMA 2CE2X 1AQNA 2F64A 2J9RA 2BI4A 2HFKA 2ZKLA 3CUVA 2ZTSA 2C9YA 2ZYAA 3IPRA 5JO9A 3OX3A 1DIRA 3WWEA 2GRJA 2HSZA 1UJ5A 5B3AA 5F2KA 1SEPA 1MA3A 1OASA 3P45A 4TGLA 2F9MA 4EUFA 2OHJA 5LZ4A 2B4TO 3T7JA 5J23A 4HSEA 2VAMA 1BTOA 2ZRIA 4PLPA 2OCDA 4EBBA 2E4UA 4RCYA 1OWOA 3HGQA 2E4YA 1OFUA 3GPLA 3QPWA 1YUBA 1J7JA 1H6DA 1TTQB 2JRLA 2X9QA 2JD1A 4Q4LA 2FRVA 5B6PA 1R0XA 1Y7LA 2CC2A 4M6WB 5M7EA 4M3NA 1OT3A 2JKVA 2NU6A 3PGXA 4MX8A 4ZI7A 1SRQA 1ZITA 1A7AA 3URKA 4AY5A 3NTQA 3O73A 2B1JA 3P0FA 3BILA 3FMIA 4RV5A 1ZX1A 3THRA 4HV4A 1QGZA 1P77A 1B8NA 3S7TA 3N07A 1N9GB 4CQMD 5KCMA 2DERA 1UZNA 5KQMA 3WAGA 5AM3A 2LTAA 3PEVA 2RI6A 4L2IA 4Y9RA 1Z33A 2R6FA 4PTYA 3RFFA 4BGDA 1J23A 3GNLA 2WD7A 1ZXBA 2HGZA 2D3WA 2VATA 4PNHA 2XX3A 5CHEA 3CH4B 3VKFA 4L9SA 4BB6A 4BX2A 2CD9A 5IKPA 3KB1A 1KVTA 2I7TA 1AMOA 3BTUA 3AIIA 2VTEA 4LI0A 5FRDA 2O19A 4H7HA 3KR0A 3TWOA 2Y3IA 2BKEA 3BZWA 3JVUA 3ICQB 2V74B 3MJVA 3LT0A 1DQZA 3IXMA 3QNMA 4LV5B 5B12A 1EHCA 5G02A 2FFAA 4EB3A 1Q7RA 1UC8A 1KYQA 3BE6A 5HZMA 2Z8ZA 3ROQA 3I0NA 3OT5A 4OFXA 4C78A 3M6VA 3RSQA 4MLPA 3WQQA 3I53A 4URUR 1Z88A 3WXMA 2JLXA 4YY3B 2H0RA 3ANTA 1A4RA 3QVJA 2ZIGA 1RYFA 2EJTA 3NXKA 4HAZA 1YOBA 1DIOB 2X8LA 3JW8A 2A88A 3CZPA 2PJZA 4H7DA 4Y8VA 2L18A 1FDSA 2AUTA 5EUMA 4EAQA 1KJYA 1XAIA 3AHIA 3C3WA 3H1BA 3PNKA 1XE3A 3NVDA 4IBOA 4TTIA 4JKIA 5LP6C 4MI9A 4DDTA 3N8NA 1PZHA 2QJWA 1WABA 3OZDA 4KNYA 5ITWA 1Z4NA 1Z4OA 2CMFA 4NEQA 1HG0A 3PNMA 4UAVA 1Z9BA 4A27A 3CH6A 3F4BA 6ADHA 1IAVA 2AZDA 3I42A 5CT5A 4UTNA 3T9CA 5F7XA 1VLLA 3FLEA 4ABYA 3UMJA 2IE8A 1M2GA 3AERA 2YOHA 3NJRA 2H85A 3O4VA 1GAWA 1W5TA 1W87A 1Y7TA 1JYFA 3GBSA 3ADBA 1NBME 2OOSA 1XNRB 2RGXA 2D7DA 2WHPB 2JAHA 2JI6A 2IYOA 3H4IA 2R47A 3R44A 4LK3A 1QOPB 1Z4PX 1W30A 1TOAA 