4QGGA

Tmk in complex with compound 46, 2-(3-chlorophenoxy)-3-fluoro-4-{(1r)-3-methyl-1-[(3s)-3-(5-methyl-2,4-dioxo-3,4-dihydropyrimidin-1(2h)-yl)piperidin-1-yl]butyl}benzoic acid
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
204
structure length
193
Chain Sequence
b'SAFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEIRKIVLEGNDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERDQEDLKFHEKVIEGYQEIIHNESQRFKSVNADQPLENVVEDTYQTIIKYLEKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate kinase
publication title Antibacterial inhibitors of gram-positive thymidylate kinase: structure-activity relationships and chiral preference of a new hydrophobic binding region.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Transferase/transferase inhibitor
total genus 81
structure length 193
sequence length 204
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2014-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4qggA00
4Q47A 1J90A 2FPLA 4IFBA 3RSOA 4M22A 1G3IA 1T3SA 2BBWA 1HQYE 1KO4A 2AFIE 3AGPA 1KKLA 3CPJB 5JHHB 1OJLA 2EW1A 2GK7A 2NO7A 5FBLB 2GEUA 1XTJA 3K9HA 5E7MA 1KDRA 2OBLA 2YZ2A 2X8AA 4TTRA 5DGXA 2JJ1D 1WP9A 3G82C 3RANA 2QPOA 3K0FB 3OE7D 3VR3A 1XMIA 3GJ4A 4TWZA 5FTMA 3TRFA 1MOZA 1GWNA 3E5HA 4LK2A 5EE9A 3TAUA 4X8MA 2RGNC 3HWSA 4B2PA 1NN5A 2N1BA 2QAJA 3EASA 4QJ4A 4D0LB 4CF7A 4N3NA 2CHVA 4HUQA 5SZKB 1HA3A 4D4MA 3WBJA 4ZCMA 3LY5A 3AF1A 2QP4A 5P21A 5KOYA 4Q4JA 3WYAA 3AKEA 1XX6A 3K09C 4AYTA 4CEIB 4OQNA 3AUYA 4PC1A 3SYNA 3OZXA 1CF4A 4HAXA 2ZSAA 3I5YA 1GKUB 3UATA 3QF7A 1OF1A 1H8HA 1U98A 2LCFA 1OKKA 1GRNA 5FOTA 1DO2A 4IOMA 4QOSA 2WPDD 3UWKA 4JL6A 4QL3A 3OEHD 2QP3A 2X1VA 4KCGA 1JPJA 1KKMA 2AN9A 5C18A 1G5TA 1K6MA 1DEKA 1ZNZA 4Q7LA 1TU4A 1DAHA 4ZO4A 3I5XA 2WZQA 2V1XA 3ETLA 1M8PA 3LW8A 1SVKA 1WBDA 2RMKA 1PV4A 1ANKA 1G4AE 3V00A 3ZGXA 4LWZA 2YINC 2VH5R 3BXZA 2PCJA 4B43A 1AA9A 1EWRA 2XOKA 4RVCA 3HU2A 4TLDA 1TEVA 4C2TA 3MCAA 1F2UB 1E2NA 4OKSA 3TW4A 3RS2A 2PZFA 3UG6A 4PPQA 1RYHA 1IAQA 2IF2A 2FA9A 1VTKA 2IW3A 3B60A 3Q3JB 4IOKA 3T1TA 2ZR9A 1AS0A 2RGCA 3O8RA 2GESA 2QQEA 1RC8A 4G3XA 4IJMA 5DH9A 1XEFA 3AF4A 1RZ3A 1B0UA 3QKRB 1E9EA 1NVVR 4RD2A 5GVRA 5ANRB 1Z6YA 1D9ZA 4OHXA 4DLUA 1KDTA 1DPFA 1Q22A 5GADl 3PUVA 2WV9A 1ZM2A 5AK0A 5L3SA 1TUIA 3IQWA 8OHMA 2J3EA 2ZROA 3A6PC 3I92A 3DHWC 1D9XA 4D80A 1P61B 4MH0R 2YKGA 1JI0A 1QHIA 4IVPA 4HLQB 2QPTA 2P2LA 3TNFA 5DI3A 2EFHB 3BERA 4KAXA 2FWRA 2C5LA 4QFMA 4QGHA 2ZS7A 2JIZD 1J99A 1KY2A 1US8A 4Q9KA 1BH2A 4R2IA 2OO7A 1FNNA 3X2SA 1AKEA 1CIPA 3C14C 4LYJA 4PC3A 1NVXQ 4LOAA 2F55A 4BFZA 2WICA 2J0VA 3CPEA 1WA5A 3GLIB 3LA6A 4PR0A 1JAHA 2QBYB 2GEDA 5IRCD 1XTQA 1GUAA 3HYTA 2WSSA 1K8RA 2WWGA 3KFXA 3ND9A 4JLMA 5EE5B 2OAP1 1KO7A 2GHIA 3AVOA 3SHFA 3A1SA 1GNRA 2GCPA 3RS0A 4PHHA 1N6IA 1GAJA 1W4CA 3O8DA 2ZRHA 2PMDA 3HDTA 4DCVA 2ZXUA 2IYVA 3PUWA 1N5IA 1F5NA 3LXRA 4BFVA 4JLVA 2XGJA 1AS2A 2I3BA 3T15A 1NN3A 1E0AA 4D2IA 2IUUA 2PX3A 2W0SA 2OXRA 2Y8EA 1SVMA 2GRJA 3EZFA 5E7IA 3EAQA 3MJRA 3AH8A 4OK5A 1GFIA 5AJYA 3EPKA 4D4KA 4LX0A 3KL4A 3TR0A 3U4QA 4DLYA 4FI3C 2NTYC 3MUFA 1F48A 2F7SA 1HY3A 2WAYA 2EWVA 2REBA 3AVXA 1OE0A 4HUTA 1OB2A 3EW9A 3L0SA 3BB1A 4JVNA 1E2JA 2QSYA 1RIFA 2IYRA 1E9DA 1W4BA 3Q7QA 4URXR 2JLUA 3QJYA 4PHGA 1E9SA 3TH5A 2GF0A 5IDVA 2FPKA 2AWOA 1Z0FA 3PEWA 4PZYA 5BWMA 1SULA 5KDLA 1E69A 1RKBA 1JR3E 4MDEA 1N6RA 5EXXA 1Z0AA 2AFHE 3OIVA 4US1R 1J8MF 2G83A 2OCPA 2VP9A 4DUGA 1ESMA 3KXIA 1T0JB 3B1XA 1BS1A 3QOFA 4IDQA 3SZRA 2ZVPX 4PPFA 2QGNA 1KIMA 2IYWA 5LB4A 2FH5B 3N70A 3B8HA 2IYYA 1AS3A 3GJ6A 1N6KA 1G20E 1XDBA 2BWJA 4QXAA 3CRVA 4CRWB 2OESA 2ZR7A 1Q57A 3GLHA 2P0EA 3H84A 1LNZA 1JECA 3K9LA 4NCKA 2J7KA 2C98A 3QXJA 1OIWA 2BHRA 2HJVA 1BOFA 4WIAA 4LDJA 5GJVC 2JGNA 1IOZA 2IWRA 1I4DD 3H1TA 2XSZD 4BUJA 4A82A 4HLCA 1M2OB 4RZ2A 4EJSA 1MO5A 2OFXA 4LV5B 4TL6A 3ZIAD 3ZVRA 3B6EA 1G9XA 2QAGA 3N5CA 4TMXA 5JWRA 1FP6A 4II7A 5E95A 5G53C 1YR8A 2BKUA 4M1MA 1M7HA 1NIPA 1P9RA 3M4YA 2R6CA 2V8OA 5KNDA 3LVQE 3U60B 1JQLB 2CL0X 1TF2A 3CRRA 4FMBB 2ZJ5A 1TU3A 3FHOA 1ZNWA 4R98A 3TQFA 2HT1A 4KVAA 1YZGA 3QEOA 4ZIRA 1CXZA 2O8BB 5G3ZA 1CJVC 3SYKA 4BLSA 2F43A 5K8IA 3TVDA 1DOAA 2ZIAA 4KO8A 3V9PA 1T3LA 2CCKA 2QEQA 3AF3A 4WA7A 1LS1A 3ADCA 3ZS8A 4M1KA 1D5CA 3IPYA 5FTLA 1GRRA 2DFKB 4A9AA 1GZSA 4AKEA 5C2JB 4TZ6A 2O8DB 2ORIA 1R0WA 2IYUA 2W6ID 4XTRA 3T35A 3NHAA 1IQPA 3NBXX 2J5XA 4MGKR 4Q66C 5G41A 2WHXA 2FZ4A 3MFYA 4KBFA 3TUJC 2QM7A 1WB9A 3DZDA 1KK3A 4H9GA 4D0GA 2H16A 2ZI3A 3AGQA 4LBVA 2C78A 3H86A 2DR3A 2O8FB 4DKXA 1QHGA 3KX2A 3PCRB 2KE5A 1XZPA 3SYLA 2E1RA 4PO8A 1H65A 3SC3A 2A78A 3U44B 4QGGA 3RRNA 1P2UA 1NY6A 5C4GB 3ZQ6A 1A1VA 2D2EA 5D3QA 2DB3A 4HYYA 4C0HA 2NO0A 4OHYA 3F5FA 1AJEA 4EPVA 3OF5A 3MAAC 4I99A 1GRQA 1ZBDA 4IKEA 3IO5A 1XCPA 2AK3A 4Q1DA 1MR3F 3BAFA 4RCYA 4G1UC 4HUQB 2BMFA 1PLJA 1R4AA 3K0EA 4LV8B 3V4RA 2FJUA 3H0KA 2GXAA 1SXJA 3DM5A 4P4TA 3THYB 1TX4B 3CX7A 4B47A 1E2DA 1GG2A 2G0TA 4C3ZA 3A4LA 4B33A 1U9IA 2J87A 2XNDD 3LXXA 1ZUHA 1F2TA 1HUQA 2DFLA 2ZRDA 1T6NA 3C5CA 3GLIE 4MYCA 4PZZA 5J40A 2JLSA 1LY1A 2ZETA 1W36C 3FKSA 2FSHA 2ZSBA 4P31A 4B6FA 3WHKA 1NSFA 2V54A 3EIHA 4KI0A 2W83A 2D3WA 4KLNA 4BRUA 2ZJ2A 2RGEA 3MSXA 