3KTFA

Structure of the n-terminal brct domain of human microcephalin (mcph1).
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
97
structure length
97
Chain Sequence
AAPILKDVVAYVEVWSSNGTENYSKTFTTQLVDMGAKVSKTFNKQVTHVIFKDGYQSTWDKAQKRGVKLVSVLWVEKCRTAGAHIDESLFPAANMNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Microcephalin
publication title Structure of N-terminal BRCT domain of human microcephalin (MCPH1)
rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 31
structure length 97
sequence length 97
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12738 PTCB-BRCT twin BRCT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 3ktfA00
3PC7A 1IN1A 2XNKA 3KTFA 1JNXX 3I0NA 4Y18A 3T7IA 4XPZA 3SQDA 2E2WA 3OLCX 3FA2A 2HTFA 3U3ZA 3QVGA 2K6GA 3L46A 1T29A 3K0HA 2EP8A 2AZMA 1L0BA 4IFIA 3SZMA 3SHVA 2M2IA 3EF0A 4JLUA 2WT8A 1T15A 1Y98A 3PA6A 2R1ZA 4BU0A 3PC8A 4U4AA 4IGKA 3L41A 1Z56C 3T7JA 5ECGC 2COEA 3PXEA 1GZHB 1N5OX 4N40A 4OFBA 3AL3A 1CDZA 1OQAA 1L7BA 2INGX 2D8MA 2XNHA 3K0KA 4BMDA 1T2VA 3K16A 3PD7A 3K15A 4XQ0A 3T7KA 3AL2A 1T2UA 2ETXA 2JW5A 3PXAA 2DUNA 3UEOA 3PXBA 2L42A 2EBWA 3T1NA 1KZYC 3COJA 3K05A 2COKA 4Y2GA 4ID3A 3HUFA 3JVEA 3PC8C 2VXCA 3PC6A 3PXDA 3UENA 3HUEA 1IMOA 1WF6A 2VXBA 3EF1A 2EBUA 3PXCX 2NTEA 3I0MA 3L40A 4BMCA 2LE0A 2COUA 2ADOA 3QVGB 2K7FA 3SHTA 4BU1A 3II6X
chains in the Genus database with same CATH superfamily
4C21A 5HJEA 1DX4A 2X0NA 5EMNA 3GYBA 1NOKA 1E1LA 3G02A 3R6TA 3H05A 2PUEA 3M33A 1N36B 3EE6A 3GJ5A 3W5AA 2HXGA 2WAAA 4MUXA 1V1RB 2JFYA 4CR7A 2VPIA 1BD3A 3DD5A 3HKCA 4OUKX 3ZHRA 1P7ZA 5K0FA 1OXVA 3LUPA 3KEGA 2JS7A 5FHQA 1N1GA 4ZCLA 4NQZA 2BELA 4C08A 4EITA 3IIJA 2EX0A 4L5IA 1LI5A 3WJ1A 1NMQA 3P97A 1XTIA 4MUGA 1MU0A 4RPGA 1PIWA 1JJAA 1USWA 2FOXA 4UEJA 1XZKA 3GJ4A 4ZT4A 1ULZA 4CUKA 4X44A 2IKQA 3VPDA 5HQ3A 1UBLS 3RS2A 5AESA 5REQB 2IDJA 3T4UA 5F76A 1L6RA 3ESBA 3PV0A 3CKYA 2RAPA 2JHAA 1F8FA 3Q8MA 1XZDA 2W2TA 1KMCA 1SVSA 2PMCA 3I9LA 3IT0A 4PHGA 4B8ZA 1EWQA 1V6AA 1R0XA 1YGPA 2XVMA 3V7NA 1BE0A 4ZGGA 3P9SA 3W2TA 2PKEA 3E2PA 1Y3FE 1YKGA 2PT6A 4NFSA 4W82A 3WP1B 5A3JA 3HDHA 2Q28A 4KDEA 1R3DA 2GTPA 2I1QA 3FVRA 4IWYA 1J9EA 4RF2A 5DCWA 4P7BA 2BP7B 4S1OA 2XDQB 4TS4A 3O0DA 3FFAA 4JEMA 4XWWA 1IU9A 2PX6A 2QOEA 4XH9B 1NKTA 2P2CA 4R05A 4D74A 4JBNA 3Q5DA 4D0LB 5FX2A 2HPZA 2EC5A 3DHYA 4U2FA 3I8XA 5A62A 2REBA 5J2UA 1DLJA 1W7AA 3I1IA 1ZCZA 2H31A 2XMCA 3AJAA 3G8AA 1K4MA 4WXEA 3AO0B 1TW2A 4KR7A 1KETA 3UW1A 1GNVA 1TJ5A 3QXSA 4LQ4A 2HHLA 5JNRA 3C3EA 3ICPA 4TL6A 5AVJA 2GS9A 3A6LA 2BTEA 1QJ4A 2VJMB 1W5BA 5DGDA 1U63A 2X9QA 5KNCH 1MIHA 1N2GA 2DQKA 2FW0A 2GO7A 4X92A 4YREA 1SUFA 2V58A 4Q1VA 4YUZA 5JMOA 3CXRA 3COSA 1TYZA 2C2BA 2NZUG 3WC4A 2XV1A 4PNHA 4TXJA 4AKGA 2IXEA 4U7HA 1OYWA 1FU4A 2Y99A 2A88A 1G42A 2BFWA 3KXPA 2AEFA 3NOQA 5FOVA 4PO3X 4COKA 1GD1O 2B5VA 5AI0A 5BQPA 1JYSA 1WZEA 4IHKA 4ZVKA 3U4MA 5EYPA 2I8AA 1IPEA 1OU0A 4G36A 3M3DA 4RPKA 1SQ5A 1T4DA 4BOYA 4GUDA 3DP9A 4N5IX 2F55A 1UFKA 3O38A 4EI2A 5FIUA 1WTAA 1TNDA 3BIJA 4NE2A 2E5LB 2DHQA 1SUEA 2JKYA 1RIFA 2JATA 4BGIA 2G36A 4WCVA 3FGPA 2XX3A 3RC3A 1U8XX 2SICE 3F4BA 2VBFA 1HORA 4KHPB 2V0CA 1M6NA 1P8JA 3A9TA 3UUEA 3EIOA 3SHTA 1PFQA 4ZEOA 1XTZA 3E5NA 3CISA 3M49A 5AD1A 1E9FA 1HL3A 4R2XA 2BBSA 1F9AA 1ARZA 3NM4A 2QPAA 4JB8A 4IUBS 2DEUA 1TA4A 1NXOA 3IOCA 1XX6A 5D3ZA 3KVVA 1T36B 3PRKE 5A0FA 5T57A 5BOSB 3RGWS 2JD1A 2YVQA 3K8OE 4ILKA 4RDIA 1IN4A 4GPZA 3ZDXB 1XYYA 4LVUA 4AX4A 3CCCA 2WSSA 3QI7A 2WUVA 3MG9A 4UAGA 1UC8A 4MQLA 3KOYA 3ROPA 4PZUA 1BO6A 3EOAI 2V7UA 3CE6A 3I8OA 4ENVA 3WXBA 3S5UA 4NJEB 2OKGA 3UOGA 1P9LA 1HRDA 1OBOA 2W4MA 2VXOA 2ZSIA 3KB2A 4JZYA 4PC2A 4UBMA 5LA6F 4TVSA 2H8KA 2V4UA 4HJRA 4RD3A 5EKTA 1KPIA 2XOEA 1GFSA 4DA7A 2OORC 1SURA 4Q3LA 4CU5A 4IDOA 4J90A 1YQWA 1RLMA 2CB9A 1H22A 1MAWA 2M2IA 4KR3A 1QB8A 2EKBA 2FN8A 2JANA 2ZSUA 1XZIA 2GBLA 3Q1LA 1JSLA 3DAOA 4G89A 3OEHD 3G5MA 1T5DX 4I1SA 1HUQA 5AKJA 3ZE9A 5EI5A 4ZIRA 4CIYA 2RBGA 4LNUB 2QV7A 2Z6VA 1RWQA 5ILGA 4HAZA 1U6KA 2V6IA 5P8WA 3RSCA 5E8JA 3WLQA 1RXVA 4BVBA 4QDZA 4OHVA 2Z2IA 5JQGA 1JAHA 2A9OA 3BM5A 2VLBA 1YB5A 1M33A 2QTAA 1YZHA 3FLEA 2FB9A 3L4BA 4NU5A 1VKJA 1IPFA 2OESA 3OFVA 4YRPA 1K2VN 2D2XA 3COZA 3E8SA 3ZHOA 1M72A 1CJMA 4BGUA 5GONF 5L3QB 1LVUA 4I1VA 4WKNA 4YCDA 5KOHB 3M8KA 2PMDA 1UBJS 3I3SR 3HCCA 3NVMB 4UPEA 5HUJA 1YA4A 3RT9A 3NEPX 2GXAA 2GEJA 3EHDA 1IYZA 1ILEA 2YZNA 3PRJA 1MQ8B 3HDQA 3Q7QA 1P6XA 1UUFA 2GD2A 3G85A 2LIPA 3JATB 4CKXA 4RM2A 3FNFA 1X7XA 2GQ0A 1Z6TA 2GHQA 3OIVA 3PLNA 3IEVA 1EFTA 4R54A 3A9VA 2YV4A 1OGYA 1R4ZA 1EM8B 3E1SA 3RM3A 4EAQA 2A67A 4LFAB 1WDMA 3SVZA 2H8GA 3HTXA 4GNKA 1XRNA 3G9TA 4JLVA 4B31A 2ACWA 2XGJA 3MXTA 5A5VA 2ZT7A 3JQFA 1JB9A 2G0NA 2R65A 3GFPA 4JOCA 4Q7JB 4UBKA 4BFLA 2F9FA 2X13A 5A6SA 2QRZA 3WJ2A 2OCLA 1YR1A 1KY2A 1QF7A 1EP3B 4XIFA 3LBNA 4TN1A 4GX0A 2H1VA 5KVQA 3CMCO 1VLLA 5HOQA 1BWPA 4R69A 4LCBA 5LP6B 4MMYB 5D3MB 4JEUA 1ZEMA 3A58B 3L9XA 2W6MA 4A7PA 2G4CA 2D6FA 3CSUA 4OXIA 5YASA 4ICIA 2HLHA 2YZKA 4UUNA 3NDRA 1COZA 1OX4B 1NP7A 5LB4A 3SX0A 2GCGA 3PFFA 3EA5A 1XF1A 2G1AA 3IHKA 1X13A 3E8MA 3A4LA 3PNQA 4HVLA 3MJEA 3FM9A 4IOLA 3A6PC 3GOQA 3BHJA 