2AB0A

Crystal structure of e. coli protein yajl (thij)
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
195
structure length
195
Chain Sequence
SASALVCLAPGSEETEAVTTIDLLVRGGIKVTTASVASDGNLAITCSRGVKLLADAPLVEVADGEYDVIVLPGGIKGAECFRDSTLLVETVKQFHRSGRIVAAICAAPATVLVPHDIFPIGNMTGFPTLKDKIPAEQWLDKRVVWDARVKLLTSQGPGTAIDFGLKIIDLLVGREKAHEVASQLVMAAGIYNYYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Atomic Resolution Crystal Structure of the YajL (ThiJ) Protein from Escherichia coli: A Close Prokaryotic Homologue of the Parkinsonism-associated Protein DJ-1.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Unknown function
molecule keywords YajL
total genus 71
structure length 195
sequence length 195
chains with identical sequence B
ec nomenclature ec 3.5.1.124: Protein deglycase.
pdb deposition date 2005-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01965 DJ-1_PfpI DJ-1/PfpI family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2ab0A00
3VU3A 4N0MA 2ZUTA 1O1YA 3UJNA 1C30B 3P9SA 3CZ9A 1GGFA 3EZGA 3UOWA 3EJ6A 3WFZA 1GGJA 1JVNA 1GPMA 3UK7A 3RHTA 1T0BA 2R1TA 3EN0A 3PQ7A 4ENVA 4BIMA 1QVWA 3P9QA 4LRUA 1N57A 3PQ6A 1PE0A 1GGEA 1CS0B 1S1MA 3MGKA 4WINA 1KEEB 3SOZA 2RK6A 4K2HA 4AJ9A 4WXYB 4Y1EA 1IZZA 1P7YA 2XF2A 3ER6A 4ENTA 4UNIA 4PXYA 4ENUA 2A9VA 4ENSA 1P81A 3B38A 2ZUUA 2RK3A 1VCMA 4UZSA 4R7GA 4UOZA 5SY6A 2ZUSA 5BV2P 4Y0NA 4GE3A 2IUFA 2YWCA 3NORA 3TTWA 3R76A 3F71A 1OY1A 1KXJA 1KWKA 1OX4B 1IZYA 3BHNA 2ZUVA 1VCOA 1KA9H 3CYFA 1GG9A 3PQ3A 3ZJ4A 5K4AA 2ZUWA 2W7TA 3TTSA 4QYXA 4S0ZA 1L9XA 1QWSA 3CZAA 4Y1RB 3FSEA 4Y1GA 4I4NA 1OX6A 1UCFA 4ZDIA 4OGFA 3B36A 4ZDJA 1P5FA 4ENWA 1C3OB 5JZOA 4GE0A 4BTEA 4BFLA 1QVZA 4AUNA 2GHRA 4P5PA 3F5DA 4OJYA 3KKLA 4HCJA 4ENRA 2VPIA 3L3BA 4P36A 1VCNA 3NOQA 3D54D 4L95C 1P7ZA 2NV2B 3CNEA 1U9CA 1PDWA 3L4EA 1JDBC 3OT1B 4LGYA 1FYEA 1KWGA 4B7AA 1CF9A 4L8FA 3ZR4B 1I7SB 2VRNA 1GGKA 1OI4A 4MTCA 1BXRB 4OGGA 2R1VB 3UMMA 2NV0A 4UOQA 4OIFA 4OQ4A 2YWJA 4RKYA 3M3PA 1GGHA 1K9VF 1VHQA 4MGHA 2YWDA 3PQ5A 4AUMA 1PDVA 3TTVA 4N12A 2VXOA 1OX5A 2RK4A 3NOVA 4L8WB 4QYTA 4Y1RA 5SYAA 3ZJ5A 5JZMA 4L8YA 4Y1FA 2AB0A 3SF8B 1QF7A 3N7TA 2OR3A 4L78A 4ADSG 4B5KA 3NOOA 3R74A 1A9XB 3PQ2A 3TQIA 4B2YA 3L7NA 4ENPA 4ZDKA 1I1QB 1SY7A 4P35A 1P80A 4JQSA 4E08A 3MIIA 3UGJA 3OT1A 2VKTA 3PQ4A 3EWNA 4ZGGA 4GUDA 4AUEA 1J42A 4OFWA 5LIRA 3PQ8A 1I7QB 1Q2UA 4B40A 4P34A 1R9GA 1T36B 2WJZB 1Q7RA 3L18A 4P2GA 4AULA 4E5VA 2GK3A 1CE8B 3EFEA 2D7JA 3P9RA 4I2NA 5IP5A 1FY2A 3SF8A 1ONSA 1WL8A 2ISSD 2R1TB 3GRAA 3R75A 5SY9A 3NONA 1PV2A 3FIJA 2H2WA 4UCFA 2YWBA 1IPHA 1QVVA 3TTTA 3TTYA 4B31A 4D1YA 1T3TA 5SY4A 1M6VB 2R1VA 2V4UA 1G2IA 2R1UA 4RKWA 5DFAA 1OX4A 5E9AA 4MNTA 3CY6A 2AD5A 2FEXA 4I46A 3BWEA 1QDLB 3B3AA 3NVAA 4ENQA 1GPWB 4XLLA 4L7QA 1SOAA 2LXNA 3TTUA 3P9PA 2VDJA 3TTXA 2ABWA
chains in the Genus database with same CATH superfamily
4N0MA 3RTAA 1OLOA 3MF4A 1CUCA 5CNKA 5IUJC 3W5IA 2P9FA 1WSBA 1Q7BA 2QR2A 3F3YA 2OWDA 3KTAB 1TYDE 2NSJA 3IOEA 3HFJA 5DPMA 3W2FA 1XCBA 3WS7A 2B61A 4RK5A 1LI5A 4LF8B 3LV8A 3EDYA 4OQYA 3RIGA 3W4IA 4D9IA 4QHSA 3P96A 2BL4A 1M66A 2VCHA 1SBHA 3WYCA 2CLDX 3V8MA 1YA8A 2CNWA 1XDSA 2WMYA 4BO8A 2KSQA 1ILEA 5GONB 2O3QA 3ADDA 1OZGA 2FEOA 7REQA 4WUTA 2GBLC 2I8CA 3EZXA 3K8YA 3S0JA 1IVNA 3MPOA 3I9MA 3JALA 4IFEA 4PXSA 5BURA 2WM8A 1NJGA 5F2OA 4NICA 2REQB 1IAVA 2KJQA 2C2HA 4FBMA 1QYRA 3WGHA 4K1LA 1JG3A 3K6JA 1N5OX 3RC8A 2P3LA 2WJ4A 3A9CA 2I91A 1GJRA 4RPLA 3JYQA 4M7RA 1L7OA 4EUEA 1VCNA 2N46A 3TJMA 3BRCA 4BCBA 1MV5A 2Z2JA 4PO9A 5GPBA 1OZFA 2W48A 3QKRB 4RCVA 4ZCLA 4FYVA 4JL5A 1YMVA 4LMRA 4W5OA 2AN4A 4BO5A 2AA3A 2GFQA 1DTSA 2JLWA 2ZVDA 1AHNA 3D3NA 4M22A 4XGIA 1VMDA 1IBKB 1FS5A 3EZ9A 3I5YA 3HP4A 4O4HA 1E3MA 4LISA 4BLUA 5LLDA 2C4TA 3OD1A 4TWAA 2IYQA 1CETA 4Q9NA 5ENZA 3EGDB 5CXXA 1K7EB 2EKBA 1N9GB 1QM5A 2HV9A 4MKZA 1OWOA 4DBZA 2X7JA 1G5QA 2JK1A 5M29A 4B7CA 4N7MA 5EJGA 2Z4SA 5HFAA 1PWEA 1PGQA 2OBBA 4GI7A 4M9CA 1P29A 2VWPA 3ZV5A 4WMLA 1FFYA 3AEXA 2JAXA 3D2LA 3K70B 4QO8A 4WX2B 4CVNA 5LIRA 3CZ5A 1K0FA 1SB8A 3I42A 2JGDA 4IS3A 4RO0A 4KHZA 2FW7A 4OHBA 1W52X 4BGEA 2ZAMA 2OCKA 3BK1A 2IA5A 1E6LA 5DNWA 2YYYA 4BEBA 3OEED 5IYZA 4F6RA 5LQCA 2ONCA 3K5WA 2O2EA 3IXQA 1KS2A 2OT3B 2UZ4A 1BDHA 4BQEA 1H2HA 3IURA 3OJXA 4G67A 3GZ4A 3RIXA 1ESNA 5C7OO 4MVJM 5IJ9A 1XKXA 2ZZKA 5EQJB 3PVZA 5KCZA 1ZIYA 3GX1A 3HJNA 4BNKA 2DERA 2JBHA 2P40A 1AS3A 1M1YB 2DC1A 4H35A 3VR5H 7ABPA 4RTRA 2Q8PA 4OH1A 1W36C 2ZR0A 1Y5NA 3TL3A 2UXCB 2H31A 2ZIGA 2G36A 4RULA 2R8RA 2XA1A 1RCFA 3FD8A 4HFNA 2RG7A 2IV3A 2COEA 4PHHA 2LKDA 4WK4B 2PQ2A 3ZTYA 1A9SA 1E77A 3VU3A 1F06A 1E92A 4ZCPA 3IOBA 4WASA 2C8VA 1QB8A 3B7WA 3CZ9A 4UHFA 4MV6A 1XPJA 3ONFA 4D44A 1GRQA 1L8OA 3EVDA 1WSDA 4YJGA 2OTCA 3LQKA 5AVYA 5JH7A 1HR0B 5KAMA 4X8HA 1L4MA 3G85A 4EI9A 3ANYB 4A82A 3E27A 4Q34A 3AP2A 1P81A 1QNLA 1JU4A 2Y99A 4PSAA 1H2BA 3K15A 3CX7A 5EI5A 2Q29A 1O5TA 1A3CA 1IWPB 2Y1XA 3E9DA 4LQLA 1KR2A 1QV9A 1RNLA 4JGGA 1G55A 1YVUA 2CXXA 5DTEA 3JQAD 2G77B 3FNBA 4R8VA 5AM2A 1IZYA 3SBEA 4UPEA 1Y8QB 3UH1A 1CZKA 3B6IA 3DE6X 1YI8A 3A4VA 1QYCA 4MINA 4MHTA 3TJZA 1Y8CA 2HA2A 3FNIA 4XXHA 3WYAA 3I2KA 2M98A 2ECOA 3FUTA 4GOXA 2NGRA 