5KHOC

Rasip1 ra domain in complex with rap1b
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
167
structure length
165
Chain Sequence
MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAGTFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDLEDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Dimeric Rasip1 RA Domain Recognition of the Ras Subfamily of GTP-Binding Proteins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Ras-interacting protein 1
total genus 47
structure length 165
sequence length 167
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5khoC00
1A4RA 1OT3A 3GLGA 1R0XA 2BBSA 3RC3A 5FR2A 1S2MA 2GJAA 1JXMA 1E9RA 1F2TA 3EC1A 3ZZUA 3I8SA 1Z8FA 4QNMA 4QBFA 3L43A 2L0XA 1TF7A 4YDSA 1CJMA 2EWWA 1TUIA 3A1TA 3R7WA 2KB0A 4KFSA 2IUUA 1J8YF 3SYNA 2XJ9A 4HDCA 3V00A 2GXAA 5HPYB 2BBTA 1GITA 1KY2A 3NHAA 1YZKA 2H8KA 3EIQA 4HSEA 1DAEA 4NYMR 2GF9A 3LA6A 5J47A 4NONA 4UQOA 5J5CA 4LBWA 3UPUA 3LD9A 2IC5A 4US2R 1RVDA 1FMJA 4NCKA 1ZNWA 2ZRGA 3OEED 4ZIRB 2PCJA 4AKIA 1G41A 2QPOA 1NN0A 4JIMA 3TQCA 3KQHA 5F98A 1VYVA 2ZI3A 2ZYWX 4NYJQ 4ON9A 1M74A 1WA5A 5SZJA 4IHQA 2KWIA 2QM8A 3BH7A 4MKIA 3TRFA 2C9CA 3T1TA 3HP1A 3DKPA 4CDGA 2ZRDA 3T1VA 4B43A 4LPKA 3QQ5A 4I1UA 4LCBA 1ZU4A 3ASZA 4EJSC 3LQRA 4WW0A 4A82A 3A1VA 4LJ9A 1BO6A 3FYHA 3N70A 1Q21A 1OV4A 4MYCA 5HZHA 2QAJA 5JS8A 2O8EB 1G64A 2FEOA 3KTAA 2AXPA 1H8EA 1IY2A 4QBGB 3M6AA 1LW7A 3X1WA 2AHOA 3MMPA 3TW8B 2GRJA 2TMKA 1HQYE 1HH4A 3WY9A 5CITA 1NVVQ 2HF8A 4OHZA 4C0KA 2O8CB 3IEVA 1SXJB 5JCZA 4TYQA 3KUCA 2V7QD 3MJHA 3AM1A 1W0JA 4UXHA 3U60B 2JCSA 4BLOA 4UNPA 4ZDKA 1G6OA 1MO3A 1QHXA 2V1XA 1SXJA 1AM4D 1MV5A 1U81A 2CK3D 2VP4A 4RD4A 4MKFA 4Q9IA 3NDBB 1T0JB 2O0JA 1PZNA 4TQ9A 4LJ8A 3N2IA 2GJKA 2ZI9A 2J7KA 2ZJBA 4OK5A 3FWYA 2YYZA 4YMWA 4XWOA 4GMDA 2EFHB 2YNMA 2ZRPA 2ZRCA 1W4BA 3BERA 4BEJA 2J3EA 4DLUA 5TV2A 4RFSB 3VFDA 1CJUC 1QVRA 5FI0B 4F93B 5KSYA 1VYTA 1LS1A 3BWDD 1XEFA 4JLAA 4NCIA 4RFVA 2WM9B 1ELOA 4PPQA 1U2RA 2FSGA 4C4PA 4OQXA 2ZAOA 1VCNA 2XOKD 4URUR 4URWR 1H65A 2ZUBA 4DSNA 4B34A 4AKGA 3K0CC 1MO5A 1XZQA 4GT1A 2Q21A 1KGDA 4U7DA 4JLMA 2CVHA 4B73A 2ZEJA 1IM2A 4ILEA 1X3SA 2Y8EA 4NMMA 3TSOA 1WP9A 1JJVA 1S1CA 3U61B 5EP1A 2O8FA 3KKMA 2A3RA 2J0VA 4U00A 4NE2A 4F38A 3K09A 1M1YE 4DJTA 1N5IA 2AKYA 3NH9A 4A2QA 3AQ4A 3SYKA 1AKYA 1ZM3A 1GKUB 4BFWA 3T12A 3MD0A 1YU9A 4BLSA 3WP0A 2VP5A 1S1MA 5ANRB 3IPYA 1VCMA 4A2PA 1HT1E 3PQCA 4ZV4A 3GLGE 2VQSA 3WNCA 3ETLA 4C3ZA 2ZJAA 3WBKA 1R8SA 1JNYA 3OIVA 4HLCA 2REXB 121PA 4URVR 3TKLA 3ZJYA 2QEQA 5DYIA 2FNAA 2RGNC 4U5XA 4M1YA 5FTNA 2R6GA 2F55A 2WWFA 1CBUA 4XWAA 1XP8A 4MYHA 4MRVA 2X77A 1E9EA 2C98A 1G20E 3KXLA 1XXHB 4MKHA 5CIWA 4Y0AA 3AP1A 3B1VA 4O3MA 1Z47A 3QXSA 4EPWA 3ADKA 5TVKA 3MFYA 1ZAKA 4GOJA 2FFBA 1Z07A 4B48A 5EXPA 2PX0A 2QAGA 4I81A 4ZKEA 4DB2A 5GJCA 1W1WA 4C0JA 2DWQA 5J4LA 4JKIA 4YXWA 4JBYA 3VU9B 3GLFB 1AN0A 4CEIA 2A5DA 2JIZA 4A0FA 3CR7A 2EU8A 3QOFA 5JLJA 2RGAA 4MRNA 4RCZA 4D4MA 4JLPA 2QE7D 1QF9A 5B2ZA 4NCNA 4Q9HA 1FUUA 2W2XA 5DI3B 5LPNA 1QHNA 2BMFA 3EWAA 3KXIA 2G0NA 2B6HA 1FFHA 1TF5A 1N2CE 3CH4B 3IIKA 3QPVA 3DOEA 1EFRD 1SHZA 1ZUNB 4NCJA 3QF7A 4ZDJA 2X19A 3PEUA 4PSAA 3ZVNA 3AVYA 1C4OA 4F4JA 3C7KA 4KBFA 3N2EA 4UNSA 2JLYA 4RD2A 1HE8B 4BWYA 2HLDD 3EZ2A 2A30A 2LCFA 2UZIR 5KU1A 3QG5A 3B1XA 4MYUA 3S1AB 1XPOA 1XTRA 4DB4A 3K09C 2ZSDA 5J4VA 4JBXA 1AQYA 1TQDA 1S0UA 5SZKB 2VHTA 1MABA 2XTMA 3P26A 4QGGA 2XTNA 3AVVA 4C7OB 1P60A 1M7BA 4Y0VA 2BMEA 4M9ZA 4OL0A 2JJ2D 2B92A 1LV7A 1NLFA 3AUYA 2WHXA 3FHOA 4QC2A 2F1IA 5EZ6B 3SFVA 1FP7A 1Q0UA 1P9NA 3KQUA 3BE4A 1X8KA 2GHIA 1DAMA 4BRUA 4KVGA 1YVDA 1RRGA 1UDXA 3EXAA 1ZBDA 2ZRAA 2CLCX 4OYHA 2GF0A 5DYGA 4AG6A 1KKLA 2ODNA 1RJ9B 1OE0A 1FQJA 3A37A 1JR3D 3DO6A 2IUTA 4Z1MA 2IT1A 1FZQA 4ZCLA 3HJNA 1NSFA 3SFZA 1OB5A 2GEDA 2ZR0A 1RFLA 3CW2A 4Q1EA 2DHRA 1F5NA 4B2PA 1F2UA 2XNDD 2HUPA 2ZJ5A 2BJWA 3OAAD 4FWIB 4LYAA 4G0NA 3VR3A 3IIMA 3B1ZA 4D80A 5E3HA 1R5OA 5CDFA 2JLSA 4PHTA 1DTSA 2PJZA 2ZXUA 2DYKA 1E2DA 1M6NA 4CEHA 1Q22A 2J0UA 3CF2A 4L9WA 3AKYA 1OPXA 4TL7A 5FPTA 2ATXA 4G3XA 2YKGA 2ZRNA 3THWA 2ONKA 3Q72A 2ZSEA 3CNOA 4A1FA 2HDNB 3U7FB 4ZDIA 4N0EA 4LDJA 4TT3D 4PZLA 2RAPA 4RZXA 2G9NA 5TMPA 1X1RA 3GLFA 1NRJB 4ACAA 4C0AC 3CM0A 4MGZR 5C4GB 3X1DA 5AJVB 2WICA 2W00A 4LHYA 4B6FA 4A0HA 3U2QA 2YOFA 4HI0E 3DL0A 3AF0A 1U98A 2BM0A 1HYQA 1E2FA 5L3SA 3RLFA 5KUTA 1VG9B 1QHHA 1Z6XA 4JLDA 4W7SA 2OSBA 2CMKA 4DT1A 2W6JD 3PEWA 2OE2A 2W6ID 1T3LA 4TYWA 1HV8A 1J2JA 3KJIA 5F9HA 1NIPA 3CKLA 3C5HA 2AFIE 5G40A 1SGWA 1OXUA 5DH9A 3VR4A 1Z0IA 5LBIA 3P1JA 4KXFB 1VCIA 1JAHA 1ONBA 2HJGA 2FDCA 1W5TA 2ZRBA 2YOGA 2A9KA 3NBXX 4RY2A 1JQLB 2WBLC 4GBMA 4QRHA 2QMHA 2PL3A 1B23P 3AF1A 1ZIPA 3BH0A 1UFQA 2MSCB 3KZ1E 4MA4A 3WP1B 1E1QA 2GAAA 4XSGA 5FL3A 2QBYB 5TB5A 1IOZA 4JL8A 3SE0A 1ZNYA 2VP0A 2FX3A 1YHNA 1IAQA 3GJ5A 4OI0A 2C9OA 5FOWA 2MSEB 4TTQA 4LJYA 5CK5A 3M1IA 2ZUDA 3UANA 5FPHA 2WJGA 3VAAA 3EIEA 3MSXA 2P65A 3VTKA 1M7GA 3OIYA 1PV4A 1XF9A 1G4UR 4B2IA 4HAUA 2IA5A 2RGNA 4FW9A 1AK2A 4Q7KA 1WCV1 4IOJA 2ORWA 3D7MA 2R2AA 4B35A 2JJ2A 3O8CA 4GRAA 2JAQA 1AQUA 4DHEA 1RRPA 1D5CA 4TL6A 1OXTA 2QSYA 1W2HA 4LC1A 4X8LA 2BM1A 