5KHOC

Rasip1 ra domain in complex with rap1b
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
167
structure length
165
Chain Sequence
b'MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAGTFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDLEDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras-interacting protein 1
publication title Structural Basis of Dimeric Rasip1 RA Domain Recognition of the Ras Subfamily of GTP-Binding Proteins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 47
structure length 165
sequence length 167
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5khoC00
1SZPA 4L4UA 4LK2A 4D82A 5DI9A 3DOFA 4BEJA 3GJ4A 3BGWA 1E4VA 4DB4A 4EJSC 2WBLC 5M04A 4TZ0A 4NCKA 2P5TB 1RZ3A 3EPHA 5G3ZA 1MO4A 4LUCA 3UMFA 4LWZA 2XX3A 2EFGA 1L2TA 1P9WA 4ACBA 2L0XA 1RKBA 2RMKA 4OJKA 3VX3A 1X1SA 2P67A 2IEZA 1COWA 2HLDD 3SYLA 2KE5A 5HCNA 3RRYA 2O8CA 4Q4LA 4Q4AB 2O52A 4O0MA 2IBMA 3CPEA 5FOXA 3LLUA 2JJ2A 1M7GA 2IL1A 2EYUA 2ZRKA 4BLQA 4PHTA 4BFZA 4RVCA 4PAOA 3LY5A 2CNWA 2IS6A 3O47A 2CVHA 1ZM2A 1YE8A 1LS1A 3SE0A 4KITB 2GJKA 4BLOA 5JCZA 2CJWA 3SNHA 5CDFA 3VR6A 2BCJQ 4ZV4A 4KBFA 5DHFA 2Q3FA 4I1SA 5FI0B 1XTRA 1JEEA 4OQMA 1FW6A 2BMFA 1JXOA 1A7JA 1D2EA 1C1YA 2CXXA 4Z1MA 1UKVY 4OJQA 1E9CA 5DNYB 5IT5A 1S0UA 3T06B 1WA5A 4Q9KA 1G8YA 1OXSC 2WJHA 1W36B 1GM5A 3RRNA 2ZJ5A 1KHTA 4RCZA 3KDSE 1M1YE 4XH9B 2ZI6A 3VHXA 4F4CA 1DAIA 4URWR 1KI9A 2V1UA 2PX0A 4RSGA 1VCMA 4UNPA 1NVWQ 4TMVA 5FI1B 4A2WA 3KQNA 4LYFA 4U00A 4OI0A 3K0FB 5KSYA 1P6XA 4Q4JA 5JRJA 1KSJA 3G82C 3KXIA 4DCSA 3QVVA 3TUZC 4OHXA 2IUTA 2VHCA 3TUJC 4YDHB 2YWHA 2BKUA 1L4YA 1JAHA 1G4AE 1G41A 2GETA 2I4IA 3C16C 1CKEA 2ERXA 3IKJA 2RHDA 3MJHA 1G5TA 2BDTA 3HU2A 3I62A 2GNOA 2O8DA 3B9PA 3Q7PA 1Z22A 1U81A 3MLEA 2A5DA 2EFCB 2NPIA 2GDJA 3P32A 2ZYWX 1Z6TA 4JSTA 4A2QA 4ZCMA 4TMWA 5GJVC 1ZU5A 5DGXA 1FUKA 1K5DA 1MRNA 2OCYC 2GJAA 3WP0A 2NZ8A 4LC1A 3P27A 4BQSA 3QKRB 1UJ2A 3Q7QA 1U9IC 4RKFA 4DCTA 3U7HB 3B9QA 5JEEA 1N6OA 3CW2A 3DZDA 1E6CA 3K1JA 3QE0A 4KU4A 4B2IA 1E2FA 5FUVA 6Q21A 3REFA 1Z47A 1CXZA 1KK1A 2PJZA 3RWMB 3GLGE 1FTSA 2D74A 2ATVA 2WJVA 4IVPA 1AM4D 4B47A 1HH4A 3NH6A 2ZE6A 1JB1A 3Q9LA 1SKQA 1X86B 1W4AA 2G83A 1E2PA 1LF0A 4O25A 1CEEA 4Q1DA 1GVNB 2EWVA 2A5GA 2ERYA 1GP2A 3THWA 2ZE7A 3OF5A 1DVRA 5LBIA 1Q20A 1Z3IX 1BYUA 1DG3A 4KO8A 1T0HB 4QGAA 2QMOA 4PANA 4TLDA 2EVWX 1XXHE 2X8AA 4YMSA 5JWHA 4B2PA 2WJJA 2CDNA 1SKYE 3BC1A 1DOAA 5FUXA 2JAQA 2GZAA 2VRWA 4A1FA 4I81A 1ZNYA 2BJWA 5EQTA 4Z51A 4PSAA 4OHYA 1KAGA 1EXMA 3RDPA 4D0LB 1W5TA 2OAP1 4WXPA 1E98A 2NO1A 1X8KA 4PPFA 1JPJA 1Z5ZA 1HURA 1HUQA 3OEHD 4LJ9A 4B75A 3PUYA 3RAPR 4DRZA 1XEWX 4Q00A 2F1HA 4ASUA 4KLZA 1GKYA 1UKYA 3FVQA 2VHTA 4BFSA 2FNAA 3V4RA 2P5SA 3GLFB 1CBUA 3W5IA 4R71A 1ZRHA 4P0TA 2IYLD 2JLZA 4A0FA 1ANKA 1ETUA 4DSOA 4QBHA 5HZKA 1ZUIA 2OCAA 2QA5A 2GK7A 4BWYA 3AGQA 3WRXC 1UDWA 2ZR0A 1TEXA 5IHPA 1E2DA 4Q1CA 1DEKA 4B71A 1CU1A 1RE0A 2C04A 1S3GA 4TT3A 3EWAA 4DIEA 2OG2A 1W36D 4ARZB 1R6BX 2AR7A 1VIYA 1OB2A 3AM1A 1NBME 1PUIA 2I1QA 3QOFA 3ICEA 4M1SA 1XJQA 4QBIA 2B7CA 1OYYA 4NCHA 2OFWA 3KTAB 1GTVA 5IF9A 2VHJA 2W2TA 2BOVA 5FOVA 3V4FA 3ASYA 2QGZA 3THYA 2WAYA 4EIWA 4QNMA 3LRPA 2IXGA 4DSNA 4B44A 1OH6A 1DAMA 4CZ2A 2Z83A 4KYUA 3DEFA 3EZFA 4KSBA 3T5DA 4JVMA 5FR1A 3F3YA 1X3SA 2GBLC 4FMDB 5CLLA 1XFAA 1E3MA 3QPVA 3A1VA 1RRPA 2QPAA 4L9SA 1NSTA 1G5PA 4PO1A 2JASA 4KJZA 1IJFA 1YVDA 1RW4A 2W6JD 5L3VA 2OSBA 5FPKA 4IVRA 1LW7A 3SI7A 3I32A 1W5SA 4TQ9A 5H1YA 4J0QA 2Q3MA 1N0WA 1UF9A 1W1WA 3GLIE 4HB2A 5TARA 3ZVMA 1OFTA 4JL6A 4X8LA 5JHHB 3AP1A 3I1FA 1MH1A 1UADA 4FIDA 3SJBA 3RANA 3ZYCA 3JZMA 4V0OA 1ZIPA 3GEEA 1E0SA 3RC3A 4AKHA 1Z8FA 2ZS8A 2WWXA 3FWYA 4WZBE 1J8YF 1YHNA 2ANBA 4DDVA 2WVJA 4EJSB 1IN7A 4G0NA 3AVOA 5J4VA 2GKSA 4IFBA 2IS1A 3GJXC 5KU1A 5CIWA 3U4QA 1VCNA 5EXPA 4ON9A 4DCVA 1KSFX 1N5KA 1R5BA 5LD2C 1ZD9A 1A2BA 1H8HD 1US8B 2PMKA 2XTZA 2BWJA 2HYDA 3KKNA 4GOKA 3GFOA 2EFHB 4P4SA 3SHWA 4TYPA 1TQDA 2YVUA 2ZRMA 4OQLA 4MKIA 3W90A 4W5HA 3OIYA 1E96A 3RSLA 1TNDA 2AK3A 1CJMA 3BH0A 2YV5A 2W2XA 2R6DA 2CLSA 1YZQA 3K0AB 4M1MA 1W7AA 1ZBDA 4KXFB 1YR6A 5JBQA 5H70A 2QZ4A 2NMVA 4LHVA 3CZQA 4M1YA 4TSFD 3MFYA 2FPKA 5KSOA 3DOEA 1KYIA 2YJTD 2ZYVX 3SU8A 3R8FA 2EW1A 1XTJA 1NVVQ 4F38A 1U0HC 2CVFA 1QHXA 4ZIRA 2Z4RA 3FKSA 4FCVA 1EK0A 2OESA 5CYPA 1IN8A 2H5EA 3NKVA 3GLHE 3EPLA 1W0JA 3QXJA 4U5XA 1CP2A 1KDTA 5B58C 4MRPA 5HR5A 5JS7A 1D9ZA 2O8BB 1SXJA 1G17A 4JJZA 1N6NA 5EE9A 3CPHA 1AN0A 1E2GA 1G3MA 4CT4B 3PUXA 2BHRA 4RFSB 3HU1A 4Q5IA 5FTJA 4M1TA 4PQYA 4Z8YA 1RRFA 2CE2X 5EJEA 3FFAA 1AA9A 4OI4A 2JLXA 2D2FA 2JJ8A 2C9OA 2NGRA 1ZAKA 5EXXA 3OE7A 3CWZA 4NYJR 4A6PA 4JBYA 1LS6A 3CM0A 2F1RA 5JRZA 2JLUA 1BMFA 2WM9B 3IBYA 5FTLA 3N2IA 3AVWA 1T3SA 4RD4A 1VG1A 3EIEA 1EFCA 3DDCA 4BLSA 1J8MF 1E2LA 1F6BA 3B1VA 4Q1BA 2C9YA 5JECA 1NP6A 4GSYA 5HTKA 1F2TA 3KQLA 5C1BA 2NTYC 4FWIB 1YZNA 2ANCA 4C4PA 3I8SA 4H9GA 4LRWA 1E94E 2RH5A 1R2QA 2ZE8A 2PT7A 1Z63A 4C0QC 4QM7A 4A8JA 1IHUA 5E4FA 1CJKC 1KI6A 2IYXA 3S1AB 5KUTA 3QXSA 1ZNXA 5AJXA 4DCNA 3PUZA 4Q4HB 4JLVA 3B6EA 3CNNA 2IW3A 4WA7A 2VHQA 1W49A 4IXNA 3MRSA 4US1R 1E2KA 2GXUA 4GMDA 2WWYA 3WRYC 4A0GA 