3KTFA

Structure of the n-terminal brct domain of human microcephalin (mcph1).
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
97
structure length
97
Chain Sequence
AAPILKDVVAYVEVWSSNGTENYSKTFTTQLVDMGAKVSKTFNKQVTHVIFKDGYQSTWDKAQKRGVKLVSVLWVEKCRTAGAHIDESLFPAANMNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords Microcephalin
publication title Structure of N-terminal BRCT domain of human microcephalin (MCPH1)
rcsb
source organism Homo sapiens
total genus 31
structure length 97
sequence length 97
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12738 PTCB-BRCT twin BRCT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 3ktfA00
2INGX 3PD7A 3I0NA 3K0HA 2COEA 3PA6A 3PXDA 3K05A 4OFBA 3II6X 3KTFA 3QVGA 1IMOA 1L0BA 4Y2GA 3L40A 4XPZA 3PC8C 2D8MA 2DUNA 2L42A 3SHVA 2WT8A 3EF0A 1N5OX 1IN1A 1KZYC 3PC8A 1JNXX 3UEOA 5ECGC 2EBWA 3K15A 1WF6A 1Z56C 3PXEA 2LE0A 2VXCA 1T15A 1T2VA 3K0KA 3AL3A 3T7KA 2K6GA 4U4AA 3UENA 1L7BA 2COUA 2NTEA 3JVEA 1T29A 1OQAA 4IGKA 2XNKA 3T1NA 2EP8A 2VXBA 2ADOA 3PXAA 4JLUA 3T7JA 3PXBA 2AZMA 3HUEA 4N40A 2ETXA 2R1ZA 2E2WA 2COKA 3COJA 3AL2A 4ID3A 1T2UA 4BU0A 3K16A 4BMDA 2HTFA 2EBUA 3U3ZA 4IFIA 3T7IA 2K7FA 4BU1A 3I0MA 2M2IA 1GZHB 3QVGB 3L41A 3OLCX 4XQ0A 2JW5A 3HUFA 3EF1A 2XNHA 3PC7A 3SQDA 4BMCA 3PC6A 4Y18A 3PXCX 3L46A 3SHTA 3FA2A 3SZMA 1CDZA 1Y98A
chains in the Genus database with same CATH superfamily
5B3JA 1JR3A 3LFTA 2IBMA 3O8QB 3T8YA 1O0BA 3DBHB 4FC7A 4LJ4A 4QOHA 3PG5A 3DT6A 2L82A 4FP9A 4V3BA 2NU9B 1R6DA 1E79D 2PZMA 1FVFA 3L93A 3P71T 2XMGA 3KAPA 4HQ6A 2LP4Y 3S1LA 1NF2A 2O8BA 4CT4B 5ARDA 3VR1A 4XRGA 2GPWA 2RHRA 4I50B 1VSUA 2VTVA 3RU3A 2OOKA 2AMJA 1FB5A 3PWTA 3MWFA 1PJBA 3I2JA 2BEUA 2H9IA 2NO4A 1WM1A 3FVRA 3W3AA 5AW1A 1OFIA 4M0FA 2WK1A 4NFYA 4ZQEA 1EUYA 2QRGA 1D6SA 4OJKA 1FTSA 4Q9HA 4QPPA 3OM8A 3SEQA 4IIYA 4YJGB 5HIKA 4ZVRA 2ZYSA 1X9HA 2X3FA 4JI6B 2X4DA 4D46A 1WXDA 1KI4A 2GESA 2O2DA 2PFKA 2CBZA 3SQMA 3NC0C 3I5UA 4WZBE 4HOYA 4EVIA 4DR5B 3UFXB 3RAGA 3NMUF 1VPDA 1YTLA 4JP2A 2QNRA 4HCJA 4MRMB 4CIWA 3Q8KA 1FW6A 3SXJA 5IKPA 2G08A 3K9WA 5J47A 3NWBA 1R12A 2B0CA 3PFBA 1V7QA 5K8CA 3AESB 4RYDA 3HFJA 5DYGA 1NM5C 1NL3A 2CNDA 3NTRA 4KCGA 4BVGA 1SVSA 3QY0A 1P7PA 4IHJA 4RU1A 1LCIA 5CLGA 3USES 2QE7D 2QMEA 4RW0A 1V7PC 2C42A 5KB3A 3HZHA 1E2UA 1KJQA 4RA9A 2FAXA 5KWJA 1YAJA 5FOTA 3I6BA 5A4FS 3L7LA 3BK7A 1T4CA 3W2HA 4P31A 1GRCA 3GLHA 5TRTA 3EDQA 1Y5NA 4H3KB 3T5TA 3IA2A 2PD3A 2BMAA 2JFUA 4CF6A 1S3FA 2GZSA 2O57A 3AL2A 3D0OA 3FCXA 3JS5A 4PHHA 4Z2AA 1XZHA 2ORIA 2VNHA 4Y2HA 3VDXA 1DELA 2ZIXA 3M1LA 3MF4A 1ACMA 2WVJA 1HURA 3WB1A 4CKXA 4RK5A 4BQQA 3IRVA 2WJ4A 5FLXA 2XJ9A 1MVNA 2AGVA 3D4BA 4MHOA 1T9ZA 2AMYA 5SYAA 1BRTA 3GLRA 2EF0A 1ZVJA 2GN9A 3MCVA 4Q93A 3VYSB 5KS2A 3VAAA 3TRDA 3DF9A 1NP3A 5T6BA 3LBFA 1U0TA 3PCRB 4EVRA 2IHKA 4X71A 3UHFA 4C2BA 2DUJA 2BP7B 3BRSA 3T4XA 2RGAA 2AQ8A 1F8FA 4F56A 2B7BA 2O7RA 4R9SA 1AC5A 4YAJA 1IWOA 3KXIA 2JCXA 5CEJA 2B98A 2FNAA 2W2KB 5HJ5A 3KB6A 4D9EA 1JR3E 3T38A 1KVUA 1QGDA 5A62A 3AIKA 3NHSA 2V7XA 4PLHA 1WP9A 2GK3A 3FA2A 3HKDA 4D81A 5CW1A 5EMKA 3QVJA 1EWYA 5BSGA 1G55A 1M5TA 1NBWB 2OFXA 2REOA 3DOFA 4RESA 1K92A 5IZCA 3PX3A 3KTOA 1KP9A 1ODCA 3KSMA 3UT5B 4ZKDA 5GM1A 1RLMA 4P58A 1SUIA 1SOAA 3IS3A 4JLNA 3J7AC 2XQFA 3JZFA 4RKQA 3CR3C 3D7MA 3PUIA 1EG7A 1L7PA 4XM2A 1JAYA 4B2YA 3RADC 2W6JD 5KYXA 1ABBA 4E09A 4B3MB 2GCGA 1VJ1A 3K0CA 1KI7A 1DTSA 3FAKA 3F3YA 2P6MA 4LFBB 2K4MA 3NHKA 5JLAA 3TKYA 1HQYE 1EXWA 3CX3A 4Y6OA 1SXHA 5AHRA 3L6EA 1Q21A 2UVDA 1MRSA 2FUEA 4LC0A 1ZLYA 3V4SA 5FTMA 3DJYA 3EDRA 1C81A 4K46A 1DAFA 3VNBA 2XGSA 2G67A 2K87A 4QNRA 4AUMA 4B3JA 4CKEA 1KZYC 3OT1A 5AVOA 2J59A 3IBYA 2Y2VA 1RE0A 3SIRA 3ADDA 4UUAA 2IP1A 1MV5A 2VK4A 3M2PA 1HE4A 1ZP6A 4JQCA 4M76B 4A8HA 4DXDA 5BN1A 4Q19A 3V6LA 2PAFA 4YALA 1C7RA 1S2MA 3FMIA 2J4DA 4P2GA 5AJVB 1QWOA 1R1DA 1VCIA 2CYBA 3RJ5A 4N6OA 1KY4A 1YB5A 2QTMA 1Y3BE 4JB3A 5G1NA 5K3FB 4Z4IA 4RGYA 4Y2TA 4D4HA 1A5SB 1T9AA 2N1BA 4F96A 5BRAA 5D85A 3WJ2A 4XQGA 5BV8A 2PUEA 3ZGXA 1P8JA 4ZIRB 1UPXA 3AF5A 3DHEA 1WAMA 3CY6A 2E87A 2J67A 4IRUB 4WRRA 3E5RA 2BAGA 1U7PA 4NMLA 1B3RA 1HZZA 2W6JA 4WADA 4HZGA 5ESXA 1KEEB 3Q87B 5TJHA 3L06A 3GLHE 2VJYA 1EBFA 2AKEA 1SRQA 1EBBA 1PUIA 1B42A 1VXOA 4EVQA 4CM4B 1S3IA 2V45A 1F12A 4FI3F 1IXKA 1PFYA 2CCKA 4AJ2A 1JN0A 3NWOA 4ENWA 5LQCA 1R3DA 2IL1A 3IP6A 1PJAA 1BTOA 1A9TA 3KB1A 1BX0A 3JATB 2QRVA 3K4QA 3KLNA 1ODIA 4COOA 4QVIA 4Q1DA 2ZPUA 9MHTA 2Z3VA 3T0FA 1X94A 2G36A 4Q9LA 4YMVA 1GAXA 2JCBA 3GW8A 4YRNA 3LZ6A 4R69A 1ZL2A 3UAYA 3UKDA 4IJVA 4IIJA 2WSMA 3GRRA 2DPYA 1PJLA 1JFFB 1Y4DE 1S2OA 3GLVA 2RH5A 4I66A 1A9SA 1T2UA 5EHGA 3T3HA 1T5HX 4D79A 2GYVA 3KCNA 2NN3C 4Z54A 1RKXA 2H2WA 5SY6A 3K16A 3NASA 2DR2A 1P77A 2BMWA 2DR0A 3B5JA 3SZUA 1U2EA 3O1JC 3PQ7A 4HQFA 2Y1WA 3SKXA 1P2BA 1VOTA 3VISA 1ULSA 3I6ZA 4CQMB 4RCZA 2OUIA 1ZW6A 2UYOA 3TI9A 2Q2VA 4BFUA 1T5DX 3QYJA 4F2DA 3K8QA 4KVAA 4OAPA 3NHRA 4ZRNA 3OLCX 5GOTA 5DK4A 3PNVA 3KKNA 4DR7B 5T8KA 3Q0IA 5BUZA 4OA8A 4XJTA 4EI2A 4HNSA 2MWMA 4JJ4A 3M3PA 2IBSA 3O84A 3K9GA 2YX1A 1UMCA 4RFLA 4C03A 1PQWA 2DH6A 4AO6A 1IZ7A 1W581 1Z4MA 3VV2A 2DYKA 2HA3A 1LFDB 4JCCA 4C21A 