3CPHA 3LDAA 1NBME 3T1OA 2DFTA 1SZPA 1E79A 3AUXA 4KSBA 1FMLA 1S9DA 4LX0A 4UNNA 1IN7A 5C18A 1U0HC 3K8YA 3LV8A 4AKHA 5C1BA 1E2IA 4NCHA 2OBNA 1SULA 2FH5B 1ETUA 3P27A 2P6RA 4AI6A 4PPGA 3CNLA 3HPRA 4WIAA 1E9BA 1P75A 4P33A 3OEHD 3L0PA 3LAWA 2H57A 3I3SR 4G5QA 4W5WA 4JLVA 4JLNA 2P67A 2ZVPX 1XDBA 1OFHA 1G21E 2WMOB 1IN4A 3Q9LA 4V0MA 3EASA 2FWRA 1OFIA 3GD7A 4HB4A 4L15A 2QP3A 4R9UC 2XEXA 2G3YA 2OUKA 2KE5A 1TPZA 2YINC 1RKBA 1Q1ZA 2FJUA 3OIUA 4PHGA 4K46A 2GJ9A 5GVRA 1CR1A 4IDPA 4A8JC 4LGMA 2QZ4A 1UPTA 2CJWA 2XZLA 4Q4AB 1PVOA 4OJKA 1J90A 1W2GA 5FPKA 4PR0A 1QG2A 1TQ2A 4E07A 3KQKA 2WVJA 3CZQA 4OQLA 4PAQA 3GMTA 4BGDA 5AJWA 4O2RA 3HU3A 2ZSFA 5BQ5A 1CJKC 1GKYA 4WXPA 1A2KC 3WYAA 4WVFA 2JJ1D 2GCNA 5AUOB 4N1AA 1E2HA 2AD1A 1OF1A 3NG1A 3VX4A 1Z6YA 1ZINA 3F5FA 1U94A 4G1UC 3BD9A 1KI8A 1E94E 4G5GA 3U7EB 1N0UA 3CIOA 3CRMA 5FL7A 4TQUS 1NY6A 1SXJC 3K70B 1EFUA 2OCYC 1ZVQA 2F3RA 4D4JA 3VMFA 2V54A 1HUQA 1Q20A 3GEEA 4D6PA 1ZD8A 3QSYA 1NP6A 4RZ3A 1G3UA 5HCNA 1DE0A 1UBCA 4M1WA 2G77B 4Q03A 3O8DA 4FD2A 3OEEA 5L3SB 3K53A 2DWPA 4C9BA 2DR3A 4FN5A 2JATA 4I4LA 2B21A 4F4CA 4KFRA 2BMJA 1E2NA 3OE7D 2EFEB 4HAVA 4AWXA 3D8BA 1FUKA 4TL9A 3VX3A 1KIMA 5CYPA 3GLIA 5EXTA 5EP3A 5HR5A 3TSWA 5KYKA 1P4SA 4IFEA 2WZQA 3QJYA 2CHQA 3E5HA 4LOAA 4Q48A 4YMVA 4EQ6B 2BDTA 4TZ6A 4NYIQ 2ZPTX 3IGFA 2CEAA 1KO4A 2KI5A 2O52A 1G6HA 3CWQA 1B0UA 4PPFA 1KJWA 1Z28A 3DMDA 1BMFA 2OBLA 2QA5A 4W5HA 1ZD1A 3VU9A 4CEIB 1RE0A 3CR8A 2V7QA 3K0AB 2ZREA 3WNBA 3SJAA 1A5TA 2Z4SA 2PEYA 4AC9A 3BFKA 2XJ4A 3RHFA 3W90A 2ODEA 3SYLA 5EQTA 2D2FA 5AUNB 2RHMA 2RHDA 1QHGA 5JS7A 2O8DA 2J7PD 1KAOA 1Z6TA 1EFHA 2FEMA 2R6DA 5KNCA 4O0MA 2BKUA 3I92A 1KNXA 4A15A 4TMXA 4E03A 4TWZA 1G3IA 4HLUC 5H70A 2QTVB 4JYBA 4LBVA 2OILA 2QSZA 2QT1A 3CF0A 3RAPR 421PA 3C16C 3SR0A 1IN8A 2ZRHA 2IXFA 2QAGC 1LF5A 1SKYE 2C96A 2FA9A 1V43A 1NF3A 4BPBA 2Q3FA 1SKQA 4MITA 4WAUA 2O8FB 3KL4A 2VF7A 5JEEA 2NZJA 3PUVA 4US0R 4B75A 3DM5A 4WOPA 3IIJA 1OJLA 3SDZA 3WRXC 3ICQB 3VNUA 4C2UA 1U99A 2ZR7A 4AY2A 4C2TA 2ZVQX 2AWNA 4MGIR 4GL2A 2K5UA 4TLBA 1PUIA 3DZ8A 5HE9A 3X1ZA 5G3ZA 3ZZ0A 3UKDA 2QNRA 5BN4A 2VPPA 3B1YA 1D2MA 5JBQA 3TR5A 1G7SA 4MDFA 4LV8B 4RJLA 3TLXA 4A8JB 3SJBA 4LYFA 3RRNA 1BYIA 1VG1A 2PCLA 5IDVA 2IHBA 1E6CA 5AK0A 1JPNA 2WJHA 3PUXA 3KKPA 1NMYA 1KK2A 1YRAA 3GEIA 5KPDA 2SHKA 1XTKA 1H8HA 4BASA 2DY1A 2VSXA 5GJBA 1KHTA 2WSSA 2ZUCA 3R9WA 4Q7LA 4H1UA 1EFTA 2HCJB 4I1OA 2ZS8A 2XGJA 3GJ7A 4FIDA 2B7BA 1NVWQ 5H68A 3IO5A 1SXJE 4IDHA 1AJEA 1NY5A 3AVXA 2JASA 3DM9B 3FB4A 2WWWA 5JJLA 5F9FA 1Q1EA 1G18A 5CYOA 4OHYA 4PX9A 2QMUA 5HTKA 4Q9KA 3UATA 1OLOA 2A5YB 5FL7D 5LD2B 4MUBA 4F92B 1GM5A 1TEVA 5DGXA 3VR5A 2ZJ2A 5DHAA 4GP7A 3EAQA 2GBLA 2F1RA 4TLCA 2ZI6A 1JR3E 2RKOA 4ARZB 3CLVA 3MWJA 3C5CA 3GFTA 3O8BA 3C41J 1QVAA 1LTQA 1XU4A 2FMXA 1IXSB 5FBWB 1YKSA 4XTRA 5FUVA 3WHLA 5B57C 2OCAA 4G5SA 1KYIA 2J45A 2W2VA 4B3DA 5IF9A 2JLWA 1R10A 3LLMA 1OFUX 4M9XA 3Q5EA 2FSIA 4GZMA 3BB1A 3WYGA 3AGQA 4Q4HB 3BFXA 3QBTA 4WZBE 3L0OA 3WMGA 2NMVA 1EFCA 4EFNA 1S4QA 4DIEA 4MDEA 4C0LA 1VECA 1VMAA 4B71A 4IVRA 1YJ5A 1ZD9A 2IYTA 1GWNA 2V9PA 4HDOB 4E22A 2HXYA 1XD9A 5DIFA 1JAIA 2FGJA 5FPSA 4PHHA 5FOTA 5IK2A 1YZTA 5D3MA 4OBEA 1E9CA 3OFNA 4RZ2A 4KYIB 4R7ZA 5JECA 1S3GA 1E9SA 2XSZA 3AKDA 1G19A 3KX2A 3B7GA 3CUEF 4TSFA 3PXGA 3B78A 2QENA 1TF2A 1JB1A 1VYUA 2O5VA 3A36A 2GZAA 4AK9A 2C78A 1P9RA 3TSZA 3ZS9A 2DB3A 4EJSA 3NBYC 1E1QD 1N0VC 1W46A 2DFKB 5EZ5A 1DAKA 2ZJ8A 4C0SA 1JXOA 2BJVA 1TQ4A 4Q1FA 1OIWA 2H16A 4LRWA 3ADDA 4PC6A 5JI3E 1MO4A 1F3OA 2FFQA 3JVVA 3NEJA 3IO3A 2HV8A 4LC0A 4DCUA 4UKDA 4FCVA 3RANA 4AIIA 4A36A 1U8AA 2PMKA 3GFOA 3QPUA 1NKSA 4CVNA 2XB4A 1JR6A 2RGXA 2Q9CA 5FOXA 2ZJZA 4D4KA 2ZRFA 2GESA 1F2TB 3EZFA 4ZI3A 1W48A 3GLHE 1T3HA 5JRJA 4IFBA 1E4YA 3AVOA 3CNNA 3RS0A 4Z51A 4XVQA 2O8DB 4QNRA 2NO0A 3DKVA 2C95A 4TLAA 3LFUA 4B2LA 3KFVA 2YWHA 3EW9A 1BS1A 2JLVA 3RS7A 4OI1A 4G01B 4KAXA 4DBLC 3K0EA 4M4SA 3RABA 1ZM9A 1KDPA 1D8TA 1HURA 1T9HA 2NPIA 3A58B 4A0GA 1CIPA 4BQSA 5GADl 5FTMA 1Z63A 4KFUA 3W34A 1Q1BA 1WMSA 2C9YA 1TMKA 3TE6A 1WF3A 4URXR 4EFLA 3PFIA 3FMFA 4PO9A 4Q00A 1JEDA 2CL0X 2RCNA 3GP8A 1G8FA 4PC7A 3NC0C 4DLWA 2IXGA 1GP2A 1MT0A 4NYIR 3RWMB 1KI4A 3VHXA 2DCUA 4HZUB 3ZYCA 1C9KA 2N42A 4RCYA 2YC4C 4JMPA 4IVQA 5EJEA 4X8MA 2GZDA 3FVQA 1MH1A 2EYQA 1Z2CA 4EPVA 2BC9A 2JDIA 4NYMQ 1G4AE 4TYYA 1L8QA 3TK1A 1KMHA 4CT5A 1Y3AA 3FOZA 2I3BA 3WYFA 3QKUA 2CVFA 3ND8A 221PA 2PJRA 1PLKA 2FN4A 4PZZA 1XMJA 1R4AA 4P32A 4P3YA 3EA0A 1NMXA 4DKXA 1BOFA 3FFAA 2YC2C 3O47A 2G0TA 2PZEA 4PC3A 1E0SA 1XEXA 2FFHA 1CU1A 1Z6AA 2EWVA 3BB3A 3EIHA 1N6PA 3H2YA 4EUNA 3THWB 2ZANA 4KHZA 2XAUA 3BH6A 4XJXA 2BBOA 2C04A 5DNYB 3BORA 1NBMD 1GKIA 1XZPA 1L2TA 3UG7A 3NBZC 4PAOA 4KV9A 2ZYVX 4JL5A 4OK3A 1WBBA 2REBA 3RS5A 5FBVB 1KY3A 1YRBA 2W6IA 4OI2A 3GLHB 3IDQA 4FMCF 3FDIA 5AUQA 4EPRA 3SHWA 3IKJA 4XWKA 2ZQ5A 1AA9A 3CPJB 4C0QC 1VHLA 3MUFA 1U9IA 1XMSA 4YDHB 3GCGA 3FKQA 4M9SA 1US8B 5CM8B 3RRZA 3HR8A 2HCBA 4QFMA 1P73A 1ZNXA 2GKSA 5G53C 1UDWA 1QZXA 1Q57A 2MMCA 3RYTC 2VH5R 1R2QA 1U90A 2GA8A 5LB2A 3SI7A 4B3FX 3PUWA 4POAA 3UWOA 1XJCA 2BV3A 4DVGA 1Z06A 3PG5A 1UKYA 2HLDA 1FPMA 1W0KD 2P2LA 3CF6R 3HR7A 5JHGB 