3BBPA 1NMYA 3JVVA 1IONA 1FQJA 1Z2CA 1R4AA 4YMTA 1NN5A 3LW7A 4N0EA 1GILA 4R2IA 1T6NA 4TN1A 2ZVPX 4JLAA 2GK6A 4JL5A 1N6KA 3DKPA 2DHRA 3L8ZA 4YC7A 3AUXA 4NONA 4AYXA 3AF0A 4EPWA 4LDJA 3ZJYA 4QM6A 4M9SA 1P61B 3TSOA 2QAGB 4WXRA 1TPZA 2DCUA 4JBWA 1G7TA 1PUJA 4OQNA 2ZRHA 3AKYA 5D3QA 2ATXA 5B57C 1JALA 2WWIA 4E03A 3TQFA 2WJGA 1OV4A 1RYHA 3BE4A 3LWNA 4NCJA 3U3JA 5AR1A 1LNZA 1ZU4A 4DUGD 1W44A 1DTSA 2QTHA 4C0KA 1KNQA 1JEDA 4TMKA 3GMTA 3T61A 2CMKA 2XSZD 3WP1B 3W3AA 1UKZA 2WOOA 3WYGA 4R2HA 4ESHA 1ZJ6A 2XZPA 3X1XA 1YZTA 4MYTA 4QHTA 1M8PA 2ZRDA 2F1JA 4KVGA 3EZ2A 5D3MA 1HE8B 1ZUHA 1E1QA 5E95A 4OHVA 2CL0X 2WIAA 4PHFA 2EWWA 5SZHB 4D81A 3AV0B 2MSDB 2WMOB 1PLKA 2GEDA 2X2EA 2PZFA 1UAAA 4FWTA 2IYRA 4TZ6A 3RS4A 4FMCF 4XVRA 5BYJA 4B3BA 3K0SA 1KJZA 4OQFA 2QE7A 5TV2A 1ZMXA 2V7QA 1XEXA 1H65A 1XNJA 2BCGY 3ND8A 2YWFA 4NTZA 2XNDD 5GVRA 3RRZA 2QQ0A 5FPSA 5FTNA 2HCJB 2E9SA 2HT6A 1JECA 2XTNA 5BN3A 2ZIAA 2QMHA 1P3JA 2Q9AA 2QP3A 1NG1A 4DLSA 1AGRA 3TUIC 5GADl 5FBRB 2RGEA 3IHWA 4A4DA 3SHFA 3CIOA 2YINC 3H2YA 1HQYE 4BLPA 3U60B 1TQ6A 2HLDA 4HLUC 3SQWA 1OW3B 5KDDA 2GAAA 1ZP6A 2DYKA 2JJ1D 4JLMA 1H8ED 1HQCA 1OFHA 1RFLA 1HT2E 4LV5B 2FH5B 3IPYA 1XJCA 3T35A 2QORA 2H1LA 2BM1A 3X2SA 2A7QA 4GPTA 5JJIA 2F55A 3IILA 1E0KA 2QBYA 3BH7A 3ZVNA 5HPYB 3VHLB 1KY2A 1LY1A 2OE2A 2R44A 3TKLA 3R8CA 2NO9A 3KUCA 3NG1A 3BFVA 2PX3A 3NXSA 4NU0A 3WBKA 4B73A 5JI3E 4B34A 3GLIA 2ZJBA 2O8EB 1ESNA 3K70C 1G291 2FSFA 2IXFA 1ZM3A 2J87A 3AKDA 2FPLA 4MYHA 2O8FA 4PC6A 3GLFE 1HTWA 4LV6A 3ND9A 5J47A 2HT1A 1FMJA 2V55B 1VYTA 4N1AA 1DBSA 1Z0DA 5KDOA 1HY3A 2Z5FA 3U3OA 1CIPA 2IYYA 1E79D 2WSMA 1HV8A 4PQFA 1F48A 2V6IA 4ZKDA 1IM2A 3W6OA 2C5LA 1IY1A 1Q21A 4UNSA 3UIEA 1JXMA 1GDDA 4N3NA 3KJGA 2YKGA 2WKQA 4Q02A 4U02A 1N3BA 3I5YA 3AVVA 5JS8A 3AF4A 1UDXA 2QGNA 2GJ9A 2XJ9A 1J99A 4MRSA 3T15A 2CEAA 4UKDA 3ZVRA 2BJVA 1FUUA 2AKAB 2XTMA 1U8ZA 4YMUA 3LBHA 3BORA 1XTSA 2RGBA 1IAQA 3DL0A 3KKOA 3PUWA 4CF7A 4JVSB 1MABA 1P9NA 4NE2A 1E2JA 4CEHB 1P2SA 1VG9B 4PZZA 3VU9B 1OKKD 2GCOA 4IOJA 2H16A 2ZRNA 3PENA 1IBRA 3TH5A 1KJWA 2V6JA 3LFUA 4MH0R 2AKYA 2B6HA 2XGJA 1UFQA 3CF2A 4XVUA 3UATA 4HDCA 1OFUX 4Q7JB 3B7GA 1CR1A 1RRCA 3BERA 3ZS8A 1MO3A 2UVQA 3PQCA 1UM8A 3RVBA 3DMNA 1XEWY 2CHGA 3GJ3A 2ZRCA 3HR7A 3O8BA 5BN4A 2D7CA 4GOJA 5FBVB 4URZR 2FFAA 3U7GA 2GILA 3GLHA 2OLJA 2ZU0C 2NIPA 3K0CC 2FSIA 3CRVA 2HF9A 4OQXA 4AC9A 4PC7A 1XWIA 5TDHA 4CDGA 1Z08A 4PZYA 1XPOA 4MA4A 5FOWA 2ZJ2A 5EZ6B 4C0SA 3ADKA 2BBWA 5EXTA 3UKDA 4FXPA 4TL8A 2OEPA 3PITA 5FL7D 3EPKA 3B1WA 2UZ3A 1OXVA 3KB2A 1NL3A 3N5CA 5LB2A 4CGZA 3E5HA 4ZDKA 2ZXUA 1GNPA 1SVIA 1QHGA 2OXCA 1NY5A 4IHQA 5BN5A 1R7RA 4BPBA 3LO5A 1J90A 2ZAMA 3D8BA 3R9WA 1NLZA 3AVYA 3GFPA 4D4MA 2VP2A 4KFRA 3BB1A 2WKPA 3QXHA 2AFHE 1P2UA 3QG1A 1XPRA 3VTKA 4BFUA 4JIMA 1T3LA 2IK8A 4TL9A 2WAXA 3A1TA 5C46F 2PZGA 2Q0HA 1OIWA 2VP0A 4EFLA 4MITA 1G3RA 1NBMD 5ELXA 4Q4AA 2ZRGA 2ZUCA 1FX0A 1I4TD 2RGNA 3NBFA 2D7DA 3CH5A 4LJ4A 1KI4A 5DISB 5BW8A 1P7CA 3BH6A 5KNCA 1GAJA 3GJ8A 1Z07A 4B43A 1VHLA 1IQPA 3EA0A 2FN4A 2JCSA 4TWZA 3QXCA 3QPUA 3AKEA 4Q48A 1T8UA 2P65A 4LZZA 4A15A 4XJXA 2D06A 2REOA 5KSZA 2GHIA 4GOXA 1A82A 5JJLA 1ODFA 5KO2A 1E1RD 2C03A 3BRWD 5FPTA 1KMHA 1XD2A 3ZQJA 3PEYA 4M2LA 2FFBA 1K5GA 1RJ9B 2DFKB 1KO4A 3L0IB 1LB1B 2ZYTX 4HB3A 1DADA 3BJIC 2GWHA 3AP2A 4M22A 1NN1A 2IEYA 1XTIA 2PL3A 5KSPA 1YU9A 2RGDA 4LHZA 4NYJQ 4IDPA 4CEJA 2ZETA 1F2UB 4HZUB 1JR3E 4HUQB 5FOSA 4IOKA 3K53A 2PCLA 4B74A 4QKQA 1UBGA 2YNMA 3K0FA 4F91B 121PA 3WYAA 1OIXA 3H84A 1KO8A 5TB5A 1YR7A 2QRZA 1RPZA 4HAYA 1WRBA 2XB2A 4C9BA 4DVGA 1KIMA 2G0TA 5A5GA 1P2TA 2VBCA 2CK3D 4KCGA 2O8CB 3QPWA 1N0VC 4QL3A 1TX4B 2RHMA 1OPXA 3PIRA 4M0LA 2QU8A 2B8WA 2QM8A 2R65A 5JSZB 3UMRA 1B0UA 2W6JA 1M34E 4RCYA 2JLVA 3H4MA 2QRNA 2IYTA 3QG5A 3QVUA 3SJZA 3K09C 4IDOA 2YZ2A 4NYIR 3WBJA 4KHZA 2AX4A 2FDCA 3LLMA 4NCNA 4XVQA 5TXGA 4CVNA 2CJWB 2J0SA 2JLQA 2ZUDA 5SZKB 4Q1FA 4Q7MB 2OCBA 3R9IA 2ZS9A 4P33A 2OZEA 1MR3F 5B2ZA 2SHKA 4G5SA 3O8DA 5IK2A 2N46A 3GJ0A 2HXYA 3R7WB 2E1RA 4GZLA 1N6PA 2ZREA 4YXWA 2DR3A 3TNFA 3WY9A 4IOLA 2REXB 2GESA 4QGFA 1Z0JA 1G64A 3CRRA 1L7VC 2UZIR 1G3IA 4BECA 3LQQA 1E69A 1FOEB 1H8HA 3A1SA 1NI3A 3TMKA 1Q12A 4Q4JB 4OI1A 5KNDA 2XXAA 3RHFA 4G01B 1RIFA 1SVKA 1WMSA 2R6AA 2ZRLA 3DKVA 3E2IA 4V0ME 4BZPA 1C4OA 1ZC3A 4POAA 1OXTA 4MRRA 1G19A 2LCFA 4ZDWA 1YR9A 2ZJOA 3UWKA 2YOHA 4FN5A 4DIDA 3ZGXA 3GFTA 3OFND 1QHIA 1GRRA 5CM9C 5FBWB 4E22A 1SVMA 4DLYA 1GUAA 2MMGA 2O5VA 4NP6A 1N0UA 3SC3A 5DN6D 3Q5DA 4D4KA 5DH9A 3AUYA 3EAQA 1YQTA 4US2R 1AS3A 1G8FA 2IYUA 5KTYA 4TTRA 2QAGC 4LV8B 3K70B 1DPFA 1QF9A 2ZJ8A 3WHLA 1HE1C 1SHZA 1XCMA 3PEWA 3ZZTA 2YC2C 3GLFA 4OKSA 5G40A 2BVNA 4JT4A 1TUIA 3CRMA 1XU4A 4CEIA 2XAUA 4U7DA 2ECKA 1Y63A 4AK9A 4PFSA 4TQUS 5EZ5A 1VG8A 1ZD8A 4IKEA 4S2EA 1T3HA 3CF0A 2O0KA 1U0JA 2CCJA 4M21A 1KMQA 1F60A 2X2FA 2YYZA 1VKJA 1XD9A 1BIFA 1R8SA 3N70A 1CR4A 2VF8A 4CW7A 2P3SA 2PH1A 3NEJA 2V9PA 3NVAA 4XTCS 3BFKA 5CK4A 1PVOA 5H8WA 4MKGA 2BIFA 2R6CA 1JR6A 1GNRA 1G8GA 3PVSA 4LYJA 3JVUA 2A5YB 5FOTA 1QG2A 5C4GB 2IS2A 3A1UA 1EFUA 3I8XA 3M1IA 4XTRA 4G5OA 4URUR 5C2JB 5J4YA 1XB2A 2Y8EA 3THOA 2BBSA 3QENA 4DDTA 5CLQA 2P0EA 3DM9B 4P3YA 