2AB0A

Crystal structure of e. coli protein yajl (thij)
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
195
structure length
195
Chain Sequence
SASALVCLAPGSEETEAVTTIDLLVRGGIKVTTASVASDGNLAITCSRGVKLLADAPLVEVADGEYDVIVLPGGIKGAECFRDSTLLVETVKQFHRSGRIVAAICAAPATVLVPHDIFPIGNMTGFPTLKDKIPAEQWLDKRVVWDARVKLLTSQGPGTAIDFGLKIIDLLVGREKAHEVASQLVMAAGIYNYYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Atomic Resolution Crystal Structure of the YajL (ThiJ) Protein from Escherichia coli: A Close Prokaryotic Homologue of the Parkinsonism-associated Protein DJ-1.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Unknown function
molecule keywords YajL
total genus 71
structure length 195
sequence length 195
chains with identical sequence B
ec nomenclature ec 3.5.1.124: Protein deglycase.
pdb deposition date 2005-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01965 DJ-1_PfpI DJ-1/PfpI family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2ab0A00
4B40A 4MNTA 1N57A 4PXYA 4AUEA 4ADSG 3UGJA 4AUNA 3N7TA 2GK3A 4LRUA 4HCJA 1SOAA 1FY2A 1I1QB 2FEXA 2ABWA 1T36B 4OGFA 2ZUTA 3L7NA 4L95C 1GGKA 1OY1A 3UMMA 2W7TA 4ENVA 3R76A 4P36A 3PQ4A 3P9PA 1JDBC 1P7YA 4ENWA 3GRAA 3FIJA 2R1TA 3MIIA 3EZGA 3M3PA 4ZDIA 1VHQA 4UOQA 1IPHA 1QVWA 2ISSD 1A9XB 2RK3A 1T3TA 4E5VA 1P80A 3P9RA 2ZUWA 1T0BA 3R75A 3R74A 1VCMA 2NV0A 4UOZA 4L8FA 4Y1GA 4QYTA 1IZYA 3TTWA 5SYAA 2LXNA 2YWCA 3ZJ5A 3OT1B 1CS0B 4I46A 2NV2B 1PDVA 4BIMA 4WINA 3TQIA 3BHNA 2IUFA 1C3OB 1CF9A 4UNIA 1GGEA 1KA9H 3NVAA 3RHTA 1G2IA 4ENTA 1VCOA 2YWDA 1QVVA 3L3BA 3KKLA 4XLLA 4AJ9A 5JZOA 3F71A 1QVZA 4K2HA 4OFWA 3VU3A 4L7QA 1KXJA 2RK6A 4P2GA 4QYXA 1C30B 2D7JA 4OQ4A 1R9GA 1M6VB 4ENPA 3CY6A 3TTSA 1U9CA 4Y1FA 1QF7A 2AB0A 3F5DA 3CZAA 3OT1A 2WJZB 3TTYA 3P9QA 3NONA 2RK4A 5SY6A 4L8YA 3PQ5A 2A9VA 2R1UA 2R1VA 4UCFA 1FYEA 1QWSA 3D54D 5LIRA 1KWKA 1PE0A 1PV2A 4R7GA 1OX4B 3TTXA 5SY4A 1GPWB 1K9VF 4Y0NA 4ENQA 3L4EA 4JQSA 2V4UA 3B36A 1GGFA 3ER6A 4ENSA 1WL8A 4N0MA 1Q7RA 3PQ8A 1KEEB 3PQ2A 4RKYA 1P5FA 1PDWA 2YWBA 5E9AA 1JVNA 4BFLA 2H2WA 4WXYB 4Y1RB 1OX4A 4AULA 1S1MA 3P9SA 2VXOA 4P5PA 3SOZA 1Q2UA 2ZUUA 3SF8B 4GE0A 4ZDJA 2ZUSA 3CZ9A 2VRNA 4P35A 4ZGGA 1SY7A 2AD5A 5JZMA 3ZJ4A 4ZDKA 4BTEA 3CNEA 4B5KA 2R1VB 3TTVA 3WFZA 1IZZA 2VKTA 3EFEA 4I2NA 1GPMA 3ZR4B 5IP5A 2GHRA 4B7AA 4MTCA 2YWJA 3UK7A 2ZUVA 3NOQA 4D1YA 4Y1RA 1ONSA 3L18A 1GGHA 1QDLB 3PQ3A 4GE3A 3PQ6A 3SF8A 4ENRA 3NOOA 4MGHA 1VCNA 4L78A 4LGYA 5SY9A 1BXRB 4RKWA 4GUDA 4B31A 3EJ6A 4I4NA 1OI4A 4P34A 1P7ZA 3FSEA 3NOVA 4E08A 3CYFA 5BV2P 3UJNA 4OJYA 1J42A 4OGGA 4ENUA 3NORA 1GGJA 4UZSA 2XF2A 3PQ7A 3UOWA 1KWGA 1OX5A 3EWNA 3B3AA 4OIFA 1CE8B 1OX6A 2OR3A 3BWEA 5DFAA 3TTUA 2VDJA 4AUMA 3B38A 4B2YA 3EN0A 3MGKA 5K4AA 4N12A 1L9XA 1UCFA 1O1YA 4Y1EA 1GG9A 2R1TB 1P81A 2VPIA 4S0ZA 1I7SB 4L8WB 3TTTA 1I7QB
chains in the Genus database with same CATH superfamily
5EKSA 2RE8A 3ABRB 1K3UB 4R7ZA 1D1SA 3A1SA 3HY6A 1XN4A 3NWPA 3RAJA 1Y9DA 1YKSA 1ZH2A 2WWWA 3NDPA 4NCXA 1ECJA 4OGFA 3RB8A 3EISA 3U7QB 4AFNA 4B17A 4CM8B 5BW8A 2W2PA 3P2YA 3GW8A 3QELA 2A5YB 3BIOA 2FQWA 3SLGA 4H1HA 1YRBA 4IIDA 3PL1A 4C87A 1IVSA 4CIYA 4NJEB 1DO2A 2WT8A 4UHCA 4CM1A 2NLOA 2OAP1 2QR5A 3MMXA 1L8QA 4QBHA 2VF8A 3DM5A 4LJ6A 5J63A 5DBGA 5CAEB 2CDNA 3COSA 3R6TA 3RUAA 2JC3A 2X5JO 1K9SA 4BJ1A 4PRZA 4GKJB 1L5NA 2X8AA 2Z5LA 4PICA 4CMIA 4PS0A 4QPZA 1NZFA 5IBQA 4IQFA 2B8NA 3AEUA 4R05A 1QJCA 4NU8X 2WPDD 3DNPA 2AQIA 3WK5A 3QRWA 2EX4A 3QG5A 2GZHA 3ZCXA 2IUFA 2ORVA 1P39A 2YJ4A 1NBOA 4LI3X 4Q05A 5JH7B 4JKYA 1S2IA 4KWCA 1N2JA 2WLTA 3M6MD 5J47A 2JI7A 1K4YA 4KLNA 5KOHB 1X8LA 4L1KA 3ISTA 4JXKA 4QASA 4RFLA 1FFCA 4ZOLA 5AW3A 4G0VA 3IUNA 5BVHA 5E4JA 4O4JB 4I55A 3ZIAA 1MOQA 2QRVA 4JS0A 1U5BB 5IT9A 1LPSA 1I6KA 4HDNB 1XROA 1EFCA 2GKGA 4M1SA 4NK4A 3QYPA 2VJDA 1USKA 3RKRA 3B7WA 1NDUA 3C5VA 5EP3A 4IIXA 4YO7A 3VYRB 5C2JB 2GLTA 5FEUA 3H5RA 4EELA 1TRKA 3UC5A 4V0SA 2AEEA 3UOAB 3DE1X 3LT5A 3QUBA 1DP4A 3FVTA 4RYDA 3ILSA 1N1GA 2YC4C 4CQMA 4Z4GA 2O23A 1VL0A 4MA0A 4MPJA 4ZHSA 2FY8A 4EECA 4Y6QA 1IB0A 2O6LA 3IQIX 1ZNQO 4ZYYA 3D0KA 4UBMA 3WXBA 1DXHA 3ZWOA 2IUTA 4LZWA 4AF6A 721PA 5IKXA 1O94D 3AG5A 1YI8A 4ITVA 5MGBA 4AQYB 3I2FA 4WLOA 4Q47A 1POWA 4UZEA 3IOEA 3PXBA 4RGQA 1EU1A 4CZ2A 3MGAA 1H0SA 2EBFX 1VKOA 2Z9BA 2YJGA 5HF9A 4PONA 1AE1A 2YKGA 3QYAA 3GA0A 1JJAA 2C7RA 1OSNA 1P4GA 1W93A 2BM1A 3GDFA 4G23A 4XKJA 3VVLA 1PR4A 3N9IA 4B35A 4X94A 1UPAA 5ECDA 1KY2A 3MXOA 1VZ2A 1R0KA 2IDJA 3I9MA 1JIJA 3FMVA 2H2HA 1DRKA 1ODIA 2XLBA 3CJQA 3TG2A 3C3XA 2H07A 4F71A 2R47A 2R5FA 5FV4A 2BN4A 2ZWVA 4CGZA 1X13A 2FMHA 1K6IA 1GR1A 4RF3A 4E6PA 5A5GA 4R1PA 5J2UF 4E5KA 1Z16A 2O57A 4HQ0A 4CIAA 1CE8B 4W63A 3EAQA 5BYKA 1OB2A 2VA9A 2LRHA 4U7DA 1TQ4A 1GT6A 4JUIA 1KQOA 1H5QA 1AKVA 2IYWA 4YA6A 4FXOA 1BD4A 1BA3A 2XVXA 3GEIA 4MROA 5DBOA 5DGXA 2HSZA 4AF8A 1Q20A 1FFYA 1GA4A 4LRUA 1KDTA 4NHEA 3IBYA 4LWPA 2KB0A 4N6NA 4O4HB 5ILGA 5BQ3A 1ENZA 1ZGCA 3EQ2A 4KO4S 3G9UA 3CURA 3RBXA 3FRHA 3MCWA 1WHTB 2XMQA 2X2PA 4BCDA 3KV3O 1L5GB 2J0SA 1LDEA 1K97A 4JI3B 4B47A 2YUTA 2FWPA 4GPD1 4TPKA 5F2KA 5TJ9A 3AHGA 3ZN2A 5CA1F 2P2DA 3RYFA 1LLFA 1Z6PA 4BEVA 4F91B 5BWLA 1OFUA 3CB4A 3PU6A 2P5TB 1YT5A 