4KJZA 4ZKDA 1IXZA 4L8GA 4TYPA 3BOSA 1A2BA 2GJ8A 1MOZA 4IDNA 4S2EA 3W6PA 1NG1A 2LWIA 1XMVA 4JBWA 1EFRA 1J99A 2R6CA 3Q8XB 1LS6A 5CM9C 1VIYA 4V0NA 2XXAA 3FMPB 3LBHA 1KK0A 1UKZA 4Q18A 3OIWA 3KUDA 4LYHA 3EC2A 4GSYA 4Z8XA 3NDPA 1SKYB 3CRW1 4YXWD 1KAGA 2OEPA 4F91B 2NGRA 3AVQA 1XCMA 4N3NA 2OT3B 4CT4B 2XB2A 4DCVA 3VKGA 3U4QB 3EARA 1ZUHA 5DE3A 4KLZA 3CRQA 4ITRC 5F3WB 4RVCA 4JKYA 5KSOA 3GJ8A 4HZIA 4PQRA 1XEXB 1OH8A 2RH5A 2BBWA 2FG5A 2W83A 4QGFA 2XSZD 5DO9A 2C77A 1YZLA 3K9NA 1KSFX 2WSMA 4B32A 1XJ0A 4DLYA 1ESMA 2VO1A 2OAQ1 1E4VA 1U8YA 4CEJA 1GILA 3REGA 3LX5A 1HQCA 1XD8A 1IY1A 2IF2A 3W8RA 1COWD 2EFGA 1KO7A 2EQBA 1E0KA 3KKQA 3R9XA 2AKAB 4LSGA 1NIJA 5BW8A 3U6BA 1AZTA 3ZVRA 4DDWA 1CR0A 1FP6A 3B9PA 3TUIC 4D2IA 5EE0A 4ESVA 1E0AA 3EZ6A 2FE4A 2DBYA 3PUYA 2XNSA 3HWSA 5DSZA 2NZ8A 5BN3A 3W6OA 2IS1A 1K6MA 4DSOA 1NVVR 4QHSA 1M2OB 1FOEB 2GWHA 3B60A 4RKFA 2BMDA 2CE7A 3LVQE 1JALA 1XD2A 1MRSA 4NH0A 4CF7A 2OV2A 4JL6A 4IKEA 1E2JA 1E2EA 1UADA 3SU8A 2WOJA 3DOFA 2CLSA 1AIPA 1E2MA 4BRWA 3FGNA 2WWYA 3AVPA 2PZGA 3IBYA 4HLDA 1N0WA 1KI6B 2QPTA 3NKVA 4M1KA 4R71A 1Q12A 2D74A 1R5NA 2NOAA 2VLIA 4A2WA 3TAUA 4D81A 4F4IA 3RVBA 2J87A 2GCPA 1P2SA 4TSFD 3THYB 1NG9A 2PBRA 2IL1A 4QKQA 1RYFA 2Z0MA 2OESA 1YR6A 3I73A 3GJ3A 2QORA 4B3XA 2AFHE 5IK2D 4EJSB 2RGGA 4G5RA 1N6KA 1HEIA 4RD6A 4AURA 4YMUA 1GIAA 3CO5A 5G41A 3THYA 5KO2A 1F2UB 1MR3F 5HE8A 1MKYA 4F7WA 2Z5FA 2FV8A 1GAJA 1KI6A 2JJ8A 1YR9A 5TDHA 3VNVA 2AX4A 3L0SA 2R44A 3KXKA 2PZFA 4DLSA 5H1YA 2BEJA 2XX3A 2GEUA 4B3CA 2H18A 4GFDA 4LPSA 1FQKA 3LWNA 3SJZA 5CJ2A 3WMEA 2RGEA 3TVDA 5ELXA 1OH6A 1J70A 2QQ0A 2WV9A 5JFGA 2NTYC 1KK3A 1EXMA 1H8ED 3ASYA 2HYDA 4AG5A 5IT5A 1OIVA 1JEEA 1VCOA 2ZROA 2YJTD 5TY0A 4DLTA 1AZSC 1E0JA 3B8HA 2BVNA 5LD2C 1I4LD 4NYJR 1KO8A 3K0SA 1MABB 5EUQB 4OHXA 3LXRA 1KNQA 1AKEA 2J1LA 3DEFA 3G82C 3IPXA 2CHVA 4FCTA 3B5JA 3GJ0A 3U7GA 1G7CA 1LB1B 2HXSA 2GVZC 4M1MA 4DDUA 1T4GA 4LYJA 3ZDQA 4LJ4A 2EYUA 3CRRA 4R98A 3GEHA 3EG5A 2H92A 2FZ4A 2JA1A 1KI2A 4RSGA 4JLKA 4Q1DA 3SHFA 3UIEA 1CR2A 4B3BA 3W5IA 5FBRB 4K8OA 3I5YA 3TUZC 2G1KA 1ZW6A 4LHZA 5CLQA 2GZHA 1P6XA 1UEJA 1K5DA 1ZM4A 3GJXC 3K0FB 3AKEA 2Z43A 2Z83A 2E1RA 2REOA 1E9FA 3SEAA 4HB2A 4LJ6A 1NLYA 3MG9A 4II7A 3PENA 5CK4A 3RS2A 1XWIA 4M8NE 2D4HA 1M7HA 4S35A 3B13B 2GNOA 2WAYA 1LNZA 2UKDA 4DT1B 1DO2A 1EK0A 2QPAA 1O87A 3K9GA 1BYUA 4DWJA 4NZYA 3A4NA 721PA 1DELA 4ERNA 1WQ1R 2ATVA 1YQTA 2P0EA 2QAGB 4TTPA 4LJAA 5D3QA 2ZSBA 1G3RA 4TLDA 1G3QA 3B6EA 3SNHA 3WHKA 5DISB 3EA5A 5JWHA 2KBEA 4DXAA 4XIGS 1YR8A 1ZMXA 2QUZA 4A92A 2JLXA 2GDJA 2VL7A 4P0TA 5UKDA 4NBSA 5BYJA 1XCPA 2ZM5A 2OCPA 2RGBA 3HYTA 3T5GA 1GNPA 3OEHA 1NN1A 5DN6D 2RGDA 1NVUQ 2W0SA 5IRCD 1RYHA 3NC1C 5CB6A 4LUCA 3ICEA 4IJMA 1KSGA 2OHFA 3OE7A 1X8JA 4DCTA 3GJ6A 3CRVA 1YR7A 2VSFA 3X1YA 3ZS8A 3PEVA 4PSKA 5FUXA 4MRSA 4P4SB 1DBSA 5FOSA 1D9ZA 5CDFE 2ZIAA 3QXCA 4HDQB 3AF2A 3EPLA 4PC1A 2WOOA 1TADA 2Q3HA 3GLFE 1R0YA 3U3RA 1E2LA 1KDOA 3QF4A 4QJ4A 5EXSA 2R6AA 1IHUA 3VR6A 4ASUD 821PA 4IOMA 4KFTA 3KB2A 4IVPA 2BWJA 2QG6A 2VHQA 1RJ9A 3FKSA 3U44A 3EPKA 4Q19A 2WWXA 4KCGA 4RZUA 3T35A 4MH0R 1DO0A 4Q9LA 2OFOA 3TJZA 2B8WA 4QM6A 2VHCA 3BGWA 3QUSA 4D0LB 4BEBA 1J8MF 2YWGA 2ZS7A 3TW4A 1I2DA 4HUQA 4GP6A 5HKKA 1A7JA 4HAWA 4M22A 4EPTA 3AV0B 4AD8A 3H1TA 1G1MA 3T06B 1T0HB 5SZHB 1FTSA 2PLFA 4QOSA 4JYCA 4NKRA 1N6IA 4NTZA 3AF3A 5A4JA 2R6FA 4Q7JB 3LXXA 1QG4A 3RWOA 1X86B 2KSQA 2NO6A 5A0FA 1J7KA 4QHYA 4BLTA 1A1VA 1N6RA 1OKKA 1X6VA 5AJZA 1N6LA 3FHCB 3SQWA 3G5UA 2ERXA 2QMOA 1PLLA 1KMHB 3U7HB 3Q7QA 4B47A 2V4ZA 4DIDA 2J0QA 2ZRLA 1KI7A 3ONWA 2CDNA 3V9PA 1GTVA 3BJIC 1W0KA 5JZVA 4PHFA 1E2QA 1RW4A 2XITA 2JLQA 5JJIA 3AB3A 1KSJA 1S9HA 1KMQA 2AR7A 3AGPA 3IQWA 3LVRE 5KNBA 3AP2A 3P32A 2ANCA 3SZRA 3VHLB 3PJRA 4BFSA 1XTSA 3IEUA 5E7JA 2VP9A 4JVMA 2O8BB 1E9AA 1KO1A 5L8VA 1Z83A 1PJRA 1QHIA 3T5DA 2FU5C 1KSHA 4V0KA 2JLZA 4JLJA 4XVRA 1T91A 3DDCA 4C0HA 2QBYA 2QROA 2QM7A 4ZPXA 4P4TA 4PC2A 2O0KA 4A6XA 1OH5A 4JT2A 4Q9JA 3KTAB 1W4RA 4W9MC 5HZKA 4TT3A 5P21A 3NHBA 5E95A 5K8TA 2QTHA 4QHTA 5JRZA 1KO5A 4LY6A 4UXIA 2VYFA 2QP4A 4HZUA 1OH7A 1D2EA 1CS4C 1T8TA 2PLRA 2ODBA 2ZS9A 4R2HA 5AUPB 2GILA 2OBMA 2FPMA 2D06A 4TQAA 4UXJA 3SJCA 4D82A 4XH9B 1NBMA 1P2VA 2LKCA 4QG7A 1CXZA 2FPLA 3M4YA 4X8HA 1O3YA 2ZI7A 5AWFC 5HCIA 1Z08A 2G88A 1SVKA 3H4MA 3U3JA 2JLUA 4LBZA 1D2NA 2WJIA 3KDSE 3PITA 4HLQB 2FGKA 3T61A 3QKRB 3QVVA 2JEOA 5FFMA 1PLJA 1CRPA 3ZZTA 1SVOA 5JHHB 5FBLB 1P72A 2WPDD 2ZETA 3L8ZA 3AP3A 3A4LA 2B8TA 2A78A 4N0DA 2Q3MA 1WRBA 3MRSA 2D2EA 1UKEA 3W3AA 3VKWA 3BC1A 4B6EA 3BS4A 3JZMA 2GJSA 4CYMA 2W6JA 3A1WA 1E99A 1RPZA 3EWSA 1XTJA 1XXHE 3K9HA 2I1VB 3CPEA 2D62A 5KTYA 3PVSA 2R8RA 4BUJA 4I1VA 2F43B 2X8AA 4ZCMA 3Q5DA 4XTCS 4OKSA 1IONA 4FMDF 4FI3C 1GUAA 4GI7A 4HB0A 1DS6A 2W0MA 3SBEA 2G6BA 1ZC4A 3FMIA 3U6KA 4GDFA 5J4YA 2NO1A 4M1TA 3O8RA 4AYTA 1IBRA 3E2IA 1PUJA 1RRCA 2QT0A 1G8YA 3UK6A 1CULC 2ZTSA 1TX4B 3BK7A 4QBHA 5G3YA 1R0WA 4UNRA 4G5OA 2XXAB 1Z0KA 1XB2A 4JSYA 4ACBA 2HJVA 1KDRA 2WIAA 4TTRA 2HT6A 3C4JA 4TLEA 3KJHA 1YZQA 2AK2A 2WWHA 1DAHA 3H86A 3NH6A 1ZNZA 1G5RA 1TTTA 2GAOA 1NJFA 1BKDR 2G1JA 1XEWY 3BAFA 3QXJA 4HYYA 1ZM2A 4LZZA 4DCNA 5JWOA 