2PEZA 2WPDD 1SVOA 1COWD 3SJAA 1II8A 2HCBA 3GJ6A 4BE7B 3QEOA 2ZI4A 3L8YA 2Z6VA 4BFWA 3IO5A 1QG4A 4D2IA 5GJBA 2B7BA 2E87A 5DYIA 4K46A 1ZIOA 2IWRA 1UPTA 4F4IA 3EW9A 1AZTA 1EWQA 2ZJAA 2J5XA 1L8QA 2CNWD 4L15A 3RS5A 5EP3A 4XIGS 3AP3A 1OHHD 4H1UA 2R2AA 3V9PA 2NO6A 3U7EB 1TUEA 4URXR 3NBXX 1FFHA 1E9BA 1XF9A 3DM5A 4HAWA 5LB4A 3ZD6A 1TEVA 1EGAA 1NF3A 3F0TA 2W6IA 4BLTA 3FGNA 4FCWA 4NYMR 4RZ2A 3TAHA 4M1OA 2NPFA 4HYYA 3ZIAD 2ZITA 3FMPB 2DWQA 4PHHA 1PLLA 4OBEA 4ACAA 4Q21A 1BO6A 3AF3A 1U99A 2ZPTX 1WXQA 1OF1A 3BS4A 2DY1A 1VCOA 2JLRA 3LXXA 4GMXA 4CYMA 5FPHA 2HXSA 1XZPA 4JVNA 4B33A 3RS2A 3UPUA 1JNYA 2Z43A 3DHWC 4MYUA 4V0KA 5F9HA 1AGPA 3K9NA 3EC1A 4AY2A 2GCPA 2RGAA 1Q1ZA 5EUQB 2J3EA 1M74A 2WKRA 5DI3A 3SBDA 1T9HA 2GJSA 3EZ9A 4L9WA 4AKIA 5JJKA 3KZ1E 4TL7A 1TQ2A 3EARA 3T34A 2XSZA 1TU4A 2J0UB 3E70C 4Q9IA 2QPOA 1OJLA 2X19A 3K0AA 2PT5A 4RD3A 1IXRC 1Z2AA 2XITA 2WHXA 3HJNA 3FHOA 1JQJC 3K9LA 4WVFA 4Y0VA 2A78A 2PJRA 3B60A 2KJQA 2DWPA 4W5WA 2G0NA 3AVQA 5CM8B 4KV9A 3SFZA 5EE0A 3MUFA 2BEKA 3CH4B 2BEJA 4WBSA 1KI8A 2DPXA 3OESA 2B8TA 4Q18A 1VPLA 3LV8A 5EP4A 3K70D 2FEMA 3CNOA 3LBIA 1AZSC 2LKCA 2OM2A 4BASA 3IEUA 3MGCA 3U44A 1D2NA 2ZRIA 1SVLA 1IXSB 821PA 3VNVA 4BUJA 3FDIA 2GF0A 2OBLA 1XMIA 2XNDA 2IC5A 4ZCLA 4CRWB 1E9AA 1EFRA 2QTFA 3AVPA 1VECA 3I73A 1EWRA 2CL6X 1UEIA 3QXXA 5EE3A 2X77A 3SEAA 4G5RA 2A2ZA 3OAAD 4WW0A 3CRQA 3DO6A 3CX7A 4LSGA 3LA6A 1KI3A 2EU8A 1S9DA 4JYCA 4L5BA 4GDFA 4MGIR 4DHEA 4UJ5A 2KB0A 1Q0UA 4GI7A 2P6UA 4I99A 1NLYA 5JFGA 3THXA 1E2NA 4ZPXA 1H8EA 1LTQA 3WMEA 2IYVA 4US0R 2FF7A 5H68A 5EE1A 2P6RA 3NHAA 5LPNA 2YHSA 3P1JA 5AJZA 1JBKA 3QJYA 1CTQA 3B5JA 2H92A 2GAOA 4Q9JA 4A82A 1OB5A 1W46A 3QF4B 4TYQA 3KQUA 3ZQ6A 1G7SA 2HV8A 2ORWA 2R6FA 1G8PA 4KFSA 3CR7A 1OSNA 2JGNA 3KKMA 3HPRA 3PFIA 1A5TA 1Z6GA 5AK0A 4E07A 5HZHA 4Q66C 4B6EA 1G4UR 1U9IA 4XOIA 4I1OA 4ERNA 2AHOA 5BYKA 1WBDA 3P26A 4HLCA 1ZNWA 2UKDA 1D5CA 1QVRA 3H1TA 4TMXA 3HR8A 3UANA 4K8OA 4HUTA 4O2RA 2EFEB 3TW4A 4EPRA 2C96A 3ADCA 3C5CA 2RKOA 1E79A 1UEJA 3FYHA 1SXJB 4F4JA 3IHLA 3M0EA 3T1QA 2ZRFA 4ZO4A 1OH5A 621PA 4IOMA 5G3YA 5HCIA 3Q72A 1GFIA 1G7CA 4Q01A 1U8AA 5UKDA 3D6TB 1GG2A 1P62B 2Q3HA 2EYQA 2WV9A 2B21A 2Q9CA 1YRBA 3EXAA 3B13B 3I92A 4P32A 1CRPA 3TBKA 1ONBA 4QJ3A 3GLGA 4V0MA 1Z6YA 3IDQA 3LX5A 3A1WA 4QJ5A 3EZ7A 5SZJA 4QBFA 3KJIA 1KAOA 1ZINA 2G3YA 4M8NE 3AVTA 2ZR7A 4LYHA 2QI9C 1EX6A 4C7OB 1NJGA 1CRQA 3ADBA 3IQWA 5DO9A 1XCPA 1KI2A 2WZQA 2QAJA 2RAPA 4CT5A 5DSZA 2IHYA 4NYIQ 4LHWA 4JZKA 3IQXA 2ZUBA 3C8UA 2FE4A 1ZYUA 4A8JB 1P2VA 4OK5A 2C77A 3B82A 3IEVA 1IXZA 1E9RA 2ODNA 1XXHA 4RD1A 1KI6B 2IUUA 1V5WA 4M1WA 2ZSDA 3AH8A 3QBVA 4YMWA 4TLCA 3VKHA 1YJ5A 1X1RA 2QP9X 3V00A 1RRGA 3IGFA 4DLVA 1E2MA 2HYIC 1Z6AA 4RZ3A 5L3QA 4BRUA 2FOLA 5F98A 3TR5A 3U6KA 1EFTA 1N6RA 2ASEA 2XJ4A 1DAHA 4BLRA 2F6RA 4M4SA 3QKSB 2CE7A 5KNBA 3CZPA 3PJRA 2Q9BA 1E9SA 1N25A 4UNQA 4AKGA 3TLXA 5FL7A 3A4NA 4C3ZA 2YWEA 3GCGA 4TMTA 1QHHA 521PA 4Q47A 2CLCX 2QT1A 5J4HA 2ODWA 1DARA 4ILEA 3SYNA 4FW9A 2QM7A 5F3WB 4PAMA 1NKSA 2WTUA 3HYTA 1FP7A 3OZXA 4Q7LA 3LQRA 4Y0AA 2JDID 4FMCB 5J5CA 3T1OA 2KWIA 4LOAA 4DJTA 4A0HA 4C2TA 1KO5A 4EKDA 4JSYA 2ODEA 1NBMA 2IYSA 1JR3D 5CK5A 4AWXA 2WWFA 2GBLA 4AI6A 2KI5A 4LBVA 3LD9A 3BB3A 4UXIA 2DBYA 1VHTA 4PO9A 4HATA 2CCGA 3LAWA 3AVUA 3QSYA 5GJCA 1AIPA 2JLSA 4G3XA 3SZRA 3SN6A 5C4MA 1DAFA 2B92A 1N6HA 4FI3C 2MSCB 4UXHA 3ZVLA 3RABA 1NVXQ 2OBNA 3NTUA 1XMSA 5JEDA 421PA 2NO7A 3LW8A 4MRVA 4E09A 1JI0A 2DFTA 1E1RA 3NC0C 5IDVA 2EQBA 2O8EA 721PA 1R8QA 3LBNA 2DFNA 1KK0A 1Z29A 1RYFA 2A5JA 3CX8A 2D62A 2CL7X 2PMDA 3L0OA 4P31A 3VQTA 1E0JA 1Q1EA 3J81k 2BBOA 5TMPA 4DLTA 2QUZA 1V43A 3QNUA 3P4XA 3VR5A 3CB4A 3WNDA 1OYWA 4JS0A 5HE9A 4KYIB 4O2LA 1F5NA 2H18A 4K81B 4NCIA 4Q9HA 2J46A 3KJHA 3SR0A 1LFDB 1T91A 4PPGA 1KNXA 2OILA 4LX0A 2FSHA 1ZM9A 4UJ3A 4B3DA 2HUPA 1J7KA 2OXRA 4HI0E 4HLQB 4IW3B 2IF2A 4LC0A 2XNSA 1ZCAA 2FEOA 3A6PC 1KGDA 3ZS9A 4GP6A 5C18A 1BMFD 1U98A 3C14C 3FFBA 2CK3A 2A30A 4GNKA 3B1YA 4UNRA 2ZSAA 4JKYA 4CEHA 4PC2A 3VU9A 3FB4A 2W58A 1W0KD 4NL4H 2GTPA 4DT1A 4GP7A 3X1YA 1IY2A 4TQAA 2V3CC 1VTKA 1Q57A 3QF7A 3A58B 1SVWA 5GJWC 4NMMA 3UMSA 1A2KC 2GXQA 1G8HA 2JLYA 5DYGA 1I4LD 1KDPA 1NKTA 3NEYA 3VX4A 1S9HA 1I2DA 1M7HA 2IHBA 3CONA 4YDSA 4LJ6A 1EG7A 4NYMQ 4DKXA 2GA8A 3ADDA 1S3SA 5AJVB 2GZHA 3KB1A 1JQLB 3ETLA 4EQ6A 3HDTA 4BFTA 2ORVA 4KFUA 5HKKD 3T1TA 3U5ZB 2VIIA 3TW8B 3NIBA 1OXXK 2F43B 1Y3AA 2JA1A 3LDAA 3VR2A 1XRJA 4AYTA 1GL7A 1IN4A 3PCRB 4JBXA 1Z06A 3AGPA 4OHWA 3W34A 5KPDA 1XPUA 3VKGA 5EUMA 5BXQC 3BFXA 1X6VA 2VSXA 2OO7A 3I72A 3KUDA 3W3ZB 5GVSA 3P20A 4ZDJA 2FSGA 1AKYA 5IRCD 3DMDA 4KFTA 4XD7D 1BOFA 3IUYA 5K8LA 1CR2A 1UKEA 2ZJZA 2W2VA 1LV7A 1UBCA 2R9VA 3D7MA 4Z54A 3L0SA 3F8TA 4BFVA 3FKQA 1MABB 1K8RA 3K0EA 4X8HA 4XSHA 1SQ5A 2FZLA 2ZI9A 4JYBA 2GCOB 2P6NA 3CLVA 3OIUA 1NG9A 2NG1A 3VNUA 4PXAA 4TMZA 2F1IA 4B35A 1XX6A 1KJYA 1RVDA 1W47A 1Z0AA 2CCKA 4B48A 1XEFA 3LH5A 2FPMA 1ELOA 4P4TA 2OBMA 2XOKD 4PAQA 1OLOA 1SHKA 1M2OB 1R0WA 1E9FA 2YC4C 1G9XA 4MDFA 1C9KA 2A9KA 1D9XA 2CLDX 1YKSA 1ZW6A 4DSTA 4HEJA 5FUWA 2VP6A 3EIQA 5KHOC 4LJ5A 5HE8A 4B3GA 1YRAA 3A37A 3MG9A 1S4QA 1G21E 3CO5A 3TSWA 1MRSA 