3DF7A 2QENA 5I9SA 1ORTA 4MQFB 3K1AB 4QXQA 3KUKA 3WB9A 1T3ZA 3QSGA 1RM5A 3SZGA 3MGBA 3ZJTA 4LGCA 4O25A 4YO7A 4W8GA 3TVTA 4WZAB 3ZOKA 2FDCA 4HLUC 4LXGA 1C9DB 2FQ1A 3Q2OA 3JALB 3NM5A 1M2OB 1PEAA 3QYPA 2PKRA 2F7SA 4H31A 3PWTA 4Y67A 5C4IA 1LSJA 3ZHCA 2L19A 4L07A 1XZJA 1FX1A 2AOUA 4YQZA 1TF5A 1D6SA 5DYNA 3CH5A 2X40A 5JMTA 1FTQA 1SOWA 3WAGA 1HSZA 4DKJA 1LTQA 4L5YA 5LP1A 1Z2EA 4M55A 4MUKA 1Y9JA 4Y2HA 4D79A 3KB8A 1P2VA 4O2LA 4L7VA 1H8HA 4DY6A 4Z49A 1Y4DE 3GWZA 4JB2A 3PR2B 1YJQA 5GMOA 3WWCA 3PVZA 3Q6NA 2J4FA 4C5AA 1H2EA 3F71A 1E7YA 2PLWA 4CM3A 4BN4A 3DLBA 3EB9A 3U7GA 3L5OA 1PTKA 3PG5A 2RONA 3SE0A 2VF4X 3IE1A 1E18A 3B7PA 2X42A 2A58A 2DJ5A 4X9XA 1KTIA 4EVIA 1CNMA 4JBYA 2HA2A 4MIYA 3EEFA 3PHHA 1R0YA 4F6RB 2WOJA 3SZ3A 2HU8A 3LH5A 1JT2A 4CF6A 5E9JA 1AKQA 2KLHA 3RTBA 1TUBB 1UKBA 1U6JA 2EKDA 1U65A 3IJRA 5CFNA 2V6JA 1L3BA 2RJ3A 3KUXA 2XUIA 4QQ8A 1TC1A 2F3RA 1KGDA 2R6ZA 2Z43A 3CF4G 3ZE6A 1BCRB 1QOZA 4Q93A 3EEIA 2BFBB 3ZNOA 2C4MA 3CM0A 4E5NA 4ZYXA 3M5WA 2FWRA 4JLSA 4K6CA 2HK6A 1QIHA 4G1MB 2VJYA 1ULTA 2UYGA 2NYRA 4O4JA 3EFBA 2ZYVX 2VATA 4CLOB 4ER6A 3MGKA 2FSVC 5E2BA 2UYHA 4Q12A 1AZWA 2C20A 5BRNA 2FOIA 4MULA 3WWPA 2I54A 3WLTA 2W2QA 1MO3A 1H2ZA 1UKVY 2AFIB 3JQ8B 4PPGA 1IY0A 4GC5A 4CBVA 1DEOA 4YJFB 3RTAA 3TSCA 3LYAA 1MAAA 4HRYA 4N01A 4OHRA 3WFIA 3RYCB 4YCSA 4DB2A 3RG2A 3RT1A 2VOJA 1GXSA 3QY9A 4MRPA 3BSSA 1ORVA 5LB2A 4N3BA 4G0VA 1KFEB 3QUAA 1K3TA 1W8DA 4JLPA 5EKXA 1KDYA 2YXLA 2RI6A 1C1HA 2Y1KA 3ZY2A 4ND4A 4O2AB 3DW1X 1QAQA 1JEEA 2BEWB 3D8UA 4IVPA 4OHCA 4BDSA 4TN5A 5TEVA 2I03A 4GXNA 1E5TA 1PV1A 2ZSKA 1XDZA 4YAFA 3EGOA 3MYYA 1ZH6A 3MT7A 3B5EA 2RHHA 2GF0A 3L6BA 3H11B 5LYJB 4PS0A 4OXRA 3DT8A 1J0XO 5EWLA 5H0IA 4EUHA 3AVQA 2B4TO 4E1VA 1RYEA 3C7AA 2CXSA 4P4UA 3Q10A 4QPJC 4YI5A 5DNUA 2LGJA 2JG3A 4QOFA 5D6OA 5HHTA 4FILA 3PXCX 3RIYA 1SD5A 1C81A 2O5VA 5CGQB 2OKCA 2ZVQX 2W2PA 4BKPA 3BB1A 1NF3A 2P30A 2WA2A 3TIXB 4M9XA 2ADFA 1ENOA 3E23A 3GJTA 1Z0ZA 1DAOA 3R3UA 2CCKA 1AMUA 3ABOB 1T1JA 3AQ4A 5SZKB 1JJBA 1OASA 3GRFA 3PEUA 4JC0A 4Q4AB 1N8SA 5LZ5A 1T2AA 3SJCA 1QTNA 3G5AA 2GD0A 1OLOA 4FUTA 1TK3A 2C7GA 2OOKA 3B3FA 3A1FA 3EF3A 4Z2YA 2F48A 3TL3A 3VKVA 1J23A 3WDKA 4XFJA 2QY9A 3PHGA 1SCBA 3GLUA 1XR3A 3DUFA 1FEZA 4POOA 3RUPA 3IHTA 4HAWA 4EH1A 1SXJB 3RW9A 1N0UA 1GUBA 2ZAGA 1IQ0A 4BMPB 2J9YB 2OLEA 4M8LA 1NTOA 1VDZA 1YCDA 4B3SB 5CH5A 2P69A 3NZEA 3CX6A 5THKA 1SXJD 3N2KA 4RABA 2QVYX 4L8FA 1CYEA 1FNMA 1GZVA 1SUCA 5DXJA 3DEAA 3MCUA 3MWLA 1E1CA 1EQUA 2CW5A 2PKYX 2RB5A 3CZMA 3QVGA 1NW3A 4LPKA 5F78A 1XOIA 1G8KA 1GTL1 3ROQA 2YWJA 1GYRA 3KJEA 5EWJB 3TZLA 3K6KA 1QO0D 1IATA 3MT0A 4KP7A 2EAUA 3JWJA 3HJFA 1F8XA 3EVGA 3ENQA 1AS0A 4NH4A 1QHHB 4RK4A 3QJYA 2R96A 1YDWA 2VT6A 4LJRA 1H5NA 3V7YA 1VHJA 2WZCA 1TM3E 4IUCS 2P1DA 1ZM9A 1PJCA 2QQFA 3K9LA 1PUXA 1WZCA 3I9KA 1L7AA 4RHUA 4DREA 1CY8A 5BUCA 1JGTA 1HKUA 2HYDA 2ZRPA 4IMRA 4IYRA 1DXQA 3H5OA 2C7RA 4JVOA 1JH9A 2VWHA 5F3RA 5ULLA 1P62B 4NARA 2AR9A 4IJ6A 5DYYA 3P0JA 3MZ0A 1GDTA 1NUQA 2B8NA 2B6HA 3PJRA 2Q50A 2ZB7A 3GHHA 2WM2A 3IFSA 2PKXA 3OT1A 4V03A 4GLBA 2HMWA 1R37A 3QHPA 3W9BA 2OQ2A 2IU0A 2VK2A 1VE5A 4HEQA 3E7WA 3CF0A 2FK8A 4JP5A 3SYRA 4R9NA 2C4UA 1E8DA 4JASB 3UIEA 4E5VA 1R0CA 3ORRA 3PFWO 5A9TA 3O92A 1E4VA 5T4HA 1VLHA 4LVOA 3ZNNA 1N1EA 2XF2A 3GRZA 3LHDA 3EARA 1K63A 5IJ0B 1OWNA 1E9BA 1NJ2A 2H6EA 3D59A 4BNVA 3ZWCA 3ND7A 1DUIA 2RIPA 3VXKA 4BFXA 2ZXUA 4I9HA 2Q21A 4NNJA 1W4AA 1D1PA 1A9ZA 1PNRA 2E4VA 2QSJA 2GTIA 1Z17A 4IV0A 4G37A 3I2FA 3G3EA 3M70A 5JSFA 3BSFA 2JLVA 3K0BA 2UV8A 2AF4C 3CH6A 1OILA 4CDNA 3BVPA 1KVTA 2YASA 3HZZA 1X80B 2VPXA 1NN1A 3JD1A 2VXCA 1IN6A 3KKOA 4O2RA 5L3RA 3PC6A 1HWYA 1W2GA 3EDYA 1EJ0A 1LD3A 1H2FA 3FCYA 2YFQA 5CA0B 3TR6A 2QP4A 3VTKA 5FTMA 2ZYTX 1ES9A 1LZKA 4HGQA 3AESB 2DP4E 2FPKA 4DXAA 4H6WA 4MYRA 3RYTC 1IH8A 2HTEA 4K26A 4IF6A 1J5EB 4ESEA 3S3TA 3LT2A 4C1NA 2JEZA 1ZC3A 2W6OA 1DHRA 4KBGA 1X7HA 4A6DA 4W7IA 3MINB 4QFDA 2TS1A 4DJ5X 1JDZA 4J1NA 1J97A 4JT8A 4W1QA 4Z9XA 5A4DA 3SMVA 3CKKA 3W2EA 2OFPA 3BGVA 3HABA 2FPRA 1FRNA 2E55A 3EVDA 2YVKA 2QUIA 1M6YA 2BI4A 2FQXA 4K3VA 4WCFB 3NYQA 1N6NA 1SOMA 3TBHA 1PR9A 1L5WA 1M1ZA 1SWVA 2ZWIA 1ABEA 3JPWA 1WMFA 4N18A 3LT1A 4Y1FA 3NWBA 5DV9A 3UWSA 4CIXA 5TXGA 5KKNB 3WK4A 3WHPA 1X7DA 3ZWNA 2I4OA 2QRKA 1PWXA 2JZCA 5IN4A 2ABWA 1AKMA 2PA0A 1WZNA 2XOKD 3EHEA 2FJPA 1R00A 1LRKA 2ZRNA 2JFGA 2QN3A 4XPZA 5CDUA 3ZW9A 5KB3A 1W88B 2BMDA 4GLLA 2I1VB 5DRTA 3TTXA 4CQMB 1YVDA 3HFRA 3T7DA 2QM0A 4WN3A 1DCFA 4LC9A 5E8RA 4CQMD 4BQIA 3I2JA 1QPZA 3DBHA 1L1RA 5FUVA 1X19A 3LX4A 4C7VA 3IQGX 5DGTA 5DNEA 4BP3A 4NENB 1F20A 4URUR 4DJAA 3TWOA 3VPBA 1X15A 4K9RA 1WD7A 1TGYA 2OBXA 3JQBC 5JZSA 5FI5A 5SY6A 1EDBA 3SKYA 4HWTA 3KV3O 3I05A 4UTOA 3SR3A 3HYNA 4X7RA 3MNFA 1YAJA 2EZ8A 2HNKA 2KB0A 2IXDA 3BTOA 1PS0A 1IN7A 1ESZA 3BWXA 4Y30A 3SFZA 3THSA 3ICQB 4Q7QA 4E30A 3O21A 5FNVF 3K71B 3WAKA 5I5GA 1G20B 1DKLA 2Z8YM 2Q0QA 1G5FA 1E98A 3UJ7A 2R00A 5AM3A 2A0UA 5LZ4A 2OXCA 4GXQA 2SNIE 1CP3A 3O94A 1S3FA 4GSLA 1GPBA 1ZY2A 2O20A 2WF8A 3NHJA 3TRHA 4DJDC 5KMGB 4GKKB 2DMRA 3LK6A 2C5HA 3RSOA 3I92A 2R6JA 2O5EA 4LNHA 1HE2A 3B78A 4UD6A 1I3CA 1KGSA 1ZW6A 1M7HA 1T0PA 2YXBA 4RTRA 3VTZA 3E22A 