2DUNA

Solution structure of brct domain of dna polymerase mu
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
133
structure length
133
Chain Sequence
GSSGSSGSTRFPGVAIYLVEPRMGRSRRAFLTGLARSKGFRVLDACSSEATHVVMEETSAEEAVSWQERRMAAAPPGCTPPALLDISWLTESLGAGQPVPVECRHRLEVAGPRKGPLSPAWMPAYACSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of BRCT domain of DNA polymerase mu
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords DNA polymerase mu
total genus 14
structure length 133
sequence length 133
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2006-07-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 2dunA01
1GZHB 2XNKA 3UEOA 1IMOA 1T29A 2NTEA 3T7IA 3SHVA 3JVEA 3K16A 4XQ0A 2ADOA 3UENA 2L42A 2XNHA 2LE0A 3T1NA 3PXCX 1Z56C 2COKA 3QVGB 4Y18A 3HUFA 3SQDA 4ID3A 1CDZA 3PA6A 1OQAA 1T2VA 2VXBA 1JNXX 2EP8A 3EF0A 3FA2A 2COEA 3HUEA 3AL2A 3II6X 2K6GA 5ECGC 4N40A 3EF1A 3PXDA 2WT8A 1L7BA 1N5OX 4IFIA 3L40A 3SZMA 3T7JA 2E2WA 1T15A 3U3ZA 3PC6A 3PXAA 2JW5A 4BU1A 3OLCX 3PC8A 3PC8C 1KZYC 2ETXA 4BMDA 2M2IA 4OFBA 3AL3A 2D8MA 3KTFA 2K7FA 2EBUA 2HTFA 3COJA 3K0KA 4BMCA 3I0NA 3K0HA 3SHTA 4Y2GA 1WF6A 4XPZA 3I0MA 2R1ZA 3PXEA 2VXCA 1IN1A 4BU0A 2INGX 3T7KA 4U4AA 2DUNA 3L46A 2COUA 1Y98A 2AZMA 3PXBA 1L0BA 4IGKA 3L41A 3PC7A 3QVGA 1T2UA 3K15A 3PD7A 4JLUA 3K05A 2EBWA
chains in the Genus database with same CATH superfamily
1BVUA 3DXYA 4EHKA 2B8EA 2FZGA 4G5FA 2H85A 1LC0A 2QI9C 3LMKA 3V7YA 3DS8A 3U17A 5GZ1A 5HOEA 1IN6A 4MV0A 4PRZA 4BPRA 1AZTA 3WLHA 3KQQA 1Z12A 3GBSA 2CLIB 1KC3A 5CB6A 3BJZA 1IC6A 3ZCPA 1WW2A 2BEUA 2ZBGA 4Y98A 5L7WA 5CX4A 3E2PA 4MPDA 5M3BA 4DCPA 4AMVA 2CXUA 1K6EA 3Q0EA 5J9FA 1DDGA 2A9RA 3E82A 3AF5A 2IYYA 1Q0HA 4NR0A 5F5NA 2XXJA 4D8UA 1WSAA 2Y3IA 2ORED 1VYVA 3CISA 3F6EX 4MA4A 1LZLA 3ZU4A 1QLHA 2YNMC 3GW8A 1A98A 1ZESA 3COYA 3BD9A 4UHHA 2II6A 4OFXA 4Y2UA 3V4SA 4KWTA 4BRUA 2C9CA 4AUMA 2OV1A 1P3JA 2OO5A 5KYNA 1WMSA 4ZVKA 3RFCA 4FB5A 3GMIA 3V8BA 3BCUA 1U5CA 2IOFA 3AETB 2XB8A 4B4UA 2DCUA 5C46F 4X45A 2C1EA 2H63A 4IIVA 1ZW6A 2OLEA 2JD0A 2HFKA 1XQ6A 3MMZA 1A2QA 2P30A 3N6VA 1J8DA 4KQHA 1CIJA 2EU8A 1Q7RA 5AVVA 2VJMB 1H93A 1K5PA 4HLUA 1HNXB 1PI3A 1XTTA 2FE1A 2ZBFA 4D96A 2Z56A 2HDOA 4GZLA 2X6QA 2CHGA 1FZQA 3OQHA 3FSJX 4MRNA 3TR5A 5IDQA 3KPUA 1JRLA 1GZDA 4I4IA 3IQIX 1LJLA 1KI7A 2MINB 2C04A 3GJTA 1E3LA 2NACA 2ZBDA 2FVXA 4UHEA 5FULA 3HJRA 4A8JB 5TE9A 4KDEA 3DWFA 2PH1A 1J2UA 1DX4A 2IZOA 2JJ2D 2QRJA 3G2MA 1LTKA 3MLBA 4MUMA 2QZSA 1HDRA 3GDWA 4LJAA 2MYNA 4G84A 5FWYB 4A26A 4F2GA 1N2IA 5LQCA 2Z6UA 1CEYA 1CF4A 2VWQA 4ZDJA 2FPSA 3T7JA 2IHKA 3EH1A 5BV2P 4ZHSA 4JXZA 3UNXA 3DOFA 2B4YA 2F3TA 3GD7A 3B1KA 4X7MA 2PRIA 5KYTA 1NSYA 3H18A 1O9BA 3ZWCA 2FMHA 3L05A 5HVNA 1I94B 2Q8QA 2BBOA 4M38A 4WXMA 4GR4A 3WWCA 1C7FA 1QJCA 3BFXA 3ICWA 1N2CA 2AVDA 5HF8A 3F5QA 4FFBA 4WOPA 3C6QA 4YHBA 1YS1X 1EP1B 2HJGA 3CLTD 3KKLA 3RH0A 2O54A 1TO2E 3HVHA 4RSHA 2JVIA 1E2BA 4UFNA 4IMIB 5E9AA 4DZRA 2HSDA 1XEWX 3PJGA 5L7YA 3K8YA 2I8LA 3PCXA 3QVLA 4PHFA 1YAHA 5EUQB 2JCGA 2H6EA 1XRPA 2BFBA 3IP9A 3LWBA 5KQGA 2X0RA 2Z4SA 4C0XA 1DAKA 4ISCA 2KSQA 1KDYA 4BB9A 4OM8A 4NYJR 2FPPB 1NUTA 1K6IA 3Q0TA 1TCCA 1XX6A 5JAZA 3G17A 4QA9A 3COVA 5TGDA 2A9VA 4DLSA 1ZRHA 2IYNA 1BS9A 1CUIA 1R4AA 2Y2UA 3WBFA 4RK6A 3LUKA 5IT9A 1QB7A 2RHBA 1EUCB 4HK4A 3KEOA 4CI0B 5JSFA 1U7XA 2HRCA 2QE6A 1BW9A 3K70D 4MLCA 2YVQA 4WTOA 4EW3A 2O50A 2FFHA 4LG1A 2ZCUA 4FEAA 2YY6A 4J6FA 4HDRB 1O9GA 3B6MA 2A7XA 2EYQA 1OWPA 3DV9A 2JLVA 3MFQA 5IKPA 1E8MA 1UUFA 1IY1A 3SMQA 3WLJA 3MCVA 2B2XA 2WT9A 3DZHA 1N3BA 3UT5A 1DG1G 4LF9B 4K7JA 2Q6TA 4Q3OA 3IXLA 4KN6A 3VR2A 1XRRA 5BP7A 1A72A 5CURA 2RHMA 3KALA 2VN8A 4MHSA 3RGGA 1SBTA 2CFCA 3B1FA 1NN5A 5T4EA 3I2YX 1XLUA 1RI4A 1HF3A 1IIRA 2OHFA 4YJ2F 1H6CA 1U5BB 3AEKA 1BE6A 3P2JA 4JP3A 3NJ4A 4H7FA 5DKFA 4QXAA 4BLOA 4HDNA 2FWAA 2NG1A 4YMLA 2NX2A 2W6PA 1W96A 2YHUA 3I9OA 3TZQA 3UK2A 4EHDA 4EJ6A 4IFTA 4WZZA 1KWKA 4W9RA 2ZYWX 4B8YA 3GYGA 4OYLA 3V7NA 3JSAA 3LC1O 3WNQA 1SUCA 1BKDR 3VKHA 3H1FA 4QIHA 3MNFA 5G53C 4EK9A 1CV2A 2VJCA 1O5OA 3WWOA 2AD5A 1GUDA 4TMWA 3GLFB 2IIPA 1COWA 5ISMA 1OBFO 2ECPA 5GPBA 5T8KC 3RCBA 3W3ZB 2YV5A 3BE4A 3BZBA 2VSNA 5UKDA 3U9SA 3K30A 4BP9A 4REOA 5I6DA 3EYAA 3EXG1 3KSAC 1BCSA 2D5IA 3RREA 4R2KA 1RXSA 3UAVA 3CLKA 4RA6A 2J3LA 3OD5A 4E6PA 1YNOA 3N1UA 4FFLA 1QO0D 2IZ5A 2ZRDA 4IEEA 4JBWA 2X8LA 4MEBA 4MUJA 4YREA 1ZXLA 2GN2A 2XA9A 1N7IA 1CWUA 4PF1A 4LRSB 5J4KA 4HFJA 5MDHA 2C4UA 2NNWB 3LRPA 2JHFA 3I4LA 3HS3A 5DM4A 3PNVA 1Z26A 1NW4A 1Z16A 2OCXA 2ZR0A 4U8HA 1MX5A 4TRMA 4ALLA 4NMMA 3EXHA 1HNZB 1FZTA 1MJGM 4DMCA 5I7FA 1WZ2A 1DBIA 1Z08A 1WCIA 1N8TA 1WDKA 2O0JA 2VQ6A 3NBAA 4OOEA 1FUIA 2HDHA 1U3CA 2HXSA 5FOWA 3A4MA 1PW5A 3B2QA 4MKRA 1G59A 4NDZA 4H60A 5C0OE 3I61A 2CVHA 2OBBA 2YJTD 1AV6A 4RKRA 4ZEXA 3UV7A 4FYWA 1YTUA 1BYUA 1V1MB 1U2ZA 4AZ0A 4CIYA 1ZGGA 3V1LA 3ADKA 4R9NA 1JKIA 3WI7A 4AJOA 2H54A 4NPHA 4ER5A 3KPYA 1KQOA 1XLTA 3NUQA 4O59O 1KI1A 1LVUA 4RPKA 5DBGA 2QPAA 4ZVLA 3H3XA 1O94A 3TSOA 1ZMTA 1P80A 5IJ0A 4YCSA 2WHRA 3WLLA 5B6JA 3GIWA 1KK0A 5A7HA 1I3MA 1O8CA 1RWBA 2HF9A 1CBUA 1RWVA 3EZ7A 5IWAB 4YHHB 3CF2A 5C34B 3VGJA 4B2PA 2GO7A 2GRJA 2IPOA 