2AB0A

Crystal structure of e. coli protein yajl (thij)
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
195
structure length
195
Chain Sequence
SASALVCLAPGSEETEAVTTIDLLVRGGIKVTTASVASDGNLAITCSRGVKLLADAPLVEVADGEYDVIVLPGGIKGAECFRDSTLLVETVKQFHRSGRIVAAICAAPATVLVPHDIFPIGNMTGFPTLKDKIPAEQWLDKRVVWDARVKLLTSQGPGTAIDFGLKIIDLLVGREKAHEVASQLVMAAGIYNYYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords YajL
publication title The Atomic Resolution Crystal Structure of the YajL (ThiJ) Protein from Escherichia coli: A Close Prokaryotic Homologue of the Parkinsonism-associated Protein DJ-1.
pubmed doi rcsb
source organism Escherichia coli
total genus 71
structure length 195
sequence length 195
chains with identical sequence B
ec nomenclature ec 3.5.1.124: Protein deglycase.
pdb deposition date 2005-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01965 DJ-1_PfpI DJ-1/PfpI family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2ab0A00
1QDLB 5IP5A 1CE8B 4ZDIA 4N0MA 1PV2A 5JZMA 4ENRA 1K9VF 1QVVA 4Y1RB 3GRAA 1KWGA 3D54D 3UOWA 4XLLA 3P9RA 5JZOA 4P35A 4P5PA 4L8WB 4L8YA 3BWEA 4MTCA 4AJ9A 4UOZA 3TTWA 3CZ9A 2W7TA 1FY2A 3BHNA 5LIRA 4UNIA 4Y1EA 3N7TA 5SYAA 3TQIA 1P80A 2ZUVA 1C3OB 1QWSA 2ZUWA 2ZUSA 3TTTA 4QYTA 4ENTA 3SF8B 4OGFA 3P9SA 5K4AA 4LGYA 2VKTA 1T36B 3NOOA 1QVZA 4GUDA 4OIFA 4OQ4A 4E5VA 5SY4A 4B40A 4BFLA 4L7QA 1OX4B 1PDWA 3TTVA 5SY6A 2AD5A 4P36A 2R1TB 4D1YA 4AULA 4ZGGA 1P5FA 3FSEA 1CF9A 1G2IA 4PXYA 3MGKA 2YWBA 1P7YA 3CZAA 3M3PA 3OT1B 4L78A 3R75A 4B5KA 3PQ6A 3NOQA 4UOQA 1CS0B 4B7AA 4OJYA 2OR3A 3EZGA 3UGJA 3P9PA 4ENPA 1JVNA 1I1QB 2GK3A 2RK4A 4Y1FA 3TTUA 3ZJ4A 3UJNA 2A9VA 2R1VB 3B36A 3NOVA 2GHRA 1VHQA 3ZR4B 4E08A 4ENSA 2AB0A 1IZZA 1GGJA 3UK7A 3PQ8A 3NORA 3PQ3A 4ENWA 1OI4A 3L3BA 1Q7RA 4I2NA 3P9QA 1GGFA 2ISSD 4Y1GA 3TTSA 1T3TA 4R7GA 3L4EA 3L18A 3WFZA 4BTEA 2RK6A 3TTYA 1GGKA 4S0ZA 4BIMA 2NV0A 2XF2A 3PQ7A 2ZUUA 4L95C 4B2YA 2V4UA 1P81A 2VPIA 1QVWA 4ZDJA 3CNEA 3F71A 1GGHA 1OY1A 2H2WA 2VDJA 1A9XB 4RKWA 1WL8A 4ENUA 4WXYB 2ZUTA 1I7SB 1PE0A 3CYFA 4B31A 1U9CA 4ENQA 3KKLA 3L7NA 3EWNA 3ZJ5A 2NV2B 2VXOA 1M6VB 1FYEA 2YWJA 1OX6A 4JQSA 2IUFA 4UZSA 3R76A 4UCFA 1PDVA 1N57A 3PQ5A 1ONSA 1GPWB 1QF7A 3EFEA 4GE0A 4K2HA 4Y1RA 3RHTA 4ADSG 1GG9A 1S1MA 3NVAA 4RKYA 4ENVA 3UMMA 1KA9H 1KXJA 1UCFA 3EJ6A 3FIJA 3PQ4A 4HCJA 1KEEB 4I4NA 2LXNA 4OGGA 4MNTA 2VRNA 4QYXA 3R74A 4N12A 2YWCA 3PQ2A 3MIIA 1GGEA 3SF8A 1IZYA 3B3AA 3F5DA 4AUNA 5DFAA 4ZDKA 1VCNA 2R1UA 1VCMA 4I46A 4AUMA 4GE3A 1OX4A 2WJZB 3EN0A 1GPMA 5SY9A 1SOAA 3B38A 1R9GA 1JDBC 1T0BA 1O1YA 4P2GA 2R1TA 3VU3A 3NONA 1IPHA 1KWKA 1P7ZA 3OT1A 1SY7A 1J42A 4L8FA 3ER6A 3TTXA 1C30B 2FEXA 2RK3A 1L9XA 4WINA 5BV2P 2D7JA 4MGHA 4P34A 2ABWA 3CY6A 5E9AA 3SOZA 1VCOA 1I7QB 1BXRB 1OX5A 2R1VA 2YWDA 4LRUA 4OFWA 1Q2UA 4Y0NA 4AUEA
