2AB0A

Crystal structure of e. coli protein yajl (thij)
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
195
structure length
195
Chain Sequence
SASALVCLAPGSEETEAVTTIDLLVRGGIKVTTASVASDGNLAITCSRGVKLLADAPLVEVADGEYDVIVLPGGIKGAECFRDSTLLVETVKQFHRSGRIVAAICAAPATVLVPHDIFPIGNMTGFPTLKDKIPAEQWLDKRVVWDARVKLLTSQGPGTAIDFGLKIIDLLVGREKAHEVASQLVMAAGIYNYYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords YajL
publication title The Atomic Resolution Crystal Structure of the YajL (ThiJ) Protein from Escherichia coli: A Close Prokaryotic Homologue of the Parkinsonism-associated Protein DJ-1.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Unknown function
total genus 71
structure length 195
sequence length 195
chains with identical sequence B
ec nomenclature ec 3.5.1.124: Protein deglycase.
pdb deposition date 2005-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01965 DJ-1_PfpI DJ-1/PfpI family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2ab0A00
2GK3A 2NV2B 1OY1A 4S0ZA 2ZUVA 4Y1GA 2VDJA 3KKLA 1WL8A 2R1VA 1FY2A 3EZGA 4PXYA 4QYXA 1BXRB 4XLLA 3L18A 2LXNA 1KA9H 3TTTA 5BV2P 1ONSA 3PQ2A 1IZYA 3BHNA 1OX5A 5SYAA 4E5VA 3P9RA 3EFEA 1SY7A 1I7SB 3OT1B 4L78A 2VXOA 4Y1RB 4P2GA 3UMMA 4N12A 1VCMA 3EWNA 4ZDJA 3B36A 3EN0A 2AB0A 1O1YA 3CYFA 4Y1FA 4BTEA 1GG9A 1KWGA 3SF8B 3L3BA 1PDVA 1J42A 4WXYB 1C30B 3NOQA 3EJ6A 3P9PA 4AULA 1G2IA 2RK6A 4N0MA 4UOZA 4UNIA 4BIMA 4OIFA 3SOZA 4ENPA 3OT1A 5SY6A 2YWJA 3MGKA 4B40A 4I2NA 1CE8B 4Y1RA 4D1YA 4ENVA 1I7QB 5K4AA 3N7TA 3B3AA 1R9GA 2YWBA 4I46A 1GPWB 2IUFA 3PQ3A 1P7ZA 1FYEA 4GUDA 1GGKA 1C3OB 1JVNA 3SF8A 4B2YA 4ENWA 2AD5A 2R1TB 4UZSA 1QDLB 3NOVA 1GGJA 4Y1EA 1CS0B 2YWDA 2YWCA 1QF7A 4OGGA 3PQ8A 3PQ6A 2XF2A 4L7QA 1IPHA 3R75A 4AUEA 4E08A 4ENQA 5JZOA 4I4NA 3RHTA 4P34A 1QVWA 2R1TA 4RKWA 3PQ4A 4MTCA 4ZDIA 4L8WB 4OFWA 2ISSD 1OX4B 3L4EA 3M3PA 2ZUSA 1U9CA 4OQ4A 4QYTA 4MGHA 2A9VA 3WFZA 1P81A 4OGFA 3CY6A 4HCJA 4MNTA 1T36B 1T3TA 3D54D 4GE0A 4ENTA 3UGJA 3PQ5A 1S1MA 1QVVA 1P5FA 3L7NA 3TTWA 3ZJ4A 4BFLA 3ZR4B 4ENUA 1KXJA 2WJZB 1OI4A 1CF9A 1VCNA 1VCOA 3F71A 1OX4A 1M6VB 3BWEA 3UJNA 4RKYA 5LIRA 3CZAA 3TTUA 4ENRA 4ZGGA 1IZZA 1T0BA 4WINA 1QVZA 1KWKA 1JDBC 5IP5A 2VRNA 2ZUWA 3NOOA 3TQIA 1PV2A 4AUNA 1P80A 4K2HA 3FSEA 1QWSA 4JQSA 2VKTA 4GE3A 4B5KA 2OR3A 4P5PA 5JZMA 2VPIA 4L8FA 3NORA 4UCFA 3TTSA 1I1QB 2W7TA 3FIJA 3UOWA 1P7YA 3P9QA 3R74A 2GHRA 1VHQA 2RK3A 4LRUA 4R7GA 1K9VF 3TTXA 4AUMA 1Q2UA 1N57A 3B38A 3MIIA 1L9XA 1GGHA 1GPMA 5SY9A 5SY4A 1Q7RA 1SOAA 3F5DA 4L8YA 5DFAA 2ZUTA 3P9SA 2ABWA 2V4UA 3CZ9A 1KEEB 1OX6A 1UCFA 3NONA 3PQ7A 4P36A 3UK7A 4Y0NA 3ZJ5A 3TTYA 2D7JA 4AJ9A 3TTVA 4P35A 2ZUUA 2NV0A 4ENSA 1PE0A 3VU3A 2RK4A 4ZDKA 2R1UA 3ER6A 3GRAA 4UOQA 2H2WA 2R1VB 4L95C 3R76A 3NVAA 1GGEA 3CNEA 1PDWA 4OJYA 4LGYA 2FEXA 4B31A 1A9XB 5E9AA 4ADSG 4B7AA 1GGFA
chains in the Genus database with same CATH superfamily
1G3RA 1X70A 2R48A 1Y3FE 3SQNA 3NHRA 1NXWA 4FU0A 4EW1A 2J9ZB 2B36A 2QGZA 4JP8A 2RGAA 1JB1A 4PQGA 1V1MA 1ZMOA 4HWPA 4NYIR 4HB2A 3D5EA 1QH8A 3PQ2A 1PJBA 1IZYA 1OWLA 3AIIA 1ZI8A 2AL7A 5EA2A 3R7DA 4AROA 3WYDA 3RC3A 2QRVA 1MNQA 1QZTA 3B82A 1A9SA 5D3ZA 1INLA 4CMEC 1KJ8A 2M98A 3VNSA 4YMHA 3SIPA 4IJWA 4MB6A 2P9FA 3D6AA 1UDBA 2FSHA 2R44A 3E1GA 1QV9A 2Z9CA 1ZUD1 2GRJA 3UMYA 5TC4A 3D9QX 3IYLW 3JARB 1C4OA 3EULA 3ZOKA 2FR8C 1NPYA 1YB1A 2P41A 3EMVA 4OSPA 4TKVB 3SFTA 5A5EA 2B0JA 5J4VA 4NYIQ 2CDRA 3K32A 1IZ0A 1XZCA 1AE1A 1W93A 3FD8A 1OYOA 5KJEA 3PNLA 4DSAA 2H0RA 3C14C 4GBMA 1Z29A 2N0SA 2XD4A 1E59A 4G86A 4IXWA 4L8LA 3TFOA 1UC9A 2WF9A 4G1VA 3KXLA 2LNDA 4WNCA 2R1TB 4TV8B 3NOVA 3T0IA 5GINE 3AF3A 5DTEA 3P1JA 1C1XA 4GYKA 2ZIWB 4HRVA 2RBKA 3MD9A 2PMFA 2JH9A 2QPOA 3WYEA 5AW8A 1FFCA 1YZKA 2WIAA 3LVRE 4D44A 4NCAA 3MERA 4GUAA 4N7MA 3IR7A 2GXUA 3H6GA 2FHSA 3C16C 5IULC 3LCCA 4X54A 4NU0A 1TYEB 4MIEA 2UVQA 4L85A 5ELXA 2WT9A 2EZ8A 3H86A 5DEOA 5LFAA 3KOOA 1CNEA 2WTNA 1XG5A 4LV8B 3DE1X 2HA0A 3ZDYB 3B9BA 1PL8A 1OE0A 4JQZA 4OO3A 2NAFA 3GJ8A 1DWQA 4WW0A 1JDZA 4B3BA 3EIUA 3SQLA 5DISB 3AVOA 1ISMA 1XYVA 2ZT6A 3HCEA 4G1EB 3PKJA 4JNCA 3X1XA 4KFSA 3RUEA 1CY2A 4CFZA 5IJ0B 4G09A 3ZE8A 1MVLA 1A8SA 2YXEA 1LSOA 1P4SA 1NBHA 1G8JA 2X7HA 4FIDA 1RHKA 2J7PA 1QYIA 1ODSA 3DJFA 5I4CA 5I4IA 1AXGA 1BWRA 1KMQA 1YS6A 3CNOA 4I1SA 4U00A 5IJAA 2Q8NA 4X45A 5C0OE 4DLUA 1RXWA 2ACKA 5JAUA 1DRWA 3U5ZB 4ZQIA 2Q1TA 5JAMA 3DOHA 1DKUA 3Q98A 3ROEA 2J9FB 1TMKA 1W75A 1ND5A 5IFLA 5D3MB 3UEOA 2PQ6A 2G17A 2GEFA 4EO4A 4PU0A 1UMKA 1KS9A 3DHNA 4ZVVA 4ZU1X 4DCTA 1SOAA 4MZDA 4QU9A 4WACA 1ZX1A 4YT8A 3UMVA 1PR3A 2H1WA 2NPOA 4CVNA 2AOTB 1X6VA 5AI8A 1JDTA 2X0EA 3WBBA 5EHGA 4ZAYA 5HUQA 3F67A 3SS9X 3ZGZA 1PL7A 4G85A 2PV0A 3UYLA 1JE0A 3QNMA 3ZD7A 4LSMA 4CG1A 5MFZA 4PQYA 4YP9A 4CEHB 1KGSA 2FPPB 2JA2A 1UPUA 3RSOA 3QVLA 1GDHA 1HK7A 3K30A 1WE2A 4R2HA 3TRKA 3Q40A 5CXUA 2GBLC 1I6KA 4LYJA 2O8EB 3ZZ0A 4IDEA 3S2FA 3DMYA 3JWHA 1G66A 3HUUA 5SICE 1RSZA 3DKPA 1YL5A 3UIEA 2ZAOA 1KEWA 1F2UA 4KWCA 1YTUA 4W7HA 2WIBA 3CFYA 4HH0A 5D84A 4E7PA 4D4KA 3LUGA 4X7PA 4HNUA 1GZ4A 4JJFA 5BXYA 3ZJVA 2C2WA 1YC5A 4KAFA 3WHPA 3AU8A 2QBYB 2OGSA 2AKAB 4EZIA 4O2AF 4L8GA 1LY1A 1RXSA 5CP8A 3HDHA 4R1MA 2B8WA 2YJNA 4KR0A 