3LUKA 2Z95A 5BSRA 5JS6A 1TF5A 1W5AA 4V39A 5AVRA 1XQVA 1Q6ZA 1XZQA 2W2NA 1XRPA 2AN9A 2GBLC 3IA2A 3PGVA 1DG1G 1S01A 4ETMA 4JYAB 2J6BA 1E4VA 4O1HA 1CEEA 3CIFA 3RWOA 2PM8A 2DSTA 4X3CA 3MMNA 4GZMA 3X1MA 4QYIA 1M6EX 4BO8A 3ACCA 3EXHC 3EG5A 4MW9A 1SB8A 4P4SB 3CXRA 1FYWA 1R3UA 4KAXA 1FJ2A 4YCBA 5HK8A 4PYRA 2RMKA 3MJEA 2FJPA 1G3IA 1G8GA 2DFDA 4PQYA 1RWKA 3DHYA 1HLFA 5K1ZA 4JLNA 4QOIA 2YIMA 3MBKA 1XO1A 1E1QA 1UXGA 2AB0A 1GTL1 1MABA 2PGIA 4WFIA 3WB9A 3WV5A 3EULA 4U02A 3KJQA 2GM9A 2PXXA 4P3OA 1YDWA 1G21E 3LUHA 4MEJA 1PJAA 4B84A 2EWVA 3EB9A 3VPCA 4D46A 1GDDA 2SCUA 3UPTA 1N1MA 4OGLA 4MB0A 3T1TA 2Y2VA 3P9IA 4HWRA 2BGLA 4D4IA 1FDOA 4ZT5A 1GAXA 2G9UA 3RTDA 2BTQB 4K9MA 4LY3A 2E89A 3WGIA 4TZ0A 5FXMA 1NJFA 7ABPA 1UR5A 3FNEA 4GPZA 3BD7A 4LF6B 2WHYA 3EIQA 1UPBA 4FMDF 4BIIA 4EVSA 4OYLA 2CXPA 1JJ7A 4MVJE 5CYPA 2G09A 5JZSA 3W1EA 4Z4QA 1EIWA 3I9OA 2CBXA 4Z4CA 4CV0A 2NN3C 4F5DA 1LEHA 3L1JA 3LNTA 4YN3A 3W6PA 1KK1A 2H52A 5ALIA 4GE3A 1EDBA 2F59A 3MQFA 2ZRPA 3FLMA 4WBNA 4INJA 1B42A 2I62A 3LQFA 2D0DA 2DPLA 2A5FA 3PKIA 2Q62A 2E6UX 3IHWA 1E60A 3ZZ1A 5IRCD 3NWEA 2XVZA 1PFGA 1FYVA 2NXJA 1B1AA 3ZJTA 1XRQA 1VECA 2Z9DA 3FAKA 3L6BA 1RXEA 1ZYUA 4RVDA 1YB2A 4U7FA 2RHTA 3ZZMA 1T4DA 2Q4EA 1TJ3A 3AW8A 2W2LD 4IAOA 2CLIB 5JV5A 1NX9A 4BFVA 4BMPB 4E14A 1AKWA 4PPNA 3ER9A 3P2MA 4UUPA 2QOEA 3H5IA 1N4AA 3DHWC 4LXQA 2YC2C 2ZPTX 3VFDA 2B4RO 5FI5A 1LDMA 2QZ9A 4EO4A 4BEWA 4K6KA 1XPOA 5BV1A 4JWKA 2XDWA 3CT4A 4I1UA 5KYYB 1V35A 3N1UA 2DFPA 5AVTA 4DRXA 1AN0A 3GI1A 5B3AA 1MC1A 2RAPA 3NTXA 4HNSA 4IQ4A 1GUYA 2P68A 4KX5A 4L95C 4CMKA 3IKLA 4Q3AA 2W7TA 3N70A 1MO2A 4CUJA 3IBCA 1XELA 4MW7A 1E1CB 5AYVA 1U65A 2EKZA 2P5UA 3NBUA 3C87A 1DEAA 4R8KA 4BNFA 1IBKB 2JRCA 2VLIA 4U2FA 3TL3A 4IKPA 2FK8A 2XCQA 2F7SA 4Z7JA 4O4JA 5K8IA 2IF2A 2W6QA 2GETA 2OFXA 4Z8YA 5JNTA 2FK7A 2F90A 2O9JA 3JRWA 9ABPA 3U4MA 5SYAA 1G5QA 2FSPA 5CD1A 3Q6IA 3ASZA 3X2EA 1SZPA 2NV2B 4QUAA 4BQPA 3K70C 5DHFA 3WQRA 3K9WA 3PNOA 4E4RA 3HPQA 1UMDB 1RLUA 3EIFA 2AFIB 1C14A 1EXMA 3GFVA 2QLBA 1UL1X 3KZXA 3NQ41 5CDHA 4US0R 1OT3A 1PUJA 2BHRA 1DXOA 1U28A 2QN8A 1J07A 1ENPA 2G0NA 3INYA 3L6DA 4JC5A 4LYJA 3RAPR 1NF3A 1P2DA 5HSGA 5IK2A 5AVOA 2EGUA 1STOA 2P40A 2F1OA 3CY6A 3QOWA 1CJVC 4CKBB 4Z2YA 2Q4RA 4TMFA 5KHLB 1KK0A 1SN7A 3A1DA 2QRZA 3AERA 3GZNA 1UC9A 1IG3A 1SB9A 3U39A 1X1TA 4KK3A 4D8TA 5A5EA 2IS1A 4MQFA 5K03A 2B5VA 4QHSA 1AGRA 1OWOA 2HF2A 2AVNA 2DX7A 4XLTA 2P9QA 2GXUA 2VZ0A 5AICA 3VR5D 1W0CA 4QUIA 2WTMA 2RI1A 5A9TA 4PTZA 3SLRA 5CH8A 2ZRBA 3WK7A 1NI4A 1NKTA 2UYOA 1IAQA 1QHEA 5J2UB 3ZHTA 4BNLA 4JJ7A 4FKBA 2HLNA 3UVEA 2Q3MA 2A1TR 2NNLD 2QL5A 1AUQA 2MYUA 2B7CA 3DYBA 3T3MB 3GLGE 1BCSA 5LBUA 1MC8A 2FPSA 4H77A 2I6FA 1VGVA 1L4BA 1FMLA 2Q3CA 4KGXA 1E2JA 1LRKA 4BO9A 3DOEA 4HNTA 5SZIA 4CWAA 5TV2A 4N7MA 3EBPA 3THWB 1A9TA 2VUUA 1HYBA 1BYUA 1G2PA 1W76A 4WLVA 3T38A 2G40A 3VPBA 4OX9B 1UXJA 2I1LA 3F7NA 1CZOA 1XTZA 3GJ8A 4C4ZA 5FAXA 1EDDA 4HAXA 3LFUA 1B8UA 4W1SA 2HA3A 1Q77A 1CP2A 1NUHA 1B16A 2EDCA 1Z2DA 3FNHA 2JGAA 3IAS6 3NYRA 4TLBA 2A0FA 4ZOEA 3SYRA 5K0FA 2OXEA 2A9PA 3EZ9A 4F2HA 5AVSA 5HPYB 5D5QA 5JXIA 4Y6PA 2ASEA 2HIMA 1AGXA 4ROTA 2GGSA 2R7AA 3OQBA 4ND8B 3QTTA 3RVDA 2F3PA 2Y93A 2ZCUA 1GRRA 2ZWAA 3CLSC 3VTAA 1LTKA 5AVZA 1PQYA 4DV3B 1DRUA 2EU8A 3LFTA 4TLDA 4IIJA 1K92A 3ECSA 3LQRA 4ARVA 1BWQA 4YCSA 4XWKA 2BOVA 3TIIA 4V0QA 3LQYA 4RTNA 4OUDA 3N0VA 3GGSA 4C3UA 2UUCB 1L9XA 1Z4KA 4S05A 4LE2A 3WLIA 2OV3A 1CUVA 1JU9A 4OLJA 3RSZA 1UUFA 4P7KA 1N5DA 2G1KA 1E6CA 3O9ZA 1X7GA 1E2DA 2POQX 4WECA 3R0QA 1Y9AA 3S5JA 5KQLA 1LLUA 3GEGA 3W5DA 3F2IA 2GXAA 1RABA 1UBEA 2ZANA 1LWOA 2NUAB 4AX4A 2GD2A 2CK3A 3G2LA 3CUWA 5I4KA 2V7QA 2Y27A 5EMKA 5AW6A 3TOVA 2ZDHA 1IQUA 4IJMA 3V34A 3ZWNA 4EI2A 1BWPA 2OHJA 2HRBA 1DJLA 2QP4A 3Q41A 5FBRB 1QKJA 1GTG1 3PR2B 1C2YA 4TMTA 1HRDA 3U19A 1SWVA 2A33A 2PNFA 3EC1A 3TSWA 2C78A 1GSIA 3PEFA 1UDWA 3W9SA 2I2BA 4F4DA 3WYFA 3I9LA 3F74A 3ORSA 3ZI0A 4IUYA 1XZFA 3IVGA 3I4CA 2GK6A 3P2JA 5EXPA 1CS0B 3MTQA 1JQJC 3WL6A 2N42A 2CBZA 4EB0A 4F85A 3KL2A 4MRNA 4DDUA 2ZIXA 2ZI4A 3O4RA 1E6WA 1YASA 4IICA 5GZ6A 2SCUB 4MUBA 1E2FA 4NV1A 4PZLA 4I0WB 3S99A 2FUNB 4OFWA 3I45A 4BLVA 2QX6A 2X9GA 3DCJA 3WFIA 3F0TA 3BWYA 1OAAA 4ARZA 4CIWA 2C5BA 2GKSA 2GPBA 4DIDA 3DEJA 1Z4JA 1VJ0A 2V7TA 4DRYA 2OGSA 4NYMR 3KYDB 1QFSA 1RC1A 3PRKE 3TINA 1W36C 1GUAA 1GU1A 2Q2QA 5BN3B 1M8JA 1IEXA 4GX5A 3N8HA 4O2AB 1J8YF 3GEHA 3ZPXA 3KJIA 4JGBA 3FNGA 4AYTA 1ZC4A 4C0KA 4UMVA 2Z43A 1E99A 3WRXC 3VDXA 3TVYA 1N7GA 4E03A 4CIDA 1OFHA 3PTZA 5B64A 5I5GA 2IFTA 4ZANA 1QG4A 2GB4A 1USUA 4R54A 4BO3A 3VHLB 3FHLA 1W4LA 3RT9A 4DLXA 3E3OA 3FNBA 5CYGA 5AI8A 3HDHA 1CNMA 2A57A 2BMEA 2Q4DA 4EJSA 2E87A 2WIKA 4UM9B 3AUSA 4MITA 2DH6A 4ONEA 4OREX 4OYRA 3UZUA 2AYYA 2PPVA 2OLEA 1E94E 3INNA 4AG3A 1RKVA 4RQBA 3T5BA 3ISVA 4LDPA 1UADA 5IT4A 5ELXA 1FDVA 4BMOB 2YIJA 2VQFB 4NAHA 1N5KA 5HP4A 2GCPA 2XT0A 2QRLA 2WU1A 4FFRA 2ZPAA 2ZUCA 1HLPA 3K73O 2F43B 1YJBA 3N59A 3OD1A 4UPDA 2EW2A 1DVRA 3LHFA 5ECYA 3RG2A 3NPAA 4P31A 2IJGX 2OK8A 5AJUA 2B0CA 1E92A 5A0FA 1R0CA 3C16C 3A32A 1KPIA 1M9NA 3COZA 3ZI7A 1ZNYA 2A9QA 2QVCA 1IEQA 2X5XA 3HU1A 1VIDA 4N7RA 4L4ZA 4JUCA 1NSFA 1Q0UA 1TFRA 3I3OA 4JEUA 4X1IB 4D6YA 1P0PA 2OAQ1 1R0YA 