chains in the Genus database with same CATH superfamily
1OYWA 1SZJG 3B2EA 1V8OA 1AZLA 4I14A 4CIXA 4W8HA 2OHXA 3T3NA 2JEYA 1P2GA 1BQEA 4M4SA 1UXIA 2DQYA 3D8NA 2J45A 4OUKX 5LUBA 2H1HA 4G1EB 3FCSB 3VVCA 5KJEA 1QZXA 4RHTA 2PGNA 2DPYA 4TTSA 1XMPA 1JT9A 3L0PA 4IGEA 2YY5A 2O5VA 1DL5A 1SUPA 4IVQA 3X0DA 1RIIA 5IM5A 3OKPA 4UOZA 2E4XA 3W7VA 5LZ4A 4JZYA 2FDCA 3KBOA 3W77A 1U0EA 3CJQA 4B4KA 1IM8A 1G7RA 4ACBA 3K0EA 4JIMA 4LYFA 4ATNA 1IWOA 1F51E 4AZSA 5KNLA 1P91A 3IDZA 4CUJA 3ASZA 4IHJA 3GFSA 4MQFB 2ZYDA 2IIBA 1AQJA 2FMKA 1PJCA 5IC4A 4INJA 4HFMA 1VP3A 2VXYA 2XMRA 5A03A 2R7NA 1JFFB 3CLTC 3TG2A 2OWEA 1G3UA 2LP4Y 2IPNA 5LYYA 1YFKA 3VHRA 2JGDA 2X0RA 2ZBVA 2E1PA 2VJPA 1I3MA 3PNMA 3I2GA 1WMFA 1KI1A 1OZFA 5LD2C 3MVEA 4JKOA 1XD8A 3A6GA 1FPQA 2D3TA 1SD2A 4MRAA 2WHEA 5IT0A 1CUCA 3VOBA 3ZU3A 3DP9A 4QQNA 1Z6PA 2YW2A 4YONB 2O54A 1BDIA 4TVBA 4NAUA 4WXPA 5B1SA 3R6DA 1SVOA 1KVSA 4TKMA 4XKJA 4UUBA 4ZO7A 3V6LA 1PBTA 2H1RA 3GJ5A 4R8LA 4AP6A 2HWXA 2H5JA 2X2FA 3DG9A 4IMJB 1UP6A 2F8LA 3GJQA 1U8FO 3DBLA 4HWSA 4U2EA 4XVRA 5DP1A 1WMDA 3NH9A 1E2LA 2POQX 2Z6VA 3IAXA 4F2GA 4NMXB 4B31A 3FMVA 5DK6A 1D2RA 1KH2A 2RGXA 3PJEA 1H8ED 2W6IA 3LC1O 1BCSB 2CD9A 2ENWA 4I50B 4CMCA 4OI0A 1FYEA 3UMBA 2H4WA 2EKLA 2D54A 3EVDA 3IMEA 2OVBA 3PXCX 3WHPA 5CXUA 5JS7A 3I2KA 1XZDA 2PA3A 1L2TA 4C0XA 1QB8A 2NQ2C 3GJRA 1OWOA 2A4MA 3I32A 3K2IA 3LAWA 1L7RA 4JCOA 2B21A 4F0JA 5ULLA 1T2DA 5IDVA 3OWHA 1F4LA 3B6EA 4J49A 1MHTA 2W4IA 2X6RA 5L3VA 5G1OA 4E21A 3K70D 1S96A 3R3UA 4M7RA 2ZXEA 2J41A 2YDXA 3W2IA 2R0QC 1J0XO 3M0EA 1GVHA 3BZBA 2Z4RA 3N0WA 2PR2A 4GP9A 3HYRA 4JQCA 4OMUA 3Q5DA 4E94A 2W58A 4QOGA 4YQEA 4BV3A 3L01A 2G17A 5JE8A 3WGLA 3BZUA 4GX5A 3UJAA 5CD1A 3JZIA 4TSKA 1AKVA 3JQDA 4E1AA 2VHQA 2GH1A 4Q00A 2IZ6A 3OI7A 3SPXA 4EOGA 4BYGA 1R4NB 2CDCA 4JENA 4RL4A 1AVTA 1BJRE 1TW2A 2HMSA 1VL0A 2B7LA 1QYCA 3NCTA 2VTEA 3M4JA 2I6UA 2QLFA 3BWMA 3U4QA 2EBFX 1A3CA 4OFWA 4B09A 3FF1A 3QEAZ 2QK4A 4TWIA 2BGKA 5ECYA 4KQEA 4BVGA 1X77A 4TTIA 1QV7A 2Q8NA 3TCNA 4JLUA 1OFUX 3KVRA 1LBQA 1RAGA 2C8KA 1FTWA 3DT6A 1AGYA 5LMZA 1EXVA 4DR7B 3LVQE 1QMPA 2AW5A 2JCXA 1P44A 3EIWA 4II3A 4MVJE 4EUNA 1OI2A 2V97A 3ZVMA 4YTEA 4MINA 4RY8A 2O23A 3K5PA 4C22A 1PJZA 2Q1TA 1O6FA 2A5DA 3IHWA 4FFDA 2OXCA 2HEGA 5D7BA 4RETA 5FFMA 1QP4A 1NXPA 1GL3A 3ROXA 1P1KA 1TYBE 1QXSA 2F67A 3OCWA 4KO2S 3DXYA 4KE9A 5AVOA 4E5VA 1UXGA 3TL2A 4YRGA 4YFYA 4QU8A 4AN0A 3JQFA 3UZUA 4Z53A 4HC4A 3DOFA 2IODA 3M6LA 4MYSA 1SB8A 5ALOA 3P9YA 2MSLA 5E3IA 1YR6A 3DVAA 3VO8A 