4EHBA 3QEBZ 2D0IA 3MGKA 1KYTA 3B9PA 2HSDA 2FEAA 1FS4A 1QZTA 4BOYA 4X8HA 1KFCB 3KE9A 5A4MS 3AVQA 2ZW9A 4G1EB 5TEWA 4BVHA 4MVWA 1PFQA 3TVDA 2ZT5A 4FNMA 5T4EA 2NO9A 4F71A 2OD7A 4E5PA 4NBUA 2WYIA 4JOCA 3UJNA 4OHUA 4U7PB 4Z99A 2JLZA 2P77A 3BYZA 4R81A 2ZB2A 1Z6PA 1PGQA 3JALA 4KLAA 3EIUA 4DJJA 3JAMA 1LPSA 2YHUA 1DT3A 1QDEA 3FPEA 4KAFA 2XUFA 4UW9A 2FPIB 1DC7A 4HS4A 3INTA 3RHSA 2BC9A 4ETNA 1PVDA 2QLTA 2WVAA 2P90A 4TVOA 3NOQA 1RYNA 1MQAA 2NV6A 5LKRA 2RAUA 3RV3A 4HWSA 4QAJA 2C5GA 1IZ0A 4YAKA 1D2HA 4AJEA 4ABTA 4V38A 2QQ5A 4ND7A 1JXMA 5CXXA 3JPYA 4TSFD 4U2FA 4FN4A 1S9HA 1XROA 2H1RA 1X0VA 3F4BA 1MJNA 5F78A 4GE0A 3V4VB 4EI7A 7MHTA 3VZBA 4CM1A 2VDQB 2O8DB 1P5ZB 1CZLA 1JHOA 3E3AA 4EGJA 4EFNA 3PGVA 2BM8A 4BRZA 1P9NA 4DFDA 3CNQS 2FR8A 2A84A 1N0IA 2P5UA 1DKOA 1G5QA 2ANBA 3QEMA 1INLA 5G4KB 4XWOA 1VQ1A 3ZDFA 5AUPB 1CR1A 1JG1A 4OQLA 4LSGA 3ZLUA 5IYZA 1ZRMA 1ZM9A 5FNZA 5LA6F 1EUDA 2IOFK 1TJ5A 1TVEA 4OHKA 2RGCA 2BHSA 4P35A 3EQ7A 3ZU4A 4EY5A 3IO5A 2X7XA 3R9KA 5IJXA 2QL5A 4BO0A 2ZIAA 3SCZA 1T9CA 1FL9A 1NXSA 1ZITA 4GI2A 3Q4GA 4P5PA 3WYDA 5FV7A 1Z68A 4ZT4A 4H15A 4BVFA 5KU7A 4TL6A 3VJLA 5JVDB 3FMGA 3CEJA 4KWCA 2UYCA 1KBOA 5FFFA 4MR7B 1NF8A 2XMRA 4RD4A 4EL0A 3L6DA 4ODIA 5EAIA 4LVUA 2PXXA 5TF4A 1KGSA 4MVJF 3EEFA 2BY4A 3OF3A 1JMVA 2CJXA 4JC0A 3BRQA 3RTAA 3R9XB 5BORA 1U99A 3TIIA 1K8XB 3LGSA 4HAIA 4KSCA 1S2GA 2IS2A 2DPHA 2PJDA 4L8LA 4ZVLA 2GA8A 1NI3A 2HIMA 5DBOA 3COJA 4ZTUB 3O2NA 3TGWA 1MVOA 2C2GA 4OYYA 4DV1B 1ZR4A 1SMKA 5F9HA 4XD7D 5AKZA 1M5RA 1DJOA 2FX3A 3KOMA 4NARA 3KALA 2CDCA 2MYTA 3RSOA 1HFJA 2CSXA 4TS9A 1M7GA 3QFFA 4X90A 4KB5A 3VSCA 4C06A 3RK1A 1WD7A 2UUOA 5K0JA 3VR3D 1E5TA 1YGPA 1Z83A 3OP4A 3IGFA 4HG2A 2OILA 5F3RA 4ARCA 4X60A 5EUMA 3DYBA 4HWKA 4ZU1X 4RQAA 4U0KA 1KIFA 5B4VA 4F6RB 1ZCZA 2YXLA 1EGQA 1QXSA 4QD3A 2PUAA 2YZNA 1FRNA 3PC4A 1I0LA 4LMPA 5GOZA 2HLDD 4MICA 1ZS9A 2PFSA 3VBEA 4OYRA 2HXGA 2GOYA 1RKUA 2VA9A 5D7BA 2HQ1A 3TLBA 3OZUA 1SCIA 5AVZA 4Q6WA 3M34A 3BICA 1JQJC 2R5NA 4Q48A 4G0MA 1MZPA 1JIKA 3BS4A 3E61A 2WM3A 2CHQA 1FYWA 1M8JA 3BH7A 5CT6A 5BXYA 1N7JA 1ZC4A 2Z4TA 4CQNA 3QEAZ 4XD7A 4Q3LA 5JJCA 2HY7A 4K6CA 3CPSA 4Z8YA 4RD6A 4Y2PA 2R85A 4O4HF 4ZT2A 1LQUA 4BPBA 3ANYB 3A6GA 4LDAA 4DV0B 2WI8A 1RBYA 2QM8A 4ZODA 5DHTA 2RBGA 5FOQA 3HXQA 4JUAA 3MRVA 3M49A 2ZYVX 1GCIA 2E5FA 3OJEA 3R7WA 2B34A 4BLPA 3RKUA 4KIJA 4Q4CA 1TM2A 3OM1A 2R79A 2QF7A 1YI1A 1M34E 2ONZA 2Y3IA 1RQ2A 4XPIB 5F35A 1JEOA 1R8YA 1QFSA 4XD2A 4JT8A 2XZOA 1C41A 3KT0A 2VP6A 3ZI7A 5BSKA 1QBGA 1SQ6A 2AOUB 2XA2A 3CVJA 3EFOB 2BWJA 3IKLA 2M9MA 4RS4A 5CXQA 5ITSA 4OCZA 3MTIA 1PP4A 4B32A 1NRWA 1DWUA 1PWXA 1MEOA 1TTHA 4C7OB 1XGKA 2GZHA 1UBOS 4LC9A 2HA6A 2LR0A 4KRGA 3S8EA 3L8CA 2G0AA 1OI7A 5E6UA 1B00A 4K9RA 1E3WA 3M6WA 1K6EA 2O19A 1ULUA 2ATVA 4L2IA 4WESA 4MGIR 4MPRA 3A0UA 1MQSA 2J9YB 2AC2A 1ZDMA 1U4OA 4UPVA 2XYHA 4E7OA 2F62A 4OUDA 3W0LB 4Y9UA 2G8LA 3HWSA 3RI3A 1P8AA 2PT5A 3TRIA 2IZ6A 1R0RE 4R9RA 3V1MA 3W04A 1W2GA 3P19A 2L19A 1FZTA 5E7IA 1FX0A 3B7WA 2X0EA 2K5UA 4JBXA 2MMGA 2Z5FA 2XNDA 4IDGA 4XOUA 4RV4A 1SNYA 2OV2A 4YJ3A 5F2NA 2WF6A 3F3SA 3HB9A 3SZOA 1WEHA 2GXUA 1EHYA 1N5MA 1KYXA 2C97A 1I2DA 1BHJA 2QN1A 2H92A 2UZ0A 3JQQA 1K63A 3V55A 2GN8A 4D98A 1FTYA 1NW9B 3OC6A 3VR4D 4IG9A 1H3NA 2JVIA 1BGVA 4QQNA 1AMNA 2W2MA 4NEGA 4Y2JA 1UBCA 1P80A 1R37A 3ACCA 3TEMA 1EDOA 2A59A 3K9HA 1FMJA 3Q7RA 4B82A 5DM60 1JJVA 1P1HA 2FN9A 1ZNXA 4FFMA 4CG0A 3RYFB 1SURA 5GWXA 3P27A 1DFHA 1XEFA 1EFDN 1RDFA 2P65A 2ZSBA 2WD7B 3URKA 3Q2KA 1DADA 3FSGA 4UU0A 1IEXA 4WLNA 3QLUC 2FEOA 3JQAB 2WR8A 4AZVA 5JD4A 1BCSA 2A0WA 3SQWA 4FWTA 3E2PA 2I2WA 5AKJA 4FSHA 3SQDA 4C0BA 3MOSA 1EDEA 3FFBA 4GNKA 3AKCA 4G56A 4PSAA 2QZSA 1WKVA 1C1YA 4RHFA 3RVBA 4JBWA 4EJ0A 4ZEMA 1J2RA 1XFDA 1QTRA 5B1EA 1K68A 3QVLA 2YZ2A 3BDIA 1PLJA 4QZVA 2PR2A 3FBGA 4HTAA 1YQEA 4CMJA 3ASZA 4I55B 3AP3A 2PWPA 3VR4A 2FX5A 5JPIA 4CVNA 4DBLE 5FFMA 2AMLA 3MELA 2Y77A 3OCVA 1RWWA 2CNBA 2XYGA 4G4SO 1W1WA 3D0RA 4HB2A 2FP4B 2X2FA 5T7BA 1ESEA 2PUTA 2FN8A 4Y2GA 3QWIA 1XTSA 2QU7A 3H1EA 3ZV3A 3GJZA 1WY7A 2GAIA 4OTZA 2FV8A 4LXUA 1KR2A 1NP7A 4YFVA 1VM6A 2JHFA 3CRRA 4I4IA 1RQNA 1V35A 2Q7OE 1FSFA 2W22A 3OZEA 2ZU6A 1VBMA 3W2IA 3ZVMA 2PH3A 5IVHA 1G19A 3RSSA 1SHTX 3WIDA 2VDVE 1OXUA 4FQ8A 3ROXA 5GVRA 3I2FA 4UQOA 1PSDA 3DMTC 4BKPA 4EGAA 5J5CA 1K86A 2Z4SA 5ICSA 4DR1B 3OY7A 3SIXA 2BFWA 2YHAA 3UBMA 2X9GA 4IINA 1DG9A 1SB8A 2DECA 3U39A 3O26A 3GEMA 3MWGA 3QBJA 1ZIYA 3DMTA 1ZO8A 5F2OA 1ZM2A 3BAZA 2QT9A 4DXAA 3DFZA 4GI7A 4JBYA 5A02A 1U8XX 1TM1E 5FULA 3H0KA 3IJRA 1C80A 4AX4A 2QVYX 4HS9A 4R1OA 1JTVA 2AOWA 2TMYA 3KJZA 3U80A 1JLRA 1PJ3A 2QLBA 1J2EA 4IX1A 3E4DA 4U2EA 2PVSA 5H59A 1C9MA 4RZ3A 4JT2A 2WIKA 2H7CA 3OHMA 4QBGB 3VQTA 2OVFA 1C9KA 1NPYA 1WNFA 1C9EA 3HL4A 3GO4A 4XVUA 1IBKB 1F7VA 3F5SA 2H52A 4IIVA 4R51A 4BRUA 3U17A 3TZKA 4OATA 1D6MA 3CH6A 5F33A 5TSDA 2B8JA 1MIOB 5D3MB 1UIMA 3U4GA 3HACA 1QU3A 1ODTC 2P3OA 1Z38A 2VTEA 2YVLA 4RF4A 1J7KA 3IP9A 3LBHA 2FEMA 3JW8A 3THRA 2QENA 4ZC1A 1QZXA 3CT6A 4R5MA 1TT7A 3FFWA 3GB9A 1ISMA 3X1XA 4DJDC 5BSVA 5FF9A 4JYAB 1ZBDA 1N8SA 4OG2A 3LC2O 3Q1KA 4LX0A 4JJKA 3AL0C 3GLFE 2XY4A 2ARKA 4CYMA 3JVVA 2ZYDA 2X4LA 4RYLA 