4NYJQ 4TQUS 1W4RA 5FOXA 3GLGB 3C5HA 3WMGA 2ZSFA 3K70D 2YNMA 4JLNA 2AD5A 1Q0UA 2Q3HA 2QSZA 4NL4H 3AUXA 1NL3A 3BGWA 4JLPA 1ZYUA 1E1QA 4E22A 4PPNA 3WMEA 5J4YA 2CLDX 3KB2A 4GPTA 1UKYA 2PCLA 3RAPR 3WMFA 1HH4A 1JR3A 2PH1A 2XZPA 2REOA 2CJWA 5L8VA 5F9HA 3BIFA 2CL7X 3R9IA 3Q72A 1JEDA 4Q7KA 4BGDA 5LD2B 4HB0A 1MO6A 2WIBA 3VNUA 2YYZA 4O2LA 4D6PA 1DO0A 1S8FA 4BEJA 1OYYA 2BC9A 4YXWA 1N6PA 1NN1A 2C9OA 2AD1A 3SJBA 2IYZA 3E2IA 2HT6A 2FFBA 4MYTA 1DE0A 3BFVA 3CF2A 1HV8A 2A5DA 5BXQC 1A2BA 1XTRA 2FNAA 4B74A 2TMKA 2A5FA 4OL0A 4TL8A 3AP3A 3VR2A 1D2EA 1R5NA 3A1WA 4IDPA 3W6PA 2O52A 1E79D 5FPYA 5L3SB 1VDZA 2G1JA 3QI2A 2NPFA 1R0XA 3TJZA 3OIUA 4QBIA 3IIMA 4NMMA 4BQSA 3GLFA 4X8OA 721PA 4ASUA 4JT2A 4DHEA 3GD7A 2BEKA 2RGNA 1RRGA 1IJEA 3TAHA 4RFSB 2C95A 5EE0A 1F3OA 1OXXK 3GFTA 4MGYR 2CBZA 2BMDA 4JKIA 4EPRA 3KKPA 3L8YA 1NBMA 1GILA 3T61A 4POAA 5TB5A 4DLRA 2VHUA 3EZ2A 2JLZA 5CK5A 1Z83A 2IEYA 3K09A 4DCNA 5FTNA 2BCGY 3SFVA 3W8RA 5J47A 4D25A 3TW8B 1M34E 1PZNA 4U5XA 3EA5A 4TSFD 3K9NA 2AL7A 1Z3IX 4HDCA 4MYUA 2GJAA 4RZXA 1KSHA 2WKPA 1L4UA 3J81k 4UNSA 3B82A 821PA 2R44A 2IYTA 2H1LA 1G19A 2QTFA 2QMEA 2OCBA 4AKGA 2F3RA 3WYGA 2QZ4A 2ZI4A 3U7HB 3ZYCA 2RKOA 4GZLA 3KB1A 1GDDA 3RYTC 3UKDA 3W9YA 5KHOC 1AZSC 1XCMA 1P4SA 4PHTA 3I4LA 3T1QA 2DPXA 2FU5C 1UKVY 1ZM3A 4R7ZA 1KO8A 2QA5A 1DG1G 5B64A 3A8TA 3R9XA 5L3QB 2Q9AA 2C99A 2D2FA 2BM1A 1OYWA 2QENA 1Z0KA 1NP6A 3E1SA 1Z0IA 2H18A 1UBFA 1JJVA 1ZM7A 3UMFA 4L8GA 1UADA 4QBHA 2PEYA 1HYQA 1LTQA 3F8TA 3IEUA 4M9XA 1UBGA 4Q02A 4YMWA 4LV6A 5A4JA 1MABB 3CF0A 1G64A 1KI4A 2QTHA 3MWLA 4IDHA 4LC0A 3IBGA 1NVVQ 421PA 2HV8A 4LJ9A 4HB2A 1V43A 3EIQA 3NC1C 4JLJA 1ZIOA 3P1JA 2W0MA 1N3BA 1OW3B 4EJSC 1Q12A 2BMEA 2BJVA 4FD2A 2QAGC 1GNQA 1N6LA 5AUOB 2V3CC 2VP2A 2NGRA 2J0QA 2P65A 4TLEA 1G8HA 4ZV4A 5KDDA 2PJZA 1MO4A 5HTKA 4MITA 3LD9A 3QXSA 3NEYA 4K8OA 1ZNYA 1ZW6A 2NO6A 2R62A 4CEHA 1LV7A 4BFTA 1H8ED 3AVUA 3OFND 2D7DA 3DMDA 2CHQA 3BB3A 2G9NA 1FQJA 1TEXA 2EYQA 1P7CA 5CDFE 1PLLA 2MSDB 2ZSDA 4ZDWA 3IHWA 2OM2A 3DOFA 2XJ9A 3IO3A 5TXGA 1JR6A 2V7QD 2ZTSA 3TKLA 4BASA 4C7OB 2EYUA 3AEZA 2ZRIA 4A2WA 3KKMA 3VR1A 1E3MA 4NHOA 2VO1A 1DAGA 1IXZA 1U94A 3OESA 3PXGA 1CR0A 5TV2A 1WE2A 3QY0A 2QRNA 3QKSA 2DWQA 4KU4A 4LRWA 2OZEA 5JI2E 3QPUA 3T5GA 5F98A 3SNHA 2IYLD 3IIKA 5FL7A 2XXAA 3B1VA 3LWNA 4M9ZA 2F1JA 2CDNA 3AB3A 5DHFA 1JEEA 3G5UA 1FFHA 1KJZA 4G5QA 4TYNA 3T12A 5EE1A 3IIJA 3JVVA 1AM4D 3U3RA 3FOZA 1EFRA 1IN7A 4CZ2A 3GLGE 1E2MA 2WKRA 2OAQ1 4JVMA 2WJJA 5BN4A 4XWKA 2D7CA 2O0HA 2B92A 2ZRLA 4TMVA 5FBRB 1NMYA 1P3JA 4KODA 1YR6A 3WP1B 2PX0A 1Q1QA 1OFIA 4TYWA 1BMFA 4HSEA 3G0HA 1C1YA 3QENA 2KJQA 2VSFA 3EG5A 3SN6A 3IQXA 3VKHA 2YJTD 5EP3A 2IT1A 3C41J 5FPHA 1OH8A 4B71A 1NG9A 4B34A 1S9HA 1I2MA 1U9IC 4BZPA 3LQQA 2C2HA 1Z2AA 2CK3A 3MJHA 2OCYC 4M53A 621PA 5GJWC 1QZXA 2A3RA 1N6OA 3IDQA 3QQ5A 1NSTA 2ZUBA 3D31A 2D74A 4W9MC 1E6CA 4BLPA 1XTIA 3HPQA 5CJ2A 5C46F 2VYFA 3W6OA 4D26A 4AI6A 4PFSA 3V4FA 3D3QA 3B7GA 4GOKA 1NVUQ 1W5SA 2EFGA 1MRSA 1U0JA 3KTAA 3SEAA 5HKKA 2WKQA 4EPYA 2GK6A 2F9LA 4JKYA 2PT5A 1BYIA 2R65A 1Q1BA 2WOJA 3FFBA 2J7PA 4X8HA 3WHLA 2X2EA 2QE7D 1G8GA 1YKSA 1FZQA 3IBYA 4OYHA 1Z07A 2GXSA 3FB4A 2OSBA 1DADA 4QBFA 4X8LA 4RZUA 4B3GA 2W6JD 2ZRNA 2O8EA 4XWAA 1NI3A 1E0JA 2ZSEA 1XXHA 2JJ2A 2N42A 4M9SA 4URYR 4HZUB 3RS5A 3SHWA 1E9RA 2Z5FA 5CIWA 4Z1MA 4BFXA 2H17A 3PQCA 1E9BA 1G3UA 4XTCS 2HF9A 2AKAB 4F4CA 3OHMA 4JL8A 4D4JA 1E1RA 2IXGA 2ZUCA 3BH0A 3CZPA 4M1TA 3R8CA 3CRQA 4S2EA 4W7SA 5CM9C 4DCTA 2FFHA 1KMHA 3CPHA 4RD6A 4P4SA 4OHVA 2GDJA 4QKQA 1L2TA 2HLDA 2CEAA 2FDCA 1SVSA 1R0YA 3EPHA 2ODWA 2IBMA 4P0TA 2RB4A 3RS7A 3HU1A 3SQXA 3GEEA 4JLDA 1QHYA 1UJ2A 4A1FA 1BKDR 1DAKA 3RVBA 1H8HD 4DDWA 2RGXA 1II8A 1M7BA 1OXUA 3K70B 3W5IA 3AVPA 2ONJA 5E3HA 5GJBA 4BZQA 3NIBA 4U7DA 2JAQA 4NU0A 5FR2A 3P32A 3PEYA 3GJ8A 2XB4A 4HATA 4FCVA 4MRSA 4B75A 1VG9B 3KDSE 1MH1A 4F93B 1E2PA 1OSNA 3CH5A 3BH7A 3R7WB 5KO2A 1CLUA 4Z54A 4C2UA 4O25A 4FMDB 1J2JA 2XOKD 3ICEA 1TNDA 1FQKA 1YRBA 1YVDA 2JJ1A 3Q85A 4KJZA 4PC7A 5FBWB 1CRPA 1VYVA 3K53A 2UZ3A 4DLSA 1YQTA 2IWHA 3P4YA 4CEJB 3LBHA 2VL7A 3D8BA 2ZEJA 1EXMA 4YDSA 4IW3B 4A8JC 3KJEA 5LPNA 4A6XA 3GLFB 4XVQA 2QUZA 2KBEA 2RGAA 1XNJA 1IHUA 1T0HB 4PQFA 4Y0VA 1HURA 3SI7A 4C0KA 1ETUA 2V9PA 5JJIA 2A30A 4ACAA 3N2EA 1FX0B 1F60A 4FWIB 3AP2A 5FUYA 5KU1A 4M21A 1NY5A 5H68A 1AKYA 1QHHB 4LHWA 4Q4AA 1FUKA 4AG6A 4DLZA 3O47A 3QXXA 3TGPA 4QM6A 1U8ZA 2FSGA 3Q5EA 4QHYA 1RJ9A 2XZLA 4XVUA 1XMJA 4A15A 5JRJA 3CRW1 3SBDA 1Z6TA 4JYCA 5JEEA 4MGIR 3U6BA 3CX8A 4CGZA 1GL7A 3CNLA 1KTVA 2WWFA 4ACBA 1W47A 4PANA 1FW6A 3ZZTA 2IK8A 4PSKA 1CULC 1KZ7B 3VX4A 1UKEA 3KKOA 4GZMA 5KPJA 1RRCA 1VCOA 1HQCA 1Q1ZA 2F1HA 3ECCA 5D3MB 1P60A 2ORVA 1R2QA 2EFEB 1FNMA 3FDIA 4HAYA 4PTLA 1XEXA 4ZKDA 4N0EA 2A2ZA 4Q9HA 4XIGS 5F2EA 4Q1CA 3WRXC 1NMZA 2YVUA 4IHQA 3EA0A 4IDOA 4QJ3A 2WBLC 2OFOA 1XMVA 2HEIA 4BLOA 2P5TB 4JL5A 2CVHA 2JLXA 4PO1A 2W2TA 1I2DA 3U5ZB 2QL6A 2WSSD 5HZHA 1OFTA 2ANCA 4DDTA 4UXIA 4EAQA 3VU9A 2O0JA 1QBKC 5CYPA 1E2FA 4MKIA 2RH5A 4DXAA 5HZKA 2OV2A 3AVVA 2WWXA 2JLRA 4AWXA 4DSNA 3NTUA 3T1OA 1IXRC 5CB6A 4RFVA 3IHLA 5FL3A 4KLZA 4PAMA 4G5OA 2DY1A 4C30A 4CT5A 3NDPA 4BEBA 2ZRPA 3EPLA 1ZP6A 4FXPA 2ZAMA 1NRJB 