5I3ZA 4A6EA 1ZD8A 3TW6A 1F20A 1NOJA 3QQ5A 2CV1A 1ONOA 1TYEB 2JFHA 4Q1FA 3ZKWA 1IL0A 3N2EA 2YJGA 2GTIA 2FEKA 3KYDB 1REQB 3BGSA 2VZ9A 2ATCA 4H3VA 4Y2YA 2F4NA 3LBFA 2D1SA 3R5TA 5IJWA 3S55A 1XZHA 1W85A 4WVLA 1EDBA 3GJ3A 4JGIA 1YKFA 2BELA 2XUIA 2R8PA 3L3BA 5F5XA 3CVJA 4PX3A 3OMWA 3KT6A 2PL1A 4GGOA 1TIBA 5J1SB 2GYWA 3BFKA 1R9JA 1A27A 4UTRA 4H15A 1OI3A 2NO9A 3PQ7A 3NETA 2OWDA 1RCFA 3TEMA 1OH6A 1VE9A 2C1XA 3FZEA 4DBVO 3IOMA 4FSDA 1ODJA 3QPDA 4X66B 1F06A 1HE1C 1G0NA 1X9IA 2DMRA 2YNMD 3B3JA 3M4NA 4ZGBA 4R2JA 4DHEA 1APBA 4DAOA 3EASA 4RSRA 1G8PA 3PGXA 3IP1A 2CJFA 4WAUA 1XRRA 3RRFA 4EKYA 3D3KA 1QS0B 1VYUA 3ITKA 1DUIA 1X0VA 1RP1A 3L1VA 4DSZA 3GO4A 1G98A 3OQ6A 4CM5A 1CR1A 2B35A 3BX1A 1T2FA 5E6UB 3CONA 4BBZA 1F9EA 1WB9A 3IBTA 4B4UA 2Z9DA 1Z15A 4BAZA 2IK8A 4LZZA 1I4LD 1NUPA 3SI7A 3VNSA 4UMEA 1BXGA 4B4VA 3AP1A 3S2IA 3I3OA 2P2GA 3BKXA 4NXNB 2OV1A 4BWVA 5CHYA 5BMVB 2J3JA 2ZETA 4TS1A 2PXHA 4BU0A 3HCOA 5I8PA 3FKSD 3NDJA 1TU3A 3NLLA 3NYQA 5IUJC 5CH3A 4FZJA 2R7MA 3WGGA 3TG8A 3WR5A 3B9BA 3UENA 4I4LA 3QM1A 4NFSA 1RKXA 3HFJA 1CZRA 2AIRA 4KSCA 5C7OO 4XCQA 5CLQA 4BMPB 4AJIA 5T4HA 4N48A 1JR4A 2QE7A 4HNRA 3ST7A 1GVNB 4YRBA 2JLWA 2FPUA 1LPAB 1N7GA 2AYYA 4FI3C 4WINA 5BV8A 3DXZA 4MP8A 3QA9A 4XWKA 5HX7A 4YO8A 1GT91 1MOQA 1SU4A 2LD4A 4HOYA 3CA8A 3N8GA 3VNVA 2EFJA 1AD2A 2WRZA 2EG9A 3WP1B 3FNGA 3FOBA 3NHSA 5C51B 3TH5A 2VHCA 3AUSA 4YI5A 3AVTA 2G0AA 2F9FA 3VYUB 4UXHA 3ZW8A 1XA4A 3BF7A 4I5DA 3L7AA 1B6RA 1QFZA 4P35A 1EX1A 3WIDA 5BSGA 4I8XA 3F5FA 2PLAA 4Y6PA 1JVBA 1RWPA 3ZY3A 3ECCA 2P65A 3EGDB 3ONVA 3IUEA 4AL4A 2Q2WA 3B20A 3ADOA 3MRVA 4HXYA 4ZZ3A 2EXXA 1P0QA 1UPXA 3CWQA 2D7CA 3AX6A 4AJ4A 5HEKA 3ZV4A 8MHTA 3GG9A 4XSGA 5KJFA 1E5DA 3UWKA 1GQFA 4PYJA 1G9TA 1XA0A 2H2DA 1ZGZA 1SIWA 3OT5A 3OEEA 2OO3A 3Q12A 4FNAA 1HPLA 4QC2A 3RDPA 1PFKA 4ZAYA 2QD1A 3RYIB 1L7MA 5I7UA 1U2DC 1UZAA 4QU9A 1V6AA 3H5NA 1QGUB 1J5XA 2R44A 2GPJA 3BAZA 4JL6A 4YV7A 3ZX4A 1UP4A 4URXR 2AOWA 2WQ6A 4JP8A 1TT7A 4OU5A 3HUFA 1Q0SA 4OVKA 2FSPA 4D3FA 2XA1A 2I4IA 1MO4A 2GKOA 2KX7A 2WM2A 1RHKA 4M9XA 4ALNA 2QVZX 3HXOA 3U1VA 3X2SA 1ZXLA 3E84A 2DY1A 1EBBA 1DMRA 3VR6A 3MJHA 4NFLA 2QAGB 2CHGA 4Y0VA 4M22A 1Z5NA 4HYTA 4C4SA 2F3PA 2WILA 3DYIA 3E5MA 3F2IA 4AJLA 1NIPA 3F3KA 1SKQA 1E6WA 1W1IA 4Q47A 3ZDAA 4DLPA 1RAAA 2E6UX 2FUCA 4NDZA 3LRXA 3PUKA 2FWAA 5JQGF 4ZDJA 3AUJB 1NI5A 1NF9A 3O9VA 2PYIA 3QG5A 3ETDA 4U5QA 3CG0A 1U2QA 2R6FA 1KHTA 1Z6TA 3K3PA 3CT6A 3IAAA 3ZJ5A 1XZNA 3W5DA 2JI8A 1QHFA 1QMGA 4QBHA 4B46A 2OORA 1NKVA 3VPFA 5IJ0A 4RHEA 4RLQA 4TV9A 1OFGA 5LVAA 2FYTA 1GXSA 4B6QA 4AKIA 1L7DA 1K27A 2Y1CA 2Y67A 4B3XA 4ZMRA 2WV7A 3W34A 3P52A 5G40A 3DE4X 1GT6A 3K5IA 2FA9A 