2FPMA 2X5KO 3GPCA 2B7LA 4OI0A 2WP8J 3OUTA 4WECA 3PTZA 1M1YB 4HQRA 1XPUA 1M83A 3MGCA 4NOJA 3ABRB 4X95A 1Z17A 4GBED 1JSRA 2PYZA 3LUPA 1NLYA 4GM1A 4OXRA 4NCBA 3ZZ0A 1YS9A 4PBSA 5CXSA 1P2VA 4LJ5A 4PONA 4RC9A 1PGOA 3EC1A 3PITA 5HG0A 3SXUB 6Q21A 5CTJA 4YCJA 1L1QA 1YC5A 2V6IA 1YE8A 2R9VA 2ZBFA 3P9RA 4QX6A 4BN5A 3DBVO 3JASB 4WKCA 2LCQA 3RIGA 4DVJA 4Y2YA 1KZ7B 1I4EB 1P7VA 3TAUA 1RM3A 1DSSG 4NCNA 3TBFA 4RA6A 5K8VA 4KUGA 2ZPAA 2CL7X 3Q9SA 4QQKA 3AP1A 2JBAA 3W34A 1CNFA 4AUEA 3M6MD 5CA1F 4RSGA 3DW3X 2QX6A 2QGFA 4L3VA 4K0RA 1TXGA 2CW5A 3ECAA 4KQHA 2YFYA 1RRPA 3IV7A 5FOWA 2JFWA 3UJ8A 3VU0A 5KKCA 1LI7A 2C9CA 4IDAA 5FI5A 5FEMA 2QIPA 1N77A 2XEXA 2ZRKA 3FFAA 3HRKA 4G1MB 3UIEA 3PR1A 2VCYA 2F6RA 2BGJA 3BIFA 2VDOB 3M33A 1C8VB 1YFKA 3FH0A 3IR6A 1PTJA 2F7SA 1JPVA 5H70A 4UARA 3ROFA 4ACAA 2X41A 2VAXA 3H1BA 5BO5A 3M0EA 1RLOA 2LGJA 5LSAA 4I46A 3DDOA 4LQDA 4EUEA 3GRYA 4IJMA 3PXUA 5IKEA 3CNOA 2I8CA 5LOVB 1RFLA 4ZRDA 4MQEA 2BOVA 2F00A 2XVYA 2OAEA 5SY9A 3EGDB 3V5NA 4DUYB 3THYA 1FBNA 4JKYA 3WNCA 4HQKA 3UGQA 3IX7A 3CLTD 1Y8RB 1O5IA 3K15A 3S28A 3VO1A 4DIEA 1NBIA 4R71A 3OJLA 3OIGA 1O95A 5BOSB 2X8JA 5CP8A 3T9AA 2GUWA 1JDJA 3MT0A 4BFLA 5BWMA 3D3WB 2AKAB 4HI0E 2VDUE 5A6SB 4A6PA 1S02A 4W63A 1Y5RA 1KXZA 5CITA 5DN9A 4HMQA 2QTFA 4K7JA 2GRUA 3MTEA 1LRLA 3CSSA 3OAAA 3NBQA 1JHYA 1IY9A 2EX0A 2IZ7A 2FSVC 4LNUA 3KJFA 3TIGA 1FFWA 4GWGA 1AGNA 4YRSA 4UCXA 3S2SA 3A9CA 2JHAA 1BN6A 3DHNA 1VFNA 5E0OA 5H8WA 1H5UA 1QZ3A 1P29A 4EA7A 3ROKA 3DZBA 1RPAA 1GTG1 5JPDA 1WUIS 2WP0A 1PJSA 5KAPA 4M2LA 3RR2A 2VOJA 1JDBC 4L85A 2DFNA 4YP1A 2BV3A 3L02A 3IP3A 3ZR4B 2RAPA 3IDZA 5C1OA 3DO6A 3UMJA 2CD9A 4N5DA 1CUWA 1K4KA 3WYNA 4F2WA 1LBSA 4IQ0A 4KJXA 4FOOA 2CVQA 4FYYA 4H16A 1DBPA 5HKBA 1ZGZA 2R60A 3TB4A 1GCAA 4Y9SA 1H8HD 3QUQA 4NJEB 4ZAFA 4JB0A 1A98A 1DL5A 1QFMA 3GWZA 3ESRA 1NONA 4LOAA 3EVDA 5BSHA 1O6BA 2DCMA 3G49A 3RVMA 2IFTA 1Q0ZA 2FRXA 3K5HA 2YR0A 3OT5A 2GZRA 3EIOA 3A1EA 2JK0A 3R3JA 4RVUA 1EIWA 5CEEA 4V24A 2PLFA 3F6EX 3QKIA 4M55A 2CMHA 4IGFA 3JWGA 1FSSA 3HI4A 4XWAA 1DXQA 1T8PA 2C5FA 2P1RA 1E1NA 1IMJA 2VJMB 1UOEA 1DAIA 4AJPA 5JXWA 1DINA 1WBJB 1JJ7A 2GD2A 5AKKA 3G9QA 3I9V1 3WLOA 2XV1A 1ONSA 4K26A 4L4SA 4UDNA 1PK7A 3EQZA 4M37A 4GWLA 4ZCPA 1FRQA 2FPOA 3KZOA 3LSYA 3IH5A 3TW6A 1EUCA 2XE7A 4RTSA 2UUAB 4PGMA 5EESA 3KHKA 3T1VA 2DKOA 1TW2A 1N5IA 4PVCA 2O1XA 4RVFA 3DO8A 3REQA 1YFLA 1H8HA 2J45A 5EZSA 1QRTA 2O8CB 3W7VA 1FUEA 5JBNA 1A9ZA 4B4OA 4ZK2A 4R7TA 1RYHA 5H9VA 5TPZD 2HFKA 3OKCA 4UUNA 1GA6A 5H80A 3A1FA 4AKIA 3ANTA 4CEJA 5ALTA 3TD9A 1P2FA 4C2TA 4RANA 4F5EA 5EUQB 1B4DA 5ITZA 2ZBRA 3QYPA 1M6HA 2Z6QA 1W5TA 3EXIA 1AKVA 3FGOA 2WZCA 3FXAA 2PZKA 4I8XA 3BCUA 2OB1A 2PV7A 4IXMA 1E32A 4QU9A 1BU5A 2PZGA 5FKJA 4D9KA 4U8HA 4DSZA 4W6QA 3KWLA 3L8DA 1KAOA 4ZVQA 3AF6A 1QTIA 2NO0A 4RZHA 1BDIA 3CZRA 3OCCA 1Y6JA 5KMGA 1XZGA 3CEMA 3E5HA 4IKOA 4D4LA 2OCKA 1M74A 1PJRA 1EPUA 3E2IA 4OB8A 1VE1A 3L7BA 2ZVJA 4O6VA 2XCOA 3WGQA 2J0UB 2VP5A 3GLTA 1D3AA 3PENA 1OTHA 2A94A 2XDAA 3K09C 4GVLA 4UUPA 5B4UA 5K99A 5CHEA 4DXHA 1TZJA 1P2SA 3T7KA 3G13A 3O8QA 4PG4A 1KY2A 3DBHA 2K6GA 4JC8A 5I4KA 1XRSB 1UJ6A 4QBHA 2NU9A 3GLKA 3MYRA 2ZRBA 1D07A 4FJ0A 4RZ2A 1N6LA 4PQRA 3PPWA 3A06A 3QX9A 3G2JA 4L4RA 3U81A 1XNJA 5P8WA 4I50A 5E9WA 5BNWA 5EJ7A 4ZHQB 3HU5A 2J3EA 5EE3A 4RJLA 1CIPA 3B36A 2WSIA 3ITDA 3LJKA 4HDQB 1XZDA 2VDKB 3H04A 1FK8A 3L04A 2XQIA 4CIXA 1ZOSA 4BIIA 4F8YA 5JRJA 1WB6A 3Q85A 1XDDA 4OGLA 3MRTA 4QSMA 3N7TA 2O2SA 2JFFA 4ZQBA 3S3TA 3ZGOA 4P80A 1BMFD 1I4OA 1DQZA 1OAKA 3G5UA 4FGWA 4RKEA 3T7JA 3U37A 1XMPA 2RH4A 1AH2A 4YJGA 2KLHA 2HU5A 5LZ8A 4F1WA 2VQEB 3MCUA 2C9BA 3DVRX 1VFPA 4ESVA 1LK7A 3D3QA 3LDFA 5L95A 1O08A 1RHKA 1FCJA 1XCLA 1ADBA 3IQWA 4UHEA 4XUGB 4AN1A 4GL2A 2HWXA 3NATA 3DT9A 2PRZA 3UFXA 3NM4A 1RLJA 1POWA 3CF0A 4MRMA 3D5TA 2YZMA 1RQGA 2O8NA 1H9BA 2QVGA 1R74A 3TW8B 2LV8A 3DHWC 1VPTA 1XQVA 4KDEA 1E98A 5F1YA 4LJ9A 1MX3A 5GPBA 4B40A 2IH5A 2A0FA 3SX4A 1XTKA 1ZGAA 2IZZA 3AESA 4D4GA 2BMFA 3K6KA 1XZAA 2C5SA 1YACA 2W5UA 3C2QA 3EXAA 4YLYA 4Z3OA 1FFYA 1K4YA 4S04A 1JTEA 1VPLA 1WKCA 2KYRA 3C5VA 4YEDA 3QU7A 3UANA 4XFDA 4EJSB 2BL4A 5G2OA 3NDBB 3OQBA 3DCIA 3R5XA 5THKA 2RHDA 4JMLA 1XLTC 3QIAA 3OZGA 1OU4A 3IAEA 3PLNA 5L3ZA 2PKQO 4KL8S 1PWZA 1FQWA 5AXAA 4CG1A 1K5DA 2BJWA 3KQLA 3B82A 3U4HA 1XLTA 2R84A 2YNMD 4RVHA 4O4IF 1GZ4A 1Z5OA 2HH9A 3O1LA 3PYXA 5CVUA 1QRSA 1JALA 4HFNA 1I33A 2C31A 1DHRA 3F8SA 3UMVA 4CLXA 3GP3A 4K0KB 4OXXA 2PS9A 4P6VF 4XDZA 1KZ9A 5DCLA 5GV8A 2GAFA 3ZVKA 2Q41A 1MB2A 2IUYA 3ET5A 3U5TA 5GIPE 2YYAA 4IFTA 1Z8DA 1JFLA 4A5OA 3MINB 3GLGB 3G2IA 3Q9UA 1N36B 3LHFA 3T06B 3BL8A 4UBIA 3WHKA 5L7WA 1DEHA 1DP4A 3ZE9A 3VR2A 2G09A 2PL3A 1KQPA 1W4AA 3EGCA 4DCUA 2HA4A 4FUTA 3C6YA 2VS1A 4NKRA 2GETA 1A5ZA 2DUNA 3GUVA 2BP7A 4ZV7A 3BQNB 2HMSA 3ZXIA 4AY5A 4UBKA 1HQCA 3PHBE 4EMBA 1ULTA 4W5TA 5C51B 1R64A 2P7HA 2VF5X 1XTRA 1M67A 2YRXA 3AGPA 2GAJA 2F1IA 3AR4A 2W2KA 4KZKA 4GGPA 4N0PA 3LXUX 2ES4A 1LX7A 5KDLA 1M1UA 4I5EA 4Z3DA 2Z30A 1QK4A 1VKNA 3PUXA 2J9XB 2AJCA 2WRZA 2CSUA 2OFOA 2EFHB 3O31A 4MWGA 3PNPA 1KJNA 4X1OA 5HZKA 5KNDD 2B9VA 2NUTB 2PH7A 2OTCA 1MR3F 2QMUA 2YNMA 4RPKA 4WOPA 5I9MA 3ROPA 4EZBA 8OHMA 