4ARZB 4GMXA 2HF8A 3SBEA 5FR1A 1P2TA 4C0QC 2ZUDA 2VF8A 1YZLA 4H1UA 3VHLB 3QXCA 3D7MA 2WAXA 2ZI5A 5KNBA 2Q21A 3MMPA 2YC2C 1XJCA 3IUYA 2ZRCA 1KK2A 4B32A 1KOFA 2IA5A 3FKQA 3AM1A 2QROA 3OAAA 4QG7A 4I1VA 4Q4HB 4UKDA 2KI5A 221PA 1DELA 3W5JA 4Q9IA 2OLKA 4YMVA 3B78A 3KUCA 4JBWA 5CLLA 3U3OA 4DUGD 4V0ME 1NN0A 4YONB 4A0HA 4MKGA 3CNOA 4GI7A 1M7GA 3CX6A 3VHXA 4M1YA 4A4DA 1QF9A 1YR9A 1ZD9A 2YWFA 1L4YA 1Z28A 3B2EA 4JLBA 4G0NA 4OHZA 2HYDA 4HI0E 4QNRA 2VRWA 5AUNB 4ESHA 1K5GA 1R5BA 1VIYA 3Q9LA 2O8CB 2Q9BA 4LGMA 4UNPA 2RCNA 2GAOA 5KSOA 3THWA 2ZQ5A 4WBSA 2OCAA 4EDHA 2AK2A 4O3MA 2AHOA 2QU8A 5FPKA 4KBGA 3RRZA 2X19A 3MWYW 3TBKA 1KI6B 3NC0C 3ZLJA 2X77A 4LJ4A 3PUXA 4C0BA 1S9DA 4ZDIA 1SHZA 1WRBA 3ONWA 4TMKA 2ZI7A 2QGZA 2FGJA 1OLOA 4K81B 1KAOA 2ZRMA 1XCGB 1IY2A 3KJHA 1G5RA 4C0JA 2LKCA 4OK6A 4DC9A 1UDXA 5G40A 3CR7A 2WMNB 1E94E 4A92A 2J1LA 4HAZA 4QBGB 5F3WB 4Q03A 4AKIA 1DVRA 2V6JA 3P4XA 3THXA 4EQ6A 5AJVB 1Z0DA 3FPAA 5DLQC 1TF5A 1XZQA 4FCTA 4NONA 1TMKA 3SJAA 2NG1A 2IXFA 2ZPTX 3DDCA 3EZ6A 2ZANA 3CRMA 4DZZA 1CJMA 1O87A 3VQTA 4FMDF 4NDZA 3W3ZB 4NYMQ 3BS4A 1ZU4A 3W3AA 2BJWA 3CNNA 4OK3A 5B2ZA 2ZS9A 5AWFC 4JVSB 4AG5A 2L0XA 5ELXA 2I1VB 2FOLA 2AWNA 2C9YA 2CMKA 4F4IA 3PUYA 2B7CA 1Q21A 2XSZA 1CR4A 5CYOA 3HP1A 2ZJYA 4TT3A 1Q1EA 1U81A 4Q19A 1KZGB 3B1ZA 1E9FA 3JVUA 2WJGA 4LYHA 3ICQB 3CB4A 1XD2A 5FPSA 5BYKA 2ZYWX 2ZU0C 2ZR0A 4NCHA 4XSGA 1E4YA 3NXSA 3SJCA 4L15A 1ZM9A 2W2XA 2NPIA 4P3YA 1QHSA 1RW4A 4B2IA 1IN5A 4R71A 2RHMA 3QBTA 3KQLA 3PEUA 3WNBA 3LRPA 1KK0A 3L8ZA 4IVQA 4QGAA 3RS4A 4PAQA 4P4SB 3WY9A 4CW7A 3TIFA 5JHGB 3ZS9A 4Z8XA 3EARA 2ZRFA 5K8UA 1SVWA 1SXJD 2GKSA 2OBNA 1Z6AA 5EZ6B 1Z63A 2GXUA 3PVSA 2BDTA 2IC5A 4TYQA 4V0LA 3BD9A 4O0MA 3SJZA 3B5JA 3MWKA 1OIVA 1PUIA 2REXB 4MGZR 4DIDA 1XFAA 1EG7A 3FKSD 4GFDA 2QP9X 4LHZA 2JLVA 3GFOA 4Q4JB 5C4MA 2RGGA 2VP5A 3K0AA 1KI3A 4V0KA 3EPJA 4FINA 2W6IA 1OH6A 4NYIR 1N6NA 3QXHA 4GSYA 1A4RA 4JBYA 4LHXA 4LY6A 4NH0A 4OQXA 2GCOA 4V0OA 4Z8YA 4FWTA 2R6DA 2WWHA 3RWOA 2EVWX 4I1UA 3FMFA 1E96A 1KI7A 1OV4A 2IS1A 4CDGA 2R8RA 2AX4A 1ZIPA 4TMWA 1J8YF 1E1QD 1SHKA 3LQRA 3T5DA 1KSGA 3U61B 2CE2X 4AURA 2ONKA 1XP8A 3DMNA 3EWSA 3I72A 4DLWA 1XD8A 3UMRA 3PITA 3GJ0A 1I4TD 3C4JA 2ZRGA 3REFA 1M1YE 4XH9B 3DOEA 1IN4A 3RDPA 3UG7A 2I1QA 5LB2A 2MSCB 1Z22A 1RFLA 1EFCA 3IKJA 2GJ8A 4MUAA 3RHFA 2FPMA 1QVAA 3HR7A 3LAWA 1XEWY 4YXWD 1JXMA 1NJFA 2R6AA 3GEIA 4JSYA 3CR8A 4ZDKA 2JLWA 2WM9B 1SKQA 2WJHA 3MRSA 1IY0A 1OXVA 1OXSC 3MD0A 5TDHA 5E7JA 1AGRA 1E99A 2J59A 1GITA 3K0FA 3HR8A 3ZVLA 5JSZA 1GKIA 4XD7A 2FFQA 5DO9A 1UEJA 2XB2A 4PC6A 3ADBA 2F6RA 4NKRA 3QSYA 1UEIA 3O8BA 4ASUD 5DHAA 2D62A 5B30A 1X8JA 2Z6VA 2OHFA 4M0LA 4DBLC 3ZZUA 4Q9JA 4TYYA 1HT2E 1NBMD 1KO1A 1W2HA 4RSGA 5FTJA 4LJYA 1SQ5A 5EXPA 2FSIA 5CIQA 1U0HC 1MV5A 4Q7JB 2OXCA 2ZRBA 3K0CC 5FI1B 2B8WA 1W0KA 3B1YA 5DI3B 3TSOA 1N5LA 1US8B 5FBQB 1N0UA 2P6NA 2J45A 4KSBA 3U2QA 1CKEA 3CH4B 3U3KA 1G41A 1NF3A 4TN1A 2CNWA 4QJ5A 3I8SA 1EFHA 1OH5A 2YHSA 3RS3A 3KXKA 1QG4A 3X1WA 3P26A 3SS8A 1VPLA 3RLFA 5UKDA 4JT4A 4M9QA 1W4AA 3U3MA 3T1VA 3BOSA 1GVNB 1M74A 4PX9A 2P6UA 3VR4A 1E79A 1JAIA 1F2UA 2R6FA 5BYJA 2B7BA 2EQBA 2FX3A 3GMTA 2UKDA 4PZLA 4ZDJA 4GMDA 5DIFA 3AQ4A 1P72A 1W1WA 1TUEA 2H7VA 4ILEA 1RYFA 2IF0A 1WMSA 3Q5DA 1KI1A 4A8JA 1UAAA 1ZNXA 1BO6A 4L9WA 3QKRA 3SE0A 4DRZA 1T8UA 4DDVA 6Q21A 2OFWA 3WP0A 4L4UA 2PZGA 1J70A 2JDIA 3KQKA 4PXAA 3U4QB 5FUXA 1AQUA 3W90A 3NBFA 2ODNA 1G1MA 4Q1EA 1CR2A 1S0UA 1NKTA 4DEYA 2VF7A 3HJNA 1Z5ZA 4D0NA 3TSZA 1W0JD 1LS6A 1SKYB 4B3DA 3UIEA 2P5SA 4HDOB 3BJIC 3T06B 2NO1A 4P4UA 4TL9A 3BRWD 1G3QA 3CF6R 4OHWA 2GZHA 1E2EA 1XF9A 5H70A 1P73A 3AV0B 5B57C 1ONBA 5KSYA 1SVIA 1Z2CA 5HCNA 2DHRA 1DAFA 3DO6A 4OI4A 1S1MA 5DN6A 5FFMA 2ORWA 1JNYA 4WZAE 2JATA 2WWYA 3W6NA 4TYPA 2VIIA 3VR6A 1N5JA 2QMOA 4RD3A 2YOFA 2JCSA 5CITA 4ZCLA 1G4UR 2VQSA 2WOOA 4F38A 4JBXA 1P2VA 2GWHA 4LI0A 5J4VA 3GLIA 4HB4A 4BLQA 3RC8A 1II9A 2VTKA 1N0VC 2JEOA 2ERXA 5FOSA 2QBYA 4ERNA 1XTKA 1VHTA 4ITRC 1GNPA 4KSCA 4UXHA 1T3HA 2B6HA 2QTVB 1E2QA 2G1KA 3X1YA 4JLOA 3GLHB 3I3SR 3U7EB 1FMLA 4MA4A 2ZJZA 4OQMA 3TUIC 2IS4A 3REGA 3S1AA 4OQFA 2AXNA 1Z08A 2WJYA 2IXEA 3W8NA 1KO5A 3VFDA 4LCBA 4DLVA 1CP2A 2QQ0A 2HUPA 4EJSB 1KSJA 3U7FB 4XVRA 3AVYA 3SDZA 2QAGB 3ZDQA 4XSHA 4HZIA 4KXFB 5K8TA 2DCUA 4OJKA 1J7KA 5DSZA 5IK2A 3F0TA 4URUR 5JS8A 2G77B 3CWZA 3OFNA 5GVSA 3I32A 1P6XA 3A4NA 1BMFD 4NPHA 2PBRA 3DKVA 2ZE6A 2G6BA 3R8FA 4Y0AA 5TY0A 2OLJA 4CYMA 4ZI3A 4ZIRB 2H92A 2Q0HA 1AIPA 1OB5A 2F43B 2V7QA 4GT1A 1OXTA 4WXRA 1KJYA 2CK3D 3NEJA 4FIDA 4AIIA 4MQBA 4L5BA 4DWJA 4LBZA 2W00A 4OI0A 1HE1C 3U3JA 4DEXA 4UNQA 1VG1A 3PENA 4R9UC 5FI0B 3CO5A 4IDNA 2BBTA 4BECA 1YU9A 5EXTA 1U0LA 1CTQA 3MLEA 2QT0A 4RKFA 4JZKA 4CT4B 1TQ2A 5JI3E 5AUQA 2AXPA 3NBYC 4PQYA 1G7TA 1ZM4A 4JSTA 4G01B 5G3YA 1Z29A 2PZEA 3NKVA 1UM8A 2NIPA 4RZ3A 4XJXA 3VKWA 4BFWA 1R8SA 1ZMXA 4DB2A 5HKKD 2I4IA 2OUKA 3QKUA 3WYFA 2ZRJA 4NCIA 5AUPB 2J7PD 1COWA 5AJWA 2GNOA 4GP7A 1II0A 2GEVA 3CIOA 3SQWA 1JBKA 1XPOA 1GM5A 1VG0B 2MSEB 2PLRA 2Z83A 1DTSA 2BOVA 5TARA 2JJ2D 4C4PA 3DPUA 4HAWA 4I4LA 2C04A 3ZQJA 3WXMA 1NG1A 3UK6A 4Z1MD 5LDDC 1XTSA 4TMZA 5JJLA 1PUJA 4B3FX 1PLKA 1MO3A 3NH6A 5FBVB 1SXJB 1E1RD 3UXMA 1E0KA 4YMTA 