5KHOC

Rasip1 ra domain in complex with rap1b
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
167
structure length
165
Chain Sequence
MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAGTFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDLEDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Ras-interacting protein 1
publication title Structural Basis of Dimeric Rasip1 RA Domain Recognition of the Ras Subfamily of GTP-Binding Proteins.
pubmed doi rcsb
source organism Homo sapiens
total genus 47
structure length 165
sequence length 167
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5khoC00
3OAAD 5KSPA 1KZGB 1K6MA 3IIKA 4OI1A 1HQCA 5HKKD 1ZM2A 3PUXA 1E2JA 3BWDD 2GF9A 3W6NA 3F8TA 4FINA 2IYTA 1DAKA 3GLGB 1J8YF 3W9YA 1RIFA 2JDID 4BFZA 3TUIC 2OHFA 2PZEA 3EZ9A 4QNRA 2R6FA 3D8BA 1U94A 2WMOB 4M1SA 1ZYUA 3NDBB 3TUJC 5GVSA 3WYGA 1TTTA 1Q3TA 3NIBA 1G18A 1KY2A 1ZCBA 2B92A 3KJGA 4BASA 2FGJA 4EPTA 1TF5A 3CNOA 1AGPA 4XWOA 3DKVA 1CR1A 1P2VA 1TQ6A 4QXAA 2REOA 3LLUA 4B3CA 4JLVA 4KLNA 2W0SA 4R2HA 3MG9A 3EA5A 4G1UC 4HATA 2ZS9A 5CB8A 4MRVA 2ZE5A 4KV9A 3C41J 5DYGA 4CIDA 3GLFB 2WBLC 3PENA 3WMFA 1OH6A 4PXAA 1GL6A 1QVRA 2AFIE 4A2QA 3K9LA 4EIWA 1W0JD 1NN1A 4X8MA 1E32A 2P6NA 3AP3A 3MD0A 3P27A 1PVOA 3FTQA 4A8JC 1U2RA 2FFAA 3Q7QA 4OHXA 3OE7D 3W8NA 1XWIA 4V02A 5E7IA 1COWA 5SZJA 5G40A 2LWIA 4NE2A 3LNCA 3TH5A 4JLBA 2JLZA 5AUQA 1U8AA 3ICEA 1ELOA 1R0WA 2PMKA 4HB2A 5GJVC 2CNWA 2WWGA 3L2OB 4PC6A 3TAHA 4R2IA 5BYKA 1CJKC 2PJZA 4MKFA 4NCKA 2BJWA 3FYHA 1D5CA 4UXIA 1CU1A 4FCTA 4X8LA 2WJYA 5FI1B 4A15A 1JR6A 3HYTA 2ZM5A 1YHNA 1NKSA 2FH5B 5JSZA 3HWSA 4PR0A 2H18A 1JAIA 1SKYB 1WQ1R 2AR7A 3IQWA 1TPZA 3P4XA 2WV9A 4G5OA 1QF9A 4YMTA 2BMEA 2AX4A 2GXQA 4HLCA 5EZ6B 3HU3A 3BFXA 3EZ6A 3KJHA 4GBMA 4Q4LA 3DEFA 4F7WA 1AQYA 1HV8A 2IUTA 2RMKA 2ZE6A 1XEWX 2ZI6A 4JLPA 3GJ6A 4AKIA 4XWAA 3ZLJA 4MUBA 5CITA 2FFBA 2C77A 1US8A 1E2PA 2CJWB 1GVNB 3VU9A 4MGZR 3W5JA 2EWVA 2F55A 1R10A 4QHTA 4OI4A 4XVUA 4B76A 5DI9A 2I1VB 2IS6A 1Z6TA 2RHMA 3IIJA 2P6UA 1CR0A 1BIFA 1D6JA 4QGAA 1Y63A 3QPVA 3RYTC 2QENA 1KK0A 1X1RA 1RRPA 2WAYA 4FXPA 4W5JA 3VFDA 2DWOA 2GF0A 2YVUA 2NO9A 4DCSA 3QKUA 4HYYA 5EXSA 1SXJA 4TQ9A 5FBLB 1NNEA 4EPYA 1YRBA 3ZZ0A 2VSFA 5FUYA 1W4CA 3K0FA 5P21A 2UVQA 3CB4A 1KI4A 4C0BA 1QHHA 4NCIA 1EFUA 4A0GA 5CDFE 3FE2A 4ON9A 2CE7A 2O5VA 4XSHA 3ZQJA 1VTKA 2ODEA 2X2FA 2EYUA 3U7GA 1CTQA 1SULA 2GEVA 5FFMA 3LW7A 4FCWA 4OQMA 3QKRA 2Q3MA 4LHWA 5FPTA 1X6VA 1Z83A 2XITA 1KJWA 4KODA 3BRWD 3OIVA 3FOZA 3PEYA 3A1WA 1W44A 2E1RA 1QHSA 4MITA 4ARZB 2GZHA 3E2IA 5E3HA 3PJRA 1W7AA 2C98A 3NHBA 4BRWA 1II8B 1OHHA 1ZIPA 2QT0A 1D9ZA 2VH5R 4Q4HA 3VAAA 3PEUA 2C99A 1Z3IX 4FMCF 5SZHB 2BM1A 5KHOC 3QVUA 1P73A 1MO4A 1TF7A 1KOFA 3QPWA 4EUNA 2REXB 1V5WA 4G5RA 1UM8A 3BB3A 4URZR 4D0GA 2XOKD 1YJ5A 2QZ4A 3QKSA 4M1KA 1IY2A 4TLAA 3CRW1 3VR3A 1E2FA 3LVQE 4QBIA 4A2PA 2WZQA 1VCNA 2OCBA 4TT3A 1CBUA 2N46A 4B33A 1J99A 2ZIAA 3IKJA 1RYHA 3FVQA 1WP9A 4L4UA 2O8CB 4PPNA 4RD1A 3W6PA 4F38A 1ZD1A 5JZVA 1Q12A 3B78A 4LGMA 1VECA 1X1SA 2IT1A 4DDTA 1XF9A 1WXQA 3SNHA 2OUKA 1COWD 2ERXA 4O3MA 4EFNA 5L8VA 2WWYA 3CWQA 3T12A 3HP1A 4J0QA 4G5GA 2ODBA 5J4VA 1S8FA 1XZPA 1NVWQ 2BHRA 5DI3A 5KNDA 2O8DB 3VX3A 2OCYC 1PV4A 2C9CA 4M4SA 1OXUA 2F1HA 2FA9A 2JJ2D 4MGYR 4PPFA 5DSZA 3U3KA 5JCPA 2P5SA 3KKMA 2IXEA 2F9MA 4ACBA 3SFZA 2YC4C 4DIEA 3PQCA 4A36A 4I1SA 2DFLA 5AUNB 3CX6A 4AD8A 1A4RA 4DDUA 3GJ3A 1KDTA 2AD1A 3KKOA 2CXXA 3H4MA 1D2EA 2EFEB 1M7GA 4MKGA 4QNMA 1A2BA 1XD9A 2QGNA 3T1TA 4Q1BA 3WY9A 3BH7A 4M2LA 2JIZA 5L3QA 1CRQA 1Z5ZA 3IHWA 1CKEA 4AWXA 4DEXA 1SHZA 4CRWB 1KY3A 3U44A 2WICA 1KO4A 3WHKA 4URVR 2AWNA 3FB4A 1G16A 3GMTA 4ZCIA 4KJZA 4D25A 2Z4RA 1G5PA 4TSFD 3GLIA 2D74A 1JPNA 1Q44A 2HV8A 4IEIA 1YR8A 1AKEA 3GFOA 4FMDF 1ZINA 1E2EA 2BBWA 5KTYA 3T06B 1DADA 4GPTA 2J41A 4TMKA 4BQSA 5FBQB 1X8JA 2RGNC 2ZJBA 2PCLA 3ZIAD 1IM2A 4P4UA 2JLUA 1P6XA 1XTSA 1EESA 2CE2X 5JRZA 2IYRA 1VIAA 4TMWA 1U8ZA 1XTIA 1NSFA 1W36C 3BORA 1KHTA 1E9SA 2ZI5A 1E0AA 5B57C 2DFTA 2NO0A 4XSGA 1AK2A 1OFUX 1N5KA 2IW3A 2VBCA 4D4KA 2QMHA 4NZYA 4TYQA 4U5XA 2FPMA 2HT6A 3DHWC 2ZAOA 3PUZA 2P0EA 4CF7A 1DAGA 1JBKA 2C9OA 3N70A 4MYHA 4W5WA 3RC3A 2V4ZA 3Q5DA 4GT1A 4FMBB 4B6FA 2CCJA 5JSZB 4BLSA 2GK7A 1NJFA 1NVVQ 4Q5IA 4V0MA 2GXAA 4O25A 1EWRA 1E2KA 1O87A 4LZZA 3QXHA 4IRUB 1XPOA 2E9SA 2VP6A 1TQDA 5H1YA 3UMFA 3LBNA 4NYJR 5GJCA 1N6HA 2PLRA 3RDPA 4F93B 2FPKA 4N3NA 2QSYA 2ZRMA 1E2LA 1VG9B 5FBVB 4LHYA 1DO0A 1KNQA 4RVCA 1US8B 2SHKA 3UMSA 1RC8A 2PBRA 2OXCA 5KSYA 1YZQA 2NGRA 1S1CA 1XXHE 3TQFA 1Z0KA 2FEOA 3RS4A 3TSZA 3AF2A 3IBGA 3THYB 3VR4A 3B1XA 2IK8A 1MRSA 1KSJA 1AM4D 4CGZA 1BKDR 2ERYA 4P33A 1G1MA 1E2MA 5EXPA 4CEJA 2UZIR 2NMVA 1OKKA 1E1RA 1XFAA 2ORVA 5K8LA 2WTUA 1A82A 4BPBA 1R8QA 3TMKA 2G83A 4ZIRA 4AURA 4OHZA 5FTKA 1YKSA 2I4IA 1ZUIA 3K0FB 4JS0A 2RGEA 4OQFA 2IUUA 121PA 2IUSA 1SKQA 2ZAMA 3G0HA 1JNYA 4Q03A 1DG3A 1ZMXA 3LLMA 1QHHB 4A8JA 3TK1A 4GFDA 1IOZA 4KCGA 2V55B 4UQOA 5D3QA 3SOPA 3ADDA 5FBWB 3QIAA 2OESA 1HYQA 3J81k 3VNVA 4BFYA 1C1YA 1N2CE 1DTSA 1MR3F 2QMUA 5JBQA 5KNBA 4LDJA 1I4LD 4NCHA 1L2TA 2R44A 1G21E 4B44A 1Z2AA 5LD2B 2JJ8A 3QKRB 5LB4A 