2VK2A

Crystal structure of a galactofuranose binding protein
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
296
structure length
296
Chain Sequence
PLTVGFSQVGSESGWRAAETNVAKSEAEKRGITLKIADGQQKQENQIKAVRSFVAQGVDAIFIAPVVATGWEPVLKEAKDAEIPVFLLDRSIDVKDKSLYMTTVTADNILEGKLIGDWLVKEVNGKPCNVVELQGTVGASVAIDRKKGFAEAIKNAPNIKIIRSQSGDFTRSKGKEVMESFIKAENNGKNICMVYAHNDDMVIGAIQAIKEAGLKPGKDILTGSIDGVPDIYKAMMDGEANASVELTPNMAGPAFDALEKYKKDGTMPEKLTLTKSTLYLPDTAKEELEKKKNMGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords ABC TRANSPORTER PERIPLASMIC-BINDING PROTEIN YTFQ
publication title Furanose-Specific Sugar Transport: Characterization of a Bacterial Galactofuranose-Binding Protein.
pubmed doi rcsb
source organism Escherichia coli
total genus 119
structure length 296
sequence length 296
ec nomenclature
pdb deposition date 2007-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13407 Peripla_BP_4 Periplasmic binding protein domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2vk2A01
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2vk2A02
1NTRA 1GCGA 4W5OA 2QSJA 4F12A 2JCGA 5TE9A 3O21A 4XARA 1OXKB 1I3CA 3H6HA 3F7NA 3CU5A 3H5LA 5TQ0A 4PE5B 2HJ9A 4QYMA 4MS1B 3EJWA 2MSLA 4YCSA 2YHBA 3D8UA 6CHYA 5KQGA 1JBEA 1SRRA 3QLUA 4G0OA 2P4UA 1RXIA 3KYIB 2FQWA 3MA0A 4RXMA 3QK7A 1EHCA 3DGEC 2NUBA 2HPHA 4WUTA 4YV7A 3C3KA 1RPJA 5KQMA 2E4UA 4EYKA 5FWYA 5TPZD 4MLDA 2RJNA 3L49A 4MS3A 5TQ0B 3LUDA 3FGZA 4ETNA 3HM9A 1DC8A 2IPLA 4QPJC 3MMNA 3VNAA 3OM0A 1OXBB 3BBLA 1GUDA 4G0MA 2FLKA 2ID7A 2NT4A 4RK6A 4RXTA 3W9SA 1EAYA 1Z17A 3C97A 5JNWA 1J56A 3HUUA 2PUBA 1VKRA 5IULC 3GRCA 2PUGA 1L5ZA 2PUFA 4LDZA 1FSPA 1VPWA 2GI4A 3GV0A 2WJAA 5FWYB 3I42A 2HQRA 4G86A 4MS3B 2IPMA 3O2SB 4B09A 3GYBA 4M88A 4YR7A 2PE5A 3IP5A 4RK5A 5IBQA 1NXTA 1JF8A 2XDYA 4N03A 3M9WA 3HO1A 4QICA 3QELA 1QPZA 3A0UA 3RVKA 3MYYA 3EULA 4Q7EA 4NV3A 3Q15C 2W42A 3LUAA 4E7OA 4ZMSA 4TMYA 4NCBA 1ZN2A 2FW0A 2L17A 3LUKA 3BRSA 2IKSA 3RVOA 2OQRA 4WXEA 5CNIA 2IYNA 2QW1A 4MPTA 3F6PA 1C4WA 1D5WA 3A3KA 3CLKA 4RU1A 2MYTA 1YVUA 3QELB 3TX6A 3SY8A 4Z4IA 1GLGA 5EWJA 1XWWA 1YK1A 4CBVA 4MQFA 1ZAYA 1TMYA 3JVDA 3LMKA 1ZY2A 1VRVA 2VK2A 3CFYA 4NQRA 2NZVG 3RVQA 1QQAA 1FQWA 3RVSA 4EVSA 2MSWA 1PEYA 5JS2A 2MYUA 4W5TA 2F8TA 2LUOA 3N0WA 2CHEA 1DP4A 4XFKA 1C0EA 4MRMB 5KC9A 2H3HA 4KNYA 3F73A 1W25A 5KQPA 4O1HA 4RXUA 4G0PA 2MYNA 2OENG 1URPA 2JBAA 3F6CA 5EWJB 2P9HA 2PL9A 2IDMA 4MQFB 4OATA 4MS4B 4S05A 1LBIA 1U04A 1T34A 3EODA 1TLFA 3JVIA 3SG0A 3LUFA 5T3YA 1U2QA 2PUDA 4LX8A 4D6XA 5TQJA 4LE2A 1M2FA 1FFGA 3L6UA 3NNDA 4MYRA 4YWHA 1P8AA 3HEBA 2JB9A 2FMIA 3OM1A 2JVKA 2L18A 1K68A 2GWRA 4WWHA 5T7BA 2FLWA 1E2BA 3Q7TA 2FMFA 3LFTA 1M5TA 2QXYA 2JBAB 4KVFA 4PZ0A 5C5EA 2TMYA 5IUJC 2BGGA 3CZCA 3EQZA 4IRXA 1P6UA 3OLYA 3LUCA 4WZZA 4N76A 3OLZA 3OLWA 4EYQA 1YMVA 4JA2A 4FE4A 3NHZA 3Q41A 2X7XA 3A10A 4FE7A 1JFSA 1JYFA 1ZESA 4JP1A 4YO7A 4Z0NA 2FMKA 3NBMA 3UK0A 1QKKA 4RKQA 3P9YA 2LPMA 3DZDA 5IUNC 1USIA 2RGYA 4RKRA 4F3TA 3ILHA 1NXOA 3H5VA 3O1IC 1DCKA 3OO0A 3QLTA 3QX9A 1A0OA 3IPCA 4HNQA 4W5QA 1F4VA 1USKA 3TD9A 4G0YA 4W5NA 1DCMA 1CHNA 3KKEA 4KK4A 5FWXA 4JASB 3KLNA 2WRZA 4OG2A 1U2PA 1DBQA 3IP9A 3KSMA 1JDPA 2FEWB 3H5TA 3T8YA 3QX8A 3N53A 1P6QA 4EVQA 1CEYA 4N0PA 5C5CA 4IILA 1KRWA 4RDCA 1A04A 3OMWA 4G97A 3Q7RA 5JS1A 3OQNA 1Z13A 3B2NA 1ZH4A 3RVPA 1USGA 3OLXA 3OQOA 1A2OA 1PNTA 4WT7A 5FWXB 3N0RA 2B1JA 3MF4A 2WB4A 5JNUA 1ZHHA 2M98A 4KQ9A 3CZ5A 3MM4A 2LBPA 2FTKE 4JB2A 4O1IA 4TLMB 4Z4GA 3N6VA 4EVRA 1ABEA 3O1HB 4E7PA 2PMCA 3TMYA 2FEPA 5B3JA 3OQMA 4MQEB 2FQYA 5HKOA 4KREA 1QP0A 3QLUC 2GKGA 4MGEA 1JDNA 3KG2A 2O20A 1FFSA 5JNTA 3Q9SA 5IEBA 3HDGA 1U0SY 2PUCA 1UDRA 3DLBA 4F8JA 4YRZA 2QU7A 3O1JC 2JVIA 3EGCA 5KI6A 4H3HB 3KYJB 4DQDA 5JNVA 3JS5A 3HVRA 1MIHA 4PEVA 5BRAA 5DCLA 3BILA 2FSPA 4G0ZA 3CTPA 2HQBA 3VNBA 1QP4A 4KV7A 2MYPA 2RJOA 4EYOA 2FKAA 4MRMA 4LE0A 3LKVA 3RVLA 1M5UA 5IX8A 2VUHB 3KTOA 4NCAA 2DRIA 1RZRD 1DC7A 5JNRA 2JRLA 3I09A 4RS3A 1LJUA 3RQIA 3KCNA 3O2JA 4RWEA 1Z12A 2V0NA 4OTZA 3DLHA 4MS4A 3QEKA 3E61A 5DGCA 1NXXA 2WJWA 2PUEA 3GL9A 3H1EA 2R4QA 4UHKA 5D2CA 3S99A 1ISSA 3H5IA 2FEKA 2ZAYA 5BR1A 4H60A 4PICA 3QLVA 3UUGA 1E6MA 1BDHA 3CHYA 1S8NA 4ZPJA 5TPWA 3KJXA 4G0QA 1EWTA 3M9XA 3TO5A 1SXHA 1SXIA 4Q6BA 2I6FA 3M6MD 1APBA 1E6LA 4RK1A 4GPAA 5GOTA 1KGSA 4P1ZA 4HYEA 4XAQA 3HJFA 1JL3A 3GT7A 1DG9A 1W9HA 2F8SA 1JLKA 2B4AA 1DCFA 4IGAA 3N0XA 1FFWA 3RVMA 1YMUA 2A9OA 2WMYA 1GCAA 4D6YA 5I4CA 1HEYA 4KRFA 5CNMA 1MB0A 2LP4Y 3H5WA 3GBVA 4N0QA 5TPWB 1PUXA 3IP6A 5E3JA 4HNSA 3FMVA 8ABPA 3HZHA 5HSGA 1P2FA 3IDOA 1D2AA 5KQLA 1ZDMA 3HUTA 2KYRA 4LZLA 2GBPA 5CHYA 4LDAA 3R0JA 1JHZA 3RVJA 3IP7A 3C6QA 5ABPA 1XHFA 2LIVA 3HS3A 4O5AA 4G0XA 4YS6A 4Z99A 3E3MA 4RK0A 4XASA 1RZRA 4ETIA 1E6KA 4RK4A 2FN8A 3H5OA 4Z9AA 4MR7A 3D02A 1DRJA 1Z15A 3GWGA 4KZKA 1KMIY 1BA2A 2MSKA 4YGXB 2NZUG 4EYGA 2E4ZA 2ID9A 3SQNA 4KMRA 1BDJA 4MR9A 4RV5A 3SM9A 1NXVA 4YP9A 5CNJA 3HV2A 4Y9TA 1ZGGA 1PEAA 2H0AA 4LRQA 1B00A 3G1WA 4JB0A 1D1QA 2VYCA 3FFXA 2QZJA 3CG4A 3H1GA 4OBBA 1DZ3A 1QO0D 1L5YA 3T38A 1IIBA 3FDFA 4XLTA 3UKJA 2PLNA 3JTEA 2FQXA 1AB6A 1QMPA 1VLZA 4HNRA 4D74A 1NXWA 4Z4HA 1KRXA 4EGSA 1TJYA 2PAFA 4JOQA 4MR7B 1PHRA 