2RDMA 4LF8B 2CWDA 2CL0X 1T8UA 2G1KA 2OK7A 4KIJA 5EJAA 3AY3A 1C2TA 2YVAA 4MVYA 4IVNA 2VF5X 4S3MA 1NBMA 3ZOKA 3CVWA 2GAAA 4CFYA 1RVDA 2IYZA 2XX3A 3PUIA 3QVJA 2J0UB 1WVGA 5K4GA 2ZRAA 2B1QA 1UK8A 2QV0A 3OMLA 3R2JA 1FUKA 4U7HA 3JQ9A 4X24A 1OYYA 5FF9A 1I0LA 1FEZA 3FTNA 3QX8A 1Q20A 1Q7GA 3EXHC 5J23A 3RK1A 3SDZA 1N5DA 5IK2A 4TQGA 3IAS6 5FOXA 2IOYA 3EOZA 3D6TB 5CW1A 3KZMA 4R3NA 1WUJS 3KG2A 3QXXA 3EEBA 2VT7A 3WX0A 4EY4A 2O2YA 4AULA 4ZYZA 4E08A 1XOIA 1A76A 1Z34A 2P35A 2X8WA 4GMHA 5A04A 3TZCA 3IQZA 3PQEA 3RANA 4AG6A 2X2OA 1P72A 4AN1A 1EVIA 2GZHA 4TPKA 4NOLA 4WSOA 2JBAA 4N48A 1M2EA 1BWSA 1SQFA 4WKBA 5JBIA 1SZPA 1A4RA 3CZRA 2V6GA 5AI5A 3HUFA 2VZ9A 3W04A 1GUFA 4ERNA 1U28A 4PG4A 1RI5A 3JATB 1X77A 3IVXA 1SIOA 3ONNA 4QDOA 4R83A 4ZDKA 3HCEA 5I7SA 3R41A 2DB3A 3TMAA 2E37A 3IS3A 3D43A 2L2QA 5FUYA 4XX1A 1JPNA 3MRTA 4XCQA 4UATA 1HSOA 2F62A 4LDAA 1P19A 1GGMA 2Q99A 4P35A 4ZVTA 4MIEA 1JG3A 4DLXA 5TT1A 1ZC3A 4IIUA 4Z3DA 1JXQA 3PS9A 1XNGA 2PZ8A 4M76B 4J75A 2UVDA 1EBUA 2PU5A 3F0TA 3M82A 1YJQA 3OCYA 4CF3A 3ICOA 4U7JA 3DH0A 3SIPA 1Y3DE 3GEGA 1JHYA 2YWBA 1AKEA 2YINC 3PB3A 3L0IB 1T9GR 1AIPA 2PXAA 4G5GA 4A9AA 2PH5A 4QBHA 1Z8HA 3VPDA 3W6UA 4E22A 1JEYB 2I03A 3KQOA 4ENTA 1Z4MA 3KXKA 4LGCA 3H1BA 1H6DA 1KL7A 4DIEA 4JJ6A 1XJWA 3KZNA 3UAYA 1NNLA 2PAFA 4WQMA 5EYPA 3SC2B 1FYWA 1WPXA 1JR6A 4TKUA 1CDOA 3BFJA 4ZT3A 1SUBA 2KB0A 1OBCA 2ZOSA 4HZUB 3OIDA 5ALDA 3WNCA 3SWWA 4K28A 4NL4H 1KI8A 4O4IB 3U39A 3KZOA 4A8TA 4ZI3A 1XWWA 4YGYA 4PYRA 5F3WB 4FNMA 1VTKA 2G6BA 2YWGA 2DHRA 4FCWA 4UOQA 2X1HA 4YBRA 3TZLA 4MDEA 2R48A 2WU1A 3EIUA 4L16A 5SZHB 3L7OA 1GARA 3VZSA 1U8ZA 2CMDA 1Z25A 3IR7A 1QKJA 3EDCA 1LA2A 2Q5CA 3RTBA 4CGZA 1OH6A 2R8BA 2FQYA 4UVGA 4RL4A 4NEHB 1Z39A 1WXHA 1YE3A 3OEHD 3EUAA 4KQ9A 4P0TA 3GHYA 1RXYA 2Y1CA 2IEBA 1PQYA 2Y0DA 4MB6A 4B73A 2DFVA 2JFZA 5KJFA 2H08A 1GL6A 2JB9A 1E64A 1EVYA 2SECE 2B92A 6Q21A 2W00A 3BILA 3DV0B 5H16A 2I8AA 3KB8A 1HZZA 1OXTA 5IW8A 5BQ5A 3RU9A 3MYRA 2I8CA 1Q83A 3DMDA 3KC2A 3SXJA 2QW8A 3CUKA 4RSGA 1Y9ZA 2GPWA 4L8VA 3SE0A 1PZGA 2IS1A 1WZIA 4MVJI 3GFQA 2FKNA 1ZL0A 3D54D 4M1ZA 3TIVA 4D43A 2RD2A 3TB4A 3GT0A 4J3JA 1NXOA 4UUOA 1LTHR 2W2MA 3INYA 4FVTA 1TJ4A 2VUSA 4M36A 3R0QA 4MWCA 2UZ4A 4BNIA 1CY4A 1PW7A 1Q7EA 3E7WA 2A33A 1NI4A 1CEEA 1DC4A 1R9NA 3VPHA 3WWZA 1SHJA 4W7HA 1FRVA 3VYWA 1ORTA 4KG7A 2QOEA 1VE1A 2Q1TA 3HP4A 4KRYA 3UENA 3X1JA 4ENWA 4M83A 3LGSA 5L4SA 1BTOA 2FPOA 3QTLA 1E9VA 4L51A 5CLFA 2GKGA 1C8LA 3IPYA 3NRJA 4FYPA 2QN8A 4MCHA 2R8PA 1NUSA 3K09C 2LCFA 4O25A 4WJKB 2I1WA 3JATA 1BQEA 4UQLA 4Q3NA 2WG0A 2PK3A 5BSMA 1L5RA 2VAPA 4N3GA 4YRAA 1GAEO 3FKSA 4ID3A 2HLPA 4BLTA 1BD3A 1MD9A 4TVKA 4Z4QA 2BL4A 2X86A 2CHVA 4PM4A 3ZE8A 4FMBB 5FAKA 2LIPA 3U49A 3WGKA 5D3QA 1K9SA 4C7MA 1P2BA 5CYOA 1YKFA 4KXQA 3RTGA 4YCLA 5EJ6A 2J3IA 1OWLA 3FI9A 2JGMA 3JALA 1KRXA 1UBUS 3DMHA 1DG9A 4JEUA 4AUEA 3B13B 3HUEA 2Z83A 3HPQA 1D9ZA 1X7XB 3PDUA 3SFVA 1BWRA 1G8YA 2EQ5A 3LNTA 4N47A 1NKVA 2B4TO 4P34A 2ZYTX 1Y9DA 1CY0A 1IBRA 2IGBA 5FBZA 1YVPA 4DGSA 3UHJA 3VMMA 4PINA 3TZHA 1SBYA 1A0OA 1D1QA 3R3UA 2FZ5A 4OXKA 3TK1A 3W1EA 1TCVA 3M6MD 4UVDA 5C5DA 2WKPA 3DUFA 3MWLA 4MDHA 1X19A 5B7PA 4BFZA 4P4SA 5IBRA 2YBDA 3G23A 5C5CA 3WQSB 4EG4A 4PBTA 5ENZA 4DBVO 2HSWA 1X15A 2JCYA 1TGVA 2WYIA 1X14A 3PC6A 3A37A 3TMYA 1CC1S 1USIA 2GN9A 1GNRA 2VDQB 2X9GA 2F1JA 3DKKA 4JAVC 3UMSA 1KOLA 1L7RA 2JKZA 3L8CA 4GOND 1EA5A 4BWFB 4NHEA 5DM70 5FNVF 3OEEA 4CTKA 4NATA 2PXXA 4IOLA 3ODGA 3S2YA 4PGMA 4F0JA 1CXZA 1GGNA 1SUEA 3GFFA 2D59A 1EB8A 3B70A 1E58A 3H9CA 4ZO6A 1LPSA 4XPIA 5BNIA 1C1XA 3FTPA 2X5XA 1A1SA 4WK2B 2P6RA 4X1KB 1ZVQA 2VXOA 4JFRA 2AFIA 4PX5A 5SYNA 1WF6A 5DYWA 4TQ9A 2G06A 2XH8A 3UIEA 4UFOA 1MVLA 1RXEA 2NIPA 1EFRA 2FX5A 1O89A 5LNK6 2H5IA 4NYIQ 3H5WA 2Q6VA 4YAUA 3GUCA 2CVOA 1UL1X 4BWGA 5FOTA 5PNTA 2W71A 4M1KA 4HOYA 3DXZA 2C7BA 4DG9A 4OHBA 2WFLB 4QYIA 2VLIA 2A0WA 2IXGA 3MOSA 3FNIA 4H7EA 4R68A 3RSZA 2AZDA 3WB9A 2BGLA 4CKBA 3SZLA 3WYDA 2PCLA 3MWDB 3PD7A 1NBIA 4IS2A 4JC5A 3J80A 2H16A 1C3EA 1GAQA 4P9NA 4IXMA 4JVSB 1F2TB 5AVQA 4YQYA 1A3CA 2HBYA 3OJOA 4GX1A 4OA8A 1UDRA 2JKYA 3PDIA 2ORIA 2EOAA 2YHIB 4RENA 5L4NA 2WNSA 1OI7A 2EFJA 1M0WA 2O5CA 3CB2A 4GH5A 1OFTA 3IAHA 2FMUA 2P75A 4OK5A 2GF9A 1D5CA 3PFBA 4LV8B 4PZLA 3UY4A 1YUBA 3KZXA 2ACWA 1PZHA 4HDMA 1QAMA 3IPCA 2C88A 1UMKA 2MSLA 3PG5A 4WFJA 4X1KA 3W77A 1BMDA 1XRMA 4UJ5A 1T5SA 3I6ZA 4BAUA 2GPNA 1PZEA 3PLRA 4TV8F 1WNTA 4FNOA 2FSVC 4XLZA 3F6CA 2A0UA 5DHQA 2XEDA 4EGSA 4Q82A 2VOJA 4GR9A 4I6JA 2R97A 5KOJA 3FUWA 5C53B 4OHMA 6GPBA 1WNFA 5DVZA 3WLAA 2HW8A 1NUHA 3RNLA 4KO1S 3DFUA 2PGXA 4X1IB 5IJXA 4ZHQA 2AFHA 3KAKA 2N42A 1VIAA 3FTFA 2WU8A 4FOOA 4G09A 4LY0A 4UTVA 1C3JA 1YDHA 4BVBA 3DUFB 2BEWB 3IJPA 4OK3A 3UBMA 4ZHQF 3PEWA 1QF9A 3EZXA 4FMPA 2VJOA 3IILA 3LZCA 1J07A 1L4YA 4EIWA 4BO5A 1YR2A 4HAVA 1ZIXA 5CB4A 3M6XA 4ND8B 1GQRA 4A8PA 3DEIA 3SJZA 1JWAB 4XUCA 1BHO1 3V48A 1J24A 4US2R 3KFVA 2XDQA 1Y63A 2BOVA 5I45A 3HDQA 5DEIA 3OQBA 3WL8A 3EZYA 3OIFA 4CKWA 4FEEA 4QGBA 3X1MA 5ER9A 3QU7A 1DRKA 1ABFA 1HNNA 3NHKA 2PJZA 2WUFA 3FHTA 3R5HA 1YL5A 2FMXA 3JAWB 1I9CA 3DXFA 4WZ6A 4BP8A 2DETA 2EX0A 4HBZA 4ZD6A 4X20B 3ISTA 1SZJG 3SQXA 2JA2A 