2VDMB 3EDCA 4FCCA 4WLUA 4BFWA 2KI5A 1AKEA 2GCPA 4D9EA 1E2BA 2PXAA 3JV7A 2V55B 1KXJA 3K1AB 4DIEA 3S68A 2ZRDA 5B36A 2DFLA 1WRBA 4CEIB 1GQOA 2J7PD 1NVKA 4M7WA 1HLFA 2M6LA 4JLKA 4ND1A 3VU3A 2IKQA 1M7HA 3HVUA 5EXSA 2EGUA 1S9DA 2JLSA 2PUBA 1C1HA 2PPLA 5FUWA 3O8QA 1LTHR 2XYQA 5FPSA 5JARA 1JQAA 2O07A 5BNZA 4O08A 1TVKA 1CT9A 2DPMA 1N7HA 3O83A 4EF5A 4RTNA 1YZVA 5JYDA 3W9UA 1ITZA 4MW9A 1GZHB 1M1XB 3A36A 3QZUA 4QPZA 2JAOA 5HXAA 3F7TA 4KJXA 1ZM4A 4R7TA 5D84A 3OE4A 2NV6A 2WNIA 2Q49A 3FRHA 4IPTA 2QSZA 4IKPA 4UBJA 2XUIA 3BFVA 3TLCA 4E14A 1JAXA 3SJUA 3HCEA 2M9MA 4S35A 1PNRA 3C1TA 4K28A 1R8YA 1UMBB 1SB8A 3BDVA 4DPKA 4W5WA 1DG9A 3TDNA 5LJIA 4FGLA 3P32A 5FQNA 3RUPA 1UZAA 2CJWA 1D1PA 2FHSA 1L3BA 2CVQA 3Q8LA 4DLYA 4MQ6A 1J8YF 1T4CB 2C2WA 3KZNA 1WLSA 2EZUA 2JEOA 3S2FA 3STYA 3TW6A 3IQXA 4NCBA 1NX9A 1OWMA 2P1ZA 4G89A 3MERA 3UWOA 2V98A 5CTAA 4HNTA 2W2OA 2CDBA 2XWBF 5EEHA 3H1GA 4RX1A 1H0HA 2FSGA 2K7ZA 2P9BA 3ADOA 4QGGA 5E4FA 4IWXA 4F2PA 1V11A 5EJEA 3DMNA 5BVGA 5KUTA 3ZUGA 4EG8A 2ZYUX 1I7DA 3I4CA 4WXYB 4PCVA 1E5TA 2K6GA 5AVJA 1U6JA 2WU4A 1PWZA 3R3VA 1YR9A 3D6MA 2CK3A 3RPEA 1UPFA 5LQCA 5B37A 4ALNA 1BA3A 3DDNA 3U7EB 1XJQA 1R10A 2AJCA 2A5JA 3COWA 4ZN6A 4IMPA 2I6QA 1BFUA 2H52A 2O3QA 3K8YA 1I30A 3GUZA 1QK3A 4FONA 5FBZA 3ZDDA 1WVIA 2NUPB 2OV2A 2PT9A 4IX9A 2G1UA 3PFGA 1WPXA 4N5LA 4PLFA 1JEQA 3FYUC 4Y9UA 3ST7A 3BULA 5IM5A 1CUXA 3ODGA 5CG1A 4QARA 3X2FA 2CMKA 3CYFA 3AP2A 3G5TA 3KZOA 4MKGA 2MJLA 3CZRA 4QUAA 3IDOA 3N3BC 1A9OA 3TZQA 3RYIB 2W6OA 3NT5A 5LR6A 2ZTLA 3LDAA 4NZMA 3AYXB 2JIBA 3HV0A 1YJXA 2DKNA 2JCYA 2YC4C 2GLXA 2I3GA 1L7VC 3BCSA 4ZYVA 1YAJA 2C5AA 2QAGB 4DC0A 4FI3F 4DGSA 1PR1A 1HZJA 1X7ZA 2JJ1A 4PSAA 4C21A 3HVRA 5COAA 5JD6A 3W6OA 4JN6B 4S2EA 3JQ7A 1ZU4A 