3OEHA 1NY6A 1RJ9A 4TL6A 2OHFA 2ONKA 4DLWA 4ZKEA 2GEVA 3NC1C 4A0RA 3M6AA 5JWRA 5FPYA 2J0QA 2AXPA 4R7ZA 1R0XA 2K5UA 2V7QD 4W7SA 2C78A 1F2UA 4HZUA 4JLNA 5CIQA 4AG5A 2C99A 5L3SB 1WCV1 4HUQA 4LHYA 3RSOA 2QNRA 1G1MA 4JLDA 1IN6A 3VAAA 2RGCA 3SBEA 2FX3A 3GQBA 2LWIA 3C15C 5B30A 1NMZA 1ESMA 1VIAA 2VP4A 4YONB 3FPAA 1NLFA 1OT3A 1FMLA 2WPDA 1LVGA 4IDQA 2QMUA 1GRQA 1E2QA 2ZAOA 2IA5A 1U8YA 3GEHA 1E4YA 3UWOA 1LF5A 2J41A 4I1UA 3GP8A 4DDUA 3ZD7A 1CJVC 4B2LA 1FX0B 1DS6A 2QSYA 5G53C 3NDPA 2HJVA 5DIFA 5JSZA 4B6FA 1A4RA 2ZRJA 3LX8A 1SGWA 2AD1A 2H57A 4F7WA 1KTVA 3MWKA 2BMEA 2QTVB 2HJGA 2OT3B 4HB4A 1OHHA 3FHCB 1G6HA 1QBKC 4PQRA 2WSSD 1PV4A 1AQUA 3U61B 1KMHB 1XD2B 1NNEA 2RGXA 1W4CA 4IRUB 4TLAA 4ESVA 3ZIAA 1S96A 2ZYUX 2R62A 2QSZA 4HZIA 1KO7A 4D4LA 3R7WA 2V1XA 5E7MA 1SXJE 3Q8XB 3GJ7A 3MD0A 4OHZA 4CEJB 3ZH9B 3K9GA 1T4GA 2FA9A 3ASZA 4HLDA 3PG5A 1G6OA 5CB6A 4MUBA 3BWDD 3QKRA 3MCAA 3L2OB 3PXGA 3VR4A 4URYR 2GVDC 2QT0A 3TJZA 3ONWA 4M53A 3NBYC 1EFHA 4B3XA 3IIMA 2W0MA 4HLUA 2ZSFA 4PO8A 1GKUB 2D3WA 4NHOA 1GWNA 2MMCA 1IJEA 1J70A 1EX7A 2WWHA 3W8NA 3QY0A 1SXJC 4DDWA 1II0A 4C2UA 4GBMA 4FMBB 1T0JB 4OYHA 3RS3A 2ZR9A 2J7PD 3KXLA 3K8YA 2QMEA 2A3RA 4PPNA 2GZDA 1DELA 4DEYA 4IDNA 1KDOA 2ZI5A 4FCTA 5KPJA 1ZC4A 4AIIA 2IT1A 4C30A 1WDTA 4AKEA 4JL8A 1E9EA 1FL9A 3TVDA 3CWQA 3IO3A 1UBFA 3NDBB 2TMKA 1OH8A 3B2EA 1GNQA 2O8DB 5CJ2A 4C0AC 1YZUA 2C9CA 4LHXA 4DB2A 2F7SA 4GFDA 2C95A 3I61A 1HEIA 1FTNA 3OEED 2JIZD 2ZU6A 2J59A 1TAGA 2P2LA 2X1VA 3Q3JB 4QOSA 1HYQA 1Q3HA 2OFOA 4YLGA 1TF5A 4TSFA 4LPSA 1TU3A 1OFIA 3B1XA 1ZNZA 2CHVA 2JLWA 5AJWA 3SFVA 4A8JC 1TL7C 2PCJA 1DO0A 2ZS7A 4G5GA 2NO0A 4V03A 2HDNB 3D31A 3OAAA 4IEIA 4XWOA 2OAQ1 2ZM5A 1CR0A 3U7FB 4H1VA 3KL4A 4EPTA 5K8TA 3AQ4A 4PSVA 3UG7A 5J4KA 1IY0A 2XXAB 3B8HA 1VG0B 1P75A 2QROA 2A5FA 3FHTA 1KZ7B 2HEIA 4TYWA 1T5LA 4F92B 3MWLA 1P73A 4B3CA 5SZIA 3HP1A 1D6JA 4PSKA 3IIKA 4PR0A 4QHYA 3KFXA 4LY6A 1MO5A 4JLPA 5FH9A 4B3FX 2ORIA 1G7RA 3THWB 1KY3A 4ARZA 4EAQA 3ZLJA 4RY2A 3HPQA 3ECCA 2IX3A 2H7VA 1P5ZB 2FGKA 2ZRBA 3RWOA 2JEOA 5FOUA 2QY9A 3X1ZA 1CJTC 3QUSA 4GT1A 4P4UA 3TR0A 4D0NA 2G1JA 3KTAA 2BV3A 1NRJB 1IN5A 3NBZC 3EA5A 3F5FA 2AFIE 4OK3A 3K0CA 2VEDA 2GCNA 4ITRC 3AKCA 3N2EA 4OK6A 1TMKA 1XP8A 4C0JA 5L3RA 3BIFA 4KSCA 1N2CE 4CEIB 1OE0A 3SOPA 1XMJA 2RGGA 4L16A 4NKRA 1D8TA 3NHBA 5P21A 3AVXA 1Z28A 2Q6TA 4JMPA 2JJ2D 3RYTC 4JLOA 2J45A 5A4JA 2FJUA 3GD7A 3EG5A 1NN0A 2ZSBA 2BM0A 3IIJA 2FFQA 3MMPA 4OI2A 3U3MA 2GEUA 4PX9A 4NBSA 1OIVA 1CS4C 3SQXA 1KSGA 1P72A 1W4RA 5CYOA 1TQ4A 1KKLA 2AXNA 4BZXA 2QEQA 3IPXA 5LDDC 1BH2A 2D4HA 4RD6A 1AQYA 1MO6A 3B1ZA 1R5NA 2ZRPA 3U2QA 1XDBA 4IXMA 4XSGA 5J4LA 2AN9A 4RD2A 3EIHA 4QGGA 2XZOA 1E99A 5DLQC 3EX7C 3PR1A 4QG7A 4Z1MD 3REGA 3LXRA 3I5XA 2G77B 3ZZUA 2FU5C 1M6NA 2Q21A 2ODBA 4Q9LA 2BMDA 3H0KA 4KVAA 1Q3TA 3MAAC 3SS8A 4FMDF 1YZGA 4EJSA 1O87A 1S1MA 2OCPA 2WWGA 1II8B 3IBGA 2J0UA 5JI2E 4EPVA 1KZGB 3FMOB 1FPMA 3GEIA 4M9QA 4URVR 3W8RA 1US8A 3A36A 5KOYA 1KSHA 4DLZA 3EASA 5G41A 1N6LA 4TYNA 1CLUA 2G6BA 2PZEA 4DUGA 1JAIA 4RKEA 3U3KA 3WYFA 3THYB 2FG5A 3KXKA 4HDOB 4DEXA 3EPJA 2PLFA 4WZAE 3AF2A 1XCGB 3R9XA 1PLJA 1W2HA 4KLNA 1DG1G 4LJAA 4R98A 2IWHA 4QFMA 4XWKA 2FMXA 1RC8A 2RCNA 2R8RA 4ZCIA 4JLJA 4Q19A 3O8CA 3C41J 1KI7A 3E1SA 4JKIA 5AUPB 3NH9A 3Q85A 4FINA 5FUYA 5IK2D 4NPHA 5DE3A 3RS0A 1OH7A 1NSFA 4DXAA 3K9HA 2V4ZA 3TSZA 3U3RA 1ZUNB 1P60A 4YXWD 3I4LA 2D2EA 4DCUA 2VHUA 3ZZ0A 1GITA 4BGDA 3EC2A 2G88A 2I3BA 1S8FA 3OIVA 2DFLA 1J2JA 5TY0A 1GRNA 1L4UA 1FNNA 1KKMA 3UK6A 2JDIA 1E0AA 1UBEA 1FQKA 4IDHA 2QPTA 1NIJA 4E5UA 2WICA 4LGMA 2O8BA 2AL7A 1T5IA 5DI3B 5F9FA 5J40A 4JT2A 2VA8A 1R0YA 1ZM7A 1JR3A 4F93B 2N1BA 4RFSA 1GL9B 1U90A 4MQBA 3FTQA 3X1WA 2F3TA 4V0NA 1KK2A 1MT0A 2OLKA 1G18A 3MSXA 3U4QB 3OIWA 1W48A 4EFMA 3QF4A 1XTQA 3K09A 3EWSA 1Z6XA 4JLBA 5FTKA 3CNLA 2C2HA 4PC1A 4AG6A 1E9DA 2O0HA 2QQEA 3LVRE 2GRJA 4P4SB 4QHSA 4QGHA 2JJ1A 3TIFA 4AURA 4DLRA 1TF7A 3W5JA 5AJYA 2GXAA 4JLKA 1U2RA 4G5QA 4JJKA 5A0FA 4LJ7A 1GL6A 2RB4A 1G5RA 3VMFA 3PUVA 3AB3A 5FTMA 4A2PA 4NH0A 4RFVA 2OFXA 4TTPA 4KBGA 5FFMA 1FZQA 4ZI3A 3U44B 3H86A 1CULC 1P9RA 3WNBA 4PPQA 3HU3A 1SULA 4JVLA 2N42A 4UNNA 4TLEA 2C8VA 1BYIA 3S1AA 3RRMA 3TK1A 3MWYW 1JPNA 1Z0KA 4QC2A 2REBA 4Q4HA 4ZIRB 4HDQB 1XD8A 1NVUQ 1YZKA 1I4DD 4PC3A 5CJPA 1VDZA 1YR8A 1NN3A 4ASUD 4UQOA 3Q5EA 3QKTA 2DWOA 2ZSEA 1U94A 3U6BA 1R0ZA 4L8GA 3WMGA 2YWGA 2VTKA 2AD5A 1Q1QA 3RNLA 5KYKA 1QHYA 1DO2A 1S2MA 4RJLA 1GZSA 1N5LA 2GXSA 3FE2A 3THXB 3QIAA 4HAXA 4MKHA 3OHMA 2QP4A 2FFHA 4NDZA 2V8OA 3HYRA 3WNCA 4C7OA 4D6PA 3RS7A 4D26A 2BC9A 4WZ6A 3WHKA 1G20E 3R20A 4TT3D 1W0KA 4MGZR 4BFYA 3BD9A 3W6NA 3A8TA 4C0LA 4CIDA 2ZROA 1G3QA 1IOZA 1P4SA 3TE6A 5BWMA 1XTKA 1YZLA 1X8LA 1N6IA 1Z83A 1QHSA 2QAGA 3X1DA 2XB4A 4QBGB 2F9LA 3T5GA 5CITA 1NIPA 3PV0A 2PLRA 2VP9A 2VLIA 2XZLA 4MGYR 3KKPA 1OKKA 1WF3A 4UXJA 2F9MA 1F2TB 4AYWA 2KBFA 3VR3A 2H17A 3FMIA 5JWOA 3JZAA 2G1KA 2PBRA 5JZVA 5AUOB 5HKKA 1XBTA 4BFXA 3QKSA 1QRAA 1ZM4A 2HF8A 2GJ8A 5E7IA 1VCIA 4A6XA 3DVLA 2QL6A 1XMVA 2RGNC 4M9ZA 4N0DA 2W6ID 4WOPA 2WJYA 1BS1A 1FNMA 1II9A 3EZ6A 2WJIA 5L8VA 3AF1A 1EESA 2XEXA 2ZE5A 3CX6A 1PJRA 3L43A 4HAUA 1S1CA 