5KHOC

Rasip1 ra domain in complex with rap1b
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
167
structure length
165
Chain Sequence
MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAGTFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDLEDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras-interacting protein 1
publication title Structural Basis of Dimeric Rasip1 RA Domain Recognition of the Ras Subfamily of GTP-Binding Proteins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 47
structure length 165
sequence length 167
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5khoC00
3OF5A 3B60A 4TSFD 1UBEA 2QMHA 3LBHA 1M34E 4LJ7A 2FX3A 3UXMA 5EE3A 4Q1AA 1ZINA 5JI3E 1OJLA 2SHKA 3U6KA 1IN5A 2QAGB 4KFRA 4HLQB 4PSKA 3TSOA 1YZKA 4DLXA 3K70C 4DB2A 1UKVY 1N0WA 3R20A 2OM2A 5FOWA 3ZD6A 1Q22A 1WBDA 1IBRA 3W5JA 3K8YA 1G8FA 1NVUQ 1SKYE 1ZUIA 3CF0A 2AFIE 2QBYA 2BKUA 1T8UA 3EA0A 1MV5A 4WW0A 1BIFA 2A9KA 4OHYA 1P2TA 1GDDA 1HUQA 2IYRA 2ZI9A 4A36A 3WHLA 3C5HA 2Q9BA 4UXIA 1OXUA 3MMPA 3GLFB 2QSYA 1N6LA 2AN9A 4PC1A 2KBFA 2V4ZA 4DBLC 1S9HA 4D0LB 5HKKD 5HZKA 4CEJB 5LD2B 3EZ9A 1PJRA 1RC8A 1ZM2A 2H57A 2QE7A 4U00A 1ZNXA 1IQPA 2QY9A 2RGGA 3SE0A 1E3MA 2FFHA 5BYKA 3MSXA 3RRYA 3A37A 2IYWA 4V0KA 1QHXA 4OHXA 1M6NA 3KJHA 4B48A 4HB0A 3SFZA 2FGJA 3DHWC 1XPRA 2JAQA 3PEYA 1VYTA 2CMKA 2ZJYA 5G53C 3CX6A 5TDHA 1FMLA 1RIFA 1XEWY 3DM5A 3MG9A 2H7VA 3GJXC 4FWTA 4LV8B 4BZPA 2BOVA 1LB1B 4OJQA 2I4IA 5FTJA 1OPXA 1QBKC 5FTNA 3TJZA 4DLWA 3X1ZA 3IBYA 1XBTA 3FHTA 3DZ8A 1JPJA 1XFAA 1BOFA 2QORA 3U3KA 1L8QA 2F3TA 5E4FA 1V43A 2WZQA 2IS4A 2F43A 3H1TA 1XZPA 2IK8A 2ZYWX 1OH6A 3A1UA 3ZZ0A 1UJ2A 2FMXA 2ZJZA 1GVNB 1ZVQA 2CK3D 2GAOA 4L16A 4LC1A 4C0AC 4UNQA 3TGPA 1XTKA 2A78A 3BGWA 4EPRA 3OE7D 4OQXA 1G3UA 4IOMA 1LF5A 4KXFB 4NCKA 3CX8A 4QOSA 5H8WA 1DAIA 4FCTA 3TR0A 3UMRA 2ZRKA 3SU8A 4NYIQ 5EE0A 3AF3A 2AHOA 3RS7A 4DB4A 3HYRA 4WVFA 2EW1A 2PEZA 2ZVQX 3EZ7A 3HU3A 3ZJYA 3CB4A 2GEDA 2Q3MA 2J0UB 4UNRA 3AF4A 4RD2A 4M9SA 1GRNA 5AJVB 1TQDA 4PPNA 3THOA 1R5OA 1DE0A 1KI2A 1Z0IA 2NO0A 3UPUA 4OHVA 5C2JB 4NU0A 5DYGA 1RJ9B 1EESA 1I4TD 2R2AA 4B6FA 4X8HA 1ZCAA 2P6NA 4JMPA 5EXXA 1YZNA 3S1AA 5EP1A 4C2UA 2ZEJA 1SXJE 1HH4A 2J7KA 4FCVA 1KO4A 3L43A 4RY2A 3DO6A 3FMFA 4TLAA 1ZNYA 2OEPA 4L4UA 2RGBA 5DN6D 2JLVA 4BFUA 3K0SA 1YZGA 2HLDA 4XH9B 3B13B 5G3ZA 5B64A 3HU1A 3DKVA 4DSUA 1XCPA 3I5YA 1SVMA 4E22A 1D6JA 1WP9A 3NG1A 2CCGA 3I61A 2WJGA 1BMFD 1YZUA 3TE6A 3AVTA 4EUNA 1KGDA 4BRUA 3CRQA 4CF7A 3H84A 2PX0A 2Q21A 4Q66C 5C4GB 4LHVA 3CPEA 2ONKA 2EFGA 3U3OA 3ZQJA 1NVWQ 4MYTA 1CS4C 4BFXA 4R2HA 1ZMXA 1CJVC 2H17A 3U6BA 2XX3A 3TSZA 3ZLJA 4M21A 3AP3A 2P6RA 5CK4A 1T8TA 2ATVA 1P2SA 2ZI3A 4YDSA 4DVGA 4QM7A 2J59A 2ODEA 3A4MA 1E1QA 1P9NA 5KUTA 1CIPA 5KPJA 4XWAA 3U7GA 3QKRB 2IBMA 3U7FB 2OCPA 2W2VA 2BHRA 1ZU4A 2QROA 4HZUA 2I1QA 2WKRA 3THWB 4ZKDA 3IQXA 4AYXA 4IJMA 3LH5A 1N6RA 4PHTA 3VFDA 1Q3TA 1IN6A 4H9GA 2Q9AA 4OYHA 4Q4JB 4LJ4A 1TQ6A 4ZO4A 5IK2A 2K5UA 1O3YA 2QTHA 3QVUA 4XSGA 2VSXA 4HZIA 3T1QA 2BBSA 2BMEA 2ZSEA 4HUQA 1H8HD 1XMSA 1BH2A 3NBZC 2N42A 3PCRB 1UBFA 2ANCA 1QG4A 1EFTA 1TMKA 1MOZA 3KFVA 3F3YA 4BFTA 5FPYA 3UK6A 4LZZA 2IYUA 1DG3A 4O3MA 2CCKA 3NHAA 2FZ4A 1L4YA 1LFDB 3T5GA 2OAP1 4JL6A 3Q85A 3SYNA 5C4MA 1II8B 2J9RA 2OESA 2WPDA 2DWOA 2QRZA 1XD8A 2OHFA 1MABB 2KI5A 2QNRA 3GJ5A 2QT1A 3CR8A 4MRPA 5AR1A 4B2PA 5J4VA 1E1RA 4OK5A 4RCZA 2GK7A 4TYPA 1G8HA 1VG9B 4TQUS 3R7WA 4QC2A 2O8FA 2ZSDA 1SXJB 1C1YA 4NTZA 3CRMA 2EFHB 4PQFA 2VHUA 4DLSA 3ZIAA 1G3MA 5KPDA 3U61B 4BFWA 1FFHA 1LTQA 1Q21A 2NQ2C 2QE7D 3NEJA 2E1RA 2A5DA 3AKYA 3UG7A 2DYKA 1RYFA 3RS4A 1CJUC 5FPSA 2GCOB 3AGPA 4XJXA 1Z6XA 4NYJQ 3B9PA 4CT5A 5BN5A 2NZJA 2PLRA 3GEHA 1N6HA 5FI1B 4B34A 3SQWA 3C16C 4QL3A 1YR6A 4RJLA 2CL7X 2EFEB 2ZRAA 2C98A 2QP4A 3VAAA 1NF3A 4LJ5A 1XWIA 2GK6A 4CGZA 4XWKA 3U5ZB 3ADBA 3SJCA 2R6AA 2GCPA 5DLQC 3K9HA 2C9CA 2LKDA 4HAWA 3W6PA 2YJTD 2DB3A 4NCIA 1OXXK 4NYMQ 4RD3A 4PC7A 2AR7A 4HLUC 3KQNA 2AX4A 4N1AA 1VKJA 2R62A 2YHSA 2B92A 3BB4A 3OIWA 3H2YA 4DIEA 4B74A 1KO8A 1CR1A 4MDEA 2X1VA 2V8OA 1F2TB 2C8VA 2LWIA 1GSIA 2BEJA 3OFNA 5B30A 3R9IA 1E9AA 3PEVA 3K0AA 1I2MA 4CEHB 1W0KA 4I1OA 4P32A 2G83A 5FR1A 5K8UA 4HLUA 3VTKA 2G0TA 2PLFA 2XZPA 1PV4A 4L9WA 3KB1A 3M1IA 3VKWA 1MKYA 4XIGS 3SC3A 1KSJA 1S96A 1JAHA 1W0JD 1G6OA 3B8HA 1F5NA 3VU9A 2ZI4A 3ND9A 4P3YA 3UG6A 3QEJA 4YC7A 4B73A 4TYNA 2FPLA 4CEIB 3REGA 4WZ6A 3IEVA 1IAQA 5C46F 2REBA 1S4QA 1TAGA 2IWRA 1IM2A 1WA5A 1YRAA 2KBEA 4B3DA 3B82A 4KYIB 5EUQB 2PCJA 2IHYA 4G1UC 1YHNA 1DEKA 2QU8A 3MGCA 4JYCA 1JR6A 1TU4A 4NYIR 3SHWA 1GKYA 4WBSA 1KSHA 2BBOA 1M2OB 1Z3IX 3JVUA 5IF9A 1UEJA 1U2RA 3ZS9A 1EFHA 1E9SA 1SVOA 4IOKA 1X3SA 3QXHA 4BFZA 1IXSB 2W6JD 4PZLA 2QP9X 2HLDD 4ACAA 2JJ1A 1OLOA 3QENA 5AJZA 4D0GA 1FNNA 4I81A 5GADl 2J45A 5JWHA 5EZ6B 4HI0E 4IDNA 1FPMA 1DAFA 2ODBA 1E2FA 3QQ5A 4QRHA 5FBQB 4TYWA 1Z5ZA 3AB3A 2IS6A 5JRZA 4JZKA 4URUR 1P7CA 1NLFA 4GMXA 3P4XA 4AG6A 5HZHA 4XVRA 3ZH9B 2C5LA 1EFCA 2O0HA 5KSPA 3TUJC 4F93B 5FFMA 4BE7B 4GFDA 1KK3A 2WBLC 5DI3A 2C2HA 1W36C 1EX7A 1TEVA 3ICQB 4FIDA 4LBZA 1US8B 2G6BA 5LB4A 2C9OA 2OSBA 1E1QD 1CRQA 3AEZA 4LHXA 1WDTA 