1A72A 3JAWA 4OJYA 3K9HA 2AZMA 3D6TB 2AL7A 4WFKA 1IDOA 1V25A 3AR4A 3MGGA 3IQEA 2J5KA 2GAJA 3SC6A 4C6SA 3G0GA 1NC1A 2DAPA 2UYYA 3WXMA 2C58A 3OFJA 3WP1B 2BKLA 4B2PA 3UK6A 1Q91A 1NVVR 4HQ6A 1G7SA 3ON5A 1E2KA 4YMLA 1MC5A 1T9ZA 3QWFA 4UU8A 2C2ZA 2W8ZA 3I2JA 2PUEA 4DMMA 4PZDA 3IE1A 2G07A 3DEHA 4MW2A 3RC1A 3RC8A 4WZBA 1CRQA 3M4NA 3HCEA 1YZTA 1JLMA 4S3MA 5AIBA 3ZE7A 3DYVA 4FE7A 4WKCA 4ENVA 5KJCA 1CFJA 3PX7A 1Q12A 1GN8A 3REFA 1E9VA 1VHQA 3L5KA 3RJMA 3UMSA 1SHJA 5JATA 5KVVA 4S1NA 1W9MA 1KS9A 4W8GA 1UP6A 4JYPA 1YGYA 3NH9A 4HGZA 3D4OA 3R75A 5JSYA 4AAYA 5J58A 3WICA 2C4VA 1GDHA 1Z0SA 4TVBA 2P1ZA 4FD3A 5DB4A 2P6OA 4TWIA 3VVCA 4F12A 3RAFC 2P6NA 3NI2A 3GPDG 4IZOA 2V45A 3DEFA 4B75A 1H1TA 4FHFA 4KNVA 1A9SA 1GGEA 1YCDA 3F5QA 2EV9A 5LLSA 4ARCA 1TUBB 2IX9A 5HMMA 1QVVA 4O1IA 3SVTA 2PKXA 4GI7A 1JTFA 1V5GA 4U2KA 1WEHA 1OBHA 5JXJA 1BOFA 3TLGB 3EGWA 1UK9A 2IBTA 4PG7A 4AZTA 1WW8A 4RD4A 3K70B 2I87A 1NNLA 1S8AA 2WFZA 3H9BA 3RYHA 2Z2JA 3KLMX 4EMBA 4CEIA 3GLVA 5K0LA 1BCSB 2ENWA 3LU1A 1NQWA 5EZYA 1L4MA 1YQTA 2XCSB 2JCVA 4FYHA 3MZ0A 3IMKA 3KK0A 2E2WA 2BBOA 2I8AA 4Q7LA 4V1CB 3S81A 2R9VA 3SQLA 5IPFA 4BMXA 3I3SR 3WIVA 1CCWA 3G2QA 1GAEO 3KLOA 2QR3A 2UV8A 4E94A 2B20A 1SXJB 1R4NB 5AVKA 4PGAA 5E9AA 3T4XA 4RF2A 2H2WA 1KK3A 4A6PA 2MT9A 2Z56A 2J0QA 1ND5A 5HTOA 1V4BA 1G9XA 1KZ6A 2VDWB 1V8DA 1XQ6A 3DTNA 1NRXA 2W2XA 4UM9D 1R74A 5DWVA 1U9IC 5IF9A 3NVMB 1RRKA 5CXXA 3L46A 2O14A 5TGDA 4A4DA 3FLAA 2XF8A 4CDRA 4IINA 1NE2A 3A1VA 1Y63A 5FPTA 5BY2A 2PLAA 2XIQA 3ML1A 4RVCA 5EFZA 1NQVA 1XDWA 3EA0A 1KFCB 3FPJA 2ZS9A 2VIIA 3MCTA 2WYWA 3ND9A 5DNVA 3IT3A 1HTTA 4JEMA 4NE9A 3KWFA 5HQ3A 3KT6A 5E6RB 1NW3A 2QAJA 3OIDA 2BSXA 2MJLA 4WLEA 3JYNA 4WJLA 1WETA 2BJWA 1QYVA 3K2BA 4NKRA 1X15A 3UHFA 2JFZA 3SEQA 4Z9FA 4DLRA 5KSZA 1DGQA 2B1RA 1G3QA 2JFXA 3RTGA 2ZDGA 3ILHA 4J16A 4MQEB 2XJ4A 1IQRA 4YONB 3PNYA 3T7JA 5I5EA 2CXHA 4XQ0A 4ZAWA 4EKGA 4FZ3A 4LZJA 1JFSA 3N7AA 3A8TA 1RE0A 1TMGE 1QIJA 4D0SA 5F76A 1C1HA 4MQMA 3FWPA 1T91A 3ICEA 3AJRA 4I81A 2XF2A 3C3BA 3K9FC 1USGA 1EVLA 1QHGA 1JKMA 3DXFA 2QPAA 3GJ3A 4RHXA 4LWZA 3RNLA 1E4EA 1ULBA 2Y0EA 1N9GB 1BX0A 1TJNA 2XDAA 4FFSA 1WE2A 3QNMA 5AVVA 2ZJFA 1O58A 1JGTA 3V4OA 5G0TA 2PY6A 3JQFA 2V0CA 4MYUA 3L1KA 1UBHS 2ZKLA 4QJIA 4EPXA 2BFAA 1F5SA 3QY9A 4M7OA 5CJ2A 4M22A 2JGLA 3PUHA 4I99A 2Z04A 5KQMA 3OE5A 1GTSA 3IDZA 3C1AA 3UKOA 3FPCA 1F06A 3M70A 1NIPA 3WV4A 5EVCA 5I01A 1O57A 3V9PA 3PVCA 3S5UA 3GRRA 4DBVO 4RJ2A 1NPDA 3AHCA 5IM4F 1FLNA 4FN4A 4B6FA 3FHOA 2W93A 4QQFA 1AUOA 2GJSA 5DX1A 3I58A 2LDXA 1YMVA 2GZ1A 1GYRA 1H23A 1OROA 2LDBA 3ECCA 3WNCA 5BPHA 3OTOB 3HK2A 4G5YA 1YRWA 4KPGA 3OTIA 4MJXA 3N28A 2OORC 4Q02A 5ALPA 4DA0A 4G1BA 1JLLB 3M9LA 4NDAA 5LYJF 1ECGA 1NW5A 2HHLA 3UJDA 2FDXA 2FOLA 2ZI7A 5D84A 4A3SA 1X1EA 1N2XA 4OKNA 1ZIYA 1FFXA 1KTVA 2ZRCA 4YASA 3KALA 3SYNA 5HM6A 1VGQA 4NS4A 3H1BA 2I4LA 3TQFA 5AVJA 4PZEA 2AKYA 4O2AA 1OBVA 2DUMA 5EGNA 4AURA 3JVVA 3LSTA 3NJ8A 1J0BA 1KSFX 1XQWA 3I6QA 2WINI 2WU8A 1YR3A 3AGPA 1TIPA 1TK3A 4WXRA 3ZGYA 2IDKA 4RH0A 1QO0D 3VPGA 4AZVA 1OKKA 1OFVA 2VZ8A 4ZMSA 2Q2OA 1J2EA 4N7BA 3HZZA 4LOLA 5EZYF 3ZG6A 2EF1A 4D99A 2CD7A 3S1SA 3A26A 1KFKB 1D6NA 1C9MA 3LHDA 3Q5EA 5DYIA 1TZ2A 3C3YA 2I2FA 5LIRA 1P7WA 3NJ4A 2YHIB 3ODPA 1P0FA 1BYIA 3PIDA 2HPHA 4U3JA 4YJHB 2Q6LA 1N6KA 1W5EA 1XZDA 1EFRD 5IC6A 3IP5A 3E6AA 2YXNA 3KUXA 3M6FA 4LPSA 5PNTA 1K8XB 2Y1EA 2QJRA 4OATA 1DJOA 4PC6A 4MINA 1WSWA 1K5PA 2XD4A 1PR9A 1Q5PA 1WR8A 3OX1A 1AKQA 1A98A 2HY7A 2J9FB 1K7XB 1WU7A 1TC1A 3DBHA 3ENNA 3GV0A 2P4UA 3GEMA 4MWEA 2CDRA 2FPUA 5L45A 5TPZA 2O5EA 4B5KA 1NLZA 1BZYA 2WAMA 1XCMA 3OE7D 4QM7A 1UBTS 3DV2A 3KNZA 4P4LA 1Q1BA 2GSDA 2PIAA 2VT3A 2B82A 1WUKS 4KIGA 2JPDA 1TXGA 2B3TA 1RXCA 3KYCA 4MKFA 4MUGA 4R1NA 2FRDA 3RR2A 5BN1A 2QNIA 5D3MA 4KFTA 4IDAA 3JAWB 1E98A 2GJ8A 1XWFA 3OUZA 3TLYA 1GSOA 4UATA 1OI3A 1KOGA 5DNWA 4AMYA 4H4CA 3KSMA 4BJ3A 2CFOA 1H4TA 2GYYA 3KSAC 3F9IA 1JWAB 5LZ9A 3CS3A 1ZK0A 4DIUA 1ZHHA 1ZXXA 4RF5A 3DBVO 1FP7A 4KE8A 4R8LA 1AK1A 2JHCA 4GUDA 1BGVA 3ZHXA 1QFXA 3UJAA 1CE8A 2NP7A 2NXCA 5CLFA 2Z2IA 1ODJA 3VU0A 2CLHB 1UZLA 3L0DA 3D2AA 3ORHA 4QBFA 3CVYA 3U6KA 3UFXA 5TT0A 2V1UA 3T7RA 2I6UA 3WGLA 5CPFA 5IAOA 3EIXA 2O07A 3KZVA 1A8SA 2GN2A 3VI4B 1WF3A 5CB8A 3CUEF 2JFPA 1DEKA 3DT8A 2WE7A 3A11A 3EK2A 4LBVA 2DETA 5DHUA 5EA2A 1PGOA 1B8PA 1VBNA 3MTAA 4M9XA 2VBGA 1S2MA 4MQUA 5KVQA 1H1LB 1OBOA 4JP3A 3MWKA 2WZQA 2ZSJA 2EFDB 3QBDA 4A0RA 1RC8A 4C7BA 2FSSA 4PIPA 3CXUA 3FNRA 2VUIB 5F7XA 2ZUTA 5CLJA 3A6DA 2H9YA 2ATIA 4J0FA 1F8YA 1RRPA 1T8UA 1YKGA 3RYFB 3WOVA 4C1BA 3Q2KA 2WF6A 4TYNA 3RT7A 1DQPA 1KSGA 2Y67A 4E5MA 4CLRA 1EI9A 1A7AA 1IZ0A 1RZVA 2EX1A 4WLNA 3T3DA 4GPTA 1EB9A 4LX8A 1OMOA 4AP5A 4DSNA 2J09A 2QP3A 1R7RA 4FD2A 2OBNA 2Q5FA 1JAXA 1NWCA 4RDHA 5AKYA 2A88A 4S1OA 1BCRB 2DBQA 5CFNA 2PL3A 1XTJA 1E2MA 5LP6A 3I2GA 4G36A 1I4TD 2JKZA 4ZVUA 1Z75A 1V48A 5T64A 1J24A 1F12A 1XCJA 3WK9A 1OXBB 1WZNA 4QRHA 4K9SA 3V1KA 3EPHA 3K35A 4RORA 1DC8A 1THGA 2OE2A 1G8HA 3GLUA 1MPTA 1JKJA 3M49A 4P2GA 1Z56C 2PYZA 3UAGA 2VH2A 1L5ZA 3IKMB 4G63A 4IVRA 4JBHA 4UBKA 4WGGA 3VV3A 3LKZA 3ZWMA 6LDHA 1CWUA 1LF0A 5T7BA 2WLSA 2XGMA 4MLPA 4L0CA 5ADUS 1Q1ZA 2H7CA 1PJ2A 3OBIA 4EG0A 2WI8A 3TMAA 