2GRJA 4GVXA 4YT5A 1N5JA 4LY0A 3T12A 2VEDA 1I3KA 3ZE1B 5JMOA 5C31A 3UT5A 3HQ4O 2NQTA 1YGYA 4DBVO 1DOZA 1JIIA 1GU0A 3HRIA 4FZVA 4BMNA 1A04A 4MTCA 2HXYA 3LA6A 4UM9D 4RSMA 2PUVA 4O2RA 1BEZA 1MQ9A 3QQPA 4PX9A 4AL4A 3N74A 1UPAA 5A3VA 4R1UA 5DOZA 5CB0A 1A5AB 3H18A 5JDIC 1R7RA 4PXAA 1S2DA 2EDCA 2OLKA 1X8JA 1FNBA 3TNLA 1D1TA 2VDPB 3ASUA 4YRGA 4Q7JB 1KF0A 2CNNA 3L7KA 2VHZA 3NETA 2QRLA 3EZYA 2XADA 4Q39A 3EY4A 3ADKA 1MB3A 4RY2A 3NDRA 3KX2A 1RZRA 3G2LA 3MJRA 4PCAA 4HLNA 1QHHA 2ZJBA 3JRWA 2WIJA 3HB4X 3QV2A 4I4CA 5KNDA 3PFCA 4CL0A 3UC9A 3CXRA 1VKHA 4DEVA 5EG5A 4BJ5A 3TR6A 1VL8A 4E15A 3GFGA 2EKDA 1ZA1A 4Q9JA 4CMIB 4ZIRA 2AFRA 4M60A 2QPOA 4P3NA 4U9HS 3U26A 3T5AA 2WJWA 3DXFA 3BGDA 1YUMA 2ZJ3A 3EIXA 2NSJA 4GR5A 1RMQA 2G3YA 3OTOB 5JYEA 5G40A 3LUCA 5FO1A 1L8LA 4BFVA 1KEEA 4KVGA 2P78A 5CH5A 2R6HA 3C3DA 2WM2A 1KK1A 1B14A 4PZ0A 4XXHA 1UOQA 2FFJA 2ZUUA 4E94A 2KW5A 2QRKA 3I42A 3ZEAA 3EGOA 3G8YA 5I7AA 3SSAA 3ZC3A 3BTOA 1LF5A 2NOAA 3UWDA 3PFHA 4DDTA 1DBQA 3NUQA 4EX6A 3MOIA 3BE8A 4R1SA 4ZCIA 3KQKA 3JYQA 3NT2A 1J06A 4GPIB 3JATA 4IJWA 4FS8A 5G3YA 1JEQB 3GK3A 3ZJ4A 4KPGA 2J5KA 5KVQA 2ZBUA 4KW7A 3SVZA 3ROMA 1SC4A 4XA8A 1OWOA 5JQWA 4MVJD 5HA5A 3STVA 1CJSA 5JNWA 2EZ9A 4II3A 2I4MA 3KHUA 2CGEA 4IVQA 4O4JA 3RB8A 4FFBB 2IS6A 1SBCA 4H0FA 3IP1A 4H6WA 4ZEWA 3HO6A 4B6PA 1IN4A 4LOLA 2CYAA 2QMOA 1Q7EA 2OV3A 3ONEA 1K7EB 1V6AA 3F2VA 4X45A 4JUIA 2FMKA 1CY6A 3LUBA 4RENA 4I4TB 4ANFA 1PR6A 1C7FA 2JGKA 3G79A 1RM4A 1Y3AA 2D8AA 3QHPA 5F76A 6REQB 2ZVDA 4BBAA 3KVOA 4CQMA 1CJBA 5A3RA 2OAP1 2O2CA 2GPTA 1E9SA 3QXGA 3PT5A 2VWQA 3K0AB 5DRTA 2XQJA 1C7ZA 3O2QB 1JPUA 3R5HA 3W9BA 3E7XA 5KVCA 1J8MF 4RF2A 4LUCA 5IABA 4G81A 4E07A 2J6CA 2O1SA 4MB6A 4QOGA 2A9KA 4EARA 1G17A 3TEJA 3P32A 5IS2A 3WGIA 1N2IA 2OLJA 2ZE7A 4GRDA 3ZXSA 4GUAA 3V4ZA 1TMOA 4QOEA 2CYCA 1KAQA 3SIWA 1OCEA 5IVIA 2EJVA 2WJAA 3HBNA 1JR6A 1I2CA 4R84A 5JADA 5DSTA 1YU6A 4I3FA 4UQLA 2G9NA 2QTNA 3W4JA 3CLSC 1UKZA 1GPJA 1E1RD 4RV9A 1NNLA 3H2SA 3RBXA 4C20A 1L3BA 1OREA 3WLAA 3WGMA 3RVRA 4CR6A 3QOYA 5JBQA 2JGEA 4RNCA 1VPWA 4XW2A 3ZS8A 1U3TA 1MOSA 4NF2A 4B7XA 1PG0A 2QHXA 4EYOA 2FPIA 1HE2A 2WT9A 4FE4A 2AH5A 4G07A 4G5RA 4D57A 1PV2A 3RCBA 2CNWD 4C14A 2PX2A 3AHCA 5IHXA 4B4DA 1CUSA 2M6KA 3K9BA 3TPCA 1RHJA 4N49A 4E2XA 3COPA 2QPLA 3O21A 3A1DA 5EKTA 3GZ4A 4UZFA 2PUBA 1UXJA 7ADHA 1MABB 2V9ZA 1XRRA 3HWWA 3ME5A 3R44A 3N2NA 4FCVA 4ZVVA 3P5SA 3INRA 1F17A 3RVSA 4EY7A 2ZK7A 2E85A 2RARA 1TYDE 1AQUA 1ZW1A 4OHRA 3M9XA 1QZUA 4LK2A 4QBFA 2O8DA 2YV1A 3BEOA 3QVXA 5BP7A 1M8KA 1P6XA 1SIOA 2W0MA 1G291 1JIQA 2MYUA 4GI3A 3DLHA 1Z6XA 3LU1A 3ZWWA 1TIBA 2QRMA 1GZ6A 1SUCA 1UPBA 3L5OA 3BCSA 2CV2A 3D6NB 5G4KA 3WSWA 4HX2A 3IOBA 2UZ1B 4UDOA 4DHEA 5D2CA 2D59A 3ZHOA 1KO5A 1VSBA 3OOEA 4GVPA 3WGGA 4C1NA 2R96A 1W85B 4E2WA 5BYBA 4E4YA 1OHHA 1KDTA 2QUHA 3I04A 1IBSA 1R0LA 1NR5A 2CXNA 4BS9A 4CEHB 1OBOA 4Y3UA 2XIJA 4AIRA 1UJMA 3IAUA 3LLVA 3ZUPA 2VBIA 5EIWA 1A7UA 3FKJA 4BP8A 4ALJA 1U2PA 1Y4ZA 3TGLA 3IIIA 3NBYC 3FROA 4WIAA 3TSCA 2JVKA 4RAQA 5K3BA 1N8KA 1TKRA 2DFTA 3UV3A 5JVDA 3H9BA 1R0KA 3ZW7A 4MR7A 4EBFA 3D3EA 3C3JA 4RZIA 1SKAA 1Q92A 2ZUVA 1B15A 2V96A 3S99A 4NZPA 1V16A 3TW0A 2CY0A 2FVYA 2JD1A 1T1GA 3I5MA 3PEFA 4M36A 5I7VA 3NVKI 4BHTA 2HJSA 5HBGA 3OEEA 2WLSA 3H65A 4TTQA 3SSOA 4R05A 2EFYA 5AJZA 2IWHA 3TRHA 2Y0CA 2QX4A 1KRHA 2B0JA 2Q9CA 1LLDA 2VYVD 1ZOPA 4JJ6A 4H08A 2PPVA 1W96A 2JLVA 4PQYA 3PGLA 2CMFA 3DNMA 5CAEB 2CL0X 3ESDA 1GQQA 2ZAIA 4XGNA 1VSQA 2HRZA 3R6WA 4KV7A 2GM4A 1B6SA 1BQ4A 1S2IA 2NYUA 4QBIA 4D4MA 2AE2A 1EZ4A 1Q0PA 1FU4A 1UBTS 1T26A 1YZNA 3A9RA 4P84A 4UHHA 3RC2A 4EF5A 3KVNA 3ZW8A 3DA8A 4R2XA 1NATA 1KKUA 5LMNB 3HCAA 4KUEA 1G9SA 4DW8A 1T8SA 1GRNA 1XCMA 4CN8A 1KMIY 3B7PA 1DBSA 2HF7A 4XLLA 4F6RA 5HGXA 1G6OA 4ND3A 4CBVA 3EC2A 2D0OB 4Q1VA 1R9MA 1Z08A 1LVGA 4YJDA 2HU8A 4C2UA 5FL3A 4LXIA 3E03A 4UHKA 4PBRA 4G5YA 4BN4A 4B3TB 3KQMA 1S3GA 4MJXA 1BHO1 1Z4IA 4RVSA 1O4WA 2QI9C 3EEQA 2W70A 4B3CA 4J1TA 4LQ4A 4JGGA 1CERA 2AA3A 4FSDA 3LHKA 4K86A 2WA2A 1V3VA 1S96A 1HDGO 3B3JA 1T0PA 3IBTA 1QVAA 3NALA 4MZXA 4C3OB 1QIEA 3FHJA 2ZUCA 5K4GA 3GJSA 4MVJM 2G25A 1V48A 2X3UA 4XTCS 3GPLA 4QRDA 3I9V6 2P69A 4MUAA 1GARA 2J08A 4IIBA 2VHJA 4TQGA 5AM2A 3ICVA 1Q7CA 4YQEA 1G5TA 1VTKA 1UBJS 2FR0A 2YFHA 3PQ4A 4Z4CA 2CXUA 4YCDA 2JIQA 4ZGBA 5JZBA 2BT4A 2B3TA 3BL5A 2ZSIA 4U7WA 2AMFA 2H2FA 1JDUA 1V45E 1XVVA 4OQZA 5AK4A 3QY9A 1J6UA 3S2ZA 3F7TA 5JECA 2Y1LA 4WK6A 3T0GA 4E5SA 3EPPA 3FCAA 4XPIA 3EB9A 3GJ6A 5I4IA 5J43A 2XBUA 5ALLA 2XMQA 2LW7A 1EVKA 2Z2IA 4Z0NA 3K5WA 4HEHA 4A91A 2AOUA 3O74A 2ZWVA 3EFOA 2C5AA 4XCXA 4LY3A 4R1MA 4B7CA 5ADVA 1T4GA 3ZCUA 5JEEA 3IL2A 1HSZA 5JZ9A 4KXFB 1UAYA 3WRVA 1R5OA 4C7OA 1I5EA 4HYTA 1ZM7A 2C9YA 2NSYA 4OMFG 2NUAB 5DNYB 1MEEA 1QQAA 3R5JA 1JI0A 2BMVA 2O14A 1CEXA 2C5LA 3RF7A 4RQUA 2D1TA 2XXJA 4QARA 4RKRA 3GZNB 1GDTA 2FQWA 5K3CA 1OE0A 2W48A 3E4CA 4GIBA 4I36A 2HJHA 4U39A 5KTPA 4BE9A 2ZIEA 4XSHA 4RVGA 1HI9A 2XMZA 3AV0B 4BAGA 4EIWA 4GKAA 1CQJB 2JW5A 1K7FB 1U8CB 2PZEA 4KQJA 4UHFA 3LQQA 1BJTA 1RTTA 2XNHA 3N8IA 1W5EA 5FYDA 3L8HA 1XCPA 1ORVA 3LQ2A 1ADCA 4NS4A 1DU4A 1BVRA 2QPTA 5BT8A 3P7MA 1H4QA 5JXHA 5FO0A 4M88A 1GKYA 3N58A 2G63A 