4QXAA 4DWJA 4EPXA 5CDFE 1E2IA 4YQFA 2QG6A 4FD2A 2VP5A 3L0PA 4XD7A 3GLGB 5JMTA 5AWFC 2VSOA 2VPPA 2ZI3A 4Q7KA 3KQHA 3PEVA 1WBBA 4R9UC 4DZZA 3BB4A 1FP6A 3ZDQA 4EUNA 1HA3A 2KSQA 3BXZA 1E32A 2LKDA 3QBTA 1GKIA 1KDRA 2ZVQX 4IVQA 1QVAA 1O3YA 3I3SR 4RZXA 2NZJA 2G9NA 2IS4A 4QNRA 2IYZA 3T12A 3O8RA 1W36C 3UG6A 1QHNA 4B32A 1K6MA 4C0BA 2O0JA 2GF9A 4AD8A 2XOKA 4MGKR 1G16A 1M7BA 1XXHB 4B76A 5FR2A 4EPYA 1R5OA 3KQKA 1SKYB 1WE2A 2WOJA 1GOTA 4W9MC 2DB3A 4M1KA 2WMNB 3CF6R 5TVKA 5L3QB 1JJ7A 3TRFA 2EFDB 1R10A 4QJ4A 2J0VA 1TADA 4IJMA 2ZANA 1VYVA 2IYQA 2NQ2C 3MJRA 1MOZA 1QZXA 4ZDIA 2W83A 1ZVQA 1MKYA 1F3OA 8OHMA 1DAGA 5E7JA 3TVTA 1TF2A 4LBZA 2ZRAA 3KKQA 3CBQA 1Z0FA 1B23P 3WMFA 5D3MB 1QHHB 2BBTA 2YOFA 1JJVA 3RC8A 2IUSA 1KI1A 5BQ5A 4LJYA 1Q1BA 2C98A 1EFRD 2F3RA 2ZQ5A 3VR1A 3G5UA 3BOSA 3KX2A 4XWAA 3FOZA 4TLBA 3FKSD 3KFVA 4DLXA 2H8KA 2AWNA 4TYYA 1W0JD 2FZ4A 3QKUA 4OL0A 3SJCA 1E2EA 1D2MA 4WIAA 3RLFA 1XZQA 5K8IA 1XJ0A 4DSUA 1XEXB 4HSEA 2BKEA 4HAZA 1SXJD 3GPLA 1TTTA 5AUNB 4BRWA 1AS2A 2QN6A 3SDZA 3VKWA 4MYCA 2JATA 3P4YA 3W6PA 2R6GA 2ZJYA 3C7KA 4Q1EA 1DAEA 3VFDA 4A36A 4Q1AA 4DBLC 4II7A 2FV8A 4GZMA 2NOAA 4BZQA 3NWJA 3OE7D 1G3UA 5B64A 5JLJA 5FL3A 4RD0A 2FWRA 4TTQA 1VYUA 2WSSA 3AEZA 3LNCA 3A4LA 4KAXA 1Z0IA 4A92A 2W00A 3M4YA 1NJFA 3B85A 3QQ5A 3DZ8A 5EXSA 4D25A 3PEUA 2GVZC 4LI0A 4V0LA 2VYFA 5AUQA 4C0HA 2QBYB 5E3HA 1NMXA 3CR8A 2VQSA 3MWJA 4ABYA 4D0GA 3CKLA 4EDHA 3C4JA 4V02A 1AS0A 2Z4SA 4KODA 2F43A 1N5IA 2YOGA 1VMAA 4G1UC 1HT1E 1OXUA 3GLIB 2IYWA 1WP9A 1DE0A 3C5HA 3CPJB 1AK2A 3DPUA 4ZI2A 5LD2B 1T8TA 1A1VA 1AJEA 5EP1A 2O8FB 2ZTSA 221PA 1U0LA 1QDEA 3A4MA 4HAVA 4NZYA 4YMVA 1CF4A 4KI0A 1GIAA 5FBLB 4BEBA 4I1VA 3W9YA 4O3MA 2VSFA 1AKEA 4IEEA 3WXMA 4D80A 2J1LA 1X8JA 2V54A 2OUKA 2VF7A 2ONJA 4DLUA 4M9XA 1PZNA 2J7PA 2J7KA 4IFEA 3QEJA 5KDLA 2WWWA 3L82B 2ZEJA 1KO1A 4LBYA 2IXEA 1N5JA 5ANRB 5K8UA 2Z0MA 2VH5R 4X8MA 1I2MA 2OV2A 4MRNA 4DT1B 2BMJA 3CUEF 4PHGA 4DC9A 4MDEA 5JHGB 2WIBA 3B78A 3OFNA 4PTLA 4PZLA 1BKDR 1WB9A 3TGPA 4S35A 4D4JA 2AK2A 2IF0A 1Q22A 1ZCBA 2CBZA 3OEEA 2JIZA 5DN6A 4LBWA 2MSEB 4MKFA 3KJEA 2VL7A 5F2EA 2ZI7A 2W0SA 4LPKA 2PEYA 3GJ5A 3HWSA 1CJUC 3G0HA 3TAUA 4GL2A 4Q03A 1KOFA 3BAFA 1E2HA 4EQ6B 5JCPA 2QENA 4LYAA 1SVSA 4HB0A 2KBEA 4W5JA 3BK7A 3FMFA 5EE5B 3CRW1 1Q44A 4RZUA 2CHQA 3D3QA 3UXMA 3LVQE 3ICQB 3GLHB 3TQCA 2VO1A 1KK3A 1E1QD 3SYKA 2I1VB 1W4BA 4LJ8A 5L3SA 1WQ1R 2AWOA 4A9AA 4EFNA 1DAKA 4QRHA 1NVVR 1MV5A 4I4LA 4Z8XA 4GRAA 5CB8A 3QI2A 2J9RA 4LCBA 1ZD1A 4MUAA 1GSIA 4WAUA 5FBQB 2QE7D 5EP2A 2FGJA 3T1VA 5DHAA 1W2GA 4X8OA
chains in the Genus database with same CATH superfamily
3CBGA 4L4UA 4D82A 1I3KA 4NK5A 5JW6A 2Q8PA 4PYMA 5IAKA 1QH1B 1GXSB 3F4BA 4Z4GA 1DT3A 3N2YA 3W4KA 3L79A 2YQ4A 3E1GA 5E6RA 5CEFA 4DB4A 4EJSC 3UXEA 1PSWA 4NCKA 1DC5A 1N8TA 2CDRA 2RCYA 2GI4A 3NORA 3O9MA 4DIFA 1MO4A 2IGTA 3Q8KA 1MTOA 4LWZA 4ACBA 3FLMA 3Q9SA 3IESA 4B87A 3VX3A 2RMKA 2IOFK 3UAOA 5G4KA 1NNSA 2IEZA 4INAA 5BR1A 1RZVA 2PDAA 3H04A 4LNHA 4NECA 4TS4A 2X4LA 4JJGA 1HL3A 3HL4A 1C3JA 2PR2A 4Q4LA 3OLXA 4Q4AB 4DC1A 3OQ6A 5JCXA 3CPEA 3LLUA 2VT3A 1LDEA 2EYUA 4DV1B 1GSHA 1HR0B 5FQOA 4PHTA 4RVCA 1EQ2A 1ZBQA 2I34A 1TQ8A 3LY5A 4QQRA 5L40A 4RIGA 1MB4A 1YE8A 1LS1A 2VUHB 1L7MA 3JSXA 4UZEA 4KC0A 3SNHA 3KZMA 2BCJQ 2OECA 2PSJA 1E8NA 4WADA 1T4CB 5DHFA 2Q3FA 4CDMA 2NO4A 4Q34A 2VDOB 4EB0A 3MJVA 2JIQA 1XTRA 1JEEA 1WDWB 4OQMA 1JXOA 3EA4A 1QLWA 3NI2A 3IBFA 4EZEA 4FNGA 4UZSA 1QCCA 3QX9A 4FEAA 4Z1MA 1B14A 4OJQA 1ENOA 1SC4A 1HM5A 5DNYB 3HR4A 2VTBB 3GQBB 3LVFO 1W88B 3MPOA 5BQXA 4Q9KA 1G8YA 3LE8A 3VC3A 2P8SA 2CUKA 5LXTA 2EBWA 3RRNA 3ESCA 1F2VA 1ULZA 4X97A 1XNQB 1GR1A 1KJJA 3VHXA 1WHSA 4BNVA 2ACKA 1WXDA 3KQVA 4JUIA 2PX0A 2JZNA 4UNPA 1ZXLA 3K0FB 5KSYA 1P6XA 3L7LA 1OILA 1LI4A 3TKYA 3GW8A 3KXIA 3QVVA 1SUEA 3E9MA 1VM6A 1U3VA 1RKVA 1ISSA 1JAHA 4N0PA 1QOQB 5JS2A 2YW2A 4ZQGA 1V48A 3HDYA 3EUFA 4RELA 4UATA 2CXNA 3C45A 3GPCA 4C04A 4G65A 2YRWA 3TTYA 3AQIA 3HU2A 4BVFA 1GCIA 3V8EA 1GFSA 2GNOA 1WUYA 2Z4TA 4B4OA 4PG5A 5K3AA 2P9QA 4ZHSA 1KQGA 1OLSA 2AJBA 3BUSA 2G5CA 3CN7A 5HIAA 5EI5A 4AX4A 1KBZA 3E82A 4A2QA 4BO7A 4C4OA 2YICA 1CP3A 2OYRA 2PUGA 4TMWA 1NXOA 3WLEA 4H60A 3O8NA 3EEQA 2VK4A 5H59A 1W93A 2Q8QA 1DC6A 1FUKA 5J9FA 2KLHA 9LDBA 2HQOA 1YQQA 5LQSA 3WP0A 2O48X 2AJDA 5JG7A 1F7VA 4BQSA 3BCSA 1UJ2A 1PCXA 1SU6A 3Q7QA 4MW9A 1IMOA 3MWEB 3G89A 2EG9A 1PT5A 3DZDA 3K1JA 3IR6A 1SC3A 4RENA 2VYND 2XXJA 4KACA 3ZU4A 1XTVA 3N74A 2Y6VA 1USKA 2IPXA 4PZ9A 1O0BA 2D74A 2WJVA 4IVPA 5K99A 1VL0A 1AM4D 4B47A 1HH4A 2H9AA 3EWNA 4Y98A 4OA5A 2QNIA 3O5AA 4QQFA 2BMWA 4J1TC 1PYOA 4J6EA 4Z7NB 3GN2A 3K94A 1GP2A 4ZFNA 2Y71A 1ZZGA 3C7DB 3QU9A 3H4IA 1M2VB 1DVRA 3RK0A 4UOEA 1BYUA 1UM9B 4KO8A 2ZYGA 2I1WA 4QO8A 3F47A 2V7BA 2HKIA 1T5DX 4TTIA 3AJDA 5BW5A 1SXIA 4U0KA 3UB2A 2ZW9A 2EVWX 2X8AA 3MIIA 4B2PA 4HRAA 5KZMB 2JNWA 2RSLA 2FQ1A 3SZOA 2CDNA 3K2IA 3ORSA 1VPTA 2Q28A 1ADYA 1VJCA 3DDUA 3EH2A 2LE0A 3IBCA 4PBRA 3GHHA 3WJ2A 2G9RA 3ROGA 3OZWA 2GZAA 2VRWA 3E8XA 3FM9A 1TA0A 4I81A 4A1FA 1ZNYA 1Y4AE 1X87A 4M3NA 4PSAA 4OHYA 1XP5A 4AJNA 3RDPA 4D0LB 4OBBA 4L8LA 3PX7A 2FWMX 2XOXA 3MJFA 4LVOA 1LJ8A 4WXPA 2G71A 2WP0A 1EIWA 