5KHOC

Rasip1 ra domain in complex with rap1b
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
167
structure length
165
Chain Sequence
b'MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAGTFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDLEDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras-interacting protein 1
publication title Structural Basis of Dimeric Rasip1 RA Domain Recognition of the Ras Subfamily of GTP-Binding Proteins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 47
structure length 165
sequence length 167
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5khoC00
3PQCA 2JDIA 2FPLA 4DVGA 1Z6YA 4URWR 2H5EA 4YONB 1KI2A 4C9BA 3BFXA 4MA4A 4PO9A 4X8OA 3BOSA 1Z47A 3BB1A 3GLFE 1DE0A 4GZLA 4F92B 3C8UA 3X1DA 1I2MA 2D74A 4OJKA 1UDXA 4PR0A 2YOGA 1XZPA 1XTKA 2QT0A 2IYVA 1JQJC 1II8B 4Z8YA 5DSZA 5K8IA 1XJQA 3NXSA 2R6GA 1QF9A 2IX3A 4W9MC 1D6JA 5LD2C 2ZEJA 3OIYA 1GDDA 2HF8A 5LDDC 721PA 1N0UA 2NO9A 2Q0HA 5H70A 1LV7A 1UEIA 5TV2A 1D9XA 1ELOA 2GZHA 4DLXA 1SXJB 2O8FB 3HJNA 1E2HA 1VCIA 1AM4D 2OXCA 2V8OA 1E1QD 3PG5A 4UNNA 4Y0VA 1W5TA 2OESA 1G7TA 1MR3F 4G5SA 2BCGY 1MOZA 3BH0A 3ASYA 3PV0A 4NP6A 3P4XA 1NVXQ 2WKQA 3AKDA 3PUZA 3RRMA 1UKVY 1W49A 1X8JA 1Q12A 1YVDA 1NF3A 3NIBA 4PAMA 1IXRC 1YKSA 2B8WA 1VG1A 4K46A 4BFUA 3K0FB 3EPLA 3X1WA 3GPLA 2J45A 2Q6TA 1WRBA 1P2TA 4MRSA 5DHAA 5EZ6B 4TTRA 3OIWA 4DLYA 4JS0A 3ICQB 4AKHA 1R4AA 1LS6A 1LF0A 3IILA 1G3RA 3EWSA 1OKKA 4PC6A 1U8AA 2ZU6A 2WVJA 3NDPA 4JLPA 3CNNA 2A5DA 5EQTA 2CMKA 2BDTA 3DL0A 2XB2A 4YDHB 4Z8XA 2QEQA 2VQSA 4HZUA 3I72A 5FR2A 2QI9C 4FWTA 2R6FA 1BMFD 2PT7A 1F48A 1WP9A 2FWRA 1TU4A 2FEOA 3MRSA 2JASA 3MG9A 1ZCBA 5C4GB 1NRJB 2G6BA 5G3ZA 2D2FA 3MSXA 2WSMA 2X19A 4YMTA 5JHHB 1KO8A 4GFDA 5FPSA 2BMDA 4BLQA 1I4DD 2ODWA 2VHJA 4RKFA 3LBNA 3U7EB 3AB3A 1KI3A 5DGXA 2CCJA 4NCJA 4R2IA 1JJ7A 5L3SA 1MRSA 1KY2A 1NL3A 2QAGC 1N6OA 1DOAA 4JLMA 2J0UB 3HDTA 2W00A 4C30A 2QPAA 5SZIA 3OEEA 2CLDX 4YC7A 3TBKA 1KO5A 3GMTA 4HZIA 3SEAA 1ETUA 4A6XA 4MKIA 3NG1A 3WRXC 2V3CC 3SHWA 3OEHD 3ZQJA 4IDPA 3GQBA 4MKFA 4X8HA 2A30A 5L3QA 3VX3A 5H8WA 1EXMA 1KSHA 2ZRBA 5DHFA 1S8FA 1N25A 3HU2A 4LCBA 1FP7A 2QBYA 3GLIB 3GFTA 2BV3A 1XTQA 4Q1FA 2ZE5A 4N3NA 2CEAA 4G01B 1ZM2A 2R8RA 2ZRLA 2YWHA 5KO2A 2G0TA 2G0NA 3U6BA 4E5UA 1P7CA 1W4BA 3W3AA 4QGAA 5DI3A 1T0JB 3K8YA 2CXXA 3THOA 3TW8B 2CK3D 4BASA 4EFNA 3GFOA 1OHHA 4EPVA 3I3SR 3EC1A 1DG1G 1P2SA 5TVKA 3C14C 2ZPTX 1HURA 4XWAA 1F2TB 1FUUA 5JJIA 4FINA 1WB9A 2MMCA 1J8YF 5CIQA 3O8CA 3PEWA 4MQBA 3QKSA 1QHXA 2YC4C 5A0FA 5L3RA 1XEWY 4R98A 4W5HA 2WJJA 4NCIA 4JL6A 5EUMA 3W6OA 3KJGA 3TE6A 1W0KA 4HDCA 2OUKA 2WOOA 3RS2A 1GZSA 3IKJA 2CL6X 2DFTA 3MJHA 4HB2A 4RCZA 3Q7QA 1A82A 1IXSB 2GXQA 3WYAA 3E2IA 1JPNA 1QG2A 3IIKA 3PR1A 1DO0A 5EE0A 1COWA 2X2EA 1JECA 3AQ4A 4F91B 2REXB 1W46A 2NPFA 3RS0A 1E4VA 4OHXA 3SZRA 2EYUA 4TT3D 1KO7A 3CF0A 5KSOA 1LNZA 5ELXA 3AKYA 2V4ZA 2JJ2D 2HLDA 3AP1A 1E2JA 3I92A 4L4UA 2QU8A 3KFVA 3W9YA 2CNWD 3BORA 1XNJA 3X1ZA 4BFVA 4BLTA 2Q9BA 3SR0A 4RFSB 2HYIC 2ZJ5A 2DWOA 3THYB 1VTKA 1ZU4A 1FTSA 2AWOA 1SULA 2A9KA 1Q20A 3OIVA 5FFMA 3CRMA 1G1MA 4URUR 1BYIA 4HB0A 1XEWX 3F8TA 2DYKA 1TTTA 1G6OA 5AK0A 4JSTA 3VKHA 2J7PD 1GFIA 1MRNA 1TAGA 2KJQA 1R7RA 1E2PA 5CK4A 3L0SA 3CX8A 3LBHA 1ZM4A 2NQ2C 4DB4A 1G7SA 1VYVA 2GCNA 2W0MA 3LDAA 3NDBB 4XVQA 1RRPA 1IHUA 2AN9A 1MO6A 3UPUA 1NJFA 2J87A 4ZKDA 1JAIA 5UKDA 3NBXX 1QG4A 4DT1A 3W90A 5A5GA 3KJEA 1IN8A 1OV4A 2PJRA 1P5ZB 1TUIA 4IFBA 5BW8A 4K81B 5DYIA 2WBLC 1XD2B 4RSGA 1SVIA 5F2EA 5JBQA 3IHWA 1NP6A 4BGDA 2JGNA 2R65A 4HYYA 2V7QD 4KFRA 5HCNA 3IBGA 4NPHA 2GZDA 1OIXA 1R8SA 1E1QA 4HDOB 4CEHB 1KNXA 3GLHA 4MDFA 4RD1A 2ZRFA 1ZVQA 4Q9HA 1P75A 2BJVA 3K0CC 3C7KA 1YHNA 1Z28A 3LQQA 3LD9A 4PAQA 2AL7A 2IYTA 4EAQA 4KODA 1H8HA 4I1UA 4UQOA 2XZLA 2IBMA 3TH5A 3AP2A 2QGNA 3WY9A 1W36D 1JEDA 3BD9A 1VIAA 1CTQA 4IOKA 1Q1ZA 4LWZA 3K0EA 4V0KA 2WWWA 2G9NA 3MAAC 2ZQ5A 4B3CA 4L8GA 4UNSA 1PVOA 1U2RA 4HAZA 4W5WA 4OYHA 4QHSA 2XJ9A 1XBTA 5TDHA 5LB2A 4JBYA 2XEXA 5FPKA 4A8JB 3CNOA 5KDOA 3UIEA 3KKNA 3U4QB 3ZD7A 1KI9A 3H1TA 3D8BA 3Q7PA 3UKDA 1JXOA 1PUJA 4PZLA 1WXQA 8OHMA 3DKVA 2QA5A 2IL1A 5BWMA 1F2TA 1OH7A 2AR7A 2WMOB 2GCOB 4F4CA 1DPFA 3B1VA 1ZCAA 3QG5A 2RHMA 5KDLA 1X86B 4DIEA 3CPJB 4M0LA 1K5GA 4BQSA 3OE7A 3X1YA 4XVRA 3G0HA 3I5XA 4JLNA 1V5WA 3IO5A 2ZSFA 3UWOA 3DZDA 2GDJA 3DEFA 3NC1C 2OCYC 1SVSA 2AK2A 1DAKA 1I4TD 4AIIA 2RGGA 2E9SA 5TARA 2WSSA 4PPNA 3EXAA 3O8RA 4QNMA 1SVWA 1SXJC 1G19A 1N6IA 3M6AA 1E9BA 1W36B 1FX0A 1XF9A 4LYAA 4B3GA 2BBOA 2QMHA 4U7DA 2CBZA 2FOLA 2VA8A 3GJ0A 3OEHA 1I4LD 5FUWA 5B30A 4TL7A 1EX6A 4JLKA 3AF4A 2JJ1A 2JJ8A 2JLVA 2ORIA 1G20E 2ZJ8A 1LF5A 1DS6A 2WPDD 1U0HC 4KBGA 1G8FA 3THYA 2XSZD 3A1UA 3H86A 3IIMA 4Q02A 1KMHA 4M9QA 1MO5A 2X8AA 4ZCLA 1VYUA 1W48A 2VF8A 5FOXA 2WWFA 3IHLA 1W4CA 2P2LA 2JIZA 1AK2A 4MYUA 3V4RA 4LOAA 2XITA 1HE8B 3MWYW 4DEYA 3CF6R 1TUEA 1A7JA 4ZI3A 4HAWA 2QUZA 2C5LA 4IEEA 3CF2A 2GILA 3CRVA 4FMCB 3QEOA 1NVUQ 3FMOB 4G5RA 4FWIB 3LX8A 1WF3A 2Z43A 4E09A 3B82A 3BE4A 2HT6A 4QXAA 3AUYA 4GI7A 1E9RA 4NYIR 1N2CE 2EU8A 3PEVA 2V54A 4WZAE 1G8YA 1IM2A 4Z1MA 4A0GA 4IEIA 2VSOA 4B3DA 4GP6A 