2VK2A

Crystal structure of a galactofuranose binding protein
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
296
structure length
296
Chain Sequence
PLTVGFSQVGSESGWRAAETNVAKSEAEKRGITLKIADGQQKQENQIKAVRSFVAQGVDAIFIAPVVATGWEPVLKEAKDAEIPVFLLDRSIDVKDKSLYMTTVTADNILEGKLIGDWLVKEVNGKPCNVVELQGTVGASVAIDRKKGFAEAIKNAPNIKIIRSQSGDFTRSKGKEVMESFIKAENNGKNICMVYAHNDDMVIGAIQAIKEAGLKPGKDILTGSIDGVPDIYKAMMDGEANASVELTPNMAGPAFDALEKYKKDGTMPEKLTLTKSTLYLPDTAKEELEKKKNMGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Furanose-Specific Sugar Transport: Characterization of a Bacterial Galactofuranose-Binding Protein.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
molecule keywords ABC TRANSPORTER PERIPLASMIC-BINDING PROTEIN YTFQ
total genus 119
structure length 296
sequence length 296
ec nomenclature
pdb deposition date 2007-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13407 Peripla_BP_4 Periplasmic binding protein domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2vk2A01
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2vk2A02
4Z9BA 2WRZA 5B3JA 2JRLA 4XAQA 3C3WA 5JS1A 1U04A 3LKBA 1P6QA 3RVJA 4CBVA 1P6UA 3IP7A 4B09A 9ABPA 2N9UA 2LBPA 3GYBA 4MS3A 5CNKA 1DBWA 3JVIA 3LUAA 3ROFA 5HKOA 4E7PA 2E4ZA 5CNMA 5C5CA 2RGYA 4YWHA 3KYIB 1FFSA 2FXIA 4Q6BA 1QP4A 3N53A 3CS3A 5IEJA 3K9CA 3QEKA 5GOTA 2CWDA 1EWTA 2AYZA 2QW1A 2JBAA 4NCAA 1HEYA 3SG0A 4YCSA 4QYMA 1LBHA 2RJOA 3C3MA 4N0QA 4QICA 2FMHA 3QELB 3RVNA 4KPYA 4YV7A 3OLVA 1ISSA 4S04A 2M1ZA 1LJUA 5TPWB 3T95A 3K4HA 2FVYA 4TLMB 5CNIA 4EYOA 4MLCA 2PKXA 4MS4A 4OLBA 4QPJC 5EWJA 1VRVA 1YK0A 3FDFA 5ED4A 2JBAB 4YO7A 2NT4A 1QMPA 3GBPA 1PEAA 3RVQA 4LDAA 6ABPA 4KNYA 4UHKA 4G86A 4KV7A 2HQBA 3O75A 3DGEC 5IC5A 1SXHA 1ABEA 5JNWA 1ZH2A 4F06A 3MA0A 5DGCA 4XXHA 1RXIA 1QNLA 2IYNA 2NZUG 2F8SA 2IPLA 1CHNA 4OBBA 4LRQA 1QQBA 1WETA 1JFSA 4MQFA 2IPMA 4Z0NA 2FLWA 2FEWB 5KI6A 2IOYA 3L6UA 2HSGA 3EGCA 3F6PA 1EFAA 3HUTA 2DRIA 4W5OA 3O2QB 4D6YA 3EULA 1P8AA 3QK7A 3E3MA 1JF8A 4Q6WA 3SY8A 4Z9AA 3NNDA 3KHTA 1D1PA 4M88A 5EWLA 3EODA 3CRNA 1TVMA 4ETIA 1KGSA 2JVKA 4D74A 2QXYA 5BQ3A 3EQ2A 3GBVA 5TQJA 2A9QA 5TQ2B 1BAPA 5FBHA 3OO0A 5JNSA 5C5EA 3OLXA 3Q15C 2JK1A 3OQMA 3MM4A 1XHEA 2QR3A 3I09A 3A0UA 2WJAA 3UKJA 3OLWA 1DRJA 4P98A 4P1ZA 3Q9SA 2FMKA 3LUHA 1MVOA 3UUGA 3LKVA 3TX6A 1SRRA 7ABPA 1BVHA 5JNRA 1JYEA 3H1EA 5DCLA 3QLVC 2WY2D 4F8JA 4IF4A 5KQLA 4TLLB 3OLYA 1TJYA 4ZMRA 1KRXA 4Z99A 4OATA 1Z16A 4RY9A 4G0PA 3RVSA 1M2EA 4DADA 1ZITA 2MSWA 4LE2A 1NXWA 1U2QA 3S99A 1F51E 4KK4A 2RDMA 1D2AA 3JY6A 4RDCA 4IILA 1EHCA 2VK2A 3RVOA 2FTKE 2E4UA 1A04A 3H5IA 3NNNA 2GKGA 2NZVG 1DCMA 3KYJB 1ZY2A 3OQOA 1JDNA 3H5LA 4EYKA 1U8TA 3GWGA 2ID9A 3JVDA 3TMYA 5HSGA 4NQRA 1BA2A 1NTRA 3H6HA 4N76A 2XDYA 1U0SY 4MS4B 5IBQA 4G0QA 5EWJB 3I5AA 4IMJB 1USKA 4FE4A 5EWMA 4JAVC 2ZWMA 3W9SA 4GPAA 5DTEA 3H1FA 1JDPA 3QLVA 2OENG 3LUCA 4Y9TA 1PNTA 3O1HB 1A2OA 3H5TA 5BR1A 1DRKA 2RJNA 3KLOA 3H75A 4MQEA 5KQMA 2FN9A 4MPTA 5T7BA 1ZGZA 1Y1LA 3CKMA 5FWYA 4ZJPA 3NHZA 3LOPA 2V0NA 5E3JA 4RK0A 4DQDA 3TD9A 3JPWA 4F11A 3TB6A 4EVRA 2PUFA 2MYNA 4ZYLA 1E2BA 3O2SB 3RVRA 2PLNA 5I4CA 2HPHA 5PNTA 1MAVA 1DG9A 3FGZA 3LMKA 3CHYA 4RKQA 3EAFA 3MQ4A 2WWVD 4YS6A 1NXOA 3T8YA 2FEPA 1CYEA 3QX9A 3IPCA 1E6LA 3HUUA 5GQSA 1ZN2A 1Z26A 3O74A 4N0PA 1EWKA 3LTEA 1YTUA 2QSJA 3TO5A 1BDHA 3N6VA 3L49A 4RKRA 4F3TA 5JNUA 4ML3A 4G97A 1DCKA 3QELA 2IPNA 3G85A 1ZH4A 4OTZA 4MGEA 4EYQA 4L85A 3F73A 2L19A 1SXIA 4N03A 3N75A 3RVPA 3I42A 1FFGA 1NXXA 3MIZA 1GUDA 2MYUA 5IUKC 1TLFA 1K66A 1ZDMA 4L4UA 4N47A 3IDOA 5KC9A 3HVRA 1Z25A 1UDRA 1QO0A 3FFWA 1LK0A 2CHEA 3OLZA 4KQCA 4EY3A 4YR7A 3BREA 1B00A 2FW0A 3KLNA 2R25B 1AB6A 4LZLA 3KTOA 2E4WA 4O1IA 1PEYA 2QVGA 1ZHHA 4MR7B 3SM9A 4EVSA 2PUBA 1URPA 1JH9A 2E4XA 2GX6A 2ZAYA 1QO0D 4MYRA 4MR8A 2FN8A 1YK1A 2LPMA 1DZ3A 1ISRA 1M5TA 1MB0A 2JCGA 1ZESA 1FQWA 3M9XA 4WXMA 3SAJA 1Z17A 3M6MD 5TPWA 1T34A 1Z12A 3GRCA 1H9CA 4RZSA 4YRZA 4YLEA 5BRJA 2PE5A 4S05A 3OQNA 3F6CA 4G0MA 3BBLA 3JS5A 3FFTA 3CTPA 2MSKA 5EWMB 5JNVA 1Z2DA 3HEBA 4KZKA 3KKEA 4KQ9A 1EWVA 3CZCA 3N0RA 4WXEA 4Q7EA 3D8UA 1A0OA 2LUOA 5FWXB 1D1QA 3C3KA 3NNSA 3OM1A 1Z18A 5KQGA 3OO1A 4W5QA 2HQOA 1DBPA 6CHYA 4RXMA 2QU7A 4RWEA 4ZMSA 2VYCA 4G0ZA 3LFTA 1Z13A 2FMIA 4NV3A 4RK7A 4W5RA 2J48A 3EDCA 1NXSA 2PUGA 4NCBA 1LBIA 3H6GA 3I45A 3NHMA 2R4QA 5F64A 4D6XA 4FB4A 3H5WA 1I3CA 4WWHA 2FLKA 2FQXA 3IP5A 3O1JC 3ILYA 2ID7A 4PE5B 4PICA 1KMIY 5IEBA 2Q5CA 3Q7TA 4MAAA 1EAYA 2QZJA 2PUEA 1DJMA 1TM2A 3QLUA 3CZ5A 3GV0A 1MIHA 3QEMA 4ZPJA 3B2NA 3A0RB 2LP4Y 3O2JA 2GI4A 2M98A 1L5ZA 3A3KA 1C4WA 1GUBA 2PUAA 4XARA 3DLBA 1GCAA 2PUCA 2PAFA 2WB4A 2E4YA 3R0JA 5T3YA 2A9OA 1JLKA 2IPAB 1ZVVA 4GNRA 4HYEA 4QYWA 4W5NA 1JFVA 1OXKB 3NBMA 1MB3A 2JVIA 2X7XA 5TQ0A 2B1JA 2MYTA 3DGFC 1GCGA 1YS6A 4HNSA 3JTEA 3HXMA 4E7OA 4RXTA 2H3HA 1USIA 2FMFA 4Z4IA 1ABFA 3BRQA 5IX8A 1AB5A 3O21A 4XASA 2GBPA 4MS1B 5KC8A 1W9HA 1APBA 3Q7RA 2VUHB 5HQJA 1NY5A 1RZRA 3QLUC 4RSMA 1W25A 4WUTA 4DN6A 4Z4EA 5TPZD 1BDJA 3DZDA 3HV2A 5TQ2A 1NATA 3KSMA 2OQRA 3MMNA 3N8IA 2PL1A 2TMYA 3KG2A 4JP1A 1YS7A 1DC8A 5JS2A 4MS1A 5KWSA 2P9HA 3LUJA 3HJFA 3F7NA 4KFCA 4KVFA 5EWLB 2I6FA 3CU5A 5TPZA 4LX8A 4H3KB 4HNQA 2HQRA 