4CU2A 4OGFA 3Q88A 1MW8X 1SIBE 1YOVB 3C6KA 1HURA 2H2HA 1UIRA 4MEJA 3PUYA 3RAPR 1J22A 4L5CA 4PVCA 4QPZA 5EIBD 1F7UA 3KBOA 3NU1A 1UWLA 1GKYA 2FPXA 4YJ2B 5ARDA 2QMYA 3O1LA 3U7IA 3D02A 3GLFB 1KJQA 4R71A 5CA0A 4JGGA 3T99A 5DTQA 4YRAA 3H1PA 1QYIA 3SXJA 1WJGA 2L17A 4RIIA 2OCAA 1XI2A 2QA5A 4TMYA 2CB0A 1HK7A 3GK3A 1QRDA 1FJHA 2C8JA 3EDQA 3WRXC 1PT7A 4B5KA 4Y2VA 1P39A 5HQ3A 3R6WA 2B69A 3BCRA 1S8NA 3P9IA 3OJCA 1K6IA 1PFYA 4I50F 3SWWA 2ZAIA 2ZUTA 1X1BA 2BHSA 3EWAA 5IT4A 5ERXA 5EPUA 3DTVD 1K06A 1BDJA 2H06A 5AVKA 1OYOA 2AR7A 1TK9A 2CUZA 3QMMA 4NWIA 4YFYA 4ETNA 1OB2A 3GLVA 1NBME 3CVJA 1PUIA 3RGGA 2C2WA 3VRHA 1R00A 4F2PA 5AW2A 1HSZA 2OBXA 3IAS1 4H08A 1DIAA 3H87A 5IC6A 5C52B 2ENWA 2SKEA 3MM4A 4MYDA 4C87A 1OYYA 4NCHA 1Y1SA 2OFWA 2YNMD 3VMMA 3FBGA 2JFGA 3IAM6 3DBRB 3WGZA 4UE2A 1QZUA 4HFNA 1IWOA 2XD9A 2W2TA 1J2RA 1TM5E 5FOVA 3PBKA 5I7AA 5IH3A 3DR5A 3ASYA 1U7OA 4IKOA 2QGZA 2CB9A 3A9TA 3PDHA 4HHEA 4LXGA 1OH6A 4EUHA 4P98A 3F73A 1KS2A 2GO7A 5C81A 2Z83A 4FHCA 4KYUA 4F11A 1F8YA 3DEFA 4FX5A 2VUSA 4D8VA 2H51A 1RRPA 2HDOA 1NSTA 3BREA 2BPOA 2JASA 3MD9A 4TV9A 4KJZA 1IJFA 4F4DA 5B5SA 1QGAA 5L3VA 1JEYB 5EWMA 2ID4A 1Z4NA 1B93A 2FFRA 3I32A 1W5SA 2XUZA 1UBOS 4HDRA 4DE5A 1T1GA 1IEXA 2ZYDA 3KOXA 5LYYA 1YB5A 1W1WA 3L46A 4QT0A 2EHJA 3GLIE 1DINA 1HGXA 1E3WB 1U8TA 3EIWA 2FQYA 4KLRA 4X8LA 3ONVA 3UHAA 2EIXA 2OXEA 3OURA 5JHHB 3AP1A 2X4DA 1NUSA 4G26A 4CV3A 2WVAA 4EJFA 1TIPA 1Z2DA 2ZVDA 4L07A 4MO9A 4OSEA 1LV8A 1UADA 4EKGA 1XZGA 2P9CA 4UU1A 3JZMA 2YN0A 5KCZA 3SX0A 4V0OA 4PONA 5K3SA 4Q3EA 4RH3A 3OO0A 1E0SA 2FPOA 1PFWA 2OZLB 1J25A 3KSRA 4L72A 3FWYA 3RC3A 5IF3A 1YI8A 2F1KA 5K2MA 4DJFC 3MAGA 4IGEA 4F6LA 2YXBA 2GKSA 2C4NA 4IFBA 2IS1A 1KZ6A 3GJXC 5DASA 1NDHA 4YROA 5AVQA 4DGSA 1GZ5A 1Z4KA 2PMKA 2XTZA 5TF0A 2BWJA 4GOKA 4Z2YA 4C88A 1R8XA 1BEZA 2NXJA 2PAAA 1TQDA 1EDOA 3D4OA 1A97A 5M34A 1TTHA 1MAAA 2R66A 2G4CA 2LD4A 2YDYA 1T0PA 4INJA 4O5AA 4NZMA 3RSLA 5AVTA 3OEWA 5LMUB 2HHJA 3DGEC 5E6UB 2E4WA 2R6DA 2IDKA 1W1UA 3HYCA 4XRGA 2CLSA 3DE2X 1YZQA 3MUOA 4AWBA 1EVEA 1L8AA 3ZTYA 4C0XA 5CB4A 4GLFA 2PWYA 1YR6A 3JQAD 4UUOA 5H70A 4REMA 1U2ZA 3L8DA 1GTJ1 3KHSA 4OGLA 1HC7A 4M1YA 2UVDA 5I4KA 2H1VA 3LPCA 4YP9A 3MJ4A 5KKCA 4GX0A 2YJTD 2ZYVX 3H7IA 4BTLA 3QVGB 2X6TA 1UBJS 4A5SA 2IS2A 3V6LA 4M83A 1UJ5A 5HS6A 4WKNA 1SCKA 2BTOA 3KTOA 4ZIRA 4X85A 4D1YA 2Z4RA 4FCVA 5CYPA 4FNMA 1IN8A 1CUEA 5E3IA 3EPLA 3RG2A 3MXTA 3ZY4A 3HEMA 3TTSA 4Y2SA 1B8VA 1RWNA 1U2TA 3B48A 3IT0A 4LY0A 4M7OA 5JS7A 3SM3A 5D00A 3L18A 4HFJA 1G17A 1MX9A 1JIXA 2N9UA 4P93A 1Y3CE 1M1YA 1G3MA 1E7MA 1OR8A 5LP6B 2DMRA 4RHYA 1PZGA 3ZV7A 4YJ3F 3HU1A 2C5EA 3UH1A 1YRWA 4M1TA 5KWEA 4WESA 2H29A 3PXAA 3A1NA 2HK6A 3SMQA 1EU1A 2AQHA 2QZSA 5C4IA 2C9OA 4CG3A 3UUFA 1KYVA 1UEXC 1XQVA 1ZK1A 2Y1EA 5DZSA 5EXXA 2NU7A 4LF6B 3I3OA 1P29A 5HF5A 3LC1O 1LS6A 1H4QA 2CZQA 3LT0A 5IBPA 1P9LA 1BMFA 2W2KA 3OPYA 4XR9A 4OQZA 1EP9A 2XDYA 3VPXA 2NZ2A 4BEWA 2IP2A 4RD4A 5ALSA 5FTLA 5K3EA 1Q0ZA 1RD4A 4MXDA 3DDCA 4E6EA 2AA3A 3COJA 1CY1A 3I23A 4DAOA 3USES 2C9YA 3M2TA 1FU8A 2I03A 1NI4A 4GSYA 4ZXPA 3ZEAA 1F2TA 1KC1A 5JECA 1JIUA 2HIHA 3SR3A 1JHRA 1RAFA 1CEYA 2Z1DA 3RC1A 4QIHA 3KAKA 4H9GA 4LRWA 2H6EA 4UHFA 2I62A 2V4UA 4IGFA 2PT7A 1Y7PA 1T0UA 4MVJI 5A7HA 4A8JA 5HKAA 5ALEA 1IHUA 1SIUA 1XZFA 2X0JA 5BRNA 3T4UA 5KTKA 2WSLA 3MFQA 4ZC8A 2J6CA 4NAVA 3QXSA 2ZIGA 2EV9A 4QOIA 4Q6WA 1IU9A 2OZVA 5HEKA 4H7KA 2GZRA 1AB6A 3B6EA 5MF6A 1VJ0A 4WA7A 1BN7A 2VHQA 4J6FA 1W49A 3T0GA 3LUFA 1DTEA 4QUGA 1KORA 1E2KA 2GXUA 4E30A 3HEAA 2EARA 3WRYC 4DLKA 2WWYA 3BBPA 1TKAA 1KDVA 3W9SA 4TWIA 1CIVA 4EZIA 3VSDA 4DADA 2B2XA 4N0EA 5AI4A 4R2IA 1GKKA 1AXEA 3WLRA 5EVJA 5G4LA 4JLAA 4OQYA 3PZRA 3D9QX 4K26A 4ARIA 1ZQ9A 1DFGA 3DF7A 1BDHA 1GU0A 4J7AA 2DHRA 4OHPA 4O1HA 4YC7A 4EO4A 5ITWA 4AS1A 4PZEA 3AUXA 2BEVB 5IWCA 4S1PA 3B5EA 1ID1A 3HKBB 5ALHA 4ND8B 4ZT6A 2UZ4A 1ZN2A 4NNPA 5ED0A 1PZMA 4ER3A 1A5ZA 3MB8A 4OQNA 1P31A 1VHQA 1ZUWA 3AKYA 3RUFA 2BKAA 5A5DA 3KB6A 1I5OA 1TLFA 2H63A 4Q05A 3TQFA 4E03A 1N3LA 4KTVE 1OV4A 3LWNA 3C3AA 1TUBB 1VMKA 4XE5A 3U49A 5AR1A 4BL5A 4EA9A 2Z9DA 4C4YA 3JQBC 1XTZA 5EHGA 1D6SA 1DTSA 2QTHA 4HVAA 2BKLA 3ZDXB 4BU0A 1P2FA 4HJXA 1Z5WA 4D74A 5DW3A 4OSPA 2FEAA 3T61A 1V71A 2PFSA 3WP1B 4ZK2A 2VRBA 2B99A 1UKZA 2VZ8A 5C8YA 3CVWA 2C4TA 4R83A 2AOUB 3UXHA 1C9NA 1ZJ6A 2FW6A 2XZPA 2HJ9A 4FYKA 3JRNA 5A1JA 4K88A 3DE0X 3QYPA 2ZRDA 4KV7A 1JDSA 3UYLA 3O82A 3VU8A 2HJRA 1PQUA 1OVMA 2VATA 2WIAA 4PHFA 4CM7A 2KLBA 2OAEA 3TX2A 1N9GA 4UREA 4A8HA 2WMOB 3PDIA 2H1WA 2IEAA 3ECAA 3R5FA 4JJAA 4KPEC 5K4HA 2X2OA 1ZJJA 3ODPA 2BL4A 3BE6A 3TFWA 4CIWA 4MR7A 5CBPB 3Q7EA 5F76A 1KJZA 4OQFA 3H9BA 4X20B 1ZMXA 2VT7A 2AJCA 2V7QA 3KAQA 1MAVA 1HMPA 4KXYA 4RPGA 4Z3DA 2XW6A 4NTZA 4Y6LA 2J9FB 3K9BA 2HCJB 1TLLA 2WVHA 3L8GA 4OQPA 4CLOB 1GVHA 3CV3A 3DF9A 2XTNA 4UE3S 4L76A 1FP4A 4DBLE 3EXIB 1LQ2A 5J2UB 1B16A 1NG1A 1XMXA 1AGRA 4OQQA 5GADl 1MJGM 4LN1A 2RGEA 1WOYA 1TZ2A 3IUJA 3T3OA 2EJCA 2XRMA 3CIOA 3FFTA 1Q14A 3PPYA 2YYAA 1YJCA 1OAAA 2BY4A 2OUIA 4HLUC 1OW3B 5KDDA 1YO6A 2GAAA 3TLEA 4D02A 3X1MA 2Q9UA 2ZBFA 1TVEA 4LV5B 3HM9A 3DT6A 3DTTA 3IPYA 4EENA 1NBEA 4I8DA 1P7WA 1V0JA 3OTOB 5YASA 