1RVDA 2MSDB 1GILA 4JMPA 4DCTA 4M1TA 3WHKA 5AJXA 1P73A 1WQ1R 3KFXA 1CJKC 4OK3A 4UNQA 5FPHA 4XTCS 2NZJA 2OILA 1U81A 2JJ2A 2F55A 1XPRA 3F0TA 4Q4LA 1IJFA 4LZZA 2QZ4A 1G64A 4JBXA 1G7RA 4NL4H 4RZ2A 5E4FA 4HLUC 2GJ8A 1G3UA 1YZKA 4U02A 2VP0A 3JVUA 4MRVA 2DWPA 2FSFA 1US8B 3U3KA 1F5NA 4B75A 2JLXA 1Z0FA 4IOJA 4N0DA 4BLPA 4H1VA 4LC0A 4ESHA 2OV2A 2DHRA 4BZXA 3A8TA 1U8YA 4JLOA 4NCHA 5JWHA 4PHFA 4NONA 5CM9C 2AKYA 1Z3IX 4II7A 4D4MA 4PHTA 4LJ5A 4P32A 4DHEA 3HR8A 5AJZA 2KE5A 5DO9A 1DAGA 1UBGA 3C5CA 3VU9A 1RZ3A 1RC8A 2GF0A 1LB1B 1GITA 3QIAA 4JIMA 5BYJA 1YR6A 3SDZA 3THXB 1XXHB 3L8ZA 4DDVA 2TMKA 3TW4A 3PUVA 3SS8A 1Z0DA 1YR7A 2O8EB 5JI2E 1KOFA 3FVQA 1UPTA 2UVQA 2VTKA 4PQFA 1G4AE 2REOA 5TMPA 5DYGA 5TB5A 2GK6A 3BS4A 1NNEA 2DR3A 1ZAKA 1Y63A 3N2EA 1RFLA 3BB4A 1OPXA 2JDID 4G5QA 2V7QA 3LH5A 3NC0C 2OM2A 4MGKR 4Q18A 1GP2A 4ZDJA 1KJZA 3K0SA 1Z07A 2FPKA 2DPXA 1NI3A 1KIMA 2GBLA 1EESA 2IEYA 3A58B 4Q66C 3SYKA 3MCAA 2WMNB 1NN5A 3BB3A 4QBHA 2JA1A 2ZVQX 5G41A 1SXJE 4BFZA 4EDHA 4UXJA 1SZPA 2BBTA 3FB4A 1BYUA 3QPUA 3SU8A 3BBPA 4P4SB 4D4KA 4MRNA 2I1QA 3DOEA 3PJRA 4JYBA 2QTFA 2W6ID 2NMVA 4LUCA 2QN6A 1P61B 4UXIA 3AH8A 3K1JA 3T1QA 5J47A 2OT3B 4QHYA 2CVHA 3RHFA 3UATA 3ZVLA 1T6NA 1RJ9B 2F7SA 5DE3A 4EJSB 2OCAA 3W5JA 2Q3MA 1TEVA 4G3XA 1CJTC 3GD7A 4URYR 4NBSA 1U8ZA 3WHLA 4MYTA 2QP3A 4CEJA 1D5CA 2QRNA 2ZSDA 3NH6A 2FMXA 2IYQA 3I8SA 4CEIB 4OHYA 1RYHA 4C4PA 1QHYA 2ZSBA 4BFSA 3EX7C 2R6AA 4NDZA 1Z0AA 5E95A 1BO6A 5D3MA 4A1FA 2IUTA 2GJ9A 4KITB 2Q9AA 2C78A 4D0LB 1QHNA 2N46A 2FA9A 1OE0A 2GZAA 4PC3A 3ADBA 3RABA 4GBMA 2Y8EA 1AA9A 2QROA 1HQYE 3F3YA 4Q4HA 4HB4A 2JLSA 4OKSA 3ZQ6A 4A15A 3GJ3A 1X8LA 4BFXA 4MKHA 3QXCA 4PO8A 1XMSA 1AS0A 1G21E 4GT1A 1KZ7B 1M7GA 4TMZA 4JKYA 4L9WA 2HF9A 1Z22A 2OZEA 2VHCA 4MGYR 4QOSA 3KUDA 1G5TA 3M1IA 5E7IA 1MKYA 1CR0A 2RGCA 2ZR0A 4LJ9A 2ZUDA 2R6CA 4WZBE 1DTSA 1S9HA 4TLAA 1NSTA 2IYWA 2R6DA 4AG6A 3EIEA 4B47A 4C0KA 4M4SA 1P9RA 5EE3A 2DFLA 2XSZA 3KQNA 3VR2A 1ZP6A 1QRAA 1TQ6A 3CUEF 5H68A 3O8BA 3B5JA 1US8A 4M1MA 4PANA 2Q21A 1D8TA 3KB2A 4PZYA 3R9IA 3K9GA 1Z6GA 3QY0A 1E32A 3GLIE 1G17A 2ZRDA 4GP7A 4TMWA 1QZXA 4B6EA 4C3ZA 1IN6A 1Z63A 4CW7A 1A4RA 3T5GA 1VHTA 3QBTA 1N6RA 3DM5A 4P33A 1JNYA 4A8JC 4ERNA 4BLOA 5E7JA 1JPJA 4GOXA 1XXHA 2D62A 1X3SA 2GJAA 2P5SA 4RKEA 4HZUB 3U6KA 5BYKA 2O8EA 3P4YA 3PXGA 1OHHD 3A4MA 1E2QA 2OAP1 1E6CA 1NLZA 4GSYA 3SFVA 5F9FA 2Q3HA 1P62B 4B35A 4YMWA 3BJIC 3OESA 1CR2A 4LHWA 1XCMA 1XRJA 4QFMA 2H8KA 2R44A 2P6UA 3NEJA 1GNRA 2B21A 3B1YA 1VG0B 5D3QA 4KHZA 3U61B 3U60B 2PCJA 3FDIA 4MUBA 5L3SB 2IXFA 3MGCA 1ONBA 2VL7A 2G83A 4EFLA 2OLJA 2XTZA 1Z29A 5HR5A 1II9A 2PX0A 1R8QA 3BRWD 1W36C 1DAFA 2IT1A 3T15A 4GRAA 1AKEA 2BJWA 1N0WA 1Q3TA 2WWYA 4J0QA 4NYJR 4UJ3A 3KXIA 3FMFA 1KAOA 1N6KA 5KNDA 4OK6A 3TK1A 5FH9A 1E2FA 2X1VA 3K09C 5L3QB 5GVSA 1BOFA 1WDTA 5IRCD 3AVWA 2HLDD 4IVQA 3IUYA 2BBWA 2CCKA 3A37A 3BFVA 1M34E 3EW9A 5JZVA 4O0MA 3SHFA 3SBEA 2QBYB 4BFYA 4IXNA 3UMFA 4OI1A 4FCTA 4A82A 1GVNB 4B3XA 5BXQC 1J8MF 5L8VA 4F93B 3CZPA 2D2EA 1UKYA 5DI3B 1RE0A 4NYIQ 3SQXA 4LHVA 1DEKA 1N3BA 2I3BA 2REBA 4US1R 1CJUC 1G8GA 1J2JA 2ERYA 2JCSA 3X1XA 4WOPA 1S1MA 1IQPA 1N6PA 3FFAA 4OQMA 1MO4A 2ZRKA 3QXSA 2OO7A 4LJ6A 3ZS9A 4BLRA 1LY1A 3QKSB 5E7MA 4DXAA 2ZR7A 4EIWA 2BKUA 1OJLA 4QG7A 4B76A 1M74A 1E2DA 1EX7A 1TF7A 1FMLA 2PBRA 4PPQA 4V0LA 3DDCA 2GVZC 3KQUA 4B73A 4HI0E 1QDEA 1E96A 1CLUA 5FUVA 3KXLA 1P2VA 3GJ4A 2NTYC 3Q5DA 4Q19A 3HU3A 4QBFA 4CF7A 2IYLD 3FFBA 3QF4A 4URZR 1G7CA 3ONWA 4QBGB 1RYFA 3LXXA 4I1SA 5M04A 1U0LA 1Q1BA 2W6IA 1N6LA 3UMSA 1GWNA 2RH5A 1KSFX 3Q3JB 3WBKA 2PJZA 2Z6VA 4PAOA 4OHVA 2HEIA 3B9PA 1VDZA 3O47A 4KYUA 3LWNA 2YHSA 4M9ZA 1Z0KA 2J9RA 1JJVA 3RRZA 1S4QA 1ZNWA 4D82A 4FMDF 4XOIA 2UZ3A 2ZE7A 4DSOA 1H8HD 3KKOA 5GJCA 2ONKA 1JR3A 1Z06A 1U98A 3BH7A 3SBDA 4Q21A 2W2TA 2CHVA 2BVNA 4E07A 4HATA 4XIGS 2JLZA 4UXHA 5JWOA 1FP6A 2C8VA 3NH9A 2Z5FA 1AQYA 1E69A 2X2FA 3R9XA 1AS3A 3IQWA 3KKQA 2ZJ2A 2WZQA 4QNRA 2FSIA 3L0IB 1KK2A 3OHMA 4NTZA 2SHKA 2FE4A 3FOZA 1XPOA 1NSFA 2ZJZA 2ZRHA 1Z0JA 3MMPA 3P32A 2C96A 5JEDA 4DT1B 4QRHA 4DLZA 1ZM7A 4UJ5A 3M0EA 5CLLA 3MLEA 2O0JA 4B33A 1GRRA 1MH1A 4XJXA 5FOWA 1EFCA 3V4FA 1AKYA 1M2OB 3HP1A 3LVQE 1HT2E 1NN1A 4ACBA 4F7WA 2ZI6A 4E22A 5AJVB 5CDFE 2ODNA 1TPZA 2W6JA 2A5GA 3OE7D 4KFSA 3RANA 5KPJA 2IW3A 2QG6A 3GLHB 4DC9A 3Q8XB 2O8DA 3SC3A 1YE8A 3QBVA 1ZRHA 4DRZA 2IHBA 2EFGA 2XTMA 2ZIAA 2A5YB 1ZUIA 3C15C 5FBLB 5IHPA 2WSSD 4FN5A 1AGPA 4EPTA 3EPJA 3L0PA 4ZDKA 1PUIA 4R2HA 3DO6A 5HZHA 2FGKA 4PC7A 4O3MA 2AX4A 1W2GA 3IDQA 1XD8A 3EC2A 3RSLA 1SHKA 1HQCA 4PQRA 1L2TA 3QKUA 4JLJA 2O0HA 3RRYA 1J99A 3X2SA 4EJSC 4XSHA 2JJ1D 1VMAA 4DUGA 1SVLA 1OSNA 3P27A 4ILEA 4A4DA 2HV8A 1KI8A 3EZ6A 1QHHB 3WP0A 2ZAOA 2P6NA 3CX7A 1CR1A 1FOEB 1X1SA 2WICA 1ANKA 2GEDA 2JIZD 4PO1A 2D06A 3OF5A 2H1LA 1UAAA 4US0R 4PTLA 1G9XA 4BZQA 4EQ6A 3AF0A 2GXAA 2HXYA 3T61A 1HUQA 1X8KA 3T1VA 2IYRA 4Q47A 1YZTA 1Q44A 1UKEA 5E3HA 1XTSA 3R9WA 3GJ8A 2OHFA 4QM7A 4C2UA 1QVAA 1OFTA 4TLCA 1IONA 2XGJA 1ODFA 3B7GA 4LYFA 4FW9A 2GKSA 1WCV1 3E1SA 1JXMA 3QJYA 1Q57A 1U99A 4LV8B 5SZJA 4TYYA 2O5VA 2ZRIA 3NEYA 3K9LA 1OT3A 1E2EA 2VSXA 4Z1MD 2BIFA 1P9WA 1IAQA 4X8LA 1T5LA 