1LF0A 4AYWA 1FMJA 2HT6A 2ZR7A 1P2VA 2XXAA 2QG6A 3LLUA 1Z2AA 2NPIA 3CZQA 3KUCA 3GEEA 5DH9A 4QBGB 1D2MA 621PA 5IK2D 3BFKA 2A5JA 1XXHA 1ZD1A 2ZRNA 2BVNA 4DWJA 3UATA 3VQTA 1JI0A 3BRWD 2IXEA 2N46A 2XJ4A 1G3RA 1IN4A 2NGRA 3QKSA 4ARZB 4LGMA 2YC4C 3A1TA 3UMSA 3D7MA 3Q72A 2EFDB 1KK2A 1IXRC 1NJGA 4E09A 4DCTA 4HDOB 1RFLA 5M04A 1FUUA 1X6VA 2PJRA 1GL7A 5AUQA 2F7SA 3AP1A 3BIFA 3MAAC 2UKDA 2WPDD 1VCMA 4ZIRB 2P5TB 1Q20A 3B1YA 4LC0A 3IO5A 3PUXA 3V00A 1E2MA 1VIAA 2DR3A 2WMNB 1U90A 3VHXA 2IXGA 4QG7A 2FDCA 2XZOA 4JLBA 3C4JA 1G64A 2QMUA 2GJSA 5KNBA 1E1RD 5CM9C 5HCNA 3VHLB 2JLXA 1GWNA 3CRW1 1BYIA 2FA9A 1M8PA 4M22A 3FDIA 4KVGA 1DG1G 3EARA 221PA 5FBWB 1QRAA 1UKYA 3ZIAD 2F55A 1PLLA 3Q3JB 3SS8A 3ZQ6A 1FX0B 3RSOA 3EG5A 2ZE8A 1QG2A 3DOFA 2F1JA 2ZM5A 1S0UA 1Z29A 4AURA 3AUXA 4G5OA 3DOEA 1E0SA 2CL6X 2XNDA 5F3WB 4I99A 4V0MA 1CU1A 1XEWX 1Z07A 1XJQA 4RZ2A 2ASEA 2FOLA 1CULC 1PUIA 2QPAA 1E9BA 4LJAA 4OK6A 4KLNA 5FUVA 4QHTA 3HWSA 3MWYW 5J4HA 4UNNA 1UADA 3AH8A 4Q4HA 2VSFA 4DKXA 4D25A 1E2LA 3KQUA 4FWIB 1YR9A 1U99A 4DXAA 1JJVA 3W3AA 2J5XA 5JS7A 3THXB 4JVLA 3KKMA 3SJBA 2CDNA 3LLMA 1WXQA 3MWJA 4JVNA 4NYJR 4BECA 1P62B 3RC8A 2ZETA 4LUCA 4A2PA 4RKEA 2QM7A 1T4GA 3NH9A 1DTSA 1HYQA 4TTRA 1XEXB 4IEEA 2FH5B 4S35A 2OCBA 1ESMA 3B85A 4B47A 4WAUA 3WXMA 2MSDB 3QVVA 3R8CA 3AVWA 2QZ4A 2Q0HA 3KJGA 3EC1A 1KMQA 1EXMA 1W0KD 3REFA 3L82B 521PA 4A4DA 2ZSFA 3GQBA 4F4CA 1MO5A 5FBVB 4B75A 5CJ2A 2PMDA 2QL6A 1CEEA 3LW7A 4ZI3A 4OHWA 3T1OA 5BYJA 3CNOA 1G6HA 2BMFA 2OUKA 1KDTA 4M1TA 3SHFA 4B33A 1FW6A 1XPOA 3FMPB 2D2EA 4OI0A 2GVZC 1ETUA 5J47A 1MRNA 2EVWX 4F7WA 1TEXA 2F3RA 1HTWA 4G5QA 4C0JA 2XB4A 2O5VA 3RNLA 3QPVA 4LWZA 1JEDA 3ZDQA 2CXXA 5KSYA 1DOAA 1Q57A 4URYR 5JS8A 4HDCA 4JYBA 2PH1A 2ZRFA 3D31A 4GDFA 2GZAA 1DAMA 2YOHA 3QF4A 1TF7A 4BLOA 3KJEA 2QBYB 1IHUA 2F9MA 3I8XA 1G291 2QAJA 1T6NA 1Y63A 3EW9A 2WV9A 1LNZA 1B23P 4BWYA 2EWWA 3T06B 1U8ZA 4DCSA 1U8AA 2ZS8A 4PZYA 1Z0DA 2GHIA 4MKIA 5ELXA 1Q44A 2FU5C 4PQRA 2WKQA 2WHXA 4TMKA 2CCJA 1YU9A 1TADA 1CTQA 3WNDA 1NY5A 2D2FA 3WRYC 5GVSA 2O8CA 2WOOA 1ODFA 4M9XA 3G82C 4MITA 5GVRA 3QUSA 5SZJA 2ZR9A 4PPFA 1WCV1 3MJRA 4ILEA 4IXMA 5H1YA 3NBYC 4F38A 4I1UA 4K8OA 3ASYA 1X8KA 3IHLA 1COWD 5DGXA 1G4UR 4GOKA 2MSCB 5HE9A 4DEYA 821PA 2QMOA 2GEUA 4X8MA 4FINA 3HP1A 2VF8A 2P5SA 3Q5EA 2FJUA 4NPHA 1AS0A 1G3IA 4JLPA 5L3RA 3GLIA 4U7DA 1ZP6A 2CVHA 3OAAD 4JLMA 3KQLA 1GL6A 3IUYA 1W7AA 2GJ9A 2QQEA 3BFXA 3FE2A 5HCIA 4DRZA 1N2CE 3PUYA 2JA1A 1E96A 2OXRA 2NOAA 5FL7D 4CRWB 4UJ5A 1KIMA 2OLJA 1N5KA 2B6HA 3RSLA 4C0KA 5EZ5A 1HE8B 3PR1A 2YWFA 2GJAA 2XEXA 4L8GA 4OQLA 4AKEA 1K5GA 1T5IA 2VF7A 1DAHA 1EFRA 2FSFA 2OFOA 2ZUBA 4XSHA 3WY9A 1AGRA 3TVDA 3K1JA 4LBVA 5FL3A 2O8EA 5GJBA 3GJ6A 2BV3A 2ZRDA 4TLBA 3RS5A 1KDPA 3BE4A 3J81k 3PEWA 4C7OA 4DLVA 1NJFA 3EIHA 3LVRE 3SQXA 2GXAA 1OH8A 3NH6A 3FOZA 2IYZA 3D3QA 4QNMA 4UXHA 1XDBA 3FMIA 1KNQA 5F9HA 4F91B 2J0VA 3HJNA 2VHJA 3L2OB 4URZR 2WWXA 1CJMA 2V6IA 2AD5A 4E07A 1ZM9A 2HCBA 2JEOA 2IL1A 1QHYA 5FR2A 2ZRPA 2HCJB 2IT1A 1E2DA 2OFXA 5H68A 4MGKR 3HPQA 1KJWA 1E4VA 3S1AB 1GILA 3ZZUA 4D0NA 3NDBB 1KSFX 1FZQA 4RZ3A 4EPTA 2ZRCA 5F98A 2PL3A 3CIOA 4D6PA 1E9RA 3EASA 2D62A 2IYQA 3AM1A 4FMCB 4F4IA 4Z1MA 1BYUA 3TQCA 4IKEA 1GKIA 4ZDWA 3U4QA 4HAZA 1S8FA 1D9XA 4BEBA 1GNRA 4A2QA 1E0KA 2DBYA 2IX3A 3UIEA 3EPLA 4Q9HA 2BBWA 4TMVA 4Z54A 1T5LA 4A6XA 2I3BA 5FTKA 4IDPA 2TMKA 5EP3A 1KMHA 4IFBA 4HYYA 1XP8A 1F2UA 3CH5A 2ZJ8A 1KY2A 3G0HA 1Z6GA 4BASA 4PPGA 4XWOA 4EFLA 4W9MC 2MSEB 1MO3A 3THYA 4DJTA 1AGPA 1E69A 4YONB 3A36A 1FP6A 1GP2A 1I4DD 1VCNA 4ZDKA 5D3MA 4MUAA 5CJPA 3RVBA 1HQYE 3TR5A 4Q18A 1AS2A 1IN8A 1P3JA 1TUEA 2AFHE 4US0R 3ETLA 3RDPA 4HZUB 5DHAA 5LBIA 4A8JB 3W8NA 2CHQA 4OL0A 2BBTA 2E87A 1CKEA 4BLRA 3EIEA 4DUGA 3AF1A 2PZFA 2V6JA 3M0EA 1ZIOA 1P2UA 1KKMA 4NH0A 4MGYR 3CR7A 4NZYA 1NBMA 2XSZA 4HUQB 3OZXA 5EE9A 1Z6YA 5IHPA 1CJTC 2FGKA 3A4NA 1AIPA 4QM6A 1XB2A 1IY1A 2CHGA 1ZJ6A 4L5BA 4BLPA 1PVOA 4PO1A 4RZXA 2WKPA 1E2HA 2HDNB 3W34A 2G3YA 4MRVA 1F6BA 2IHBA 4DIDA 2WWIA 2W6IA 1EWQA 1ANKA 2IC5A 1FNMA 3QKUA 5AJWA 5JSZA 5KU1A 2FNAA 3BBPA 3CF2A 3LV8A 5JZVA 5JI2E 3BH0A 5DSZA 2AD1A 4NMMA 4RFVA 4D4JA 3VX4A 3PUWA 3I62A 4IVPA 4EJSC 4EQ6A 4OK3A 1MR3F 1UM8A 2AXPA 1TQ4A 4UJ3A 1N6PA 1JQJC 3R7WB 3RAPR 2BMJA 2WJIA 2FPKA 2OG2A 2YC2C 4GP6A 4GOXA 5JHHB 4QGAA 4C0SA 2YNMA 2WSMA 4PPQA 4JS0A 2HEIA 4X8LA 2RGNC 4D4KA 1T3SA 2ONJA 3ZVMA 2DHRA 3CM0A 1OYYA 4P33A 3LXXA 1SKYB 4JSTA 3EWAA 2RCNA 3MRSA 4X8OA 1KZGB 4EJSA 4BGDA 1NMZA 2YWEA 2ZI7A 1JEEA 2JDIA 1WMSA 4NKRA 5GJCA 2D7DA 1N6NA 2CHVA 1U94A 2ZJOA 1N5LA 2X2FA 3LRPA 3QI2A 3CF6R 1NG9A 1JBKA 4JJKA 1M7GA 2ZVPX 2RGNA 4AK9A 1YVDA 4PTLA 4CW7A 3PV0A 4GOJA 2JLUA 3E1SA 4M1YA 4Q7JB 4LYJA 3GMTA 2RGCA 1G1MA 1M7BA 3NWJA 2PZEA 1OXVA 5FUYA 2WIBA 3D8BA 2D3WA 1KTVA 2NPFA 4TT3A 2W83A 4KBGA 2J46A 4GRAA 4JBYA 3L8ZA 3LA6A 4XVQA 4IFEA 3I72A 1G18A 3BORA 2ATXA 1XXHE 2ORVA 4HAUA 4LBWA 3WMEA 4DC9A 1Z47A 4BEJA 4OQFA 5JEDA 2AL7A 2CEAA 1U0JA 4YDHB 4L9SA 1IOZA 1W2GA 4KBFA 1TTTA 1EFRD 4HUTA 4JT2A 4XVUA 3GLFA 3X1YA 1LV7A 1E99A 1O87A 3K0AB 1D8TA 2VP6A 4OI4A 1ZAKA 1ZYUA 5CIWA 4TTPA 5B2ZA 3V4FA 4MYCA 3KXKA 4LJ6A 2L0XA 3RRNA 1VDZA 2ZYVX 