2EFDB 4XOIA 2JJ8A 3I8XA 4NCNA 4DLTA 1FTNA 1G7CA 2EWWA 5FOUA 4AY2A 3IILA 4DCUA 2FZLA 4URVR 1F2TB 1ELOA 5TMPA 2IL1A 1N0WA 2O8BA 4AYWA 2HLDD 1G3RA 4YC7A 1R6BX 2OEPA 2FF7A 5DI9A 3VMFA 1EK0A 5KNCA 1ZCAA 2GBLC 1X86B 2NQ2C 2J0UA 3IGFA 2D06A 2XTMA 4ZKEA 3TMKA 3NHBA 4A0FA 5L3VA 5CK4A 3K70C 5CLQA 1G6HA 2PMKA 3ZD6A 2RHDA 4E5UA 2V6IA 4HLUC 1G21E 3OEEA 2O8DA 2R9VA 1YRAA 1ZVQA 2QE7A 4B48A 1XD9A 1XPRA 1NMXA 1OIXA 2FEOA 4F92B 3AVTA 2CJWB 2WJIA 2W6JA 1OKKD 2ASEA 1OHHA 3A58B 3DVLA 3FMOB 1KI2A 2O8FA 2JLYA 2H5EA 2OG2A 1S2MA 4PSAA 3I62A 3U44A 3RSLA 1VHLA 4F91B 4B3BA 2OBMA 4BFUA 3QUSA 5CDFA 1SKYE 2OT3B 4NTZA 3Q7PA 5JSZB 2HCJB 1KDPA 2LKDA 3B9PA 4FW9A 4GOXA 2VHQA 1R0ZA 1ZUNB 4B35A 1VG8A 3KZ1E 1W49A 2ZS8A 4EPWA 3GEHA 4BLRA 4JMPA 3WNDA 2VPPA 4NZYA 3U6KA 4IFEA 4D81A 3M0EA 5J4KA 1GL6A 4O2RA 3THYA 3OIYA 3LX8A 3A37A 3X1XA 3OE7A 5B58C 2GVDC 5EZ5A 1TF7A 2Q3FA 4BWYA 4V0NA 1A7JA 1ZRHA 3QBVA 1CRQA 4IEEA 1SZPA 2VP6A 2SHKA 2V4ZA 1KSFX 1GP2A 1HT1E 4JIMA 1NLZA 5J4HA 2DFTA 5KSPA 1CR1A 3A4MA 4RKEA 4IEIA 3UANA 4E07A 1ZD8A 1XJQA 3AVQA 1W36D 3KJIA 1Z47A 4GOJA 4JS0A 1A82A 4G5RA 5KPDA 1YHNA 3ASYA 1K5DA 3QE0A 4WXPA 1DARA 2VHJA 5J4LA 1G7RA 4WAUA 4NE2A 4WVFA 3TVTA 3GLGA 3GLHE 2VP4A 1G8FA 3W34A 2X2FA 1OFUX 4NYIQ 4W5WA 4KVGA 2G88A 4A6PA 1UF9A 2WPDA 5FUVA 5DNYB 2WJVA 1YZKA 2J46A 3OEHA 1S4QA 2GXQA 5EQTA 1ODFA 2BKEA 2QMUA 4F4JA 1T91A 3C15C 2UVQA 2QNRA 5H1YA 3WBKA 2ANBA 2J41A 3BFXA 3LVRE 3O8CA 1TQ6A 3B9QA 1VCIA 3EX7C 2BMJA 1GL9B 1IY1A 3CM0A 4AK9A 5JS7A 1JXOA 2IUTA 3DM9B 3JZMA 2FV8A 2Q9CA 2YV5A 2ERYA 4A8JB 4IOLA 3MGCA 2O0KA 1KAGA 4LSGA 1CS4C 3QF4A 4AC9A 5BN5A 4ON9A 4QNMA 4E09A 4JLKA 1WXQA 2ODBA 4EPTA 4C0SA 5A0FA 1GTVA 1R10A 4KV9A 1A5TA 1MKYA 1LF5A 1N2CE 2WVJA 4RD4A 4YQFA 2NO9A 2VHTA 5AR1A 4B76A 3DEFA 1QDEA 2IYSA 1UPTA 3C7KA 4KYIB 4ABYA 1NIJA 1RRPA 2ZREA 3QVVA 5HPYB 4MKFA 3NDBB 2MMCA 2F3TA 4M1WA 3PV0A 5JCPA 2RAPA 3I1FA 1XRJA 5EUMA 3GJXC 4DSUA 1CBUA 1WCV1 4JJKA 1R8QA 2QPAA 5M04A 2WTUA 4RFSA 5H8WA 3KXLA 1LF0A 1DS6A 4OJQA 2ZVQX 3KQUA 4PO9A 1AZTA 1W7AA 3TSWA 1W48A 2CCGA 3TQCA 3PR1A 3LV8A 3NWJA 1ZUIA 1M6NA 1TTTA 2IS2A 3K8YA 3SU8A 2A7QA 4EPXA 1W2GA 5C1BA 5KDOA 2WIAA 5BQ5A 4E03A 2C8VA 4CEHB 1C4OA 1N5KA 4G5GA 1XWIA 5JEDA 1U99A 2JIZA 3HU3A 3LX5A 3K0CA 2PL3A 3OAAD 4ESVA 1JQJC 1NLYA 5JFGA 4P33A 5EUQB 3KUDA 3LW7A 1E2IA 3QKTA 2BM0A 1A2KC 4LJ8A 4URWR 1G7SA 1XU4A 4UXJA 3VAAA 2BEJA 4NCJA 4Z51A 1E2LA 2FGKA 3UPUA 4TLBA 1KGDA 1OT3A 2F1IA 2XJ4A 3CBQA 4LHYA 5EJEA 5JECA 1G8YA 2GZDA 3S1AB 4KHZA 2ZE5A 4W5JA 1SXJE 2DWPA 4CVNA 4DJTA 3BH6A 5KSZA 3L43A 1E2GA 1XMSA 2HXYA 1QHXA 5KYKA 3VKGA 2P67A 3CZQA 5FH9A 1RVDA 4DT1A 3QKSB 1CJTC 4W5HA 5L3QA 4FMCB 2WSMA 2XXAB 521PA 3UWOA 1CJKC 2NOAA 1KI9A 2XAUA 3LO5A 1L7VC 4KFSA 3NBZC 3X1DA 4TLCA 4URZR 1YJ5A 1MABA 2GZAA 4TQ9A 2H57A 1Z0JA 3GCGA 3LFUA 1AK2A 4WZ6A 3U7GA 1FL9A 4QM7A 3KFVA 4ZPXA 4B44A 1HE8B 1N6HA 3QPWA 4PAOA 4PPGA 5FOVA 1YZUA 4ZCIA 2B8TA 1WDTA 4OI2A 5L3RA 2GJKA 3DL0A 3LLMA 3IPXA 1NNEA 3C8UA 1WF3A 1XPUA 5CM8B 5K8LA 3ZVNA 1X8LA 2ZYUX 4YLGA 5E4FA 1VYTA 4DDUA 2J9RA 2ZJBA 2NMVA 3ZZ0A 2CXXA 4MRNA 1T4GA 2DWOA 4NP6A 5F9FA 4MUBA 1OPXA 2K5UA 4LPSA 1EGAA 4TL7A 2J0SA 4QHTA 4Q21A 1T9HA 2ATXA 2Q3MA 3PG5A 2FFAA 4C7OA 1SVLA 2A9KA 1RPZA 2FSFA 1XEWX 1E0SA 5EXSA 5HCIA 4HAUA 2AKYA 3ASZA 3KQNA 4F7WA 2EU8A 4B2LA 3CLVA 2ZE7A 2YWHA 2GJSA 2G3YA 3GLFE 3KTAB 3ZVMA 1L8QA 3VR5A 4TT3D 4OBEA 5AJXA 3I73A 1SGWA 4M4SA 4C0AC 4DIEA 4GRAA 4QRHA 2ZJOA 4Q1AA 1R5OA 2F1RA 2YC4C 4M2LA 2V1UA 4I1OA 1NBME 4Q18A 4MDFA 2QY9A 2C96A 2ZI6A 1WQ1R 3EC2A 1LW7A 3LLUA 2Z4SA 5JLJA 1YZTA 3TE6A 1HEIA 4J0QA 2O8EB 1TAGA 4AYXA 1XXHB 4EFMA 3FMPB 2YOGA 2Q6TA 4LPKA 4Q48A 4Q9LA 3EZ9A 5FPTA 1FP7A 4IXNA 3ZIAA 1GIAA 3Q8XB 1NJGA 4KFUA 4LHVA 1EX6A 2IYXA 3IEVA 4U00A 4M8NE 2CE7A 5JCZA 2VLIA 2KBFA 2CL6X 2VP0A 2PEZA 4TTPA 2J0UB 2RGBA 3ADKA 4MRRA 1VECA 1KMHB 2VHCA 3AKDA 4Q7MB 5LBIA 4BRWA 1KNXA 2PLFA 1DBSA 1TPZA 1JALA 3QNUA 1OH7A 1TADA 2WWWA 3FGNA 4RJLA 2DFNA 1AGPA 2R6GA 3BWDD 1D6JA 3LNCA 1IN6A 4BFSA 3RABA 2LWIA 1XJ0A 3CUEF 1T5IA 3I61A 3R9WA 1Y3AA 1X6VA 1W46A 1ZJ6A 3BB4A 1II8B 3EXAA 4MRPA 4NBSA 4P32A 4U02A 4LZZA 1ZC4A 5EP2A 5JWHA 1VCMA 5IT5A 2GF9A 3K1JA 4LBYA 4UJ3A 2KSQA 3FE2A 4I1SA 3WNCA 5KUTA 2ZITA 2RGDA 1FUUA 1RRFA 2IYQA 4US2R 2A5GA 1IN8A 1NLFA 3F3YA 5CJPA 3BBPA 2ZJAA 1IJFA 1CU1A 1UBCA 1ESNA 2ZJ8A 4N0DA 3RRMA 3B1WA 5JRZA 1U2RA 4IOJA 2DYKA 5BW8A 4B73A 3T34A 1VCNA 3GP8A 1B23P 5LD2C 1JR3D 3H2YA 5DYIA 5EP1A 2FN4A 4MYHA 5HR5A 3LBNA 1W44A 2F9MA 4TMTA 3BK7A 4HZUA 2R2AA 3L0PA 4A36A 3C16C 4V0MA 5DYGA 2G0NA 2XNSA 1EESA 4H1VA 2QORA 4UNNA 3ZJYA 1X8KA 3L82B 5DE3A 4TTQA 1GSIA 1VMAA 4M1SA 3DZ8A 4XD7D 3B13B 2P6RA 2XITA 1UFQA 1TQDA 3RWMB 1G5PA 1U90A 4LJ6A 2GJ9A 2XNDA 4LUCA 1P2SA 3UMSA 4Q4AB 4R2HA 1G17A 3D6TB 2BVNA 2FE4A 1D2MA 2BIFA 2KWIA 4LBWA 4JYBA 5AJZA 4ZI2A 2IHBA 1RJ9B 3QG5A 3ZH9B 2QI9C 1G18A 1W36B 2N46A 2JLQA 4FCWA 1V5WA 4LYAA 4TLAA 4A2PA 4B3XA 3H4MA 4QHSA 1UKZA 2GBLA 2QG6A 1IONA 3M1IA 2QN6A 5JBQA 2DBYA 4YMSA 5SZIA 2FMXA 4Q00A 2ZAOA 1W0KD 4BFYA 4CIDA 1E98A 4GBMA 5HE9A 1F6BA 4IXMA 1FTSA 4CEIA 1ZCBA 5EP4A 4UJ5A 1MRNA 5DISB 4BE7B 2CNWD 3FYHA 4FMCF 4HLUA 4B3CA 3QF4B 1X3SA 4GDFA 1XEXB 3KQHA 1VKJA 1KI8A 