3ROMA 1WZEA 2IW3A 5ELMA 1LVUA 2UDPA 1JA0A 3S2SA 1YOVB 1X92A 4C43A 5C3UA 3JAKB 3TVDA 2JK0A 2DVMA 1MGPA 5EXPA 3FKJA 1DQPA 1XEFA 3OQPA 4OMFG 3ELYA 2CJPA 1ZK1A 3ANSA 4Q3BA 3L4EA 2W6ZA 3KQKA 1M1ZA 1SOVA 4FNGA 5HWSA 3ILHA 4M0PA 4PY2A 4BE9A 3GJ5A 3R6DA 1CB7A 2FUNB 4ZVRA 4UVHA 3HGTA 3EF3A 4M7WA 1JS1X 2DQYA 3FWYA 1TQ2A 4UVGA 1PR3A 1VG0B 5K99A 3VR6H 3Q3EA 4AUMA 5LZ4A 4W4TA 3TTVA 2PTHA 4YJKA 1CS4C 4D3XA 2J48A 3GB9A 4IEIA 2ORWA 4W5HA 4AM8A 1TU4A 1PU2A 3CLRD 3ZDQA 3KTDA 4E5MA 4MHSA 5DNCA 1I2ZA 2QX9A 3SFVA 1LEHA 3DBVO 1JAHA 4A2WA 3ZWKA 1A2OA 3GBSA 2WSYB 5B58C 2CBXA 3Q9LA 2PA3A 4QXRA 4DIEA 4EPTA 2D0DA 1VXOA 3DZHA 5JO9A 3B1WA 1Q20A 4FHZA 4X65B 4IJKA 4YRJA 1ENPA 1R74A 4LQDA 1E1CB 2C3YA 1F8YA 2A0UA 2ECQA 4GUDA 4K6MA 4MUAA 1R88A 3TZHA 1C2TA 1PZNA 1II9A 2BKLA 2GRJA 2NX2A 4FMCF 1R0LA 2QM7A 4N0QA 4ZA2A 4ZYTA 5JMOA 2CNDA 4I1SA 3BULA 4P2GA 4B3SB 4NMHA 2FN3A 5FTKA 1G21B 3I37X 4BBJA 2BUAA 4J0QA 7MDHA 4OJNA 3NDRA 3ZCPA 4RSHA 2XITA 4H77A 2BFEB 3IVAA 4LDJA 3EIEA 3R3XA 4GYWA 3RRJA 4D6XA 2QJFA 2Y0EA 2PKCA 3N0WA 5TXGA 2J0UA 5CBPA 3WXBA 1EGVB 1HYGA 1QYXA 1U4NA 4O3FA 4N8EA 1PQYA 3UXYA 2AQKA 3V4RA 4EEXA 2HH9A 1GLVA 3BMCA 3F4KA 5EL0A 1Z0UA 2JF0A 2Q50A 1TL7C 2O0LA 3H5NA 4DLYA 5A4KA 3MEQA 1TM5E 5E1OA 3SVZA 2J3KA 4OO3A 1TADA 2FWNA 3KDSE 5F3WB 4OBBA 4WKNA 3BXHA 1NW4A 1U0RA 3G8AA 5JU6A 2EFHB 4C1BA 1EEXB 4PQRA 3CMMA 3R6WA 1QF9A 1T5IA 1F4VA 3HGMA 4FT4A 2FKAA 4BNIA 2LDBA 3O4JA 3TOVA 3GAMA 2WZCA 2OHGA 4OXKA 1AGPA 2A4KA 1IBSA 2V7WA 2W0SA 4KQ9A 1PRYA 1SCBA 1Y3AA 2WV7A 2XKAA 4WLFA 1ZAKA 2WF8A 3E7XA 1J0EA 3LCUA 2I0FA 2VUHB 1BQ4A 1DCMA 2IHUA 1SXGA 4YP1A 4F2DA 5CDSA 1XDGA 3FHOA 4K2HA 4RXUA 4X45A 3HE3A 3HZZA 3EH2A 2X1VA 3KDAA 4G0WA 3G8YA 1MIOA 1DOZA 2G08A 1UMBB 3EMKA 3KOMA 4G07A 3LW8A 5JQGA 4ED9A 2O2IA 4B84A 3LBYA 1UFVA 1EKXA 2A9JA 3WQSB 3ZK8A 1RHQA 2QV0A 1E9FA 3ZVLA 4EYEA 5LZ5A 3UVEA 5IEBA 2EZUA 3DM9B 1DO0A 5H3CA 3X2EA 1XTBA 1M7GA 1BRTA 2LDXA 3KLPX 1MD9A 1T9ZA 2P2ZA 2ASVA 1NUQA 1PN3A 1L5LA 3PUWA 2EX1A 3BPSA 1KZHA 4A8JA 3I32A 2F8MA 3K35A 3UGQA 1N4AA 4DCSA 4JAVC 4K86A 1SBCA 1KH2A 4QEKA 1TYEB 1HTTA 2W93A 2NV2B 4HMQA 1REQA 4P7FA 4WKOA 4B32A 1WXHA 4WD3A 5BMVF 3R20A 1C5KA 5ER6A 4Y0VA 5K4GA 2RAVA 3DZ8A 3I5MA 4H1VA 3W34A 5JMWA 3UWPA 1I33A 2R1VB 1EFPB 3M6IA 4BB6A 4O63O 4EKYA 3RK4A 3LHIA 3ZW8A 5I3ZA 2VP9A 2O7NA 4IV5A 1N7IA 3LRXA 1CUDA 5I7EA 2B1JA 4AZ0A 1DAEA 5JPIA 2ZIWB 3WLEA 4Y1RA 1NMYA 3THWB 4PM4A 2O8EB 2I33A 3SYNA 2P9BA 2ZEJA 4TN5A 4ZQBA 1NI4B 4ZVPA 1T1RA 1ZHHA 5E7MA 5JCJD 1CZLA 3MT7A 1QRDA 4GMFA 4XYMA 3RYFA 3V7UA 1J33A 1AA6A 3HB9A 3RD5A 3TQRA 2JDIA 2JZOA 2Q1SA 2OD9A 2DPLA 3FPSA 4AKTA 4C89A 3DQQA 3AYXB 5HFNA 1RRFA 2BC9A 3DZDA 2C7VA 3TLXA 2PMFA 3W5DA 2J30A 4DDUA 1F17A 1Y4DE 5ALWA 3PDCA 3I72A 4KXUA 4Q7LA 1DZIA 2IU4A 4MAAA 2BM1A 2GTPA 3FDFA 4K9PA 1TO6A 3TMKA 3UAWA 3RF7A 1XCPA 4WJZA 3PT9A 3T5CA 3TW4A 3VU1A 1Y82A 2P7HA 1CY0A 3MINA 1V3QE 4Q1CA 4EP1A 6Q21A 3U7HB 4IHJA 2BGNA 4FJ2A 3WLLA 4AN4A 1Y3HA 5AVWA 5AQEA 5EA2A 2VZEA 3VPHA 4UM9B 1ETHA 2IV2X 5CLQA 4LDAA 5B2ZA 2GESA 1YH3A 1AKQA 3I2GA 4M0CA 2HFKA 2E49A 2Q1TA 3PUZA 4RESA 5JPDA 4J4HA 3C16C 2BHTA 2V6GA 3GT0A 2D1FA 3IP1A 3K6RA 3NTQA 2JB9A 1JKMA 4Q12A 4XLLA 1B15A 1DKRA 1K6XA 1N4DA 5CLGA 1DXYA 1BW9A 5FUXA 3ZDFA 2I3BA 1SHKA 5CIYA 4DR6B 4TMYA 3ZS9A 1JZQA 1U9YA 1E7MA 1DFIA 1OT3A 2HNBA 2QG6A 4XCQA 3UG7A 3D3KA 4FPXA 1LC0A 1FNDA 3VKVA 4OLAA 3U3MA 3ISTA 4RK6A 5ECGC 4HJRA 3EFBA 2JLAA 3ET4A 3CHYA 3OEEA 1J21A 1SWWA 1EXDA 3ASVA 1WB9A 3R7AA 3LGXA 1GKUB 4PC1A 4YBRA 3Q8MA 1HLGA 4X9XA 4AJKA 1JJ7A 2R7NA 3KP1A 4ENTA 3SICE 3VR1A 4BATA 1X1QA 2X8BA 2FWRA 3TNDA 5B58T 5I7UA 1RXVA 4R98A 3QVWA 2FTKE 1PS8A 4J0GA 3RTCA 1WUYA 2GPNA 1TQ6A 2FPGB 4GLOA 3FSJX 1CUJA 1Q3HA 3COPA 3IKLA 3ILYA 4ESEA 5JEEA 4G1VA 3SQNA 2PUDA 3GRVA 1IEVA 3WWZA 2LNDA 4HGPA 4N40A 3PF9A 4QYSA 2YVKA 3O3CA 4FFSA 2ZT5A 1J8VA 4X0EA 1QK5A 2RHRA 4C14A 4C4TA 4BBZA 1NVUQ 3MA0A 2E7ZA 3IKTA 4TM7A 3FFTA 4K0RA 4OBEA 3RBAA 2D5AA 4RAOA 4EENA 2VG8A 4KMMA 4LWOA 2OEPA 1COWD 3TOXA 3UK1A 5FX2A 4DJJA 3LY5A 1N8SA 2B20A 4KLRA 5C1BA 1QONA 5CAEB 1NONA 3JQDA 2FEMA 2CXUA 1DKPA 3KQNA 1Z4PX 1SUAA 2W2OA 3CONA 4NHOA 5IXYA 2A5LA 5AM3A 3KKPA 3NHAA 1XA3A 1MVNA 1FQOA 2J6IA 3CC8A 1U5CA 5J4HA 3FI0A 2O8DA 5JFGA 4ALMA 1N77A 4AJ2A 2AGVA 1DRVA 3S2FA 5HFJA 4EA6A 3HCPA 4MH0R 2WILA 1AUXA 1YS6A 2Q6VA 3S40A 1TJYA 4MQUA 3WHLA 4JI2B 1UQTA 1ZN2A 1K2WA 5DLPA 4GI1A 1R6XA 1QHGA 1ZONA 2B34A 4FK8A 4FCVA 1LI7A 2V6IA 2FSHA 2Z1MA 3L7NA 5EGNA 3UEOA 2VIIA 4CL8A 4NYIR 1QGYA 3HV0A 5LJIA 4FHEA 4ARSA 4YJ2A 1TMOA 1TW2A 5LNK6 1CLEA 4I19A 3U44A 1ZOLA 3MJDA 2Z2YA 1W6RA 3HU5A 4XX1A 4JI0B 3C98A 3HBJA 4OHZA 4NAVA 5JXJA 1D1QA 2A9QA 1YC2A 2Y1WA 4RGQA 1ZW1A 1A8HA 2E82A 3EXHA 1EJ2A 3EHEA 1VDMA 3ZV4A 1Y6JA 3FMIA 5EPEA 4EFMA 4LSZA 2PRIA 4B6PA 4E32A 4BRWA 1NI3A 4IQ8A 2DFVA 3M81A 1GCGA 2W2MA 4TMVA 1XCLA 3KKQA 1KVSA 1MTOA 2BEUB 5DHFA 3PNYA 4D4JA 1BSVA 1JT9A 1US8A 3BICA 3UFXB 2HYDA 4EATA 1K3FA 1YBFA 1PNOA 1RAAA 4RGYA 3VDMA 1ISPA 4MCAA 4JLWA 3ZDRA 3A2KA 4MYCA 3AT1A 4FYIA 4EVQA 1ZVVA 2QMQA 3U4DA 3FZYA 1M83A 3BWEA 3PFNA 4DUYB 1LPBB 3Q5EA 5FLKA 3QV1A 3V55A 2BYTA 3N3AC 2QMHA 3VZPA 2FW9A 2TECE 4HAOA 5CYPA 1ZOSA 4GQBA 1J8MF 4QQKA 4EI7A 3RLIA 