5TY0A 1XTSA 4G3XA 1YE8A 1SHZA 3BB3A 3CX7A 3VU9B 3TQFA 5GJVC 3LY5A 4M1MA 1KZ7B 3AVVA 3FFBA 3MJHA 2RMKA 1Q1ZA 3AQ4A 3LQRA 3X1DA 4POAA 4AC9A 1TU3A 1XD2B 4HDQB 4HSEA 3I4LA 4NDZA 4UNPA 4BQSA 1E2NA 3AVPA 4EKDA 4KI0A 4ABYA 2QPOA 1L4UA 2JLWA 3E2IA 3FKQA 3MLEA 1RRCA 4MGIR 1EFUA 3VR5A 1XPUA 1RZ3A 5FOSA 5J5CA 1SVSA 2OILA 3R8FA 4Z1MD 1KO5A 1DARA 4MDFA 2OCAA 4RD1A 4PC2A 4A0GA 4LK2A 2XITA 3BC1A 5L3QA 4LCBA 3F8TA 1JXOA 5EXTA 3TRFA 1G20E 3CKLA 4TL8A 5LDDC 4V0ME 5G40A 3PJRA 2WOJA 1CRPA 4HAXA 2ZRHA 3CO5A 1OXSC 4H1UA 4JKIA 1P61B 3K70D 2R6GA 2WWYA 1TL7C 3ZVNA 3WNBA 4F92B 1ZIPA 4MUBA 1R5BA 5TARA 1G7TA 3E70C 1E79A 5A0FA 3DVLA 4PSAA 2D06A 1Z0FA 5JECA 1N0UA 2ZSAA 1G21E 4QGHA 3LX5A 4G01B 2J0UA 1L7VC 1OXTA 3GCGA 5DI3B 3H86A 4Z8XA 1IJEA 1Y3AA 3LDAA 1U98A 4YLGA 5KSOA 2XOKA 1JR3A 1S1CA 2Q6TA 1W48A 2P0EA 5CB8A 1OFUX 2NO9A 4N0EA 2D4HA 3MWLA 3LAWA 5BWMA 2IS1A 2FZLA 4M8NE 1R0ZA 3B7GA 3NVAA 1OFHA 3T34A 2EQBA 4DUGD 4DT1A 4QBHA 1Z83A 1T9HA 3BERA 1XXHB 4IOLA 2GVDC 1Z2CA 3ADKA 5CYOA 2O8FB 1VYVA 4Z8YA 1E32A 1J8YF 2J7PA 1P9RA 2XSZD 2YWHA 2JJ2A 1T91A 1KO7A 3W8RA 3WMGA 3QNUA 1G16A 5JFGA 4ZDJA 4LX0A 2QENA 1KI6A 2PJZA 1UAAA 4C0HA 2XGJA 2W6ID 3FB4A 1KOFA 2R9VA 4NCJA 1GITA 1AA9A 5AJYA 4ZCIA 2F1RA 4ZDIA 3FFAA 3SOPA 4TQ9A 1ONBA 2BEKA 2YVUA 3RS0A 1ZM3A 5DHFA 2BCGY 2C99A 3FTQA 2VPPA 4MRSA 4PHGA 3KTAB 2XNSA 1UPTA 1QHNA 2ZIAA 3FWYA 4B76A 3QG5A 3PQCA 5CYPA 2XB2A 1E9DA 2BM0A 2RGDA 1XTJA 1JALA 1NRJB 2DY1A 2J3EA 4DEXA 3ADCA 1YQTA 1W46A 2HF9A 1OKKA 3RS2A 3OIUA 1R10A 2QGZA 3AVQA 2CL0X 5L3VA 2CJWA 3O8DA 3VR2A 5LPNA 3SFVA 2JDID 4A92A 1ZW6A 3OEHA 2FEMA 3I5XA 4WXRA 4V0OA 5JCPA 3M6AA 3KKOA 4FMCF 2KJQA 1KDRA 2IYXA 5IRCD 1A2KC 4DSNA 1W5TA 3DKPA 3T35A 4G5GA 1OH5A 1D5CA 1SVIA 3NBFA 2IUSA 2DFTA 4MYUA 2BJVA 3VR3A 4ERNA 2ECKA 4Q4HB 5AUNB 1XMIA 1QVRA 2AXNA 4LYFA 4DLYA 2YV5A 4PHFA 3WP0A 3WHKA 4RZUA 6Q21A 5KSZA 4QJ3A 3TAHA 4D4MA 3U44A 4ZI2A 2WIAA 5J4YA 4TT3D 1II8A 4EAQA 2ORIA 3JZMA 3GLIE 4C2TA 4EPVA 1TF2A 2W2XA 3DDCA 2YZ2A 3U7HB 1JNYA 3U3MA 2OBMA 1E2IA 1OFTA 1A4RA 4UKDA 2PEYA 4DLRA 1NY6A 1F3OA 5DIFA 1GTVA 3QE0A 1T0JB 3UWOA 3EIQA 2WICA 2KB0A 2C78A 4TTQA 1A1VA 2XTNA 3N5CA 1D9ZA 2BKEA 4EDHA 1J8MF 1QHHA 4R2IA 2PT7A 5E3HA 1CR2A 3ZYCA 3TLXA 2WWWA 3FHCB 5KHOC 2QTFA 4MGZR 5FBLB 1NP6A 4IRUB 3O8RA 3DZDA 4XTCS 1KI4A 1GG2A 5A5GA 1DS6A 2GCOA 1XNJA 1OIXA 1Z28A 4RD0A 1VPLA 1ZD9A 121PA 2PX3A 4KSBA 1RPZA 5JWRA 1AN0A 1FTSA 3BWDD 4FXPA 2VP0A 2FFBA 2QP3A 4NHOA 2C77A 1H8EA 2WJJA 2JLQA 3VR6A 1RVDA 3AVXA 3AGQA 4DLTA 5FPKA 4UQOA 2FEOA 4AY2A 4JLDA 2GJ8A 4DDTA 1OFIA 3P26A 3SEAA 4KU4A 4TN1A 2JLSA 2IYYA 3FKSA 3QSYA 4Q7KA 4KSCA 3EPKA 3SI7A 4PZZA 5CDFA 3PUZA 5BN3A 3PEUA 1AQUA 4KAXA 2XJ9A 4PAMA 3QF4B 3UMFA 1CJKC 1AJEA 4Q1FA 2BMDA 3CONA 4Y0AA 4DDWA 2ZQ5A 3FPAA 4KV9A 5ANRB 1HT2E 3AUYA 4HAYA 1T0HB 3RRZA 3SJAA 2V7QA 1F2TA 4LBYA 4O2LA 2VA8A 4Q19A 1NKSA 2NIPA 3V4RA 4G5RA 3QY0A 4LI0A 4FMDB 2Z5FA 4PXAA 3T1VA 5LB2A 2Z6VA 1J7KA 1J99A 1A82A 4A82A 4IDOA 1U0LA 2GRJA 1E2KA 4LPKA 2O8CB 5L3SA 2P65A 4A0RA 5HR5A 1ZBDA 4TLEA 1NN0A 4M1KA 3I8SA 4TQAA 3W5IA 2PZGA 2IUTA 4US1R 1GIAA 3WBJA 4DSOA 2WAXA 1DAEA 2FWRA 3B5JA 4M4SA 1J90A 4JLOA 4XTRA 3AV0B 1JR3D 1HA3A 1SVLA 1VIYA 2RHDA 2OE2A 2C04A 3B1WA 1W49A 3RWOA 4V02A 1KO1A 3TIFA 3TKLA 3GLIB 5B57C 5EE1A 3GLHA 2B7CA 4TYQA 1E6CA 2B21A 1XU4A 1R5NA 1NMYA 4MKGA 4MRNA 1OHHA 5EUMA 4HB2A 2JIZA 2D7CA 1UKZA 5SZKB 1N3BA 3BD9A 4PX9A 1XTRA 2QQ0A 5EQTA 1DAKA 2V55B 2OAQ1 3QIAA 4TL6A 4B3FX 2NO7A 3K0EA 3OFND 1NBME 2ZROA 2KE5A 4M9ZA 5KNCA 4KYUA 2O8EB 5K8IA 5SZIA 3PFIA 4JVMA 4B2IA 5HKKA 4KVAA 3W9YA 4C7OB 4KFTA 1TPZA 4NYMR 4TMWA 4WOPA 4A15A 2O8DA 4D4LA 2RGEA 3KKQA 1U8YA 4DSTA 2H18A 2ZREA 1W5SA 1LVGA 3GFOA 4NCHA 4HATA 2ZRLA 4WZAE 1C4OA 3EA5A 1FP7A 1P6XA 1ZD8A 2G77B 2QT0A 3WRXC 1US8A 5FUXA 4TL9A 4O2RA 4GT1A 1Z0JA 2RAPA 4P4SA 4AWXA 2NTYC 4O0MA 3Q7PA 4EIWA 3MWKA 4NONA 1DO0A 2AK3A 2GILA 4JKYA 1XJCA 3K9LA 3WMFA 1P75A 1CBUA 1KNXA 1MO6A 4BFSA 2DPXA 3EZ6A 1R2QA 4C0BA 5JJIA 3RABA 3OEHD 3IILA 4ON9A 2RHMA 2R44A 3U4QB 2BJWA 2EU8A 3QEOA 4CYMA 3N2EA 2G0NA 2D74A 2JJ1D 4IVQA 3NTUA 2A7QA 2FSIA 4Q01A 1M7HA 2UZIR 2ZJBA 4KODA 4RSGA 1G19A 1RRGA 2H92A 3RS3A 3IPYA 3RHFA 4EFMA 5JHGB 5JBQA 1Z08A 3K70B 2IF2A 3VKHA 2FG5A 2VP4A 3ONWA 5CM8B 2J0SA 2XZLA 2W0MA 3T15A 4ESHA 2A5GA 1KMHB 4JL5A 5DI9A 3CZPA 4HEJA 1JPNA 1W4RA 1F2UB 2G88A 2JATA 3QPWA 2ZTSA 2VEDA 2VIIA 421PA 5F2EA 5FPTA 4KFSA 5EXPA 4BRWA 3THYB 3IIJA 1E2EA 2YOFA 4IEIA 1OYWA 4IDQA 4BZXA 2QGNA 3U60B 5FI0B 2P6UA 5JCZA 1OW3B 3VKGA 5D3MB 3DMNA 4NBSA 4QGGA 1NVVQ 2A2ZA 3N70A 2P2LA 4C9BA 1QVAA 5BW8A 3NDPA 3K53A 2J41A 3GLFE 2PCLA 4RFSA 2ZRGA 2R6DA 2X77A 3L0IB 4M1WA 3L0SA 1W36D 4YMVA 1H65A 4QHSA 2EWVA 2PBRA 3CLVA 4E5UA 3K9GA 3GJ3A 2WJVA 4FI3C 2F43B 3HR8A 2ZR0A 3QXJA 3K0FA 4LJ8A 4ZKEA 4C3ZA 3A1WA 3NKVA 4RD6A 1XEFA 1F60A 1G17A 3KQKA 1Q1EA 1X8JA 2ZJ5A 1HT1E 1DPFA 2XTMA 1KK0A 2VTKA 3FKSD 2WJYA 2VP5A 5KOYA 4YMWA 3HYTA 1X1SA 4XOIA 3SN6A 4Q7LA 5J4KA 4N3NA 4M0LA 4Q7MB 2GTPA 3NC0C 3UWKA 1X86B 4R98A 4ZCMA 3Q9LA 4PAOA 3QKTA 4ASUA 2QA5A 5FBRB 4Q1BA 1EK0A 4OHZA 2V7QD 4EQ6B 4A0FA 1E94E 4DLZA 1R0XA 2WWHA 4GI7A 3U3RA 1ZNWA 4A1FA 3KJIA 