2DUNA

Solution structure of brct domain of dna polymerase mu
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
133
structure length
133
Chain Sequence
b'GSSGSSGSTRFPGVAIYLVEPRMGRSRRAFLTGLARSKGFRVLDACSSEATHVVMEETSAEEAVSWQERRMAAAPPGCTPPALLDISWLTESLGAGQPVPVECRHRLEVAGPRKGPLSPAWMPAYACSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase mu
publication title Solution structure of BRCT domain of DNA polymerase mu
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 14
structure length 133
sequence length 133
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2006-07-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 2dunA01
2LE0A 1CDZA 3PXCX 2M2IA 3T7JA 1IN1A 3PXDA 3FA2A 3AL2A 1KZYC 2EP8A 3EF1A 3K15A 1N5OX 3HUEA 4JLUA 3L46A 2D8MA 2EBUA 2R1ZA 3SQDA 2VXBA 3II6X 3K16A 4Y2GA 4Y18A 3PXAA 3T7IA 1IMOA 4BMCA 3I0NA 4XPZA 3SHTA 3PXEA 3SHVA 1T2UA 2ADOA 4IFIA 2K6GA 4BMDA 3PXBA 4U4AA 2INGX 3PC8C 1GZHB 2COEA 3L41A 2ETXA 3JVEA 3T1NA 3SZMA 1WF6A 3COJA 4XQ0A 3U3ZA 1L0BA 1Z56C 2COUA 3L40A 2AZMA 1OQAA 3T7KA 3UEOA 4BU0A 3PC7A 3EF0A 1T15A 3K0KA 3PD7A 3KTFA 2DUNA 4BU1A 2NTEA 3UENA 1JNXX 3PC6A 2E2WA 3K0HA 1T29A 3HUFA 4IGKA 2K7FA 3K05A 1Y98A 2WT8A 4ID3A 3AL3A 2JW5A 3PA6A 1L7BA 4N40A 2COKA 2EBWA 2HTFA 3QVGA 3PC8A 2L42A 4OFBA 1T2VA 3QVGB 2XNKA 2XNHA 3I0MA 5ECGC 2VXCA 3OLCX
chains in the Genus database with same CATH superfamily
3WL6A 5DGHA 3WK6A 4MVWA 3M1YA 3B3AA 2M1ZA 3ZU3A 4TMTA 2ODAA 1GWNA 5IZ4A 2Q5OA 4XQCA 3HWRA 1NN5A 1VHDA 4RPHA 5EWJA 4JLMA 2O8DB 4MW2A 4PSCA 4Q1DA 1UFVA 3IV6A 1G5HA 1WCIB 3EH1A 4TMWA 4G86A 5EYPB 5GIPE 1PR3A 4XYBA 3FFWA 2JAWA 4LXUA 4MYUA 1GV0A 2WU1A 2P6UA 5FL3A 4QTYA 2YV1A 5KMGA 4MQFB 5EZ5A 3K8YA 5B4VA 1QU3A 1ONSA 1VL2A 2Q3EA 1H66A 2BM9A 3SC2A 2SCUA 4CCSA 2H2IA 2VP5A 1Z4PX 1KQGA 5J2UA 4HDNA 1SXJE 1OX6A 2XT0A 4OFZA 2XCLA 4BLWA 4DCGA 1T4CA 4P7JA 4CE6A 2GXAA 4WNCA 3HEAA 3M3DA 4I5GA 1YJ8A 3KV1A 4NF2A 4DQVA 3LCCA 1RC0A 4TL9A 1Y80A 4F85A 5HVNA 4OQMA 1WZCA 1IVYA 3L3BA 4JGBA 3MGBA 4EBFA 2IX3A 3WIEA 1K7XB 3WLFA 5GADl 1TEHA 3LO8A 4U39A 1GUZA 1SXHA 1U1DA 5FL7A 2ORIA 3PTLA 1KU6A 3RIHA 3ENVA 2R84A 2QQGA 3M6IA 2MCFA 1JLLA 5DNDA 1FDSA 3M6UA 3MS4A 2PWZA 2WKWA 3F9IA 1ZJ5A 3JQFA 1R4NA 3N05A 5I51A 5K1ZA 2IPMA 5ESXA 4DC9A 5AVRA 1WHSB 1G66A 1BMFD 1ZFNA 4HH0A 2FF7A 2O8FB 3IQEA 4G0MA 2ZJBA 1XJQA 1SCIA 5AI6A 5E9JA 1RYYA 4E2XA 4DQDA 3B6MA 3FLEA 3OJCA 4LRWA 1Q1NA 5ALUA 1AKUA 1T3GA 3NC0C 4A27A 4ETIA 3A04A 4HDKA 2Q2QA 4J1NA 4G5GA 5CMLA 5D84A 5BXQC 5IABA 3FSEA 3LNTA 2CLSA 4W1QA 2BN4A 2VHUA 5CXSA 5KAMA 4R2IA 4EYEA 5JLJA 4M9XA 2HWXA 3LVRE 1VLVA 4DNFA 4EB0A 3AHJA 3HI6A 3WRYC 2WFAA 4K6CA 5EJAA 4WXHA 4EQZA 1TM3E 1BN6A 2J3EA 4H31A 1BDJA 3TQQA 3DZ8A 2P2SA 2WM2A 3LWBA 1VGQA 2GZHA 2FPPA 5LQJA 4TT8A 1PFGA 4MCHA 4C3ZA 1SQGA 1TIKA 2CLMB 1GTG1 1LQTA 4LN1A 4R83A 3SQOA 3A9TA 1BKDR 4XSHA 3LPLA 4XOUA 3DZFA 2PUFA 2FP4B 1GZSA 3VYTB 3WA6A 1KBZA 1ISPA 2VT6A 1IRIA 2ZETA 3OEHD 3WK9A 2C29D 4Q7QA 1XZDA 4YRZA 2AOTA 4I8IA 1X2BA 4J4BA 1CUIA 4K81B 3TCKA 4ZV4A 4KV9A 2QP3A 4XIFA 4EG5A 4OQNA 3UK7A 1XVIA 1VP9A 2F1JA 2NYVA 3PWSA 4FDVA 2N9UA 4DBVO 5AM2A 4OKIA 1XDZA 3CCBA 4UDOA 4JT2A 3T3HA 4M99A 5EZYA 4UCFA 4I6EA 3AY3A 4YJ2F 4N8SA 5FOTA 4N6NA 5BQFA 4DDHA 2X4IA 1P80A 4QU9A 4QPZA 2BCEA 3WWOA 5IYZA 1ZC4A 3C3BA 1ZU5A 3A70A 3G79A 4PHTA 3ZQJA 1JEYA 2PFSA 3W5AA 3GFSA 1C8LA 3FVVA 3EZGA 4AZVA 3UXMA 4J6EA 3O8RA 3O0DA 1VC2A 1AF4A 2WIJA 5EIFA 1QVRA 2EFHB 5BNTA 1M0WA 1ETHA 1DQNA 2QVZX 2WIKA 3RUHA 2R9VA 3S27A 3ZE6A 4IQ0A 4NCIA 2FUKA 2B6NA 4H1UA 5B3KA 1MO3A 1KARA 2YCLA 5A2GA 3U7IA 2AFHB 2R6R1 1U2QA 3BHMA 3DYBA 4P53A 4Q7MB 4GWLA 3O2QB 1TL7C 2PSHA 1EZZA 1GQQA 3ZBQA 2CDAA 4KRFA 4G1FA 3E03A 3ROEA 2QTVB 5JH7B 1HMYA 2R6DA 3AIOA 4ESVA 1U1GA 2CBGA 2WE7A 3WGMA 5BSEA 1JDTA 5GOZA 2IZ6A 3EEOA 1M8KA 1FFXB 3PFKA 4L9RA 1A9SA 4R1LA 3P0FA 3VH3A 2OGUA 4N49A 3DLAA 3HN6A 1B16A 3GEDA 3RC7A 3Q12A 4ZQIA 3GLFA 5JCJD 2QKYA 3EEBA 2GBPA 1NM5C 1FFBA 3PT5A 4X1KB 1EWTA 4ZV9A 3S1AB 3UT5B 1LLDA 4I36A 3FTDA 2VPZA 2YIMA 4IG9A 4Q5IA 3JQ7A 2WJJA 2NO9A 4XGIA 3T7RA 4CMBA 5FEUA 1B23P 1CX9B 4HRXA 1ECPA 3RJMA 4IDCA 3AMVA 3PWKA 4N4AA 3X43A 4BO1A 3WV4A 2Q5EA 3R9KA 5J58A 1RBYA 4AMVA 5A4AA 5EXEA 4AJOA 5BMVF 4CKEA 4IOJA 4RCYA 2VEOA 1GN9A 3FZNA 1Y8RA 2O0HA 3MMSA 1E2LA 1MZVA 4KDFA 1QIDA 3M4YA 5JFGA 5IN4A 4YV2A 4L0QA 3ZWKA 2YXDA 3UJAA 4TKUA 5F7OA 1YB5A 3MAGA 4PFKA 5EKUA 5I4CA 2PKQO 4YV0A 3U26A 1UFRA 5IT5A 2WG1A 1MR3F 1I0ZA 5EXSA 3A1SA 4YYZA 1YS1X 5ICSA 1Q15A 4H4EA 5LIPA 3FYCA 1GT6A 4GP9A 4M9SA 1GNRA 2G9VA 2J48A 3SQWA 2AQ8A 3QYPA 4FI3F 4ZQFA 3O93A 2ZSEA 1OX5A 2VBCA 1OLUA 4Z9AA 1L7QA 2DHQA 2IZ1A 1DQZA 3PCXA 3AK4A 2Z2XA 5H70A 3OHMA 1S1CA 2VJMB 5F3WB 3PZBA 4I2NA 3I73A 4FE4A 1ETUA 2IXAA 3ZNNA 3S4YA 2GCIA 4RLHA 1IM5A 1E2QA 2CVQA 2Y05A 1U28A 4E14A 1U0FA 2EFJA 1PD1A 2IEDA 1LJLA 2IHBA 4M1WA 2QQ5A 1QJ4A 1CQPA 2X2PA 4POOA 2GCNA 4LRTB 2X42A 2AKEA 5JSKA 2BI4A 4RXTA 3AEUB 3EPRA 3O9MA 3UWDA 2C4UA 3L2OB 5CT5A 4HN2A 3CVYA 1N2CE 1TRHA 2RSLA 3G0BA 2RD2A 4C0WA 3PFWO 4JXJA 5CD9A 3KXDA 1N9ZA 1JAZA 4X3OA 1A5ZA 2J0VA 2XNHA 3AUYA 4OOEA 4XB6B 4JI1B 3GLGA 2OBMA 1AK2A 3RIMA 2BE9A 3IUQA 4UZFA 3LWDA 