2VK2A

Crystal structure of a galactofuranose binding protein
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
296
structure length
296
Chain Sequence
PLTVGFSQVGSESGWRAAETNVAKSEAEKRGITLKIADGQQKQENQIKAVRSFVAQGVDAIFIAPVVATGWEPVLKEAKDAEIPVFLLDRSIDVKDKSLYMTTVTADNILEGKLIGDWLVKEVNGKPCNVVELQGTVGASVAIDRKKGFAEAIKNAPNIKIIRSQSGDFTRSKGKEVMESFIKAENNGKNICMVYAHNDDMVIGAIQAIKEAGLKPGKDILTGSIDGVPDIYKAMMDGEANASVELTPNMAGPAFDALEKYKKDGTMPEKLTLTKSTLYLPDTAKEELEKKKNMGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ABC TRANSPORTER PERIPLASMIC-BINDING PROTEIN YTFQ
publication title Furanose-Specific Sugar Transport: Characterization of a Bacterial Galactofuranose-Binding Protein.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 119
structure length 296
sequence length 296
ec nomenclature
pdb deposition date 2007-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13407 Peripla_BP_4 Periplasmic binding protein domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2vk2A01
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2vk2A02
1B00A 2V0NA 1DP4A 1Z26A 1LK0A 3IPCA 2LP4Y 4Q6WA 4IRXA 4F06A 2FQXA 4MS4A 1PNTA 4G0XA 3BRSA 5CNIA 3LMKA 3FFXA 3H6GA 4P98A 1RXIA 1LBHA 3MYYA 3HXMA 3D02A 2H0AA 1JH9A 2P4UA 3Q7TA 2I6FA 2QW1A 3LUGA 3NNDA 1QO0A 1PUXA 2FQYA 1YTUA 3FMVA 3IP9A 4Q7EA 4MQFA 3BRQA 4PYRA 3SG0A 1FSPA 1TMYA 3GBVA 3H5OA 4WZZA 3DBIA 2FMFA 4S05A 4MR9A 4N03A 1YK0A 1LBIA 3JVDA 3RVPA 1JDNA 3MMNA 4DN6A 8ABPA 1EWKA 1NXPA 1USKA 1DCKA 2IOYA 3HUTA 1T34A 1LJLA 5CNMA 3N6VA 4HNSA 3OM1A 2NT3A 4RV5A 4KMRA 4Z4FA 4G0ZA 3OQOA 4DADA 2E4VA 4MR8B 2YHAA 3HV2A 3KS9A 5GQSA 3OQNA 1E2BA 3Q7SA 1MAVA 1F51E 1CEYA 1DBQA 2B4AA 1ZH4A 3KLOA 3SM9A 2QR3A 2E4ZA 1L5YA 3OO0A 1NXVA 1R8JA 2CHEA 4Z99A 2PL9A 1DCFA 4JA2A 4E7OA 4YLEA 3RVMA 3OQMA 4KK3A 1ZHHA 4NQRA 4RKRA 3EQZA 3F7NA 3C3WA 2R47A 4JB0A 4RK6A 3KSMA 1S8NA 3C3KA 3T38A 1D2AA 3JTEA 3RVJA 1NXWA 2BGGA 3CRNA 3ROTA 1SXGA 2MYPA 4FE7A 9ABPA 2HQRA 3SAJA 3C97A 1AB5A 3DGFC 4MR8A 1YS7A 3CHYA 5HM6A 5T7BA 1D1PA 1DBWA 1QKKA 4H3KB 5CHYA 5EWJB 4ZYLA 2VYCA 1U0SY 3SQNA 3G1WA 1ZGGA 4Z4EA 3OLZA 3QELB 4MR7A 3TX6A 5GOTA 2WJAA 3CG0A 3OMWA 3O21A 4EVQA 1RXEA 4NCAA 3I45A 2P9HA 1YIOA 1FFWA 1TJYA 3ILHA 4Z9AA 4KNYA 3NNNA 2FMIA 1NATA 1RPJA 3LUCA 1TM2A 1EFAA 3UKJA 2Q5CA 4HNRA 1JHZA 3E61A 7ABPA 1QQAA 4IMJB 1VRVA 2LBPA 4LDZA 4LRQA 2LPMA 1VKRA 3H1GA 1VPWA 1ZITA 1GCAA 1P8AA 1DG9A 1Z25A 3EULA 1BDIA 3I42A 3K4HA 3F73A 3HDVA 4LZLA 2QU7A 3LTEA 4RZSA 3NHMA 1JBEA 4RWEA 2L19A 2PUFA 2JB9A 1HEYA 3LUAA 1Z12A 1DJMA 3E3MA 2FSPA 3QLVC 2QVCA 1ABEA 1Z17A 2PJUA 4MPTA 4HYEA 2F8TA 1JYEA 1QPZA 2GX6A 4Z4GA 3JS5A 3QELA 4RU1A 3DLHA 2JBAA 4N41A 3LUFA 3RVNA 2H3HA 2RJNA 1D5WA 1BDHA 3GWGA 3T8YA 2PUCA 2GBPA 2L17A 4RY8A 3H1EA 5KI6A 1XHFA 1K68A 2MSWA 3CG4A 4Z0NA 1DRKA 4RK1A 4ETNA 3H5WA 5HKOA 3A10A 3T6KA 5DCLA 4OLBA 4LE2A 1URPA 2F8SA 3A3KA 2KYRA 1E6KA 4O5AA 1A2OA 1EAYA 4PEVA 4PICA 3H5VA 4WXMA 4YS6A 2B1JA 3HO1A 4YV7A 2GI4A 1JX6A 2GKGA 4ZMSA 1Z18A 1QQBA 3H6HA 2NZUG 3P9YA 4IILA 5JNVA 1SXIA 1JFTA 2HJ9A 4YP9A 1NY5A 2JVKA 4XASA 1U04A 3QEMB 1EHCA 3HDGA 4N47A 3RVLA 2FEPA 3CZ5A 4YRZA 1VLZA 4RXTA 3KG2A 2L2QA 3CLKA 2WB4A 4IMIB 4WWHA 5JS2A 4EYQA 5KWSA 1EWTA 3S99A 5D2CA 1KRXA 4MQEA 5DLEA 2DRIA 4N0QA 1OXBB 2L18A 4RY0A 4W5TA 1U2PA 1DC8A 3GV0A 4N0PA 1Z15A 3UK0A 5FWXB 4RXMA 1CYEA 3IP7A 4RKQA 2HQOA 4RK0A 3FDFA 1YMUA 4Z4IA 3HJFA 1TLFA 4RK7A 4OBBA 3Q15C 2JK1A 1QP7A 1QP0A 1A0OA 2QXYA 5IEBA 3FGZA 4D6YA 5JNTA 1PNRA 4YWHA 2HSGA 2NZVG 2J48A 3LOPA 5IX8A 3HVRA 4KPYA 5E3JA 3L49A 1DZ3A 4ETMA 1P2FA 5HSGA 5KC8A 4JOQA 1W9HA 5KQMA 3QK7A 1QP4A 2OENG 3FFWA 2XDYA 2R4QA 3IP6A 4HNQA 4QYWA 1RZRD 2CD7A 2IKSA 3M6MD 1ZH2A 1D1QA 3FFTA 5FWXA 4F11A 4Z4CA 1RZRA 1ISSA 1PHRA 5TE9A 5IUNC 1P6UA 4XXHA 4H3HB 1ISRA 4PE5B 2E4YA 3H5IA 1JWLA 2FLKA 2JRLA 4KFCA 3MA0A 2IDMA 2R48A 2PKXA 5DKFA 1E6LA 4WT7A 3K9CA 5IC5A 3RVQA 1ZY2A 3H5LA 1W25A 4EVRA 1MIHA 3URMA 4YO7A 1C0EA 3EDCA 4ZPJA 3IP5A 5KQLA 3DLBA 4G0OA 4D74A 4QICA 5FBKA 3RQIA 4UHKA 3A0RB 2TMYA 1K66A 4EY3A 4F12A 3UUGA 5FWYB 2QZJA 4N76A 4KQ9A 1NXSA 4WXEA 2IPMA 1SXHA 3D8UA 4G0MA 2VK2A 4ZMRA 3RVRA 2QV0A 5TQ0B 4P1ZA 2FEWB 4W5OA 1YK1A 2ZWMA 5DTEA 2MSLA 2N9UA 3OMXA 2YHBA 5KQPA 4O1IA 1JLKA 1RNLA 1I3CA 3F6CA 3O1IC 5F64A 3RVOA 2PE5A 1PEAA 1XWWA 4LX8A 3QX9A 4W5RA 1YS6A 1ZESA 1BVHA 5CNJA 3N0XA 3N0WA 2FN8A 3NHZA 3QLVA 1M2FA 4FB4A 1NXOA 3CKMA 1M5TA 1NXXA 2WY2D 4RDCA 1DC7A 1JDPA 4L4UA 3NBMA 5I4CA 4WUTA 3OLWA 3Q7RA 1DRJA 5EWJA 2PUEA 1ZAYA 3N8IA 4JP1A 5FWYA 3KJXA 3H1FA 5TPZD 2LUOA 4EUKA 4F8JA 3TMYA 5EWMB 3BREA 5TQ0A 3Q9SA 5JNRA 4YCSA 4RK5A 3A0UA 5CNKA 3KHTA 3LUHA 1Z16A 5EWLB 4Z4HA 3CFYA 2FMKA 1JFVA 5JNWA 2FN9A 4DQDA 1AB6A 2M98A 4QYMA 3O74A 3TD9A 4ETIA 1LJUA 1KRWA 5TPWB 2PLNA 2FVYA 4KREA 4JAVC 5ABPA 1DBPA 1ZGZA 2MYTA 2PMCA 3G85A 3HEBA 4UHJA 1SRRA 4G97A 4OTZA 1ZVVA 3QLTA 2JCGA 4ML3A 2IPAB 4MS1B 4YGXB 1U8TA 1TVMA 3KLNA 4XLTA 4ZJPA 3NNSA 5KQGA 2FMHA 3CU5A 4MRMB 5EWMA 3HK2A 1MB3A 3ILYA 1Z2EA 3QX8A 1NTRA 1FQWA 3KKEA 4XFKA 1MB0A 3LKVA 4RK4A 2WMYA 5T3YA 3EJWA 1FFGA 2FEKA 4KVFA 5EWLA 5B3JA 5KC9A 4W5NA 3I09A 3GA5A 3C3MA 5B3JC 1JF8A 1EWVA 3F6PA 3KCNA 3QEKA 6ABPA 4MLCA 1JFSA 1QO0D 4QPJC 3LKBA 