2H5IA 5CT6A 5ILOA 3C6XA 2FUG1 1CUZA 1ZJJA 2AZ4A 1V7QA 2Y4OA 1TEXA 3BTUA 2C5FA 5JPDA 1ODSA 2FZKA 3DMFA 3VMFA 4CLEA 3KJXA 4XOUA 1SBNE 3IT3A 1LWOA 4OH7A 4WJZA 1KJNA 4EO4A 2L42A 3FTFA 1U8ZA 1YXMA 3AONB 3LFTA 4FGKA 2OHFA 1WDKA 1ZIXA 4XRRA 1EK2A 1GPJA 4I50B 1VJ1A 4TV9A 2D0PB 5FA5A 5IDVA 3S5JA 1WR8A 1P72A 3KKKA 2NPOA 1KJZA 1BXZA 2QDXA 1NE7A 4JNKA 3ZDZB 4HYEA 2JIPA 4N7RA 1VHLA 4IAOA 3RODA 1ZD9A 4DDUA 1KKMA 2GZRA 3KEFA 5AXDA 2IELA 1WCV1 4OQYA 5IVPA 4G0XA 3EF1A 1SG6A 3NVAA 1ZPDA 2EBUA 4FEGA 1CZOA 4CU2A 4IHJA 2IE0A 2OCBA 3OZTA 3MJFA 2QY6A 3OM8A 5IT4A 1RRFA 3L9WA 2YHIA 4BY9E 4PE5B 3R6LA 5IFLA 4XVRA 3AB3A 1JVBA 3FVVA 1ETHA 2VNKA 3G2JA 4LGVA 1ZRHA 1K0UA 1M7BA 2ROQA 2ZEJA 1X42A 4LSGA 2R6CA 2XYPA 2CY0A 2XJ4A 2A94A 1EPUA 4D3XA 3LPAA 1E5XA 3Q5EA 4JY7A 3KD3A 3U5ZB 2WHEA 1GG9A 1JHDA 3VHRA 4AYXA 5E38A 4WLOA 4UMEA 4BE4A 1UF9A 4ENSA 3G7UA 1IHPA 1UZLA 3MTJA 3QXHA 3JWPA 4CM4A 1RHJA 2O8FB 4UQOA 3V8BA 4WA7A 2O2HA 3CU5A 4II3A 1CUGA 3JQ9C 3LT5A 4RQUA 5H5JA 5A2GA 3GJ8A 4U02A 4B4VA 1V0JA 3BMQB 3OKAA 4MQ5A 3C15C 4S2EA 1A4RA 1A95A 3GUYA 4RLHA 3OF5A 5DGXA 3F67A 1ZD8A 4AWXA 1Y3HA 3FNGA 3A06A 3IQDB 4KRGA 3NBKA 2X9LA 4N8SA 4D56A 1O6CA 4AIIA 2JI7A 5K4HA 1WIWA 1P8AA 4YAGA 2B4KA 1ZUHA 3C4JA 2CHEA 1D8TA 3VDNB 3GLIA 3A14A 3UHOA 5CM2Z 3P9KA 2ZT5A 5JXGA 2WJ6A 4NZNA 4OVKA 1J5PA 5B6JA 1IZ9A 2RGRA 1BN6A 1VBFA 4AF7A 2PBFA 2E18A 4R4JA 2HT1A 1U2EA 4GH5A 1C3OA 1ATIA 3SDSA 4ASUA 3VOAA 1I3OA 2FFHA 3OCJA 2EKQA 1ND5A 1CUSA 3HPQA 1UMDA 1V48A 3I52A 3MW8A 4B35A 3A28A 3PDCA 3EGXB 5IK2A 3QXXA 4C3ZA 4F04A 4G25A 5F73A 2Q07A 3W6UA 2YJGA 1YZUA 3BXPA 3CB4A 4KO8A 3G2MA 4D4HA 4ML3A 1HYGA 2XODA 1VIDA 3BMOA 2QN8A 1EXVA 1OAKA 1PGQA 5DHQA 4CF3A 2I66A 1U1CA 3K8ZA 1P75A 3AF2A 1A2KC 1F0YA 4OHKA 4F91B 3HCPA 1Q84A 1XEXB 4TLMB 1AURA 1ACLA 1G18A 3FNHA 5DGIA 1BDJA 1WKBA 3TRDA 5K8LA 2QSZA 3O47A 3V7WA 1EFVA 1XQXA 3LP8A 1KAHA 5ALIA 5HZKA 2BGWA 2JIOA 5K8VA 4IPTA 1ULAA 3RHTA 1NY5A 1F8UA 1RKVA 4KH1A 5IBPA 4CG1A 2A0FA 2NTNA 1MAVA 3ASZA 3QOWA 4J2HA 5IH7A 1WXGA 1E2FA 4Q1BA 1N7GA 1NTRA 4P33A 3AERB 5CLQA 1N5KA 1GAWA 2ZI7A 2XEDA 5ESRA 2ZATA 2JGAA 5IJAA 3SJBA 3HZOA 1E5QA 4JQYA 1LPMA 4KQJA 2H00A 3HH8A 1TEZA 4OG2A 4Q9IA 4K87A 1UDWA 3T9FA 3FMIA 3OPYI 4MVJM 4R0NA 4P3YA 1V71A 4LHYA 4BFCA 4CM9D 4RGQA 4CKCB 1PHRA 4CV0A 4NY1A 2DQZA 3UH1A 3B1KA 4Y6OA 4BO1A 4IGAA 3UOWA 2PJRA 2FSIA 5D5QA 3D8NA 1PJ2A 3LZDA 5GV8A 4OMCA 5ALSA 3PYXA 3WYDA 3ER8A 2QR5A 3G2OA 3O73A 3H1FA 4AURA 5IPFA 1YBVA 3FW1A 5JOQA 1EZ4A 1SBYA 2KLBA 5CB4B 1CY6A 5FYDA 5MFPA 2GM9A 4BGEA 1EVJA 5DBOA 3LFUA 1Y3DE 4RPLA 3AM1A 3T0FA 1C9JA 1QHYA 2BTQA 3E35A 4JXJA 4I4CA 4OI4A 3RTCA 4E2YA 5ALVA 3HKBB 1NF2A 1D6MA 1OD6A 2MHCA 2ARKA 3CZ5A 4G1BA 3SIWA 1IZ8A 1HZJA 2WF7A 3D4LA 4JFRA 2G9NA 2JGIA 2R4UA 2DKFA 4EGAA 1NN0A 4ZTZB 3CWCA 3I12A 3BX1A 3KYDB 1DHTA 4Q24A 2DZDA 3WHIA 2A9PA 3O7WA 2RMKA 2XUQA 3FCEA 3OKPA 4OXQA 2ZRIA 3ZZUA 1Y6QA 3QLJA 1RVDA 3B7WA 3FF4A 4TOIA 4U3JB 1WP4A 2R2GA 3K0AA 1JXMA 4AIRA 4ESHA 1E2EA 1ISFA 2ZB4A 3GLIE 2NO6A 3SS9X 2ZIWB 3C5CA 1NW6A 4HDRA 5J43A 1B8VA 1FNDA 1HXHA 1WW3A 2Z2YA 5D1NA 3HB1A 4CI0B 3LKVA 3CIOA 1P4GA 3VR0A 3PIIA 1E2GA 1FYFA 3OX1A 1JPJA 4QDTA 4ZAWA 1JR4A 5AWFC 3LPLA 3DC7A 3WTBA 2BFFA 4PR3A 2FMKA 1B6RA 4L8GA 1W44A 2AE1A 3BFVA 1GTJ1 1BVYF 1RXWA 1CT9A 2PA3A 3BERA 1SQSA 1WSDA 4REOA 3EK2A 1N2ZA 2I7DA 4FZ3A 7REQB 2QTVB 3C6ZA 3E6AA 4KJZA 4MW4A 4OV6B 3BXZA 1USGA 3FYUA 5FR2A 2QUHA 4FNMA 3NKLA 4D2IA 2A1IA 5ARBA 5C5EA 2JLYA 5K1ZA 1MCZA 2AW5A 3AGPA 4B6FA 2IX9A 3KQOA 3ZHTA 5J2TB 2BUBA 3IAHA 4LV6A 4M38A 2VP9A 4G4IA 2JLWA 4LDPA 4RDCA 1I6LA 5JSKA 1NURA 1GRNA 3EJ6A 3R23A 2LD4A 2NPIA 3F2VA 1JU4A 3FHJA 2F43B 1A2QA 3IO3A 2EFCB 2WU1A 3G89A 3PR3A 1QX3A 1DMSA 3UJ8A 5JDIC 1KHTA 3QMVA 4IIHA 4QYWA 4DYHA 3BWYA 1YTUA 3VR1A 4PC3A 4QE3A 5JBNA 4PYOA 2R6DA 3DVQX 1RKBA 3CLRD 1UP7A 4Q5IA 4GQAA 3D6FA 2BTOA 3BMXA 3KDSE 2IHZA 3FFTA 4JUDX 5KNCA 3DXXA 2PYIA 4OSEA 4U2BA 4U2KA 3VAAA 2H4YA 2ZIZA 4RYDA 1IG3A 4B6RA 1OZHA 2N75A 5L8VA 3NX4A 2MSCB 2XBUA 3MS4A 1JEYB 1ZU4A 3H83A 3EA4A 4X61A 4TTJA 2QAGA 1QHEA 2CNDA 1B2RA 7MDHA 3GZNB 4MWDA 5ALLA 1ZH0A 5CURA 221PA 2JCXA 4MV1A 4R84A 3D0KA 1N6RA 3HJRA 5I3CA 4MW1A 1Y89A 3VA7A 3O3MB 1YQEA 4OFZA 5DHAA 1FMFA 1LBQA 2QTMA 1NIJA 4PNZA 1FJGB 1YS6A 4F6CA 2M6SA 2I2FA 2QAJA 3NTRA 5HMLA 1VCIA 2QTRA 3GFVA 2G25A 1GNRA 2ASVA 4OQXA 1Z6XA 5L3VA 3SZLA 4Q4CA 4PSKA 1RE0A 4IQ4A 4QDUA 2VDUE 1E0DA 3C45A 4FN5A 4G2NA 4R2KA 5DH9A 4LC1A 5EIXA 2GJSA 3AETB 1MRSA 4JUIA 1EJ6A 4TMFA 5GV7A 1WHSA 2QF7A 5F5LA 5I45A 4MICA 3VNRA 4UDNA 2QNBA 1EBFA 2XMGA 4PVDA 4G97A 5CMLA 4DN6A 1KO1A 4DPLA 2Q3DA 5GOTA 5KVSA 3ZK9A 1B4DA 4BDTA 1J33A 1VPTA 5EVCA 3QPBA 3A2NA 4QXMA 2AJLI 4MGIR 1X7ZA 1IN1A 3CLUC 4FBMA 3FTNA 5B4UA 3PICA 1D1TA 4G0ZA 4KAJA 1PBTA 3AHEA 5EJ8A 2NNLD 3LGSA 5L95A 4UU7A 5IRCD 1HYQA 3IV7A 3PGLA 4FYIA 4CLDA 1E8NA 2AMFA 1UDBA 3NTQA 3OO0A 4W63A 5JISA 2BFDB 3AOEA 3KEQA 3PE6A 3TTSA 3CF6R 4FLEA 3T95A 3UN1A 2K6GA 2BGUA 1W4RA 3H5VA 1T4CA 3F5FA 1L0BA 5KKCA 4CL0A 3BXHA 4IIBA 5HF8A 3DQZA 5CB6A 8ABPA 4YT5A 2V5UA 5DHRA 1O57A 2QMEA 3ZD6A 4E22A 5JLAA 1RPJA 2X5KO 4KIUA 5DSZA 4NXMB 3PRYA 4MJ3A 4NZMA 3URKA 1YFLA 2NVOA 3EZ6A 1KYZA 