3G85A 4RZSA 3GA5A 1MB3A 2QV0A 1DBWA 1M2EA 1RXEA 3EQ2A 4MR9B 2HSGA 1MVOA 4XXHA 2CWDA 4MQEA 5BRJA 3O74A 1TM2A 4RY0A 4OLBA 1NATA 3LTEA 3LUHA 1Z26A 2IPNA 3HK2A 2HQOA 3IPAA 3KLOA 3O75A 4DADA 4Z4EA 2PKXA 3HCWA 1SXGA 2QR3A 4RSMA 1DJMA 7ABPA 2N9UA 1F51E 3RVNA 2FN9A 3FFWA 4ZYLA 3KS9A 1CYEA 4FB4A 1Z25A 5DKFA 2WWVD 4F11A 3CNBA 2IOYA 5PNTA 1JFTA 1ABFA 1R8JA 1QQBA 4KK3A 4F06A 2FVYA 3H6GA 3A0RB 3K9CA 5FBHA 1NXPA 1LJLA 4YLEA 1Y1LA 2RDMA 1H9CA 4LE1A 5FBKA 1Z2EA 3RVRA 3LUJA 1BDIA 2R25B 4Z9BA 3HXMA 1LK0A 2QVGA 4N47A 1RNLA 4MAAA 3Q7SA 1JWLA 3C3MA 2NT3A 4IMIB 1YK0A 2Q5CA 3JPYA 4GNRA 3ILYA 3C3WA 3I45A 4MR8A 3URMA 1QO0A 1ZH2A 2PJUA 1Z2DA 3LUGA 1YTUA 4Q6WA 3OO1A 4N41A 3HSYA 2PUAA 1QNLA 1ZITA 4P98A 3T6KA 4KQCA 4L85A 4ML3A 3HDVA 5DLEA 3O2QB 5CNKA 2E4YA 5IUKC 5ED4A 1Z16A 1SD5A 3JY6A 3H75A 4KFCA 4W5RA 4Z4CA 3DBIA 4ETMA 3LKBA 1JYEA 3BREA 3CS3A 1MAVA 3SAJA 2FXIA 1PNRA 1JX6A 2J48A 2FMHA 4MR8B 5EWMA 2A9QA 2L2QA 3GBPA 1BAPA 5TQ2A 5B3JC 2QVCA 3NHMA 4RK7A 3LOPA 1JH9A 2IPAB 5GQSA 2E4XA 1NXSA 1XHEA 4WXMA 1D1PA 4TLLB 2R48A 1TVMA 5HQJA 5TPZA 5DTEA 4UHJA 1EWKA 1YIOA 2E4VA 4QYWA 3T95A 4ZJPA 3K4HA 2M1ZA 1GUBA 3MIZA 5KWSA 2CHFA 3OMXA 3NNNA 1QP7A 4S04A 1DBPA 2AYXA 3ROFA 5JNSA 4DN6A 2CD7A 1K66A 5EWMB 5F64A 5BQ3A 1EFAA 6ABPA 5EWLA 4KPYA 1DRKA 3CRNA 5TQ2B 2R47A 2VUIB 4EY3A 2A9RA 3CG0A 5IC5A 5HM6A 1ISRA 3EDCA 3NNSA 3RH0A 3SNKA 3BRQA 2E4WA 3DGFC 4ZMRA 2AYZA 4PYRA 4OLAA 4TN5A 3EAFA 1YS7A 3KHTA 3QEMA 9ABPA 2PL1A 4EUKA 1EWVA 3JPWA 4H3KB 3CKMA 1AB5A 4NICA 5KC8A 3OLVA 5EWLB 1ZVVA 2L19A 2YHAA 3QLVC 1YS6A 1D4ZA 2JVJA 4RY8A 1U8TA 1WETA 1JFVA 1LBHA 2GX6A 1Z18A 3TB6A 3I5AA 4Z4FA 3N8IA 4MLCA 3ROTA 4MS1A 4IMJB 4JAVC 3H1FA 2A9PA 3FFTA 3MQ4A 2JK1A 3N75A 4L4UA 4RY9A 2ZWMA 3QEMB 1ZGZA 2WY2D 4IF4A 1BVHA 5IEJA 1NY5A
chains in the Genus database with same CATH superfamily
2UUPA 2B8NA 4DQLA 1UDBA 4TMVA 2C8VA 1M6NA 1HE5A 3VBEA 2NXNA 1PJZA 2F3UA 3QHPA 1SN7A 3OX4A 2P5TB 1EGQA 2VZLA 2Y4OA 3FNEA 1GCIA 2ESRA 3CJTA 3NAGA 4PE5B 4TMXA 2F3SA 3A1CA 3QV2A 2GJ4A 2R5FA 4PTZA 4C3UA 4YRAA 3FPHA 3SEQA 2OG1A 1GNLA 4IG9A 3UMFA 1I2MA 1XQ9A 4YCSA 5K0CA 4CF5A 1IOLA 1P77A 1K7FB 1GA4A 1IDOA 2B20A 3VH3A 4II7A 4MV4A 4ZJYA 5K4HA 4WTOA 4BCDA 1KR2A 4F2WA 3UW1A 1SHTX 4RXMA 2AR0A 3RU2A 5IZCA 3T1NA 1T5DX 1FPQA 1TW3A 1Y3DE 2F67A 2VTBB 4RHUA 4C2BA 2XCOA 5H80A 5FLKA 3G89A 2HD4A 3A28A 2V4ZA 2P75A 1KZYC 3C5HA 3KJZA 1KJZA 1RQNA 1ZO8A 3GNQA 4Y0AA 2CVOA 3BXXA 1QGUA 1OXBB 1QTRA 4G0MA 4P34A 3A37A 3ABSB 4NVRA 1LCIA 2ZJAA 3U09A 2DT8A 2W6MA 1PRYA 5DNAA 2C94A 3WLIA 1EXDA 2W48A 4YT4A 3I9V6 1NJ2A 1Z0JA 4S1OA 2KPOA 3QPCA 4BO2A 3NWEA 3RF6A 3RI3A 3E1SA 4D0LB 1ZSVA 3EVGA 1RQ2A 3PCXA 4G85A 4XIIA 5I7EA 5M7EA 4E5VA 3ZLUA 2H2WA 2ORVA 3V7WA 1FE8A 1FUKA 3PE6A 3O7WA 2H4JA 3W7VA 4YR7A 3C4QA 1Q1AA 5LP6B 3DL4A 5SYNA 5H4HA 3CPJB 1V96A 3HO1A 4FFNA 4ZO9A 1PR2A 2X9VA 4CIAA 1OD6A 1YA6A 5CGZA 4HWSA 3T5DA 4M36A 2B8TA 2J41A 1BXZA 4GT1A 5DBFA 5EJAA 5BYAA 2TS1A 4Y98A 4NAHA 1NMEA 4ZVTA 4BHTA 5KJCA 2GTIA 5EXDA 5KX5B 3P0JA 4LJKA 4TMYA 3EZ2A 4MCJA 1NVEA 1VL2A 3ASUA 1DQYA 3G59A 1HYBA 3FSJX 1N92A 4CZ2A 4PQYA 5DMXA 5EZSA 3H2GA 3BXEA 5BT9A 3KVOA 2VZEA 1RRVA 2C2KA 2GZDA 4BLUA 1VSBA 3I32A 1ISGA 3USES 1PZMA 4UXJA 3OC0A 3F96A 1T9GS 4DRXA 1Y3BE 2NU6B 2R1TA 5LSAA 1JTVA 2F00A 5BT8A 3PSHA 3GVIA 1AQUA 1JMKC 1GUYA 4U02A 3QBEA 4DG8A 4R54A 5ULLA 3RSSA 1I5EA 4BB0A 3L6DA 1BW9B 1Q0PA 3HBMA 4LYJA 3R9XA 4AL4A 1NPTO 3GN2A 3N0WA 1FA9A 2CHEA 3GLHE 4J1TA 2P4EA 1RJWA 1ZK0A 2AL7A 3CKLA 3EGWA 4M3NA 5A71A 3BD8A 1FRZA 3M6XA 3GUYA 4UW9A 5COBA 5BQOA 1OQAA 1CVLA 3VPFA 3SIWA 4BE4A 4H7KA 3DF7A 4E3WA 2FSGA 2WWWA 3O8QA 4B3DA 2GBIA 5BV2P 1CY1A 3GJSA 5H9WA 4YV0A 1T34A 3DMTA 3QGMA 4TWBA 3IHLA 2B4RO 2WIGA 3SG0A 1KQOA 4DIOA 2FX2A 3LV8A 3TW8B 1HXHA 1OVGA 2X4IA 1AQIA 1HC7A 3FWYA 2VHXA 3L0CA 3MPOA 4RFLA 4X7MA 1W6UA 3QA3E 4K8RB 4OHUA 5TC4A 4HB4A 1HTBA 4EX6A 2QUKA 3FLMA 4UE3S 5EA2A 1Z6GA 2ZUFA 1B23P 3Q7TA 5AVRA 1Q84A 1M5TA 3FM9A 4FWBA 3B7WA 4CR8A 4I81A 3L7BA 3UYKA 3BK1A 1VI6A 4J03A 5JWRA 3E53A 4FD2A 2R6JA 5TEWA 2I4OA 2IXGA 1P6UA 1E0SA 2QRHA 3ADPA 5FULA 3ZZUA 3OLYA 4ED9A 3UMSA 3A58B 3KAPA 3OLZA 1BXRA 3FTQA 1EVIA 1AA9A 1P72A 2A92A 1QSGA 1KDTA 2IE0A 2W2TA 1J09A 3F90A 3WLMA 1N4DA 1RM3A 4O25A 3WL8A 2W11A 2W8ZA 4I4IA 4K26A 4BYMA 4CF6A 4WACA 3O4VA 1ZESA 4UBMA 1HE4A 5F77A 4NCNA 4QJBA 1VCOA 2ZUBA 1V7ZA 2VXYA 1SA0B 3LYUA 4QL3A 4UHCA 2VJQA 2AWNA 4JQSA 3RYIA 4MCIA 1JR4A 2EKPA 4FHZA 1L4EA 5IUNC 3B48A 2Y1DA 4RKRA 2W4MA 2W6PA 1VSQA 4AKEA 3ZVMA 3Q40A 5IVHA 2VDJA 3I0NA 4JR1A 4F3KA 1JE0A 5AKYA 4MW9A 4MW0A 4Q1FA 4QJ5A 5KPJA 2ZSIA 4DV1B 4I4TF 4LOLA 5HMMA 3VU3A 1AUXA 4D4GA 3V8PA 2OY0A 4DR6B 4Q18A 3HGQA 1U2DA 4E14A 3RO7A 3ABZA 1OWOA 3IP9A 1LS1A 1NBWB 4AZSA 2UXDB 1D0SA 4IKEA 4MRAA 4XJTA 4K86A 1LDBA 2FSVA 5KPDA 3UT6A 5KYXB 3ADKA 2EQBA 4L5YA 3L02A 3UGQA 2CXOA 3IA7A 2X0KA 4QPPA 2YVKA 5BSUA 3EDMA 4QSMA 1K06A 5ALNA 2E0IA 4BC0A 4KQWA 4B3CA 2X3FA 3W8RA 1NQWA 4DUGD 1N2HA 4HLUC 1VXOA 4F8YA 3OD5A 4QXMA 4Z8YA 4XPIA 1GSHA 3IUYA 1VJTA 4YCNA 3T0GA 3R6LA 3O82A 3H1PA 5ALGA 2X5OA 3Q85A 2C7GA 3DEKA 3ZWMA 5DI9A 2I2WA 1OZFA 1QRAA 3JZIA 5JZVA 1VA5A 2REXB 3NJ8A 2P68A 4HTAA 3JALB 3VYWA 5E7MA 3O1HB 4RETA 3LK6A 3OIDA 3D6FA 