3BS4A 5F98A 4CQLB 2GKOA 3BXHA 2I0FA 3IMKA 3JYOA 4HGPA 1SCIA 2PDAA 4Y6SA 3LBIA 4KMRA 5LOVB 2E7ZA 2R8PA 3M6AA 3MMSA 3WLLA 5EHZA 3ONVA 2CXNA 1WNTA 4XYBA 3UTDA 3PTAA 3OFJA 3FF1A 1XRPA 3LDFA 1BKSB 1HDOA 1SA0B 2D3TA 2E4WA 3FSGD 3KUXA 2P2ZA 2F9LA 5FBQB 2TMKA 2GJ8A 4F1WA 2XA9A 3LY5A 1DJLA 2V1UA 3RREA 2YH2A 4YBZA 5CCXA 4EEKA 2IUEA 2VJMA 2UUAB 1PW5A 1AO3A 4BMVA 1XNGA 4JT8A 2WEKA 3TQSA 1X77A 2O8CA 4NATA 4XX0A 3LI2A 1MMFB 1SCAA 1MQAA 2OXEA 3R3JA 3WGJA 4QPJC 5HBGA 1N6LA 2HOQA 4GM1A 4V39A 2H5JA 5IC5A 3RBZA 1XCLA 4UQLA 2G1PA 1XCJA 4XD7D 3HEBA 1NQTA 1X86B 1E98A 2D5IA 2VSFA 4Q12A 4HB2A 4TXHA 2WU3A 4UNPA 4Y2XA 2REOA 2VDLB 5CVUA 3UV7A 2ZBVA 5A03A 1H22A 1MUUA 5JSFA 1ACLA 4ON9A 3KYCB 2ZITA 4B3XA 4X62B 1AH2A 3RHSA 5IT5A 3TEFA 2QP3A 2GWHA 3N8HA 1G20E 2WBLC 4OYHA 3DMGA 3R5SA 1JS1X 3ZHXA 4BEWA 2ZI5A 3PQ4A 5AKJA 5AJVB 4BN5A 1EFUA 3LDHA 2VNJA 3NATA 3SE0A 3QOYA 4AN0A 4E5SA 2XH8A 5IXJA 4R40A 3THXB 1QLWA 3IUBA 4TWZA 5FX2A 2R8BA 2VWPA 4EKGA 2PR2A 3AR7A 1CG6A 5HF8A 2VG8A 4YJKA 1FC0A 1L5QA 3ZBQA 3MC1A 3DLBA 3MJFA 2ISCA 5E2AA 3LKZA 2ILVA 3WK8A 4AUMA 4AO7A 4KP7A 4R0VA 4OBWA 1L4BA 5C35A 2VZ0A 2AFHA 3KB6A 1HURA 3K94A 4URFA 4KRYA 2BUBA 4B4WA 2X0FA 3L9WA 5IH7A 1VE3A 5DTQA 3SZLA 2NAFA 3DWIA 4D9NA 3SFTA 3IE1A 1R0SA 3D7LA 2XECA 3B89A 4RTQA 2WKPA 3PHBE 1P75A 2Z6VA 2D7JA 3SZ3A 3AFOA 4DILA 1XNHA 1CK4A 2A3NA 5HGJA 2B1IA 4ENVA 1TT5B 1YT5A 1U8XX 4OXRA 3FWKA 2Z1NA 3VMMA 2GR9A 5DM60 3ICPA 3MWKA 4B3MB 2C2GA 4JBIA 3GGOA 4M9QA 4ZICA 3R6LA 2XRYA 4EGJA 4HDSA 1JQ3A 1UEIA 3JQBC 4QJ4A 5IRCD 1Z39A 5CA1A 2A8YA 1IXKA 2HIGA 3KDAA 3VV2A 4U8HA 3SCZA 4KIJA 3JALB 1NMZA 4PYKA 1Y7IA 4BCCA 2VZEA 1Z5WA 1RPNA 4PLWA 2QQEA 2BTOA 5AM0A 4LQLA 3BGDA 1B8VA 4UHCA 3L8EA 1NWCA 3QPBA 4V38A 4YDRA 4RMGA 