4CCWA 4JLWA 3PQ4A 3SQMA 1DTWB 3ZGVA 4BB6A 2WYUA 1U5BB 4JJ4A 1E58A 2A7QA 1Q0RA 2P9ZA 4GPTA 5A3VA 4AZ3B 3L0BA 1F8FA 2NLOA 4Q3CA 3KSBC 2QBYA 1CF2O 3D7KA 1SHUX 4P4LA 5DGIA 3ZVNA 1BVHA 3GUZA 4RVSA 1GEGA 4JMLA 3CRNA 4IIJF 2RG7A 4X6XA 4AP5A 2EW8A 4ALIA 3VNBA 1KMMA 3VDMA 4AJ9A 2NV0A 5ITZA 1NVGA 4LF4B 1QRTA 2EFJA 3GFVA 3LU1A 4M8LA 2I2FA 5A5EA 2R7AA 3NG1A 3BFVA 3NXSA 4NU0A 1QFZA 3GAFA 1C0IA 1EAMA 2C92A 5E9AA 2IXFA 1ZM3A 3AKDA 1Z82A 1JMKC 4HNGA 1JHQA 4PC6A 2R1ZA 4C08A 3WIEA 5CW1A 1K7CA 2YZGA 3LUHA 3LCUA 3BMQB 1NBOA 3EVCA 4N1AA 3ZXUB 1PK8A 4B3TB 4KXXA 4DNOA 5CFRA 3EVZA 3U3OA 2IYYA 3QGMA 4O33A 1QRUA 2GSWA 4PQFA 4QDTA 4JX9A 4Q16A 2V6IA 1IM2A 1IY1A 2OD7A 4GO1A 1JXMA 1GDDA 3CB2A 4N3NA 1YGPA 3KJGA 5EHQA 2LPMA 1JSXA 1LSOA 3DE1X 3W5HA 2WKQA 1N3BA 1ORDA 3QVKA 5A4FS 4NI5A 1N8SA 5D7BA 2HIMA 2GJ9A 1NWHA 2CEAA 4O2BB 3FDFA 5TMBA 1TAQA 5C5DA 2O7NA 4ZJYA 1NW6A 1VSBA 4XPIA 3T7IA 1NV9A 4AO8A 1F5SA 3ISTA 3MT9A 3LBHA 3QVSA 1N2HA 3PI6A 1ZHHA 1QGUB 3K1AA 4UEJA 3JYHA 4ECEA 3KSAC 2W2LD 2YYYA 3WLTA 2GCOA 1NATA 2O4UX 4JBLA 1WM1A 3C3XA 3TH5A 1KJWA 2CXUA 2V6JA 1TK3A 2YJ4A 3ONNA 4RV4A 4XWYA 4MH0R 2HA0A 2FWAA 1PHPA 1HQKA 3CF2A 4E2WA 4QOJA 3GEPA 3IAFA 3UATA 1OFUX 3HH8A 3SNKA 3BERA 2YS7A 3GH1A 5IT9A 5EN4A 1NTOA 3PQCA 1TZCA 1UM8A 1N2BA 1XEWY 3GJ3A 1A3CA 3HR7A 1SXPA 5GONB 1A4XA 1XWFA 1HI9A 4GOJA 5FNVA 4CR6A 5ICCA 2FFAA 4Y9DA 2NSLA 4MGEA 5T4HA 2OLJA 2VYNA 2HF9A 3CRVA 3UM9A 4AC9A 5BN3B 1XWIA 2B3DA 3Q5GA 3TDNA 2PGLA 4ZANA 2NUAB 3R74A 2ZYRA 3D4IA 2BI7A 5J58A 1CZOA 1FDOA 2ZJ2A 3HL0A 2Q1SA 2C7OA 4C0SA 1XSEA 5KNBD 5K0BA 4KR6A 2JIPA 2REQB 1NC1A 2I7CA 2OEPA 3L9WA 3PITA 1H1LB 1A69A 5FL7D 1AOXA 5MGNA 2AEJA 3M5WA 3KB2A 3TMAA 3N5CA 3I9V6 4CGZA 3QUQA 1CY2A 1OFUA 1TC1A 2OHJA 3B6MA 1TJYA 5SYNA 4KR3A 3BA6A 1L7RA 4RKQA 5ALKA 3BGOS 2C7PA 4IHQA 1R7RA 1CY4A 3KK0A 3LO5A 4JOSA 5BNWA 4XOUA 3UAYA 5F7ZA 5F23A 4H7DA 4LISA 5HRAA 1DC7A 1Y8RB 1NLZA 4RJJA 3GFPA 5BSUA 3UMCA 4D4MA 2RKWA 2VP2A 3OHPA 3QXHA 4IG4A 2AFHE 5DNWA 3KVYA 5I7UA 3MC1A 3QG1A 4KZPA 2UU9B 1AHIA 3ROZA 1XPRA 1P3DA 3HDGA 4RPHA 1G20A 1QMGA 1UDBA 2J3QA 3NIWA 4S1OA 2AOTB 3RF6A 3VV2A 7ABPA 1S2LA 2WAXA 2XCLA 3A1TA 3SY8A 2PZGA 4ODIA 2Q0HA 1VLHA 2VPQA 2I8CA 1ZSNA 4LZNA 4RU1A 4U7FA 1RLJA 1NBMD 1FYDA 1NXXA 3U5TA 2ZRGA 1XZ8A 4DDKA 1NHWA 4I6EA 4BN0A 4MVJG 4LJLA 4BGIA 2D7DA 1JBEA 2VDWA 1KI4A 4LJ4A 5DISB 4AG3A 4KE7A 1YDHA 1ZCFA 4RM2A 4TX1A 1JDTA 5KOIA 1AA6A 3AB8A 1CZNA 3GYBA 3EA0A 2FN4A 3AR6A 5TRTA 1FUEA 2QTVA 1E5DA 3QPUA 2EJBA 3K8QA 4Q48A 4TRNA 4LZZA 1X80B 1MH9A 3AI2A 2QWXA 5IP5A 3QX3A 1M0TA 2GHIA 4DM7A 2RAVA 3LCJA 3L02A 4GOXA 1JDBB 4Q3DA 5B36A 5D1NA 2W8BA 2CC2A 1XQWA 4QX6A 5J5AA 4KN5A 1SPXA 2DFKB 1RJ9B 4FCCA 1Q2XA 3VDXA 2A86A 3DC2A 5CHEA 1CUFA 2Q1UA 4G41A 1FFXA 5CXQA 3M7IA 2RGRA 1XTIA 3Q15C 3EW7A 2O07A 2YBEA 2PL3A 4KMOA 5KSPA 3DTVA 4IICA 3NTXA 4YR9A 3U09A 2FY8A 2FX2A 3NOVA 5JH7A 5EJIA 4NG5A 5CFQA 3FSEA 4V1CA 4HUQB 3ROEA 3WA6A 3T5AA 4YMIA 5JXHA 5HJ2A 5E6RB 2HMSA 2PCLA 4B74A 1UBGA 2YNMA 4I14A 3SEQA 3JR3A 3UJ6A 3WSVA 2PZMA 121PA 5KTNA 2C59A 4KQIA 4BC0A 5A4IS 1P0QA 5HRCA 3H84A 4L5IA 2NT3A 2XMPA 1KO8A 1O4VA 1XRLA 2RJOA 1J9GA 1YR7A 2HHCA 3GA5A 4P5DA 4TTJA 4JJ8A 1PIWA 5DN9A 4CL3A 4G9EA 3MTGA 5G4KB 5AQ1A 1RPZA 1YWGO 2YVLA 5IBCA 4ZTUB 4GR9A 1D5WA 2G0TA 5A5GA 4MUEA 2CK3D 1PTJC 2F3QA 4S3MA 2X5NA 3WB9A 2CLIB 2RHMA 4I9FA 1WCYA 2IZZA 1M2WA 1TMYA 2R65A 5FLYA 1B0UA 1OCEA 3O4FA 1M34E 4HK4A 4YCDA 4YRCA 3VV3A 2FMUA 4OGWA 3E4DA 3W2EA 3K09C 3K9WA 1F8GA 5CRIA 1V16B 2I6TA 5TQVA 5JDIC 3FOWA 1AU9A 3ZHYA 3WBJA 4KHZA 5F12A 2HBQA 3AHIA 4CVNA 2FDCA 3EPPA 5COBA 4MP6A 1NUQA 4JKOA 4GICA 4Q1FA 1FSFA 2IHVA 1NUUA 2OCBA 1T1EA 2QJWA 3A32A 2ZS9A 4RDCA 1MR3F 3TLJA 2QRGA 3DKIA 2X41A 3NHYA 4IKPA 4P80A 1XCOA 3O8DA 3M9XA 4C7JA 5JAUA 5IS2A 2ZJ1A 1L5FA 4CUJA 1GGMA 4X24A 2N46A 1C3VA 5K0GA 5JC1A 2HXYA 5IWAB 2E1RA 4GZLA 3OQMA 1Y4UA 3QE9Y 3CCBA 4Y1FA 3CUWA 4O8CA 3C8HA 4M98A 5LXTB 4HDMA 3GVIA 3TNFA 2EX4A 2W4QA 1RQ7A 4IOLA 4KQMA 2HQBA 2REXB 5FNZA 2GESA 1A71A 3DNMA 1L7VC 4U2DA 3LXUX 3QFSA 4AT1A 2VWPA 3B2QA 1G2OA 1I2AA 2X22A 3IS3A 3LQFA 1FOEB 1NUTA 1U1GA 4X6YA 3WNVA 1Q12A 1ADFA 1Z0UA 3GT7A 1PVVA 4OI1A 4CR8A 2XXAA 1GSAA 2EATA 4G01B 1RIFA 1WMSA 3KJNA 3Q7TA 4PYQA 5TQJA 2DQKA 3N0XA 3LGXA 1JJAA 1MIOA 4BZPA 4CQMD 1OXTA 2W90A 4ZDWA 1YTUA 4QATA 4MUIA 2V45A 1U7PA 3OFND 1QHIA 3HY3A 4HPJB 3LUGA 5JCOA 5JS6A 1M5UA 4R7GA 3U9LA 2MMGA 1OLSB 1EDBA 3PICA 5ALMA 3JQAA 1Y48E 4KQJA 1FYEA 4LJRA 4PYLA 4CKXA 2WIFA 3PIIA 4L7VA 1FBNA 1NT2A 2AYYA 2GJ4A 2NW6A 4LNAA 5EJFA 1GUBA 3ROXA 4L27A 1CHDA 4P3NA 1G8FA 4US2R 5KTYA 3H42B 4KIWA 4EG3A 5AKHA 2C5SA 1C3OA 1WUKS 2QAGC 1T6YA 2QLTA 1GZDA 4KGDA 5D86A 4N7MA 4ZYUA 4D97A 2FG6C 4HBZA 3H4TA 4YB8A 1DJLA 4DARA 4KX3A 5GGXA 2JFQA 3LKDA 2W22A 3ZZTA 2FFJA 5G40A 3SD7A 2HA4A 3HUDA 1P4RA 1M8KA 1TUIA 1XU4A 1WXXA 4ZMSA 3ZE6A 4JOBA 2JH8A 2RC5A 1DXYA 3CUVA 5AVYA 4BFLA 4PFSA 4TQUS 2Q0QA 3JWPA 2C83A 2RHOA 4P6VF 4F12A 1VG8A 3CR3C 3WK6A 4PYJA 4UAVA 3U7RA 3HB1A 3SJ7A 4PSUA 4RHTA 5BN1A 3CF0A 4CKBA 1CUSA 1EDDA 2X2FA 2WYWA 1PFQA 4MJLA 1ZWLA 1L1EA 4NU8X 3H9GA 1FDTA 3JZIA 2GS9A 1MJGA 2P3SA 2QXYA 3KAJA 1OX6A 4YMLA 1YBMA 