3KAKA 5BPHA 3OQMA 3CEHA 1QBGA 5CCDA 4J0JA 4LAFA 4R6XA 1W0JD 3IP3A 5IDVA 1IK4A 3IQDB 4KXFB 1JAXA 3F8TA 4B8ZA 1TUBA 3AHCA 2HJRA 4RD2A 1JHDA 2EG9A 2WUEA 1FJ2A 2UUAB 4PG6A 2V45A 3AM4A 4WVFA 3HG7A 2ZSDA 1CNEA 3WMWA 4NPAA 3UBMA 5BN3B 4QQFA 3HVRA 1FNCA 2I66A 1U0FA 2JFZA 4FHDA 3R8FA 5GZ1A 1MXHA 1V4NA 2D2IA 4E33A 2FR0A 1ODKA 1XPRA 4HT3B 3W5CA 1EJ2A 5A7HA 4REOA 3LDGA 1MD9A 3GAZA 4MWSA 4K9LA 5LP6C 1UM9B 4GYKA 2CK3D 3KTOA 4TYMA 4NYJQ 1V7PC 2B82A 1XMSA 4JT8A 1E6UA 3FR8A 3L8ZA 3WK8A 4D45A 2I33A 5FYQA 2VAXA 3R3ZA 1Q0TA 1R8QA 1V6SA 3DOOA 1R0CA 2YOGA 1GG9A 1QHHB 3NUGA 4HDNB 3EVTA 4C03A 1HLDA 3WLQA 3GDFA 3O4GA 3DE0X 3URKA 4M6WB 2F59A 1Z34A 3BPSA 3JQDA 4OAPA 5DGCA 4M1MA 1VA4A 1IBMB 5AW6A 1D3AA 2RHRA 4UHKA 3AIKA 1OXMA 1FP4A 2JA2A 1YOVB 1N2CE 2Y68A 2PEZA 4O2AF 4JWKA 4MH0R 2R2AA 5G0TA 5K3SA 4N7BA 5BR1A 1L7OA 2EAUA 2PUTA 4LF6B 1E6MA 2WQZA 1YHNA 2RHTA 3FZGA 3WX0A 1NUHA 621PA 1HQDA 1ISJA 4B7XA 1Y9AA 1KF0A 4O29A 4RVSA 5BV0A 2BF7A 1J5XA 3UJNA 1DAKA 1Z63A 1J22A 2Y1FA 1T2VA 1S9DA 3C5WP 5B58C 1DEXA 5CDGA 3A1UA 3JD1A 1ZHOA 2RI6A 4NFYA 1V3TA 2G09A 3CIFA 1GZ4A 2P9JA 2FOIA 2VDOB 3R7BA 4EGCB 3ERCA 4Z3OA 2E6KA 3DE3X 2YWGA 1JW9B 2VTDA 3LI2A 4GE0A 4L76A 4DLNA 3EHDA 2G17A 3LQQA 3SDBA 1K5HA 1MB0A 1D9XA 2BIFA 1RJ9A 3CLTC 3GBVA 4LXYA 4LKOA 3THOA 4TSFD 1UZUA 3IDOA 4RZQA 1R8XA 1L4GA 2VSXA 1LPNA 4Z7JA 4DG5A 4LDAA 2VRWA 3LCMA 1XXHB 3R0JA 4JENA 5DGHA 3RVJA 2LIVA 1U0BB 4IEEA 4NBRA 5IXJA 5DRYA 5DEOA 4NFSA 5FLEX 5A3JA 2VDNB 1SHUX 2AEMA 2NTYC 3GK3A 4FPXA 4JDUA 4Q00A 4XASA 4PIMA 4ETIA 1RZRA 2C4NA 4RK4A 2FN8A 5AH0A 3P97A 1RYNA 1XZKA 3G9ZA 5DGDA 1G5PA 5JO9A 5K3CA 4GDMA 3HN7A 1JHYA 2Q1YA 1HE2A 1KWGA 4LXQA 2J31A 2FPOA 3HV2A 1W19A 5AOVA 3ZV3A 3HBNA 3QXJA 4Y0VA 2AR9A 3E8MA 4JB0A 4BO0A 2H57A 1R00A 4KRYA 1YI1A 4OO3A 3CN9A 1NHGA 1VG1A 3OF3A 4QXRA 2Y1EA 4GC9A 2CWWA 2VZ9A 4RTLA 4XLTA 5ALWA 2Y6UA 2B94A 4EI7A 3AINA 3IBYA 4R2MA 1VGVA 4CUKA 1QZ3A 1TJYA 1YR1A 3UJPA 4MO9A 1QZXA 3IXQA 4M8NE 3VTAA 3MWEA 2QV0A 4ZPXA 4MR9B 2OFPA 2UVDA 3EC2A 3FR7A 3HFGA 2QPAA 4NE7A 4Q24A 1TYEB 4ZOCA 3H4IA 5ILGA 1WUTA 2H31A 4E7OA 2I3ZA 3AKEA 4IHKA 5TARA 3X2FA 3T15A 2VHUA 1N36B 2Z08A 1UP4A 2QP3A 2Y9MB 3BE6A 4HQKA 4YBRA 4ZYTA 1TM5E 1NG9A 4Q3BA 3STVA 5DN6A 1T1SA 1XRSB 4DEVA 4Z2YA 3PQFA 3WOVA 2VNAA 1T2CA 3KRTA 1EVZA 2B4TO 5E1DA 2P5UA 1PO7A 3A06A 4KV9A 1ZKDA 2GYYA 1HLFA 1VLLA 3EGDB 4GVLA 4FFLA 4C01A 4DC9A 5KTKA 5AOAA 5FV4A 1LDNA 5BVHA 2CNOA 2FVYA 3P27A 1R12A 3DT8A 2PRYA 5EY5B 3GG2A 5ES3A 4JA0A 3RASA 1G5QA 1JG2A 2AG0A 2Q62A 1SOUA 2BSXA 3CGGA 1WF3A 4I19A 2ZZMA 3OEEA 3I6ZA 4ZFNA 4G36A 3ZD7A 1LK0A 1GDDA 2OT3B 3H04A 2VHJA 3O4HA 4C76A 2WE8A 1KFKB 2D7JA 3IMGA 3PDHA 3CGWA 4CIXA 5CB4A 2BKLA 3GW8A 1CJBA 1FW6A 2EWMA 4XWTA 5MN4A 4AMBA 1CJCA 4EHLA 4X61A 1TVKB 2X22A 3R76A 4G8DA 1NYTA 1TF5A 4MR8A 4DWJA 4EY5A 4UHDA 3JD2A 2PXXA 1H2RS 3L7KA 4M0PA 1TNDA 1VRWA 5J2UB 3WGUA 1WB9A 3GFFA 2QL7A 1VE5A 2Y05A 4NYJR 4ZI7F 1NFQA 4ML3A 2ZIZA 3GJYA 4KDRA 4LBYA 1X8JA 4BCCA 5A6VA 1II9A 1U31A 2H5LA 3TQIA 3H75A 3N39C 4ZDKA 5IU6A 5KTSA 4ENSA 1U7WA 2P3QA 5CR9A 4AG6A 3ZDAA 3RYFA 5M2QA 5HK9A 3OT4A 2CY0A 3B20A 4KO8A 1BOFA 3CRRA 4EPVA 5KSYA 1DKLA 1TCCA 2Y67A 5TQ2A 1F3OA 2QVCA 2QXTA 3EIHA 1KZ9A 1YSCA 3WWDA 3COJA 5GQSA 1CQZA 4LY3A 1MQ9A 3E8SA 3ZVLA 5DLQC 5BMVB 4F5ZA 1ULAA 5DTEA 2YQ4A 2CC2A 5GWXA 2N1MA 3NBUA 3AUJB 4EAQA 5C81A 1O6CA 5DCUA 2VQ6A 3BWXA 4QOIA 1IEVA 5P8WA 4X64B 4PG4A 1QFJA 1ZEMA 3JWIA 3OKAA 1QP7A 3X1WA 4DLKA 4BUJA 1NHWA 5KKCA 4QTTB 3BD7A 3LU1A 4QJ4A 4QIHA 4JT2A 2PCJA 3TLYA 2XMQA 2NAFA 4BASA 2H9IA 2VQSA 3VO8A 3V4SA 1ORTA 2R47A 1K3FA 1OB5A 1XMJA 2G9UA 4BGDA 4L5IA 3VZRA 2EATA 3TE7A 4EL0A 3NYIA 4CKZA 1WTAA 4EPXA 2HWKA 3H9GA 3JZAA 3ONWA 3ZHXA 3OZAA 3EQ9A 4GWLA 1GTMA 1IN8A 3AT1A 2CYCA 4IUYA 2RHJA 5K4AA 1V1RB 3WR5A 1WXEA 3VZSA 3I1JA 3LF2A 4QTYA 4HADA 5JISA 3IBGA 1L3CA 2VNSA 4PYNA 2Y0DA 1RJGA 3TKAA 1KQFA 3SXJA 5BNIA 3TG8A 5JY1A 3K1ZA 1HR0B 3P9IA 4IGFA 4LRWA 5JFTA 4F5YA 3JQCA 2GEFA 4B35A 2L82A 2QE7A 4F4JA 3LY9A 1UPUA 3E7DA 2YMPA 4GXRA 2OBMA 1VPTA 1DKMA 3TNFA 2MT9A 2A1UA 4C0KA 3SC2A 4F56A 4WGFA 5JYBA 5A9SB 1G16A 5C8YA 4RTSA 2QZZA 1XNGA 5EJ5A 3CZ9A 3IVRA 3EUFA 3II6X 2B34A 5HUJA 1OTYA 1T9ZA 1JFRA 4X8LA 3ZVRA 5IC4A 3UWPA 5DNCA 5HJEA 2KBEA 4XYBA 4BTEA 2YICA 1J7JA 1KI8A 1P0PA 1NYLA 4MV1A 4ENVA 3AETA 1WZCA 1NZJA 1ZVJA 5DK6A 4TQAA 5FI1B 4NFHA 3HLKA 1KMCA 2HV8A 3AR5A 1XZAA 3HCFA 3OU6A 2F1HA 2WJVA 3QITA 4GGMX 4JGIA 4DS3A 1I1QB 5DM4A 3RJ9A 3Q0EA 2HJ9A 2IS4A 1DARA 4UM9D 3VO2A 2BF4A 4FMPA 3U40A 5IHXA 5MGNA 1MRSA 2GPWA 4HF7A 5GJBA 3D8UA 4DY6A 2WP0A 4AMYA 4MGIR 3WL7A 4N0EA 4DNPA 5I47A 1B8NA 3BTOA 4KQMA 2O8CA 4UHEA 2YS6A 4ZOBA 3HUDA 3G8BA 4OHFA 1XJ5A 5EJ2A 5T8KC 4MWTA 5CFLA 5HZMA 3ISVA 1VHWA 2HZ7A 4YV7A 4ZICA 2GHIA 5JXGA 1H66A 4BO9A 1IG0A 1C9MA 3W2HA 4ES6A 2WKWA 1J25A 3D4OA 4Q1DA 5TQ0B 5HG0A 4QG3A 4Q3OA 4YMTA 3PLNA 4IDCA 4QUHA 1K98A 4FC6A 2P6NA 3BYZA 1CEXA 2UZ0A 4NMLA 2Z58A 4R3WA 2LIPA 3UJBA 4L1KA 2GA9A 4MKZA 5EHNA 4DAOA 3GUUA 3P2OA 4O8CA 4KSCA 1XVTA 1ZC4A 1KPHA 3GDGA 3WLNA 3OM0A 2V7QD 3LQKA 3L40A 4YMVA 5LXTB 3CPEA 1XKLA 3IQIX 3UO8B 1ZOLA 3N5KA 1GUZA 3DLAA 3IUQA 2PUGA 1YT5A 3BMCA 1W46A 1X1SA 1MAUA 1WU8A 2VPIA 4JJZA 1X15A 4WXPA 1JVNA 4C14A 