1Z0JA 4MRSA 1N0UA 2HF9A 3I1FA 2D2EA 2B7BA 2RHDA 2QG6A 2N1BA 2O8FB 2DR3A 2V3CC 2HDNB 4URUR 4Z54A 2ORWA 3THXA 4Q4HB 4HUQB 3KFVA 5EP1A 5TY0A 1DAFA 3TVTA 2HLDA 1ONBA 2ZJ5A 4KBGA 2JLSA 4B32A 2H7VA 1CRPA 3QKSB 3PXGA 3CRQA 4JLJA 1TF2A 3D31A 3DMDA 4LCBA 2DHRA 4QKQA 4NPHA 1GNQA 2YC2C 1E2QA 1N6LA 4ZI3A 3OZXA 4IXMA 4Q19A 4FIDA 2BOVA 4TMZA 4EDHA 3U61B 4HI0E 5DN6A 4MGIR 4PC2A 1P2TA 4M8NE 1H65A 2BWJA 2J59A 3QENA 4HDQB 3RLFA 3RS2A 1RJ9A 4II7A 3JZMA 4AI6A 3KXLA 2XSZD 3X1YA 4GSYA 4D4MA 3CF0A 3PEWA 1VG1A 1XEXA 2ZTSA 1Z22A 1QG2A 3QXCA 3ZGXA 4V0LA 1N6OA 2OEPA 3K0EA 4B2PA 4GZMA 2G3YA 3R9XA 3OIUA 4ZI2A 3K0SA 1H8EA 3GFTA 5DI3B 1ZBDA 1S9DA 2QORA 4WZ6A 3WRXC 4W5HA 3T1VA 2CHGA 1E0SA 3DPUA 3SBDA 2IBMA 1Z06A 4LSGA 5JS7A 4IKEA 2IYQA 2CHQA 1XCGB 3DL0A 2BKUA 2YHSA 1Q0UA 3KB2A 1FFHA 3W6OA 1FOEB 1G4UR 3EAQA 2VHQA 3EIQA 1R5OA 5F98A 1G17A 3Q8XB 1N3BA 4RD0A 5L3QB 5TMPA 1E2NA 1R0ZA 1CJMA 1BYIA 1PUIA 3U44B 4JLAA 3X1XA 2GBLC 1ZAKA 5AUPB 4POAA 3EIHA 1G64A 6Q21A 1NY5A 1F6BA 2GZAA 2ONKA 3AUYA 3GLIB 2J0VA 4C0SA 4HLQB 4DLVA 2YOHA 5JJIA 1E99A 2MSCB 2R65A 2PT7A 3RS0A 4JVLA 1ZM4A 2WWXA 3DOFA 1XPRA 3ZVMA 2QTHA 4XIGS 2O8BA 4QRHA 2Q6TA 1MO6A 5BQ5A 5FOUA 3TVDA 5A0FA 3SHFA 2DWQA 1F48A 1F5NA 4LJ7A 4WIAA 4A82A 1DAMA 1UDXA 3T34A 1PUJA 3A36A 4JLMA 4PHHA 2RGGA 1E1QD 1IHUA 3LQQA 4L15A 1QRAA 2J46A 2XB2A 2MMCA 2OAP1 3GLHE 1XCPA 3GLGE 3R8CA 4M53A 3U4QA 1F60A 2PH1A 3JZAA 3K9GA 2OXRA 2ZRNA 4NYMQ 2GKSA 4Q9LA 3T35A 1JECA 3U3RA 4P4SA 4D4JA 5BN5A 2ATVA 1HA3A 1JR3D 1P4SA 3ICQB 2GRJA 4IDNA 4CYMA 3P1JA 4TYYA 4E5UA 1CEEA 5KNCA 4ABYA 3BC1A 1NG1A 2ZRJA 1L8QA 1KI8A 4WZBE 3GJ4A 4PHFA 1G41A 3TE6A 4BLPA 1NN5A 4HDOB 1IN7A 1ZNWA 3L82B 4KI0A 2Z5FA 1Z63A 4BRUA 1YZUA 5DH9A 2IS4A 1BH2A 1ZP6A 1NP6A 2BMFA 2FSFA 1N0VC 3R7WA 1YZTA 4BLOA 1P60A 1XEWY 2ZYTX 3NG1A 1XPUA 1JPJA 3REGA 1X8KA 3VKWA 4BGDA 3EPLA 1GRRA 4Q7KA 1PLJA 1T9HA 4TMTA 1N6RA 3ZZTA 1M1YE 2Z0MA 3BJIC 3QJYA 3JVVA 4HUTA 1OIWA 3KQKA 1DPFA 3ZS8A 2QQ0A 2GZDA 3HPQA 1FX0A 1XJ0A 3THWB 1N6IA 3PR1A 1TU3A 2HYIC 4EQ6A 2A5FA 1KYIA 3Q72A 2HJGA 4G0NA 1OFTA 2ZJZA 1E3MA 3TLXA 1B0UA 1RZ3A 5CYOA 3WNCA 1BOFA 5FUWA 4NDZA 3AVUA 2ZJAA 3GJ7A 4ZIRB 2WMNB 3TAUA 2ANCA 4V0OA 2WJIA 3U7EB 1UEJA 2BDTA 4HDCA 2F3TA 4LJ8A 1BYUA 2R2AA 1G5RA 3QSYA 3U60B 3X1WA 4A8JB 3L8YA 4HAYA 4DB2A 3CX7A 4GMDA 3WRYC 4LYHA 1XMSA 3BXZA 5CLLA 1FP7A 2B21A 2C9YA 5FTLA 3PEVA 1FPMA 5G53C 5HE8A 4M9ZA 1WA5A 1T3LA 1QHYA 1JEEA 3IHLA 4G5QA 3BAFA 5IT5A 1R4AA 3OESA 2A2ZA 2J5XA 4US1R 2LKCA 4AY2A 4L5BA 2AWOA 2B8WA 2FFQA 5IK2A 4NBSA 2QQEA 4Z8XA 4YDHB 4IFBA 2VTKA 3QY0A 3KFXA 3EWSA 1G3RA 4HZIA 4IOKA 1W5SA 2NO7A 1E9RA 1FZQA 1G20E 4DCNA 1GUAA 4K81B 1C4OA 5SZIA 4F92B 4Z51A 2ZRLA 1TQ2A 3GJ8A 1ZD8A 4LUCA 4YDSA 3QXXA 3MLEA 2FZLA 3B13B 3RSLA 2Q9BA 5DGXA 4C9BA 4LBWA 4DT1B 1RRFA 1UKVY 2XXAA 1OH8A 4LC0A 1T8TA 3FMIA 4YLGA 2GJSA 4KHZA 1S3GA 5FPSA 3VNUA 2H92A 4IDHA 1NVUQ 1MO3A 1W0KA 4EPWA 5FH9A 2R6AA 1GILA 1L7VC 4XTCS 5FR2A 1OFIA 3KJIA 3CRRA 3OIYA 1IY1A 4XVRA 1OPXA 1U99A 2ZE8A 4LBYA 3IBYA 2QGZA 4TQAA 4JSYA 2FZ4A 4ZDJA 4F4CA 3AP1A 1T4GA 2ANBA 4H1VA 4MRRA 4NH0A 4DSOA 3RC8A 3P32A 3I3SR 3PUYA 3SBEA 2ZYUX 4PZYA 1LV7A 1XEXB 4JLOA 4JLDA 4PPGA 1KK3A 4BLTA 5G3ZA 3QF7A 5IF9A 3LRPA 4OQLA 3RAPR 3UMRA 1N5JA 3ZJYA 2IHBA 4Q7JB 4LBVA 1VCMA 3FHCB 1H8HD 4HLUC 4YMWA 5KDLA 4QFMA 3TW4A 2J0UB 4WA7A 3DO6A 2NOAA 4IEEA 2CMKA 2WHXA 4LK2A 2VP2A 2F43A 2YWEA 4MRPA 4A1FA 3H84A 4DWJA 3W3ZB 4CEIB 3KQNA 4JJZA 2RGAA 2JLRA 5EXXA 1W4RA 5CDFA 1E4YA 2NZJA 3N2EA 2G77B 3RRZA 5EJEA 5KPDA 4U00A 3IIMA 4V0KA 3JVUA 4NONA 5EE3A 1YU9A 1EX7A 1MO5A 1Q22A 4WXRA 5JLJA 1TEXA 4OQXA 4KVAA 1LFDB 3ONWA 4D2IA 1VIYA 3B8HA 4XVQA 2ZREA 621PA 4PANA 2YINC 3K70C 2QN6A 5ANRB 3U7FB 1XJCA 1IN8A 4QGHA 4WVFA 2GESA 1VCOA 3BK7A 3DKPA 4FMCB 4PHTA 1E0KA 1FTNA 1UF9A 3DOEA 1G8PA 1Z0AA 3I92A 1TEVA 3I72A 1SQ5A 5CJ2A 1RPZA 4IW3B 2AD5A 3BH0A 2IS1A 2EU8A 1EFRD 3CW2A 2IEZA 4OHYA 1LY1A 3SZRA 1W47A 2GDJA 2GXSA 3FGNA 3KUDA 1YVDA 1LF5A 2CL0X 2OG2A 2ZRDA 3LQRA 5DIFA 4DKXA 1KI7A 5FR1A 4JKYA 1TX4B 4P32A 4H9GA 4PFSA 721PA 3KDSE 4KFSA 2DYKA 4BLQA 4RZUA 3IEUA 3A1VA 3H2YA 2R8RA 4Q00A 3T5DA 1AIPA 1DAHA 3ZYCA 1ZM9A 5HPYB 1FQKA 3N2IA 2GVZC 3LX5A 3IPXA 1NBMD 4TQUS 3QEJA 5KPJA 1F2TB 2XNDA 1D9XA 3P20A 2ZVPX 1W36D 821PA 4C0JA 1IN4A 3U4QB 2CL7X 1XJQA 2WSSA 3ADCA 1E9DA 4P4SB 5FOXA 4IVQA 3CZPA 2YKGA 4CZ2A 3O8CA 3QQ5A 1M2OB 1S0UA 1ETUA 4R7ZA 1ZNXA 4GNKA 3I73A 1OW3B 4WAUA 4RCYA 4UNNA 3NC1C 4KSCA 4B43A 3TGPA 5BWMA 3MAAC 3ZVLA 1UBEA 3EZFA 1OXVA 1DARA 5FOWA 1ESNA 1F2UA 2GCPA 1ESMA 2Q21A 4Q4JA 4UXJA 3ETLA 3R7WB 4Y0VA 1VYVA 1QG4A 3NHAA 1C9KA 2G6BA 2EYQA 1AS2A 5AWFC 5TARA 3LX8A 2FMXA 2QU8A 1QVAA 4D0NA 4Z1MA 4N0DA 3VQTA 3X1ZA 4UNRA 2O0JA 1IY0A 2GEDA 1OB2A 2PX3A 3B7GA 3GJ5A 3GEHA 5JEDA 2GBLA 3CONA 2IS2A 1AS0A 1W0KD 1CR4A 2BVNA 2Z43A 1FX0B 4HB0A 5J5CA 2D7DA 1OV4A 4P3YA 2QP3A 4I1UA 1PLLA 3KKPA 2PJRA 2Q3FA 4IDOA 2QAGC 5FPYA 4TL9A 5TV2A 2G0NA 3F0TA 2EVWX 2WOOA 5GJWC 4YONB 4D4LA 2ZITA 3CRMA 2GCOA 2WM9B 3SQWA 3NDPA 1IXSB 3GJ0A 2ZR7A 1NIJA 3BH6A 4TLEA 3AF4A 4R98A 3E1SA 1P72A 5H8WA 4LJYA 1W36B 3K8YA 1XU4A 3TR5A 5BXQC 2YOFA 3CLVA 1GP2A 1JXMA 2FSHA 2HCBA 1J2JA 