2Z09A 2J6HA 1PZEA 1B2LA 2R7NA 5AK0A 4JI1B 3TH5A 3VSDA 4BX0A 3K5PA 2I6GA 1QH8B 5CIYA 4TLLB 4R2WA 1QUFA 1E79D 4MRPA 4CFSA 4QUGA 4LEIA 4Y1RA 4OSEA 1FYWA 2NO5A 4U2BA 2PPVA 2WHEA 4LDQA 3CWZA 4BNHA 2O6HA 3WICA 2Q50A 5KU7A 5AVXA 3URKA 2HJHA 1Z6TA 2PXAA 1HYGA 2GT1A 3FPKA 2CVQA 2I2FA 1UM9B 4HL6A 1U2QA 1MC4A 2OA0A 1N34B 2RGRA 4ZYWA 1JG6A 3PHGA 1JEYA 1G2QA 1A2QA 1KAMA 1ZOLA 1CZLA 3H05A 3JS5A 1AO3A 1YKFA 4HAVA 1M75A 2YQZA 1NU8A 4UHJA 3KLPX 5KJ1A 4K0KB 3IV6A 1B8VA 3MTDA 4I6EA 2D06A 3R75A 5BRJA 2PHZA 1KQ3A 1MNAA 1VSQA 1I24A 1UANA 5G0WA 1SUIA 4EUNA 1YJXA 3GARA 3REGA 3D6MA 3NBFA 1NVUQ 1Z4KA 3ZUPA 5LU8A 2P6PA 4ZOAA 1SOUA 3I9LA 1NU6A 3PCTA 3MWYW 4Z54A 4DUPA 4CF5A 3OU2A 3IKJA 4BQEA 5LZ7A 1SVUA 2B4QA 1JZTA 3JZDA 4EEKA 2QMOA 2R8ZA 2YXDA 1BJRE 1N3IA 5KOHA 1S1MA 4BFZA 3FNQA 5BT9A 3GIDA 3WB1A 3L6BA 1T29A 2FSFA 2C78A 2GARA 4MS1A 3SC6A 3ZDBA 1T4BA 2UZ4A 7MHTA 4EI2A 2Y1OA 5BT8A 2VJKA 4GSKA 4TRNA 3R3WA 4GO1A 1ZOSA 3PC7A 4QULA 1VL2A 2R8PA 2XCUA 3KTAB 2H17A 3HVJA 3R6WA 1K0FA 3EVNA 4HR7A 4LC0A 3CSDA 2WSBA 3K0CA 2JGNA 4J0GA 4XFJA 1GT91 5C5CA 4KPYA 3JTEA 3J81k 1E9DA 1WP9A 5KYUA 1P2GA 1CUBA 3JWPA 4DJAA 5C32A 2JH3A 3ZLTA 3O3OB 4OAPA 5TGTA 4B46A 4KQGA 2Y1WA 2FAXA 2WB2A 2UXDB 1R64A 3TTSA 4IIXA 1LJUA 1BS9A 4D9BA 1W4LA 3NKVA 3ADKA 4EHHA 1GKYA 4R7GA 3L0SA 7REQB 5EJIA 2A0XA 3WKCA 3BX1A 2NTVA 3R9KA 1XROA 1JTEA 2JFZA 4PZYA 3A9SA 4HB3A 4IX1A 4QXQA 1SXQA 2ZETA 5H82A 3KSRA 3DE0X 3MQ2A 4C2TA 3FAZA 1Y9ZA 4U9UA 3S2ZA 4ZK6A 5KDOA 2VP3A 2PFGA 2ZE5A 5F2NA 4KSBA 3IURA 3G0OA 4MUXA 4E33A 3WMGA 1ONPA 2E5LB 3UWSA 4AZWA 8MHTA 2X2EA 2Z2IA 4JASB 3ROMA 1RAIA 2Y9MB 1UM8A 3IHKA 2GNAA 2QVZX 1H3FA 3A1NA 3R24A 4JSRA 1AURA 4IIGA 5IBPA 4W5TA 3A1DA 2ILTA 3DPSA 3QPAA 4KU4A 1E2FA 1EX9A 1PK9A 4YMWA 3D31A 1E7RA 2ZYIA 4OXKA 5KOJB 2EATA 5F1PA 5IBCA 2H59A 4XPZA 3IDZA 1TOAA 4KXFB 4I4TF 3HXMA 1XKTA 2EFEB 2G88A 1JH9A 4BECA 2JLVA 1AGPA 4P9NA 1LEHA 1ZC4A 3SZLA 3KR9A 3AR3A 3RGWS 1E9BA 1GY8A 1DV1A 1II9A 1FFHA 1ZOIA 2ZSDA 3K6KA 3QYAA 2P4UA 3O21A 4HGYA 5SZIA 3PGXA 3W5BA 3I9V6 5EQFA 3RUAA 2E4YA 4P80A 5J43A 4YDQA 1UMDA 4GKKB 2G9QA 3KKMA 1OZGA 1RM4A 3QYPA 4NR0A 1EQAA 5EVJA 3REOA 3OPVA 2FQYA 4TQGA 4KOEC 1NLFA 3ST7A 4Q7JB 4PYIA 3CINA 1GUBA 2Z6QA 4H7HA 5COBA 1U8TA 4WXRA 3AY7A 4ENWA 3EC2A 3GJTA 3H1TA 5AUOB 2E2WA 4Y2PA 4LE0A 1SXJE 1QS0B 3W34A 5FUBA 3HU5A 4ZCLA 2WF6A 3NXSA 1LPOA 2O3QA 4U2EA 3TOSA 3ZWXA 1QV7A 4ZT3A 2QXUA 2ID9A 2BFBB 1J24A 4D97A 4G5YA 5CTJA 3M4XA 1BFDA 1Q1ZA 1TD1A 3UFBA 4EPWA 3I6IA 3Q7IA 3LLVA 3ICOA 1L7AA 3RV3A 4BWGA 4U0KA 2VAWA 4BLQA 1SKQA 4BZPA 2CYBA 1CULC 2GK4A 4L4XA 3V8VA 3WFZA 5DBHX 3ONWA 1TZBA 3P20A 4QYWA 3W5HA 4H1WA 1VL1A 4ND8A 4IIEA 2GMWA 3BL5A 4O0MA 5EMNA 1TT5B 3Q9UA 2O14A 2W37A 2KBEA 1R0YA 3TZLA 3IA2A 1CG6A 1JLLA 2CLMB 2QVBA 2HWKA 3OFSA 3TVDA 2XCRB 2NU8A 1XZNA 1IVNA 1H0SA 2G5CA 3I1FA 1OX4A 1RFGE 4LFCB 3WRXC 3TI9A 1WXHA 4L4UA 4PC1A 5DSZA 4CLEA 4Z53A 5B2EA 1IWPB 4NJEA 3SX2A 2PJDA 4FQ8A 1NNI1 2H85A 1GARA 3WLMA 1FTGA 2NYVA 4C4SA 3K35A 3DGFC 3TM4A 4PZUA 3ZXSA 3FDZA 5K3OA 2H4ZA 4MARA 4JQYA 1ODTC 2D0DA 3K94A 2JGJA 4FSHA 4WKPA 3DP7A 1WHSA 2MHCA 1Y1RA 5JQGB 1QYRA 1HT0A 2WHQA 2WUDA 3AR4A 1JHQA 5KVCA 1IQPA 3T3PB 2AYZA 4JEHA 3I2YX 1JVBA 1U11A 3TTVA 2PFSA 3QI2A 5AM4A 4EVQA 3IDAA 3AQIA 4QOHA 2FFBA 3R3HA 1NW5A 1Z15A 2IBMA 2J46A 3GNLA 1VL6A 1PT7A 4R05A 3I8OA 4I55F 2BLNA 3RIYA 3I39X 3EXIB 4HEA1 1GCGA 2X9QA 1H0KA 1GNLA 5KSOA 2EOAA 3QVMA 4G67A 1ZFNA 1FS4A 4KUGA 2GCIA 3V8BA 4E94A 1WL8A 3FWHA 2J6IA 3DW3X 1F60A 1FP4A 1TVCA 1RWVA 1JHDA 3L18A 4J3FA 4MRSA 3ESZA 3TXAA 3C6KA 3UVEA 4OXXA 1XP8A 2AS0A 5CHEA 5ARCA 4F7DA 1Y6ZA 2QU7A 1QE5A 4TZTA 4F5EA 3EGEA 4DV5B 5IN4A 4ON9A 2OCYC 5JWRA 4ZVUA 2QG9A 1VCMA 3V8RA 1ISHA 5LQAA 1J8FA 5JPIA 3E22A 5LQCA 3F6CA 2X8JB 2FDXA 3K5IA 1OMOA 1CEEA 1E2LA 1KR5A 1FDSA 1JW9B 3NYWA 3BF7A 3HDTA 4PC2A 4HP8A 2H5JA 3NKLA 2Q5JA 4K5QA 5FBKA 4CI0B 4PO9A 5JNSA 3CO0S 2RH8A 4MO2A 4ES6A 4XR4A 1RCUA 2GN6A 1W29A 5DRYA 3SF0A 1BD3A 3ZGNA 2PZEA 3QNUA 4A3SA 3GLRA 4EB6A 1HRDA 4U2CA 1KI3A 4HEJA 2BTEA 5FOWA 1RP1A 5EJ9A 4RVUA 5FOVA 4UUPA 4PZZA 4YJ2B 4YY3B 1LFDB 1TZ2A 4S12A 4QODA 1MAUA 1K06A 3RM3A 1P73A 5JLAA 3RTDA 5BV8A 2Q3FA 4FDAA 2YWDA 1TTTA 4DG9A 1K86A 2I6QA 4G25A 1UQUA 3HGMA 2Z5LA 3SX4A 3KUCA 1YQDA 3HU1A 4KQEA 5KVQA 2R84A 3AFGA 1CLUA 4NYMR 5HKOA 3GEDA 3T1VA 1Y3IA 4EBBA 2PYZA 4ZDIA 4X61A 1CC1S 4PYOA 4PCAA 2I6UA 4B7ZA 4LWQA 3WKBA 1C9YA 2AW5A 3BGOS 1ESMA 3M3PA 4KQ9A 4B34A 2IU4A 2GZMA 4MQFB 1PVVA 1AA9A 1HT3A 4JT2A 5ETJA 1ULZA 5HMLA 1FPQA 1A9QA 1RXIA 4R69A 2PIAA 2GJ9A 2H18A 3LLCA 1PG0A 1AGRA 4NSNA 4FYVA 2IWHA 2CL6X 1PD0A 4ZYUA 3NGXA 4NYMQ 5FBLB 1IQUA 4PLPA 4C2AA 4YAIA 3LS2A 1DO2A 2PMDA 3FDJA 1EM8A 4DLLA 2XQFA 4E3WA 2IH4A 2JEYA 1M2HA 3T9AA 1LLFA 3I1YA 3K6RA 5GWXA 1UDRA 4A91A 3BHIA 3L7LA 4I6JA 4DQKA 2P4SA 2VKTA 1DQRA 2A9PA 4G5FA 5K20A 1Y7LA 2VLIA 2QYSA 3A3PA 2OO5C 3P2JA 5G0UA 3TLGB 4B2PA 1T0IA 2WJAA 3UA3A 4AMZA 4CKEB 1QRDA 1EZ4A 3FYUC 2IF2A 2VAPA 4HS4A 3OSUA 2YYAA 3RYHA 1DBIA 3K9GA 2DLNA 4DR7B 1TQ6A 4FW8A 1U9YA 2Q2NA 3G6WA 3GPIA 4MI6A 4DQXA 2WAYA 2FPXA 2Q29A 1ENYA 2NNLD 4HK4A 1UKEA 4E5SA 1ECCA 1G16A 4YUXA 4C7OA 3ZK7A 4E70A 5LXTF 1Z8DA 1M54A 2NT4A 1TQ8A 1XU4A 3KVVA 4MV5A 