1FTGA 1RWQA 2P0AA 1Z7GA 3HJHA 1E69A 3HL4A 4TT3A 4NLLA 4U2DA 1K92A 1X42A 1LLCA 1VJ0A 1GIAA 4IVRA 1WTCA 1X8LA 3COVA 5EERA 3ANNA 4GFDA 4MVJI 2ZRGA 1QPGA 1O6BA 3VDRA 1UKCA 4PX5A 1AK1A 1PX0A 4QYTA 2NACA 2G04A 1T2UA 4N6GA 3RYHA 4HWGA 5A4MS 1C1YA 2BFBA 3IOCA 4BWFB 4CTNA 1ZD2P 2QNIA 4NZMA 1Q7RA 4UOEA 2RSLA 3D6TB 3QUTA 4O4IB 1E3IA 4QELA 5E6UA 3EG9B 4TUYA 5IN4A 2AMLA 5BSEA 4X41A 4FT2A 1MX9A 2TRSB 1JLLA 2V96A 3NM6B 5AVWA 4ARCA 2ZT8A 4XVUA 4CM8B 3F6PA 1KARA 3U2QA 1GU7A 1QHSA 1XTJA 2X0JA 2NYUA 3M89A 4MICA 4NE2A 4RVFA 1SPBS 3BULA 4XCXA 2Q5LA 4BLWA 2R00A 4CMBA 4HVLA 4DV5B 2HJGA 1Q6ZA 4MWCA 3E2MA 3W7AA 2D5CA 3L7YA 3FHOA 4FYYA 1XMOB 4FFWA 1NF2A 1TMYA 3QBDA 2GESA 2WI8A 1SBQA 2IXTA 2TYSB 1C7RA 3FPGA 1QJ4A 3R3YA 4GU5A 4B6JA 4BNKA 1UJMA 4CMJA 1JJFA 4G9GA 3MBOA 5HGJA 3A9TA 1SCNE 4D9FA 1NT4A 4Y30A 5CX4A 3M81A 3K6KA 4NAVA 4NDAA 5C8YF 4LIPD 4FOOA 4CGYA 1X1EA 4U1RA 2D1TA 4LPSA 1KO1A 3K0KA 4X1YA 2EARA 2R5NA 2X0DA 3ECCA 4YMGA 1E3WA 1G8JA 2G71A 1L5WA 1E9AA 2P9HA 3D8SA 4G1CA 1GSAA 3F6SA 3M6AA 1MJGM 2H51A 3AY3A 3E0QA 4P4LA 3EODA 2PBLA 1PT8A 1DOHA 2AG5A 3ITEA 3I3OA 1A69A 3ITKA 3GZNB 1PWEA 5T3YA 2PUDA 1VKOA 2W7TA 1E64A 1G2OA 5GGYA 3U48A 4BNGA 2H4HA 3DBHA 3L6UA 4HP8A 1XZ8A 3NDBB 3PFWO 3LQFA 2O2IA 3HWRA 1MB4A 5L3SB 1L7XA 5BNWA 4I5DA 4RTMA 2MR6A 2FMFA 4JC5A 1KZ4A 3DTNA 3OEHD 4Z0HO 1HYEA 5EKDA 3QE2A 4QJ3A 3DG9A 1GLVA 4FYPA 4FILA 4HVAA 1PE0A 5HCUA 8ADHA 4UNPA 2VUSA 3CF4A 3ES9A 4M0CA 1G9TA 1FFCA 1U0NA 1QFMA 2J07A 4PSUA 3GJZA 5FUXA 4ID3A 4JEHA 2JGKA 3DZIA 1LS6A 2ZR0A 5ALUA 1V1JA 2JH8A 3SJ7A 2AUMA 2YC4C 4E30A 1TYBE 2DXIA 4OL0A 3ZE7A 1JYFA 1R0XA 4N48A 2I7CA 1E5DA 2K2WA 2P1RA 3PWKA 4JLSA 3RV4A 4OMDA 1GG2A 4CKEA 2Y1WA 4KKVA 4B84A 2FW6A 1J9EA 4LXUA 1FNMA 2GAAA 3I6MA 1KEZA 4DRZA 3VC7A 3GLSA 1FNNA 4TL9A 1I2CA 3T7EA 3FSEA 4U7TB 3HYSA 4E6PA 4W5QA 4X1IA 1H3FA 4H7DA 3NHYA 4UVHA 4NMXB 5UKDA 2RGGA 3QNUA 4WOCA 2J4DA 4FI3F 1NRJB 4X45A 2AHRA 2O7RA 1GQQA 5AW0A 2GRJA 2WRZA 3CEMA 4OG2A 2JANA 3OIYA 1WKBA 2D5IA 1CE8B 2P62A 4FMCB 5JVDB 4D8YA 4CIYA 2WV7A 1THTA 5LIPA 3DEZA 3WTCA 3HMKA 2C7BA 2CDCA 3NRBA 3QXGA 2IZZA 3LL4A 3R41A 3D6MA 4M0FA 3V7NA 3KX2A 4AUNA 1F5NA 2Q0XA 2Q3JA 3GLKA 3H17A 1Y6RA 4FVTA 4AMGA 5JD5A 1O94A 2LRHA 4YXFA 5IYZF 4HYQA 2HMWA 4LYYA 2Y93A 5B7NA 3OQNA 2IEDA 3VTZA 5I9TA 1J8DA 5JCJD 4EFMA 1DTEA 3GI1A 4KACA 3KUCA 1U7UA 2VZ0A 4UASA 5FPYA 2VQFB 4PNEA 3MF4A 4DDUA 1ZMBA 4G81A 3S1AA 5DW0A 3IESA 2EFYA 2PZLA 1SOMA 3O73A 1NOJA 1TQ4A 2V0GA 2FTKE 3HJCA 1XDGA 1E5LA 1P4GA 2ECPA 3N74A 2CXUA 1L7PA 3BICA 1MXFA 1R3UA 3F8WA 4HCJA 4EA6A 1X94A 2JGNA 2FEPA 1W5BA 1G3MA 1UAYA 2JJYA 2GO7A 2H00A 4AYWA 1AF7A 4FEYA 3UAGA 4OHPA 4MB0A 4AYXA 1FMCA 2FN7A 5IF9A 4G3XA 1JDNA 1TVCA 1U9IA 4G41A 4JXKA 1QHXA 4DIUA 2HV9A 2K7ZA 2QIOA 3UK6A 5ALHA 2FPSA 2VSFA 3O1JC 4FC7A 3RSFA 2AFHB 3EGCA 3O8BA 1FDOA 2PVPA 4JIMA 3BIWA 2XITA 5AKKA 1SVUA 4COKA 1XDZA 3QXCA 1CK4A 2GZHA 4NESA 5AM5A 3DDOA 5AW5A 3TZLA 4JYBA 3WL3A 2FSPA 1K6XA 3VNBA 1KYWA 2D2EA 2G9NA 1AK9A 1N75A 2BCJQ 4ISCA 1XD9A 3IEUA 2RGXA 3EXHA 1F06A 2Y77A 3I28A 1W4CA 2G83A 2WABA 3BHIA 5CTAA 2B3TA 4C4ZA 1TF2A 3KKQA 4WMLA 1EP1B 5J5VA 1J90A 2BWJA 2HA4A 3QZUA 2PVSA 1KU0A 4WOJA 3F5QA 2POCA 3GZTB 4HNGA 3U6BA 3QI7A 3E61A 4J0KA 3J7AC 5CTJA 3SQDA 5JS8A 1SXJA 4DLAA 1QG0A 2B4YA 4ZT3A 1M34A 1X80B 4U6QA 5ENDA 3S99A 1JB9A 4DYVA 4FEEA 1BGWA 1T9GR 2VEDA 4IH1A 4RACA 4BU1A 1EMDA 3AZQA 5F9HA 4FQ8A 1ETHA 4MITA 4JN6B 4UNSA 3ROKA 3RT9A 2RK4A 1Y9DA 3UJ7A 4DPLA 2QMYA 3EZ7A 5I3ZA 4YRIA 4ZO6A 4LXGA 2XNJA 1JQAA 3ID6C 2VS1A 3EMBA 4HHEA 4H1HA 4EOGA 5EG5A 2CV0A 2VQDA 5GOTA 1LI4A 1MH1A 4XTCS 4Q4LA 5L4SA 3OC6A 2PFGA 3HB7A 1T24A 4MYCA 2C92A 1DG9A 6PFKA 3O8RA 5JPDA 1JLKA 3GLGE 2FDXA 3PR3A 2WHPB 1N5DA 3DYVA 5IAGA 3ZGNA 1AKYA 2XGJA 4X3CA 1D07A 5IAEA 3OCUA 2JGRA 4B5LA 1ZMTA 1SHLA 5HSGA 2WHEA 4RGVA 4GEGA 1EUCB 2DMRA 3MD0A 5DLPA 1J23A 1M1ZA 1D04A 1DZIA 2GZSA 4FNMA 3HUTA 4OBWA 4UOQA 1A72A 4XGNA 1UDWA 2ZT6A 3IP7A 2PJZA 1C3EA 2CBZA 4YS6A 2ZSFA 1KMHA 4CMAA 1NASA 2Y27A 2CE7A 4IXWA 1EE9A 4P22A 4PYOA 3GCGA 3SKYA 5K8TA 1ADJA 3C7AA 1MEEA 3K16A 4UUNA 1WDTA 1TO6A 5BW4A 4U7DA 3QX3A 3KOYA 1XZIA 2GHQA 3MMSA 3EIEA 2QY6A 2O8EA 3H19A 1F17A 1TCAA 4HUJA 5DTQA 2Z6QA 1UBTS 2Q9BA 1PEAA 3H9JA 3X0DA 2R1VB 3I9NA 4XDHA 3F7TA 1DFHA 4QRDA 5BQFA 2VYCA 4CHTA 2DFNA 3NQ41 1KOJA 1HFJA 3WBFA 3TXXA 1BD3A 3FXAA 5KMGA 1QG2A 1AB6A 1XD2A 2WFZA 3DE5X 5DJ5A 1YZKA 1ZGCA 3VFDA 2YMMA 3IUBA 2VPPA 3AL2A 4K6CA 3VGJA 4A0HA 2CN1A 2OCXA 3O8NA 1ZCZA 2MTBA 4K03A 4GW3A 4WBSA 4LYHA 1L5LA 2FPWA 2H18A 2F9LA 3V1LA 1Z4MA 1LDEA 3EPKA 1X7XA 4B8WA 1P7VA 3CLUC 3COPA 2Q46A 3R7SA 1L5FA 1KC3A 1NI4B 4TKMA 3TLEA 1BVUA 2B30A 4GYYA 3MTDA 3KJGA 5T5QA 5JALA 4DM4A 1Z6YA 1TB4A 1L7EA 1NVKA 4H4DA 2HRQA 2Z4SA 4DBLE 3BKXA 5HRAA 2N9UA 3OZWA 2ZRQA 4FFOA 1C1XB 1UFKA 4DCNA 5JC1A 4YUAA 4YAWA 4QBHA 4CEIA 5AUQA 2VT7A 2ZRLA 1Z25A 4INAA 1XTUA 4F11A 2YWDA 3G17A 2AFRA 4BE7B 2C1ZA 5AVTA 1ZI8A 3B1XA 3D3KA 1KE1A 4HLCA 1WXGA 1VHLA 1L4UA 4F21A 2VJCA 4IXMA 5DULA 1DAOA 5K0JA 3WAJA 2VT6A 4GRAA 5B4VA 2NPOA 2UUOA 2OKCA 2GSDA 3RVRA 2XQKA 3BTUA 4HDRA 3VPGA 3S2EA 4DMGA 4Q3DA 3QA9A 4A2QA 4G63A 1GZ7A 3X1DA 1YDHA 4NMWA 2ZITA 3C8DA 1P17A 8LDHA 4W99A 2BZ0A 3VOBA 1QWOA 2ZSHA 