2QI9C 3KUCA 3RRYA 2FN4A 4M1WA 3WMEA 4C0AC 2A7QA 3AVVA 3VR2A 4NYIQ 2ZQ5A 3U3OA 3W5IA 1R0XA 1QBKC 2AK3A 2OFXA 1E9CA 2I1QA 4W9MC 4CT4B 2W6JA 2RB4A 3EX7C 1UKZA 2CNWD 2G1KA 3B2EA 2G0TA 4DC9A 1A2KC 5FPHA 3GFPA 1SVKA 3L0SA 3ZS9A 3ZVRA 1OH5A 4FW9A 3AF1A 1K8RA 3IILA 3HPRA 4DSUA 2QM7A 4C3ZA 4LWZA 1G6OA 1V43A 2ZEJA 4TZ6A 3U6KA 4PQYA 4DLXA 3IGFA 2EW1A 2ZRPA 2XXAB 3AP2A 2LCFA 3SJZA 1N0WA 1G3UA 1S2MA 4UNPA 4ACAA 5KUTA 4D81A 3L0PA 3NC0C 5B58C 3SYLA 1DEKA 3QPUA 2Q0HA 2B8TA 4HAZA 1VPLA 3O8RA 1Z0DA 3G82C 4ZDKA 4LY6A 1KGDA 4AYXA 1ZJ6A 1FMLA 5UKDA 4F4IA 1OIVA 4DB4A 1XXHA 2XNSA 3TRFA 4DUGA 2D06A 2ZU6A 5J4YA 4N1AA 1MV5A 1P2SA 2UZ3A 3WXMA 3M6AA 1BS1A 2W2TA 4JBWA 3SU8A 4EJSC 3EA0A 4XD7A 4GZLA 2A5DA 1Z29A 1FNNA 4Q9JA 2VQSA 3AVYA 1SXJD 2K5UA 4OKSA 1OYWA 5DLQC 2ECKA 3BD9A 1TAGA 2IL1A 4QGGA 4LJAA 2FGKA 3C4JA 2F43B 5HZHA 3QE0A 5B30A 1E79A 4LYJA 5M04A 2BC9A 1GTVA 4BZXA 5BN3A 2VHTA 3SQXA 3CUEF 3ZH9B 3RS7A 1UKYA 1J7KA 4AG5A 4C0KA 1KTVA 3QG1A 3EW9A 4L9SA 1GKIA 1U98A 3MWJA 5IRCD 1JQJC 4B34A 1XNJA 2YWFA 4A0FA 5DISB 4ZKDA 1CF4A 1G4AE 3QG5A 5FOTA 3HYRA 4C0LA 3L0IB 1AQUA 2IXGA 4LJ6A 1RRGA 4RSGA 4Z1MD 3H86A 5KSOA 3T61A 3NTUA 1T5LA 2VP4A 3KZ1E 2H5EA 3Q3JB 2FOLA 1ZCAA 2R6GA 1OHHD 2V6IA 1GRNA 4OHVA 3I5XA 3WBJA 2V1UA 4GOKA 1E6CA 2IF0A 1AS3A 4B3DA 2A3RA 3AGPA 2ZI3A 4JZKA 5FPKA 3KQUA 4GDFA 1Z0IA 5FL7A 2F6RA 2RH5A 3BGWA 4JT4A 4Q01A 3RRMA 1S1MA 2ZETA 2AXPA 4DEYA 4B3GA 3VU9B 2EFDB 4BEJA 1E94E 2D3WA 1E2IA 3CNNA 4DVGA 2AKAB 2ZVQX 2CK3A 2ZRKA 4QM6A 3LO5A 1JJ7A 1NKTA 4L16A 2ZRHA 1PZNA 4DZZA 3PIRA 3QOFA 4TT3D 2QPAA 1TMKA 4ESVA 1P61B 1AN0A 5JJLA 2CLCX 2RGDA 3QI2A 4IHQA 1O3YA 2JGNA 2JJ1A 3R9IA 2ZSBA 3EG5A 4MYTA 2VHJA 1AGRA 4IOLA 5F9FA 1SXJB 3AKYA 3HR7A 1FL9A 3KB1A 4LRWA 4OQNA 2X2EA 1CR2A 4IFEA 4HZUA 1K5DA 4DDWA 1XZQA 4HLUA 4MQBA 2HUPA 3A1TA 2HXSA 1KDPA 2ZU0C 1AZTA 5JI2E 3NWJA 5TB5A 2IYLD 3K0AA 2EFGA 2OM2A 4M1MA 4KSBA 1W1WA 4TTQA 3MGCA 5KOYA 1MKYA 2CLSA 5A4JA 4UJ5A 1FNMA 4Z8YA 5H68A 4JL6A 3B1WA 4YMVA 3GJXC 4EFLA 4WZAE 1J90A 1FMJA 2QMOA 1F2UB 4KO8A 3KKNA 4BUJA 4Q4JB 1KDOA 4GL2A 3FHTA 2FF7A 2ATXA 4YXWA 2ZRGA 1WMSA 2WKPA 2KE5A 5CIWA 4CVNA 1ODFA 2XB4A 3OHMA 4C2UA 2ZI7A 4M9QA 1PLKA 1VG0B 2CCKA 2JIZD 1GZSA 4KFUA 4Q4AA 4BFUA 2QAJA 4PTLA 4NCNA 4F91B 1CJUC 4M9SA 3SN6A 2ZR9A 4QBHA 1CP2A 3VR1A 1KNXA 2D4HA 2O0KA 4FCVA 1TADA 2RGBA 2QM8A 3TR0A 3DM9B 1NJGA 2MSDB 4B35A 4WXPA 3U7HB 3CF6R 1GITA 4KYIB 1E9EA 3IO3A 2OILA 3SYKA 3WP1B 1RYFA 3BFVA 4GI7A 1TL7C 5EE0A 2FSIA 2HEIA 1S3SA 4JVSB 2G9NA 1LTQA 2IC5A 2YV5A 3OEEA 3AVXA 2OBLA 1Q1BA 4Q1CA 1W2HA 4RJLA 3ASYA 5DO9A 5JHGB 4BE7B 3RANA 1CJTC 2FWRA 3AKCA 3LVRE 2IYUA 1E79D 3CRVA 5J4LA 1VCIA 3C16C 1KAOA 3OEHA 1P9RA 2H16A 3O8DA 5TDHA 2BCJQ 4A6XA 2QBYA 4QC2A 2R9VA 3PV0A 4A4DA 2OFOA 4AIIA 1U0HC 4LJ9A 1LS1A 3GLHA 4W7SA 5IHPA 1WE2A 2RGXA 4MRNA 3GLGA 1VKJA 2QEQA 3SHWA 5D3MA 4ERNA 3VR5A 3UPUA 4TN1A 1WF3A 3IUYA 2GJ8A 4BZQA 2ZRFA 3ND8A 3PUWA 1CS4C 5KSZA 4YMUA 5A5GA 3EXAA 4DLYA 2C2HA 1GNPA 2PMDA 2JLYA 1E2GA 1G3IA 4EKDA 1P9WA 3FFAA 4C0QC 1II0A 1XMIA 4C0HA 4LPSA 4URXR 2WJJA 4LI0A 3MCAA 4X8OA 2QT1A 4KITB 3HR8A 2PL3A 3KX2A 4AK9A 4M0LA 4L8GA 3L0OA 3LBIA 2VHCA 5HE9A 3U3JA 3E70C 3AVWA 3DMNA 1RW4A 2X1VA 4C2TA 5E7MA 2IYYA 4RD2A 1SVIA 1XXHB 2A30A 2OSBA 3V00A 2GJAA 1W48A 1JR3E 3V9PA 3H0KA 1BMFA 2J7PA 2QAGA 1R2QA 2D7CA 2DPXA 4MYCA 1EGAA 2OCAA 4D0LB 1R8SA 2A78A 2FV8A 2ZUCA 3TBKA 3V4FA 4E09A 2FJUA 4FWIB 4CW7A 4XWKA 4LV8B 2ZUDA 1OKKD 1E1RD 2B6HA 2CL6X 2ZSFA 4NL4H 2CVHA 2IYXA 3FKSA 4B75A 2PT5A 4BZPA 3VMFA 3I5YA 3OAAA 5G3YA 1L4UA 1HT1E 3Q7PA 3W3AA 1UFQA 1NN0A 2FE4A 5HKKA 2OBNA 3D6TB 4WW0A 2ZE7A 1PJRA 4KXFB 2NTYC 2WSMA 4M1TA 4MA4A 4Q02A 4HB3A 1N25A 5JEEA 5E95A 2W83A 1I2MA 2KBEA 4JVMA 1XX6A 5HCNA 3O8BA 4OI2A 1NF3A 1G8HA 1NMXA 3REFA 4ASUA 2ZXUA 2PCJA 2WPDA 3CPHA 2PZGA 4HAUA 5J4KA 1Y3AA 2QA5A 2WJGA 3UATA 4OJKA 2IF2A 2NG1A 2O0HA 1U9IC 2JLQA 3CWZA 3UG7A 3KJEA 2BEKA 2Q9AA 3B9PA 4BFXA 4JYBA 2HXYA 3SJBA 3AUXA 2JASA 1VG8A 5B64A 1IXRC 3GLFE 2VIIA 1A5TA 1XTRA 2DCUA 3ASZA 4DIDA 2NO1A 1G8GA 2HLDD 2P3SA 4OL0A 2VPPA 2VF7A 3LAWA 4DCVA 2J0QA 1W0JA 4URWR 4AKHA 4LV6A 2C5LA 4BFVA 3OE7A 1ZUNB 2HCJB 2GWHA 2ZJ2A 5J40A 4WOPA 1WBDA 2BM0A 4DSNA 3VR6A 4DCTA 1HE8B 2QROA 2VP0A 1XDBA 5BYJA 4R9UC 2JLVA 3K09C 2QP4A 3QVVA 2LKDA 4KLZA 1YRAA 4Q7MB 4FN5A 3LWNA 2W0MA 4DLWA 2XEXA 4A0HA 1JJVA 4EJSA 5DN6D 5K8TA 4CEJB 3SFVA 1R5BA 2W2XA 1OT3A 4JLNA 3SJCA 1P9NA 3FWYA 3K0CC 2X8AA 2VYFA 3DM5A 4HZUB 1SKYE 1GWNA 2RGNA 4I99A 3SDZA 4DHEA 2IWRA 1CXZA 3I8SA 4HB4A 4RY2A 3A37A 3K0AB 3KTAA 2FEMA 4JMPA 1B23P 1ANKA 1H8ED 3WYFA 1SVLA 1JI0A 5BN4A 4B47A 2QY9A 3ZDQA 3HJNA 3I4LA 3QXSA 3MUFA 4HAWA 2BV3A 5E7JA 5LDDC 3RRNA 1P3JA 5FTJA 4IDPA 3VHXA 1S96A 1G19A 1FTSA 1ZU4A 2QNRA 2PEYA 4TLBA 3SE0A 4I81A 4DJTA 4F4JA 2V8OA 3K53A 5JWRA 3CH5A 1T6NA 2DFNA 4QBGB 3K70B 3AV0B 1KI2A 1M7HA 1VYUA 1CIPA 5FL3A 4PQRA 1P75A 2W58A 3DDCA 3THXB 5EQTA 4B3FX 2O8CA 4IVPA 2NPFA 1N5IA 2VSOA 4Q4AB 4PHGA 2R6DA 4JL5A 5CB6A 1KK2A 4TYWA 3LH5A 1Q3HA 2FG5A 2IHYA 5C4GB 3A8TA 5EUMA 3THOA 3CR8A 3M4YA 1BMFD 1ZNYA 3F3YA 2J7PD 4Q21A 1EK0A 4YMSA 5EUQB 1WRBA 5AJZA 2XX3A 4TWZA 3KQLA 1Z08A 2CEAA 2RCNA 4TMXA 