3CCFA 5JIBA 4IMIB 1VA4A 5EJGA 1CB7A 2W00A 3ORYA 1NBOA 1O08A 1YRYE 3RK0A 1HURA 1TQ4A 2H2AA 5A4AA 3SIXA 2A35A 1WUHS 3KKQA 3BS4A 3OZCA 1U8YA 4Q12A 4OHXA 2O2ZA 2DH5A 3SSAA 5D5QA 4OH7A 3K0EA 4Q34A 3SHVA 4WWHA 3CE9A 2FQQA 2I2BA 3N2GA 1LWOA 1WKBA 3FI9A 2CXQA 5TV2A 3AFHA 4RKFA 3W5SA 3VR6A 1QO0D 4ALIA 4PNEA 2W2KB 1JGTA 4BMOB 3KQWA 1SGWA 3ONFA 3OE5A 4B47A 2XUIA 5G1OA 4EI7A 3NP9A 3EVGA 4TKLA 1EFLA 4GOND 2V3CC 1CUZA 4FN4A 1KYZA 3CVOA 1EEHA 3DLHA 2D62A 3TF5A 2E55A 2PA0A 1HWYA 2Q4BA 3V8NA 4D9EA 1YZLA 3ZCTA 5FI1B 5C1DA 4UBLA 1FP4B 1M2KA 3N8HA 2Z5GA 3ZVKA 1XP5A 5F98A 4UOZA 1XPRA 3BMCB 3LQ2A 1OBVA 1UXIA 1Z0SA 1BE1A 1ZCJA 4C6SA 1EB8A 1DPGA 1TO2E 3BJRA 3R9WA 1BW9A 5B1IA 4DXDA 2OL4A 4MRMB 3DHYA 4PZCA 4YRFA 5DM2A 4WBNA 1PZGA 5HJEA 2V55B 2QX7A 2YIJA 1WUTA 1JFTA 3P26A 4MVJD 4KW7A 3KQSA 2HU7A 1B73A 4GM4A 4R3WA 5EE5B 5TS2A 3TMKA 3F6YA 3I09A 5LB2A 4RTPA 4JYAB 4PX3A 1CR6A 2PWPA 2GJ4A 1WAMA 3BXPA 3PS9A 3PA8A 3EQ7A 4Z9BA 4UM5A 1O5IA 1K63A 1OU0A 5CCEA 2HHCA 2UV8A 1SBCA 3OSZA 4JA0A 2H1CA 2ORVA 4JKYA 2P4QA 3MJVA 3TB4A 4R71A 5CVTA 4GF5A 3L6EA 2VXCA 3DT6A 5H0IA 1ZJWA 3NETA 3K0FB 1YL7A 2JHAA 3LX5A 2QTTA 5EJEA 4OQEA 1KJWA 1V47A 5GVSA 3NC1C 1M72A 1GZ5A 1U1EA 1NDHA 3X2FA 3PEUA 4ALMA 1KI2A 1XF9A 3B6KA 3GP3A 4G5HA 4IUYA 4JT8A 5AKIA 3SLGA 3WQSB 2PZLA 4EF6A 3OZGA 3KJHA 4EUSA 2VNAA 4OXIA 5JADA 1N9GA 4IOJA 4F92B 3G1UA 4GNKA 3QWHA 4PEVA 1L4HA 4FC7A 4RTMA 1KOLA 4NU8X 3WNCA 2FVYA 2Z8YM 2EGUA 2DQSA 1OAAA 2AUMA 3AERA 2NTJA 4ZDWA 3HKBB 5LJIA 4NKRA 3VPCA 3KT8A 1FXSA 1VSTA 3R0JA 1LRLA 4YRBA 3ZIUA 4KYIB 3AJ9A 4M0DA 3JD3A 4PV7A 4W5WA 5BN4A 4C05A 5DULA 2HUNA 5FUXA 4NQZA 1H2ZA 3EMKA 1KEKA 1O95C 1GZHB 4WBSA 2GPWA 3ITDA 4Q3DA 1F7UA 3F0TA 3PWKA 3VR2D 4EJFA 5BNIA 3WBKA 1QG6A 4NCNA 3OQ6A 4JR2A 3KEGA 1PR2A 3NI2A 5TE9A 1DDGA 3ETCA 2JDID 2YTZA 1KC3A 1MB4A 2QRPA 2HZBA 3BWYA 3R3SA 2IXTA 4UVGA 5CT9A 4L95C 4WOPA 3FPLA 1TEXA 4YECA 5HKLA 5AVRA 1UK7A 1VLHA 4NP6A 1KQFA 3U37A 2PUTA 4NYJR 1FL9A 4RIGA 8ADHA 4M8KA 1LS1A 1XRLA 1YRWA 3LVQE 3OKAA 3QE2A 3JQDA 2XNSA 1QJ4A 1A82A 5AR1A 1JG7A 3RHSA 1SUPA 2HLDA 1OAKA 3OKCA 4LOIA 4BQNA 5AW3A 4RTNA 1XNHA 1E6UA 4DV4B 1SG0A 3KQOA 1RWWA 2NM0A 5J1TB 1N9KA 4BFVA 1JT2A 1OW3B 1PJRA 2AF4C 3IT0A 3OJLA 3AHDA 1E0AA 2HF8A 3ZV7A 1HYHA 4NHEA 1IQRA 1ZN2A 2I2DA 4JL5A 5A3RA 2IW3A 4CM6A 4TYYA 4OBXA 2P2DA 1ISGA 1E1DA 1DUVG 3L7MA 5EP1A 2NADA 2JBWA 9MHTA 3W0LB 1DAMA 3JAWA 3L06A 3M4NA 2CUNA 1BFKA 1EE2A 2OBMA 3D3WB 3KBOA 4J0HA 2PE5A 1UBCA 3TW8A 1IATA 3GLVA 4UU8A 1QQ7A 3VZBA 3FKQA 3IMGA 1QAQA 2R751 2FFAA 3A06A 3FI0A 1R3UA 1KAOA 4ENVA 1O2DA 1CQJB 1ZA2A 3I83A 5B3JC 1Q1GA 3FOAA 3AW8A 2MYNA 3GX1A 3MBOA 2DWOA 2E0IA 3WXMA 4XSVA 1XSEA 4FSXA 2QW8A 4D92A 2MIIA 2OZLA 1TM3E 1ZOOA 3LVBA 1P4AA 4F93B 4B3MB 3RV4A 3NDBB 5TS3A 2CF6A 2J41A 4OK5A 5E1OA 6NULA 3OURA 3TIVA 1OLSA 3I01M 4N7RA 3FWYA 1EQUA 2GAOA 4JBNA 4E5KA 4GP6A 1P0IA 3T5DA 5KWEA 2ECKA 4ZODA 4EMTA 5HUJA 5JD5A 5JO0A 1XTZA 2ISCA 3AUJB 1PO7A 5HXAA 1Z4JA 4IY1A 5KQRA 4NV0A 4LDNA 4AS3A 2IYXA 1HYBA 4MUFA 4AN0A 3OCWA 5M7EA 1RKVA 2C2BA 1D4FA 2OV8A 4JHLA 4TXNA 1NI5A 1JQAA 5IVDA 4AG6A 4YHHB 4XXHA 2XE4A 3DVQX 4EKIA 3SP1A 4Y9SA 2XWBF 4TS3A 4BWVA 2WVJA 3RI3A 4CKCB 4QO7A 1PSZA 4HNHA 2GCOA 1PFQA 4RZ2A 1E58A 1S2LA 3MILA 1UP6A 3TNYA 1S1CA 4IQ0A 5F7XA 1J99A 1EZZA 4UXJA 1DJPA 2JCXA 4KFUA 2G0TA 2POQX 5K0GA 3N7UA 3A1UA 3MSCA 2RSLA 4ZIRA 3IPRA 5HILA 4ZARA 4AMBA 3RS0A 3VJKA 1GG8A 1ZEJA 3OJWA 4FHCA 4L6AA 3CPEA 1XLUA 3MTAA 4EHNA 5K6RA 1PR6A 3ANSA 4B5KA 1KZGB 1B26A 2GR9A 2RHTA 5EEGA 3TR0A 1KC1A 3VI3B 2YRXA 1UJ4A 4FFDA 2MWMA 2ZR0A 5JCJA 4BKQA 2G63A 2EWVA 2I7XA 1XZEA 1JKIA 3MRVA 5I7AA 3UB2A 5A6VA 3TTXA 1FP2A 4Z49A 7GPBA 3WLOA 2GPAA 3C6ZA 1O96A 2G77B 5KSYA 3AOEA 3BG5A 4PS1A 3PWSA 2O06A 1BXGA 1JJVA 3OU6A 4B3FX 3AINA 1PLKA 1KQPA 1R4MB 3A1SA 3I9MA 3N2EA 1JYSA 3W3AA 4PLWA 1NF3A 4B3DA 5JEEA 5JOQA 5KTTA 3KAKA 4X90A 3CRZA 3RD5A 4HS9A 1ICIA 2C8LA 1J7KA 1HF3A 2P2YA 1E6EA 2WLSA 3L9WA 4RGQA 2ZYUX 1X74A 3SIRA 2YCLA 3AQ4A 1BO6A 1YE5A 2BH9A 2O7SA 3EGVA 4R1UA 4WCFB 3VYVA 1KEEA 3I42A 2ORED 4GOKA 3CLKA 1I13A 3LC2O 3CQ9A 4ZO8A 4ID9A 4WA8A 4RJTA 1UWLA 3DGEC 2P1RA 1JH8A 2P9TA 1RLTA 2Q2QA 3L49A 3OZBA 3HWSA 4YRCA 4LZLA 4EF4A 2A9FA 2WWTA 4HRXA 5ESDA 1UFRA 3Q7QA 4LDJA 2WWYA 1RCFA 3KB8A 1PWYE 1U28A 4CF3A 1WX1A 1HMPA 1U2GA 1GNQA 2A58A 3G88A 4AK9A 2VNJA 5JAIA 3PWTA 1JMVA 2Z57A 1UJNA 1JLSA 5LVAA 3VPAA 4YP0A 2IGTA 3WLRA 4TV9A 3RVSA 1Q3KA 4D42A 3KEMA 3RS3A 4BQIA 3P97A 3G9TA 4LWZA 4XWOA 1YDMA 5FI5A 4DT1B 1ZD5A 5A05A 4KHPB 1VGQA 3QA3E 5BQPA 3KDAA 5K6AA 1YBFA 3B6EA 5BVGB 3CR7A 2XQJA 1YO6A 1YV9A 2A1UA 2A7QA 1S96A 3E7FA 4DA8A 5G4LA 5JQGF 2G72A 1I5RA 3CLTC 4W1QA 5A4KA 3S5UA 1C9DB 3DB2A 3T9BA 1N8TA 2MOKA 4GUDA 4HTAA 4ITVA 2QXYA 2HSZA 4UU7A 3U4GA 3JAWB 4DIKA 4Q48A 3TZBA 3J7TA 3P4UA 5LC1A 4EJSB 4DC9A 1CE8A 1VHLA 4MDEA 1BDMA 2V7BA 2INGX 3VH3A 1RABA 3CIFA 1QGED 3ZW8A 2MSWA 5JEDA 4P4LA 2M1XA 4YACA 1E2PA 4TSKA 1XHEA 3I45A 1GP2A 3WNZA 2EV9A 3QW2A 4J0DA 3ZDRA 2DMRA 4IV8A 1TVKA 2XB9A 2WABA 2P6RA 5FEMA 3O8QB 5CLJA 3LXUX 4M1TA 4HMPA 1C7ZA 2CHUA 3CW9A 1EYZA 5K8JB 3ZTWA 2DWUA 4IDHA 2XB8A 1SXJB 5DGCA 4PTLA 4JLJA 1KSHA 10MHA 2VRCD 3ABSB 3FZEA 1QR2A 4Q3LA 1N6IA 2EKZA 3N75A 4D8TA 