2ZXUA 3VDXA 4KN9S 1ZH8A 1AQYA 3VYSB 2IFTA 4G5XA 5CJPA 3I5YA 2B82A 4EJ6A 4PX9A 3RVLA 3Q0EA 1OASA 4D9EA 4DDMA 1F8GA 4GBED 1HDEA 1JE0A 3K1ZA 3W06A 4B4DA 1PZNA 5SZHB 3EGOA 3CVXA 2QROA 4JWTA 4X7PA 1GAWA 2AMFA 4M54A 5ELMA 1EUZA 1PL0A 1Q3TA 2B9VA 3QHPA 5AI0A 3FMPB 5TX7A 3N3BC 1VMEA 4BJ3A 1ORHA 5CBKA 5HM6A 3FHTA 4XYEA 5LYJA 3ZU6A 4A8JB 1XQWA 2V7QD 1Y7TA 1YE5A 4IX1A 2YJ4A 2VF5X 4X71A 4G9BA 4XYMA 3MPOA 4HDSA 2J8ZA 2RGDA 3TIFA 3A3YA 5C7OO 4PIMA 1NZFA 1LV7A 1RADA 2LCFA 3C43A 3L7IA 3GZNA 3M6LA 3ZOZA 4COKA 4K1LA 2J9FB 3ELBA 5C5IA 4BZZA 4F9TA 4AROA 1MC8A 4JY7A 4RDXA 2ATIA 3G17A 4WAUA 1FMFA 2DC1A 4ESHA 2AOUA 3AUKA 4M1MA 3FOAA 4MZXA 3W2FA 4KODA 1GRQA 2YJTD 3N2GA 3DE5X 1ORVA 1E2GA 3G8CA 1HE8B 4LNHA 3FVTA 4Y0AA 4NU5A 5CVJA 2YICA 1MVLA 1UOQA 4WBXC 1JHOA 5AJYA 4YT8A 2DB3A 2YIDA 4Y98A 1F2DA 1NVWQ 1FSFA 1L7DA 2AI2A 4OHFA 5JNSA 5A0FA 2VUIB 4DM7A 5CNJA 3U3ZA 1PV1A 2XYRA 5K09A 1WXGA 2MINA 3HACA 4MW1A 5AXAA 5HDQA 1LWNA 2YWXA 3CZ4A 3FMIA 5DYWA 5KAPA 3A58B 1P18A 1WUIS 3L18A 1DAOA 4IHJF 5CCDA 2KYRA 3WGKA 5K3AA 4HMQA 4ND3A 4N0EA 1PG0A 2V6FA 5EXDA 2V6MA 1H2AS 1KGDA 2XB8A 4YXWA 3RODA 3ONVA 3QKUA 1GVNB 3RYHA 4F6LA 2BD0A 2WF9A 2B0CA 3MTIA 3VO8A 4ENPA 3FUVA 4TVOA 4EPWA 3M4ZA 3QENA 2C5AA 4RF4A 3SLRA 2XKKA 3ICEA 1X1TA 2HF8A 3ZXXA 5C51B 4AWXA 3GLSA 1M75A 2ORED 1ESDA 4I50A 4B8YA 4B7ZA 5AI8A 3A3OA 3LH5A 3ZIAA 1L5GB 2TMYA 1RJWA 3B2QA 4WUTA 1H22A 2C3OA 1ZVJA 3VOAA 3L82B 4DMLA 1Y63A 1DRWA 2HUNA 3KVOA 4EEZA 5GJCA 2B94A 2GGSA 4A2QA 1T8WA 3LV8A 3DXFA 4K6HA 4MI1A 3GVIA 4JUFA 4MVJA 2WAMA 3MGCA 4UMFA 4AUEA 2WA2A 4IIDA 3AVUA 1SUEA 4MMZB 4YLEA 5EUCA 4DR1B 2WPDD 2DVMA 1HA3A 4UQPA 2XKBA 4ZTBA 2C57A 2P9JA 5E8RA 5JWHA 3HYSA 1UMDB 3OJLA 5AVQA 1X38A 1ML3A 3F5FA 2WYVA 1EVJA 2W2PA 1NW6A 4A5OA 2IIPA 1P1FA 5J59A 2ZI7A 4JR2A 4EMTA 3HVRA 3EPKA 1EK6A 3NBAA 3GAMA 2A0UA 1DKPA 3IP7A 5A4MS 1GAXA 1MGOA 3ZUPA 4D8VA 3HS3A 4INAA 2J46A 4UNNA 1M2JA 1H9AA 2PVPA 2VXOA 3PUIA 2WUVA 2QUJA 2PRJA 1VE6A 3GRZA 2PQ6A 1A5TA 3ZHYA 2WE8A 2X8JB 3H9GA 3HFGA 4UUMA 4EATA 1E32A 5I4BA 2B6HA 4MA5A 3UG6A 4M6WA 1A5AB 4AK9A 2CV1A 2PSJA 3HU1A 5A2QA 3O26A 4FFBA 3G13A 4BFCA 3UV7A 1I3NA 2IT1A 5C0OE 4GPBA 2DHCA 4JVOA 2P6OA 4DJTA 4DSOA 3V55A 1H1LB 4W99A 1M0EA 5JCOA 5ULLA 3R3ZA 3I45A 2QMQA 4GPTA 2CV0A 2QAGA 1E2NA 4KQ2A 1WUTA 2A0FA 1SY7A 1JDBC 4MJLA 3RS0A 2GCOA 2C20A 1Q0LA 2J4FA 5GV8A 4Q9JA 1U8YA 1UBNA 5KQSA 3U7GA 1Z5NA 5I6DA 1P6XA 1JIUA 4PIVA 4DCOA 1VYUA 3OQ1A 5EGNA 4A1OA 2C94A 2C2BA 4NULA 1JECA 3FCOA 4AS3A 4Y6LA 3AR2A 4YACA 2KLHA 4MVJH 2E55A 4EQ6B 2FQQA 2QNBA 2YWEA 4PSDA 2DFNA 2EX4A 5F12A 1OCEA 2CDCA 4MH0R 1ULTA 3T7DA 2P9CA 3FNEA 2VYNA 3P45A 1GZVA 1MRNA 2BEUB 3PC3A 4JJFA 2CXOA 2OGZA 4R68A 2YYAA 1PLJA 2RHJA 3S2GA 2WUEA 4TXJA 3U7EB 1O94D 3TX6A 3FPGA 5JHGB 1QPGA 4HPWA 2I78A 4RTQA 4AU1A 1U0TA 1SIOA 4GIBA 2BELA 4PPNA 2PUTA 3W1VA 5DW0A 2VLIA 1Z34A 1IM2A 3DE0X 3MF4A 3TS1A 3U6BA 1CDOA 4UVIA 4IUCS 1KBOA 3X1JA 5CB4F 4M21A 3FWNA 1U65A 2RJNA 3DBLA 4LJSA 4DLLA 1JTFA 2QRLA 2FFAA 4PAOA 3V6MA 2B4TO 1IXYA 5DX8A 2BFOA 2CK3D 4R9VA 5TQ2A 4YGXB 1GAQA 1DG1G 4MKGA 1P3DA 2ORVA 4OIMA 4YJKA 1U7TA 4XWAA 4LSMA 2X5NA 1RXUA 2NUAA 2RC6A 3K09C 3LSTA 5KDLA 3S2YA 1M10A 4C7BA 2WF8A 1ENOA 4KXYA 1CYDA 2E2WA 4MVJI 1N2OA 3EEYA 1V48A 1W9MA 3OFSA 1B1AA 3Q7PA 5KPDA 2I7DA 5BOSB 1N2JA 3DTVA 4WBNA 2ZUUA 2FSVC 4KVFA 4AG5A 3HU5A 1U9IA 3HKBA 4INZA 5C1PA 1ORIA 2FW1A 1NJSA 2GCEA 3ASVA 3PNBA 4G9EA 1E1RD 3ZDZB 4ENRA 5SICE 1YZYA 4MR9A 5EMKA 4BFLA 3CT4A 3OPNA 4UEWA 2XTMA 2VP9A 3FYTA 3HI4A 4FOOA 2ZRQA 3KQHA 3ESYA 4WY2A 4LHSA 4JT9A 2L82A 1W1WA 4NATA 4X54A 4OFBA 2YZ7A 3NBMA 1RW4A 1OXXK 1MB3A 4G0ZA 4TMYA 2FY8A 2PRYA 3QUBA 2R65A 2JGJA 5A7FA 4KJXA 3QKIA 4JJZA 4CLRB 4DV4B 5H16A 4R8SA 1H8HD 1K6XA 2OOSA 3GO4A 3ABQB 3G9TA 3VPXA 2O59A 3T94A 4XFDA 2DF8A 4EPYA 4YJHA 3SIXA 2XD4A 3LBNA 3NTLA 3T38A 1FP7A 2QRVA 3AL2A 3FCEA 1KZYC 1XXHB 1E5DA 3EF1A 3I4CA 3KSAC 1ZMXA 4ZVKA 4F3KA 3FIUA 1I4WA 3G7NA 2EAUA 1VMAA 1EFVA 2OM6A 1KMCA 2C8JA 1EJBA 2NO6A 3I2FA 3KUCA 5K99A 3RR2A 2DLDA 2Y93A 1WMSA 4M53A 4CMGA 1IBCA 3PNKA 4KL8S 4U2BA 1DUVG 3PPVA 3OLZA 3RSSA 4P9NA 3HVJA 5KTOA 2WU8A 3C3XA 1TO2E 4JQYA 1Y3IA 2D3WA 2FSGA 2RKOA 1HNNA 4A3SA 1HZJA 3C3AA 3O8NA 4LMRA 1MQ8B 1L5YA 3T1YB 1HM5A 3RK4A 2I3ZA 1L8AA 4BMPB 2O05A 1ZHOA 4PRZA 1IUPA 3LRXA 3ZEIA 1R9NA 2HV9A 4I4NA 4UQOA 3RADC 1AKEA 4KQFA 5DHFA 1K6JA 1O77A 3NRJA 4MGHA 2W43A 1FYWA 3HADA 1GGHA 2HUPA 5F7JA 3RKRA 5AESA 2DCMA 3MS2A 5DNYB 1DWQA 1XZKA 1SBCA 2Q3JA 4O4IB 1U3CA 4MW0A 5J5AA 2YNMA 1NBAA 4XXHA 5CH3A 1E1NA 2C78A 5K5EA 5KIAA 1XPUA 1T5IA 4N8DA 4F12A 4QEZA 1OWNA 2JHAA 1L9XA 3ESCA 3QOXA 2ZS7A 2R00C 3NV9A 3OIYA 3SOZA 1JDVA 2WTUA 4OI0A 1PNRA 1HI9A 3SX0A 2CJWA 4P7GA 2BBWA 3I5XA 3MWKA 4HJXA 4OIFA 3D7KA 3F97A 4GSLA 2BMEA 1DGQA 5FCDA 5C8YB 1GD1O 2X4LA 3H5AA 4TZ6A 1QM5A 4BU1A 3MT0A 1A7JA 1TZKA 2WILA 3K7EA 4P3YA 3L4EA 4Q3CA 1RM5A 5TQVA 3SY8A 3PGXA 3IAHA 1OGYA 4ZT3A 1NBMD 2O3TA 4YRMA 3A0UA 2B5VA 3QJYA 4QUIA 3BDVA 1BVHA 1N1MA 3MCVA 2XUOA 1PJ4A 1RIFA 4BFSA 2GETA 1QCDA 4QBKA 5AKEA 2O8CB 4DL9A 4HQOA 4NBLA 3K0EA 1P60A 5E7JA 4IDEA 1M7HA 1L7BA 4U9UA 1S4QA 2GT1A 2VP2A 4G24A 4M4SA 2B2CA 1V43A 5K8CA 1L7NA 1R4MB 