4XWAA 1Q0HA 2GCNA 2WPNA 1P0CA 3HKDB 2VYVA 1V5IA 2GLUA 3JQBA 3QW2A 3RQIA 1D3AA 4ZALA 1P2VA 4F72A 1PDOA 2PG3A 3REQA 3P0FA 1R3DA 2AWNA 1R6DA 4E51A 5ILOA 4BQSA 1Z06A 3PKZA 3NDPA 4QTUB 3MW8A 2QKYA 2RKOA 4GICA 5KC9A 4O4IA 1J4AA 1G41A 5C2JB 1KIFA 1OWNA 1SQGA 3I3SR 4UUAA 1CZUA 4P3OA 5T6BA 4W7SA 2ZUSA 1JEDA 2Z8XA 3ANLA 5TMEA 4I5GA 1JE0A 2GM5A 5TMPA 1DXHA 4PAMA 1JZTA 3QBVA 1II8A 1F0KA 5KAPA 1NNI1 3EXFB 3KHSA 3BEOA 4S2EA 2A30A 1YR7A 1WTAA 1IK4A 2BVNA 4H6VA 3H5RA 3TZBA 3WYEA 4YT5A 5LA6B 1EVKA 3KL4A 1YL5A 3SZGA 1HM5A 2PYIA 5F9HA 4I55B 4XE5A 5D51S 5DN6A 5KC8A 4AUNA 1OFVA 3GFGA 2O8CA 2WWXA 5KVVA 2ODNA 4WWHA 1ZMRA 1Z8HA 2Y9MB 2CV0A 2EBWA 1FTQA 1QIJA 2C5HA 2HDWA 1ZI6A 2YINC 3OHSX 1U3TA 4PYRA 4B8YA 2GCIA 4NJMB 1FYDA 1MEEA 4DDMA 1XXHB 2CBZA 2J5KA 4LNUA 5KPJA 2PNFA 2X1HA 4CNQA 4D6PA 4UBNA 1E1LA 1ZEJA 4IFIA 1HDIA 1XTQA 3OIWA 3GU3A 4ZK6A 3C1AA 3PEVA 2ZUFA 4RKQA 3CUYA 2FR1A 2RCNA 1U28A 1Y3DE 1UH5A 1NN1A 1K7CA 2PGXA 3A4TA 3QKWA 5DHAA 2P30A 2Q41A 2YX1A 5A3QA 1KIAA 4EZBA 4F2WA 2C7QA 1ZW6A 2JW5A 3QVMA 3HWSA 1VECA 1BA2A 5GAJA 1WV1A 3QVLA 1CUYA 4TLLB 5CT4A 2QTLA 3SDZA 3TKLA 2K6GA 1OC2A 1J97A 2GCOB 5C80A 4TSRA 2PWAA 4W5RA 1GYPA 2ZI9A 3QU5A 4KQJA 3TKYA 4NS1A 2RH4A 3GK3A 1YKSA 5FT9A 4DMGA 5IDWA 2CY0A 2FSUA 4QXQA 2HV8A 2JGRA 5GZ3A 4DEXA 2ZKLA 1H1LB 3G59A 3IO3A 2ZS7A 1R4MA 4KE6A 1JALA 4QUBA 2R8EA 4C2BA 2PS0A 4BNFA 4YQZA 4UM8B 4POOA 3E3OA 3AVXA 3C7KA 4L02A 4O2BF 5FP0A 2AOXA 2XVMA 4ABYA 5AW4A 1ZM3A 2GPWA 3QUBA 4HB3A 2CCKA 3LY7A 1E32A 4E4RA 2ZDHA 1GL6A 5GJVC 1HTBA 1XNQB 5AW8A 3QUAA 2FW0A 4HATA 3H19A 4I4CA 1UOPA 2YXDA 2OCBA 1W4LA 3RYTC 1CRPA 5DYTA 5E9AA 2ROQA 2VAXA 4QU0A 2R7MA 5JS6A 4OKNA 5TT1A 1JEOA 1V8FA 3O94A 4A73A 1EG7A 2G5TA 3AR9A 1AN0A 3I8SA 2CF5A 2EP7A 1GFIA 1Z5PA 1ZJJA 1FSZA 2Q3BA 4B4VA 1RT9A 4KX3A 1I1OA 3CTMA 2X5JO 3DV2A 1DAKA 3ENVA 3W79A 1EP9A 1TM2A 2EFYA 1LLQA 4QGFA 5AW5A 3HJFA 3AVTA 4FWIB 1JHDA 2JI9A 5JCOC 2GETA 2AXQA 3F5SA 2HMYB 3F4LA 5JZVA 1XIVA 2GLTA 5I7OA 2ZRCA 1TI7A 4W7IA 2GO1A 3GFVA 2WJHA 1Q84A 3K0CC 4KSYA 4U2CA 4E31A 1QU3A 2NZWA 3D3WA 3WHKA 5IVPA 1OLUA 2Q2NA 2JJYA 3IEIA 4ZEOA 4YGYA 4BRUA 4F71A 4GLFA 5LA6F 4JT2A 2H07A 1WMEA 2PM8A 4AN0A 3AQ4A 5A3RA 5A3SA 2OGTA 1X3LA 1N2IA 2EC5A 3CF4G 3HMKA 3NBZC 4XIYA 3T7TA 5L7WA 2PSJA 3BERA 4KN9S 1IQ0A 3EXAA 3VA7A 4NMWA 4E11A 1JLKA 4MV1A 2CB9A 3IAS1 5B30A 3DMTC 1M0WA 5DTJA 3RC1A 3OZCA 4R2LA 10MHA 4RD2A 3HM9A 1LNSA 3TQOA 1W59A 4AJIA 1SA0A 2YV2A 4CQLB 4E14A 4HH0A 1DLJA 4N5IX 1W47A 3H4TA 4LBWA 2V7EA 3W6ZA 5HZKA 2M6LA 5T3UA 4IDNA 3FDZB 2Q1UA 2VCYA 1ZWKA 2WE8A 3CZCA 1L5OA 3DEJA 5DMHA 4DQ0A 5JV5A 2HGSA 1JNYA 2M1ZA 3R0IA 1XR3A 4BV3A 4Z4EA 1T36A 5DT2A 4Q6WA 4RNCA 1U8YA 5T6MA 4A23A 1BCRB 1ZHOA 3NWPA 1GPDG 4L4UA 1G291 4K81B 3B5EA 5FO0A 4NV0A 2H1HA 5HF5A 4HRYA 5EJ2A 1P4RA 4MPRA 3RVPA 1M6YA 2G1PA 4FILA 4BY9E 1G98A 3AF1A 2BGJA 3AY6A 3SR3A 2QE7A 1SQFA 1H6DA 1K8YB 1XBTA 4YDRA 4B75A 4UNNA 1W5SA 2VTDA 5M5BA 1WS6A 3VVCA 1QRRA 3IVCA 1YR6A 1P1HA 3UMVA 4HXYA 4KPYA 3OWOA 1QXSA 3MWEA 3NNNA 4JBXA 5EQTA 4AC9A 1ACMA 1MRSA 3HN7A 4BQQA 4IW3B 2F3UA 5B7QA 2XVXA 5UKDA 4UHJA 5KWSA 1GXSA 4UBIA 4QYIA 3CEAA 3AI1A 4ZVKA 3PNKA 3B89A 1DZ3A 4DUGD 3X1DA 5DN9A 3LKDA 3KTOA 2OUIA 1MV8A 5G1NA 3PA6A 1WHSA 1XMIA 2ZP1A 2ZXEA 2MINB 2OZVA 3I9NA 5T4HA 4CUKA 4UJ3A 3FPLA 2UAGA 1EE2A 3AXTA 4B4WA 1TZ2A 3ZZMA 1KSFX 1USWA 4RIIA 1RP7A 3EZ2A 2W2QA 4IJVA 1ISFA 5AKJA 4AS3A 5DW0A 4C9BA 2NSHA 4PQYA 3RU2A 2WJZB 4JJFA 1Q7RA 4KVAA 1WTCA 1TEZA 3IAEA 3C15C 1MQSA 3HP7A 2CLSA 4RELA 5F9MA 4ARZA 1YZLA 2R1TB 4AZSA 4OI4A 2ZBVA 1AGXA 1J39A 2NU6A 3EVTA 1FVXA 4TS1A 4U7JA 1JDPA 2XT9A 4OHFA 3BIOA 3DJYA 4IUDS 5J3JA 1OFUX 1RAGA 5B5SA 1N2HA 2A92A 3JZFA 4PTZA 1CY7A 3UHAA 1C3OA 2ZS9A 1HYBA 1U98A 1CEYA 3IUYA 1VI6A 2XDAA 2WWRA 1CRWG 2F1OA 2WTXA 3GVIA 1KDPA 2ZYGA 3HCEA 4QHTA 2F8TA 2O0JA 2Q3LA 2TMYA 3LT5A 4Q1EA 4UU7A 5HIMA 1ADFA 3AFOA 4K9KA 4XSVA 1ZJWA 2DFNA 4KXVA 2P69A 3WI7A 1OKKD 4MUFA 4TKUA 4MV5A 4G4JA 1KP9A 1P2UA 4QUGA 4V38A 3ZV3A 3JV7A 1OIWA 2AFHA 1MJNA 2P79A 4ZJPA 4RS3A 4EFLA 4NOLA 2BY4A 2HIGA 3EN0A 1M1UA 4BJ1A 3H0CA 4PPNA 2IEGA 4N0DA 4ZJYA 2JHCA 1Z9BA 5B6PA 2GK4A 1S1MA 3CR7A 5JWRA 3V1TC 4WLVA 1C0EA 1I4WA 1G2PA 4CIXA 4DQLA 1NVWQ 5F73A 3WRYC 1TKRA 4CM3A 4CM7A 5K1ZA 3MTDA 5JECA 3HJAA 4G4SO 4QDJA 4U5QA 1FJGB 2DHQA 1ECLA 1ZINA 3EPPA 3VR6D 1TDJA 4DOMA 1DLIA 2BD0A 1FLNA 2GZDA 5HMMA 1P8AA 3M6VA 5CCEA 5FAKA 1XPRA 3PSHA 4Y2YA 3K0CA 2JAUA 3VR3D 1HLFA 3ZQKA 1PQWA 3NV7A 3O47A 2GYWA 1PR2A 2VEOA 2WSIA 2FE4A 1OX6A 4YMIA 4DV4B 2R62A 1XF1A 1MG5A 5FBWB 2OYRA 3UXHA 2NUPA 2XZOA 4P5EA 4I50B 4MPDA 3ZE0B 4B2PA 2FGJA 2OBNA 3RNOA 3SQMA 2EIHA 4MMYB 4MJ3A 3D7KA 4LI3X 4LBZA 2H8KA 1AA9A 1IY2A 1IHYA 4TKVA 2XVYA 1CIVA 3JRNA 4LS3A 4N65A 1RYFA 2IQIA 1XX6A 4XYBA 4DR3B 5EP1A 4YLYA 1NNEA 1KYIA 1RXEA 4TLEA 4I3GA 5AKZA 5J2TA 3TKAA 4CM9A 5F4ZA 2Z30A 4XWOA 1A4UA 2OORA 3QF7A 4M8SA 1OUMA 4ALNA 1VG9B 1QTRA 2V7BA 1N33B 1Y8AA 1W581 3D8SA 3QUSA 5B4VA 3HVUA 4TYNA 2PX5A 2OCGA 2BP7B 3GEIA 3VVLA 2FLVA 2WIDA 3FUXA 3M5CA 4YRKA 2ONJA 2Q3DA 3CLKA 1N0VC 3DXXA 4O08A 2F43B 4MW0A 2D2VA 1UKAA 4B6GA 4XSHA 4ZPJA 2QD2A 3MMSA 3H87A 3P4UA 2IS1A 1OKKA 3R0JA 3PEYA 2JA1A 4NH4A 2DXIA 4WBNB 4CKXA 1AKEA 1YE8A 