1YJCA 2C42A 4NNOA 4C7XA 2JFBA 1B8NA 4O8CA 4YT2A 7MDHA 4O3MA 2QEQA 5BV7A 4KGVA 1U98A 2WP8J 4F1WA 2EFEB 3JZDA 4DBLE 5DF1A 2XRMA 3GP8A 4YUXA 1ZA2A 3W4KA 4MVWA 3F1LA 5KYUA 1XVTA 1NAHA 3TCXB 2VK1A 1KQFA 2I54A 3EISA 5ARDA 5HRUA 5DYNA 1GM5A 1M1UA 2ZGVA 4I08A 2RH9B 3LWZA 4G8DA 1HDZA 1Z6XA 5LZ9A 4AJ1A 2A0YA 1O95C 1XCBA 2PV0A 1U1CA 2R5WA 3M4ZA 4MRVA 5ALHA 5U4XA 3EFHA 4FFVA 3T5GA 3WGYA 4AJ4A 4R0MA 1H0HA 2BJWA 2XYRA 1W47A 2PFKA 3HEBA 5FA8A 3CEAA 2GEKA 3BFPA 5JCPA 1PTKA 2YJNA 1Y81A 2VHEA 5ECDA 2EJWA 1P5RA 3AR6A 2QLFA 2XZPA 3HP1A 1IBKB 4KIGA 3EIHA 2RAUA 3CY6A 1EP3B 1II8A 3EXAA 4YRDA 3SZOA 3WQBA 1QO7A 1E1RA 4MHOA 5D7BA 1PBNA 4YP7A 1NW8A 4RU1A 3TDNA 3TDKA 1E0AA 1S2IA 1Y5NA 1P44A 3QVUA 2CZQA 2HWXA 5BNWA 1N3IA 3Q9UA 2GEBA 1T3LA 5CFLA 4L5CA 1KMMA 3A25A 5CB8A 5CB4F 3RW9A 5FWDA 3I9MA 4O4LF 4OBBA 1U02A 1QF6A 1XZAA 1S2DA 1X7WA 4BLSA 5FPHA 3EEQA 2LE0A 2JCBA 4Q00A 1I3NA 4C87A 1E2MA 3CF4G 5BUCA 2W2TA 1FP4B 3BWCA 2FP4A 5BN4B 5LBUA 4BYGA 3A9WA 4ATNA 1J5PA 1C9JA 4N5NA 4F9TA 2GJ8A 4P5EA 3K9GA 2IOQA 4YMVA 1VQ1A 3NKFA 1L7QA 1OCEA 1YDWA 2MMGA 4FOPA 3HR8A 2HCBA 4PFJA 4UEQA 5EG5A 3E2IA 5AKZA 5F3RA 4QODA 2FPKA 1ISFA 3B2EA 4X3PA 1XXHE 1XF1A 3FCUB 2J09A 1N5KA 3B9PA 2EW8A 3ORYA 4AJIA 4WFIA 3C3DA 5IBCA 1JIKA 4JUBA 3ROZA 1QQBA 1GAXA 1RXWA 3DKIA 2TMKA 2VYVD 3VSBA 1JFSA 1IN4A 2OILA 3OESA 1HH4A 2P68A 3L0DA 1VP9A 1XZIA 3NNNA 4WI1A 4KYIB 1OA0A 5EYPB 4RH0A 5LN1A 1KZ7B 1Q74A 1BC5A 1IQRA 3AO0B 2Q9UA 1Y1KE 3RHZA 2QN7A 2UV8A 4WWHA 2GEDA 2G9VA 2QSYA 3QKIA 2QZPA 5IVDA 2R6JA 3I39X 4ITVA 5ALTA 4DDHA 2PVSA 4UDNA 2F8LA 4F85A 1ZD2P 5H4HA 2YHSA 1W0CA 1QK3A 1TKRA 2IIVA 5F7XA 3C85A 3ON5A 2QMQA 1RM5A 5FR2A 5JVDF 3IVGA 4H0NA 4C0BA 3IKLA 4WBNB 3GWGA 4JNKA 2C5HA 4MI3A 2GK3A 5I8ZA 3A2NA 4AFNA 1KYVA 3ZDRA 5A0VA 1S5PA 1PGJA 1EJ0A 3BMCB 1N7JA 1MXHA 1EFPA 5A9TA 3EDOA 3JW8A 4EFNA 4EH1A 1EG7A 1UOQA 3R4CA 3T5DA 4GZ3A 4IOMA 3AXTA 2NUPA 2ZUDA 1VHDA 1H2XA 1QVZA 3ONVA 4I55A 4R1TA 1AOXA 2VZ8A 5IN5A 4D2IA 4LQCA 4UBIA 3WGMA 1FUUA 1VE9A 2A0XA 4HPJB 3TB6A 4BKOA 4EY7A 2QTHA 3ABIA 1WO8A 2QTCA 2Y1XA 2ZRQA 2J5BA 4LPKA 3EGXB 4M0MA 4UPVA 3PEYA 1M6NA 2EAUA 16PKA 1JQ3A 3IR5A 1LV8A 1EJ6A 2EL7A 3KVNA 1RABA 4JP5A 5HJEA 5HPYB 2PD3A 1C7JA 2D0PB 4OG2A 1DZ3A 4IEIA 4KFRA 3EXIB 2C83A 3LVFO 1A9XB 1EU1A 4B6FA 1GGJA 1Z5WA 3CLUD 4NEGA 2C98A 4RZSA 2IU6A 3F71A 1JHAA 1PIWA 2RAPA 3LQYA 4E94A 4I81A 5HS4A 4KXNA 4OX9Y 4IJMA 1XCMA 2GILA 4L9WA 4G1EB 4O3FA 4S05A 1G6OA 2EDCA 2GVDC 3GFTA 4C03A 3UJNA 2XUDA 4D3FA 1Q57A 3AVYA 3GLKA 1H2AS 3SD7A 1XVAA 4PNZA 1B74A 3T5TA 1YMVA 1X3LA 4GZMA 1M8GA 5F21A 5FL7A 1XWFA 3UEOA 4AP5A 1ZUHA 2R5FA 4LW8A 4ZDIA 1ZHFA 3E4CA 2NO9A 3B1VA 2H1LA 2H57A 5DYTA 4PICA 1LBTA 3ZXXA 4BLWA 1XP8A 1I36A 1COZA 2CUZA 3ZOZA 2WBLC 1WHTB 4CKCA 3KUXA 1K06A 1P7PA 1U81A 1FTWA 1RE0A 1DUVG 1YRHA 2V58A 3KDAA 3L8YA 3Q87B 2GK7A 4KAFA 4ZO9A 3X2SA 4BBPA 1D8AA 1XELA 1UJCA 4N82A 1I0IA 5EHQA 3GLIE 5EESA 3EVZA 3N76A 3CUYA 4EFDA 2XNCA 1ZI6A 1M2VB 5ES4B 3C3EA 2VNIA 1QONA 2AE1A 3GPBA 1VIYA 3KLOA 4CTJA 1UQTA 3CEMA 2QJTA 1UBLS 3C7DB 1ESZA 5DSZA 1ZC4A 1GTL1 1HLPA 3IAM6 3OOJA 3VJLA 3KQYA 2J07A 2WU4A 3QEJA 5BXYA 3KQUA 3ND5A 4KXYA 2QP4A 4CEIA 3GLIA 1I4EB 1YRWA 3A06A 4GOOD 4J7AA 4C4SA 2OV2A 2PGAA 1I2BA 3PA8A 4Y2HA 1GN9A 2BHRA 3AHGA 3DEAA 3IV6A 5FO1A 1JH9A 4IKOA 2PGLA 3E9MA 3UJHA 1NVUQ 3N0VA 4Q3DA 4FLFA 3MWKA 4D9JA 1PVDA 4RD0A 3G79A 2WF9A 3IEIA 4NE2A 4EMUA 3PT5A 5BMVF 1FYEA 2UXBB 3WK8A 5FWNA 5BW6B 3WGZA 3LPMA 2G77B 1Y4DE 3N2NA 1JS1X 5TQJA 2IHBA 3HKDA 2QL5A 3QQ5A 4EEKA 5FOQA 1E1DA 3CFYA 1LWOA 1H0RA 3GJXC 1E9SA 1V95A 4R1PA 4Q1FA 1PWXA 1NM5A 4GUDA 4W1PA 5IJWA 2BMJA 4BMOB 2I6GA 3KQWA 2BHTA 4GGOA 1SIUA 2B34A 4BWYA 4BNHA 1T9AA 1WR8A 2HK6A 4DAEA 5COBA 3CE9A 3LCRA 3FOFC 1O6FA 1NLMA 2WV7A 3B3JA 3CLUC 3F3YA 5E0KB 4Q4HB 4C4XA 5EIWA 5LJLA 2C2WA 3FHCB 1M0TA 4AY4A 3AQIA 2ID4A 3AEYA 3B1WA 4B34A 3N53A 1K89A 3HO1A 2OGTA 3VHRA 1JJAA 4YAGA 3IVCA 4QELA 4P3XA 3AK4A 2OGZA 4FC7A 3T9BA 2Q1UA 2XA1A 4R1LA 3MF4A 4N54A 4C21A 4URHA 1ZBQA 4G23A 4JT9A 3COJA 2GD2A 2J7PA 3L92A 2I3AA 4RD2A 4RPIA 5HE8A 3WGQA 4FR0A 1M6WA 5JLAA 4PSDA 2GCGA 1GTZA 1VBFA 3T3HA 5L51A 1LJUA 3BM5A 4G1UC 3UAOA 1OOEA 3CINA 3RWOA 1TQ2A 5JSUA 2PANA 5I9IA 1GDTA 4C0JA 1PQUA 3AC0A 4JQZA 3LC0A 1GNQA 1GO2A 2YN0A 1YCDA 3OTHA 4KU4A 1SKYE 2A1TR 2QW1A 2FFBA 1DKNA 1DWOA 4RPJA 5L3QA 4CM7A 4QXOA 1WKBA 4CIDA 1AC5A 1UBHS 4DADA 4F3RA 3B1ZA 4G0WA 5JRDS 4O4HB 1QCCA 2X9VA 1AK1A 2WJVA 5TMEA 2Q8NA 3IDQA 4DY6A 3VOSA 3BSSA 2L18A 5JOQA 3K15A 4D9MA 5F35A 1S9DA 4KRFA 4FIDA 1YONA 5TX7A 4FCTA 3C48A 3JRXA 4CIWA 5IM5A 2J5KA 2I65A 2ZPUA 3I3SR 4DPMA 2WZQA 4KB5A 2MYTA 3TTYA 4F8YA 5JSZA 5ALMA 4W5TA 3C1UA 2CVZA 2UYOA 4I19A 1JSCA 4AZVA 1MB9A 1MP0A 2CCGA 2GO1A 2PUBA 3KZKA 1JHQA 1JNYA 4CQLB 2BGKA 2QX8A 5EVJA 1GTJ1 1KEPA 3RABA 4DJEC 1WCV1 3I83A 5JVDB 3SICE 1LI5A 4DDVA 3SSAA 5A9SA 2Q41A 2XBUA 5HRCA 3TMKA 1ZKMA 5MN5A 4GM0A 3MS4A 2DQZA 4PCVA 4NCAA 2FW8A 3K1YA 2QBYB 1N5IA 1MVNA 1QLJA 2HBRA 3QLUA 5IVPA 2YQ5A 1OI4A 3LAWA 5HK9A 1KK3A 4NFYA 3PHLA 3RSOA 4HFRA 1IN7A 4TT3D 2Y9MB 4PO3X 3R5FA 1NW9B 1QQTA 2B6NA 5T41A 5C5EA 1Q14A 1UODA 1XXHA 2VSXA 5G0SA 4DMMA 3C8DA 1GTG1 1A7KA 1QF7A 2DKOA 