3ZLJA 4K81B 4HEJA 4MUAA 2OLJA 2HF9A 3U3KA 2Q0HA 1U0LA 2ZE7A 5FH9A 5KDDA 3U5ZB 2FPKA 4TMKA 4LV5B 5H8WA 1CKEA 1JR3A 3REFA 4C7OA 2H5EA 4TL8A 2ZJOA 4LJ5A 1WBDA 2IYQA 2IWHA 4M2LA 5JMTA 1G7TA 4JSTA 2CHGA 3GQBA 4Q5IA 2V55B 3W3ZB 1UBFA 2QRNA 3QBVA 2OCBA 2J9RA 1P2UA 2VP2A 3I61A 4W5JA 2C99A 5L3VA 2ZI5A 5FTLA 2HEIA 2GXQA 4JJKA 3OFND 1FNMA 3BXZA 4CW7A 2IS4A 3LBIA 4RD3A 3A6PC 1QDEA 3RRYA 5KHOC 4D25A 2F6RA 3HU2A 2X2EA 1EX7A 1ANKA 5JEDA 5E7MA 1SVLA 3Q3JB 3QKSA 4TMWA 4A8JA 1TEXA 1W44A 2IW3A 3OAAA 4QM7A 2VEDA 1IXRC 4Q4LA 5JSZA 4QXAA 4AKEA 2YV5A 2IHYA 3WMFA 1Y63A 1KKMA 1T3SA 3C14C 4DLXA 3LW7A 1R5BA 1IY0A 4WBSA 1W47A 2C8VA 3U4QA 5EP4A 2V8OA 3MAAC 1KZ7B 3I4LA 2IUSA 2UVQA 2J5XA 2DFLA 1EESA 4HAYA 4B3GA 4DLZA 2C5LA 2BHRA 2N1BA 2DFNA 3HYRA 3KKOA 4PQFA 2CLDX 4JJZA 4L9SA 4Z54A 1VG0B 3H84A 3UMRA 3TAHA 3ZVMA 1GL6A 2WJJA 1X8LA 1KI3A 1VTKA 4OQMA 4MRPA 2QE7A 1FNNA 1T5IA 4BFTA 1UEIA 4FMBB 4YMSA 5FUYA 3KQLA 3OHMA 4KO8A 4OI4A 4D26A 1XMIA 1MO6A 1HY3A 2AL7A 3RNLA 3LBNA 4Q4JB 5TXGA 1KI9A 4DDVA 5AJYA 1XBTA 1GNRA 1Z3IX 4Q66C 1W36B 3PR1A 1CEEA 4DRZA 2F3TA 4PO8A 2V6JA 2X1VA 1GDDA 4Q01A 3X2SA 2YOHA 3KFXA 2R9VA 3IHWA 1P9WA 1OHHA 2ZITA 1GNQA 4DLVA 2GETA 1P7CA 2QN6A 3QE0A 4BE7B 1WXQA 3M0EA 3AH8A 5AJXA 5BYKA 4EIWA 1II8A 2F43A 3T15A 1UJ2A 1CJTC 4Q47A 1US8A 3R8FA 4NP6A 4Q4JA 1DEKA 2DPXA 3R8CA 1Q1QA 2OAP1 2PT7A 4IRUB 4PSVA 1UM8A 3PUZA 2H17A 2GBLC 2BCGY 3THXA 2P5TB 2FF7A 1G17A 4WZ6A 1F48A 1II0A 3PCRB 4IW3B 5J40A 2IS2A 4M9QA 2HT1A 2EVWX 3GLHA 2X2FA 4FCWA 2PT5A 1SXJD 1G16A 1VIAA 1KI1A 4IDOA 1NN3A 5C4MA 4LK2A 2QMEA 2WJVA 1GOTA 3P4YA 3X1XA 2GXSA 5GJVC 5EUMA 1EX6A 4I99A 1VKJA 2ZI4A 4GPTA 5DI3A 2WWGA 3NEYA 3SS8A 3DVLA 1GFIA 2BOVA 2KBFA 4LHWA 1TL7C 1KJYA 2IWRA 3R9IA 3D6TB 3B9QA 1RC8A 4JLOA 3QEJA 3FTQA 1W7AA 3CX6A 2BEKA 1H8HD 3QIAA 1AS2A 3QI2A 2J46A 1GL9B 2QRZA 3QXXA 3SN6A 3LX8A 5F2EA 3THOA 1T8UA 2PMDA 2FFAA 2BKEA 2ZAMA 3KQNA 1CJVC 4WZAE 2I1QA 2RB4A 4CGZA 5FTJA 2XOKA 1JECA 4BFYA 4DEYA 2OXCA 2IYYA 4XSHA 4ESHA 1DVRA 2VHJA 1W4AA 4Q4AA 4V0OA 4E09A 2NPFA 3IHLA 4Q4HA 4TZ0A 2WIBA 1NLZA 4B44A 5BWMA 1TQ6A 2O8BA 1UBEA 1E1RA 1AGRA 3BIFA 2MSDB 4EPXA 1P62B 3BRWD 2JGNA 3NIBA 1R8QA 5DN6A 2ZRMA 2D7DA 4BFVA 5CLLA 3NWJA 3OESA 3B82A 2N46A 4IXNA 4EAQA 1SVWA 4OQNA 1L7VC 4BFUA 3G0HA 2WKQA 4FWTA 2A2ZA 2ZU6A 2ZYUX 5B58C 1SVMA 3ZGXA 3U3OA 1D6JA 2O8EA 2GTPA 3MCAA 5EP2A 3C8UA 1ZC3A 1KDTA 4DC9A 3AVUA 4URYR 1DG1G 4UJ3A 2Z4RA 1LVGA 1CR4A 1W0JD 4CEJB 2MMGA 2OXRA 2ZE6A 1Z6GA 3NXSA 2J7PA 2CJWB 4A9AA 2NQ2C 2CCGA 4ZI2A 1G291 5EE3A 2AXNA 3WBJA 4NHOA 4PQYA 1IN5A 4R2IA 3TH5A 1Z0AA 3TGPA 2OZEA 4BLPA 1Z5ZA 2J0UB 2NG1A 2WSSD 5AR1A 1CTQA 2PH1A 1FL9A 4YLGA 3ND9A 4JVSB 3WRYC 2J0SA 4BLQA 4U02A 1DAGA 4D0GA 2AN9A 3DZDA 1Z0JA 2P6NA 4XOIA 1KK1A 1N5LA 5CJPA 4D0NA 4X8OA 3EPJA 1LY1A 3I8XA 2WMNB 3K9LA 2GVDC 1GRNA 4Q1AA 3MWLA 2PEZA 5FPYA 5M04A 2ASEA 1K8RA 3B2EA 5A5GA 5CB8A 5D3MB 3AF4A 4PPNA 3F8TA 3K1JA 1BMFD 1FW6A 1II8B 2ZR9A 1DG3A 4PTLA 4Q7MB 2Q9AA 4JVNA 4IXMA 4TN1A 3LQQA 4DEXA 2IX3A 3QVUA 4GOKA 2OFXA 3RS3A 3T1QA 1N6HA 4DDTA 3PIRA 1DARA 4KBGA 4V02A 1AS0A 3CBQA 3DHWC 3Q85A 1OW3B 2W2TA 4OHWA 3TQFA 1JPJA 3SBDA 4US1R 1E1RD 2XZOA 8OHMA 2RGCA 1QHHB 3N5CA 1YZNA 3QPWA 4CIDA 4IDQA 1GRRA 3I62A 1N3BA 1HA3A 2VBCA 1OHHD 1P61B 3IBGA 1EWQA 1ZM7A 1SVIA 2FSFA 4DSTA 2Z6VA 4P4SA 3ZH9B 2IF0A 4LHXA 5LB4A 2D3WA 3VR2A 3NVAA 2CL6X 3IUYA 2P6UA 4GMXA 1HE1C 1KJZA 1NN5A 1P5ZB 1Q3TA 3F3YA 3W5JA 1ZU5A 2JJ1A 4QGHA 621PA 2EFDB 2ODWA 5E4FA 5JSZB 4J0QA 3UG6A 3LH5A 2VA8A 1XTQA 2H1LA 4CEHB 3FHTA 2GK6A 5KDLA 2IXEA 3UMFA 1TU4A 4KITB 1Z29A 2DWOA 1XFAA 4H1VA 4HUTA 4UNQA 3K70D 2GEVA 3EX7C 1ZCAA 3TIFA 3D31A 3A1SA 3V4RA 3ADBA 4PXAA 2OM2A 2QL6A 2AK3A 3R7WB 3ZQJA 4PFSA 3THXB 1E79D 4NL4H 1AS3A 4JLBA 2V1UA 2QI9C 4M1SA 1XXHA 3QY0A 3V4FA 4EKDA 3PEYA 2EFCB 2IEYA 1P2TA 2ONJA 3UMSA 2JLRA 2IYUA 3CX7A 2VP6A 4BLRA 3BB4A 2B7CA 1ZYUA 1W4CA 3QEOA 1M8PA 2CCJA 5K8LA 1IJFA 4KYUA 1L4YA 5BN5A 1R7RA 1UAAA 1W5SA 2NO9A 5FOUA 6Q21A 2ECKA 4UJ5A 4YC7A 1KOFA 1OFTA 4AYXA 4CRWB 3MJRA 1F60A 3TBKA 3CONA 4BECA 3HU1A 4YONB 2F1JA 3KJEA 5EE1A 4DLRA 3ZIAD 4L16A 2A5GA 5IHPA 1E2KA 2ZRKA 4QJ5A 5DLQC 5FI1B 1MRNA 5JJKA 2GXUA 2VTKA 3B85A 4B33A 2E9SA 2J41A 1W36C 3A1UA 3AVWA 2YWEA 5EE9A 1G8PA 1S3SA 3TNFA 2CXXA 5J4HA 2ZRJA 3ZQ6A 2IEZA 1RRFA 4YQFA 2HYIC 3LLUA 4IOLA 4YMTA 1CP2A 2A7QA 1DPFA 1E2PA 4D4LA 4BFZA 1VG8A 4GZLA 4V03A 3WXMA 3R20A 3T34A 2VIIA 1FTNA 1XPUA 5B64A 2ANBA 1LF0A 1ODFA 4EQ6A 2OLKA 3W8NA 2NO7A 3F0TA 3QKSB 3S1AA 1KZGB 2A5JA 2VF8A 4V0ME 3GLIB 1R0ZA 2E87A 1COWA 3IILA 3TVTA 3VQTA 1TNDA 4IEEA 1U9IC 1G5PA 2WWIA 3B1WA 3OF5A 1CF4A 2YHSA 2QU8A 5C2JB 2CNWD 1BIFA 4KODA 1HT2E 4KVAA 1XD2B 3QKRA 2FZLA 4M53A 1E2GA 1G7RA 4O25A 1EWRA 4WA7A 2AD5A 4V0LA 4BZXA 3EPHA 3Q7PA 1HTWA 4XVUA 1G8HA 3TR0A 4L5BA 4GOXA 4BFXA 2C03A 2CNWA 2IYZA 5KPJA 2V3CC 4PZYA 4RKEA 1C1YA 4L4UA 3LNCA 3KJGA 1NNEA 3MWKA 1ZRHA 1N25A 3ZD6A 3HPQA 2CBZA 1E3MA 1K5GA 2YZ2A 1G3MA 1U8ZA 1NJGA 1W49A 4A0RA 3CH5A 1S8FA 3FE2A 2XNDA 1S96A 3OZXA 4XD7D 5FR1A 4OK6A 4ARZA 4DUGA 2YWFA 3A4MA 1CRQA 4C0BA 5C46F 1JJ7A 5TARA 2QQEA 4FINA 3SOPA 4GNKA 2GCOB 5J4KA 1E9DA 4OHVA 2IK8A 3D3QA 4TMVA 