5C3MA 2X0NA 4GXQA 5TMPA 1U9ZA 3P1JA 3M82A 4NZOA 2P5TB 4YMIA 2R1TB 4UDYX 3AR8A 3BTSA 4IICA 1PEYA 2ZIZA 3I76A 4HD8A 1D6NA 2BELA 4C07A 1M7BA 1UM9B 2EHJA 2OCAA 3SU8A 5T4FA 5GGYA 5CDGA 5EGNA 5J23A 3RYFA 1KDZA 1IUPA 4CM9A 5C5IA 1CX9B 1DCTA 1SU7A 2E49A 2EATA 1X77A 2WD7A 2Z2ZA 4WA8A 2P5YA 1QANA 2XZPA 3B85A 3F9CA 2FUKA 4NENB 1RJFA 3ZTWA 4CDNA 1N5LA 4FINA 5J59A 2IYPA 2H1VA 3ANLA 2B4YA 3QXJA 3MJFA 3H9JA 1Y33E 1PHPA 3UG7A 3NKFA 3IUEA 4HKTA 1GY8A 4N47A 1R3UA 4A6XA 2BFBA 3WNDA 1EU1A 3U48A 3KZ1E 2HAEA 2IF0A 2IIVA 1FTGA 4ZOCA 3TQHA 2OHIA 4TTJA 3L6RA 4ND2A 5E38A 3K31A 3NYIA 2GO1A 3U13A 2VDRB 3IYLW 3WKAA 1Y3HA 4PSCA 1G8JA 2A2ZA 1EFAA 4GGMX 3EW9A 3CNEA 1ELOA 4HXYA 1DQNA 4P8RA 5KYTA 4NPHA 3GLQA 4I55A 4UXIA 4EQ6B 3WWEA 1NZJA 4FBLA 3HYLA 2WAYA 1HETA 1QTNA 4HAZA 4UAGA 2HV9A 4EPRA 4NBKA 1QIHA 4LBWA 3UJ3X 1XB2A 3VNSA 1OH6A 1KYZA 4FFOA 3G5MA 1Y1TA 1YA4A 2FP4A 2QM7A 4ZZ3A 2H17A 1QGED 1KWKA 1HKUA 3A31A 1OZFA 2WIFA 2ZI4A 3P20A 4KYTA 4JR0A 1QIMA 4RM2A 5DN6D 4HGZA 3RYIB 3HSKA 2YIDA 4ZZ1A 1TU4A 2OV6A 1LEHA 1DV2A 1WPXA 1QFYA 3COZA 4MJLA 3WB2A 5KOHB 2R11A 3IAHA 1QLHA 4IO1A 2DY1A 1HTBA 3ABZA 4HN4B 3HYRA 3N7UA 2Y92A 1AF7A 2IEBA 4BNIA 4EFMA 1F9AA 1U9CA 2O3RA 3IJ5A 4NG5A 2A57A 1DJLA 2PRYA 4MB2A 2BYTA 4OGWA 3B1JA 1COWD 1KFEB 2FMXA 3NEPX 4BZPA 5JNRA 2DHQA 3GAZA 1HDRA 3I9FA 3EVZA 3O8BA 2WU4A 4MPPA 5JMPA 2IHTA 2XD4A 1KPHA 1QU2A 1BG6A 3WZ2A 3H84A 5A5FA 5E4YA 4KQ9A 2HD4A 5E0KB 4WLFA 1GG9A 2BFEB 1XELA 2QZZA 4LY6A 1V43A 1OT5A 4HXEB 3SJUA 5IJ9B 5JWRA 5AT1A 6AT1A 2C54A 1ZXBA 1D5WA 3EZNA 1QCYA 2JEYA 3LT4A 2N1MA 1KI9A 4YRLA 5J40A 4EZIA 4GBGA 2QTTA 2JAXA 3IHKA 3PPXA 5DHPA 2VT6A 4JJIA 2ZSKA 3C16C 5I3ZA 2DUWA 4WBSA 1UXKA 2I2BA 5K45A 1C50A 3R3HA 4EHAA 4KU4A 4HVLA 3PUKA 4JENA 2DMRA 2ODNA 1OIWA 2H0AA 2OBMA 3CMCO 2RJOA 1YZGA 4HEQA 4YRPA 1X9GA 1LNSA 1N33B 1CUCA 2P62A 1A5TA 4ZQFA 5JZMA 4LF6B 4I2VA 5DHAA 2VAMA 3I32A 4YRIA 1HDEA 2W6OA 2ZRFA 3Q3GE 2PS3A 1F2TA 3KM0A 2X5NA 3WB0A 4LOHA 3C7AA 4ARUA 3P0RA 1COWA 1JKIA 1E69A 1I6KA 2CLOB 2YN2A 3D8SA 3WLKX 5JHGB 3AUJB 4NC9A 5JDCA 1ZFNA 4IFEA 1PDOA 3VPCA 1E3MA 4DWVA 3LHIA 2GBLA 3HWX1 4G09A 1CWUA 1IE3A 1AUPA 1DV1A 3CGGA 2RAFA 4O4LF 5CMLA 4D9FA 4GOND 1KFBB 2ID8A 1E9VA 2V1XA 3QVSA 1O57A 1FMCA 3V3KA 3O0DA 2DLCX 3VI4B 3AU8A 3CONA 1M1YA 1JNYA 1UDAA 1XU7A 1ZSVA 3BXZA 2J9ZB 4ZO8A 2FRVA 4XPZA 3UXYA 4J6FA 4OU5A 4S1WA 4YP9A 1T2EA 1YR1A 1Q0QA 1VB3A 3GD5A 3AMVA 3PVSA 1RABA 1CRPA 3N70A 3UAZA 3CNBA 3TPFA 4FXPA 5KO2A 5ECWA 1RI5A 2ONCA 1AD2A 3IE2A 5E1OA 5C1DA 4XEUA 5F3DA 1A8SA 2HU2A 4OLJA 4UXJA 2QYHA 1OFVA 1SHJA 1TGVA 3QYAA 2CFSA 2AC7A 2WBLC 2Y0BA 4QEKA 1G5PA 3WIEA 4EYSA 1NJ8A 4F8JA 1AO0A 3VO9A 5HQTA 1K75A 1WQ1R 3SYMA 3OC0A 1BEUB 3PEVA 4NYIQ 5B2ZA 3UGTA 5IRCD 2BMDA 4KQ1A 3ZJYA 3BWEA 1GITA 1KEUA 2MSWA 3BJZA 4PWYA 4BBPA 6NULA 4YAUA 4QYIB 3OF5A 4LDZA 5JS8A 2HV8A 1L4FA 5L51A 2H57A 1K8ZB 1ZH2A 5IDQA 3IULA 1A8HA 2PH5A 1K6IA 4GQAA 3SI7A 4PZ9A 3UWKA 2DETA 3M70A 2F67A 2B4KA 1BE8A 1U7TA 3D02A 1O8CA 2VNIA 3H05A 4WXEA 2X9QA 4PC1A 3FVWA 4BTVA 2VPIA 5M2QA 4FWBA 1GLNA 1RQXA 4X66B 1WHSB 5BSTA 4RXUA 1F51E 5LOVA 3IPRA 3L0SA 1QO7A 4FFDA 3N8DA 3EGDA 3ZE2B 2VVTA 3V2UA 3V7YA 3FRHA 2Y1FA 1Y8RA 3ADBA 1X8KA 2VLBA 5FPYA 4B34A 5BOSA 4BTEA 2HC9A 4F2PA 1RWNA 4L8YA 2AK2A 3D3WA 5TQ0B 1GNSA 2C2MA 4Q00A 3TX6A 3WL6A 4YCSA 5A6SA 3DV9A 3VMMA 2JCSA 3I01M 1BE1A 4W8OA 1RQLA 3OHPA 3QM1A 1QQ7A 1YDEA 3ICOA 5E95A 5AI0A 7ABPA 1I01A 4P3YA 2FF5A 4BNJA 3TTWA 2O2JA 4BVAA 1FEZA 4DNXA 4WFQA 5C4MA 3AFNA 1ZH4A 1F0KA 5JSHA 3JQPA 1U0RA 4UCFA 2ACKA 2X9VA 3F73A 3DEHA 3RANA 3ZDBA 1AXGA 1KI2A 1TJ4A 1V2GA 1UP6A 4RKWA 1I9CA 3H0CA 4HBGA 3ZNPA 3DFKA 3QHQA 2Q8QA 3H86A 2QUIA 3RQIA 1Z5ZA 4GAEA 4FFNA 2YASA 2X0FA 1D2GA 1GT91 3L7YA 1A50B 3HJAA 4HDAA 1ETHA 1WD5A 3MK31 3N2EA 1P0MA 1CF9A 3D3JA 1ZH8A 2A58A 1LK5A 1PK8A 2XUAA 1E2HA 1W0JD 1Z45A 1M2EA 1M66A 1L3IA 4ROSA 1IJKA 3ABQB 2Y4NA 1MLDA 2YIJA 1E2KA 1M1YE 1THGA 1F5SA 3DR5A 3MTGA 1Y98A 3SM3A 2VQSA 2PN1A 2Q6IA 3DXYA 2I2AA 1DRVA 1NXWA 3K0HA 1P0FA 2DJ5A 3PGKA 5DM1A 2KJQA 2RHBA 5FI1B 4NBSA 2J8ZA 1YHNA 4LY9A 3K73O 3LPDA 1Y63A 3OZFA 4LWPA 3B48A 3EQ8A 2VJOA 3CB4A 4X41A 1ECFA 3FX2A 5INTA 1HYEA 4OK5A 3B52X 2FK8A 3I2GA 1DAPA 3OJ0A 4Y2SA 4OQMA 4H1WA 4EI8A 4LDNA 5DX1A 1O87A 1YZQA 2BFFB 4HLUC 4QA9A 2ZQZA 1XTIA 4NATA 1OX5A 5C7IO 1FVOA 1WMFA 1U7WA 3JQ9C 4NRDA 1QYXA 2VJMA 3PC3A 2QRUA 4MW1A 4R98A 5JBIA 1JSXA 4Z4HA 2AN9A 3FTPA 3EMKA 3A1CA 4NH4A 4AF6A 3R20A 2IU3A 3GR6A 3OURA 1TYAE 4JJZA 4J0JA 4UE6A 5DMXA 5DK6A 1KVSA 2BI7A 3LUGA 2YXNA 5TXGA 1CVLA 5JNSA 4RZSA 4B2PA 1FPQA 1W0JA 3ITKA 1I1HA 3MCTA 3D64A 3OWOA 4JBNA 4YAOA 3UK7A 3CN7A 3NV9A 1E96A 2HO5A 4K3UA 4D4KA 3FWNA 2FLWA 2CMDA 4J8PA 4TTAA 3WRXA 5AW5A 2WOJA 3PXXA 3D2CA 3DE6X 1EUQA 2VBGA 4R2IA 5EQFA 5AVJA 1G3QA 1GA4A 1XG5A 1XUOA 1F48A 2O23A 2Q4RA 2VPZA 4IEFB 4RPGA 3HUDA 3NTOA 1GGJA 3H5IA 2ID9A 2VRBA 5F1KA 5HDQA 3ZDQA 2VDJA 3LUHA 4W7HA 4JOQA 3G9TA 3JU3A 4IGKA 1OTYA 1L5RA 1FSZA 2JI4A 2OCYC 1NUHA 3CPHA 3O92A 3BGSA 1W5AA 1T5LA 1ISFA 2ADOA 3OPVA 1L8XA 2XDWA 1M75A 3QENA 3KQQA 1TUGA 1CUDA 3GF4A 4QAQA 1A8PA 1R6TA 3MBOA 3RS4A 1GCUA 5LBTA 1PN3A 2J0UA 1Q3TA 1GPNA 1JJFA 3FLMA 2ZYGA 2OVBA 