3UK0A 3JQGB 3O93A 1W36C 3L7NA 4O4LA 5KQSA 4EMTA 5DYGA 5EP2A 4A8HA 1X74A 2WM8A 3WG9A 4Y2SA 2FW0A 1L9XA 3T4XA 3HYNA 5FR1A 5A3RA 1AQLA 4WN9A 4UVIA 2COEA 3GUVA 2FN7A 2GESA 3H1GA 1DFHA 3H17A 3AFIA 1VL6A 1RRMA 1UPCA 4IFEA 4PW0A 2B1RA 3KB1A 4XIGS 4NFSA 3AHIA 1RWWA 3VDMA 5ICGA 4REQB 5AVJA 2XEXA 2VYVA 3ST7A 1RLUA 2H4JA 1L7NA 1G9TA 5B5SA 3HBAA 4OSOA 2FPMA 1K88A 3LM8A 5LM3A 4RAQA 2XCLA 3KQLA 2PUDA 1E9RA 4OIFA 1H5QA 1XTRA 1J7JA 5DT9A 4HGQA 3T4UA 2PUAA 4D46A 1A8PA 1SNYA 1PV1A 4I4CA 3M3DA 4E2YA 3TSAA 4QLBA 3AR8A 1KRHA 3ZWYA 4C89A 2CXRA 5FI3A 3JYQA 3KE9A 4LQ4A 2VJMA 4QFMA 4AS3A 4IMRA 4ARBA 4BX8A 2DLCX 1XAGA 1A5AB 3VVMA 2GBLC 3L02A 3H86A 3DKPA 4R5MA 3V34A 1CW2B 5THXA 2KW5A 2ZVJA 4YROA 3VPAA 5K3BA 1JU3A 4QVGA 2QRNA 3IQXA 4UUMA 2XTNA 1U99A 1CUHA 3OOYA 2CVFA 2VSFA 1F9EA 1DV1A 1OSNA 2LGJA 4H35A 1XQXA 4XFDA 2DULA 4EF6A 3ZKWA 4HGOA 3HDYA 4FKMA 2ACVA 4KOEC 4RANA 3PFFA 4X6XA 1PJTA 1OXBB 2R8XA 3ITDA 3WYCA 4JBHA 3SHTA 3WLMA 2QUZA 4QHSA 4BQOA 1JLKA 4GEGA 2ADMA 4L74A 2GNPA 2ANCA 4XJSA 4LBZA 4Z49A 5BN3A 1EYZA 3OCXA 4KH1A 4YFVA 1YOVA 3AU9A 4ZZ0A 5I5GA 5KCMA 5JBNA 1TTTA 2WJYA 1T2AA 3A2MA 5HKBA 4KBFA 3EDMA 4EY3A 2IF2A 1SIBE 4D8YA 2AJTA 5IMBA 5CK4A 1LVGA 4DKJA 4YUZA 4AWXA 1P6UA 3VBEA 4RCZA 1K68A 4DBLC 4NYIR 3OOWA 5KOHB 3C16C 1U2RA 1G55A 3WWEA 3HCFA 3L07A 2UZ1B 5E3JA 4IG9A 4DRYA 2PVCA 1FJ2A 4HDOB 2JCSA 1OX4B 5AJWA 3CX6A 5IAJA 5F52A 3VH1A 1NI5A 3AW8A 3QBJA 1DLIA 4KVFA 4B0OA 2GCOA 3N2GB 2JHAA 3IT3A 5T4FA 3OQIB 1L6IA 4ZOAA 4G0YA 4BQFA 5KOIA 4PEVA 1PVOA 1IZ7A 3VUFA 2CXTA 3DMRA 3QE3A 3VR3A 5IU6A 1F3LA 3ZBUA 3FOWA 1UC5B 1WB5A 3KB6A 2O2EA 2PX6A 1M66A 4ZICA 3F1KA 4QGHA 1F8GA 1KY2A 3O2NA 4IH4A 1ISHA 1BH2A 1E2LA 3D6AA 4IM7A 5EWJA 2H18A 3OA2A 3HJHA 4HQRA 3O82A 3LXXA 4UNSA 1W8DA 4WY2A 4RK0A 2C5GA 4LSWA 2BFCB 1V9LA 4E5VA 3R1IA 4TMYA 1BEEA 4S12A 1PNOA 2QTVB 1ZOSA 1FUYB 2XWPA 4Q4AA 3REQB 1YZYA 4FI3C 3W5AA 2C9BA 1BJRE 3Q7RA 4NS4A 5LYJB 2VHVA 2ZWPA 4BWVA 3D1VA 3PX3A 3A8TA 1B41A 4LV6A 4KZPA 4MV6A 4E13A 1JQEA 2ZIVB 2XUQA 3IUMA 3VR4A 4U3JB 4U9HS 2JIOA 3ABOB 4XVRA 5ITSA 5IDWA 2UDPA 3E6AA 1GAWA 2HZBA 2QQ5A 3GGJA 2GPJA 1E4VA 3SMVA 1P0CA 1TPYA 1KGDA 3WRXC 2WNIA 3PI7A 6PFKA 4MYSA 2FUG6 3QVTA 4KHZA 5BRAA 4JYAB 1KRWA 5CT6A 1U2QA 2QQEA 1YU6A 3QHAA 4J0GA 1ANKA 3PX2A 4PGFA 1ZI9A 3DP7A 5E1MA 3AJ8A 4K6OA 1U2TA 2ZUSA 1L7EA 2W8BB 1S9HA 3D7MA 3KWLA 1KKLA 3CRNA 3NYIA 4IJQA 4TN1A 1UZAA 2GA8A 4EMBA 3NWBA 5LOVF 3KPJA 3WLPA 3FDZA 4D0GA 2XVXA 4KZKA 3U1VA 4ID9A 1RRVA 3WKBA 1UCFA 2IVZA 2DUJA 3MMPA 4LVOA 4RVFA 3ZIUA 4ONEA 3HKCB 4OHPA 4RF2A 1ACMA 3I6QA 1QIIA 3K6JA 3SM9A 1CJUC 2BFDA 1YR1A 4GX0A 3U61B 3KFXA 1GTRA 4LZJA 1BHQ1 1G2QA 2QRGA 2YC4C 3LHFA 4GC9A 2IH5A 4M9RA 3ZU5A 1AK9A 3NHRA 3SZRA 1E62A 4FZJA 1JWLA 4JJAA 1EE1A 1MDFA 1K7SN 1PR1A 2L69A 2Q3HA 4ZDWA 2F48A 5DULA 3G7NA 3ICPA 5LU9A 2ZI7A 3DOIA 1OWMA 3E3LA 1QQ6A 2QIOA 3LKVA 1IY0A 4UU7A 1L5MA 1WY7A 4QWWA 2DR0A 1JKJA 4CMKA 2QTBA 3EWAA 1P1IA 4M8LA 2P2ZA 4RK1A 2JFVA 4ZQGA 2FE4A 3ZV5A 3B6EA 4EY8A 3GG2A 4JSYA 4MX8A 3QPAA 3VTKA 4D25A 3FYDA 3S0JA 1W36D 1JBEA 4M2LA 2FOLA 1ZNYA 2QNBA 2YUIA 3MWYW 1ES9A 3Q3CA 1T3SA 4K3UA 4L8LA 3LW8A 4M6WB 5TC4A 5JO0A 2XRZA 2H2GA 5LYJA 1Z4OA 1G5RA 2X42A 1ISJA 3MD9A 3ZGVA 1H4QA 3BCHA 1DINA 2NUTB 1DT5A 5HZGA 1QGUA 2ECFA 3ZTWA 3JYLA 5JDCA 4KR3A 3WLKX 1JILA 1XP5A 2OQIA 1KPGA 2HF2A 1NMYA 2R8ZA 2ZJZA 1ZVKA 4RK4A 5JS6A 3VPXA 1M2KA 5I51A 2HA7A 1YK0A 4AURA 1SN7A 1N2HA 1SEPA 5AQ1A 3W9SA 1JZQA 3T8YA 5KJ6A 1BDBA 1I4TD 3IP8A 2ZIXB 5KPDA 1LFDB 1ZGBA 4QYXA 5CITA 3DMPA 4QEKA 1VB5A 4WBXC 4AXXA 1M6VA 5SICE 2DGDA 3KEMA 1KFBB 5DHFA 4Z5XA 2P69A 3K0AB 3VV2A 5A5DA 3CURA 2R79A 3T9DA 1TQHA 2WJHA 4LXQA 4B6EA 3HUDA 1ESCA 1QIHA 1QKKA 4ZYUA 3ZI0A 2G9UA 1I5RA 2EQAA 5IH7A 3D7KA 4B3TB 3ORHA 4NI5A 2L0XA 3U16A 2WRZA 1IYZA 3O8CA 2P2LA 3G85A 4Q47A 4FKZA 1HQKA 2R86A 4ROSA 2B99A 4DWWA 3ICEA 1WEKA 4E11A 1XQYA 1ORDA 2EFDB 3U3DA 2VQ3A 2FN8A 1CDZA 2LKDA 3ZE9A 5DLQC 3E5NA 2G72A 4ITUA 1ZM4A 4LOHA 5JANA 4L5BA 3VZPA 4OHVA 3VZQA 3K9WA 2QR3A 3ASVA 1Z7WA 2FXVA 2G4CA 1Y82A 2OCPA 4JB8A 3JX9A 3DONA 4XCVA 5C2JB 5E0OA 3VC7A 1K0FA 2X5NA 1N1DA 2BFEA 1D0VA 3CLSD 3OTGA 4KJZA 3ET4A 4MIOA 5A3VA 1P2UA 4IRXA 4BP1A 4CEHA 4Z1MD 1M2JA 1E2JA 4N40A 1SXGA 4B3MB 2Q3JA 3WWPA 3ZHBA 2B5WA 2YQZA 1WKVA 4EG5A 2YW9A 3G59A 2XKKA 4P3PA 5K3FB 2ZAMA 3LX6A 4KSBA 4V0MA 1ORVA 2HU8A 3DF9A 2H1WA 4AN4A 4YAJA 4CG1A 2AKAB 1PJ4A 4HAWA 4ND7A 1DMSA 1F6WA 1F12A 4LJYA 2ONJA 1QZZA 1WULS 4EYGA 2CDCA 2WR8A 3BXEA 5ADVA 1AMNA 1ZOOA 3WFJA 1SELA 3SEFA 3FKSD 3COSA 4LMAA 4AJKA 5HK8A 1LD3A 3NUGA 1Y5MA 1C8BA 4XR9A 4F5EA 3HDTA 3U7FB 4E0BA 2W8ZA 3VO1A 4J29A 3G2IA 5IXYA 2X40A 3OO1A 3OJCA 4RQTA 4WY8A 5FP0A 5KQRA 3KB2A 4MIYA 1P5HA 1U1DA 2RK4A 2VH2A 2QLJA 4DC1A 4WBNF 1JWBB 2D00A 3U5TA 1G7RA 3WHLA 2DFKB 4C3OB 2OGSA 2JAOA 3G2OA 3KT6A 2E82A 4TMZA 3FNQA 3DCNA 4IEFB 4V03A 1F0NA 1K2WA 4G01B 4BAZA 2V5UA 2B7BA 3PFKA 1JQDA 5E6RB 1D4ZA 1C9MA 1P3Y1 1QHXA 1XFDA 3GXOA 3SQNA 1G64A 1C9EA 1G5IA 3PGJA 4M8KA 1P5JA 1MPTA 1J70A 2LDXA 2QX7A 1M5RA 3TL3A 1ZN2A 5AFSA 4HVCA 4UNPA 1TIBA 5CMLA 4M9CA 5CFQA 3SC3A 4JLKA 2V7BA 1SUWA 2AFIE 1A9QA 3LQ4A 1Z6TA 3EXG2 1POWA 4MHTA 3G9UA 3JV7A 1J06A 