1M5UA 1TMYA 5DKFA 4MS3B 1E6KA 1QKKA 3ILHA 3LUFA 4H3HB 1P2FA 1PNRA 4EYGA 1NXPA 4G0XA 4XLTA 3E61A 2CHFA 4HNRA 3GT7A 3LUGA 5FBKA 3H1GA 5HM6A 3BRSA 3Q41A 1D5WA 3OM0A 4LDZA 4RK1A 2YHBA 2LIVA 3T6KA 4IGAA 4EUKA 1YMVA 3OMXA 2QV0A 4PYRA 1YVUA 2QVCA 4JB2A 4MR9A 1JX6A 4PZ0A 4H60A 1R8JA 3MF4A 4O1HA 1J56A 1ZAYA 3FMVA 3GA5A 5D2CA 1JFTA 2FSPA 4MRMB 1RPJA 5IUNC 3KJXA 1VKRA 4ETNA 3OMWA 2FQWA 4F12A 3RQIA 4ETMA 3RH0A 4JOQA 4KREA 3JPYA 3IP9A 2JB9A 4PEVA 3D02A 1C0EA 4LE1A 1QP0A 4MQEB 3QLTA 3CNBA 2FQYA 1YMUA 4MRMA 2E4VA 1DBQA 1D4ZA 1DCFA 3RVKA 4EGSA 2F8TA 3HSYA 4RU1A 1JBEA 3RVLA 3URMA 3DBIA 4XFKA 2WJWA 1USGA 5TQ0B 4OLAA 4JB0A 4KRFA 1SD5A 4MR8B 2KYRA 3UK0A 1JWLA 4WZZA 5FWXA 4JA2A 2B4AA 3HS3A 5DLEA 3RVMA 3SQNA 2L17A 3ROTA 3KS9A 1VPWA 2HJ9A 1Z15A 4YP9A 3CFYA 2NUBA 3H5VA 5CHYA 1XHFA 1NXTA 4G0OA 3CG4A 5B3JC 3H5OA 2A9PA 1RNLA 4RXUA 4TN5A 1RZRD 1M2FA 2FEKA 4JASB 4G0YA 3HK2A 4NICA 4IRXA 4RK5A 3EJWA 1L5YA 3HZHA 5JNTA 1DP4A 3LUDA 4TMYA 3CLKA 1OXBB 3N0WA 4O5AA 2VUIB 1S8NA 3LUKA 3MYYA 1VLZA 4FE7A 1KRWA 4OG2A 4RV5A 4W5TA 2R48A 1JL3A 2PJUA 4Z4CA 3C6QA 4UHJA 3VNBA 1RXEA 3C97A 3IP6A 3KCNA 2L2QA 3QEMB 2R47A 4Z4GA 1JHZA 3IPAA 1K68A 1BDIA 5FWYB 1Z2EA 2PMCA 4RY8A 1U2PA 2AYXA 1IIBA 2O20A 3SNKA 1QP7A 1ZGGA 3Q7SA 4LE0A 4WT7A 2PUDA 2WMYA 3G1WA 4KK3A 5KQPA 2BGGA 4IMIB 4MR9B 2W42A 2L18A 3N0XA 2IDMA 5CNJA 4Z4FA 2JVJA 4MR7A 3P9YA 1FFWA 4RK6A 3GL9A 3HCWA 2GWRA 3O1IC 2P4UA 2FKAA 1PHRA 3EQZA 4RY0A 4KMRA 1F4VA 2PL9A 1LJLA 1PUXA 3CG0A 1YIOA 3QX8A 1FSPA 8ABPA 1NXVA 5IULC 5IUJC 5ABPA 1QPZA 3DLHA 1SXGA 1E6MA 4Z4HA 1GLGA 4RS3A 2CD7A 3VNAA 3BILA 3M9WA 3HDVA 1JYFA 2MSLA 3FFXA 4MLDA 3HDGA 4RK4A 4YGXB 2H0AA 1XWWA 1CEYA 4MQFB 3A10A 4N41A 2IKSA 3HO1A 1QQAA 1DC7A 2NT3A 5BRAA 2MYPA 3T38A 2A9RA 2YHAA 4EVQA 3HM9A 5TE9A
chains in the Genus database with same CATH superfamily
2N42A 1MEOA 5JFTA 4LBZA 4V03A 2D62A 1E94E 2JJYA 3TR6A 4CFSA 1YJ5A 4HX5A 4GEGA 5JH7B 4UNNA 2N9UA 4QDTA 4Y1RB 4Y2GA 2P68A 4MS3A 1FXUA 3JVIA 3NJ8A 4OBEA 4TT3D 1FVXA 4FYIA 4LPSA 5AHWA 4B4UA 2Z1MA 5CU7A 1WD7A 4JJKA 4M0MA 2OZVA 3HO6A 1E2PA 4KQXA 3MCUA 4D9FA 1AN0A 3WLJA 3Q40A 3H2HA 4CMJA 4BASA 1M9NA 3I23A 3K4QA 5AOVA 3I2HA 4V1CA 3O38A 4G4SP 1AV6A 1DFIA 2BSAA 4AFNA 2G4VA 3OZBA 2HU7A 1XMIA 5FLYA 2OHFA 2A35A 3OQVA 4PY2A 3JD4A 5FOQA 4KQ6A 3RTGA 1ID8A 3QELB 1B8OA 5DDIP 3NTVA 4TL9A 3FTCA 4QJBA 4EAQA 4AQYB 2R87A 1RHUA 4L3OA 5FUBA 2BRUA 5LJLA 2W6JA 5A3SA 4OLBA 1MT3A 1S3GA 1X7GA 3W5JA 2WEKA 3HCNA 3COVA 2NT4A 4JOSA 2WVHA 1ZICA 1G8KA 1JPVA 2ZYIA 3JASB 4JYMA 4DQUA 1J06A 1WXXA 3EDRA 3A28A 4G86A 5CRIA 5KTNA 4M1EA 1Y37A 4WMLA 1L8AA 1O8CA 2OBFA 3NXSA 4KLAA 3RU2A 3O47A 1ORDA 1V3UA 3O4HA 3B9RA 5AK5A 1KP2A 4AK9A 2Q62A 3DAGA 1ZIPA 1PFQA 4PHHA 3G9TA 1J8DA 1E7RA 3Q0EA 4BRUA 5BVHB 4O2BB 3Q8KA 4PGMA 2NO9A 5L3VA 1JFSA 1N0UA 1XZFA 1P4RA 5CLGA 3ESAA 2DCMA 2VNAA 4DYDA 5K4AA 4C29A 2RGNA 1I2BA 4D6YA 3D0OA 3JXEA 1Q2XA 2IHYA 3K0KA 4YJKA 3QIAA 1LGYA 3SKXA 5P8WA 1IHPA 3TQQA 4GX2A 2TMDA 2R97A 3EW9A 4H7PA 1KAMA 5TGZA 3GJTA 1HORA 4WLEA 3IIIA 5TS3A 3DYBA 4DMHA 1LRKA 5EERA 4Z1MD 1RM5A 5LXTA 4B32A 4UDOA 1N2HA 1JQJC 4KWEA 1MRZA 2G70A 3H9GA 1YHYA 5EA2A 3SN6A 3WGZA 2CL6X 4UPEA 3I72A 5I9IA 3H8VA 2FVXA 2Q6TA 3VI4B 4BO3A 4YRRA 5DTRA 4TLDA 3OH8A 1CXZA 1J2RA 3RUFA 2R8EA 2XT0A 1P5FA 3UGQA 4ZGWA 4R0VA 5JWOA 4FPXA 4ZYZA 2FRXA 1HGXA 4NMMA 4M0EA 4HAOA 4NU8X 4A8JC 2FV8A 2G0AA 3PEWA 2JHCA 1PGOA 4RHXA 3RS0A 4JQZA 1WUIS 3FR7A 2AJ8A 2QLBA 5EMNA 1M2EA 3OZ7A 1I30A 2HDWA 3QX7A 4I5GA 4UU8A 1Z0UA 5E1DA 3JY6A 3FD8A 4XDYA 2GA8A 1MXFA 5A0FA 2IUUA 3B48A 1SC4A 2ONKA 3GZJA 4TX1A 3C8DA 1NYLA 4YPFA 3UY4A 2DC1A 3R3WA 3DBLA 1REQA 3QI7A 3QV2A 2VHWA 3HJNA 2Q4TA 4N82A 4QUHA 2VRCA 1DKRA 2IVFA 2Q1SA 3VOAA 2E18A 1U8TA 2ID9A 1YS4A 5MF6A 3W8EA 1Q7BA 3F98A 1HYEA 5JBNA 5H9VA 1RMYA 2W8BB 2XDYA 3S7TA 2OC4A 5BV2P 2BI4A 1QH1A 3KZNA 1QDEA 1ZISA 2CDNA 1SZDA 1H6CA 2O0LA 1ZIXA 2OENG 2JAHA 1MMFB 2FQ1A 3H5TA 1WXHA 4WE3A 3U37A 4KHZA 1V8PA 1JLHA 2JFXA 4LJ8A 3VPSA 5J1SB 3DE5X 1E6WA 2R4TA 4FOPA 3OZWA 3OPQA 2JD2A 5D5PA 1SOMA 2ZI9A 1R0WA 1TC1A 1J8MF 3FNQA 2YJGA 3EA0A 1TRHA 4QRIA 4NARA 5E9JA 4E6EA 3JPWA 2N46A 3JW8A 1RQXA 3VU9B 1WUTA 3ZWQA 3P27A 4BMOB 1T36A 4H08A 3PEEA 3WBFA 1N8KA 2PT5A 3NTRA 4J1TA 4KNVA 3SE0A 4BU1A 3AI7A 3JD0A 4TKUB 1WQ1R 3DLCA 5TB5A 3K0AB 3PS9A 2WPNA 5CCXA 2IYFA 5IC6A 2FA9A 3ABOB 1VJDA 1W5EA 3I37X 1KO5A 3N05A 4BQFA 4YV2A 1KYTA 1Z26A 4GEKA 1EBBA 4RETA 2OAQ1 2Y1EA 1Q1ZA 2REQB 3UA3A 1D9ZA 4IDPA 3FJOA 5EMKA 3WLTA 4CLHA 3EOZA 5JVDF 1A7JA 1RAIA 1U7OA 2EJBA 4R16A 5GY7A 1Z47A 3C1TA 1D6NA 4L72A 4HQNA 1XQYA 5DYGA 1HO3A 1YNSA 4MDYA 4J29A 4WCFB 1HSOA 1H5NA 1AN9A 3IQWA 1YKSA 2CVQA 2OAEA 4JLBA 1B7GO 3AUFA 4JITA 3RVPA 3ZQUA 2GZ1A 3D6TB 1ZR4A 1QTQA 5REQA 1W5SA 3DZIA 4NFYA 4RLQA 4YJ2B 4IIFA 3KT8A 4IZIA 1W0KA 3L8GA 2X41A 4NFSA 3WK9A 2H52A 2CXTA 3OLZA 3ZS8A 2UV8A 1AGRA 4HZUB 2NACA 3QE0A 4F4IA 1EM8B 1WLYA 5KEIA 4B0PA 4L0DA 3NANA 2QMZA 4C5CA 3ZTYA 4ECAA 4QPPA 3T9FA 2BCGY 2N75A 2Y6UA 3ZQ4A 3DDNA 4DSNA 3CNNA 2ZYAA 3K7EA 4NSNA 3ER9A 3GB9A 4W8HA 2QMHA 4GWKA 3W8DA 1DEXA 3STWA 4J16C 5J4HA 3L0YA 4L8FA 2FZ4A 3A1DA 4DV6B 2A33A 4RZQA 4Q4LA 3ZPXA 1TA0A 1QHNA 3RKSA 5A6SB 3D3WB 3IIEA 3ZBUA 1Y7TA 5AW5A 9ATCA 