5ETJA 4C2AA 4UTPA 3K0SA 2N47A 3TEFA 4DYVA 1D2AA 3VNRA 2HTFA 4LGMA 2CLCX 4EPVA 1ZGCA 5D85A 4EKEA 1DC8A 5CM9C 4ZYXA 3G0OA 2ZAMA 3PYXA 5CGQB 4YT4A 3P9RA 3VISA 4RTMA 1W85A 3N7TA 2QD1A 3O4HA 4R01A 1LA2A 2GRJA 4K05A 3W6NA 2G04A 1YA6A 3I6BA 1EGQA 2PX4A 3B9RA 1Z26A 1Y1QA 1Z5OA 1QTRA 1X7WA 4YP0A 4DDWA 1J1IA 2NU6A 1JEAA 4DQXA 4XWWA 3DBVO 3MHPA 2RKWA 2XA2A 1SG6A 5LA6A 4BMSA 1MX3A 2QBYA 1WEKA 1E99A 3O95A 4L15A 4IYRA 1VPVA 2GZ3A 2IEYA 3OQBA 3HGTA 1GA1A 5JQGB 1BE6A 1FFAA 2BGTA 3O03A 2H5EA 3PDHA 4HL6A 3IV7A 1KYWA 1TXGA 4Z7JA 1FDUA 2Q49A 1XROA 2VUSA 4XCQA 3X1ZA 2IP2A 2Q9BA 4G5SA 2EV9A 1D6JA 1R6DA 3X1DA 1RZVA 1WA5A 3N0XA 5CT9A 1Y6ZA 3RTEA 3WX0A 1Q7EA 2HPAA 1OWLA 1IOLA 3L9WA 5CHYA 5G4KA 4TRMA 3GCZA 3V4VB 2XB2A 4KQ6A 4XTCS 5GVSA 3OE7D 5K9ZA 1EKXA 1QQ7A 2W5UA 3N6RA 1WP4A 1CRQA 4UBNA 4JIMA 5IHPA 2IW1A 5KJEA 1C29B 3RI3A 3QOYA 2GM3A 2ONKA 4MQEA 1ZH4A 2PH5A 1JB1A 2QL5A 2RHCA 2ET6A 2RJOA 1L5KA 4BN5A 3MOGA 4C0SA 4LJYA 5E38A 2CLDX 3ZYCA 2A7XA 4G8BA 1T2NA 2VJOA 2CDRA 4XWGA 1UR5A 1J9ZA 2OO5C 1NJGA 1TUIA 1WSAA 1VJGA 2EYQA 3ROXA 4ZKEA 1V71A 5BW5A 5M2QA 3FPJA 3UB4A 1MA3A 3SE7A 1F5NA 2I65A 5EIAA 4B1FA 4FN4A 4MYHA 4WECA 5BW4A 2Q1WA 3SZMA 1QS0B 2PCJA 2FOLA 5A9RA 1E9VA 5J1SB 1Y6QA 1RZRD 3H0EA 1ZG3A 5K3FB 3IAM6 4R7TA 3GJSA 2VVTA 2C2HA 1UBFA 3OLYA 4BO5A 1BDMA 4MXDA 4D42A 1I6WA 1RQLA 2I3BA 2HNAA 3OBIA 2FJ0A 4L5CA 1LJUA 1Y8CA 2PLAA 1KDOA 2CMHA 4R9NA 3TRJA 4RKFA 1Z07A 4LZOA 4OK3A 4ZU3A 4DCJA 4ZVPA 5TPWB 1IZ8A 2I8AA 2CNWA 3CHYA 4Y8VA 5ISMA 3RSFA 4J0EA 4U63A 2Z5GA 3ED5A 3BE6A 3OWXA 4JKIA 3V4ZA 3AR6A 4OXRA 1E2KA 5HJ7A 5KNBA 2AJLI 3AZPA 1VKZA 2OT3B 1QO0D 3V00A 1C9YA 5ALSA 4ZVNA 3TOZA 3TRHA 4BMZA 4ZMRA 1KL7A 4LSZA 3ORHA 5JMTA 1RHUA 2JK1A 4P1ZA 1U0RA 1CLEA 3G82C 3HUFA 3S29A 1IATA 2ZUCA 4B7UA 3M3PA 1QIIA 1HQDA 2I4LA 2ZROA 4M1ZA 4IDPA 3B51X 4LI3X 5JXWA 2PH3A 4P80A 1WVMA 4ID3A 2GBCA 3AL3A 3D3NA 3NGXA 2EFDB 4RZQA 4EB6B 4OLFA 1LRLA 1OBFO 2LRHA 2JGDA 4K0KB 3V34A 1R0CA 1QP8A 4G09A 2EOAA 3ADDA 3KR9A 1JHZA 3VSAA 3S3TA 4AYTA 4EX6A 3EXHA 3X2EA 5LLDA 1XTZA 5JS8A 4ZTUB 1KI8A 3IBCA 5DB4A 1RAAA 5TF0A 3FPCA 3EVEA 4WKPA 1C2TA 4BCDA 2VDUE 1UOEA 2DE0X 5CDGA 2F8LA 1XVLA 3VZRA 2BJVA 1LZLA 1K8YB 3MXTA 5DT2A 4QNRA 3TPFA 5AW2A 3JCZA 1CZKA 1I2MA 2NADA 4NL4H 1V5WA 5G02A 3OZGA 5DM60 2QM3A 4B09A 2C5SA 1II8A 3EZFA 3OO1A 2ZWOA 4F9GA 1QRUA 3FJ1A 3UG7A 3GA7A 1MDFA 1FX1A 4TM7A 5FWXB 5G0UA 3TW4A 1YZVA 1DCFA 1O97D 1W49A 3F5SA 4BC0A 3ZVMA 3EWIA 1N2CA 2E48A 1MJ5A 1G8AA 2P5SA 3QYFA 4IIUA 4EMSA 4UAJA 4YJ3B 4O5AA 4NBUA 4JI2B 5KWVA 1I3KA 3D4PA 4FK8A 2PWYA 3VKHA 2CB0A 2F8MA 3O1LA 3CY6A 4PG4A 3S8MA 1F8FA 1HYGA 4C7XA 4NDZA 1AO3A 4P92A 5BNZA 4Z4EA 3ESRA 3KU1A 4MPPA 3F71A 4Z9XA 2WY2D 4HH3C 5AJZA 5DU2A 1XV5A 2JBWA 3V1UA 1YR1A 2BF7A 2D0OB 3QU5A 4GR4A 5B1DA 1M1YB 1SB8A 3A1DA 3TQTA 1DS6A 3KJHA 1XO1A 3UMJA 5HMLA 3TZCA 4JLPA 1A88A 1Y4AE 2ZYIA 3O7MA 4IO0A 5NULA 3EDMA 1H9CA 4FX5A 5EESA 3GGJA 4Z8XA 5JFTA 3FYHA 2YX1A 3O5AA 1I4OA 4RMGA 2OK8A 3VV2A 4JI3B 1L1FA 1NF9A 1BXRA 3QVTA 3S99A 3IA2A 3OZRA 4TQUS 2YASA 4BLVA 4G5OA 1Z62A 3L8FA 3H9QA 4BLUA 4XGQA 2NQ2C 3HPRA 4MUHA 1BXZA 2HMAA 3IMKA 1GRRA 3ONFA 1RZ3A 5H82A 5IF9A 1GADO 1US8A 4WZAE 2A14A 4X95A 3ZV6A 3GN2A 4LZAA 4BP3A 1LTKA 1OFIA 3G49A 4KLNA 4ALLA 2EWMA 2H5JA 3B5EA 2IVZA 2D1FA 1OXTA 1TI7A 2JLSA 2IUTA 1BWPA 2HKIA 3TN7A 1Z2PX 4BGIA 2CJPA 3D1LA 3SQLA 3WR5A 3JYHA 4KRGA 1PV4A 4RPLA 2AD5A 1TCAA 3AYXB 3Q8MA 1FXWA 1U7DA 5GGXA 1VDZA 2QRHA 4V0RA 4IQFA 1HH4A 4MX8A 2X0KA 1XLTA 2QZ4A 4RKEA 3OP4A 1E1LA 1S8AA 1YASA 4L75A 4O4HF 5A9SB 2HJGA 3K9HA 4IIEA 1N34B 2MSDB 3E4CA 4RTNA 2PUDA 1RAIA 3QV2A 3O21A 1K9VF 1XA4A 2YZNA 4D9IA 1DJMA 4NJEA 4YH1A 3U44B 4RVUA 2O23A 3DAFA 3NBYC 4PU0A 1KIFA 3VDNB 1F4PA 2HM7A 3B3FA 1FDOA 5JADA 3UMCA 4LCBA 4YQYA 5BO5A 2RHBA 1OI4A 3I2KA 3R8FA 4OI2A 1M3SA 3EPJA 2YN4A 1XVVA 4BJ6A 2R25B 4AJEA 4IXMA 1G5PA 4YCNA 5DTRA 1ESMA 2PBRA 2EZ9A 3I92A 2C2XA 2D8AA 2IF0A 3HHEA 4B3RB 1WCV1 3RBXA 1IFXA 2BFDB 3EISA 5JAQA 2FPGB 4CKBB 4DKXA 1C9NA 1GAEO 4DR2B 1MJGA 2NO5A 3IBGA 1RE0A 1OA0A 4R9UC 5DN6D 1U7ZA 1RQGA 3OTHA 3MTAA 4UFNA 2OPBA 2YRXA 2R6HA 1UBTS 3GY0A 2BVNA 4QC2A 1JWLA 4HYEA 1DBVO 1PBTA 4P93A 4AYWA 2XWSA 1FMLA 4FM9A 3MTJA 2YS6A 1M1UA 5JTUA 2ENUA 1K7CA 1KDYA 3ORQA 4CCYB 4ENUA 1T2DA 3EZ7A 4BQNA 4C7OA 1YA4A 5JJLA 4WWHA 1RC8A 4MV6A 3BICA 3CYFA 3OIWA 1P9OA 4BNUA 4HVLA 2WTMA 4K9SA 4C6TB 2G40A 2CMFA 2CXTA 3A11A 3QIAA 2R8ZA 3SI7A 2XMBA 2OCXA 4WKOA 4ND8A 2P1ZA 3A28A 4FMPA 4INPA 3NJ4A 5DV9A 3DT8A 5BQPA 1UWKA 1YDGA 1S2NA 2PQ2A 3HBFA 3AFMA 4WFQA 3TQHA 4RZ3A 4C4SA 4QLBA 2Y66A 4RCVA 4G37A 2OHVA 3G8YA 1WE2A 4HLUA 5E4YA 1CQIA 2Z09A 3RYFB 1B4DA 4L5IA 3GQBB 2O8EB 1VPDA 1JR6A 3OCWA 2RHWA 4B3SB 4HT3B 4G5FA 1RYMA 2AUMA 6Q21A 1II0A 3DD1A 3KCQA 4AT1A 4ZEVA 4XLLA 7MHTA 1MN6A 4HVAA 6AT1A 5CNKA 3GPDG 3K94A 2EEPA 2LW7A 3LUAA 4ZAGA 1SQFA 5T6MA 5JAIA 3OCUA 1QE0A 1W47A 1WXFA 4MARA 2AWOA 2I7TA 4B48A 2FQXA 5E6SA 1PDVA 4C2UA 2WFMA 1IQPA 3GPIA 1SCAA 4Q48A 4Y1FA 3TLCA 2XECA 3CR8A 1K3FA 2RBEA 2FJPA 3U7JA 3ZOKA 1GKYA 1YTLA 5KWJA 2QM0A 3ZBTA 4BNYA 1E1CA 2WP0A 1PJCA 4QQFA 4UPVA 4HBGA 3FIJA 3KJXA 4REQB 4CT0A 3C98A 2YKGA 4ZALA 3OQNA 1F0PA 2VWQA 1E8NA 