5KJCA 5D87A 1WABA 3AR2A 3VOSA 4LYJA 2H31A 4M0UA 4RL6A 1QG2A 1IIBA 1Q92A 3CZ9A 3RUAA 2VPZA 1BS2A 4X60A 1XROA 2YN4A 5GWXA 4D45A 4EY8A 5LYJB 1SMKA 3R3HA 2Q4RA 2VDKB 4BCBA 4FSXA 4EJ2A 5AW6A 1GN8A 4U7HA 3I6MA 4JJ7A 1Y6QA 5AO9A 2XUAA 2XMDA 1W4ZA 2BBSA 3MS4A 5CTJA 3THOA 4DDTA 4N41A 2Q5EA 5KINB 5DTJA 2WPDD 1SVOA 1GPYA 5CVCA 3C0KA 2ZSKA 1E1YA 2QPLA 3GJ6A 5BW8A 5HS4A 1W6UA 4G4JA 4GKBA 1OXKB 2Q4TA 3L8YA 4WNCA 4DA8A 3IO5A 1O5IA 4ZEXA 4A5OA 2E87A 1C41A 4K46A 4L1KA 5DYIA 1N5DA 2NV2B 2WJ3A 5IBRA 1UPTA 4J43A 3GEGA 5KAMA 1UMDB 1ND6A 4BMYA 4D3YA 4F4IA 3MHTA 2Y1DA 1FDSA 4ARBA 1WKBA 2C9DA 4EKYA 4XIGS 5CA0B 2PWAA 3CSSA 1OHHD 4WACA 4H1UA 4UOQA 2O0LA 3VR6D 3GXOA 1IXYA 4URXR 3NBXX 1XF9A 4J0KA 4O1IA 3GGGA 1C7IA 4H7PA 5EPOA 1AKUA 4G5HA 2COEA 3DAFA 4LRQA 5HQ3B 4FCWA 3TAHA 4M1OA 4HYYA 1Q7GA 1KEVA 2ZITA 3SZMA 4RK6A 4PHHA 3ZWBA 2JD0A 2OKCA 3IH5A 2VDRB 4OBEA 4ACAA 1ACMA 2DCMA 3R0XA 4YPOA 2BFWA 4KHPB 3OJWA 2GN2A 1BO6A 2XKAA 2FRVA 2ZDHA 1U99A 3AF3A 3BS4A 3BZUA 4LSWA 4YR7A 3U56A 1NM5C 2JANA 5CVUA 1BA2A 4ZYVA 1IPFA 1FB5A 4D8WA 1VCOA 3GY0A 4QXMA 1KFCB 2JLRA 3LXXA 4B7UA 1J0DA 2J3KA 2YYSA 2J3LA 3QYFA 4GMXA 3FNQA 4B33A 1XZPA 3VR4D 1G9TA 3FUTA 1MJ5A 1YS6A 4BJ6A 3GLQA 4WV3A 1Z13A 1NJ1A 5A9TA 4GM4A 3BD8A 1O94C 4LJSA 3DD1A 5JJKA 1PW5A 4L02A 3KZ1E 3FY4A 1TQ2A 3T0FA 1YR3A 1ONNA 3T34A 1NDUA 2J0UB 2C4VA 5EJ5A 5KVAA 4L9AA 3AJ8A 3IT2A 4Q9IA 4X0EA 3ZU2A 1OJLA 4RD3A 5C8VA 2DLCX 1M8GA 3K9LA 1U8XX 1FLAA 3H6HA 4LXXA 1XMOB 2YVAA 3B60A 3KO8A 3QX8A 4INZA 4O4IB 1SG9A 2CBXA 4JBGA 4KV9A 4PLYA 4PZ0A 4R16A 4TV9B 5EE0A 3MUFA 2HWUA 2BEKA 3KAPA 4LZJA 4R8SA 3WWDA 4WBSA 1KI8A 3TD6A 4C7KA 2ZAGA 4HDRB 4PHCA 5AI0A 4ZZIA 5IG2A 4QJBA 4ZYZA 2ZXFA 5BSTA 4LY3A 3W7AA 2FEMA 3CNOA 3LBIA 2LKCA 2OM2A 4U2BA 4ER6A 2J9YB 2HEGA 1WETA 2WZCA 2ZRIA 2PA3A 4QDUA 4BNFA 3FDIA 3A0UA 4LFAB 1RQ2A 1PE0A 1B6RA 1CY0A 2JAPA 1RWVA 2P9GA 1RMYA 3B1KA 3MQ4A 2ZUEA 2B2CA 1XMIA 3DXYA 2I3AA 1T1SA 4R1OA 2IC5A 1YVEI 4YNBA 4ZVTA 4ZCLA 1C5KA 4CM8A 4BQOA 4CRWB 1E9AA 3H8SA 1EFRA 2QTFA 3I73A 1WP4A 3LY8A 3P19A 4BMOB 3FNGA 1S89A 3WIBA 5A4AA 3SEAA 2A2ZA 4K1LA 4LJKA 2VBGA 4YRQA 3I5AA 3CRQA 2YH2A 2FPSA 2ZJFA 2A9PA 4G2TA 4KK4A 4NESA 1SIOA 1YDGA 3AUTA 4IDAA 4XJVA 5DKFA 2EU8A 2HCTA 3DP7A 3ELBA 4EBBA 4L5BA 4DHEA 1I3OA 3H2HA 1Q0UA 3UMGA 2EQ5A 2E5FA 2DWCA 1NLYA 1WCIB 3IEXA 3QMVA 1IATA 4LEIA 4ZPXA 1A8IA 3D6JA 1LTQA 1ORRA 3EG9A 3GRCA 1P2DA 1KF0A 3T5BA 5BSFA 1UFRA 2AZDA 1WY7A 2HSWA 3Q87B 5JNUA 4H6WA 4H7JA 4HWSA 5AJZA 3QJYA 4LAFA 5H4GA 3NM4A 4A82A 2H92A 3KG2A 5JQGF 3E7WA 1W46A 2QTGA 2PRZA 3QF4B 4GOOD 4OF4A 3D0OA 2NYVA 2PKQP 1JH9A 1G7SA 2P35A 1AY0A 1H3EA 2OVFA 1G8PA 3PNYA 2JGNA 1CY8A 3HGMA 3KKMA 4E07A 1KFJB 4XLZA 1K89A 3M1LA 4IJUA 4E1VA 4PR3A 2ZJ7A 1NHGA 3UGKA 3FI0A 5I9SA 4AM8A 1HDCA 4CLEA 2JD2A 1IHYA 4HUTA 4H4DA 3GCDA 4M6WA 3CSUA 4EGCB 4YCSA 4X1KA 4DREA 4OXXA 2C96A 5BSHA 1H69A 3E5NA 4HZGA 3LOPA 5BSGA 3FYHA 2E85A 4DV5B 4FS3A 1ZIDA 3M0EA 4ETWA 1X0XA 4J1TA 2O20A 3AHJA 2RHHA 5A3JA 3HLKA 4DWOA 4TXLA 2W2QA 3I2YX 1CYEA 1VE6A 1B6TA 3DZJA 5UKDA 4WESB 1GG2A 3COWA 3BWYA 1K8ZB 1P62B 2P2DA 2Q3HA 2EYQA 2P7IA 1DKRA 2ZIXA 3EXAA 3IUSA 3B13B 4Y2PA 3AM3A 4DJ5X 3OWHA 3PGLA 3Q4GA 1VBFA 1ONBA 4ML3A 4Y6QA 1I1QB 4V0MA 3ZBQA 2W2KB 2HSJA 3CZ5A 3ZHCA 2JF0A 4BO0A 3NP9A 4QBFA 2GCIA 5ERGB 6CHYA 1KAOA 1RDFA 3AVTA 1PSZA 4JWTA 4PN3A 3LT5A 4EGFA 3R75A 2TRSB 1CW2B 3PLNA 2I3DA 1QF7A 3DQZA 2HO4A 1X7ZA 5AM3A 1B6GA 2VSYA 4R9NA 1WUHS 1KI2A 4RKYA 1U1CA 2PKQO 4UAUA 2QAJA 5AJTA 1DZ3A 5DSZA 1D3AA 3OX1A 2IHYA 3AESA 1EFVA 1U4SA 4LHWA 4PX3A 2ZUBA 4ZVUA 2FE4A 3W78A 1PQWA 4A8JB 4HX5A 5CJJA 4FR5A 1UBMS 4FFRA 4RD1A 3ESRA 4BJHB 2N47A 4IHJA 3ZCSA 3AH8A 4KRGA 4ZZ0A 5AVWA 1RRMA 4BCCA 2BGIA 1PYGA 2IYEA 2QP9X 2WTBA 1RRGA 4DLVA 5AM1A 3AFMA 3GDWA 3BN3A 3NTQA 4ID9A 1FFSA 2C2OA 5AKJA 3BX1A 3DW3X 3TR5A 2XJ4A 1DAHA 1JYFA 1GGHA 2H5JA 2FZGA 3WRXA 2F6RA 4RLQA 2WE7A 1AZLA 4MV4A 1YSCA 1B0ZA 3QKSB 1GV1A 1KIFA 1YJXA 3A28A 3YASA 3CZPA 5KNBA 2H1OA 3BT7A 3U4MA 4QNNA 4AZWA 2Q9BA 1QGDA 4UNQA 5FL7A 4W5QA 2DT5A 3A4NA 1UZAA 4K03A 1V7PC 4LRUA 4YRJA 1M3SA 1QHHA 2XUPA 1FLDA 3BWEA 2QYOA 1G60A 3L7CA 4GPAA 3UHJA 5GIPE 1EZZA 3OUZA 2AT1A 1HFJA 5AFSA 1WPGA 2ODWA 4AUKA 1YZVA 2OQVA 1A9PA 1NPDA 5F3WB 1O96A 1I10A 1NKSA 4ZCPA 3HYTA 3CG0A 2VOJA 3OQNA 1F1JA 5G1PA 2A9OA 3KZNA 5HGXA 2F4NA 1Y3HA 1L0BA 4G8DA 1DJOA 2GBCA 4Q7LA 3I30X 1P7ZA 4MUFA 3BGDA 3JAWB 4KQ2A 4R68A 5B7QA 1CUGA 3DB2A 4L85A 3VPSA 3FETA 3PNVA 1SUWA 2KWIA 1U7UA 4XUGB 5T6BA 3BDIA 4P7BA 4A10A 1IZZA 2WG1A 1H6BA 1NVBA 5KWSA 1NBMA 3LXMA 1NX9A 3MYYA 4AWXA 1Q7CA 3ST7A 2R68A 2KHZA 3I9LA 4GI1A 1J21A 1RMTA 4UXIA 3LD9A 3BB3A 4MQMA 5JLAA 4OLBA 5ALQA 1EINA 3CQ9A 3QSYA 5C8YB 4L4ZA 5FX2A 4OXYA 3DHEA 5A3QA 2VSNA 1NW8A 5U1PA 2MSCB 4I3GA 4V39A 5LOVF 2PKRA 2OWEA 1T9BA 1WCWA 2OV1A 3HI6A 1NXVA 5JEDA 3INNA 2D1SA 3AG5A 1FVHA 3VC7A 3TDMA 2RB5A 4FEYA 4N5NA 2DFTA 5J2UF 5C34B 3FSGA 2JFOA 2WU1A 3PDIB 4G1EB 2HNKA 2EQBA 3JQ9C 1R8QA 4NJEB 5G02A 2FN9A 3Q8LA 2AJ8A 1KK0A 3CX8A 3KLOA 1RYFA 3L0OA 4K6OA 2D62A 5T4EA 5GTDA 3GFRA 4KIUA 1CUCA 2RHTA 4MR7B 2DVMA 1RWKA 1PEAA 1PL7A 1UQUA 2AH5A 3K6KA 1JSLA 1LQUA 5DCYA 2BI4A 2VVTA 2BGWA 1JZTA