3RRMA 3EUWA 4M9QA 3U5TA 2JZCA 3G0CA 5A5DA 3EY4A 4ZD6A 4EWLA 3K2IA 3O0DA 5HK9A 5IDXA 4RD2A 4IUDS 5FL3A 4O2BA 5C8YB 2J9GA 3GEMA 1CDZA 4JBGA 4Y7DA 4F9GA 2X7JA 1YQWA 1NXPA 1OSNA 1T25A 3OPYI 1QWSA 1NW9B 3EPRA 4P5DA 5GM1A 5LB4A 2PKQP 1O8BA 2GCOB 8AT1A 1DMRA 5K3EA 1WVGA 2B83A 1XZJA 3COWA 1Z25A 1YVEI 1OILA 1SCNE 3FVTA 5D5HA 4PIMA 2WEKA 2OV1A 1ATZA 5JXJA 4YJ2F 3SLRA 4F5ZA 5H3CA 3DE3X 2ECPA 3DTVB 3EIQA 4OQFA 2FN8A 3GT7A 2AN1A 1PFVA 2P7IA 3CRMA 4GXNA 4RL6A 2BSXA 2QZZA 1IWOA 2BDUA 2XCLA 1WA5A 2FSGA 1X1QA 4Q39A 2WICA 5DX1A 5EJAA 3TLJA 2H2WA 5PGMA 1OC2A 3NJRA 3EXEB 3I04A 4FD2A 5KKNB 2CL0X 4RHFA 4P7BA 3F78A 2M32A 1S2IA 1S0UA 2H11A 1QHFA 5LKRA 1RJEA 1KH3A 4M7WA 5SV2A 2F3QA 2BZSA 2VDKB 2Z1MA 1R5BA 2VHTA 5KVSA 2PNJA 4Q47A 4PNHA 5J2UA 4JOCA 5BV7A 4MQ5A 1K9SA 1KVTA 1XQVA 3DL2A 4H1VA 4KMSA 2ZWIA 2CJYA 3MAJA 1XZQA 3WHLA 4GOLD 5GONB 4R2IA 4IFEA 4NZOA 5JYDA 2QAGA 3VSAA 4ZI3A 2NV6A 2HRRA 1R12A 1L1QA 1X94A 3H5AA 4V0MA 2OP0A 3HO6A 1A1SA 3I05A 5TQ0A 2ZT5A 1EU1A 4Z9XA 1WPXA 1TVMA 3ZWAA 1MEOA 2CEKA 2IYVA 2MTBA 2PY6A 3QVGB 5EQJB 4ZCMA 1KJJA 4RH0A 5AVOA 5H1YA 3R3XA 3GDFA 1EM6A 2PRIA 4HDAA 1H05A 1DSSG 3DVSX 2O7QA 5DWVA 2WQ6A 1I2AA 4RK4A 3KSBC 2K2QB 2GBGA 4LZWA 4OIMA 5ICGA 2OWDA 3GJYA 1SB8A 2HRZA 1J5EB 4HPJB 3I2FA 1IXSB 4ZCTA 3SYLA 1X7YA 5FBQB 3M0EA 1ADBA 3KFVA 3PFIA 4LZOA 5CITA 1A7AA 1CR2A 2CNNA 3NIBA 2OQVA 2ZUEA 1CUWA 1E9RA 1XMPA 1A9ZA 4P3YA 3EARA 4DSUA 1Q92A 1E4EB 3ONEA 5KYVA 1UUFA 2OMKA 1JT9A 4PXSA 2XODA 4URVR 4L0QA 2VDPB 1KQOA 2PGLA 2Y1KA 5FTMA 5LLTA 1DWUA 2W48A 3RT1A 4FEAA 3VR6H 5FB3A 3UWMA 2A9VA 1N92A 2A88A 2XZDA 4YV2A 4BEVA 3BMOA 4CF4A 1V16A 5KU1A 1IYZA 1S6YA 3D54D 4HMQA 1ZRHA 2VBIA 3UJDA 4MUNA 1AZSC 3OD5A 3T38A 5K8UA 1THGA 3U7FB 2GM4A 1KPHA 4R9SA 1Q7GA 3ETJA 3CC8A 3F71A 3G9QA 2YIMA 5HTOA 4AP6A 1VQ1A 1JIQA 5B5SA 1CQWA 1TVKB 3ZHTA 2E21A 3O2NA 2D5CA 4W63A 1QGAA 4IF6A 3JALA 1A3CA 3B2EA 4AMGA 1QKIA 5EMLA 2VO1A 3NM6B 4N7JA 5KI6A 3B78A 3O26A 3HVRA 3AW9A 3TQQA 5B3AA 1REQA 3K9WA 4CWAA 4N41A 4OHWA 3EIHA 1DXHA 3Q15C 1Q0PA 1A4RA 1HTBA 2JHPA 1U94A 1NUUA 1PF7E 3D3JA 1QIGA 2OORA 3O2JA 1QGUB 4YX9A 3SHQA 4MZXA 1BEUB 3GLUA 2BFAA 5L6LB 3NUGA 3UN1A 5HIMA 4OLFA 1GPMA 3D1VA 3DG9A 4L0MA 1JNXX 1LPNA 1JR2A 4DYVA 4ABTA 3QELA 4JLOA 3IAAA 4XCVA 3HV2A 4D3FA 3SHWA 3QPUA 3IVRA 1EK2A 4IO1A 3LPCA 3UT0A 4LK3A 3D3QA 4YMGA 4BGDA 2Q5EA 5KO2A 1XOIA 3CR8A 4QGFA 1IQ0A 3GUZA 4BMDA 5ERXA 3WGHA 2UAGA 1PZNA 1LNZA 2D54A 4JA2A 2CNOA 4ESHA 1JHPA 1B6RA 4OHPA 4ZN6A 2HUPA 2DYKA 3R0VA 4P32A 2ETXA 4QTZA 4E5DA 3KQYA 5CLHA 2RIPA 1X3LA 1Q1AA 5FTKA 3BJZA 4JP3A 1BE0A 3OX4A 1IBCA 1AHIA 1XCOA 3GEGA 4HADA 4C7XA 2AUNA 3A4TA 1D2CA 1DBWA 1JQKA 1OAOA 4KXUA 3HUDA 4YXFA 4CLHA 1CR1A 2NW6A 2ZR8A 3RJ5A 4DIEA 2X5KO 1RLIA 5EWMA 4IH4A 5IAAA 3N8GA 3TLZA 1MX3A 3PF9A 4V38A 1BXRA 4Y1FA 1WU7A 3LY7A 3P9XA 1JJBA 1NXVA 1RRGA 3PKZA 3MMNA 1WRBA 3ECAA 3IQEA 4N40A 3RT9A 3SDBA 4AJIA 1KU6A 3PDUA 3SICE 5K6TA 4JLNA 1ODIA 2QAGB 5K0BA 1FNSA 1N5RA 2C4MA 4MWDA 1KYYA 5IDQA 1XIVA 1Z6PA 821PA 2HSJA 2R6CA 3CU5A 4P58A 4WADA 3BDVA 3F7MA 3TQCA 4D4IA 1OGJA 3TB6A 3NLLA 4BMCA 5FWNA 1AGYA 4KN6A 3A4NA 4Q9HA 2FF7A 1GQFA 2AGVA 4YRNA 2IT1A 3H0KA 4DA4A 3W4JA 5CCXA 4J90A 1YRHA 4PYMA 1D04A 2EARA 1VKHA 3V3TA 2RHRA 3U6BA 1IE3A 5LDHA 1QU3A 1J49A 4NOJA 4JP2A 4HDQB 1N3LA 1VL8A 3UB3A 4RELA 4Q6BA 2AA3A 3RTEA 1S2DA 2AI1A 4Q1DA 1KE1A 1BU8A 4P1ZA 1P1HA 2GNPA 1OR8A 1EXVA 1OZHA 1TK9A 3COPA 3CY6A 3CUYA 3ZNNA 3SM9A 1LWNA 2YV2A 4MCJA 1F5SA 1DEHA 1XO1A 1Z5NA 4JB3A 2OHIA 1A8UA 1DOAA 3HHPA 4CM9D 3QF4A 3ECCA 4BZXA 3WGJA 2NIPA 4Q0MA 3BMQA 2IC5A 3QX8A 2BV3A 4HN2A 3TTUA 4P98A 1UZNA 5JSZA 5ILQA 4LJ7A 5JWHA 4AO7A 3T5GA 1ESNA 2B30A 3VFDA 1TIBA 3E2IA 1E60A 3T7DA 3OQOA 2A33A 2E4ZA 4JODA 3SEZA 3KV3O 4LGCA 3PEYA 1YH3A 2C8JA 5FI0B 1HMYA 1RJWA 3GLGE 4F4IA 4TZ0A 5HZHA 3FTPA 2G6TA 3GMIA 3SEQA 3NV7A 3KZOA 2FZGA 2JFOA 5K5EA 3RYCA 4O4JB 5EC8A 4NCHA 1RJDA 1H8HD 3QZUA 3UAOA 1KF0A 3T7RA 4HNQA 4JJ6A 3Q7RA 4UZFA 2PK3A 3CH5A 4HDRA 1E0DA 5K0TA 2QN8A 1IY2A 3AP2A 2PZFA 4HGOA 4B76A 3OG9A 1B74A 2QJRA 4OAOA 3QVJA 3P8ZA 5F1OA 2M9MA 4LYEA 4YJHB 3R76A 2Q5CA 4WBNF 3DXXA 1HKUA 3DAGA 4PQFA 1B93A 4EYOA 1GQ2A 2QN3A 1VGVA 1VECA 3NXKA 4WFKA 4C4YA 3K0AA 2F9FA 4WD3A 4CKWA 5E9WA 4RPKA 3BD7A 4IBOA 3A1CA 4ZALA 5KQGA 2H1FA 5JZ9A 1FY2A 2A9RA 4OGLA 2AJLI 3LKDA 3EQ9A 4GPD1 4HRYA 5KCMA 3MNFA 4GZ3A 1ZG3A 4AY4A 1DADA 2GILA 3NRJA 1NM5C 3LIIA 4CQLA 4YIHA 3HZZA 1QKKA 4N54A 2F17A 1DEAA 3INNA 4AW9A 2TYSB 4ACAA 2WV7A 5KNDD 3ZHQA 3AVXA 1GYPA 5J58A 3HK2A 1FDRA 1CLEA 4AJEA 2R6R1 1YDWA 3V4LA 4UVEA 2X8BA 2ZJ3A 2C2ZA 4KPUB 2BRUA 1UJ2A 1LGYA 1QFXA 5HEKA 3SHOA 5JTTA 5EAIA 2ZKLA 4OAQA 1C5KA 2GF2A 1C9MA 3VAYA 3L7IA 4DUYB 4C06A 1DXOA 1XJWA 1C3OB 2F3RA 7ADHA 5AJTA 4PG7A 1Q14A 4GYWA 5INTA 2C9CA 4OLBA 2AJBA 3PXXA 4MQEB 3GEBA 2IS2A 1PI3A 4UULA 4FWIB 4Q3OA 4MP8A 3KZVA 3T5AA 1DRVA 5AXAA 4ZOEA 1I3KA 3GJZA 4RLQA 5A62A 3JX9A 4PYQA 3BXGA 3HNOA 1AH2A 3VU9B 4YT2A 4CCYA 1WTAA 2F59A 1NC3A 5A9SB 3TG8A 1FFGA 1H1LA 4MR9A 4CUKA 2CSXA 2C7OA 3L8EA 1P31A 4FOPA 2G04A 4L51A 4O6VA 4XGNA 1FIUA 3QIVA 3FBTA 1B16A 1P81A 2O4CA 3PGLA 4C0QC 4C20A 4BPBA 4LQLA 3SC4A 2VTKA 1JR3E 4CMHA 3ZY4A 4DABA 5EYPA 3AX6A 4Q1EA 2ZPAA 2GD6A 3ESRA 