4H4DA 2CD9A 5KWIA 3G6WA 2PFGA 4GOOD 3M2TA 4J75A 3JVEA 2PZAA 2O8FA 2WUGA 1Z07A 1E2MA 4YMTA 2VL7A 1JSRA 4TV8F 2R1ZA 3KPYA 1Q6YA 1MTZA 1W4BA 2I2BA 2X9VA 3HB0A 3PGLA 3AU9A 1NATA 3LMKA 3KQMA 5IBCA 1G2IA 2JIBA 3L8EA 2HRBA 1G5RA 2P1ZA 3G7SA 1EXNA 1Y4ZA 3H5WA 1E2QA 1AKUA 1EP3B 3Q8LA 4R8RA 3PL5A 4MVJD 4COOA 3HP1A 2WV9A 1NRXA 1ZUD1 1XAJA 3V1NA 1JJAA 3W5AA 2ZI7A 1S9DA 2G17A 4ZTUB 3CSSA 1VSTA 2WVGA 2I6QA 4PZ0A 4DNPA 3ESYA 2D1TA 1EK5A 4FOOA 4XIGS 1WNFA 2JDID 5BW8A 4Y6RA 2DUUA 3RK0A 1QLWA 5LOVA 5LDDC 13PKA 5AM0A 3T9AA 1UL1X 3WLTA 2WBLC 4RVGA 3BXGA 4DW8A 3GW8A 6REQA 4L15A 2Y9PB 1CQIA 2DR0A 5ES3A 1XQ6A 5SV2A 3V8BA 1GILA 1JQJC 3JQFA 2PH1A 3OTOB 4E1VA 3SHOA 1EH5A 4C29A 2SCUA 2IHZA 5C5CA 1YR8A 3IIJA 2XNDA 3VU0A 2WT9A 1O96B 4IXMA 1G21E 2NUTB 3JQ8A 4JGIA 6ADHA 4HFJA 5DHSA 1K08A 4LZZA 4KKXB 3GEEA 2V3WA 3O7MA 1WD5A 4X3OA 1JHVA 1XUOA 2IH2A 4HSEA 5EPUA 4NCJA 4S35A 3D3EA 5HQ3B 2Q4RA 3E7FA 2HBYA 2YHAA 3HVHA 4P3PA 3T0IA 1YQWA 2XW6A 4POAA 3DB2A 2H17A 1WSAA 3INTA 4BLWA 4F7WA 4J4TA 3AVQA 1WKVA 3HLYA 4HWKA 3IRUA 3TLMA 4C06A 3OC6A 3WWEA 4D42A 4TGLA 3ISVA 5L40A 1WUJS 3UQZA 4HQRA 3THRA 3AERA 3ETJA 4YUZA 3R0QA 4BX0A 1VSVA 1JI3A 2XMZA 3JY6A 3QMMA 4A6XA 4PWZA 4GKJB 1VL6A 3O4GA 4ZV9A 3BDVA 2X2FA 3DM5A 5JAZA 1GGKA 5CD1A 1NMQA 3QU4A 4JOQA 3G9QA 1NC1A 5LYJF 1F4LA 4Q3EA 2FUKA 1U6KA 3BQNB 3S55A 4BBAA 2NMVA 1PJ4A 2P27A 2ZYIA 5CXUA 1CQPA 3KAPA 1AD2A 1Z7BA 4DSZA 5D6NA 1ZYUA 4GLJA 4Y6PA 4BNXA 2SBTA 2VOJA 4BMZA 4FDMA 2H9YA 5J63A 1RMQA 1FSSA 3DVSX 1EA5A 1PEDA 1YV9A 4R1UA 4YLGA 1ZGCA 1YFKA 3FDXA 3GGSA 4BZZA 4QM7A 3GCZA 2B1RA 1DIOB 5D3MB 2EKDA 3EYWA 4AKHA 1DO8A 5GJBA 1CY1A 1CDZA 4GXRA 2CXRA 2Z8YM 4PE5B 2QVXX 3B48A 1ISJA 1JT2A 1R12A 4B3GA 2VAWA 1CIJA 3JVDA 3BIFA 3KPUA 5ICSA 1P9WA 1Z15A 4KV7A 3ZE2B 1QFXA 3P9RA 4J2OA 2ZOSA 3RASA 4LIPD 5K8LA 1R4MB 4UEWA 4HN9A 4P1ZA 3QPWA 3TZEA 4FKZA 3QVSA 5EEGA 3TMYA 2YWBA 4Q18A 4QOEA 3PB3A 3SC3A 3WLNA 1UDWA 1XYVA 2C0CA 2P5SA 4WZBE 3HY6A 1JG7A 3WMFA 1QFSA 1M8JA 2P1RA 2YBEA 1EAMA 1WZIA 4MAFA 3LC7O 4WBXC 5C8XA 4RTKA 2BHSA 3H97A 1XJ0A 2VF8A 2DEUA 3UWKA 4FMDB 5JSQA 4G63A 3OQOA 3PJRA 2NVOA 3VSDA 5ARDA 5EAIA 1F3OA 1HQKA 3O83A 5ALTA 1EUZA 3IVRA 1YOBA 2HMSA 4GOJA 4JVLA 4RJIA 4Y9TA 3FYCA 1BJTA 5DCWA 3ZLTA 2QQFA 4CTMA 2ANBA 2P2DA 4JFRA 2FPMA 3AP1A 2C42A 1A1SA 4IV0A 4YP6A 1RCTE 3VPDA 4CQMB 3PDIA 2Z4RA 3HK2A 3A3OA 5A4AA 4JQCA 1E61A 1UIMA 3I2FA 1KRHA 2I6GA 1BN6A 1Q83A 2FCRA 1X7HA 4E13A 1N36B 2PYDA 1UFKA 1Z0DA 2AH5A 2CHGA 2ZFUA 3HKBA 3X44A 2OO5C 4QL3A 2PXCA 2Z8ZA 2ZIAA 1CJUC 4G5GA 1E6CA 4E3ZA 1E2KA 4ND7A 3O82A 1Z13A 1IBCA 2XDWA 2PJDA 2VP6A 4GPBA 5D3KA 2BGWA 4P80A 2WINI 1SCIA 4EJ0A 1NURA 1M7BA 3OLCX 1JIUA 3IERA 1OXKB 4EFKA 3R3YA 3ZVMA 3DHWC 2Y77A 2GNAA 1GD1O 3ACDA 1VL1A 2Q27A 1GPH1 2FP4B 1SK8A 3I1YA 1SU8A 4HQNA 2KHZA 2OV4A 2XI4A 1ZM9A 3LHDA 4UTZA 3R8CA 3DUWA 1BE0A 5C7LO 3CLUC 4R69A 1EJ6A 5FWXA 5I9BA 4F4HA 3ZDDA 4ARIA 2RI0A 3DO5A 5A0VA 3REQB 4L22A 4RDXA 3WB9A 2QW0X 3SSAA 1KWGA 3A6EA 3EDMA 1WMDA 4JKYA 4BX9A 1KI2A 1VIYA 4PCVA 1IDOA 2H7YA 3O2QB 4JU9A 1P4AA 3VYTB 2REXB 4HNRA 4FOLA 4TTAA 4W9RA 1KYXA 2HQOA 3LNTA 5CB6A 4YHHB 4MK4A 5I9TA 1E0AA 2G7ZA 3OE7A 4UVDA 3T0FA 3VO2A 1QDUA 4QNNA 4EG1A 5JSZA 4B4DA 3L0PA 3SIWA 2FWBA 3CF4A 2QJTA 2I29A 3Q98A 4FN4A 1HNXB 4ZHQB 4YJFB 3A9VA 5CJJA 1RYYA 4HLCA 4RL4A 5E8RA 1LBIA 2HU7A 4AJEA 5JQWA 3QVUA 4JP2A 1MX5A 3DQPA 3QEJA 1TFRA 2QUBA 4IKPA 1TGYA 1UT8A 1C0LA 4PIMA 4R2IA 4MWEA 4Q4HA 4S2UA 4II2A 1HX7A 5FWXB 3D7LA 2WB4A 1LDNA 3P94A 1O9BA 3C6QA 1S01A 3LSYA 1UZLA 3IVXA 3WL3A 3I39X 1AGNA 4QLOA 3WY9A 5IWAB 1LJLA 4ZEWA 1IM5A 1JHOA 4HT3B 5DBFA 5C8DA 5IDVA 1QR2A 3HCRA 4TVSA 2H6EA 5D1HA 3IDFA 1F2VA 4YJ2B 3I2YX 1PSDA 1S96A 3NBXX 1YR2A 1WIWA 4KBGA 1YQUA 2A9PA 4G2NA 4TMXA 4BNTA 1QP4A 1J25A 2B37A 1LK0A 3L1HA 3OM1A 2J32A 4UKDA 1K63A 2EQBA 5TT0A 1OREA 2WUVA 3ANMA 4G9GA 2R7AA 1ZK0A 4GWLA 5EN4A 2AEJA 4OI0A 3PCTA 4NG4A 2QQGA 4FBGA 1XZBA 3Q7QA 4YECA 1NULA 4HDOB 1TQ4A 3H2JA 5KOJB 1U9IC 4ZYYA 5I5GA 1XWWA 3C14C 4CR8A 4QDZA 1KAMA 1XTKA 2Q8QA 2VJMA 4KRYA 1KFEB 2Q8NA 1WUHS 4RMIA 5E6RA 1KAOA 3KQQA 1T0BA 4FCTA 2IODA 3KS9A 1ULSA 2ZCJA 4KVZA 4AKEA 4FFWA 3U4QB 1PL7A 4A26A 5M3BA 1DAOA 2PSSA 1ESDA 1QG2A 2D1YA 1V4NA 2ESRA 3UK2A 5DWQA 2JHAA 3VC3A 5DBIA 4CEJA 1DFGA 2JRCA 1FW6A 2IGTA 2O0HA 5JS8A 3O4FA 4XYEA 4PAGA 1ZWLA 3BUSA 2GAJA 1QOQB 3G7UA 5ICFA 3A2LA 5ITZA 5K8IA 3M1AA 3SJBA 1X1EA 2WW8A 2WJAA 1PD0A 4PO8A 3C5VA 1KYZA 5CLJA 1COWA 1KVRA 4ASUA 4FIZA 2PGAA 4DQXA 4RYLA 4NZNA 4EL0A 5B7GA 2R8ZA 1BCSA 2H1SA 3K0KA 1LSSA 1AXGA 4F12A 3T12A 4YAEA 1XZMA 2CHUA 2J9YB 4XJTA 4JC4A 2AMVA 2DKFA 4RKRA 1LSUA 1LSOA 3UENA 2H5JA 4LSWA 4IHQA 1HUQA 2DU8A 4CKCA 2F4VB 4BTEA 3EPHA 5CCBA 3S5JA 3D3QA 3O9MA 3HCAA 1ZMOA 4EJ6A 1G6OA 1JXQA 1JLHA 5EZ6B 4WKGA 2RGUA 3WLJA 4YQFA 2GCPA 1M2VA 4OIMA 1NTOA 4P7JA 2OXRA 5CB0A 5IZ4A 3PC8A 3M4YA 1JXMA 3GEGA 4EO7A 3DWIA 1J0DA 1T1IA 4YP7A 4TS4A 1SELA 3BEDA 1NMSA 5H68A 3UJ3X 2BI4A 4GNKA 1A88A 2CVHA 5ECDA 5JIBA 1RRCA 2C03A 3VZDA 3BMQA 1RYDA 3ICVA 2VQ6A 2I03A 4EUKA 3QTLA 1JKFA 3K1AA 3L7YA 4KXMA 2K7ZA 3AB7A 2Z57A 1LX7A 2P5TB 4BP1A 2IXAA 4JLUA 3IP3A 3L6UA 1D4AA 4CMJA 4EMTA 5F2KA 4C6RA 5AVSA 3IILA 2QIPA 4U8HA 1F6WA 4ODIA 5C1IA 