1QG2A 1UDWA 2GILA 2QT1A 4K46A 2ZM5A 4JJZA 1QVRA 3AP1A 3BC1A 1S1CA 3R7WA 1YZNA 3P20A 3PEVA 2VBCA 1P62B 1Q20A 2HDNB 4WOPA 1JJ7A 121PA 3KKQA 3GJ3A 2V55B 4HLDA 1G6OA 3LH5A 1GOTA 3CWQA 1RE0A 4JLAA 3KKNA 1ZINA 2A5JA 5EE3A 3CONA 3VU9B 4CEJA 2HXSA 2ATVA 2QMHA 5SZHB 3VTKA 1XB2A 4EIWA 3A1UA 3CW2A 4PC2A 3RC3A 5A5GA 3AKCA 3BE4A 1FX0A 3HYRA 4DB4A 2XEXA 3EIEA 3AKYA 2P3SA 1JPNA 2ZI9A 1KNQA 2GA8A 2JDID 3RNLA 1WBBA 5SZJA 1ZD1A 1ZC3A 2QM8A 3MG9A 2OE2A 1QHHA 3GQBA 4LJAA 4XWOA 2O5VA 2VSOA 3VX3A 1C9KA 1G3MA 1KY3A 4V03A 1MT0A 2HJGA 2WMOB 3PFIA 3L0IB 4MKHA 4GL2A 2BBOA 3EZ7A 4DVGA 2WWIA 1EFTA 1T5LA 1ZAKA 1X1RA 4MRVA 4QC2A 5JMTA 4LJ7A 4N1AA 4S35A 1O3YA 2AR7A 4US0R 2ZRAA 3N2IA 3NVAA 3OIWA 2CHGA 1S3SA 3MWJA 1Q44A 2W2VA 3P27A 2EFCB 3L0OA 4EFLA 3THOA 4DLXA 5DN6D 4TSFA 1KDOA 3GJ7A 4TQAA 4RY2A 4D4LA 2VSXA 5D3MA 3QG1A 1Q3TA 1IM2A 1G291 1NVWQ 4EUNA 1IXSB 1XXHE 3R20A 3RRYA 1KMQA 3WRYC 4DT1B 2ODEA 3KJGA 2VA8A 3AF2A 1CJUC 2ZYTX 1X1SA 1DAMA 1KHTA 4C9BA 2GAAA 2BBSA 1Q3HA 5JJKA 2YOHA 5IF9A 2ECKA 3BFKA 3BORA 4AD8A 1OFHA 3TUZC 1I4LD 4PQRA 2XX3A 3DKPA 1UBEA 5CB8A 2GETA 5BN3A 3FVQA 5JWOA 5FUWA 3PJRA 4OI1A 1TL7C 4UQOA 3THWB 1LVGA 1KJWA 1Y63A 3LDAA 3GPLA 3FMIA 1Z6XA 3QEJA 4HAVA 2FEMA 1PVOA 2HCBA 1XBTA 2IS6A 1W0JA 3ND8A 3X1ZA 3QVUA 5FOWA 3B85A 2VEDA 2ZRKA 3TK1A 3K0SA 1E4VA 1E2KA 4IVRA 2NZJA 1P5ZB 4B6EA 5FL7D 1E9AA 1Z6GA 2JA1A 3NG1A 4Q4LA 4FN5A 2CVFA 2XTNA 4KITB 5IK2D 4ARZA 3AVWA 5IHPA 4LJ5A 4Q01A 2ZYVX 5TVKA 4A0GA 2W58A 1E2HA 1EFRD 2XTZA 4NYMR 1W5TA 2YWEA 3SOPA 2E9SA 4EFNA 4EQ6B 3THXB 2QRZA 2C77A 4JVLA 2OILA 1H8EA 5KTYA 2GCNA 1EX7A 1QRAA 3JZAA 2CCJA 4Q4HA 3QIAA 4EKDA 4HB3A 2E87A 1Z06A 2H8KA 2BCJQ 3K9GA 4HDQB 2Z43A 2IEZA 4DSTA 4Q1FA 3SFZA 1NKSA 1VYUA 2Z4RA 1KK1A 1YZQA 1QHNA 3SR0A 1FMJA 3ZD7A 2GVZC 2IUSA 2PT7A 1P9WA 1AQYA 4YDHB 1EWQA 5FTKA 3PIRA 1IBRA 4PSVA 4WW0A 3M6AA 1DAEA 3FHCB 3E70C 1U8AA 2UZIR 3FTQA 2GTPA 3HPRA 4KYUA 1E9CA 4C0LA 2O8CA 1D8TA 1G16A 4BZXA 2ZE8A 3A1VA 4TZ0A 3TR5A 2IHYA 4AKHA 1COWD 1U8YA 3QPVA 2XZOA 3TLXA 4Q5IA 4D82A 1YE8A 4KFTA 1N25A 1XD2B 4DSOA 1CEEA 1BYUA 4UNRA 2Z0MA 2IX3A 1KI6A 4GP6A 2C03A 3GFPA 3PUZA 4RD0A 3EWAA 4I81A 4OQLA 2FG5A 1SXJC 1Z8FA 2CLSA 2MMGA 4YMUA 1LFDB 3FWYA 3EC1A 3A1TA 4WZBE 4L16A 4RCZA 2PJRA 3FFAA 1YR7A 3AF0A 4BPBA 1G8PA 2NZ8A 5JZVA 1JB1A 3CKLA 3GJ5A 2HYIC 3L2OB 1T8TA 4RD1A 1S96A 1E32A 4L9SA 4LC1A 1VIAA 4NYJR 5J5CA 3K0AB 2JASA 4V02A 2A5YB 5GJCA 1DAIA 1HTWA 5HE8A 3VNVA 4G5SA 3LBIA 4HEJA 1R7RA 1BIFA 2D4HA 1FOEB 1FPMA 3FHTA 1GKYA 4LYFA 4GNKA 1D2NA 1LB1B 2GCOB 2C9CA 4IRUB 4M1OA 2CLCX 4A0RA 3OEED 1S3GA 3ADDA 4A2QA 2ZU6A 2B21A 4QGFA 1P75A 1ZU5A 1P9NA 2YWGA 1KYIA 4Q1BA 2BV3A 1DG3A 3NH9A 1AN0A 1TQ4A 3A36A 4KFRA 1EFUA 4PHFA 1OHHD 4DCSA 1PJRA 4BLTA 2KB0A 1SVOA
chains in the Genus database with same CATH superfamily
1OPRA 1NTRA 4PYQA 1J90A 2FPLA 4Q6BA 4Q47A 3T5MA 4L4ZA 3WAJA 4Y2XA 5J1TB 2IW1A 5KCMA 4H2DA 4UM9D 5IAKA 4CMEC 1DG9A 3PE3A 4DLAA 1O57A 1KKLA 4K88A 3LUGA 3O4RA 2EW1A 2YV4A 1F5SA 1RBZA 1TO2E 2AFHB 2PUAA 1BD4A 4MARA 3AHJA 4MIOA 4AN1A 3K9HA 5E7MA 1KDRA 1VA4A 3OTGA 3QE9Y 5FNZA 5DGXA 3M3HA 4DC1A 2IYFA 3RANA 1CFZA 1U3CA 3TJRA 4FJ2A 4N03A 1CIVA 5CB4B 4JMLA 5FTMA 3IEPA 3TRFA 5J1SB 2EL9A 4U8HA 5EE9A 1WHTA 3GEDA 1FNBA 1F4LA 1ECGA 4ICIA 1TYZA 1VIMA 5H59A 4B2PA 3EASA 4CF7A 2XVAA 3W77A 4D0LB 5JNRA 5LQRA 4Y6QA 5SZKB 4D4MA 3RJ9A 3WBJA 4EARA 4LRTB 3RIMA 1B3BA 4M1ZA 2GCEA 5E2AA 4Q4JA 3AKEA 4AYTA 4CEIB 5ICFA 2XYVA 4PEVA 2PRKA 1FSFA 3AUYA 3K31A 4OQNA 3GIDA 3WGOA 2H1RA 3OE4A 1CF4A 4IJ6A 4HAXA 1GQOA 3I5YA 1G6KA 3H2BA 1XROA 2CDCA 3ESYA 4XFKA 3UATA 1SQ0A 2CXRA 2C59A 2HA2A 4JEHA 3JU3A 5LYYA 3GRZA 3CCCA 1GRNA 1X9IA 3MB8A 1Y4AE 1DO2A 3OQHA 3ZDRA 4ATNA 2X0DA 4CPDA 1YE3A 4L95C 4TRMA 5JS6A 1MHPA 2IXAA 2QP3A 4H35A 4OLHA 1KKMA 5NULA 4EEZA 1UAYA 3MBIA 1DDOA 1DEKA 4Q7LA 4JB8A 4ZO4A 1F2DA 1P1FA 2TYSB 1LRJA 2WG1A 1DKLA 2H4ZA 2XWSA 1TLTA 3DTVA 2V1XA 2IEGA 3PQ6A 3QVSA 3OZRA 4OGKA 3UJ7A 5LQDA 5LZ2A 1VPWA 1WBDA 3RO7A 2B2CA 4O5AA 3VNRA 1B74A 4AMBA 5BNZA 1CEQA 3ZE7A 4JJ4A 1TO6A 3O8NA 5FA8A 3CZRA 4HQKA 1EK5A 4JU8A 4C2TA 4FYJA 3F67A 4YUZA 3QVXA 3MCAA 5IJWA 3OZVA 3DKRA 1E2NA 3FNRA 4NAHA 1V8DA 3G0CA 2PZFA 5K3BA 3RS2A 4CR6A 2NAFA 1ZUWA 3LKDA 2JH9A 3CZAA 4GGMX 4XX0A 5F21A 3DAGA 2FA9A 2EG9A 4IOKA 3B60A 3UHJA 3O8RA 1E5QA 1UFVA 4DLKA 2J9FA 3IC5A 3GNSA 1C3LA 4IV5A 2JFUA 3L6CA 4IJMA 2LUOA 1RC8A 1EXDA 1RZ3A 1YH3A 3DXFA 3QELB 4YJ2B 3OQPA 1E9EA 1PKEA 8ATCA 4TMYA 1NURA 4TWRA 2Q8QA 3S2UA 1YBHA 4ZEMA 3CU5A 3TQOA 4XJSA 3OSUA 4N76A 4EWLA 1EBBA 2JCGA 1ZGBA 4D8XA 1Q22A 5A4MS 3PUVA 1L5MA 1ZM2A 1KWGA 2Q6IA 1K63A 1WZ2A 1FFEA 4P38A 3IQWA 4EYSA 1U2DC 4EH1A 5JMWA 2ZROA 3H18A 1ZHOA 3O31A 2EHJA 1EVEA 4HMQA 3SSMA 4D80A 1D9XA 3I2HA 2H63A 1P61B 1M2EA 2XVXA 1KOGA 3NEAA 4HLQB 3QX9A 1WPGA 2QPTA 4R01A 3L0ZA 4G4SP 5KYUB 1IWOA 1N9GA 3BERA 3LP8A 3ZIUA 3HKEB 4WJLA 2XBUA 1I7NA 4RESA 1US8A 3RBXA 4ER6A 3MLBA 4WE3A 2GNPA 3ZN2A 1S8NA 2AJBA 1DJOA 3ORQA 2QDXA 2Y99A 3UV3A 6CHYA 5KYXB 4EGJA 1KC1A 1AKEA 3V3TA 3C14C 2YV2A 2LV8A 3TIIA 2F55A 1DQSA 3G0IA 3CPEA 4RORA 1D2CA 3AEYA 5BN3B 3A9SA 3LA6A 1I5RA 2VYQA 2J6BA 2QL7A 4PR0A 3HFRA 1QC5A 1D4AA 3MT7A 4YS6A 3PPIA 3JPWA 2D6FA 5EKDA 3KK0A 