4Z8YA 3P20A 4JZKA 1N6NA 2ZU0C 1Q44A 1X1SA 1XTIA 1AGPA 3E1SA 1NVXQ 2FOLA 1OB2A 1GVNB 3K0CA 1Z0DA 5L3QB 1NL3A 2LKDA 3BBPA 2QTFA 4MYTA 4JS0A 1U0JA 2VRWA 3UXMA 3A8TA 1OSNA 3L0IB 4M21A 1G8GA 2F1HA 1NI3A 3WNDA 2ZJYA 1GSIA 4OQFA 4XD7A 1M34E 2WKRA 4HAXA 1OIXA 2NIPA 1Z0FA 3LRPA 2QGNA 4MGKR 4ZCIA 5FTKA 2WPDA 4HLUA 4KI0A 1UKVY 3FMOB 2ZE8A 1QHYA 3TUJC 1WDTA 3HDTA 1GL7A 4JT4A 5K8IA 1G9XA 4CZ2A 4M1OA 3CB4A 2JDID 3KB1A 4FMCB 1DAIA 1ZUIA 4HAZA 4LV6A 4Q1CA 3W9YA 3AEZA 4B76A 4TMTA 4BZQA 2BCJQ 2FSHA 2BIFA 2I4IA 4H9GA 5BXQC 1L4UA 3LY5A 5EXXA 5K8UA 1KTVA 2P3SA 2R65A 3BFVA 4RFSA 1N5KA 3GLGB 1V5WA 2WJYA 1T5LA 4Q1BA 3LO5A 1GG2A 2ERYA 3QXHA 1DAFA 3EZ7A 1VHTA 4AYWA 1OYYA 1UF9A 4QGAA 3CZPA 1T6NA 3LW8A 4HUQB 1UBGA 4QBIA 3K70C 1Q3HA 4Q02A 1E98A 1ESNA 4EFMA 1OXSC 5KOYA 1Z2AA 1XPRA 4M0LA 521PA 4IEIA 1QHSA 3RSLA 3DPUA 4DUGD 2P5SA 1A82A 2WAXA 3JVUA 3QENA 2RMKA 1JQJC 3GPLA 5E7IA 4ZO4A 5DI9A 3U44B 2QGZA 5L3QA 4DSUA 4JVLA 2VSOA 4LHVA 1IQPA 2V6IA 4Z1MD 3AKCA 2O8CA 1XNJA 2GK7A 2J59A 5LDDC 1BH2A 2CL7X 1NMZA 2GCOA 2H7VA 1R6BX 2WKPA 4MGYR 4A6PA 3EZ9A 4DZZA 1TU3A 2F9MA 4P4UA 1DADA 5B30A 3QG1A 2XZPA 4OJQA 3MGCA 3ECCA 2ORIA 1OXVA 1JI0A 4HB3A 2QY9A 4KSCA 4QL3A 3L82B 1GRQA 5KNDA 2XTZA 1FX0A 3SQXA 2F9LA 2F7SA 4MRRA 1JBKA 5KSPA 1Z22A 4HATA 5SZIA 3QKTA 1QRAA 2IYWA 2G83A 4FXPA 3ZIAA 4LJ7A 3I1FA 4PO1A 1SVSA 4PANA 2CE2X 3KKNA 1RZ3A 1XX6A 5JCPA 4URZR 2WTUA 1N5JA 5L3RA 3ZD7A 3PV0A 4NDZA 4ZIRA 4B74A 3ADCA 2IS6A 1WE2A 1OYWA 2W58A 3W6NA 3IQXA 3RC8A 2OG2A 3TMKA 2UZ3A 1SQ5A 2IYSA 5FUWA 3FFBA 2EW1A 3P4XA 2R62A 3AVTA 1I4DD 4LBYA 1GZSA 3QNUA 1ZJ6A 2ZRIA 3RS4A 1ZCBA 2IYXA 3L8YA 3UWKA 4ABYA 2CCKA 3CX8A 4BZPA 5KSZA 5FOVA 3C15C 2D7CA 2YVUA 1EG7A 2OFWA 3CWZA 4RD0A 2OO7A 4NU0A 4ZDWA 3U3MA 1D9XA 2Q9BA 1SHKA 2IYLD 3SC3A 2PX3A 4MQBA 1NKTA 4DCSA 5JWRA 2IBMA 1TUEA 2ORVA 4E5UA 3I72A 3FKSD 1E32A 4TYNA 3E70C 4RD1A 2CK3A 2JIZD 1OXXK 5EE5B 4FMDB 2IYRA 3I32A 4TMZA 1TAGA 4ASUA 1CLUA 1FX0B 3K0FA 3NTUA 5GJWC 1DOAA 3J81k 1E69A 4I1SA 1VPLA 5HKKD 3JZAA 3GJ4A 4LI0A 5FBQB 3RDPA 3RRMA 2VHUA 2O0HA 1I2MA 3NBFA 4C30A 4P31A 1QBKC 1XEWX 3ZVLA 3FPAA 1E96A 2Q6TA 5DHFA 1WB9A 1RIFA 1IJEA 1XRJA 4MKGA 4EPYA 2A5FA 3DMNA 1LFDB 1VDZA 2ZSAA 3RSOA 3GFPA 1NSTA 3QF4B 4EDHA 2IYVA 4IOKA 1IN6A 2AWOA 1EGAA 2C2HA 1YZUA 3MLEA 3I5XA 3VR1A 1ZIOA 1N6OA 4O2LA 3GLIE 4KU4A 2ZYTX 4NPHA 3MWYW 1W36D 1XJQA 1OKKD 4KLNA 2KJQA 4PAMA 4A4DA 1F6BA 2ZE5A 4QJ3A 5KDOA 1P3JA 4WXRA 5JI2E 1G5TA 3K0AA 1ZP6A 1II9A 1YE8A 1XCGB 1I4TD 5CIQA 4LWZA 3VKHA 3L2OB 2QP9X 5GVSA 1YZGA 3H0KA 4Q21A
chains in the Genus database with same CATH superfamily
2G80A 3GLGA 2J3HA 3VR5H 1S2MA 1JHXA 4HRYA 3DEJA 2IH4A 1F2TA 3D6FA 5IJ9B 1PTJC 2ZIZA 5IG2A 3WB0A 2Y0CA 3DAHA 2AJTA 3CUTA 3FCEA 3NDRA 4YASA 2D1YA 5BY2A 2EBHX 5I7EA 2EWWA 4KVZA 4WCFB 2G71A 4CLHA 3A05A 2KB0A 3QE3A 2VSYA 4JR2A 4RIEA 3MMNA 4WHMA 2IUUA 3SYNA 2X86A 1DI0A 3IDFA 3OE4A 4HDCA 1WOMA 4C04A 5HPYB 3IDSA 4XKJA 4IZIA 3FUTA 3KYIB 1EUCB 2FPSA 5JO9A 3ONVA 3VKVA 4NONA 5J47A 3AG6A 1H6BA 2H1RA 4F12A 5DMXA 3LD9A 5ICGA 5E3JA 1ATZA 4C76A 1ECCA 4OBBA 2XUKA 1ZNWA 3OEED 5H0IA 2XDQB 3COYA 4J43A 4W8HA 3WRXA 3KQHA 5EAIA 3TQCA 1VYVA 1Y37A 2ZI3A 2ZYWX 4NYJQ 4PXYA 4ON9A 1M74A 1WA5A 2QDXA 3HI4A 4QU8A 4IHQA 3PNVA 4RANA 4EHHA 2QM8A 4D3FA 1QS0A 3MSCA 4FZJA 4IGAA 3TRFA 4U1RA 4Y18A 3PQFA 4OLHA 1EDOA 4PLGA 2ZM6B 4ENQA 2RHCA 2WDPA 4G84A 4B43A 4DA9A 4RJKA 2VT2A 5KBYA 3QQ5A 3K96A 3KJZA 4LCBA 4M1ZA 3HG7A 4ID3A 2J6IA 1HEUA 3M5CA 4MWEA 4WW0A 3L0BA 3A1VA 4LJ9A 1BO6A 1H94A 4PGHA 4MB0A 5HIJA 4MYCA 5KKAA 4GYWA 2FEOA 3KTAA 2GN4A 2AXPA 4E5KA 4HR7A 4QBGB 2P79A 4GZ5A 2G76A 2ZT8A 1DUVG 3MMPA 5ER6A 3KELA 3EGDA 2CFRA 3DXFA 2HF8A 1AO0A 1K4KA 1PZHA 3O82A 2NU8A 2DQKA 2YVQA 4TYQA 2V7QD 4MV0A 1YFJA 4RPGA 1W0JA 4ZT5A 3HL4A 2QG4A 2RJOA 5IDYA 4RVDA 4S1TA 4GXTA 1QDLB 1MO3A 3WWDA 5CW1A 3B1JA 1QHXA 4N9WA 1SURA 3QE2A 2VP4A 4DREA 1LK0A 4MKFA 1YOVA 3O91A 3VUFA 4C29A 4RTNA 2BLLA 3EGDB 2O0JA 1MOSA 1Q74A 3OKAA 2GO1A 5D7NA 1L8OA 3HRIA 2ZI9A 2APJA 5D7BA 4ZMBA 1JHYA 4WNYA 5FHRA 3HCBA 3WICA 4XWOA 2AVNA 4EY6A 4B5KA 1LV8A 3VYRB 3JQBC 5JXWA 3TXYA 2BP7A 3CS3A 1V8PA 4IIUA 2AOWA 3DQQA 1LK7A 3B89A 2J3EA 1KEUA 4TXLA 3PNBA 1RWVA 4F93B 5EJGA 1U1FA 1RMQA 2G1UA 4EVRA 2FX2A 3IBSA 1J8FA 4PPQA 1PSDA 3OJLA 3CW9A 1U2RA 1N1MA 5HMMA 4W9NC 4BJ3A 5K3FA 3UXYA 5DW0A 1VCNA 4Y9RA 5J2UA 1ZN9A 1H65A 4DGQA 3DV0B 1YHZA 5EGNA 4L50A 1HQKA 5BN4B 4AKGA 3PRJA 5TQVA 1WW8A 1HBJA 2BISA 2XVYA 2WHRA 2NT4A 2X7XA 4J91A 2VRBA 3WLPA 4U7DA 1GEGA 1WWKA 4WZAA 2VNSA 2Q7DA 1IM2A 3HI6A 4ZYYA 1CUVA 1YB1A 4JWTA 4PPYA 3FUXA 2Y8EA 4HQLA 3T7EA 3VZPA 4AS2A 4EKIA 1Z8DA 4M9CA 5HSGA 5DSXA 2WTXA 4FC7A 1UODA 3KP1A 4LRXA 3U61B 3KKMA 3KOXA 4H08A 4U00A 4OXNA 3K09A 4MA0A 1L7BA 3H5IA 1F6DA 3TJMA 1M1YE 1KP9A 3FLEA 4JGBA 1RWBA 4JGGA 4IF4A 1SIOA 3OZDA 3HYSA 4MVJF 5KVSA 3M6IA 4RXTA 2I0FA 3AQ4A 3SYKA 4YRBA 1LBSA 1CHDA 1ZM3A 3MJTA 4G8BA 5TGDA 2BW0A 1T34A 5DYYA 1GLGA 3KJNA 1DWPA 1UJNA 3T12A 2JI9A 2Z9DA 4ZHSA 2VP5A 5AXCA 5LCXA 1XAIA 1TTQB 2AJ8A 3IPYA 3MHTA 1VCMA 4IS3A 4A2PA 4BQRA 2GJ4A 5ISMA 2Y9PB 4ITVA 1J0AA 3C8DA 4CLOA 5JZBA 4ZV4A 3GLGE 3KQPA 2AE2A 3A7DA 4RIFA 4O33A 