3AF0A 2V9PA 3S1AA 2WKQA 4MGKR 3NH9A 2VRWA 4QL3A 3K9NA 1OYYA 1YE8A 3QEOA 4PAOA 1Z6YA 1NL3A 2O8DA 5CLQA 3K9HA 4TL6A 2GK6A 4ZCMA 1NG9A 2WJVA 1EG7A 1GG2A 3Q9LA 2OV2A 5CM9C 5F2EA 5ELXA 1RJ9B 2GEUA 2KI5A 1DG1G 4EFMA 5EP4A 1L4YA 1G7RA 5EE1A 1N6PA 1KI6A 2J9RA 2QBYB 5B2ZA 1W2GA 2MMGA 1HEIA 4DLZA 1WBBA 4R71A 1KSGA 3ZD7A 2CLDX 2VO1A 3FKQA 4JT2A 4DRZA 5C2JB 5IDVA 3GLHB 1HTWA 3ZQ6A 4HSEA 3AF3A 1GSIA 4PC1A 4ASUD 2XAUA 4OHWA 3U6BA 2WPDD 4UNSA 2XTNA 5D3MB 1LW7A 3MJHA 4DLRA 3I32A 1X86B 2ZYVX 3WP0A 3PG5A 5JI3E 1XMVA 3LDAA 4ZPXA 1VYTA 2ZJYA 1QDEA 4M9XA 4AKGA 4V03A 5J4HA 2QRNA 2IEYA 3FFBA 4H1UA 3EARA 1IQPA 2XOKA 4EPVA 2C03A 2NZ8A 2ZROA 1T8UA 2ZYWX 4CT5A 1GL9B 1GAJA 1T0HB 3TSWA 4A2WA 2KSQA 1G7TA 3EASA 5G41A 1VMAA 2J7KA 3QF4A 1Q20A 3EZ7A 4LYAA 3B60A 1DOAA 1OFHA 1NBME 2A5GA 2DY1A 4IOJA 4O0MA 1NN3A 2WWFA 2J45A 3LBHA 1T91A 4ESHA 4QGFA 2CHVA 4LC1A 4D26A 3C8UA 4PX9A 2YOGA 5FI0B 1Q57A 1E69A 1QHXA 4Q48A 2H1LA 1KO7A 1IJEA 1NI3A 2V54A 3C5HA 4DSTA 4UXHA 2HJVA 2QAGB 2P5TB 1G7SA 4GOJA 3G5UA 3IDQA 5FBRB 2VA8A 2JCSA 3FDIA 1TUIA 2A5JA 4A0RA 1ZM7A 2O8BB 4OBEA 3T1QA 2F7SA 3BS4A 5JJKA 1UKEA 2VP9A 2JJ2A 3VKHA 3B5JA 5FTMA 1D2NA 4C7OA 2BKEA 3NEYA 4C4PA 1Z6GA 2YWHA 2ZRBA 3AKDA 3GP8A 1KDRA 1T5IA 3FHOA 4LBZA 2GAAA 2A5YB 4B2IA 1KO1A 1KMHA 4X8HA 5KDOA 5JMTA 2Z6VA 1S9HA 1NY6A 4BECA 5K8IA 3CZQA 1IJFA 4US2R 2OLKA 1WDTA 3QBTA 4G3XA 5DHFA 1GL7A 3SJAA 3ADKA 1FW6A 4Q1FA 2FU5C 2ZJ8A 3ECCA 4TZ0A 2FNAA 4JIMA 1AA9A 2C95A 3EPJA 3RWOA 4RCZA 5AK0A 4G5SA 1JEDA 4UNQA 1YZGA 4LYFA 1I4TD 3AVOA 1VHTA 4YQFA 2QRZA 2OT3B 1T3SA 5IK2D 3H1TA 3MJRA 5JRJA 1UDWA 4FD2A 3THYA 2EFHB 1TUEA 4TSFA 3FPAA 3TQCA 1E9BA 1MABA 3GEIA 1FUUA 3CO5A 2JAQA 4Q1AA 1K5GA 2YZ2A 1HE1C 3PITA 3MRSA 2ZI4A 2YJTD 4RD3A 5AJWA 5FTNA 1HH4A 1M34E 1T0JB 1IN5A 2QP9X 2NQ2C 2IYWA 4NYIR 2HT1A 1Z47A 2AHOA 2WJHA 1GOTA 3ZIAA 1Z6AA 1RVDA 2ZI9A 3P4YA 4RZ3A 4NU0A 5GJBA 4IDQA 1DS6A 3B82A 1RKBA 2P67A 4QBFA 5HR5A 1YR7A 1KKMA 1ZRHA 4PO1A 1UBGA 2XJ9A 4JL8A 2CBZA 4V0NA 2DBYA 3GD7A 3PCRB 5JFGA 4EQ6B 1DBSA 3ZZUA 3B1YA 4EJSB 4NKRA 3Q85A 2P6RA 4FMDB 1OIXA 5DNYB 4BEBA 5CYPA 2ZRCA 4B71A 2O8FA 4RKFA 4GRAA 1Z8FA 1Z0FA 1XTJA 3KTAB 5LBIA 4EAQA 1Z07A 2FFHA 4KYUA 4HUQA 1MT0A 3EWAA 3CPEA 1EXMA 1OH7A 1DVRA 2OZEA 2WWIA 1JALA 2WAXA 3WNBA 3M1IA 3I8XA 2YWGA 2QUZA 1E96A 1DAEA 2IYZA 4AG6A 1GRQA 4PO9A 5JS8A 3WNDA 4OYHA 4QOSA 1UJ2A 4PO8A 1Q1EA 1E98A 2F1IA 3C14C 3HU2A 3F5FA 3MWYW 1MRNA 1W5TA 1KO8A 1G3MA 2N42A 3U2QA 4IXNA 1U9IA 4JYCA 4MYUA 4RFSA 5AUOB 1OJLA 2Z4SA 1LVGA 1I4DD 3BB4A 1CJVC 1R7RA 3ADBA 1NSTA 2X19A 1SXJE 5E4FA 3D7MA 1N6NA 1R6BX 2OE2A 4Q1DA 2BBSA 2QE7A 4DCUA 2PZFA 4E07A 2F1RA 2GA8A 4DDVA 2VF8A 1MH1A 1EFCA 3SR0A 4E03A 4MKIA 1SVOA 1SZPA 3MWKA 3SI7A 4US0R 2QL6A 1NLYA 3S1AB 4B3XA 3BFKA 1ZC3A 3OF5A 4PQFA 3CR7A 2WIBA 4CEHA 1NVVR 4XTRA 1ZUHA 3L43A 3T5GA 3K09A 2JATA 4S2EA 1G5TA 3UWOA 1W46A 2FPLA 2WVJA 2QSZA 2JLXA 5C4MA 4M22A 3BB1A 1KI6B 1JAHA 1YZLA 3CF2A 4LPKA 1E9FA 4FWTA 1G291 2XNDD 3SEAA 3K0CA 3E5HA 2D2FA 4ZV4A 3RVBA 1A1VA 4A92A 4B2LA 1KO5A 2H17A 5EP3A 1NIPA 3B85A 3P26A 4OK5A 1T3HA 2NPIA 2FDCA 4RKEA 2WSSD 4JSTA 4AC9A 1XTQA 421PA 3CH4B 4AYWA 3VKGA 2G88A 2GXUA 4UKDA 4PAQA 3LD9A 4O2RA 3KQHA 1AJEA 3UWKA 4QJ3A 2BJVA 2XTMA 3BERA 3DVLA 1E4VA 3WHLA 1XTKA 3OIWA 2GTPA 2WOJA 3SS8A 3GQBA 2MSEB 2VHUA 4A9AA 1KJZA 3QF4B 2Q3HA 1GDDA 3AB3A 1P5ZB 1U0JA 2GJ9A 5L3SA 3QXJA 2ZRIA 2Y8EA 3TW8B 2JEOA 3CBQA 1W4AA 4Q18A 4ZCLA 1FP6A 4JBYA 5LB2A 2ODNA 4UJ3A 4PSVA 5F3WB 3QNUA 1GM5A 2C04A 1IONA 3AVPA 4AYTA 4RZXA 2CCGA 4I4LA 2C8VA 2GETA 1NRJB 2XSZA 4JBXA 3OFNA 4XJXA 4TTPA 4MKHA 3FMOB 3NVAA 4LX0A 4MDEA 4D82A 2ODWA 2L0XA 4ZO4A 4B48A 1KSHA 4QHSA 4PSKA 1ZU5A 2WIAA 1W49A 1NLZA 4LOAA 4TLCA 4N0EA 5CK4A 3A1UA 1IBRA 4RD6A 1ZD9A 5JWHA 3I62A 2RKOA 2OAQ1 1D8TA 1G7CA 2EQBA 2W6IA 3AH8A 3LV8A 4FI3C 4NHOA 3TJZA 4A6PA 3MMPA 3ZD6A 4C7OB 3C15C 4JKIA 1KI3A 2IYVA 1MOZA 2AXNA 1KMHB 1KK1A 1NLFA 2BMJA 2GJKA 4EPXA 2QPOA 4DLSA 3FMFA 5DHAA 5CJPA 2O8EA 4O2LA 2HF8A 3PUVA 5GVRA 5C46F 3MFYA 4RD4A 2GHIA 2FSGA 1U90A 3O47A 521PA 1XBTA 4PPQA 2GAOA 3RNLA 1DAIA 1QHGA 2ZSEA 3NBZC 2XGJA 1UPTA 2IXFA 2REBA 4HEJA 4ITRC 4Q1EA 3UXMA 4BFSA 2VP5A 1SVMA 3IQXA 3R20A 1M7BA 3IPYA 1GKYA 2CDNA 1YQTA 2J3EA 2W6JD 3GLIE 1MABB 2OLJA 5HTKA 5L3VA 3THWA 2WKRA 5KDDA 1R5NA 3RS5A 2P2LA 2DFKB 4TYPA 1A7JA 2C78A 2FX3A 4LHXA 5TVKA 4OI0A 2B7CA 2I3BA 3D3QA 5DYIA 5FUXA 2NO6A 1N6KA 2QE7D 3HDTA 1E2HA 2W2VA 3NBXX 4HAXA 5DE3A 5HZKA 1I2DA 4KU4A 5J47A 1Q1QA 1LNZA 1E1QA 1R0YA 8OHMA 2DWPA 4AKEA 3EZ2A 3BIFA 2BMDA 3VTKA 2R6CA 2KWIA 4HAVA 3PVSA 5JWOA 2KB0A 2GVDC 5GADl 2V6JA 1AKYA 1P7CA 4IJMA 4B74A 3VX4A 3NEJA 1KKLA 4DUGD 3PFIA 3IO5A 4NYJQ 1JR3A 3MSXA 1XD2A 1ZVQA 1KI9A 1KI1A 3CPJB 3CX8A 2GCOB 4PSAA 4QHYA 4WBSA 4GP6A 5C18A 1XCMA 1G8YA 3MWLA 2DB3A 221PA 4V0ME 3A58B 2KBFA 1QZXA 1SGWA 4OJQA 2J87A 5AJXA 1U0LA 4XD7D 3FMPB 1LB1B 1UADA 2ZPTX 3QKTA 3NBYC 2O52A 3V4RA 3NH6A 1HUQA 1OXSC 4TL8A 3AGQA 2F1JA 2QTVB 5EP2A 3T15A 2ORIA 5EXTA 1GFIA 1QHIA 1XMJA 2JLWA 4C30A 4Q47A 1XRJA 3WYAA 3UIEA 3B6EA 2PX0A 4ZDWA 4YC7A 1E2DA 4DT1A 3I61A 2VL7A 4KAXA 1IAQA 3GCGA 4MDFA 2YNMA 1P62B 1EFTA 4D80A 4IOMA 2VLIA 5EZ5A 