2C5EA 4GP6A 4LJLA 5J40A 1AQLA 4H60A 4ITVA 1ZISA 3G2QA 2YZ7A 1TVEA 3B6JA 4LY3A 1ABEA 5FL3A 4CCAA 3FF4A 1M34A 1E0KA 3NP7A 1J00A 5L3QA 3QE4A 2Q5LA 4G2TA 3SE0A 5D5QA 3RUAA 2GXQA 4KQIA 3NBAA 4UAUA 3RNLA 4DM7A 1RABA 5KNDA 1M0EA 4G5RA 1TCVA 4JYZA 2DUJA 2GBCA 2X22A 4K8RB 3QTTA 3KPJA 2HPZA 2XDQA 4E33A 5I6DA 1OE0A 5FOVA 4F45A 1HE5A 3EDRA 2BFDB 5AO9A 3EEOA 1EDBA 2RHTA 1QQ6A 3VQTA 1Y1TA 4GBED 4JLDA 3AXSA 3MCVA 2WUWE 3TQHA 5BUQA 4WN3A 4AIIA 1GR0A 2YHUA 1X8JA 2AG5A 3ZZTA 4D0GA 1N1MA 2FXVA 3PBKA 3K7EA 1VI2A 2AF4C 2OORC 3R24A 2ECKA 3RJ5A 4Q7QA 5B3LA 2AD5A 5REQB 4FHGA 4IQ0A 4KO2S 5JYCA 2FOLA 2PO7A 3O93A 1WPQA 1ZNXA 2WOOA 3PJDA 3GEDA 1VPDA 4IDQA 4PG7A 4QAJA 2YV4A 5EIBC 5TEVA 4EPVA 4Z8YA 3EWAA 1HNZB 2FGKA 3W3AD 1M2EA 1WO8A 3FFWA 3UBTA 1XAGA 3UCFA 3ZHOA 2W00A 2ZIZA 1IN1A 3M7IA 4ZAFA 1UKCA 1OQAA 4B3IA 1EFPA 5JI2E 1GGFA 1TFUA 1CDOA 3EIUA 1W7AA 2CKDA 3U31A 1Z0IA 1P39A 4WV3A 3TIVA 3VDQA 3QJYA 5HCIA 1J1UA 4YJHA 3EC1A 2XQJA 1QGDA 3GZJA 3D1VA 3SBOA 4R40A 4LTNA 4Y9DA 4WDQA 4WBNF 1QBGA 4W6ZA 2O23A 5H7XA 4GECA 1KAGA 4JR1A 4MROA 4BWVA 4BX2A 3CVYA 1NG9A 5FUQA 2G6BA 3CKYA 3O1LA 2DQZA 4A8JB 1TUBA 3TUIC 5IXSA 3S8YA 1WHTA 4ZWNA 3L0SA 5ER9A 3RO7A 3ZGLA 3N2EA 4BEVA 1JP7A 3JR7A 2L42A 3T7DA 4XQCA 3BK7A 4XFDA 2EFGA 3QSYA 2O54A 1KFJB 4X63A 5FHQA 3EFHA 1P18A 4X6XA 3HSSA 3B9RA 1VMEA 4C7OB 4XD7D 4D79A 3NR2A 2QTVA 3V34A 3ZBUA 1II0A 2XUOA 1TC2A 3CKLA 1FOEB 3IO5A 4GM1A 4L0CA 4YYEA 5D5HA 3WVNA 4UMDA 2ZB4A 5C8VA 3C3XA 1DX6A 1U2DA 3C3CA 1GPKA 4QKQA 3AESB 3AV3A 1JNXX 3OSUA 4GO1A 5HQJA 3LY9A 2QMEA 3SLGA 1YQTA 2J3DA 3P5BA 3TCKA 1DQRA 5A9SA 4S1OA 4KLAA 2Z3WA 1OMOA 2R25B 1WWKA 2NT3A 4B87A 5H81A 1OI7A 5HJ7A 1KI3A 3B1XA 4ER0A 2NU7A 2G71A 2PGLA 4WKPA 1QNFA 3MJ4A 4HSGA 2V7QD 4NEQA 2OHJA 1C4KA 3ZWWA 2NXJA 3WIEA 1MDFA 2OE2A 4MPJA 2Q4DA 4MJXA 4KI0A 1SVSA 1PFWA 5IAEA 4QXAA 4H7FA 2ZRDA 3LHFA 3LP6A 3N2LA 3AKZA 1DKLA 2I6FA 2FWIA 4QYTA 2AWOA 1M75A 1K5HA 2OM2A 3W9UA 5FEUA 5IDYA 2AQ8A 3BK2A 3ZDAA 5J2TB 3MJTA 4HBZA 1Z2NX 3HM2A 4JI3B 3SDBA 1JKJB 3DC7A 1VSBA 3OLZA 1RE0A 2VHQA 2ZE5A 5H83A 1QE3A 1YAJA 3ZV7A 3ZHUA 4KNYA 1ATZA 2HO5A 2TMKA 3EXHC 1R64A 1T5HX 4J1TA 5K8TA 1AT1A 1BN7A 2G70A 2X4IA 3VKHA 3I9JA 1YB7A 1CTQA 2KI5A 1M8GA 2I4OA 2HHHB 4IYRA 1TMKA 3IX7A 5TF0A 1RKQA 1E6WA 3T3GA 1PFUA 2RI1A 4DR1B 1G60A 3MLBA 2HSDA 2IIPA 4MQ5A 1QUFA 2KPOA 2PCLA 4N5DA 4CPDA 1Y3CE 9LDBA 1O9GA 1I4OA 1S7GA 1G9XA 2FX5A 3NC0C 5EJ8A 5FBHA 4XD7A 1RZRA 2P4SA 2PV0A 1EFDN 6AT1A 2J6HA 4Z0TA 1WB6A 5J2TF 2Q5IA 2XUZA 2NO4A 3AL3A 3VAYA 3ZGYA 4L4SA 4UTPA 4WT7A 2ZI6A 2A1IA 3WIDA 2I7DA 2LUOA 3KOZA 4OB6A 1U3GA 4EGJA 4RADA 4K87A 1DQYA 1TB4A 1R4AA 1ZRMA 4AW9A 2JASA 3KX2A 3O31A 1ONPA 1TO2E 3ND7A 3B5JA 3MAGA 4L7VA 1S8OA 2TSYB 1Q1BA 2HHCA 4MUGA 1GQOA 4AU1A 5HR5A 2XJ9A 3CZ4A 3SXPA 1TPYA 1CY2A 2GD0A 3WDLA 4F4FA 4LE2A 2H1IA 2PKRA 3IV6A 4NYMQ 2QMYA 3QFTA 3RV4A 1X15A 1XTZA 3GLGE 2OAP1 2GH1A 1QCYA 3C6XA 3HY4A 3O73A 4GG1A 1ULZA 4LXYA 3VYSB 4CMHA 3I9LA 3AVWA 2Q21A 1DCTA 2VJLA 2C29D 1H0RA 5GVRA 4B6QA 4OXXA 3SWWA 4Z99A 3HU3A 4RLSA 5A4MS 3RG8A 4YWJA 2V5VA 2FV8A 2KE5A 3Q88A 2YQ5A 2DJ5A 4I9UA 4RABA 3SHVA 3VDXA 2JI7A 1W73A 4LGVA 1EM8B 4C01A 1JIQA 1Z5UA 1DJPA 1WXEA 3B38A 4K9QA 3OOEA 2I80A 3A9WA 3CB2A 3AG6A 3GQVA 4NX2A 4ZOAA 4ZEXA 3HWWA 5JAQA 5AW3A 4CEIB 4I1YA 4TTIA 1QIIA 3VAAA 3U4HA 3GHYA 2CZQA 1I0ZA 5KTNA 1Y8QA 4E30A 2GZRA 4TYQA 1BROA 1UM9A 3WHPA 2RONA 5JH7F 2RAPA 1P2SA 1Y33E 4A0QA 3WNBA 3IUJA 4PLHA 4YHBA 1JHYA 3BSYA 3EPKA 1DBVO 4II3A 1VGVA 1JPJA 4GXTA 2NU6B 5DGTA 5IUNC 1MB3A 4P8RA 4FJ0A 3GLHE 5DIZA 5BWLA 3LBHA 3JWPA 4TMWA 4TTQA 2CXQA 4D46A 5JYDA 3AESA 3IQZA 3AW9A 1EGQA 3BFKA 1ACLA 5E4YA 3WSWA 1XELA 2BFOA 4KNVA 4DNXA 2PKQP 1Z2AA 3ZQUA 4ZVMA 4YJGB 2W2LD 3EAQA 5EP2A 5C7IO 1D5WA 4PW0A 3ZV6A 1RHJA 4UCXA 1WV0A 3NHBA 3GNSA 3RVQA 2MINA 4OGLA 3UJ9A 5D1NA 5K3EA 3EDCA 3PFHA 3KZMA 4HWSA 3TLCA 5JBQA 1P2FA 3L40A 3TDNA 4RH3A 4QYIB 1E1QA 2F9MA 1U0GA 4ZOEA 1YZTA 1PGJA 2ERCA 3N2NA 2BOVA 4FZJA 1FYWA 3SC4A 2CLEB 4HZIA 1KMQA 1GUBA 4CL3A 1RFLA 1VJTA 3SXJA 1HKHA 4XDZA 3ZG6A 2VF7A 1SJ9A 4RHCA 2QPAA 2FUG1 4GSKA 1R7RA 5EHXA 4N3NA 4X8OA 1X1RA 4ER6A 5C18A 4L57A 5DCLA 1V5FA 1XZDA 3E9QA 1AHHA 4B6RA 3QUCA 1M74A 3DDWA 4UFPA 5B36A 2IHVA 1WABA 5IVHA 1HE8B 3EXEB 4WXRA 5JCPA 2VJKA 2CLLB 3RJ9A 1TJ3A 4AVYA 2OCAA 3CPJB 1NL3A 4NE2A 1E4YA 5F3DA 1T36B 1ND5A 3DWFA 4ID3A 4KTTE 4LY9A 2RKBA 1FUIA 1U02A 1H3FA 2ADMA 4G9EA 1D1PA 1Y0BA 5DHPA 4CU2A 3EOBI 5HYVA 1QC5B 2JL1A 2YMMA 1V8BA 4FQ8A 5REQA 2WAMA 1RACA 4K6OA 5LYJA 4J4BA 5C8YA 4QLAA 1CERA 3IEXA 3NBMA 1LPPA 1N9GA 3S5UA 4E22A 3EGDA 5KTTA 1XMPA 1NUAA 2XF8A 3H7AA 2XUQA 4PQFA 1J06A 3TRFA 4KGXA 4C4YA 3I1FA 2GO7A 1U9IA 2RH9B 2I22A 1JQLB 4O4HB 2AUMA 3LOPA 3OJFA 3K96A 2PX3A 5FFFA 5FI3A 2GPSA 5FNVA 1YQXA 1DJMA 4E03A 1NR1A 3TBFA 1JBEA 4IIJB 4N82A 1QGZA 4E5NA 4DR7B 3RC9A 5YASA 1SM4A 1HDYA 4KH0A 5L3QB 3FMPB 1BX0A 4I81A 5AI9A 2F9FA 2ZRJA 1R0KA 2V7PA 4QASA 4AY3A 1I30A 1KZ9A 1T9KA 2HMUA 2NTVA 4BKRA 3KSRA 2QJOA 2Z8YA 1SD1A 1AKMA 1DEHA 3UMFA 4BLSA 4ZGWA 1Y48E 2Q1YA 2QU7A 1QPGA 2DHDA 2BMDA 2CL5A 4O1HA 5KYNA 1GSIA 2REQA 9LDTA 1BYUA 5LQJA 5JNTA 2OZLA 2R6JA 3N8HA 2HMTA 2O3JA 2ZG6A 3BB3A 4Q37A 2FK8A 2EV9A 4RPCA 5K2MA 4YP9A 4BRSA 