3N2GB 1B0UA 1JSRA 2X0KA 4FT2A 3BBLA 3AVUA 2AGVA 1M34E 2CNOA 3QG5A 4XLLA 4XOUA 3O95A 5EWMB 4CL0A 1OROA 4OJQA 1MOPA 3Q8XB 3MTDA 3NC4A 3W1VA 2LUOA 1SXJA 2R1VB 2R7KA 4FEAA 4IGIA 1I7DA 1KR2A 3VO1A 2BEUA 5JAPA 4Y0AA 3GXBA 2H3EA 2V7QA 4JP2A 4LXIA 5JO9A 3RWOA 1NE7A 1NV8A 1HEIA 1Z4NA 2W11A 2P41A 3GD7A 4YBRA 2JGIA 4KI7A 3WZMA 2BEWB 2RKOA 4BVJA 5IN5A 2DP4E 2VYCA 1NJ2A 4IXTA 1K8YB 1V4VA 2DFKB 2KLBA 1YCHA 4NKRA 4QFBA 4WAUA 4MWTA 4F4FA 2I91A 2DFTA 1MV8A 2W2MA 1TW2A 1NASA 3KQLA 3OM9A 2C92A 3BL5A 5FTWA 3TLXA 1MKYA 4GNKA 2JIQA 2NUPB 3HYTA 2JIZA 2HOQA 1W4LA 3A4IA 3IP5A 5E0OA 1GPKA 4YCJA 4YRDA 2XB4A 4KWCA 2K2QB 4MV8A 3HACA 1JHOA 1A2QA 2DWUA 3QUCA 3PNBA 1ZIYA 4GO1A 3UO8B 1XMPA 5JQGA 1GAWA 3LXUX 5AHXA 1A9TA 1EJ2A 2AKEA 1TTPB 4HUQB 1NW9B 3DF9A 3B7WA 3JTMA 5IARA 4A2PA 1GILA 2O8CA 1E92A 2DSNA 2PKWA 1ZGCA 4QO8A 3RREA 2C8VA 4YK7A 1Z5WA 4NBKA 2H2FA 3PFCA 1CIPA 1KPHA 4TL8A 3ZH9B 1T8PA 1O1YA 2VF7A 2XOXA 1DXQA 1JMVA 2A9OA 3FUUA 2CDCA 4HNAA 1ZNZA 3A4YA 1QFSA 1IHDA 2WUEA 1Z62A 4K0RA 5JLAA 1WWKA 3HXMA 2BKUA 3BRWA 4FDAA 5LQNA 1OH8A 2WWHA 3IBYA 4OB6A 1GGKA 4PPNA 2IK8A 3R74A 4HMPA 2PAAA 4RIFA 3VC1A 1NLFA 2F1KA 4XRGA 4YMHA 5JY1A 1XDDA 1NYTA 4PSVA 3CH7A 1E9VA 4YPOA 4N7RA 3EIQA 5B1HA 3PCXA 4DLKA 5LOVF 3DT8A 1AM4D 1W5BA 2H51A 2I4LA 4Q7JB 4U7HA 4XZ3A 4XUCA 3CZ4A 5KWVA 2FGKA 2NZ8A 2AN5A 3PI6A 1VJRA 1NP7A 2GH1A 3EZYA 4CM4B 5ARDA 3LLUA 4CM4A 4D43A 4E12A 3IXMA 4FHDA 4JIMA 1GNSA 3N8IA 2UXCB 2HPAA 1WX1A 3KTAA 4BV8A 3PK0A 4I9NA 1Q57A 2YS7A 2OQIA 4G5QA 1LDNA 4HTAA 4MS1A 4PCUA 3HCBA 2Y2UA 5C2JB 5KWSA 1QU2A 3HTXA 4DVGA 2DUNA 1IXZA 5HZGA 4KFCA 3FVQA 2FR8A 2MOKA 2VJBA 3HCDA 1M5UA 5DSTA 4MOWA 1XL1A 4ZI7A 3C3PA 3G5UA 2D0IA 1ATIA 3WLKX 1WVGA 2B3DA 4Q7QA 1J6UA 2ISCA 3G9ZA 1JR3E 4XLTA 4I66A 1N3BA 3TLKA 2ZI4A 3UJ6A 3JAWA 1R3DA 4HTFA 3H19A 3LRTA 3UJHA 4ZAVA 3H5RA 3R9KA 1PT7A 1G6HA 3BRSA 3MN1A 4LF4B 2CE7A 1EWQA 4LXYA 1ZP6A 3L7KA 1KJNA 2XCQA 3B38A 3U7FB 1UDBA 2OHIA 1QQ7A 2Z0MA 3HSKA 4DC9A 5LWHA 3DOJA 1QK3A 3A04A 1KJJA 2DPYA 4ZEOA 4YRIA 2YINC 4EYSA 3FCEA 1PJQA 4JBGA 5IT9A 4QVIA 4IIYA 1QE5A 1JKJB 5A5VA 2RBGA 3C6ZA 1BROA 2GM3A 4FDVA 1JSZA 2ZYWX 1KBQA 3QYFA 4O1HA 3TVDA 3X1DA 4CU5A 3U1BA 3P26A 3R8FA 1EBUA 3SXJA 4PAGA 1JFTA 1IQPA 1W76A 1RPJA 3AIMA 3IAXA 2IP1A 5MN4A 3N8DA 1SUAA 2Q50A 4JEUA 1L8LA 1BXGA 5LFAA 4C07A 1QIHA 5FHRA 4UASA 3UMJA 4KREA 1XKTA 2JB9A 3DKVA 2AW5A 5B7PA 2GF0A 2X3UA 2W90A 3DL4A 4HD8A 3K0BA 4Y2YA 3TTTA 1XFAA 3TJZA 2ZB3A 3AEKA 5TXGA 3VSEA 3DH0A 2A4MA 2BGLA 2J4CA 3PB3A 4LPKA 4DAOA 5BV7A 2V7EA 3BH0A 2XF8A 4EGSA 4MJ3A 3Q7EA 1YMQA 2Q8PA 3Q2OA 4HEHA 4DBZA 2VF2A 1IZYA 1QCDA 1E1KA 2GHRA 2ZATA 3RIXA 3KE8A 5C8YB 4ARZA 3T1TA 1GOTA 2PCLA 3PGKA 4C4ZA 1ISFA 1ZMBA 1SUEA 3SM3A 4LRSB 5CCDA 3OLQA 1E9AA 4DDVA 1YR8A 5ALOA 1MJNA 2NVUA 5BW5A 1IDN1 1VPWA 4MO2A 4D42A 3S40A 4Y7DA 3KZMA 1BDMA 1BOOA 4GE3A 4FGZA 4HDCA 4D96A 2EJUA 4BV3A 3DQZA 1E3EA 3BGOS 1V26A 1Y9DA 1E2EA 2UYQA 1JR4A 2WVJA 3ONVA 2WR8A 1G98A 4LZAA 1D6MA 3F49S 3H5OA 5TMBA 4X66B 3WO1A 1QB8A 1FVFA 3ECCA 4YIHA 3WL6A 4HNUA 3L4BC 4FYHA 1WZUA 5FLXA 3DTNA 4I5EA 5HTKA 1DP4A 4RFLA 5K03A 3LUDA 4DSTA 1I5RA 1Q92A 2W2TA 2QB5A 3K9HA 1PJLA 1Y5IA 4MWSA 1UF9A 1VE1A 3FYUA 3KL4A 3LBAA 2RFLA 4HGRA 2OLJA 5F23A 2UZ0A 1UT8A 1WB6A 1K8XB 4R40A 3HVHA 4W5TA 5AWFC 4Z4CA 4AUMA 3HU1A 1C3OB 1KPIA 2XSZD 1P4AA 2Q1TA 4FCCA 3C97A 4IDHA 4LMBA 5F51A 5HDBB 2D2XA 3TAXA 1E5VA 1ZN7A 3HR8A 4YRBA 1GTG1 3K9FC 5DNUA 1JHZA 1K9SA 2XB2A 2CY0A 3I6YA 2WJGA 4I50B 5EMJA 5FD8A 5HZHA 2SCUA 3PUZA 1BQ4A 2C5FA 1ZGGA 2HJRA 2R5NA 4YO8A 4Y2UA 3IUJA 5H9WA 2Y1FA 5JAOA 5ALFA 3VDNB 1DKQA 4CT0A 4P22A 1ECCA 2AR0A 1RAFA 2IW1A 3IAS1 4NBNA 4A5OA 3HGTA 3D2BA 4TTVA 1FB5A 4UCWA 3UOAB 3UXMA 1K8RA 3OQHA 4CYMA 5JSZA 1KC1A 3EXFB 2F3UA 2W4QA 4KJXA 3BGVA 4IS3A 2X0FA 3O4RA 2XWQA 3R7AA 2OFFA 1QV7A 4KQ1A 1HTTA 3BZUA 4IVNA 1FU8A 3T3GA 5FRDA 4WY5A 5EZYF 3VNAA 3ST7A 1ZD5A 1GZVA 4UDNA 1N9GA 4PRYA 4V0RA 3AF0A 5JXWA 3U4QA 2V7VA 1GNQA 1WQ4A 1G41A 3MFYA 4BGVA 5DCWA 2PT7A 1U8AA 1QQAA 2ZBPA 4FQ5A 3ZXIA 3JD1A 3TWOA 4M0LA 1N2SA 3UGKA 4CF4A 2IYSA 1L1FA 3U3DA 4B3XA 1SC3A 1HK7A 3EG5A 2YNMD 3AJEA 3DL2A 4YAFA 4MEBA 3THSA 2QAGB 3GNTA 2IUTA 1E3WA 3EYAA 1L4KA 1W8DA 1PT6A 2CYBA 3K0FB 3L7AA 1AMNA 3H4VA 1E63A 1U4OA 4QQRA 1XEXB 4HDSA 4FS3A 1ST2A 3D8HA 4EABA 3NZEA 3CSSA 2J46A 3EQ6A 2J4FA 4FKZA 2DM6A 2V7BA 4I5FA 2FXIA 3QW4B 4Q6BA 4PAWA 4YWHA 5GPBA 5HW0A 2Z6UA 4EG5A 1YQDA 3KT3A 4IG4A 4N5NA 2JCBA 4WESA 3FDIA 1CQIB 4HX9A 4QKQA 2M2IA 3P0FA 4NCAA 4YC7A 1YR2A 1W19A 3RGGA 3IXQA 3MJDA 1LS6A 1GNPA 1R0BA 2EW8A 4IP0A 5BNTA 5K09A 3J81A 2AI1A 3MTEA 2PUEA 2W48A 5HS4A 3OLVA 4I1UA 5CK4A 5IBCA 1Y6QA 3FFAA 3CRQA 4NOKA 1MEEA 2E3JA 3E4DA 5JEDA 1FP1D 5TPWB 2G1KA 2AS0A 1A9SA 3ZHCA 4B81A 5AVZA 2HIMA 3I9JA 3RS3A 5CLLA 4ZV9A 1SU4A 2O2HA 1THMA 2RB5A 1NNI1 3FUVA 3LKDA 4BRZA 4ER6A 2QG9A 2F2TA 2AIRA 4G23A 3VRHA 5C8VA 2WWRA 3VSDA 1OFUA 3DULA 4WECA 2ZSHA 3RVQA 4DCNA 2NZ2A 3CCBA 4KNYA 1Y1RA 1JG3A 4JOCA 1BHO1 2B6HA 3S55A 2HNKA 3A1CA 4KMRA 1GG8A 3NUGA 2JFNA 2OV4A 1RYDA 1ISGA 1T3TA 4GF5A 4HFNA 3COJA 4RJKA 1SD1A 1QF9A 1GZHB 1D2EA 5KTSA 3EGVA 3VH3A 4C4SA 2ISQA 5AVTA 4ECEA 2OCBA 2HBYA 4KWTA 3MS7A 3B7PA 4Z7OB 2WJIA 4DCOA 4BO0A 4BPBA 1TEXA 1Z5NA 