3EPKA 4LGMA 2ZAMA 2WKPA 2O8BA 2C03A 1A1VA 2YWEA 5EXXA 1FX0B 3CR7A 3TIFA 4Y0AA 5CM8B 1AZTA 1E79D 2FEMA 1G3MA 2ECKA 1T91A 1XCGB 1XMVA 1XMJA 1OXSC 2QP9X 4A2QA 5JCPA 4DZZA 2CL7X 1S0UA 2XOKD 3QEJA 3PEUA 2JLWA 1XTRA 1OB5A 3DOFA 1MO3A 3U3MA 1KMHB 5KSYA 4Q03A 1P2UA 3B2EA 1XB2A 1LVGA 1XEXA 3EAQA 3IGFA 2OG2A 2F1JA 3CH4B 3AVXA 4B34A 4DB2A 4HAXA 1DARA 4BPBA 3QXJA 4LJ7A 4U5XA 2EFDB 4TQUS 2W0SA 4Q1CA 1OH5A 3T1TA 2VP4A 3KKPA 1S3GA 1FNMA 3FKSA 3LO5A 2A2ZA 1KI7A 4WA7A 2J59A 3PENA 1KYIA 3LV8A 3FWYA 3AVPA 1T3LA 3ASZA 4MUAA 2QE7A 4V0MA 3BAFA 4KBFA 4DKXA 1KI4A 2ZJOA 4HDQB 1JAHA 4LPSA 3QVVA 2YVUA 1ZINA 4HLQB 3R7WA 2WJVA 3I73A 4A6PA 3WMFA 2FGJA 3TAUA 4US2R 2JATA 3RVBA 1NVVR 2N1BA 4D25A 2G1KA 3MWJA 1TF2A 2P65A 3WYGA 3EWAA 2LKCA 4NYJQ 4LBWA 4JT2A 2ZXUA 3HWSA 4LI0A 1HE1C 4Q7LA 1XCPA 4LX0A 3L82B 1PLKA 2F3TA 3KL4A 4FMBB 4NHOA 4YMUA 1JQLB 3VR3A 3FKQA 4LBVA 1E9EA 3EPHA 2QRZA 4PHGA 1E3MA 5GJBA 4AKIA 4DLVA 4R9UC 5AUPB 3ND8A 4Q7MB 3VHXA 3AVTA 4AWXA 5EP4A 4PZZA 3BH6A 5J4KA 3QXHA 3PEYA 4BEBA 4XD7A 3SYNA 6Q21A 1AS2A 1YR8A 3W3ZB 3GJ7A 4RY2A 1ZD9A 1ZMXA 4DDWA 3EG5A 3M4YA 1P3JA 5EE5B 3LA6A 2ZYWX 1W0JA 3NHBA 4IDQA 4UKDA 3VU9B 1E2GA 4IDNA 1QHHA 4N1AA 1FNNA 5TY0A 2RGAA 3DMNA 1NKTA 2P67A 5FPTA 2BEJA 4D4JA 2XNDD 2FFHA 1UF9A 3Q5EA 3CO5A 1L4UA 4I4LA 1NVWQ 1UDWA 4O2RA 5HCIA 4UNRA 2NGRA 2W58A 3TVTA 5CYPA 1ZC3A 3HYTA 3B85A 1JALA 3CONA 4HUQB 4WIAA 2FH5B 1UJ2A 4Q01A 2QM8A 2W2VA 4KFUA 4NZYA 1GKIA 3IIJA 4B43A 5DIFA 5F98A 3BGWA 3KKMA 2XZOA 3VQTA 3EZFA 5FTKA 4CYMA 2PEYA 1K6MA 4LK2A 1EWQA 3TSZA 1E0KA 3AF3A 4JVSB 4M1SA 1EK0A 1CEEA 4RZXA 4Q48A 1E99A 3EZ9A 3DM9B 2QSYA 3CRW1 2ZRPA 3DZ8A 1Z2CA 3P20A 3AKEA 4PSKA 1E2IA 3GJ6A 1KI6A 3LLUA 5FTMA 1GM5A 3N70A 4QGFA 2C2HA 1SQ5A 3A1WA 2EFEB 4E03A 1SVMA 1A2KC 5FPYA 2QT1A 1AIPA 1GUAA 2OE2A 4ARZB 3GLGA 4EPWA 1KNQA 5CJ2A 2ZI9A 3RWOA 3NBFA 4CEJB 1WE2A 1GL6A 2PX3A 4R7ZA 4PFSA 3NWJA 2ORVA 1NBMA 1CULC 2QNRA 2PT5A 4JJKA 4TLBA 5J4YA 3WNDA 5JHGB 2V6IA 2ZRMA 5D3MB 3U44A 3RS4A 4BLSA 1NY5A 5EP2A 2ZI3A 5J40A 4A2PA 3ZD6A 5FBWB 1W44A 3KTAA 3AVOA 3KUCA 5FR1A 4WXPA 1HY3A 3LW8A 3VTKA 2JLYA 4B71A 2G88A 621PA 2PMKA 4Q4HB 2GJSA 2YOHA 5JRJA 2IS4A 3B9QA 1GSIA 4GOKA 4PC1A 2F9MA 5LBIA 1Z6AA 1DVRA 1XU4A 2YWGA 3I1FA 2GCPA 2ZI5A 2HDNB 2D4HA 2O52A 1C1YA 2ATVA 2OLKA 1U9IA 1EFTA 1E79A 3U7GA 5SZKB 4IFEA 1S9DA 1ZNZA 2ZS7A 3V00A 4BWYA 3B1XA 1Q22A 4DCVA 4KFTA 4GDFA 2C98A 2WIBA 2DWQA 1UADA 2PCLA 1CF4A 2J0SA 1NKSA 1VCMA 2XOKA 1TEXA 3GLFA 1EFRA 1Z2AA 3U3RA 1VG8A 2YINC 3PUWA 3SE0A 3U3JA 1ZIOA 3DPUA 2A5FA 3IBYA 4C0SA 2CCGA 1SVOA 2VH5R 5FTNA 1KK3A 2QQ0A 5AR1A 4Q4JA 2WTUA 3PITA 5FBRB 1ZM3A 2ZUCA 1Q3HA 2ZETA 1E0AA 4QC2A 3CWZA 4IOLA 3WYFA 5CK5A 1K5DA 3LVRE 3PIRA 1OLOA 4RZUA 3R20A 2F1HA 3IO3A 4TMXA 2QQEA 2XJ4A 2IF0A 2ZYTX 3W6PA 4YDSA 5KNCA 221PA 1KZGB 1E98A 2B8TA 1JB1A 3TUJC 4HB3A 3TUZC 1M1YE 2KSQA 3U7FB 1RRCA 1OFHA 1AN0A 2YZ2A 2D7DA 4B44A 1DO2A 2RKOA 2WWHA 3UMRA 4DLWA 5EXPA 1S2MA 4HUQA 4TQAA 2C9YA 2ZRAA 1GL7A 4L15A 4QBIA 4QJ4A 4PPGA 5B57C 1CR4A 2WKRA 5KSZA 4XSGA 2ZUBA 1L4YA 2QM7A 4WBSA 2QMOA 2JLQA 3LBIA 3NKVA 2ZU0C 2BM0A 1T3HA 3OAAA 4BFTA 3D6TB 4IKEA 2ORWA 3GEIA 4BECA 3THWA 3DKPA 3CRRA 1SGWA 2DBYA 1G5PA 4A9AA 1NMZA 1T9HA 5JRZA 3WP1B 4IJMA 2VO1A 4JZKA 2RCNA 3BWDD 4FMCF 3RLFA 3TNFA 2ZVPX 1YZQA 4AYWA 4L16A 3W34A 4C2TA 1Z08A 2CJWA 2ASEA 3IPYA 1GG2A 3FTQA 4AURA 2V1XA 4OQLA 2WWGA 3AF1A 1E1RA 2MSCB 3SJBA 4KCGA 2YNMA 2FG5A 2NZ8A 2R62A 1DELA 1U94A 1XP8A 2YYZA 2NO6A 2ZRCA 3GEHA 4M1WA 4ARZA 3QVUA 2VYFA 3WRYC 2PZEA 4TYNA 4LJ4A 1JR3D 2GEUA 1NG9A 5FBQB 1GKYA 3EZ2A 2BEKA 4IXMA 4G5GA 2XNDA 2F9LA 4LHZA 2P5TB 2J7KA 2V6JA 2ZTSA 4TZ0A 3O8DA 1NN3A 2H17A 1KDPA 3ICEA 2XNSA 1RW4A 2ZYUX 1XWIA 4I99A 3TLXA 1UKZA 4YMSA 5EP3A 1KK1A 1NVVQ 4LBZA 2GAOA 4OQNA 2RB4A 4D0GA 4AK9A 4IHQA 3SQWA 4JJZA 5DISB 3OFNA 2OAQ1 3ZDQA 4ASUD 1PLJA 1N5IA 5SZHB 1NJGA 1LFDB 3BFKA 4HUTA 2EYQA 2QMUA 5B64A 2WV9A 2G77B 5FOSA 1NLFA 3QF4B 3UXMA 3AVQA 5HZKA 4MGZR 2Z0MA 5AJYA 4V02A 1KGDA 1OB2A 4JL8A 4FD2A 2OBNA 4DDUA 5DN6D 5G53C 1OXXK 2V55B 4BE7B 3J81k 1GL9B 2Z4RA 2W6JD 2ZM5A 4ESVA 5JWRA 1FZQA 1XJCA 3DVLA 1P60A 2VHTA 5G3YA 4LJYA 3D31A 3WMEA 1TU3A 2FPMA 4PSAA 4EPYA 1DAEA 4JLDA 4KI0A 1Q1QA 3AGQA 1G18A 3T12A 4DCUA 2V1UA 4TYWA 5J4HA 5HE9A 3TQFA 5K8TA 2OFWA 4YQFA 3RDPA 2JAQA 1CJVC 1WA5A 4P4UA 1IY1A 5BN5A 4FIDA 3CM0A 4DUGD 4OHZA 1IOZA 2BM1A 2EFHB 1ZUHA 2WJHA 3L2OB 4LYJA 2DY1A 2ZSAA 3H4MA 3LLMA 1HEIA 1R6BX 1Z83A 3I61A 4AC9A 4C0BA 3LNCA 5IT5A 4W5JA 1P72A 4KV9A 4KVAA 1UBFA 1R10A 2RGBA 1OFIA 3SJAA 1VPLA 3K0AA 2KI5A 1TF5A 2OXRA 1P9NA 4Q4AA 4TYQA 1HYQA 4DDTA 5HKKA 4ACAA 2WWIA 2WAXA 1BH2A 1FTNA 3PCRB 4PXAA 5C4MA 4TZ6A 1KDRA 1XPUA 1GRQA 3T35A 3TAHA 4P0TA 4KJZA 2GBLC 2IUUA 3AGPA 3KB1A 4P4TA 1G8HA 1OH6A 2NPIA 3A4NA 3GP8A 1IXZA 2GF9A 2O8DB 3I32A 1T3SA 1RIFA 4IRUB 4I1OA 4RD0A 5C46F 421PA 4JBWA 5CIWA 3WNCA 2GESA 3DHWC 3A36A 4ZCIA 3BIFA 2XZPA 5FUXA 4Q7KA 3TSOA 3HU1A 4Q1DA 1ZU5A 4MYCA 1M7BA 4C7OA 5CLQA 2QMEA 2KBFA 5KDDA 1YR9A 1DAHA 5JECA 1SKQA 1E2MA 2ZE6A 5F3WB 4OJQA 4WAUA 1FFHA 2W83A 5JS8A 4PSVA 2CE7A 1ZYUA 4N0EA 1M8PA 5J4LA 4D26A 1Z6XA 1IN4A 2AD5A 3F5FA 3NTUA 2F1RA 3ZS8A 1ZD8A 