2Y1XA 2X0KA 3IAUA 4KMOA 4TXMA 3ZJUA 2PKCA 3V00A 1G5IA 4ZXPA 1OFIA 1MLDA 5DKFA 4Q47A 2OGTA 3E7FA 3I8OA 5H83A 2HRDA 1DG3A 4H3SA 4PC1A 1Q14A 2QTCA 3U3XA 3KT8A 1GPNA 4IL5A 3ZDQA 1XK7A 3JTEA 3MAAC 4TRRA 5IC6A 5TS3A 2JFZA 4X3OA 2PWPA 4J2TA 2AT1A 3AIOA 2YJ4A 2AUMA 5T67A 4CDGA 4O2AB 1L4LA 4ZJZA 4D0RA 2Q8NA 4N18A 3VHQA 2FYTA 2V6FA 4L78A 1LBEA 2YMMA 2R60A 4RZ3A 3SYRA 2IWHA 1ONSA 3BF7A 1J49A 3FIUA 4NE7A 5ULLA 1J24A 1RQ2A 3C7AA 4B32A 4BNWA 4I1UA 4MR9B 4YMUA 1AF4A 1W34A 5HDQA 4AUEA 1ZINA 2IHZA 3C24A 4COKA 2XYHA 5L3RA 5AD1A 1XF9A 3HKDB 3K2IA 3D7RA 2L19A 1KAHA 3V9AA 1TMKA 4XD2A 3NC0C 3SXJA 3WWZA 1QOZA 2JJ1D 1KRWA 1K2WA 3LQ1A 2Z2YA 3ICWA 3OJWA 3PGKA 1GKLA 2C5SA 2FQQA 3A26A 1JBKA 1H8HD 3BMQB 4FS8A 4ZEXA 3WHKA 5EUQB 1E2DA 4FSXA 1MO2A 2WPNA 3C98A 4AMVA 4R1OA 3H9GA 1AD2A 1WVGA 1LUAA 5ER9A 4BZZA 1ADBA 2PYZA 3EEQA 1YOVB 4BNVA 3E22B 1IOZA 4F96A 1C3VA 3HA7A 1ZH4A 1T36A 4FZ5A 16PKA 1W93A 1MHPA 4CKZA 2IV2X 3ZV7A 4DRXA 1GRQA 2OXCA 2WHQA 4F93B 3LVRE 4MWDA 1C0PA 1BE6A 5ERXA 4JI6B 3O82A 1YKFA 1Z56C 5E7IA 2EU8A 1M74A 1CJCA 1O97C 2DHEA 1Y80A 3OOSA 4D9MA 3P20A 1E5VA 1FFSA 1TGVA 1ZOLA 4M0KA 4XWYA 5L53A 3ESRA 4EWLA 5CVTA 1C7RA 2EZ8A 3SKXA 1Q20A 2ADMA 2R2AA 3A2NA 5D00A 3TCXB 4BMCA 1RLOA 3H0KA 5IJ0B 4RTSA 4RHFA 3HN2A 2JFWA 4JP5A 1OLSB 4MRSA 4E08A 3MT9A 1FTYA 2GJSA 3OQHA 1U04A 4DQUA 4DB4A 3IP8A 5C7YA 1V47A 1HL7A 2ZR0A 3OTIA 5FTNA 4HWSA 1P2SA 1V16B 1N2CB 4FB5A 3A4YA 1FTGA 2MYPA 4DM4A 5L95A 1W6UA 5G0TA 4QUEA 1OX4B 5BURA 4IQ4A 4DVGA 4OLAA 4AYXA 3BWMA 4IVRA 4WVFA 4UHEA 3K1AA 3BX1A 1U0FA 2NP7A 4KDCA 2PSDA 2O5RA 2WT9A 1THGA 2WIJA 4EL5A 1JHMA 2VTKA 1BIFA 5FBWB 2O0HA 3PIRA 3ZWNA 3Q5EA 1RZRA 4EHFA 1KYXA 4D02A 1KZ1A 3NGMA 3OUTA 2DBYA 2RH4A 1UDWA 2ZDHA 2GARA 3EH2A 3KJNA 