3ROFA 5IBQA 5TPWA 5BRAA 3GYBA 4TN5A 4JASB 4D6XA 3JVIA 4MGEA 4FE4A 3QEMA 5C5CA 3RVKA 3OLXA 1C4WA 2AYXA 1JL3A 4MS1A 5C5EA 3N0RA 4RSMA 4S04A 3LUKA 3OO1A 1ABFA 4G0PA 1ZDMA 4NCBA 3EAFA 5TQ2B 2WJWA 3GRCA 2WRZA 3KTOA 4OG2A 5PNTA 2RJOA 4MRMA 4RY9A 2VUIB 2A9PA 1WETA 1PEYA 2X7XA 4GNRA 3MF4A 4KQCA 3KYIB 2M1ZA 4MAAA 5JNSA 2O20A 1USIA 4RXUA 2PUBA 2PAFA 2QSJA 4MLDA 1MVOA 4H60A 3R0JA 1P6QA 3GT7A 5BRJA 6CHYA 3TO5A 4KRFA 4EYKA 2A9OA 4GPAA 3M9WA 5IULC 1A04A 3SY8A 3LFTA 3T95A 5JS1A 3IDOA 5BR1A 3VNBA 3BILA 4MR7B 3OM0A 5DGCA 2GWRA 3SNKA 3O1JC 4TMYA 2LIVA 4G86A 2MYUA 4JB2A 2WWVD 3HUUA 1GUBA 2MYNA 1Z2DA 1BAPA 5TQ2A 3CS3A 4IF4A 3O1HB 4OLAA 3O2QB 2NT4A 3N75A 1GCGA 2E4UA 4Z9BA 4EYGA 3MQ4A 3EODA 3M9XA 5JNUA 1APBA 2ID7A 3GL9A 3DGEC 3O2SB 4M88A 1YMVA 4EYOA 1USGA 2W42A 2RGYA 2JVJA 2FXIA 2A9RA 5IUJC 1FFSA 1JYFA 1UDRA 2NUBA 3OLYA 4YR7A 3LUJA 4EGSA 4EVSA 1D4ZA 3TB6A 4MS3B 1M2EA 2FW0A 3QLUA 4KZKA 3JPWA 4O1HA 1KGSA 4LE0A 1E6MA 2E4XA 1GUDA 1KMIY 1XHEA 1Y1LA 2OQRA 4LE1A 1GLGA 4TLLB 2PL1A 3RH0A 5IEJA 3QLUC 1YVUA 2IPNA 2JBAB 3B2NA 3W9SA 5IUKC 4F3TA 1SD5A 1OXKB 1QMPA 3MM4A 3VNAA 3L6UA 4Q6BA 5HQJA 1ZN2A 4G0QA 1Z13A 1H9CA 2A9QA 3EGCA 4KK4A 4RS3A 3CTPA 3H75A 2AYZA 3KYJB 4LDAA 4XARA 4W5QA 4CBVA 1BA2A 5TPZA 4Y9TA 1U2QA 3I5AA 2CHFA 3C6QA 4B09A 5FBHA 3OLVA 4G0YA 3JPYA 3LUDA 1CHNA 2CWDA 4MS4B 4NV3A 5BQ3A 2QVGA 3O75A 2PUGA 2IYNA 1QNLA 3HZHA 3HSYA 4KV7A 2VUHB 4MS3A 1IIBA 1J56A 2JVIA 3MIZA 3Q41A 4NICA 3IPAA 1BDJA 1M5UA 2HPHA 4TLMB 3EQ2A 3DZDA 4XAQA 2ID9A 2HQBA 1L5ZA 3N53A 4IGAA 1DCMA 3BBLA 4OATA 2E4WA 3RVSA 3CZCA 2FQWA 3JY6A 1NXTA 4MQFB 2ZAYA 2FTKE 3HM9A 2PUDA 2IPLA 3HS3A 3HCWA 2MSKA 3H5TA 4MQEB 2R25B 2PUAA 1F4VA 3CNBA 3GBPA 4L85A 4PZ0A 4E7PA 2FKAA 5TQJA 3O2JA 2FLWA 4MR9B 4MYRA 5ED4A 2RDMA
chains in the Genus database with same CATH superfamily
3M70A 5IRCD 2W2LD 4KR3A 2DR0A 1IOVA 4CHTA 1K6XA 2XB8A 5D00A 4F92B 4ID9A 3P94A 4MS4A 4YALA 1IK6A 1QKIA 4G0XA 5BQPA 1XDBA 1ZSYA 4QTYA 1SFRA 2ZEJA 1RJEA 3GUVA 1A27A 3L8MA 1GRCA 4DNPA 5DK6A 4A8TA 1VZ2A 5AJZA 2B8TA 1NVTA 4QARA 1NV8A 4HH1A 1KYQA 4QQ8A 3GLIE 4CKEB 2VJOA 3IS3A 3R20A 1QVRA 2XBMA 1I94B 2IOQA 2R86A 3L1JA 4C2AA 3MJDA 1HYGA 1BN7A 3QE4A 5E6UA 4F97A 3VC7A 3F4BA 2FUNB 1CVIA 1L8OA 2VXCA 3SIRA 4AUMA 4MQFA 3LX5A 3GRRA 1SELA 1ZD5A 4G9EA 2JFGA 1RJ9A 2ZDHA 2VSXA 4IEEA 1CEQA 2J59A 4W9RA 5EXSA 3W6ZA 4F4JA 5BNIA 5C1BA 4RVOA 3IL2A 1VCIA 3WYGA 1QNFA 5KU7A 1YA8A 5LWQA 2DOKA 2J46A 2JLCA 1YK0A 3DUWA 3VNSA 4R3UC 5HZMA 1VLHA 1XP5A 3T7JA 3ZV4A 4RMNA 3IKTA 3MT9A 1ZJWA 2ZR8A 4OEHA 4Y2HA 2QUJA 3LQ1A 4OFWA 5I7RA 3K09C 3PS9A 3TTUA 4JT8A 2HR1A 2CXPA 4F9GA 2QD3A 4TKMA 4MO9A 1DWPA 3V9PA 4BVBA 4QFMA 2FW7A 1EWRA 1ZIPA 4E6EA 1RRPA 2I6XA 3I3OA 4EPWA 5CLFA 1GPUA 4KMRA 1AMNA 1P7PA 1SBYA 2AEEA 3HDHA 1JAHA 3OTWA 3ASYA 4JSTA 1UJCA 2FKNA 3HV0A 4JCOA 5ALTA 1IJEA 5E6RB 4CEIB 3DZHA 4RV9A 4PAWA 4AUEA 3ZDFA 1AHIA 1F51E 5JANA 2UYHA 1WD5A 1Z4PX 3VZRA 3WRVA 2C5FA 1D6MA 2Y1WA 3K9HA 3RRXA 2BN4A 3TJRA 3TMKA 4BBAA 4JA2A 1Y4SA 1P73A 2JK0A 4N5NA 5CA0A 3ZX4A 2WVHA 3NTUA 2EOAA 3RR2A 1CG6A 1H94A 3AKCA 1ACLA 5JRDS 1NBME 1AJEA 3HBAA 3LF2A 1NVWQ 2PZJA 3FI0A 4HEQA 2J7KA 4OQQA 5HFNA 1E1QA 1R6XA 1SBQA 1XZPA 2QY6A 2R8EA 3PPWA 1I13A 3L0SA 4FQ5A 1J23A 1U3CA 3MJEA 3BSSA 3N76A 3D4PA 4L3VA 3K6SB 2BGGA 2IF2A 4CI9A 2WJVA 1D0IA 1O8BA 4Q1BA 1ISMA 3RADC 1YI0A 1MQSA 4LHSA 3TNLA 2HPVA 2X76A 3H8JA 4QYIA 2M2IA 4HPWA 3SAJA 2O4UX 3NONA 3H3XA 3C7DB 1LBSA 1EFVA 4BJ6A 3PD1A 5CHYA 5DGXA 2G9QA 1MGPA 3NOOA 3U7HB 3ADDA 2UXBB 1D09A 4MDEA 1A9RA 4ZYUA 1O5OA 3GFTA 4QTUB 4DJTA 3A1TA 3ZIDA 2UZ3A 2FJPA 4QXMA 3HB7A 3SQLA 5HBGA 2K4MA 2CFCA 3I45A 4NCAA 1XP8A 4NEHB 3GN2A 4HLNA 1B0AA 1AQIA 4UEQA 4B6GA 1I4TD 4RJ2A 1Q3KA 2G04A 4WA8A 4B85A 1Z5PA 2QS9A 3N2ZB 5HKKD 2C4UA 2R1VA 3U37A 2NTVA 3AI7A 2YH2A 3K6RA 3PJFA 3N05A 2QE6A 3ZZMA 1HC7A 3W34A 4LQ4A 5IJAA 1ZSVA 3UB2A 1MXHA 1FEZA 3JSAA 3NUGA 4MGYR 1KEVA 2AXQA 1VI6A 2QYOA 2DQZA 4LQDA 4TUYF 2P1ZA 3HN7A 4NMWA 4FNAA 2ORIA 1GRVA 4LKOA 3WV4A 2XYQA 4U7FA 3T5CA 4C4OA 4BE9A 2H29A 3OEWA 4GMHA 5FB3A 3KQKA 4CKBB 1QPZA 2EKDA 2VSNA 5TMBA 4NU6A 1POXA 4GH5A 4B43A 4EA6A 1VE9A 2WF6A 1AKVA 1IY9A 4MRPA 4A0QA 1DKUA 1RDFA 3EEQA 3QU7A 3HFJA 5IARA 1BDMA 2ECQA 1SU4A 3IAS6 3R6LA 1W29A 1X87A 4TRRA 4U2EA 4BMVA 3EW7A 3A05A 1QBKC 3G7NA 4NG4A 5EE0A 2PUCA 2X13A 1HBJA 1T8SA 2OTCA 3GUZA 4Q39A 5JUWA 5DBIA 4RKEA 3GCXA 1RWPA 4NARA 4Z0HO 4Z0NA 4Z2YA 3TOVA 4ETNA 2VATA 5DCLA 4OLBA 4HJRA 1QDUA 1E92A 1UC5B 5BV7A 1X1QA 5EP3A 3VPFA 4LJ6A 1RI1A 2FOIA 1RYMA 5A4JA 4BB6A 1ZFNA 2ZGVA 3L4EA 1KH3A 2AC4A 4W1SA 3VPCA 5AK4A 5KYWB 1EI9A 4KU4A 1XJWA 2QAIA 2WA1A 2GB4A 1F0YA 5JNVA 1WHSB 1ZINA 4LZZA 1OLSB 3BL6A 5AHKA 4YROA 3WQRA 3L8DA 3V4VB 3MUEA 3RUHA 3WTCA 4PSAA 1J70A 1U04A 1L9XA 1RXWA 2XLCA 5DGDA 1MPTA 5FI3A 3UEOA 2PT7A 2XY4A 4WY5A 2WHQA 5EMKA 3KR0A 2LV8A 3RUPA 2P6PA 1J8YF 2GNOA 2YN0A 4EHBA 3GPLA 5TC4A 3JAKA 4BNJA 1B0PA 4MDYA 4IIBA 3DXXA 2JGMA 2ZJZA 3JYLA 1F8YA 2VYVD 2IU0A 3PC8C 4EA9A 2XRZA 4YDHB 1BYUA 4QDKA 3P9CA 4D26A 1DC3A 5JSZB 3T94A 3AINA 5E0OA 3L79A 1AV6A 4QXAA 4C06A 3KIPA 2BHSA 1E2EA 2H51A 4MVYA 5E4TA 1H2EA 1TFRA 3UV6A 3KAPA 5AM0A 1Y8QA 1JT2A 1YJ5A 1YQWA 2OBYA 3DE6X 3TZKA 5K9ZA 4RK7A 4N3BA 