3C3WA 1LF5A 3CR3C 3URMA 1GZ3A 2PJUA 3DYBA 4BVGA 2IPXA 2NSYA 4RMHA 3M6FA 2ZM5A 1IY0A 1JEYA 3LL7A 4CEHB 1DAFA 4KN9S 1PFKA 4XLZA 3L92A 1N9KA 3SBOA 2C2ZA 3O2QB 3FMGA 2I6SA 1AY0A 3K2IA 2PAAA 4Q4DA 4WZAB 1IQRA 1Q20A 4LCBA 3QUCA 4IIBA 4PVCA 5EPEA 1KY4A 2YS7A 4RYLA 3CR8A 3A31A 1LBQA 2BMFA 4P7GA 3U13A 1JX6A 4AF6A 3GXBA 3PNLA 2QI9C 2FUCA 2UZAA 2R8PA 5FP0A 5LWHA 2L2QA 4JJAA 4C20A 4ZD6A 5C5DA 4XYLA 2I3BA 1HNNA 3HBAA 3IKLA 4PHFA 3WNBA 1G2PA 4IO0A 2IYPA 1JIKA 2LKDA 4AS3A 4WFKA 2FJPA 4EL5A 1ZK3A 2CHQA 4A2CA 4FGUA 1YB6A 4K9KA 4I6GA 1CQIB 4B43A 3IAEA 3T95A 1GPKA 4EHDA 3L0YA 3CVYA 3KQTA 4IHJF 5LQCA 2CHFA 3OMXA 3V8RA 2I1VB 2I7XA 1QS0A 2XUIA 2BFDB 4EMTA 1EQUA 3G2QA 4G1BA 4ZVOA 2R86A 4NCJA 5F64A 5BQ3A 4FBMA 2X2PA 2UXBB 1XIVA 3P26A 3SFZA 3ESBA 4P54A 3M34A 1ESMA 1EVYA 3EDCA 3GCDA 1UBLS 1B8UA 4G0WA 4XR9A 3ZZNA 4KYTA 1NDQA 2JLVA 2PMFA 1E2QA 2AX4A 2VP9A 3SMQA 2QMZA 5J40A 4BJHB 2A59A 5AK5A 2R8OA 4LSZA 4BIMA 3C8ZA 1Q7GA 3KHTA 4R7TA 1Z5PA 1IG3A 3UKDA 1N0WA 1C4XA 4H3KB 5D51S 1G8KA 2O2EA 2VJLA 4BPRA 3RIMA 2YHAA 1PSWA 2Y71A 4OQNA 1FSZA 4B6EA 4L0QA 1XI2A 2WR8A 2KM1A 2Q3BA 4X91A 5GJVC 3EMDA 1A5TA 2NYVA 3CA8A 2EBUA 2FG5A 4MDFA 2NOAA 1HDYA 2XE4A 1IMOA 3IAM1 3WS7A 5JMOA 2A5JA 3N75A 3LCCA 1Q7CA 4MVJH 4R2LA 1KOFA 4AJEA 2WUWE 5KYYA 2ZM6B 4EJ6A 1VG0B 3HSKA 3I9OA 1K8YB 1GGNA 1D6JA 1NY5A 4AT1A 4QBKA 3K0AB 4GSYA 2DFKB 3DB2A 4FGWA 5AUNB 3IA2A 3O03A 2FQQA 3R0VA 4P3YA 4KZPA 4XARA 4PHTA 2OTCA 3F7NA 1UC5B 4YJFB 1UMBB 4OGGA 4B85A 1RC8A 4DQVA 3LWZA 1SRQA 5EGSA 4BZXA 4EA8A 4IZOA 4WESA 5JCOC 2O2DA 2HMYB 3AILA 1JQDA 3DDNA 2WU8A 3HM2A 5GPBA 3OIVA 3U37A 6CHYA 3WIVA 4X66B 2C3UA 4PWYA 3TCXB 4G0OA 2BM8A 3WSTA 3KL2A 1AM4D 1SXQA 3NKVA 3GG9A 4BFVA 1SKUA 4YRCA 4YFVA 3PYLA 1MAAA 5F21A 4TKUA 2OE2A 5IMBA 4FX2A 2X23A 4AVYA 5TMDA 5FBWB 3GBSA 4Q16A 1PD1A 3U3MA 1JDZA 1R1DA 1U28C 1Y34E 1F6WA 4QFCA 5I8WA 5KQMA 2C5HA 3GFPA 4G65A 4TLDA 5B4TA 2XVZA 2RJNA 4MVXA 5DWDA 1N7HA 1JEEA 2GN4A 3EVFA 3IKVA 3JQRA 4MI9A 4Y2HA 5CA1A 4M8IA 5JYCA 3WWOA 3ZJUA 3ADDA 3X1ZA 1Z2NX 4CQMB 1NBIA 3KSDO 2JLYA 1MDFA 4AB1A 1ZUHA 1V9CA 5KCZA 4DR4B 3BA1A 5EXXA 3R8CA 3W9SA 3E9EA 4M98A 3CVJA 3M8KA 1Q95A 5JNWA 1A95A 3DQPA 1NU6A 3NOOA 1KETA 5CDYA 5BMOA 1YC5A 4BBZA 1TQ8A 4LDZA 2IOHA 4II3A 1FCJA 1WDLA 1VPWA 1VL5A 1GKLA 5FT9A 1MW8X 1Z88A 1BJKA 2X2OA 1Q15A 3VR0A 2DH5A 3CW9A 4CV0A 3DF9A 4GUAA 1T10A 5TVKA 3D0RA 1YZTA 5C53B 1EE2A 4QUAA 3I76A 1S9HA 4G01B 2QQGA 5BNTA 2DC1A 1QYDA 4B71A 4M0UA 1CTQA 4CEJB 1AH2A 5G4KA 1PVDA 1YKFA 5FEMA 2FWAA 1ZGAA 1J2UA 2JLSA 2RHDA 2WNIA 3BMOA 3QKSA 1ULBA 1EM8A 3EULA 3RG8A 4HUTA 3LTNC 3FMPB 3CUEF 4WDQA 1PV2A 1UOOA 1J33A 2Q0QA 2ODWA 5A0FA 1WHTB 2XNDD 1XZEA 4M1ZA 4O4JB 2EW1A 3T61A 3UUFA 4OYLA 4KLCA 1M75A 4R1QA 3I73A 3D6NB 1TA9A 3O2NA 1VE7A 2VAWA 1D5WA 1L4MA 3AERB 1TM7E 3HB5X 4MHOA 5FUWA 3S81A 2J9RA 5BN5A 2JIZA 1H1LB 1T3HA 2JIBA 5LMZA 4AF7A 4BEJA 5AXAA 4OJTA 1T6ZA 5LPNA 3TLXA 1TFUA 3G2JA 4V0QA 2AFIB 2BFMA 3ACCA 4LJ6A 1KEWA 3ZIUA 2ZJBA 4MYTA 5SY4A 2B37A 2YVAA 1SC4A 5CB6A 1W88A 3LBFA 2CZCA 3UAOA 1NR1A 3GB9A 1D0IA 2WIDA 3DPIA 1DAMA 1TQHA 2XA2A 3C3PA 3KHKA 3T3IA 2GRAA 3PDIB 3ZW9A 4GOOD 1TW2A 3MJRA 1XGKA 1C14A 1JEQB 1RQLA 4E22A 2G88A 4MGKR 4J16A 3GA0A 3KQOA 4UU7A 4BCBA 1YCFA 4M55A 4HWRA 1Y7TA 2JBAA 3L1IA 3OKCA 4V39A 3HXTA 3RWMB 4X94A 2VATA 3V8BA 4EG7A 2A9FA 3DC2A 1Q0QA 4MCHA 2G80A 3GLHB 4XFJA 2EF1A 3TL6A 1ATZA 3DWFA 3GAAA 3KALA 2IIPA 4TPKA 1BSVA 1DWPA 4MPPA 5A05A 2J5QA 4J2HA 1KI6B 5AT1A 5KAMA 4JVNA 5BSVA 2CKMA 2Z98A 2DZDA 3EQ6A 4HN4B 1G3RA 3K05A 1UUFA 4BXOA 1LZKA 1G6Q1 2PT5A 3K4PA 5KNBA 1PFUA 2OXIA 4ZAFA 1B2LA 5IH3A 2QUIA 4MO2A 5C4GB 1K68A 4L07A 5JJCA 1P1FA 2NV6A 3AUFA 2CF5A 2TMYA 1JALA 1QOPB 3U7EB 4MMZB 1KBQA 5BY2A 5HMLA 1K7CA 3K5HA 5ICMA 2ZIXB 3UJHA 4GRIA 4ER6A 1KORA 3NH9A 4YUWA 4GMHA 3HKEA 3OJLA 3LE8A 2A30A 3TTUA 5KTPA 3MJTA 4IDPA 4LRTB 2Q2QA 3DXZA 3SBEA 1NRWA 2WD8A 3O93A 1M8KA 4IJQA 2XDWA 2CUNA 2WMOB 3UJ8A 2G1AA 4I6EA 3AEZA 4NONA 4FHCA 2PX6A 3PGKA 2BCGY 3A9UA 4RQTA 2FPPB 1W5AA 5LBIA 3TZHA 1FVFA 1FDUA 1VIMA 3KOUA 2WDPA 4Q4HB 4AO8A 2XZPA 5CEJA 1HQYE 2JLXA 2W4QA 1FYFA 1IH8A 3CWCA 1F8UA 2I4IA 2VVTA 3DZCA 3U49A 2HM7A 2Q99A 3PE3A 1T2EA 1UIMA 3O1IC 1DCKA 3OO0A 4HNQA 5DSTA 3EZGA 3SQOA 4HGPA 1TUGA 4ZJZA 1HE8B 4W5NA 2FNAA 5AMXA 2UUBB 2OGUA 4K9PA 2P0YA 1L5VA 5CB8A 1W1IA 4U7WA 5DTRA 1UF9A 1M1YE 1DBQA 3I9LA 1Z8DA 3CX3A 4MX8A 1AOXA 1DIAA 1V11B 2MIIA 3A1FA 3E0XA 1ZIOA 4A0SA 3GLIE 1XTTA 4H77A 2V7GA 1NQVA 3CH6A 3U4HA 1NM5A 2I2DA 2SCUB 4M87A 2H08A 4EBFA 5KDDA 3OX1A 2JZCA 5CW2A 4IILA 3UN1A 2GJAA 3NFYA 4EUHA 2X42A 3FDZB 2X9LA 3HU5A 3MJSA 1M54A 3PC2A 4LDNA 2A9KA 4V38A 1XN1A 3RVPA 1SG0A 1WU7A 1DXOA 1Z2AA 3OQOA 4K88A 2VAVA 3Q3EA 1DAPA 5ECDA 2HK6A 1G8GA 1T9CA 1V3QE 1JHAA 4ECAA 2PXHA 5CMLA 2PRKA 1WXFA 2ZOSA 1N3IA 2IIVA 3GGOA 4O1IA 5IAKA 1Z0IA 4BLVA 1XFAA 2I4MA 3LWBA 4BQOA 4EHIA 3QIVA 3VGPA 4TMTA 5D3KA 1TC2A 3FNBA 1R0LA 3DD5A 4C78A 2OCKA 1H0RA 3GD5A 2AN9A 3G82C 4CL2A 4BVHA 5DNUA 1J24A 3W90A 3NG1A 2HOQA 4LHWA 1TE2A 5IS2A 2X1MA 1DS6A 3KYJB 1K89A 3JW8A 1PJSA 5JNVA 1RI4A 2GN2A 3LXUX 3PK0A 1LVHA 1LZLA 2QUAA 3FNRA 4EGAA 2J0QA 3NYQA 1GGFA 4DSNA 3BILA 3TQTA 1FXWA 2FLVA 2O3RA 4BMPB 4PSKA 4KLZA 1BGXT 1O87A 1SVMA 1VCIA 