5EJ4A 3MK31 5A5GA 1ZH6A 2CFOA 5BN4B 1SU6A 3VKHA 2QF7A 4KVAA 1GG5A 3IEMA 1R9GA 5CFMA 2AG5A 3OQBA 4RVNA 5B2EA 3V32A 2PO7A 4X6XA 3RVNA 5EUBA 3ABQB 3BAZA 4K3UA 2JZCA 4N3GA 4FCWA 4BFUA 3H0EA 4V1CB 2AC7A 1Z2OX 3LUHA 1HX7A 1OROA 1BZYA 2CJXA 3AI7A 2C4MA 2GYYA 2ODBA 3CW9A 4LDPA 3AR5A 1NYQA 3EGIA 1AA6A 1JH9A 2ONKA 5FNVB 1GAJA 5K3EA 3I72A 1MO6A 2BMVA 2E4ZA 1YRHA 4PLCA 1KFKB 3KTAB 3PDIB 2ZUTA 2ROQA 4Q4HB 2FI1A 4UDNA 4ZO8A 4ZHQA 5IKOA 3CB4A 3M82A 5FHRA 1OC2A 5C1IA 5AW4A 2OILA 3TNFA 2FUG1 3CLUC 3G88A 4P4GA 4PX5A 3GDHA 1PN3A 3CLKA 4UMEA 4YI3A 3T5MA 1OB2A 3OT1A 1UBTS 2Z1MA 1BXGB 1BX0A 2FU5C 5EIBC 3OQNA 3DUFA 4TX1A 3B52X 5GMOA 1Y6ZA 5H0IA 2QTRA 5REQB 5KINB 1TUGA 1DRUA 3KPVA 2DCMA 4C29A 3DOFA 1R6DA 1GNTA 1ZD3A 3PV0A 2XNDA 1Y1RA 2FMKA 2HIHA 5ERYA 1R64A 1T2FA 3D0QA 5B4TA 5GADl 2XMDA 2PUAA 2PX2A 3ZS8A 1X38A 4C4XA 1L4NA 3TMKA 5BW5A 3F3SA 1ZL2A 3DG9A 1SVIA 3PR2B 1SKQA 5HUJA 4LXXA 2FFRA 3PTLA 5SY6A 2C9DA 1WBJB 5ABPA 1XTZA 1TDJA 3M4JA 2DSTA 3C8UA 2BAGA 3FVTA 2YL2A 3HY3A 2P8SA 4G5FA 2HF2A 2RFLA 2OO5C 1PDOA 3JD1A 2JFOA 3RUHA 3SNHA 4P1ZA 2QL7A 3AFIA 5IJ0A 1BMQA 1EZ4A 1QWOA 3UHJA 1EFAA 2FWIA 2FW0A 1XF1A 4PZEA 1GGMA 4QDZA 1T2AA 4Y2JA 3STXA 2B6HA 1J2UA 2NSDA 4MI1A 4Z2AA 1TJ4A 3DCIA 1YI8A 1O54A 4KAFA 1LNSA 1N0HA 1GDDA 2F8MA 4W1PA 1XHLA 1KMQA 2RGBA 3O8OA 4ZPXA 4N3BA 3OI7A 4XQGA 3MF4A 5DNAA 1SKMA 3JPWA 4KYVA 4HFNA 4Z3KA 3K71B 1W0JD 2R6AA 2F43A 3ORQA 5LA6A 4JZKA 5EC8A 3WKAA 1GNSA 3BWYA 4TKVA 1ZM7A 1HYEA 2OE2A 4OD0A 3UIEA 2D4HA 4EI7A 4P86A 1J0BA 3FPEA 4LYYA 3IHLA 4I7EA 1U1GA 3C39A 3NI2A 4XM2A 2Y92A 5DASA 5EPOA 3LT1A 4IF4A 1TUBB 1AS2A 1J0AA 2HNBA 1THMA 2ERCA 1I10A 2OBFA 4L95C 3ESBA 4M60A 5D5PA 1PI3A 1DJOA 4Y6RA 1ZWLA 1Y89A 4EHHA 4ER7A 4F3YA 3IA2A 1NULA 3S2EA 