1N2ZA 3AERB 1MF7A 5B58T 1SHLA 1GVNB 2AEFA 1BS2A 2V9CA 1XTPA 4AU1A 1HE5A 2D06A 1IMOA 1GITA 1T0UA 3DQQA 1FIUA 2D2XA 1DIHA 1QK4A 1RD4A 5BWBA 3JQ7A 1JR3D 5CK5A 4OL0A 1CF9A 1RP1A 2ZDGA 3NDBB 2GEVA 3LWDA 5EJGA 2EJUA 2FGKA 2RKOA 2PBZA 2FEOA 4W7SA 3AQ4A 4OY3A 1MC4A 1ZK1A 4PQRA 2ZSFA 1JDZA 3AIMA 4B5KA 3ETLA 3HYTA 1G20A 2FF7A 3U4CA 3DV2A 1DEXA 2DFTA 4IXWA 1IDN1 3ADCA 3PVCA 3R3ZA 4N5HX 1UWCA 5EOVA 2BGGA 4ZT2A 3OEWA 2FZCA 3Q1LA 4W6ZA 1KYTA 1T36A 4JGGA 4CLOB 4RVSA 5A06A 1BAPA 4DARA 1ZR2A 3D4LA 4X63A 1WSBA 3ZCUA 4ER7A 4DCUA 5JYEA 4KYUA 3KRTA 4J6EA 3WZ2A 1A7AA 3RVPA 4Q4CA 3UHFA 4DJDC 3ZJUA 3DDSA 3DVQX 5BPFA 3CS3A 3SF8B 3LXMA 3WGJA 5E7JA 1P62B 4QUKA 5CXUA 4TV8A 1ONOA 3JVUA 2GDJA 1UMBA 1LTQA 3DE7X 1GA6A 1T9KA 4DYVA 3HU3A 4TV8B 3I09A 4TKVA 3GZTB 3O8QA 3VH2A 1T1GA 5KBYA 1IZYA 2WJJA 3ESQA 1ZAKA 2AJCA 1UT6A 5DTEA 5JY1A 5KNDA 2GXSA 2DECA 4NESA 4DV0B 3KJIA 4QUGA 2O2XA 2OPHA 2GCIA 3H9JA 2P65A 3KU4A 1OXVA 3HLKA 1H2BA 4HUJA 1R9JA 1IBMB 2WIBA 4MWDA 1A9SA 1MGOA 1T3HA 1ZJ4A 2JIZA 3E9YA 1QGAA 1TW2A 3NHLA 3TQFA 5BO5A 5C35A 4RVDA 3OU2A 3G8BA 3OZTA 2IBTA 2F1RA 3P45A 3P9KA 4GI1A 4HB3A 1SJ9A 3HRKA 4HPWA 4QATA 4B7AA 2FP4B 3H6GA 1H66A 2YWXA 4J0KA 3K8QA 1JQBA 1R1DA 2C0PA 4WEOA 1ZIOA 2ZYVX 4DPLA 2CLHB 2ZKIA 1M34E 4P38A 4LZLA 5CHEA 2Y0BA 3ROPA 5KYGA 4NTZA 3HPRA 1MX9A 4F84A 4ALKA 2WQ6A 1TA9A 4UTNA 5LZ5A 3G0HA 1H4VB 1LF0A 1Y4ZA 4C4ZA 3DYIA 1DPFA 2YRWA 1I2MA 3L7DA 4M7OA 1GEGA 2QGZA 5HBRA 4OF4A 3SFZA 1E69A 4QOHA 4X9XA 5J4HA 1KEZA 2DWOA 3RNOA 3CVUA 2VJLA 5FOUA 1UEIA 1W9HA 3AU8A 5JWOA 4UUAA 2DHDA 2V45A 5REQB 1ZM9A 1CRWG 4L7VA 3QUAA 4XM2A 3CVOA 1E79A 3CNOA 5JNRA 3RYHB 3ZCVA 3EFOB 1OV4A 1V5FA 4TS3A 1U7ZA 1FSFA 4X6UA 3E27A 5FBWB 1EFUA 1PFKA 1ZMBA 2IE0A 3WDKA 5AUQA 1XZCA 1BIFA 2JGKA 3LVBA 2IF0A 4J7XA 4AF8A 2BFAA 4JJGA 3P9QA 1N92A 4P98A 4Q66C 4Z4IA 1RZRD 4MA0A 5CAEB 2VYQA 4RORA 4BGUA 4CMEC 2NT3A 2V0NA 4Y8VA 3ZDCA 1P8AA 1H1LA 2EC5A 2IYUA 1EX7A 3WR5A 4HC4A 5CXSA 4G4SP 5KU7A 3RT7A 5BN3B 3HKBB 3RSGA 3BXHA 1PJQA 2LZ0A 4IVQA 1PQ4A 3KJFA 1OC4A 1XPRA 3GGDA 2J32A 4HADA 3ZDZB 3DO5A 1N2SA 1E2IA 2Z8YA 1R8QA 4BCCA 4MGIR 1KDTA 4BEVA 4YLYA 5KREA 3JD2A 2P41A 3JYOA 1PUJA 1QIDA 3U31A 4E70A 1W49A 3RSLA 1E4OA 2FX2A 2V9PA 3NMUF 1H8ED 3PD0A 5GONB 1XG5A 1OGJA 1VJ5A 1JT2A 1JTVA 4H1HA 3OZWA 2QTNA 1S89A 4DB2A 2HR1A 2ZXFA 3X2EA 3FPHA 2PR2A 2REXB 4ND8A 3V8MA 1JSXA 3CTMA 4R1UA 4D0NA 3H2BA 2GETA 5EHXA 2VHCA 1ZGCA 2VP6A 4M0EA 4URVR 4C6SA 2OG2A 4A5OA 4BE7B 3IKVA 1FCJA 4FMCF 3F96A 5KMGB 3EIXA 3JQ8B 3WAJA 3UAZA 5FNVA 3UAWA 3IYLW 3FBTA 4M21A 4B8WA 3ACCA 1WMBA 3P2EA 5KHAA 4F3YA 1E96A 5DNVA 4IF4A 3SYRA 2GJ9A 4URZR 2E5FA 3M0EA 1IJKA 2IRWA 3I3OA 2ET6A 2OFPA 2OXIA 3K2QA 4MW2A 2WMDA 2WVJA 4H16A 4HT3B 1A5TA 1WXFA 5KTRA 1NF2A 3IULA 3PQDA 5JAOA 4Q4JA 3QUBA 3LI2A 3WKCA 4A4DA 4X00A 3FFBA 3AUFA 1RFLA 3R74A 3I5AA 3O4RA 4KAAA 4CLHA 4D26A 3KOXA 1UWVA 4DDKA 1PFVA 2X3YA 3HCDA 4XB6B 5I8WA 3LIPA 2PPLA 1B8PA 2UUOA 4WK6A 2EKZA 1WLYA 5FPSA 2WG2A 5KX5F 2PVPA 4YS6A 1QTQA 2AUMA 5C5IA 4H4DA 2CJYA 1Z73A 2UUAB 2NU7B 2W2QA 2VHWA 2ZBEA 2PBLA 4GMKA 5DNWA 1L5NA 3R9IA 3UM9A 2G36A 2FI1A 3MAAC 2QBYA 1WDLA 3S2ZA 4EPWA 5FTLA 2QVBA 4DA4A 3IAM1 3D4NA 2ZRBA 2QD4A 2HQBA 2BHSA 2P3SA 4GE3A 4OO3A 5K3AA 5BURA 1FW6A 2HFJA 1KOGA 1U04A 2JIBA 2O52A 2ZJYA 2XTJA 1NA5A 2OCDA 2ODAA 4Z9XA 5ERGB 1QYRA 3PTLA 4UBMA 3MWDA 1PZMA 4ER0A 2HF8A 2IEZA 4MGYR 2IDJA 3PRJA 3TSWA 2CXSA 4QJ5A 1EWVA 3MA0A 4Y1EA 2WD7B 3BWYA 3WO1A 2H7YA 1HQCA 1EZ4A 3MAJA 3PSHA 1UWKA 2A14A 2ZUBA 1LBEA 1SUFA 1OTXA 1FQKA 2PX3A 3TEFA 1HE2A 4BS9A 4E4TA 1NT2A 4ZC8A 4BEWA 4CL2A 1AKYA 4O4HA 1DC8A 5BRNA 5EWLB 2CSUA 4C5AA 1DHTA 1G0NA 4JYBA 3QW2A 2P6UA 3F4BA 4IFBA 5IHXA 2C5LA 3I8OA 4WXPA 2ZJ2A 1LRKA 1SOAA 2PUCA 3ZHTA 2Y71A 5B30A 5CH8A 1CVIA 2FR8A 2HREA 3GRCA 3CYFA 3TLAA 4EO7A 5MHTA 3LTEA 3GLFE 1GG2A 3L6CA 3EYWA 3DP9A 4XYLA 1T34A 4V02A 1C7QA 2A5LA 4GWKA 4J1QA 5BW4A 1RRPA 1QGYA 3WL5A 3KYCA 4BFLA 1CYEA 3SEZA 4H18A 2C7RA 3FLMA 3GPCA 4L9RA 4O08A 1MO4A 3F73A 2HSJA 4K40A 3ISVA 5ILQA 3KJXA 5HOQA 2WJIA 2AUNA 1T2CA 4UXJA 3UB4A 4EG1A 5JCOC 3DKVA 4OJKA 2CMHA 1JDUA 1Y1QA 1D2GA 3CUEF 4CDMA 3DDHA 3GYBA 3R6GA 3NS7A 2NSLA 4I8IA 1ICEA 5L6MB 4YIHA 2DBQA 2JGDA 4H59A 1CUCA 4H1UA 1SVOA 2LPMA 2OBMA 1IFXA 4YH1A 4AO6A 2BGTA 2CHFA 4FN4A 3UGQA 2LV8A 2ZSBA 3NX4A 3WL3A 2YTZA 3RRXA 1KAOA 5FI5A 1U3GA 3MAGA 1I3LA 5JISA 2OK8A 4NDAA 4MUXA 1UDAA 2ZCVA 1IHXA 4LOLA 5FI1B 4EG3A 4GI2A 4MKGA 3VJMA 2BONA 2VPYA 3QEOA 1N6NA 2P9HA 4JZYA 2WIDA 2W70A 1WS6A 3LS2A 3VYTB 4BCDA 3BQ9A 3ZBTA 4YONB 2YXBA 1FJGB 1M83A 1GZ6A 2ZQZA 4FFDA 3AEUA 4WOBA 4DWOA 4WKCA 4HXGA 3PNSA 4YCDA 3ZIDA 1TVCA 2XE4A 3FHJA 3UB3A 2AG6A 2X14A 1QGZA 4JP2A 2FW7A 3MEQA 2D3TA 1YI1A 4MINA 2NAFA 5DNDA 4BXOA 3QE2A 4I1OA 5LKRA 3EZ2A 2R1VA 4LZNA 3TW0A 1HKHA 4YRGA 1VSUA 4BVGA 2HU5A 3KQSA 4MJLA 1XA4A 4C2UA 4HNUA 1MC5A 1PV4A 1OAAA 1IN5A 5JARA 2E4VA 4TM7A 3TGWA 1PQPA 3DTNA 1A8IA 1DUIA 3NYRA 2H2FA 4G0NA 2PPVA 4MGHA 3H87A 1CY2A 1UC4B 3FPAA 1MW8X 4QM6A 2ZANA 1V11B 3P2IA 2OHHA 4MWTA 2P27A 4D3DA 1GPBA 2QZJA 4PZEA 5AVWA 3MJDA 1E18A 6REQA 5IAEA 4GBGA 3I01M 3PGKA 3LQFA 4YP5A 2ZZKA 3RARA 3CZ4A 1S3FA 2GCOB 1Z0JA 3DAOA 3N2GA 1M9NA 