2EKBA 2RJOA 4NQRA 2JIQA 4O4HB 3WG9A 1LDNA 4UAUA 3HXQA 1MPXA 2Q2VA 1S9HA 3PCXA 4RQUA 5AMXA 3K70D 4TUYB 3HRIA 3VDMA 2G28A 2UZ1B 2PYIA 3DBRB 5ECYA 1D0IA 4B3SB 4Z4CA 1CEQA 2V6GA 2A7XA 2Q8QA 4N0EA 4NBWA 5EWJB 4HYEA 3QI7A 4PSKA 4ZAFA 2XOKD 2G9VA 5IZCC 5LZ4A 1RC8A 5BY2A 3LZDA 3H5RA 3IKTA 2R8RA 2CXOA 3IUSA 1W9HA 3QE3A 1MG5A 5BVHA 1EUQA 5ALSA 3W6NA 3AEXA 4N5HX 1V5IA 5TEVA 2XGJA 1QYWA 2YHBA 4F3RA 3AZQA 4YPOA 2NVWA 1PQYA 3RS8A 2QYTA 4EG7A 5IF9A 5KX5A 1NW6A 2VZLA 1SEVA 3QEOA 2XCOA 5AK4A 1JEEA 2VYVA 2ZE6A 4BMPB 4DCSA 2HYIC 3OZAA 4C0WA 2J3MA 3K05A 3SC3A 4EBFA 1IVSA 2UDPA 4REQB 1YJQA 2EEPA 4Y0VA 1U3UA 2MSKA 2HW8A 3WC4A 2NV0A 4RGVA 1ZSNA 1Y7HA 1W25A 4JLPA 2EBWA 1E94E 4KNWA 2Q0XA 4QPNA 3PUZA 3SEFA 2F8SA 1FC0A 1ZMBA 2IP1A 3OX1A 3JQ9A 4XZ3A 5JD6A 4QNMA 2A3RA 5T6MA 5FLEX 1KJYA 4PX2A 4CBVA 4E2WA 3BPSA 3F6RA 2JLCA 3AUSA 3LT2A 4YAFA 3T3HA 4AIRA 4C76A 4OYLA 2BFOA 3WB0A 1EXMA 1PHRA 2K6GA 4ER3A 5B64A 2IHNA 5JSHA 4O3MA 1ML3A 2R6GA 1M2VA 1RQGA 4GQBA 4M9SA 4NBSA 4I4IA 1UOQA 1JDPA 1CP3A 3ADPA 4TT3D 1MV8A 1W49A 2QQ0A 1GNVA 3T1QA 2ORWA 1XK6A 2A0UA 3DLCA 1W34A 3MTQA 1MLDA 4OQPA 3DMNA 5E1MA 2WMOB 3ZE2B 1XTBA 1QCCA 3DTTA 3IE0A 2FA9A 2ZRDA 5GVRA 3CH4B 1F12A 1C30B 4QOSA 2FPOA 2O8CA 3T1OA 4DE5A 4DRXA 5BYKA 5JW6A 2EL9A 3E82A 2WMYA 1B8NA 1QPGA 3PGMA 3M6LA 4WBXC 3PL5A 2GYUA 1L5LA 3NUZA 1E9EA 4Y18A 3UWOA 4GGMX 4IHQA 4G65A 1Y4DE 2GBPA 2OCXA 3QLUA 4S24A 5EKTA 4AX4A 4EFNA 1IEXA 1O6GA 2O50A 2VVTA 3NIDB 2VHWA 3NHBA 1PW5A 3GJSA 4KBYA 4DLAA 3EQ8A 2ERCA 3TW4A 3LK7A 5D2CA 5BQ5A 2CVOA 3T4XA 2A1IA 4ZYVA 1P74A 2IXDA 4I2VA 3WMXA 3TLBA 1JHRA 1H2WA 2M6LA 3E1SA 4CMJA 3SK0A 3HNRA 2HQSA 1B76A 1O6BA 3ZU5A 4ARBA 1KFEB 3IHTA 1G7SA 3KHTA 5IC5A 5BWBA 2GCEA 3DT8A 1JE1A 3DUFA 4QA9A 4L1KA 5AOAA 1XNJA 1YVRA 3AI7A 1CR4A 1PUIA 3S55A 2NO9A 2SNIE 2O2GA 4DJJA 5CFRA 3UF0A 721PA 1BYIA 1XAHA 2EL7A 3GZTB 3NWPA 4WX2B 2ECOA 3O31A 5FA6A 4B82A 9LDBA 3UK0A 3KAJA 1D6NA 5HKKD 2VZ0A 3LVFO 3RBVA 3D4IA 3LOUA 3BHMA 3KD2A 1H1LB 1RMQA 3PDIB 2GQ0A 1C3EA 3WGYA 3INYA 4WLUA 4B80A 5AFSA 3KAPA 1QIEA 1SULA 3JVIA 2ATCA 3HYNA 3FSGD 4IIJA 3RQIA 5BOSA 4IZIA 1AS3A 3GT3A 4K87A 3TQIA 3ZI4A 4R4JA 2JGIA 1N6KA 4PF1A 5EYPB 2JFPA 3IMCA 2WQ7A 2ZJBA 3H2BA 1WQ4A 2I76A 3ENKA 4KVAA 2J3JA 4Q82A 3P9YA 4NJMA 4G4SO 2BGJA 5JY6A 1OTYA 1L7EA 2J4DA 1A9TA 1FNNA 3NTOA 4IXNA 4TV9F 4XJXA 3QM1A 1HQKA 3D7MA 5C1OA 1HFWA 4P31A 3I9NA 2CCKA 2ZUTA 1FSFA 1MT0A 3IQHX 3JV7A 5HIIA 2V1XA 5DTQA 1DX9A 3FCXA 1Z6YA 4YJ3B 2JAQA 4K9KA 3RKUA 4AJ9A 4BDSA 4EA8A 4ZT7A 2VUHB 2PUJA 3L05A 1MTZA 4GX1A 4RK6A 3EDQA 3CH7A 3T7TA 4WT7A 3VR4A 4MKRA 4YI5A 2ZQYA 4RPJA 4AYTA 3EVFA 3MLEA 3IA7A 1C7EA 2PRZA 5ALZA 5FPTA 4QGSA 4KYVA 4PGGA 1AG9A 1DWOA 1UODA 2AMYA 3B1JA 3OQPA 4JEIA 4QGAA 4R8MA 5ALIA 3GZNB 5U4QA 3PNYA 3ADOA 4YH1A 3ZVMA 4TZ6A 4JITA 1NUAA 3ZLVA 1U3DA 5JYBA 2PWAA 3JWJA 1L9KA 1ELOA 1MRNA 1UXGA 3W05A 3B52X 3OOEA 1V4NA 3I0NA 1T2CA 2O2JA 4A1FA 4EJ2A 2B1RA 5E3JA 2QHXA 2NQTA 1V7QA 3RU3A 1SD1A 3W5JA 2VPPA 2ASEA 2ACVA 3D7LA 1VSUA 4QVIA 3I72A 1DG9A 1OA0A 3BXOA 3Q88A 4X1YA 4XFDA 5GM2A 5C31A 5IYZA 2QZJA 4Y8VA 3QUQA 3FLEA 3SHFA 3MMPA 3TFQA 5KBYA 3NIFB 1U3CA 3O74A 3WBJA 3G7SA 2RB4A 5M3BA 1BOFA 2G71A 4Y6PA 1KJIA 1E4YA 2QTHA 4QOFA 4WHMA 3S8EA 1JAZA 1T35A 3R8FA 2YASA 2JJ1D 3GCXA 3ADDA 4GKVA 1O77A 1E2KA 1AKMA 2IYAA 3BRWD 4B17A 3GN1A 2VH1A 2AEMA 4BFUA 1NZFA 1NRIA 1VLJA 2REQA 4IMJB 4J2TA 3M3DA 4CN8A 4NXMB 5B3KA 3L8HA 4Q3BA 2E9SA 3CEHA 3FSRA 4KXWA 1DFGA 5HM8A 2FDCA 5AXDA 3LO8A 1OCEA 1PFUA 1XRNA 3M34A 3RWBA 3K4HA 4IOKA 2ZB4A 3NTQA 3KSUA 4CR8A 4D79A 3IOYA 4LXXA 3K0CC 4E4RA 5E6RB 3EXHA 1HOXA 2W0MA 2H16A 1EK1A 3EDCA 4AYWA 4BE7B 2HOQA 3E3AA 2FX3A 2VJCA 3L84A 1F0NA 1YFJA 4ZT6A 3V4SA 2PDAA 1XQ6A 1T36B 1X2BA 2GETA 1U1CA 2QE7D 1NRXA 3V42A 2BSAA 4QNRA 4BFLA 2YV4A 4YMUA 4KZKA 3A9RA 1ADJA 1P0MA 2WAXA 3MWEA 1R50A 3A4LA 3AGPA 1KBOA 5J2UF 3F9CA 2C99A 3GDOA 3PX3A 1XPUA 1LQTA 1JS1X 5H70A 1HTTA 1W7AA 2IZZA 4YO8A 3MJSA 1WULS 2D4HA 3E9QA 4EO7A 2O3SA 1WEKA 4C7BA 3D4NA 5IBRA 4RCYA 1K2VN 1X9IA 5ALGA 1VPDA 1PKXA 3MTEA 1F7VA 5CFNA 4L9RA 2ZS7A 2I6TA 2YIDA 1W5EA 3UY4A 3JYHA 4DBLE 1KIFA 2WJ3A 5A4IS 3QOFA 1A9PA 4MPPA 4PYNA 4UAVA 3O91A 4XARA 1IMOA 2YZ2A 4IHKA 3OWOA 3STWA 2OBXA 5B37A 4Q93A 2YNMD 1SCQA 4GRIA 1E2MA 5EMHA 1DC6A 2WP0A 3C8HA 5F3RA 3I2GA 2G8LA 3QEMA 1KE2A 2PYDA 3EXAA 1NYQA 3A6JA 1IZ8A 2CYCA 3H11B 4A6DA 4E1BA 1T2FA 5CR9A 2TMYA 4BC1A 1EMDA 2QZ9A 4P81A 5B57C 4NY1A 3MCUA 5JAQA 4RTLA 1WEHA 5DTMA 1Q3HA 3Q5EA 1EFAA 1RACA 4G0OA 2O54A 1TLLA 3BWBA 3FMVA 3I9JA 1DHTA 4IGKA 5D51S 5EIBC 3ZHCA 4XVCA 3HCCA 4IIFA 3FFBA 1A71A 3QUTA 1AMOA 1FP7A 1VFNA 5FWXB 4V0LA 3R4CA 4HKTA 1U65A 3N2KA 4RVNA 3R7NA 4HUQB 2C5HA 1CBUA 3DDNA 4DLVA 1RYHA 2ASVA 3LWZA 4TLBA 4ATNA 4DCCA 1B42A 2PMWB 3Q6MA 4JMPA 2EBFX 1KHHA 5HKBA 1QZZA 3DEKA 4KC0A 2FSSA 1IPFA 1U1GA 2KWIA 3PD7A 1M0EA 3VKHA 3VVLA 3FCEA 5JCXA 4DLKA 1U4SA 4NG4A 1Y5NA 3LWDA 1JDSA 4ZVTA 5C51B 4I8DA 3KPWA 3BTVA 2AMFA 1MHTA 5AM1A 4IDGA 2ATVA 5AHWA 1JLKA 1PL6A 2ZYAA 1EIZA 1LX7A 3NHUA 5T6BA 2EG5A 4LPSA 3DL4A 2VP9A 5TEWA 5IFKA 4V1CB 2QX8A 2LTAA 1TCAA 3FHCB 3QJGA 5FT9A 2VP6A 3MMZA 4XKJA 4OH1A 1GGJA 3BRSA 1JBKA 4GOOD 3S2YA 2JLZA 3ZGLA 1ZXXA 2BC9A 4F5DA 1V9CA 