2FX3A 1D04A 1I3NA 2ZS9A 3LU1A 2ZPAA 1Q19A 2XYRA 5WRFA 3FMPB 1IUKA 4MYUA 3BH7A 3G8DA 3EGWA 2VCEA 4K3UA 5BQOA 3EF3A 3F71A 3PQCA 4ND8B 5CMLA 5FPHA 3RK0A 5CFQA 1OPXA 1X8XA 2C5GA 2HA3A 4ITUA 5I8ZA 1A77A 4MWCA 3QE2A 5KJ6A 3G7SA 4Z4QA 1F7VA 3RRMA 3H4TA 5G02A 1VMIA 2IRWA 2PANA 1XAGA 2MT9A 2R4QA 4V0MA 5SZJA 4YT2A 2BUCA 3NAZA 4F11A 4Z4CA 1EXVA 4F2HA 1RI4A 4L5IA 5EIOA 2XWBF 3PJGA 1QGYA 5HBRA 1GG5A 4KFCA 2UZ1B 2ZZKA 1FRFS 3FSRA 5LFAA 5THKA 3NVKI 4FOSA 1QF9A 1V2GA 1KYYA 1Y6JA 5BSUA 4LK3A 2R7NA 5BMVB 5JDCA 1II0A 1J9GA 1XFDA 2E5FA 5TSDA 4BUZA 2O0LA 1I4DD 1SNYA 1EGHA 2OPBA 4YCBA 1DHRA 2FPSA 5GVSA 3MD9A 4MUNA 4CM5A 4G0OA 4M8KA 3NQ41 2FSVA 3A4YA 1SHJA 4C7MA 2P9EA 2YHUA 1QR2A 4QICA 1EFPB 1Z2AA 3L6OO 5BMOA 1BTOA 5EJ5A 5HR5A 2DQSA 1ZK3A 2FG5A 2JI4A 4QU0A 3CTMA 3R5TA 2OCGA 4O4LB 1ILEA 2LWIA 1NW8A 2I1LA 2YR0A 4QJ4A 3WLTA 2FPIA 1TU0A 1KEUA 3WIUA 2EQ5A 5A4DA 3R5JA 4ZT5A 1BKSB 3OIDA 4WNCA 7REQB 2H4JA 3RO7A 4DBZA 1ONPA 5T67A 4X0EA 2F3UA 4JJ8A 4HT3B 5LQRA 2GO1A 2OV2A 3SHVA 4O1MA 1BKDR 5KSPA 5A6VA 3A9VA 3M6IA 4ITRC 1BVHA 4MYDA 3K30A 4Y3UA 2MCFA 3RIMA 3L8EA 3AM5A 4N40A 1MMFB 1T1EA 2XQFA 1WDWB 3RFFA 4L0QA 3IHKA 2IXGA 1WO8A 4GP7A 1M5TA 1FDIA 1QANA 3T3GA 4F8YA 4CNQA 4TS4A 3LBFA 2I54A 3T3DA 1TQ8A 3QUAA 2ZG6A 3GLIA 2VKQA 3T4UA 1GT6A 3OC0A 4U02A 5ECWA 2ZJ2A 1HL3A 3AESB 5KINB 2C31A 1DLIA 1N7GA 2YXNA 4Q9KA 5CU7A 5F5XA 5KVCA 1CUDA 3PF9A 4V24A 4UTZA 4JI1B 1ZICA 2QSZA 3BQ9A 1CZKA 5CNKA 3V55A 5JZ9A 3IP3A 4GI1A 4AYXA 3LUHA 1MBZA 1MJ5A 3M1AA 4IGKA 4RQUA 4AJ1A 1S4MA 5LSAA 5ECGC 4F4DA 4QD3A 1DB3A 2AQ8A 4BJ1A 1J97A 2BM1A 3ULKA 1UEXC 1WQ3A 2VWPA 1XZJA 1AB6A 4TWAA 1SA0A 2FDCA 2OCYC 2FI1A 2W98A 1CRQA 4K03A 4LGCA 2OGSA 4Q4AA 4X20B 3TJZA 3U81A 5LJIA 2D3WA 2J87A 2OCDA 3JQ9A 2WLTA 4R1MA 3AF6A 4YP6A 1U80A 1A3CA 1R4AA 3EFEA 3KQWA 1QRAA 3DE5X 3HY4A 1T0JB 1UQTA 1E62A 1MZVA 3L7NA 3LF1A 4HFJA 2AS0A 5DX0A 1TADA 2CFOA 3RIHA 4C4YA 1XKTA 1TVMA 3HBLA 4FDUA 1ORRA 1U7UA 3QNMA 4QDXA 1YDEA 1GPYA 2LXNA 1YJXA 3L7YA 5PGMA 3R7WA 2IHJA 4HAYA 4EB6B 1LPBB 1CUCA 3FE2A 1U2DA 1E3WA 2OXFA 1UP4A 4MIEA 1QRUA 3ESAA 4RK4A 2I67A 5T3YA 5I7OA 2WUWE 1JAIA 1FFGA 2R6JA 3VTFA 5L7TA 1C3EA 2WTUA 3LTNC 2JCXA 4GKKB 3KWJA 4K6GA 1TIPA 1UC4B 4G2NA 2O7NA 3IDZA 2XADA 3FDIA 3L7OA 3OZUA 4BAGA 3HDYA 1Y37A 2OT3B 1S3SA 2EKQA 3KKNA 2EEPA 1MOQA 2IEYA 2YIJA 4JOCA 4NBTA 4ROTA 2ZDGA 4ZIRB 3NUQA 3VC2A 1Y89A 3GG9A 4C2TA 1LEHA 3V7YA 4CKWA 4O5OA 4AFNA 1NW5A 2ZRDA 3DAGA 2C77A 4UTOA 5D5QA 3LBAA 4R1OA 3CKYA 1W47A 4IDPA 1XN1A 3DOUA 1XE3A 1U0NA 3N0RA 1AXGA 4V0RA 3KSRA 5HE8A 1TB4A 2I1QA 1F17A 3LUKA 3R6TA 4PG8A 1YB1A 4IGFA 2XDWA 4OJMX 2Y1DA 5KWIA 3KTOA 3RRZA 2RJOA 3NT2A 1DAMA 1G7RA 4UTRA 3H97A 5K0TA 1G7TA 4WOKA 3W04A 1JG4A 1XTIA 1BFUA 4RA6B 3DPSA 2X0IA 3HXLA 3EZLA 3NBZC 3WAKA 2PX6A 5FP0A 1X94A 5I48A 3U4MA 4KRFA 1IK4A 1FS5A 3AU9A 3AF2A 4ITVA 1L5LA 4B6EA 1GAQA 4TTRA 1M2JA 1CDOA 2APJA 3STHA 3G2QA 4AY6A 3TAUA 3GIDA 1ISHA 4M7WA 4R9SA 1D2CA 4D1YA 3SC6A 1J25A 1CUSA 1U6JA 1I7DA 1QHFA 1YVRA 3HXPA 3EQ7A 2IYEA 3NM6B 3CR3C 4I9NA 3AP2A 5C1OA 1DUSA 1K89A 1Q0PA 4FCVA 5KYXB 3CQ9A 4REMA 4FFLA 2GEUA 1FLNA 5CDGA 1GUBA 4TL7A 1BAPA 1QH9A 3U3RA 4BX3A 4PO8A 5ICCA 2R1TB 1K86A 1JDSA 2DY0A 1RP1A 1RQNA 2ID7A 3HYTA 3UAYA 2G63A 5HQ3B 2FA9A 2NV6A 3GVXA 1IULA 4L74A 4NJEA 4W4TA 1ZX1A 2OEPA 4B3RB 1KIFA 3AI2A 5ADWA 3R6WA 2CVHA 3U7EB 1G5PA 2I33A 3JQAA 2BY4A 3JQPA 4BN4A 1E79A 4JL5A 1P2TA 5C52B 1RXVA 1D4ZA 2C57A 3RQSA 2GVDC 3MINA 3OUUA 5B7PA 1W35A 2I4IA 4IX1A 3ADOA 4M1MA 1MRZA 9MHTA 1GUDA 2Y9MB 5JH7F 1PG2A 2VHZA 4B7XA 5EZYF 2CUKA 3STYA 2AC7A 4OUKX 3A1EA 1QVWA 2IE0A 1KDPA 4NLLA 2HADA 1IIRA 3FPSA 5J1TB 2CLFB 1QYXA 1V8BA 3EC1A 1RIIA 3PT9A 3UB3A 4IFTA 3WGUA 1JA0A 3O95A 3RWBA 3GFGA 3VO8A 5E7JA 4RESA 2IIVA 2NXCA 3R24A 4IMPA 1MPXA 1ZNYA 4MW6A 5KDOA 3ZBTA 2CK3D 2WQZA 2AFVA 3I2JA 5MF6A 4CBVA 4N12A 5FLEX 4BQQA 2OAEA 5K4GA 2YHIB 3AF4A 2V4UA 1U02A 3FLMA 4EX6A 1YMQA 2YY5A 3BFKA 3J7TA 1VL0A 3OEHA 4QHTA 1JHOA 3OLCX 3QZUA 1FK8A 1N6IA 3UT5B 1SQ6A 4IUDS 5B3LA 4JLUA 3KUUA 3EVCA 1K97A 1W1IA 3B3QA 4ASUA 4PIMA 1GL6A 3USES 3LPDA 1AN9A 4CFZA 3IV7A 1P0QA 2PT9A 5JR3A 4KXLA 5DW0A 4RTRA 1DAOA 1FMLA 1KZ4A 1AV7A 2C3OA 5JFTA 3CXUA 4KL8S 4DLTA 3BBLA 3DMNA 3QBJA 3RS4A 2P9BA 2H7VA 4NR0A 4CQMB 2QENA 4QFCA 4LQLA 2J1LA 4KTTE 4REOA 2IHBA 3GHHA 1P1BA 4IWYA 3WLPA 2ZB7A 1W0CA 1L5MA 4X92A 3ZYCA 5A4MS 3K0SA 3ZY2A 4EHFA 1MUUA 3HSSA 2C8VA 2FLWA 3U7RA 4MR9B 1FUKA 2OAQ1 1E2QA 1VHJA 3G9UA 3T1OA 5AVUA 1P1HA 3AHGA 3PFWO 1C9KA 1CQPA 4M9ZA 2IY7A 2PWPA 3LMKA 3MB8A 4RENA 3RAPR 5DV9A 5FDFA 1RFLA 5HIIA 1LBHA 1UBJS 2AN4A 3HYLA 4LW8A 5FKJA 4ZWNA 3AVOA 2XXJA 2ZIXB 2FZLA 4OLHA 4PW0A 5AVSA 2C9ZA 5JJCA 3FKSD 1OF1A 2BSAA 3ME5A 3TSWA 3D02A 3FHLA 4X8HA 1W73A 2ZVPX 1OD6A 2DP4E 1Q12A 3RHSA 3I9FA 1YGYA 2X7HA 3MMSA 5FLYA 3VFDA 3EUEA 3LWNA 4DR1B 4MV1A 2J0QA 1NVDA 1R9NA 3SYNA 2WQ7A 4MYSA 1VHWA 4KRYA 1C50A 4PYRA 1CS0A 3SHFA 3WIEA 3CJRA 2PS0A 4N49A 1KI6B 3GBVA 4P38A 5BN4B 5DNUA 1GFIA 4XDYA 2BFCA 3M4YA 1YZNA 2DKNA 3L9WA 1C1XB 4YHHB 3A6DA 1SGWA 4XQ0A 3TTTA 1Z4MA 2W2VA 2MTBA 4AS2A 3VJKA 5B6PA 2WC1A 3MS2A 3W3AH 1EWKA 2ZRPA 1VYUA 3GO4A 2JGKA 1DCKA 3QHAA 3QXGA 3ZHXA 4BOYA 3U4AA 3PNLA 5A2GA 2W90A 3W1WA 5BWMA 1MAWA 1WF6A 