3RD5A 3A0UA 3VHQA 3FZEA 9ATCA 3A1WA 5TMDA 4UHDA 3HCPA 3H11B 1DOZA 3F6RA 3DEJA 4AZTA 4G4SO 4DR7B 1FTSA 4KQXA 1JMYA 2GR9A 3BTSA 4FZRA 1HBJA 4WADA 3ER9A 4F9GA 4H2DA 5CM8B 4IPTA 3CX7A 4QPJC 1MDBA 1SKMA 1UXOA 1C2YA 4PXAA 4H7JA 4D5EA 5LVAA 3OC0A 3RU2A 2P0YA 3ZQJA 1KDVA 4XWWA 4DR2B 2Q0SA 1BWQA 5DWVA 2PT9A 3RC9A 4JI0B 1Y9JA 3FCSB 4I9HA 3OFJA 3PC7A 2J6IA 5K0NA 4BNXA 1ZU4A 3AI7A 4Z4HA 2P2CA 4HN4B 2FJ0A 4FXPA 4K9SA 1C0PA 1O54A 5HZKA 1R3UA 1MFZA 1ORIA 2F67A 4ZYYA 4PQYA 4NXNB 1Y7IA 2BKXA 2WIFA 3AI3A 3QI2A 2RJOA 3SC4A 1EA7A 5A4IS 4X3CA 3VKGA 1AHNA 1ACJA 3W8EA 2FSGA 3DZGA 1T36B 4CLOA 3ONFA 3ZEAA 4D9HA 5G0VA 1A9XA 1CIVA 1BSVA 2BDUA 2G0TA 3BD8A 2MHCA 1OWNA 3EXFB 3LG2A 3VNAA 5BV1A 2ZJ3A 3LWNA 3OHMA 4G2NA 4WVLA 2VYNA 5DGCA 1T0JB 1BU5A 1Q17A 3CPHA 3H5LA 4PO8A 3RRFA 2C7OA 4I7EA 3LA8A 3ZHSA 5FT9A 4JXXA 3BA6A 4RHYA 1EUQA 3JQQA 3WYNA 3FB1A 3COPA 2IYFA 5LPNA 3OZSA 4UARA 3IQDB 2AD1A 2Z6QA 3DTYA 4RJLA 5JS2A 1D04A 4PG6A 3R0ZA 2YMPA 1DG3A 1NQWA 1H65A 1FMJA 3LT1A 4NBWA 4DV5B 5K8TA 1PO7A 3ISJA 4TT3A 1DX9A 5KQMA 3I45A 3HLYA 3CPJB 4XX0B 3OHSX 3UJCA 3GLQA 2WYOA 4W1RA 2UUBB 3DDNA 2AXQA 1P2VA 4G8CA 3LL4A 4KXFB 2LWIA 3OH8A 2WD8A 4B3RB 3AL2A 3LZ6A 1ZUIA 3T5BA 4KE6A 1VHLA 2IX9A 1D4AA 3TLGB 1OX5A 4DG5A 4B3JA 1Y8ZA 5EZYB 4L3OA 1Y42X 1WE2A 2HK7A 3M6WA 1FXWA 1G8FA 2ZIAA 5BSHA 4K8OA 1EUDB 1Z6ZA 2BEJA 2YR0A 2H52A 3KQMA 3JYNA 4Y2XA 1I2DA 9GPBA 2OYRA 2W2VA 2HHHB 2E4YA 4CV3A 4GMGA 1O2DA 3QVWA 1X94A 5DP2A 4GR5A 4HH3C 4ZODA 3W5JA 2RIRA 4MR7B 1C8VB 1WD7A 1US8B 2E6KA 1L7PA 3EMKA 3QMWA 4FP9A 1ZXXA 3NHYA 1DS6A 5CFMA 4C2BA 5LD2C 2FSUA 1IZ0A 2IC5A 1MV5A 4TMXA 3NJRA 3N05A 3WOHA 3PC8A 2R44A 1YDEA 3EZNA 3TCNA 2EEZA 4RKWA 4COOA 5B6IA 1A8QA 2ODNA 3CSSA 3LT0A 4QRIA 5BNZA 5HW0A 5H3CA 1EEHA 4C3ZA 3KOWA 2RONA 5IK2D 4C6TA 1WD5A 4JOQA 1EGMB 1EZ1A 5A9SB 5JVDA 3GUUA 2QJFA 2Q9BA 2VHXA 3BD6A 3OFVA 1D3AA 3KQKA 2A4MA 1HE8B 2X9LA 4ZAZA 1WMEA 3JAKA 4ZQCB 1KI4A 1CZLA 2VRBA 3QNMA 1V37A 5K2OA 4JY7A 1I7DA 3AVTA 5JSZB 2HQRA 1ODTC 2G1AA 3U4AA 3RYFB 1KNXA 5EIHA 3UMVA 1IPEA 1LY1A 3FM9A 2OECA 3UK7A 3R4VA 4NULA 3HM9A 1YDMA 3W9YA 1XU7A 2I4NA 2Z2XA 4JL6A 4M1EA 3G82C 1M6HA 4I5DA 2ZAOA 3QKSB 4CFZA 3WGUA 3NTRA 1F06A 3THSA 1Q0SA 1R8XA 2PQMA 1R88A 1N32B 1LRLA 4K6HA 4KXLA 1EGAA 1KFCB 3INRA 1IG0A 2Y0CA 3GJQA 2QXUA 5KU1A 3I73A 1UP7A 1J2RA 2O2IA 2QTWB 1M1YB 1VRVA 2A1UB 2J0VA 3DT8A 3Q3IA 3QY0A 3TRFA 4AJLA 4F8EA 1DKLA 2PHZA 4FBMA 2F90A 1T29A 2G5PA 4A82A 1QYDA 2R7AA 3FROA 3IIEA 3QMVA 3VZCA 2XLBA 2REQA 3CZ5A 5D85A 5HQTA 1V8FA 2C5AA 4HL6A 4KLZA 5EIAA 2AQ8A 1GN8A 1XZGA 4FYHA 5TQ2A 1R9GA 2RGCA 2W90A 5LR6A 2CT8A 4RK7A 3TW8A 4FLEA 5DFAA 2FUCA 5KDDA 5GWXA 3Q8KA 1D0IA 1DAFA 4JWTA 4Z2AA 3CZ9A 2ZXUA 1L1EA 4NJMB 2WUDA 5EQTA 4L78A 3BHNA 1NUPA 5A03A 3ONEA 3R40A 3KE8A 3Q7EA 2CDBA 3S1LA 3C87A 4ZEWA 4NCIA 1VKJA 1GHTA 1LPBB 1E3QA 1R3DA 2Q8PA 2VBCA 1ZFNA 1VOTA 1AXRA 1P9OA 2HXYA 2WIJA 4NBLA 3S70A 2V7UA 3FPLA 5EMLA 4MVCA 3CJQA 3UWMA 3HB7A 3HKDB 3K5PA 2QUHA 5F78A 1X1TA 3GMSA 4XSVA 3OZAA 5L4LA 2RHOA 1VLMA 2GHTA 1DQPA 3QXHA 1QV7A 2DWPA 3GX1A 3KHKA 3KU1A 4FOSA 4ENVA 5C8YB 1THGA 3O8OB 5TJHA 4NAVA 4N39A 1HDEA 4IRMA 3UKJA 2K2WA 2EJCA 4N4AA 3FVVA 3BX1A 1M75A 4RKFA 4Y0AA 3RC7A 4FK8A 2SHKA 3VR5H 4BEJA 2IV2X 1NMEA 3IHKA 4RLHA 5J3JA 2YJ3A 2ZSAA 5HIJA 2D13A 4PNEA 4OL9A 2HIGA 2G1JA 2XHEA 2ERXA 3K72B 4OXQA 4OI1A 4IDEA 3TINA 3IOBA 3U7EB 1PVVA 3VI3B 2PTHA 1VA4A 2WF6A 3INTA 1CUGA 3RJ9A 1CDDA 1W19A 2PKEA 5KYYA 3BKXA 1OFHA 3WYFA 3DQZA 1CJCA 1MZVA 2HWUA 4XTRA 3VNUA 2C9DA 4TKUB 3JQBA 1GKLA 3E9QA 2IPMA 4HN9A 3R5SA 4K05A 1UDCA 3C6XA 1CS4C 1HGXA 5EY5B 5TS2A 3TQQA 3AR7A 5HDBB 3V4PB 2CD7A 4M0PA 2IIQA 4OM7A 4UEJA 4CTMA 4HAZA 3ZDQA 3HC7A 5I7HA 2OENG 4ZAFA 1WRBA 1Y34E 3EQ9A 1S2NA 2WA2A 3DL0A 3E2MA 3UMYA 3EPHA 1XNJA 1UKAA 2XBLA 1YI0A 3RTAA 4BNNA 3M4YA 1KFEB 1VMKA 5AVSA 4WRRA 4AIIA 4TKVB 4CUJA 4JU9A 3H4TA 3TW4A 1FXUA 4EB3A 1GG9A 2FV8A 1YWGO 3FFTA 3MTGA 2AOUB 2BR4A 2QQ0A 1B0ZA 1M0EA 3VNVA 5CIQA 1Y7TA 4KXVA 4TTAA 5ESWA 1TJ3A 4D3YA 3AMVA 3QUCA 3SJCA 4EY6A 2IUFA 5JQWA 1SXJB 1ENZA 4UHKA 2EFGA 1E2UA 3ORFA 1RLOA 3RAJA 3OLWA 1QHGA 2IX3A 2HSZA 3FCAA 5CT9A 5JMPA 1F1JA 1Z2CA 2Q7DA 3K4QA 3L7KA 3HP7A 1P61B 3OE7D 1NQXA 4KGXA 4N0DA 5EE5B 3KZCA 3RS9A 3GROA 4FFRA 4TSKA 3CZMA 2D5LA 3ANLA 2DQKA 3UATA 4MGZR 3CC8A 2MDTA 2X13A 1UFOA 4UAUA 1XPJA 5JNSA 2SBTA 1RP7A 3EJ6A 3T7IA 4TMKA 3EG5A 3EXFA 1IG3A 1W9MA 2D54A 3UFXA 2OFWA 2IZZA 4OHWA 3TPFA 4QQRA 2XOXA 1Z2DA 4LRTB 4DUPA 1YVUA 4WDQA 1UFRA 4CCYA 5AW8A 1N5RA 4IIBA 4LJ6A 1ZI8A 2E1RA 3IO3A 3U80A 2LKCA 3EC7A 2IY7A 2WSYB 1G1MA 2VBFA 4FONA 1N6PA 1TMOA 3FCXA 1VL5A 3QTTA 2BFMA 1HDYA 1KSJA 4CQJA 1FMTA 3GH1A 4J2TA 2P4HX 3EWSA 3PQ5A 4ZANA 1HE3A 2AZTA 3RJTA 4JLAA 4DYHA 2XOKA 4GI3A 1BGXT 4FCCA 1P2GA 1T10A 4CLRB 3AGPA 4Z99A 4IDHA 3UG6A 5K6AA 4LJRA 3ITNA 3RIYA 2VQDA 3ESYA 3V1YA 5BSGA 3OLYA 2PE5A 1J5EB 4LXYA 2XKBA 4UBNA 4QPNA 2PD4A 1C9NA 4KH0A 2QP9X 4Q1EA 1Z6PA 4X44A 3RYIB 3LFTA 1X1RA 3CONA 3CPSA 2FW6A 1KF0A 3CMCO 4NOKA 5DBOA 1BN7A 4BNKA 3ER6A 1Y6QA 1MORA 5F64A 2G17A 1JAXA 3E4DA 3DUWA 3L3BA 4RHEA 4WX2B 3ZWNA 4CN8A 5K8UA 1V9SA 3S1AB 3BYZA 5JI2E 1W44A 1QR6A 3DMTA 1KERA 2Q4BA 3H1EA 5D3MA 