2IU4A 3IESA 4EDFA 5JSZA 4JJAA 3JQ7B 4QOJA 3VJKA 3BA6A 2EIXA 5A2GA 3NBFA 4M0MA 5JAHA 1XK7A 4NZYA 3H5AA 2I3DA 5HFNA 4LEIA 2EF0A 3FGPA 1GZ7A 5AVWA 4OK6A 2QYSA 3B3AA 5T8KC 3K7EA 1WEHA 3LLUA 2ZKIA 3CZQA 5H3HA 1FU8A 1SJ9A 1SM4A 4IJWA 3BKWA 3O75A 4XZ3A 1ONBA 1Y8QA 2R6CA 5JDIA 3GEBA 4UAGA 3LTEA 2BV3A 1SZCA 3N87A 3LOPA 3I8SA 4K88A 1U3GA 4KC0A 4P82A 5BYKA 3T9DA 4DUPA 3CR7A 4NCBA 1MPTA 1OIWA 1FFHA 4EHFA 1L9XA 4MB2A 2JJ8A 5SZHB 1GTVA 2BGRA 3SOZA 2MHCA 1YRYE 3C0KA 3H19A 1FUIA 3P9KA 4F2DA 5CFZA 1ICEA 3MOIA 1ULZA 5FWXB 3OCZA 1WA5A 4PAMA 4QO8A 4F9EA 5H3CA 2Q21A 2M2IA 5HW0A 5CA0A 3TIFA 4AC9A 3VPSA 4YCMA 2H8KA 2C5AA 2NNLD 2PA0A 4KMSA 4B8ZA 5JMTA 3FJYA 3L8ZA 3GK3A 2JLYA 4AWBA 5BQXA 1YK0A 3JSXA 4Q12A 2H7XA 1JU9A 2K2QB 1YL7A 1G8HA 3GLTA 2SICE 2WJGA 1H3FA 2IXFA 1NMXA 2XNDD 3IOCA 4RH0A 3WGYA 5K01A 4MRRA 2NU9B 4B3DA 5D01A 3VI4B 1NXQA 4XDZA 2ZUVA 3TMKA 1ZNZA 2VZ0A 1MIOB 3CUEF 1FX0B 3DMGA 5CGQB 3SC4A 1JAXA 5AM2A 2GM4A 2VR1A 2R6AA 2XNHA 4HNAA 1YMVA 3G02A 5JRJA 4JYAB 4R05A 4J43A 1CR4A 1XTRA 2XHZA 5L9AA 2ACEA 3HU5A 4ND8A 4L3WA 4NJEA 5EIOA 2Y76A 2OG1A 3HJCA 3QKIA 4PLPA 4ER3A 1R6TA 1EHCA 2XUZA 3EVNA 3M9WA 4FDMA 3SJUA 3VKFA 4WESB 2POCA 2HJSA 2W6PA 2XQJA 3R7WB 3OZIA 4R2MA 4RYDA 3THWA 3SM3A 2BFEA 2QTHA 5EMNA 2C59A 3L5OA 3RJMA 3CX3A 1ADGA 4Z9FA 4F4FA 3WQBA 4OUDB 1I3OA 3TR5A 4AS3A 3FMOB 3P0JA 4DLAA 1VB5A 4BO9A 1YT5A 2Q99A 4XFKA 1V1MB 5EWLA 4F7DA 3HEBA 5CA1F 5KTNA 2ZWVA 1RPZA 2AJDA 3V6MA 2ECOA 2NO5A 4G36A 4XUGB 1YCGA 4LJ4A 4BP1A 1G7SA 4EGAA 1J2YA 2G6TA 5AKZA 5TQ2A 4MPTA 4BBJA 5IDYA 2Q2NA 4LK3A 4MB0A 3VR2A 3RFVA 3U31A 2XE4A 3LZ6A 2X0FA 2OBBA 2WYUA 3KQUA 4P22A 4BVHA 1O5TA 2WMYA 1WBBA 4OYRA 3BL8A 2OD2A 3OFKA 1LSOA 3QKUA 2I9KA 3ABZA 2AN9A 3LKVA 2P75A 3RGGA 1V8ZA 1XDSA 3NTVA 4DQVA 4JQZA 4JJ7A 1FDUA 1NBEA 2VUHB 2ZRBA 1YE5A 3PYXA 4R51A 3WGQA 4WJLA 4FFNA 2R87A 3O1IC 3H2JA 1J7JA 2OMKA 1ZM7A 4GPD1 5EWJB 2G9UA 1LK7A 5AI8A 5G0SA 4RCVA 5K05A 4YWJA 3L4BC 1HQDA 1P17A 3B82A 1Z6ZA 4GL2A 2C2YA 2FQWA 1ZONA 4MKFA 1KU0A 3ZHUA 2I4LA 5BPHA 5ALGA 2D0DA 3UH1A 2IY7A 3IRVA 2PEYA 3V8EA 3COJA 4G09A 2O3RA 3LT5A 1TGVA 1HC7A 1WHSB 3K1AB 3LUHA 1SXJD 1SD1A 2R1UA 4CG0A 4CG3A 4DJ5X 2CV0A 2GD0A 2BFBA 3EWSA 2XMPA 1BFDA 2A30A 3DXXA 2BR5A 3IUSA 4I8IA 3ZXYA 5IU6A 2BEVA 5JTUA 1WW8A 1WPXA 3KSMA 4FUQA 1N4DA 2O5EA 1DRWA 3RK1A 1PEYA 4GLJA 4CIDA 3BF8A 4YJHB 2PX0A 3DBRA 5BN1A 1Z6QA 4AZ0B 3K0HA 4HRAA 3COPA 1SURA 4KFSA 3HI4A 4RPCA 4H08A 1Z36A 4CKCA 4X9XA 1UBUS 5LM3A 1OAOC 1G5TA 1Y4UA 3BTUA 3GQVA 4CM3A 4JOQA 3CO0S 4OYHA 3I01A 5AOAA 3PFBA 3O31A 4UNNA 1QIEA 2PWYA 1OROA 4YXFA 3INTA 5NLLA 3KB6A 3T3PB 4UARA 1TLLA 2BMDA 5A4KA 5C1PA 4OOFA 2VHXA 3SLRA 5A4IS 