3A1SA 1M74A 3QJYA 1KI3A 1SULA 2QUZA 2H16A 3QXXA 4MKHA 4MQBA 2YKGA 4QXAA 2EFCB 3HR7A 3SBEA 3KUDA 2G1KA 3P27A 4M1SA 1OE0A 2WSSA 3RYTC 4EJSB 2VHCA 2XNDD 1S3SA 1N6OA 5AUOB 1UBCA 1ZM4A 3SJZA 2IYSA 1TQ2A 4B3BA 1VHLA 4G0NA 4IHQA 4JIMA 3CH4B 4M2LA 1VG0B 4WA7A 1H8HA 4TWZA 4BLQA 4B35A 3GLGA 1VG8A 3LQQA 1KI8A 1OIVA 1Q3HA 4Q4AA 5BXQC 3L0PA 2RB4A 2Q3HA 5JJLA 3AKCA 4EFNA 3DEFA 2W58A 2RGXA 4PHHA 1W2HA 1N6IA 1JR3E 2XAUA 1OB5A 5D3QA 4Q21A 2FSGA 4W5JA 5EJEA 3LBNA 3T61A 5DNYB 3SDZA 4B3XA 2DFKB 1DAGA 3I92A 3KXIA 2O8BA 1OHHD 3FVQA 2JIZD 2GAAA 1PUJA 4W5HA 5BN4A 1DBSA 4LYAA 3P1JA 5L8VA 2FN4A 3ZGXA 4KHZA 1KI7A 3ICEA 3RC3A 1VHTA 3LO5A 1NNEA 2WJHA 4P0TA 3TUZC 4TLCA 4AKHA 4BUJA 1VECA 2QSZA 3MUFA 1E9FA 3CPJB 4LRWA 3KX2A 1KAGA 4NL4H 1S2MA 2KWIA 3W6NA 5DO9A 3OESA 3U3JA 4FW9A 2W2TA 3IHWA 3NXSA 1D2EA 1XTQA 1UBGA 1AKEA 1SHKA 3DPUA 4IVRA 3GPLA 1ZNZA 5FTMA 2ZITA 3A4LA 2GXUA 4M9QA 4V03A 2NO1A 3FHOA 5G41A 1TF5A 1QHIA 2AKYA 1DADA 2OV2A 3Q8XB 3QG1A 4IOJA 2IS2A 1Q1QA 2EYUA 2HV8A 3GD7A 4PR0A 1E2PA 2FSHA 1XMJA 4DCUA 2NMVA 2R8RA 1WQ1R 3ADDA 1P60A 1R8QA 4GPTA 5DYIA 2DWPA 4B3GA 1XCGB 1G8PA 4R9UC 4B71A 5L3QB 1CR4A 4P4UA 2GF0A 1HURA 4UXJA 3SBDA 3EWSA 4C0LA 4B44A 1JJ7A 4JLNA 3C5CA 2Y8EA 3JZAA 4G5SA 5IDVA 3N2IA 2UVQA 2NO6A 3GEIA 2ZANA 4Q9JA 2ZRMA 4M53A 1A5TA 4TZ0A 3AF0A 3QXSA 3IKJA 1X1RA 4IDHA 1J2JA 2IYVA 3EX7C 4FMDF 1HV8A 2NG1A 1YR7A 3B6EA 1W0JA 1WF3A 5DE3A 2QAGC 3AKDA 4HAVA 4I1VA 1K8RA 4BFYA 4KO8A 3BFVA 4PC6A 1G7CA 2A5FA 3BK7A 721PA 3PUVA 5FPHA 1Q12A 3B9QA 3MCAA 4Q1CA 1G5RA 1N25A 1U0HC 2A3RA 3X1WA 3GJ8A 5B58C 1CXZA 2OXCA 4K46A 4PANA 4B6EA 3WNCA 2F1IA 2YWGA 3AKEA 3TW4A 1YZLA 1F48A 4JBXA 2QAGA 1Z0AA 1I2DA 3GFTA 4FN5A 4DT1B 1T3HA 2F6RA 2RGAA 3AVYA 4GBMA 1KJYA 4MH0R 4BLTA 2ODWA 1KHTA 2ZUDA 1GRRA 2O52A 3ZS8A 5LD2C 5FOVA 2W6JA 2VLIA 4UNSA 4GMDA 1YKSA 4HB3A 2C9YA 3P32A 3TNFA 4CZ2A 4AG5A 1MRSA 4DDVA 1ZCBA 1G41A 4PAQA 1KK1A 1NVVR 1EWRA 4JLVA 4Q1EA 2CE2X 4MYHA 4HB4A 2OT3B 1KI6B 4WXPA 1V5WA 2BIFA 3O8BA 1RRPA 3KL4A 3KKNA 5P21A 4A2WA 4CEJA 1KDOA 1AZSC 4LSGA 4CIDA 2GF9A 3T1TA 2RKOA 5BQ5A 3EAQA 4OQMA 4A8JC 2BCJQ 1JB1A 1YRBA 4WZBE 4TZ6A 3ND8A 1A2BA 2A5YB 4JLAA 4ASUD 3C8UA 5CDFE 2REOA 2CNWA 2DFLA 2IF0A 1L2TA 5GJWC 4U5XA 1KAOA 4PO8A 4QHYA 1G4AE 2GA8A 4FMBB 3EC2A 3LX8A 1IY0A 1SQ5A 3B1ZA 3FYHA 1CR0A 5CLQA 4Q03A 4A8JA 4Q02A 1KI9A 4LV5B 1UDWA 1SGWA 3LW8A 2C03A 2R65A 2WSSD 3HPRA 2CJWB 3AVOA 3IGFA 3Q7QA 4Q9LA 4ZV4A 3KFXA 3R9WA 3CW2A 1GUAA 4Q00A 3PXGA 4Q1DA 3KDSE 1EGAA 4OI2A 3A58B 2CLDX 4C4PA 3A1VA 2JJ8A 2GETA 1KSGA 2A30A 4US2R 3DM9B 1WB9A 2X8AA 1FOEB 2OO7A 3B1XA 4A6PA 3CWQA 3O47A 4GNKA 4MKFA 3EPJA 3PENA 5C1BA 3U44B 2ORWA 4EPYA 4NP6A 1HY3A 1JXMA 4Y0VA 2ZJ2A 1KI1A 3PITA 1NSTA 3GLHE 1PLKA 4JLKA 2JCSA 3I32A 1YZQA 3C41J 4FD2A 1K5DA 1E9CA 4LV6A 3PVSA 1E0JA 2ZRJA 1UDXA 1JAIA 1I4LD 1QDEA 2BC9A 3LD9A 3CWZA 2V1UA 4LYHA 3QPUA 1RJ9A 3ASZA 3I73A 2YYZA 2HF8A 3SR0A 4AYTA 4FCWA 2ZXUA 2IEYA 4YMSA 2VHQA 2FPMA 4BLSA 1QHHB 5CK5A 1NI3A 4YQFA 3IO3A 4LY6A 1YJ5A 2JGNA 2AK2A 1KYIA 3MFYA 5SZHB 3OEEA 1J70A 3O8CA 1YR8A 1HE1C 4EPWA 1E2GA 3VX3A 5E7JA 1W36B 1Q1BA 3OIVA 3IIKA 5DISB 5E95A 1GFIA 4Q47A 1SVKA 1HQCA 3P20A 1YZTA 4MRRA 5KDDA 1G8YA 4YMUA 3QKSB 3TBKA 1NBMD 1NMXA 3KQHA 2RH5A 3AP2A 2FE4A 1UEIA 2V9PA 2ZPTX 4NE2A 4AKGA 1FTNA 1Z63A 1IJFA 1TX4B 3WYFA 4URXR 4I4LA 3CNNA 2FF7A 4RKFA 1IONA 5FOXA 2QPTA 4I1SA 2JLYA 1IXZA 2VH5R 3F5FA 4P4TA 3IQWA 4R7ZA 1R8SA 1P4SA 3KXLA 3MD0A 2HT1A 4QJ5A 4C30A 3U7EB 3LNCA 5K8LA 4BPBA 4JL8A 2ZU6A 3W90A 1FQKA 5AJXA 2IW3A 3WBKA 3IDQA 2OLKA 2X2EA 4KCGA 2OZEA 1R7RA 2ANBA 1OT3A 1XD9A 1II9A 5G3YA 4PQYA 5C18A 4JLJA 1XMVA 2B8WA 3ZD7A 1MH1A 4PO9A 2IYTA 4DCVA 4AI6A 4URWR 5TV2A 1Z8FA 3M4YA 2FV8A 1G3QA 3QKRA 1RE0A 4ZCLA 2ZRBA 2ZI6A 3L0OA 3THWA 3A6PC 2C95A 3DL0A 1RW4A 3UKDA 2AWOA 2ZI5A 4QGFA 4OBEA 5CB6A 3GFPA 5L3SB 2KSQA 2ZSBA 4Q4JA 3LWNA 3W6OA 4R71A 3BAFA 2F9LA 2ZU0C 1ZUHA 2QM8A 3GJ4A 2HXYA 1LW7A 2DFNA 2J0QA 4TMZA 4URVR 1OB2A 1AS3A 1RRFA 5CLLA 1S9DA 4KJZA 3SYLA 2DCUA 1MT0A 2CVFA 4Z51A 1XD2A 2B8TA 2YOGA 1X8LA 2OFWA 1OV4A 1AKYA 2WVJA 1S1MA 1G9XA 2ODNA 2VL7A 1OH7A 3K9NA 1GNQA 2ZS7A 4RCYA 3WYGA 1S3GA 1P5ZB 3GLHB 3VNVA 2OBNA 5HPYB 1GM5A 1SXJC 1Z06A 2G1JA 1RYHA 1NG1A 3X1XA 4GZMA 1QF9A 3EZ2A 4NCNA 1D2NA 1VG1A 3TUIC 1E98A 4W5WA 1GRQA 1MABA 3G5UA 5HE8A 3TAUA 1ELOA 2OBLA 1QHGA 4WIAA 5JLJA 2WAYA 2F1HA 5JWOA 1KY3A 4HLDA 4H1VA 1PLJA 1XJ0A 1GOTA 2ZE7A 3TVTA 3BH7A 1VCIA 1Z22A 1P73A 4DZZA 2IEZA 4B3CA 3LXRA 3A8TA 2GDJA 4OKSA 3RWMB 4II7A 1SXJA 2B7BA 5FOTA 5TVKA 4XD7A 1AM4D 2OCYC 4MA4A 2Z43A 1WE2A 2JLRA 2VHTA 3RRMA 2H8KA 3GP8A 1CP2A 8OHMA 2XXAB 2O8DB 2QTVB 4AKIA 5KNDA 2X19A 4KITB 3OIYA 1R0YA 4D82A 1NN3A 4U02A 3W3ZB 3C14C 1OIWA 1NKTA 2WM9B 4J0QA 1A7JA 2CNWD 1COWA 1W44A 3BS4A 2Z4SA 3U2QA 1TUIA 4P4SB 2C96A 1FL9A 1IN7A 1NLZA 5JJKA 2VP9A 1TNDA 2QMEA 3KB2A 2VYFA 4P31A 3SYKA 3GJ0A 4GSYA 2LKCA 2N1BA 5UKDA 2ERXA 4K81B 3OAAA 3VR1A 2VRWA 5E7MA 5KDOA 4ESVA 4JT4A 4M1OA 2GXQA 2DWQA 5KTYA 1GNPA 1W4BA 5TB5A 1T3LA 3ZZTA 3I3SR 3IBGA 1W47A 5FL7A 5TMPA 5F9FA 3BJIC 3VMFA 5JMTA 3EZFA 1NIPA 2IWHA 3IIMA 5EP2A 4YXWA 3CRVA 4QFMA 1XRJA 4CVNA 2Q9CA 3GLGE 1AQYA 3T12A 1W4CA 