4F96A 1ZD4A 3NGMA 4FSXA 3E8XA 1VLJA 4UUBA 1QH9A 2XQVA 3A6ZA 1E1YA 2BCJQ 4G36A 4LTNA 3O83A 3VAYA 4CJXA 5AOBA 2HX1A 4WLVA 4X7BA 1YFKA 2R11A 1Y3AA 3T7DA 1KK1A 3NBFA 4M0DA 2I3DA 1VSTA 3DOJA 3B52X 2YFYA 3IEKA 4LDNA 3N2EA 3ZDEA 4MRSA 3KX2A 3KKZA 4FI3F 5HG0A 1TB4A 3U09A 1GGFA 1JX6A 3W5VA 1G291 3RVLA 4TZ0A 1NQVA 2ETXA 1QNLA 1W30A 3BXFA 4OKNA 2AF4C 2OZKA 1SOMA 4RO0A 3NYWA 1GXSB 3VR5A 4AD8A 3CJRA 2QG4A 3GRZA 3CH4B 3PFIA 1TCBA 3U3RA 3FLEA 3DZIA 4F9FA 3BOSA 5MN6A 2AV6A 3EDQA 4F3KA 1WSWA 4KFTA 3RUHA 4QJ4A 3R3XA 1S4QA 4BNVA 3K1ZA 3OQJA 1TEHA 4TXLA 3NAZA 3WLQA 4HNVA 4Z1MA 5C18A 4RPCA 3DDCA 3N3AC 4JI4B 2O8CB 5ELXA 4OQZA 5ULLA 4Q7MB 1R16A 2NSHA 4K9QA 3QOXA 1MOPA 1YU9A 1A71A 1GKUB 3RRJA 1M2NA 4W7IA 1O96B 1VLHA 2YNMD 3AFGA 2B9EA 1ZQ9A 2JI7A 4YDRA 5GOTA 4LF6B 4LJ7A 2QVCA 2RBGA 4XGIA 4F1JA 2QZ4A 2ENWA 4XI9A 4D80A 1G7TA 4NENB 3K31A 1RJWA 2QORA 4IHJA 2AMJA 1N5LA 4DCMA 2P1RA 5DCUA 3GGSA 1IWPB 4R8KA 1V5IA 4WESA 1YZLA 1YB2A 2R5NA 3KUDA 3GOQA 1P4SA 3GZJA 4RABA 1HEYA 1XXHB 4BNWA 2FPUA 2FZLA 5KYUB 5TGZA 2VJAA 3FRHA 4M55A 4ZQEA 3Q3GE 1JMVA 3R44A 5I7EA 2HM7A 4NK5A 1LSSA 5KSPA 4LFCB 1T9GS 3TRKA 3GUHA 2RGNC 4A3SA 4MB0A 5E2IA 4DJFC 1RYHA 1ZVVA 3AESB 3RBAA 5JD4A 4TTSA 2PEZA 2B0JA 2I78A 3GEDA 3LECA 1Y6FA 4RJKA 3A6PC 1RKBA 1GJRA 2PGOA 5A6SA 3KSDO 3W8DA 1LNSA 2OA0A 4HGNA 3UXYA 3SX4A 4MW6A 3AZQA 1SG9A 1EX6A 4F4JA 3OPVA 4C07A 2WE7A 2XNDD 1G63A 1E2QA 1JQJC 5JFGA 4TLCA 4BNZA 4P36A 2I4OA 4Y9UA 3UJ3X 4LHEA 4DDWA 4CKEB 4PZAA 4YCAA 5GM1A 3ZDAA 4JSTA 5EXSA 4WA7A 1QKIA 2JH9A 5ERYA 4HQFA 2F3RA 4PCLA 2WD7A 1O95D 2NQ8A 2NU9A 3PNQA 3SNHA 1KO4A 1YS4A 1GADO 4HSEA 4ZPJA 5ILGA 3QENA 1TAUA 1MC1A 1QFYA 1RWPA 1A4IA 3LJKA 5LBTA 4CDGA 1EPUA 4OU5A 5FOSA 3NHPA 1NC1A 4OGKA 3TS1A 3CKYA 1N2OA 4NCKA 3C14C 5A62A 1DAGA 4GBMA 4DA9A 5KC8A 1GTSA 3GVXA 1WB4A 1Z2NX 4K46A 5LQDA 1EBFA 2GZMA 1JECA 6AT1A 1QOQB 1XZFA 2NZ8A 5L8VA 3G49A 2GBFA 4HPXB 4I9FA 3EZ9A 4W5WA 5CLJA 2B98A 8ATCA 2VDUE 3JWJA 3V1UA 1UPAA 3O21A 1XZDA 2X7HA 4WKOA 4DMHA 1O96A 2VSYA 3G1TA 5IEJA 1UF9A 4FLMA 4G5XA 2J5QA 2VCHA 2WUGA 4RMJA 4I4TA 4L9SA 3HG7A 1KZ4A 3C6MA 4LRUA 3HVRA 4CF4A 4XEUA 1S8FA 2Z09A 2OWEA 4UHJA 1IHOA 1V3TA 1F14A 1GQOA 1HYBA 4Z2YA 4DKXA 3IEVA 2WVGA 2R62A 3KOMA 2ZPAA 3ENKA 3G89A 3UJDA 1SPBS 1XVLA 1D2CA 2VP0A 2R68A 4YACA 3ZCQA 1PWEA 1ZAYA 1KXJA 3KJNA 2WDPA 3PXEA 3ZDDA 4HXEB 1QGDA 1K8XB 1SO8A 1U8TA 3A05A 1JU9A 2Y6UA 1SBIA 1F8FA 1SR8A 1P4GA 5CJ2A 2GFIA 3WA7A 2ZTUA 1PR9A 4LCEA 5HWSA 3HSYA 2RGXA 3BQMB 2IDMA 2OM6A 1GAJA 3A9TA 4JODA 2PO7A 1WG8A 1PKEA 1Z6GA 3MSCA 3C3KA 3DT9A 4MS3B 1OFVA 4I1IA 2OHVA 4S2UA 1XD9A 1ACLA 1Z6AA 2XUZA 5EKUA 1ONBA 1QG4A 3R20A 1LI4A 2P9BA 2F1OA 3U4IA 5EIOA 5TEWA 3L6BA 1SVNA 4DY4A 5HXAA 4RK5A 4DIKA 4YXWA 1XTZA 3LT5A 3AVUA 3EPRA 4OQLA 3UXHA 3EPLA 1THTA 3L1JA 5EKXA 1UADA 3M6AA 3B3FA 2YFKA 1XZHA 4I9NA 4NFHA 4RTJA 3RFUA 4F2HA 1N0HA 1BE8A 1FFXA 4XOIA 2P6PA 4LYGA 1NP6A 2AOWA 2JZOA 1GILA 2FJUA 1SU6A 2FF5A 2XB9A 4WT7A 1W2GA 3S1AA 3W6OA 4B7UA 3NAQA 4R7TA 2FPXA 4AF7A 3EIQA 3F47A 3TXYA 3R3VA 5DO9A 3GO4A 1FBNA 5IUJC 2HRDA 1KO8A 1AKQA 1U11A 2QG6A 4OV6B 3SFTA 4KP7A 3IX7A 5T8KA 4EHHA 4RIEA 1RW4A 3FJOA 4LWZA 1ZMOA 4BPBA 3K7EA 3D7NA 1RNLA 3IVRA 4GPAA 4X97A 2IHTA 1RI2A 2XODA 3KAJA 2C9ZA 1PV2A 3QFRA 4L6AA 5GIPE 1EP9A 1F0YA 3LDAA 5A05A 3F3SA 3OKFA 3M4NA 3RJ5A 6REQB 2JJMA 2JJ1A 3SIXA 2VEOA 2BI4A 1E1LA 1OLXA 3C98A 5EINA 4EKDA 3MT0A 1G21A 3CG0A 1QU3A 1YOVB 3IE1A 3M5CA 4XXHA 4C2TA 3TAUA 2FWBA 2IP4A 1KVSA 2C9OA 4ZIRB 2GCPA 2VATA 3TNDA 1Q1QA 1G5HA 2C8LA 2QTGA 3MBIA 4BLVA 1AQNA 5I4IA 4FW9A 3P5BA 2Z30A 3OG9A 1DAHA 1VSQA 4GLFA 4X71A 4AUKA 1T6YA 4J49A 3E9DA 2I6UA 2NZVG 3N2YA 4Z8YA 3VC1A 4V39A 1V48A 4AY2A 4L4YA 1JDBB 4OB8A 1OLUA 5ECYA 1QU2A 2JZNA 3PR2B 3T41A 4P2GA 3OSUA 5GZ3A 4WECA 2Q0XA 2OHGA 1P33A 3EY9A 1CZHA 1WX1A 2EATA 8MHTA 4UM5A 4MW5A 1RWOA 2O3QA 2GWRA 1JAHA 1DXHA 4MPPA 4Q9DA 1ZK2A 3T9AA 3ZUGA 4EEZA 3WZLA 3G6KA 4Z7QB 4LJLA 2AJ8A 1BX0A 1WV0A 3TCKA 4EVRA 1E98A 3EULA 2GQ0A 2OBFA 3H4VA 4TRNA 4KRGA 1EWTA 5AI8A 4H7PA 4H7KA 1SKYB 3SR3A 2QRKA 1DJPA 3CW9A 1CX9B 3VNSA 1JXMA 2OBNA 2BKVA 2BE9A 2BKLA 4WJZA 3MTBA 2Q6OA 3RC8A 4V1CB 4OH1A 1UOOA 3GFVA 4RFVA 3WLIA 3BEDA 2P62A 1F20A 4P32A 2O0MA 4TX1A 2XUHA 2VBGA 3E0XA 4B79A 3DFIA 4R9RA 1ZBDA 4BQNA 4CYMA 5DTQA 4ZU3A 1UZMA 2AK2A 1TM5E 2DWUA 1APBA 1AVTA 4WOKA 5D5PA 2B6HA 2XUGA 5CFOA 3P94A 3H04A 3UKOA 4RHTA 3L46A 3ZWMA 3PNOA 1UK6A 2MR6A 1KH1A 2X1VA 3DWEX 1JJVA 1ZLYA 1H4TA 1V6CA 3ME5A 4L4XA 5FXMA 1SCAA 2GYWA 1RPAA 2R87A 3L9WA 4P7JA 4CU2A 3DV0A 1XZPA 3KUUA 2JLSA 4ZK2A 1ABBA 3O4JA 4OJMX 1R4NB 1ZUD1 5HJ7A 1E1CA 1NF9A 1VSVA 4F71A 4R9SA 4BKQA 1PJLA 2OMKA 2B8WA 2ZB2A 3GEMA 3OP4A 1N1MA 2GASA 4FHCA 3WK9A 1T8WA 2CY0A 4AF6A 3ZV6A 4KMOA 5FL3A 1JI0A 1GSHA 4E1AA 1Z6YA 3O26A 4B4OA 3ODPA 3O0TA 3WL6A 4MSUA 4IS3A 4PR0A 2FPLA 2KBFA 3E7XA 3GRVA 2FR0A 2JLRA 3K3PA 3LY7A 2FFRA 1SC6A 3B3GA 4FINA 2W2PA 5BPHA 4EG7A 4Y1RB 3ZVMA 2QTLA 2ZJ4A 1TJPB 1BHSA 2XTMA 1S4MA 1W73A 4FX2A 1ETHA 3C3MA 3NM5A 5BUQA 4ESVA 4Y6OA 1LB1B 5K1ZA 4LQLA 4UKDA 1W93A 4TL9A 1AUVA 1AJEA 3JQ7B 1JYEA 3AM5A 1FMCA 4G9GA 3TTTA 2EWVA 3QU9A 3IA7A 2H9IA 2XSZA 3L6RA 2HB6A 4DE5A 4HYTA 1UT5A 