4H77A 4IGFA 1CZOA 4W6QA 5EZ6B 3H1PA 3T9CA 4DANA 2HA2A 2IHNA 3MWJA 5TQVA 5H1YA 1ULTA 2Y77A 4U7HA 1U0LA 5K3DA 4CCYB 1TMKA 4NBUA 2GXAA 4TTJA 2HI0A 2BFDA 4GMXA 1MOSA 3MGBA 2AD5A 5DP2A 4BMNA 3EUFA 1JHPA 3VPDA 4AJHA 1HFWA 1DXYA 3IMCA 3IBCA 2GBGA 4AVYA 1KEPA 3KVNA 2B1GA 4MUNA 1Y4SA 2A35A 5M3BA 1BX3A 1RM0A 2ILTA 2GBIA 4IMRA 4BVLA 5L3SA 1FUKA 821PA 1SCDA 2FRDA 2QVYX 2SHKA 3V4PB 5TV2A 3L1UA 5B6PA 4LIPD 1TPZA 2GEKA 4R1PA 3WRWA 4YJ2A 1LNQA 1BW9A 1HLGA 2VTKA 3KQMA 2GHRA 3PENA 4KQJA 5B2EA 1FW8A 2PR7A 1FP4B 1JMKC 1I94B 3U4IA 1LUAA 4TPKA 5KOYA 4TXLA 2PNFA 3VO2A 2AR9A 1UUFA 1QAQA 2FSVC 3ISVA 4Q4HA 4B1FA 1BDHA 1SVIA 2B99A 2B1QA 2OXTA 5FHRA 3RS4A 3HEMA 1K2WA 4NI5A 2NQTA 1NKSA 3CWCA 2Y1KA 1V5GA 1DKUA 4LGVA 3CW9A 4L8LA 4JBNA 2CLOB 3K2EA 1EFKA 3RSGA 3RVMA 4Q0MA 1K68A 2LBPA 1YUNA 5ER9A 4CKXA 1BNCA 1WDWB 1XDGA 2PD6A 1T9KA 2XTAA 4Y7DA 4JZKA 2HRZA 2NUAB 3ZDXB 2I87A 3K1ZA 3PS9A 4A2WA 4ENQA 3CLSC 3TIXB 1ZUHA 4MA4A 1DRKA 2DWQA 2HV9A 9ATCA 2NV2B 4RXUA 3WADA 5KYYB 2CXPA 3LCVB 1MQAA 3IDFA 4Q66C 5C7YA 3HS3A 4M9QA 4MWCA 1JXMA 5L3QA 5LKRA 4E5DA 2JFYA 2GHTA 3FHOA 3U0BA 4LDRA 3TPZA 5SYNA 4W5NA 5K1ZA 2OQRA 2X4LA 5KB3A 1GPWB 1KOFA 4NBKA 4QQFA 4DLKA 4MSUA 3AEXA 3OEWA 1PSWA 1ZI6A 2XBUA 3W9YA 4QPDA 5CYPA 1NV8A 1PJSA 4ML3A 4OK3A 4UULA 1X1QA 4JJ8A 4MVJG 2FF7A 2GUGA 4AKGA 3KOUA 1QG6A 3H0CA 4FBGA 3C6YA 3ETEA 2C83A 5HMLA 2H5IA 3KWFA 2OBMA 3M5PA 3RAEC 1YDWA 4ND6A 5IW8A 3J81k 3TECE 1SO8A 3R3ZA 3HXQA 1MJFA 3R0IA 5CT9A 1Q7GA 3AESB 1N9GA 3NW9A 4NZZA 2R4UA 4M37A 2FSFA 3B9PA 3C85A 4WOBA 1VP9A 1HFJA 1E6EA 4KHZA 3ECSA 3EMDA 3RVPA 1ZOPA 5ER6A 2ZIXB 2PSEA 4BQOA 4WZBB 4N76A 4DB2A 4QBKA 1U8ZA 3O94A 5EFZA 4U8GA 5HCIA 5T6BA 1ENYA 2MSWA 4OA8A 4IRXA 1FTSA 1MUUA 3HWX1 1EFTA 1SC4A 1CUAA 3ZYCA 5FULA 3FFWA 1U1CA 1AMNA 1X7XA 3UHJA 3ZZ1A 1KZ7B 1QOZA 4EPVA 2OHVA 3T4PA 1DBIA 1GYQA 4JT9A 1TUGA 4GL4A 3OZAA 1I2BA 2ZRFA 1ZIOA 3C3BA 4MB6A 1QQBA 3AFMA 1KRWA 3N2KA 5J2UB 3L40A 3OQIA 4AKEA 1RQNA 3KQHA 3B6ZA 1B1CA 3V1MA 3P9SA 3QOXA 2O8DB 1CUDA 4ILKA 1A9ZA 4NOLA 4PZ9A 1EGVB 3LKZA 3VTAA 2GASA 3D81A 3B1ZA 2EQAA 2BDEA 1R64A 4G23A 4JYCA 4M76B 5TPWB 4X6XA 4MP3A 2VWGA 3PWKA 4GP7A 1XCGB 1FSSA 5CW2A 1HETA 4HKTA 3V4LA 1SWWA 1MAVA 2IHZA 2EZTA 1OIXA 4L3OA 3PC7A 4ON9A 1KJ9A 4BNWA 3EGXA 2B8JA 1T9GR 1ZGGA 4OA5A 4GOXA 4TM7A 5DM70 1T3ZA 1IQPA 1UKBA 1VPVA 5CU7A 2EIHA 2ZR8A 5B7QA 5ILGA 4BO5A 3G0HA 3GLHA 2W9XA 4G9BA 4AWXA 1BKYA 1JQKA 2C8LA 2X9GA 2YWFA 4TMKA 4ZT7A 1NVVQ 2R5WA 4F91B 1CZHA 1N2ZA 2FZ5A 3HHEA 2BKAA 2HLHA 1G42A 1FYDA 1KC3A 1JEJA 1NHGA 1OXXK 3QMVA 3QU2A 4XASA 4PZLA 3U4CA 3L79A 4ZQHA 4D4JA 4DF3A 4DLBA 2ISSD 3EULA 1FXWF 1XD2A 4LJ8A 1G20B 2I91A 1ECLA 2GEUA 