2HA2A 2LIPA 4NQRA 2VQEB 4BLPA 2CNBA 1XTRA 4EG6A 4RVGA 3CINA 1JLRA 4GP6A 5EIWA 2NW6A 3JU3A 3VDMA 4L08A 4P4UA 5BOVA 3Q3GE 4RABA 2OCKA 2JI9A 1OXSC 3M81A 2YXLA 2BFEB 2XSZA 2C1XA 3F9IA 3H9BA 4NMHA 5I4KA 1DKOA 1EUDA 2DT8A 3CG0A 3IEKA 5LMUB 2ZEJA 5JNSA 2EX1A 4DV4B 1CR2A 3B6IA 4V0NA 2XWJI 5AYVA 3T94A 2GK4A 2JI4A 4M98A 2VJQA 4L16A 1XFDA 4E5DA 4BP1A 4OU5A 2X4GA 1Y1SA 3Q2KA 2ZRMA 3EXHA 4AJNA 4EENA 2QTWB 4OBEA 5EIHA 5H16A 5AVUA 1C3OB 4G4GA 4EG4A 1IBMB 2BEKA 3H2YA 1GQFA 3P5BA 5E6UB 3WMEA 1A88A 2JFBA 3A0RB 4JT9A 1ISHA 1J20A 1GL7A 1DQRA 2H1SA 2QL5A 3G89A 4JKYA 4EG3A 1UC5B 4L1KA 1WLYA 2OUIA 5DYTA 5EXTA 3RV4A 2PNFA 4B44A 3CR8A 4Q18A 4JL5A 3HO6A 4G5OA 5L3ZA 5TNXA 3LWNA 3DSRA 5H02A 1JBQA 2C3YA 3FXAA 4US1R 3QSYA 5KVVA 2J0VA 3QVSA 3MJ4A 2AZXA 4WH0A 1L2TA 4YRTA 2F67A 5BY2A 3FI9A 4F8YA 2PEYA 1RABA 4DFDA 3SS7X 2CWWA 2CMDA 2OAP1 3C3PA 4MW4A 4YCBA 2GHQA 3LUKA 4OHVA 4QYIA 2CJYA 2QL9A 1H0RA 2XA2A 5IVIA 5TGZA 2A9RA 1WTAA 4BYMA 4N3AA 2FW8A 1WUIS 3STUA 1SXJA 3ORYA 5JZSA 4KQMA 2EBUA 4DDKA 3C1OA 1QO0D 3L06A 4PZAA 3IP3A 4YCMA 2A1TR 3NOQA 1NDHA 1LQTA 4HAIA 4R69A 1CUHA 3FFXA 3SBDA 4ZIRA 1F0NA 4EW3A 3GEHA 1RKVA 1X7HA 1NHWA 2G08A 4GYKA 4ZA2A 1XDGA 4UPEA 1F3LA 1RPAA 3EVNA 4E94A 1PU2A 4HQ0A 2YWFA 1KH3A 3T3EA 1HZZA 4D6XA 4E07A 1ZK2A 2JFHA 4CXMA 3KETA 1E9DA 2QN3A 3GRKA 4H3KB 2VOJA 3QIVA 5AHXA 2IHJA 2QN8A 3BSSA 4MVJP 3OM1A 1T1JA 2YIVX 2V1XA 2ZR8A 1KYWA 5ECWA 3AM1A 1CWUA 4LZAA 2C94A 3WNBA 2G06A 2Q4RA 5F64A 4KQFA 1IULA 1R8SA 4JSTA 3ZJVA 4KMMA 3BOSA 5CXQA 1OGYA 5PGMA 4EMBA 3AEYA 4ER3A 5EJAA 4JNCA 3COPA 3UMMA 4H15A 5F76A 3SICE 4D45A 1ISMA 1J2RA 2AYXA 1MC5A 3QMPA 4L4UA 3L5KA 1W36D 4AZ0B 4M1TA 3NYQA 3CEHA 4KVGA 3D4LA 1DAPA 1Q77A 1TJYA 3W5IA 1DIAA 2AEFA 5BPFA 4OB8A 2ZIUB 