3AHIA 4BVAA 1PWHA 3KQUA 3EXG1 3CWQA 4FM9A 2WQZA 1TKBA 5K4AA 2KW5A 2A3NA 5IANA 2ZZMA 5B6IA 4BE4A 2PUFA 1N5RA 4HDNB 2YOHA 2RKWA 1AM4D 2CF6A 3OLXA 2DLDA 1BXGA 2HRRA 1AB6A 4I7EA 1NIJA 5EKUA 4UAVA 1C1YA 1OYOA 4P4UA 5ICCA 2X41A 3F5DA 3KTFA 3NEJA 3GROA 3AEZA 2VBFA 3CLTC 3I04A 3MB5A 2B8JA 4Y6OA 5CYOA 5J43A 4Q03A 3MCZA 3LVFO 4R9VA 2EARA 2IZOA 3INNA 1GTRA 1H1LA 4DXHA 2XWJI 3TAXA 3OPYB 4XR9A 2CLIB 5CFOA 1PBNA 1XROA 3B6EA 1BCSB 1XD9A 2HSJA 2ZSDA 3ICPA 3P2KA 5HKKA 3U09A 3F7TA 2BTQB 3EVCA 2IEZA 1NSFA 4OOFA 1F9EA 4FSDA 2WUEA 4OATA 2AJLI 2X9QA 5DHRA 1PX2A 3DNFA 3OY7A 1I14A 1UBLS 3OCYA 2LVBA 4XIFA 1O6FA 1OX5A 3E3MA 5ITZB 1MU0A 3TSOA 1EFAA 1XRPA 2QRJA 4U0JA 4IXDA 3RUEA 1DNPA 3ZZNA 1G16A 1BXKA 4U7GA 3BT7A 1XMVA 3TIIA 3O6VA 4MR9A 3CQ9A 3OICA 2BWJA 3ERCA 2EBFX 3IXLA 4CKWB 4LJ5A 3U4QA 1TYAE 1ITZA 1Y5LA 1E3WB 1C7FA 2ZJ7A 3DNMA 4LHXA 5CT6A 4CN8A 2Q9BA 3JYOA 1AQYA 2NSYA 2E3JA 4IWNA 3DBLA 3EVZA 1XQYA 2ZYRA 1O03A 3C7TA 3LUAA 1FS6A 1WCIB 3IR6A 3AFHA 1P7VA 4H7PA 1N2JA 3HZHA 4ZT5A 4AZTA 2Q4TA 3CZMA 4UFNA 4XI9A 2O8CB 4JJ7A 5FLEX 1P7WA 2QK4A 1TIKA 2D7JA 4JB8A 3REOA 3HDHA 4G4IA 2JRLA 4RZIA 5LA6A 3RTDA 4EHJA 3BXPA 1M1NA 3TFWA 4ZHQF 5CB4B 4JXZA 1C3JA 1EFCA 1WCYA 3ABQB 3C4QA 4RF3A 1HORA 3PXXA 2EF1A 2P3SA 2ETVA 3O1IC 3U7IA 2V4UA 2R1UA 3DAGA 1RM5A 2ZRIA 3WZLA 3C6BA 1U2GC 3OVMA 3TZLA 4D4KA 3OZAA 4JJKA 2HL6A 3ZY6A 2EF0A 3T5TA 3WLKX 1RC8A 1IN4A 4G1BA 3LUCA 1UKYA 4DNQA 4KITB 4MUMA 4BGDA 5ADWA 3A4IA 3F9CA 4WOCA 2YKGA 2HLHA 4CZ2A 2O19A 2R65A 4XCVA 4IG9A 3JQ9C 4PINA 4AX8A 4F6CA 4MKXA 1J7JA 1ZGHA 4EPYA 5CDTA 4NZPA 3ILVA 1J8FA 4QATA 1MT0A 4V0MA 3U9LA 1SRQA 1FL9A 3F74A 1ZNZA 1OF1A 5DBOA 3TEFA 3DPSA 4WCFA 3NHRA 4FYKA 2D4AA 4PGMA 3RIMA 3ZUGA 2YJ4A 1T4DA 2PUJA 4YJFA 4RY9A 1CS0A 1GTL1 5EKXA 5IJAA 3R8XA 2A1TS 3VU8A 3ZWXA 2RHJA 4HZUB 1XJCA 4LF9B 5MGBA 4JLPA 4YT4A 3OIDA 1OXUA 1RRMA 2A5YB 1Z6PA 2EQ5A 4K40A 4KMOA 2QN6A 1QLJA 1V41E 2QRPA 3IOMA 3NYIA 2HF8A 2NT4A 1FFDA 2IT1A 4HZUA 4UXJA 2P9GA 4YP0A 4EMBA 5D5PA 4EA9A 4MB6A 2UYQA 5FNZA 1QR6A 2OA0A 3A1VA 5KIAA 3OCXA 4MAMA 4L16A 1EWYA 1L7PA 3DFIA 5E9WA 1P75A 2R11A 5FJJA 4HNHA 3V4SA 4LJ6A 2WJVA 1YGYA 3R09A 3RSLA 3FVRA 4C0KA 4F1KA 2MIIA 1U8TA 2FFRA 1U7ZA 4FDVA 1VPWA 3GRPA 1EUCB 2FP4A 4LTDA 1Z0AA 1Z47A 2EQAA 4OGWA 5EMHA 5A7GA 4JDPA 1C3EA 4KFSA 2BM8A 2YW9A 1VDZA 2H4YA 4KUEA 1A9ZA 4ZQGA 3OETA 1I2BA 1QG0A 2JS7A 1HMYA 3LLVA 3NV9A 1E2IA 1VE3A 4WCDA 4ZU3A 4CMAA 5BV0A 5E0OA 3TGWA 5KYUA 4MPPA 3W9BA 2P41A 4X64B 1SKAA 3N5KA 3ZK7A 3HFGA 1DJNA 1UBJS 1A82A 4M49A 2PBZA 3W2EA 3ANXA 2CXOA 5JDCA 1LZKA 4JLAA 3UT0A 1L7MA 1P6UA 1RAHA 5THKA 3CX6A 1U2QA 2WVAA 2X1MA 4QGSA 3QP9A 4QSMA 5L45A 4QPCA 1XLTA 2ZDQA 1Y6ZA 1V39A 1H42A 1D4FA 3GEBA 1WCIA 2QD5A 3U7RA 2IBSA 5JJIA 1DUIA 1ZD1A 1QK4A 2Z3VA 3O4IA 1JSLA 4D6YA 2YRXA 3CM0A 2VHWA 1IXYA 4DLSA 4HEA6 3FDIA 4NCAA 4PCUA 2POQX 3VZCA 4I0WB 3HMQA 3LVQE 3NBFA 4KDRA 2EW1A 4GU5A 4OFWA 1BYIA 3CKMA 3WGUA 3L18A 2FPSA 3CRQA 3EK2A 3T7EA 3OOSA 2XTNA 2CEKA 1JDSA 1BEZA 1VZ2A 3P1JA 1GPBA 4HYEA 4LDQA 5BQPA 4EGCB 5L3VA 2AHRA 4QJBA 3NT2A 1S2NA 3H4IA 3L6DA 5AIBA 3PNPA 4WY5A 5B57C 1R5JA 2O0KA 4CLEA 4OAQA 4DCCA 1WMFA 4X41A 4GX0A 1L4YA 2J5QA 3NRJA 4OBXA 3V8RA 4F4JA 1UIRA 3QQPA 3RR2A 2ZWIA 1PLKA 2VR1A 1L5MA 3TINA 4F85A 3ZXYA 3SP1A 4FNMA 2VZ0A 3ZWCA 4C4RA 3MM4A 2Z08A 2FRDC 3VZQA 4NU0A 3NJ8A 5FA8A 5JMPA 4L5YA 1KAEA 1NP6A 1GCUA 1UJ2A 4RMGA 3MSCA 1H9AA 3BORA 4LECA 1GM5A 1MT3A 3ZE8A 4ZFNA 1KOJA 1USKA 3AX6A 2FWJA 3ANNA 4G0QA 1E5DA 4X54A 4Y9RA 2G0NA 3IAXA 2WT4A 3A1NA 2QUJA 2Y1EA 4HDNA 3Q6IA 4AT1A 4MQ6A 3OIVA 1JB9A 5J2UB 3WGLA 1QJCA 1RKVA 3USES 4EL5A 1ILWA 4EY8A 2ZGVA 4JVSB 2JH9A 2VTEA 3A04A 3K9GA 3P2JA 4KX5A 4AAYA 4HO1X 4OH7A 2CN1A 3VZRA 4DMKA 2DM6A 2ZTSA 3D5EA 4MIEA 3VR4D 4YVFA 2OCIA 4NQZA 4A8TA 2YFQA 2ILVA 4FU0A 4UZSA 3WTBA 4J16A 3UUEA 1M3SA 5SY6A 3TRHA 1NQ5A 1WMSA 4X6UA 4ZQHA 4YI3A 3CXUA 2FZ4A 2ATXA 2AX3A 1QQTA 2JVJA 1XTPA 2UYOA 3NFYA 1EJBA 4NR0A 3BTUA 4GRDA 3B13B 3BHNA 3DLCA 4M37A 2H18A 1XP5A 2OBXA 1YSCA 4PLTA 4UD6A 1Q91A 3ICCA 1KO7A 1JH9A 2JLCA 2X4GA 1B8PA 3DOUA 1C80A 4CBVA 4B17A 3T7AA 1WQ3A 2Y66A 4R41A 4RD4A 4FR2A 4TUYA 4YJ3F 4EFDA 4BFLA 1E3WA 1H2RS 3C7DB 1DJOA 3LZ6A 4YR9A 5A2GA 3FZEA 1JU3A 3NNDA 3OTHA 4MR9B 1D9XA 2HA6A 5E7IA 3N07A 3CUTA 3K6SB 1PR0A 3QV2A 5LDGA 2WYHA 3DBHB 3LQRA 1RAIA 4MTCA 3RK1A 4CMKA 5C8YB 5FPKA 1DC6A 1R00A 3JQ8B 4LXIA 3R3SA 2QVCA 5L51A 1NI4A 3AUJB 4FI3F 4F1WA 5B4UA 1MX9A 2HJGA 2X8JB 1RI3A 2XUJA 1PJ2A 2FQQA 2Z2KA 4N12A 4B73A 1H65A 2EP8A 3O8DA 3UF0A 3QBEA 4RENA 4HG2A 5K01A 3UH0A 1E2LA 2N75A 4RQAA 2HT6A 2CWDA 2ZUDA 3C39A 2AYZA 2WVJA 3KK0A 1LUAA 1HL7A 5JE8A 3R7DA 1JFRA 1FZQA 1GNRA 2OV6A 3B8EA 3EVBA 3OZWA 4W82A 3EY4A 1DAFA 1YR3A 4I1OA 2NU8B 1SXPA 3F3MA 3MWYW 5LOVB 3G2JA 4JXJA 3DZJA 5I7SA 1ISRA 2JD2A 1BVRA 1E9VA 2R87A 2JAQA 4FWTA 4G0XA 4ZT7A 3BJIC 4JP8A 3F6RA 1ZL2A 8ADHA 3IQIX 1NW7A 3EIWA 5C0OE 4M86A 2IU3A 4Q05A 1RHMA 4HDAA 4Y2RA 2QWXA 2UZ3A 5JXIA 2FI1A 1X9HA 1CDEA 1CV2A 2XTJA 4U2EA 2I7TA 1TU3A 4D3SA 5D7BA 3V8PA 4LQCA 5KVAA 4MRMB 4D1YA 1XVTA 2C5AA 2GRUA 3L4BC 1SEVA 2FF5A 4GVPA 3C97A 3GLTA 4A1FA 1R8QA 2H2DA 5E8JA 4ZI2A 2YTZA 1B0UA 3WJ2A 1PCXA 4U1RA 3IT1A 1MIOB 1UMBA 4JP5A 5C5EA 1HURA 