2NYVA 4HRXA 4F9TA 3IRVA 2B61A 2Y76A 2OXFA 3EHDA 3GJSA 4FZ3A 1RXWA 2BMDA 3UHJA 4HDNA 2J09A 1XQ6A 4RTNA 5HBRA 2Z8YA 3EGCA 2MCFA 2VDQB 2FZCA 2DRIA 3HUTA 1FLDA 3OIGA 1DTWA 1YR1A 4PX5A 1K7XB 1AK2A 3RS8A 3L0DA 1V16B 2K4MA 4QAQA 2X13A 4DGQA 2XBUA 3VR2D 4HDRA 1KQ3A 1WO8A 1CZLA 3EGWA 4CMGA 1QQ5A 2JFYA 3AL3A 1UL1X 3EZNA 4MKHA 4ID9A 4OQMA 2BJHA 4URFA 3RD5A 3V8EA 4AWBA 3OO0A 1Q1GA 2ZTLA 4NC9A 3FDJA 4D56A 3DE0X 4CR8A 2PTGA 2XITA 4UKDA 2FMKA 4K03A 3SX2A 4ZDWA 1DAOA 2CLHB 2R11A 3IDQA 1T5TA 1F06A 4CL8A 4V1CB 3U56A 2OUIA 3IIKA 3PEUA 3MSCA 3K1ZA 1PR3A 3E9CA 1ZN9A 3AM5A 3MXTA 1G9TA 3ZZNA 4KIFA 2H1HA 3SVLA 3C5HA 2MR6A 3K0CA 4ZMRA 3QHPA 3LH5A 4Z99A 1D8AA 2AF3C 1TZ2A 1Z16A 1U3WA 2OKCA 2W37A 1LSSA 4L8LA 1C1XA 4ZQIA 1OH7A 4KR3A 3DUFB 4Z0PA 2VCHA 4EMUA 4P2BA 1O96A 5ALJA 4XCVA 3Q0TA 5CHEA 221PA 2B6NA 2XMGA 3MJSA 4YBZA 4EJFA 4U02A 2VF4X 4IDEA 3G2NA 4NY1A 4M0UA 4K9RA 3B1VA 2FTKE 2E4UA 3V1LA 4LFAB 1CJUC 2D4HA 2HFKA 4YRCA 5AICA 1ZU4A 3VMMA 4AZ0A 3Q87B 5KOHA 3IUNA 3L0CA 3ZU2A 2EEPA 3PVCA 1JDNA 1DO2A 2AD1A 2PU5A 3EGXA 3QOXA 3JVDA 4KOEC 4BP3A 3ZWNA 4C76A 4H1WA 2EP8A 3AI2A 1LI7A 1UBRS 2MR5A 3NWBA 3ZNQA 4R7TA 5BMVB 3MT8A 1BJRE 1GAXA 1UC4B 1X9GA 2A86A 5ENDA 4MDEA 2Y71A 4B2IA 2ZXFA 3E7FA 5DMXA 3F9RA 4KLRA 3VHQA 2ZKLA 3HN2A 5TY0A 4CQLB 3V3TA 4E5SA 2RJNA 3FF1A 4LK3A 3WBJA 2NSLA 3FMOB 3IBSA 4E32A 4OGGA 3FNIA 5AT1A 3HU3A 3MINB 1UK8A 1V25A 1NULA 2O5RA 2A84A 1YIAA 2ORYA 1C3EA 1ESNA 3BL8A 4FCTA 3VKVA 4IWYA 2XWJI 4ZJPA 2P65A 3NHZA 2JC3A 3OPYA 3QMWA 5DHAA 5E3JA 3P9RA 5EGSA 2BUBA 2GB4A 5BORA 1P1JA 5NULA 2G5CA 5L3SA 3WLIA 2ATXA 4CDGA 2V96A 1YBAA 2Z2KA 1X7XB 1G42A 1W96A 1DI0A 1KDZA 3NVDA 2AR9A 2NO1A 1MAVA 2I2FA 5DRTA 3CHYA 5CG2A 1OXTA 1VA5A 2BBSA 2WSSA 1NXOA 3CT6A 3GN2A 4W9NA 3CW9A 1I2AA 1JIJA 4EF4A 5E9QA 2XZPA 3M1AA 1UWLA 1PJSA 2B34A 3ADBA 4LTDA 4TMXA 1PHPA 4EKYA 4JSRA 5GIOE 3GF4A 3LTEA 5E2IA 5CBPA 4P82A 4D0GA 3EN0A 3S8EA 1CY1A 5JNUA 2PS0A 3MWDA 1DCKA 1UBSB 1EJ6A 1VSQA 4IMRA 1I94B 3WQHA 3VJRA 2BWJA 3F3KA 5H68A 3SHFA 1ZONA 5EJ9A 3DZBA 1N2XA 4RFSA 1KMHA 5LPNA 4QXRA 3VOSA 5J2TF 2XB6A 5IUKC 1TLFA 3H9CA 4TWBA 4DJTA 5LB2A 5KC9A 3DG9A 5EHGA 2HLHA 3AQIA 4DCVA 2BFCA 1SCBA 3CWZA 1AVTA 4GRDA 4PZYA 4KB5A 2Y93A 5B12A 1GG5A 3UPUA 1RRVA 1US8A 4X8HA 4JT9A 1ZJWA 2AZ4A 4KO2S 3X3HA 1QIGA 2P11A 3KPVA 4H7IA 4UREA 5LA6A 1Z0KA 1CC1S 2EYUA 4QDXA 1E62A 4EELA 2BKAA 4UNIA 2IV7A 5LJIA 4DSOA 5CM2Z 5EIBC 4EQ6B 3NHRA 1FNNA 1YZYA 4XSVA 2VDMB 3RYFA 2WNIA 4RZIA 4RGBA 2ERYA 1UBLS 4H7EA 2D0OB 3GCDA 1FQWA 4M9SA 1WPXA 2SECE 4OHPA 3K8ZA 1NKSA 2H92A 3WOHA 2CB0A 3GRCA 2CNKA 4U2DA 4BVBA 3T3OA 1H9CA 3A6PC 2VK1A 3ZE9A 4GYJA 1T0UA 2WJ3A 3GVIA 1RWMA 1YAJA 5BQOA 2YMPA 3TNFA 3RQSA 5FPPA 1Y6RA 3IA7A 4DYHA 5JNVA 1GYPA 1IHYA 2YZNA 1J7JA 4UMFA 3ZXSA 3CZCA 1YO6A 3C3YA 1TM7E 1IUPA 1QKIA 4O3FA 4X92A 3V3KA 2RCNA 2NTJA 4TKUA 3OT1A 1EDOA 2HRBA 2Q3CA 3H1AA 1HQDA 1XRJA 1DGQA 1C7IA 1QMGA 2FMUA 2QU7A 3PPWA 4I8IA 4RH3A 2EEZA 3PIIA 5H5JA 1I3KA 1VSUA 2JZNA 2XAAA 4RK7A 3UZUA 2ZJ6A 3LPAA 4B5LA 4EYEA 5MDHA 3PNVA 3T5TA 5B6IA 3CE9A 2JASA 3BIOA 1JIKA 2R7LA 1ZSYA 5DJ5A 3NT2A 3ILYA 3RT9A 5IDXA 2PBZA 3M33A 3TRFA 1UUFA 1WCV1 1NLMA 1XPRA 1E8MA 3QKIA 4QFMA 1UAAA 1A88A 1J39A 1D2HA 1EIZA 4RTRA 5K8UA 1J7KA 4E31A 1KBZA 1QFZA 4B80A 5LUAA 1TJPB 1DXHA 1PFGA 3IUBA 3NC1C 4H2DA 2GDZA 3PWKA 4IXDA 1UQRA 3A0RB 3SI7A 1XMQB 1VJ1A 2BSXA 4Q1BA 2HCFA 1RHMA 1QAOA 4G67A 4LV5B 1RPZA 3LRXA 2TECE 2WVAA 3KNZA 1NGSA 1ZXBA 3PXBA 3EPJA 1DX4A 2BF4A 2XQGA 3ORSA 4GWLA 4Q7MB 4ZO4A 3ZOZA 4KFSA 5B30A 5D87A 5F1YA 1ABBA 1A50B 3R0JA 1PZMA 2V7QD 4EA9A 3W2IA 2HDNB 3UKOA 3AHHA 2J87A 2V5UA 7YASA 4WBNB 5JI2E 2YOHA 3ACDA 3DOFA 3N2IA 1YS6A 2FR8C 1X9IA 3JTEA 3O2NA 4KXMA 4N6GA 2BPOA 3RV3A 5JSYA 4DPLA 5FAKA 2PUGA 3QA9A 1P0PA 3S44A 5EHXA 1BCRB 2MJLA 2G9RA 2IF2A 4O4IA 3AJAA 4NOLA 3TQSA 1GFSA 2VYVA 3G5MA 3F4LA 2O5VA 2W6CX 5I7WA 2EGUA 4IUCS 4KTVE 1X80A 5LQRA 4W1RA 2VUHB 1FNCA 1PL6A 1JHYA 2GYVA 2VTEA 3U4HA 1NXQA 1WVMA 3PFWO 3RYHA 2WJYA 2P4EA 4NS1A 1NM5A 5AW1A 1EPUA 1SIWA 4ZVOA 4GU5A 4GBGA 3BD7A 3G49A 2QN2A 2X8AA 3WL8A 5A2GA 1KEKA 5K4GA 2BR5A 2F8MA 3E58A 5EP1A 1VC2A 2I7TA 3ESCA 2ZIXA 2HI0A 3LF1A 1PTJA 1APBA 4M83A 4F3KA 1USVA 4JMPA 3FHTA 2MDTA 4WK6A 4ZI5A 4YQEA 2PX5A 3WIEA 2IXDA 4L5CA 2D8AA 1U0FA 3PNQA 1RRKA 1L5KA 1UZAA 4IAOA 1NF2A 5EKUA 2QAGC 3LUFA 2X15A 5FPSA 4BO2A 3VZSA 5FPQA 4PLPA 3ROXA 3HCCA 4RW0A 3GPDG 2O2DA 3D3WA 4Q1EA 4ZZ3A 3WJAA 3G02A 4R7ZA 1JEOA 4P7GA 3BERA 4PG4A 4OUDA 4XWGA 3ZJVA 2E37A 3RF6A 3AG6A 1ENPA 1U1FA 3ZHYA 3DFZA 1SPXA 4GYWA 4MKIA 4PWZA 4MDFA 3SOPA 1KI6A 4DUZB 1EP3B 3KM0A 1MRSA 3AF3A 1X7ZA 3DPSA 1GQ2A 1QYCA 3KLMX 2BBTA 2H0QA 2WUVA 1ENOA 4H0CA 1TEVA 3SJBA 2RK3A 4BKQA 4FFMA 3DHYA 1RLTA 5EVJA 5NLLA 3EQ8A 4DLVA 1GV1A 3IEXA 3U4CA 7REQA 3AERB 2PZAA 4AZ3B 1N0IA 2UYOA 5HILA 2FSPA 4AJKA 4F46A 5IHPA 1UXGA 2ZGVA 3Q10A 4MV1A 3RASA 4ETMA 1KKLA 1UXHA 2IX9A 1JHUA 3K0HA 1G8AA 3A4MA 3GI1A 3QVKA 2GBCA 3WLMA 3FYDA 3OURA 4LE1A 4QECA 2DBVO 1TFRA 2OD2A 4I7EA 3IDZA 4KAFA 1TTQB 4HYQA 4Q4HA 4ZCPA 4BZZA 1GQFA 1ORVA 1QH8B 3L0PA 3ZHQA 2I67A 1YMUA 1S1CA 1NOKA 1SXJC 4BQIA 4O0MA 1Y4SA 3ZU4A 3MRXA 1F7UA 1C41A 5AJUA 3TW4A 5J2TA 1W30A 1S8OA 3SMVA 1VXOA 4G6ZA 2EX4A 1U3VA 4NG5A 