3LKVA 4M9CA 4RH3A 5B30A 1H42A 2BL4A 1FVOA 2AKEA 2NUAA 3TR6A 1HFKA 2ZI6A 2PQ0A 1XL0A 2DRIA 1D0VA 3FCCA 1G66A 1YHYA 4TV9B 2IGTA 2ZUDA 1J8VA 3IQHX 4JGGA 5ITZB 5C7YA 2MCFA 4OTZA 2FW7A 3F2IA 1NONA 4CQLB 4BZZA 3IKJA 2DPHA 3DFZA 1GNPA 4M0MA 2J3KA 1WL8A 4YJGB 5D2CA 1EA5A 2O4UX 2H54A 4BMYA 2JI8A 1QX3A 3RJ5A 1W4LA 1XDUA 4GD3Q 4F7DA 3BOSA 4KH1A 4QRIA 5ERXA 5THKA 1SKAA 4LTNA 1JPJA 4G0QA 5KWIA 3A6FA 4UM7A 3O92A 2SKEA 4HRVA 4MVJA 1G5HA 2IU6A 2XXBA 1KU6A 1SXHA 4GYJA 4BNFA 3JWEA 5B1IA 1WOYA 5EJIA 2OGWA 3D3JA 1KZ1A 2OZLB 4ZYYA 1CB7A 3L6RA 3GVHA 4PXAA 1GR1A 5EE0A 2OAQ1 3GMSA 3KT6A 3PQ8A 2CXPA 4HYEA 4PPNA 4X7RA 3S2UA 5JYEA 1JL3A 1CDZA 1KC1A 1Q7EA 1YRQA 1ZUWA 2KS6A 2ZAOA 5ER6A 2F8SA 4HEA1 2HSDA 3WLAA 4BNVA 4CIVA 1F6BA 3BHJA 4EKNB 2A8YA 3M4YA 2K87A 3GLIA 2HLNA 2C4MA 4JUIA 4P4TA 3MWLA 3RKRA 5F3DA 5JSZA 4NEQA 4C29A 3SVTA 3L7NA 4YAGA 4I8DA 1UJBA 3AFOA 4NE9A 3OPYB 2VK8A 4QLAA 2KW5A 4YJ3F 5DB4A 5AXCA 4BV3A 1Y5NA 4BX2A 1ZDMA 1Z4QA 3KTAA 2CCJA 3IBSA 3SHQA 3TQQA 5CHYA 3MGGA 4PCVA 1UBRS 3AUTA 4UAGA 3THWA 2VLBA 1W76A 1OI4A 1Z4KA 4IQ8A 4XOIA 3INTA 5ITSA 1P0QA 3LKDA 4P5EA 5E2BA 1IXKA 4YRKA 2DQZA 3GY0A 5AIAA 5BWLA 3L0DA 2Z83A 2ZJ1A 5CXUA 2CJFA 1IAVA 3TINA 3GGJA 1LD3A 2P77A 2XUGA 3HA3A 1EVJA 3JQ9C 5ICFA 3JYNA 1GFWA 1UKEA 2ID9A 4HPXB 4DHWA 1BDJA 1FDSA 1JNXX 5EL0A 1ODJA 1AKEA 3GT0A 3F6YA 5LD2B 2MSCB 2F48A 1MPTA 1KPGA 3D4LA 2ZUUA 4RJIA 3IOEA 1V5WA 1B0PA 1OHHD 1WWKA 1Z0DA 2PWPA 2C97A 3Q6NA 1KHTA 2D13A 4ZTBA 2YJ6A 3K96A 4YHHB 3HJNA 4CG3A 3OCJA 1WZNA 1GG8A 1PK8A 5CYPA 3RRMA 3KAJA 3P7MA 3KYDB 1BWQA 5A1TA 1W4RA 5K20A 2CDBA 2P2LA 3LZDA 4QOEA 2XTAA 4FKMA 2WVHA 1P3JA 3K0CC 1MIOA 4B7ZA 5JHGB 2CDAA 4IJ6A 4I3GA 4GXQA 4M54A 2BW0A 4A8PA 1YFLA 3D8NA 2M6RA 1ZRSA 1HRDA 3FPEA 1EFDN 1M1NB 2CWDA 1ZMOA 5A06A 3ZCUA 2LGJA 1TM2A 2NGRA 1QPBA 2D1QA 4KQEA 4RTQA 3EQ7A 5JD4A 2J0SA 1T36B 3U4MA 3DWGA 3I30X 4TVSA 1XYGA 4A6XA 4DV4B 4CIWA 1RE0A 1UDAA 4Z4EA 2JCXA 1SXGA 4YN3A 4LG1A 1XZNA 2HU5A 1FXWF 2J85A 3PA6A 3C48A 1O5IA 2AN5A 3FWNA 4PYKA 4GDFA 4ZCLA 3GPCA 3D1VA 2R66A 3TEMA 1KDOA 3NIGB 2HY7A 2WDZA 4CF7A 3THYA 1QQBA 2BFCB 4RVHA 4AC9A 1LNZA 1JA1A 4X20B 1LK5A 1ZM7A 2C29D 1DV2A 3AJRA 2LDBA 3RSLA 4MYDA 2HC9A 2VFAA 1RACA 3CO5A 3F5MA 3GVCA 1TJ3A 4HN2A 2XTNA 5JWHA 3T0IA 5BV8A 3O4RA 2L42A 4LE1A 3RUFA 1CUZA 2A0UA 3MTGA 4P4SA 1BDIA 3AI3A 4B3GA 1EBBA 1Z6XA 4II2A 4W8OA 4BDSA 3H11A 3JYLA 3KSUA 5FA8A 2PNJA 4WJZA 4OK6A 5ECYA 5TQVA 3K4QA 3QHQA 4BGUA 1K88A 4PZEA 1I4TD 2P41A 2IBTA 4IDHA 3A26A 4LJLA 3HMQA 1G3QA 3PF9A 3P1JA 4XGRA 4KWTA 5EZYB 2JLUA 4W7IA 4MVJF 5EZQA 2QVBA 5E7IA 1UK6A 2XXAA 3GH3A 5EIBC 4R16A 1V48A 1YR7A 3A1WA 4DYDA 1U1EA 5AI4A 1ZUIA 2C61A 3BAZA 3I0ZA 4WLNA 1O3YA 4CKCB 4NOJA 4MWZA 1RJEA 1GZHB 3AHEA 5FTKA 3PC8C 5EIEA 4NXNB 2B2CA 2PUWA 4PQFA 4ETMA 3GPBA 1OLSB 1Q21A 1RTKA 3A6ZA 3PFIA 3SYTA 3E48A 5K6TA 5AHWA 4WASA 5BNZA 1H3EA 2C2WA 4F4DA 1BU8A 1ESZA 3OE4A 2DFPA 4FP9A 4N49A 2QBYA 2J48A 4QULA 2FMHA 4JKIA 3U4CA 4AZWA 1LV8A 3OBIA 2R0QC 2P2DA 3HV0A 5H4GA 5M04A 3GAMA 4ZCSA 2J33A 3U60B 3R2JA 4K8OA 5DMHA 3T9CA 2XKJE 5SZKB 3C70A 5HKBA 3FHTA 4MV9A 4CKBA 3NDIA 1MCZA 1XR3A 2R97A 4HDMA 4C4AA 3FWKA 1S3FA 3L43A 2CT8A 2W83A 3BTVA 4KGXA 5DWVA 4JWTA 3EXG1 5C32A 5HQ3A 1RCTE 1XEXB 2WHRA 2QTLA 3F7MA 3QQPA 4OUKX 3MIZA 2I3AA 3NNNA 1ADFA 4OXKA 1NI3A 5K0ZA 2RBGA 3KT3A 3KNZA 5BQPA 1T9KA 1UBSB 2FP3A 1GWNA 2CD7A 2D7DA 2ORIA 1OAAA 5EWMB 1COZA 5FL7D 4ND3A 1W93A 4RHYA 2JJ8A 1GUFA 2JBHA 4ZVPA 3UGJA 4GQBA 1EX7A 4FFBA 1ISRA 1QO9A 4Q19A 2W8BB 4JJGA 1S2OA 3RS3A 4QKQA 1Y8QA 4FN4A 1Y1QA 5FPQA 4BNLA 4COOA 3O38A 4HRXA 4HY3A 5HA5A 3CUSA 3ZS8A 4F04A 1T9AA 2HXGA 1CR4A 3G02A 2WVJA 3HCDA 2VQEB 2JEZA 1DDIA 1VIAA 3ASZA 3LIIA 1MT3A 1ZL0A 5G1NA 3VHQA 4JH0A 1AB5A 1SCAA 2C3PA 4V3BA 1KFCB 3RAJA 2XSZA 3ZJ4A 3FPSA 2AG6A 1D4ZA 1T15A 3IB6A 4DC1A 2F17A 1DC4A 1G8YA 3IE0A 4NQZA 4QPNA 4UNNA 4Q3CA 3GZ4A 3WLFA 4WW0A 2M6KA 2I4TA 1PSZA 1IZYA 4HNUA 5A4AA 3MT9A 3SOZA 1JKFA 3KHUA 4PG8A 4MW6A 4FNAA 3UV7A 1O9HA 3OEWA 1LJ8A 3E5HA 2NP6A 2WV9A 4W9NC 5F52A 2JK1A 2FSHA 1C7EA 4HLUA 2F55A 4AUKA 4D6YA 1NTRA 4NBLA 1X0VA 5KTTA 3O4FA 2DLNA 3WQHA 3ADBA 2VTBA 2IBMA 1OE0A 1MDBA 2G3YA 3FPAA 3EAGA 3NTQA 4Y6PA 1C3JA 4JHXA 5F2EA 3DUFB 2WM3A 3TVTA 3GDHA 5BN4B 1RYMA 4AY5A 1XPUA 2PWZA 4KO1S 1RWNA 4LY0A 2IEGA 3AI2A 5GY7A 5ALSA 5LD2C 1R37A 1W85B 3LIPA 5TT0A 4F2PA 2TMGA 4LMAA 1KYYA 1SOAA 1N25A 3ER9A 5BXYA 1FP7A 1RXIA 1A9RA 1TIPA 2HF8A 4B9EA 3N7TA 4ZZIA 4BNJA 3N2IA 3DGEC 4IFBA 1QE5A 4LRSB 3PJGA 2NQ8A 1AO0A 3UG6A 4EYKA 2OXTA 1L5MA 3WAGA 3C5CA 3OH8A 1IQPA 1TLTA 3PFCA 3C14C 2FPRA 2QROA 4G4JA 2IC5A 1X0XA 3CLSD 4ZARA 4N7JA 4F9EA 2VC2B 4J4HA 2VPZA 4EWLA 5LP6A 3KQYA 3HCNA 4X0EA 4ZO7A 3OX3A 1C0PA 3KQKA 1DG1G 2NT4A 4EMSA 4RK6A 3GEBA 4BLRA 1EAYA 2J7PD 4Y9SA 4RMNA 3RS4A 3PITA 2GM3A 2HZBA 3JQGB 1W30A 4F9GA 4EPWA 1SZCA 1QCCA 4P8RA 2D0PB 3SIRA 1NKTA 3CCFA 1L5NA 3U81A 3UHPA 1FRVA 1E9FA 5I7AA 3UOAB 3U7QA 5D8DA 3GYBA 3VO9A 5DZSA 2ODQA 1OBOA 4BV9A 2ON6A 3FCSB 5D84A 3TXAA 4A1FA 4KXQA 5HVNA 2B8EA 5KSOA 2QIPA 3ETHA 3OFVA 3FX2A 1CT9A 4Q7KA 4YWJA 1NIJA 1L4LA 3WQBA 4FT4A 4ENRA 1M2HA 4J94A 2Z09A 3ZDDA 1PUIA 1S7CA 2HHCA 2NU6A 3V7UA 1HQCA 4G2TA 3CKYA 1X7ZB 2E6UX 1P1CA 1J06A 1CDOA 1Q1BA 