3GMDA 3OO1A 4QJ5A 5AHOA 5JHGB 4S1WA 1YIAA 2QRNA 4BO3A 1E2QA 3W9YA 4L4SA 4B44A 3W2HA 4H7KA 5I7AA 1S2GA 3GRKA 5LXTB 1HDCA 3GPDG 3I2KA 1BCSB 1CUHA 1XSEA 3PENA 5CPBA 3RS3A 4AJOA 5KYKA 4L72A 5FO1A 4C4YA 2AKAB 3FXAA 1B1AA 3R74A 3ESCA 3HR4A 3NBYC 2Y1GA 1YDHA 1JQ5A 4EPXA 2VF8A 1WWKA 3RADC 3JD3A 2Z1MA 1E0JA 1YRYE 3M4NA 1JYFA 3K9QO 4RXUA 2GVDC 3TDMA 4AVYA 1Z25A 3B1ZA 4E5SA 1B74A 3NNSA 4QHYA 2E4UA 2JPDA 4K28A 4MR8A 2BE7A 1THZA 3MTBA 4AMYA 1K68A 2AQHA 1AQLA 1R6XA 1RBMA 5FA6A 4UE3S 4UDYX 1BJRE 1DRUA 1LFAA 5DGHA 3IL2A 3RKRA 1UFQA 4IMIB 2GJ4A 4FMDB 3MTAA 2FLVA 5KX5B 3KQHA 1EWVA 1YQDA 5H16A 4B2LA 2DSNA 3EG9A 4RLQA 5KTMA 4JA2A 2WU3A 2QKYA 5FBLB 3TIFA 3H0CA 5CFZA 1F60A 1X8XA 3OQVA 4HOYA 3WLAA 1JEDA 5HCUA 4YUAA 3COJA 4PTZA 4R1MA 3T1YB 3HNPA 3OOSA 1T8TA 4MMZB 2PZEA 4FNOA 4NU0A 4CIVA 2HHAA 4HNAA 2HHJA 2QD5A 3T9EA 1NBHA 2ZAOA 1VKHA 2WNHA 4KUEA 2RH5A 1PTJC 1EFDN 1AKUA 3DL7A 3PXXA 2B34A 3JQPA 1Z5OA 4KX3A 3R5XA 1RJ9A 1TZBA 1OVMA 3CGGA 4KQ1A 2WTEA 3FB1A 2FV8A 5F4ZA 1P6UA 3EAQA 5IZCC 5FUMA 3M9LA 1N7IA 1BWQA 5TJHA 5KNBD 3I0MA 4OO3A 1UL1X 3LDFA 3QE3A 4LYDA 1MGPA 5J4YA 4TUYB 3RS7A 2H1OA 2R6HA 1Q95A 2B0JA 4M3NA 2PWYA 3CTMA 1UBOS 2GM3A 4JKOA 3ZXXA 3H1PA 5IJ9A 3WGLA 1JW9B 1UJ2A 3CO5A 3K2IA 3P9QA 4M8KA 1JRLA 1K86A 4QPPA 4ZYZA 4WNAA 2W22A 2UVPB 5EHZA 5T41A 3OU6A 1Y5IA 2ZJAA 3C3AA 3FPJA 5E0KB 4D99A 1QFSA 2BR4A 4TL8A 3TW8A 2CWWA 2DPXA 3EZXA 3NKFA 1ZC4A 4WLFA 4DCMA 4EMSA 1XLTC 1LV8A 2FP4B 3CWZA 4KJXA 2O8BA 2WWIA 3HADA 2X0IA 5AW3A 1P39A 5LBUA 3EBLA 5CB0A 1K66A 1BXRA 3DE2X 2JF0A 4B7ZA 2R2AA 3W5CA 2O8DB 1OC4A 4ZZIA 1XU7A 2LCQA 5ALPA 5CDSA 3Q98A 2XZDA 2PEZA 4GDFA 1F2VA 3Q8KA 2VZEA 4U7TB 3O2JA 2IYXA 2Z8XA 3GGOA 3JRNA 5TJ9A 3WNDA 3OCWA 5JVDB 1U5CA 2CXOA 3GMTA 2JZOA 3AKEA 3DFUA 3LM8A 5IWCA 3OE7D 3KD2A 3NFRA 3NHLA 1MB4A 4MVJG 4E5PA 2O8EB 1GPMA 2V7XA 2PZFA 2XGGA 4JLUA 3QVXA 4L5AA 1ESEA 4ND8B 1YI8A 1GR0A 1X0VA 3JQQA 5EG5A 4K1LA 4NG5A 4CMEA 5J40A 2JGJA 4KMRA 1Z8FA 4EW2A 2GN0A 3QUQA 3M4YA 1QNFA 2ZYIA 4MDEA 2YUIA 5J5VA 2YRFA 1JL3A 1LPBB 1XHLA 4LZJA 4Q3OA 4I55F 4HDCA 4QXAA 2VEOA 4PNPA 4KO3S 3SPXA 3EGWA 4TMYA 4B5LA 4IH9A 1V1RA 4UOZA 3GRPA 5CFLA 4HGYA 2D3TA 3K5WA 5BQFA 1YR6A 1S7CA 3DGEC 1MJFA 1QVVA 1U0TA 1JZSA 2ZBFA 3FMPB 3IPRA 4DDMA 3AL3A 4DZRA 2BDEA 1XDGA 3KVRA 4D4IA 3BXXA 3FVQA 4KLNA 4Q7EA 4DMCA 1TVKB 4FE4A 4GW3A 3R3VA 1KAEA 3KYBA 2WUFA 4GMGA 1E7WA 1T24A 2PKQO 4V0SA 1Y9EA 3IB3A 3RGGA 2JFHA 4ETWA 3EUFA 2REQB 5IJ9B 2OEPA 4GRAA 1U0OC 2AUMA 3D8HA 1YL5A 4L5JA 5CW2A 1MC8A 5HGXA 2YV5A 1IOWA 1EA5A 3RDPA 1YDEA 4G4GA 2JI9A 3PNYA 2VQ6A 2XCOA 1WUKS 3C1UA 3MTEA 3N2NA 5AHWA 2DERA 1YUBA 5CT5A 1NFFA 5E4JA 2B7BA 1T2EA 4DLNA 5B58C 4Z3OA 3SHWA 3D6UA 3PXBA 4TMZA 5KTPA 3MWKA 3T3EA 1WZIA 1X0XA 1SQ6A 2BP7A 2O4CA 2XDQA 3LW7A 4MEAA 1NQTA 1NT2A 3T3IA 1R6VA 3LK7A 4BP9A 4RJLA 5T4FA 3B2NA 3IR5A 4NE9A 4PTYA 1DTEA 1LRJA 1NI3A 2X6RA 3F7OA 4D98A 2QRQA 2A57A 4UZFA 4KR2A 1GZ3A 1YRAA 4WESA 3DXFA 1RQ2A 4H18A 3SKXA 1GYQA 2JZNA 3IUEA 4ODIA 2VDWA 1E1RD 4NEHB 4QOHA 4PZPA 4B75A 4P86A 2NTVA 3QX7A 4TLCA 3RIMA 1E3SA 4PG6A 1H2RS 3FUUA 3NOXA 4JI1B 3ZE2B 4AKEA 1HFWA 1ONSA 5I47A 2R8XA 1M7GA 1WXFA 3NTLA 3Q7TA 5GVSA 4MGEA 4ER5A 4RD6A 2O7VA 3BFPA 4QPCA 4ZZ3A 4JJAA 1XXHE 1GPNA 3A6FA 5C8ZA 5K9ZA 4Y1RB 2A4MA 4HXFB 3WMXA 4BMZA 2W48A 5INTA 1U8FO 4I5EA 3RKUA 3G8YA 4X1IA 4NE7A 3ZQ4A 1SBZA 3HMQA 4UXHA 3ETCA 4DV2B 1KQGA 1EX1A 1MB0A 1ORRA 1WSAA 5G02A 1RXSA 3RVKA 3Q41A 1BMFD 4I36A 1A1VA 4K7JA 1OZFA 1NVDA 1RJWA 5JARA 5TARA 1M66A 4OL9A 4AN4A 3QBDA 5G53C 2NV6A 5FWXA 1Z37A 2FUKA 4P81A 5AI4A 1P1CA 3ND6A 1E3LA 1EVYA 1QUEA 5JDCA 1KWGA 3DLIA 4UOEA 3AZOA 3MC1A 1GNSA 3ONEA 5AW2A 4FZRA 3L8MA 2OB1A 3I72A 3CRNA 4X8OA 1NPTO 2EG5A 3B6ZA 1CY1A 1KEZA 2TMDA 1W1WA 4IL5A 4QJBA 5CJ2A 3S2YA 1NBEA 1WUYA 4KAAA 2RH4A 2WKPA 4P38A 3A4YA 3GQBB 1CY2A 3EEBA 5AM1A 4Y0VA 2W83A 3Q9LA 4KCGA 5K51A 5TMEA 2G1UA 3JQ6A 3OKCA 1HDRA 5GJCA 1EZ1A 4YRLA 3CEHA 3SR4A 3N3AC 3W2GA 4NBKA 5K03A 3H9EO 1SQGA 4NV0A 1MG0A 1AB6A 3KU4A 4EVQA 4C14A 3HJNA 1PX2A 4E32A 2H2HA 1J1UA 1A1SA 1ZQ1A 1LTKA 4B2YA 1RYMA 3CPHA 1T25A 2DWUA 2P9ZA 1FCJA 4WDQA 2FPSA 1L7BA 2MMCA 1P45A 4OMDA 4URYR 1U90A 4EPYA 1XYVA 1V3VA 2O5RA 1DKRA 2JLSA 4EGFA 5BW5A 2AEMA 4NS1A 5EQTA 4AMBA 2L69A 5KTSA 1WB5A 3D5TA 3F90A 2C1EA 4LNUA 1PGJA 3RFVA 3X1WA 5FH9A 1D2NA 1JU3A 1LC3A 2AVNA 3CYFA 4FOPA 4FP9A 3AILA 3WK9A 4ZCRA 3FDZB 3W5JA 5K0ZA 1PE0A 3S2IA 2X8JA 3ZVMA 4RJIA 2Q4BA 1JWBB 3PNMA 2FKAA 2Q5OA 3K0EA 1Y3IA 3SHOA 5EA2A 1BX1A 2YIJA 4AUNA 1J21A 1KSHA 2GF9A 5GJBA 3LUKA 1OYYA 4KQEA 2ZWMA 5U1PA 5KOHA 4IXMA 1CQIB 3U61B 1ODKA 3IUJA 3LCJA 4B45A 2J5XA 2J9RA 2RHTA 4ZZ2A 1E8MA 1WY5A 1KZYC 5JQGF 3DBLB 3RFCA 3WGHA 1XPOA 1DQYA 4L27A 3JATA 4DJEC 5ALUA 3O93A 4KFCA 1HQKA 2SCUB 3VNQA 1FDVA 3MGAA 1RLJA 2O7RA 1HDYA 4RCZA 1JSRA 3B9QA 1L6IA 4ME6A 4MWTA 2RKWA 3SJ7A 2W58A 2HSWA 1Z2NX 2IEZA 2VO1A 2W6JD 2J6CA 1R9JA 1YQTA 2BMVA 1XDBA 2O3RA 1QIEA 2YS7A 5DTEA 1POWA 2R0QC 1D0VA 4NV1A 1E2MA 4JIGA 5HUHA 3RS5A 1NYQA 2VFAA 2OP0A 1W48A 2Y8EA 3DWFA 3KVOA 4M21A 5JADA 1CQPA 1YZYA 1A8IA 4DB4A 3QUBA 2HIHA 4GO1A 5D01A 4E3ZA 4MJ7A 2FPUA 4NIMA 3WLHA 1NUPA 3AJDA 1Z29A 2N3ZA 4U7WA 3V1LA 2CVZA 1FTSA 