4OHWA 4ERNA 1VSTA 2KYRA 2QRJA 2ETXA 1XMJA 3CB2A 1EMDA 2J9GA 3G0DA 3QTLA 4QPCA 3KOUA 3PDJA 3EF0A 2FSHA 2OGZA 2QTWB 3MLAA 1RQ2A 4N9WA 2X0DA 5KOJA 3AR5A 3P8ZA 1I6MA 5J5CA 3DBHB 3DBHA 3RBVA 5ENVA 4OGLA 3SMQA 1GPH1 3ZZTA 3E35A 4QM6A 5AKKA 1PQYA 1PZFA 2NUBA 3HXLA 4BEWA 1F3OA 3RK0A 3SXPA 2H0RA 4EHNA 1GSOA 3IALA 2Q7XA 4WNCA 2FKNA 4NNJA 4DV3B 1XC7A 2C4MA 1R7RA 1Y7PA 2BLLA 1EFTA 2QYTA 2RH9B 3IQGX 3M5CA 4N4AA 4O4JA 5AH0A 5C51B 1GZSA 5JSQA 4EKNB 1BC5A 4ASUA 3TW8A 2B21A 3HXTA 4KITB 4YP5A 1EUQA 1L3IA 4BS9A 1PX2A 1Y5LA 3H7IA 2WSMA 2Q07A 3ID6C 1R0CA 2WJJA 2XCUA 1F9AA 1S8NA 3FYUC 3MTGA 4HCJA 2IU0A 4AECA 4FE7A 1SD2A 3G9QA 1DRWA 2I78A 4H1VA 5F5NA 4RV5A 3VBEA 3T4PA 3S2UA 3FOWA 1JL3A 5K3EA 3IODA 3IPXA 2I55A 1TVKA 2QLJA 1ZXXA 4NX2A 2PTHA 3KR2A 4JT8A 4HAZA 2B83A 4EPWA 4I4CA 4Z4GA 1K5PA 2B4TO 2IGBA 4GBJA 4IDBA 4OY3A 1ISHA 1XRNA 4RM2A 5GAJA 1DIOB 2JI8A 4UFNA 3OC6A 4CLEA 4YY3B 1EXDA 3JYQA 3X43A 1KEVA 2A4KA 2IEDA 3AWDA 3NAQA 3H13A 1R6VA 5G41A 1XZBA 3HB4X 5SYNA 3U9TA 3VTKA 4MYSA 3IE1A 2QN9A 2PUDA 1ZNYA 3NEPX 1DAHA 3A6GA 1T9GR 2E48A 3CT4A 1GUFA 3V7NA 2PQ0A 2VHXA 3MGKA 4IBOA 3Q72A 4RK6A 5JAMA 1NSFA 2IUEA 1BHQ1 1VCHA 2Z6VA 1YQQA 1C50A 1CS0A 1Z0IA 1TUGA 1ONSA 3MFQA 4KX3A 4PPYA 4QTYA 5IWCA 4KXXA 4OB7A 3QX8A 1GKLA 1H9BA 4UHHA 1RLOA 4Y6PA 3S8YA 4KYTA 5KUTA 2XVAA 4FFRA 1U8FO 5IF3A 4CMCA 3C85A 5JO0A 5HUQA 1NIJA 2R8RA 2YZMA 5LZ8A 1XTZA 2GOYA 2PR7A 4RK4A 1KH1A 1XWWA 3ICWA 5LXTB 1A9XB 1AK9A 3ILSA 4OFXA 3E0QA 4G1VA 3BG5A 1J8VA 2W0MA 3CURA 4G1BA 2Q1XA 3FH0A 4CF3A 4UNRA 1DB3A 4X1KA 4WL0A 3UK1A 1EVEA 4YCNA 5BN3A 1IMJA 3NLLA 3H3XA 1R4NB 4S1WA 1O6GA 3HUDA 5GGXA 1MVLA 1LSUA 1JLLA 3ZHOA 1G21E 1OILA 4R98A 3ENNA 2JRLA 2OLKA 3Q1KA 3V33A 5ALVA 3R75A 4R3WA 3KV1A 5EFZA 2XMQA 3IL2A 1LQTA 1JN0A 4JI2B 1EWRA 3PF9A 4KGVA 2VH1A 1DBWA 1RPTA 5D3MB 5ALEA 1R64A 1L5WA 1B42A 4FMCB 5E4YA 3IOCA 1X15A 3RNLA 5I4KA 4TTJA 2CXOA 5CNMA 1AX9A 3F90A 2QTZA 4BE9A 5D51S 3GP5A 3N07A 3QPWA 3TSAA 5I7RA 5KNDH 2ZRCA 3L8ZA 3DHWC 2CFRA 3QEKA 4RENA 3L1JA 4UNPA 1NUHA 1TJ3A 2EF1A 1LXCA 2CCJA 1UZNA 1PDVA 4K5QA 2DHCA 3U7QB 2O8CB 3HP1A 3IEVA 1NJSA 2WM2A 1HG0A 1CE8B 1X74A 2XXBA 3LBYA 4UU7A 1ATZA 3WAJA 1R4MA 2ES4A 1QIIA 3CVOA 3NS7A 4PX2A 4Y6QA 1IWBB 3NHSA 1P2BA 5CNIA 5JSKA 5EZYB 2XRMA 1SEPA 3BIFA 1TADA 4OQPA 3FDFA 4BAGA 4KO3S 4MVJD 5ED4A 3FOEC 1G3MA 1QMPA 4X8MA 2YC2C 3ENKA 1NKTA 1M5RA 1PD0A 1LTQA 4ALMA 2AMFA 2PRSA 2VDWA 3AFOA 1Q0QA 4EY4A 3GLHB 4TYPA 3I34X 4QTXA 2Q3DA 3T7TA 4G9BA 1EA7A 1O0SA 2HDOA 2J41A 2LKDA 2R68A 5GONA 1XTRA 1DC4A 4R9SA 1GFIA 1W2HA 3LLSA 4OBBA 4LRQA 3GUZA 1WETA 4K46A 1IEWA 1NR7A 2HMTA 1R15A 4BLQA 5JV5A 2IPMA 4CTJA 5A3VA 5IVHA 3MB8A 3NH6A 1DELA 4GRIA 5FKJA 4AROA 2WICA 4DJAA 2C5LA 5JPIA 2D5CA 1XU9A 1N6HA 1E2DA 2I0FA 4FMDF 2I2AA 3PX3A 4TV8F 4F6CA 3MAJA 3CISA 3EULA 4BGEA 4WOPA 3PLRA 1HH4A 4UM7A 1KQOA 4RE6A 4RYLA 3RIGA 4IDOA 4KBGA 2YZGA 3NP7A 4RA6A 3OM8A 1CLEA 1L4LA 4C20A 4ZJYA 1X42A 2ZTMA 3TW0A 4DY4A 3DBRA 3JYHA 4D74A 1F48A 5JYBA 4R2HA 1S7CA 2IDKA 1C9EA 2XVZA 4W7IA 5U1PA 3SK0A 1G8HA 1HTWA 2YJTD 4ALKA 4KOAA 4G09A 3SYNA 1RI3A 1VMIA 4Q7KA 4YMLA 5K6TA 2WQZA 1YVPA 2Q9CA 4WJKB 4Y1EA 1YOBA 2FPIB 4D9JA 4WXRA 1SRRA 5KYVA 3RLFA 3O8NA 2D5IA 1GL7A 4HBGA 4M0CA 1NN1A 2WBLC 3H1EA 4WY8A 4ZRDA 5M5BA 4GMKA 2ODPA 2CJWA 4MWBA 4O63O 1GQYA 3TQOA 4NBRA 3U44A 3MJTA 3B1KA 3OQPA 2BGNA 1J9ZA 2HHJA 4K05A 1C1HA 1VMAA 4PONA 1BYUA 4J16A 1QHEA 4EEKA 2IYPA 4Q9KA 5KTKA 1V43A 3UIEA 3BE5A 5BV8A 1CNFA 2WOOA 2R85A 3BWVA 4MI3A 5FXMA 1KFJB 3VU0A 4CEHA 3UEOA 4E2FA 3W5BA 1ULHA 3FPHA 3C1UA 2JHAA 4UD6A 3AMVA 3W34A 2BH9A 4PIPA 3K96A 1Z5ZA 3RVOA 3RAEC 4ZYWA 5U4QA 3EVEA 4Q0MA 1OWPA 4EO4A 2X9GA 4K9SA 2AN4A 4FSHA 1DAIA 4QFCA 1J23A 2XEDA 5H83A 5KNDD 5EHIA 3UB4A 1RTKA 1UK9A 2ZSAA 3AI3A 4WOBA 1QWOA 2BTQB 2ZUWA 3AR6A 4IJMA 3TMYA 1FXWA 4BFZA 3ESRA 2ZB4A 3W1EA 5IBQA 1C9MA 4X7RA 2WIBA 1C9JA 3KOMA 4C7XA 1HDYA 2ZWMA 3W9SA 4BO4A 3UXEA 3ISTA 2W2PA 1GQRA 3AUKA 5ESXA 3LUCA 1U4SA 2GLTA 2XRYA 1XZHA 4D3XA 3B60A 4M8NE 1GDDA 1KEWA 3E5RA 4KMMA 3EUEA 3RDPA 5KQMA 1PLLA 2FN9A 5CR9A 1NBIA 4GUDA 3JALA 4WK0B 4R83A 5ITSA 3TSYA 5JZMA 3BJIC 1B74A 4ZQGA 3I8SA 4ME6A 3KSUA 4OHKA 8ATCA 4R1MA 3HBJA 5DTQA 1G8GA 4LRXA 2CHGA 5AOBA 3UN1A 1YDGA 2BFNA 1U6JA 2MYNA 3RJZA 2XYPA 4C43A 4E2WA 4E2YA 1T8WA 4FW9A 3QBEA 5DHPA 4J1TC 2H1OA 1RWXA 2ZSIA 3OF2A 4M1OA 3R9IA 4HWRA 2LE0A 4B8YA 1NX9A 4RDHA 4N40A 1KQGA 1PJ8A 3H04A 3T8YA 2DWCA 3PTLA 4IQGA 1CYEA 1SKAA 2Q4DA 3EJ6A 1LW6E 1DNPA 1GCOA 2WKWA 3ASYA 1UOOA 4RGYA 4LZZA 4ZZIA 3FYTA 1VG1A 1T35A 4HHEA 3OAAD 3ADKA 3R0QA 3L7YA 1YTUA 3PXUA 1I3MA 2HSEA 3GLIA 5AKJA 2QTHA 4JUFA 4KDRA 4XVUA 3GEHA 4O29A 4OAPA 2REXB 4KR6A 2O5CA 5ADWA 1O96B 2IYEA 3KYDB 3AETB 3E0XA 3L93A 4L85A 4XD2A 3B78A 5EN4A 4DNXA 4WEQA 1H6BA 4BNLA 2VJKA 1FFGA 4RQBA 1JEYA 4FGLA 3PYLA 4PFSA 1UINA 4AJOA 4NECA 1ZDMA 4L4UA 4EUHA 2Y0DA 3F3YA 1WZ2A 5KWJA 1ZAYA 2QTCA 1YFZA 3AONB 4YRKA 1CVRA 1WA5A 1FTNA 4MKZA 4BUZA 3OEHD 2W4IA 3ZLVA 2R00C 1TT5B 1Z0ZA 2PUHA 4MGIR 3Q5GA 2BHTA 3JV7A 4X6XA 2RHRA 2DTDA 4KMOA 3ZHVA 1T6YA 3IX7A 1K08A 4G9GA 3DEJA 3UJNA 3KKKA 3V34A 4DWJA 4NK5A 1M8GA 1QO0D 1YQTA 1Z6GA 1XDSA 4MR8A 3GPIA 2QNIA 2W6IA 4HYYA 1WMBA 4KPUA 2JCGA 3PPXA 4WGGA 4X3PA 3H1PA 2WU1A 