3NALA 1XAIA 2FCAA 2QVXX 1GPWB 4BQQA 1NU6A 1YUMA 2H57A 5KREA 4NAVA 2XUIA 3VHQA 1NP3A 2QQGA 2WW8A 4MKZA 2OLKA 2RH9B 1TT5A 3CEAA 5E6SA 5ICEA 1QNLA 3QNWA 4F4CA 4HO1X 5T8KA 5BXYA 1Q1EA 1L7NA 3H5NA 3ILVA 4NZNA 3R20A 3U7EB 3TW6A 4U7TB 4N76A 1WY7A 3G1TA 2ZYAA 3SE7A 1IZZA 1UMKA 2I22A 2ZEJA 2GN6A 4IVPA 4KUGA 1P1RA 2CEKA 2P35A 3CSDA 3F47A 1T0UA 1FTSA 3TKYA 2F4VB 3ELBA 4OJTA 1DAMA 3B3FA 2RHRA 3CMMA 4DT1B 5BWBA 1B4DA 2J8ZA 2N1BA 3HCDA 4HAIA 1T1SA 3AJDA 1HRKA 3LH5A 1DKMA 3LC2O 2ZRAA 3JQAD 4QPDA 2NQ2C 4ARBA 3NTLA 1ZGZA 4Q9NA 2YV2A 2JJ2A 5B6IA 2E4XA 2H08A 4UNSA 5CB4A 4PW0A 3ZCSA 5JTTA 4QTXA 1QIGA 3TZ6A 2VSFA 1MFPA 2C9DA 3IIJA 5JNRA 2CLLB 4P86A 1LBSA 4HDSB 4TXJA 2ACKA 3DDZX 3LQ4A 1KZ4A 5EWJA 1XQ9A 3EXAA 3KELA 1MJGM 1GGMA 1Z07A 2A5LA 3L5OA 4NOMA 4BWVA 3IT0A 4FYIA 1R0XA 2AFRA 2GO7A 2HDNB 4A10A 1PUXA 4M1EA 4QT4A 3KB6A 4QICA 1LDYA 2XVYA 1Z4OA 3Q9NA 4DDWA 2V4ZA 1PKEA 3BRQA 3EVGA 1MMFB 2NZUG 2YW9A 3A3NA 3F3YA 4MW4A 5JXWA 1O0BA 4B40A 1GFSA 1BGXT 3JCZA 2H0RA 3R4CA 4LDRA 4P53A 1KO4A 2WHPA 4FFOA 1GL6A 2WY2D 2B4KA 4W5OA 3OQVA 4UD6A 3A10A 4PSDA 4LISA 3KAPA 4X8LA 3C7CB 4EY6A 1BO6A 1TEHA 1YOVA 2D3WA 3IUPA 1ESEA 1YE5A 4IDBA 1NSYA 1W34A 4URUR 3REGA 2OBLA 2GD0A 2X8JB 3CNHA 3P9PA 3IO3A 1LTHR 4IP0A 4L27A 2HU5A 4OO3A 1H9BA 5E9JA 3RLFA 1JA0A 4GKKB 4EK9A 4RM2A 1RZ3A 1KNXA 4UEKA 2AI2A 1JEEA 4MDYA 1JJFA 5D87A 3ZU6A 1XK6A 3GLSA 4J76A 1J7JA 1SKAA 2DJ5A 4QPPA 2W8BB 2OFFA 4E2XA 4IZ6A 3HSYA 4GSKA 5E7MA 1ACLA 3OT1B 4ZEVA 4DUZB 5H9VA 5DHTA 5C5EA 2X0EA 2CSUA 2G7ZA 2OKCA 4CLOA 2RKBA 2XE4A 4WINA 1F2UA 1H8ED 1N0WA 2AG5A 3GX1A 1A95A 1QRAA 1V5FA 2PKCA 5GIOE 2AZXA 2P9FA 2V54A 3INGA 2A30A 1H1DA 2QGZA 4K2HA 4N5LA 4A15A 1T29A 4HGYA 2B2CA 3HM2A 5E3HA 1RYNA 5CIQA 1GKIA 3O1IC 2FZWA 1M34B 2MYPA 4ND1A 4YAFA 5H3LA 4C14A 2WJWA 4EHDA 5K4GA 5M29A 2EP8A 3C74A 3QFTA 3AZOA 5DK6A 4BNMA 4MAMA 3IPXA 2QLJA 2J4DA 2C7GA 3E9RA 3DMTA 3CLHA 1BD3A 1UP7A 1X14A 3KP1A 3IUEA 2H7VA 1IXRC 2YWEA 1UJCA 4NZ9A 1NPYA 5LQJA 1QU2A 1EFPB 4A2CA 3BS4A 2HC9A 1JIUA 1Z9BA 4M7RA 1PD0A 3D7SA 5T8KC 4BFCA 4L5JA 2FWAA 3HN2A 1M6VA 2B5OA 3DMGA 1U7ZA 2GZSA 4GLFA 1MR3F 1K5GA 1T9CA 2BZGA 1KO8A 1GZHB 2Z0MA 4FFBA 4N3NA 1P2FA 2G1AA 3MERA 4KO8A 5AOVA 3RJTA 4OFBA 3K8QA 4KSBA 4TWRA 1XMIA 4NZYA 3IDOA 1TA4A 3ODGA 4UXIA 5DI3B 2ONJA 4AKGA 3Q3GE 2ATVA 3W5CA 4H1TA 4IX9A 5AW5A 3WKDA 1B76A 1AQJA 1PX2A 3QVVA 1T8TA 4MKIA 2XMZA 4FKZA 3AVQA 1VTKA 5TQ2B 4FOSA 1JP7A 2PX2A 4EYGA 5CVVA 1P18A 4OXXA 2ZRHA 1J5PA 3W3AH 1VI6A 3AETB 3LUPA 3N6XA 1FXSA 5H02A 3S1AB 3HYRA 4IUBS 3N8IA 5CB4F 5MFPA 4CEHB 4EATA 4H6XA 5KVAA 1CERA 2P65A 2Y6UA 3TM5A 1COWD 1QPGA 2D2FA 3LZDA 4O02B 1O9GA 2PUGA 4F3NA 1HI9A 3AL3A 4E3ZA 4DCCA 4JXXA 1TLFA 5E1BA 3VAYA 1T3GA 3FYCA 4NARA 3ZY6A 1HO3A 4JVMA 4YYEA 2FWBA 1EFLA 4ZCSA 2QUAA 1U81A 4PZCA 4HDAA 2QROA 5ELMA 3I39X 2AR9A 3R5SA 2V4MA 5T6MA 5J43A 5CAEA 3IDAA 4MV7A 1G8SA 2DY1A 3SU8A 4BNXA 5J4VA 1BROA 5H68A 1V96A 3O3MB 1JG1A 1EK0A 2BSAA 3O93A 2CJXA 4FQ8A 4LNUA 1XYVA 3N6RA 3BTOA 4P54A 1D6MA 2JFWA 2FOXA 3LUDA 4AJKA 4BUJA 2NZXA 1Z0ZA 2H06A 4RD6A 2ACWA 4AC9A 2BGNA 2LIPA 2GTHA 4URWR 2Q5EA 2BCGY 1YS4A 2FWIA 2P9ZA 1U0OC 3WNZA 5B2EA 2VHWA 2CZGA 1CF2O 1ZVJA 3EF1A 4IDNA 4NENA 1AA6A 3DEIA 1I7NA 7ADHA 3GG2A 2CY0A 4EUFA 2OHFA 5EWMA 3MUEA 3MRXA 3AHDA 4PSUA 3Q5GA 4WT7A 4KLZA 1OU0A 1WBJB 4RU1A 3F7TA 4TLLB 3TTWA 2W0SA 1MX9A 4YQYA 3MOSA 4ZT7A 1PNQA 5CITA 4X3PA 4KG7A 2GAOA 3IO5A 1P60A 3I12A 1II8B 5BMOA 1SR8A 2OHGA 2X4GA 1QV9A 1D2CA 5JDIA 1EK6A 2GNAA 1EAMA 2FDRA 2OHOA 4GW3A 4QQKA 1CR1A 3NC0C 2ZR0A 4LE1A 2VUHB 5EERA 4Y6RA 3QPWA 3SQMA 3AU9A 1HT2E 2JJ8A 2ZW9A 4F97A 1SIWA 4UVDA 1NVWQ 5LQCA 5GP1A 2LE0A 1K2WA 1FVXA 1PW7A 4G5SA 1PNVA 1GNTA 2BE7A 1UZAA 1Q1QA 4JLVA 5KINB 5KJFA 3L9XA 5B7QA 1ZHFA 3ETDA 3TD9A 2CT8A 4GGMX 3ICWA 1QPZA 3IPLA 4ZCRA 4Z3KA 2BUCA 3HKBB 4E2ZA 1KI4A 2VXOA 4MCAA 3SKVA 3EAFA 2W83A 4UUOA 2G70A 1EEXB 1JXQA 3OHPA 2ZRGA 3L6EA 4DMFA 4ABTA 1YVRA 5TNXA 4ZO7A 1MQAA 1ACMA 3AC0A 3FJOA 4EBFA 3AR9A 4XB1A 4POOA 5JEDA 1Y3DE 2UKDA 2BCEA 1H3EA 4OJKA 3UGQA 1JR4A 3MMPA 4FKMA 1ZISA 1A7UA 1ADCA 3AHIA 1AA9A 3H5WA 4FEEA 5FB3A 5I9MA 2GXQA 4QXQA 2CE7A 3D3EA 3QVWA 4FSXA 3AF1A 4YJGA 1T0HB 3LTEA 5DM70 2QMQA 1JHYA 1UMBA 3GJ7A 3O26A 4ZP1A 5FD8A 4HB0A 3HV0A 3OZWA 1D2GA 1Z25A 2AG1A 4LJKA 1LF5A 2HO5A 1SUAA 3E05A 4DUGA 1HNXB 3GG9A 1U2TA 5LZ7A 1G55A 2XYRA 4J7AA 1C8KA 2L19A 4B31A 4GGPA 3KTOA 1X1CA 2FW9A 3K4PA 4Q5IA 5EUQB 5K3FB 4GPEA 4CYMA 1FIUA 4AS1A 1BXRA 2C9MA 5CTAA 3W1VA 4E22A 2PZJA 3R3SA 2PTHA 2HHAA 1S8NA 4ID9A 3WQBA 2QX4A 2C61A 3OQPA 3VSDA 1WVIA 2PUCA 5GM2A 3CG0A 1C0KA 1QAOA 3FWNA 5AK5A 4NQZA 2L18A 2ZITA 2PO5A 4UTXA 1T15A 4CR8A 5K0BA 3T3HA 4OLHA 5HUQA 3CX4A 4RE6A 3W4KA 5M2QA 4RH3A 4NV0A 2BGUA 4TMXA 5A0VA 4FONA 4IIGA 4OY3A 2B4TO 4RETA 3DZJA 2PUTA 1KHHA 4GYKA 2Q8PA 2YQ5A 1RJEA 4RLFA 4HEHA 4ZHQB 4PRLA 2C42A 5CVTA 4OU5A 2P27A 5JAIA 5E4YA 1EQ2A 5KCZA 3GLHE 5DEOA 1AQNA 4RY2A 1OH8A 3BCRA 2X6QA 3TOZA 1N9GA 5BV7A 3ROZA 5CG2A 5JC1A 1IB6A 2ZUFA 2ODNA 2NO6A 3CZ4A 4G9GA 2H7XA 2W70A 4C7OB 3TW8A 2ESRA 5EMMA 3FYUC 3O2SB 5EJ5A 3NIGB 2FMUA 2NM0A 3PRYA 5KAMA 4E5VA 4B44A 1E6LA 3HC7A 1IZ7A 5AI0A 4BWYA 4D0RA 4DMKA 2UZ4A 1KJYA 2XNJA 4BFUA 4G6ZA 2FPGB 4MW6A 