2PY6A 1NQAO 3T9CA 1KO7A 5J23A 3AEXA 1EK5A 1A50B 4RV5A 1O0SA 1U9ZA 2QA5A 2WM9B 2Z1NA 3AOEC 3ORSA 2VP3A 4FHEA 4DADA 2QRQA 2FFJA 4M7RA 2AK3A 4KWIA 4ZD6A 4A1OA 4ARZB 1YBFA 4F2WA 5MFPA 2O2HA 3E9YA 1PUIA 3G9QA 4B4KA 5CT5A 4BVJA 1P4SA 2G76A 2GNAA 3COWA 3ZCXA 2XAUA 3LYAA 1S2LA 1V7ZA 4N8SA 5D7NA 1TU3A 4C87A 1YE8A 4EMSA 5IPFA 3PUXA 4D6PA 2UXCB 4KGZA 1P72A 1WBBA 3FNGA 1D9ZA 3SFVA 3C3WA 1E1QD 2D1YA 4XOIA 5D87A 1CUAA 1I51A 2IYZA 4BLQA 1NPYA 4YRBA 1DV2A 2GRUA 1HE4A 1E6EA 3PLAE 4GYJA 2J5RA 4Q1EA 2WAXA 4EHLA 1YVEI 2F43B 2O8CB 4DM4A 4ZYVA 3THWB 2O14A 3AVPA 3VTKA 1YZQA 3IALA 4BVHA 1P1FA 1K7SN 3DAYA 1KFJB 3CHYA 3LHFA 3KDSE 4XGNA 1T2EA 1EVEA 2XB6A 1VTKA 3FWNA 3PKZA 4NE2A 5FF9A 3GJSA 2QSUA 3WWZA 4XZ3A 2AI3A 3QELB 4XSHA 4R5HA 4ZGWA 1DMRA 1K88A 2ZCUA 4BP8A 3T5MA 2CNBA 1Y6FA 3KWFA 1E64A 1WX1A 4Z5XA 1ZRNA 1E69A 5IF9A 1DJQA 1D2GA 2C9MA 2G88A 4US1R 1GNLA 4ZCMA 4IDNA 1U2TA 2Y27A 1KAGA 4E13A 3K92A 5KEIA 4FHCA 1T1SA 2HO4A 1UMKA 3SIPA 5K2OA 5C81A 4ZREA 2VJNA 2PM8A 1SCUB 2VRCA 5D1NA 3EC7A 4ILEA 4IIDA 4R4JA 2C0CA 2NWQA 4X1KA 4YRLA 4DJEC 1X42A 2P9TA 2GJ4A 1T26A 1ZD2P 1XU4A 3LX8A 2GN4A 4QC2A 1LF0A 1OJ7A 1X86B 3M3PA 4LHXA 2Q2WA 3M89A 5ALIA 3RC9A 3BERA 3DKKA 2YASA 3CZ9A 1JKXA 1Q17A 5IVIA 3DL4A 4B83A 3ZWDA 4BU1A 1SD1A 2YXDA 2B7BA 2GLXA 1QAQA 2LRHA 4I36A 1Z6XA 2GARA 3V8VA 3BGDA 5SYAA 1E3DA 2UUCB 1JTVA 3H3JA 2VI5A 3C8UA 3LCCA 1L2TA 3DBRA 3LZDA 5JAHA 2EZUA 2QX9A 5SY4A 3Q3CA 4KSCA 5ALYA 2C4WA 2MSWA 3W1EA 1XVAA 3D4OA 3NDRA 4IWNA 3AKDA 5E2IA 1QVZA 4DW8A 5CFNA 1NAHA 1W2WB 1A95A 2EWWA 3QMMA 1QDLB 4YS6A 1J90A 1ORIA 1TU4A 2H57A 5K8UA 2BR3A 4QUAA 5FNVF 2GI4A 3AHJA 2WSYB 5DHPA 3SYRA 1FXSA 2EBHX 2B0JA 1EUQA 2PRIA 1EGAA 4YP9A 1YNOA 2W00A 4NXMB 2DWPA 1ZLXA 3QKRA 2IDKA 3A1NA 2YXPX 1FYFA 3EVEA 1NHWA 3N7TA 2NXJA 3WFIA 1VLZA 3HVJA 3K1AB 2VHEA 1Q1GA 4P32A 1GPMA 1FA9A 2AZ4A 1OTHA 3SVLA 4B3IA 5C1IA 4KR2A 5E1BA 4B3DA 3ASZA 3RF6A 3PRYA 5CP8A 3WB2A 2QRHA 4UFNA 1RABA 1MC5A 2IUTA 3L6EA 4JS0A 4WESA 2I22A 2OHHA 5IMBA 1EEXB 4W5TA 1HDOA 2F64A 1YRHA 1M8JA 3DM9B 1I0LA 3FCEA 4BKPA 3PD0A 1GTZA 2JG3A 3F74A 4RKQA 4LEIA 2Z2KA 1L7MA 1ZOIA 2FSUA 4NCJA 3PNQA 1G2OA 4JT9A 1C9EA 3ZK9A 4DXDA 4CE6A 1RHUA 1QIFA 2Y3IA 3N5KA 2RHTA 1CVLA 2QXYA 3UA3A 2X3FA 2OBBA 2QHXA 4IWXA 4GL2A 1D2EA 3LOPA 4JB3A 5BNZA 1GZHB 1O95A 3WSWA 3JR3A 2C0PA 5LWHA 1T8RA 2WI8A 3OD1A 4HO1X 4N5LA 1POWA 2NO5A 3CRVA 1TZCA 4ZVOA 3AOGA 4RWZA 1KEEA 2WFAA 1JQJC 5CJJA 2VFAA 2VNHA 2HHAA 2GMWA 2XDYA 4DQLA 2CY0A 2ODPA 5CX1B 3GNQA 1PR0A 2C4NA 4RCYA 4GKAA 4ZA2A 5ARDA 1RHMA 5AI6A 3V4SA 1VHQA 1NRXA 3HYNA 3CGGA 5FWXA 5HZHA 4CL0A 3GJ4A 3LE8A 3PHIA 4JVMA 3RABA 2HK6A 4F93B 3VZSA 2E4YA 5TV2A 3H5IA 4RTNA 1FLVA 2A5GA 4QQNA 5K8VA 3H5AA 3WLQA 1IM2A 3X1YA 2IDMA 4QFBA 1D2HA 1Z0UA 2QU8A 3JQBC 1ZJJA 1UWVA 2PIDA 5DKFA 2GZSA 4MOWA 2QL9A 3HR7A 4GAEA 1TM3E 5C34B 4LQCA 4P36A 2XA9A 2WF7A 5DSTA 3TNYA 3LPAA 4FYJA 5KNBH 3B51X 3DO6A 4F4HA 1MIHA 4RGBA 2G40A 1N92A 3CX6A 2ZRCA 1MW8X 3U3MA 4J29A 3U1VA 4HRVA 3N2YA 1DWQA 3TQOA 2CV0A 4RNCA 1N2CB 4D8WA 3CNEA 3DEFA 1HSZA 2QUAA 1U9JA 3LZ6A 5K51A 3P7MA 5M3BA 4ACBA 4N76A 3U7FB 5LQUA 3OPMA 2IITA 1W75A 1ZD1A 5HKBA 1BGXT 1IXKA 3M9LA 3PC6A 1GPBA 1L4MA 1VG9B 2HF7A 3R4CA 3VXKA 2QN6A 4MVJE 1Q14A 4E1BA 4BQRA 2R4TA 1XRPA 2NAFA 3AR6A 3OJEA 5A1TA 3WYFA 3DKRA 1BE1A 3ORQA 1OLXB 2RI0A 3PPVA 3KFLA 4LDPA 1M9NA 2WM8A 4KJZA 4O1IA 2DTXA 2IV3A 4A10A 1M67A 1J99A 1L4UA 1RM5A 2EGUA 4XH9B 3X1JA 3ZCSA 4GLBA 3K0CA 3NDPA 3ORYA 4D9KA 1JQEA 2BFDA 3BD6A 5D7BA 2EARA 5AKJA 2RBEA 4MP3A 3WYCA 2DSTA 4AX8A 5EP4A 1SURA 4O8CA 4BNXA 3CPJB 1HT0A 2WYWA 5BV0A 5JYDA 1MB2A 2RSLA 3ZNNA 4RDCA 4OQXA 5AVJA 1OA1A 3QUCA 3IX7A 4P3KA 1E99A 3S55A 4MUXA 4J1SA 3KYCA 4QBIA 5GM2A 4GX1A 5FWYA 2RONA 1CQJA 3QXJA 5DXAA 2FF5A 1U4NA 3ZHUA 4DUGA 5BVGA 1JXMA 3CGWA 1CUWA 3CLSD 2P2DA 5F2NA 4W9MC 4R0VA 4OX9B 3BXZA 1BQ3A 1LGYA 3FIUA 2TMGA 4LYHA 3B52X 4GYWA 5TQ0A 3TQFA 4HHEA 4HWKA 4N3NA 3TX2A 2AGVA 3CMCO 2OFOA 4BO1A 4LC0A 2GXAA 1GL9B 2P69A 4OXIA 3HE3A 4ZEVA 5JQGA 1ZUIA 4IGEA 5DTRA 4LFBB 4FNOA 2JF0A 4D25A 1RYBA 1I7NA 1ZL2A 1KO5A 1PT9A 3GAFA 3THYB 2AF3C 4EJFA 4NYIR 1VP3A 1ZAKA 3PUZA 5KJ1A 2ZZMA 2EU8A 1JEYA 1OPRA 4AULA 4PWZA 5JFGA 1IN4A 1LJUA 2UYGA 1NDUA 3EJ6A 4LZPA 1U0EA 2NUPA 4MO2A 1IOLA 4O63O 1DT5A 3WO1A 2B4RO 2V5UA 5C7LO 4PAQA 1JG2A 3PNSA 4UUAA 5J4YA 5KYGA 4YJFA 5JVDA 2PGNA 1AUVA 1ZG3A 3LD9A 1ZS9A 3T9EA 1N0VC 1AS0A 4LCJA 1GZ4A 3UHOA 4UOQA 5EHGA 2XKBA 1DUVG 4YMIA 2HRZA 3ANXA 1TEVA 5ES3A 1NU8A 1BGWA 3QOWA 3OHMA 5B1YA 1I5RA 1QWOA 3UO8B 4B3GA 2QT0A 1BFDA 4CMEC 3IQEA 3OJXA 3OT1A 4D8UA 3W5IA 3ZVRA 3KELA 2BH9A 2H9YA 1JKMA 3ADKA 3PUVA 1TZ2A 3PQ8A 4EPRA 1O4WA 1NBMD 1U9IC 1W4ZA 2OCBA 3M5CA 1TA4A 3PP8A 4IH1A 5IHPA 2V6FA 3MS7A 1NP6A 4W82A 1L3CA 3UJBA 3EEOA 2JLVA 5HP4A 4C6TA 1XRNA 2WHPB 1GQQA 3KJNA 3K53A 1OGJA 2EKPA 3OJOA 4H2DA 1RQPA 4JA0A 2JKVA 1DHTA 1T24A 1UBHS 3JATB 4Y2SA 3R7AA 3WRXA 1UJ5A 3D3EA 5AJVB 5BRAA 3L92A 1ORDA 2GASA 4FJ0A 4DG8A 3MCAA 2FOXA 4QEDA 1T10A 1C80A 1E1RD 1W4AA 1T5OA 2EJUA 1W0KA 2GN9A 3KXIA 4JIMA 4M7PA 5HRAA 3VOTA 3U48A 4YYEA 4UPVA 4RSMA 4V02A 4H7DA 1PLKA 1PWZA 2O07A 5JQWA 1X1RA 1AD2A 4I55A 1SB9A 3QVTA 1OBFO 2OB1A 4KKVA 4L5CA 2GHRA 4ZQGA 3A9TA 4CWAA 4DT1B 5C7YA 