2J0EA 3JAWB 3RQSA 1FYEA 5EUCA 3WSWA 2F1OA 4BZPA 4NCBA 1OGJA 1Z6ZA 1Y5RA 3E5NA 3K72B 1L2TA 2PDAA 1BW9A 1JSCA 1IBRA 2B6NA 3QTLA 3VOTA 4OHOA 1YRAA 3RVOA 1DUIA 3PXBA 1EG2A 3AKYA 4Q9LA 3ZE9A 2AR7A 4ZYUA 2X14A 3HDQA 4HXEB 5B1DA 5C4MA 3TD2A 1UPAA 4TM8A 3W2EA 2PYIA 3DCIA 2CJYA 3G0OA 3AL3A 5LUAA 1M8GA 4FS3A 1EUQA 1A7AA 3TQSA 1EX6A 1QM5A 2AMJA 1YK1A 2YNMC 2PV0A 1I4EB 3ED1A 3ISTA 2OP0A 4FZ5A 2HRRA 1LSUA 3DOFA 4XUDA 5DHAA 4W5JA 1PR6A 1UZNA 4PFJA 5F5XA 3OIWA 2IDJA 4YPOA 3OPMA 1R6UA 1FTQA 1FQWA 1WSBA 1NP3A 2YJZA 3TW8A 3MEQA 5IASA 1YQWA 3IVCA 2Q6IA 2IKQA 2FEXA 3I5YA 4BVEA 2H17A 3HC7A 4L5CA 1SIOA 1XEWX 4XFKA 3ZJYA 4NSNA 2XCTB 3F67A 4TRJA 4OFWA 1OSNA 2ZI7A 1HA3A 2VT3A 5D7BA 3MT0A 3L0OA 3R7NA 1L8LA 2J5BA 2RK6A 2X3YA 4ALKA 1R4NB 4O0LA 2QZSA 5KNBD 3GLUA 3Q3IA 4K9OA 5I7HA 2ZRKA 3C1TA 4M37A 1TEVA 3DVSX 3ZWBA 4M7OA 1UKBA 2XUJA 3OCYA 5A5FA 1E4YA 3NWJA 2AE2A 3DBLB 4KUHA 5EFOA 3GHYA 1VECA 5H0IA 4ZAWA 5BNFA 1RRCA 3ML1A 3BERA 4IPTA 4OGKA 1N2XA 3DHWC 4CDNA 2FMIA 1HDIA 2QNRA 1SA0A 3FUWA 4JSTA 2Z2JA 5FOSA 1SIWA 3ROEA 1P8JA 4E09A 1SO8A 4S12A 4G9BA 2DH6A 1Q92A 4QYSA 1YDWA 4HFMA 2YV1A 2H1RA 5FWAA 4EKYA 4C3VA 2VO1A 4MV0A 2IZ1A 1YJQA 2JFYA 4JA2A 2O5EA 1D6SA 3AR9A 3UOGA 3E9CA 2VNJA 1Y8ZA 2VWQA 3SYLA 5LP6F 2ZU0C 3DD1A 2BGMA 3BZUA 3GC6A 3LP5A 4FLMA 4PINA 3U3XA 4D96A 5EIFA 4MUJA 3ZZMA 4YROA 5KYXA 5ICSA 1U6KA 4HPJB 3SJCA 3ND9A 2L69A 4KUEA 3UQZA 4DNOA 1J0XO 1K8XB 1YZQA 3G5AA 3H5VA 3MJHA 2J5XA 3WK6A 2NXEA 3NWOA 3T3GA 2M6LA 4C21A 1H65A 3KEQA 3IOBA 4HYTA 5HRUA 1H8HD 4TXNA 5KX5F 3ACDA 2FZLA 4LTDA 3FGNA 4P0QB 4G0YA 1ID8A 1CHNA 3KKEA 2FW1A 1CRPA 3O3MB 4UTZA 3A05A 3B85A 3HRIA 4BN4A 2Y1KA 3ZHRA 1BMFA 1PK7A 2CLLB 1NVVR 1UPFA 1UWKA 2ETXA 2RG7A 2ZI9A 1IM8A 1K27A 1YQUA 3E27A 1B15A 2JJQA 4RFSB 3WJ1A 4ASUD 3V4LA 3L1VA 5J9FA 3JALA 1WUYA 1P6QA 3N53A 3VVCA 1BWSA 4B4OA 2ZYUX 4EX7A 2YN2A 5FR2A 4ZEVA 1QYXA 1PFQA 1M1XB 4NYMR 5F1KA 2Q2VA 2PH5A 4P9NA 4D81A 3K6SB 4QU9A 5D6OA 4WAUA 4RF2A 1ZH4A 4AO7A 3WZLA 3I64A 2V6BA 4GE3A 2ID8A 2G72A 3JQ8B 3F3YA 1O6ZA 3GN1A 1IEXA 2ZAMA 3NASA 1AUOA 5FADA 5BN3A 5CLLA 3HO6A 1BYUA 1J9ZA 2ZJ5A 3MM4A 4L0DA 4GLFA 3P52A 3RBAA 1BWPA 1ST3A 1Y1KE 4BN0A 5A7FA 1RMTA 5EUBA 3E82A 4V0MA 5K6AC 1CJUC 1FQJA 1MA3A 3CNLA 2WWGA 1UM9A 2WSYB 1A76A 4ENQA 1QIFA 2MMCA 3D2AA 3GCZA 2OO3A 1YL7A 3LBIA 3ZNNA 5AUOB 2IZ7A 3VV3A 4MGEA 4QNNA 3U0VA 1GYQA 3O26A 4C4RA 1QHHA 4HDNA 1I8TA 2HLDA 2PZFA 4HEA6 2G0NA 1UJ6A 3EDYA 1KDPA 4O59O 3FPLA 4IIHA 4M6WA 2MU1A 3WIBA 1U5AA 2QD4A 3VR3D 2YIMA 3GRFA 1PR1A 6AT1A 4KAAA 4R31A 1F20A 3CZPA 1JBKA 4G8CA 2RHBA 2XB9A 4YXWD 5DBOA 2QJOA 3IT1A 3LYLA 2QPTA 5DCLA 5ALMA 1U3DA 1ECPA 2HQBA 4C5AA 2IF0A 7YASA 1Z06A 2WUDA 4EYOA 4MRMA 3O4IA 3RVLA 4EY6A 5BYKA 1CUGA 1E2LA 1VL8A 4YMHA 1B6RA 4O63O 2OAP1 5IF3A 3Q9LA 3IO5A 2IHNA 3BG5A 2NXWA 1G19A 3H9UA 3KR0A 1EFLA 1JG1A 2JRLA 2JPDA 2B9VA 3G8AA 4XQ9A 1COWA 4KC0A 1G59A 4FOSA 1XZLA 3WQQA 4BMVA 1Z33A 2V0NA 2VCHA 3E2PA 3OCCA 4DV0B 3A6PC 2CUTA 3RARA 2XKBA 4JEMA 1EZ1A 2XNSA 4BQRA 2BPOA 2WVAA 5FI5A 3UK2A 1XNJA 4OB7A 5F33A 1T3LA 4M9XA 1OZ0A 4HQ6A 4BNDB 3Q3JB 3WYFA 3BQ9A 1Y6QA 4J9VA 1M2KA 2F2TA 3KFVA 4QO8A 2DKNA 1ZUNB 3BKWA 1UXIA 3RROA 3I8XA 3BXFA 1C0KA 4QG7A 1H9AA 3DP7A 1Z5NA 1KJJA 4WEQA 1L6RA 5CM8B 2IHTA 3KYBA 2CF6A 4IW3B 3I2KA 4Q6BA 4AJLA 1YB1A 1FSGA 3M3HA 3M3DA 3ZHOA 1WIWA 1XXHA 5CFNA 3OQIB 4EJ2A 3DV0B 4MGYR 4LOAA 1U3WA 4Z1OA 4E6EA 4UFOA 3JD0A 3EA5A 1JDUA 1HORA 3TZEA 4UFPA 3DMFA 1NLUA 1OXXK 1UODA 3B3QA 1JR6A 5I4KA 2QQ5A 4LBVA 5ALJA 3WIEA 2OCIA 2I54A 1BDBA 4Q7MB 5EPOA 5CYFA 5KTMA 4N0QA 1O5TA 1ZM4A 2WFLB 2EZTA 2FR1A 3RWOA 3JARB 3E84A 1QYCA 3QF4B 4MIKA 4WCFB 1NW3A 4LY9A 2JKYA 4L5JA 4FDAA 4BNHA 5M29A 3MSXA 1H3NA 2RB4A 2O5VA 5M5BA 3L5KA 5IT0A 1NULA 1VCMA 2XBUA 2ZRFA 1QYVA 3E3MA 3OPNA 4PRKA 4OL9A 5T8KA 3Q6MA 3OHPA 4L8YA 1GTG1 1RKXA 1E5TA 2PWAA 2XYPA 4JODA 4QAQA 3UUWA 2JJ2A 4ER3A 5K0FA 2WWYA 3JR7A 4CLDA 2AJTA 1WBBA 3OOEA 2WNHA 2QX4A 3WGVA 1TKBA 5CA0B 1Y6GA 4A36A 3ROGA 3LH5A 3UGKA 2A1TS 3PEEA 4MR9A 2OHVA 1EVKA 4PW0A 3K1AB 4KEAA 1ZGGA 5FA5A 4UQOA 3ZHCA 5FNVF 2Z1NA 1B00A 5IKOA 3S29A 4DREA 4B6PA 1REQB 2GF0A 2QVLA 4G24A 1KK2A 3OLQA 3LPAA 1I2DA 1OC2A 3W3AD 3MXOA 2H2HA 1S96A 2CFRA 4YEDA 3L8YA 4DJ5X 2J32A 2CMFA 1SXPA 2FK8A 2J08A 2NU7B 3CE6A 4HBGA 1L7NA 1PHRA 2P6UA 3EGDA 3FJOA 2RGEA 5AVKA 4AF8A 4IAOA 3IHTA 4RSRA 3O31A 3H9QA 2J9GA 3TEJA 2J9XB 3I2HA 1WM1A 3UFXB 1VCNA 3NVDA 3OCVA 4Q9NA 2A5YB 4MQEA 3X3HA 2EJWA 4TTQA 5EKXA 4WLVA 2R6R1 4G89A 4Z51A 2BBSA 1EQ2A 1O95C 2D2FA 3L8HA 3SE7A 3B9PA 2Q6LA 4BO1A 5IDWA 4MKHA 3HCWA 2ZWOA 3KE9A 2AE1A 3FRIA 3J7TA 4V0LA 2K4MA 3UH1A 4EW3A 1PDVA 3Q1KA 5T64A 3NXSA 3FOCA 4XPZA 5GV7A 4B87A 4H15A 1VLHA 1TVKA 2IH4A 2XMRA 3B52X 2ERCA 3AVVA 2GT1A 2COKA 1WUKS 2X8JB 3D5QA 3MRVA 5D87A 1JLSA 5J2UA 4XWWA 4ZTZB 4C0XA 3FFBA 3KR1A 4UREA 3QYFA 3I9JA 4WJLA 4TZ6A 1C7FA 2Q4RA 3RK1A 2NVBA 1RQGA 2IUYA 1B14A 2WWRA 2AFVA 1VIYA 3CXRA 4ND1A 2H7CA 2GN8A 2YFKA 5BSWA 4MB6A 5LYJF 3A3OA 4DA9A 2ZUVA 1YE8A 4BX3A 3VR4D 2Z6UA 4IMIB 1L5KA 1K75A 2GJ8A 1Y6FA 4XQ0A 1T5LA 1QAOA 2O2HA 4D99A 2YR0A 3N7AA 4JJEA 3KVVA 3TNLA 3QTTA 4K2AA 2ZPUA 4HQFA 4FX5A 1VJGA 1ZVQA 1OWNA 1OPXA 5AVVA 1MPXA 1U0TA 4UBLA 4P98A 1JPUA 2WIBA 4KQCA 2BBTA 