1DOHA 3WLNA 3NT2A 3SFVA 1NXXA 1UBKS 5JISA 3KB1A 2IYSA 2IZ0A 4O3FA 4BGEA 2A59A 4IQGA 4Q1VA 4MK4A 4MSUA 1Q7EA 3ZWKA 1RYEA 2EBWA 3G7UA 5B7GA 4NE7A 4LFCB 5DVZA 1V16A 2HIHA 1O8CA 2QRGA 2C1XA 2R7NA 2V7QD 2R6ZA 2PZ8A 1WMAA 5THQA 2H2GA 3BA1A 2E5FA 4RAQA 3AILA 1AXEA 1RC0A 1ZCBA 1SQ6A 2M9MA 1XYGA 4I50A 4N41A 4F1KA 4GVLA 2QLMA 2VFAA 1BVHA 1C1XB 1OH6A 3A9WA 2R48A 3IALA 2B2XA 3F7OA 3EBOA 4FR0A 4KLRA 3S28A 2ZYSA 2Y9MB 3QBEA 3KVNA 2CFCA 1NF9A 2P75A 1GZ7A 5I7SA 5DYWA 2VI5A 2H5LA 1HSZA 3UAOA 5EZ5A 4GX0A 4LRSB 2OY0A 4O4LA 4MMYB 1N6PA 1ZMOA 4HHEA 2MSLA 2YV1A 1SCAA 3KAKA 3E1SA 1CZRA 2AWOA 3PIRA 1JI3A 3P9SA 5T6BA 3DMYA 1A97A 2R7KA 4FC7A 4L5AA 4BYMA 5C81A 3N6VA 3GLGB 4DHWA 2Q5CA 5FNVF 1TECE 1V0JA 1U31A 4H7EA 4C29A 1W0JD 3A6GA 4RGYA 3RGWS 1OFTA 3SD7A 4H31A 2ZAMA 4MVJD 1FX1A 1XMQB 2IS6A 5ALDA 1ECCA 1J2YA 2X1MA 5JVDA 1DUSA 2YWJA 2C5EA 1QV7A 1XUOA 1GQYA 2P2YA 3EDRA 1G41A 3FDZB 3MOGA 4M53A 4RVFA 4BZZA 4D9EA 1G9SA 4DBZA 3A28A 4FDVA 5F9MA 3BGIA 2BEUA 3MT7A 1Q83A 5L40A 2BD0A 3K53A 3INRA 1MP0A 1Q6YA 1VCNA 4KFSA 5E95A 4ZKEA 4EZEA 1UK7A 1I24A 2JLWA 4EI8A 4E15A 4PLTA 1SEVA 3ZCUA 2XUZA 3FIUA 3E9CA 4I36A 2Z4RA 4BX0A 2XRYA 1NX6A 2ZVDA 4EYOA 5DX8A 2I4MA 1PJLA 2GYUA 1CQXA 4M7PA 1GQOA 4DREA 3FB1A 2A1TS 4L3OA 3QU2A 3NOVA 3A6PC 1N5OX 2Q3JA 4LMRA 3A6HA 2X3UA 2I76A 2LWIA 3M1LA 2JBAB 1W88B 3NM4A 3ZBPA 1S2OA 4JQZA 2QBYA 3SX2A 4NXMB 1DKPA 4PPYA 4U63A 1J90A 3U60B 5BN4B 1H2HA 1NW7A 1RDFA 3SWWA 4NMHA 2WAOA 1B93A 4V0LA 4LHSA 1IZ8A 5C4IA 1BJRE 1I2BA 2HU7A 2VJYA 3L7OA 4NMWA 4EUEA 1E9FA 2CXRA 2QLTA 1A96A 2PT9A 3AOEC 3D6FA 3ROPA 4PYNA 2WIAA 2IP2A 2P5YA 1OCEA 2H4WA 3BIXA 5ULLA 2YDXA 4W99A 5D86A 3ZCRA 5L3ZA 4HTFA 2X4IA 4HBZA 2I6XA 1GV0A 4KWHA 2XKBA 4MH0R 3WL8A 1Z2NX 5DH9A 5LM3A 2IIVA 3V8EA 1JEYA 1IIRA 1OAOA 2AFIA 3TQRA 4YCMA 1QAQA 2VWPA 3WS7A 4C6TB 2W6MA 4TKVB 4LA4A 4XQGA 2BMVA 1TUIA 1MGPA 1XJ0A 2CMKA 3IAM1 2GF0A 2GHIA 2AXQA 1R64A 3LLVA 4PAMA 4EI7A 3P2IA 2VZEA 1EBUA 2Q1XA 2QPLA 1U9YA 3CEJA 3TE7A 4D4KA 4K6CA 3ZGZA 1ZBDA 4YLYA 4IJ6A 3VSCA 1RHUA 1VLLA 1PFQA 1ZOOA 5HGXA 1YHZA 3Q9UA 1RXUA 1L2TA 2ZOSA 1O95C 3GGDA 2AG8A 3SSAA 3WLMA 2F8TA 1MT0A 3LPLA 2CWDA 1NONA 1W5FA 1H2RS 4GO1A 4BVEA 4LW8A 4QYWA 3LO8A 1JEOA 2YQZA 3HCNA 4KAJA 1O97C 4YJ2F 3PI7A 3ER8A 2YY5A 3U61B 5I7VA 1NVMB 3F5DA 3CLTC 4K26A 4JB2A 4XUCA 3GRYA 2VQ6A 1D1QA 1PV2A 1P4JA 3NAQA 4R8RA 5CLGA 5FWAA 3TTXA 2UUPA 4CF3A 1ZIDA 4EOGA 1BN7A 4G5RA 4Q39A 3TRKA 4ME6A 2IKQA 3B89A 2XXAA 1JSCA 3A3PA 1RACA 1GTMA 4I55B 3EIHA 5JDIC 5ALWA 1OA0A 3CZPA 4P32A 5C4GB 5EPEA 4B82A 4D6XA 2OLJA 1N6RA 5TPZD 1Z4QA 1RQ7A 3PNQA 1AZWA 1MG5A 4YBZA 1BXZA 1VPVA 2VF5X 3ENKA 1GJRA 4YUYA 5KTSA 1G0OA 2COKA 2FYTA 2BAGA 4ZCPA 4M54A 4MPDA 3K7EA 3PENA 1M1NA 1SK8A 2I3GA 1O77A 1DWUA 2ZG6A 3OPYA 2O20A 5K3FA 4MVCA 4ZHQF 3I83A 2I8LA 3MSXA 1DX9A 4J75A 1N2CB 4GX2A 4I8XA 1LQ2A 4C01A 3E7XA 5IX8A 2ZQZA 2ZJ0A 3B82A 3DUFB 3KSBC 4A16A 3T52A 4FC6A 1G20E 1YR6A 4HXYA 1DUIA 2EZ9A 1OKKD 2EHJA 4XAQA 3CLUD 5LDDC 4F84A 1QGDA 5B4UA 3CT6A 4JHXA 3EDOA 2JKVA 2NXWA 3BK1A 4DA7A 2J3HA 2D4HA 1Y4DE 1KWGA 1E64A 1K0UA 2C4TA 3LC7O 1DC4A 5DFAA 1BHSA 4GICA 1ZGBA 3KT3A 2W4IA 5K3CA 4G5FA 3BYZA 1ZJ4A 1EFHA 5CEJA 2FJUA 4CLXA 1ZY2A 3QK7A 3Q9LA 1B23P 3K5PA 4CM8A 1ZI9A 2GZ3A 3GRKA 1N0IA 2IEIA 2DC1A 1AURA 5JCPA 5KWEA 4MW5A 3RF7A 4QUJA 2ATXA 2V96A 1C3EA 3E27A 3RWMB 1IATA 3FDIA 4MV3A 5DM4A 5A4IS 6PFKA 4HWOA 3O03A 2WM3A 3KLNA 2J9RA 4UHDA 2MDTA 3UMMA 4MVJG 2F1JA 2PANA 3QKWA 4PAQA 5CNJA 4RV9A 4LF8B 1JG4A 1HG1A 2O8FB 3MWGA 1E9AA 4L57A 1N3BA 1U7TA 3MG9A 3PQDA 1HF3A 4KQFA 3K15A 4QATA 4QYMA 5CD9A 3ENZA 5A7HA 3TNDA 2PCLA 1L5FA 2EDAA 2ODEA 1H4SA 2NX2A 2FPOA 2WZCA 1Z38A 4PXAA 2OV4A 4UHJA 2W42A 1NN3A 3TZHA 2RDMA 3OZSA 2B9VA 5EXXA 4HDMA 1CETA 3FTNA 4HVAA 4Y2GA 3NBMA 4HOYA 1SO8A 2D5IA 5DSTA 3VOTA 1PZXA 4D9NA 1GQQA 1GTRA 1ZH8A 2RGXA 1I6MA 3U9SA 1PL6A 3ASYA 2FPLA 2QKYA 3HE3A 4ESVA 2C77A 3MWLA 1N6HA 3PK0A 2I91A 4FQ7A 2ISCA 1A9ZA 3S1LA 2JAPA 4RS4A 1JVSA 3AM1A 2DCUA 3QPVA 3K9GA 1KY3A 4B2LA 3QFSA 3V80A 2AX4A 2O8EA 3ORRA 2Q0QA 3HQ4O 3OM8A 5HZHA 5FLXA 1FTQA 2CN1A 4JMPA 4GYYA 3OT1A 5HFAA 1SUSA 4OBEA 3SF0A 3E8MA 4LRQA 5EJEA 2H1OA 3PCTA 2QTZA 2QTMA 1QWSA 3D7MA 1HK7A 2WZDA 2Y77A 3H83A 4R7GA 3UCEA 1ECBA 1S7GA 2NG1A 4AMUA 1YB1A 2XUJA 1JT9A 3LPNA 5JVDB 4B3SB 4WH0A 3ESQA 5IH7A 3HNPA 1YOBA 1HE3A 1H2YA 2CDBA 3UT6A 5JWHA 5J3JA 4FSDA 1OXUA 2IY8A 1GD1O 3PPWA 3KXKA 1NOJA 1SXIA 2CKMA 3USCS 4AP9A 4M9ZA 4GE0A 2FXIA 4KDFA 4P35A 3EGCA 1Y3IA 1BVUA 1F8XA 1M74A 2NTEA 2YQ4A 1GNVA 1V8BA 2ZCVA 1MRZA 2ZE8A 4JITA 1LXCA 1QHXA 2I1VB 5EESA 4YXWA 4EJ0A 2WB2A 3LI2A 2A78A 3F78A 1GQRA 4N49A 5GPBA 2F1KA 4E33A 1ZQ1A 3HEBA 5JZ9A 2YY7A 3FTFA 4WUVA 5HIKA 4D4GA 2A0WA 1KQFA 1CZUA 1R66A 4FOPA 4P08A 1TGYA 3NIWA 5B58T 1Q0SA 1BMFA 1XHFA 1D09A 1TZKA 1WMFA 2QD3A 2N9UA 5G2OA 2J6CA 1WCV1 2H4HA 5ECWA 1EVKA 3P9ZA 2BEWA 3V2UA 5GTDA 3KKOA 3RU7A 2ZXUA 4PLCA 5JPCA 1NBWB 2WJPA 1XZCA 2EW1A 1ZR2A 2W6JD 5KIAA 2O8VA 2D0PB 4MV0A 4U5XA 2NZYA 1G64A 3A7DA 5ICSA 4X66B 1HEYA 4KGZA 2OGUA 3HYTA 2IGTA 3C5HA 1V9CA 4NHOA 3T5TA 4G0ZA 5FOSA 4O0MA 4ALIA 3PQ7A 3UOWA 3B3AA 1APBA 2Q5IA 4IXMA 2J3IA 2HAEA 1DHRA 1E7SA 2WSSD 1OFGA 3EN0A 3GZ4A 4JBLA 1I0ZA 4ZTBA 5JYBA 2FZEA 