3QKRB 1NOKA 3FGOA 4B87A 4C1BA 1I5RA 2AEMA 2WIDA 4Z49A 2XNCA 1VJ5A 3E22B 1MNAA 2OKCA 3CU5A 3HJHA 1KZGB 3ND9A 4D8YA 2X5OA 3HY4A 3SR3A 4CM1A 4DSAA 2C2KA 2R5NA 2PLWA 2KBFA 3Q5GA 5K8IA 2Q1SA 3EXIB 4ZOBA 1V1RB 5JR3A 2MSEB 5HW0A 5ICFA 5FPYA 1SCDA 2H1OA 3CLVA 3UAWA 2XUFA 4MRPA 1YNSA 2QN2A 4YMLA 5KTNA 1KRWA 3IIKA 2OBLA 4J2HA 4B7CA 2WJPA 4QQ8A 3LY7A 4JEIA 2ZZMA 4YRKA 1W0KA 3D2AA 1M9NA 1V16B 3DL0A 2FPMA 4E70A 5SY9A 4DUYB 1BEZA 4CF6A 1F7VA 1PG5A 2OXRA 2VIIA 4OMDA 3I61A 1GRVA 1GFSA 2AN1A 3GMTA 2VI5A 4O1IA 3SVTA 5LMUB 4DEXA 5KYYB 3IX7A 2BAGA 2IIBA 1M6VA 2REOA 3COVA 3SU8A 3W34A 5BN1A 1ZH6A 2W6JD 2P69A 5L7WA 4GLJA 3BGDA 4R6XA 4PLFA 4QBGB 2IYVA 4LK3A 1JA9A 4PBTA 3TMYA 1IN5A 3DMGA 4EY8A 1PSWA 1Y37A 5KSOA 3X1WA 4X93A 3V32A 2FA9A 3LYHA 5CB6A 3T5GA 3A2LA 1DJOA 3FNRA 5BQ5A 1YVEI 3LAWA 2RMKA 5EIOA 1I8TA 4F8YA 4RVNA 3THYA 1JFVA 1G55A 2C9MA 5FOUA 3EZXA 2O2GA 3ZIUA 2ETVA 2H1FA 2DTDA 4ENSA 1G9XA 3SBDA 1PJTA 3PHBE 4LXIA 2FEOA 2GPNA 1XT6A 4EKYA 2BL4A 2W2LA 3MCZA 1K1EA 2XI4A 4BB9A 3D7LA 1JJAA 5I3CA 4RIEA 3ZWVA 3T1QA 1Q11A 3CF4A 3PQEA 3T5TA 3EEIA 1OSNA 4LJ6A 1NP3A 4JFRA 3NPMA 3NH9A 4I55B 4KYIB 3I2IA 1U1EA 1DC6A 1N6KA 3QFRA 5CA0F 3UK1A 4EEKA 4L9WA 2VR1A 4E46A 1ZMBA 3M81A 4XB2A 4X62B 4R9RA 3K9FC 1HNZB 2HHAA 3M7IA 4FKZA 4PCUA 2JCGA 2WB4A 1XCLA 3IHTA 3AVQA 1XYYA 2D2FA 2X5KO 3OQIB 1OV4A 2C9CA 1UPAA 2QGNA 3LVQE 4B3BA 3VBEA 3H18A 3IVAA 4REOA 1VG8A 3STXA 4CMJA 3EFOA 4XUDA 4YQEA 2VKQA 1BD3A 2GZRA 1N3BA 2W90A 3M6MD 4Q4JA 3KSRA 3A6KA 2DRIA 3PX7A 2BHRA 4KIFA 5DXFA 3JR3A 1E3TA 3L43A 4FJ1A 2QD2A 1I6MA 3IV9A 1AT1A 1K2VN 1X92A 2NAFA 2Q2NA 4HO1X 4BMDA 2BTQA 3VPCA 1F2TA 4D4LA 1Y5LA 3AQ4A 4LG1A 2R86A 2BOVA 4XPIB 1SG9A 3PP8A 4I1YA 3UC5A 5B12A 2VHVA 3EAFA 3P52A 3RT7A 1GZHB 4Q05A 4UEKA 1JDZA 2FU5C 4Q1CA 3C1TA 2GAOA 1UBMS 2OO7A 1VJCA 3CEPB 4OUDA 4X24A 1JNYA 4E5UA 5I9IA 5DM1A 4IF4A 5J4HA 4TTQA 2O3JA 4ZQHA 4B83A 5BSFA 2JD1A 1WQ4A 4QG7A 3JYPA 4ZDWA 1CY4A 2Y0CA 4NYIR 5AKLA 4NPHA 3LDUA 4JBIA 2YUIA 3VKUA 4H7PA 1JMVA 4D7AA 1I33A 4QRDA 1A9OA 3PC7A 2PN1A 3Q8LA 5ILGA 1YCFA 4F6RB 5IJ9B 1FDIA 4CTJA 1AS2A 2J3DA 2DFTA 1EFPA 2PZBA 4TGLA 4ZVQA 4A8JC 4E7PA 1YJQA 4ZQGA 5B37A 4ZQEA 1TEVA 5PGMA 1N33B 3A6EA 1G4AE 3RRFA 3UAYA 621PA 2NO4A 5IJZA 4AJNA 3HRKA 1RTKA 3CNQS 2IDKA 3GUCA 2CW5A 4O25A 4TTIA 2C7PA 5DCWA 4B81A 1X7XB 3JALB 3PUVA 1ULBA 4YYEA 3CEAA 1O6CA 3PDWA 3A9VA 4ZEWA 1U90A 4LOAA 4KP7A 1BC5A 2PS0A 3P9YA 3KYBA 2VJNA 1L7OA 1PR4A 3PFFA 1QPZA 1G8MA 1KP9A 4BRZA 4CGZA 1NUUA 2HSDA 5KS2A 1R4AA 1IUKA 4O63O 1OLSB 4KXVA 4L57A 3ZWWA 1IY8A 3Q2IA 2M98A 4LHYA 4C7KA 5JU6A 4AMBA 3OPYA 1WWKA 2BONA 1SKYB 2IYFA 2NYRA 3HDGA 2ISQA 4OHMA 4HQLA 3GA0A 1KNQA 4NG4A 3G2PA 1O95A 2X3FA 2F1IA 2DWQA 4OHWA 1MRZA 4KQGA 1AOXA 1P45A 1N7HA 2GAJA 3EASA 3JSAA 4K6KA 4QREA 4C76A 2I6FA 4UARA 2R5WA 2WM3A 1X13A 3CUWA 9GPBA 2DQKA 1E3WB 2Q6OA 1NJ1A 3KOXA 4YUWA 1CF9A 3C45A 3H7IA 3M5CA 2ZLBA 5GAJA 2IPAB 4ES6A 3Q1LA 3L6DA 4L3WA 3VRHA 1GEEA 4Z7QB 5FKJA 1FZQA 1Y4ZA 2I6QA 4JB0A 4EZBA 5LU9A 2EW8A 5JPIA 3HBNA 1DC4A 3MJHA 3NWBA 5J4KA 1M54A 3HUEA 3IS3A 1WUKS 3VJLA 1NVKA 3FZYA 3RD5A 4FFOA 3VU1A 3E3OA 4PNPA 4OGKA 4QWWA 1XRPA 4CXMA 3TH5A 1LC0A 2Z56A 4U7FA 2G17A 3C6MA 4E1AA 1SAYA 3FYUB 1WZUA 4LRQA 1DDIA 1AKMA 1N6PA 4ACBA 2ILTA 4M37A 4Q9LA 5DHUA 4RJJA 1D2NA 2CLIB 3DW1X 3N9IA 1OC4A 4RPKA 4XRGA 4C89A 1OFTA 2UVPB 2V98A 2Y0PA 4DVJA 4JENA 1RC1A 1UC8A 2VZEA 1O89A 3REOA 3U3KA 2I2CA 2PGLA 2X1VA 3TO5A 3OQPA 3PDCA 2UZ0A 1HT2E 5FP0A 2QMUA 5GJVC 4CTOA 1UKEA 1H5UA 2INGX 1EU1A 3AM3A 3Q72A 4YCJA 1ZKMA 5E4TA 3WO1A 3LPNA 3ZDYB 3AHDA 4RSGA 3TSZA 3VR5A 4C06A 3DXZA 1Z22A 3IMGA 2ZWMA 3NOOA 2IE8A 2PD6A 5E6UB 1J42A 2OZVA 3KDAA 3TXYA 3WGTA 1J97A 2HA3A 3W9BA 1MT3A 1Y1RA 4AN1A 2J0SA 1MIOB 1H0KA 1VE5A 4TV9F 2JD2A 4BZPA 4X64B 4C3UA 4AKHA 4BVFA 3TLAA 4GWKA 3ETGA 1SKMA 1VYHA 1V3VA 3CINA 1VJDA 2EX0A 3SG0A 1QVZA 2A9QA 4H7DA 1WDKA 2PGXA 3KAQA 4WK2B 1I9GA 3TTWA 1TUBA 4TV8F 1CRWG 2Y0BA 3D3WB 3MWJA 3TINA 3PD7A 2OVFA 1L7EA 4JJ8A 4OJQA 4C04A 2C5EA 2P4UA 3HGQA 1KA9H 3PEYA 2FWJA 2GBLC 2XR1A 2V7TA 2BP7A 3I1FA 3LOQA 2GPYA 3O2SB 2JLXA 2XUGA 3KZCA 3JRWA 5EWMB 3ZJ5A 3L1VA 5F73A 4OLJA 5LXTA 5K01A 1DG3A 1WQ1R 3BBPA 2NXEA 3GB9A 4N5DA 3UHFA 4C2TA 2H07A 3WWPA 1ZUHA 1QH8B 4RJLA 5BR1A 3DZCA 5SYMA 3HXMA 1VHQA 2FSHA 2HQBA 3ZV3A 4X8OA 5FFNA 1JPJA 3KEMA 2CUNA 4WX2B 1P1KA 4QA9A 3WQSB 4X0EA 4PBRA 2KBEA 3LLCA 3OPYI 4D82A 1E9AA 1NYTA 1EAMA 4HAUA 4EHJA 5IUJC 4WASA 2VQEB 3W6OA 5IT9A 2N75A 1XRSB 4WJZA 3AEQB 5ITZA 5JTTA 5FPSA 2F9LA 3SC3A 3BK7A 2MYPA 3VR5H 4L02A 4DJ5X 3G5LA 3T34A 3GRKA 3ZVLA 1XA0A 4NU6A 3NKVA 4Q3LA 2E4YA 4DIMA 2JFHA 3TSYA 1KR2A 3MSCA 2ZIVB 3MTBA 3GVXA 2WAXA 1G8GA 3V46A 5A6SA 3NYQA 4MR8A 3V7WA 1XD9A 3NTOA 3N0VA 3UN1A 4YX9A 1NVTA 4KTTE 4DMHA 4M9ZA 5FD8A 2ADFA 2B69A 2RHHA 3U4AA 1Z82A 4OJKA 2VA8A 5ERXA 1DO0A 4W5RA 2W6CX 3DFUA 4HGPA 3H1BA 1T5OA 5D3MA 1X80B 3N6VA 4FGLA 4PHHA 3KT8A 5AH0A 2IU0A 5K0TA 1KOGA 2ID9A 2OZLB 1MRSA 4RFSA 3UMFA 3PJGA 2RK3A 5AVTA 4LX0A 1DKQA 2VJAA 1CZRA 4C43A 2HHJA 1P2BA 3NORA 2R751 2XUDA 3Q41A 1G8PA 4RZHA 1W2WB 3HFJA 2VDWA 3ZR4B 3H1FA 2EP5A 3KQUA 4YO8A 3QF4B 1R0ZA 5KYUB 2EW2A 1L9KA 2ZZNA 1QO9A 3NEYA 1UOOA 