4CEHA 2HYIC 3B1VA 1N0VC 1E79D 4GL2A 3QXCA 3FGNA 1IY2A 2ZE5A 2BM1A 3HDTA 1NVXQ 1AK2A 2HJGA 1DO2A 1II0A 1PZNA 1UFQA 1Z6AA 2Z83A 3TK1A 2GKSA 3CNLA 2O0KA 2J1LA 3GJ7A 4YMTA 4CEIA 1BO6A 1N5JA 4KFUA 2QN6A 2ZYUX 3PG5A 3KTAA 5EP4A 3R9XA 4TLDA 3V9PA 1OSNA 4TSFA 2P67A 2XOKD 3IEUA 3Q5DA 3RANA 4GP7A 3ZVLA 3OHMA 5FH9A 3WYAA 4TYYA 3DMDA 4QNRA 5HTKA 2QI9C 3KKPA 3RLFA 2QEQA 2W0SA 1NN5A 3JVVA 3X2SA 1G5TA 3OEED 2FFAA 4LOAA 1GKUB 4TL7A 4JSYA 4RFSB 2JLZA 1U81A 4ACBA 5EE5B 1ZM7A 2WWGA 4LHZA 5TXGA 1FQJA 5KYKA 2GBLC 5JRJA 2V3CC 1GZSA 2REXB 3CRRA 5CIQA 4DDUA 5IT5A 1OF1A 1GAJA 1ZUNB 1XCMA 1UKEA 2HJVA 1LY1A 1LS1A 2J7PD 5KO2A 3LVQE 2ZUCA 3ZVRA 2JJ2D 1LS6A 2O0JA 2ZAOA 3K0FB 3LFUA 5FUWA 3B78A 1EX6A 3QBVA 5K8TA 1NSFA 2PMKA 2CLCX 4N0DA 5FTLA 2WWFA 2VBCA 1BKDR 1SVWA 4D81A 2GBLA 2YINC 4Q5IA 3NBXX 4LDJA 5EXSA 2CBZA 5A4JA 5H70A 4ZPXA 1KJZA 1C9KA 1NN1A 2GEVA 3TMKA 2GCNA 4C0QC 3TSWA 2V54A 2EYQA 1P9WA 1DELA 2HXSA 4GZLA 2VSOA 1SZPA 1E2QA 4D2IA 1HEIA 2Z4RA 3D6TB 3QF7A 4EPXA 4CDGA 3FMOB 4A9AA 2I1VB 2XTZA 3P4YA 1U9IC 4E03A 1E4YA 3BOSA 1WBBA 4BFVA 1W1WA 1G7SA 4JVSB 1OKKD 3TH5A 1G5PA 3NC1C 3C7KA 2UZ3A 4V0NA 2GNOA 2IXFA 2R6CA 1ZC3A 3T5DA 4ITRC 5AK0A 1QHSA 4Q48A 3TW8B 2FFQA 2VQSA 4D80A 1E2JA 2MMCA 4JJZA 5J4LA 4QKQA 1NL3A 2ZJAA 1U9IA 3NIBA 3WP1B 1VTKA 4ARZA 3VNUA 3GLGB 1KKLA 3L8YA 3ECCA 2CK3A 3SNHA 5E7IA 5CITA 4Q4AB 2GZDA 4LJYA 4LPSA 2G9NA 1P72A 3OE7A 1EG7A 4LJ9A 2GZHA 4KLZA 1ESNA 1WRBA 2JASA 5FOUA 3C15C 1BS1A 2Q3FA 2R6FA 4ZIRA 5AWFC 4CT4B 2GXSA 1RKBA 2O8BB 1AZTA 2IUUA 4QBFA 2P3SA 1XZQA 4TMTA 4PFSA 3VR4A 3H0KA 2V1XA 1R4AA 2GESA 2WTUA 2ZAMA 4Q9IA 1XF9A 4F4JA 2BDTA 2AKAB 4QJ4A 3F0TA 1W4AA 3CPHA 3KZ1E 2CE7A 1SXJD 4B2LA 4LHWA 4XD7D 1MO4A 1K6MA 1XX6A 2MMGA 1JQLB 1VMAA 5JEEA 1FX0A 3B2EA 1M1YE 1SKQA 1VCOA 4JBWA 2QRNA 4W7SA 3EPHA 4RD4A 4RVCA 1JECA 1R6BX 4Q4LA 3I1FA 4DHEA 1XTIA 2ERYA 2AWNA 4LHYA 1Z6TA 2J87A 2HYDA 2IYLD 4IXNA 1DVRA 2GWHA 3AF2A 3E5HA 4OJKA 2H5EA 5DN6A 2VP2A 1H8ED 2H1LA 3LBIA 3CUEF 4V0LA 2ZS9A 3K0CC 1BMFA 2W00A 1N5IA 4AD8A 2CLSA 4L15A 4PSVA 4D26A 3AVUA 1QZXA 1FUKA 4DCNA 4IW3B 3THXA 1N6KA 2Z0MA 3HU2A 5KDLA 4OI1A 5JSZB 1E9EA 1VYUA 3K09C 4OQNA 5J40A 1R0WA 2HUPA 4B32A 3NHBA 3PIRA 5AUPB 2VO1A 3NEYA 2ZRIA 1XEXA 1Q0UA 3K0CA 3QBTA 1ZU5A 3BXZA 2IA5A 4B43A 4YXWD 2ZE6A 3UANA 1GL9B 4QBIA 3QOFA 2E9SA 1CF4A 1Z0KA 1G7RA 2LCFA 1G8GA 1B0UA 1NLYA 3K09A 1UF9A 3EXAA 3BH6A 1E0AA 4S2EA 4TMXA 4O25A 2GJKA 3BB1A 4Q9KA 4HLCA 2NZ8A 4BZQA 4AIIA 2BWJA 1ZC4A 3CBQA 4A0HA 1NIJA 2PT5A 3SZRA 1ZRHA 2WMOB 3IPXA 4DLUA 3H4MA 1CLUA 4PC3A 2ZYTX
chains in the Genus database with same CATH superfamily
2R8YA 1Z4KA 3B60A 1G98A 4KIGA 5ELMA 3OF2A 4YJ2B 3BG5A 4XCXA 2QMHA 2GWRA 5CEJA 1UBTS 2G5PA 4UTVA 2NSLA 2ECPA 1B43A 1S8AA 3K1ZA 1D2HA 4C4ZA 5JAZA 4RDHA 5EE3A 4Q1AA 5JI3E 3WWZA 2SHKA 3FWPA 1OC2A 1ZCJA 3GAAA 5GV7A 4L8VA 3UMVA 1IN5A 1YZKA 1G1AA 3K70C 5HS6A 1PT6A 4PYMA 3GNSA 4JY7A 4PZUA 4W1QA 5LMZA 1WMFA 2IITA 2OM2A 1CQXA 3GT4A 3QE3A 3AJ8A 1VGVA 3GUZA 3W5JA 1CHNA 5A5DA 2FJPA 4EOGA 3QVGA 3R6DA 1GO2A 2V0CA 3E8SA 2B1RA 4UFOA 3F5SA 3D4OA 3H16A 2PUJA 4NFYA 4OHYA 1P2TA 4MLCA 3OZ7A 1MDFA 4PINA 4WD3A 2IYRA 4Z99A 2X0JA 2IH4A 3RU3A 3C5HA 4JELA 1H1LA 1SZDA 5AKKA 1RBMA 4DNXA 1ZOSA 5KNCD 1QV6A 1SM4A 2DPGA 2N0SA 2RAFA 4HWTA 1WPRA 1S9HA 3MA0A 4H35A 1PJRA 3ESRA 3KP1A 2ZBUA 3DHNA 1HDEA 2QE7A 3C48A 2H7YA 2O59A 3RUDA 2IGBA 4O63O 2PIDA 2OA0A 1F4PA 4BUZA 4HVCA 1DIBA 2QJRA 2C2MA 4OMCA 4OQQA 4MR7A 4R01A 3A37A 1PUXA 1J09A 1EGQA 1KHHA 4MYSA 1XPJA 4OHXA 5E4JA 1QFJA 3L6UA 5EPEA 2R6R1 2BFNA 1ND5A 4B48A 3INNA 4CKEA 4LMBA 4Z7OB 2FGJA 4MIYA 3W5SA 2IFTA 2R86A 2CMKA 2AOTA 4Y8VA 5BO5A 5HRUA 3CX6A 1L4EA 1SIOA 5TDHA 2VWGA 3DJYA 4CMAA 1J00A 5BOSA 1XEWY 1WLYA 2FPPA 3DM5A 5E9WA 1G2IA 4FWTA 5BORA 1OPXA 4M0KA 3TJZA 1UP7A 4FGKA 1Y8ZA 1JA1A 4O1HA 4R2KA 2X42A 1V1RB 1NXPA 5CNIA 1XYGA 1R18A 2JBHA 3C39A 2M6KA 1JPJA 1XFAA 1BOFA 2PPLA 5HK8A 4P38A 5B7QA 1Q84A 2WQ7A 2AJLI 1SG9A 4LQCA 4UW9A 4ZO6A 5ALVA 1V43A 1LPOA 2RI6A 2F43A 5J2UA 3TLMA 2IK8A 4DR6B 3VRHA 1OH6A 2CWDA 4TQGA 3ZZ0A 4CM4A 2HK7A 1BN6A 2ZJZA 2B4RO 3PKIA 4GEKA 4LC1A 3I28A 4K9PA 3SS9X 4JN6B 5IDXA 4LG1A 3HBJA 1KEEB 2QUJA 2GDZA 4O33A 3SHTA 5TSDA 5CLJA 5CCXA 4PO3X 1AMOA 2JAPA 5KTNA 3CX8A 4WZAA 3S55A 3UMRA 3PTAA 3MMXA 1FIUA 5C31A 1KP2A 3SU8A 3UK2A 4AJIA 1YL6A 2A9RA 3AF3A 3RS7A 1T24A 3HYRA 1DJLA 3SKVA 1K8ZB 4U2BA 5JUWA 1BXGB 1C0EA 4FFVA 3HU3A 4JQYA 3VR4D 2AI2A 2VKQA 1T2FA 4KXUA 2FN9A 3DCIA 4YRKA 3KWLA 4UNRA 3HJFA 1DC5A 1U0EA 2G9ZA 4CF6A 2AF4C 4FR5A 4ZQHA 2ZDQA 5CCDA 4DMGA 1ZI9A 5AJVB 1QX4A 3C0KA 4RL6A 1RRVA 1Z0IA 3D5TA 1KI2A 3OJFA 4FZJA 5E4YA 4D99A 4OHVA 5B6IA 4NU0A 5IAGA 2W8ZA 5FA6A 2VQ3A 3KQTA 4ZGGA 1B6SA 1MA3A 2WK1A 4JMPA 7REQA 4TOIA 4LF9B 5EP1A 1U1GA 5GGYA 4MA5A 5DOZA 1O77A 3DVRX 4I4NA 4HJRA 2B2CA 1HH4A 3T38A 2XUGA 2DUNA 3PUJA 3NP9A 4WINA 5HKBA 3KALA 1NR1A 4RY2A 3V1TC 3LUKA 4TLAA 3VA7A 2QYTA 1ORHA 3QUBA 5TMBA 3TL2A 5JH7A 1PGPA 4WKPA 4Z4EA 3A9SA 1JE0A 4RH0A 3G2LA 1H9BA 1Z37A 3LLCA 3PGKA 3BDAA 3I5YA 2FSSA 4QIHA 5AHWA 4CE6A 1XIVA 4HRYA 1BE1A 2Q5IA 1R88A 3NG1A 2CCGA 3QBDA 1AQLA 1BMFD 2WJGA 4A1OA 2FW1A 4X7PA 3TE6A 4EUNA 4BRUA 