4IQ4A 1TEZA 3AY3A 3ZXSA 3SKXA 4GM1A 5CB4A 4AWXA 3PJDA 3Q7EA 3BC1A 4D92A 1GNRA 4WIAA 4KQCA 2GPTA 1PX0A 1UEJA 2AKAB 3DZBA 5G0UA 4MAAA 3OICA 1C9YA 4CGYA 3BMCA 3RYIB 3D6AA 4CN8A 1K6EA 5KVVA 1JKJA 4WKCA 4QPCA 3IELA 4HB3A 1WW8A 3KE8A 4HNGA 2F90A 3ZLBA 3AILA 5JQGF 1NR1A 3ZEAA 8MHTA 1AKMA 1ID1A 4KRXA 2JFHA 4EUNA 1NL3A 3CR7A 3UXHA 1P29A 4ZI2A 1TYEB 2POQX 4MMXB 4ZTZB 4H31A 2C04A 4R9UC 5FOWA 1TX4B 2Q5HA 3LS2A 5F23A 1Z5ZA 3I53A 3RS8A 2DXIA 2XGOA 5IH7A 1JYSA 2Z3VA 4FONA 5GJVC 3WMGA 3CUSA 1GUAA 2RHHA 5G3ZA 3RSHA 1IOWA 2F3TA 3DCYA 3ET5A 4HADA 3WNDA 2JFWA 1P19A 2JA1A 3S8YA 1H66A 4PZDA 2NO6A 1UZMA 4K6HA 3ZHTA 4QO8A 1RP7A 3M9XA 4WK6A 3KAQA 3OEYA 4B0OA 3KKPA 3IKVA 3UJ9A 1D0VA 4HPJB 4ZAGA 4IUBS 5FD8A 1VDMA 1UBFA 2A9RA 2Z1DA 3FD8A 1ZNXA 1OAAA 1T36B 4BTEA 1ZCAA 4W6ZA 1JJIA 1WXIA 2I2DA 3D54D 5D6NA 4EI9A 5KOHA 4MS3B 2ZSHA 1X1SA 1QLHA 4FDAA 4J49A 1N6HA 2WTEA 3JPWA 4PU0A 3D0QA 1V16A 3RH0A 1MV8A 1ZM7A 1TQ4A 4FCCA 2K2QB 4B2IA 4BLTA 2CV2A 3T4PA 3K8QA 1W8IA 3EIOA 3O8OB 5LMZA 4DSAA 4PYKA 4MMZB 2IS4A 1OXMA 3QPWA 1WTCA 2R62A 4TXHA 1FYXA 1QHNA 1VBKA 1IUNA 1HFJA 2DJ5A 3LECA 3OY2A 3ZGNA 4H35A 4BCCA 4OMDA 2KB0A 2V45A 3QRWA 3PX2A 3ABRB 3L06A 4PHFA 3WKAA 3RJ9A 5IDXA 1U2QA 2XH8A 3KWLA 5DZSA 2VHTA 3C6QA 1E94E 3SZ3A 3E9RA 2RI1A 5FBHA 1UEIA 2AF4C 3B1XA 4PYOA 2VHQA 3JPYA 1RHJA 1UM8A 2X8JB 3AFHA 3B6KA 3O5AA 3TR6A 2GOYA 2PUGA 5E0KB 4URFA 4YV2A 3LWZA 4NBSA 4NJMB 2QW0X 1WJGA 1US8B 1S4QA 2GN1A 3H0KA 1OA0A 2OLEA 1RACA 1XYGA 3O3NB 3RUAA 2DFPA 3TRKA 5F9MA 1YB5A 3EEFA 3N3BC 4X90A 3DZDA 4DV3B 4C03A 1AS3A 2RKBA 5H9WA 3C3XA 3OA2A 2R6FA 2GVZC 1SOAA 1OZ0A 3KB6A 2JAHA 3WJ7A 5C35A 3CH5A 4FDLA 2H3EA 3CZCA 4RD3A 1G2IA 3SS7X 3TKLA 3BSFA 2O8BB 2ZAYA 4S2UA 4QM6A 2PYZA 2IPLA 1RYNA 2YDXA 3IO3A 4C0HA 3W9YA 4MQEB 4W5WA 1GPDG 5DO9A 3VKUA 1ZONA 4F3RA 1EK2A 3SEQA 4CXMA 5GIOE 1R18A 4MYRA 4L3OA 3NMUF 1V9SA 3VYSB 1DP4A 2INGX 3U7GA 1JEQA 2C83A 2I29A 3C4QA 3RBXA 2CJPA 2JEOA 4GZ5A 1K6IA 2VP5A 1IHYA 4QVKA 3RANA 4OYRA 2CUTA 3HP7A 1BXGA 1OHHA 1V47A 5KOYA 4D4LA 1O96B 3R4VA 3R3SA 3R8XA 1A82A 4DCPA 3Q5GA 4IL5A 1NM5A 2PJDA 4HDMA 2MOKA 1E1CB 2AG1A 2ZREA 1XQ6A 3BHJA 2JEYA 4OCZA 5KSWB 2SKDA 3CPSA 3N7AA 3FYTA 2BDUA 4BNFA 1GWNA 5IDVA 3IKMB 5LL6P 2VKTA 3IHLA 5C2JB 4YWJA 2CJWB 5ELXA 1E1KA 3O03A 4KX3A 3RROA 3EISA 1A9XB 2II6A 3NAGA 1W88A 1I1OA 1II8A 4HLUA 4IHQA 4A8JA 4BO6A 2F00A 2BWJA 3C1UA 2WWGA 4WCFC 2EZTA 1KORA 1VL6A 1TYAE 3R9XB 2QRKA 2PO5A 1RRCA 1XAJA 5TGDA 2YWBA 4PNPA 4LJAA 2JEZA 4BX0A 1RRKA 1SUPA 2PKQP 3P9SA 3UKDA 4RTLA 2AUMA 4IXWA 4YN3A 3MHTA 1QIDA 4DLZA 3IULA 3WV5A 1L5QA 1TVCA 2FNAA 2VSOA 2IHUA 2V3WA 3H2BA 4OQDA 3V8RA 4B0PA 1ZVKA 3DQQA 1WABA 1X7WB 1KQ3A 2A8YA 2IFTA 2Y05A 3EGEA 4LY9A 4F7WA 1NVMB 2BT4A 1R0YA 4WJLA 5JMTA 3K70C 1T4CB 4YPFA 3QOYA 3S2EA 4R41A 2QMZA 4JL8A 4UU8A 1R6VA 4M54A 4MK4A 2XNHA 2CB9A 1GDTA 4GNKA 1Y81A 3K8YA 1RZ3A 3T4EA 4DQ0A 3VU9A 3E05A 2OAGA 5G0WA 4U2KA 3NC4A 3RVMA 1N6OA 3I01A 4P33A 1OBOA 4NQRA 4A92A 1OFIA 1E2KA 4NU5A 5JZSA 5I7FA 3PDCA 3FN4A 5KCZA 5ALUA 1ACMA 3AONB 3KVVA 4RK6A 2WAMA 2HMVA 3ES9A 3UA4A 3F5SA 4DUYB 1YHYA 1NXWA 3NRBA 3F5DA 4X7RA 5K3OA 1KR2A 2WAOA 5HS6A 3WMWA 1BJRE 2DFDA 3ZK7A 1K92A 3BS4A 3T7AA 2HCJB 3WGJA 4BFVA 3ZDXB 1Y34E 1E4EA 4AIRA 1GTSA 4MR8A 1ZBQA 4G65A 2H1FA 3CUUA 4IAOA 4TLAA 2BP7B 4AJNA 3QPUA 5BXQC 3EPHA 3D5QA 2XCTB 1ECPA 2V03A 3D7LA 1NBOA 3HCOA 4KTVE 5AUPB 5GOTA 3KTDA 2HZ7A 3RU3A 1C7IA 2I76A 1GU7A 3OOHA 3U31A 5EI5A 4R3NA 4ALIA 1NE2A 3FPFA 1F7UA 1XOIA 1RWVA 2QLJA 1JHZA 3MVEA 1GTVA 2A78A 4NDNE 3SWWA 3GQBA 4E09A 5KX5F 5DTJA 3OOSA 3U7QA 3KYDB 4MTLA 2ZWVA 3C5HA 1HLPA 3E3NA 4IIYA 4C7JA 1Q1BA 1QYRA 3GNSA 3GDGA 4KQMA 1KOLA 1DG9A 1D6JA 5GGYA 1IBKB 1BDIA 4WXHA 2Z08A 3D7RA 1Z7YA 2HM7A 3ODPA 4ZKEA 3RB8A 5MN6A 4FGLA 3V4RA 2YDYA 1PZXA 2W2QA 4GR9A 4URHA 2BHTA 4MPTA 4WVFA 3MMPA 1VJTA 5ICMA 1XBTA 2BI8A 1N7JA 2REOA 4FGUA 4L8WB 1PJ8A 2YICA 4MJ7A 3AIIA 5ESDA 3M4JA 4X64B 3TQTA 4CUZA 1TIKA 5B2FA 3I2IA 5KTPA 3W7AA 1PWYE 1AG9A 3T8YA 3KQLA 2OCKA 2NPFA 1MABA 5I7AA 1J20A 3FCUB 5DM2A 1RRGA 5DN9A 3VR1A 5CW2A 4U9UA 3AY6A 1F8GA 3T38A 2J3JA 4YO8A 4LHEA 3ZY6A 2O8VA 1OH7A 1WR8A 1ZNWA 3MWYW 4HUJA 4GSYA 4OKSA 3UKOA 3WQHA 4ARUA 4B3CA 1CBUA 5HW0A 10MHA 1PTJC 2FOLA 3EZXA 3NYQA 4NYMQ 5DVZA 2JHGA 3UAZA 1A9XA 4RF3A 1E8DA 2HJ9A 3E53A 1NY5A 1AKYA 2QG9A 1UOQA 1Y9DA 2JHFA 2QTZA 1SR8A 1PT6A 3V1NA 3JVEA 3RVLA 2ZBFA 3O92A 4O2BA 1KNQA 2G5CA 2PVPA 3O3OB 4I4TB 3B2EA 1C3VA 2G1AA 3WIDA 2DAPA 2A0UA 3RTDA 1GGKA 1A2QA 1RMTA 2X14A 1ECJA 3MJ4A 3T3IA 4WWHA 4X6YA 5AM2A 3VC1A 1EWTA 1OILA 3F3MA 3ZGOA 1OX6A 5LLTA 3IMFA 4ALLA 1CKEA 2IL1A 1U2PA 4HG2A 4QQFA 3DOIA 5I47A 1PYDA 2JLSA 3BKWA 4C0LA 5GOZA 3ESXA 2VNAA 1ID8A 3WIBA 2HDWA 3H2HA 4MULA 3Q72A 3WRYA 2XUZA 2HGSA 3ONFA 4L50A 3W2TA 1S2GA 2C2HA 2SCUB 4ENSA 1R0SA 5T57A 4C4PA 1KETA 1E60A 1GFWA 4QYSA 5H02A 3LT5A 5EXPA 1QP7A 1QP0A 3BMQA 2ABWA 2HCRA 3CO5A 1M0SA 4MW1A 2PK3A 3TOXA 2VA9A 3CISA 2E89A 1EK1A 2TRSB 3IXMA 2PSDA 3BA6A 4M2LA 3X1DA 3IUSA 1GR1A 4XUCA 3NW9A 3HVRA 5EFZA 2W2MA 2VHVA 4PZ9A 4X3CA 3N8HA 5DM4A 4KBFA 3MOGA 5A3VA 2Q3DA 3A6KA 3F97A 3OC6A 3U40A 2QL7A 4ZQEA 4DGSA 5JYBA 2AYYA 1QP4A 4Q4DA 3FFWA 1KMNA 2VT6A 3O90A 1X3SA 2VTBA 3AEQA 2SHKA 4Y2VA 1DQYA 3ROQA 