3WNCA 3VI4B 2PM8A 4GWKA 1BE6A 1C7RA 3FPGA 4Y9TA 5BUQA 3NEAA 5B2FA 1JG6A 1D0IA 1JNYA 1CQXA 1BMTA 1WXIA 3TKLA 3ZHVA 3SZMA 4KB5A 1M2EA 3LY8A 2FWBA 2YJ6A 3OC6A 1X2BA 4M98A 5F1OA 2H3HA 4DNXA 5FTNA 1B42A 2OYCA 2R6GA 4EW3A 1ACMA 3F3SA 1NBIA 4D6YA 4MYHA 3R74A 4BATA 1E9EA 1KORA 3RK1A 2ABWA 4R6WA 4FS8A 1U2TA 4Y0AA 3RJMA 5C5IA 4E46A 3UPTA 1WBJB 4ESEA 3LP5A 2RHRA 3VPHA 3V5NA 4X97A 3UH0A 3HJUA 3OHSX 5E2BA 3UW1A 3H8WA 4BPRA 4F3YA 2R48A 4U2FA 5FWNA 3IAM1 2XVXA 3WDSA 1FS5A 1LNQA 2PX0A 4DB2A 4UAGA 2YV4A 1XLVA 4KFCA 4EELA 3K1AB 2PGAA 3ABRB 5EJ2A 4LXUA 4N5NA 4C0JA 5I3ZA 1UBUS 2XTAA 4CNQA 4YXWA 1TM5E 3RUPA 3SXJA 3GLFB 1VRCA 3ZI7A 5MN4A 3Q7IA 4A0FA 4TXHA 3QOFA 4D43A 1NR7A 1LPMA 4RQTA 4RCZA 3UWMA 2MCFA 2QXYA 2BYTA 4W9RA 5BMVA 5LPNA 1CZHA 1N2CE 2ZQYA 3IIKA 2JCBA 1ADCA 1M2NA 3QIVA 3QVWA 4MRMB 1KE2A 3RR2A 4XQCA 1AQJA 2P6OA 3LXMA 2Z2IA 1K4MA 2JVIA 4U8HA 3ZW9A 3UWDA 5EOVA 3BX1A 2ZAYA 5H3CA 4CQMB 5LLTA 3ZVNA 4F4JA 4PG5A 3AHIA 3C7KA 3FOWA 3N2EA 3ZGOA 2AG1A 2ZSHA 5AM5A 1HE8B 1JU9A 2AE1A 3IP3A 4RZHA 4DQ0A 1D8AA 2PK3A 3UA3A 3ZV7A 3GYGA 2ZIUB 1A9SA 3QG5A 4JX9A 2GSWA 1DC5A 1R6DA 3Q40A 4PSUA 5AI8A 3WGLA 3K09C 1VB3A 4Q37A 3O83A 1AQYA 2H7XA 5TPWB 2N0SA 3ORHA 2VHTA 3I9V6 4QGGA 1EJ2A 4AZ3A 2FWIA 1WLSA 3AVVA 3K1TA 3FVRA 3O90A 5EHGA 4LQ4A 1CY4A 3HNRA 1PR6A 4ND3A 4DCCA 4UTNA 2V74B 2H54A 4X66B 3FHOA 4RH3A 3HKEA 2ZBFA 4X20A 4UBNA 2O2IA 3BE4A 1X8KA 2HRRA 1F9EA 5EQFA 1RRGA 4BKRA 1WMBA 4RZSA 3NBMA 2ZRAA 2CLCX 1YQGA 3MGAA 3HKCA 3UWPA 2QUIA 4G1EB 2HL6A 1MH9A 4BV2A 3HXKA 1P0PA 4ZREA 1OX4B 1LJUA 4TOIA 1JKJB 2ODNA 4C07A 4REQB 1OE0A 1FCJA 1GAQA 1MG5A 1RRMA 1LBQA 3OZGA 4RC9A 3DO6A 4NABA 3FCXA 2H4JA 2QTVA 3F6CA 4B46A 4Y2XA 1WKCA 4TV8B 3BXHA 1RFLA 3W5UA 2F64A 3HKBB 4RVHA 2DHRA 3FGZA 1K7YA 1F2UA 3KSDO 2HUPA 2ZJ5A 2BJWA 3MBKA 3OAAD 4NMLA 1DEHA 1N2GA 2BGLA 3IIMA 3SIXA 1EM8A 1E3EA 1RWNA 1DEXA 1JG4A 3P9PA 4D80A 3ZJTA 1V96A 3OSUA 4RHFA 4CIWA 2JLSA 3EDMA 2FQWA 2GD0A 3VO2A 2CF5A 2VWHA 3D9QX 3PTZA 4PHTA 1B1AA 2ZXUA 2QJWA 2X0NA 5C5DA 1V35A 3ZV6A 2WUEA 5K99A 3NEPX 2ZWAA 3O38A 2NZVG 5DHUA 4AMGA 3DZJA 1C41A 4G3XA 4IZHA 2P7IA 4ZO7A 2ONKA 2PUTA 3CNOA 2VUIB 3DP9A 4M55A 3OPNA 1HL3A 5M7EA 1WMDA 1CQPA 4LDJA 4HGYA 5KAPA 1RHQA 2FW7A 3LUCA 3GRPA 4RGBA 2G9NA 4ZZIA 1X1RA 2E3JA 3GLFA 2PX2A 3M70A 3MOGA 3UXEA 1ZQ1A 3IBTA 3NYRA 3UAOA 3G23A 4MGZR 1PYDA 1S2GA 5EWJA 2IPLA 3DD5A 5E1OA 4UFPA 3GLFE 4DV2B 3AY7A 3Q88A 2NZ2A 4Z0NA 3EXIB 2IV7A 2YOFA 4W99A 4RDXA 1RWMA 2QTWB 4MPTA 2KM1A 1PG5A 1E2FA 3QYFA 2NUBA 4P58A 4RSMA 3SHTA 3X1MA 4ECAA 1T9CA 2LIVA 5JO0A 2H7YA 1GCOA 4O4JA 3G8AA 1OI2A 4P9NA 3RLFA 3NM5A 4WK0B 4EF4A 3LVFO 4G86A 3FSRA 4OU5A 2W6JD 3A3NA 3PEWA 3FBWA 4WKNA 3BKWA 1QOQB 1FJGB 2W6ID 4MPRA 3UJ9A 3WNVA 4TYWA 5DP2A 3T9FA 4K9OA 3KB8A 2GZSA 4RTSA 3A31A 1NIPA 3W8FA 4ENSA 2F3PA 1ZRMA 3BF7A 3CQ9A 4MR8B 4NZNA 3H3XA 1SGWA 1OXUA 1R0SA 2CKMA 3OZRA 1Z0IA 4G1MB 4L0CA 4R68A 1RT9A 1L5OA 3O73A 3OO0A 4M38A 1UT8A 5AJTA 1D4AA 4X95A 3SP1A 3C2QA 1O0CA 4CLRB 1W5TA 2ZRBA 3D4PA 1GV1A 1SIWA 3DE6X 4HADA 4Z53A 3ON5A 4O1MA 2XF2A 4N54A 3RVMA 4QRHA 4FKMA 4CIYA 3LQ1A 1J0CA 2RKWA 1XQ1A 2V3WA 3ZD9A 3I58A 3JYQA 4NLLA 3WP1B 1E1QA 2QMQA 5BSHA 5F5NA 2RKBA 1SN7A 3E7DA 3UB2A 4ZYXA 2VP0A 4UE3S 4OI0A 1KXZA 3GJ5A 3VVBA 4Y6SA 1Y89A 5DNWA 1XMOB 1PT9A 5GIOE 2LP4Y 2MSEB 4FSXA 1D4OA 1SB8A 1AKQA 4O4LF 5I4CA 2C4NA 3WIDA 4LQLA 1J5PA 1L9XA 2B5VA 3EIEA 3MSXA 5AMXA 5FNVA 2JL1A 4RU1A 2HM7A 4FW8A 1J24A 1L7DA 4IZOA 1PVDA 5A2QA 1IXYA 4U2DA 4E31A 5L7TA 1TK9A 2IA5A 2W90A 1E59A 4Q7KA 5FJJA 1GGEA 3O8CA 4GRAA 3OF2A 4LXQA 1D6NA 3T94A 4F7DA 5FO1A 1EU1A 5CT6A 4DHEA 1D5CA 1WEKA 2BMAA 4D9BA 3NOOA 3TI7A 5LXTA 4OATA 5DIZA 5JQGA 1OLXB 2AV6A 2GN0A 3CPHA 3C6MA 4IUYA 3T1OA 4NBWA 1SZPA 4LDQA 5DTJA 3MTGA 4EX7A 1FMLA 3HJTA 4X60A 2UUPA 5C18A 1T6YA 3LV8A 4HMPA 4TUYB 4XB1A 2VSNA 5C1BA 1WS6A 4OHCA 3ZE2B 3A2NA 3V7YA 1DINA 1ETUA 4UFNA 5J1TB 4N7BA 2P6RA 1Q0SA 3IUBA 5JQGB 2I29A 4AS3A 1QH0A 1JHQA 1ABEA 2Y1WA 3VPBA 3ZLTA 2JAUA 4M0KA 5C8DA 2R751 1E9BA 4BRZA 3CLRC 3G0IA 3QLTA 3P5BA 3OEHD 3L0PA 4GKAA 1ZW1A 3JWJA 5FULA 1RFGE 3D0QA 3O21A 4B8YA 2ZVPX 1TM3E 2XMDA 5SV2A 3RSGA 4CMKA 3IE1A 1XDUA 4V0MA 3GD7A 4WN9A 2GFQA 3LUAA 1SU8A 4HB4A 1JYFA 2OUKA 4QOFA 1A1SA 1H2ZA 5FNVB 1EM6A 1RKBA 3A4VA 3EIUA 3WO1A 4A8JC 2GTIA 3CA8A 2QZPA 3BJMA 5THQA 5ALYA 3RV3A 3W2TA 1XVUA 4YT4A 3QU7A 2CJWA 1S3FA 4BQIA 2O0LA 1J90A 1W2GA 5DTEA 3ORFA 1KZHA 4B82A 1SD2A 3JQPA 3X2FA 4BV3A 1FMTA 1G20A 1W9HA 4E07A 3CZQA 4OQLA 1PZGA 5HF8A 1RPJA 1ZXBA 2QW0X 1X1AA 2JW5A 1ZGHA 1A76A 2ZSFA 3IP5A 4HH0A 3W2IA 2W93A 3JTMA 3DKKA 2I78A 4WVFA 2IDKA 5AUOB 2GBCA 2HIHA 5K05A 2AD1A 1VPTA 2ZYGA 4RK4A 5I48A 1U94A 3TW6A 2Z6QA 1K2WA 2FEAA 2QRVB 5K03A 2HPVA 3H5VA 1FY2A 1V1JA 3I45A 3N7AA 3KSAC 1ARZA 2HQBA 4G5GA 2PE5A 2F1KA 4GW3A 1VZ2A 1TOAA 3OHPA 1M6VB 4O2BA 4DV0B 1OMOA 2WU8A 4FX2A 1ZVQA 4DMHA 3R6LA 1JFFB 3IV7A 3IAS1 3CR3C 3HBFA 3KWLA 3VMFA 3OIGA 1R1DA 4RZ3A 3UW3A 4ZZ1A 5CVDA 1SBQA 4B45A 2YV2A 3W6ZA 5IJZA 5L3SB 3D3KA 3T8YA 2JATA 3C3KA 2B21A 3ITNA 4KO2S 1F0YA 5AP9A 3A6JA 2JJMA 5KYWA 2BGRA 1GZHB 3I05A 4AWXA 4FOLA 1R50A 3OPYA 3AKZA 1Z2PX 2GLXA 9GPBA 3RS9A 2GPSA 2X22A 4GHWA 