1PGPA 3T4PA 1O1YA 3VU8A 2Q9AA 2OC9A 5HK9A 3WG9A 4WGFA 4XYBA 5IANA 1R5NA 1SCUB 1QLWA 4EGJA 2NU6B 4X1YA 2OO7A 3PXUA 4OG2A 1X80A 1Z8HA 4FYMA 2PFSA 4HMQA 3HLKA 3H8SA 5JRZA 4R2XA 1CP3A 2AC7A 2TRSB 1EX9A 2C8KA 4TN5A 2BP7A 3F5MA 3P9CA 3SC4A 4GH5A 3F90A 1GGKA 1NBEA 3BUSA 3FVVA 2VUTA 1KI3A 2WT4A 1L4FA 1VDMA 4AO8A 3BL8A 3FKSD 5F23A 2RI6A 4LMAA 1SU6A 3H2SA 1WWKA 1JA9A 2A14A 1V39A 3BXGA 1UQRA 1NNUA 3LHIA 1LC3A 1B26A 3N74A 5IT5A 1Y5RA 1ZW6A 2TMYA 1FX0A 2RKWA 2V65A 4L9AA 3IAM6 3TLGA 5JH7F 5L6MB 3MMZA 1Q0ZA 3S44A 1CQPA 3SZRA 1JR3E 4DIEA 2EKPA 3V1MA 3EGXB 1VBMA 2FPIB 3VR0A 3RFUA 3F6PA 1J0AA 1ETUA 2EKDA 3D3WB 3Q98A 1SBHA 3TRDA 3U9LA 3VSBA 5NULA 2XYQA 1ZSYA 3LOQA 2IU4A 3B1WA 5JZOA 3AT1A 1HQYE 4GKVA 1RM0A 4D4JA 1KJIA 4YXFA 1ZU5A 1BXGB 4RCYA 3BH6A 1C7JA 1OYYA 2QUKA 1FP6A 3CX6A 1VI5A 1LRLA 4JEHA 2YN0A 5DHAA 5TRTA 1JBQA 2JFOA 3WLTA 1T1EA 2AOTB 4HWKA 4N9WA 4E6EA 2HMTA 5THXA 5L4NA 2CZCA 3MLBA 1LSUA 3DC7A 2FX3A 4F4IA 5KOIA 5HCIA 3AOEA 5IUKC 3JATB 3FWHA 2Y9PB 2DTDA 4C2UA 5ERYA 3USZA 1MZVA 3B6ZA 3WGVA 3FCAA 3N2KB 2C8LA 3NPMA 4E13A 1N33B 3CX8A 3WBFA 4LCBA 3ROTA 3X2FA 4ND6A 5CT8A 2OQVA 3VU9A 3A4VA 4KTVE 4PCVA 3GLFE 1LQUA 3KHSA 5E1MA 3AV3A 1CX9B 3WLQA 3FBGA 2DPYA 2ZSIA 4EG3A 2O19A 2ZAIA 3WGYA 3WLEA 1RAGA 3RVLA 1CNFA 1XVUA 2C20A 2OYSA 3D2BA 3GDWA 5G0SA 4QEZA 5A3JA 4F8YA 3KM0A 3HABA 3OBBA 1S4MA 4Q4JA 2V58A 4FYXA 2XTZA 4INAA 4OU4A 5AM0A 5EY5B 8ABPA 3ET4A 3OZUA 3KJXA 3NIDB 5DNAA 3SBEA 3SDBA 3V3TA 4DDTA 2GPSA 4DR3B 3OX4A 1VCHA 2C9OA 5LB2A 2IA5A 3N07A 2EIXA 1XCGB 2X0RA 4X20A 5JFTA 5DYNA 4QOFA 1F1JA 1PVVA 2GLUA 3QF4A 4PINA 4JI6B 4LGYA 5A6VA 3R7WA 1ISSA 5LQSA 2NXEA 2XQKA 3FNIA 4J0EA 4OOEA 4E1VA 1EUYA 5K7SA 3O91A 1W1WA 1WB5A 1HYQA 4PHFA 3IIEA 4BEBA 3RFXA 1M1YE 4I4NA 1SZCA 3OPMA 3VYTB 3QFFA 3UANA 4B7CA 3R5HA 2HHCA 4RJTA 1X3LA 4ENUA 2AN5A 4W7SA 5FWXB 4QXAA 4DR6B 4NCHA 2I7TA 3LCCA 1T6ZA 4G07A 4JWTA 2VH5R 1CBUA 2HT6A 3ZHYA 2V6GA 4ZQFA 4A26A 1ESZA 1U6IA 5CT5A 3F9CA 3UMBA 1YB5A 3PYXA 2KBEA 4BV2A 4DRXB 1EQAA 1V3UA 4C08A 5F73A 4ZVNA 3IURA 2V03A 2ZRQA 2QG9A 2PU5A 4X6YA 3UUGA 4UVHA 5A4DA 4GL2A 3KETA 2UXCB 2C99A 4I4TB 3QWBA 3CN7A 3RC7A 5CA1B 2H54A 1B7GO 2JATA 1RAIA 3GJ0A 3QE4A 1JDNA 1QX3A 4OIMA 2GAFA 3STUA 5AHXA 2CK3D 5DPMA 1ZLXA 2R87A 5JSZA 2CD9A 4HWPA 3QH4A 3AR2A 4NBWA 4OXIA 5FOUA 1Q22A 2GD6A 2FE1A 1QIIA 3FIJA 4F0JA 5H4HA 5JVDF 1P9LA 3ZKAA 1WTCA 2CCGA 5IJ0B 1D2MA 3LX6A 1T1IA 5JQGA 2YVAA 2IEAA 2I71A 3FX2A 1FSZA 2C97A 3AB8A 1XKTA 1MJFA 3BQNB 2BFBA 3B51X 4F2PA 2VC2B 4WOBA 4ZOBA 4DV7B 2RJOA 3BDVA 4Z2AA 3WLRA 4G41A 1UP4A 3NHUA 1P7PA 3COWA 1OF1A 3DZKA 5AI9A 4GSLA 1T6XA 2ZSAA 2QZJA 4MP6A 4BDTA 1Y81A 3I1FA 3UJBA 1JR3A 2ADFA 1UFOA 2QLFA 1PS8A 2PSJA 2O0KA 3LT0A 2ZZNA 1COWA 4W4TA 4TTTS 4AJIA 3O84A 2IC5A 4Q1AA 5D1NA 1KC1A 4BUCA 4QPCA 3K6SB 1QK5A 2XV1A 1ULUA 3JYLA 4R01A 1AS3A 2WIGA 2ZWMA 3EXHB 1OZ0A 4BLOA 4D79A 2UDPA 4I50F 3F4KA 3Q7IA 3DC2A 4ZYLA 4XSGA 3ZD8A 4DIMA 1ILEA 3SZ3A 2QYTA 5IKMA 3VTFA 1FPMA 4JLMA 1C7RA 1DARA 1N2CE 3BMOA 3F9RA 3R0XA 4ODIA 1UM9B 5KS2A 1EWVA 2XEDA 6GPBA 4LJRA 2ZJ8A 5BQXA 4WXPA 1QYCA 5C5CA 2H1FA 4FXPA 1QE5A 3GH3A 2JHAA 5EQTA 2GM3A 2SKCA 1E89A 1Z6ZA 3M1YA 3RH0A 4ETIA 2FW6A 2WG0A 3OLZA 3IE2A 1R6AA 5JS1A 2VYVA 1TK2A 3KUCA 3OQNA 4A73A 2W6ID 4O4LB 5LBIA 4Q3CA 2JLBA 4KNWA 1RM3A 4H08A 4BAUA 4BJ5A 1YKFA 1WCWA 2GCEA 2GBFA 1SOWA 1PZNA 2ZT5A 3MN1A 2VCEA 2BT4A 1IWBB 3G2IA 5CLIA 4YDSA 4O4IB 4TRNA 1YQUA 2UXDB 1A76A 4LDZA 2ZU6A 3DJFA 1A5SB 1SC1A 3CBGA 2WFAA 1JS1X 3QLTA 4U9HS 5DLEA 1OYVA 2GVZC 4C4SA 1M1YB 2ONKA 1GKKA 4I9NA 3JQFC 5CR9A 2QRQA 3DDCA 1F3OA 1H8HA 5HFNA 4H17A 4RMJA 4YO8A 3HNRA 1D07A 5P21A 4ZI7A 5H7XA 2GAAA 4PZPA 3ZCPA 5IHXA 1IY8A 4KE6A 1M66A 4L6IA 4XWTA 1T6YA 2ZIWB 4DA6A 4KDRA 1HY3A 4X7RA 2O3JA 4UFPA 2WJ3A 1MNQA 3KKPA 4B6GA 1E5VA 1XOIA 3D6JA 3WSVA 3EXFB 2HSDA 3BG5A 5AOCA 4L9WA 3RQIA 5HRUA 4B3FX 4KQWA 2L42A 4CUKA 1H65A 2H31A 4RAOA 5H1YA 5BW4A 3UY4A 4B4OA 5TIIA 4TTQA 3KZKA 3L7NA 1Z5OA 2IZ1A 3TKAA 4MP3A 1KI7A 3CEMA 3SXUB 2VH1A 1JSLA 1LA2A 1Z0UA 2VDOB 3D3WA 3E61A 3I05A 4M89A 2Z3WA 1CRLA 1GEEA 3AIOA 1J8VA 2WYIA 4ISBA 2YJZA 3K71B 1EDZA 3A58B 3LT1A 4XR9A 4XTCS 2Q0XA 1S96A 1TTPB 4Y9DA 4CTOA 1XZAA 2MR6A 1L7PA 2QX9A 1BDIA 1J39A 1QQBA 3KEFA 3DV0A 3ELDA 1LI7A 3ZGXA 1DINA 1GU0A 1BX3A 4FBMA 4GLLA 4RXUA 3KZMA 4H4EA 2QP9X 3IBFA 3SNHA 4M49A 4W5WA 4XM0A 5EJ7A 1E6KA 1Z0KA 4F3YA 4DCPA 1PGNA 1M2WA 1Y7HA 3K20A 3SG0A 4ZOQI 1UKAA 3CB2A 2C03A 4G65A 4M36A 3QEKA 3R6LA 2BGMA 3V8BA 3H18A 4EH1A 4JOBA 1HE5A 3VU9B 8MHTA 5KQPA 3CRW1 3IUSA 3E9MA 2CYAA 4W9MC 4MR7B 4CL0A 4Z4IA 1NMQA 3GPIA 1U8AA 1KFBB 3A1WA 3BZWA 1L3IA 4HGNA 3IQXA 1TMYA 3EE6A 1U3VA 2Q4OA 3FMPB 4M0FA 2DHEA 5I7WA 4AMZA 3DULA 1B1CA 1PZEA 2G1UA 1Z8FA 1ZGHA 3GRFA 3SR0A 1G5RA 2GK4A 4LJSA 4U7HA 4IYJA 4TS1A 3ZHCA 1V2GA 2BMWA 3SZUA 3CRZA 1EFDN 1K1EA 2M1ZA 3QTLA 3ZW7A 1CUUA 3N2LA 4IIVA 3QLVA 2YICA 3R24A 5D3QA 4QOJA 3IDSA 5CDGA 3FVQA 4KN9S 3SF8B 3SSOA 3KQHA 1GPH1 1EHYA 4K9QA 3H2BA 1A27A 1ZJ6A 3FVRA 4KN8A 3ZYCA 4MGZR 4MS1B 1YV9A 2IWHA 4KVAA 4DYVA 5FBLB 2GPTA 4NCAA 4DNPA 3CIOA 2Q7OE 1JYEA 3LGXA 4KQ1A 3NOQA 4B9EA 3J81k 1R4NA 4D1YA 1J2RA 2WC1A 1Y6RA 1RQNA 1YE8A 2WJGA 2G17A 5A9RA 1XLTA 3Q8XB 3CO5A 2GA8A 