3R0XA 3UHPA 2XQGA 3FFTA 4MZXA 4RPCA 4ZPXA 1L1FA 3GLHB 4PRLA 3ZDQA 5C8ZA 1PI3A 2GZHA 3P2YA 3TZQA 3HYSA 2GEKA 1P1IA 4Q34A 4BDTA 5IF3A 4Q7JB 2AA3A 2YVAA 4TT8A 1T0HB 4IDHA 2B8EA 4LJRA 1UBLS 2HXSA 4B3SB 3AR9A 1BH2A 3T9BA 1OCEA 2G9RA 1EINA 2ZTUA 4R51A 1F14A 4Y6QA 3U56A 2FGJA 3A36A 4JSYA 2XUQA 4G85A 4TRNA 1OYVA 4LA4A 4OA8A 4L57A 3PGVA 4QEKA 3MZ0A 3RUFA 3T5GA 3MIIA 3D7SA 5FBKA 4YRAA 1YHNA 1N1MA 4KNWA 3TIFA 1ZCBA 1OX5A 3GJ3A 3TWOA 4K8RB 4KE6A 4K9NA 1WD7A 2DHDA 3O7MA 4AMGA 2VHWA 1A76A 1N5RA 3LCJA 4FSHA 4HK4A 3FSGD 2FMTA 2KX7A 1E7QA 3ZV6A 1E5TA 1FMTA 1KAMA 2J9RA 1N2GA 2QV0A 3DE2X 4LWQA 4LYJA 1AY0A 2PUWA 4YEDA 3IT0A 1AVTA 2AD1A 4TLCA 3PC2A 1CNFA 4GZMA 5F64A 2Q45A 1AUQA 3EBLA 2YCLA 2YZ7A 4LX8A 5DX8A 4Y1EA 1GZUA 3VV2A 4F6RB 2W5UA 1YRQA 4W5RA 3M5DA 2AT1A 4LXXA 4B34A 4K8OA 1FDUA 1HH4A 4FCTA 1Q1ZA 1WMBA 4XCVA 1YRWA 2JS7A 4C21A 4WUVA 1M74A 1NX9A 1NXXA 2NO9A 1BS2A 1DC7A 4TV9B 3UJPA 1J2RA 3HMQA 2OLKA 3MTIA 2QAGB 3BRWD 4H7EA 4IFEA 5ETJA 3FYUC 3N8IA 3NALA 4A36A 1BRTA 3WNCA 4OJKA 1YIDA 5AW9A 3VR5A 1FSGA 4BCBA 1U28C 4DV2B 2C9OA 3C3AA 3EAQA 1ONBA 1ZIDA 1ONSA 2X2EA 2YV2A 4LISA 1T2AA 3TMYA 3BREA 5HKAA 1M33A 1GA4A 1QQ6A 3ETNA 2X42A 4RK5A 5EZ5A 1HEUA 2GCNA 3LSTA 1TKRA 1DDIA 4HLQB 1P6XA 5B37A 5JG7A 4M0KA 3STUA 4F6LA 5J63A 4EKDA 4ZCRA 5HJ5A 2R6GA 4FNMA 4NMMA 4IIXA 4ZVMA 5H1YA 2NZYA 2M98A 1Z5VA 1NVXQ 4M22A 1FNSA 2FWJA 3B20A 5LVAA 3SR3A 2HIGA 2C3YA 1PZMA 3SCZA 5COQA 2HNAA 2QEQA 3ZWMA 4DB2A 1YJQA 3BFPA 4JAVC 2R6ZA 2ZUBA 2MYTA 3EFOB 4ZO7A 1QBGA 3NFRA 4H27A 1TRKA 5DU2A 3UMYA 4G97A 2FFBA 1ZVVA 2XYPA 2FWAA 4BQEA 2FEOA 2D2FA 1RLJA 1Y5RA 4HNAA 2C0QA 2XCLA 3KQMA 4S1PA 1MX1A 1YR6A 3CR8A 1Z62A 4PC7A 4TSRA 3ZOKA 4ZI7A 5FTJA 2O7QA 1F2VA 1YXMA 2R44A 5EMMA 1QG0A 1R00A 4QTTB 1V37A 3NKFA 3ZIAA 3PD7A 4WXPA 3I3SR 4EM6A 5JC1A 1EBFA 1YUMA 2F62A 3N2NA 3PNVA 5DISB 3WL8A 1O58A 5A9SB 2TMKA 3JQDA 5CA1A 2GQ0A 4Q47A 4CLDA 3SQOA 3QEKA 5ALMA 2Q6TA 4KDFA 5ILQA 2Q7DA 3CX8A 3LKBA 4LRUA 4M55A 5IBQA 5IT4A 2WMOB 2W2KA 3REQA 1W0KD 2QIPA 5LC1A 4CTMA 4BFWA 1R6DA 2DFNA 1EX6A 2P2YA 2RGCA 3KKZA 4EGFA 4GPD1 4B46A 5ESXA 1R12A 2HBZA 3CUWA 5C5EA 5SZIA 5EKDA 3OO1A 4JLAA 3I83A 1OIXA 1XCBA 1FTWA 4JHLA 3U4DA 1R4NB 3RF7A 2WRZA 2EIXA 4DZRA 1NG1A 1XROA 1GPNA 3MGKA 3O3CA 4CL3A 4XWTA 2P2GA 5KJFA 1DUIA 1U90A 4J43A 4GW3A 5U1PA 3K71B 3NZEA 5BRJA 1TKBA 4IHJA 1ZEMA 4KRGA 2ZRQA 2TECE 1H5QA 1ZL0A 4YQZA 3ZG6A 1VMKA 2R96A 5JS8A 2QRGA 3MTGA 4G37A 4IXDA 1A04A 5CYOA 4ZAXA 4AP5A 4ES6A 4B4VA 4CN9A 5C7IO 1X7ZA 3UFXA 3FGNA 2VT2A 2Y68A 5BR1A 1CQIB 1VCOA 5IJ0B 4CFSA 3GIWA 1G64A 1Y3DE 4TMYA 5EQJB 4FKMA 2YIMA 4JB2A 4HQRA 4YJ2B 3W5CA 2I7XA 8ADHA 3MELA 2DCUA 2EWMA 4XCQA 1HI9A 3WBBA 1EB9A 2QLLA 4E30A 3FJYA 1E32A 1HFWA 4FBMA 3D31A 2G08A 3QIAA 5CCDA 2OSBA 2ZIFA 4DWOA 3EZGA 3DDOA 3N8DA 6GPBA 1QHXA 4EYOA 2WLSA 1NTOA 3O8DA 1UKVY 2N47A 4IZOA 2FPPB 5B1IA 4XD7A 2FMUA 2FWMX 2WNIA 3VZPA 5L3SB 4YCCA 3N6RA 2GH1A 2JGEA 3HN6A 4JGBA 4XI9A 4O0MA 2EWVA 1Z8DA 1M2EA 3U3JA 3ZZ1A 3QXHA 1MIOA 2I1WA 3HJRA 1IN8A 1QK3A 2P4SA 3O4IA 2B9VA 4LE0A 4L7VA 3NBKA 4X00A 2OQRA 5BR7A 4KFUA 2VDMB 1B2RA 3AZOA 1BMTA 2AK2A 4QZVA 1SD5A 1OXKB 4OL0A 4BJHB 3OQJA 1QMPA 2O8DB 4PM4A 4ZMBA 3T7SA 2HV8A 1AQJA 2RHBA 3BE6A 3PENA 5IAOA 1O89A 2GT1A 4F2GA 4HH3C 1ND5A 3FLBA 5FPTA 4RDXA 4H17A 3S44A 4PNHA 1G8HA 3GJZA 2X1LA 3A4TA 4RGQA 3ZHRA 2P65A 2WP0A 3GEBA 6REQA 3NJ4A 2D8AA 1K75A 3I52A 3L77A 5DI9A 1D2RA 2Z9DA 2P62A 5IAAA 1T8PA 1OFGA 2R6CA 1XZ8A 3LVQE 5C0OE 4R68A 1W6RA 3MIZA 3O73A 3IAM6 3IPAA 3SJCA 4AY4A 4DYHA 4EPXA 4J76A 4DG9A 5NLLA 2ID9A 4J6FA 3N53A 1TA0A 2QD5A 1DCMA 4TXMA 3BH6A 3HVHA 4EF6A 2CJFA 2BTOA 2RHGB 4M1SA 4XTCS 1UPFA 1CY1A 5DJ5A 2J0UB 2KE5A 3DTYA 3WVNA 4AUNA 2DHQA 1WZIA 3F2VA 3FJ1A 3HVKA 3HCBA 2X2OA 4QWWA 4IVPA 1X92A 2BFAA 2XUHA 1QGUA 3DULA 1DFHA 3MEQA 3SPXA 3A6EA 3HSKA 4BVAA 4EHNA 1X7HA 3BGIA 1K63A 2V0NA 3MXOA 1Y9ZA 2JBHA 1KA9H 4BWFB 3K5IA 3A8TA 2NIPA 1UBSB 3NO4A 3I9V6 3WLOA 2DR2A 1K4KA 2M9MA 4YECA 2G1PA 3HBJA 1J8FA 3FYHA 3NVMB 2V4MA 1BW9A 1R0KA 3OQ1A 3RSGA 2PCJA 2SECE 2ZAMA 2WMNB 1L7DA 3AETA 4PSDA 3VHXA 4Q1FA 4UPDA 1GV0A 3WDLA 3IIEA 4G67A 4XM2A 1QO9A 1Z7GA 2CSUA 1YJCA 2EW8A 2EHJA 2G5TA 3C3YA 2Z57A 4Q7MB 5FBLB 4BP9A 3QGMA 4FZRA 2XEDA 2QTAA 1H6AA 1FJ2A 1HT2E 1UJMA 5KAPA 3CH7A 4EUSA 1EUDB 3PIIA 2NQ2C 2Q9CA 4QO7A 4YRCA 5JTUA 3URKA 5K8TA 1SCBA 3S1AA 2DPMA 3ML1A 1M6VA 2OQVA 2IDJA 5EQFA 3HN2A 2ZIVB 2A59A 3D3WA 4YFYA 3LL7A 1XX6A 1AE1A 3ICPA 2VLBA 3INGA 3KDAA 4L72A 1TMYA 2JI8A 2IZ6A 1QCDA 2WILA 2B98A 3H5OA 4WZZA 4DQUA 2FMFA 1CT9A 2NVOA 3LW7A 3DKPA 1TAUA 2R8RA 3DEHA 4BNHA 4V03A 4DLLA 3ANNA 4C88A 3CH6A 5FAXA 3OBIA 2O3SA 1YS4A 4V2UA 1HE3A 4LXUA 1RC0A 3KP1A 4JL6A 8ABPA 1M75A 1SRQA 1NXPA 4MVJD 4TVOA 1S1MA 3KV1A 5F4ZA 3L8HA 2AZXA 5BWNA 5KWJA 4Z4FA 1JLHA 4URZR 4W5JA 4CKEA 1DLJA 1FFXB 2VJDA 3T1VA 3S68A 4QU5A 4PRYA 5K0JA 1C0IA 3WLAA 3MERA 3DVQX 1DGQA 4ZVTA 3L0YA 3I8OA 1JJVA 1Z34A 5BYKA 1L5GB 4DIEA 3WAJA 3U13A 2I3AA 4UMFA 2QR3A 1CB7A 3AWDA 2NOAA 3AHHA 3D2AA 4EHKA 1V8DA 1HTWA 1KR5A 1RWKA 2PBZA 2ZYDA 4RD2A 3RSLA 5KKCA 3T35A 1QUFA 2IYOA 2OC4A 1JA9A 1C1DB 4B9EA 3B6JA 5ICFA 1HDYA 4DEYA 3AXTA 2CKMA 2GAJA 3KSMA 4FMBB 5ITWA 5J5VA 2RIRA 2P7HA 4I8DA 4M1OA 6NULA 3AR3A 