2C00A 5PNTA 1M5TA 2IYRA 3HB1A 1XUOA 3ITKA 4UTOA 5CCEA 5IHXA 2AEMA 4OX9B 2FPIB 5BYKA 1ONPA 4FDAA 1ZNQO 4L75A 3TE7A 2AN9A 3H13A 5DXJA 4YH1A 3FSRA 3MGKA 1IYZA 2AB0A 5FWYB 2PZAA 4JSYA 3TSZA 1K4KA 4ECEA 3RC3A 2C0CA 1NLFA 3ZD8A 1PT8A 3B2QA 2GZSA 1UJBA 5CH8A 1PP4A 1J5EB 4X8MA 1T0UA 1YQEA 3PXAA 1R0YA 5KYYA 4LRYA 4EZBA 4XUDA 4KIFA 1PG0A 4OKIA 3DXZA 2GBLC 4KBFA 3HY4A 4LHYA 1XR3A 4RGVA 3U5ZB 3JAWB 1TYZA 4G8BA 1GCGA 1RBQA 3Q72A 3EUEA 4BVFA 3GEEA 3W5SA 3LUAA 1U3VA 3AF3A 3W2GA 2UVDA 2BKAA 3E1GA 3Q3IA 3R1IA 3AI2A 1TZMA 4QDTA 1UUFA 4RJLA 2BDUA 5NULA 1CBUA 1X1AA 2AMFA 1P62B 3FCSB 2FZKA 5EE5B 2C54A 1Z83A 3P0IA 1JLHA 3BCUA 1TZJA 4YJGA 3QBTA 1ZVKA 1N4AA 4DMGA 1G60A 2CDRA 1SIUA 4IJWA 4P3YA 2ZRNA 4Q3EA 1M34A 1SIOA 2Y67A 3OE7D 4P7BA 4PO1A 4R9UC 4CMIA 5JQWA 3LLCA 4F38A 3EZXA 3B9RA 2WG2A 4YFYA 4CMEA 1A3CA 4ARIA 1W49A 2IHKA 5GIOE 4R8MA 2FEOA 1X9HA 2HM7A 5DT9A 4ZHQB 3EGWA 4IHJA 2FRXA 1TIPA 4AXBA 5D1NA 5HIIA 5KOIA 1RXVA 1IVNA 2VHTA 4TV9F 4D6PA 2PANA 1QNLA 3RJZA 4S1WA 3WY9A 1I3LA 3A1UA 1UPCA 1KZYC 2Y0EA 3DLAA 3FBGA 3FUUA 4FHCA 3TVTA 4XCQA 3JASA 1L8QA 2QIOA 3FPKA 4F6CA 4FQ5A 4MARA 3VPSA 1YULA 4E4TA 3LZCA 3BTOA 3QLVC 1NM5C 4RTPA 5AVSA 5HQ3B 4HMQA 2BM8A 1PWXA 2Z83A 3TW4A 2E21A 2OP0A 2WVGA 3ENQA 5EHIA 5IVHA 4PLVA 1M7GA 3SC3A 3WLQA 1SG9A 1NDQA 1PNQA 1U99A 3FMVA 1N2CE 4DQLA 2AXEA 1DQNA 1MVOA 3AF0A 5F33A 4LC0A 3GLRA 2XRMA 3FETA 3JWIA 4YJHA 2C7GA 1RXYA 4CL3A 5IK2D 2XQIA 4RTOA 2ES4A 2EW1A 1JKJA 1SD1A 1PVDA 2GN6A 4ZT6A 4GRIA 4Z8YA 4RVSA 1QYXA 3GAMA 1TTPB 3L49A 3BIWA 3O1HB 3W7BA 4F5YA 5ALYA 3QFTA 1U8CB 4D0GA 1Q17A 3RS0A 1BOOA 1RVV1 1QHXA 1VI6A 3Q7TA 3GBVA 4Q5IA 3JQ9A 3GGSA 2Y4OA 3AH8A 4TPKA 1CYDA 2XYRA 5BMOA 1QHSA 2OHHA 3T41A 4WBXC 1TM2A 4GC5A 5KNBD 5KOJB 1KO8A