1VPVA 2IHTA 5ULLA 1D0SA 4BKOA 5IYZB 4P0TA 1O0CA 4AP5A 2O20A 2BZGA 3ND8A 1RZRD 4UTXA 3ZQJA 1LDYA 2TMKA 2VF8A 5DLPA 3BZBA 4IUCS 4DBVO 2V3VA 1KAGA 4L8WB 1NGSA 4XR9A 3SQOA 5KZMB 2V59A 4ZVRA 2Y1LA 3H04A 1P0CA 3SE7A 1W30A 4L4YA 3DMFA 5T57A 3U9TA 3PPYA 3LLUA 3LBHA 1NAIA 5LZ2A 4WDRA 1C9EA 1H1DA 3NHYA 1Y6FA 5F9FA 1FNMA 3B5IA 4QUDA 3V4RA 1FW8A 2AOVA 4MOWA 2AZXA 1N7IA 3VHQA 1QTIA 1WUIS 2J0UA 3U3OA 3HWX1 1DO8A 1FNBA 4EKGA 1Z88A 1EVZA 1ZAYA 4HLDA 4PRZA 2L0XA 4NLLA 3PPVA 5H9VA 1TM2A 3PWZA 2OENG 1IM8A 1Z35A 4BNUA 1ACMA 1VKRA 1P80A 5E1BA 3ZHRA 5DW0A 1P6QA 4D82A 3RVRA 3HA7A 4JR1A 4MWEA 1WD7A 3NBXX 3QEKA 4G36A 2VWGA 1Y1SA 4OYRA 3TYXA 2QN2A 1VL5A 2VK2A 2AXQA 1K3UB 1H85A 2PS0A 1RXVA 4JJZA 3CB4A 2PX0A 4KYTA 1IN5A 1A5ZA 2X58A 1EUYA 1Q7EA 2DC1A 3DZCA 4Q3KA 3RARA 3TIIA 2V0GA 2O5RA 2BUCA 4I14A 2GZSA 2LWIA 4CMGA 1GZ7A 4A8JA 4P5EA 3KOMA 5JASA 4KAAA 5L53A 3FZGA 1XCLA 2Q1UA 1VBNA 2G1JA 2CN1A 1BOOA 1D2NA 2DUNA 1R10A 5T3UA 1W35A 1Y0BA 2P68A 1YQGA 2IDJA 4ER5A 2R4UA 1K0UA 3DA8A 2AX4A 4M8NE 5REQB 4A26A 5LKAA 1P9WA 3QBEA 4GRAA 5DI3A 4B6PA 5JDIC 1X7XA 1NVFA 1YMQA 1Z6QA 3W04A 1FP1D 4UHCA 1UK6A 4DNFA 3OHSX 3GP8A 4HAXA 1Q21A 1PSWA 4PXYA 1EGMB 1YDEA 3ZU2A 1H6DA 1II8A 4BP8A 2LXNA 1OH6A 5K3CA 3KOYA 2OOKA 4BX2A 3PUWA 1A76A 1GCOA 4HQFA 1YBHA 1GUDA 4FEGA 4DIUA 4Y7CA 2VHVA 3UZUA 4ZCPA 1OXVA 3QYJA 2PFKA 2PT9A 4EG0A 4MQLA 3EGWA 4RVGA 4DIBA 4F2GA 1C1HA 3BGDA 3I3OA 2AJTA 1YS9A 1J6UA 2CKDA 4IOMA 1ZK0A 2I2CA 4PYKA 3KL4A 4CLXA 5JI2E 5LUAA 2ZTLA 1OH5A 1IZ9A 1YK1A 2H9AA 3Q3EA 4G0WA 3KB1A 2X2FA 1C3JA 1R18A 2J33A 6PFKA 4LJ4A 2H1LA 4IICA 5E9JA 4KSCA 3BQMB 2PAFA 2WYWA 4ND5A 3QXSA 4LMAA 3S29A 4XIJA 1IK6A 3B3AA 4BNKA 1VXOA 1E6KA 2KSQA 3MINB 4X44A 2F3UA 1LDEA 1A7UA 4Z6KA 1PUXA 1ZGCA 2P9JA 2HIMA 1R0ZA 2VJAA 2AIRA 1IHDA 3GRRA 4EPVA 5HM6A 1U7TA 1L7RA 3RFTA 5IMSA 1O6FA 1FQWA 3K0KA 2IV3A 2GCNA 2DPGA 2MSNA 3R2JA 5I3CA 3U26A 4ZGBA 4HEA6 2HXSA 1C7JA 3QKSA 4F12A 3GUYA 4WCDA 1P77A 2FG5A 2IEZA 3WGOA 5FL7D 4HPWA 3ENWA 4U2FA 3TZ6A 5DYTA 2XZPA 3E81A 4PLFA 3RVNA 4D74A 2M2IA 1IRIA 4EA9A 1A98A 3G17A 3LFHA 5K4HA 2JJYA 3L8CA 3UENA 4C1NA 2DSNA 1BEZA 1Z2CA 2WILA 2X23A 4GR9A 1RMYA 3NWEA 4KV7A 4MUEA 4O2LA 3RS7A 4OBBA 3JY6A 2CJWA 1L6IA 4EFLA 3HM2A 4NS1A 4FYYA 2HBZA 5DSTA 4IHAA 1VBKA 4OQXA 3UJNA 1ORTA 2HLPA 4MJXA 4ZGGA 5ICFA 4JBWA 3Q0EA 4MB0A 3I30X 3FCUB 1PS9A 3KYBA 3L4BA 3I34X 4A5SA 2XMZA 4GMXA 4KK4A 3VMFA 4A7PA 4US0R 3AHFA 4HQ6A 4IDPA 1Z2EA 3K2QA 2JJ8A 3FM9A 4IVNA 3T9DA 3TZKA 3UW3A 3ZWBA 4MK4A 3HUEA 4KLAA 3WSWA 2IW1A 1DLIA 4WXMA 3SJZA 3GVPA 3H2JA 5LMCA 3MQ4A 1RWMA 1D07A 4TVBA 1NN0A 2OLKA 2V74B 3B9PA 3D2CA 3A2KA 4DIOA 1QVRA 1Q1NA 1TO1E 2DETA 5CDSA 2JI8A 1M6HA 3FFWA 2QVLA 1X7GA 3LM8A 5A06A 1E1CB 1FU4A 3NONA 4URZR 3FCYA 1NQXA 2FV8A 1K88A 3JZAA 2ORYA 4C5AA 3TTYA 4MUMA 1XWIA 2O4UX 2VYCA 4IWYA 1L7NA 1ZHFA 2B35A 2BFDA 2MR5A 3LLSA 4OQZA 2C4WA 4PHGA 4PHCA 2H2HA 4Y2SA 2J09A 3C1UA 3H3XA 5JS8A 1N3BA 5KHLB 3RVOA 2XRFA 2O0MA 4KHZA 4EM6A 5HQ3B 4QUHA 3IAM1 3WLSA 4JI0B 1W36B 2W0SA 2WFLB 1B6TA 1CJVC 5GY7A 1M67A 1WCXA 4A6PA 4W4TA 3GEHA 5HIAA 4IDAA 1JDBB 2P79A 4XD7D 4E07A 4N82A 3THWB 3ELUA 3ORSA 1CU1A 1GU0A 4NXNB 2MINA 2OSVA 3PFWO 3V97A 4DIMA 3DPIA 1XHFA 3PPXA 3FPSA 4KVFA 2QTNA 4XRRA 4E21A 2GVNA 1J1IA 4I1YA 3D2AA 3LDFA 1PK8A 2QRQA 1Y5MA 1JAIA 2J0VA 4C78A 2Q5FA 2WJJA 1O3YA 5T64A 3UUFA 1GPJA 1XNRB 2BM0A 2PKXA 5C5IA 2ODTX 2IP4A 2FLWA 5IT5A 1IMJA 3K1YA 4DR4B 1Q83A 2QT9A 3FR8A 1N2HA 1R5JA 1MABA 2BY4A 5SY6A 2AI2A 2Y0BA 4BQFA 2RJNA 4LXQA 4WEQA 2CNKA 2ZRLA 4CW7A 4RY0A 4E5PA 2AZ4A 5A2QA 5DKFA 3HDVA 1OD6A 4IG9A 2HF7A 4AYXA 2FU5C 3ELDA 4M1ZA 3BWCA 1GPNA 2F00A 2F3SA 4UZSA 1NX9A 2YHAA 2ODQA 3F3SA 1K8XB 4Y2RA 3R7WA 2YWCA 2ZVPX 5KWIA 3DMTA 3K9QO 5KX5F 2XF2A 4CF6A 2FZLA 1RWOA 1ZRSA 3NHWA 4DZTA 3E3OA 3H5VA 1E96A 2PUWA 2R00A 1BG6A 4G8DA 4OHRA 3BD9A 2W5UA 4NCBA 3RS5A 1W4AA 4X1IB 4DTCA 4ETMA 3AF4A 1ZM7A 1DLJA 4IOLA 3FYTA 5H4HA 2Q9CA 3G23A 2HK8A 3UWPA 4F6LA 1NMSA 5ITWA 3EPJA 1YOVB 4RDCA 4ITUA 1JPVA 5A3VA 3T4EA 1T26A 2FWBA 2ONCA 5FF9A 1Z28A 2AF3C 2Q28A 1FQJA 2HLDD 1EX1A 3DFIA 3C87A 3LY9A 3VC2A 3ZJ4A 5K0SA 2VKQA 3C6MA 4WCFC 4XH9B 2YYSA 3AFOA 1U4OA 2XUDA 3GPDG 1J00A 2YYZA 4KDRA 4FB5A 1S2OA 1AV7A 1F14A 4CEIA 3AMVA 2J6CA 5BWMA 4MEAA 2SECE 2IZ0A 3IXQA 3N0WA 2OAP1 3ZLBA 3H4MA 3K1TA 4ZO9A 4X20A 3L4KA 3LT0A 1ZRNA 2X15A 3A2LA 3F4BA 1VLVA 4D0GA 4PG8A 1T5BA 2NZWA 2CSUA 2VDQB 3WLIA 3C3WA 4EHKA 3JXEA 2QLTA 4GVPA 3N0XA 1HFEL 2ID4A 1P7YA 1X80A 4GPBA 1XZAA 3GCWA 3L5OA 5EFZA 1O9GA 2RAUA 4BCCA 3STYA 2JJMA 2HSGA 4CM8A 1OXXK 5IKEA 1VCHA 3AHJA 3G9XA 4K05A 2WJHA 3TUIC 3GLTA 2ZEJA 1P2BA 1Z56C 3A4MA 3CZ4A 3F96A 4HDKA 4P7GA 4CQMB 2Q3JA 3X2SA 5EZSA 4BMSA 2JLQA 3N87A 3OIDA 4IQ8A 5JWOA 4RJKA 4HF7A 4X9XA 1H23A 4RMJA 4BGVA 5AJZA 4LF5B 1RTTA 2G5GX 1JU9A 1QAOA 4JFRA 4JLUA 1YDHA 2NQ2C 2W6CX 1N36B 4EJSC 1QUEA 4KQKA 3GLSA 3S4YA 3PPWA 1VI5A 2OK7A 5CM8B 4C3VA 3TUZC 2MU1A 2QSUA 3PU6A 5FWYB 3IAS1 2XDWA 1O95D 3HDJA 2DUMA 4N3BA 2VEDA 4DV6B 1SUCA 3IPCA 521PA 4E5VA 5DNEA 4KOAA 1S2MA 3BXZA 3H2ZA 5F33A 1U8ZA 2GESA 2PM8A 1AB6A 5K09A 2IHZA 2FUNB 1NJGA 1WV1A 1G55A 1HE5A 2QN9A 1BD4A 1U1DA 3I92A 4BNDB 2IVFA 1H2HA 2H2DA 4JNKA 3ZE0B 1BH6A 1YDGA 4OJQA 3ZWPA 