4K28A 4A0FA 5DNUA 2WZQA 5AW6A 2V58A 3BUSA 2HRDA 5BPFA 4JEIA 1JDTA 4M0KA 3OIWA 5JWHA 1K3UB 1I7NA 4G9GA 3WISA 4DA9A 3L0OA 4ARVA 2BDUA 3KU1A 2YWCA 4UULA 3WLNA 2ZCUA 4LFAB 2CNOA 1N3LA 2EL9A 3J7TA 3M1IA 4ZHQA 5AK0A 1SKBA 2YBDA 5HIJA 1XQWA 1MG0A 2MDTA 4I3GA 1VL2A 1GYQA 5JAOA 4YLGA 4YHHB 4K1LA 3FNEA 1AIPA 3BXOA 4C43A 2RBEA 2AWOA 1VHJA 2CT8A 2AX4A 3I2YX 4MUBA 1L5WA 4J43A 4UVGA 2A3RA 3SIPA 5JS6A 3VGPA 4WN9B 2IUSA 5DB4A 3H9GA 1Q20A 2I6XA 3RC3A 5K6AC 5F98A 4WK4B 3QKRB 2UXCB 4RUKA 3FPHA 2A78A 1CUXA 1YVUA 3E9MA 4K2HA 3H2IA 4QWMA 2QLFA 1A1SA 4YMWA 5IG2A 3JSXA 1ZGCA 2UDPA 1TJ3A 1KJYA 1CJUC 1HT1E 1IG0A 5C7OO 4C6TB 3BTVA 3VVMA 4DMFA 4Q4AB 4ZO9A 5FCDA 2P40A 1ORHA 3SEFA 2WG1A 3TW8A 3IKMB 3W9UA 4U7GA 4KKXB 3FBWA 2BZ0A 3M4YA 2IOFA 4EG1A 1CUAA 1HLDA 2OGUA 1SD5A 2OOSA 2W7TA 4CF7A 1L0BA 2UZ4A 4NYIR 2IKSA 4RZQA 3ZDZB 1SC3A 2AFHB 3O93A 2C2KA 4EJSA 2WQ6A 1CHNA 3DZJA 4ZREA 3ZBUA 1GKIA 4FZRA 3JRXA 3KE8A 4ZOBA 3VR4H 2B1RA 1K5GA 4Z53A 1Q77A 3ESBA 3FJYA 4Z9XA 3EXHC 2BRUA 1ADYA 2QJTA 4D74A 3UEOA 2GJ8A 3LP8A 2P9HA 3WKBA 3KOWA 2JD0A 3FRIA 4TXNA 2BF4A 3PR3A 4FFSA 4HMOA 5IF9A 1USKA 3H4MA 4ZYLA 5KC9A 3ZY2A 1NBOA 4Z0PA 5LMZA 1VPEA 1PG2A 5I7OA 2Q4EA 1CVIA 3PWSA 3ZE0B 4YP5A 3UH1A 1UXGA 3T3GA 3MC1A 2NNLD 4ECAA 2HK9A 4XVRA 4Y1FA 5BQOA 2OHJA 1U1GA 3EVGA 3R3XA 4CI0B 5KNBD 3FI0A 4WXHA 4C0JA 3PJRA 4O29A 4KX3A 5FR1A 3SZ3A 1AY0A 1Y82A 3GLGA 4XGIA 4KN5A 3SHQA 3ABIA 5DZSA 1H42A 1A27A 3C7CB 4OP1A 2HDHA 2EERA 2XUDA 1BYIA 4LYHA 3E53A 2PQ6A 3I6YA 4GX2A 4L5BA 3PTAA 2F43B 5B3AA 2HR1A 3QVKA 1ML4A 4FONA 4D26A 2XNKA 3BFKA 3BC1A 2WWXA 1E9AA 3SC4A 1TVMA 2QEQA 3V8VA 1R88A 4JSRA 1G63A 3D5QA 2E37A 3KU4A 2X5JO 4EYQA 2DSNA 3I4CA 4WKBA 3HP1A 2NQ2C 4RMNA 1C1HA 2ZI3A 3MGBA 1OF1A 4LRSB 5B1YA 5JXJA 1RMYA 4L5YA 2NUTA 3L2OB 4E6PA 1U0BB 2HJRA 4WJKB 3B3AA 1G7RA 3ABOB 3T5CA 2L69A 6YASA 1VBFA 3AUTA 3BJEA 1QH8B 2O3UA 3KSUA 5L3SB 4YMLA 2RBKA 1LBQA 2V7TA 1I30A 5LZ7A 3ZDXB 2XT9A 1QGAA 4M1TA 4L22A 3Q6MA 3BGWA 3UCFA 1Q1ZA 3TLCA 3TTTA 2I7CA 4HXFB 2TSYB 5UKDA 4PF1A 1HT2E 2MSDB 1YNSA 3PIRA 4A3SA 2Z6VA 5BQ3A 1C2YA 1FU7A 1JH8A 1QG2A 3H8WA 4KBYA 4AZ0B 1OFGA 3OFJA 4H6PA 1SUAA 2I4NA 2VQ6A 3G2PA 2JKZA 1XHEA 3O1HB 5L6LB 2E1PA 2E89A 4X20B 1F6BA 1M6VB 2C3PA 2VPPA 2Q62A 3H3FA 4JL5A 2PPLA 2ZQ5A 4QDKA 1KZ6A 1WB9A 1O6CA 3A4IA 1DZIA 3C87A 4K87A 2Z8YA 2EGGA 1T36B 2WE7A 4YUVA 4RTRA 2RDMA 1XRNA 4MW6A 2BKEA 2I22A 1G1AA 2C78A 2YV5A 3B1WA 4KO3S 2ENWA 4OU4A 4JJEA 3C6MA 3SR4A 3TMYA 1EIZA 3HYTA 2FCRA 4CMIA 2O05A 2Q6TA 4LSWA 1Z22A 1SVIA 1SHUX 2ZQYA 3BHNA 3IQZA 4H1HA 4US1R 5HIMA 1DBVO 4BLWA 2P9ZA 2Z5VA 2Z0MA 3OIVA 1X1AA 3PVZA 3X1KA 4DLKA 4M9ZA 3LAWA 4EKGA 5LD2B 5TMBA 5LBIA 4LW8A 1GLVA 3ZI0A 1J0CA 1W19A 2XWQA 4FYPA 4MQLA 2FHSA 2Q8PA 1JLSA 2ZRHA 4UXHA 4X9XA 5JTTA 1PX2A 3DOHA 5COAA 3IUJA 3W5CA 3N5CA 3PP8A 3ROTA 1PZGA 4ZQIA 3D7SA 4A36A 4I6GA 3PFKA 2QG6A 3HDGA 4JVOA 3GRKA 4FB5A 3KDSE 1JEQA 1T9DA 3KHTA 4K81B 3RK0A 16PKA 2C0QA 1CZRA 3MMSA 1XVTA 3PQCA 3VFDA 4DRXB 5KQPA 3VBCA 3SYLA 1MOPA 1L5OA 1XYYA 2BR3A 2ZRMA 3F4LA 1Q1EA 3IALA 2WWRA 5AM5A 4C7BA 4FFBA 3ILSA 5ALKA 3DPSA 4LYJA 1X0XA 3KT3A 3KJQA 3CNHA 4PZAA 3G89A 4YPFA 4I4TA 2OSBA 4DWOA 1WV1A 5AVXA 3TSYA 6REQA 1W4ZA 1W87A 3UK6A 5B37A 4IILA 1PUXA 4RTKA 3PQDA 1GQYA 3L49A 4PU0A 4MO2A 1K88A 1LWNA 2OZVA 3K0AA 3QOFA 4P0TA 4U7DA 3QUCA 1VA5A 3WHPA 3WRWA 2I1VB 4EG4A 2XCSB 4W5QA 2O07A 3G68A 3I45A 3KQUA 2I2DA 1ZU5A 3BK1A 2JRLA 4JLSA 3M81A 4HEJA 2RK3A 1WMSA 2G9QA 2FEKA 4P4NA 1WSWA 4OLBA 4CMBA 4YR7A 1GFWA 4N40A 3ZDCA 2DFPA 3MT9A 1PNOA 2V8BA 3L7MA 5K7SA 2FEXA 1TZBA 2HSGA 3WSVA 1MCZA 2ZRJA 3SYTA 1SU8A 4NONA 5BNIA 4MQ6A 3HKEB 5AJHA 4AURA 3WK9A 3FIUA 2PBLA 1PW7A 5EHIA 5C1PA 1A8IA 3EVNA 3U49A 3COSA 5SYMA 1SCKA 3QLVA 3NJ8A 5F51A 1N2CB 5IASA 4QBTA 4AP6A 2VZ0A 1EZZA 4G1CA 4GZ5A 3MCZA 5AVRA 3JWEA 1GNLA 3EA4A 5FTKA 4V1CB 4PR0A 2VDLB 4YBRA 1U8EA 3OFSA 4CLDA 1OA1A 4DT1B 1DAEA 5DBIA 5CB4F 1TJYA 4J49A 4K6FA 3RSQA 4M54A 1ZVVA 4K9PA 4C4ZA 4JODA 1O97D 3ADCA 5JZVA 1NBMA 5CJJA 3AUUA 5KYUB 4G67A 4MMYB 4QTUB 4DABA 1CUUA 4AQ7A 3E9CA 4LYDA 1Z7WA 4TV9B 4BMCA 1BE6A 4PC6A 3S70A 5KWIA 2C00A 4H17A 3KD2A 5CA1B 1XAGA 3CG0A 3FNRA 2GVDC 3G7NA 2CLSA 2QSZA 3PF9A 4N1AA 1YIAA 3SE7A 3VR5D 2YOHA 5CFMA 4O59O 5JJ5A 1EFRA 2FTKE 2R8EA 1D1QA 3OTIA 3HH8A 4CQLB 3C70A 1NAHA 4EJFA 2UZ1A 5K3EA 2GLUA 4H1UA 2KHZA 3VHXB 4RY8A 1W85A 3CB2A 4ZYVA 4US2R 4Z9BA 1JVSA 3B5EA 4CEHA 3CT4A 3U4QB 4KSBA 4GXRA 1R5BA 1RQRA 2FPSA 5AQEA 1FYFA 2C96A 3U3DA 4LJAA 5KTMA 1IMOA 4Q9KA 3GJ3A 4IJUA 1K3TA 1VGVA 3S40A 1VG0B 5EXEA 4M8IA 2A0UA 1RHRA 4JT9A 4P7GA 2C29D 3O83A 4E13A 2DPGA 4WL0A 2R00A 4CLEA 3IV9A 4LJ8A 3TOXA 1NKTA 2H5JA 2ZIVB 3H99A 1MFZA 4B83A 5H9WA 1IN1A 4OQ4A 1GXSB 3RKRA 5IEBA 5SV2A 3RIHA 3VTAA 3LI2A 3BDAA 1D5CA 1QVZA 4ED9A 1ZQ1A 5LLDA 1EWVA 1P5RA 1I3NA 2G17A 4IQ4A 4MKHA 4X91A 4H4EA 2FN7A 3VR5A 1JR4A 4UTXA 4JA0A 3INNA 2R1VB 1TAUA 1JILA 4GM0A 4PHGA 5CAEA 5ALHA 3DD5A 1ZI8A 1RW4A 3PRKE 4Y7CA 4FZ3A 13PKA 2YVUA 4GX1A 4PPGA 4WGFA 1R6AA 5FUVA 5ULLA 2DPXA 2OEPA 1QHNA 1F06A 2IYVA 4NJMB 4LYFA 3TECE 1KEVA 4HYQA 2G1UA 1MPTA 3H75A 1PR2A 3W1EA 4EVSA 5DYIA 3NUZA 2XIQA 1VI6A 4BB6A 3G23A 1HFWA 1L1RA 4TWZA 