3IVCA 3GLIA 1I10A 3PFWO 1FQWA 4DDVA 1X8XA 5DTEA 4PU0A 4JQOA 5HF8A 3RNOA 2AX3A 5ADHA 1GTVA 4F4JA 2G80A 5DLYA 4PX5A 2P77A 3C70A 1K98A 3WYGA 1RJFA 3QKTA 3QVJA 1UBFA 3H65A 4R2HA 2WWFA 3ED1A 3JASA 1EZ4A 3D6HA 3EMVA 4YP1A 2Z6VA 4F11A 3FGOA 1CV2A 2P9EA 3KE9A 1Y4ZA 3VISA 4RYLA 4EI9A 5BQPA 5AVYA 1HYHA 1JG7A 1ZAKA 2OV6A 2XIJA 5JOQA 3QE9Y 4GECA 2PKYX 2Q5LA 1ODCA 3PC8A 4JR0A 4D80A 4KP7A 2PGNA 3LKDA 3T94A 3VR6D 1A9OA 2BR5A 2JAOA 3EFOB 4URYR 5EMJA 3AVTA 3L7CA 1AHNA 2B6HA 2A86A 1I3CA 1G1AA 4PO8A 1N0HA 3O8DA 1YDFA 3L6RA 4CLHA 4YX9A 4JLAA 4P83A 4IGEA 2GK7A 2BCJQ 2VPZA 5AFSA 2B92A 2B4AA 4H2DA 4LKRA 4MWDA 4DV6B 4L6AA 5JYDA 4B3RB 4QXOA 1EGVB 3USES 4OHYA 3Q4GA 4URZR 1JAIA 2HZBA 2WNIA 3KWJA 3QTBA 5BW6B 1IQ0A 3CVJA 1WCIB 5C3MA 3Q2OA 4WZBE 1Y8QB 1TKCA 2A7XA 2YDYA 3JD3A 5JMPA 1RKXA 5AJHA 4JROA 1IMJA 2NO0A 1Q0HA 1DE0A 1XDDA 1OH5A 1TU4A 3RRZA 4C4PA 4BMNA 2AI3A 3HDYA 4WN9A 1ZUWA 4GEKA 4Z9XA 5EN4A 4XQ9A 2ZIGA 1I7PA 3AY3A 3SXJA 4II7A 1TUBA 3B2NA 2MHCA 1ZA1A 4U4AA 5T5QA 1BJTA 5JQWA 2GZ2A 1FMCA 3L1HA 4FN5A 4NNOA 1YJCA 5FI3A 4C07A 1REQB 4BIMA 1ZGGA 1N5MA 1KMMA 1NVKA 2O2IA 3WWPA 1S2NA 1CUJA 1V47A 3OZXA 3THYA 4AZ3A 4GBMA 1AB6A 1PLJA 3NBAA 5G0WA 3KEOA 4GZ5A 4CNQA 1KBOA 1O3YA 1XHLA 2RC5A 4HH4A 4JJEA 2AC2A 2XSZA 5HIJA 2ZAYA 1XCOA 3FY4A 5KWIA 3LGSA 4L6CA 3QHQA 2I3BA 3OCYA 3UK2A 3OAAD 1NM5A 1QYWA 1ZN7A 1KDOA 3CE9A 2EJUA 2KS6A 3COPA 1KWKA 1OV4A 4Y6OA 5H4GA 4XDHA 1N1EA 5MGNA 3WLJA 3FE2A 2BFDB 2YN4A 1Y6FA 2BI7A 2CNWD 3I0ZA 3AR5A 3PQ8A 3V4ZA 3PLRA 2H3EA 1XF1A 5LJLA 1U3TA 2XAAA 3QBTA 2QDKA 1O96A 1WHSA 4XGRA 4B3DA 2O8EB 2H2IA 3TKLA 2PH3A 3C3EA 2RGWA 2R8EA 4ZDWA 3CZ9A 1AF4A 3ANXA 2CNNA 3LL7A 3VR4D 2IODA 1JZTA 1L8OA 4GVXA 4OI1A 3M5PA 5LA6F 2YINC 1WOYA 3TSYA 3EFEA 3IEXA 5JAZA 3ZVRA 10MHA 1BRMA 1MAUA 4FSHA 3NGMA 4PYMA 5GM1A 1AZTA 4MTCA 4YCAA 1NA5A 4K46A 4TRRA 2BEJA 3HMKA 1MO4A 3KFVA 1LPMA 1R0ZA 3WWOA 4F2GA 4K9NA 4KQCA 5HIIA 2ZWPA 4LSMA 3EZFA 3RC2A 3SX0A 3MBIA 2D5AA 3E9DA 4RPIA 4ZRNA 1BFUA 2XNDD 3Q3EA 5CXUA 3C85A 2AWNA 3QJGA 3U3RA 2O1SA 1J23A 3I9JA 3OIGA 3P9YA 1JEQA 2FI1A 4IEEA 2XZOA 3RDPA 2Y6VA 3BT7A 3X43A 3JD2A 4PHCA 4XJSA 5KC8A 5KMGA 2D1YA 1MB0A 1E4EB 1B3RA 2A3NA 1YZYA 2DGDA 2I66A 1DL5A 1XAJA 2IDMA 3N3AC 1MEOA 4RHYA 4UZSA 1N92A 3WMGA 3NB0A 1L3CA 4W1PA 1CDZA 4P0TA 3EWNA 1A4IA 5CT9A 1UAAA 1P3JA 4OLBA 5U4QA 1CEQA 3MSCA 4P1ZA 4RK6A 2WZBA 2ZBQA 4J49A 4WJZA 3VBEA 1GRNA 5TS3A 1TRHA 1KZGB 3LWZA 3FYSA 2EJTA 4C5BA 4EJSC 1NIJA 2WFLB 3RF6A 3D43A 4ZQBA 2AGVA 2X58A 3N2NA 1U7HA 3BJZA 3VZBA 1P1FA 3G82C 1KR5A 3DMPA 2JI4A 1A2KC 2OM2A 3E03A 4JLJA 3R8CA 4UUNA 5K0TA 3V33A 3QVOA 1E0JA 4F9TA 1X7XB 5AMXA 4IWXA 3GLHB 1JEJA 3BORA 3VDRA 1OGJA 1IN8A 4ND3A 2R96A 1KMCA 2R1TA 3MIIA 1KE1A 5AUNB 3HCBA 1NDQA 4ZVQA 2AK2A 2IVZA 3F6EX 3OIYA 1FRZA 4KO1S 4FCWA 3M6VA 2O7NA 3ZJYA 4CE6A 3IODA 4B4UA 1X7ZA 1A3CA 4Y9SA 2PA3A 5HXAA 2V9CA 1XTKA 3AUFA 4BBAA 5PGMA 1PNRA 1Q92A 1XZHA 4FYPA 2WWYA 3C7DB 1NC3A 2IOYA 3D4BA 1T43A 3DE4X 4WY5A 5AKLA 5CURA 1Q0TA 2K7ZA 1S1CA 4QDJA 1J0XO 2AOUB 2R6CA 2VHQA 4H15A 3OSZA 1QIKA 3L7DA 3WZLA 1WVGA 1NASA 2Q3DA 4OYYA 1FX0B 1E79D 2DJIA 2ZIUB 1ND6A 1UMCB 1WRBA 2N0SA 1AGPA 3AESA 1TEVA 1KP3A 4QWMA 4D3FA 1T6NA 5BPFA 4JI2B 2P6MA 5H59A 2XNDA 1VYTA 1W581 1MQSA 2P90A 3PUZA 4OGKA 2NVBA 1ZL0A 3UGTA 1VJDA 4YRIA 2CHQA 1GZ5A 3A37A 3DBLB 5DIFA 1SPBS 2FWMX 4FINA 2VXBA 3AR3A 3GP3A 4N03A 5CXQA 3DDHA 5EHZA 3EHEA 4NOKA 1X86B 2O2SA 4B0OA 4OJNA 3FDFA 4PLZA 3DOHA 4H16A 4ENSA 1PJ4A 4YRNA 3OIWA 1XKLA 1P5FA 1PDWA 1U28C 3PICA 3G8YA 2JL1A 2O8CA 1ISJA 4JP1A 1XR3A 1ISRA 2A8YA 4I1IA 4NEGA 2FZCA 3E48A 4Q9LA 2XGSA 3HR8A 2QW0X 2K5UA 2VHXA 3C4VA 4E31A 1KH2A 2H0QA 5DRTA 4BFYA 2HA7A 4S2EA 2RGEA 2XZLA 1M1UA 3M6AA 1E8DA 2IZ6A 1VKHA 2ERXA 4FGUA 3AF3A 1V9SA 1DTWA 3DLTA 1SC4A 2CL7X 3FTPA 1ZUNA 5A4FS 1Q95A 4MX8A 5JLAA 3R3JA 4J2TA 4YCNA 3WIOA 4D9IA 2FZ4A 2BFEB 1OIVA 2O48X 3JPYA 2XXBA 2RHBA 4J4TA 3RRXA 4DQUA 2ZB7A 1Z13A 3KPVA 3R5JA 4MGHA 5IN4A 3JARA 3ORYA 5DWQA 1ODKA 2Y68A 5AW9A 2YUIA 1RLJA 4TYYA 3ZS8A 4IDHA 4OQFA 3B6KA 2SNIE 3UAXA 4G1MB 1EYZA 5CFOA 4RACA 3HPRA 2OHXA 5JD3A 1FFBA 3GJTA 4Q4JB 3H1AA 5EKDA 1A9QA 4AECA 4NCJA 2JI8A 3CQ9A 2X7HA 3ETCA 3RS5A 4CM6A 2HHHB 5IXJA 2EP7A 1KU6A 2LKDA 1QCYA 4G0XA 4NEQA 1RCFA 2FXVA 1EWRA 1E3LA 1OFUX 3I4LA 4PLHA 4YPVA 1E2BA 3H3FA 2ISQA 2A9OA 4PQGA 4A23A 5KNCH 1QZUA 2UYGA 3U4QB 3ZE9A 4QLBA 4PCAA 1TB4A 3D7KA 3ITNA 5DHRA 2NTVA 4G1UC 5EHQA 2HJWA 3QELB 5BSTA 2AFVA 2XVAA 3GPBA 4WN9B 1TK9A 4EGAA 1WUJS 4AO7A 5ALJA 5IW8A 4AN1A 1OE0A 1H2EA 3SHFA 4KI7A 2WYOA 4KR9A 1Y1KE 2ZYVX 3BIFA 1CY8A 3DWIA 3O21A 2WWGA 4P3NA 5AVXA 2RSLA 5ALSA 2IUSA 2IW3A 3KBOA 1E0DA 1I51A 3AY0A 2EX0A 5FL7A 1TW3A 2IEGA 3TGLA 4LSZA 1BCRA 2XCUA 4LOHA 5E1OA 4EW3A 2Z4TA 4YRGA 2UUBB 3T34A 4LF9B 2WHPB 2GTIA 2QG4A 3FYHA 1WW3A 4NSNA 4WZAA 1MB9A 4OLFA 3I0NA 3O4FA 5JBIA 4ZC1A 1WDKA 3QXGA 4A8JB 4PLGA 3DMNA 3IYLW 2IIQA 4LOIA 5TQ0B 1R6DA 1FYDA 1PR3A 3TQIA 3M9WA 4EITA 2C0PA 3HKEB 3V7UA 2VXYA 4HLNA 4DM7A 1EUQA 3WP0A 3IRUA 1U1CA 3JWEA 4NH0A 4PNHA 1EX1A 2IP1A 4R7TA 3UHPA 2VQ3A 4A92A 2QY6A 4HEA1 4M37A 1WZEA 3AO0B 3BSSA 2VS1A 4OQ4A 1UDCA 4BHTA 3AJAA 1K8QA 1PQWA 2BFCA 2J0EA 3EVZA 3HI4A 3HXLA 3VUFA 4ATNA 2K4MA 4CKCA 