3ZY4A 5BOVA 2OV6A 4IIJB 2YTZA 1IPFA 2YXBA 3H65A 1SCBA 2A9VA 2W8ZA 4MS1A 2BTEA 2CHQA 5C8ZA 5K7SA 5LUAA 1UPAA 5ECGC 1OAKA 1U1EA 2UZ0A 3OLVA 4NYIQ 2PFKA 3R5XA 2P30A 3TSAA 3WRYA 2VS1A 4KZKA 4O2BB 1Z0UA 2KI5A 1QK5A 2O52A 2IODA 1B0UA 1I13A 2ET6A 1KJWA 2GYVA 3DMDA 3UYKA 5EJ6A 5LMUB 2OBLA 5ALFA 1QIEA 1V2GA 4QXRA 1ZD1A 4NFHA 1U7XA 2WTAA 5IFKA 5L40A 1PJ8A 1YZYA 3K0AB 3O8NA 4J7CA 2WQZA 1MENA 2DQYA 4RADA 3ONNA 4BGVA 3HY6A 3CE9A 1Y1QA 2HCTA 3BFKA 2XUHA 2LRHA 4IHJB 1QZZA 3OOEA 1TUBB 3TNYA 4F60A 4TS9A 1QH1A 2XE8A 4PCAA 5HFAA 2MYPA 4C4ZA 2QN9A 4F3RA 1G2QA 3ZWAA 1JFLA 1GZ4A 1QHGA 3BE8A 1OA1A 1FTGA 1EK1A 2O5EA 1H3EA 3PX7A 1YU6A 2CMFA 3QOXA 1Y6QA 1OPRA 4LTNA 4TMXA 3QBDA 1FDWA 1ZH0A 4G07A 4YRTA 2OVFA 3LBYA 2QRHA 1FP4A 2PPVA 3DL4A 3CF0A 3RAPR 1QLJA 4YAFA 3NDJA 2P9CA 2QAGC 2BHTA 4CQLB 2Z9BA 3ZBTA 5IEBA 1C3EA 2Q3FA 2PSJA 3V8MA 3KL4A 4QNNA 2NZJA 2QVXX 4US0R 4U7TB 5EZYF 2WJ4A 3QU5A 4WOPA 3IIJA 1OJLA 3MOIA 4ZD6A 1WULS 3SDZA 1I7LA 4CU5A 5JSUA 1H6DA 4C2UA 3E22A 2P2CA 5JFOA 1T9AA 4WXHA 1ZN8A 4TLBA 3FF4A 4YJHB 3RFTA 1WVMA 3X1ZA 2GRUA 4JYMA 2YRFA 4OVKA 5G3ZA 2Q5FA 2G0AA 3B1YA 3ZQKA 1D2MA 3LTNC 1G7SA 2QRGA 4EBBA 3DFIA 4LDAA 1E3DA 3TLXA 1U0SY 3I2HA 4AB1A 1JDTA 4IWNA 1VG1A 1N2BA 3CNBA 4ILKA 1E6CA 2VG8A 5AK0A 2J3DA 5LZ7A 1V8BA 3A3PA 3RUFA 5AVRA 1JHMA 1MLDA 4HS9A 3GCZA 3A26A 5HUHA 3G9XA 1H8HA 3PNMA 2DY1A 4N47A 4QDOA 4Q7LA 1Q92A 4D9GA 1ZPDA 5D87A 5IAOA 3WV4A 2ISSD 1R4NB 4E2WA 3UA4A 1NVWQ 3IO5A 1XZHA 2O20A 3EXEB 4PZUA 2H2FA 5KOHB 1AJEA 5EXEA 1UMKA 2H11A 1XF1A 5HKLA 2BSQA 2GM4A 3K4QA 1M2WA 1QGZA 1BJKA 2O3RA 3DW1X 4QYXA 3V4OA 1ZHHA 4F3KA 3CTPA 4N9QA 5F9FA 5KJ1A 5JJLA 1C8KA 1Z62A 1Q1EA 3H1GA 5CYOA 4EBFA 4XRGA 4JQOA 2VQ3A 4BTVA 2H6EA 1KR5A 2J8ZA 5F76A 1OLOA 4L72A 3VGPA 5HG0A 4MUBA 5A02A 3V4ZA 2ZT7A 2CNOA 3EYAA 5C8YB 4XIYA 1YS4A 2PUVA 4AKTA 5HNKA 2GBLA 2NXNA 4P7JA 4LF6B 1E1CB 1NXTA 1UWLA 2PXAA 3L7OA 2VZ9A 3UK7A 4KPEC 2OXIA 1LUAA 2YJ3A 4OSPA 4AICA 4XJSA 4H1WA 1YAHA 3C5CA 2ODQA 1QVZA 1LTQA 4HVTA 1QM5A 2PD3A 4YRQA 2NXEA 2QSUA 1SBNE 2H65A 3IFSA 1P77A 3EGCA 2NV6A 3E9EA 4L8VA 5B57C 4FM9A 2OCAA 1QTQA 4K6MA 3E03A 1RLTA 4FFVA 1DJPA 2J45A 3DE1X 1AURA 4L8LA 3H1PA 1T4DA 4XFKA 3T0FA 3DFZA 3WRWA 3LLMA 4N48A 1N1EA 4GZMA 4ZI7B 4BNYA 4AQDA 5CFLA 5TF4A 1F14A 3P94A 4EUSA 3OCZA 1E6LA 1FF9A 3GNTA 1J8DA 3C24A 4NS4A 3OE5A 4QGBA 4X1KA 4YIKA 3T54A 3PGLA 1MQ9A 2W6PA 4MS4A 3ND6A 1XTTA 4EFNA 2OL4A 5CHEA 5AHOA 1ZGJA 2Q5EA 1VECA 1L1QA 2YYSA 1JL3A 1YJ5A 2H8GA 2GLUA 3D8SA 3EZNA 3R6GA 4HDOB 4B71A 1AGYA 2R7LA 1K92A 1WSWA 2B2CA 3K1YA 3DPIA 5AVYA 2FDRA 4Q34A 1E3TA 1A9TA 1ABFA 3FZYA 5KJCA 2D2IA 4OBEA 3A1NA 2HSZA 4FHEA 5D3MA 1AF7A 3G8DA 4H7FA 3OFNA 3Q2KA 4RZ2A 1OBVA 1EQUA 2C84A 3V1LA 4R7ZA 2ZFUA 3TXXA 1Z4IA 4WXEA 2NUPA 2JFYA 4OH7A 3HZHA 1QS0B 3CUEF 4DYDA 5BR8B 1M2JA 3A2LA 5CXSA 4YAKA 3IVAA 5AIBA 4OM7A 3OJWA 4K5QA 1L1FA 2QTGA 3U9TA 1JB1A 5HP4A 1I14A 1LQ2A 1VYUA 2O5VA 3A36A 2GZAA 2UZ1A 4CUKA 4YRAA 1LA2A 5I9LA 4DPKA 2B4QA 2DB3A 1VL5A 3I01M 4E1AA 1MPTA 4R2WA 3URMA 1GCIA 2HSWA 5I51A 2O7QA 2UVPB 5EZ5A 1DAKA 4YRZA 5A04A 4XDGA 2Y6VA 4KG7A 4Q3DA 2I22A 3W5AA 1XV5A 1OIWA 2XBLA 4AULA 4LRWA 1NOJA 3JYOA 1UOOA 4PC6A 4CKYA 5JI3E 4RM2A 1O6CA 2P90A 3IO3A 2HV8A 4WT7A 3QE4A 4RO0A 3PDCA 3A4IA 3T5BA 3MTAA 3RANA 4A03A 2VK4A 4AIIA 1U8AA 1J00A 3I9KA 3QPUA 1Q0ZA 4RW0A 3U39A 3WYBA 1M10A 2PA0A 3CLUD 4D6XA 1V4NA 3K9FC 2GESA 3EZFA 3D54D 3DOHA 2O1EA 3GLHE 2FUCA 4C6SA 1ZN7A 5JRJA 1E4YA 3AVOA 3GOHA 3NHRA 4P34A 1C4KA 1XMPA 4XVQA 1AO3A 1ISRA 1EK5A 3JZDA 4QNRA 5ENZA 4B7UA 2JD1A 2C95A 4EMTA 1FMFA 3OOHA 3LFUA 4FU0A 3V8PA 2YWHA 3EW9A 1EVKA 1SK9A 1DV2A 2WYOA 3RS7A 2JLVA 1L5GB 4LXGA 4ZOLA 3RI3A 3TKAA 2NN3C 4OSEA 4PR3A 3ANNA 2GK4A 2G9RA 2ZIWB 3RABA 4PYOA 3CVXA 1D8TA 3B2NA 4GKBA 2NPIA 4Q05A 3O94A 3SLKA 1Z63A 5TJ9A 3TOXA 3W8DA 1EA5A 4DMKA 4TWAA 1YQWA 3AEKB 1TMKA 1WF3A 1RCFA 3GAFA 3F3KA 3W0LB 2HA6A 4DJEC 2XE6A 1PWYE 1CUWA 5C34B 1YDEA 1G63A 5HK9A 3GOQA 4PLZA 1GP2A 4DABA 1HORA 5ADVA 4HMOA 1SM4A 2O23A 3KB6A 2ID9A 3GT0A 4F9FA 1GZDA 1RWQA 3VHXA 4F1WA 4JP1A 3CZMA 2DCUA 3ZYCA 2PZAA 1XN4A 3NC4A 4PLTA 4RCYA 2D5BA 2YC4C 2C7GA 3L7JA 1B74A 1WABA 2GN6A 4X8MA 3NALA 2OMEA 2WD7A 1MH1A 2EYQA 3WVNA 4BV9A 5F7ZA 4P5PA 4NYMQ 3Q2OA 4UE6A 3ZYZA 4BNTA 4TYYA 1CUHA 1NXXA 5FV7A 3AERB 2C20A 3TK1A 3MS2A 2HGZA 5FFNA 3W79A 2I3BA 3WWPA 3NFYA 5EKXA 4X6XA 3ND8A 4QPPA 221PA 4CM8A 2PJRA 2FN4A 2WVGA 4PZZA 2P8JA 1R4AA 3GA0A 4P3YA 1PD1A 1X9GA 1FP2A 3QU4A 3DVQX 3AESA 4BVGA 2G0TA 3FWPA 1BVYF 4RVFA 3DLIA 3B5EA 3BB3A 5DEIA 2DBQA 1PWHA 2X3FA 3HVRA 1ZHOA 2G5TA 2P5UA 1XU9A 1GT91 3BH6A 3F8WA 3ESYA 2A9FA 4MHSA 1ZD4A 5J43A 5GONA 2BBOA 1I5RA 2C04A 2WB2A 5DNYB 3BORA 3VR4D 5C1PA 3V42A 2QY6A 1Y6JA 1L7OA 1MUUA 4KVFA 2WYVA 4UAVA 2ZIXB 1YULA 2P0YA 3DT9A 3GGOA 2CHFA 3H4VA 4AJJA 4DJAA 3DCJA 1YJ8A 4M36A 1E92A 1HNZB 1ZDMA 3P2KA 1OWMA 4IDBA 2I6QA 1RACA 2AZDA 2COEA 4MW4A 4FMCF 4TLMB 3W9UA 2ETXA 4CL0A 4MV1A 4CR6A 5BSKA 1T3GA 4UTOA 3ANSA 4NEGA 2KX7A 1PEDA 3T9CA 2K6GA 5E1DA 1UJMA 2PWZA 1E60A 2EFYA 2I54A 3MUFA 4KIFA 1U9IA 1XMSA 2A0UA 2O4UX 2RHLA 1I3KA 1RJDA 4ZQGA 3AFMA 4I9FA 1ONPA 4U63A 4CQJA 3BG5A 4DJDC 4QFMA 1P73A 5DNCA 