3BT7A 3TZKA 1SU4A 1WUYA 4UULA 5T4EA 4B35A 5CA1F 2W83A 3RB8A 1D2MA 3LWZA 3VHLB 3ICQB 4AF8A 2XNDA 4Q3KA 2NUTA 2C5HA 2VH1A 3WBKA 4CRWB 2JLRA 4L6IA 1SKQA 5EJ8A 1OKKA 3WLKX 4NC9A 2BFWA 2SNIE 3OPMA 3GMIA 1ZNQO 1MF7A 2PJRA 1F9AA 5IAAA 4URHA 1R6BX 2BFPA 1K4YA 4RPCA 3QE4A 2J5RA 3VR0A 1P5HA 4XVUA 4GKJB 3OEEA 4LVNA 3NG1A 4CLXA 2RHLA 2YYYA 3H5VA 2GVZC 4ZHQA 4D8UA 1KS9A 4I1IA 2UUCB 3RANA 2ZFUA 3AEYA 3DYIA 1FDRA 1K7YA 4G6ZA 4S2UA 5CURA 4OHVA 2VSQA 1DBQA 3AU9A 3MJFA 4GYWA 3PEUA 3L06A 5FLEX 3RYTC 5L9AA 3REQB 5D3QA 3BAFA 4LC0A 4QO7A 2Y99A 1DKUA 3P4YA 4IIYA 3K1AA 5FNZA 3R8XA 3ZWYA 4CLEA 5C32A 1B2RA 4FGUA 1N0HA 4RMNA 1NBOA 4WCFB 4ZC8A 2OB1A 3CJTA 4MWCA 3WLIA 4OHOA 5AKGA 2HWWA 2XQVA 3BMQA 4DM4A 2JLWA 1CR1A 2WUWE 4O2BB 1IIRA 5JUWA 2JAPA 4WZAA 4EL5A 1FBTA 4XARA 3W0LB 1PTKA 3PYLA 5GZ3A 3K71B 4YP5A 1XHLA 4D25A 4MV7A 1KTIA 4WJLA 2OCGA 2QYOA 3SCZA 1AUXA 3IT2A 2NX2A 5CITA 2DPXA 4DREA 1DQRA 1CJMA 2IU4A 4RQAA 4RWEA 2C7RA 1PL7A 1Q6ZA 3JWPA 1Y98A 1JQKA 4N18A 3E5HA 5EMLA 3V2UA 3HKCB 3RRXA 3PNLA 1TM4E 2A4KA 4L8VA 1TZCA 2QG4A 2X6TA 3DP9A 4M46A 2L0XA 3IRUA 5EE9A 3Q3HA 4F91B 1CBUA 2HBYA 1JKMA 3ENKA 4D0SA 4U00A 1KKMA 1DQSA 4IYJA 1IEVA 1T9HA 4PO9A 5JS7A 2GPWA 3BXOA 4RIIA 4CPDA 5KNCD 3U4QA 1R50A 2PHZA 4AUNA 1SBIA 5C53B 3L6CA 3I9FA 4KGDA 4MYSA 4LVOA 2HYDA 2XCIA 3L4BA 2FXIA 5B1HA 1X8LA 1WDWB 4G9GA 1S2DA 1SU7A 5AM1A 2FKAA 3LZDA 3RRJA 3FFAA 3OLCX 2FPOA 4Q1BA 1XQ1A 4PAQA 1XKTA 3WTCA 4NE2A 3UT0A 1U9ZA 4BAZA 2HBZA 1VBMA 4OPMA 4HXYA 3OIGA 5JDCC 2PKYX 1JIKA 4ZRNA 2GA8A 3RRZA 2J45A 3OG9A 4MQ6A 2GLXA 4KE8A 1LTHR 2NXJA 3GV0A 1AD2A 3SVLA 3UKOA 1VHLA 3HYNA 3NIGB 4AI6A 2Z6AA 1EEXB 1PR0A 1H23A 4HC4A 4ND7A 1TM5E 2Z9CA 1NPDA 3PPIA 1NYQA 4GSYA 5IM5A 5JD3A 4BOYA 4HQKA 3C39A 1PL6A 2J7PA 3RS2A 3L8GA 3NUQA 1OTYA 5E8JA 2F43B 2EJCA 4L4SA 3IVRA 2BFAA 2WYHA 3TZLA 2W6IA 1U0LA 3GFVA 5FRDA 3R9WA 3DV0B 5IARA 5IFKA 1PGJA 2YVQA 1YV9A 2IWRA 2FUEA 4YAOA 3GT3A 4N6OA 3A1VA 1WOMA 4XDZA 2CFIA 4RF2A 3IUJA 1LPBB 1L5ZA 4J3NA 1X15A 1X1EA 1R9GA 4GICA 1D6SA 4LHXA 4J0FA 4E88A 4DCPA 3ZI7A 1D07A 3SDSA 4GKBA 5HUHA 1E94E 4OGGA 1LQUA 1RKUA 4WUVA 1U3GA 4I99A 3RIEA 1HE4A 3KL4A 4XFKA 4DLVA 4QYTA 1GDTA 4EABA 4B5KA 3HNOA 1KI4A 3UEOA 1REQA 2OXFA 3D8SA 3TLKA 2G9ZA 2H4JA 5EHGA 5B1YA 2BM0A 2Q41A 4ZOAA 2C4WA 5HUJA 4Z4GA 3JQQA 5J63A 1CB0A 4Y2SA 4MNTA 1V2GA 5I7EA 1OGJA 3G68A 1K6MA 1G6Q1 2YN0A 1GXSB 1XNRB 1DHRA 2BBSA 1SBTA 1XP8A 1XXHE 2A0KA 3X3HA 3AETA 1BKSB 1UH5A 2BKAA 3Q7SA 3CN9A 4JBHA 5DNWA 3ETDA 2AXQA 2QVCA 4KRXA 1T8UA 1CWUA 2IYNA 4K6FA 2ZSIA 4UHHA 4ZOLA 4B8WA 4EA8A 2ABWA 4O2AA 3NYRA 1J25A 4TLLB 4ZDKA 1ZGAA 2HN9A 1PGQA 2VSFA 2Y1WA 3GVCA 2BGWA 4RJIA 4MRMA 1KERA 5ADVA 1UAYA 3HJFA 2PMBA 2JLBA 2XUAA 5DHTA 5TSDA 3OH8A 1KF0A 4JLSA 4D97A 4GX2A 5CLIA 2BHNA 3MWFA 3W5UA 2VRBA 4IWYA 3S1LA 4JVSB 4PR0A 1KEWA 1XLUA 1Q95A 1DG9A 2H06A 3H17A 1P0IA 1AKVA 2O8BB 2PGAA 5IVDA 1D1PA 1ES9A 1PGPA 1QFSA 4BQFA 5JH7F 1BCSA 1KXJA 3PR3A 2BGKA 4EPRA 5TNXA 5JAHA 1PT7A 5KKCA 3PLRA 4RKRA 5EPOA 3QEBZ 5KX5A 1E4YA 3LVFO 4PZ9A 1NHWA 2C4VA 2G0TA 5D5PA 3GU3A 4IIFA 3FSJX 5L7YA 2VTVA 5EIBD 3L84A 3A1FA 3QFCA 1KMIY 3OY7A 4L5BA 3C6XA 4EBBA 4F71A 3QXSA 3ZTWA 1CUSA 3PXCX 1E0AA 3N59A 5DGIA 3R9XB 4I19A 2OL4A 3GNTA 4ETMA 5CVCA 1EBUA 3PPXA 2I2DA 2BZGA 2RKBA 5IJ0B 3ZCPA 4D4JA 1FRFS 1QX4A 5E7IA 1OZGA 4B0PA 4BBJA 3JQGB 4RY9A 1QFMA 1WSDA 1V8BA 2G7ZA 2QB5A 2L2QA 2W6MA 3RC1A 4BO3A 4DA0A 4F06A 2BRUC 3M6WA 4L95C 1YVPA 1B43A 4KGXA 4TSFA 5EIXA 3DQPA 2ZJ2A 1NMQA 1RT9A 3AVPA 3WP1B 1ZAYA 5TXGA 4BTEA 4DT1A 1NVXQ 3LP5A 4M98A 4DV6B 1SOAA 3R7FA 2AC4A 4CBVA 1YH3A 4WQMA 3BSYA 1EZ4A 1E1YA 3E6AA 4TTTS 4J75A 4UHFA 1MABB 5T64A 1BQ4A 4FUQA 3TDKA 3ZZNA 2ZAOA 3ZX4A 3EZ6A 4HEQA 2XE7A 2E5LB 5IAJA 2MU1A 3MINA 1IWBB 3H0KA 2C3YA 3BERA 3HRIA 4BCCA 2ETXA 5HWSA 3RAFC 4E31A 5IUNC 2Q50A 3FWKA 1O96B 4UJ5A 4DWJA 3OZTA 1XMPA 1J06A 1OIWA 2VSNA 5LBTA 5T4FA 3UMGA 3E70C 2FPRA 4EJSA 4JKOA 3IALA 1GYPA 3GJTA 4TLBA 2FMUA 5DOVA 2CVOA 2RHRA 3J81k 1FFEA 1E0JA 2AUNA 2IYQA 4LYAA 4TMKA 4NAUA 3RSCA 3IVXA 2E5FA 16PKA 2HRBA 2G83A 3R5HA 1XTJA 3R3HA 2H17A 9LDBA 4BV9A 1B93A 1NATA 4HZGA 1E4EA 1A50B 1PZGA 1ZN2A 1PNTA 2HO5A 2V58A 2ZB2A 3BQNB 3VVMA 1UWVA 3EIWA 1Q1ZA 1NMEA 4YREA 4IZOA 1BDHA 1QTIA 4ZYUA 1ABFA 1P1JA 3URKA 2DAPA 2CNKA 3DONA 1ZYUA 4Q7KA 3WICA 1I0LA 1DKLA 1NRWA 2QTLA 4K9PA 1EDBA 1UANA 3EZLA 4YRJA 1PDWA 1K7SN 2BEVA 2MHCA 4UPDA 1I9CA 2QX6A 3JWEA 4FC6A 3VSDA 1QH0A 1ZN7A 4EX7A 4HI0E 1EXDA 2Q5JA 3U1BA 8ATCA 4DWOA 3PU6A 2A6PA 3EEQA 5JC1A 4LFBB 1XQXA 3NUGA 4LE1A 3LTNC 1R18A 5HOQA 1IJBA 4WADA 3UXYA 1TK2A 3VC2A 4X41A 4EGFA 3VVBA 1KMNA 1T9BA 4OP2A 1XKQA 2PX8A 3PC4A 2QW8A 4BB5A 1JFFA 3IILA 4DQLA 1AN9A 3B1JA 4Y2YA 1EGAA 1T4GA 1JEQB 2BJWA 5GONB 4EOGA 1RSZA 3RUDA 4DILA 3DWEX 1QP4A 1M33A 2G3YA 2OC9A 4FYKA 1POWA 4FYIA 4Y1RB 3T5CA 3WGJA 3TECE 5CLGA 5F77A 3HMKA 5IK2A 4BX9A 1Z15A 1LPOA 2D1SA 1GCIA 1H4QA 2NMVA 5B7NA 5J4VA 2FFBA 4B40A 2CLEB 3O92A 4N7MA 1YBAA 1YE8A 4XGKA 4LZJA 1FOEB 2WR8A 3GHYA 2VYVA 3D1JA 3R4VA 5JNTA 2AN5A 1QTQA 4GOXA 1QIJA 4W9RA 1W581 1JLHA 2H8GA 1YONA 2HL6A 4OD0A 3O8CA 3K15A 2EBFX 1VE9A 1LH0A 1V8PA 2I2BA 3L1IA 1SRRA 4QUDA 2IPXA 5EIBC 3MWGA 1J8QA 3JYNA 