2HMSA 3BCUA 2PX0A 4UUQA 5C4GB 3TTWA 4LHVA 3ZLBA 4BP8A 1DZ3A 3U0VA 3NTLA 3KKLA 1IFXA 3U4MA 3H2SA 4MYTA 3M4JA 4R2HA 3CS3A 1CJVC 2AHRA 3E7XA 1F51E 4FI3F 2LDBA 5BYBA 3BF8A 3J80A 4HH4A 3LRXA 5BRNA 5DYYA 3CKKA 4G6ZA 5CK4A 5IMBA 2Y1XA 3O8NA 4XVCA 1P2SA 4MQMA 4YALA 4YBZA 2J59A 3CLSC 3ZCRA 4JXJA 1LSSA 1YCGA 3WDMA 2JRCA 1KQGA 4KJXA 4C0XA 4AZ3B 4YEDA 1VLQA 1EK2A 5K8CA 2BHRA 1DKPA 3LT4A 4PRZA 1E60A 2WKRA 4HZUA 4K9KA 3V32A 3GGPA 3O2JA 4EENA 3IQXA 1V45E 4GP9A 1DKNA 1BXRA 1NAHA 4IBOA 4MQLA 4EZEA 1Q3TA 3O93A 2VJAA 1DRKA 5IK2A 1FRQA 2HJRA 4R81A 3I6IA 2K5UA 1LVHA 3DUFA 5ED0A 3QVUA 2QTHA 2B83A 1UXKA 4F2HA 1FRFS 4HNHA 1VMIA 4UE6A 3KHUA 2VSXA 2VC2B 4A7PA 1HM5A 4ABTA 2ADMA 3UHOA 1XYYA 1JN0A 4HUQA 4BJ6A 3K32A 3NWOA 1BH2A 2IJGX 2BRUC 4DBVO 2N42A 3TDMA 4EH1A 3NGMA 1UBFA 2HQOA 4X7MA 1LK7A 3H4VA 1TMKA 3KFVA 3VKFA 4KXXA 4LE0A 3MTGA 1KY5A 3UK6A 1X7WB 3HVIA 1PTJA 2WC1A 1DG3A 1LDEA 3HCDA 3QPAA 3NHAA 4KQIA 4LZZA 1L4YA 4IX1A 4PEVA 4E6PA 1LFDB 3O8QA 3E3OA 2P9YA 1UAGA 2C5HA 4GOMD 4JL6A 4YPFA 4RTRA 1EHCA 4MWTA 1TC1A 5GQSA 4OU4A 5D5QA 3SYNA 5AJHA 1E7RA 1YS7A 1EI9A 3H3JA 3DE1X 3P0IA 2BRUA 1OA1A 5BVGB 2AZTA 3K2QA 4IGAA 2CLFB 1WVGA 2KI5A 2QNRA 2ZULA 4LXUA 3FCOA 2IHNA 1J56A 2ICAA 4RCZA 1E4OA 1TMYA 2OKGA 3B6KA 3QWAA 4NU6A 1Z75A 3RV4A 5HIIA 2AF3C 3ZV4A 4OX9Y 4L0MA 3HRKA 2XEDA 4KFCA 4QC2A 1OLXB 4LC9A 3OQMA 4OFZA 2EFHB 5JSQA 5BSHA 2E6UX 4OA8A 4XQ0A 1FDTA 4BMOB 1FFHA 3U40A 4KR6A 2NQ2C 5IXJA 3D6JA 3UG7A 3RVKA 3IUPA 5T6BA 4UQPA 1CJUC 1KMMA 4NYJQ 4R31A 2BHTA 8AT1A 1VJCA 1XA4A 1YVRA 2RHOA 3UWDA 4LF8B 2NZJA 3SM3A 3GEHA 4KWCA 4KV7A 4B34A 3NETA 3M49A 1A9YA 2CL7X 4WJZA 3TI7A 3SKYA 3SG0A 3RVDA 2PUDA 1HSZA 1T36B 3CTPA 4ZWNA 2AG6A 2XH8A 1U4OA 4AMGA 2ZW9A 1J07A 1TJYA 4LJ5A 3Q2KA 3U5ZB 4QOHA 4ODIA 5KWJA 2GCPA 1ECJA 3K9HA 2R1VA 3I30X 2X9QA 2VUIB 2I6SA 3AR6A 3H2GA 3HYNA 4LA4A 4PC7A 4LTMA 3KQNA 1P5HA 4PNEA 3JSAA 1VKJA 3LUJA 2R62A 5ILGA 4EAAA 5AVWA 3OIWA 3TG2A 1EK1A 5TQ0B 1H0SA 3H2YA 1NBAA 2DG2A 4GC5A 4PVCA 1J25A 1KO8A 2O2DA 3AEUB 4RV9A 1AK9A 2X1VA 2X15A 4ITVA 4CR7A 4RULA 4EW6A 1CQWA 4I7EA 4E0BA 2C8VA 2X1HA 4UM8B 2BEJA 5B30A 3JZIA 3E15A 1L5SA 3AINA 4HEA1 1GADO 1R3DA 1E9AA 3ITDA 4N6OA 3K0AA 3CUUA 3V4LA 1W0KA 4RMJA 4C7BA 2MOKA 4BZZA 5JMPA 3I9JA 3WHIA 4KMRA 2C8JA 5IARA 1CRLA 3ZU3A 5B55A 2PLFA 2PWAA 1UKBA 1N7IA 1ZGZA 4L9WA 2NSYA 2V03A 4QUAA 1TCVA 2A6PA 1PV4A 1IQUA 4X92A 1QRTA 1S96A 1W0JD 3IVCA 3B8HA 3A2LA 1F5NA 4MQEA 2GGSA 4X1YB 3T6KA 4UUPA 1YRQA 3NANA 4YC7A 4RBNA 2EHDA 4WBNB 3TOSA 1MB0A 1MQAA 2JLBA 1NYRA 2R85A 4H31A 4WZ6A 5BY2A 3IEVA 3JQAD 1E20A 3NB0A 4CODB 3ZD8A 3D81A 4Q3NA 1RXCA 3EQZA 3O4JA 1U5BA 3DAGA 4UDYX 2AZXA 1C8LA 2Y3IA 1GGHA 1HKHA 1NMEA 4MK4A 5EUQB 3GGDA 1EGHA 3CF4G 2W9XA 3L6CA 1XZGA 3JW8A 1RZRA 4XLZA 1PYOA 2FW9A 4AF6A 1MDBA 1Y0BA 4NYIR 3HYSA 4NWIA 2BEUA 4PYJA 3EGXA 3JVUA 2HKIA 1MLDA 2GNPA 5IF9A 2OD9A 1U2RA 2QTWB 1L5HA 3HXOA 1EFHA 1E9SA 4LWPA 4BXOA 3Q7IA 5FQOA 3WAGA 1EKXA 3IJ5A 4IOKA 3QXHA 3C3DA 2QRLA 4BO9A 1XZEA 1XNRB 3MYRA 4I9GA 3MINB 5AFSA 2QP9X 3F8SA 2DSNA 3EDMA 3V1NA 1ZJ5A 1PU2A 1GLVA 3CYFA 2G25A 4R1UA 4I81A 5DK4A 4GF5A 2ZWPA 4HMOA 5JWHA 3PDUA 5EZ6B 4AP6A 3QFFA 4FDAA 2WA1A 4IDNA 2Q3EA 2F3SA 1E2FA 2ODBA 3QQ5A 4WOBA 5K3FB 1GXSB 2XKJE 1Z5ZA 2VI5A 5HUJA 1FSPA 3OEWA 4H6PA 1RT9A 4MRMB 3FTCA 3GUHA 1NPYA 1V35A 4AG6A 3DF9A 1H5QA 2ONYA 3EQ2A 3TOVA 3OO0A 4FFLA 5EHGA 2O0HA 4F93B 2BUCA 2VVTA 3ROPA 1L5LA 3M82A 1KK3A 2TS1A 1ARZA 1SCNE 1TEVA 4WNAA 3ICQB 2R68A 1XG5A 4LHXA 3AEZA 2C2XA 4QUGA 1MAAA 2VJBA 4UDNA 2I4MA 5B1EA 4QTYA 1FMJA 3RI3A 1W30A 1HNWB 1P2VA 2B34A 2QG6A 1U80A 3CZQA 3LK6A 4Z7QB 1JKIA 1TE2A 4XM1A 3DS8A 1EIZA 3E53A 4DA0A 4QBGB 2VBIA 3GDHA 2IYOA 3OTWA 1XXHA 4BV2A 2P62A 1M2HA 1GZDA 2A14A 3G3EA 3PHJA 2X14A 3VQTA 2CNDA 1U0GA 4FFMA 2XJ4A 4X45A 2WIJA 3LWZA 3GCXA 4D97A 1C9JA 3O4IA 4P83A 2Q99A 1H3NA 3A1TA 2PAAA 3QKWA 4L02A 1E8MA 4Z0HO 1WUKS 3LL7A 5E1DA 3MHPA 3UUFA 3T3OA 3FOBA 3TD2A 2OV6A 4EFKA 2VZ8A 1JQ5A 3EXFA 3OURA 2E37A 1J2UA 2BGWA 1NR7A 2J09A 2BL4A 1PL0A 3ZD9A 4RHFA 1X6VA 4CMIB 3E84A 4ETWA 2PJRA 1VBFA 3C7AA 3C3WA 3ZOZA 3GFRA 2Q2VA 4OXXA 3MAAC 2FOIA 3OMLA 2JJYA 1MHPA 2WPDD 2E4ZA 1N36B 1PO7A 1ODCA 2FQQA 2RHCA 1A7UA 3O90A 4RNCA 1V9SA 3V00A 3HG7A 3VHXA 3WGQA 1C30A 1ZGJA 2WW8A 3O4GA 4QG7A 5ALNA 2EX0A 1NUHA 4Q9DA 5INTA 2N47A 3ST7A 3INRA 5C8DA 4ZO8A 2HJWA 5HSGA 1JEYB 5HCNA 3RFTA 1FYEA 2EHJA 4GP6A 4YJDA 4IIJA 3IV7A 1U8XX 1JNXX 1H22A 3UWPA 4JJEA 2BONA 1KE1A 3AUUA 3UF0A 1YOVA 3UJAA 1DRJA 3C2QA 4NK4A 1P17A 4LQDA 1PLLA 1XCJA 1L3BA 5AI4A 3PL5A 3ZQ6A 5A3RA 1Y1TA 3RVPA 3SOZA 1N2SA 3DOFA 4ZVNA 1SC1A 3SJ7A 4I6GA 5I7RA 2ZM5A 1PZEA 1S0UA 1Z29A 2PIAA 2VUTA 2BDEA 2XQIA 4AURA 4ZN6A 4ZVKA 3CGGA 3WLHA 2OZLA 3DOEA 4AP5A 4UM5A 2XNDA 5DM60 2JCVA 5F3WB 5FWDA 2I03A 3ZWNA 1U7TA 2QJTA 3KZKA 2P3LA 1TT5A 1WOMA 1YDGA 4DEVA 1KDYA 1O54A 1XJQA 3OLYA 4RZ2A 4RY8A 5SICE 1PUIA 3GL9A 3RAGA 4NXMB 3FZQA 1V4BA 4L0DA 1QQTA 4OK6A 5FUVA 3HWSA 1V4VA 2J9ZB 1JBQA 4UNNA 5J4HA 1UADA 3AH8A 3H5RA 2C4HA 3RB8A 5IAKA 4XLTA 2ZAIA 3BF7A 4AIRA 3KQUA 4EA9A 3EISA 1G9TA 2QTNA 4WQMA 1N5RA 5DYNA 3W3AA 4MQFA 1EFVA 2J5XA 5JS7A 3H11A 5I8WA 1NW7A 3KKMA 4KMMA 4YJHA 