2YHAA 3ML1A 1VYUA 4RKFA 3B48A 2EGHA 1RXUA 3IUBA 4R7GA 3GLHB 5D3MA 4CFSA 2QX4A 1BVHA 4NAUA 1LJLA 2M1ZA 3TLJA 1MZVA 2RKOA 3KELA 1JTVA 2G1KA 1JXOA 1OX4A 3GUZA 5D5PA 1OFHA 4J1TC 3RSHA 3UFXB 3U48A 3ZIAA 4DSTA 1VBKA 2WRZA 1CCWA 3NNDA 3IIEA 1D2HA 1WXQA 4YACA 4GBGA 2DHDA 3BB3A 1QPBA 5AFSA 5HW0A 2RHDA 2ZUFA 2IVFA 1AQNA 3WJAA 3P52A 3K1AA 2XTMA 1QFJA 1Z45A 4QGFA 1DXOA 3E9QA 3H3JA 1D2MA 1GWNA 1M6VB 2RGAA 3BFXA 1SVOA 3KYIB 4BV3A 1U8AA 1HH4A 1T5TA 4WZAA 2X4GA 1EB9A 3K9BA 2P9YA 421PA 4AMVA 3G2KA 3JALA 3BMCB 4TZ6A 3LX8A 1NDHA 5DPMA 1P2BA 2UYCA 1M2OA 2VL7A 3U1VA 2D4HA 1J49A 3ESQA 4HWSA 1IUNA 5DXFA 5HA5A 1GEEA 3X0DA 4DYDA 2QBYB 1UZNA 4AF6A 3D3NA 2PR7A 2V0NA 1IRXA 3QELA 4FJ0A 5DYGA 2JI8A 4QKQA 2V0GA 1NXQA 3A0RB 5JCOC 1XPJA 2FSGA 1YD7A 4C03A 1MXFA 1L7QA 1MQ9A 1PDWA 1Y8CA 4G5HA 3GZ4A 4PNEA 1UDXA 3GCDA 4XX0B 1TEVA 5IDYA 1W5AA 3TPFA 3TRKA 2FH5B 1DJNA 4H2DA 1NMZA 3REFA 4GP6A 3B6EA 5IVHA 3R6GA 2PUBA 3U3DA 1NUAA 3H99A 2IZ5A 1SKYB 1KDZA 5I7HA 1A4IA 3MAJA 1DAMA 4EF5A 3U7FB 4O4IB 1VJ5A 1ZA1A 2NO5A 3V1NA 1Z7GA 3R5KA 4YRKA 3WGKA 2FZWA 1XHEA 1VZ2A 5AKIA 3DNPA 3TS1A 4AG5A 1JXQA 3B5IA 2WWVD 2ZI5A 4F6RA 3G1WA 3T7KA 4YUYA 1R4AA 4PYMA 2DXIA 1MW8X 3DONA 3R9IA 2KWIA 3PF8A 7ABPA 2PJDA 4RMIA 2CF5A 4KZPA 3R7WB 3TIVA 5K0TA 2YN4A 4JMLA 4BVFA 1MJHA 3TDNA 1BCRA 1P9OA 1EWKA 3DL0A 4FFBB 1PL7A 5ISMA 4OFXA 4BBZA 1A72A 1I3LA 3P2MA 4Y2PA 2WSLA 4UARA 2HU5A 2EIXA 4HDMA 1V5IA 2NO0A 3TF5A 4D9CA 4DIBA 2P65A 4DSAA 3MWEA 5F2OA 1TVMA 1RKXA 2XJ9A 2FPGB 2GJ9A 2PO5A 1ZITA 3KPWA 4L78A 3D1VA 3QVMA 5TQVA 2GLXA 1N6PA 3BQ9A 2AHOA 2C3UA 2R8ZA 2MSWA 3OQIA 3IP9A 1BDMA 4IOMA 2QI9C 3V1MA 2ZB8A 2AFIA 3JQ8A 5FWAA 4BEVA 4BMVA 4ZV4A 5B6PA 1XEFA 2ZRMA 4YJFA 4EJSC 4YAIA 2IDZA 5DEIA 2JK1A 1RTTA 4CCAA 2LW7A 3A6KA 1M1XB 3ZKWB 1CUXA 4PINA 1SU6A 3ELWA 4O4JF 4UUMA 8ATCA 1CUDA 2RGNC 5AVWA 2GPTA 4GIBA 4K46A 3C1TA 1TCVA 3DZFA 3N74A 2CXNA 3WKAA 3IIKA 2PLRA 1DXYA 2B20A 1WE2A 2BEWA 3C4QA 4X8HA 5BSMA 1FZQA 4HZUB 4NYJR 3CZQA 4XW2A 3S1LA 5LQKA 4DV0B 1WVIA 4D46A 3F9CA 1Y1SA 2GARA 2G82A 2JVKA 2ZTHA 3CLSD 4NC9A 1P77A 3VPFA 3ZE8A 2GZ2A 2HDHA 2F00A 2NXWA 4G5GA 5CTAA 3RVBA 3H11A 4OSOA 3OTQA 4UREA 1SNYA 4IHQA 5C46F 2DPHA 1FNCA 1XWWA 3F47A 3C3CA 3FOAA 4J0QA 1Q44A 4KR0A 5FNZA 5BV0A 4HZGA 4LFBB 3OCXA 3KOMA 2CVHA 3A70A 3R3HA 2OA0A 5DM1A 4C5CA 2PUTA 2QZ9A 4O33A 2NP6A 2DPMA 2X58A 2ZIUB 1XMVA 2AT1A 4H7FA 3U60B 4YAWA 3C5VA 3EXHC 4PGMA 4HNVA 1W52X 1YQUA 3GDOA 2CE2X 2NZWA 3HLKA 4FFVA 4O3FA 3W0LB 3U9LA 3T3DA 2AXQA 4Q4AA 2OL4A 4Y2TA 5LCXA 1U0RA 4KUHA 1X1QA 3NBFA 3VDMA 1EUQA 2DT5A 3D6MA 1TMGE 2ZW9A 1U2RA 2JLRA 4M8SA 2YZ2A 5E95A 3UFBA 1MNQA 1PK9A 4M0KA 2HMTA 2QTCA 4I3FA 4MH0R 3SJUA 3U6BA 1LDEA 1EI9A 2BBTA 1CFJA 3UJHA 3WLLA 1SXJA 1JG3A 1OWPA 3BJIC 4WUVA 5LC1A 5IYZB 1JEQB 1Q0PA 4KNYA 3RVOA 3CT6A 1FP7A 4IDEA 5JJIA 1FSZA 2V8OA 4M7OA 3ECCA 2LWIA 4TYPA 2AMJA 2YQ5A 4UNNA 4WBNB 2RGUA 4IJWA 4Z1MD 5AVUA 4WXYB 3EUEA 3DO8A 4Y2RA 4FBGA 6CHYA 1Y1KE 4ZT2A 4AJ4A 4UTNA 5SYNA 5JEDA 2NO1A 1YZLA 2OAGA 5EWJA 3OUUA 4Z7NB 4C0QC 4G56A 3CH4B 4QX6A 3FCCA 1HOXA 5H82A 4LY9A 1QHHA 3JD4A 4PC7A 2CGEA 3BKWA 3IDFA 4B17A 2A33A 2WG0A 5ICMA 1N32B 4YRGA 3VR6A 1E64A 3IQHX 2FX3A 5D2CA 1DC8A 1S1CA 3MEQA 3S2FA 1KSGA 2PGNA 3H2HA 3HDJA 4DR2B 3K2BA 2J0SA 4L0QA 4BP1A 1O96B 4YA6A 5A4AA 3S55A 4ZJUA 2E5WA 3KZXA 4JSRA 1GAXA 3MILA 2BKUA 4D9MA 3N39C 2R7NA 3ZV6A 4AJNA 2GLUA 3A1NA 3AG5A 1YVEI 1EP1B 1I2CA 2OD2A 3OPVA 3RU3A 1XMSA 3N70A 2XYGA 4QFBA 4MVJF 1G7CA 4G0UA 1NQ5A 4KREA 1AKTA 1KRWA 1A7JA 1E32A 2WZBA 4J9UE 2GA8A 1D2RA 1P7PA 4U2DA 1CUBA 5KYXB 2JBAB 2ZB2A 4DM4A 4HN4B 2QTWB 4GD3Q 4HGOA 5IANA 5IJ0A 3DTNA 4U6QA 1WU7A 1GJRA 1U4NA 1JEOA 1C4XA 2PT7A 3LRXA 3WFJA 5A5FA 3GIWA 3FDJA 1EFLA 1QYIA 5IN5A 2W2OA 4PIVA 3PU6A 1XTJA 1G8SA 4CCYA 4O1IA 1LB1B 2XB8A 2A1UB 3FYHA 4QU0A 1HDXA 3PR1A 1PG0A 4FMBB 2C03A 3NTVA 4UPDA 2XA9A 3KTOA 3HB5X 3KFXA 4PG8A 4L8WB 4M9QA 3I04A 3SC4A 3WBFA 2V97A 3WYEA 1X80A 1K75A 4FR0A 4LYJA 4MA5A 3RROA 3TJRA 3R3YA 4GFDA 1OGIA 1OA0A 2Q45A 2X1MA 3ENVA 4M7RA 4N4AA 1T5OA 1MOZA 1OZ0A 3PL1A 5HILA 4E2XA 5L7TA 5FPKA 1I2BA 1JDVA 1CV2A 3ZD8A 5BSGA 1CERA 2FU5C 2ZQ5A 1U3DA 2IF2A 2Z0MA 3GU3A 2CCJA 4EARA 3DMPA 1PV4A 4QTYA 5JRDS 1DDIA 2PUVA 4BB9A 1BGXT 3U3ZA 3K0FB 3PUXA 1YQ9A 2IYFA 2M6LA 3ZQKA 2ECFA 2QM3A 1AQUA 1NVTA 3TNLA 3I6IA 5I9NA 1ZSVA 3ZU2A 3SQXA 3ZU5A 1NQVA 3E9MA 3ICVA 3QLEA 2WIGA 2V03A 3UH0A 4WCFA 4RTQA 2FMIA 1PLJA 4XIGS 1WCIB 3D8SA 2PLFA 4PG7A 4YGYA 5AP9A 1L4GA 5CHEA 2HEIA 1U9JA 1OX5A 2Q6VA 3ENWA 4BNFA 2ZAYA 4IWXA 1ODTC 2PL5A 3UXYA 1AKWA 1BXGB 2QTFA 3GFQA 4R9SA 3FY4A 1K92A 3H8JA 3KFVA 3IBTA 3QG5A 1HV8A 1ZVMA 3TEFA 4EB8A 3UB2A 5HKKA 3ADBA 4BPBA 1VMAA 2IS1A 4KX5A 3S7ZA 2OB2A 3ND8A 6GPBA 1XLWA 3SS7X 4KE9A 1W88A 4ZDKA 4F46A 4EYGA 4CQMA 2B9VA 2P5YA 2FMXA 1BEUB 2RGEA 3KQVA 4F72A 4RULA 1VJTA 4N39A 4E31A 1XKLA 2F8SA 4FGUA 3PUYA 4KFSA 5B1SA 4JDPA 1VCMA 3L7MA 7AT1A 1HOTA 1MO5A 4TMXA 5FA8A 3IQXA 4NENA 3HCOA 3QF4B 4N0QA 1EB8A 5EUMA 2C5LA 2H65A 4P22A 4AJ9A 5JZBA 1T8WA 2JH8A 2TECE 5J47A 3T3NA 4L08A 1P1HA 2PH3A 3D81A 3WIBA 4EVSA 4MR9B 4NYIR 4EG1A 3A6DA 4I4LA 4Y98A 4E4YA 1GAJA 1LK0A 1OFTA 2H5LA 1O95A 3HG7A 3JZDA 4HP8A 