2QAGA 3MD0A 2DCUA 1NG1A 1OFUX 3K53A 4M22A 4OQXA 3W6NA 3E70C 3PFIA 1TADA 1V43A 1VECA 3EA5A 2AK3A 1RPZA 4EQ6B 5BN3A 2RGEA 1G291 2V9PA 1FQJA 5F9HA 2BOVA 2HT1A 2PLRA 1OYWA 3FMIA 2C9CA 3FKSD 5GVRA 1Z8FA 4EPXA 3D3QA 4H1UA 2VIIA 3I8XA 4M9SA 5CYOA 1VCOA 2QE7D 4CT5A 5FI1B 5AUNB 1BS1A 2VP9A 3TMKA 3HPQA 3N2IA 1NN0A 4KAXA 4D80A 2OBMA 4Q7JB 3U3OA 2FZ4A 4B2IA 3CWQA 4GPTA 1WBDA 2JLUA 4QM6A 1H8ED 1EGAA 3QOFA 1IY0A 4RCYA 3H84A 4LSGA 4B3FX 1BIFA 5HPYB 3K9HA 5G40A 2O8BB 3BXZA 3A6PC 2F6RA 1ZBDA 1G4UR 5EUQB 1ESNA 2IWRA 5C2JB 2AXNA 4KLNA 4O25A 3EIHA 1F2UA 1S1CA 4ZIRA 4EUNA 4JYCA 4F4JA 4QKQA 1E9FA 5BN4A 3RS7A 4MRRA 1T4GA 4P31A 4DCSA 3WMGA 2J0VA 1CS4C 3B60A 3A1VA 3A1SA 1KJWA 2I4IA 1R0WA 4JLBA 3CR8A 4D81A 3BERA 3VKWA 1KAGA 5JJLA 2BHRA 2EFCB 4D4LA 2XXAA 4MITA 3VR4A 4XWOA 4I81A 3ZZ0A 2YC2C 4EFMA 3U5ZB 2GJKA 3MWLA 1XEXB 2FNAA 5JS7A 4V03A 1N6HA 4OHWA 1RRFA 3P26A 1P6XA 4BFWA 1J70A 3G82C 4XD7D 1FMJA 3RYTC 2ZANA 3ND9A 4LV6A 3AVYA 1Z0IA 1LW7A 4L5BA 1U90A 1W0JD 2EW1A 4ASUA 3CZQA 2IEZA 2RGXA 4NCNA 1E9CA 2MMGA 1Q1EA 2CL0X 2VEDA 3HPRA 5KU1A 3R7WB 4ZCMA 3VNVA 2FFQA 5DH9A 4LJAA 5FOTA 1PZNA 4TL6A 5EE9A 3FGNA 3GCGA 2WHXA 2K5UA 2F1IA 4NH0A 4AD8A 1G3IA 4HSEA 4H9GA 5FBVB 1W7AA 1LTQA 5DN6A 4URVR 4KXFB 5JSZA 3Q9LA 4POAA 3LW7A 4B6FA 4NYMR 3U7HB 3E5HA 3C4JA 2UZIR 4TSFA 2OSBA 2CHQA 3SJZA 4ZI2A 2C99A 4RD3A 1DAIA 3HR7A 1ZJ6A 4PPFA 1XZQA 1RKBA 5ANRB 3AVUA 2ZE8A 4XTRA 3EASA 4NKRA 1VCNA 1G8PA 3WBJA 3EIQA 3ZZTA 4IVPA 4RJLA 3VHLB 1EFHA 3OZXA 2Z83A 2QTVB 1VYTA 3TSWA 3QKRA 2G1JA 2RMKA 4DLTA 2FJUA 1F6BA 4M8NE 3IEVA 3PUXA 1O3YA 2QSZA 5JI3E 1H65A 4Q9IA 2IS2A 1JR6A 1C4OA 1CBUA 2C9OA 4B2LA 3K0CA 4NCKA 2ZRJA 3B1WA 2XTNA 4HLDA 1KKMA 5J4VA 2H7VA 4AYTA 2YOFA 2FV8A 3PUYA 1NLYA 2FFAA 4ON9A 4QJ3A 2QTHA 2EWWA 2BMEA 1YQTA 4TLEA 2NO1A 1NBMD 1YZGA 3EA0A 1E9DA 2IYZA 1HV8A 3A4LA 3LAWA 5EXTA 4CGZA 3KXKA 5KNBA 3VR1A 3KJHA 1SKYB 3L43A 3MFYA 2ERXA 3REFA 5B58C 3MUFA 3CPEA 3CH5A 5H1YA 2OEPA 3HYRA 5B2ZA 3QXXA 1KTVA 4TL8A 2YKGA 2H57A 4X8MA 2DFNA 3G5UA 3ZH9B 2R9VA 5EJEA 1CRQA 3S1AA 2QY9A 4TTQA 4A0FA 2ATXA 3ZIAA 4DSNA 4OI4A 4QGGA 2CVFA 2O8CA 1PLLA 2LCFA 3QG1A 2C04A 1DADA 1KMQA 2ANCA 4Q5IA 3B6EA 4ZO4A 1FW6A 4B2PA 2IYXA 4JLAA 2GA8A 2GXUA 3DMDA 2PL3A 4Z54A 2GNOA 2J46A 1XFAA 2ZSEA 2AHOA 1YJ5A 1E0JA 2AKAB 2NO0A 1KY3A 2WJYA 4JVMA 4M9XA 3V9PA 4DJTA 1KSJA 1KI6B 3CBQA 1R5BA 4XH9B 1XTJA 3FMPB 1D2MA 1CJMA 4AI6A 3MWKA 3NBZC 4LC1A 3CPHA 1SVKA 3CX6A 4QHTA 4MGIR 4I1VA 1II8A 4TMTA 1EFRD 1GIAA 2ZS8A 3T1OA 3RWMB 3GLGB 4LRWA 3NBYC 4NU0A 1N5LA 2HJVA 4LDJA 1KI1A 2FSGA 2ZROA 1SXJA 1D9ZA 1CU1A 4WXRA 2O8FA 1OXUA 2EVWX 4FXPA 2VSFA 3WXMA 3U44B 4OK5A 1XXHE 1M7HA 1QVRA 4QJ5A 1YZUA 3KTAB 4JKIA 4PHHA 2CLCX 3ZVMA 5FL3A 4BRUA 5FTLA 1N5KA 3PVSA 2ZJYA 2FN4A 4EPRA 2B7CA 4IOMA 1D2EA 1H8EA 1YRAA 3RSOA 5IDVA 3K0FA 3SFZA 1ESMA 1T0HB 2RHDA 2VRWA 2X77A 3ZVRA 1UFQA 2L0XA 3QI2A 3K70D 2AFHE 1E94E 3CIOA 2RGDA 3GFPA 1QHGA 3P1JA 3LRPA 2KB0A 3IEUA 1XX6A 2AFIE 2HJGA 4F4IA 2NO7A 4DIDA 2Q9CA 4W7SA 5K8LA 2WIAA 1G5RA 1YU9A 2DFKB 4MYHA 4CDGA 4Q1BA 2J41A 4GZMA 1G41A 1X6VA 3OAAD 4G5OA 2GXSA 1B0UA 1A5TA 4URXR 3GLFB 5DNYB 3B1ZA 2Z4SA 3KQHA 4GNKA 3ADCA 2B92A 3KX2A 1KSGA 1ZW6A 2IYYA 1GNQA 3ADKA 2P0EA 1FQKA 4GL2A 2NOAA 2N42A 1PJRA 3W8RA 3CW2A 5AWFC 2CE2X 1W2HA 2R2AA 4ZKEA 3UG6A 3RNLA 1E2LA 4Q4JB 3ECCA 1AJEA 1CIPA 3LY5A 4IW3B 2PH1A 5EXSA 1K8RA 3KQKA 1E1RD 2VBCA 1MV5A 2HCJB 4G1UC 3ZJYA 4DSTA 2J0UA 3ZVNA 1OH8A 2FZLA 4HLUA 3TRFA 5AUOB 1ZC4A 2ZJBA 5FI0B 4O2LA 1N6NA 4LY6A 2VHQA 4A0HA 2VP6A 3QPVA 4QL3A 3TQCA 2Q3FA 5JEEA 3QQ5A 5C18A 2FF7A 4CIDA 3LFUA 4MDEA 1E9AA 1E4YA 2ZJAA 3K70B 2OBLA 3B8HA 4V0OA 3BK7A 3AP3A 3SYLA 2HYDA 1R0XA 1XJ0A 1FPMA 3GLIA 1B23P 2C77A 3QKTA 1S96A 4KSCA 3OFND 5GADl 4YXWD 2JLRA 2WJGA 3FHOA 1HH4A 1ZIPA 3RC3A 5LB4A 2VHUA 4BZPA 4S2EA 1R0YA 1FUKA 1BMFA 1DAMA 4V0NA 3SJCA 3THWB 4ZPXA 5KOYA 2H16A 2A78A 4M21A 5FL7D 3VAAA 2IK8A 3GJXC 3QNUA 5IK2D 1W5SA 1Z6TA 1GOTA 4CZ2A 4LPKA 3I5YA 5FOVA 1XMIA 4L9SA 1VHLA 2VP2A 2ZYVX 1WBBA 3GEEA 2ZITA 2CJWB 2ODBA 2FX3A 3D7MA 4HLCA 2F43B 4C0HA 5JLJA 2XB4A 4NE2A 4FI3C 4K8OA 1JR3E 2NIPA 3VFDA 2FDCA 4JVNA 2IUSA 1VKJA 2QL6A 3TJZA 5JFGA 3EARA 1CRPA 4C0LA 2OFXA 2H92A 1F3OA 4TQ9A 3I62A 4AY2A 1R5OA 3TR0A 2ZI7A 5HTKA 5P21A 3QENA 1T5IA 3AV0B 4GMDA 4LJ8A 4S35A 5AUQA 1EFUA 4JL5A 1AQUA 1GAJA 4HEJA 3CRQA 1UM8A 3JVVA 3AKCA 1KO1A 4OL0A 2D3WA 2ZREA 2AXPA 5KSPA 3B13B 2A7QA 4RFSA 2LWIA 1OW3B 1NY6A 4HAUA 2VP5A 2F3RA 3LQRA 1ZNYA 3JZAA 1CXZA 4NYMQ 2ZS9A 4XWKA 2CK3A 1NIPA 4AG5A 5K8UA 2BMJA 4R71A 3L0OA 5AJWA 3RS5A 2ZRGA 5CITA 5HKKD 4MRPA 4LV5B 4A2WA 2O0KA 1R5NA 1N5JA 4BUJA 1KDOA 2A3RA 1KO4A 1R0ZA 2GEVA 1M6NA 3W5IA 1GKUB 4AYXA 5DI9A 4DEXA 4ABYA 4OBEA 1BKDR 4RD6A 1OYYA 2WM9B 3UANA 1YRBA 1FL9A 4AKGA 4DSUA 3ADDA 4F38A 2J3EA 4DLUA 3TR5A 4QGHA 2H18A 2GHIA 1IY2A 5JCZA 3U2QA 1XD2A 1E9SA 1ZM9A 3TVDA 5LD2B 1J7KA 4HAYA 1XD9A 1TQDA 4Q9JA 4TN1A 4TT3A 3TUIC 4Q9KA 4CEHA 3BC1A 2PMDA 1Q0UA 3EZ7A 2P3SA 1P4SA 4G0NA 4JSYA 4B74A 2CNWA 4MKGA 2GWHA 1MABB 4KVGA 2CHGA 2WOJA 3GJ5A 1R2QA 2GRJA 2GTPA 521PA 1G6HA 4YMVA 5TXGA 2DB3A 2VLIA 1T8UA 1J90A 3CNLA 3T06B 3ZZUA 4ZDWA 3JZMA 1TMKA 2J7PA 3K0AB 