1EFHA 4Q66C 3WMGA 3LW8A 4OK6A 3AQ4A 2IYSA 1JB1A 4QJ4A 5EE5B 4RFSB 3RWMB 5AJYA 4NCJA 2AL7A 1M6NA 2V7QA 2AFHE 1EWQA 4U7DA 5LPNA 4Q7LA 1IXZA 1G8FA 4NP6A 2E87A 4Q9HA 3OFND 5H70A 4GMXA 3CNLA 3CIOA 2XZOA 4PZZA 1XP8A 1U8YA 1J8MF 1Q21A 1JQLB 1S4QA 1LF0A 2EFCB 3U3MA 4RZ2A 4NYMR 1SXJC 2VSXA 2F9LA 1OF1A 5FUVA 3GLFA 1OSNA 2QPTA 2RAPA 3QBVA 2XJ4A 3BBPA 4NMMA 5FL7D 3T1OA 2G1JA 2OFWA 4CEHB 2J0UA 1E9AA 1W4BA 1EX6A 1QHNA 1VDZA 2W6ID 1YZNA 2AKYA 2IWHA 3UANA 4PAMA 2ONJA 2VEDA 2CK3D 4CEIA 3LFUA 1ZNZA 1TNDA 3CKLA 4XH9B 2BBOA 4PC3A 5K8UA 3AVQA 1LS6A 2V1XA 1KMQA 3C7KA 4ILEA 1OLOA 4LJ5A 1X8LA 5LD2C 4M1YA 2JJ1D 1F3OA 4I1OA 5JCZA 4DLUA 3C5CA 1RRCA 3GPLA 1D2MA 3UKDA 2ZS8A 4G01B 1X3SA 2ASEA 3A1SA 4ZKEA 2BBTA 3TNFA 2WWHA 4LJ4A 4MH0R 3CM0A 4PC7A 4OK3A 1RFLA 1ZW6A 5BW8A 4JVNA 1WCV1 4S35A 4TLDA 2PLFA 3W8RA 2ZANA 3LA6A 3LXXA 3LY5A 2OCPA 5EE9A 1UBFA 1XEFA 3N5CA 5L3RA 5KO2A 1BO6A 3QUSA 5L3SB 3DZDA 2GNOA 4DBLC 2YYZA 4M1OA 4XOIA 5AR1A 3IEVA 2JDIA 3X1DA 4K46A 1Z28A 1NMZA 3B1VA 4D6PA 2AK2A 2J1LA 2CJWA 3EC2A 2BIFA 4YXWD 1TQ4A 1G3QA 2PEZA 4DXAA 2IA5A 5CM8B 1SVWA 3R8FA 1M8PA 4BWYA 1RE0A 2J0SA 1G6HA 2RGCA 2BEJA 4TYNA 3LXRA 1UAAA 2QTFA 3K70D 1WB9A 2JA1A 1F2TA 1GKUB 3NBFA 4MUAA 2GCNA 1P2UA 3EPKA 3KXKA 5TXGA 3SC3A 3HU1A 2AN9A 2X77A 3ND9A 3EPHA 3B9QA 3BE4A 3AM1A 4QM7A 5JECA 4BFWA 1TU4A 3UK6A 4CDGA 2XZLA 1H8HA 4QJ5A 1OXXK 1ZIOA 4LHZA 2HYDA 1ZC4A 3R9WA 1J70A 4L9WA 3BOSA 1NMYA 3EIEA 1KSFX 4B73A 4U02A 5KU1A 1KIMA 5JHHB 2ZR0A 4LV5B 4KVGA 3OEED 3AKEA 2ZJOA 1DO2A 4P4TA 4GOXA 4RFVA 2O8EB 1HT2E 1YZKA 2H57A 2Q9CA 4LHVA 2GILA 2OBMA 2ZRAA 1Z2CA 2XZPA 5C1BA 1HQYE 4KFTA 3AEZA 2NIPA 4PZLA 3ZVNA 3OEHD 3RSOA 4QG7A 3A4MA 2OO7A 3W34A 1OE0A 4P0TA 4ARZA 3A4LA 1KZ7B 1II9A 3NKVA 1HURA 4EPRA 3AVTA 1II8A 4KBFA 3KKQA 3GEEA 1CLUA 2QMEA 1EFRA 1GIAA 2BCGY 5CK5A 4B3BA 1FQJA 1UEIA 1IN6A 1XD8A 4I1VA 4BLRA 1NVXQ 1VHLA 4JLKA 2ZUBA 2EWWA 5CIQA 4NTZA 3X2SA 1OXTA 2V7QD 2A9KA 4Y0AA 1Z6XA 5SZKB 1FUKA 2W00A 1G9XA 3UG6A 4DLTA 2H8KA 2D62A 1XB2A 1M74A 3L8ZA 3WBKA 1U81A 4GP7A 3RABA 3NXSA 4B6EA 3A6PC 4TMVA 4TL7A 1KJYA 2R62A 2ZS7A 5FOSA 1DELA 3SYNA 4HLDA 4TTRA 1NBMA 3DZ8A 4K8OA 1OB5A 4IVRA 2F3RA 1E0JA 1N5LA 3KL4A 4M21A 2P65A 3W90A 1GNRA 1KAGA 2KJQA 3TSOA 1YR6A 3U5ZB 5HCIA 3M0EA 4JJKA 4P31A 1DE0A 1SHKA 1ZM3A 2TMKA 2XTZA 1Q1ZA 1JXOA 1XD2B 1YR9A 2CVFA 5KYKA 4Q9IA 5F9HA 2IX3A 3TIFA 1UBCA 5AJVB 2C96A 3EC1A 5FOVA 3B1ZA 4URYR 3TKLA 4BFTA 4Q9KA 3RS3A 2WWWA 1CULC 3TUZC 3VHLB 2Z83A 3Q5EA 3RHFA 2UKDA 4E22A 1SVSA 2ZSDA 3FKSD 3KXIA 4ZDIA 2ZSAA 1AZSC 1HY3A 3K1JA 3A4NA 4KFRA
chains in the Genus database with same CATH superfamily
3OAAD 4TZTA 4KREA 1ZWKA 4A2WA 4DNPA 2QM3A 2W4QA 3AEXA 2C2GA 4Z3OA 1DB3A 4URFA 1E2JA 2V58A 2XQKA 3N7AA 2Q5OA 1Q0PA 1QE0A 2GF9A 4TSRA 1R6AA 3W6NA 1A9SA 3RLIA 1QTQA 2IYTA 3GP3A 2WHQA 4YIKA 4B7ZA 1MX9A 1RYBA 2BGRA 3HWX1 3OTQA 3MRVA 5D3ZA 4BFZA 3TUIC 2IZ5A 1V26A 2TECE 3D8BA 2P5YA 2YTZA 5GVSA 1TTTA 1ZCBA 2H1FA 1Y1RA 3AB8A 2FQ1A 3DLBA 3CNOA 1OU0A 2B1QA 3DKVA 4JFAA 3NASA 1KIFA 4U2EA 5CVCA 4QXAA 1RBZA 2DECA 4KK4A 4EGQA 1JHDA 3EA5A 1WXWA 3MG9A 3JALA 4ML3A 4KO3S 3AHDA 2ZE5A 1HLPA 3GGDA 1M34A 1MX1A 1QIGA 1USVA 5DYGA 4CIDA 1XZCA 3O94A 3FSJX 3TSYA 3H9BA 3WMFA 3WZMA 2P91A 5JPIA 2GN1A 1GL6A 4EELA 5I4KA 1E9VA 3OZCA 4M0PA 3H9EO 4A2CA 4WEOA 4OGLA 2C5HA 3MD0A 3PXCX 1D7OA 1EX9A 4OJYA 4X8MA 4OHCA 1JKFA 4KXNA 3AEKA 2P9JA 2WQ6A 3D7SA 3SZOA 5SY6A 3BREA 5LOVF 2GASA 3CS3A 1OWPA 3OH8A 4E6EA 3KHKA 4NE2A 3VR6D 4E2ZA 1PSWA 4JLBA 4UCWA 1XQ9A 2VK8A 4RENA 2PMKA 2QPLA 3DVRX 4HB2A 4IQFA 1TPYA 1WD5A 2CNWA 1FYDA 4B8WA 5DCWA 3L6RA 4UZFA 4MKFA 1GU7A 4HNAB 2GPTA 3AEUA 4MP3A 1YZFA 3F74A 2WU0A 3FJOA 3G6KA 3NV7A 2NO4A 4NMWA 4ZZ0A 2MINA 2J08A 3JZFA 4D9GA 1ZAYA 4OLBA 2VXOA 2G5TA 3HCFA 1XZNA 4F3NA 3VH2A 3ZDYB 1SEVA 4PR0A 1WQ1R 2AR7A 1Z5UA 3WGOA 2W6ZA 2P30A 3EEQA 1JL3A 1B76A 3U7QA 4HSGA 2LUOA 3I01M 2VF5X 2LDXA 3BFXA 4RH0A 1LJLA 3AT1A 3I39X 2LV8A 1HDOA 3AK4A 1AQYA 5AKXA 4ER5A 2IUTA 2AW5A 2RMKA 1ESCA 2ZT6A 4TS9A 1CZHA 1ULSA 4AKIA 3V1LA 4XWAA 3BE5A 3EGXB 3IP7A 2C77A 1US8A 2G8LA 2Z4TA 3ANLA 4RTMA 1GVNB 3VU9A 3VNQA 3LKVA 1N3YA 3L4SO 4M87A 5IUJC 3ERCA 1R10A 1IZ8A 1W5AA 4OI4A 4W5OA 2G5GX 5JTTA 3H2ZA 1DTWA 4KP7A 3UAZA 2R6ZA 1Z6TA 2RHMA 3IIJA 3W06A 2P6UA 2CMFA 4BFLA 2EW2A 4K9NA 1I32A 1RQRA 5EMHA 3O84A 5ARCA 4MUJA 1CK4A 3RYTC 5DOVA 5TJ9A 1VE5A 3RROA 1WSBA 1MG5A 1SEPA 4FXPA 4JA2A 1UWLA 3UJNA 5EESA 2AC4A 3LT1A 1JILA 3PKIA 4W5JA 3IE1A 1L5QA 2YVUA 1QWOA 3GGSA 5A4DA 1Z39A 3EFOB 5LMUB 2AYZA 2FWJA 1H0SA 3AUSA 2WDPA 3QKUA 3G8DA 4FHFA 4HYYA 4HXGA 4YNBA 4MW5A 1VLMA 4TQ9A 5FBLB 1NNEA 4XYGA 3AMVA 4A5OA 4EVQA 3K0FA 3A6FA 1GARA 2PN1A 3CB4A 2AX3A 2WUDA 2BRUA 1QHHA 2YMLA 3DV9A 1EFUA 4U5QA 5DB4A 1G5QA 1TZKA 1GCUA 4PY2A 5FPQA 1DQNA 3RTAA 4ON9A 3LKDA 1VM6A 5EIHA 1YB6A 1BFUA 2JIQA 3JAKA 3PPYA 1QC5B 1VTKA 3ZQJA 1BU5A 1UFOA 4MTCA 3V2GA 1PNRA 4QPJC 5LUBA 2LD4A 4IHJA 3RUCA 3ZY4A 2GEVA 1ODIA 2A9PA 3OJWA 1HQDA 2AUNA 3M3DA 4EHJA 4FCWA 4CL2A 5BQXA 4NE9A 4HT3B 3V8BA 1C14A 2J48A 1L0BA 1T43A 3DCNA 3IC5A 3NM6B 4HFNA 4KQCA 3IMKA 1UIRA 4BNWA 5LYJA 2W5UA 3A1WA 3NOXA 4ARZB 5BV2P 3G5LA 5E3HA 3IT0A 2YZGA 1HLGA 