1EUCB 4JP3A 3MIIA 4XB2A 1YRWA 5DKFA 4Q9LA 4QECA 2HDOA 2Q2OA 4Z8YA 1G20A 2NU7B 1Y1LA 4I5FA 4Q3AA 4YMGA 1Q3KA 4LBVA 2FMFA 4KFUA 4KU4A 5H3CA 1BKYA 1O3YA 4X91A 3KYJB 2PSJA 3O91A 5CXSA 2XYRA 4HQOA 4V39A 3LC0A 1ZN9A 1K27A 1KI6B 5JCXA 3L6RA 3HO8A 3JVDA 4DTIA 3S81A 3B8EA 3AR8A 3HN6A 3AXSA 3UF0A 1WF6A 3TLGB 3U7QB 3E7XA 1SB8A 2XWBF 1DS6A 1EFRD 1BTOA 1D4FA 4OLBA 1K7YA 2IW1A 3FTPA 4WCDA 4X60A 3UT5B 5A06A 3ZWKA 4R1NA 5F9MA 1DT3A 3HKEB 1H2AS 4X90A 1VDMA 3F8SA 1H2BA 4B6QA 4DRZA 4FFPA 3RAJA 1NNLA 1H4TA 2HNAA 2RBEA 1H0KA 1Z6QA 1GQQA 4FSDA 1SEPA 1XT6A 4TLEA 4B74A 5K05A 3OZWA 5LWHA 3PEVA 4ZK6A 3L1UA 2B94A 1ZNYA 2V1XA 4PLTA 4PZ9A 4BNXA 1GFIA 4DA0A 3MBOA 2C0QA 2WFLB 4JT4A 4GMKA 5JXJA 2HWUA 4P5PA 3F97A 2XPCA 3JTMA 5A3VA 1F7UA 4GDMA 1KDTA 2GFHA 2X8WA 3FF1A 2DBQA 4WOPA 4XUEA 2DB3A 3V8QA 1GG8A 3VDXA 1LLCA 4HNQA 3WNQA 4KKXB 3DEFA 2PWBA 4OJQA 4DVGA 1DTWB 4GS5A 2H2DA 2Q1TA 3G6KA 4TV9F 1G60A 4WGFA 3W7AA 1MLDA 1CJSA 2Q9AA 2VN8A 4LZPA 4UNRA 3QLTA 2ZWAA 4LMRA 3BE5A 3RVMA 1UPTA 1T4GA 2FEMA 4QUKA 3BHNA 4BO8A 2HTFA 2AWOA 2QQ0A 1N2XA 2PUDA 1NXXA 3PI6A 1SVUA 3LP5A 3LQFA 1H0SA 3VH2A 1EYZA 2V1UA 3DZGA 3WI7A 1SCAA 4IHJF 1Z0FA 1ISRA 2C2GA 3VUFA 4KLAA 4Y2VA 3WHKA 5AKGA 1T9ZA 2FZ5A 4HDOB 1NHWA 3DZBA 4HSEA 3NDPA 4MRMB 4YGXB 1UPBA 3M6IA 4KTTE 4QNRA 3NLLA 4XGIA 1IB6A 1KEWA 1EG7A 1KU6A 2NM0A 2ZPUA 3L8YA 1R5JA 5G40A 1YGYA 3VOTA 2JEOA 5GJWC 5LR6A 1B7GO 2DWCA 4DR3B 2NADA 1MPTA 3DHWC 4OU4A 1NW8A 4UQLA 2O8FA 1F2UA 4LRXA 1VGQA 2BHNA 2D1TA 2WU8A 2ZSHA 3A4NA 1BNCA 3B1WA 5ECGC 1WXHA 4EG6A 1TJPB 2AQKA 4URZR 2H7XA 3BMQA 2NAFA 1IOLA 3F73A 3T52A 5J58A 5JNSA 1IM2A 1W4ZA 1V43A 1MC5A 2I3ZA 2GYVA 5JZ9A 2Q0XA 2AKEA 1EDZA 5EP4A 2BHRA 2C7VA 2E9SA 2VWGA 4LDZA 3CXUA 1E3JA 5LWQA 4EK9A 4OD0A 3A6JA 1YK0A 1NOIA 1ZEJA 3PGXA 4M54A 5HGJA 5BN4B 5FWYA 4KVFA 1C0PA 2AZTA 2QRVB 4WD3A 5JD4A 3M82A 1NJ1A 3HCBA 1RLTA 1P33A 1YHZA 2C2XA 4MPJA 1P3Y1 1S1MA 3PITA 1G20E 4WLUA 5KPDA 2YWRA 1U7UA 4PYLA 3LUHA 2WZQA 3A6HA 4AS3A 4PSVA 2PGXA 4J49A 4HS4A 1HDEA 3EGXA 3V2UA 4CG0A 4AN1A 2YJ5A 4PXSA 4ZVOA 1KPHA 1DAKA 4J16C 2OBLA 2P0AA 4I46A 3WL3A 1AJEA 1SCUA 3W3ZB 2TMYA 4FYYA 4JJ8A 1FL9A 5DTRA 1G8GA 5BURA 3ROEA 2B6NA 1KI9A 4CIAA 3H9UA 2Y0DA 4F84A 1H4VB 2EL9A 2FGJA 2BRUC 2Y9PB 3FUXA 1PR0A 3W5HA 1X77A 3GW8A 1R9MA 4Q3EA 1W0KA 2FPLA 4YMLA 4XZ3A 5LLDA 1XEXA 3OZGA 1SXPA 1SUAA 1HZZC 1JHVA 2FQWA 2N46A 2QJRA 1RIIA 4C7MA 4K2AA 2QLBA 1HE1C 1JDUA 2VF5X 3H1AA 3C3PA 3JQDA 4BYGA 4ETMA 4F1KA 2ZSDA 5L3SB 2FSUA 1XCMA 4HH1A 4UE2A 5CDYA 4K8OA 4X66B 2FCAA 4HLDA 2D8AA 2UZAA 4FCWA 4D9JA 3LPCA 4XYBA 2YJTD 5DGCA 2BFEB 4Z86A 2BC9A 5HE8A 5I9MA 4H0NA 1Y9DA 4R7ZA 2J7PD 1BEEA 3A3KA 4B32A 3UHPA 1UZAA 2YHBA 3OPQA 4QLAA 4Q05A 5BVGA 2XE7A 1NE2A 2Y1CA 5FOQA 4OBEA 1Z7EA 1YZKA 1VIMA 4ZO6A 3CW8X 1KSJA 4I5GA 2I4LA 4P54A 1UWKA 3CQ9A 4CM9A 1TJNA 1LEHA 1XI2A 3EFEA 3EIWA 3FPEA 3FWNA 4G5XA 4MUAA 1HT0A 1NPDA 2Q6IA 4JGBA 3U13A 4LVNA 4RIIA 1L1FA 1X1RA 4CKCA 1O0CA 1THGA 4D42A 3HSSA 3MFYA 4J8PA 1LH0A 4KRYA 1DADA 2I99A 3CNOA 1A7UA 4JBIA 2ODTX 3QVOA 1C9KA 1V6SA 2G7ZA 2H1SA 4FEAA 1CS4C 1TX4B 2E4YA 2GR9A 2NXJA 2QNRA 3BOSA 2J3EA 2F90A 2XKJE 3OZXA 3HVRA 5JJKA 3ABSB 3GVPA 3F5QA 4Z9FA 1H93A 5KBYA 4CVNA 3UK0A 2B1QA 4NZ9A 1BU8A 4B8WA 2YIDA 4IIJB 1TLLA 1P4AA 2BMFA 2MSKA 2ZAMA 3JR3A 4JH0A 3F6BX 2EQ5A 4J3NA 2DUUA 3ZY5A 5EJEA 1Z5PA 3HKBA 2J31A 4F4CA 3ETLA 2HA5A 3R3XA 5JIBA 2Y0BA 2XAAA 3N0WA 3CKLA 4MW9A 4TM7A 4F2HA 3R3SA 1XE3A 3IAAA 1J2RA 5THXA 2GERA 3GLSA 1DKOA 3QPUA 4KR9A 2E21A 1QRUA 1KNXA 2G67A 4PAOA 3CNEA 1V5FA 2WPNA 1WHTB 2C2WA 2AOTA 2O7SA 3KYDA 5B4TA 5AW4A 4XM2A 2ZT8A 1O54A 3DAHA 2ZS8A 3RK1A 3BD7A 1DUSA 3G9UA 4A0HA 2AQ8A 3IOMA 1JLHA 3A27A 1QGAA 3BCUA 1L4UA 3MRTA 3OM0A 1QWOA 4U3JA 4JI2B 1Y7HA 3CLTC 4QULA 1BYUA 4D8UA 1G7SA 4YC7A 3IAM1 5DBIA 3WBJA 4EKIA 2PU7A 3N86A 5AOCA 2IV3A 2JJYA 3O75A 1AX9A 2NV0A 2EZTA 4J07A 1LBHA 4GR4A 3ZHZA 4L9WA 5E6UB 3KUCA 4JC8A 1FMJA 1KY3A 2H07A 3DMGA 3EXG1 3ESXA 4N0PA 5ICGA 1FJ2A 3KSRA 3IDAA 4WKGA 3IEMA 4MHSA 4XKJA 2RGWA 4OX9Y 2FLKA 2POCA 4OUDA 3AI3A 3LQQA 7REQA 3UV6A 4YUWA 2ZYDA 4QUGA 4A27A 2QTVA 3H2YA 2J3LA 1ZICA 5C8YB 3O1JC 2JFUA 3CX3A 3LYUA 1AZLA 2ZIAA 4JSTA 2VCYA 4YP7A 1XELA 3HY6A 4RSRA 3TZKA 5TMPA 4CEJB 1CR0A 3IPYA 2SKDA 4MNTA 1Y6JA 1EH5A 3WNBA 5J2TA 3P26A 1RJDA 2GMWA 2I9KA 1PZHA 3HNOA 4WOBA 1K0FA 1A0OA 1FMLA 3RJZA 3I4CA 4B6EA 3EASA 3KAKA 1I8TA 3I1JA 2F43A 4XIYA 4BBJA 1QHXA 2C0PA 4P08A 1RCUA 2DX7A 4JSYA 4KE7A 3W6ZA 3PC4A 4ZDIA 3A2LA 1UQTA 3K6SB 1R5NA 1XMIA 1HTWA 1PK8A 1BRTA 1FDUA 4BAZA 4DC1A 1E5DA 1L2TA 3U1TA 3EXFB 3DKRA 4YMTA 1JEYA 2CEKA 4ZYLA 1GO2A 3O2SB 1N2HA 5B2ZA 4JXKA 1A5BB 1SULA 4RXMA 4L2IB 2PUHA 3HLYA 3R5SA 4WACA 1KMHA 3TQSA 2IBSA 3GZNA 3QGMA 1EBBA 1ITZA 4HG2A 1U0JA 4MYHA 1F4VA 1YNOA 3OA2A 2GAJA 2DHEA 1KI7A 2H1IA 2J6IA 2QS9A 4LSWA 4LJ4A 3WQHA 4EB3A 2P4QA 1W0JA 3TFOA 4JB0A 3SR0A 4CMGA 1QTQA 1AKEA 3WK8A 1ZD5A 3QXGA 1S4MA 4JX8A 3ZV7A 1VBMA 3K1YA 5T3UA 5FWDA 2JLZA 3P45A 1YZ3A 3OQHA 3P32A 4HB3A 4GYWA 4QLOA 3U56A 1ZLXA 3F6RA 2PZ8A 4ESVA 1Z4OA 5LUAA 4JYAB 1PT9A 3OLCX 3WGOA 4R2MA 2B4RO 4JKIA 3T9CA 3TSYA 1WQ4A 1XCLA 2J5BA 1U80A 5JAPA 2DETA 5JBIA 4OXNA 3EMBA 5CFOA 1PQUA 1QYVA 