3QVSA 1KY4A 2IU6A 4FNOA 1UMBB 3VTKA 1CJCA 3H5VA 4XR9A 4DR5B 1H65A 1JT2A 4WASA 3RGWS 5CXQA 4L9AA 4NY1A 2C0QA 6YASA 3CNEA 1ZINA 4D3SA 1GRNA 1Q84A 1C2YA 3CUYA 1EGQA 1AQUA 1Y7LA 4I08A 1ZJ6A 1GR0A 4W1RA 7MHTA 1RHMA 1YFLA 2EL9A 2I03A 3NH6A 1C41A 1RI4A 1YUMA 3CMCO 1ADBA 1WV0A 3D7LA 4I99A 2M9MA 3MTQA 4BE9A 3ZNOA 3SYTA 4C03A 3AXSA 1C0EA 2AI2A 5LWHA 1DTWB 5LJLA 1OASA 4GI5A 5LZ8A 5KC9A 2GK6A 4IOJA 2CYBA 1U5BA 4BVFA 1R4ZA 2QD3A 1F8FA 4MEJA 3C5CA 2WF7A 4GYKA 4AM8A 4I1RA 4Y2JA 2J6IA 3AO0B 2R6HA 2JNWA 3NANA 2XVAA 5CJJA 1H8HA 1VMAA 4FD2A 1RYYA 5HZMA 4QFDA 5AOVA 4DJTA 2DH6A 2GLXA 1RFLA 3SSOA 1Q44A 1G6Q1 1OA1A 1TQHA 1ZK1A 2FSUA 5A9RA 3TKYA 2AK3A 3H05A 1YQEA 2QTCA 2RONA 3ETHA 2AF4C 1SEVA 1CULC 3GHYA 1G66A 3KSUA 3PRHA 4INOA 4GZ3A 5CAEB 4MEAA 5C4MA 1GITA 2J7KA 3JV7A 1XN4A 3BMCA 3M34A 1T0IA 1MVLA 4FIDA 4X84A 5F77A 1WXQA 3EK2A 3T5DA 2P3QA 4UHEA 4OLHA 3GAMA 2FP4A 2RSLA 3A9RA 3VDRA 2GA8A 1BWQA 2OYSA 3MK31 1MKYA 4OREX 4WXEA 3TR0A 4MYRA 5DBFA 2GESA 1G17A 1FRZA 1RRMA 4WKCA 1KR5A 3GLVA 3PSHA 4FE7A 2R86A 3LDFA 3ZIDA 1PF7E 2G28A 1QX4A 1VG0B 3D6TB 4OHZA 1D2EA 1T1GA 2AZMA 2JBHA 3K9HA 4LNUB 4LWPA 3CBQA 1WUKS 1WZEA 4GLFA 4JY7A 4KRFA 1DX4A 3E23A 4QXAA 4RW0A 3MGGA 5HF8A 1KOJA 5AIBA 4IMPA 4XJSA 5FWYB 2LDBA 5HXAA 2I6GA 3K73O 1JEOA 4MJ3A 3BFPA 1XVVA 1SPXA 3NTXA 4JOBA 1A5ZA 2HFKA 3IKVA 4E5PA 1M1YA 1PT8A 2BKVA 1ZM2A 3STYA 3OE4A 3RVJA 2EFEB 3VHLB 3A27A 1PKEA 1HMPA 5A0FA 4DMCA 1NWCA 3PVZA 3EGEA 2QNIA 5IYZF 5DM1A 3H1FA 3CZ9A 3C8MA 2CJWA 1FY2A 3PQFA 1Z29A 1KDZA 5GIPE 5DN9A 5AJYA 3BM5A 1L5QA 3ZY6A 1KYZA 2AOXA 5DWVA 3SR4A 4IFBA 5DRYA 5JR3A 3F5SA 2H5LA 3OHPA 1DC4A 2OPHA 1TVMA 1YH3A 4QTTB 3TOSA 4E6PA 4YCLA 2A5LA 3G6WA 2GDZA 1GPBA 1FJHA 1SFRA 3IULA 2NU8B 4ARBA 4XOIA 2AW3A 2MT9A 3GIWA 1C8KA 2ZDGA 3VNRA 2VYND 2PSDA 2Y1LA 3RIMA 4HX2A 4CNBA 1E6LA 2ORED 4N8DA 1KQ3A 1E1DA 1LPPA 4I3FA 4IX1A 4NHEA 3ZXIA 4KE8A 5CCDA 2OK7A 1MJ5A 4RKRA 1KEEA 5E9JA 4IXDA 4FXPA 1E0DA 3H7AA 3L6EA 3RUHA 2FZLA 2OUIA 3SF0A 2XOXA 2AB0A 2J85A 5AW1A 3TK1A 1E7RA 2VL7A 2PKQO 2R7AA 2XRMA 4PTZA 2HMWA 4RKQA 4KN9S 5DOZA 3WLIA 2Q3MA 4Q16A 3P19A 3PPVA 1NVKA 1E2HA 2G9NA 2VHEA 3NV7A 3AW8A 1IOVA 2RAUA 3BEOA 3SQLA 2YIJA 1YS4A 3CO5A 2ST1A 1ECCA 1FF9A 1GILA 2I4TA 2QRZA 2W48A 3KEMA 4JLJA 4EFMA 4EUSA 3DEHA 1VHTA 3LUPA 3ZK8A 4DIUA 1H4TA 2QXTA 4IF4A 2W6JD 3CR8A 3FFBA 1WG8A 3EARA 2IWRA 3OP4A 3QVKA 1ACJA 2PRIA 2QAJA 5FTWA 3G2PA 4RA9B 4FKZA 3GLIA 2ZU6A 3E8MA 2MDTA 2NSDA 3TGWA 1RWXA 3WOHA 4BEVA 3GELA 4A36A 4O59O 4BQRA 4UTXA 5BQ3A 2WD7A 4AF7A 4HDMB 3DYVA 2QQ5A 3JD4A 4R6XA 4TYMA 1F5NA 3D8BA 3EJ6A 3ENZA 3UAVA 3WLQA 4XCXA 3RIEA 4TYQA 3QEOA 1WCXA 2P9QA 2G9VA 3ECAA 1YZGA 1RKQA 