3F5SA 4KRXA 2FWIA 4EJMA 5JZVA 1LSUA 3PG5A 2MDTA 2WP8J 2Z4RA 1U6IA 3N1UA 2QROA 5FA8A 1ENPA 3FVQA 1EJ6A 1W4CA 2QI9F 4UPDA 4D6YA 1OHHA 3MJRA 1E6MA 4DC1A 5IG2A 5G1PA 2AFIE 1W19A 1W2WB 4OREX 4TTIA 3O4VA 3W1EA 1GCUA 4CIDA 4EAAA 3L1KA 2WSSD 1CQIA 2XTZA 3PQCA 4IIJF 3KPJA 4KQCA 2BDEA 2EX0A 4EGFA 4PZAA 1VLZA 5CVUA 3A9VA 3H97A 1N77A 4PZ9A 2B2CA 1U0TA 5L45A 2F4VB 3AVTA 3IUEA 1F1BA 3EIXA 2NO4A 2PZMA 4QFCA 4WZAA 4GPZA 1CS0B 3F7NA 1QLHA 1UBSB 1T5OA 3GZJA 3ZUGA 3UJBA 1D2GA 2VI5A 3D8SA 5KIAA 1TA4A 2OILA 3A14A 2ODNA 4JFAA 3OTQA 1BJTA 3S27A 1A50B 4LW8A 3W8DA 4BJ5A 1OTXA 1Z9BA 4D8YA 5KPJA 2X4LA 2RGCA 4DV3B 3QITA 5IRCD 3BTOA 1HC7A 3UXMA 4OQ4A 3BIOA 3V2HA 1LVUA 4A6EA 3IOMA 1GR0A 2CVPA 4UEQA 4WKNA 5GOTA 5IHXA 3C5VA 1M83A 2G1AA 3TDKA 3U4QB 3SS7X 3SYTA 1Z17A 2EYQA 2XMDA 3U7QB 3AF2A 4DLRA 2ILVA 4QBKA 1G60A 2WJZB 2I3BA 2ZGVA 3AOEC 2OXIA 1BDIA 3M82A 4B6EA 3BB4A 1SU7A 3Q3VA 1PBNA 3G2LA 4W7SA 2FEWB 3R5KA 4PAMA 2EJBA 3EUEA 5GGYA 2YICA 3NR2A 3P0EA 3TL2A 2HHJA 3VR5A 5HIJA 7MDHA 1JFFA 1TMGE 2DZDA 2CFRA 5JROA 4K9RA 3QUAA 1YU9A 4X1KA 5CDUA 1ODFA 3FWPA 3BE5A 1HE3A 4MMXB 1ZO8A 3IB3A 3KIPA 1UOOA 2ZWOA 4WZZA 2WTUA 3HLTA 1ST2A 1ZOPA 3RFFA 2BEWB 3KT6A 2NUPA 3O2QB 2HA2A 2VOEA 4GYYA 3AR9A 4MCHA 3TLEA 2BM1A 1NOIA 3QBDA 4WJZA 4YRKA 4IILA 1JN0A 4QOGA 5BSFA 2ALJA 4U7GA 4RCVA 2GVDC 3PUYA 4I7EA 4X94A 1EH5A 2ZYVX 4P86A 3KEOA 1VBFA 3V7UA 2Q6OA 1JJ7A 2XE8A 4ZAZA 5IYZF 3WI7A 4URYR 1U28C 1J0XO 1U2GC 3EZNA 1UBOS 4DJEC 3A04A 1E7WA 3ILHA 3L41A 3OQVA 1T2DA 3T7SA 1A0OA 2PBRA 1UKBA 1WTCA 3MZ0A 1NV8A 2R1VB 4LI3X 4RD4A 2G1KA 3CJQA 1W5FA 2BTQB 1ONBA 2VTDA 3CA8A 3ZE9A 2GAAA 2ACWA 2DFDA 4A6XA 1U04A 4MUKA 1CUVA 2QG4A 3QEAZ 4CL2A 3GQBB 3PUHA 5K6AC 3CWCA 3EZLA 4G63A 4IJ5A 4UDXX 8GPBA 3IJPA 2C2OA 4YXWD 3EIOA 2JAUA 3OUTA 4AVYA 4P0QB 2AFHE 4UEJA 3EZXA 3ZCVA 2BEVA 2VDWA 2EKQA 3IUMA 2IYQA 3NYQA 5DHQA 5ARDA 1F9AA 3PKIA 1AMNA 4KQFA 1Q6ZA 1H5QA 4Q24A 1F51E 4ZJZA 5IPFA 1ORHA 4JU9A 1XHLA 4ZT4A 4MCAA 5EP2A 1CX9B 1YHZA 1ZJ4A 4MIKA 3F6PA 3ZHSA 2ZI3A 4JZYA 4IAOA 4IIUA 2Q1YA 2Y3IA 1R00A 1J5PA 2G08A 3ABRB 2OV4A 1DHRA 1ZGZA 2I2WA 3N28A 4H3KB 4PSVA 4YONB 3K6SB 2VCHA 3ESQA 4RLSA 3DBLB 1HUQA 1XZHA 2HRDA 3D2BA 3G5MA 3OI7A 3X1WA 1U1IA 4BO5A 4PN7A 4ZZ3A 3OEHD 2F8TA 3P45A 1F0KA 1ZN9A 2HBRA 3L8DA 5DI9A 3O1JC 4UFPA 2I3DA 3C5HA 4D5GA 4B3CA 4NCIA 4GVXA 421PA 3ANMA 4ZVKA 1JEQB 4Q19A 2DSTA 4BV8A 3UPUA 2I29A 1S3SA 4D9NA 2BFPA 4JBYA 1PWXA 3RRZA 1RQ7A 1C4KA 5DNUA 3ISJA 2X8WA 1Y8CA 2OD2A 1ISJA 4W82A 1ZMTA 3OCCA 4KI7A 4NZNA 1UQRA 3RUCA 4HQNA 4DCNA 2V7WA 3OBBA 3T15A 2Z2KA 5F23A 2TECE 3GA0A 2P75A 3K6JA 1ECLA 5FJJA 5CG1A 2RGNA 2YBEA 3H1EA 3BSFA 3G0BA 1ABBA 4MAAA 1ODKA 3ISTA 1FRVA 3FOEC 3LPDA 4BGUA 5JS2A 5AW5A 1JJFA 2PUVA 1QX3A 5CA1B 3T7IA 4BO2A 1AOXA 3UPDA 2IYEA 1WCWA 1U8FO 3BYZA 1XQ9A 2Q2OA 1I5OA 2FEKA 3A1TA 2ZBRA 4W9NA 4KN8A 1NVBA 4XOIA 4EX7A 4YAGA 4L3VA 5EPEA 2I6SA 2W43A 3SFZA 3FFAA 1GXSA 3GGCA 1A5SB 2QXTA 5TJ9A 5BSVA 1IXKA 1ZGAA 1P5FA 2HMTA 5EJ7A 5ITSA 4KRGA 3UHOA 2RGUA 2XH8A 4XAQA 4KDCA 1C81A 3DD1A 5CH5A 4PX9A 5CA0A 5HKAA 4DADA 2VT6A 1XD2B 1U5AA 3EEIA 4U7FA 3K0SA 4XYBA 4ETIA 1QHHB 2R8XA 4IJMA 3UWKA 3VGJA 3M70A 2JLRA 1AKWA 2QF7A 1B3BA 1NLYA 1UC8A 2FFRA 2XITA 1BMFA 1ORWA 3DSRA 4J1TC 3Q4GA 1H93A 2D1SA 2JGLA 5EKSA 4KR6A 2AG1A 2R9VA 4Y6QA 4CPDA 1HOTA 1L5QA 4RDIA 1QP0A 4O4IB 1E20A 5TPWB 4BB9A 1G17A 4NPHA 4ZMBA 4TWBA 1J70A 4H1UA 3D8NA 3WGGA 1VZ3A 1DVRA 2R6DA 2GX6A 5B7NA 2Q3HA 2FJ0A 3DT9A 2EP8A 1NP3A 2WWWA 4FQ7A 3IVAA 1SXHA 1NNUA 2W6QA 3V46A 4BVHA 3NNSA 3P2YA 3V4PB 4R0NA 1XD9A 4OPMA 3U9SA 4UBIA 3RJ9A 1SC1A 5KNCA 2QAGC 4UNRA 4XQ9A 4YN3A 2SCUA 4FW9A 2FN4A 3NCHA 1Y1TA 5JJIA 4HRAA 4ZKEA 4DCVA 1YUNA 2IYLD 1G4HA 2P5YA 4FMPA 1U0FA 2FFJA 1U0EA 1K8ZB 2V03A 1A72A 3C70A 3WRYA 5L3QB 2JARA 4IJVA 4U0JA 1TXGA 3SSOA 3MYRA 2FHPA 2ZWMA 5LYYA 1FS5A 2NV2B 1L5MA 2YJ4A 3V55A 3AL0C 5HVNA 2IFTA 2ZJ7A 4H2DA 1JG4A 3BB3A 1DS6A 4ZAWA 1M2FA 2DXIA 6AT1A 3CISA 1V6SA 3OUZA 1WZCA 1VE9A 2AQHA 2JB9A 2UVPA 2PH7A 2A94A 1IJFA 1W88B 2ZSJA 4LYAA 4DPKA 1AD2A 4G41A 5KYXB 4TLEA 2FEMA 1UXHA 3WBFA 6ABPA 3FPHA 5D87A 3HYTA 4B5LA 1MOPA 2JGDA 4J16A 2VPYA 3ELBA 5DNCA 1I3OA 1K7SN 1YBMA 3EWNA 3IAEA 1LFAA 2BGMA 2B25A 1BVUA 2X5JO 1EGQA 1NY5A 1P0PA 5FA5A 1T4MA 1W8IA 4I9GA 4DSTA 1XWWA 4UFNA 5AOBA 1B1AA 1KORA 2VA8A 4WLVA 3SOZA 4DJFC 5EPOA 4DLPA 1XMQB 3ET4A 1SMKA 4LGMA 4Z0NA 1MOQA 4CMIB 1UJ6A 4TSFD 1ZR2A 2HH9A 2XMGA 1T5HX 5FNZA 3TJZA 2C4UA 2Q9AA 4BXOB 4QM6A 3A05A 3ZCRA 4MWBA 4JI2B 4BNMA 2QMUA 5DHFA 5K8IA 3ZX5A 1EWYA 3IXLA 1G21E 3FKSD 4QG7A 1NE7A 4UD2A 2W6ZA 4RIEA 3DQZA 4DILA 2HLHA 4Q1CA 1CRPA 4YQFA 2RHLA 2VTBA 1ZL0A 2XECA 4JLDA 2AXEA 2XUPA 3KSZO 5AVTA 5LQNA 3IO5A 1I4WA 4P2BA 1Z2OX 1P9OA 1UPAA 2MMCA 4JLBA 3U1TA 1K1EA 4G0NA 2E18A 3GOQA 4H3VA 3NWOA 1N2XA 4DN6A 2QB5A 5L3RA 2OORC 1J2UA 2GZRA 1Y8QB 2IHBA 1V5EA 3WGIA 3D81A 2GEVA 4PC7A 3IUYA 2P5UA 2PS3A 1U31A 2GEDA 1BWQA 4OHUA 1JTFA 2SKCA 1G20A 1KARA 2XMRA 4QBHA 2PL5A 2XCSB 3IVXA 3VOTA 2HD4A 5TB5A 2QVCA 3DONA 3BL6A 2HSEA 4FNGA 1LB1B 3JQAD 4MW0A 2R11A 4CLRB 3G89A 3GP5A 4P22A 4L0CA 4BX8A 3EQ6A 3FZQA 2D0IA 3UANA 4GVLA 3NANA 4JS0A 4D4MA 2GPTA 4IGAA 4DHWA 4X5OA 1VMDA 1WQ1R 2V6JA 4BXOA 1FXWA 3AEUA 3ITKA 