3HYTA 1EUCB 2WSSA 4ARUA 4JGBA 2GHIA 5EESA 2FUCA 4J16C 2QLJA 4NBWA 3TEFA 4YV1A 3MSCA 2I4LA 3KSRA 4NBKA 5EVJA 4CQLB 1ZWLA 3F7TA 7YASA 3ENQA 1A9QA 4DCVA 2IYVA 2I3BA 3T15A 1HZZC 3HXMA 3HSYA 3M4NA 4HF7A 1HETA 4CTOA 5ADUS 1KJ8A 2W0SA 1I4OA 2OXRA 4KPYA 2BGTA 3EZFA 4CQMA 2Q41A 5CDYA 3WE7A 1H2ZA 3RB8A 2LXNA 2X5JO 3UOWA 2GR9A 4OK5A 2LGJA 4LE1A 3I8OA 4LRSB 1PYOA 5AM4A 5LC1A 1XTZA 3R7NA 2LDBA 4R05A 2BW0A 3SBOA 3QW4B 5IKMA 4CKCB 5BSFA 3MUFA 1F48A 3ZDYB 1HY3A 2WAYA 5IJ9B 4CU2A 1CUGA 4RVFA 1T5BA 2OOSA 4RTMA 2FX5A 1O77A 3FWKA 1I3CA 1NVMB 4JOBA 4M38A 4E5DA 4HUTA 3U09A 5K0FA 4E11A 3L0SA 1E62A 3E27A 3JQQA 3IMEA 3MTGA 4R68A 3T3IA 2WA2A 3DR3A 1E2JA 5LQAA 1T10A 1E9DA 5DHUA 3Q7QA 3SXPA 4URXR 2P2CA 1SCJA 5KHLB 2JLUA 3AUAA 4OPMA 4IWYA 2PL5A 4AF6A 3EIUA 5IDVA 3F9RA 2FPKA 1ILWA 1OTYA 1QIFA 2W2KA 3KSZO 4FZRA 4L08A 5KDLA 2IP1A 1LI7A 4FONA 1L8OA 4XUDA 1C7ZA 5TJHA 4B79A 4IIGA 4B7AA 5HILA 3IT2A 1H2AS 1Z0AA 3CX3A 3VAZA 4XVCA 5BWNA 2QUIA 2IGBA 3EY4A 3PGA1 2O4CA 2OCPA 4IQFA 3OQ6A 3TM4A 4DUGA 1ESMA 4G8DA 3TFQA 2YW2A 2OAGA 3QPDA 3BREA 1NM5A 3WOVA 1KZ9A 3UNXA 3FLEA 5B37A 1HRDA 4K5QA 3NVMB 3WGJA 1TMGE 4U6SA 1NX9A 2FH5B 1DB3A 2MSKA 3B8HA 1JHPA 3N70A 4EW1A 1MJFA 5I7OA 4ERXA 1UWLA 6ADHA 4ZQFA 1GXSA 4NARA 1UC5B 2ZBRA 2ET6A 3FCUB 1KEPA 4L85A 2DCMA 4B31A 1CK4A 1J2EA 4COOA 3KSAC 4HDKB 4KWHA 4QUAA 3K8ZA 5J2UA 2AT1A 3FFXA 1Z0SA 3QOYA 3AJ9A 4M98A 3H04A 2DBQA 4HC4A 5JH7A 4W5OA 1PZEA 4W63A 4PLCA 2IWRA 3O3OB 1I4DD 5I5GA 1N34B 2XSZD 3RVKA 4Q12A 1MO5A 1OLSB 1WB4A 2QAGA 2WFLB 4IDFA 5BYAA 2BKUA 1H2WA 3OQOA 4IDBA 3F8WA 3LVQE 3U60B 1JQLB 3H99A 1G2QA 3OT1B 3T8YA 2DR0A 3FHOA 4DV1B 2CL5A 3R6LA 2FWBA 4WKBA 4WFKA 3TQFA 1VLMA 1Q77A 1F0NA 4KVAA 1FFBA 2AQHA 2AX3A 3F7MA 1BHO1 3QEOA 3OCZA 3JQCA 3ER9A 1CJVC 2F43A 2BTQB 3UJ3X 5GY7A 2UYQA 3D7KA 4ME6A 3N6VA 4RQTA 5HFNA 1T3LA 1YA6A 1BWRA 3KVOA 1HFKA 4U2FA 1IDN1 3FDZB 4G0MA 3OC6A 3ZS8A 3ADCA 4M1KA 4RXUA 1GA6A 3IPYA 1G5HA 2DFKB 3EF3A 4K3UA 5ICSA 4N6GA 4C5AA 3VMMA 3F3MA 4B7XA 2PZAA 3EMKA 2HSZA 2WILA 3R3YA 4K9LA 4RETA 3RIXA 2ORIA 4H31A 1R0WA 3K35A 4XTRA 2GUWA 3A32A 3VZRA 2J5XA 3FDXA 5E1DA 2WTMA 5K6RA 4G5XA 3FETA 4MWGA 3MFYA 5ENVA 1L5KA 1QP7A 3LDFA 1L7PA 4D0GA 4G2NA 2H16A 3TQQA 3IR7A 5DP1A 4LTNA 3Q2IA 5TIIA 1ZLXA 2VYNA 2AJTA 4DIBA 1N9KA 4QGGA 4LDPA 4Y2VA 2CZCA 3AC0A 5IKXA 1GEGA 2D2EA 3PIIA 5AHXA 4HYYA 4TWIA 1ISJA 1B0PA 1U7OA 2G4VA 3PK0A 5F73A 4OHYA 3F5FA 1GG8A 2FETA 2AOTA 4LTDA 1GRQA 2I6TA 1JT2A 2J9YB 1MJNA 3IO5A 4IKEA 4ZT4A 4C6SA 4L4RA 1XCPA 2AK3A 3F6BX 1MR3F 2QY6A 4RCYA 4HUQB 1SCAA 1PLJA 2A9QA 1T35A 3HKDB 2X0EA 1A04A 2VI5A 2GXAA 5DCYA 2H85A 5EXEA 3G5AA 2I2DA 5CFZA 1LDEA 3ITNA 4P4TA 3C3AA 3H2ZA 4TXMA 3HEBA 1GKKA 1PP4A 2C0PA 3FPJA 1GG2A 4J91A 5BNFA 1LX6A 4HUJA 4PF1A 1U31A 3BGOS 1NR7A 4GZ6A 1ZUHA 4UAUA 1HUQA 2ZRDA 3AG5A 4J76A 4U3JB 4EVIA 4MYCA 1BXRB 5EMNA 5J40A 3ZY4A 2JLSA 2O50A 5MGBA 2Q4TA 1E3IA 2QSJA 3FKSA 5CXQA 2XRFA 5HDBB 1DUSA 1JPUA 3WHKA 3I01A 3GMIA 1XT6A 3T0FA 2BGWA 3BSFA 1LA2A 1TFUA 2H29A 5LQMA 3SHVA 4YRNA 1V4VA 1JAZA 1W4RA 2JFOA 1KYYA 5FJJA 1XI2A 3WMGA 2ZSFA 1SK9A 3JD4A 3K70D 2PRZA 4ONEA 2AUTA 4UVGA 1CNEA 1EE9A 2ERCA 2Q3HA 5LXTF 2W6CX 1ZYUA 2OUIA 4M37A 5DHQA 3TSYA 1RZRD 3WMEA 1DJMA 4N48A 3KB2A 3RRJA 1UKYA 4PNEA 1SVUA 2AXQA 3KLOA 2ROQA 1JR3A 1JEOA 3U7QB 3QYFA 3HKCA 3V2UA 4G5HA 4UCQA 3BIFA 3OTWA 4FS8A 1JEDA 4Q7KA 1E3TA 3AB8A 2ZCVA 5F2NA 4NDAA 4UOEA 5DEOA 3H8SA 3WGYA 4G1BA 3D4OA 3D6VA 1Q91A 1QRSA 4QPNA 1JU3A 5JXGA 1GZHB 3MT9A 4RK6A 1JEYB 2YS7A 1DO0A 1S8FA 2DUJA 3LWBA 4MCHA 5BN5B 2BC9A 4BEJA 5I7FA 2JZCA 1N6PA 2C9OA 1XLTA 2AD1A 2VJLA 3JAWA 2CNOA 4MR8B 1K9VF 2PSFA 5CX1B 1EDEA 2FFBA 4OM8A 4BN5A 3JQGA 1DWUA 4CMEA 2A5DA 2LCIA 4O1IA 1A2BA 4FYWA 4NFLA 2JGDB 1JBEA 1GA4A 1NUHA 1K7CA 3I6IA 2TMKA 2YUTA 1TMYA 2YJGA 5ESXA 3M6IA 4MI3A 3AP3A 4WD3A 4IDPA 5B7QA 1KMCA 4H3KB 2YXLA 5T6MA 3ELDA 3TX6A 3E58A 3BPSA 2G1JA 1I30A 3QI2A 1G2PA 5E3IA 1VLZA 4AY4A 1I7QB 1ORVA 3OIUA 4NXNB 4CHTA 3IIMA 1XOIA 4IUDS 4K8RB 4BQSA 3HXKA 2Q5CA 3ZWWA 4DG5A 2PZKA 3RSZA 3R40A 3VTZA 1OGYA 5TSDA 3GD7A 3UQZA 4DHEA 2OENG 3A04A 3OCCA 1D2RA 4FU0A 3ABRB 3WKEA 1TVCA 4P93A 3EVGA 4BEVA 1OXXK 1Y9JA 3GEPA 4MGYR 4U2BA 3WK9A 4EPRA 3KKPA 3T61A 1PFQA 5IM4A 2P11A 1TI7A 2AG0A 3EZ2A 1Z83A 2IEYA 1P4JA 4NJEA 2Q5HA 4DCNA 2E6UX 4OLFA 4NENA 2OYCA 3FOBA 3GDOA 4JN6B 1T5DX 1ORWA 4DABA 1T2CA 2RI6A 3JX9A 1M34E 3COVA 2JL1A 4MB0A 1JZSA 1ML4A 4Q3OA 3HVRA 1HNXB 3LRXA 3GJSA 4RZXA 3TTSA 2L82A 3OU2A 2X3FA 4UNSA 3K0BA 4K3VA 5IBRA 821PA 3NAZA 3ER8A 1AGYA 3GLVA 2JHGA 2XDAA 3PA8A 2QMEA 4A8TA 2A1TS 2AGVA 4FOTA 2LR0A 2GLUA 4KFCA 3SIWA 5IYZF 2RKOA 2V9ZA 2Q3BA 2P4EA 3Q7SA 4GZLA 4QDZA 5KAPA 5KVAA 3WZ2A 4ZYZA 1JNXX 1U28C 4J0CA 5KCZA 1XCMA 1P4SA 1RQLA 3ZWQA 1UOQA 1Q0TA 4HGYA 4NQRA 2FU5C 3KHSA 1ECFA 3L6DA 4P8RA 4PO3X 4XFJA 5JDIC 2QA5A 1X0XA 3BKWA 3IA2A 2ES4A 1RWOA 4HGQA 1RAEA 1ZI6A 1GGVA 2Q9AA 4YASA 4ZO9A 1THGA 2BTOA 3NP7A 2P4QA 3IAHA 4NATA 2HPVA 2IOFA 4MV8A 4WEOA 1OYWA 1B1CA 3OH8A 3SX2A 3GRUA 3V8QA 1UBFA 2XNCA 1YRYE 3HP4A 4L8GA 1PG2A 2I1WA 4QBHA 1SCNE 3F8TA 1VB3A 2CW5A 3IEUA 1UBGA 1YI0A 4LMPA 3E05A 4M9XA 4YMWA 5I7RA 1MABB 2HMUA 1F0KA 1G64A 4IDHA 2QTHA 4JJGA 5E38A 2NQTA 4UOQA 4AF7A 4LJ9A 