3CB2A 3QI7A 1ISIA 1A69A 3NHBA 3E1GA 4W9NA 4U2CA 1YA6A 5ECDA 1OHHA 1ZIPA 2QT0A 2RG1A 2B1IA 3NIGB 1E3WB 3D7NA 1I6WA 1R9JA 4FMCF 4KKVA 2OYSA 3NS7A 4BMYA 1DJLA 2P4SA 2J5RA 2LIPA 1QGZA 3I53A 1MHTA 2F59A 4M1QA 3OZGA 2REXB 2C8KA 3EEFA 4BRZA 4URZR 4BP9A 4D0GA 2FHSA 2GZ3A 2XOKD 4MJLA 3HCDA 4MWSA 3I6YA 4WNAA 4Y6OA 2ADOA 3HCEA 3QUCA 4FR5A 1NXTA 4IIGA 5CNIA 4MJ7A 5DYWA 1VKHA 5GWXA 3WISA 1V39A 1VCNA 3EAFA 4TT3A 4D0SA 2BYTA 3P2KA 3CKYA 4JI0B 3IKJA 4Y2PA 1RYHA 3NAGA 1NF8A 3OPQA 4R2MA 4RE6A 2OGUA 3GGJA 3A05A 4JHLA 4X1YB 4CL8A 5BPHA 3MRXA 3I6QA 1K3UB 2O50A 1PL7A 2YMMA 3C97A 3SNHA 4RTQA 3B7WA 1JIQA 3G0OA 4JGIA 3ZI7A 5HFNA 4FP9A 4R9SA 4KZKA 1COWD 4GU5A 3IS3A 1JHMA 3GR6A 4DMKA 3CWQA 2NQTA 2F3SA 4BQRA 1D0IA 1BQEA 3BN3A 2ODBA 3ETHA 3P0JA 3Q1LA 4G5GA 5IXJA 3BCUA 1L3IA 5J4VA 1QMGA 2VF4X 3D2AA 1X7ZB 1YKFA 5CU7A 2VNAA 2OCYC 3BGVA 4HWGA 1PV4A 4IX9A 3GWGA 4CE6A 4EG8A 1H6BA 3RUAA 2F1HA 1NF2A 2F8MA 1EI9A 2FA9A 4PPFA 4YO8A 5DSZA 5T4HA 5JCPA 1EU1A 4RAQA 2IXEA 3CCBA 4F3YA 2E4WA 4RX1A 4I1SA 3MIZA 5MGBA 2FPGA 2Z8YM 1T3GA 3WLKX 1KDTA 2AD1A 2IHKA 5U4XA 5K6TA 1P0PA 1XKLA 3G0BA 3H4MA 1DL5A 4GM1A 4FBGA 3TL3A 2VT7A 2HB6A 1E6UA 3JW8A 4OHMA 4QASA 2PUVA 4ZU3A 2NZYA 2PV7A 1EVJA 3JWGA 4M2LA 3D3EA 1CRQA 3H16A 3ISTA 1CKEA 4JJFA 1UXHA 2Y99A 3LUHA 3WJ7A 4P4LA 4CRWB 1PT9A 4FE4A 4O2AF 1D0VA 2WICA 4ZVNA 2D1QA 1QSGA 3WHKA 8AT1A 2PBZA 2LPMA 4AU1A 4ZCIA 5ALRA 4KJZA 3T5TA 4E5PA 3A04A 2GZRA 2E4XA 4RH3A 3DFUA 3HL4A 4DBLE 1CRWG 2W2OA 4GXRA 3H42B 1G5PA 2YIJA 2O5EA 3TS1A 1JPNA 2ZUTA 4BNNA 1C0LA 2DE0X 3GFOA 3OPYA 5IANA 3JALB 5LSAA 2ZJ0A 3GROA 4C08A 1E2EA 2BBWA 2NAFA 3FKJA 4RVFA 5JO0A 5COQA 3C2QA 3T06B 2NX2A 5HWSA 3ANYB 3GPBA 4BQSA 4KHPB 2PNFA 4B31A 4UAUA 1NBOA 5CHYA 3LTEA 3PHLA 4B0OA 1W581 4F1JA 3HXOA 1WZEA 3AEKB 5BV7A 3ILHA 3QTLA 1HLFA 1FDVA 1HE3A 2IYRA 4MKXA 5GIPE 1XTIA 2QT9A 3OZTA 3EMDA 1NSFA 1K7CA 4U2FA 3HI6A 3RS9A 1E9SA 4F71A 3NATA 3RH0A 3F1LA 5LDGA 4BBJA 3OM0A 3NHPA 4RZQA 2DFTA 4FR0A 2NO0A 1JZTA 1ZH4A 4UVHA 4L3WA 3NYIA 4DR7B 2OV4A 2QJFA 3KEQA 1FSFA 5JARA 2FPMA 1ORTA 4L5CA 2TRSB 4PVDA 4NI5A 5EIAA 4AY3A 1ORDA 4Y30A 3RQSA 1R0LA 2IOQA 2VDPB 4PICA 3N70A 2I78A 4ZANA 2IZ7A 2C20A 5BW4A 4B6FA 4ZEXA 1EGHA 4PAGA 4R9VA 3LY9A 2RKBA 1DCMA 2AZDA 4Q5IA 2B69A 2AZ4A 4O25A 5C52B 2Z1NA 4DNQA 4PX5A 3AW8A 1XU9A 4LZZA 1VKZA 3QUAA 4RPGA 3T4PA 2QQ5A 2PSDA 3IX7A 1K6IA 3W9UA 4CFSA 3UMFA 2J3KA 3AI1A 1ZJ5A 3D1VA 3RRXA 4CM1A 1TYBE 5K0EA 1IOWA 1CZOA 3MWFA 3FM9A 4NYJR 5GJCA 1BCSA 4UAVA 5TSDA 3UXEA 1ILEA 1Y3BE 4DQDA 5FI3A 1OLXA 4BNXA 3QYAA 2ZRMA 4L3VA 3JTMA 4KG7A 2Q45A 5FBVB 5ICEA 3S99A 2CB9A 3ER6A 3W1WA 1RC8A 1US8B 1KY5A 3A6LA 4EATA 2ZBGA 2CUKA 4GKKB 5KSYA 1YZQA 4RA6A 2BKVA 1UAYA 3C6XA 1EE1A 3BIJA 1XXHE 1Z0KA 1DTWB 2WW8A 4FK8A 5K8JB 1NLMA 4OXNA 3AF2A 3GFGA 5FAKA 2HA7A 4DY6A 3OZUA 1RQPA 4NZPA 2CF5A 5DU2A 1CLEA 4CGZA 5EFZA 3R41A 3F5MA 1E2MA 3W5UA 5IJWA 5IJ9B 1VLJA 4J0HA 4MPTA 4YH1A 5EXPA 2HD4A 5C7YA 3KQPA 3FLMA 1E1RA 1AKTA 3TMKA 3Q6IA 1JFRA 1FDIA 2GZSA 3GRUA 4DJJA 2FZEA 4YUWA 5JAMA 4U7FA 1BDHA 5FTKA 4BKMA 3A3OA 3K0FB 1XVIA 1QMPA 2DHCA 2G17A 3OZ7A 3G0HA 4Q03A 1DG3A 1ZMXA 4BLUA 1QHHB 1SCDA 4IIUA 2R6R1 4GFDA 2IUYA 4KCGA 1IEWA 1QYRA 3SOPA 4BBAA 3ADDA 1LLCA 1D2HA 1T2EA 2HA4A 4E1VA 2ZCVA 4G8BA 3EXIA 3PNPA 3REQA 3UNXA 5I7OA 1GFZA 1WPGA 2JAOA 3A70A 1JAZA 1RQXA 3DPSA 3FCOA 3G5TA 3IEIA 3JAKB 4JB0A 5CT6A 1MR3F 2WAMA 4QLOA 4EB8A 4IHJB 2R44A 4CIVA 1FRZA 2PGDA 1RSZA 2HMAA 3DE5X 3E82A 2KQUA 3JR7A 1FEZA 4G56A 4LQDA 4PZDA 4YROA 4B44A 3U40A 3TTXA 2A9JA 4UQPA 2B36A 1O0BA 1U8CB 3FNFA 2XDQA 1J9ZA 1SG6A 3LNTA 4UPEA 3S27A 1BFDA 2D2EA 3MCTA 5HBRA 1EK2A 5LYJB 2RHDA 3VSAA 3Q8LA 2QG6A 2YRWA 3A32A 2AR9A 2QRHA 2O8FB 2HDNB 5HA5A 3NYQA 3ZOKA 4D9BA 3NBAA 4Z54A 1KH3A 3H1AA 4JJIA 1QO0D 1T5BA 3KFVA 4RY0A 3D02A 3TVTA 3NC4A 3Q7RA 5FWNA 2GMWA 4HYQA 2PFGA 3A25A 1EGVB 2ZJ5A 1M10A 2H29A 4KBGA 3RG8A 5C1PA 3V46A 4ONEA 2C4KA 4B32A 3GJYA 3K7EA 3FSGD 5BWCA 1M2JA 1RKVA 5HQTA 2O2HA 3W5CA 3SMVA 3DHNA 4JLJA 4C01A 4PGAA 1RQ2A 3DMDA 4LCBA 3IEMA 1G2QA 3NT5A 1M8KA 1DCKA 1PT5A 4X00A 2GEFA 4D3FA 4X6YA 5JQGF 2BEUA 1N6LA 2RONA 5AVWA 4HQFA 3QZUA 4IL5A 5HEKA 1TI7A 3GD5A 3PUHA 3PK0A 3I0NA 4EO7A 4BO4A 5BR8B 3U61B 1W6UA 4GDMA 2AFVA 4MGIR 5AICA 4R6XA 1XA3A 4MCJA 3GFRA 3MC1A 5CTAA 2D4AA 3A26A 4H4CA 1RRMA 1C2TA 5FRDA 3O83A 3JZMA 1PZGA 4AI6A 3KZOA 1GVHA 4HGRA 3WWPA 3EISA 3F7TA 3CF0A 3V8QA 3GLTA 4XQEA 2VK1A 1VQ1A 4H0FA 1UMBA 4F7DA 5BQOA 4V0LA 4H08A 4L27A 4GZMA 1YQDA 7ABPA 1UODA 2UVPA 3OIUA 3QW2A 3OJFA 3F9IA 3QNWA 2FW7A 3OCWA 3EVEA 8GPBA 4C2AA 2BGNA 1S9DA 1AQ6A 4JGGA 1PYOA 1T4MA 3H11B 1XELA 2W6NA 1E0SA 1CY0A 3I2HA 4J1SA 3DPUA 1BDIA 4JI7B 2IEAA 3GWZA 1TM1E 1UPBA 1SIWA 1Z06A 2JFBA 2Q2VA 2GPBA 4CLHA 1YZ3A 5D84A 3RD5A 3DL0A 5B1SA 2HLHA 3H6GA 3ABRB 4MQ4A 2FPGB 1P0CA 3DVQX 2VWPA 2YHSA 3O73A 1Q0UA 3T3PB 3TBHA 3JY6A 5JIBA 4R1UA 1RHMA 4OX9Y 1GTJ1 3HVJA 3KB2A 5FWXB 3FRHA 5BNIA 5I5EA 1GQFA 3EIQA 2J4DA 2EX4A 2I99A 2FE1A 5F98A 3VDNB 1OGIA 4RD0A 1SOMA 1R0ZA 4YLEA 1JMYA 4UUOA 3DEYX 1RHKA 2IIQA 2IPNA 3I34X 3X1XA 3EVCA 4UVGA 3GEPA 5LJIA 4ZWNA 1NY5A 1U7HA 2GZAA 3I0MA 3JYOA 4MB2A 2ONKA 3SHQA 3ZLTA 3F7MA 1USWA 1UANA 