1PKXA 5F2NA 4AKSA 2JDIA 2PMBA 4WQMA 3OC0A 2AXPA 2WAXA 1TT5B 1Y7TA 1GPJA 3D5QA 3I52A 3TCXB 1EXVA 1OX4B 3ROKA 2LCFA 3W04A 1ZN2A 2J6HA 1UJ6A 3QVUA 3J7TA 4G8JA 3RQSA 3V4LA 5INTA 3M6IA 3DMHA 4TUYA 1M8KA 1AHIA 1WDWB 1ZJ5A 3KD3A 1GRQA 1XJQA 4IV5A 3FOEC 2UYHA 1EFAA 2DY0A 3K6SA 1M0SA 4R2IA 3EXHA 4C03A 1MLDA 3BWVA 4R68A 2XNCA 4NBVA 2QX7A 2J67A 3RANA 2VAXA 4JOQA 1NYLA 3WIEA 4L16A 3DLHA 1JNYA 2CXNA 1NUSA 3NDBB 3LUFA 3MWYW 1H93A 1FTWA 4DM3A 1YUNA 2IZZA 3KDAA 4R83A 3CE6A 3FUXA 4D44A 4JLBA 2DLDA 2GFIA 4H35A 4C0QC 5LOVA 1DJPA 2VDQB 4UUMA 3SSNA 1QQ5A 1P44A 4V38A 2VJKA 2XWQA 3GEDA 2KX7A 1FDUA 2C7PA 3BPSA 5B1SA 4BGIA 3KG2A 1W35A 4MW0A 2O5VA 1EESA 1XTQA 5FWXA 1GG2A 1POXA 4GP9A 1R8JA 2ZJ4A 5AJWA 4FGJA 1ZRNA 5CNKA 2C5LA 2II6A 5C35A 4XOUA 3G02A 2J07A 3H0KA 2X86A 5CVUA 4NBKA 1ZNXA 3WGHA 3K5IA 3N86A 1YS7A 3PQFA 1J9ZA 5KTPA 5CDFE 1Y8ZA 1QO7A 2PU7A 2XITA 4WNAA 1OGIA 2ASVA 1SRQA 2XMRA 3R0IA 5BT8A 3DW1X 4M8KA 2YFYA 4XGNA 3EDYA 5ES4B 4DARA 2VQDA 4P7GA 2DBVO 2AI1A 3FUUA 1XWIA 1O9HA 4PC1A 1JL3A 3G9TA 1P81A 3SIRA 3NVKI 1QUFA 3MINB 1T9GR 1C9YA 1XMVA 2W2MA 1CYEA 1MGOA 3T0GA 1QB7A 1NBAA 3U3OA 1XNQB 1K6XA 4D4LA 1M67A 4BGVA 2QM8A 4Y7CA 1KEZA 5FTNA 1KO1A 1V1RB 4BO2A 4CUZA 5IDWA 4XEHA 3QOXA 4RTSA 4AY2A 3CW2A 3DQPA 4A0GA 2ZAGA 2B2NA 1LLDA 1JHRA 2O59A 1FEZA 1Z4MA 4YV7A 1I14A 1MPXA 2PX0A 1Y8RA 2XB6A 3KLPX 3BERA 4YMHA 2F2TA 1OYOA 4DQXA 4B3HA 2CMFA 2VP6A 3WNVA 3CLRD 3HJUA 3O74A 3QEAZ 3A2MA 2BKVA 4PTLA 4ZGWA 1ICIA 2RAFA 4QJ3A 4XLZA 3L93A 5EZYB 1D7AA 1T5IA 3FTCA 4C21A 3GRZA 1Y7IA 3PT9A 2R60A 2ES4A 1Q7GA 2Q7DA 3U13A 3TSCA 1T0JB 5F5XA 3O8BA 3FD8A 5DCWA 2X1VA 3T5GA 4XGQA 3F46A 1M34A 4ZVKA 1VE5A 1Y4UA 2R00A 4JL5A 3S68A 2J46A 3NC4A 3O3CA 5HKKA 3MUFA 3CZMA 1J09A 3M4XA 3FKQA 2OCPA 3I1IA 3ZHRA 1PQ4A 3QMMA 2OO3A 3LC0A 1NXOA 1OUMA 1CUCA 1Z29A 2W00A 1YTUA 3PUYA 1KORA 5MN6A 1MO5A 3JZDA 1G9TA 2OTCA 4KPYA 1BFDA 4DQLA 3VQTA 1JAZA 5C5DA 4L4SA 3IQZA 4V2UA 3PBKA 2AJDA 4D4HA 4R31A 4N0MA 3L04A 3L6OO 1D0SA 3RUIA 3DO8A 4A6XA 3F97A 3OOSA 4PAGA 5E3JA 1UF9A 4ZARA 2Q3FA 2ODPA 3AKYA 3PF9A 5HCUA 4AN0A 4DUPA 3IX7A 1VG0B 2AA3A 4K28A 4RTJA 4OSPA 3CRVA 5FTKA 2J45A 5FAKA 3LT4A 2BTQA 4YGYA 3BFXA 5KCMA 5ETJA 3ZV5A 1NNI1 3RC3A 4KQGA 2Q8NA 3S1AA 5LIPA 1RAFA 2AF3C 3BQ9A 1USVA 2V8OA 4TGLA 2BKXA 2QPOA 2VZLA 4B43A 2H16A 2Q1UA 3GA7A 4RK0A 4XD7A 3VAAA 4EUKA 5CM2Z 5LLDA 3DLBA 6ABPA 3ESCA 1Z0IA 5SY9A 1Y9EA 4MYSA 2H85A 1R6BX 3D0RA 4YMIA 1HNZB 3ZHSA 3LOPA 4R16A 4QUHA 3UJNA 2DUNA 3PDIB 1AMOA 4E70A 2WWXA 5I9SA 3VTZA 4FMPA 3RAEC 1I94B 5DM1A 4CVNA 1UPFA 1UOQA 1C4XA 5LXTF 4U0JA 4PGFA 5D5HA 1EQUA 4BO4A 1PK8A 1DEHA 2BTOA 2RC6A 3OQ1A 1HOXA 3PPYA 1M2OA 1DCMA 3DAYA 4EFDA 1NFQA 4DR5B 4B6OA 5DLQC 3UAVA 4ND8A 4ZEWA 2NUPA 2FB9A 4PXYA 4NCIA 5C8YA 5DSXA 2ZTLA 1NJ5A 4FLFA 2WF5A 1RYHA 1MH1A 5BNTA 1XP5A 1V6CA 3S6JA 4FZ5A 3S40A 1EWYA 4UOEA 5CB0A 5BQ5A 3W5JA 3HGTA 4JR1A 2OVFA 1GZ6A 3ZNPA 4C7VA 4EB3A 1XXLA 4K9RA 1OASA 1TAQA 4MUHA 1TYEB 3K32A 5KYYA 1PI3A 1L5RA 4C4TA 1I36A 4PQRA 1F6DA 1S5PA 1WF6A 3PS9A 5EXEA 4K8RB 3TLJA 2E5LB 3MD0A 1AMUA 4NQRA 1R9NA 4ZU3A 1YVUA 5KTMA 4ZO9A 3WVNA 1ZR4A 2XCIA 3PJDA 3JVDA 4KN6A 2HRDA 3Q7QA 4DWWA 3R7DA 2QI9C 1Z73A 4HUQB 3HO6A 3QJYA 3ZJ5A 3IPCA 3FFXA 5FO0A 4M1YA 1I32A 4RM3A 4U3JB 2F1RA 2AR0A 4HDOB 2OEPA 3PSAA 2EQAA 5CLLA 5ANRB 4BZPA 3T5CA 2YJNA 1PIWA 2Q49A 4B48A 4DNOA 2DZDA 1UBMS 2PIDA 1ODLA 4OQPA 3M34A 1WZ2A 4V0KA 4RVUA 4O25A 4OBWA 1WY5A 2AFHB 2Q07A 4MWTA 1RNLA 4DEXA 3BE5A 3MS7A 5B4VA 3C0KA 5CM8B 1JIKA 2VHJA 2B83A 3WKEA 4CF5A 1XJ5A 4LOAA 4BB9A 5EGSA 4G0OA 3FOFC 1PE0A 3WTBA 1UBNA 2HA5A 3A36A 1M2HA 4LVUA 1XAHA 5IVPA 1TQDA 1TMOA 2B8JA 3C4QA 1U8FO 3M3HA 4S1TA 5AK4A 4DPMA 1KEKA 1XTBA 2F55A 2ZBFA 2A4KA 3EMBA 5JPDA 4US1R 2TSYB 1ECFA 2F3SA 3H8WA 1E20A 1ULHA 3KVYA 4M21A 2GNOA 4OHVA 5F7JA 4ZCMA 1ULTA 3MVEA 4F7WA 3AXTA 2PQMA 2C3PA 3DP7A 3FYTA 2B1GA 3T95A 4DB4A 1WD5A 3H1GA 3INTA 4DILA 4Q12A 4IRMA 4OAPA 2VZ9A 1T2FA 2CBGA 4ZQEA 3LCJA 3TTVA 1HYEA 4YDQA 3KQKA 4I2NA 3TS1A 2IXTA 5G1NA 1R00A 4J8PA 1RKQA 4YWHA 1RHMA 3IELA 2PRIA 2KYRA 2AUNA 2OXFA 2XNKA 3KX2A 3BBLA 4V02A 5AESA 1II0A 4RTRA 3AVWA 5DNUA 4ER5A 4FNOA 1MAHA 1WABA 2PMKA 4MQBA 5ICCA 4CG2A 1NVXQ 3I6MA 3HKCB 3Q72A 1Q14A 2FG6C 3S8MA 3W5HA 1JIQA 1O5IA 4RK4A 2WF7A 2FZ5A 3B6MA 1AZLA 1SZDA 4HDRB 2QTAA 4LY9A 3TH5A 5F77A 3ZZ0A 1NRIA 3OA2A 2XJ9A 4E0BA 4H27A 1X8JA 3CV3A 4K86A 1C7IA 1M8PA 4G5HA 2GHTA 5EP1A 1F1BA 2WSMA 3KOYA 3L7AA 1RI5A 2IV7A 5DBIA 3B38A 2QHXA 1O03A 4LOKA 4G0NA 2HK6A 3D7LA 1LDGA 5L53A 2IYVA 1XTPA 2GJ4A 2Q0SA 3EXEB 4CG1A 1O87A 4MPPA 1ZVKA 1WPRA 4G1VA 4E2FA 1OPXA 4NJOA 4RFSA 3PUIA 3K6RA 5BVGB 3S4YA 2H59A 4I08A 1B6SA 2I8CA 1ACJA 2X2EA 1HTBA 3B1ZA 2WKQA 4Q4LA 2EATA 4UQLA 1LH0A 1UANA 1T4CB 2ZIVB 3QPBA 3DKRA 2OKGA 1WTAA 1DELA 1ZBQA 2YYYA 2ZCJA 1DKOA 1QCZA 3JZIA 3W6NA 4D25A 2R00C 1DRWA 3DGEC 1VJCA 1Q0QA 1AKYA 2VF7A 4V03A 2X23A 3ICQB 2TMDA 1R6XA 1AJEA 4JSTA 5CVCA 3SGLA 3ZDQA 2VRWA 2LXNA 4HN2A 4M1TA 3JD4A 1M5RA 2DUUA 1WXEA 2WSSA 3G23A 1E0AA 5K45A 1Z63A 1U2RA 5IWCA 4I4IA 1I2ZA 1SAYA 1QLHA 3BHNA 3JWJA 3SEFA 4EHHA 3ADOA 1O94C 1H4QA 3TUIC 5HR5A 1VRVA 2WNHA 1OB5A 4DCVA 4YI5A 4FU0A 2XWBF 4XVQA 3MGCA 3HGMA 4GM4A 3PJRA 2J4CA 3ZE6A 2MSKA 2I78A