3SJBA 2CDNA 2C54A 1RLOA 2VHVA 2QM0A 1UQRA 3AEQA 3L5KA 3LLMA 3LP8A 1P62B 3GIWA 3WLQA 4LUCA 4PAWA 4TKVB 5D3KA 3H2JA 2EFJA 2WEKA 4G41A 4A2PA 4LOHA 2DECA 4IEEA 3H9JA 3H7IA 3NM4A 5BWNA 1S3IA 5G1PA 4WAUA 2HTEA 2J48A 4IDBA 4M8KA 3WXMA 1KZYC 2WYHA 1JKJB 2B37A 2BCEA 1JFSA 3ZR4B 4J4TA 3AVWA 3DO5A 2E5WA 1E6EA 3MTDA 4FNOA 4EF4A 5LDGA 1Z5UA 3JVEA 3HKEA 1M10A 3BK1A 3G5AA 4UAJA 521PA 2HMAA 3HADA 4GE3A 4CL2A 4D8TA 4DN6A 4IJVA 4U2KA 5BT8A 5FBVB 1AF7A 2QL6A 1CEEA 3GRKA 4ZI3A 3T4EA 1PZHA 4OHWA 1XTUA 1EP9A 5D51S 5H0IA 1ZGAA 2VDRB 5FHQA 3GRFA 3IPCA 4UTXA 4N76A 2P40A 1PJQA 2VJQA 1KDTA 1N1DA 3BILA 2OECA 1YB1A 3SHFA 2C7PA 4BE9A 5GJBA 1FW6A 1XPOA 4F3TA 2M1ZA 2B1IA 2GF2A 2D2EA 3KR0A 3OFJA 3R24A 5FO1A 2CHEA 1UCFA 3FWHA 4FSXA 2VWQA 1ORDA 1PJBA 1RDFA 1MRNA 5JDCC 1K88A 4MWBA 5ERXA 3PNKA 1TEXA 3A26A 4MUYA 1FE8A 1HTWA 3OH8A 4TV9F 4DV0B 1RQLA 3GGGA 1RBQA 2XB4A 3TEMA 4C0JA 1YWGO 2VRCA 3QPVA 4MJLA 4PQGA 3RNLA 2C7OA 2CXXA 2XCTB 1GCOA 1Y5MA 3VKUA 4CI9A 4DCGA 1JHXA 4HDCA 2GN8A 4PONA 1USIA 4II3A 2ZRFA 3MFQA 4D5EA 1DAMA 2P9GA 2XWBF 4IVNA 3O1HB 4DLLA 3QVOA 5JDCA 1A71A 4MDYA 2GA9A 3IOYA 4OG2A 3VPFA 2ZRQA 3C5WP 1DC8A 2GZ1A 3MEQA 4MP3A 1LNZA 3ZGYA 2EWWA 1I13A 3G2MA 3GLTA 1M33A 1Q83A 1Z0DA 4PZYA 2GHIA 3BWXA 4HFJA 1IUOA 1DDIA 4MMXB 4L78A 3HXPA 3RGWS 4PQRA 1CZLA 2YCBA 1YU9A 1TADA 4BBAA 1TC2A 3W4JA 2IDZA 3D6HA 4C88A 1VJ5A 5GVSA 2Z04A 1FDSA 1SXIA 4PXYA 2JGAA 3UAZA 3ZCUA 1GA1A 3OX3A 3QUSA 3HRIA 5SZJA 3WNQA 2IXBA 4ILEA 4I5DA 5DYWA 3NBYC 4UHCA 1BCRA 2X4LA 3WNVA 4XX1A 3N2ZB 2ZUTA 3ASYA 3STXA 2MR6A 1UZNA 1X8KA 2OHJA 2VNIA 2WTMA 3WKBA 1G4UR 4MJ7A 3ZWYA 1CY8A 3WJAA 2Z56A 4FZ5A 3DR5A 4GOKA 4HDMA 4NOKA 4PF1A 2NP7A 2O2EA 1BD3A 3NBUA 821PA 4X8MA 1BS9A 4JR0A 3HJCA 3UCFA 5CA1B 1IULA 3BD7A 2P5SA 3UA3A 1I14A 4CQMA 1NW5A 1FX1A 2E21A 5F76A 5GONB 1GPBA 3N6RA 1Z6ZA 1ZP6A 1E8DA 2CVHA 3OAAD 4JLMA 2EP5A 1YDMA 1JU9A 5CTAA 5T4HA 1NUPA 4W5RA 3E2PA 3JALA 1U7WA 3KZCA 3PUYA 4TVOA 4CI0B 5IUNC 2O8FA 4G2NA 2NOAA 2V58A 4HEA6 5IKOA 4CRWB 4EW3A 4UJ5A 2Q62A 2G17A 2B6HA 4WCFC 3RSLA 3U0BA 4C0KA 5EZ5A 4DM4A 3U09A 1H3EA 2PVCA 1HE8B 3HWWA 3PR1A 3SK0A 2YWFA 1OOEA 2XEXA 4HNAA 4MLDA 4OLHA 3TRHA 5THQA 4OQLA 1D09A 1K5GA 2J3IA 4K9SA 1HORA 4UDOA 1ZCFA 4RESA 1HLDA 1SIUA 4N5NA 5F1OA 1TW2A 4CG1A 4F3KA 5GY7A 5DASA 2ZUBA 5CBPB 1L4FA 2HJHA 2MYNA 2Q41A 4YS6A 3TVDA 4C7XA 2E82A 4LBVA 2O8EA 2ZWIA 4CV3A 5IG2A 3GJ6A 2BJHA 2R84A 4TLBA 2Q3LA 2ZRDA 3PEWA 3MAGA 4FD3A 1REQA 1Y1LA 5ABPA 1NJFA 2I76A 4JOSA 4WCFA 2GXAA 4UFPA 2H2AA 2WM3A 1OH8A 3NH6A 1MAVA 2IYZA 3RASA 4KNWA 2HCRA 3EDCA 1LD3A 3JATA 4QNMA 2QPLA 1XDBA 1LUAA 2BF7A 4ZRNA 3SYTA 1ZD4A 5LYJA 2E49A 2WV7A 4EG6A 3MJTA 3AETA 1VFNA 3QMMA 5DX1A 2OPHA 4DGSA 5EN4A 4URZR 1NP3A 3UAOA 2GARA 3ANXA 2PWBA 1XQYA 1ZM9A 2HCBA 2JEOA 3TOZA 3ICPA 1QHYA 3CH6A 4G56A 2A58A 4KQGA 2ZRPA 3AHGA 1N9ZA 3GQVA 4HNUA 2IEDA 3ZDDA 4CUKA 1E4VA 1JJIA 2BI8A 3NDBB 3OPVA 3HJHA 1A96A 2ZRCA 4PGMA 5KQPA 3DBRA 2RDMA 1M8JA 3DVQX 3HB5X 4KGVA 3V6LA 3VJKA 2IYQA 4AMBA 4D6PA 4MCAA 3TW8A 2WE8A 2JIOA 2IPMA 4NS1A 2G67A 4DBZA 2XVAA 1GKIA 2OXEA 2J8ZA 5DWQA 1MJGM 3KSUA 1GNRA 3PPYA 5E6RB 3V7UA 3GH1A 1A50B 4M76B 2V3WA 2JD1A 3VC3A 1E0KA 1FQWA 2DBYA 2XLCA 1CEYA 3WHPA 4WBXC 1RWKA 2B4YA 3EYWA 5GP1A 1QH1A 1WMAA 2PGDA 3MGAA 1Y37A 2BBWA 2H2GA 1QYXA 5PNTA 1NQOA 3TD9A 1EE1A 1T5LA 2VBFA 4A6XA 2QD2A 1DOHA 3QBJA 1H6DA 2FZVA 4D3SA 2X0IA 1XZAA 2G06A 1WY7A 4I5EA 3QBEA 2WLSA 3H9GA 1FRNA 3PDWA 5EP3A 5JFOA 1R3UA 1EUYA 2FSVC 1ZIYA 1M2JA 1P3Y1 3CH5A 3BHNA 5LUBA 3G0HA 1Z6GA 4FCCA 4YMGA 4W9MC 2POCA 4BS9A 2DLNA 1Y5NA 3S29A 3Q11A 3ETNA 5I9BA 2QX7A 3A36A 3DEJA 3F5QA 5GPBA 3EIUA 1P6UA 4H6VA 2G71A 5D3MA 3F6SA 3K5IA 3TR5A 5CB0A 2O2HA 1TCBA 2VNKA 4K03A 3KG2A 4GICA 2FSVA 1HTTA 4B4OA 3OE1A 5REQA 4BNUA 1M76A 3E8MA 1A8SA 1N7HA 4QPJC 1DWOA 3H9CA 4UAVA 2VZEA 3KJNA 4OL0A 2BBTA 3OJLA 3KVOA 3PFWO 3WIUA 4BLRA 1G38A 4DUGA 4PLCA 3KUXA 5IF3A 5J2TF 2V6JA 1EHYA 3BULA 4MUHA 1KKMA 4PAGA 5CT6A 2ZM6B 1JH8A 6ADHA 3EVBA 3W2EA 1R64A 1J5XA 3EJWA 3H05A 4KQMA 4YQZA 3LHKA 5KOHA 5KVCA 5C53B 3OZXA 2OO5C 3ML1A 3UPDA 5IHPA 1GZ7A 1RWNA 3A4NA 1QRDA 4AZ0A 2K6GA 2ACVA 1GPH1 2QLLA 1IY1A 1HZJA 5LZ9A 1YMUA 4DZRA 4EG1A 4DVJA 3STTA 3TPFA 2G3YA 1PSZA 4KQWA 4MRVA 4RMIA 1F6BA 1SBZA 2O1SA 4BNKA 2WWIA 2H3HA 4RPLA 2DKNA 4CCSA 4X41A 3QKUA 2XUQA 3PGA1 1P1KA 5AJWA 4ER0A 5ES4B 1JEAA 4G0MA 2C83A 4KKXB 3BBPA 1CX9B 5JPDA 3CF2A 1ESCA 2OO5A 4EHBA 3UYKA 5DSZA 1YRHA 4YUXA 2AD1A 1JEJA 4RFVA 1B2LA 2F1OA 2PYDA 4HWSA 3VX4A 4D4JA 3JPWA 2NTEA 4G5YA 3UAGA 1H9CA 4EJSC 5ERYA 3V55A 1O5IA 2PK3A 3WB2A 4ZYXA 1WULS 1UM8A 2VG8A 2F3PA 3G88A 1WPQA 4QEKA 1JQJC 1DINA 2L42A 3R7WB 3RAPR 4G26A 2WJIA 2FPKA 2OOKA 2MSKA 2YC2C 3LYAA 4FGUA 1K8XB 1TRHA 3FSGA 4C1NA 5AESA 2WSMA 3T7EA 4JS0A 6PFKA 2HEIA 1YQGA 3EIOA 2RGNC 3DWFA 4M98A 1W0CA 2W8BA 4KK3A 4C5AA 1AV6A 3CM0A 5EZYB 2VQDA 4P33A 1AE1A 4Z2YA 1SWVA 3LXXA 5BSMA 2AFIB 1W5FA 3DFZA 3TSYA 3BKXA 3MRSA 4EJSA 2QYHA 1MAWA 3UHFA 4DXHA 3JX9A 3E3LA 4WV3A 1JEEA 3H75A 3R7LA 1RAGA 3HY6A 1THZA 2VDWB 2ILTA 3F3SA 1N6NA 1X14A 2FN3A 1VM6A 1CEQA 1IB0A 2PX2A 3HUUA 3HLKA 3L79A 3S8YA 4O0LA 3P97A 2RGNA 4RQBA 4AK9A 1KR5A 1XE3A 2P79A 