4CR7A 1NJ8A 4DLVA 3JSXA 2VG8A 3OPYB 7YASA 1QGYA 1QK5A 2XRMA 1OZFA 1IOVA 2MSCB 2VHVA 3AY0A 1IXYA 1ZSVA 4JVLA 1UJ4A 4R0VA 4J3NA 3ZV4A 2HMTA 4P0QB 2OY0A 3FMVA 3DVAA 1U3GA 2OFPA 2DWQA 3HRIA 1F48A 4GLOA 1ZJYA 2AJ8A 2ABWA 2AOTA 3B48A 3Q87B 1DAMA 1UDXA 3T34A 2C00A 3P2OA 2MU1A 1B0PA 2HNAA 2I2BA 4FE7A 4KQ9A 4PHHA 4QLAA 2RGGA 1IHUA 2CY0A 3D4NA 2WY2D 4JV5B 4FJ2A 3LQQA 3N75A 4KRXA 3UB4A 3ZE0B 4BRSA 1QRAA 3CLRC 2C4MA 3VC7A 1T9GR 2PIAA 2FQWA 1MFPA 4S04A 2VOJA 3WYNA 1KQFA 1EA7A 4M53A 3R8CA 1NT2A 1F60A 2PH1A 4MULA 4NYMQ 4Q9LA 4BO6A 5I6DA 2O3QA 2YV3A 1TECE 1HA3A 4XDGA 4JK3A 4YAKA 4LDPA 3ICQB 1V41E 5J58A 1UXOA 2PUGA 4TYYA 1JDPA 3I6BA 1ZBQA 4ABYA 1NG1A 1IMOA 4P53A 2BPOA 3R6WA 3B5IA 4TN5A 3NP7A 4WZBE 3GJ4A 4PHFA 3CUUA 5HRAA 4LOIA 3L06A 4RKQA 4X63A 2Q4EA 1B0AA 2P4UA 4Z4QA 3L0CA 4BRUA 2XQIA 1SKBA 2EP5A 2GEKA 3EJ6A 2V0GA 2BMFA 3N2GB 4MKRA 1OLXB 5E0KB 1ESZA 2HU8A 2XCOA 1DT3A 3QLUC 1YZTA 4A7PA 4WFQA 1MJGA 2B8JA 4FSHA 3VKWA 1U3TA 4BGDA 1I7LA 2D0PB 1LDNA 4UEKA 5IVDA 4RA6B 4TKUA 1TVEA 4MZDA 4TMTA 2H2AA 1Q7RA 1E3QA 3ZZTA 4EM6A 4F8YA 4WOCA 3JVVA 1OT5A 5LIRA 1DPFA 1D8AA 3L1HA 2QQ0A 4JX8A 2VDQB 2RD2A 3MJDA 1A96A 2FPWA 4XI9A 3L4KA 4Q82A 1P5JA 4QU8A 2NWQA 3PR1A 1TU3A 5IUKC 3SX4A 3THWB 2HYIC 4ZYYA 1R5JA 4YN3A 4K1LA 2HJGA 4KH0A 1SBCA 1XZMA 2ZJZA 4K40A 4JY7A 3TLXA 3WWEA 1B0UA 4ZZIA 3ZGZA 3BZUA 3WNCA 1X0VA 2HMVA 1GPDG 4PGFA 2IKQA 2OO5C 4GMFA 4NDZA 4X45A 3E9RA 5A3SA 5K01A 3AVUA 1GPJA 2WMNB 3TAUA 4CG3A 4D41A 1P91A 2WJIA 3U7EB 2BDTA 1WZ2A 2F3TA 4ZQEA 1BYUA 1JAYA 3PJDA 4O4HA 1J2UA 1VPTA 4PLPA 4A8PA 4BLVA 4EG0A 2HIMA 4XUCA 3QSYA 4TKMA 1COZA 3BMXA 4HAYA 4E2WA 1VJDA 2VJPA 1E2UA 2YFHA 3EXIB 1YGYA 4LYHA 3REQB 3WRYC 1DDGA 1Y4UA 3E7PA 5M29A 2C9YA 4HF7A 4YJ2A 2ZP1A 1Y6RA 2ISCA 3TW6A 3N8GA 3PEVA 4AFNA 3P52A 1T10A 5L45A 3E35A 1I6KA 1TKBA 2XPCA 3G79A 4FC7A 3WGZA 4MAAA 5IT5A 4EA8A 4RYDA 2A2ZA 2J5XA 4US1R 1F06A 4ARIA 3NAMA 4YALA 1P6UA 1RACA 3TCNA 4EY8A 2B8WA 4AY2A 5IK2A 4NBSA 1LQUA 5EXSA 1GQ2A 2WHPA 1B7GO 3H18A 4IFBA 4YDHB 2P9GA 3TLZA 4GXQA 3JAWB 3QWAA 4HZIA 4CIWA 3OOEA 1HFKA 1E9RA 4LCEA 2WINI 1TLLA 5E4TA 1AX9A 2PK3A 1ZJWA 1EVIA 1YI8A 4G85A 1V7QA 4BVAA 2G6TA 3B3AA 3W2EA 1J7JA 1PFQA 1TQ2A 3GJ8A 5K0LA 5CB4A 4DR2B 3QXXA 4H6WA 4AJHA 4BWVA 4MVJI 2OBBA 3D6VA 1N8KA 2V7PA 2CJPA 1ULZA 4DT1B 1RRFA 3DXFA 1XWWA 3KPUA 4GIBA 1OH8A 3ZHRA 4TOIA 3FMIA 4G0UA 4OLAA 3BCSA 2DBVO 1HGXA 1T3ZA 1M0TA 2K7FA 2Y0BA 1QIHA 3QYJA 5FPSA 4ND3A 3LUAA 4HVLA 3B6MA 1J2RA 2GEJA 1BS9A 1W0KA 1XA0A 4UTOA 4EPWA 1GTSA 4QICA 2WT8A 3KOWA 1L9KA 3AUTA 1OFIA 3KJIA 2IODA 4H7KA 4V1CA 3CLTD 2CNDA 3FNIA 1IY1A 1TQHA 1OPXA 1WMAA 2ZE8A 3N87A 3OBBA 2QGZA 3OIYA 2EGUA 1ZK0A 2PX8A 1ULBA 3MJSA 3OMLA 4ZDJA 4F4CA 1WVIA 4AZVA 2JAWA 1YI1A 5B7NA 1J2EA 1W8DA 2ANBA 1QGDA 4H1VA 4L9AA 2R1UA 1PL6A 1BNCA 2VRCD 4KDCA 4MLCA 1D1PA 1BN6A 2Q4OA 4QYIB 1C30A 3Q3GE 3GVHA 2OXTA 4PF1A 1WVGA 4JLOA 4JLDA 4PPGA 5KNCH 1KK3A 1FZTA 3WJ1A 5HIAA 1RI3A 2CSUA 2DUMA 4YRZA 2C9DA 2UVPB 4OQLA 1DRUA 2QUBA 3RRJA 1AUOA 3HXKA 3TX2A 4YMWA 1QZ3A 2VWHA 4JVOA 4QFMA 2WSBA 2GPYA 3L49A 2NOAA 4B0PA 2JW5A 4HRYA 1DJPA 2CMKA 4LQLA 4A1FA 1XRLA 3VYVA 3KQNA 3QHPA 1P7ZA 3L77A 3GRCA 4W99A 2RGAA 4IZHA 4LQ4A 4L74A 1E4YA 1XHLA 2NZJA 5KPDA 1D03A 3CH7A 3BJEA 2XVZA 4U00A 3IOYA 3ZHTA 4ZYXA 1YU9A 1EX7A 1MO5A 4AN0A 5JU6A 3I6MA 3F2VA 3O90A 4IILA 1NNLA 4XVQA 3DWIA 1DJMA 2QD1A 3A10A 3PXEA 1ENYA 621PA 4RU1A 2QN6A 2YW9A 1B74A 2CHUA 1XCLA 2PQ6A 4QGHA 4Q3DA 4R1OA 4XJTA 5ECWA 4BKPA 2IP4A 2O6HA 1WCXA 3O9VA 3FTNA 4RM2A 3DOEA 1FTNA 1JA9A 1IYZA 1Z0AA 2ONYA 2LVBA 1NXSA 1CYDA 2NV6A 4MRAA 3DC2A 5AVKA 5A3RA 3EXFA 1RPZA 2Q0QA 4AJIA 2AD5A 1WKCA 1R1DA 3GNTA 1YB2A 4R31A 1EFRD 5BN1A 5MDHA 1Y3HA 2EG9A 2IEZA 1GR0A 2CLIB 4NXNB 1GLNA 1QQ5A 2IJGX 3FGNA 2QX8A 4ZVVA 5EJ4A 1YVDA 1Y1TA 2FTKE 2OG2A 2PGIA 1DC8A 1TVMA 1I14A 2ZRDA 3LQRA 4MGEA 4IV8A 4QEKA 3DVAB 2RC6A 3R3XA 4DKXA 1F7UA 2EGHA 4P32A 4QNNA 3M82A 3KDSE 3DZHA 4KFSA 3B3FA 3E9DA 4NVRA 4YT5A 3RVRA 2AOTB 3UMMA 1SXPA 1VHQA 1R6TA 1IQRA 1VE1A 2EHDA 2XLCA 3MTDA 4MR9A 2XGGA 4B4WA 4BO9A 3I52A 3Q40A 1RWBA 3UV7A 1U2TA 4TQUS 2F8SA 2XNDA 1Y8CA 3G8YA 3F4BA 4RGVA 4JNCA 3TX6A 3ENWA 3I2GA 821PA 1PX2A 4PW0A 3PNSA 5FIUA 5AJHA 1Q16A 1K4MA 1SD5A 1KJJA 1K8YB 4MKZA 2GS9A 4YCBA 5LA6B 4A91A 1HDEA 5BO5A 4X1IA 1KZHA 4E5YA 5JY6A 1BKSB 1E9DA 2JKVA 2WLTA 1FFSA 3CCCA 4YR7A 3E15A 1KYTA 1LQTA 1J6UA 4NBKA 1KYYA 2PYDA 3C8DA 4GNKA 1AUPA 1CQJB 3OZIA 4CMCA 4CU2A 2BEVB 1OW3B 4WAUA 1H3NA 4Y7DA 5JBNA 4I8DA 4UNNA 3VTFA 4UQLA 3TGPA 3KD2A 3BMOB 3PIDA 4RUKA 3QEMB 2ZB8A 5F2OA 4AX4A 3C6ZA 4BE4A 3UT6A 1ODKA 4ALLA 1MDFA 4KWHA 3W5AA 1ESMA 2VEOA 4N7RA 4Q4JA 5IULC 4O5AA 1QF7A 1TKAA 1VYVA 3HN2A 4QAQA 3DWGA 1C9KA 4QTUB 4MW7A 4OQQA 3N0XA 4P54A 4NNJA 3RBXA 1QVAA 1TZBA 4TKUB 4Z1MA 2FZKA 3VQTA 2FEKA 4MMXB 4RWEA 5L4SA 2FX5A 2OLEA 3MYYA 2A4KA 2PX3A 4PYNA 3WBBA 3GJ5A 1NV8A 1FDOA 2ACEA 3GJTA 3HFRA 4BS9A 3LLCA 4O59O 5JEDA 1AS0A 2RH8A 2Z2ZA 3NAQA 4LRXA 4WN3A 3B70A 4BQNA 2BVNA 4CMBA 4P9NA 4OX9B 1CD5A 4QO7A 5H82A 1JMVA 1VDMA 1R18A 1XWFA 1P80A 2B6NA 2QP3A 2G9RA 4LWPA 4FB4A 4I1UA 4NV0A 5K6RA 1GYPA 4OL9A 2PJRA 1UJCA 2Q3FA 1ZR4A 1M2HA 3KKEA 5FPYA 5DBHX 