5GJVC 4Q4AB 3UG7A 3WNBA 5DLQC 1T8TA 3TKLA 1CP2A 1Q21A 1KKLA 4TTPA 2YWFA 3LXRA 2AD1A 4B48A 1EWRA 4KO8A 2ODEA 1S3SA 1NMXA 2YJTD 2A5JA 5JJKA 5KPDA 1KHTA 4A8JA 1XEFA 4A92A 4IVRA 2CLSA 1EG7A 4TLDA 2EQBA 1IJEA 2IXEA 1HTWA 3U4QA 4OI0A 1UEJA 4C0QC 3FYHA 3MJRA 4TMKA 2BBSA 1X1RA 1C9KA 2I1VB 5FTJA 3LX5A 3RAPR 2QPOA 3IPXA 2GCOA 1A2BA 4M1KA 5EE1A 5GJWC 4C7OB 1G3QA 4B3BA 2RGNA 5CB8A 4A36A 1YZNA 4ITRC 1VIYA 2P6RA 1WMSA 1D2NA 3VMFA 1QBKC 2F43A 4TYPA 1UBCA 1KDTA 3FHCB 1JBKA 3NVAA 5CDFA 2KWIA 2AWNA 3B78A 3C16C 1YZLA 5IF9A 2QAGB 2W2XA 4HAVA 4D2IA 2PZGA 1TL7C 3QE0A 5C1BA 2VPPA 2QP4A 4Z51A 3REGA 3ZLJA 1IBRA 1OF1A 2CDNA 2ZRNA 4KLZA 4P3YA 2BCJQ 2IC5A 4IDHA 3SI7A 4V0ME 4UNPA 2GK7A 2WAYA 1W4AA 3K09A 3KZ1E 4LYHA 1KK0A 4TWZA 4CRWB 2ANBA 1U0JA 3K9NA 4LHXA 1OIVA 2LKDA 4YXWA 2J0QA 3TGPA 4FCWA 3FE2A 4EKDA 3VR6A 5JMTA 1AGRA 3IQXA 1VG9B 1L7VC 1SHZA 2E87A 3QSYA 2VF7A 4Q1EA 5FL7A 5IK2A 3VX4A 2RAPA 4JT4A 3CLVA 4GMXA 1U9IC 2D7CA 2OCPA 4KU4A 4PC2A 2MSEB 3GLHE 1TQ4A 1F60A 1F2UB 2E1RA 4ZIRB 1TNDA 2BWJA 1OKKD 4A0RA 4C0JA 2IYSA 821PA 4OI2A 2PEZA 1II0A 3FPAA 2GAAA 5EP1A 3Q85A 3NHAA 1W1WA 1ZNXA 2IHYA 4TSFD 4DLRA 4BRWA 2IS1A 1RRGA 5FUYA 4KSBA 2XXAB 1JI0A 2KBEA 2HXSA 4JLVA 2HCBA 4GOJA 2WWXA 2IA5A 2GVDC 3Q72A 4D0NA 3A1TA 2OFOA 2PLFA 3AVVA 5A4JA 1NMYA 3SNHA 2FSHA 2G3YA 4BEJA 1G16A 2IXGA 3QF7A 1KJYA 5BQ5A 3UK6A 4DCNA 5L3VA 4DLSA 1MABA 4PQYA 4IDOA 3C5HA 4Q9LA 2WPDA 4JVLA 3H2YA 1TQ2A 1LS1A 3N5CA 1HA3A 3OEED 3T5DA 1L8QA 3QPWA 3RC8A 1CKEA 1SKYE 1OXVA 3SN6A 1Z5ZA 1IN5A 3K70C 4MH0R 121PA 1GRNA 1W4RA 1QHSA 4M53A 3KQLA 3RS3A 3AUXA 3QUSA 4LHYA 4M1OA 4DWJA 1JEEA 5JSZB 2B7BA 1O87A 1IN7A 1E0SA 4RZ3A 5FOUA 3T34A 3AM1A 2IYUA 1GTVA 4WZ6A 1ZUNB 2PZFA 4Q00A 3R8CA 4DBLC 3THXA 4TMVA 2BKEA 4B32A 4Q1AA 4CVNA 5KTYA 2QPTA 3ZIAD 5LPNA 1W47A 4FMDB 1DBSA 3L8YA 2QORA 3ZYCA 5KYKA 4CT4B 3CB4A 2FU5C 1OIWA 3RRNA 4OQFA 2QGZA 4D6PA 3H0KA 3QKRB 2RGNC 2XX3A 4YLGA 4WW0A 4RFVA 4RD4A 5EZ5A 1XDBA 3VKGA 1OXTA 3KDSE 4NMMA 3GLGE 1MT0A 2OCBA 5J5CA 4C0AC 1NIJA 1W0KD 1XTIA 4XVUA 2QAJA 4RVCA 1PV4A 2BMFA 1NBME 2ZR9A 1E2KA 4M1YA 3C41J 5HE8A 2QENA 2ONJA 4P4SA 2WJIA 3W8NA 3ZGXA 3VR5A 1I2DA 5KUTA 5CJPA 2GETA 1COWD 4LBYA 1SXJD 3CKLA 3KJIA 1GNPA 2BC9A 3AEZA 1Y3AA 3ETLA 1DG3A 2FFBA 3SOPA 4FCVA 4PX9A 2B6HA 1UBEA 2NG1A 1QHIA 2J5XA 4TL9A 2IS6A 3OIUA 1RJ9A 4EJSA 3AF2A 4U00A 2J1LA 2YV5A 4KYIB 4ZV4A 2EWVA 2UKDA 4AKEA 2IF2A 2XAUA 2C95A 3I4LA 4M2LA 1HT1E 1ZD1A 4RD2A 1TX4B 1N0VC 4ZDIA 3VNUA 3S1AB 5KHOC 1AZSC 2ZI4A 4CEIA 2O8CB 2JEOA 3UWKA 4WVFA 3FHTA 3R8FA 5CB6A 2HUPA 1E2NA 2IWHA
chains in the Genus database with same CATH superfamily
2WIKA 4GLJA 2JDIA 4IO0A 1DWUA 3RFTA 4URWR 3UHFA 4K6MA 1KI2A 4C1NA 3P0IA 1W85B 5EUCA 4C9BA 3TG8A 3BOSA 4QUEA 5AI8A 3GLFE 1M76A 2ZJ7A 1XHFA 1GTL1 1NW4A 3PC2A 2BEVA 4HBZA 4B17A 2ZZMA 1YCHA 3NJ4A 5JD3A 1YRHA 1ZH4A 2IYVA 1P2FA 1II8B 3P5SA 5AXBA 2RCYA 2R6GA 4MI6A 3DL7A 1ISHA 2JJYA 1D6JA 2Q5QA 2ZEJA 2B4KA 3I8OA 1Z36A 4UPDA 3ZW9A 1GDDA 2HF8A 1USGA 1CQJB 3PPYA 5LDDC 3RIYA 2WU1A 3ETGA 1D9XA 1ELOA 2HTFA 4YWHA 3N3AC 4IDCA 4CI0B 5E1OA 5I9TA 1OLUA 5IG2A 2O8FB 3AIMA 4MUYA 2OXCA 1HYBA 4Y0VA 1X7WB 1H1LB 2J67A 2FJPA 2V3WA 3FF4A 4LOKA 1W5TA 1L5HB 4WUVA 1G7TA 3SBXA 3ETEA 1JHZA 3CEJA 3ED1A 1YI0A 3CJTA 3KRTA 1MOPA 3OUZA 4N49A 5ELMA 4G5SA 3UT0A 4DZTA 4MV1A 4BNDA 2BCGY 1KDZA 1T5OA 1UMCB 1X7XB 3G59A 3LBYA 3RRMA 4WASA 1FFAA 4IGIA 1WCIB 1W49A 1Z8DA 3UJNA 1RAHA 4LG1A 1Q12A 2YMPA 3DFZA 1OQAA 3LSYA 1SOVA 4ME6A 1JKIA 5LZ8A 4K46A 3RD5A 4BFUA 3IT0A 3K0FB 4Q9DA 1Q5PA 4GPEA 1FW8A 2J45A 1DPGA 2AJCA 4Y2QA 3X1WA 4DLYA 2B7LA 5AI5A 3FAKA 1LF0A 2I9KA 5JRJA 3EWSA 4GVLA 4LS3A 3EXG2 4LYEA 4OYLA 3NDPA 5EQTA 1NXVA 4QATA 5FWAA 3P9ZA 2BDTA 3AR4A 3A9SA 3L8MA 2EL7A 4E33A 2DPYA 1QZTA 5AW1A 2GZ1A 4BUZA 4HZUA 2VDJA 3QV1A 1H0RA 3G2LA 2XV1A 3MRSA 2FEOA 3QWHA 4ID3A 4Y2SA 1TYEB 3BZWA 1IPFA 2QLLA 1NPTO 3MSXA 4X91A 3PF9A 2GN8A 3T3OA 1EQUA 1CZOA 4BVKA 3E5RA 5FPSA 3F1LA 2BMDA 5IVHA 4XJTA 3ZE0B 5JH7F 2ODWA 1PWHA 2O3QA 2VJMA 3E2MA 3LBNA 1Y1RA 2I6QA 2OO3A 3JQFC 2V9ZA 3BHNA 4R2IA 3ER8A 4YRZA 4O59O 1JJ7A 5L3SA 1E1NA 4H0CA 4C30A 3OJLA 1T29A 3MWFA 3PA8A 2OHIA 4HNVA 4YC7A 3TBKA 2CWDA 3GBPA 3IUNA 1KO5A 3HC7A 5LA6A 2VPIA 4N3AA 2WYVA 5LDHA 4BIMA 4WCFC 3N0XA 3C7DB 4FB5A 3WRXC 1N32B 5IEBA 1NV8A 2VBGA 3OEHD 3SHWA 1XPJA 2AOUB 5L3QA 1PJAA 1PTKA 2RGWA 4JT9A 2R7AA 5I3CA 1LA2A 1S8FA 4NXNB 4TWBA 3EUAA 2UXCB 3RM3A 2BFMA 2OCKA 3GFTA 4DIUA 2ODAA 2ZE5A 1ZM2A 3ANNA 4UHBA 2YWHA 2G0TA 2H0QA 4B31A 2QLNA 3HCCA 1P7CA 5DI3A 4EFNA 3A2NA 3GFOA 1YS6A 3IUSA 3WAKA 4EPVA 5H02A 1P2SA 4CMAA 4RUKA 1T5DX 3KK0A 4ONEA 1Z4LA 3MWDA 4OHKA 5JAOA 3WQBA 3EEFA 3WLAA 4XWAA 1ORDA 4FINA 1J8YF 2IYFA 2OV1A 5CIQA 4BLVA 2VUTA 1T2EA 3GDGA 3EXIB 2P30A 5DBIA 5DNDA 1ADFA 2F3UA 3RGWS 4W5HA 1MVOA 3N2ZB 4QOIA 3G0GA 5BOSB 1SHTX 3PGLA 3Q9UA 3FCXA 3QOYA 3KJGA 3W6OA 4FGWA 2VYVD 4DQ0A 3TE6A 2GNAA 1J8VA 4O2BB 3JYNA 4XDGA 3E9ZA 4F1WA 3EODA 3IKJA 2C5EA 4HB2A 3RVLA 5HM6A 4HF7A 5ALUA 4U7GA 3KHTA 2YN0A 2BGIA 1WPRA 2Q5OA 3CZRA 3ORYA 5K45A 2Q8QA 1GTMA 1QG2A 1QX3A 3IIKA 1M5UA 1WVGA 1ZXBA 1FXUA 3AQ4A 3DDZX 4GZ3A 3HTXA 1W46A 3RS0A 4DKJA 3DEZA 4RJTA 1YE5A 2R4TA 