2YCLA 4JBHA 3AF4A 4XCXA 5HTOA 1CVRA 1J8YF 2C94A 5EP4A 2WJ6A 1YBHA 1A7UA 2E4WA 4DCVA 4Z9YA 3CU5A 4BX8A 3W6NA 3RUDA 4IIJA 1X7YB 4ZKEA 4CKYA 4Z51A 4WBNA 2GR9A 2H4JA 4OXRA 2B7LA 3H9UA 2YICA 5ESRA 2Q5EA 1ULUA 3KAKA 3NUQA 2EERA 3NTOA 1BJKA 4G0PA 1AZTA 1H8HD 2C9BA 1YULA 3PD7A 2PZEA 1D09A 3G6KA 3GV0A 4MQEB 5ILGA 4Q1DA 1PSWA 1SCUB 2XUFA 1U8AA 2OAGA 4L2IB 4BMPB 3TGPA 1M6EX 1AUPA 1ZG3A 1LDGA 2OKCA 3HTXA 4I1IA 2B82A 2HM7A 2GDZA 4IYJA 1ZO8A 3IHTA 4IXNA 1WPGA 2B2CA 1S4MA 3HR8A 1EM8A 1XQXA 3HNPA 4GQAA 2BSQA 1S5PA 1UAYA 4Q02A 2V6MA 2DP4E 3NKLA 1MO5A 3IELA 4FKBA 2I4IA 3T38A 2DTDA 4RU1A 4EDFA 2VZLA 2X0KA 4ZODA 4H4CA 1NVBA 4LHWA 5BSGA 2P4HX 1KI6A 3IBTA 4PNEA 4F5DA 1CNEA 1FMTA 1V6AA 4BJ5A 5AI5A 4XWKA 1KP3A 3LYLA 4GH5A 3LCMA 1CF4A 4E2YA 4D9EA 1NF2A 2EX0A 3GC6A 3OPQA 5LZ7A 3AK4A 3EXEA 4PPYA 3P9IA 1EAYA 1OTYA 1R3UA 1BS1A 4PYMA 2IUUA 4V1CI 3V4ZA 4DIUA 5K8JB 2NNWB 1NRWA 3E9CA 3KAQA 3VTZA 1BZYA 3LY8A 3WBBA 3MTGA 2QVZX 2OZPA 5ESXA 3IDZA 3L82B 4BLRA 3VZBA 2CCJA 3ELWA 4DLZA 1VMIA 4EHAA 3QLTA 4YRTA 4KLNA 2QVYX 2QRLA 4EY5A 5TC4A 3F6BX 3I52A 5CJ2A 3JAWB 1R66A 4DNOA 3N6VA 1BNCA 3RS2A 4RHEA 3KQWA 1DIGA 2W2PA 3OT4A 4AJOA 2OM6A 4DVJA 4BEWA 2AUNA 2COKA 2CDRA 4WSOA 4DJDC 4AP9A 1A5ZA 3KZCA 3QE0A 1NN3A 1J23A 2WKSA 3F5QA 4G1UC 5ERGB 1GN8A 3RSFA 4L0MA 4OK6A 5DX0A 1VTKA 4NBTA 4ZT2A 1F8XA 1G4AE 1YBMA 1DEAA 2YIVX 3GVHA 1F0YA 1U1GA 2QL9A 5ERYA 5G4KB 4RY2A 5KJFA 1W49A 4FUTA 2G5PA 4J2HA 5EZYF 4MW9A 3KVNA 3SSNA 3IAHA 1TEHA 6YASA 2FOIA 2DCMA 4P22A 1MCZA 2I4RA 3TLAA 5CA0F 4LHSA 1C14A 3WQQA 4DREA 4ER7A 4Z7JA 4ZHSA 3K9QO 1QANA 1U94A 3MBOA 2BFWA 2GWRA 5G3ZA 1J42A 4G56A 5CVVA 4CT4B 1JKJA 4RH1A 3GR6A 4D4HA 3JD3A 3GVPA 2XUGA 4G01B 1IEQA 5B1IA 3PFWO 1UK9A 5SZJA 1Z7WA 3AJ8A 1QKIA 3BZWA 3I0ZA 1PT8A 2XZTA 3RC3A 221PA 1NP3A 4KLCA 4AY6A 4OEHA 1FBTA 1Q0LA 4LSMA 4PWYA 4C21A 3ADCA 1G5FA 1IBRA 3S1LA 4M98A 2YDYA 3GLKA 3T5GA 1X8XA 1R0XA 3OHPA 3TAUA 4ZICA 5IKPA 1UFOA 1JYEA 1TM7E 1F2TB 2AC7A 5HGJA 2CJYA 1GCIA 2B2XA 3O8LA 4CG1A 4WXHA 4EJFA 1W46A 2OQVA 1T13A 3WLFA 2ZWPA 5JJLA 4JA0A 3AVUA 4GBJA 5FTWA 3ZD6A 4BVKA 1KOGA 2R3SA 2CDCA 5AXBA 3UUWA 2X7HA 1L4GA 2HEGA 3A70A 1N5JA 1D2GA 2CE7A 2JFFA 2R8BA 3ZN2A 3EIHA 1CC1S 4E4TA 3LKBA 4PLPA 3SKYA 4JT9A 3UOWA 4Q3LA 5MF6A 3FTCA 3EG5A 4LYHA 5DASA 3BH7A 1WA5A 1ZRSA 2XADA 2VA9A 3DL0A 2YXNA 3GNQA 3Q7TA 4MLDA 4ZCQA 1KSJA 3JAWA 1Z34A 1ZRNA 4K05A 4QU9A 1BGXT 1MABA 4M9UA 1FLVA 4ZYWA 3K4HA 4CR6A 3PRHA 4OFXA 4BRZA 1ZGGA 2QDKA 1B8NA 1VKOA 2HXYA 2X5XA 3RW9A 1JR2A 2OV2A 2YV1A 1W76A 1KHHA 1R0SA 1FYVA 2HWKA 1XTSA 4EW3A 3V8QA 1VHWA 2JGEA 4GD3Q 4KR0A 5FUYA 4O6VA 1CUIA 3ZWAA 4AICA 3PPXA 3EODA 4EYKA 1A4RA 3DG9A 4PN3A 3TIGA 2UV8A 3PUVA 3G5MA 5DX1A 3VVMA 3EBLA 3GBPA 3LXXA 1JTEA 1EX7A 4QPZA 5CH8A 4YV0A 1LKZA 3GJTA 4F6RB 5LYYA 3QI2A 5KQLA 1P0IA 1X14A 4EJMA 2NO9A 2GNOA 1IJEA 4MEBA 5EWJA 1V3UA 3M9XA 1EP1B 4QU8A 4UDXX 4JN6B 4XTCS 3ZC3A 3DL7A 5HNKA 1T9DA 1W8DA 4G0MA 5HQTA 4LYJA 3LU1A 4IINA 4B3HA 2CLHB 1N0WA 2X14A 3MRXA 4BGUA 2NZUG 3B3JA 3K70D 2QD4A 3IBCA 3TZKA 4DLRA 3FCOA 5A9RA 1OB5A 3WQHA 4R8LA 3GFFA 4DIOA 1H66A 1V8OA 3A1CA 2YZNA 3VPBA 2W9XA 3U62A 4YNBA 4R2MA 2F1IA 1WU7A 5KYWA 1O97D 2VK1A 4GXQA 1NC3A 4A27A 5BWCA 3L7CA 2NU7B 1ZD8A 2XYPA 2QP4A 1D6NA 2XDQB 3CXRA 4I3FA 2OFXA 2YXEA 4LXGA 4GSYA 3UIEA 3K31A 4B71A 1X7YA 5B2EA 4QVIA 3AF6A 3O26A 2VO1A 2H4ZA 1HMPA 3IUEA 2OPBA 1FUEA 1S4QA 4B1FA 2P9TA 4K9LA 1ZIXA 5H9WA 1FS4A 1UDBA 3QKRA 4BLOA 2HPVA 2FW6A 1OLXB 2SKCA 1GNLA 4ZU1X 4C7BA 3PICA 1T24A 5LPNA 5CT5A 4UE3S 1B23P 3UWDA 3EVFA 1DQZA 5DDIP 1ZIDA 4EY7A 5TS2A 4YUWA 3K32A 2ISSD 5DKFA 4R83A 6CHYA 5CD9A 1HDZA 3C5HA 1XQ1A 5DXJA 3ZYZA 4EGSA 1C0KA 3ZXIA 2VDPB 3WGZA 4PLVA 5H70A 5J4VA 3QLEA 3MT8A 1YMUA 5MGNA 1Z68A 4NAHA 4FC6A 1Q1EA 2X2EA 4FYHA 2ZU0C 1QIGA 5CK5A 1V1JA 4XVUA 1XKQA 4DR5B 3HACA 1ZS9A 1NBME 2V59A 2WA1A 4MUXA 1Q57A 4UU8A 1QPBA 5U4XA 1K7XB 3WA7A 1U8ZA 2H92A 3U7QB 2CXHA 3P2YA 5KQSA 1V71A 3U80A 4ANFA 1GPWB 1NJ8A 1QQAA 1N25A 2AFIE 4WJLA 2Z6QA 2VPYA 3M3HA 1I6WA 1T5DX 4KPFC 5B4TA 1NUPA 3CSUA 1PKXA 2HC9A 2JGFA 4GIBA 4X85A 3DCJA 5TJHA 1L5NA 5HP4A 1EXVA 2AFRA 4ISCA 1CT9A 1KFBB 2AG1A 1LV8A 3OX4A 3ECCA 4RD3A 2IPMA 2OFOA 1YZQA 3KTAA 4YAOA 5KX5B 4L3WA 3H1BA 1FUYB 5EWLA 1LCIA 5J4LA 4I55F 3C8HA 4A3SA 2X4DA 3SHFA 2OO3A 1QG6A 3G23A 2Q6TA 1V2HE 2XE8A 4YMVA 5BR8B 4A2PA 1U80A 2A9RA 4YCCA 3D59A 1PR1A 2WYOA 1ST2A 1Y4AE 2V8OA 2LE0A 4JUFA 5LLTA 2GBPA 3HDJA 2VPZA 2ZUUA 4M1OA 4U9IS 5HA5A 5J47A 4IO1A 2J6BA 4YK7A 1ZUIA 2QL6A 4LMPA 4CEJB 1JBKA 4BJ6A 3F78A 3ZHVA 3HYLA 2PN1A 3P52A 1SQ5A 1NW9B 1S2LA 3MJHA 1B14A 1XXHA 4TUYB 4ZXPA 4OP2A 1VG8A 3HRHA 3URMA 5JAPA 1ZM7A 2PBRA 3R3HA 5DK6A 3RU3A 3AIOA 1O6CA 3O9VA 5E6RB 2WYWA 4P7KA 1RBMA 4ME6A 3OFJA 5THXA 2VDNB 3MNFA 3SCZA 4NKRA 3J81A 5TGTA 2VRCA 4RC9A 1UJMA 3NYWA 1N78A 2R8PA 1FMJA 4XWTA 5CRIA 4D57A 4LY0A 2R5FA 2MMCA 2PL9A 4XGQA 1BU8A 2QA5A 5ULLA 1JDBC 5E95A 8LDHA 4RX1A 1ZICA 1H94A 1PFQA 3EXFA 3E0XA 1CF9A 4L8FA 1UBOS 3KOWA 5I9MA 1II8B 1NPYA 1UKZA 1W6UA 4O2AA 1TT5A 2X0EA 5JNRA 4BLPA 3HXPA 3EA5A 4DHWA 4JX8A 2JH3A 1RPZA 3WB0A 1OVMA 3E7PA 4DWWA 3I1IA 3VBEA 1X3SA 3FCYA 3PPIA 4WFQA 2VF5X 2GAAA 1XMJA 4JSYA 1CUFA 4OREX 4PU0A 2XA9A 3UKDA 1V11A 