2ZTVA 3L6DA 3AI2A 4S2EA 4G1BA 3LX4A 2BMEA 3VTAA 3WB9A 1YZHA 4XGKA 3UXHA 1GZUA 2HK7A 1E9VA 3LKVA 1ADCA 4GW3A 1YFZA 3SZ3A 3MIIA 3QOXA 4PY2A 3RUIA 4BE4A 4IKOA 2QQGA 3BUSA 3MCAA 5C8DA 1FLVA 1Z36A 2Q6IA 4L8YA 1XTPA 2ZSKA 4L74A 2I9PA 4DQLA 2XAUA 3PUJA 1AQYA 3MXOA 3WDKA 1OAOC 3WISA 3CEJA 1ZICA 3EDOA 4KE9A 1N0WA 1UIRA 3ZW9A 2CWWA 3T0GA 3GRAA 1XCPA 2PRKA 3EA0A 3EEQA 3RUDA 4EQ6B 2YFYA 1LSJA 1C2TA 4HNRA 1RS0A 3ZX4A 2CUTA 2F1KA 1QH9A 3GU3A 4HAZA 3B1XA 4F72A 4PLCA 2A9QA 1SQ5A 2VQSA 4K6FA 4MVXA 3U3RA 2KX7A 1HT1E 3ZIAD 4CR6A 2DBYA 5B30A 3DEFA 3BCSA 3T1NA 1CJCA 1C1YA 2WZBA 2SCUB 4FYIA 4UVHA 3RC1A 4F4UA 4RTRA 1JTVA 2BF7A 2QG6A 3ZY2A 4RM2A 4Y6GB 1QAMA 4RAQA 3HI6A 2OB1A 2MYUA 1WDMA 3IT3A 4P4SB 2A5LA 4TL9A 5NULA 2WWVD 4BB6A 4HVLA 3BWVA 4JL8A 1WKCA 4JUDX 1ESCA 5EMJA 2ENUA 3DNFA 2G4LA 3BMNA 4AXBA 3QF7A 3GCDA 1N2CE 4FCCA 1C8KA 5HUHA 2AN3A 1CDOA 4HPXB 4DAOA 2GF9A 4F6CA 4Z4FA 1YVPA 1E1QD 4LOJA 4MA4A 2C20A 4LDZA 3ER8A 3CNQS 4B9EA 3LXRA 2B4RO 3KCNA 4GS5A 4R16A 5LA6B 3RK4A 2D8MA 1P6XA 4EATA 4LZZA 2AK2A 3OLWA 1TK2A 1NXQA 4AWXA 3OQBA 4PAWA 1HSZA 3GLKA 5JLJA 2J85A 5DXJA 3CNNA 2QRZA 5ELMA 5FEUA 4QJBA 1ID1A 1WXDA 4KXLA 4XJSA 4PQEA 2C77A 3DOIA 1VE3A 1YC2A 3RSCA 4XA8A 3CN7A 1OFHA 4DV2B 2AJCA 3B89A 3X44A 2Y99A 4I6GA 4N9QA 2XNJA 4LJYA 2FUEA 5LPNA 1UMCA 1XTRA 5HE9A 4HDOB 3DVAB 3AM1A 2C57A 3ESYA 1I32A 4V2UA 3UW1A 4KR7A 2FPMA 2IEBA 2GRAA 2N75A 1H3EA 1GSAA 1I33A 3KDPA 3O1HB 1LZLA 1ZNZA 1UBFA 3T54A 1YK0A 3ZWNA 3G5AA 4LPKA 2A4KA 5J59A 4A73A 2GUGA 1F6BA 2Z3WA 2RGYA 3H9BA 3TAUA 2ZUSA 4BWYA 4R81A 2I65A 2X5OA 3RRBA 5JRDS 1VE1A 3I61A 4BO7A 1OB5A 3U4HA 2JCBA 3UT5A 3U0VA 3QUCA 4FGKA 4CKBA 3ADCA 1C7IA 2CLHB 3C97A 1Z68A 3RS2A 1VLQA 4QYSA 1G8PA 1R37A 4BX9A 2V7UA 3ED1A 3H6HA 1YS7A 1HGXA 2CXSA 2FSVA 2XBLA 1DTWA 2D74A 4BEJA 4UHKA 4Y98A 3RU7A 1JF8A 5BO5A 3HB4X 5B4UA 3THYA 2FWAA 2HQBA 4YREA 4YAUA 3QIAA 3FNRA 3SNKA 1AUVA 3F4KA 1DAPA 3PC3A 1L9XA 1ICEA 5A4MS 3RVLA 3AWIA 1IUKA 1NR7A 3FLMA 4AZ0A 4CT0A 3JAKB 2P30A 5JNRA 2XT9A 3O9VA 5JT1A 5ILOA 4RFVA 5EWLA 2JD0A 4EX6A 1RAHA 1F8FA 2NWQA 4UNSA 2AR9A 3AP3A 3BILA 4MI3A 5FNVB 4BB0A 3KOXA 2UXBB 1WZUA 2X8AA 4GLBA 1VG0B 1Y6QA 4N47A 1UBHS 4DM7A 4YRTA 2H65A 2AQKA 3AKYA 4MW6A 3KVOA 5I7OA 1BDHA 2CHVA 3SVZA 3BL8A 4LZNA 3ESBA 4WNYA 2XKJE 1ML4A 2BPOA 3TI7A 3G59A 1SVWA 4Q66C 5HSGA 1TAUA 1L1RA 1M2OA 2G1UA 1G98A 2ZJ6A 4XIYA 2BRUC 3KE9A 5TT0A 4ZCRA 1IY0A 1CVLA 3ILYA 4RTKA 4DUZB 1T5SA 4LNUA 2IOFK 4G5OA 5H59A 3HZOA 4LRYA 5ITVA 3GVXA 4RSGA 4NICA 4YQYA 2WUVA 5FX2A 2IOQA 1NONA 2HHAA 4E46A 1U2TA 4C7KA 4UMFA 4AM8A 1JWAB 1ZGHA 2DECA 4J4BA 3GPLA 5DLEA 4C4RA 3SQDA 1Q44A 2YXLA 1PJAA 3DZIA 3PXAA 2QLFA 2QNBA 1DTEA 2HI0A 4YDSA 3T34A 2O8DA 3I6ZA 4UE2A 3SF8B 3TINA 1M1NA 4DCGA 5CB6A 3P9PA 3SYNA 4ZICA 5BQXA 3QBVA 1D2HA 3P0IA 3KALA 4RSRA 2J6BA 4JYCA 1G7RA 4P08A 5CVJA 2B6NA 2W4QA 3HCNA 3LYUA 2PH5A 3GDWA 4Z99A 5C5EA 1V3VA 2IITA 1MAAA 2HBQA 5IVHA 4FZ3A 3GHYA 2W6MA 3LCRA 5JJCA 3D7RA 3AG6A 3FOBA 4ZTZB 1ESZA 4IIBA 1TKAA 2RG7A 3TOVA 3ELYA 1T9BA 2YJTD 4W99A 3KTFA 3IAFA 4GDFA 3VDNB 3GH3A 4U7TB 5EPUA 1YCDA 2JLWA 3IV7A 3U31A 1XBTA 4IDCA 1NURA 2FXVA 4IR7A 2AZMA 2I7TA 1E4VA 3B1FA 4H6WA 4F9EA 4ITRC 4AB1A 4ZC8A 3UOAB 2CYAA 3O93A 1BHJA 2R8EA 3FYCA 2VNIA 4WNIA 3NBQA 4R2XA 4Q9JA 3GRCA 1XGKA 3L93A 4IVQA 5E6UB 5PNTA 5C8ZA 1QRTA 1DJOA 3KZCA 5K45A 3U7RA 1OFUA 3B51X 4MYTA 5KHOC 3GLFE 3GBSA 2X6TA 4LOKA 2ZIFA 3IRVA 4Y9TA 1T3TA 3F3MA 4JIGA 4GE0A 1W2GA 1KPGA 2GZDA 1I6WA 4LKOA 3EFOB 3SMVA 4HUTA 4Q4HA 1NSTA 2YFKA 2ZVJA 3AVPA 5JC1A 2GBIA 4MDFA 3OQJA 1KRXA 2ZRFA 3NBKA 1U0LA 2D5BA 2PZ8A 4XGQA 3KUXA 1XEXA 3KDSE 2RHDA 1JP7A 3F1KA 4X63A 4L57A 2C7RA 3JQ9C 3HEAA 3ETGA 3PC8A 4XRGA 5HE8A 4FYHA 3G79A 3V1NA 1M6VA 1XXLA 3FJOA 4BLRA 4J07A 4GLJA 4JVMA 1PVOA 2ERYA 2Q7XA 3EZ9A 1V11A 5E38A 2GHRA 4ZYLA 1BCSB 2OV6A 1A9OA 2V9ZA 1G5HA 1ONOA 2QSZA 2EW1A 3PNPA 4WN9A 1RBQA 4V02A 4MGZR 5CJ2A 3SYKA 2HV8A 4YRMA 1PFKA 2VZEA 3E3NA 3FTNA 5BWCA 1CR0A 2O5VA 5CAEB 3VKGA 2QTVB 2JAXA 1TX4B 1FUEA 4C3UA 1ZK3A 2C2MA 2QWXA 4BUZA 3QEBZ 3QE9Y 2PU5A 1EFPB 3ER6A 3VNAA 3TBKA 1TM4E 3VNRA 4XM2A 1O6ZA 5ERYA 2RH4A 3OIUA 1BE8A 1RE1A 1YJCA 1HE8B 2P9CA 5I9MA 4G0UA 5C1PA 3BERA 2B8TA 5IF3A 5J3JA 3UC5A 3TLKA 3RAPR 1MC5A 2DAPA 4BFYA 4XGRA 5EWLB 3M49A 1M1ZA 1EHCA 3IEUA 4XQ0A 2XUGA 1V41E 4BU1A 4OHKA 2BGTA 2PX5A 3KWLA 3MWGA 3R5TA 3OJFA 5EHQA 4HWOA 3WGTA 4ARSA 2FZVA 3VNQA 2OVBA 1N0UA 4KCGA 1NQTA 2O3UA 1Z5OA 1K3FA 3A6LA 3ANNA 3BK1A 3QLUC 1UKCA 1UPFA 5TMDA 4OXYA 4A36A 1FRNA 2P90A 1XC7A 1R0WA 3ISVA 4QELA 1BYUA 4A0SA 1JFRA 3EYWA 3OLZA 1E3WB 2LKCA 3IT1A 1IONA 2Z56A 3WWOA 4HXFB 4UCWA 4O4IF 3PC2A 3T4PA 1WMSA 4QARA 4OIFA 5KYWA 3DMDA 2AFHB 2WM2A 3R41A 4RU1A 5CT8A 4TTJA 5FIUA 3HJTA 1LPSA 5TQ2A 4C6TB 4E1VA 2XUFA 5IAEA 2GKOA 2HO4A 4LCEA 4M99A 3H1BA 5EZQA 1S7CA 3LT5A 1FMFA 3RVKA 1R8YA 3U80A 4CL8A 4O5OA 2JGKA 2GHQA 4MYRA 4MS3B 4Z0TA 1TYDE 2V7PA 3DKKA 3SJCA 2LGJA 4I0WB 1T10A 5G53C 1Z5UA 4B4KA 3K1AB 1CYEA 2CLFB 2UZAA 5LBIA 2XGSA 1HI9A 2PLFA 3IQDB 3OP4A 2E1PA 1L3BA 9GPBA 1E1NA 1QQ6A 3C1OA 3F47A 2WY2D 3DJYA 3ZGOA 3CJRA 4JKIA 2XXBA 3AVQA 3L7DA 3UQYS 3EIFA 3EPHA 1A95A 1T1RA 5FPSA 3ED5A 4MWOA 1VKNA 2JKZA 5IKOA 3LWNA 4F8YA 4QREA 1K7EB 3ZY3A