3CVWA 1OFTA 2DEUA 5JROA 1OWLA 2C4HA 2XBUA 3MJVA 5L9AA 5FPYA 5BYJA 3VZQA 1K8QA 4PS1A 1Q95A 3ELUA 3GPCA 1ZVQA 3G5MA 3OCUA 4CCWA 2HJWA 1GSOA 5H16A 3C97A 1GQYA 1KFEB 2ECOA 2X1HA 3NOXA 3PWKA 3P2KA 3RSZA 3DGFC 3TRIA 5L45A 3BD7A 3T5AA 2P6UA 1KMQA 2E5WA 4IDQA 4CEIA 4D97A 2GBGA 3UJ8A 3TOZA 4F3CA 3QEBZ 1Y9JA 2FX5A 3CA8A 3JRXA 3Q3GE 3VPHA 5K0CA 4K6OA 4RUKA 4JJIA 4MYTA 1SCJA 2XR1A 1YR1A 2Z6VA 4C89A 4EO7A 2WD9A 1ESCA 5JDIA 1ES9A 1S02A 4QPZA 2VK4A 5AI5A 2CYAA 4ZQBA 2HI0A 2I55A 5JSFA 1QRTA 3E2MA 4C29A 5JSUA 5KNCH 3M3HA 1R9MA 3NXKA 5JXGA 4EI7A 5KCMA 1ZRSA 1R2QA 1CY6A 4YRDA 5BT9A 4UULA 4LDJA 4WOBA 4MV3A 2F59A 4UE6A 4Q3EA 4K2AA 1V6SA 3LPLA 1ZITA 3SKVA 4XFDA 3PSHA 4R2KA 4AN4A 1KFCB 1VIYA 3FMOB 2Z98A 4KYUA 1F9AA 1NBAA 3NHMA 4Q7LA 4RWEA 1R64A 2FRVA 3D5EA 3LUAA 3BHMA 2IYTA 3SC4A 1N5JA 1UKCA 4G9GA 4HYEA 4M8IA 1JLRA 4XUDA 2WU3A 3JS5A 4J4BA 1U2EA 5DXFA 4WNIA 3FZYA 1WDLA 3SFTA 4U2DA 4N41A 3ON5A 3QKIA 3VH2A 3DFFA 1PWHA 3GJ5A 4M6WB 1ZN9A 3DD5A 4YJHA 1O87A 2BRUA 3DOFA 2Q1UA 4ZCQA 3UJ6A 4A1FA 4ZGGA 4KO8A 2C1XA 1BXZA 5COBA 3BWEA 1W49A 2X77A 3Q1KA 2G6BA 3H5WA 1KOJA 4QODA 4GL4A 3LXXA 1QJ4A 2NZXA 3OCCA 5DYNA 1Q84A 4LE2A 5H70A 2X23A 2Q50A 1FLDA 1K8YB 2W4IA 3MFQA 3TIVA 5HZKA 3VBCA 4V0NA 2GBFA 1A5SB 4RJJA 1EVLA 2GILA 4TQAA 4YRGA 1WHTB 3VUEA 1XALA 2C59A 2AUNA 1D9XA 3CKLA 4HRXA 4HAVA 2HKIA 3T7TA 1ZRHA 4DDUA 1EGVB 4HC4A 2EDCA 3CW8X 4YRFA 4QYXA 4XDZA 4ARIA 4FYPA 3JAMA 3Q6IA 3E18A 1EJ2A 3EDOA 3F49S 2DWUA 4UPEA 1SVMA 4IMIB 2FPRA 3WGGA 4HZUB 1QXSA 4MEAA 1A8SA 2N1BA 3KPYA 3TLEA 1GN8A 1ZA1A 2XOKA 3KTAB 1L1RA 2OY0A 2Y4NA 5DLEA 2VP4A 3ETCA 2H4YA 1E7RA 3C48A 1EDDA 1QB7A 1DELA 1BCSB 1GCOA 1Y3FE 2HMAA 2YNMA 3AJ8A 3FZQA 3GPDG 3O8LA 5JSHA 4RK0A 5IS2A 1FW6A 3FDFA 5E9WA 1KZYC 4GXTA 3R40A 4MIYA 2EKZA 2O50A 1HT1E 2OWDA 3K09A 3VPGA 1PD0A 1ZK2A 5B12A 4C2BA 2IXFA 1KE2A 3HM2A 2QYSA 3UCEA 1CJKC 2ZJBA 1RQRA 2DQYA 3N1UA 1WHSA 4R16A 1OLSA 5LQKA 3CPHA 1UOOA 1N5IA 1QR6A 3EAGA 3HHPA 4QFDA 1I1QB 3E5RA 5DN6A 5JXIA 5LJLA 1WPGA 1F9EA 3K0BA 2J48A 1MX9A 4QNMA 2VPPA 3RIXA 3WLMA 4ACAA 3QVVA 1CY7A 1E3TA 2NO0A 2XTAA 1XRSB 2FFAA 3M33A 1FFBA 1QGOA 3NHRA 4JD5A 4ZU6X 4CMAA 5C46F 5KC8A 1Y3BE 1MX5A 1RXCA 2QVLA 4BNWA 5CYPA 2FN3A 4CMIB 5K0LA 4XJXA 3THOA 1H0KA 2VF7A 2PEYA 5BQ5A 3K0EA 5JSZA 3S70A 3MJFA 3P52A 4DMLA 1Z9BA 1OH6A 4MAMA 4QUBA 1BU5A 1IM5A 3FW1A 4PVDA 1FXWA 2NTYC 1ND6A 3LYUA 2AW5A 1EKXA 2NSDA 4QUEA 1YB7A 3NHUA 5DYTA 1WU7A 5A1JA 3J81A 3KU4A 2BVNA 2IEZA 4OQEA 3RVQA 3G9XA 3P9QA 4RHTA 4CQLB 4ND5A 2Q3EA 3BRCA 3N6XA 5KVSA 2ZSBA 3A9SA 3EOBI 3REFA 1QC5A 5IYZB 1N4DA 3HCDA 2IA5A 3O31A 4ND8A 2BKVA 3L0DA 4OFBA 2HIAA 4QPDA 2OP1A 2V3VA 3DNPA 5KTTA 4YUZA 5L40A 3WZMA 1VKNA 1IL0A 1VL5A 2L42A 5E7QA 4AKIA 4TN1A 2CBZA 2NM0A 4IXMA 3PPIA 3WAGA 1A9ZA 4CG2A 4LHYA 4HGPA 1ZUD1 4JYZA 3W5AA 2I6TA 5FUBA 3WNQA 1N3LA 2XZTA 4L6IA 1WXXA 5AD1A 3DEZA 2ONZA 2JDIA 3QYPA 1Y9AA 3VH3A 4B3XA 4CEHB 3I6IA 2X1MA 4HWRA 2PD4A 2MSLA 1CIJA 1Z36A 1YA6A 2BFNA 4F60A 2UZ1A 1KIAA 2ZYRA 1E3MA 1P7YA 3TUJC 1K3TA 1NF3A 5BMVA 3J81k 5KNDD 5CITA 2BFPA 4AICA 3QW2A 5KNCA 1FYEA 1XRQA 1WSBA 3I9JA 4B75A 1MB4A 4KLNA 3B6IA 1YACA 2FSIA 2ZRKA 3EMKA 2QR2A 4FD2A 4H0CA 4IDEA 4X3OA 3ZHYA 4YH1A 2F2TA 3QITA 4E3WA 5HHTA 4H7FA 4DA8A 3OLWA 4I7EA 5EWJA 2FUG1 3SJ7A 3IPRA 4DKJA 3PYMA 4MKHA 2LTAA 2CNKA 4C4RA 3COPA 4O4LA 3VR5D 4KWTA 3V2GA 1P3DA 3VU8A 3BD8A 3VGPA 4A2QA 3VUFA 2KMLA 4EBBA 2G71A 1BC5A 3H8VA 3SQMA 1M2KA 2DPYA 5CHEA 2QVBA 3G0OA 1HA3A 5KTRA 1IPFA 1GGEA 1KVRA 1NPDA 1Z7BA 1RYHA 2DT5A 1I0ZA 2AWOA 2O2GA 2ST1A 3HU1A 1L3IA 4U39A 1P4AA 5CM9C 2FMKA 3SGLA 5JASA 5JEDA 5F51A 1A7UA 1UODA 2I03A 3TLMA 4BP1A 1GZVA 1LZLA 1Q7EA 1CR4A 3C16C 3GMDA 1MP0A 2P6OA 4IQ0A 4O6VA 4UEKA 4Y6PA 1YR2A 4GXRA 5A62A 3DP7A 5TPWB 1O97C 4TMKA 4DJJA 5D3ZA 5EZ6B 2P75A 5GADl 2NLOA 4KQ2A 1WDTA 2R1ZA 3AERB 3HEBA 4K9LA 2I6GA 2VYFA 5IVPA 2CBXA 3GJ6A 3FBTA 3E5MA 2O5EA 5AUQA 1BEUB 1EFUA 2OZLB 3G0GA 2IQIA 4JU9A 3WLRA 2AOTB 5I9TA 2WZBA 2EP5A 1HDIA 2ZUDA 2JHAA 4WLVA 3F7MA 3C3PA 1CDDA 3KK0A 5TEVA 1JDVA 2X86A 1VM6A 1TM7E 1FBNA 2FPOA 3CIFA 3EWSA 3FOWA 3HCPA 4O2AA 4AJKA 4C5AA 3SSMA 4E12A 3ZIAD 1TCUA 3V1UA 4D0GA 4PXYA 1LA2A 3EJWA 5AJTA 1H4VB 4RKWA 1SVIA 4UEOA 2UVQA 5B3JA 3TQRA 5HK9A 4RTQA 4I9FA 1V8OA 5LB4A 1HE8B 2XB4A 2P9GA 2WG0A 4X20A 5BW4A 2BBOA 2EIHA 1XCOA 4GS5A 4MPDA 2OXIA 4DWWA 1ZM3A 3GCZA 4GKBA 1E2DA 4AD8A 1A72A 4NTZA 4WRRA 5EE9A 1E9DA 3ZQJA 3N86A 5FQNA 2B99A 3IDFA 1R6UA 4C08A 3LLCA 4FMCB 3TINA 1Y6QA 1IBRA 3TI9A 2I78A 2H11A 1DNPA 5IXJA 5LPNA 4QOEA 3SQXA 1E9EA 3KCQA 3OOEA 2P0YA 1XCGB 2I99A 3V33A 4EB6A 1GTL1 3BCHA 1I5EA 2P1DA 1R0LA 4GNRA 4RTJA 1CULC 2FZ4A 1G41A 4IYRA 1PZNA 4PBTA 3WYAA 4FR2A 2PAFA 2BPOA 3P0EA 2ODBA 1RBZA 4IIJA 1AUOA 1SUBA 4EO4A 1PL0A 1QAOA 3GCWA 1CR2A 5DX1A 1TPYA 4B80A 1XU7A 1EVJA 2B6HA 3PNBA 4GDFA 1D7AA 4ZIRA 1M5RA 1OLUB 2ONKA 5G40A 4PYQA 2GZMA 1B0UA 2V74B 2VCHA 1JG1A 1U4SA 2JLRA 1CIPA 2YFYA 4MCHA 4MQ6A 2AOXA 1HSOA 1H2HA 2DCMA 4NAVA 4O29A 1VSBA 5EA2A 3ZW7A 4DM7A 4E5NA 3L6CA 2CXUA 3ZWOA 4QG7A 4C0BA 4J90A 1JJAA 3EH2A 3QKTA 2ZYGA 1XEFA 4V0KA 5TB5A 2CT8A 1VE7A 3HVUA 4JP8A 3D4IA 1Z2DA 3IJ5A 1KVTA 2ATIA 4K2HA 3QKUA 2Q4DA 1JPJA 2YINC 3O2QB 3MILA 3LCUA 4OQYA 7YASA 1PV4A 3VPSA 