3U9LA 3EAQA 4I5FA 5MGBA 4RBNA 1Y7PA 4NBTA 5AOBA 1G60A 2XUPA 3T3DA 2HK8A 4D97A 4CETA 2R7NA 3AKYA 1FX1A 3M4ZA 2IEAA 3RGWS 3O5AA 4YXWD 2UUCB 5HMMA 3EH1A 3PNBA 3Q6NA 1P7WA 1TA4A 3KTAB 1VBNA 3AFMA 4Y1RB 2GJKA 3R2JA 5MFZA 4MEAA 2F1KA 5DWDA 1NGSA 1USWA 1N7HA 3QIVA 4Q5IA 1J42A 3DC2A 1XQYA 1TZKA 3K7EA 1BYUA 4OAQA 3VKGA 3RRXA 3KV1A 2G04A 4N0QA 3SBEA 2DCUA 2BD0A 1KMQA 5G0UA 4HNTA 1IB6A 1U90A 2XLCA 4R4JA 2P3QA 4PLCA 3T7IA 1U94A 4O2AF 5DIFA 4KE7A 1NLUA 1X92A 1S01A 3DBOB 4PPYA 2B2NA 1T1RA 1UJ5A 2IHYA 5AKLA 1GU1A 1Q1BA 2EOAA 4LTDA 4HAWA 1QIJA 1SHLA 2IC5A 2GEKA 1JXOA 2C57A 3K92A 4H3HB 3EF1A 1OX6A 2ZIFA 4I3HA 3GA5A 1AKYA 1Y7HA 5DM0A 1DO8A 1PR0A 5KVAA 1Q2XA 1D04A 3ZWYA 1NTRA 2W4IA 4PCVA 3DEZA 3AQIA 3R6GA 2AB0A 4YJFB 5AI6A 1MO4A 4D3DA 5AUOB 1AE1A 1WDTA 4PGFA 2FY8A 1R27A 4LQCA 4RHUA 5A0FA 2D54A 3ZQ6A 1CS4C 3I9KA 3LM8A 2Y1CA 2Q1SA 4IYRA 1AZLA 2G6TA 3PXCX 4IM7A 4URXR 5HBRA 4K1XA 5F23A 2AYYA 3NHUA 3LQFA 4ES6A 1SQFA 3CCBA 1WCXA 2ZRPA 2FZEA 3RU2A 4CMCA 4ZFNA 4MDEA 2NUAA 3VVLA 3VDRA 2EFDB 1N9GB 3CLTC 1H5NA 1JU3A 2OGZA 3E9YA 4IBOA 5K8TA 3VC2A 1ZSYA 3GZNA 4IH4A 3I0ZA 1H9AA 2YJGA 2PMCA 1RAEA 1RZ3A 2WAXA 3RVNA 4BZWA 1KS2A 4IDQA 5AFSA 3LVFO 1G16A 1WCWA 4ITRC 2VRCA 5F7OA 4QHTA 3WQBA 4W99A 3F5MA 2C3YA 3W5BA 1CQJA 1RCTE 1ZEMA 3ZY3A 5E7MA 1I4WA 4GFDA 4Y9RA 3K71B 4A2QA 4NBLA 5FHRA 4F3TA 1XP8A 4W1QA 5AR1A 3HLYA 2IOQA 3DAPA 3JQBC 1KOLA 3DMRA 3QXCA 3UJHA 4B45A 2ZTLA 4N5HX 3T1OA 1NFQA 1CDDA 4IL5A 1JHZA 3JZIA 4ZAYA 4TVSA 1TKAA 2PO5A 2YJZA 3IPYA 2G40A 3B9RA 1Q7RA 4R41A 4RHYA 4ER3A 5JISA 1Q5PA 5IT9A 3T34A 2R1TA 3JQBA 4WKOA 2A4MA 1Y9AA 1BCRB 1HR0B 2UYHA 3E22B 1P4GA 1X2EA 2WPNA 4QJ4A 2ZKIA 3UICA 5EHNA 3WK7A 5JMWA 5K0BA 2C4KA 2AOVA 2ZTHA 2OBBA 5EJIA 4Q7QA 4EF6A 2OV4A 3EK2A 2PGAA 1JMYA 2Q3JA 3WLQA 4EPWA 2G71A 2RKWA 5HJEA 3GBVA 4OAOA 3M5WA 3UENA 2I80A 2OHXA 1W93A 1G4HA 4YMTA 2XH8A 4EB8A 3ZCQA 1C3EA 4X3OA 2FFHA 4EB6B 4DF3A 1M8FA 2QUZA 4AUNA 4CE6A 4N41A 1DQRA 2IJGX 3DVSX 3HCOA 4BNMA 3AF2A 3AJ9A 3QUBA 2WKSA 2HSWA 4CQJA 3R24A 2BDTA 2OGTA 1Z37A 1DJMA 4XSVA 2PJUA 2O3TA 1M2HA 3IRUA 4WACA 4BYGA 5H4GA 1IUKA 1XAJA 3H3JA 4P83A 5KYYB 1UXOA 2V5AA 4PGAA 3PNYA 1AUVA 1FP4B 3ZZUA 4AJKA 5A4KA 2WSYB 3CR7A 1MXFA 3WP1B 4E22A 3UMFA 5LQJA 1QE3A 2EL7A 4CKWB 1PCXA 2ZUWA 2FJ0A 2FZVA 1A88A 1SULA 5D6OA 3T3MB 1CZNA 4EQ6A 1CF2O 1JSCA 3PTLA 4GPTA 5KHAA 1Y6FA 1AM4D 2GPYA 1ISIA 2W2VA 5IJ0B 1NNUA 4ARIA 2BE7A 1YZ3A 1L5NA 1B8NA 3C8UA 3FUUA 3O9MA 4LGYA 2QN3A 3A8TA 4F9EA 5MDHA 4N01A 3JYHA 5ALXA 3GDWA 1XZFA 3OZ7A 1OXTA 2QMZA 4PYIA 5KNDH 1HYHA 2GZ2A 3O6VA 1C3VA 1QHXA 4KFSA 3RYIA 1XXLA 4FHDA 4TMZA 4MV8A 3WL3A 2H16A 1D4ZA 3U1VA 1UJBA 1XHLA 4H7KA 4FR2A 5KOHA 4QL3A 2HBZA 4AYXA 2RGNA 3VPDA 2HCJB 2YWGA 3IA7A 2CLKB 4O4IB 4TRRA 4F5WA 3EWIA 4IH1A 5HVNA 2G1KA 1QMPA 1ZCFA 4WEOA 2QUKA 2IZ0A 3VO2A 2QRJA 4AQDA 2ZRIA 1USIA 3ADOA 4L7VA 4MIKA 4PRKA 3F7OA 4OHOA 4BQPA 4KI0A 2IYUA 1Q14A 2AUMA 4KYIB 1BN7A 3NDPA 3PIIA 3Q40A 3ENQA 1TCBA 2AYZA 2RCYA 3RFUA 2V0GA 4OJMX 1X7YA 3STXA 2BGWA 2BFEA 1GLGA 3PI6A 4BZQA 4CDMA 4MKRA 4RHTA 1YL5A 1BU8A 5IJ9A 3EY9A 1PNQA 3UC5A 3FPBA 3R9IA 4B4KA 1PGNA 5AVSA 4W4TA 4ZT3A 2PMFA 3IAXA 1HNXB 2XXAA 1N2OA 3OEWA 2NMVA 2RKBA 2WEKA 4X8MA 1XFAA 5DLYA 5K0NA 3C8HA 4I1SA 2NPFA 4PTZA 3I09A 2ACEA 4I8IA 1OI2A 4INJA 4TLMB 3OFND 3K8YA 4MJ3A 2IY9A 2OM2A 4BMVA 2B5OA 3A6DA 3GFSA 1UT5A 3OF2A 5TGTA 2Y9MB 3CIOA 3O90A 4R7GA 1NVTA 1NVBA 2CHUA 3SC6A 1NU8A 1XDZA 4EW6A 2WUGA 3PCXA 5K2MA 1YTUA 3BMNB 5TX7A 3WLLA 3HHPA 5JATA 2A5FA 1IOWA 3H5NA 1UDXA 3M89A 2A9FA 4J75A 2C9DA 2GPBA 4POOA 3GDHA 3MJEA 3DE0X 5ALQA 3ZZTA 2O3QA 2X77A 3W7BA 1EJ0A 1OT3A 5TR9A 1CQZA 4IEIA 1W47A 2R2GA 2P6RA 1DOHA 3OPXA 2RIPA 2Q3HA 3CRNA 3CRVA 1T8UA 2XUKA 1AKTA 2YY7A 4JBIA 4FLEA 1X7DA 4DLPA 5IM4A 2BTOA 1M6WA 1L9KA 1X1RA 1TB4A 4LKOA 4G1FA 1IG3A 2REQB 1Y6ZA 1MG5A 2YBEA 1EX1A 3QI2A 3ZBQA 4BEVA 2QNBA 4HPWA 5ADWA 5IU6A 3HBJA 1X38A 2FDXA 4FFLA 4XB1A 2XODA 2PCJA 2CMKA 4PZEA 1TEHA 2Q0SA 1B73A 2VOEA 4KFUA 3S7TA 1J25A 4KODA 3G2NA 3OZTA 5EI5A 3QX7A 3MFYA 4HDKB 3VNAA 4ZK6A 3CSDA 4J4TA 3U3XA 1KE1A 2V3WA 4HNQA 1H2AS 1NOKA 1X14A 1P0IA 3R6DA 3IBCA 1ABFA 4BUJA 1GSAA 4RD1A 1FDSA 3FLBA 3UXHA 3KOZA 1CC1S 3DTVD 2QLJA 3LQ4A 3AVXA 4REMA 1KJ9A 1YUNA 4FI3C 4BB9A 4QYIA 3QF4B 2IEDA 2E4UA 2PNJA 1IATA 2Q3DA 2ZSEA 1H3FA 4J90A 4AAYA 4TQAA 1DLIA 4J2TA 4EEZA 2HMWA 4DAEA 3WDLA 4C30A 4DHWA 4DCPA 1XMSA 1JQAA 1HF3A 2B2CA 4FHGA 4NQZA 4RTQA 3HA2A 4O1MA 2IUTA 1RYYA 2ORYA 2HDOA 3PNMA 1L7NA 2QUBA 1G7CA 4UEQA 2B9EA 3TZLA 4O8ZA 1Y1PA 3IQDB 4P33A 3PC7A 3Q9LA 1RM5A 1GM5A 4BFYA 3I37X 2PX4A 2BBTA 4H6VA 1C7QA 2WZDA 3SZGA 1JXAA 1NSYA 4P7KA 4QVGA 1DEKA 3ZY6A 4CKZA 2XCLA 3IMKA 4L5JA 1CFJA 1OBCA 4EMSA 1Y4AE 1GEEA 3BE5A 4J1SA 1P17A 5TQ0A 4MZDA 1HEUA 1XWIA 3EOZA 3HDJA 4PXYA 5CRIA 5EJMA 2NZYA 3FN4A 3KG2A 4GMDA 3LFUA 5BOVA 5BVHA 4WZAB 3O8LA 1YV9A 2JKYA 4H3VA 3TIVA 3WY9A 4YV7A 4EO4A 3A14A 1DMSA 5DF1A 1PYOA 5L53A 4DREA 3AEZA 1V4VA 1RYZA 1YJAA 3ET4A 4MVXA 1IJEA 4YREA 2DC1A 2DTDA 2GNOA 3JXEA 3K6RA 4NBWA 4U9IS 4ASUA 2IX3A 1CUGA 1CYDA 2VSOA 4QPDA 1PS9A 2G1PA 4QO7A 1XVAA 1QB7A 2ZJFA 3CEPB 3ER6A 4KIFA 4ZEOA 1UPTA 4DCMA 4EG6A 1T5TA 4LDQA 3VSBA 3LGAA 