2ODPA 4PGGA 3UAYA 5J2UA 2DETA 1A3CA 3B3AA 2B37A 2Z3WA 3U1BA 4FZJA 2JJ2D 1J1ZA 1VYHA 2HLDA 3DV0A 3FMVA 2N47A 2ECPA 4G0WA 3CVOA 3BWYA 3MTJA 3KFVA 2AGVA 2CNWD 1XNJA 1XZLA 3O75A 1SQGA 4R3WA 4GYYA 4YJGA 3SR0A 3VPCA 4BFVA 2P7IA 1J8FA 1VP3A 3TMYA 2EW8A 3BWVA 1ZU4A 1CJCA 1FTSA 1SULA 4DRYA 2P9CA 3DPSA 1Q20A 3RF7A 3PXDA 4XRGA 3CRMA 3HVRA 3A04A 1BYIA 4HB0A 5HFAA 2DYKA 4L57A 1TTTA 1G6OA 4JSTA 1NPYA 4RVNA 2OD9A 4XGQA 3WO0A 2G70A 1MRNA 5KQRA 1GGEA 2I7CA 1TTQB 1E2PA 3AW9A 3L0SA 4GI1A 1NM5A 4JP1A 4UAUA 2WNSA 5LXTB 4NOMA 1L7XA 4F97A 2NQ2C 5EIFA 2JAXA 4ZICA 2W0MA 3NDBB 1YUNA 2JK1A 3GJZA 1I32A 4KMSA 4HX5A 1SD2A 4UPEA 3AHGA 1OTXA 1EH5A 1TIBA 4EY3A 2YZMA 3N59A 1SELA 3QJ5A 1JAIA 1H6DA 4KXLA 5K09A 4HVAA 2QM3A 3EH2A 3RJZA 3B2QA 2WB2A 2BI4A 2H1VA 3D8RA 5E9AA 2GZ2A 4NZ9A 4O4HA 4UATA 1C9JA 1I4EB 2BONA 1XD2B 2ID4A 2WBLC 4RSGA 5DEOA 5DYIA 3ADPA 4EHBA 2GFQA 3UGTA 3CKKA 4OQEA 4RZIA 7YASA 1NP6A 4BGDA 3WLJA 3LPDA 2R65A 1B8PA 4HYYA 2O7RA 1OIXA 2GZDA 2JGIA 5JQGA 1Q7EA 1H2WA 3HKDB 3SR4A 6ABPA 4MV3A 3UJDA 5CEJA 2I4NA 1EDOA 2NZ2A 3EXG1 3D7NA 4PQEA 4Q9HA 1JN0A 2IXAA 5WRFA 2XPCA 1YHNA 2ZBVA 4KWHA 4F5EA 3ZWNA 2R66A 2DF8A 4FUTA 3K5WA 1NGSA 4I1UA 4DIMA 9MHTA 3TH5A 4DV3B 3ZK7A 1KQGA 4YPFA 3WY9A 3CVYA 1SUCA 2VT7A 3LKVA 4ITUA 5H0IA 4IIJA 3QI7A 3LPLA 2NV2B 1OTHA 1G2PA 3JQ8A 4V0RA 3PJGA 1E3DA 2I5PO 4O4LB 3VO1A 4V0KA 2Q45A 2WWWA 1D2GA 1YNSA 4HXYA 4B3CA 1GT6A 1Y4SA 4EF6A 3FF1A 4PLWA 3EMVA 3KWMA 4UNSA 4HAZA 4W5WA 4UCFA 4ZAVA 1PVOA 4I9UA 2HLNA 2R6JA 5I5EA 3ZW8A 3IPCA 5LB2A 4DWWA 4YIKA 3E4CA 1CUFA 2XEXA 3A6KA 4KQFA 3T7TA 3ZCSA 2ABWA 1NZFA 2PXCA 1KI9A 1H4TA 3GRRA 1LPPA 3L1HA 1DEAA 3D8BA 3UFXB 3UKDA 1E3WB 3ZQKA 1KEWA 4F56A 1PUJA 4R6WA 1E3LA 2AVDA 1B6SA 2C2BA 2H31A 4HC4A 1F2TA 1BTOA 1MFZA 1WDKA 4F4CA 3CFYA 4GU5A 2M32A 3AI3A 4AG3A 3GI1A 3N6RA 5AM1A 2O7SA 2XNKA 4M0LA 1FQOA 2RIPA 3OE7A 5BMVB 3R5KA 4XIJA 2GEFA 2R8XA 3CXRA 3P9YA 4DANA 4JLNA 5JNLA 3IO5A 2VCEA 2XIQA 4EY8A 3R76A 3DL4A 1W8DA 5AESA 5KCZA 3WV4A 3NHPA 1VL2A 1ZJ5A 5TARA 1YD7A 3QFHA 4OAQA 4BYMA 3FYUA 3ZE1B 1PUXA 3T1YB 1FE8A 3P71T 2JCGA 4QNMA 2G9RA 3T9FA 1G19A 3M6AA 2H1HA 1E9BA 1MLDA 1FX0A 2JFWA 1JBEA 1CB7A 4U7DA 1UL1X 1KU0A 1JIJA 5IX8A 2C84A 2MSNA 4FEAA 2IEBA 5B30A 1R50A 1MH9A 2JGAA 4TL7A 2JJ1A 2XDQA 1E5TA 1LF5A 3HXPA 4FFDA 4J3FA 5LMZA 1GXSA 4M7PA 2WPDD 5C8YA 3ZZ1A 4KBGA 4MV6A 2NYVA 3A1UA 2H1FA 3H86A 3PFNA 1MO5A 3WYDA 1PQYA 1AC5A 1WMBA 4I1IA 1VHWA 4IIVA 4HRVA 4ZCLA 3R75A 4DAEA 2QVBA 2VYQA 1R9NA 2GSDA 4D4IA 1AK2A 2D6FA 3ERCA 1IEWA 3HB4X 5K0TA 2XITA 4DYHA 4YV0A 1DXOA 1HE8B 3CNBA 3NW9A 1MCZA 2IY9A 2Z8XA 4P22A 4DMGA 4IQ4A 4WESB 1TUEA 1A7JA 2V96A 1B1CA 4J07A 3LRXA 2C5LA 4FKMA 1TCAA 3C3JA 3CRVA 4RLSA 4M98A 3FIJA 4AWBA 4EECA 3WGVA 3NTOA 2OYSA 3DBVO 2Z43A 4FWIB 4OSEA 5CVDA 2NU6B 2QTTA 3BE4A 4ROTA 4QXAA 4F2PA 4KR2A 3ZIDA 2IEIA 4K0KB 4NYIR 1N2CE 1KDYA 4JEHA 2EU8A 3I83A 3LLCA 3PEVA 3DE5X 4EG1A 2OC9A 4HH0A 2C7OA 4BBAA 3OMWA 1R0RE 3LY9A 2VSOA 4FSDA 1SVNA 1SWWA 1ST2A 4QQKA 3C6MA 1B0AA 3PI6A 4WY5A 2I0FA 1ODIA 2AMJA 2NU8B 2AJ8A 1A7AA 4JMPA 1IN1A 1KAMA 4F3RA 5DBEX 1QK4A 1UQRA 5IJAA 3CRNA 1CJKC 4OPMA 4NRDA 2C7PA 3AY3A 2ZWIA 3L8HA 2WSLA 5BSRA 1E64A 4YJDA 1TFUA 4RXTA 2OILA 3ZXXA 3ZQ4A 3CJRA 1MGPA 2BZ0A 4PY2A 3D1LA 3TMAA 2OV4A 4LZZA 2FWNA 2QZ4A 2X13A 3P0RA 4JBXA 3MIIA 4NL4H 5K03A 5E4FA 2AZMA 3OETA 1SRQA 3G2JA 1QTNA 4RVGA 4DLKA 4KN8A 5GGXA 1QCCA 2FR0A 2NNLD 3KKKA 4U02A 2PX2A 4NJEB 1K7FB 2O06A 3ICOA 3EQ6A 1BDJA 3MOGA 5DWVA 4ZEWA 3ZDEA 1DJNA 2DSNA 4CUJA 5DM0A 3VR5D 2HRBA 4QASA 5IJ9A 1CX9B 3KM0A 2J9ZB 5LQNA 2XB9A 1RWMA 1J25A 4CKZA 2B4AA 4BLPA 2QUBA 4LC0A 3DNFA 4N6NA 4K9SA 3AL3A 5JWHA 4J49A 5SYMA 4HNAA 1Z3IX 4D4MA 4LJ5A 1G60A 1CUEA 2JGDB 1XTUA 2V58A 3V2UA 2RHJA 5FHRA 2GHRA 1UBGA 2VRCA 3UFBA 1RZ3A 3FPEA 1H66A 4WXEA 3ZU5A 5EJ5A 3QIAA 1GITA 3FSJX 3NTRA 3L8ZA 4OGGA 3V97A 2MIIA 3TW4A 5LKRA 2FMIA 4G09A 2ZXEA 1WS6A 5JI2E 1UPTA 2UVQA 4PQFA 1QK3A 4GUDA 3RFFA 2REOA 3FBGA 4UFOA 5TMPA 2UUCB 4QT0A 5GGYA 2GK6A 1JHPA 4D8YA 1WWKA 1RYDA 1ZAKA 3LPCA 1V16B 1FP2A 1Q15A 2G06A 4I1RA 4RA9A 3VZSA 3DAOA 4XCXA 5F21A 3S2GA 4Z5XA 1LDBA 1EVJA 2B1IA 2G5PA 2OM2A 1AV7A 2PO7A 1GP2A 2DCMA 3LH5A 3CYFA 4Q18A 4UASA 1LJUA 1PDOA 3W4KA 3F3SA 3W8DA 3HB7A 3PFFA 1BE1A 1NI3A 3TZQA 5CGZA 1KJ8A 3Q4GA 2GBLA 2IEYA 3A58B 2JFVA 3KSDO 2WTEA 3RK4A 1OJ7A 2AFIB 2HFKA 5L6LB 4IZIA 3U4GA 1XDSA 4I6JA 4D41A 5IFKA 2GRUA 3CIFA 1D1SA 1SXJE 2FW7A 3KFLA 1L4BA 1U5CA 4OQPA 2FZGA 3SLGA 4AJ9A 4BC0A 3QPUA 3UMCA 4F84A 4P4SB 1ZQ1A 2C7QA 3FR7A 1KMMA 3D5TA 4PVDA 1TC2A 3BREA 3DOEA 4YJHA 3W9BA 1K97A 2XW6A 2PAFA 1C3OB 3E7FA 3GT7A 3HXMA 3AWIA 2V0GA 3T1QA 1FDVA 3B89A 3ZVLA 4QHYA 2CVHA 3UATA 3O94A 1ZR4A 4H4EA 1YMQA 5I9BA 1RJ9B 4JYPA 1PS8A 3LCRA 1NJ1A 4TM8A 6LDHA 2YJ3A 3HNRA 4AB1A 5ULLA 4B84A 1F8GA 1XVLA 1EFVB 4NBSA 4R4JA 4ZOLB 1U8ZA 4CJXA 2HF2A 1X1CA 4MYTA 2WWVD 2IOFK 1KEEB 1VHJA 2P0YA 2QRNA 2ZSDA 4JVOA 4MA0A 3D54D 2IYQA 1GQQA 3ABZA 4PNHA 3I8SA 1F8UA 3X0DA 5GZ3A 3SDSA 2W4QA 5CFZA 1T2NA 2O14A 4BFSA 1DX4A 4NNOA 4JUCA 5HQ3A 4NDZA 2XCRB 1E8NA 5E95A 3EX7C 1TIKA 5D3MA 4HNRA 1LRLA 3IMCA 4YN3A 3QH4A 4ARSA 1FMCA 3IE2A 4JNCA 1WXIA 2IVZA 1JEQA 2MR6A 