2P3LA 3M5PA 4OXQA 3SF8B 4DCMA 1SK8A 4RA6A 4KIUA 5JS6A 3TLAA 1A98A 4OBXA 5JMWA 2ENUA 5AFSA 4N0EA 3DGEC 3NWOA 5HUHA 3BCUA 1PDWA 3BHNA 2J0VA 4HVCA 2EJTA 2JGLA 2JJ2D 3FSEA 1IQ0A 1CPYA 1W581 1YCHA 2OZEA 2X19A 1N9ZA 2WPDA 3LUJA 2A33A 4JLVA 2RGUA 1AK9A 3EIUA 2F1JA 1IHXA 2MWMA 1TUGA 2VF8A 1XHEA 4UARA 2XWJI 3OF5A 3VDXA 5KB3A 3LDAA 1DV1A 2WUFA 1KKUA 4PF1A 4QUKA 2GZ3A 4PLYA 1Q92A 4HJXA 2FQQA 1P0MA 3WHKA 1YJBA 4UFPA 4HB0A 1Y4AE 2GFQA 2FWNA 3MQFA 4IGIA 2XMPA 4EA8A 1RCFA 3OFKA 4CR6A 4A0RA 1RFGE 5EKXA 3EWAA 4E5KA 3DOOA 3VR6H 4BN5A 4DR6B 1DXYA 2P8SA 1L1QA 1SOVA 1EU1A 2R1TA 1C9JA 2R4UA 4RS3A 3ZLVA 3A1SA 1EZZA 4NY1A 1Y3IA 3EQ8A 5HQ3A 3I5AA 5CGZA 3OHPA 2G5GX 1NUSA 4B31A 2PNJA 4GZ3A 4DA4A 1KJJA 4TV8F 2Q6KA 4LBVA 4DR5B 2ZWOA 5REQB 4I4NA 4JELA 4AKTA 3QM1A 4OUDB 5KOJA 2CF6A 4C0KA 5F78A 3EDYA 2I3DA 1UQRA 3PL5A 1VA4A 3HCRA 4XVCA 2C07A 1XTVA 5KOIA 2I1VB 4DSOA 5H4HA 1KYZA 4HMQA 1YI1A 5FXMA 1Z83A 2WWIA 1Y6GA 2JLYA 2POCA 1AZWA 2BSXA 1WUKS 2GCOB 4R0MA 1Z4KA 3HGQA 1CLUA 2Q8PA 4L5JA 4B45A 2EVWX 4BO8A 1CRPA 1E9RA 3ZY4A 5SV2A 2GKOA 2H85A 2HBQA 3T3OA 4P82A 3INTA 4OH7A 2Q0SA 4PSVA 4EDFA 3UK7A 2R25B 4QSHA 2VJLA 2VQ6A 3G3EA 4EJSC 1OI2A 2HU5A 3MUNA 5TQJA 3KE9A 4NHOA 3T7DA 3GFBA 1OT5A 1U3FA 3QWAA 4MPPA 4Q5IA 2BYTA 2I91A 1JFLA 3F5QA 5JTTA 1YAJA 3F4KA 2I6QA 4IDAA 4MW7A 2YMMA 2R6R1 2HTFA 3SR4A 3FFXA 1U1EA 1PK8A 4GLOA 4XIYA 4EX7A 2QT9A 1N2CE 3BF8A 4G1VA 4ZO9A 3KHSA 1JH8A 1XRMA 3DDSA 1DEKA 1N5MA 4NHEA 4OYLA 5F5NA 2BGUA 2NPIA 4AT1A 2NAPA 2OMEA 4D8YA 1TQDA 4OHKA 5DEIA 5AMXA 2JIZA 2GPBA 3BRQA 4MV8A 5BVHA 4CYMA 1KEPA 2P9FA 3E9ZA 3PGJA 2RH4A 2FUEA 1NUHA 2OCAA 4GP9A 4M8LA 5CR9A 3WL5A 1CUUA 3AW9A 3DPIA 3GN1A 4C3ZA 3G2NA 2HJRA 3OJLA 1FS6A 1EK6A 4KP7A 1VHDA 1IRXA 4MR9A 1ATIA 5J1SB 1THGA 1UC8A 1K7FB 4ZOCA 1KI2A 4PBRA 2BUBA 4LDRA 2PFGA 2AG5A 3BWMA 3SHQA 4BS9A 1V3VA 3WGZA 3K8OE 3DE0X 4LV8B 5J2UF 4PGGA 1EZ4A 4E5VA 1LJLA 2HYDA 3CKKA 2EW1A 4K9MA 1Z4LA 2PKEA 5EPEA 4HNSA 4NDAA 5D01A 3R7NA 3P9ZA 4DZTA 5IP5A 5E3HA 1RXYA 3GJYA 1Q20A 1CB0A 1E3JA 2I34A 2O0JA 2DT8A 2QX6A 3GGJA 3P0IA 3A7DA 4TWBA 5HMLA 1TCCA 3PXAA 1MAVA 1UPCA 2EZ4A 3H0CA 3P19A 4P7KA 5TEWA 3RRBA 4H3VA 3SR0A 3KQYA 1EMDA 4JLKA 5BUZA 2XQJA 1P4GA 1ZH4A 1JAZA 1SXJB 2ZUWA 2E4ZA 3GMSA 3IVAA 2P11A 3N7UA 9LDBA 5DGIA 4IOMA 1WW2A 1KI6A 1N6LA 1MJHA 2GSDA 2HDHA 3AFIA 3ENQA 5B3KA 2O52A 4YLEA 3KB1A 5AVWA 5KUTA 4WLUA 2C7PA 2JASA 1CNEA 3DG9A 1Y1KE 3GD7A 3K9NA 1C1XA 1FDSA 4L5YA 2MU1A 3T06B 5F77A 4EEZA 3F6YA 1OASA 3D8HA 4B7UA 3B2QA 3KQQA 2PXXA 4YMWA 3ICEA 4M9RA 1DG1G 3BDAA 5KHAA 6LDHA 3OTOB 5KQSA 3ROTA 5B7NA 1SC6A 3VKHA 2HNKA 1EP3B 2PX3A 2C58A 3GOHA 3EWIA 3ZHQA 1AB5A 4DNOA 1RAEA 1KGDA 2G9UA 3PKIA 4Y7DA 5FJIA 4ARZA 4CLOB 4KN9S 1PWXA 1U0SY 3VDRA 2NU7B 1XVVA 3G1WA 2VTDA 1AM4D 3OZAA 4UM5A 4YVFA 1QHSA 3ETJA 5HIKA 1PQ4A 2CLOB 3N58A 1JHVA 1HT3A 2C8LA 3HUEA 3NBUA 1R88A 5B7GA 2P9HA 3CX3A 4INAA 3X1KA 5I6DA 4C0WA 1VRWA 1KFBB 3TI7A 1DAHA 1ARZA 4HRYA 3EIWA 1F0NA 1Q44A 2ZYVX 5K09A 1I80A 2R7AA 3KQSA 2HJHA 4MKZA 7GPBA 1VRVA 3AKZA 3ETHA 1Q91A 1YD7A 4LRQA 2LPMA 1N3IA 4RX1A 3OP1A 3CNHA 4MV7A 1ODIA 1PFGA 3A6ZA 2H92A 4ND6A 2A30A 1SA0B 2VJAA 3VR6A 1Y7HA 2O8CA 2C8JA 3THWA 2QU7A 2FMXA 2AKYA 2AE1A 2MINB 3VHLB 5K0BA 3QLJA 1IU9A 4TUYA 1BGVA 4BBZA 4NXNB 3VR4D 3QVWA 1DXHA 4JIGA 4P7BA 4XJSA 3ABOB 1J0CA 5KZMB 1TGYA 4CDMA 4OHOA 3WYEA 1Z3CA 4XWWA 3HLYA 2GM3A 2XTJA 5TT0A 3GLRA 5G1NA 2FSFA 3EHDA 1YDFA 3G5AA 3QELA 4HDNA 5HYVA 4OLAA 2QMYA 1Z39A 5AXAA 3DSRA 2DQ4A 1S3FA 1D5WA 2FR1A 4C7VA 4D5EA 4RKYA 4WLEA 3EFBA 4CMHA 3QBEA 1EXWA 1TJ4A 4FFMA 4MVCA 4MW9A 5E4YA 3GLTA 3FKQA 2R5WA 3EHEA 1MO2A 1CZRA 1PCXA 4OV6B 2E55A 4GM4A 2CLMB 4BGUA 3H86A 2C7VA 3MWEB 1HQYE 1NQTA 3LOQA 4HNHA 4O5AA 1HWYA 5AIAA 1SCUA 3IBCA 3MPOA 4HXGA 5FYDA 4BP3A 1TUBB 1BD3A 2Z0MA 2GNPA 3IAHA 1A97A 2D2IA 1Z29A 2VPXA 1Z5WA 3PUHA 4TX1A 3DM5A 3X0DA 3BKXA 1XPUA 2QRMA 4ENRA 2AX3A 3I9LA 3P9YA 2A35A 4DA0A 1SUDA 3DFZA 3TFQA 4DLPA 2ILVA 3RCBA 1VFNA 4CR7A 3CZRA 1Y5LA 2UUOA 5HTKA 1EDOA 2BTQB 2FEPA 2IYSA 3R7BA 1U7DA 4NAUA 1JHMA 4Z7QB 1JXAA 3KG2A 3UOAB 3L8CA 5UKDA 5G1OA 1GSIA 3ZV3A 2DBQA 4CIWA 4EZEA 1WKBA 5T3UA 2F67A 2G3YA 2GD6A 2Q4BA 4GWGA 4N0QA 2OFWA 1IAQA 2JGIA 3PEUA 1JVBA 4IRUB 4Z49A 4LXYA 1W76A 3C8DA 3UCXA 3UK0A 1TTPB 1D4OA 1JHXA 3A4MA 4UCWA 5CPFA 1Z6QA 1ZK4A 3AFMA 1RAHA 3HNPA 4YQYA 3WB9A 1ODCA 1SOMA 5AVTA 3RW9A 1P80A 1JQDA 3HJFA 3HO8A 3I8XA 3OOJA 3TQSA 1ZGBA 4QYTA 4FEGA 3CH4B 4BZZA 5BOSB 3DAFA 3T3NA 1DBIA 3HXQA 1MX3A 1A0OA 4GVPA 3GXBA 4LXQA 4PYLA 2ZQYA 1UADA 4ZARA 1ZGHA 1N2XA 2ZQZA 3DTVD 3QNWA 3HU3A 1XMIA 3C5WP 3L9XA 1IHOA 3HR4A 3TLCA 1IZYA 2Q3JA 2YOGA 3K1AA 1PR1A 3AEYA 3B13B 3P32A 2P6NA 3PFFA 2LCQA 4BC0A 1T1RA 4ETMA 3UPTA 2JLZA 3LHSA 5FL7A 4R9NA 1BD4A 2OENG 3AO0B 5JLJA 3UWPA 5J2TB 5JPCA 2HF2A 4DV1B 2MDTA 1KDVA 1LD3A 1C1HA 4UBKA 3Q9UA 4EH1A 5C51B 1L5SA 1JPVA 3R09A 1Q1AA 1ISSA 1V3QE 5EIBC 1J5PA 5LBTA 1W2GA 5E7IA 4D4IA 5C8YF 4HN2A 2JRLA 4PFSA 1OYOA 5J59A 1WRBA 3GEMA 4B3BA 1QOPB 4B2PA 1H9BA 3U2QA 2VP9A 2A0KA 4GI7A 2JGRA 1OBCA 4BMNA 3MINB 1EVYA 3RAFC 1UKZA 3EUWA 3K9CA 2B3TA 4DL9A 2PBLA 5DGHA 3AU8A 3JQ8B 3GF4A 3R74A 3RUIA 1BZYA 1M1UA 2NW6A 2NUAB 2QVZX 2HYIC 1HKUA 3EDCA 4TKVB 3C14C 1KPGA 1PGJA 1PSDA