5IPFA 1PUIA 3GFTA 4EJSB 3DVQX 1AHHA 4NCHA 1S89A 1T2EA 4UFNA 3ZQJA 3Q9LA 3MPOA 4ALMA 4V24A 3KQLA 3OP1A 3AVOA 2X8LA 2IPXA 2VHUA 3R3XA 5U9CA 2XRYA 3FLBA 4BV9A 3AMVA 3TE7A 5C18A 4Z1OA 4EYEA 1N75A 3CH6A 3R3HA 4ZO9A 1PJ3A 2WVGA 4G4SO 1OT5A 1ZD2P 4JH0A 3KDPA 3MJFA 1NMEA 3R3YA 4MRMB 3NIDB 5EHXA 2Q9AA 1YRBA 3G2LA 3ND5A 4M53A 2Y1DA 3DTYA 3O73A 4HZGA 4UW9A 4EYQA 2A14A 1KETA 2ZB8A 5KWVA 1N92A 3ET4A 4NPHA 4NBSA 2QIOA 4O1HA 2EKBA 2RBKA 2XUDA 2YZ2A 3IAS1 4EO7A 3A4TA 2AG6A 1VIYA 4QOSA 3HI6A 2C7QA 1E32A 4YPFA 1R9NA 2IOFK 4O6VA 2PKYX 2IGTA 4K7JA 2I4MA 5AHWA 1HDGO 5ERXA 1KP3A 2JBAA 2J9XB 2EYQA 3HN7A 5K6TA 3TVDA 3A4VA 2ERCA 3GNQA 3S1AA 4D74A 5C5CA 3IPLA 3U17A 1H69A 4LGCA 5A6SB 5K51A 1QOPB 4L22A 4KO1S 4OSEA 2R60A 5GONB 2FOIA 3GGGA 4OQ4A 2G5TA 5P21A 4YV0A 1Q0ZA 2FRVA 5E2IA 1LDGA 4JT2A 3CPEA 5F1OA 4ZU3A 4DQDA 2PVCA 2XAUA 3HB1A 2GCGA 1QJCA 4K5QA 3TRHA 1SKMA 3KWJA 5JMOA 1U2SA 1CUGA 4L2IA 2XZLA 4WUTA 4C88A 4MUJA 5IUKC 1TB4A 2N9UA 2UZIR 2NSHA 4EA8A 2NO0A 1H5NA 4C87A 3DFKA 4L4XA 3ELWA 1GSAA 3WRVA 3PSAA 4RGQA 2K4MA 4HNSA 5EYPA 3FRIA 2FB9A 5JAPA 3WAGA 4BY9E 3GRCA 2GQ0A 3NXKA 4J2HA 2DT5A 1IY2A 1NQOA 1ZVJA 3K9NA 4WOKA 5BN4A 2RHGB 1BXKA 1P4SA 2B4YA 1I2DA 2JK1A 4PLTA 1JIIA 4E2ZA 3OOWA 4EKDA 4EJMA 3A9UA 3FAZA 2YDYA 4KQHA 2EW2A 4G5YA 4S0ZA 5AWFC 2OZVA 2BISA 2PYZA 1EAMA 1KZ6A 4FM9A 3C6QA 3MJSA 2RJ3A 3KOZA 1W0KA 4MQ6A 5KINB 3DZBA 2PUVA 4RKWA 2QRGA 3GBVA 1TCVA 3A06A 3B7WA 4J2TA 3CCCA 5JO9A 4F6CA 2OKCA 4DSAA 1JMVA 4QKQA 4HLDA 5CJ2A 2G6BA 5E8JA 4H6VA 4GZ6A 1X80A 4J90A 1KO1A 2QN2A 4BNDA 3REQA 1PT7A 1L4EA 2O1WA 1XRQA 2EW1A 5HF9A 4DA7A 2E9SA 4EITA 5K3FA 3AVVA 2QAGC 3S0JA 3SFZA 4AG6A 2GPTA 2NQ8A 1OSNA 3A37A 1NA5A 2DHRA 1T5BA 3DLAA 4MR7B 3SEZA 5AI6A 2OTCA 3BDIA 4ZVMA 1CVLA 4WZAB 4AO6A 1ZX1A 2J59A 4KMRA 5CH5A 4UBNA 4O2BA 2C2GA 1NFQA 4GPTA 2BJWA 1X19A 2PWPA 1B14A 4RVUA 1RQ7A 3T7EA 2A88A 2QDXA 1IXZA 3N2IA 4CLXA 5JADA 4PQYA 3PIDA 3FSGA 3LWZA 4K40A 3AFNA 1TA0A 1Y6QA 4NYMQ 4MROA 4QPNA 4LDPA 1IBRA 5FPTA 3WNZA 5HQJA 4N47A 4RF5A 5ELXA 3EG5A 2E3JA 2DHQA 3AL3A 4XIIA 1B73A 2VJMA 1KAEA 2JAHA 3DEYX 4DMKA 5KYWB 1C4KA 1X87A 2YYYA 4IP0A 4JP1A 4GMKA 3ANYB 1XXHA 2WSSA 2VBIA 5HGJA 5B3JA 1U2DA 1V9SA 1OQAA 2OXRA 2EHDA 3UV7A 4PFSA 1VECA 3B8EA 2C5FA 1XNHA 4FN5A 1JA0A 1GTRA 3W5AA 1XC7A 4S1VA 3P9XA 4RD0A 2HMAA 4FLEA 1NONA 4N7RA 1MQ8B 2QLTA 2G1PA 3BMNA 3ZOKA 3SS8A 3TOCA 5CB0A 2C3MA 1VL5A 2L0XA 4FK8A 3F7NA 2X9NA 1PLLA 1RAIA 3S7ZA 4RVDA 3HA5A 1EVQA 2Z2IA 2C9CA 1PWEA 1J90A 1OLUA 1SQ5A 2V5VA 5AHKA 3NATA 4MZDA 5K03A 3Q3IA 3FWYA 4WGFA 3T7KA 5AQ1A 3LQFA 2CZCA 2ZB3A 3L0ZA 1RNLA 2Q8PA 4CTMA 5J43A 5KJCA 1ABFA 1C3JA 2YHIB 3SJ7A 3WV4A 1KDRA 2V6JA 