1WSAA 4O4LA 2ZE5A 2R66A 1AV7A 4YLGA 4UAJA 3HKBA 1MO4A 1BE8A 1PJZA 5EEGA 3X1WA 2J1LA 1CUCA 1FTWA 5IBRA 3FLEA 5H82A 3WYCA 4KQIA 5BYAA 4WLOA 2IS2A 4M8LA 1VGVA 4MVJG 2Q5OA 2C9OA 2C7GA 2PV7A 2QEQA 5AVVA 5FWXB 2JH3A 4MITA 5GTDA 5M04A 1S9HA 1W9MA 3TN7A 3X2EA 3B1WA 1OX6A 1R9NA 4UE2A 4I55A 2O0KA 3HCEA 2UVDA 4EWLA 1QCYA 3NJRA 3LYLA 1HNZB 1DT5A 1NXSA 2TMGA 3TVYA 1H1LA 4KH0A 3NRCA 4F6LA 1TUEA 1X86B 1N0WA 5LSAA 4WBXC 1AKEA 3F8TA 3IH5A 4OA5A 5B2ZA 4MB6A 3M6IA 4AN4A 2BF7A 1KFCB 2FQXA 2FW7A 2JAOA 1H5QA 1KY4A 2ID7A 2PUWA 4G01B 4IH9A 3VHLB 3AOEC 4R05A 1AGPA 2Q5CA 3UBTA 1M2NA 3WGTA 4G07A 3GFBA 1VL0A 1QB7A 3WISA 4ZCTA 4MUMA 3JARA 3UFXA 1TM2A 2IZOA 4JVSB 2C42A 3RJ9A 4EFDA 3EVDA 4DMUB 3B2NA 1Q44A 1V39A 4LNAA 3REGA 1PVDA 2IWHA 4GC5A 3WAKA 3O2JA 5I8PA 3I5YA 2H9IA 2HU8A 1KOJA 3GMDA 4UZSA 4LHVA 1G3RA 1PN3A 1ZH6A 4KE9A 1V5GA 2YVLA 2X2OA 1PSDA 2P91A 3OT5A 1TNDA 2C3MA 4HXGA 4WDQA 2GHTA 4L27A 4N8DA 1X1QA 2OORC 4URXR 3UV7A 2RH8A 3TKYA 1M1YE 2VCYA 4BFXA 2NU6A 2Q2WA 3NDPA 4EFLA 3TPZA 3W5IA 2P7HA 2O0HA 3P9QA 5YASA 3UGTA 4LYAA 1FQKA 2GXSA 3U4IA 3IMEA 4Z4IA 2FDRA 3IBCA 2HX1A 1A7UA 1M0TA 1RQGA 1TQ2A 4E2XA 4KSYA 4L5AA 4M0DA 4AL4A 2N1BA 4LYJA 2R1TB 3TDNA 3V6LA 1I4TD 5LR6A 4QO7A 2WB2A 1RZRA 1ZUIA 1QS0A 3LPMA 4K9QA 5K05A 3FKSD 3NV9A 4DN6A 3ESQA 1SBTA 3F4KA 5FLKA 1BN7A 1GQOA 1TCUA 1U11A 2YBDA 4FYKA 4OQNA 1JRLA 2BI7A 4Q1AA 2PV0A 2NTNA 1I01A 3MMNA 4R8RA 5TEVA 3V4VB 4F3RA 2TMYA 4ESVA 1J2UA 1NSYA 3GROA 4N7JA 5ALTA 2QXTA 3ZU5A 4LGMA 5DN6A 5A4KA 1RACA 4XGKA 1VLVA 5B37A 4IQ0A 4CM6A 1V1JA 1GJRA 4MKXA 3GGGA 2WZBA 2B2CA 4I36A 4W9RA 2LTAA 3QV1A 1JVBA 2JFWA 2Y1WA 4PWYA 4H6WA 4Q3AA 4A5SA 3ILHA 2AUMA 2JLCA 5C7OO 3PA8A 1RP1A 2NLOA 4XVRA 3SGLA 2WSBA 3AHJA 4JGGA 2WMDA 4R8VA 1PWHA 3C3AA 5CP8A 4CIYA 2C7RA 4XDGA 3E61A 3L1KA 3DD5A 4B6GA 3VH2A 1HDIA 3T4UA 2QW0X 5B1IA 1X3SA 5I9BA 1T5LA 4WN3A 1B3BA 1NJ8A 2YDXA 4B4DA 4PSDA 4BFWA 3T5DA 4C30A 2GEFA 2FPXA 4GE0A 4LDZA 1I80A 1LJ8A 5EY5B 4JB8A 3TL6A 3V2GA 4BVLA 4RSGA 3Q3EA 3RODA 3V6MA 1UKZA 4CT4B 2W71A 5DXFA 1W73A 4O4IF 4FINA 1NU6A 4KFUA 4DMRA 2DPGA 3IPYA 1G8FA 3QW2A 4HSGA 4HPXB 3THWB 1L4MA 3RB8A 3QVJA 3FMVA 5L3QB 1FRZA 1P1BA 4N54A 2FSIA 3U80A 2PH7A 5IUNC 3KJXA 3SHQA 4RFVA 4ZZ2A 3TUJC 2QP9X 1NVEA 5LNK6 4Z51A 3CC8A 3DXYA 3EXFA 5IM5A 2HCTA 2WUFA 4JOQA 1JDVA 4WLVA 3LRPA 1BO6A 2GR9A 3NC0C 4L4XA 4U6NA 5AI4A 2Z83A 5CBKA 1YRLA 4UTOA 4L8WB 3DVAB 3VYTB 5JXIA 1EVQA 2J59A 4PZCA 2QX6A 1SJ9A 3KOWA 3VBCA 5BPFA 3HB7A 5CD9A 5LZ2A 2Y8EA 2GM4A 3A6HA 2IUSA 4I19A 4YCMA 3TTXA 1PJ4A 1FUIA 2GCEA 2HK6A 3HSYA 3NUQA 4L5IA 3PEYA 4MIYA 1NRWA 2DPMA 3EB9A 3UWMA 1IXKA 2HRRA 3ESBA 1ZUNA 3MCTA 5H3CA 2QI9F 2Y0BA 1DFHA 1Z8DA 2BEUB 4WZZA 1WNTA 4P7BA 1BXRB 2ANBA 4XFDA 1U8EA 2BZ0A 1VA4A 2P9FA 2P9EA 2ZIGA 3EEYA 1MIOA 4IFBA 3KJFA 4MJXA 2ZIXB 5HF8A 5THXA 4BMPB 2A67A 3QXSA 3GZNB 2BGJA 2OGWA 3SQNA 5EJ4A 3OY7A 3ZD7A 2X7JA 3SIXA 3O8OB 1N1EA 1ZZEA 2HF9A 5ESDA 1ZVQA 2QAGA 4M60A 4W6QA 3RNOA 4YT8A 5JZ9A 1JIUA 1N2ZA 2E5WA 2G1JA 4I3HA 4BFUA 3DEAA 3NJ4A 3PX2A 4II2A 4B3IA 4UOZA 1OI2A 3CG4A 2NN3C 2ZREA 1J1UA 2DLDA 1Q21A 4F92B 3CA8A 3LWDA 1J2TA 1HYQA 3TAUA 5AI0A 4UPDA 4YHBA 1CG6A 4TUYA 3ETGA 3NBKA 4IRXA 1HQYE 2DKNA 3RE1A 3QZUA 5GZ1A 4XH9B 4JL6A 1TQDA 3D59A 4HVAA 4TMYA 5GZ3A 3GMIA 2X5XA 3A25A 3DZCA 4HRAA 3WYEA 4BC0A 5CBPB 2J9RA 2Z58A 1GR0A 1GTMA 3BJEA 2IHNA 4M53A 1R0KA 2X2PA 1VLZA 5KNCD 3A58B 1KVUA 3OJXA 3ITKA 4JK3A 4OG2A 4QTTB 1CDZA 3KVNA 3N59A 2C7PA 5JC1A 3HYSA 2DETA 3FLBA 4RFSB 1NDHA 1MPXA 3DCIA 1UP7A 2QA5A 4EFKA 2PGLA 4G5OA 5DT9A 5A3QA 1UJ2A 3PJFA 3TQTA 2GAJA 2M6KA 3LA8A 3DFIA 4E4TA 3QMVA 5ADVA 5GZ6A 4BWGA 2AG6A 1PAUA 5F98A 2HXYA 2CVFA 1U2PA 4MW1A 2LR0A 4X44A 1OFTA 1KYQA 4N1AA 3ESYA 1Z6PA 5KQPA 2P9ZA 2YOFA 4BNKA 1NVDA 4XQ0A 3TQFA 1ZWLA 1FP6A 4C1NA 2JIZD 1OLUB 4IOJA 1JR3D 2FPLA 1WABA 2PD4A 3C7DB 2X77A 3TL2A 1TD9A 2DKOA 2XLCA 2VZ9A 1F2DA 1LJLA 1W5TA 3HJAA 5G0SA 4QAJA 4DPMA 4RACA 4UHBA 4JX8A 4CM3A 2EKQA 4OKIA 2DHEA 1QG6A 3K5WA 4P8RA 3RRBA 3T9AA 1M6NA 4JS0A 3GC6A 3BTOA 5DHUA 4WNAA 2DLNA 5CA0A 2WJVA 1JYFA 3FFXA 2I7CA 3M1YA 5CJ2A 2GZMA 4IUYA 4ETWA 1N3LA 1A95A 3RUIA 3A10A 4K8OA 3DE4X 4KACA 2L69A 2OFOA 5HE8A 2QN1A 1WRBA 3L0ZA 1JEAA 3VR6A 4LK2A 3HWRA 3WKAA 1GPDG 5FWNA 5C7YA 3E9RA 3JZDA 2CSUA 1NRXA 1U8XX 4Q1FA 2BP7B 2BP7A 2OCKA 3KQQA 1RZVA 2VBGA 1RRMA 1M3SA 4U7PB 1KSFX 1TU0A 3LKBA 1RP7A 4W9MC 1Y33E 4NOJA 2ZBRA 5EJ8A 1AK1A 4B09A 1ISIA 1E66A 1A8SA 1JWAB 3LS2A 5CNKA 4F9GA 1QYRA 3GELA 4E5MA 1J0EA 1MG0A 1S2IA 3PC3A 1QVZA 1Z2AA 2O2XA 2A0UA 3F8SA 4PTZA 4B6RA 1X1BA 3KYIB 4O4JF 5DYYA 1K6XA 2X5KO 1FU4A 3KIPA 1CF4A 1T5IA 2Y9PB 4PHCA 3CYFA 1L7QA 2FPSA 5ER6A 1SUSA 4DCCA 1FUUA 3HKEB 1LNZA 3HKEA 1VG0B 3HP4A 2RGXA 1ZD9A 4IVPA 3SZMA 3D3NA 1F38A 2D13A 5JG7A 2ECKA 1FYXA 2PX8A 5C8YF 3AEQB 4HRVA 2D1QA 3JQ6A 2QSUA 1BX1A 3T95A 3K4HA 2G7MC 1KBOA 4TLMB 3PDHA 1LWNA 2XA2A 4RNCA 5CW2A 5LP6C 1SGWA 2GAIA 3MW8A 4OA8A 3KSDO 4Q4JA 1RDFA 1H8HD 3BH7A 2CZCA 2Y4OA 3W5VA 1Z4QA 5CX1B 3GGCA 3WADA 1QVVA 3S8MA 1Y8RB 5HIKA 2P7IA 3TSCA 2PSDA 1S2MA 2CHUA 1JR2A 1R88A 2BMEA 3MJEA 3OF3A 4BCBA 3VAAA 3C4VA 3OJCA 5JS6A 2ZFUA 2ZYUX 4JYPA 3ZJ4A 4BMCA 1YS2X 1O9BA 1PQPA 2QIPA 4HG2A 3RC9A 5JMOA 1AGNA 3F71A 2AMLA 3GUVA 3VSCA 