2YN0A 2AUTA 3BDAA 4GSLA 5J2TF 4IJWA 1MW9X 2XXJA 2OHHA 5AXBA 3GDWA 3UT0A 3DBIA 1RYFA 2IY7A 3DM5A 3DZHA 5AM1A 4AS2A 3I01M 3G13A 3LQRA 3Q2OA 1R9JA 1HDOA 1XO1A 3D8TA 3CCCA 4IOMA 4GX2A 2FPGB 1EFPB 3GBPA 3MYRA 2PKYX 5FFFA 2GUGA 2YUIA 4B34A 3LOPA 1PK9A 1P9RA 1CUJA 4JROA 3W5AA 2VDQB 4NV1A 7MHTA 4Z1MD 4WD3A 5F98A 4E88A 2QT0A 1YIOA 3H4MA 3H65A 1V1RA 1E1KA 4NPCA 1BKSB 2YBEA 3DS8A 2VRCA 4YR9A 5KCMA 3F4BA 4EG6A 3GJRA 1PT9A 2VP4A 1M74A 4IVPA 4J0EA 4XCQA 3PHHA 4NJEB 2VSOA 4N5NA 3N5CA 4NBUA 5JSKA 4Q3AA 3AFMA 1WEHA 4YB8A 3VYUB 4KPYA 3DYIA 1T3SA 3CG0A 1QIJA 3OAAA 1VSUA 4I4CA 4I9GA 5A9SA 5DM1A 3ZDBA 3LHSA 2WD9A 1TVEA 1YAJA 1YZFA 3EFHA 1RXWA 3DHEA 1VIDA 3WLLA 3ICCA 1NUUA 3AXTA 2IY8A 3ET4A 3KWFA 3IP1A 1ONPA 5EMKA 2VDKB 4N9WA 3CKMA 1CUXA 1J7KA 1JU3A 1SC3A 3JQPA 3T1HB 3STYA 1OWMA 3O8DA 3TRJA 4G23A 1CUEA 1CJKC 2RB5A 3RHSA 5J1SB 5CGQB 4KO3S 1SIUA 5KNCD 3OURA 4FJ2A 4WCFC 3DMDA 2PQ6A 2NTVA 1N7GA 5CT5A 1WLYA 2ASVA 3NX4A 3VHXB 3MMPA 2H9AA 4Q9JA 3VMFA 5KOJB 1IXYA 3IV7A 1P5HA 1TMGE 2EJBA 3S8MA 4A10A 4JYAB 4UAJA 1EZ4A 3MT7A 3QEMB 1I7NA 1ZAKA 4U7PB 1QONA 2WY2D 4EUNA 1OT3A 3JVUA 4L3OA 2G40A 1UPBA 5E1BA 5DM2A 3TUZC 4C5CA 5E38A 5WRFA 4U0KA 4JJ8A 4RKFA 5J2UF 3HRKA 1PU2A 3IHWA 2FXVA 3NUZA 5TQ0A 3VZDA 1B6GA 1LC0A 5AKLA 4U9UA 2PUFA 2AZTA 2I4NA 3EJWA 3W77A 4YP7A 2GF2A 2B21A 1X70A 2ZRNA 2Q5EA 3EGOA 1H0SA 1P2UA 2CLMB 2XYVA 1WY7A 3V5NA 4CCWA 2ADMA 1T9HA 1UBNA 4I1SA 5FHQA 4NIMA 4Q01A 1ZVMA 1T2DA 1CFJA 1JAZA 2I1WA 4WUTA 1E60A 2SICE 3LDFA 3WDMA 3OE7A 3W7BA 3ASYA 4CGZA 1P73A 3KLBA 4PIVA 2NQTA 3DVLA 4QOHA 5B3KA 3OPXA 2XAAA 3C6BA 5EJMA 1XVVA 1YAHA 3I04A 3W6UA 3WHPA 4RDIA 5BMVF 3F7OA 4J75A 3P0RA 4WRRA 3UPUA 1TJPB 4QOSA 3CURA 4UUPA 3C3JA 4C1BA 4HOYA 4Q9KA 5EXEA 2MSNA 5EMHA 5GZ6A 1CSEE 2VP6A 4RXTA 4BLOA 2F3TA 1IUPA 2PO5A 1PI3A 1L3BA 2ZJOA 4NCHA 4TZKA 2FRVA 2OZVA 5A7GA 4O4IA 5CFMA 1KI3A 1HNZB 3EG9A 4URFA 3FHJA 4IQFA 5LVAA 3TRDA 1ZJJA 2QRJA 1ABBA 1PW5A 4IX1A 4YECA 1CR1A 1SZPA 1Q50A 1E3EA 3P45A 4LC0A 4V3CA 3I2GA 4CM8A 3WHKA 4ENTA 3GUCA 1VLJA 3L2OB 5BYJA 4CU5A 3T1TA 3NDJA 3SD7A 1J5EB 1EFRA 4EF5A 2WAMA 3KJHA 5MHTA 3ZU4A 4LHYA 3NKFA 5DASA 1TF7A 2FFJA 5EIOA 4FJ0A 4DVGA 2MMGA 5LMUB 2C9DA 1NIPA 1GAJA 2BSAA 1SGWA 1D6MA 1XQWA 4QFDA 2J3EA 1W2HA 4B3RB 5HILA 2G7ZA 4D26A 4LF4B 4DKXA 2W42A 1M73E 1J0DA 4KG7A 4NBWA 4GKKB 4R83A 3V4ZA 2OP1A 3ED5A 3GMDA 5T4HA 2OA0A 5JI2E 4IIDA 1GU1A 1WPXA 3GXOA 3PRHA 4F6RB 4Q1EA 2DU8A 2LZ0A 3QWIA 3W5HA 1BE8A 3WJ2A 4B1FA 4XUEA 3MUFA 1CUIA 1ZD4A 1QXSA 4K28A 3O1LA 2YW2A 1ZEJA 3TLGB 1N5IA 1XNQB 3KKOA 2INGX 2REBA 1TMKA 3CFYA 1FSSA 3MS7A 4CIBA 2H11A 3IYLW 2H1VA 3GZNA 3UAZA 4Z4QA 1ODSA 3BXHA 2IWHA 4P35A 3V8EA 3BIOA 3DMGA 1VGQA 2P35A 3QMMA 5DM0A 3ICWA 4WV3A 4I3HA 2JFOA 4YHBA 3IL2A 2GEVA 2O54A 2IYYA 3F73A 1VTKA 5L3SA 3NONA 3RJZA 3U7GA 3ZHBA 4ER7A 3ZDRA 4US1R 1JBQA 4FGKA 1NGSA 2B4QA 4MQFB 5H02A 4OATA 1N33B 1XA4A 1E6EA 1WMFA 2NNLD 1I4LD 4FSDA 5B5SA 1G38A 1FTWA 1OYVA 1TC1A 4OAQA 3L84A 3DEJA 3DHVA 2OYSA 4FOLA 1BHQ1 3PHBE 1QR6A 2EJCA 1AMNA 2APJA 2O0LA 2PZJA 2OM6A 4NJOA 3FI9A 2P1ZA 4LNHA 5A0VA 5H68A 1QHEA 3TFQA 1UBOS 1G2IA 4C0WA 2VUUA 4YWHA 1UBHS 3VX4A 1NE7A 1NZFA 4U6NA 3RODA 1N2ZA 1WOMA 4B40A 2Z3WA 3M6IA 4P2GA 5ALYA 1DIGA 3LNTA 1MAWA 1Z38A 3CLRD 5F76A 4DZZA 3ZHSA 1EEXB 4GOND 3W8NA 4ZI3A 1CUYA 5BXQC 1WMDA 4ERXA 4R7ZA 1EHIA 1OJ7A 1R2QA 3P9NA 1MORA 3UHOA 1OBCA 3OCXA 2IV2X 1GNRA 1ZK1A 1CE8A 1WRBA 2HSJA 2XH8A 3MIIA 3X1JA 3SZUA 4E51A 1LFDB 4UCQA 5JVDA 2WQ6A 2RONA 3QXXA 4INJA 4LV6A 3BHMA 1RJ9B 1VDZA 4IRUB 2L0XA 4RKQA 1I01A 4H0NA 3B6MA 2WA2A 1YQGA 4QUKA 1QZUA 2JHPA 3IRVA 1LSOA 1KJWA 3OJEA 3MTBA 4NECA 4H4EA 3TZCA 2PM8A 4WK4B 1QNFA 2ZXEA 4ZU1X 4A4DA 3S28A 3PIRA 4Y0NA 5AW1A 3ICQB 2P8JA 5GTDA 2OLKA 3DEYX 3OTGA 2EBFX 2BMAA 4HDOB 4GGPA 3ZHUA 3D7MA 5U4QA 1B43A 1SUCA 4JT4A 2EVWX 3A1VA 3OD1A 3PDCA 4LOHA 2XECA 1I7DA 2GNAA 3MCWA 3PUIA 3QX8A 4WXRA 4RPLA 1RMYA 2D00A 3QMVA 4JI2B 4E3ZA 1M1YB 4M1EA 4OQEA 5AKEA 5H16A 5FLXA 4ARIA 5JS1A 3Q7RA 1KZHA 2CVQA 3ZWVA 4GVXA 5C1PA 1BCSA 1XNRB 1BE1A 1ECJA 1U3CA 1ZPDA 1ACJA 2Y2VA 1SHJA 3OEYA 3UG7A 5AM2A 5IRCD 3BXPA 4ZOLF 5BURA 4W7HA 1GNSA 2AFHA 1TCUA 2P7HA 5B2EA 3QYAA 3SZOA 1YO6A 3F9CA 2DG2A 1DT3A 2JEOA 2LBPA 1YJBA 3FPBA 4Z4GA 2HFKA 1ZH8A 4WZBA 4FDLA 2P4SA 4PTLA 4XYEA 2EGHA 2ONKA 1DB3A 1SEPA 2W2KB 3GELA 4P36A 5B1SA 3VH4A 1ONBA 3IV6A 1H2EA 3RDPA 1FUEA 3KPWA 3QV1A 3MCTA 1DAHA 1MC8A 1OOEA 3SLKA 1U81A 5KVVA 1KJIA 4DABA 3Q5DA 1AGNA 3CX4A 4PZAA 4GPIB 4X84A 4X9XA 3WGLA 1F7UA 2W9XA 3HKCB 3FBTA 2OXCA 2O20A 3MG9A 5J3JA 3ICEA 1U0SY 4HGYA 3IIMA 3KZKA 4UVGA 2NAPA 5EKSA 2P9FA 5BR4A 1U0LA 3RS9A 2QRNA 1GGMA 3T4UA 1S8OA 2YQZA 1S6YA 2YUTA 3I9KA 1X80A 5FTLA 3I6YA 4RJ2A 5E1OA 3C2QA 1TT5B 4PNPA 4KDFA 5EFZA 3AUYA 3BCHA 1U7DA 1ZINA 2RJOA 4QU5A 5BVHB 3R5SA 4HKTA 2B8JA 4LXXA 4JJ4A 2X9QA 4ZQFA 2OPBA 1IK6A 2TSYB 5FYDA 2FU5C 4A91A 4IF6A 1LBSA 3KQWA 4XUGB 1W36B 4LYAA 2PANA 5HIMA 2HHAA 1RI2A 3SSAA 2IH2A 2VP0A 4M22A 2EP5A 1P91A 2FV8A 5LZ8A 5JMWA 1J9GA 4AQYB 2GJ9A 1E1CB 2R4QA 2VKQA 3F97A 1HURA 4UZEA 1KAEA 4CMGA 5CB0A 1I33A 1S0UA 1FQKA 1LLDA 1BX3A 2WHPA 3NYRA 4H60A 1XCJA 2H4WA 2ZIGA 3E9QA 3G7UA 2VTEA 4NC9A 2XAUA 1CUWA 2HQSA 1Q11A 5C34B 4DWWA 2QB5A 1NQOA 4D9JA 5K0BA