2OZPA 5K5EA 1WOMA 2DTXA 4C89A 3NC1C 2AZXA 2O5CA 4GLOA 4B4OA 3MBKA 1N3BA 3M9LA 4EJSC 2FLWA 4OQ4A 1CUAA 1S2DA 1SN7A 4M86A 2JGKA 3RJMA 1IPFA 2GCGA 3N7AA 5D1HA 2VP2A 1U1EA 2J0QA 4U7FA 3I4CA 4C4YA 5CVUA 5IM5A 3PNPA 2X0FA 1U2DA 3LD9A 1FIUA 4A10A 4CEHA 1ZNYA 1VM6A 1ZW6A 1LV7A 1AN9A 1H8ED 1RYMA 4RZQA 3OFND 4MB6A 5AVSA 1D09A 4NJMA 4RMJA 3VO1A 2I7VA 3GCDA 4TWJA 1TEXA 1GAEO 1VL1A 2FEXA 3KO8A 1RQNA 3MUOA 4QAQA 2H2AA 4TV9A 2QMQA 1E6KA 4HNRA 1YJXA 3IHWA 4MTCA 4Q05A 1QTNA 4BN4A 4BNHA 2XCRB 4Z49A 4RK7A 1GCGA 5D5QA 5DF1A 3GA0A 4BASA 3AEZA 5FPQA 1EVZA 4EW3A 3SDSA 3KKMA 4Z9BA 3VR1A 4P81A 1E3MA 5B58T 4JT8A 2NXNA 4QYTA 2HJHA 4KJXA 3TECE 3LT0A 4O4HB 2VDPB 2VO1A 3DS8A 1DAGA 3OESA 3OTHA 5TV2A 3SICE 1WE2A 4KIJA 3H5AA 4HWOA 4DGSA 1ORHA 2XLCA 4EHFA 1QE5A 4YT8A 5BNIA 2OZEA 5HIKA 5DOVA 4BUCA 2E4UA 1GPMA 1TB4A 3Q3IA 4J16A 5BNWA 2ZBPA 3O2NA 3AERB 3B1VA 4M9ZA 3R7DA 3AB3A 1HZZA 5K2MA 1N4AA 3VTAA 1VGQA 4XUGB 3DDHA 4ND6A 2H4WA 4PAGA 3GLGE 2HHJA 2NADA 4ZZ2A 3ONNA 2E6KA 1Z5OA 3BWMA 3WV4A 4PRZA 4HO1X 4OP3A 2WJJA 4YP6A 4DA7A 4XWKA 2D7CA 2O0HA 2EGGA 4QQ8A 5I45A 4TUYB 3ESDA 3ZWOA 5L3ZA 4R2LA 1YR6A 2V8BA 2PX0A 1Q1QA 4GLBA 3VI4B 4TYWA 2IXTA 3K9BA 4YRTA 1F9AA 1C1YA 3DW3X 3QENA 3HS3A 5CFMA 2VSFA 4IXDA 3EG5A 2V58A 2ZTLA 3OZIA 2NT4A 4OU4A 5CLIA 3DBIA 4S0ZA 5IMBA 4BMDA 2YJTD 2IT1A 3C41J 2FQWA 3PXDA 4FKBA 4E32A 4B3IA 4YYEA 4JBLA 3FWZA 3IAM6 4LZWA 2R1TA 3MGBA 3FW1A 4JA0A 5C5CA 1Z2AA 1I51A 2CK3A 3B6ZA 5J2TF 2A9OA 1OA0A 4R9NA 1IHYA 2OCYC 2QRQA 5IJAA 4Q3KA 1RPJA 2PUFA 1QAOA 1QFYA 4F2DA 1LBIA 2F48A 3NLLA 3DKKA 4IHAA 4J29A 5LUAA 3QQ5A 2P9HA 2PGDA 4B6SA 2UYYA 1E6CA 3D4BA 3KTOA 4RV5A 2RHBA 4UUBA 3EEQA 3HPQA 4XRRA 5CJ2A 3WDKA 5HSGA 2ZWIA 1IXYA 1EZZA 2C29D 1P1CA 1YTUA 3W6OA 1H0SA 3HXQA 1K7FB 2BFOA 4D26A 3HK2A 3EFOB 4AI6A 4K1XA 4PFSA 3ACBA 1CYEA 3V4FA 2HBZA 3JVDA 1PR2A 4MV6A 4GOKA 1W5SA 3RQSA 3DD5A 2WKQA 1EVIA 2GK6A 2F9LA 2H7XA 3A6EA 1BYIA 2R65A 3JZFA 2UAGA 3AFGA 2J7PA 3WHLA 4D9CA 3HDVA 2X2EA 4FXOA 1G8GA 4ZVKA 3IBYA 1LBEA 3TLYA 1TTPB 3FB4A 3FR7A 3UJDA 4DZTA 1Y82A 4HRVA 1E1KA 4B3GA 1TGVA 2W6JD 4DBLE 4YXFA 5TMDA 4BV9A 2ZSEA 5IN5A 5L51A 4DC0A 4M9SA 2ZLBA 1FQOA 3CUKA 1PFUA 1XZ8A 3O8OA 2HMVA 3DV0B 3ESQA 4C6HA 3KQPA 1NWCA 3PQCA 1SO8A 3HSSA 3DNPA 4XTCS 1XRNA 3OWHA 1XTBA 4V1CB 5DTEA 3OHMA 2O2EA 3LCVB 3WQQA 3FUWA 4HRAA 1IIRA 2D5LA 1Y1KE 2PANA 2XDWA 3BMXA 3FSJX 3L06A 3MPUA 3QBJA 5AVTA 3V46A 2IZ7A 3KJFA 4W7SA 1NF9A 3ECSA 1J2TA 1OOEA 4RVUA 3GO4A 4QDKA 3UJ9A 3EEYA 4F21A 1UAGA 2F9FA 1UBJS 1XRLA 4S1VA 3WKCA 1A7AA 2EGHA 4PFKA 1OLUA 3G6WA 4GM1A 4FYPA 2QG9A 2FDCA 1R0YA 2HRCA 4P0TA 5DSTA 3HU1A 4ID3A 5KQGA 1KH2A 1QHYA 1UJ2A 3B5IA 3TEJA 1RTTA 2Z4TA 4GX5A 4RELA 3U19A 4TGLA 5EWJA 4XGNA 4DDWA 1JFVA 1II8A 2DERA 1UJMA 4EP1A 4OM7A 4WHMA 4EB6A 1I36A 2CLEB 3H42B 1JLKA 1SM4A 2C5FA 5KAMA 4UHHA 2OV1A 1PK8A 2OD2A 1SK8A 4X71A 1YHZA 4I5IA 4FCVA 4MRSA 1I32A 3OU7A 1DKRA 5E6UA 1TZMA 4B75A 1T2NA 2QM0A 4GI3A 4QQKA 2C8JA 4Z3KA 3H3XA 1KJNA 2HMTA 4G25A 2JFNA 3RW9A 1J97A 4ZOLB 3RIHA 3T3NA 1I4WA 5ALQA 1J2UA 4RK1A 3DH0A 1W5EA 2Q62A 5A2QA 4DLPA 3ICEA 1E4OA 2FZ5A 3I6ZA 4PC7A 5AXBA 1GTSA 3Q85A 4KJZA 4W8HA 3ZOZA 4UW9A 2UZ3A 4P6VF 2R8PA 1YQTA 2WHEA 2JRCA 4EA7A 1QH8B 1AC5A 1WV0A 2RARA 2VL7A 2X4LA 1EQAA 3TRDA 2P90A 3K20A 1Q7TA 1LDGA 4H77A 5EZYA 1CQZA 1UT8A 3CIFA 4Q39A 4A6XA 3GLFB 1YZYA 2WTXA 3SI7A 1XNJA 4Y0VA 4F6RB 5CW2A 5I9TA 2HCFA 1QG6A 2X0KA 2PT9A 4REQA 5DM0A 5FYQA 2KHZA 4OP1A 3UB3A 2PRYA 1RWXA 1N9ZA 2X7HA 2BI8A 1SHLA 4AJPA 1DUIA 4HNSA 4FWIB 2C0CA 4CIXA 4P84A 1DLIA 2GARA 5KTMA 1JWBB 3C2QA 4TKVB 3WIBA 5KVSA 1QHHB 1H1LA 2P8JA 1V8FA 2ODTX 5IT4A 1QFJA 1CLEA 1D2GA 1D4FA 1FDRA 1MN6A 3ZE0B 3TGPA 3IAXA 3G9UA 3Q5EA 1Z37A 3P96A 5HGXA 4XB6B 1ZIDA 1GPJA 5JPDA 1XZNA 3W4JA 4MINA 4RF2A 4IHKA 3OQJA 2AQ8A 4A15A 4WCVA 3CRW1 1C0LA 4Y6RA 2Z2IA 1T9CA 1AKRA 3CUTA 1H9AA 4JOQA 4DNXA 3U6BA 1GL7A 3EXFA 1Q7BA 5H80A 3RADC 2JHPA 3NX4A 4G65A 4PANA 1BJTA 4WNYA 5B1SA 5SYMA 1FW6A 2FZKA 1UKEA 3KKOA 3JAKA 1RRCA 1C8VB 4RVGA 1HQCA 1D3AA 2C82A 3AFNA 3BGVA 5D3MB 4LRYA 4WZBA 1U2TA 1VL6A 3JATA 4M0KA 3D3WB 4PTLA 1MIHA 2BHSA 3CKKA 4ZKDA 4KLAA 1BHSA 1XEXA 3DOOA 5IF3A 1FNCA 4JLSA 3C7CB 3BCSA 2A2ZA 3F96A 1NT2A 3BMNB 1NMZA 3PLRA 4Q1CA 3SS7X 5JVDF 1KQGA 4ZK6A 3HCPA 4HNVA 3ZHXA 1XMVA 3FTNA 1Y8ZA 2JLXA 3BMQA 4PO1A 4ETWA 1RABA 1V0JA 1FDWA 4NG4A 3ZWXA 2E5FA 3A9CA 1WLSA 3OD5A 1UBNA 2E2WA 4OXXA 4DDTA 4EF6A 3PRJA 4OX9Y 1JFFB 3VU9A 3LKBA 4CIYA 3RIYA 1X1AA 3Q3CA 1QBKC 1E2FA 3V8BA 2RH5A 3S4YA 1OYOA 3C8DA 3QFRA 1MORA 3S5JA 2NP6A 4AUEA 3N87A 3TRHA 1ADBA 1O4VA 1PDVA 1JIKA 2JLRA 1ZVJA 4J7XA 2V7EA 2CT8A 1CE8A 4OYYA 1BWPA 3AUFA 1ZICA 3PDCA 4LE2A 1Q1GA 3WLTA 3OQMA 1QGDA 4PAMA 4N12A 4C30A 5C35A 1IJBA 2J3LA 4NBUA 2F8MA 3C3MA 1Q19A 1V9CA 2CUTA 3QBEA 1ZP6A 2QF7A 4FXPA 5AKKA 3NIDB 4YI5A 3W7BA 3T95A 2B0JA 3M7IA 4HFMA 1R6XA 2C1EA 1P2TA 4C0QC 1PQUA 1UWVA 5AI6A 3ZWNA 3T99A 1P5RA 1MQAA 1PGJA 2YZMA 4MCJA 3NDRA 5ALDA 3JD1A 4MZDA 2OK8A 3M6XA 1ZA2A 4IJUA 1L5LA 1YIDA 1GZVA 1X7YA 2YC2C 3LKZA 4KLCA 3EUEA 2GM4A 2DY0A 3P2EA 2AEJA 1MC1A 2HMWA 2IA5A 4L51A 2QROA 3STYA 4IIJA 3OAAA 3W79A 2CFRA 2V5AA 1Q0QA 5IEBA 3S2YA 1MAAA 4M7OA 4J6FA 3O9VA 4MAMA 2KI5A 5JLAA 2P35A 2Y2VA 