3BIXA 3E8SA 3AF5A 5TJ9A 3EULA 2XMCA 1TO1E 1EWVA 2Z1MA 3E58A 3WQRA 2ILTA 3ADBA 4KQHA 2QROA 4BKRA 3H4TA 1HQYE 1LPMA 3F3YA 4HADA 4HB4A 1OTYA 4OKSA 1XZ8A 2H63A 3ZQ6A 2RK6A 3GJ3A 4A15A 4UHHA 2CV0A 5KOJB 1EK2A 2AC4A 1UP6A 3H04A 3H83A 3LWZA 4R68A 5TPWA 1AS0A 2OZLA 2PA3A 3AZQA 4FONA 1KZ7B 1M7GA 3C6KA 3M1LA 4GT1A 2HJHA 4JKYA 2OQIA 1Z22A 2D4AA 2HK9A 2P4EA 4IQGA 4NMXB 1G5TA 5BWOA 2YV4A 1UPAA 1MKYA 1CR0A 3HUDA 2RGCA 3P2EA 2YIDA 5D7BA 4L51A 1RHUA 2IHVA 2ZUDA 4XRRA 3AX6A 4WBNA 1S8OA 5CW2A 3UBTA 1ECLA 6PFKA 4PBSA 4QOEA 4G67A 5FEUA 1Y8QB 5CAEA 3FOEC 4J9UE 1BEEA 3ZLUA 2FK7A 1WTCA 2PBLA 4TS9A 3EIEA 1YZYA 4HFRA 1P9RA 1Y1SA 3NETA 5EE3A 7REQA 1M8KA 3KQNA 3GX1A 1ZP6A 1QRAA 3CUEF 3H5VA 3O8BA 5AYVA 3G8YA 2FN3A 2H2GA 5F2OA 1PFYA 2JKZA 2J9FB 1PNQA 2XD4A 3ABOB 1FA9A 2GOYA 2AYZA 4IUYA 9GPBA 2I29A 3WJ7A 3C5EA 2FPGA 3HABA 3K9GA 3COVA 3DUWA 3I52A 4GP9A 1E32A 3N8KA 4TKVB 1G17A 2ZRDA 3C8DA 1QONA 3OM8A 3PYMA 1Y8CA 1XO1A 2REQB 4HDSA 5IKEA 3VJRA 4CW7A 5E1DA 1SM4A 1VRCA 3W7BA 3QBTA 4N5MA 1CDOA 3AFNA 3ECSA 4G9GA 1RKXA 2Y0PA 4CLOA 3WL3A 1MPTA 2QTMA 2ZAYA 3PRYA 1PYGA 1N2EA 2ZDGA 3WISA 3ZHOA 3WNZA 3L0ZA 4ZAGA 1XXHA 2HJSA 2D62A 1X3SA 3C24A 1KYQA 2X40A 1K08A 4MEAA 4RKEA 5KYGA 3U6KA 4R1QA 5A9TA 1OHHD 3A4MA 3KZCA 4EB3A 2DTDA 3R5HA 2VNHA 2EG5A 3NGMA 2BEWB 1E6CA 1NLZA 1HDOA 4TSKA 2C9ZA 1IUKA 1GPJA 5T3UA 4HQRA 4JC4A 5JZBA 3K9WA 4LHWA 1XRJA 3H9JA 4DQLA 1YA6A 1B0ZA 4DG5A 4X85A 4M8LA 4QFMA 1MJFA 4YAOA 2R44A 2P6UA 3VR4H 1VJ5A 4IMPA 3O4RA 3HV2A 2GAJA 3S2SA 2L17A 3JYLA 4KHZA 3U61B 2QN3A 2VAPA 2PCJA 1GDTA 5C5IA 3OLYA 1BN6A 3A6ZA 3MK31 4CEHA 3EQ7A 3HKCA 3MGCA 4X6UA 2G83A 2OO5A 2XTZA 4U2CA 2UUBB 1II9A 2OZKA 2PX0A 1WV1A 3BF7A 1N3LA 3W5HA 5IXJA 1Q3TA 3B7PA 1VGVA 1X9GA 1DG9A 4FR5A 2C8KA 2GD0A 3TK1A 5FH9A 1OGJA 1MORA 2HREA 3CLSD 4EJ2A 5I48A 1IOLA 1KEPA 1BOFA 3CNQS 2UU9B 3QVMA 3AVWA 1PWZA 2PU5A 3IUYA 3EW9A 2C4NA 3GVIA 1M34E 2YMMA 4KRFA 3PU6A 1VI6A 4BFYA 3UMFA 3R0JA 4PLFA 4BO5A 4CMEC 4AS2A 2CNOA 3WI7A 4FCTA 5BXQC 5DV9A 5LYJA 1N9GB 4R8SA 2G0AA 2D2EA 2BFDB 3EIWA 4YRKA 4W5RA 2I6UA 1PSWA 3EEIA 4QAJA 3Q9NA 1IULA 1N3BA 1YZVA 4GWLA 2BF4A 1RWQA 2I3BA 2Q1TA 2REBA 2QOEA 2WD7B 3HN7A 1RZRD 2ERYA 1ZSNA 3SEZA 1HDRA 3GBSA 4K9OA 3WLQA 2CLLB 3S44A 4UVEA 3PZRA 1DFGA 2RH9B 3HCFA 3L8EA 1NU8A 3IMGA 3SMQA 5C5EA 3PWSA 2VNSA 4LJRA 3VPFA 1U28C 3DVSX 4YV2A 2ZR7A 1OJLA 2JFHA 1V7ZA 1ZA2A 1YJBA 3ZJ5A 1M74A 1E2DA 4D9EA 4W5QA 3RFVA 3ZU6A 4Q3KA 4EZBA 3C3DA 4CMHA 2AG1A 3EGIA 3KXLA 3Q1LA 3N75A 2ES4A 2V9CA 2XOEA 4Q19A 3HU3A 2W37A 4J7AA 4I1PA 4UPVA 3FFBA 3IH5A 3QF4A 3ONWA 4X65B 1Z9BA 2ARKA 1WPQA 5TS2A 1Y33E 4DEVA 1PEYA 3FETA 1Q1BA 2UYOA 4RIFA 3RNOA 3MCZA 3TLKA 4CKEB 2VQEB 1KSFX 4U9HS 3AEKB 3KQPA 3UK7A 4RVOA 4YGXB 3FX2A 1L4KA 1VDZA 1FU7A 4YFYA 1XF1A 5D1NA 1EK5A 5GOTA 1FUIA 3CH6A 3KQMA 1J9EA 3RRZA 1K7YA 1OA1A 1ZNWA 2V98A 5L7WA 4FMDF 3OEYA 1NE7A 2UZ3A 4XOIA 1XTTA 3O2JA 3KKOA 1PWEA 2BFOA 4W9NC 1PT7A 4TUYB 1KFEB 2VJNA 3S6JA 2PUVA 2CHVA 1SBTA 2SICE 2BVNA 4HATA 4BO8A 4OXYA 4J0IA 2VVTA 4JOCA 5JWOA 2C8VA 3BE8A 3JALB 3OKCA 3NH9A 4WSOA 1AQYA 4YY3B 3KCNA 4PLCA 3QVTA 3R9XA 1AS3A 4KUHA 2G5TA 1I3NA 2XLCA 3O03A 3R0XA 4QYSA 4AJ1A 3IQWA 4RLQA 4DBLE 2C2XA 5BSVA 3IOMA 4GMGA 2WZQA 4QNRA 5BNTA 2Q1UA 2SHKA 3TOCA 2FE4A 1VHQA 2BGLA 3V8QA 2YXNA 5KJCA 2ERCA 4BMZA 3OQIA 1P44A 3HWWA 3QVSA 1QIEA 2KS6A 4FYIA 4ZMSA 4HN9A 4TWRA 4QRHA 4QJIA 1U4SA 1WJGA 1FRQA 2VZ0A 3CVJA 4HNSA 3U7QA 3WC4A 4LN1A 1I80A 5CLLA 1QCDA 1EJBA 1D6NA 3MLEA 4U6QA 2CN1A 3A7DA 4WL0A 4D4GA 3SX0A 3V4FA 4BNMA 1M2OB 3AB7A 3LCJA 4BB9A 5CB4F 1NN1A 5BR8B 5DU2A 3WK8A 3GIWA 4JWKA 1LTKA 3DPIA 3GHYA 4R69A 4CV3A 2HJRA 2Q9UA 2RBGA 3DV9A 2ODNA 3HFJA 1PFGA 1S2GA 4ILKA 1AO3A 2A5GA 1HWYA 2QLJA 2XMQA 2GCEA 2IW3A 4KFSA 3RANA 3GLHB 4BMOB 5DGCA 1L5QA 1NXTA 1VPVA 2Z2JA 1YE8A 2IHBA 2EFGA 3IPRA 1G9SA 3MJ4A 4FSHA 1RRKA 4RK7A 3DT6A 4MVJG 4Q9AA 3C15C 4GR9A 4XYBA 3UK1A 4D99A 4FDAA 5K3BA 3UMMA 1E61A 3GXOA 3KAKA 4J75A 1D7OA 5CP8A 3SSAA 3AIKA 1ZVJA 4R2HA 5F3DA 1OZHA 2FGKA 3FYCA 4YI3A 2R1VA 1W2GA 3N8HA 2OR3A 2PX8A 3N74A 5HGJA 2VK1A 1HQCA 2YJ5A 3DVAB 1L2TA 1PL0A 5REQA 1ENZA 2VDUE 3ODPA 3LQKA 4JLJA 1WUIS 2PNFA 4QFCA 1DX9A 4KPUA 4LHEA 2J32A 3X2SA 4BQFA 2V65A 4RTRA 2XMGA 3VV3A 5IFLA 1VJDA 5JALA 3VBEA 1TQ8A 1VMAA 4IZ6A 1HM5A 4DUGA 1SVLA 1OSNA 1H4SA 4A4DA 1MQAA 4PFJA 1AO0A 5AKYA 3I6IA 4C4ZA 4ND5A 4BS9A 1KQ3A 3HHEA 2MU1A 4I5EA 2NQ8A 3KUKA 3DBRB 4Z99A 3CX7A 1USWA 3LUKA 5TEVA 3OIGA 4I8IA 4MQEA 1A5BB 3RVMA 2GEDA 1XAIA 2D06A 4KQ2A 3OT4A 3H1GA 1G9XA 4BZQA 2BUBA 3AF0A 2PKYX 1WEKA 2HXYA 2YUIA 3AOGA 3UTCA 1ZD2P 3RODA 1Q44A 4DMKA 1XTSA 1XTBA 2HTEA 2OP0A 2YQ4A 4DE5A 4TLCA 4G1BA 3T0FA 4LYFA 2RHWA 4A7PA 4IHJA 3V1UA 4LV8B 3QJYA 1U99A 2HO5A 5A4DA 4B3JA 4TYYA 4L78A 4E14A 4EVSA 5H4HA 2ZUVA 3B1JA 2QZSA 4GI3A 1E2EA 5T6BA 3D6JA 4Z1MD 4G4SO 2BIFA 2CKDA 1TJNA 1BU8A 2VAVA 1IAQA 4KGVA 3K4PA 4Q39A 4ZXFA 4MULA 2CXTA 2FPPA 1X7ZA 3KSRA 3RTEA 2C03A 3H2KA 1UAYA 3K2QA 3KOZA 3G89A 3QY9A 1LNSA 1ENPA 2B20A 3AHHA 3O4VA 3OTGA 3QV2A 1KS9A 4PVCA 4UHDA 1KZYC 4Y0AA 4ZCSA 3TIFA 4E4TA 3GEBA 4W8OA 1JLHA 1DRUA 2ECKA 3P9RA 4OX9B 2F00A 1Y4AE 4CM3A 1ZMTA 2BTOA 1PD1A 1IVNA 3HBNA 