2ZU0C 1ZL0A 3AEUB 3NALA 4NBNA 2AG0A 2PCJA 3KX2A 1J00A 1NNI1 1PJSA 1EUDB 2B92A 4HUQA 3TEMA 4I6GA 3G5UA 1NY6A 4X24A 1P5RA 5EY5B 4HS9A 1XTUA 1L1QA 1U3GA 1W1UA 2JBWA 2R7AA 3M6MD 1JA9A 4Y9UA 3I2HA 3MCVA 1UKYA 2BIFA 2FW8A 3HEBA 5HKKD 2NX2A 5EHQA 5AVQA 3WQBA 4D57A 2WWFA 2BFDA 4US0R 2X3YA 3HE3A 1J09A 1MEEA 5BN5B 1OT3A 2FXIA 3R7BA 3PQFA 3UK6A 1E62A 1Z3CA 4DJJA 1QF9A 1BMDA 2IOHA 1M9NA 3CEAA 4IXTA 3IQFA 1ZD3A 4M1YA 5FTLA 4JJKA 2EJBA 4TVOA 2VPQA 4NCBA 4XXHA 2QT1A 3QJGA 4JN6B 5IAGA 3RIEA 3D5QA 1YT5A 1FBTA 1NMSA 4HPJB 3KCNA 4TSFA 1T5BA 3P27A 1SC9A 2FMUA 1T8YA 3AF4A 1U02A 3W5DA 2O7QA 3ZLJA 1Q1BA 4JOBA 3VSEA 2XHEA 1GN9A 3AVOA 2DQYA 2HSJA 3LY5A 3TOSA 1NG9A 1BDHA 3K9NA 4NFHA 5HKBA 1RFLA 3X44A 2FDXA 1L7MA 3GJXC 3P2KA 3N2LA 4JFAA 2M6KA 1XQ6A 2IWRA 5LXTA 3V6LA 1FVFA 1S5PA 1BCSA 2ZR0A 3QIVA 4G1UC 4JYCA 5EZ5A 5L4SA 3PTAA 1JBQA 5JS8A 1WUTA 1XRJA 1N75A 2DFPA 2H4FA 1YOBA 1BRMA 2JLAA 4ZQEA 1JIVA 4DUGD 4QVIA 1DAHA 4IICA 4NFYA 4KMOA 4EPWA 3FCAA 5H9WA 1LJ8A 3IGFA 1US8A 3JRWA 1I5RA 3J7AC 4DV5B 3GO4A 1XZNA 2HBRA 1CJUC 2PL9A 3PDJA 5C1IA 2NUPB 2UZ4A 3KZKA 2W6NA 3OLQA 3L7CA 1B6TA 4TT8A 3R5JA 1UK9A 3DWIA 5C34B 5C31A 1RS0A 2OO5A 1VB3A 1DV1A 3JVUA 4RVNA 5FOWA 1FW6A 2NUAB 2NUTA 1KPGA 3EQ2A 1Z47A 3EGEA 1EK5A 4ENWA 3CCFA 3M89A 4M49A 4OTZA 5CUQA 3RC1A 2FHSA 5KX5A 2PTGA 1TOAA 1LSUA 1SEVA 3BWCA 4I6EA 2CCGA 4CFYA 2PS1A 3E1GA 1YTLA 2QAIA 4ITVA 4DV4B 4DGSA 2J4DA 3IR6A 3OLYA 2D5LA 3SXPA 2K7FA 4EX7A 1LVGA 3FWYA 2IH5A 2B7LA 3KQMA 1AT1A 5JRZA 4R9RA 4I66A 1EUYA 3K32A 3BSWA 4TYNA 1RFGE 1NBMD 1ZO8A 2H4ZA 2C9OA 4U5XA 1JUDA 2V9CA 5SYAA 1KMNA 3ROTA 4E5UA 3RWMB 2WJ4A 2RJOA 3A3YA 5EPUA 2W42A 1P0FA 1QOQB 3ASUA 4QUJA 4LYYA 4PIPA 3TZEA 1MB2A 2Q5FA 3KPJA 3DYVA 5TS2A 4GZLA 4TUYA 4YK7A 1DBWA 1ZIYA 2ZETA 1MEJA 4F45A 4B5KA 4QEDA 2WHXA 5KYYB 4I8DA 1GGFA 1X7GA 4NBLA 4JI0B 2F62A 4O4HA 5TMDA 2X0RA 1RKUA 3WGVA 4BCBA 2FR8C 1I0IA 2G28A 4XRGA 4QD3A 4ALJA 4NICA 2UVPA 1XZAA 3CRQA 4KLZA 4LBYA 3CUYA 2Z95A 2ZYGA 4LV5B 3NUZA 3OLZA 2O0KA 1SB9A 3E2MA 2EERA 4AZ3A 2ZBPA 4NCXA 2DU8A 3MA0A 4KGDA 4M0LA 1K4YA 4LGMA 5FORA 5HBRA 5F7OA 5ALZA 2CFCA 1VYTA 3BRWD 2OR3A 4N54A 5ALJA 1U11A 1KXZA 4LSMA 3W5UA 5ALWA 2O8DA 1LJUA 1NYRA 2QJWA 4TX1A 4Z0HO 3JQEA 3TLEA 3LPDA 2WEKA 2RGXA 3HGTA 3MWJA 1QYDA 2R7MA 1XZFA 2WT9A 4IVNA 3OE7A 1QO9A 1UM8A 2ODAA 4K5QA 1A9OA 2Q2NA 4FIDA 3HP7A 3T12A 4LCJA 3T5CA 4HBZA 1UEJA 3EZ2A 2AGVA 2YV1A 4BJ1A 5LBIA 2PUWA 4L4RA 1QDLB 4PIMA 2C8VA 3GWGA 2VH1A 4QDXA 1YI1A 3FFBA 3MVEA 4ND8A 5ALXA 4BMDA 5CYPA 4S1TA 1YDMA 2ZUSA 4IKPA 2R25B 3NORA 2HCBA 2IPLA 1OREA 4C2TA 1EWYA 3H5NA 2JAUA 4LXHA 2R8EA 5CG1A 4QRHA 2FUNB 2HT6A 3Q2IA 1CY0A 3KV1A 2SECE 3LG2A 2WILA 5JANA 5LLSA 5KAMA 3NHUA 4GC9A 3TKYA 4RZIA 3QTTA 2EF0A 2JRCA 3N6VA 2XRMA 4HYYA 4P7KA 4LOJA 1BGVA 3NEAA 3KPUA 1NW4A 3TAUA 4H08A 4TKVA 2ODPA 3SXUB 4R8LA 3UK7A 1OLSB 1K6JA 1MC4A 3F49S 1KOLA 1P1FA 1TVKA 4LF6B 1YR2A 2YNMC 3DUWA 4ZAZA 1XFDA 3RJ5A 4ZTUB 1XCBA 3HUFA 3IBYA 1RQPA 4YT8A 3AF6A 2WPDD 2REQA 4RVHA 4NRDA 5BMVA 3Q3VA 3OMLA 1G64A 4K40A 2VF2A 4FXPA 4G1VA 4X97A 1XZHA 4E15A 3THOA 1PAUA 2QMZA 4BKQA 1CDOA 2GBCA 2JJ1A 2BGTA 2CNWA 3X1DA 5K6TA 3DVAB 1FDOA 1E6MA 3NANA 1C7IA 1HYHA 4KQ9A 5CIQA 2YMMA 1NI5A 2MCFA 3TECE 1DG9A 1HLPA 3G6WA 3OE4A 4FDVA 3FNQA 3L40A 4I1RA 1JHOA 5AI9A 4YMVA 3EJWA 2QW1A 1U1IA 1T4BA 2CLKB 1CNEA 3L7LA 4H7HA 3IEKA 4HK4A 3T1HB 1DG1G 2MYTA 2PRJA 4EB6A 2HJSA 2AR7A 4EVRA 1KK2A 5FCDA 3EZLA 1Z0DA 4P2GA 4IW3B 2P68A 4YAOA 3EIQA 4YTEA 5CH3A 4EX6A 2GTHA 4LISA 5CK4A 2ZXFA 5AJWA 5B57C 1SG9A 3V4SA 2ZBGA 2OBBA 3T3MB 4TTAA 3DDCA 4NYMQ 5HKLA 3VPHA 2NPFA 4V1CI 2WTBA 2OBYA 2Z2JA 2HDWA 3ECAA 2CB0A 1M2NA 3G1TA 3L6OO 3QUTA 2I6GA 3DFKA 3OIYA 3ME5A 4KE8A 1KIMA 1GP2A 5KYVA 5I9TA 3V1UA 2QGNA 3ZWWA 4AU1A 5C5DA 3A32A 2R84A 1W581 1I24A 1B2LA 1JSZA 1D5WA 5K8TA 5CNIA 2IYOA 4HGPA 4XGRA 3NHRA 5JD3A 3Q15C 4Y1RA 1OF1A 2VJAA 1KO5A 3FOEC 1V5GA 4R6XA 1H3FA 4B71A 1WBBA 3ZJVA 1BMFA 1PLLA 4RA6B 2R68A 3CUUA 3VNUA 2GI4A 3T8YA 5A0VA 5IEBA 1HA3A 2P35A 4C7OB 1H1TA 1SVMA 1YC2A 4G5YA 2FE1A 5G0SA 2VQFB 3QV1A 3TDKA 2JI4A 1Z68A 3GNQA 2P9HA 2BAGA 4HMPA 3U3RA 1GL3A 2Y93A 4KITB 3X2SA 2IXTA 3Q7SA 1TM2A 1LLFA 4BEBA 2IC5A 4WNCA 3GEMA 5TQ2B 3WA7A 3AB7A 3M5CA 3N2GB 3G88A 1K7SN 4XGKA 5BNTA 1ADGA 3L4SO 1LA2A 3H5AA 2GAIA 3UCXA 4LY3A 1N8NA 1OTXA 1YBAA 4INJA 3TOXA 2C9MA 2QL7A 2ZBUA 3JZAA 3AFGA 3JYOA 5A9SA 5DYWA 3KIPA 1WZUA 5LMZA 1AXGA 2HEGA 3CUKA 3HY4A 1H9BA 1XA0A 1OE0A 2VHCA 3UWPA 2R1VA 5KTNA 4P2BA 3KTAB 3GQBA 3OIDA 5AOBA 4BZZA 3SF0A 4RC9A 4ER3A 4UNQA 1UEIA 5C35A 1F6BA 1O97D 1II9A 4RZHA 3GCXA 1XRMA 4AG6A 3ZQJA 4MTLA 1FFBA 4GLJA 4G5RA 2QQGA 4N8DA 4XOIA 2C58A 2DWOA 3RNOA 5K7SA 5LFAA 5F3DA 2WP8J 3L1JA 3OIWA 1JB1A 4QIHA 4GXRA 5E7IA 1JXAA 5DHFA 1QG0A 3MJCA 1V1MB 5JRJA 3O7MA 5BQ5A 2G83A 1J6UA 4BO0A 3ZG6A 1JAYA 3LOPA 5KQGA 1Z5ZA 3C7CB 4LDRA 3EXG2 3UNXA 5EN4A 2F64A 2GN9A 3JVVA 3UJ6A 3WOVA 1FDWA 1GCUA 1SK9A 2CE7A 1PYDA 2CLMB 2OVBA 4XLZA 5BUZA 4KPEC 1WBDA 2OV4A 4TPKA 4PCAA 2I34A 2LDXA 3LO5A 4WUTA 5KTTA 4PTLA 4LXUA 4B3TB 3ANNA 1I4EB 3BDAA 4FU0A 4RESA 3FDZA 4B3GA 1SFRA 1GR1A 2UUOA 2JJ2A 5BQXA 1YF3A 3VMMA 1JQKA 3EC7A 4O4LB 1QR6A 1PJ3A 1MX3A 4TLDA 