1SCJA 1E2FA 4PGFA 3FYSA 1NSYA 3KCNA 3WAGA 5LZ2A 3IA7A 3AR3A 1JG2A 2EL7A 5GTDA 4P7FA 1NQ5A 2OOKA 3FNQA 2PE5A 5AW8A 3BWCA 3HH8A 3I1YA 3JWHA 4YCAA 2A5FA 5FBHA 5B3LA 4FBMA 1Z0IA 1IEXA 3CKYA 3DNPA 4J94A 1U2RA 4QAQA 1XRJA 1TJNA 3WG9A 1YQWA 2H11A 2P9ZA 1KEEA 3WJ1A 5EIEA 2GF2A 4FFDA 1U80A 3C87A 2C7QA 2HK8A 1YDMA 3WNZA 3UFXB 3P0IA 2ARKA 4UC0A 4ADSG 2C2OA 2SICE 1XI2A 3IDQA 3NKLA 4OKNA 5AOAA 5F52A 4HGYA 1ISGA 2FPXA 1WMDA 1N3IA 1IN6A 3KS9A 2UZ1A 4BFVA 1GZUA 3NZEA 2O2ZA 5JCXA 4F3NA 4QYSA 2ZBVA 1UODA 2X0EA 2XYVA 3YASA 2G1JA 2PFKA 4EECA 1VLQA 4PFQA 4YIKA 3UHPA 1J33A 3GNQA 2LIVA 1D0VA 1S9DA 3ON5A 3G2IA 1Y3AA 3QXXA 4BLOA 1J20A 1WR8A 3DMTA 3UGTA 3GPCA 4QZVA 4I4TA 2J0EA 2QTWB 4FR0A 4LNAA 5DP1A 4IVRA 2A2ZA 4DPLA 4N0MA 4IH1A 3UCEA 2YY5A 3N6XA 3NB0A 3OF2A 3HCPA 3W6ZA 3NMUF 2V74B 3F5DA 5C7YA 3KTFA 3OD5A 3ME5A 4BNHA 3EVTA 2VFAA 5E3JA 4W1SA 1DPFA 1H8EA 1MC1A 1U3UA 2JATA 1N5MA 4FDTA 4RZUA 5EWLB 4N7BA 1PIWA 1U9YA 2HSGA 2ZE8A 3EGIA 4PLPA 4MS1B 5CHEA 4GZ3A 4JOBA 3ANNA 3IP3A 4MAFA 4JZYA 1QANA 3AUTA 2DBYA 3SHWA 1WHTB 4K86A 1YAJA 4W6ZA 2H3EA 4JK3A 4KFUA 1KPHA 5T4HA 4CR7A 4DV3B 4HRYA 4Y2JA 3PUWA 4CIAA 2VXYA 4GXQA 2J31A 1M1YE 4II3A 5KC8A 2W6ZA 5COBA 4RS4A 4ZARA 1ZCFA 3IP6A 4S2EA 3UWOA 2GUGA 2C2GA 1DIBA 4ND1A 3VR2D 3H2IA 5F51A 1QF7A 1RD4A 4U5XA 3ZDRA 4CN8A 4YFYA 5TT1A 4MHTA 3NTUA 5CCEA 4AJPA 5J3JA 1P2TA 3AVXA 1XU9A 1GPYA 4GT1A 4PXYA 3UQZA 4BE9A 4RJTA 1T24A 3AKDA 2NT4A 3O8OB 1I32A 4MIEA 5C1BA 1JFTA 3PXUA 3HTXA 1UJMA 1F6DA 1JXOA 4HNUA 4L7VA 2XDQA 3OU7A 3RT9A 3WIBA 1KC3A 3USCS 4DC1A 5F1YA 3R3UA 3QE0A 3V8BA 2E4UA 4GM1A 3W1WA 2I80A 2AN3A 1ZK2A 3LW8A 1N3LA 4B6QA 1I6KA 1EVKA 3F49S 2OCDA 3FW1A 1VTKA 3ZZ0A 3AB7A 4RHYA 4QX6A 3Q3VA 1I7QB 2V0NA 3FTQA 2GTPA 3NHAA 5L53A 2QYSA 2AR7A 2D8MA 3AX6A 3RQIA 2DERA 2HK9A 2VL7A 1WBDA 4N3GA 5F4ZA 4P4SB 3OETA 3LCRA 2DFVA 4IJQA 1YBMA 1G1AA 1C3JA 3HHPA 4EZEA 1CUEA 4RTKA 4KPUB 5AVYA 1FYVA 3HJGA 4EI9A 1BW9A 4OB8A 2ZXEA 3LA8A 2CDNA 4EHHA 5HF8A 5LWHA 3FLMA 5J2TA 1C9DB 2B35A 3D4BA 4KGVA 3QOFA 2V03A 4YO7A 3VO1A 2EJVA 4UXHA 4L74A 3UBMA 4NV0A 1HKHA 4YPVA 1MKYA 1A2KC 4NNOA 4G97A 2P6MA 3S7TA 2RBGA 3KWMA 5ECDA 3SDZA 3E9EA 3W3AD 1JJFA 3WY9A 2WSSA 2IV7A 3WFIA 1UK9A 2QW0X 2ZIZA 2DWUA 3M6VA 1OI7A 3P9CA 4PCVA 5F9FA 1F8XA 1Y8ZA 4KR7A 3PDIB 2XZDA 5FBKA 3SXUA 5AO9A 5AW5A 2X77A 4TROA 4C4PA 3DJYA 2HMYB 2XDYA 3LHFA 1LK7A 2ZE7A 1G18A 3KX2A 2OBNA 1B26A 1LKZA 1NN0A 3ND5A 3AKEA 4HH1A 3SQNA 4HQNA 4KFRA 1UXJA 3RS9A 3BXZA 1JU9A 3OM9A 5DHPA 5H81A 1CUFA 2VTBB 1U0HC 1DDOA 5C4MA 2OFPA 4Z7OB 3LHKA 2ZM6B 1ENZA 1Q3HA 1ZD1A 3CUYA 1U11A 1P2DA 1W35A 1PWEA 2P7IA 5EHQA 3FZQA 1V5EA 4DCNA 5C18A 5BSTA 3C14C 4ENWA 3EH2A 2F3UA 5HRUA 4OJTA 1NT2A 1UCFA 1XZQA 3H5WA 1DIOB 1S2IA 1USWA 2X23A 2XXBA 3P2KA 4D3DA 4DVGA 1L8OA 1KYYA 4HWKA 2FWPA 2I2WA 4ILEA 2AW3A 2DPMA 4F3CA 4G4GA 3S8YA 3TOCA 3A3NA 3BJRA 4TZ0A 5ERYA 4N1AA 1QQ5A 4YB8A 1CQJB 2OM2A 2HXGA 4FOSA 4BRUA 2LP4Y 1NXOA 2IPLA 4K9KA 2A84A 1L5HB 4TLAA 2QTFA 3WNDA 3WLNA 5E2BA 2W42A 4X1IB 1F20A 1WDTA 1W5TA 4D5EA 4BV3A 2V55B 2JA2A 4CEJB 1NTOA 2W8BA 1LJ8A 2A94A 4RK5A 5L3QA 1LVHA 1T13A 4G0OA 2HT1A 1DKRA 1ORDA 3DUFA 5EJ4A 5TGDA 4QHYA 1HDZA 2GEVA 2IXGA 3WHKA 1JQDA 4G1VA 3ZHZA 4H4CA 4Y7CA 4NMLA 4BO7A 5LLSA 3MD0A 1ONPA 4F1KA 1Y9ZA 2PAAA 3OUUA 3MLAA 2FUG1 3R7AA 1C7IA 1UKCA 2WF6A 3MUEA 3O8QB 4FGKA 1TYZA 2H4XA 3P19A 3L6OO 4GI2A 5C34B 3OCZA 4U2EA 2BMDA 1E3IA 1H6BA 3KYIB 3QQPA 4RXMA 3ZNOA 1OB2A 2B1GA 2QY6A 3I9NA 5F5NA 4D9CA 3EUFA 4MWEA 4CI9A 4V0SA 1VXRA 2J32A 2QLTA 4QBFA 4ER3A 2V65A 5BR4A 5KYWA 4DR4B 4JR1A 1OX4A 1ZITA 1WXIA 5KMGB 1JMYA 3RUEA 4M60A 2FPSA 2Q7DA 2G9QA 4O4IF 4Z3KA 3SC2B 2ZRMA 5B3JC 2SCUB 2MDTA 5ADHA 1X1RA 4FCCA 5J2UB 1BYUA 1FX0A 1I6LA 4HDNB 4MAAA 4U1RA 4ZC1A 4CI0B 1T4CB 1C81A 1V39A 2Z0MA 3VH4A 5BV7A 7AT1A 4NABA 4W7HA 4PS0A 5IPFA 2UYHA 4K3VA 2Z95A 5M04A 4RNCA 3AEXA 4WLFA 3SWWA 3QPAA 5FWNA 3RYCA 4HP8A 2C4MA 4LDZA 2ZJ0A 3A8TA 2MR6A 4Q21A 4BYMA 3WS7A 1X9HA 2YN2A 2MSKA 4KE9A 5C8YF 2R8OA 3D6UA 1ILWA 1TYCA 2B8JA 3OA2A 4JJ6A 3BH7A 4P8RA 1JLLB 4XVHA 5H83A 1J2JA 4YRQA 3T9CA 4DBLC 3UJ6A 3DULA 3RF7A 3EGXA 3SJBA 5K8UA 3I5MA 3L8DA 5F1KA 3WAJA 1DMRA 1YR6A 3GF4A 3DHNA 1A9PA 2XMZA 5TQJA 3A27A 1P7CA 1NVVR 2RI1A 4EI8A 3MTDA 2B36A 2P2DA 4QYIA 1OF1A 2GN6A 2GN2A 3GRVA 4JDPA 3QWHA 5CYFA 1N5RA 2I99A 1ZGGA 5MGNA 2C9BA 1G6KA 2JKZA 1M1ZA 1L7XA 2QN1A 3KJFA 3QBTA 4MR7A 3V4LA 1GO2A 4HDKB 4PRKA 3T1HB 5LZ8A 3VZBA 1JHUA 2NVWA 2EJUA 1CJBA 1THGA 1J0BA 2C3PA 2JJ2A 4AWAA 3PGVA 3A2NA 2PMDA 3AR7A 3BZWA 3HR4A 3HZZA 1V7ZA 2BI8A 3FYUC 3L8MA 3FCCA 1C0PA 1N1GA 1EK1A 4FEGA 4D4KA 5LBUA 2O8VA 3DKIA 1P1HA 3DZJA 4NCXA 3ZXYA 4CQMA 3A3KA 3AGPA 3Q3JB 3CCCA 1QG6A 4IXWA 2FPPB 3RHZA 3BWMA 1E3SA 3VZQA 4BQPA 4Y2HA 4XYLA 5K6RA 1CETA 1GPAA 1XAGA 4IUBS 4BVLA 1RRFA 5CGZA 3KKZA 2R4QA 3V7NA 3FFBA 4HF7A 3MBOA 2K7FA 2QLLA 3WGUA 4UD2A 1UK7A 3EVGA 2XX3A 4EHDA 1N8TA 4M88A 5E3IA 1PRYA 5JQGF 5DTMA 2C8VA 1KQOA 5FLKA 2ZI9A 5JSUA 4HFMA 2CF6A 2AOTB 4FFNA 1DO8A 2PU7A 3IAAA 1KVUA 3PQFA 4YECA 2FP3A 4XYGA 2O6HA 4XJXA 5K3CA 1VMKA 3OOYA 1D1SA 3CRQA 5C8DA 4CMKA 1YSCA 3G0HA 2IY7A 4KXMA 4AP5A 5JEDA 5M29A 1B6TA 3PHLA 5K3DA 2UXDB 5EZYB 2HDHA 4K9DA 