3HY3A 4AZ0B 1C2YA 5ALOA 2JBAA 2OLKA 4N6NA 3OZUA 4Q9IA 5EINA 3V8RA 1Y0BA 4DCGA 1T5OA 1JJBA 3E5NA 4HHEA 5CLLA 3DT8A 4V0ME 2ZB3A 4X90A 3CVYA 3MTJA 5JPIA 1V16A 4GI7A 4IFIA 1X7XB 3L79A 3VH4A 1ZD9A 5MDHA 1B0ZA 2YWFA 3TCXB 1OZAA 3WL5A 1B6TA 1L4YA 4Q9NA 2RGWA 3RF6A 3DZBA 3WO1A 2O2SA 3FWNA 4QNRA 1TT5B 1U28A 3U9LA 4I1PA 2YQ4A 1HDCA 1K5GA 1R5BA 3FA2A 4LZLA 5KJEA 3T9CA 3ZU2A 2Q9BA 3KOMA 4LGMA 2ZZNA 3L0DA 1U8FO 4WCFC 4FHCA 5AKEA 4ED9A 1ABFA 3H5RA 1UP6A 3IQIX 1Y1LA 1WETA 3ESCA 5ERGB 1QCZA 3ONFA 2AHOA 4CMBA 4HVAA 4C5CA 4C20A 4EMSA 4JQSA 1SUIA 3NC0C 1FVXA 1RNLA 4DWVA 2FK7A 4QECA 4BB9A 4F1WA 1TIBA 2PMFA 2WJAA 3ENZA 3FPBA 4HP8A 4JP5A 4ZDIA 1SHZA 3AR6A 2NVWA 2JHFA 2FB9A 2O2XA 2PXHA 2ZI7A 5FBHA 4YAIA 2PE5A 1FYDA 1XCGB 3BE5A 3KJHA 1J20A 5KNDD 4QQFA 5CDGA 3T4XA 1XSEA 1XLWA 4ESOA 1N1EA 3CR7A 4LJRA 4C6RA 4TXJA 1Z4MA 2J1LA 5F3WB 1ESCA 3DVSX 1M6VA 5FAKA 2A3NA 3F9IA 3P4XA 1DC5A 4EQ6A 1T4CA 1G66A 1Z0DA 3NHFA 2FJ0A 3EDRA 3MJEA 4GL4A 1T2VA 1GEEA 2PXXA 3WGLA 2FRXA 3BAZA 3LQKA 2PPLA 4EYGA 4JYAB 1ORRA 3AL2A 4UBJA 4MW4A 4F4HA 3LY7A 3EZ6A 3O92A 1KMNA 1PSWA 1Z73A 2FWIA 2ZANA 1C7IA 3H5WA 3LFTA 3RBZA 3SKYA 1O87A 2E4YA 3NETA 3REOA 3VR6H 1HM5A 2R6R1 3C4VA 1FYVA 2VDOB 1OI2A 3H1GA 1M67A 3WLOA 2BJWA 4YJFA 4A91A 2RHWA 4KDFA 2W22A 2C4UA 1JQ3A 4JVSB 1MU0A 2V4MA 4DJDC 4JI8B 3Q98A 2FOLA 2C9YA 3SYTA 3NS7A 1AHPA 1TD1A 1I2ZA 2B7CA 4NSNA 3E3OA 2IVZA 4HXGA 4BTLA 1BEZA 3AG6A 4NESA 1SWVA 1OILA 3I5UA 4CM4B 2R97A 1KZGB 3B1ZA 3MJ4A 2ORED 2WJGA 4LYHA 1YUMA 5BYKA 1KVTA 3C4QA 2ZYWX 4XSGA 3SQLA 4BQEA 1E4YA 3I05A 4UCFA 4ZYWA 2FUKA 5BPHA 1KS2A 4M7PA 1C2TA 4MULA 4RVHA 3STTA 1WUIS 2IHUA 3WNBA 1KK0A 5I9SA 3T7IA 4IVQA 4PIPA 2HSDA 4QGAA 4WOKA 2O3SA 3RS8A 3EUFA 4P4SB 3RYFA 3HEAA 2ACKA 1M2GA 3DYIA 2G04A 3TIFA 1XKTA 5I9BA 4Z8XA 5F4ZA 4KZPA 3ZS9A 4YRLA 5JNTA 4L3WA 1SXJD 1RT9A 4TXNA 2FRDC 3IDSA 5K8CA 1T1JA 1Z63A 2GXUA 4WL0A 3M1AA 5DNEA 4V0LA 4KQ6A 2SCUB 1L4EA 1DBWA 2GKGA 1A97A 3LBFA 2REXB 3MTIA 3PX7A 2OM6A 5BOSB 5HMLA 5THQA 5FQNA 3H19A 1XFAA 1EG7A 1VMIA 4LHZA 4MQFA 4DA0A 4YRAA 4RTRA 3UICA 1ULZA 2D1QA 4CKWA 4F8JA 2FKNA 3WSWA 3EPJA 1N5OX 1Z82A 2BUCA 1RJGA 2VHWA 2BI4A 4Y2SA 1YZ3A 2IELA 4EGQA 1H69A 4G4GA 3TNLA 3QXHA 2GZ1A 1A4RA 1PE0A 4NOJA 3RT1A 2GCOA 3HCRA 4Z8YA 3G2HA 4FWTA 2ZBVA 2YNMD 5B2EA 1E96A 1OV4A 3D3EA 3WJAA 1IOVA 3EBOA 4TMWA 4I1YA 1SHKA 1VRVA 2MWMA 3OPYB 1QRDA 5K3EA 3DWEX 3EOBI 1KSGA 1SAYA 3TCKA 5TGTA 1H9CA 3ZHUA 3EWSA 2YN0A 4DLWA 5CXSA 1JEAA 2QLLA 2IIQA 2IEAA 1CS0A 3KZCA 3UMRA 2YMMA 4QTUB 4L5JA 4EO7A 2IE8A 3GJ0A 4DMGA 2VZ0A 3OP1A 1P1HA 3C4JA 4X3CA 2ZRGA 4U0JA 5JO9A 4UUPA 3REFA 4WUTA 4EA6A 5ALNA 4XIIA 4OBXA 2YJ6A 1ABEA 4NQZA 3UG7A 2RJOA 4LZPA 1Z22A 3OZWA 1RFLA 1EFCA 3A9RA 3F5QA 3RHFA 4CV0A 1I2BA 1ISPA 5BT9A 3RYCA 1QVAA 1IJKA 4YXWD 1MUUA 5IDYA 1BFUA 2W6PA 2JLWA 1P91A 1IY0A 1QMGA 1OXVA 1YKFA 5AKIA 2QTGA 3S7ZA 2K7FA 1TVMA 3DBRA 3HCCA 4AQDA 1S4MA 1YDFA 5AKYA 1WHSA 4QD3A 4B8YA 1ZJZA 3OTOB 4Z4GA 1QIKA 2FFQA 4AFNA 1TYCA 4PC6A 4MROA 5C8YF 4ENPA 3IA7A 2O19A 2F6RA 1G20A 2OYRA 1AMUA 2NU6B 1XZHA 1P0MA 2CFOA 4JQCA 1VPDA 3DFMA 3A14A 4J1SA 2OHFA 1M0TA 2AHRA 3MF4A 4GUAA 4AO6A 3HJFA 1J5PA 2FEPA 4TYYA 3ANYB 1HT2E 4KRXA 3L6OO 1KDZA 3UT5A 5DBHX 1SQ5A 4XIYA 2IDZA 4O4IB 4MVWA 3N1UA 1JLMA 1U0HC 4Q7JB 9ABPA 5JPCA 1T0IA 1L8XA 3ZQKA 4LQLA 4M1EA 1W0KA 4KQWA 4B3TB 1R8YA 2OK7A 2AMFA 3DOHA 1WPRA 1R0RE 1XCLA 2JHAA 2ZJ4A 5BSRA 2NV2B 4CN8A 3TRIA 2HWYA 2J45A 2PYZA 3C5WP 3CH4B 3HXLA 1G41A 1NF3A 2VJOA 2CNWA 2DT8A 3PPWA 3R3JA 4NMLA 3I8SA 4QJ5A 4X94A 3ANMA 5AP9A 4LFCB 3NNNA 1T5SA 2A0WA 2AQKA 3KEOA 1K8XB 1YS7A 3AM5A 3TGWA 4MWZA 4R3WA 5DHRA 1L4GA 1UQTA 3N53A 2XUOA 4GR9A 1BAPA 3P26A 3SS8A 3X1WA 3W06A 2DLNA 1RSZA 2WHRA 1VPLA 1Z26A 3R5FA 1J42A 1L4KA 1W4AA 1MGPA 2ZUWA 1FLDA 3BOSA 1GVNB 5JJCA 3C6QA 4PX9A 4UMVA 2P6UA 3SF8B 3PWKA 1AXRA 2XIQA 3AY7A 4L9AA 5F1OA 5KTSA 7MDHA 4G86A 4RVNA 2FX3A 2EQBA 3R24A 4NK5A 2UKDA 4ZDJA 4GMDA 1FBTA 2NU8B 1P7WA 2OGWA 5KWJA 1EPUA 2B4TO 3ROKA 8ABPA 4A6EA 1P72A 4DIMA 1TUEA 3P2YA 5AESA 4ILEA 1M9NA 1WMSA 1ZKMA 3Q5DA 4M54A 3DXZA 4I9UA 2O20A 1BO6A 1ZL2A 2XODA 2JAWA 4DDVA 3WP0A 4KC0A 5CCDA 1Z13A 3WTCA 2DHCA 2XTAA 1U1DA 2IH2A 5LZ7A 3P9QA 2R7AA 3W90A 3A4VA 3CRNA 4OIMA 4Q1EA 3FCEA 2IY8A 1S0UA 1DIAA 3MXTA 4CE6A 4DEYA 2C4VA 4AU1A 1BXGA 2VZ9A 4EKGA 1U4SA 3QEMA 1GT6A 1ZQ1A 4H16A 4L9RA 4X92A 3ISTA 4XJTA 3UIEA 2C58A 1U7UA 2QYOA 4HDOB 2HSJA 4PVDA 2NO1A 4I14A 4TRJA 3INTA 3BRWD 4B46A 4MW2A 1E2EA 4KQKA 2HPHA 4ARZA 1X80B 5JR3A 1P73A 4WBNA 1Z4QA 2POCA 4M1QA 4NMXB 4OREX 1I2AA 2WQ7A 2G6TA 2PBFA 4KAFA 1DAFA 4K26A 4OG2A 1NAHA 2G25A 1DCKA 1M2WA 2ZDGA 4N47A 5LOVB 3BFPA 4FCCA 3KRTA 3LHIA 5BWOA 2YOFA 5AM1A 2XUGA 1Y4DE 2PAAA 3GYBA 4WA8A 4DCOA 4JBXA 2GWHA 1UXKA 3B6IA 3EZXA 5J4VA 5T4BA 1UBRS 5B53A 1ZOOA 3GLIA 2EBUA 3PKIA 3RC8A 1II9A 3USCS 5LKRA 1MNAA 1CUBA 1NU8A 1NUPA 1N0VC 3EUAA 3MT8A 3NW9A 3QITA 5ETJA 3LF2A 5FOSA 4ERNA 2ZVJA 2YZGA 4JSRA 1EX9A 3B20A 1QQTA 1JIIA 4MI9A 3T3PB 1GNPA 1V8ZA 3E7WA 4UXHA 1OWPA 4YWJA 3OJWA 5EJ7A 1WSAA 2JFXA 4PTZA 2ZJ0A 2G1KA 2Z98A 2AJCA 5E9WA 2O3QA 1U6JA 4MA4A 4ZOBA 2ZJZA 4OQMA 4CM3A 1JHDA 3OX1A 4F8YA 2IIBA 1EGHA 1TCBA 5LUBA 2GS9A 4H6PA 3T3MB 2IXEA 1E60A 4IY1A 3RE1A