4J76A 4FC6A 3PWZA 1U0TA 1HMYA 4ND8B 4NPHA 1GU1A 1IG3A 3ZWKA 4KVAA 4IIBA 3N0TA 1G8SA 2CK3D 2BJWA 2RGWA 4DMMA 5ELXA 3KKNA 1RJGA 1USWA 5KVSA 4L4YA 4KQEA 1Y6FA 5DM4A 3RC8A 2B5WA 1E1RD 1T2AA 1E5XA 1EXMA 5F5LA 2G3YA 3U48A 2X4IA 1FJGB 3TGPA 1U2TA 3I5UA 1OI3A 2EKZA 1JEQB 3IHLA 3EODA 4M88A 5I9NA 1KGSA 4QGFA 1GZDA 3TIFA 1NA5A 5C46F 3KVRA 3GBVA 4MTLA 4MARA 5TQJA 4C3ZA 2XCIA 3BICA 3BWEA 4U39A 4OHZA 1KJ8A 4MVJA 3OE7D 1PL7A 3PFNA 3PRJA 4I3FA 4JI3B 4LBVA 5HWSA 3TBHA 5A71A 1DRJA 1R6AA 5E7IA 4ZOAA 1BWRA 2YJ5A 4J4HA 6YASA 2QPOA 1ULZA 1RCFA 2PSHA 4V0MA 4CQMB 4OUDB 4A6DA 3EQ7A 4PN7A 1NBWB 4H6XA 4B7XA 1JYEA 4B8WA 1IM2A 1NW3A 2I6TA 4P31A 2WC1A 1SXJB 4ABYA 2XYGA 2YN4A 3GJ8A 2GFHA 4MIKA 3MXOA 5IFLA 2HHCA 1NFRA 1SC6A 1RXYA 2RGEA 1MJFA 2ZR7A 3EDYA 3L4EA 3FW1A 4OATA 3ZY2A 5IKMA 1X2EA 5JYEA 4QYIA 2E6KA 5F9MA 2V0GA 3WNBA 4KH1A 1WZCA 2NUAB 3EGOA 1ZITA 2A0FA 4UE6A 3SVTA 1O0CA 5F3WB 1PCXA 4HATA 4TUYF 1IE3A 2P9CA 2W22A 1Q1EA 4C05A 4P08A 2CF5A 1LF0A 1CULC 1QLWA 2Z4TA 2QMOA 4WD3A 1PE0A 4DUGA 5D3MA 3JVUA 4RDIA 2GKGA 4RV4A 1CUGA 3BXGA 2ATEA 5MN6A 2I22A 1PGJA 1IQ0A 3H17A 3OA2A 4DG8A 3L7BA 4XD7A 4NCNA 4J94A 4ZVNA 3C7TA 3I5XA 2YWBA 2AFIA 3LFUA 3PR2B 4P2GA 2VDRB 1FMLA 5CFRA 3LVFO 5HIIA 1ULUA 2WQ6A 4ZO9A 4A6EA 3GPBA 1NF9A 1E5QA 1Z75A 1ADBA 3ASVA 4H6PA 5DYNA 1N2CA 4ZU6X 5DYTA 1X6VA 2GVNA 2X40A 3JQFA 5DE3A 2CLLB 3DCNA 2VEDA 1ZM7A 2A94A 2EFEB 3SQXA 3EVCA 4NZMA 4DIUA 2DFNA 4HAYA 4PN3A 1ZGZA 1Q7GA 5JU6A 1H4VB 2ZI6A 2B8NA 2DOKA 1JHXA 2ZSUA 4KAAA 3VKFA 3I61A 2HA4A 4QHYA 4CW7A 2Q2QA 2WD7B 3BWXA 2DR2A 4ZEMA 3HUEA 4BNHA 4EHFA 1CUWA 2VG8A 3L4BA 1Y9EA 5DGIA 1LD3A 1Z0AA 4HPJB 1FU7A 1AS0A 1LDMA 2ZSBA 1SAYA 1O2DA 1XCGB 3O31A 4QBTA 2EW2A 3IV6A 4EO7A 4NNOA 1SRQA 4OSPA 2QIOA 4RKQA 2WWVD 4TZ0A 5A06A 4CCWA 4BKMA 4MHOA 1KKMA 2FUEA 3ZYCA 5GQSA 4FFVA 1VP3A 1ZD1A 4UVEA 1P91A 3AXSA 3D4LA 1VQ1A 3KKPA 3TI9A 2UYHA 1EFDN 4PPGA 2WV9A 4URHA 4P3NA 8LDHA 5FYDA 3PYMA 4B7CA 2AN1A 2Q6IA 3G6WA 2FUNB 2WJHA 1X7DA 3JQPA 1CUYA 1NF8A 3QELA 4LQDA 1WBBA 4XEHA 3GGSA 4ZTZB 2W6QA 1MO6A 2YHIB 4X64B 4B3SB 4DJJA 4ZRNA 4BQRA 1CF2O 2ZJZA 4IVRA 4XW2A 2OMKA 3H2YA 5TQVA 2EP7A 4C5BA 3N2KA 4DA6A 5LQUA 3EZ9A 4P80A 4JQOA 1Z25A 1H65A 1NPYA 4ZP1A 4L0MA 3SFVA 2FWNA 2YICA 3E7PA 1LK0A 4C78A 4OX9Y 2PMBA 2AQHA 3G1UA 3WZLA 1Q77A 1U3FA 1W85B 3DT6A 1TVCA 3HFSA 2AJBA 3JATB 3KLNA 3M1LA 1OGJA 3UTCA 2XGJA 1QH9A 3DTVA 5KJ1A 3ZNNA 4O1IA 2KQUA 1PEYA 1NLZA 4UJ5A 1SQ0A 1P1CA 4M9UA 4MGYR 2ZYGA 3CUWA 2FPPA 5FO0A 4TMZA 3OUUA 5G40A 1PBNA 5AW9A 4QUKA 4ND4A 4UTRA 5LQDA 1Z17A 1KK0A 5TPWA 1B41A 5HIAA 4F2PA 1FXWF 3O4JA 4MUHA 4LNHA 2VBCA 4K2HA 2XH8A 5AXAA 4E21A 2UU9B 1A8HA 1HE1C 2IZ5A 2MSKA 2O23A 3DE6X 3VQTA 1WUHS 2FWBA 3UPDA 3R7WA 4XJSA 3VFDA 1CEXA 1QNFA 2VAWA 3BMOA 4Q05A 1Z39A 3N74A 3H99A 4G1MB 4YXFA 3JQ8A 1DBPA 1AUQA 3K72B 4R9RA 3IAM6 5EGNA 5EINA 3SZOA 3UV3A 4BO9A 3GGDA 3BGIA 3HY6A 4DRYA 5K8TA 2C77A 2X5OA 4N3BA 2F48A 5EXDA 4AS3A 1H3EA 5F9FA 1MFPA 3AY0A 3WS7A 1IOVA 4B6QA 5AMXA 3IUMA 2HIHA 1J9GA 2ZP1A 1T5DX 4WX2B 4EX6A 3UJCA 3JQAD 3SU8A 2H4WA 1P39A 4GICA 2P1DA 4LXTA 2JEYA 5C8XA 1DVRA 5KNBH 5IHXA 3GV0A 1GKUB 5IH7A 3PVZA 4YCAA 4NI5A 2H1LA 2RK4A 2EIXA 1AS2A 2GI4A 5IM4A 3KO8A 1Q3KA 4LVOA 1QM5A 2O8BA 4BXOA 3DYIA 4D4IA 1HWYA 4RGQA 1JBKA 4Z53A 4OK6A 4O6VA 3DLBA 3LT0A 4LSZA 3NEAA 2GNAA 3IQZA 3LL4A 2QBYB 4F4CA 3SR4A 3UH1A 4XQ9A 3PRYA 1OAAA 4D9KA 5JBIA 1N1GA 4JLWA 2Z6AA 4EBBA 1JLMA 3LT2A 4IGFA 3CINA 3QUTA 3HFJA 2FE1A 5CB0A 4KPGA 2BFFB 2XA1A 4F8EA 3WIDA 3WA6A 2WF5A 4U6QA 4K6KA 5F3DA 3RU3A 4MZDA 4JV5B 3KBOA 1MJGM 3GLKA 4FCVA 5IX8A 1BJKA 1IHOA 2JGFA 4MS1B 4GQIA 3DZ8A 4CLXA 1ULSA 1KAHA 4OP3A 3TK1A 3CPHA 1P0MA 3UJDA 4C7VA 1H42A 1XV5A 4RSMA 4HWKA 4XPIA 4INPA 1TIKA 4HQFA 2F1JA 4Z4EA 2IOFA 3FOAA 1UJMA 3L1IA 5KOHB 5COBA 2AR7A 2QS9A 3CF4A 3LD9A 1GSHA 3QKSA 4KDEA 3TRDA 1YR6A 2Z8XA 3O8CA 3RRMA 2DE0X 1A9YA 1F4PA 3DMDA 1L4UA 4O4LF 2QE7A 3ZI4A 1I10A 2FRVA 1MV5A 3ZU6A 4BV9A 1TF5A 4QD3A 3USCS 1L5MA 2ARKA 4RTKA 3GRFA 1VSBA 1PVOA 4H16A 1U0NA 1XN1A 3STXA 3SHVA 4AULA 1SELA 3GRKA 3L7OA 2QQFA 1E6KA 1WV1A 2D2FA 1J0BA 2C95A 4CR7A 4CIXA 4WJLA 2QKYA 4JH0A 1PGQA 1RM3A 2GPWA 2P4HX 3E84A 5DN6D 3AQ4A 3G88A 1WMEA 3Q0IA 1E2NA 1CQJB 1OBFO 3KB8A 4AQ7A 5I3CA 2C03A 3IUQA 3QTBA 1F1JA 1HZZA 2RBKA 2RHMA 5HVNA 1M0WA 1BIFA 1PKEA 1U8YA 1AE1A 2GBGA 2ZIFA 4RMHA 4LCJA 1HTBA 4TMFA 3OCYA 5DCUA 2RKBA 3ZDBA 2K6GA 3W7VA 1BH6A 1TKBA 3I05A 3IDAA 4LJ9A 4C87A 4DUGD 2QL6A 3D3QA 4NU5A 2HNBA 5BPHA 5IBPA 3WIBA 3EUWA 2IRWA 2DPXA 1E99A 4HZGA 5JXGA 4FOLA 4UUBA 1V7ZA 2WYUA 3QVXA 1HA3A 4Q4DA 4CDRA 4JLSA 1J5XA 1KFBB 3G0BA 4IHKA 2H07A 2Q9BA 2EATA 4F72A 4UTPA 2X22A 2PQMA 1EBFA 3I1YA 2V4MA 1YZTA 1N3YA 1T9AA 3E2IA 4MRMB 4V0LA 5KU1A 1RM0A 3R0IA 4BB5A 3UCEA 4DIFA 5LMUB 5IJZA 3P52A 1Y8CA 1N92A 4IICA 2J9FA 3T7DA 3OJWA 2JIPA 1HFEL 2BFMA 2I4TA 2VT2A 3C14C 4MSUA 3VHRA 4AF6A 2LXNA 5E6RA 5EIFA 2XOKD 1HM5A 5K9ZA 1OXVA 5KO2A 1OGYA 1E2HA 2GS9A 4WESB 1P29A 5F7XA 1XNRB 4FN5A 2FQYA 1CQXA 2ECQA 2D2EA 4Q34A 2E4VA 4JC0A 4YDHB 3RHSA 4B3HA 3LVBA 2VTVA 1NX6A 3URMA 4QQNA 1Q6ZA 2WJWA 5MFPA 2XD4A 1DHRA 1WCXA 3QYPA 4US1R 5FOUA 5F9HA 4UOQA 4LVUA 2FHSA 1ZK1A 3R5XA 1PJBA 2POCA 2ZJ0A 3N39C 3WGNA 3VMFA 4ICIA 2CB9A 3V4ZA 