4Q03A 1J8FA 4KE9A 2YZGA 2IYYA 4N54A 1Z7BA 1U0LA 2CCJA 5DGIA 1GAEO 1E4YA 1XJQA 1XBTA 1E77A 5K4HA 4ZVTA 1FNSA 3DOCA 3DUWA 4ZI7B 3U56A 3C1OA 2PA3A 2GK6A 2O2HA 3KKEA 1KMHB 2B21A 3DM5A 4C4XA 2P9JA 3LBIA 2VTBB 4BV8A 5EXDA 2VXCA 1T3LA 3VZRA 5HJ7A 4L0CA 4FWIB 3AM1A 4IRXA 4E5VA 2WWFA 3IQFA 1TA9A 2GTHA 5TMEA 4F6CA 1UBNA 3ZBTA 4FOPA 3WYGA 4C76A 3WV5A 5KYVA 1K5PA 5F73A 5LJLA 1N0HA 4LECA 3QVVA 3G0HA 3RFFA 1NJ6A 4JU9A 4M3NA 1QNLA 2VXYA 4A0GA 2GXQA 4I1OA 3PIDA 3NJ4A 2WD8A 1THMA 1N4DA 2P9CA 3SMQA 1YZHA 1MIHA 3HUTA 3UY4A 4YLEA 3PX2A 2HXSA 3QPDA 4JI3B 2WVGA 2BFFA 2VHCA 3SQLA 2GN6A 4ENUA 2OORC 5EE0A 2ZS8A 2DAPA 5JJKA 3LIPA 2HGZA 2BBSA 3EFHA 3AT1A 1LI4A 2WY2D 1YKSA 1ZZEA 3F8WA 3QTTA 1NXXA 5DJ5A 3AZQA 4KAXA 3E48A 5IMBA 2X1VA 5IANA 3DV2A 1G3MA 1MC8A 1FFSA 4I4LA 2ZCVA 3GUZA 5H82A 4GYKA 3BRCA 1ICIA 3TSAA 2I6TA 4TZ6A 1DZ3A 3T7EA 1P0QA 4NX2A 5CPFA 3M8KA 5EJ2A 1K0FA 4NK5A 2AJBA 5ETJA 3K32A 3VR3A 4EUNA 2WAAA 4LZJA 1RVDA 2Q0QA 1CQWA 4LZWA 5M04A 3B8HA 5FBZA 1XX6A 1B0ZA 2P4QA 3R0JA 1AT1A 2UYGA 2OM6A 3LOPA 4J16C 4JSYA 4NYJQ 2WYVA 5L4LA 2W8BB 3A6EA 2PMKA 4PO1A 5BNFA 5JC1A 3R7DA 3D4IA 2W6NA 3I64A 2PSJA 2GKGA 3GG2A 1I2BA 1EFHA 1M0WA 4KUHA 1KSGA 1EEXB 3QUTA 2W6CX 4TT3D 3N2GB 1IQUA 5CCBA 3ETEA 4ABYA 5E9QA 2LZ0A 1JHXA 2V7QD 3F6PA 3E18A 4KQKA 4M46A 4RK6A 1YRQA 3RAPR 4QYXA 5EN4A 1I3MA 5FPHA 4NK4A 2W6ID 3AGQA 4MS4B 4XAQA 4ZYXA 1W36D 3KB8A 3PEWA 4PEVA 3SJBA 4LHXA 2RMKA 3NB0A 4PNPA 1XQXA 1TAGA 3D6TB 1MB4A 3QELA 4J7AA 5AP9A 3W5SA 4YAWA 2P8JA 1XXHE 1E1LA 2OYRA 2MR5A 5L40A 3BWCA 1YCFA 1SXJD 1RYBA 2XNCA 4ZALA 2HGSA 1PJZA 2W43A 3FB4A 3D8BA 2D2IA 3FWPA 3II6X 3WNZA 2EZ4A 4U2BA 1E6KA 5I51A 2B92A 4FD3A 4FOTA 4N48A 1HRKA 3R8XA 5GP1A 2OCPA 3VNQA 1QYIA 2PEZA 2MCFA 2ZULA 1ZMTA 2FPGB 1GNVA 1H6BA 4Y0AA 4F9GA 1PUJA 1AQ6A 1IY1A 3Q5GA 4RH3A 2AXQA 2WUVA 1YBMA 3R4CA 4FCTA 3GXOA 4N5NA 4HDSB 1IHUA 1WMDA 4ZCLA 1ZIOA 2QRQA 3CCCA 4WN9A 1LY1A 3F6BX 4CMEC 5I8WA 3H1AA 4LHSA 4RJIA 4EPYA 3QKRA 4NYMQ 4D2IA 1I7DA 2X58A 4RZXA 1Y5LA 4AU1A 1HLPA 1QK3A 1E2JA 1Y5IA 2ZWPA 1A9QA 4L9AA 3RRMA 4TKLA 5G53C 2W2QA 4MNTA 7GPBA 1R0XA 5KJCA 2G83A 5E1DA 2YC4C 5FOVA 1SAYA 4PG5A 2NVWA 4Q4AA 1C0LA 3HJUA 2V7PA 5E8RA 2B78A 2DSTA 3G5LA 5HS6A 4FR0A 5DPMA 4R1TA 4EKIA 4HH4A 1UMDB 1WPQA 3FR7A 1P9WA 3LT1A 4KGDA 4E5YA 3HRHA 4MINA 2AFHA 4HN2A 1SCDA 1YJXA 3LO5A 1U2ZA 3KLBA 2CHEA 4E4RA 3COYA 2CE2X 4N7JA 3HBAA 4C2AA 2EWWA 2W98A 3UM9A 2H5LA 3VAYA 1UKBA 2IV3A 2ZE5A 1Q57A 4D0GA 2B4AA 4BNLA 5TQ2B 3WR5A 3ENWA 5G1OA 3EYWA 4OSOA 1Q84A 1VLQA 5HTOA 3EG5A 2CFRA 2LKDA 2VYCA 1E7WA 5TARA 3R76A 3UYKA 4UM8B 1ZR2A 2CK3A 3UQZA 4WUTA 4GOJA 5KOYA 5CCXA 3KL4A 2IU4A 3STYA 3WVNA 1BH2A 1ZJYA 3H4VA 3LUAA 1T0IA 1Y37A 2QOEA 1RC8A 4NCXA 4MVJE 1L4UA 3HFGA 4U7HA 2C77A 4FXOA 1TZCA 1S2NA 4KSYA 4DNPA 1EE1A 1I36A 2CZQA 5I4CA 5JNLA 2HHJA 2YHSA 3HP7A 5CDFE 2OQVA 2CE7A 1LTKA 5CVJA 3UF0A 4FDAA 1UPFA 3UWOA 2PGIA 3L41A 3TDKA 2O8EB 2J4FA 2XCTB 1YJ8A 3V80A 5KVSA 1LBEA 1DKUA 3LX5A 2ZDQA 2QX8A 1XMOB 2WQZA 4M86A 4EF4A 3UGKA 1AGRA 4PG6A 3QITA 3EDOA 3LKBA 5JY6A 4ZWNA 3ZU2A 4YJHB 1QUEA 2I7XA 1PNRA 4TN1A 3WBJA 3E84A 2H4FA 1U8TA 1AGXA 1SXPA 1K5HA 4Y0VA 3H0EA 1AX9A 1M2VA 2FYTA 1ORTA 4L8VA 3WYAA 1GSOA 3GFPA 4UVDA 5GAJA 4ER6A 1FQKA 2QA5A 5BSMA 4XYEA 2H4HA 4PPFA 1ECLA 4FCWA 2QTZA 2A33A 2VDWB 4FMBB 4M0LA 1QH8A 2KI5A 2J9GA 1IHPA 1D7AA 1E0KA 3K8ZA 3RVLA 3EBOA 5L3SA 1F8GA 3VC1A 2HN9A 3WWPA 4KR3A 2WT4A 3SXPA 1OYOA 2XUQA 1Z8FA 1JEEA 2P30A 1Z5PA 2E5WA 3P8ZA 3PXDA 2YN0A 4M89A 3CSUA 3DKVA 4L07A 1X15A 5AI9A 3ZKWB 2FUG1 3NHBA 1TM3E 5HKKD 3AONB 1RPNA 4IUDS 4P4GA 5JJBA 5TQVA 1RHQA 1FXUA 3HADA 4MV0A 3A6ZA 3BGIA 1KL7A 2VNKA 1GGKA 4PFKA 4RETA 4BQEA 4DQKA 4AZ0A 1IRXA 1NY5A 3L84A 4WK2B 3V8QA 2WFLB 3WIVA 1KO4A 5BW8A 3I61A 1C7IA 2FPWA 3KUKA 4X20A 5FWAA 1M6VA 5JD6A 2A8YA 4PHFA 4IIFA 4YAEA 3TLKA 2IHNA 4FU0A 1TCVA 2F3UA 2Q1YA 1SOUA 4NZMA 1Z4NA 2O3SA 5TMDA 4PQGA 1T36A 1X3SA 1Z4PX 2Y1EA 3HA7A 1KK2A 3N3BC 1Q50A 1E2GA 1JIXA 3G2QA 3SJ7A 3TZHA 1FFBA 4CCYB 2JCGA 3A9TA 1LDGA 3OY2A 2Q5EA 5LD2C 2DXIA 2AFHE 3A4TA 2WPDD 4MQ5A 5CYGA 1I7QB 3NDIA 5FI0B 1E5VA 1YB4A 1KYWA 3JRNA 2RD2A 2HLHA 1YO6A 2G8NA 3KQSA 3IELA 1NLZA 1QR2A 1E92A 2A7XA 4QTZA 1RRFA 4XDHA 4YT4A 3DDUA 2QSUA 4LVOA 1Y7TA 5JXIA 1VL6A 4KNYA 1WZNA 2D0PB 4WCDA 3A58B 4MUKA 5JTUA 4JXJA 3MIIA 1M1ZA 1PFVA 4R3UC 3UB4A 3L7JA 1HSOA 3L0IB 4KRYA 1P4HA 4GPBA 3SHWA 4QNNA 2CZGA 1B1AA 2X14A 1XTTA 3VJRA 4GNRA 1NOIA 4NYJR 3OIFA 4WA7A 3PE4A 3ASYA 4LGCA 4WZ6A 2GCOA 4DRXA 3V1NA 5BXQC 1IZ8A 1ZOIA 1A7AA 1CNMA 2WJPA 3MTBA 3ORRA 3B3GA 2I33A 3IEPA 3MJDA 3RRNA 3OZXA 2PUHA 3FKSD 3FBTA 4LRXA 2ZUEA 4P3XA 3T6KA 4K8OA 3R3UA 3CVOA 2Z9CA 2ZRCA 1G98A 2DWQA 3U3ZA 1Q95A 4GEGA 3FWYA 4MCJA 4EFKA 3KR1A 1TAQA 2XTMA 3L7NA 4E70A 2J3DA 2WHYA 4JYPA 1OIXA 4M7OA 1QS0B 4MWDA 1SG9A 4JP1A 1Z7GA 3AG6A 4LGMA 2JEZA 4PAMA 3L79A 3V7FA 1MENA 1WO8A 4G37A 4PO8A 1KARA 3TB6A 4Z7OB 1K7XB 2KSQA 1UXIA 1ZJWA 2C8JA 2X2EA 3W8RA 4IP0A 4MUHA 3ICPA 4DE5A 1ANKA 2DQKA 3I92A 2OY0A 3I1JA 3ZY5A 3ANNA 1DQYA 4K9NA 4PLFA 4Q3AA 4U3JB 4POAA 1GTRA 2JJ1D 1J7JA 1O8BA 3DAFA 3ECSA 3GAMA 5HCUA 5C0OE 2GHQA 3L46A 4F85A 5SZJA 3L4BA 4J76A 4NMXB 4QPNA 5DHSA 3VR0A 2PWBA