3K1TA 4B09A 2CL7X 3CISA 1MDBA 2IE8A 3PEUA 3UCEA 4CF5A 2BDUA 2W22A 4QOFA 1SBNE 1KMHB 2DG2A 3IQZA 1LVGA 3STUA 1IQ0A 2W98A 3RC2A 1HFEL 5J63A 5GONA 3U48A 2Q2WA 4HAXA 4BPBA 3CS3A 5CVVA 1TA0A 1PFUA 1Z75A 2EFDB 2B78A 2W0SA 4KXYA 1EEHA 1E2BA 1S3GA 2C9DA 1L5LA 3COZA 1P5JA 2A2ZA 3ROPA 1X0VA 4UVGA 3ZBQA 1KYIA 4FGSA 1LSSA 1RI5A 1RAGA 1T3LA 1RXSA 1J6UA 2AXEA 2VNIA 4FJ2A 4CM5A 4V0MA 2GBPA 4O4JF 4YAKA 3KLNA 5CYGA 2Q3DA 1HDEA 4R1LA 4PLZA 4AJNA 1NOJA 3ST7A 1T9GS 2P78A 4KMMA 4AJJA 2YHUA 1D4OA 1EUCB 1ZGCA 2WJVA 5EKSA 4QYTA 1KHHA 1U04A 1LQTA 1VE9A 3OLCX 5CVJA 3WMFA 4PN7A 4US2R 3R09A 4LZLA 4OHCA 3TCNA 5LN1A 3GZNA 4FR0A 1CDZA 3PPIA 3UEOA 4LOLA 1K3FA 3MWJA 3CX3A 1QS0A 1X3LA 2ODQA 1OWNA 1UANA 1GPUA 1SIWA 2DECA 4IX1A 4M55A 4XR9A 3TW6A 4BYGA 2LKCA 3FSGD 3HWSA 4E31A 3RRFA 5K3FA 2RAFA 3ICWA 4LE2A 3IDFA 5EINA 1E8MA 2F3TA 3KL4A 4FMBB 3HDGA 2MYUA 1JQLB 2JBHA 5HKKA 1EX1A 2Q5EA 4GVPA 5J2UB 1IE3A 1D2RA 2X23A 4F3YA 2CXRA 3EIXA 3PVZA 4R9UC 3LL7A 3TO5A 1QG0A 1C1XA 1HETA 1BU5A 4UVIA 5JCOA 5KAPA 2FFRA 4TTJA 3ND8A 2VWQA 3AVTA 1NJ5A 2AFRA 3FNQA 3GUYA 3KTOA 1XTPA 4GI2A 4XQGA 2P62A 4AWXA 1JJFA 3S8MA 3CVVA 1FYDA 2OORA 1PTJA 1YR8A 3MJSA 3PQ6A 4I19A 1CY1A 4UM9D 4E15A 1ZMXA 4DDWA 5H4GA 4HRXA 1TZBA 1Z4QA 3EG5A 1WF6A 1P3JA 3MN1A 4QODA 5EE5B 1N5DA 1NW7A 3QFFA 4B7AA 4RJ2A 4EW1A 3NHBA 3WO1A 3NDJA 4PV7A 2PWZA 5JZMA 2ACEA 1QHHA 4L8WB 4N1AA 1FNNA 4RHFA 4EA7A 4UQLA 1VBMA 2RGAA 1NKTA 3DMNA 5G2OA 3TGLA 3K6SB 2P67A 4Z9BA 4D4JA 3N8DA 1H2EA 3FHLA 1MB3A 3FBWA 3CO5A 2B8JA 4I4LA 3DYVA 3H1AA 3SXJA 1SOAA 1XHEA 3S7TA 5KOHB 2J9GA 3DC7A 1ZC3A 3DBLA 3SCZA 3L4SO 4JYMA 1NURA 4AZTA 5B3KA 4Q01A 2QM8A 3F97A 6YASA 5CD1A 2XGSA 5HWSA 1W29A 3X1MA 4KFUA 2PFSA 4NZYA 4B6RA 1ZRSA 3I12A 4MUJA 5DIFA 4TSRA 2I22A 1RXIA 3BGWA 5AK3A 3EJWA 5F98A 1X13A 2YIVX 3K32A 3PQ4A 5KYVA 1K6MA 3GPBA 5TMEA 2AW3A 3WIDA 2PLAA 4XD2A 3F6YA 4E6PA 5J2TB 1EWQA 3I2GA 3NBQA 3OJ0A 4ZYYA 2V5VA 4CKBA 1H0HA 3G1TA 2V7VA 1Y1PA 1E99A 4Q48A 4RZXA 2X42A 3ROTA 2QSYA 3H5OA 2ZTLA 4L5IA 4HV4A 3ONVA 3C0KA 5EYPB 1U7OA 3T7DA 1K92A 5CPFA 5A9SB 5FWXB 4K9RA 3OFSA 2P4UA 3V8RA 3TN7A 3BWCA 1IM8A 4M99A 6REQA 2J31A 3AEYA 4F3KA 5KNCH 1SQ5A 2C29D 1UPFA 1ND5A 2JI8A 1SOWA 2R3SA 3DE2X 3P9KA 4HDAA 3RSQA 4IP0A 2C82A 4GI5A 1GUAA 1K0UA 2Y05A 3GMIA 4AJLA 4B46A 2WB4A 4DM4A 5JFOA 1E6KA 4HWSA 4EPWA 3T7AA 1M10A 2ZI9A 3I2JA 1WE2A 1GL6A 2JZOA 1E4EB 1EXWA 4PFSA 4FFNA 2XUDA 5CHYA 1R8YA 1QOPB 2C4MA 4C08A 4EB0A 2QNRA 1BS9A 4AS3A 4FFBA 3KYBA 2DLCX 2BISA 2YR0A 3U44A 1MA3A 3RS4A 2XNJA 3EHDA 5BV2P 3EXFB 2HEGA 3ANTA 3LBAA 4QVGA 5HVNA 4BLSA 1NY5A 2P3QA 4UC0A 4A2PA 3PXEA 2W43A 3DBHB 2CZCA 3KUCA 2Z09A 4OLAA 5FR1A 1HY3A 3ZHVA 3LW8A 3WGJA 4QUIA 1QF7A 2UV8A 4DR7B 1E6MA 2GJSA 2AOWA 2P41A 3ZHTA 1SC6A 1W1UA 2F9MA 1IOVA 3DTVD 3BIWA 5LBIA 1CUJA 3UHJA 3PIDA 3WZLA 1Z6AA 3HE3A 1XU4A 1VL1A 1XZJA 5AKZA 2H1CA 4N18A 2ZI5A 2E7ZA 2HDNB 3CG0A 2IELA 4PG7A 5ALRA 4ALMA 4AJ4A 4MB6A 2C94A 1ZX1A 5LU9A 1E79A 3TCKA 3ROQA 5SZKB 4AZ0A 2IPXA 1GPMA 1GAEO 3JQBA 1RDFA 2CUNA 3V00A 4Z4FA 1G1AA 2VHZA 1RKUA 4PQGA 4GDFA 1I7LA 1UADA 3M6WA 1M6YA 3EBOA 5CH3A 4WNAA 5JNWA 3WWCA 1VCMA 4LISA 1CPYA 1K8ZB 1QP8A 3A31A 4W63A 3KOMA 3NX4A 3S8EA 3ANXA 4KTTE 1D8AA 2G8NA 5EIHA 4AICA 3H13A 3F49S 3U3RA 5BR4A 4CFSA 1VSTA 4K5QA 1FF9A 1C9DB 4PG6A 3UAGA 5CA0F 4M0PA 2BYTA 5IBRA 4HEHA 5C34B 3EFEA 1N4DA 2VF2A 4HFNA 3H9EO 2CCGA 4PF1A 1A4IA 3A32A 4C4RA 3L7IA 3B6IA 3GFSA 3ZUGA 1KK3A 1RAFA 2JCYA 3TQQA 2BFEB 4OM8A 2QLMA 4Q4JA 3PITA 3VR6H 3WA6A 4BDTA 5BVGB 2ZUCA 3G9UA 4WKBA 1B8VA 4NU8X 4Q7QA 3RT9A 4HDNB 4J7UA 4QC2A 4IOLA 3ZY5A 3WWOA 4JAVC 1K5DA 4BVAA 4DMHA 3EMDA 4MVJP 3RLIA 5B3JC 2YVKA 3CUWA 2EJTA 3D8NA 1OBOA 3PIRA 4QO8A 5LMNB 5T57A 4E7PA 2O5EA 3AFOA 4OMCA 1RHRA 3CWCA 3V6MA 2QRMA 4XAQA 4JYAB 2C7VA 3DR5A 4C88A 2CD9A 3EQ2A 4TMXA 4K7JA 5LUBA 1U1GA 1L4LA 3ZZMA 3TUZC 1OU4A 2QD1A 3HR4A 1SD1A 5AQ1A 3ACDA 1OFHA 2C61A 2O57A 1RJFA 3E15A 3M4JA 5EESA 1I9GA 3KJZA 2Y27A 1XEAA 2I76A 2QX8A 2BJHA 2QUHA 1J7JA 1S2MA 3GJSA 2J0QA 5ICEA 3R44A 1AGNA 1GL7A 2UZ1A 4ND8B 4QJ4A 1WV0A 2WZDA 5B57C 3BDAA 4LXYA 1L4YA 1TJPB 3LDFA 2NU9A 2QMOA 3LHSA 1E3IA 4HFJA 4RC9A 4WBSA 1T3HA 2XT6A 1XR3A 4Z9YA 2GPWA 4M36A 5DMHA 3D6TB 3M89A 4BECA 3V7UA 1QQ6A 3DKPA 2OBYA 5KHAA 2G36A 2QQ5A 4X20A 3WFIA 3JS5A 1G5PA 4I36A 1NMZA 2PRZA 4DV6B 4IJMA 2A9QA 2RHGB 3GZ4A 1NLMA 3RLFA 4JP5A 3RYIA 2ZXFA 1YZQA 2AZ4A 2Q0XA 4K8RB 1R0KA 3W34A 2CJWA 2E4UA 3AI1A 4OUKX 4Y2JA 4L0CA 1M2EA 2FKAA 3FTQA 3G0DA 2GPBA 3GO4A 1TKCA 2ODTX 3VMMA 4I4TF 1E1RA 2WZBA 3G85A 2MSCB 3SJBA 2D13A 1KBQA 2FG5A 2FMKA 3NR2A 4BV8A 1AB5A 2DE0X 2NO6A 3GEHA 1KL7A 4M1WA 4EGSA 4ERXA 3RJTA 1T5TA 2VYFA 3VR4D 5IARA 1WXDA 1TLTA 1QLWA 5CT9A 1JR3D 5ESXA 5AKJA 4YP7A 5FBQB 4BKQA 5U9CA 4IXMA 1NG9A 3KT8A 1MOSA 2ASVA 2D0IA 1M3SA 2H1SA 1SH7A 2J7KA 2OK7A 2YW2A 3BD8A 4TZ0A 4BMSA 3NUZA 1UBMS 5BN3B 4MS3A 1Y7HA 1QQAA 3SM9A 2IDZA 5CGQB 4YRJA 3HJAA 1KK1A 1A71A 3PT9A 4KK4A 4MLCA 2RB4A 4QLOA 3WZ2A 1P4GA 2WEKA 3U4DA 5JJBA 4C4OA 1DCKA 2MHCA 4XCVA 3K8ZA 5CH5A 3OFNA 1X92A 4CG2A 3MQFA 2WJ6A 5F9MA 2NP7A 3BRCA 2RK4A 3HU5A 2RJOA 1I5RA 2H06A 3R3VA 1C7IA 3T7RA 3G6WA 2QTNA 1SCIA 2WF6A 4EI8A 3WADA 5K0GA