1U98A 4HH0A 1JR6A 1GZ3A 3EEQA 3TRJA 3ROTA 4Q9DA 3PSAA 4ONEA 3O0TA 3SX4A 4B33A 3FHOA 2PLFA 3VGPA 1Z15A 4C3VA 3AR3A 1HI9A 2NO5A 2OVFA 2BR3A 2RGCA 4L4RA 5DBEX 2QM7A 3GCZA 3IIMA 4MMYB 1RWVA 3ZI0A 5LQMA 2XXAB 1P5ZB 1T4MA 2PNFA 4JLAA 3WLQA 2VDJA 5A6VA 1GVNB 2XMSA 3HA5A 3ODGA 2I3ZA 2AK2A 2DWOA 2Z04A 1WY7A 1PYDA 1ZK3A 2ZJ5A 3KUUA 4UAUA 1FQJA 2Q1UA 5EKTA 3SJ7A 2QU8A 4QUBA 2Q5JA 4XVQA 2QN3A 3QEJA 2YIMA 4FK8A 1HLGA 1VHWA 3M6FA 3VJKA 3WG9A 2PGOA 3Q3IA 3O4IA 2Q8NA 4UTZA 3MERA 1G1MA 3Q6IA 4Z9XA 521PA 1RWPA 3E1KA 1EG7A 4PLCA 4OGWA 2J6CA 4RMNA 4WQMA 3ZOKA 3QXXA 1XZPA 5I8WA 3NU1A 2WHXA 1XCOA 1ZUHA 2VUIB 2PMEA 1Z22A 1QIFA 1I2CA 2JI7A 2WE7A 3H97A 2VR1A 4UXJA 4YV1A 5K2OA 4XIIA 1JIIA 4M1KA 4DLBA 4LC1A 1KRWA 3UA4A 4XDZA 2C00A 1O4VA 3BSFA 1C7ZA 2YYZA 5E1BA 1ZGJA 4Z4QA 3IOBA 3KPJA 4D2IA 2Z5FA 1P9NA 1RE1A 1YB6A 5DT2A 5CDGA 2O07A 2Q0QA 5HKKA 1O5IA 4JJAA 4J03A 2R47A 4DQKA 2YCBA 2AK3A 4GMGA 1NKVA 2P27A 5CAEA 3NHYA 2O3JA 4IHQA 2RI0A 3Q7SA 4UHDA 1JDBB 3FUCA 4EKGA 2WTAA 1A27A 3OQIA 4E30A 2VDLB 3M4XA 4D3SA 3I53A 3NT4A 3P94A 2JVJA 3TOZA 3LO5A 1TK3A 3D7NA 3MWLA 1N9GB 1ZMXA 1QGOA 2PH3A 3FETA 3O8QA 1UDWA 2PA3A 2XADA 3LZDA 2XQVA 4DBLC 8ABPA 2QD4A 5KAPA 2ZSFA 4D79A 1I5EA 2BONA 1ZSNA 2A5JA 2G82A 1OLXB 1KO1A 3Q88A 1G8PA 4HQLA 1XLWA 4IDDA 5SZIA 1MZPA 4GPBA 3K09C 4D81A 5JQGF 3V7YA 2W4MA 3B1JA 3U7EB 1TLLA 1JPNA 4NYIQ 3CH6A 4QL3A 3UAVA 1YVEI 1KAEA 4HFMA 5DWVA 4REQB 1T1IA 3M6WA 2RGRA 2OQVA 1OYYA 4ND3A 1P1KA 4YCDA 5JPDA 4GRAA 3JSXA 1QYWA 2E82A 5BR4A 1BCRA 1UOEA 3NAGA 5H4GA 5FYQA 5CMLA 1YA6A 2F7SA 3VA7A 2JJ2D 3LV8A 1SHUX 4Q66C 5B3JA 1B6RA 2CD9A 3RVJA 1C4OA 1UC5B 1P6UA 5L6LB 1SUFA 2VDPB 2ZM6B 2FSFA 1M2VA 3NYWA 4JI5B 1ZM9A 3S7ZA 4UUQA 4BCDA 5ELLA 3ETCA 3SFZA 4OK5A 3QM1A 5TC4A 2B25A 1ULBA 4OIFA 5FPTA 5FNVB 1DS6A 2NTVA 1P9RA 3GVXA 3W7AA 1ADFA 1U6IA 2O1WA 5IEJA 3EEIA 2XUDA 1Y3BE 4BTEA 4PYLA 3PXDA 4Q39A 3HN7A 1VCNA 3K6JA 5L3SB 2BV3A 2CDAA 3BE6A 2ZSJA 1H6AA 2IBMA 3A1UA 3N8NA 1U0GA 1XEXA 2VAVA 2RJOA 2XGGA 3FVRA 2Q5EA 1UMDB 2R44A 5L7WA 3P9ZA 3IKLA 1A5AB 1C7QA 3FKJA 3K1YA 1BEZA 1OV4A 3DWEX 4MUFA 1HYGA 4XSGA 3EW7A 1A72A 1UXIA 1II8B 3EOAI 3LHSA 1H3NA 1ND5A 4N7BA 1ONBA 4M6WB 5LP6A 3ANLA 3CTMA 2I4RA 3A7EA 3U49A 5HYVA 1ODIA 3M6AA 1FW8A 1HLPA 3P9PA 1XJQA 1GA6A 3QHQA 2PX3A 3MNFA 1R2QA 1AKTA 1U9JA 1MG5A 2RHHA 1QBGA 2B20A 2IJGX 1T3LA 3CRZA 2F00A 2WHYA 1W88A 2GZ3A 2HMUA 2PMWB 4I1VA 3MILA 4YUXA 1OA1A 5FEUA 3REOA 1WIWA 2Q6KA 3ROQA 5K3BA 2I7XA 2G4CA 1XEFA 1GGEA 2Z09A 4FHCA 1O97C 2FDCA 3QE3A 2FP4B 1W581 4IR7A 1WMAA 3VVLA 4B7UA 2IITA 2P30A 1FSSA 2XGSA 2IYUA 2QWXA 3LW8A 2FGJA 1XN4A 2FPOA 4J2OA 3KKZA 1MP0A 2R62A 1U80A 2ZI5A 3F97A 3A1TA 4J2HA 4K6HA 4RJIA 3S28A 4BZWA 2IDJA 5FH9A 4LECA 2VPTA 4U1RA 4R69A 1PF7E 3EVNA 3A26A 3BHNA 1U1GA 4O4JB 4ER7A 3KEGA 3OOEA 1YBFA 4WKGA 3RHZA 1TM3E 3T1HB 3I39X 4MUIA 1KYYA 2FUG6 1ORHA 1XJWA 3F0TA 1QDUA 4RF3A 1WW2A 2HK9A 1ISJA 2QP4A 2X7HA 3U4GA 5L7TA 1LRJA 3GG2A 1BW9B 5JNSA 4MI9A 1ZEMA 3KTAB 2B99A 2JK1A 3OCXA 2C2XA 3MM4A 4IWNA 4RHCA 5H81A 5SY9A 2WJAA 2R96A 3FB1A 3EG9B 3EG9A 1LRLA 3O7MA 4P1ZA 3AIIA 2R9VA 3ZGYA 4CF7A 1E2QA 2HEIA 2ZBQA 4LF8B 3PQDA 4GX1A 3MD0A 4A0HA 1U7XA 3WGGA 5FUMA 1PFVA 5JNRA 4AKTA 1QANA 2RK6A 3HI6A 2WE8A 3QLVC 3C41J 1U3DA 1Y7LA 4IF4A 1M2OB 4A8PA 4TWJA 2C4HA 2C3PA 4KQWA 5KCMA 3U62A 5JAUA 2GRUA 1QF6A 1DUVG 4DXDA 5CB8A 4S0ZA 4E11A 4QJIA 1ZYUA 3TIXB 2E49A 1RADA 1XEAA 1P74A 2KW5A 5A9TA 2OM2A 2QVYX 3PR3A 3SYTA 4DWVA 2REQA 1NZFA 1FYWA 5LXTF 4F96A 1VJ0A 2DAPA 3B36A 4EKEA 5C5DA 1XDBA 5LQKA 3C39A 3V8RA 2UZ1B 2XMZA 3C3DA 4BNGA 1I6KA 1GAQA 3R5HA 3OQOA 2Q1YA 4D0SA 1ZRSA 1OBVA 4GXNA 4YXWD 2JA2A 2YCLA 4KKVA 4PAQA 1OLOA 5FADA 1BE0A 2JFHA 3AUJB 4XJTA 4ZHQA 1R27A 4OI4A 4L9WA 3QBJA 3I5AA 4R2LA 4XQGA 5EWMA 4B47A 1U63A 3OPYB 1PIWA 3RARA 4ZOQI 1EE9A 3OOHA 3KU1A 3WDMA 2Y1OA 1V37A 2HRZA 2GPTA 5BYBA 3MWFA 1Q7RA 4BAZA 1U5BA 3ZW8A 1N36B 5CYPA 1JPUA 1K9VF 2AJDA 4MQMA 4BE7B 3U3RA 3U60B 4QBIA 4J91A 5CXQA 1GGNA 3LOPA 2GO1A 3G2QA 1E7MA 1PK7A 1XOIA 4MCAA 4K81B 3TE7A 1CY2A 1P3JA 2JLSA 4F11A 5KJFA 4B75A 3W9UA 2AWOA 3TQHA 3OAAA 3PDUA 3M34A 2CJYA 4JD5A 2Y77A 1VKNA 3SC2A 4A6PA 3L92A 4DIKA 1XK6A 3LP5A 5EE1A 2J7PA 1MB2A 5PNTA 3R4VA 1QG2A 5T57A 3GZ4A 1A9PA 1RJEA 1I6WA 1N8NA 3GGOA 1YE3A 3NYQA 1YCDA 1C8KA 2ZYTX 4C4XA 4RORA 2F4VB 4TUYB 4M0PA 4G4IA 1WS6A 2XTZA 2GXAA 2WFZA 2YJNA 3H1TA 4UUPA 3SZUA 4I1IA 1C3JA 3UUEA 5BUCA 3L9XA 1XLVA 1KI6B 3FYCA 4TZTA 4KU4A 1DARA 1ZD2P 1UAYA 2HQSA 1DZIA 1BRTA 2P0EA 4HH3C 5DXJA 5SV2A 1IN8A 1E8NA 1ZH4A 4UBLA 1GEEA 3D8NA 1JMKC 1Z82A 2IXBA 1AG9A 2YW2A 4AZSA 2CMGA 4JJGA 4E5NA 1RZUA 1T5HX 1ZKDA 3HEMA 4N03A 4BOYA 4BX2A 1RHKA 1KS9A 3BGSA 2EIHA 1FX0A 3FDXA 1GUDA 4FMBB 4MEJA 4AAYA 5DH9A 3EDMA 3KDAA 4DILA 5FJJA 2JJMA 3IDOA 1EK6A 1YZLA 2JIDA 3I01M 3QWAA 1OHHA 3G17A 4LW8A 3TD6A 3OX2A 3Q5DA 3WYDA 1DBSA 2XPCA 4NBVA 4CQMD 3IFSA 3PQ4A 2I6SA 3G2HA 1JTFA 1DKOA 3THYB 1XDWA 1HDRA 1UZMA 1W47A 1WQ3A 2NYRA 3Q3GE 4MVJH 3SDBA 1KQPA 4HP8A 3LECA 1WU7A 1UBGA 3SM9A 3SJUA 4AC9A 3PGLA 2PEYA 3GJ6A 2PWYA 2H1IA 3ZE6A 2Z6QA 2MSNA 4OMFG 3KRTA 5CJJA 3VNSA 1BE6A 1S4QA 3H86A 3OX3A 2CLSA 3PX7A 1JU4A 4J49A 2Z2YA 5KZMB 3D43A 2HR1A 1PYGA 4LJKA 5LU9A 4XM2A 2X1HA 4RZSA 4YRZA 2QP3A