1QZZA 4YJ3B 4CTNA 1XA4A 3KB2A 1X86B 1BRMA 4GEGA 4JVMA 4O4IB 4TV9F 1FSFA 3Q8XB 2DB3A 2RFLA 1NXVA 1WETA 2IKSA 4DN6A 2CEAA 4AZWA 3HDTA 4MEJA 3E3NA 4MA4A 4DZZA 4ZZIA 1T25A 1WE2A 1UEXC 3KKNA 1N2EA 3PQ4A 1QFZA 1YRLA 1KE2A 2QQEA 3GZTB 1FRQA 1HPLA 1OV6A 3OECA 4HN2A 3NC1C 3TR6A 1M6NA 2HBZA 2VQDA 4BO3A 2REOA 2GNPA 2ZRMA 3CNQS 3EFEA 4D8UA 3HFSA 5CBKA 2PE5A 5BQFA 3PC3A 3U9TA 3O95A 2BLLA 4G89A 4IDGA 5AUOB 5AM1A 2NTEA 4A15A 1VYVA 5I7WA 4BFXA 1P61B 4XSGA 4KXFB 4DGSA 2ZBGA 1WZ2A 1T8SA 2J1LA 5BN5A 4IVRA 1MRNA 1WDLA 1L6IA 2DQ4A 2DH6A 3CW9A 3F3SA 1Y9DA 1HE1C 3U0VA 3LFTA 4TYWA 3ORRA 1R4NB 2O2XA 1VBFA 3BIXA 3Q41A 1VKNA 4IQ4A 4GM4A 4XQGA 1YE5A 1PJAA 3UYLA 3IB3A 1ORIA 1ZESA 4JB3A 2QI9C 3G79A 3OQ1A 4PSKA 1P5RA 4W9MC 1UQUA 4BHTA 5KNCA 2VDJA 3GFRA 1FW8A 1KKUA 1OU0A 2A9FA 3QVVA 4BUZA 1NLYA 2J0SA 2PKWA 4YBZA 1CEQA 3QXGA 1AIPA 3ZHZA 2O52A 3G49A 4N48A 3LLCA 4J0FA 1QHSA 1SRRA 2VSNA 4H59A 4KDCA 2YJNA 1BE6A 4X92A 4DLAA 3BMNB 4HDMA 3T1NA 2GF0A 5LBIA 3WL5A 2ZAYA 4JLVA 2RHDA 2FZKA 3KOUA 3TVTA 4BMXA 4NXMB 1Z0JA 1GRVA 1Z8FA 4Q9DA 1NYTA 2WD7A 1SKMA 4LDNA 3NIWA 4WXYB 3B9QA 2AFIB 2DWQA 1E6EA 3FWHA 4HGRA 2QY6A 3BMNA 1JQAA 4HDMB 4DXDA 2FHPA 2XCQA 3HUDA 1PNQA 2RK3A 4EVRA 5IFKA 3G0CA 1I4TD 1R50A 3IR5A 1PT9A 3PEFA 1C81A 4OXYA 1GAWA 2VOEA 2YBDA 1K92A 3L9XA 1VBMA 1WKCA 3I2JA 5KYYB 1VE7A 2C0QA 1EUCA 1Q1NA 3ICWA 3LHSA 4C78A 4IDPA 5D00A 4P58A 5F98A 1DC4A 1SUSA 2VJCA 4DHEA 2BZ0A 2GKSA 1XRJA 3LC1O 1FRZA 1SAYA 2AJ8A 1DHRA 5FOXA 3KUCA 4P54A 5TJ9A 3TNJA 5AW7A 1Q19A 4TLBA 4AD8A 3DFKA 3LUBA 5BN5B 1DU4A 1J49A 1Y4UA 2A7XA 3H04A 2X4LA 1D2NA 2AW3A 3E9EA 3GEPA 1E7RA 2E4AA 3K72B 4NYJR 1SHZA 4JB2A 3TL2A 1RZ3A 5AJWA 3KT0A 1BDMA 2B4YA 2WLTA 1EZ1A 4WOJA 4B7AA 2WB2A 1NGSA 1G7CA 1KRWA 1MOPA 1L5WA 1GQQA 5K2OA 5JCJA 3DV9A 3RQSA 3JSAA 4S1VA 1DARA 5TLSA 4URYR 1L3BA 3LBFA 1UMDB 3HO8A 3VNRA 3Q40A 3U26A 1D0VA 4NZOA 1FIUA 2DBRA 3OLWA 3PEEA 2HQRA 4WCFB 3KAJA 4AX4A 3H1GA 1MC8A 2Q3JA 3M6XA 4GZ3A 4A5SA 2X13A 3CSDA 2VJPA 1USGA 2YN2A 2RBEA 2R5NA 2QN7A 2IDZA 2IELA 3HA2A 4RV4A 2QF7A 1AY0A 1YT5A 5GTDA 1QZTA 4YB8A 1BC5A 3JSXA 5C9ZA 1JXAA 3J81k 2C2GA 2FVYA 1F8GA 3EXIA 4YJ3A 2ISCA 2WUDA 2XT0A 1SC9A 3AF2A 3K73O 3O1JC 4RANA 3NEPX 5E1MA 5BSRA 2R8OA 3SX4A 3BSWA 3WLQA 3HXKA 4H3SA 2OG2A 3D8RA 5KYXB 3PF8A 1TIBA 1G7SA 1XTRA 3RODA 1C9DB 1TT5B 4O2AB 3FGZA 2C96A 1YIDA 2B4AA 4H1HA 3P27A 4TWJA 3QU7A 2CJFA 1Z5GA 2B5VA 2J07A 3H17A 3FUWA 1SFRA 3HKBB 2QTGA 2MSWA 3F8SA 1O94A 2C4KA 4MWDA 4B47A 3PA8A 3PC4A 3ZHBA 3PPWA 2W6IA 1QK3A 4YP5A 3UJBA 2X0DA 1M6WA 2BKAA 4V3CA 4F9EA 2PXXA 2XECA 1R0RE 1I8TA 1B16A 2XPCA 3N6XA 4MVWA 1JQ3A 2MYUA 4U2DA 1EFTA 3P2MA 2YHBA 2GD1O 3DBLB 3MQ4A 3IFSA 2MHCA 3R3UA 1LPMA 1MJGA 1DWOA 1VI5A 4QD3A 1YRHA 5FOUA 3WRXA 2IEBA 2YOGA 4JJ4A 4MA0A 5LFAA 5F5NA 3DAPA 4RZQA 3WXMA 1J9EA 1Z22A 3F9IA 4AQDA 3MS2A 1FFGA 3SZMA 5AWFC 2RHCA 5K0ZA 1WDKA 2WTEA 1MW8X 1WVGA 1TYCA 3GXBA 3DQZA 4M9QA 5LP1A 3A1UA 1DP4A 2WICA 2QM0A 2W2TA 3KEMA 3SS7X 3K4QA 1G59A 2GF9A 2OC4A 4D3ZA 2KX7A 3GIWA 5BSTA 4OYHA 2ZB3A 2QMZA 1PL0A 3C5WP 4JU8A 2BTQA 5BRNA 2FUCA 5JQGF 1FNCA 3DE5X 2NZYA 5AVUA 2PNJA 3VPFA 4CQMD 4E1AA 2A7QA 1IULA 3BIWA 2I8AA 5ALGA 2ODQA 1U7HA 2FOXA 3X2SA 4L8GA 4EY6A 2XCRB 3A6KA 4CG2A 2X0RA 1PO7A 2NACA 1MX3A 2AL7A 4DRZA 3ME5A 3V42A 3WICA 3IJEB 1UQRA 4JBNA 4KNWA 5ALQA 4G65A 4I4TF 4IRXA 3SZRA 1Y98A 4H3HB 3UAOA 4LZOA 4MTLA 5T4BA 2RGAA 2PMBA 2VYFA 2JEYA 2QTMA 1HFKA 1OAKA 1GPUA 3AR5A 4PGHA 2C98A 1PG2A 1VSUA 5DI9A 4JQYA 4PBRA 2W6PA 4DLWA 3L02A 5E0KB 2XQFA 2YY5A 2K2QB 2X0IA 3KT6A 3LA8A 4J94A 2GD2A 1AXRA 1RQPA 4NEHB 4OKSA 5B53A 1TM3E 3KHUA 1MRZA 5A0FA 5I47A 2W2NA 4TTSA 4KV9A 3VX4A 2CFTA 3UV6A 4R68A 1KDVA 5K0EA 1S6YA 1T2NA 4QX6A 1H5QA 3D6JA 4OMCA 1JTVA 4KO4S 3TSAA 3KZVA 3B1YA 3O9ZA 2DH5A 4OGGA 4CV3A 4HLDA 1Y37A 2O06A 4QTTB 5AXAA 2IBTA 2G4CA 2CZCA 4NU8X 1OLXA 3K30A 4O59O 3TLKA 3UANA 2HPAA 1E9EA 4RTJA 2KM1A 1B6TA 2OO7A 4WK0B 3J80A 1YS1X 2NTNA 1OYWA 3O03A 1J6UA 2Z9CA 5K0CA 3VSEA 2Q0XA 4B3FX 4BB9A 4XB6B 3AERB 4CQJA 3GBVA 2YIJA 3R74A 1HQCA 3AIIA 1AGRA 4UTNA 4BXOB 1U7PA 3LWNA 4QWMA 5HCUA 1NNSA 3UMBA 1S89A 4ZDKA 5DGXA 1KJYA 1XZAA 3CMCO 4H7JA 4IY1A 3JWJA 2ZSHA 3PIDA 1AF7A 3LLUA 5KYWB 4W5TA 4LCBA 2A0FA 3IB6A 3O90A 1VHDA 2BONA 2WFAA 1XZJA 2D13A 1E3EA 2A84A 3JVIA 4PHTA 4U9UA 4XQ0A 3ZCVA 4IX1A 5JNVA 1YZUA 1QO0D 2J5BA 2R44A 4PYIA 2WFMA 1D03A 4QG3A 3DYBA 3DSRA 2QXYA 2YWHA 3HKCB 3OCCA 4D8TA 1C3XA 4LK3A 4MUJA 3WK9A 1E58A 5IX8A 2QRVB 3FOAA 3IIMA 4L9SA 4F0JA 3V3KA 1ECCA 3OEHA 2KLHA 4US0R 1KH1A 3LGSA 3MWKA 1CY6A 1CQIB 3DDUA 3W3AA 3E1GA 4QARA 3T9CA 5AXCA 5AM5A 3UKOA 4CFYA 1THMA 1UBHS 4R0MA 4YAKA 3M6WA 2HA4A 4URWR 4KB5A 2XBLA 1XXLA 1YASA 3QWIA 3WGGA 3ZKAA 4FLMA 3OZFA 5H3HA 1W96A 3JZMA 2BTEA 1EUQA 2GGSA 2A0WA 3DHYA 4QEZA 4EF5A 1J90A 1U5BA 2IIVA 4BVBA 2DFDA 2IHTA 4FGWA 2JGNA 4R1SA 1SVWA 1U0LA 3U3OA 4ZMSA 2JLUA 2CE2X 2Y0DA 1BKYA 3MGBA 3KNZA 3L49A 3R3VA 2PMCA 2V45A 3L46A 1Y1PA 3VNQA 2X3YA 1N6KA 1N5MA 1W0KA 5CYGA 3IXMA 1JWAB 3N8NA 2I1LA 3I62A 5FLXA 1T5OA 1DG1G 3OESA 3RYIA 2EKQA 3RT9A 3A8TA 4HAYA 3SYRA 4A1OA 4A92A 4BO0A 1UBUS 1ZVQA 4LI0A 4RA9A 1AOXA 2IH5A 4KPEC 1WW2A 3AHEA 4RZSA 4KWEA 4IWYA 1VJ5A 4HRXA 2HDHA 4F8YA 4DY4A 2FETA 4LTMA