4OJTA 5CLIA 5I7VA 4JI6B 4CT5A 1J42A 3G1UA 1IAVA 3GBPA 5CLLA 1KS9A 1QFXA 1ML3A 4M9UA 1QIJA 2AMVA 4MH0R 1JLHA 2EHJA 5DCYA 4D74A 2JASA 3I92A 3QVMA 4ZZ2A 5FPPA 3E35A 3D31A 5JJCA 3DHEA 4O2LA 2JAWA 2YMQA 1E3JA 3F6YA 1HT2E 4K9RA 4UTZA 4YRMA 1U9ZA 1U0NA 4NV0A 4EECA 3R6DA 1NZFA 2ZI3A 1REQA 1NJGA 1NM5C 2EKLA 1YB5A 1XTJA 2B3TA 2XYQA 3BMXA 2AL7A 3I5UA 3KYIB 4G41A 1WXIA 2EDAA 2FN3A 2ICAA 2Z5FA 3LRXA 5HF9A 1IN8A 4PHGA 3K2EA 1E1NA 3D8TA 5DPMA 2JFUA 4YJ3F 5JYCA 5I7RA 3L4JA 2I71A 3AKEA 4NE9A 2DQSA 2P2GA 3TVDA 3DBOB 3BTVA 3G2QA 2V3VA 1SULA 4B8ZA 1P1FA 4KE7A 2EWWA 4RACA 4GRDA 1HA3A 3WZMA 1E7MA 4D4JA 3OIYA 5IKEA 4HATA 2Y76A 4O4IF 4QFDA 4DM3A 1YQTA 2EBHX 3CRQA 3E7DA 3EZGA 1PZNA 2CNBA 2Z2ZA 1VGQA 2X23A 2O3UA 2WVAA 1BVRA 4BVLA 2CXPA 4AS2A 3QKTA 3ZH2A 1XDDA 2ZI9A 4ED9A 1PT9A 1VECA 4TL8A 1O0CA 3N87A 3RK4A 3KR2A 3ZLJA 4UCXA 1PWYE 4HS4A 4LHWA 4CKZA 2XDQB 2YXNA 3NASA 4TYPA 2J3MA 3IV9A 3QW4B 3TIFA 4ZK6A 3O8NA 5C80A 2Z3VA 5KIAA 1FNSA 3N28A 3QKWA 2XWJI 4NH0A 5LQAA 2WJPA 5JTUA 1KETA 2GPSA 3UWOA 1BE0A 2AXPA 1YJBA 3GJ5A 5EL0A 1T6XA 3H5TA 1FRFS 1M7HA 1A1VA 2VA8A 1KH3A 4ARZB 1OLXB 2QGFA 5CXXA 4HNGA 1FLAA 1H5NA 2COUA 2BUAA 5AKXA 3RHTA 3RQIA 3V46A 4DLYA 2XAAA 1E9EA 2XE7A 2Q2QA 3BGVA 3CLRD 3STUA 3I9KA 3V33A 1GPJA 2VUTA 2JG3A 2HWYA 1J56A 1S3SA 2VPTA 2YFHA 3HA2A 3HXKA 3AUTA 4WD3A 4BMXA 5CCBA 4YCCA 1L1QA 1HYHA 2RB5A 3K32A 4JUCA 4Z0TA 5JD3A 1ODSA 1OVGA 3FW1A 5DM0A 3STTA 1KI6A 4EAQA 2CSXA 1NR7A 2R25B 1WUYA 1RCTE 2JEYA 4TVBA 3V8QA 3VDQA 3WK4A 5A0TA 4BX3A 2Q27A 3M1AA 3GAAA 4ZCQA 3ZZNA 2TMYA 3HKEB 2RGRA 5EIEA 4S24A 4MI9A 3GT4A 2DWQA 4NF2A 3OVMA 4DM4A 1LV7A 3H4MA 1T0PA 1T8RA 5I7OA 1XHLA 4TZKA 1W35A 3FLBA 3MTJA 4TZTA 1UJBA 3WDLA 4CM5A 1R0CA 1LZKA 2XCSB 2XJ4A 2HIHA 1PR6A 1XALA 1O0BA 1KSGA 4D8TA 3BQNB 1ZMXA 3X2FA 5DHRA 2ZRGA 1IRXA 1KA9H 1NPYA 3W9UA 3GRRA 3K0SA 1B6TA 2WZBA 4LV5B 2V1XA 4UMDA 3FFWA 3A32A 4QGAA 1QGUB 4TLAA 3IP1A 3LHSA 5KQPA 1DTSA 2W6MA 1RPTA 1NDHA 2E18A 1VLZA 1OJLA 2ZAGA 4LDRA 4NWIA 1KZHA 3K6SA 1DI0A 1XC7A 4UCWA 2GZ1A 4D9FA 5AVZA 1ZLXA 4NABA 4A5SA 1FS5A 2YIVX 4MVXA 3ZK7A 3GRYA 3AL0C 1MN6A 4XM1A 2DT8A 3IAFA 3WIOA 5HZMA 1Q0TA 2ZJBA 4YQZA 2G09A 1QE0A 4CKBB 2ZIZA 5HJ2A 5U1PA 5JPIA 2DU8A 1L1RA 5KNCA 4XWYA 4ZV9A 3BZWA 4JD5A 2QV7A 3UN1A 4KRXA 1XV5A 1Y7HA 3PXXA 4B9AA 1IULA 2IYEA 2YMLA 4M6WA 4F5YA 3MELA 2OOKA 5FYQA 1GUYA 4D4LA 4QDJA 3GCZA 4WN3A 1CUEA 1SCUB 3DEHA 1Q50A 3NV7A 1BOOA 2E7ZA 1XRQA 2IXFA 3CZAA 2QUAA 4XYBA 4X1YB 3Q4GA 4I55B 5I4BA 1JKJB 3Q8MA 4XIYA 1TM1E 4BJHB 5K99A 3L06A 3A1SA 4OQPA 2ZBVA 5KJEA 5IJZA 1N34B 1SH7A 1IHDA 2R4QA 1WXGA 3LX5A 4LDJA 4UD6A 1K97A 5AM5A 3WSVA 2JGNA 1V2GA 1SXJA 3WMWA 3K8OE 5ICEA 4EPYA 4O4JB 2FR1A 4HFNA 3IAUA 3RU3A 1F7UA 1F8XA 4IDCA 4P22A 2GYUA 4GWLA 2QMOA 3OJEA 3OT4A 2OP0A 2R65A 4E15A 3GLSA 3IEMA 3Q7SA 5CDTA 1NRIA 1NJ8A 4NMLA 1YB6A 1TYEB 4P3NA 3AJAA 3WE7A 3R8XA 3M33A 3P9CA 3UWSA 3ZJYA 1YZ3A 3ILXA 1XMXA 4OK6A 4PZPA 3TOSA 5FBVB 3GNSA 4IQ8A 2PXHA 4DCCA 1NC3A 2FHSA 3PIIA 3D4OA 1RZUA 3A27A 5JH7B 5JU6A 3IRUA 1KAGA 1T0BA 3PEEA 4RIGA 2JLQA 4UHFA 4ESOA 2XMRA 4JMLA 1EE9A 1CE8A 3AOGA 3OJ0A 4KWCA 1JB9A 4MI1A 3ZTTA 1IPHA 3K96A 2UU9B 2WKSA 1CVRA 1X8XA 1R6XA 1XAIA 1HTWA 3JQEA 4NU5A 3ETCA 4PBRA 2JZCA 4OQEA 3TLEA 3BS4A 7GPBA 2ZUVA 2ZVQX 4WERA 4BV3A 2H1IA 4NAHA 5EUBA 5GM2A 4AKSA 1NVMB 4P3YA 1Q1EA 2PU7A 2RKBA 2W6QA 3A1CA 3AUUA 3KCQA 1YR6A 4BX2A 2Y4OA 2O8BA 1PT6A 3BH0A 3J81A 2ZDQA 4W99A 4JOCA 4BFCA 1TKCA 1CY6A 2O4UX 4ND5A 3JARB 4D41A 2JI9A 5KVSA 4QUBA 5KI6A 2GM4A 3DL7A 1AO3A 1E2NA 1I4DD 3BRWD 3PI6A 1OYOA 5F4ZA 3TLBA 3ZWPA 2Q4RA 5B1HA 3JZFA 4Q4AB 5K5EA 3RRYA 4KK4A 1G3MA 2HY7A 2YV2A 4ACAA 2BMEA 4RJIA 4RY0A 4EG0A 3R7DA 1V3UA 1FC0A 4E14A 3MC1A 4K9LA 2QG9A 2XIJA 1YCHA 3V9AA 3A3NA 1FVOA 1R8JA 5F2NA 4CIXA 1YA8A 1XHFA 4AMGA 1OH8A 4YV7A 4YX9A 1UPTA 3K2IA 4JI7B 4PLWA 4EKEA 5ALKA 1ZOIA 1PT7A 2P9YA 2P77A 3MLEA 4IJVA 2COKA 1U6IA 2ZEJA 4GSYA 2JGDB 2WG1A 1N4DA 5SZIA 4G0UA 3EC1A 1JKFA 3VFDA 2YZ7A 1C80A 4HTFA 4KWHA 5E6RA 5JW6A 1YQXA 3GY0A 1NE7A 4JEIA 3PVZA 3D4IA 1WJGA 3ILSA 4DC0A 4M9QA 3NNDA 4IOKA 3L1KA 3V6MA 2GN6A 4B6RA 3PJRA 1TYDE 3ZD6A 2OP1A 1Q7CA 5LMNB 1P2FA 4I3GA 4LXXA 3DAYA 3QEBZ 2O2DA 3KYCB 2FUG1 4GIBA 1ADFA 3BWDD 4NBTA 3EN0A 3QPUA 4RV4A 1TUBB 4HRYA 3QLVA 2RC5A 3GDOA 4J16A 5P21A 4OSEA 3RWBA 4HB2A 3EEYA 3K5HA 4GVPA 4MK4A 4PYMA 3E61A 3GG9A 4LX0A 1KQNA 3SF0A 4YR9A 4MV3A 3ENNA 2FW1A 1FX0A 1MX3A 1VL0A 3G0GA 3ND9A 3KR9A 4OUDB 3ZPXA 3P5SA 1WBBA 3GUYA 1XSEA 4ZJZA 3N3BC 1G4UR 5I3ZA 3ZQ4A 4DV3B 2JK1A 3DVSX 4J0JA 3AP3A 3OQOA 1HYEA 3ROKA 3D0RA 1ILWA 4ZOBA 2AC7A 4CUKA 4BFTA 3GNTA 1NXVA 1AKMA 2EKPA 5C1DA 5BXQC 1W59A 1R6UA 2ECQA 2XDYA 4WW0A 2OCIA 5DSXA 3ZJ4A 1LNZA 2C84A 1XIVA 5CB4B 2BFNA 1FFYA 1XZEA 2UZIR 1WVMA 3AI1A 4V0RA 1YS7A 3WWYA 5AMXA 5JE8A 1GCAA 1GPH1 1DDOA 3K0BA 3R9KA 5F77A 1V43A 3DVAA 5SZKB 1GL7A 1E9CA 5D01A 4RZ2A 2O3RA 4E30A 3RTEA 1EWQA 3GRFA 5LXTF 5I3CA 2TRSB 4V1CI 2O1WA 1IK4A 1V16A 1M73E 2GI4A 3VHXA 2J9GA 3P0FA 2UVPA 1J1IA 2CL7X 2IOFK 4B40A 2Z9DA 1XZ8A 3F2IA 3ORRA 4N3BA 3L5KA 4GPIB 4YJKA 5THKA 3ZCSA 4D9NA 1OHHD 1KQ3A 4NBKA 1AX9A 3NC0C 3NT2A 2EIHA 3GPIA 3LCUA 4XR4A 5HF6A 1L4GA 2IDZA 1UJ6A 3T7KA