3VO8A 4I5FA 3FBGA 4GBGA 5TV2A 1XQVA 4Y6RA 3WYCA 2ZITA 2H65A 1ML4A 3CRMA 5HG0A 4M0KA 2FR1A 3JVEA 3NDPA 4Y9UA 3RVJA 4N8DA 4O4HB 5HFAA 1CPYA 3GVCA 4W4TA 5E9QA 1PK9A 3BH6A 1KAMA 5LJLA 1ADYA 4JSRA 4Q37A 2I7CA 5L4LA 2I91A 1HR0B 5H8WA 1FJHA 5FA6A 1RE1A 3SNKA 1Y82A 2YOFA 1LRJA 2WAOA 3PUKA 1JXMA 1CS0A 4ZALA 2FSHA 2MSWA 3ZWKA 1SM4A 1Y7LA 3B51X 4M1WA 2P9CA 3WMEA 2B7LA 4N0MA 1UKBA 2W2LA 2A7QA 3P2MA 3ROZA 2VT6A 1WETA 3AVVA 3EUWA 5E8JA 3VR2A 2GQ0A 2GHRA 2G9QA 3EEYA 1PFGA 3RF7A 1R0XA 3U3OA 1OASA 4M49A 2WHPB 2I1QA 4N7JA 4EUEA 4W9MC 2GT1A 2W6JA 4WRRA 1UKZA 2G1KA 1S7CA 3I4CA 4JR0A 4XUGB 5IC5A 5T4EA 3GFPA 1SVKA 1SXIA 3ZS9A 1QYIA 1CUEA 4ZXFA 4BMVA 3HPRA 4EVRA 2VUTA 1E1CA 3OWHA 5BW5A 4LNAA 4N7MA 4OOFA 5CB4B 2JGEA 2VNIA 4XIFA 2GHQA 2ZEJA 1X80A 3AO0B 3UMCA 4EF5A 3L7JA 1I2AA 2V7WA 3KT3A 1SC9A 3CZ5A 3QLUA 3HDYA 3TFWA 4IIDA 2FMTA 1S2MA 3AIKA 4UNPA 1XIVA 3JQRA 2W11A 5KUTA 4IIXA 1B8OA 4Y67A 3NC0C 3K6KA 4YRFA 3QPUA 4FN4A 4OAOA 1VPLA 2ZIXA 2YJ6A 2W93A 4RXUA 3V48A 5BOSA 4K28A 2HRCA 3PXXA 5DP2A 1PNOA 3HY6A 4QVKA 5FEMA 3P9NA 4AYXA 1A88A 1ZJ6A 4WMLA 3VO2A 4NBNA 9ATCA 3O0TA 3FLAA 4DUGA 4ZVUA 2BKLA 2GNAA 5F3RA 3RIEA 3AIMA 1GQSA 1C30B 3M6AA 4KQHA 5KJCA 1TZMA 2OO5A 4EI2A 3ILSA 5TRTA 1OC2A 3ADPA 1DIRA 2OP0A 2YY6A 1ODTC 2HIAA 2ZSHA 3MBKA 3MS4A 4GZLA 1FNNA 3SIRA 4Z1OA 2RJ3A 2A0UA 2C61A 2LZ0A 5AW0A 5K4HA 2H5IA 1DIBA 3HJHA 2E7ZA 2Z3VA 4OKSA 5LNK6 3UCFA 1KP3A 2B99A 1NUTA 3GPCA 1CUBA 1U0TA 2BTOA 4J0CA 3TL2A 3WRYA 4LJAA 3C4JA 5HZHA 1YRQA 1J25A 3BHJA 2A58A 4L0DA 4BTVA 3CUEF 4HR7A 3ZH9B 1EYZA 3HYLA 5A3QA 1T5OA 1Q0LA 3LC0A 3K94A 4NIMA 5LLDA 1EE2A 1NR1A 1UZAA 4W5QA 1H2AS 3EW9A 4J7UA 1EXNA 3TCXB 3IPLA 3MWJA 4YP5A 5CA1F 3U9TA 1IY8A 3KM0A 4LY9A 4PZAA 1U3CA 1EBUA 1ODCA 2XA2A 3QG5A 3WK6A 3L0IB 4LJ6A 4A27A 2LIVA 2QX4A 4E1BA 3HBFA 5KSOA 3BD6A 4I08A 1T5LA 2VP4A 2Z8XA 4B3IA 5BVGA 5E3IA 2BN4A 3EVBA 2GI4A 5AVRA 1VP3A 3EXFB 4G81A 3UJ7A 4YR9A 4OHVA 3JQ7A 1U0SY 2R5FA 4MA5A 5HX7A 2V1UA 1ISHA 1T2FA 3AJRA 3KR1A 2IF0A 2PV0A 3VVLA 4KFRA 3TEJA 3W5SA 4B3DA 4BVJA 4EMUA 2A3RA 2HQRA 5DBFA 2X4GA 3KQUA 1YJAA 1W85A 3KVRA 4GDFA 2AF4C 1PJ4A 2F6RA 2RH5A 2H4JA 3BGWA 4JT4A 1JFLA 3RRMA 3R23A 1K3TA 4H7DA 4LE2A 4TTVA 2X5OA 3OO1A 4YJ3F 4LFAB 1E94E 2D3WA 1E2IA 1K2WA 2I6GA 4QUDA 3MM4A 2AKAB 4DVGA 1X3LA 4YDQA 1VB5A 3T1HB 3W2HA 1NKTA 3OF3A 4DA9A 5C53B 1O5TA 2ZRHA 4DZZA 2I9KA 2PR2A 4CTMA 2CXOA 1TMKA 3H1GA 1P61B 4NF2A 3RFTA 4OXYA 1AN0A 4FEGA 5JJLA 3T7TA 3CLUD 4IHQA 4L0QA 4GOND 1QWSA 2GA9A 3WGGA 2IYPA 3EG5A 4Z4FA 3DEZA 3HQ4O 4F4HA 3UEOA 1RYZA 3CSSA 3AKYA 5ULLA 1C4KA 1PHPA 4QUHA 7GPBA 1URPA 1VJ0A 4M9RA 4X1IB 3H6HA 1JU4A 1M5TA 2HBYA 3C48A 4ZYVA 2FN8A 5E1MA 1ZWLA 2O7VA 1TT5A 2Q2WA 2R8PA 4GVLA 1QKJA 1CIJA 2JCVA 5ICMA 2ZU0C 3WA7A 3NWJA 3MGAA 1IVNA 1ZO8A 2GPAA 1SXGA 2QYSA 2CUTA 4QUAA 1TJNA 5KOYA 4L95C 1MKYA 5HIKA 2CLSA 3VVBA 4Z8YA 3JYLA 3INTA 4ALMA 3B1WA 1ISGA 4YMVA 3BXXA 4K1XA 4EFLA 2Y2VA 3F49S 4OXKA 3F97A 3E7WA 4HGZA 4KO8A 1FMJA 5IKEA 6ABPA 2CJYA 1XN1A 5K51A 4Q4JB 4NX2A 4N40A 1KDOA 3L8HA 4UASA 1R27A 4BTLA 2FF7A 2ATXA 3AX6A 2UXBB 4FKMA 2QXTA 2ZRGA 4TXLA 2WKPA 5LMNB 8LDHA 2Z09A 2ZATA 4MW2A 1HKHA 2C07A 4DIOA 3KOUA 3LDHA 1MTZA 3B5EA 1ODFA 2XB4A 4CVNA 4FZ5A 4EW2A 5A5EA 5CEJA 1WHSA 2PZKA 3V8VA 2H5LA 1XCJA 2ZI7A 3L79A 4XB2A 4J16C 3UK0A 1AUXA 2JIZD 4MWGA 1ACJA 4ENTA 1QXSA 5LQCA 4MWZA 4LECA 2QAJA 4FYIA 4PTLA 1U4SA 1BDBA 1VOTA 4F91B 3D6UA 1JT9A 3W5VA 3CHYA 4U7PB 1KFCB 4MQEA 1DCFA 2F90A 2GPSA 3UMJA 2SKEA 3TR0A 3V4SA 3GDOA 5HILA 1NJGA 2QTMA 2X6RA 5CX1A 5AKYA 3OI7A 2DB3A 1GITA 4KYIB 5HF6A 2H52A 3PA8A 4O6VA 2IH2A 1JXAA 1TL7C 3NT4A 5EE0A 1PP4A 4OREX 3AVXA 2X42A 2OBLA 3DMFA 3EEOA 3JYPA 3A4IA 4I4CA 1UZMA 5CYGA 2QUKA 1IWPB 4RJLA 3JASA 4AJ1A 4BMOB 5SYAA 3U4AA 3TD9A 3RANA 3LVRE 1D4ZA 2IYAA 1EEHA 1XL1A 1E79D 2H2GA 5DF1A 5J4LA 1VCIA 3LXUX 5AI6A 5FV7A 1HFJA 1FXUA 1DI0A 3HA5A 4WXMA 2H16A 3A9VA 2BCJQ 2XT0A 1H3FA 4KIJA 5FP0A 1N2HA 1GPBA 2B0CA 4YGXB 1OZGA 1SU4A 3GLHA 4L08A 1WE2A 2QK4A 2RGXA 1NULA 1UWKA 1MP0A 1VKJA 3DE0X 3FA2A 3RC2A 1SU7A 1HDXA 2FB9A 3ILXA 2D2IA 1NQTA 5D3MA 3O38A 4D9KA 1C2YA 4ERNA 3L07A 1NAIA 2G06A 1E1CB 3LL4A 3UPUA 3R5FA 2NTVA 3L1IA 1LBEA 4G37A 1ZXXA 3IVAA 2C3YA 3EE6A 1WJGA 4LYEA 4YRTA 3ZY3A 1NOKA 4RHTA 1P9OA 1Y4SA 3FCYA 1II0A 1XMIA 5B36A 1EXDA 1PJSA 2HTEA 4Z9YA 1IRIA 1IIBA 1U1FA 1V47A 1XC7A 2OMKA 3DV0A 3X3HA 3MCAA 1JHQA 4P7KA 5JISA 3WV4A 2K4MA 2PL3A 2ZIXB 2VJYA 3H3JA 1ML3A 4Z3DA 2O2EA 3UB2A 1M6EX 1XDDA 1PUXA 2O2JA 2VHCA 1U8FO 3U3JA 4CQMD 3E70C 5ALEA 3ZE6A 4YUYA 4C2TA 2NXCA 5E7MA 4MEJA 3UPTA 3D5QA 1ZZGA 5CFQA 3YASA 1SVIA 1C3VA 4LC9A 2A30A 1M1YA 5T3YA 2V97A 1PQWA 1JHRA 2NM0A 3L04A 4IG9A 3ROFA 3SOZA 4FM9A 4L8WB 3VR4D 2D7CA 1NBEA 2DPXA 4MYCA 2OCAA 3HNPA 4K2AA 2FV8A 4AS2A 1VBNA 4MIEA 3V4FA 1J22A 2MTBA 3RVSA 2FJUA 2IEIA 2WFMA 2Y1KA 3FHJA 4FWIB 5ALQA 1PQPA 3KT0A 4AJ4A 1XKXA 3RTDA 1EK6A 4WCVA 5F1OA 4BGIA 4C5CA 5LYJF 2B6HA 2ZSFA 1W93A 1YT5A 2CVHA 3O21A 4TWIA 2QX7A 9LDBA 4FFWA 3VJLA 2J9FA 2WIGA 3OAAA 1L4UA 1HT1E 3BCRA 5FF9A 4HQOA 2FE4A 1L7QA 4YP7A 1NVEA 3H1PA 2KS6A 4KXFB 5EHNA 3UUFA 4S1WA 1YS4A 1GGJA 4F9TA 1W4ZA 2X1LA 4WY5A 3OVMA 1L3CA 4HB3A 2HO4A 4UZEA