5BPFA 1UXOA 1A77A 2HI0A 1LBEA 3L04A 4BHTA 3DE1X 5IUNC 5LQJA 1ID1A 5CVJA 1ACJA 4F1JA 1IK4A 1KJ9A 1KE1A 2GK6A 4RSMA 1UQRA 1DC6A 1NI4B 2GAOA 2V7EA 2XWPA 3M6AA 1RVV1 5EQFA 4A2QA 4QOJA 1EVEA 5JW6A 2FN3A 3NGLA 4HX9A 2WFAA 3GVHA 2PM8A 4UEKA 4BMSA 2A14A 3ESRA 1DAEA 3DYBA 4K86A 4BV9A 4G86A 4JENA 1Y63A 3U9SA 2DQSA 3CX4A 4IZIA 3ISTA 3VISA 3W7BA 2YBDA 2FPMA 2OCAA 2ZJ8A 1TMYA 3L0PA 2V5AA 3NHKA 4D97A 1W34A 5EQJB 1K8ZB 1Q91A 4WT7A 2YKGA 1DP4A 2QZPA 2SCUA 4KXMA 2IXGA 4EI7A 1PCXA 4YPOA 1P4HA 2W6JA 2VAPA 2WYVA 2R6R1 2VZ9A 1QIIA 2X4DA 1XZGA 1RYFA 3C16C 1TFRA 4BNHA 2YCLA 2WG2A 4W6ZA 4KYUA 3V55A 1IHYA 5A4JA 3KOZA 3GPBA 4KBYA 1C1XB 8ADHA 1D0SA 1C0EA 3ELBA 5ALMA 3BRQA 5IULC 3WADA 5KWEA 1OBCA 1P74A 3NPMA 2CLLB 3TE7A 5H3HA 2EJTA 3P0IA 1N5LA 1P7YA 2IH4A 2IPMA 3KT3A 1RRVA 4Q9JA 1QKIA 3DHNA 2WUGA 3OHSX 4ACBA 2HJGA 4JZKA 4CKZA 5KQLA 3DL2A 3DV9A 2XQIA 4L57A 5TPWA 4YIKA 1GVNB 1T5IA 1VLZA 3UFXA 3ZE7A 1EESA 4WZBA 3WQSB 5KYNA 1C9EA 2I87A 3U2QA 1W85B 4MPDA 3TG8A 3ETDA 4CL2A 1JQDA 3JQFC 1VOTA 4R2LA 1GSHA 4DQ0A 1KMMA 1AB5A 2JGDB 1YU9A 5LP6F 2AQIA 4WI1A 2FP3A 1ECBA 4HAOA 2AW3A 1VPWA 2F17A 5K8CA 1M6VA 4FBLA 2FZ4A 4YAJA 5KVAA 3VR2D 4G3XA 3FJYA 1T9GS 4Q4HB 5FB3A 2ONZA 3WLOA 3PEEA 2VP6A 3BMCA 5FPYA 3RS9A 4XD2A 4CLRB 4XWOA 2ZJOA 3HDTA 5L6MB 3Q8LA 1OI7A 5K4AA 5LZ9A 1XQ9A 4MGZR 4YFYA 3UUWA 2QBYA 1BFDA 3PUJA 2LIVA 1NW9B 1L7RA 2DJIA 2YV3A 3BA6A 2VT3A 1KDOA 1WO8A 3N76A 3X2EA 3DE4X 3NWOA 5C3UA 4BAGA 4MS4B 4DIEA 3BE6A 4ZZ0A 5KKAA 1B8NA 1IY9A 2IIVA 3IJEB 4DSUA 1S2LA 4YLYA 3LYHA 3BIFA 1YA8A 4CQJA 1QGZA 4URFA 2GYUA 4OU5A 2BMAA 4XX0A 1CZKA 2O2CA 4NJMB 4QEKA 2QTHA 3ND9A 3L0DA 1JILA 3AOGA 5KQRA 1FLAA 4X95A 3ZYCA 1W9HA 2XZTA 3RRZA 5EHIA 2WVAA 1R8SA 1TTQB 2WD9A 1HE3A 3S40A 1SZDA 4O4IA 1RPTA 1MQSA 2PT9A 1H3EA 3HRIA 1B8PA 1E7MA 1HPLA 2ZTUA 3AUFA 4G4SP 3Q6IA 3N2IA 2I6FA 4JBXA 4MVCA 4WKBA 1L7PA 3MJ4A 2RHRA 1RWOA 2YR0A 3GNLA 5F21A 4RZ3A 4QM6A 4B87A 1ZM7A 3NEYA 5LL6P 2JARA 2QLFA 5EFZA 5KZMB 1XNQB 3P0EA 2X2OA 3DJFA 5EKSA 3K1ZA 3EMKA 1FLVA 1T2FA 2CLOB 3QVVA 4L4UA 1P60A 1FUEA 1PEYA 1V16B 3KK0A 2A92A 4R1UA 2HX1A 3ZGXA 4X7PA 2GK7A 1SELA 4MX8A 4UUAA 2XY4A 4WTOA 4WZZA 2FWNA 4X1KA 2COUA 5TLSA 1PNTA 4WFIA 3QTLA 2IITA 1O8BA 4N12A 2JAOA 4UU0A 3FB4A 3PFIA 1ZRMA 3E5RA 1IQPA 1ISIA 3DNFA 1Y82A 3HYRA 4OSPA 4Z9YA 5F5NA 3LPNA 3U9TA 3UJNA 2FPGA 4N49A 2V7QD 5F98A 1D4ZA 4BFVA 4BO9A 5MN6A 2QUAA 2OCKA 2F8TA 3RVJA 3KE8A 2I22A 4DARA 1ULHA 1ST3A 1ZXXA 3LXRA 4XASA 5EKUA 4CKWB 5KWSA 1TO2E 2VPPA 5CCXA 1S8OA 3ABZA 5FPSA 1DCKA 5JFGA 1KJWA 4H7PA 4DAOA 4MQUA 1ZHHA 1GG2A 4XM1A 3ZKWA 5BUSA 3BJZA 1NULA 4YMWA 1TUEA 5D7BA 3T3HA 2JLQA 2EJUA 4X64B 3WYAA 4I08A 2QMYA 5IBCA 1G2IA 5AJUA 1J1IA 2Q5HA 1JIKA 4M9RA 3I0ZA 3LUDA 4J6FA 3OMWA 3AP2A 2PT5A 4QGBA 2C9YA 4HZUA 3IDSA 2I3AA 3L7YA 3RQIA 5AIBA 5FF9A 4RA9B 2PGDA 4OH1A 1GQYA 1UP4A 1G8FA 1B14A 1K98A 2MR6A 2ZIFA 3WL7A 2FW1A 4FYXA 2XSZA 1DQNA 2P4SA 1FS4A 1H65A 4EW3A 4WZBE 3L6DA 4UXIA 3LHKA 3TN7A 2VPWA 4FOTA 4NULA 3AG6A 4H59A 1CR4A 4O2AF 1OV6A 2GKOA 3D7MA 2Q4DA 3U7HB 2YDYA 3ET4A 4KQ6A 3CURA 1N2CB 5BSHA 3Q72A 3L8DA 5BXQC 2JIRA 1N0WA 3TIIA 4EHIA 8MHTA 1C29B 1VE6A 5MDHA 5JAQA 4J4TA 4MQ4A 1RQRA 4WH0A 1G3UA 3R9XB 1MB9A 2V9ZA 1PGPA 3KFLA 1GZHB 3FPBA 3CLUD 3E9YA 3M6VA 2Q7XA 4HCJA 3GXOA 2Z9DA 1EDDA 1CDZA 3GFRA 2C83A 4G0WA 3KXIA 4G63A 4JK3A 5B30A 5BP7A 1U5BA 4UATA 4BTVA 3WMRA 4MJLA 2RAUA 3SOPA 3UW3A 3I09A 4XWGA 1A9YA 4GWGA 2PX5A 2VTDA 4D8VA 5GM1A 4M1TA 4DUPA 3TVYA 2IS6A 3BL6A 2GVNA 1P1JA 2YOFA 3RYIA 1N9GB 5I7EA 5J4HA 1ZWKA 2GM4A 2GZAA 4TRJA 3SXJA 2DR2A 5M7EA 3O4FA 1CQZA 1NP3A 2CXHA 3G68A 3O8OB 4QC2A 3R9WA 4L8YA 5IYZA 2OM6A 3CE9A 4E21A 4Z1MA 3G2LA 2NU9A 3E5HA 4HVAA 1W94A 4V0OA 4XCVA 2Q3LA 3MUOA 4JOSA 5AKYA 1C7QA 3TBKA 2BGJA 2DFTA 1BHO1 1CTQA 1X7YB 2H1WA 2NGRA 2VJLA 2I2BA 3HC7A 4YO8A 5ARCA 3TQCA 1KFBB 4WBNA 3MFQA 2GM5A 4PN3A 1A8HA 2V6FA 2UKDA 3T7SA 4XD7D 1PLKA 2YFYA 3H1BA 3MWFA 2ZJZA 3K9FC 2XAUA 1VMDA 1O2DA 2BM9A 3NMUF 1Z7WA 2XTAA 3FBWA 4ZXPA 1RDFA 5LLTA 3JARB 1QU2A 4MO2A 5FT9A 1CUYA 4U7FA 3I58A 4KBFA 2PL3A 3BWEA 4KIFA 5HCIA 4C05A 1XMOB 2PXAA 1E99A 2P8SA 1UBCA 2C9BA 3IULA 1ZN7A 3Q4GA 3H8WA 5B3JA 1EJ2A 1IONA 1KI4A 1V11B 2OTCA 2B83A 4NF2A 2FN9A 2HMYB 5EZYA 3QPCA 1FQOA 2FW6A 2FE4A 4PZ0A 1GARA 1R18A 2BZ0A 4GOMD 1DARA 4N6NA 5JT1A 2ERYA 3CVUA 3DLPX 3KLPX 3EVTA 4FGLA 4ZICA 5C1BA 4MVXA 5T6MA 1XAHA 3F8WA 5JV5A 4KYVA 1W49A 2XDWA 1J07A 3HYCA 3UAOA 3LVBA 5E2IA 2WNSA 1JQAA 1WCWA 2FPWA 2A9QA 2H1RA 1TC2A 2I7TA 2QZZA 3GRRA 2OD7A 3PNVA 4LOIA 4PGGA 4UBOA 1HMYA 5K99A 1FRVA 3C87A 1GPLA 2EZ4A 2HNBA 1QVAA 1Z2AA 2NZYA 3WGUA 3QWIA 2JAPA 2H2FA 2RARA 4WRRA 1HX7A 4C6RA 3HVHA 3LS2A 1SKUA 3OZUA 5KYXA 1NVUQ 1IXZA 3IMEA 5DTQA 4II7A 4F2PA 3A37A 2JGLA 3AX6A 4PZLA 5H3LA 1TO1E 3TSOA 1UPAA 1E79A 2Q1SA 4YVFA 2FETA 2IYLD 1Q74A 3PC2A 2LR0A 4NR0A 4ONEA 4S1PA 3KQKA 3MHTA 1N33B 1TPZA 1FJHA 4AUMA 3LC1O 1SXIA 1BWRA 1OFGA 2Z2KA 1Y34E 2XDYA 3IUPA 3KPYA 3M9XA 4KLCA 4QUAA 4NCKA 3OF2A 5D8DA 1U0LA 1ZIDA 4C0AC 4EW1A 5HZHA 5MN5A 1YJ8A 4Z7JA 5I4KA 3AVVA 4JX9A 3TM4A 3S2ZA 2XVAA 3RG8A 2JI6A 4FDLA 3LTEA 1GRRA 3U3OA 3HBLA 1ZGZA 4PO8A 2QMUA 1WPGA 2G0AA 4LE0A 5BSTA 4J7UA 3RF7A