4PTLA 4GOJA 1HFWA 5E1MA 1L6IA 1YS4A 4M1YA 1WS6A 4LYJA 2RGCA 3R3JA 3ZNPA 5KYTA 3O4FA 2W37A 1ONPA 4P7BA 2QRUA 3AUFA 3D8BA 4XQ9A 5FUYA 5CG2A 1QQAA 2RK6A 4EQZA 4DPKA 2X76A 1EAYA 3O94A 4DIFA 1V47A 1KTVA 2NPFA 1ECFA 1KC1A 3GVIA 4YFYA 1V9CA 5I7SA 1IMJA 3RSZA 1G18A 2ATXA 1MFPA 4R05A 3WLKX 3FNEA 4XR9A 1X7DA 4YUWA 4IHJB 1K7EB 1U2ZA 2EJCA 1IOZA 5FT9A 5LQNA 1T4CB 1JHPA 2HSZA 2QMQA 3HJRA 3QVTA 1BS2A 3AR3A 1NBWB 3NX4A 4FUQA 1CE8B 4JT2A 2VP6A 1XRPA 2VJPA 1BW9A 1OFUA 1ZAKA 2QRMA 3DXFA 3L0BA 4MJ3A 3U7QB 3LHIA 1C3LA 3U7RA 4GYKA 4CN8A 2QN7A 4LJ6A 5DNAA 1JEOA 3RRNA 1EJ6A 2XD9A 2ZJ3A 4N6GA 2AZMA 4PIMA 1YE8A 2VRNA 1RC0A 1EGVB 3EVAA 3CX7A 3QW2A 3H5NA 2BKVA 2CUTA 2VYQA 4IIHA 3SXPA 3TQFA 1FTGA 1RZVA 4P36A 3R7FA 4ENTA 2AMFA 2PRIA 3WLAA 4RPCA 3G1TA 4NCBA 4F2GA 3AVVA 1XVLA 2WFLA 3KZVA 3AQ4A 3LQRA 4U6QA 4UM9D 2P9QA 4L8FA 2XRMA 1TVCA 1XD2B 3V8EA 4E14A 5ICEA 4J3FA 2P35A 1E2NA 1EWKA 2PS0A 3WS7A 4YHHB 1R6UA 1I2AA 1ZESA 1RHKA 3AVPA 3I9NA 1ACMA 1WZCA 1L4UA 3FAKA 3E2IA 4KI0A 3R7AA 3I09A 4RTOA 1RRCA 4MGIR 1H2BA 3HV0A 1TKBA 1LI5A 2FWJA 2IZOA 4OVKA 1L6RA 5DCYA 3GUUA 3T7IA 1KQFA 4Q4DA 5J5CA 1SVSA 2UVDA 2YXBA 2IXAA 4MDFA 3L7YA 3Q0EA 1P2DA 2CUNA 3AK4A 4O5OA 4KACA 1YULA 5IM5A 3FNIA 2G4VA 5JNSA 2H5JA 2ZSHA 1TM5E 1G8MA 1KH2A 4B6RA 1T2EA 1JXOA 1XQVA 3ZY6A 1G20E 2G76A 4GUAA 3KOWA 4BKMA 5HFJA 4ED9A 1FDRA 2ZRHA 3CO5A 1BVUA 3HEMA 4H1UA 4OV6B 4CLOB 3BZWA 4OFXA 1HMPA 2Q6VA 4FNGA 2J9FB 1ZIPA 3F1LA 4X66B 4TUYA 4MUBA 1G7TA 2GCGA 3E70C 3G23A 1M2NA 5JC8A 4YV7A 3DVLA 1GZ6A 4H6WA 5AHKA 1Z0FA 2XYGA 1BXKA 2CXSA 2OK8A 3KQQA 2NW6A 4QGHA 4EKYA 3BMQB 2EL9A 2QD4A 4TXNA 1OMOA 5DI3B 1GRCA 4OHRA 2IUYA 1WHSB 3VSCA 1KFKB 3NFYA 3PPIA 4ZEMA 1A27A 3ORHA 4X6UA 4AN1A 5LU8A 3MYYA 1MTZA 1Y3AA 4XUCA 3VU0A 1U98A 4ENUA 4Z7NB 1J9ZA 3KUUA 1JR3A 1Z36A 3O3NB 3ZLTA 1RXWA 3FUTA 4PLPA 5I4KA 2EKPA 3GZNA 5IAOA 2P0EA 5TX7A 1EFKA 2HSJA 4HADA 2NO9A 3D2CA 3OCVA 1R0ZA 3FVTA 1IHYA 3NVAA 4CPDA 4RC9A 4DA6A 2QXUA 5JD4A 2CFOA 1W6RA 2EQBA 4ND3A 1UUFA 3NNSA 3P0EA 1MRZA 4Q3AA 1UPFA 1ODLA 3MK31 1LTHR 2O8FB 3SZUA 4CM3A 1J20A 2XUDA 4JJ4A 5ADWA 3H2BA 4FOLA 1E32A 3TPZA 1WVMA 5AW3A 4B85A 1P9RA 2XSZD 3IR5A 4QWMA 3L7AA 4QVIA 4ML3A 2PMCA 2DWUA 2B99A 1G16A 4BO6A 4DYHA 2AN5A 3L7KA 3V5NA 4ZDJA 5B53A 1KFBB 2GEBA 2E5FA 5KVSA 4IS3A 4M9UA 4F8EA 1H4TA 3II6X 5IWCA 1Y5RA 4G0YA 4M0CA 1RQPA 2W6ID 5GWXA 4UTRA 4LE1A 2X5KO 4LRSB 5HVNA 2GAFA 2HMTA 5AJYA 2C0CA 1TK2A 4RTMA 3ACDA 3H5TA 2RKWA 3MMZA 3KDPA 3DL7A 2QLTA 3VC1A 4FB5A 3A1CA 1C4KA 5K4AA 4RQAA 1QKIA 1U8FO 1GEGA 1N2BA 2YVUA 3HU5A 3RC2A 5ITZA 3ETCA 5KHLB 5M7EA 5DHFA 3PT9A 5B7GA 2VPPA 4PHGA 2CMGA 4F86A 1CUDA 3RK1A 4E5YA 2ZIAA 3HB9A 4J9VA 2GZMA 3EIXA 3QG5A 4QFCA 1RABA 5CYPA 4B76A 3VVCA 2RAUA 2B35A 2XB2A 1ISMA 3WICA 5LKAA 3UA4A 5A03A 3ADCA 5A4DA 1GJRA 2BE9A 1RM0A 1C0KA 1DOZA 2GI4A 2CJFA 1OKKA 2HF9A 2IXDA 2QVZX 2V7EA 4WXMA 3RS2A 3RUFA 2XQJA 4M0UA 5LC1A 3FPLA 1BGWA 2CL0X 1KL7A 1GV0A 1HE2A 2JHFA 2QL7A 2CJWA 2ZSUA 5IJ9A 1K0UA 3SFVA 3W6UA 4RIEA 2JDID 1ZW6A 3M8KA 2FEMA 3OEHA 3B8EA 3OP4A 2FP4B 4FEYA 1YUBA 3PIIA 4FMCF 4LNUA 4EMBA 1HQKA 2NZWA 1GYRA 2PX4A 1DAOA 3L1VA 3QNMA 2EC5A 3C6QA 4TXHA 1SC4A 4KK4A 1W5TA 3T35A 4DMHA 4G5GA 4YRAA 8GPBA 1IVSA 1D5CA 4AN4A 2Y1OA 3TCKA 2VYCA 2DFTA 5AUNB 4XKJA 5AKEA 1MT3A 1PJCA 4Q4HB 4I6EA 2GLUA 3UB3A 4AO8A 2AXNA 4LYFA 5E7QA 2YV5A 4GOOD 4DLYA 1IN1A 2A1TS 1G21B 4P54A 1TLLA 4RZUA 3TAHA 5JAIA 5ARBA 3U44A 3FTNA 1QK4A 1WETA 1T8RA 4L6AA 3JZMA 4LSMA 3FLAA 1B74A 2P4QA 4EPVA 2IQIA 2YZ2A 3DDCA 3HS3A 3M2TA 3OOEA 3PD7A 3S5JA 1JNYA 4WK0B 3EBPA 2JRLA 2OBMA 3N0RA 1E2IA 4DIMA 3HCFA 1OFTA 3L7NA 1C8KA 4YJGB 3T3GA 4KR0A 5A4KA 4DLRA 3W5VA 4UBMA 3JQ8A 4XCQA 1GTVA 3H19A 5F9MA 2D8AA 4BVLA 4ER5A 1UWKA 4ZJUA 2FPGB 4ZQFA 1MV8A 3IE2A 4O4JA 2XTNA 4AZTA 4Y6PA 4CLRB 1R0RE 1YK1A 2BKEA 3T5CA 2PT7A 1E6MA 3ZYCA 4DY4A 1O5TA 4E2FA 2A4KA 3O84A 3NTRA 2WWWA 3A11A 5HA5A 2B1GA 1MEEA 3UJ3X 3OZWA 4DREA 3UGJA 4C43A 4DR7B 2EJUA 3RR2A 3MCZA 1KI4A 5A5GA 4S1VA 3AXSA 1YL7A 4WXEA 1DS6A 1XQ6A 2XUPA 5DXFA 1OIXA 3UC9A 3ZUGA 1VPLA 4CDNA 2IOFK 1ZD9A 4I5GA 3R5JA 2X58A 3RBAA 2FG6C 2CZQA 3AC0A 4FYJA 5KWIA 2RI0A 3PDHA 2PUTA 1XOIA 2C20A 4NHOA 1YQUA 4OQ4A 2C77A 3RU9A 1H8EA 1TYEB 3AG5A 3KD2A 4ETMA 4MVJG 5BXYA 3QTLA 4NFLA 3E5RA 4EHNA 3F2IA 4LKOA 2FEOA 2PSHA 4NBNA 4D3XA 5FEUA 2OV8A 1U3CA 2GJ8A 2YHBA 1OFIA 3RKUA 2I2CA 3PJDA 4W6ZA 4TN1A 4DDTA 4E2ZA 1E1CA 3UJHA 3FKSA 3D64A 4EY6A 2IXTA 4Q7KA 3L6EA 1JT2A 4D9JA 1VPWA 4PZZA 1Z38A 5CDFA 3PUZA 5BN3A 1PT7A 2IH5A 1E7MA 1RWWA 4FT2A 4KAXA 2XJ9A 3GDGA 2O8VA 3WIOA 1TUBA 3DT9A 3UHJA 4Q1FA 5C3UA 2O9JA 4Y0AA 4KO2S 5ANRB 1NDQA 1NQVA 1ZRSA 4KV9A 4L57A 4BPRA 1H2WA 3IULA 4HAYA 1VJGA 3SJAA 4E51A 2GFHA 1F2TA 3MOGA 3AL0C 4O2LA 2ZT7A 3IEXA 2VA8A 1H6BA 1BG6A 1L7MA 1NKSA 3HUFA 3ZY4A 4PV7A 3N2KA 1U2QA 3QY0A 4FMDB 4PXAA 2W2QA 4MV4A 2NTVA 4WLFA 5BRAA 2XVMA 4A82A 4LFAB 3HJUA 2B61A 2O8CB 4HAIA 3CCBA 1JIJA 1ZBDA 2FMFA 4TLEA 4O4IB 1LI7A 1SPXA 1FY2A 1I10A 2CMDA 2V7WA 2BR5A 2FCRA 1CG6A 3NGLA 3ORQA 2I7VA 4IEFB 4TQAA 3WBJA 1GIAA 3OSUA 4QYIA 1DLIA 2OYSA 1V11A 4MUXA 3HB4X 2FWRA 4RZQA 4TYMA 1V7PC 1OZFA 4IIYA 3IMKA 1PWEA 3D7LA 4JLOA 1EXNA 2ECOA 4GNRA