5CH3A 2BFOA 3TTWA 3M9WA 3Q4GA 1Q57A 1CQIB 2VH5R 1MC1A 4WJZA 3SYRA 1R2QA 4QEZA 1TEHA 2WWYA 1C29B 3PDUA 2QRLA 1NX6A 4TROA 4B3FX 4POAA 1LK5A 3WMXA 2PLWA 3OLWA 4XIFA 1L5KA 5LSAA 1RAFA 4MZDA 4YJDA 1X38A 1FPMA 4JP5A 3HU5A 3P2IA 4WGGA 1H5NA 4OHUA 4E2ZA 4ZKDA 5I45A 4ATNA 4GMGA 4L8GA 1A2BA 4O5AA 2ROQA 1KDYA 3CCBA 3W6PA 2LWIA 1XMVA 3FCUB 4JBWA 5CEEA 3AUKA 3EUAA 4MLDA 1J99A 2R6CA 3OUZA 2AZTA 2AI2A 1L6IA 1OAOC 5TEVA 4D8YA 3PC2A 1LBTA 1F4LA 3M2PA 2OP0A 4N41A 2XXAA 2JIBA 4PAWA 4MCHA 3Q7EA 4E5PA 4FGLA 5CX1B 1OI4A 3FLAA 4UCFA 4CFSA 2P4UA 3EC2A 4GSYA 1E4EA 4JJ8A 4UZEA 3NO4A 2W37A 4Z8XA 1WXXA 3P2YA 2D1RA 1C30A 3VH1A 5TNXA 4C22A 2UDPA 1KEWA 2QW1A 4P4NA 1XCMA 2SCUB 1E20A 4UCWA 4L9AA 5J63A 4CT4B 2XB2A 3Q3HA 3E9ZA 2FOXA 2Y76A 5ED4A 3EARA 4KLZA 4A2CA 1SUWA 3CRQA 4ITRC 4CKBA 2I6UA 2YQ4A 4YMLA 5JISA 5KSOA 2R60A 3JQGB 1Z73A 3NV7A 3EVCA 4K88A 1XEXB 5DX1A 1OH8A 1FYDA 2VUHB 3I6ZA 4NZOA 2BBWA 4Q12A 4QGFA 4F1JA 1AZWA 1GN8A 5CFPA 1NW8A 1YZLA 4YP7A 1M1UA 3KYBA 3LPLA 3MRTA 2WSMA 3D0KA 1DXHA 2IGTA 1P6UA 2VO1A 3ZQ4A 3HV2A 3UQYS 5JD5A 2C94A 4QTYA 1DHRA 1G98A 4BVEA 2WU0A 1XD8A 1IY1A 3OU2A 4RK5A 1DJMA 4AW9A 1JPVA 4F86A 4UMFA 1WMAA 1M1YA 4O4HF 1TC1A 4JYZA 1UQRA 2PSHA 4N3BA 5K5EA 4W1QA 1BVUA 4FFWA 4HEQA 3R9XA 1MDFA 2OUIA 3ACBA 4R31A 1X1EA 2RH9B 4D2IA 4X1KB 1AV6A 1H9BA 4L6CA 9ATCA 3TBFA 4PG8A 1RBZA 2DBYA 3HFRA 3ND5A 4ESVA 2E6UX 3PUYA 2XNSA 2A4KA 3PDIA 3HWSA 2RCYA 2ZUWA 3W6OA 2PV7A 2XWSA 4IGIA 1ZVMA 1PR1A 2GK3A 2V6GA 1K6MA 3SXUA 4DSOA 4D3DA 3AG5A 2JZCA 2V3VA 3DZFA 3EK2A 2YFKA 1PT8A 1U4NA 2YN0A 3WB2A 1NASA 3I2KA 3MAGA 1AXRA 3B60A 3T5CA 1X70A 4WLOA 3FBGA 3TLBA 3KYCA 2YW9A 1FYFA 3TW8A 1XD2A 2N1MA 1L5WA 3V2UA 4E12A 4CF7A 1DXOA 2JEYA 4IQ8A 1W52X 1U3VA 4QT4A 2C2MA 1F0NA 1UADA 2DFVA 2PAFA 3PE6A 2O8NA 3DOFA 1H85A 4XASA 4AP5A 2BCEA 2DTEA 3B2QA 2CNDA 1QCZA 2XH8A 3EFEA 3FGNA 3NPAA 4BRWA 1BW9B 4F6RA 3PCTA 1ZR2A 2HK9A 1RJFA 3NDIA 3WI7A 2NP6A 1XZMA 3ZGYA 4HPXB 2PUAA 1D03A 4GXNA 1JYEA 1GQYA 4HGQA 4KH1A 4OOEA 5BOSB 3R3HA 2B3DA 2O3JA 4XFDA 4D81A 5IM4F 5KNBH 3GROA 4HFMA 1VLVA 1SZCA 3BJRA 1SC3A 3R0QA 5DWVA 4F2PA 4QKQA 1IQUA 2Y1EA 3GJ3A 1NMQA 4XR4A 3PC8A 3HHPA 1R0KA 1F5SA 3CPSA 2P68A 1T5TA 1ADFA 3PGVA 1OXKB 5A62A 2A0WA 5KYVA 2ECQA 2VXOA 4YHBA 2NZYA 3VAYA 4KNVA 1F2UB 2AQHA 1PZEA 1FUIA 4I4IA 5K3FB 3IE0A 3ENQA 1XA3A 3ELWA 5AO9A 1DXYA 4XX1A 1GAJA 2JJ8A 3O1IC 2FF5A 3RH0A 3HGMA 2PLNA 2OQRA 2RD2A 1IDOA 5FA5A 1V7ZA 2PBZA 1Y7HA 5LJIA 1UWVA 2XX3A 5H59A 2XUFA 2GEUA 5K8JB 2H18A 4PX3A 2O0MA 3TZCA 4DMFA 4LPSA 5DXJA 5CJ2A 4C03A 4YNBA 1UFOA 1P9OA 2HMVA 2BGNA 2RGEA 2YS7A 3NAQA 1WCIA 2I7VA 4RHTA 4RMHA 3VU0A 2WV9A 3A9UA 2NU9B 5KWVA 3JQDA 5T64A 3F9CA 3WK8A 4H7EA 3O2JA 4ND8B 1OIVA 2PA3A 1VCOA 3VGJA 3EOZA 5TY0A 1UEXC 4KQ1A 4DLTA 1AZSC 1EGHA 4BQFA 3UV7A 5LQUA 3L8GA 5LD2C 5F7OA 3WL6A 4NYJR 2HO4A 4G2NA 4RTLA 3K0SA 4OHXA 3BRWA 2J1LA 2Q2WA 3DAGA 5AVWA 2Y2VA 3G82C 2BSXA 2NAPA 4FCTA 2DAPA 5K8CA 2ZPUA 1R9NA 5HUQA 1CE8B 3B5JA 3QW4B 1F8GA 3RS8A 1G7CA 4V0SA 2CLEB 4DDUA 3WTCA 4DLPA 2EYUA 4U2CA 1XN1A 3EG5A 3OQIB 2H92A 1L5HA 3IEIA 1KI2A 2CF6A 2QN2A 4Q1DA 4N5MA 3RCBA 4RIHA 1CR2A 1OGJA 3UIEA 3W5IA 3HE3A 4K8OA 4ZOEA 2IYFA 3ADOA 4N3GA 2YWXA 3TD6A 1H4SA 3R1IA 1ZW6A 4LHZA 5CLQA 3ZD8A 1UEJA 1E1DA 2OCKA 3HCRA 4ALIA 3GJXC 5B7NA 2Z43A 5C1OA 2CL5A 3NT5A 1E9FA 1N1DA 1THGA 5H83A 1NLYA 3MG9A 4CUJA 5D3KA 4PRZA 1HE3A 3PC4A 1PR5A 2IP2A 2C5BA 4K9DA 3SX0A 1QB7A 2QHXA 3K8OE 1U5BB 2Q6LA 1FRFS 1TVKA 2VDMB 4HQOA 3Q3VA 1PL8A 2UKDA 2C5SA 4DT1B 3WGVA 5CB4B 1EK0A 2QPAA 1LX7A 3GMDA 4UU1A 4I9HA 4NZYA 5EPEA 4CDRA 1A9YA 3LXUX 4MR7A 721PA 3HCWA 4AS1A 3A04A 1JQEA 2ATVA 1YQTA 2P0EA 2ZIFA 2XB8A 4ZOAA 1JTFA 4CMJA 2JKZA 5F23A 2H4YA 2FW0A 3DS8A 3LLVA 4WZZA 1QRUA 5D3QA 4AN1A 4KOAA 2EQ5A 1G3QA 3B6EA 3G3EA 4TLDA 3EA5A 4QUDA 1QVVA 3S3TA 3BHMA 1G66A 3EIOA 7REQB 1YR8A 1X7XA 4ZICA 5ITZA 3T3DA 5KWJA 5KTSA 5J5VA 4MUJA 4PW0A 5EWLA 3RAFC 4P0TA 4KR2A 1KH3A 1DZ3A 3R4VA 4I4NA 4K6OA 2ZM5A 2A6PA 2DUNA 3HYTA 3T5GA 4D9CA 1L7EA 4NFYA 3D4NA 3IAAA 4O4IB 5DM70 2VDWA 3MQ4A 5BQFA 2H06A 2R1VA 3D0RA 1EFVB 3NCTA 3CLTD 5DN6D 2H5LA 4IDAA 4L4RA 4ZAXA 3I9LA 4Y6LA 1X8JA 2QX7A 4DCTA 3CRVA 2VSFA 4KQGA 5JIBA 3PEVA 1JE0A 2FZ5A 2SCUA 4HAIA 3PJEA 5FUXA 1JH9A 5BVGB 1DBSA 2EGHA 3OT5A 1TO2E 3FETA 1EM8B 3EDYA 2CNKA 4H7IA 3EXHA 2F17A 3SZOA 4C21A 5HTOA 3EPLA 2WR8A 3IKVA 2QAIA 2O1XA 3Q11A 1CPYA 1E2LA 4XA8A 3QF4A 4PX2A 3LK6A 1SRQA 4N3AA 4IOMA 1RP1A 1GR1A 3PD0A 4MQUA 3VR6A 4H27A 3KB2A 4OG2A 1LVHA 1VBFA 2I7XA 4EYEA 4RJJA 1SRRA 2YIDA 3QX8A 2X4DA 1RJ9A 4KN6A 3MCVA 4J0FA 2GLTA 1K5PA 3FKSA 2AX3A 2PMFA 4KCGA 3C5WP 4G1CA 4GLBA 4MH0R 3VJLA 1QH8A 4KIJA 1W85B 3P8ZA 4Q9LA 4WN9B 3ZCSA 2OFOA 5KKCA 5LVAA 2B8WA 1TUBA 2ZBEA 1T5BA 1Z7GA 1NU6A 3BGWA 2Z6AA 4QFCA 5IEJA 4BEBA 2PNJA 2YWGA 2ZS7A 1LDNA 2R2GA 2HTEA 4C2BA 2XUPA 4HAWA 3H5RA 2A86A 3L4BC 3D8HA 2R87A 1UWCA 5IF3A 1T0HB 1EXNA 5THKA 4JYCA 1B0PA 2G63A 1OT5A 1H1DA 2RK3A 4NTZA 4EX6A 2JH9A 4MR9A 5A4JA 4LMPA 4R84A 4YQEA 2AOVA 1QG4A 3NAZA 5DM4A 2FN9A 1X86B 3GH1A 3K7EA 4XEUA 3EN0A 1WZ2A 2IBTA 1UZNA 4QHYA 1LXCA 1K9SA 1NT4A 1U1GA 1XE3A 2Q4OA 3QKWA 5MFZA 1XNQB 2ZVJA 5AJZA 1N6LA 1O94D 3OZSA