5FUVA 1JLSA 1VRWA 2QZ9A 1H0HA 3W8DA 4B4UA 4IXDA 5CP8A 2XXJA 3O84A 4RULA 1O5IA 1B00A 4L28A 4PSVA 4X5OA 1LBSA 1UP7A 4JSYA 4PCAA 5IYZB 1JEYB 1E1KA 4XD2A 4UZSA 4DIBA 3PTZA 4D3FA 4F84A 2XE4A 3ID6C 2W58A 4D2IA 1NLZA 3S6JA 3OTWA 4V1CA 3ZVRA 3OUTA 1XOIA 4G1CA 3ZWQA 3MLEA 2QTHA 4IS2A 4RH1A 2BGLA 4WDQA 4R7GA 4DXHA 2OORC 1ADYA 2O20A 1KZ7B 4HEHA 2FDXA 4YHBA 4H9GA 5EAIA 3RU7A 2D06A 3A14A 3HA3A 1GLGA 3H9UA 4D96A 3ISTA 1B41A 3MGKA 4UUBA 4WZZA 4ESEA 4F4IA 1GRNA 1YT5A 2AN9A 1DEAA 3EW9A 2AQKA 3PE4A 4KI0A 4ZVSA 4XLTA 5JNWA 3BMCA 1PG2A 1LLFA 3RVSA 3OX4A 4D81A 3RSGA 1V4NA 3GJ6A 4LQ4A 5FUYA 4DA7A 3U7QA 2NP6A 1YS4A 1WULS 1YL5A 4B80A 3KZVA 4FXPA 3SHVA 5I7HA 3WYGA 3M6XA 3B6ZA 4PLGA 4INJA 4BTVA 1TIBA 4G85A 4MP6A 3ZLUA 1O4WA 1MMFB 4R40A 3CH4B 1EX9A 1GZDA 3BXPA 3ZE0B 1CW2B 1KKUA 2YVKA 4CEHA 3WLHA 4DN6A 3JQ7B 3MN1A 5TB5A 4EPXA 4EA6A 1HE2A 3WRYA 1VCIA 1WF6A 2ZTVA 4TS1A 3ZI0A 1JIXA 2PWPA 3PIIA 1PYOA 2FN8A 2WVAA 4CFZA 5IX8A 4M0LA 1E1QD 3TJZA 4A6PA 2A9KA 3F6BX 1FK8A 1X1SA 4K9MA 3SM9A 4JCCA 1OQAA 2QTTA 3GNLA 4P83A 2AYXA 4CKEB 5HTOA 5E9AA 1G8YA 4L9SA 1MEEA 5JAZA 2CWDA 1NNSA 5D3KA 1Y8RB 4OEHA 3FDFA 2QUBA 3OSUA 3DFMA 1UDCA 1K68A 2F67A 4QAJA 2RGCA 4H08A 2GXUA 4TSKA 4AICA 3V8EA 2ORWA 1WUHS 1Y8QA 2Y1GA 2R0QC 1R2QA 3EVCA 5BRJA 4JEUA 3KQNA 3IESA 3RF6A 3RASA 4BO0A 4HD8A 3E82A 1K6EA 2AOVA 5JV5A 4DEVA 1YOVA 1MD9A 2NAPA 1T5BA 4D92A 3D8HA 4Q9AA 5EEHA 1PFVA 1OLUB 3PC6A 3JQRA 4L4UA 4M9UA 5KO2A 1BD4A 1EDDA 1IY0A 1BJRE 5D2CA 5BNWA 3ENWA 5EZ6B 5KTTA 3CX7A 3R0XA 3VNAA 2HX1A 5CEEA 3KD3A 4KSYA 1MB9A 1DP4A 2B2XA 5UKDA 1GPKA 4B3XA 3E5MA 3KQWA 4JUBA 4L8WB 1G60A 3FUUA 4QPCA 4TKLA 3T54A 5A0TA 1Z0KA 4G65A 3PPWA 1VCHA 2CMDA 4YJ3F 2NPOA 4CL3A 1XCJA 3JRXA 3T99A 1KYZA 3FNFA 3P2EA 3ANSA 3B89A 5ITVA 1JUDA 1CUHA 1DADA 4MWSA 2I8LA 3ICWA 3NOVA 2V9ZA 3MYRA 5D5HA 5K51A 3R6WA 3E9MA 5ALEA 3MT9A 4GKVA 1Z0UA 2BHSA 3UAVA 2ECOA 1SA0A 4TYPA 3I9OA 2CL6X 1KOLA 3L4KA 4P0QB 3EHDA 3QXGA 4YN3A 4DEYA 3RG2A 4M76B 4N0DA 3ADOA 4V1CI 2PT9A 2Q1TA 4DDVA 1KS2A 3SOPA 5KJCA 2Q2VA 4WLNA 3HCFA 3D0KA 3TLEA 3QVKA 2J4DA 1M1XB 3RARA 2UDPA 4LJKA 2XMCA 5DNAA 1Y6RA 2PYZA 5JFOA 3CNEA 3FCAA 2ZRJA 4BB6A 2WJWA 3TNLA 1N32B 4R1MA 1N5KA 3PTAA 1DV1A 2B7LA 4BQIA 1HG0A 1J1ZA 3DP7A 2JIQA 5EI5A 4G0QA 5KHLB 2VQ3A 3HABA 4WJKB 5LYJB 4DCTA 1W1IA 2PAFA 3TF5A 1ZM4A 2BZ1A 3NM4A 1FXSA 1HDRA 2VPQA 1CVRA 3Q2KA 3V2IA 4CMEC 1FYEA 3QJ5A 3FSGA 4HDSB 4PXSA 1F2UA 2C59A 3ENQA 2JGNA 1OBHA 4ABYA 2WHYA 3LI2A 3RAJA 3RKSA 4D3SA 3GZNB 4L73A 4XDYA 4TWAA 4RY0A 4ZGGA 3E7DA 4RD0A 1Z4IA 2WTNA 2GF0A 2J3HA 2Q3LA 5AW9A 5J9FA 3W1EA 3DMFA 3BC1A 3VTFA 1FUIA 1NR7A 2YFQA 2AOUB 1XWWA 3C6ZA 3DAPA 4R7ZA 3VUFA 5C5CA 3N2GB 2FGJA 2G5CA 4UHCA 3KIPA 3P2OA 1BMFA 5JMOA 4GDFA 1FL9A 1LDMA 3PRHA 3Q9NA 4JP3A 5MN4A 1ZEJA 1K0FA 1YVUA 1FFHA 2C07A 2PYIA 2Q0SA 3RC9A 1P91A 2PBZA 1FTSA 4WZBA 4GU5A 4ALMA 2MINB 4RSHA 4US1R 4LQDA 5AI9A 1YB1A 1WXDA 5DW3A 2JI4A 3KR1A 4RTOA 1YI1A 4X60A 1D5CA 4MW5A 3VOTA 4DY4A 1T15A 1FBNA 2OZEA 5BV1A 4XX0A 1SVWA 2PT6A 1SEVA 4I1SA 5T41A 3K4HA 1YQUA 4S35A 4U6QA 3A6PC 1KVRA 3RYHB 4UM8B 1ISSA 3INRA 1UEIA 2SECE 1UBOS 4RLFA 5LNK1 2YJ3A 3TMAA 13PKA 1RHKA 3RFVA 3ICOA 3SK0A 2QLJA 3EJ6A 1A1VA 2I0FA 4QVGA 3UTCA 3UWKA 3NEAA 3S2FA 3UY4A 4Q15A 3MVEA 4IINA 3D2CA 5JRDS 2WWYA 3W79A 3OEHA 5DVZA 1BJKA 3F7TA 1JL3A 4L6CA 4Q37A 4ZI5A 4BEVA 4GW3A 2OFWA 4GPZA 2HB6A 2XE6A 2Z6VA 2A67A 4LZZA 1PWHA 5GM1A 4A26A 3CGGA 4PG6A 5I47A 2HQOA 3LY5A 2XQGA 1A7UA 1WAMA 3GIDA 4NH4A 3EPHA 1JBKA 4HADA 3K0AA 4KE6A 5BRNA 5K8JB 2JD0A 2FJUA 5FV7A 5JSHA 3LIIA 2PUBA 3O83A 4E0BA 2PPVA 2OLKA 5K3SA 2BFMA 1XMJA 5CDYA 3G1UA 4RHXA 4RL4A 2DSNA 2PK3A 4OQFA 3WMXA 3EY9A 2W2TA 4DUGD 1KI9A 3GUUA 3GZ4A 3P7MA 4PZLA 4D6PA 1FSGA 3QVGA 1RKXA 3AY0A 3ZZ1A 1IY2A 2HA5A 2Z57A 4H1VA 1J56A 2ZUTA 2V8BA 4H18A 4EP1A 5A3QA 1TYAE 2XNKA 3DVQX 4AB1A 2QMEA 1ORWA 4BHTA 4ISCA 2E9SA 4IRMA 4D41A 2RONA 3TX2A 3CTPA 3U3JA 2BYTA 4QOEA 3P9IA 1UADA 3WYAA 1X7HA 2FWIA 4GMFA 5GIOE 2O7NA 2HLNA 5COAA 3AM1A 5GPBA 1NN1A 1BWSA 1FQKA 2Z43A 1ZNXA 4GZ6A 1XCOA 4AZSA 1KFJB 2I4OA 1CB7A 2P0EA 3AUSA 4N3CA 1YZFA 4HS9A 4X63A 4MJ3A 1G63A 1F1JA 2XTNA 3OAAD 2EJWA 3V7UA 3DEIA 4M6WB 3W9YA 3HM2A 1EJ0A 1MXFA 1EPUA 4DYHA 4O4HA 1CUCA 4FFBB 2UZIR 3BL5A 1ZN9A 4EM6A 2OP1A 5DWVA 1Y6FA 4B75A 1XMXA 5H0IA 4QD3A 4A16A 1DX4A 5F78A 2OV6A 4CKCA 2CY0A 2QAGB 4MGKR 5DGDA 3R0VA 4JAVC 1KSHA 2BGNA 1HE3A 2GCOB 1CU1A 1HDYA 1X8KA 2OECA 3I6YA 5JCJA 3VX3A 4B6EA 4BL5A 2Q1UA 2NUPA 2Z4SA 1XA3A 4CT4B 3RS8A 2HIAA 3E27A 2YWRA 4C01A 1POXA 4RDCA 4UAGA 4DWWA 1I2ZA 2XODA 3V8NA 3ZE8A 4HWPA 4S0XA 1RXCA 5DM70 2KMLA 1FSPA 3PJDA 3OE1A 2CHUA 2JVJA 4FEYA 2PR7A 5DFAA 1XMQB 2YMLA 4KE7A 3AKZA 1L8QA 4E4YA 3SP1A 2IEZA 5JRJA 1G7RA 5HFAA 3FBGA 5JWOA 2KX7A 3I83A 2C3MA 4IDBA 4XQEA 5I7SA 2FWAA 2W4MA 4M83A 3IAFA 4NZ9A 3F9CA 4W4TA 4QFMA 5CVEA 3TBFA 2NZ8A 4FIZA 4UCXA 1YK1A 2ODPA 2BMAA 1JHDA 3FCUB 1XJ0A 2WAOA 1H2WA 3EE6A 2J08A 4NOLA 5EIWA 1X74A 2Y8EA 1NPYA 4L07A 4PX3A 1J90A 1MW9X 2HYIC 2XQJA 4HN9A 5FUMA 5JY1A 1OT5A 3TXAA 3JD3A 4GOKA 3B5JA 3AKCA 5EUBA 3LNCA 1ZCAA 2XGGA 4W5HA 1I4DD 1OA1A 4PTLA 1C1YA 3TLJA 1MOPA 1SOUA 3GN1A 3F1KA 3DBLB 3ZNQA 3UOWA 4F97A 1XEXA 5DBHX 3I5AA 4I6GA 1WZIA 1TU3A 2W2QA 4FX2A 5TQ2B 3TRIA 3QUSA 3ZD6A 1AF7A 4KC0A 4QJ5A 4W5JA 4UEQA 4D80A 3J7AC 1TVKA 2X15A 2NUAB 2CLFB 3SN6A 1C0EA 4BO4A 3MTGA 4I55F 3HM9A 1JLMA 3C48A 4P3PA 3HMQA 2XB9A 2X3UA 3TKAA 4ZYYA 5LDDC 1G3UA 4A8PA 4PN7A 4ERXA 3DTVB 4H16A 4C0QC 4CMIA 1BDBA 1H6CA 3AHFA 4CU2A 3HKBB 1W0CA 4FS3A 4YHHB 1NE2A 1G2OA 4PAMA 4XD7D 1R0SA 5G0TA 3DC7A 2Z2IA 4G5RA 4IDDA 3ZCQA 4MR9B 4GE0A 3P71T 5C8ZA 4D74A 5CIYA 2C2MA 2X0RA 4BVGA 1RYFA 2XSZD 2Q5HA 4NBSA 3WQHA 2PZKA 3PITA 5E6RB 1JR3D 3U3RA 4JU8A 1B74A 4KX3A 4LGCA 5ICCA 2P8SA 1MIHA 1TZ2A 1RHQA 1WS6A 4BEBA 1F5SA 3CZCA 2NVUA 4JP1A 4BP8A 2RGAA 1I4EB 3KUKA 4EYSA 4KO3S 1G5FA 2IZOA 4EELA 2GHQA 4M0KA 2XUKA 5GV7A 3WVNA 4E09A 3UC9A 1AA6A 1G7TA 1ZW6A 3I53A 4YJHB 2F9MA 3R8CA 2B61A 2P7HA 2QRVB 1GPJA 3NHZA 5IDYA 3TFWA 4BB0A 1CT9A 2V7QA 2CYBA 3L46A 4BZQA 4BAUA 1YDFA 2WTAA 2PRKA 3FNGA 1MX5A 1UJ5A 2HTEA 1LW7A 2JBAB 4LA4A 5F21A 2OFFA 5K6TA 3CNNA 1NF3A 2Z6QA 1EFVB 3WBFA 4DRYA 1QFZA 2XWPA 3BD8A 2Z3ZA 4ZDIA 2GO7A 3V1LA 4CNQA 1EINA 2Q4RA 2GN1A 3GR6A 1J5EB 3L0IB 1I24A 1CS0B 3W4KA 1R6UA 1OLXB 1YC5A 2MYUA 2PUWA 2O14A 2QRZA 3MCTA 5AKZA 2Y1FA 5JPCA 2YDXA 5IVHA 1Z3IX 4QULA 4DTIA 3T5PA 1X8XA 2JNWA 1CJKC 3OFND 3PXBA 3R5FA 4I3FA 2I91A 4QECA 5JXIA 2IXBA 3M70A 3MIZA 3T3GA 5JSZA 2DKFA 5FTNA 5KSYA 3UXHA 1J5PA 2EKPA 2HH9A 3EOBI 1JB9A 1XZPA 3R75A 3C7CB 3MFQA 4OHPA 1I2DA 4V0OA 4J0JA 1NX6A 3OX3A 2GERA 3KAKA 4ZQBA 1SXJB 3C97A 3T9BA 3ZCUA 1Q21A 2O2DA 1FPQA 4HGOA 1QGUA 2FRDC 4HMPA 1S8FA 3E9RA 2QVGA 3K09A 1CC1S 3MGGA 4RE6A 1FJGB 2D54A 1KP2A 2Z1MA 2G70A 3WADA 4H4DA 3RVRA 2JLCA 3NS7A 5LBIA 3DMRA 3L7LA 1MAHA 5BVHA 1KAOA 2ZI5A 5KOJA 2CKMA 1YS2X 4HZUA 2JRCA 1JEOA 5GZ1A 4MUGA 1K8RA 3JQAD 1U5AA 1W8IA 2FSVA 4C1NA 3NBQA 2ZATA 3E3MA 1IQRA 3I64A 2Q4OA 3GRFA 1VJTA 3AJAA 3M1IA 4MUKA 3WIOA 2CJWB 4HXFB 5HBRA 3WWCA 1UDBA 2GQ0A 5B55A 4RW0A 1RWVA 3T06B 1Z39A 3UENA 1FQJA 3T5DA 2P3LA 5LB4A 4WERA 3TMKA 2FI1A 1XD2A 4M49A 3GG2A 3R7BA 3HC7A 4RSRA 4IZIA 3T3OA 5GJBA 3B1XA 1AKRA 2D7CA 3FWYA 2JHFA 3QKSA 3RDPA 1EUYA 2ZTMA 3S5UA 1J00A 1MOZA 1TMOA 2WPDA 3GGCA 1U3FA 1OGIA 4RM3A 1IONA 1RYZA 1VI5A 1OB5A 1U2GC 1C7EA 1A4RA 1D8AA 3N2LA 2CN1A 1SQ5A 2YVLA 3CSSA 3JAWA 4AAYA 4F2PA 1ZRMA 3U0VA 1Q20A 2I6XA 2IZ7A 5E0KB 4DV5B 3KZKA 4HUQA 1K6IA 2P8JA 3L93A 4N6GA 1QR6A 3Q8KA 2GJ9A 1R5BA 4L3OA 3ZEAA 1Y42X 2BMWA 3R20A 3KKPA 1ZD5A 4B4VA 1W85B 2NNLD 3ZHUA 3SXJA 3AZOA 1Z25A 3EUEA 2OV2A 4B6RA 3WNQA 3CX8A 1EG7A 4NEGA 1GT91 2I34A 1Z4NA 1KO7A 1TF5A 4IFTA 1NF2A 1X7WB 3Q2OA 2NU6B 1SVUA 3KEGA 2I1WA 5EPEA 2QBYB 4E2WA 2AB0A 4N39A 1U7OA 1YMUA 4I6JA 4UTNA 1WV0A 5KOYA 1O6GA 3EMVA 3ECAA 5H80A 1WRBA 2PL9A 4DJAA 4GBGA 4FQ5A 3JQ6A 4X20A 4TWJA 5D5QA 2A8YA 2J3QA 3RJ5A 1K8QA 4DKJA 1MH1A 1NJ6A 1X14A 2YZMA 4B6GA 4WHMA 5AW3A 1SWWA 5BORA 2QL7A 3IQZA 1C3EA 1HTWA 3E3NA 3FDJA 5EXPA 2O1WA 1JYEA 3KJGA 3TOXA 2WJ4A 4ZJYA 3IPRA 5G4KB 3UAOA 5DN9A 1CSEE 2VJYA 3I9LA 4DA8A 1MXHA 2IZZA 4M7WA 2ZSAA 1C30A 4DBZA 3KVNA 5FHQA 3M2TA 3ADPA 3CTMA 4DA6A 1P7WA 2XWJI 4MQEB 1KDZA 4ZI3A 3EBPA 3LCUA 4MVJG 4MV1A 1JV2B 4A91A 1E2JA 4NCKA 1MZPA 1I0IA 2Z08A 3C4VA 2XAUA 1BMQA 1GZ6A 2HAEA 4G4JA 1KHHA 2JGMA 1TTPB 3DO6A 1INLA 4LV5B 3WQQA 1QB8A 5IS2A 2COEA 3K2BA 1YO6A 4LC1A 1RAHA 1VL1A 2KLBA 4ZCPA 3LXXA 4MLCA 3TSCA 4AUKA 5BVGA 1YFJA 4K6MA 1TYDE 4W9NC 1PSDA 3GAAA 4GKKB 3NNNA 3V6LA 4LI0A 3ZLBA 4PFSA 1YB7A 2WC1A 2YQZA 2GPAA 5AYVA 4YA6A 4NBRA 2AZXA 4JVLA 1MUUA 2XBLA 3WDLA 1E3DA 1PYDA 3EGVA 1DXYA 4IKPA 4CIYA 2II6A 5JZOA 1B1CA 2H4FA 1ZI8A 2NG1A 1YBFA 4KNWA 7ADHA 2F1RA 1A5BB 1NXSA 3HO1A 2CK3A 4DLTA 4ENTA 1I3MA 2P5TB 3R5TA 1A72A 1CNMA 5FO1A 1X7ZA 2TYSB 5AK6A 1ODFA 3DT6A 3D4IA 3L8YA 1D1TA 1ZONA 1BEEA 4FFLA 8GPBA 1PDOA 1PFUA 1Z6XA 3QE2A 5FLXA 1IEWA 1GSOA 1EFDN 2IOFA 3A7DA 3G2NA 1RWMA 1ULHA 1DEHA 3A1EA 3O74A 3WHLA 2I1LA 5H3CA 4MDEA 5CIQA 5EE3A 3TZBA 3CKKA 5JJBA 1N2SA 2IGTA 3I30X 3KUDA 4U7GA 4KQ1A 2OYCA 1EXMA 1NL3A 2Q3HA 5JRZA 1PFWA 2H4YA 3OA0A 2J5BA 1SWVA 3WGNA 2QT1A 4E15A 4RY8A 1E1RA 1E61A 1XNHA 2WWIA 4JLNA 4QGHA 1E59A 4JI8B 3HVUA 3PJRA 2TS1A 5E4FA 4KKXB 1ESCA 5EA2A 1ZM2A 2E1PA 2HJVA 3LK7A 4TL8A 4Q4CA 1QK3A 2W4IA 3NH6A 4YNBA 1NULA 2QF7A 2B92A 3EXHB 1A9ZA 3O94A 3WL8A 4RGQA 1BHSA 3LFTA 4XSGA 5C7LO 3NYWA 2FYTA 4MVJM 4OQLA 5FTLA 4EGAA 3KEFA 5K3BA 4JA0A 2OAEA 4FD3A 1UAGA 1H8HA 2NSJA 3L77A 4WVLA 2VHZA 1FEZA 1QFYA 2WJAA 3ISVA 1ECLA 1TAHA 4RH3A 5DXJA 2RBKA 3TPZA 5FB3A 1DIRA 3GLQA 2R4TA 3GUVA 3N0WA 4G0XA 1H2ZA 3LGXA 4PNHA 5L3RA 1TUGA 1DZIA 4E12A 4DIEA 2OHFA 3H42B 1DOHA 4HGNA 1Q0UA 1ZK4A 5I9LA 3OLVA 2JFNA 4WE3A 2H5LA 5LKRA 2NSLA 3VVLA 4YRTA 4F5WA 1YL7A 2XW6A 2YIVX 4RANA 2YHAA 5ECYA 1S5PA 2BZSA 1GTMA 2QTGA 4KYVA 2ZAGA 1JHVA 1GUFA 4FCTA 4RA6A 5DISB 5CVVA 1V11A 2CXHA 4U2GA 1N2CB 2OG1A 2AMVA 3WYNA 3ANYB 4UTXA 1AO0A 2ZWVA 4IMJB 2POQX 2QAIA 3V9AA 4JROA 3RH0A 3FHJA 2XF2A 1ISIA 1TQ4A 5IHXA 2IK8A 2BF4A 3Q7EA 4MQLA 3IYLW 4RVOA 2NYAA 3DH0A 3HKEB 5ENVA 2WIBA 3NT2A 1E6CA 1HQCA 1ST2A 1PJAA 3CW2A 4ITVA 5EFOA 1N2HA 3GH3A 2IS4A 3ECCA 4B4KA 1C1HA 4ZVLA 5F33A 1NV8A 2WG2A 3UMMA 2XXAA 1XEWX 5K8LA 3DV2A 3G0GA 3TW8B 4M36A 4O2BF 1OXVA 4BUCA 1WPGA 2CLLB 4QUBA 3W2HA 1RQPA 5A3RA 2I55A 1SK9A