2R4QA 4DFDA 4I9GA 1F60A 2K2WA 1ZS9A 5EJ2A 3W4KA 1YA4A 1EFPA 1G7CA 3IIMA 5B1IA 3BD6A 2X9QA 4RORA 1VSVA 4RQTA 4HZUA 3QVLA 3C74A 3EZLA 4HNQA 2W2MA 4PXYA 4CM8A 5A7HA 1AX9A 4GBJA 4PVCA 4X44A 3S40A 2I34A 4AX8A 1XNQB 4O1IA 3WYEA 4PZDA 2OR3A 3VR5H 5DNEA 4KAFA 2OHOA 3FETA 1NW8A 1Z2CA 3E58A 3QYAA 4ZVQA 4ENPA 3OUTA 3FHJA 1NBMA 3B36A 1I51A 1KNQA 2QIPA 2R8RA 5EZSA 5HF5A 4IIUA 4E15A 2ZM6B 2D6FA 5C8DA 1A9XA 4Q7KA 1VJCA 2AC4A 3TEJA 4TZKA 5KVVA 4ZAZA 4YAGA 3QKRA 5BVHB 1K06A 5T8KA 4MKXA 5DGHA 5EE5B 4S12A 4DMHA 3CNQS 3F74A 1Q1ZA 3JQ6A 2H54A 4A1OA 3AJDA 2ZUFA 3MWDA 3S2EA 1QANA 4DDUA 4CKWB 1ZCBA 2YRWA 2IXDA 3DOOA 1DWPA 3JALA 5D5QA 5TIIA 4LWOA 4U0JA 2YMPA 2RBEA 4LMBA 3WGKA 5EIXA 1S4MA 2WMNB 4UM9D 3WB9A 3WRYC 2WU8A 2EYUA 3L9XA 4OP3A 1C1DA 2BFFB 2HXGA 2X4IA 1Z73A 1Z8FA 4J9UE 4TL7A 3VC7A 2C8JA 4D4IA 2I4OA 3QPVA 1GNPA 4MV3A 4WFIA 5ALKA 4IO1A 5AR1A 3IJPA 3FXAA 3ICVA 4YP5A 3ZE1B 1XU9A 5EJFA 1L4GA 1ZFNA 3LUBA 2MINB 3U3XA 2YFQA 1SHJA 2XYPA 3D2LA 3JQAA 2Q2VA 3JYNA 4J0QA 4IOMA 1Q0UA 5DN6A 3T7TA 5AM3A 5JEDA 3KO8A 5FBWB 3UBTA 2HPVA 2WZBA 3P9IA 4A9AA 1FZQA 3PE6A 4KJZA 4PINA 2E5FA 1IK4A 1GZSA 4G4GA 4B47A 5LYJA 3OLWA 3AVYA 2X7XA 1T6NA 4HADA 2P3SA 3IVXA 4I46A 2HF2A 3BJEA 1JHRA 1DQSA 4QDKA 4RCZA 5THXA 2XKKA 1PR6A 4RABA 4TOIA 1EUCB 3L2OB 4E2WA 4DR6B 3PC8C 1DFIA 1X8KA 4ZXPA 1HEUA 2O07A 2A5JA 2LKDA 1WZ2A 2YWRA 1OJ7A 4B6OA 4NXMB 4L72A 2C4HA 3NRBA 3IHTA 4BUCA 5K8VA 1Q7CA 2OFPA 2QRQA 3DMHA 2Q07A 4H9GA 3DZKA 4OQYA 4MGHA 1Z5VA 2G72A 4I8DA 4RDHA 4F8JA 1SBIA 3EJWA 4EARA 1DAIA 3H3XA 1LLFA 2OSVA 2QTZA 3CNNA 1FQKA 2WA1A 4XVQA 3SQXA 4GMDA 2FWMX 5FXMA 3QBDA 2ODTX 1OVGA 3VGPA 4ITUA 3VA7A 2Q49A 4J7XA 4BWYA 4YGYA 5C32A 3QMPA 3T3HA 3OPYA 2ZOSA 3AVUA 3GMSA 4V0LA 1N0UA 3BBLA 4NV3A 1GV1A 4JROA 3K2BA 4QASA 1A4UA 4FMCB 5T6MA 3V48A 5AJTA 4QWMA 4A91A 2ZTVA 4G0QA 3M33A 5AUOB 1E79D 5ES4B 1Q15A 1F0YA 2J7PA 3ICOA 5KYXB 2BONA 3IAM6 4ENTA 1E2PA 1XDWA 4HK4A 4OI2A 4ZPJA 2XOKA 3F8TA 4GUDA 1PG2A 4CUKA 2P9FA 1DQPA 3W0LB 2I2AA 3WGIA 1O4WA 4FHZA 4FQ5A 4MVJD 4DADA 4GDMA 4BECA 1K08A 2W2LD 4OQFA 3P5BA 2IKQA 4YR9A 3N6XA 3WGTA 3VPHA 3GLGB 5G4KB 5KX5A 1W2GA 2CLIB 4HP8A 4Z9BA 1V7PC 4GNKA 4CM9D 3UGQA 3AIOA 4UKDA 3P2IA 3L4BA 4Y9DA 2HL6A 4Y1FA 3CPSA 2GS9A 2WKSA 1TJYA 4RK6A 3UJHA 3RYCB 1A8PA 2WWYA 3WWCA 3EPHA 3LLMA 1JIKA 3L07A 3X44A 5AM5A 4R71A 4KQFA 4JUCA 1XTPA 3QVWA 3D8TA 4WRRA 4D9EA 2GN9A 4WEOA 5CM8B 3L6OO 3HVRA 4Z9AA 721PA 5IANA 5LZ9A 4HH0A 2A1UA 1EK0A 1E96A 1D1QA 2LRHA 2FWJA 3BD9A 1SKBA 3L82B 3PR3A 3M81A 3KAQA 3QUCA 4KN8A 4KUEA 1DWOA 4QUIA 4HRYA 4DT1A 2K7FA 2XECA 2UDPA 3FH0A 4L4YA 2NU7B 4U0KA 5C5DA 2Q3BA 3LA6A 2HBRA 1HT2E 4DM3A 1JWBB 2D8AA 5HTOA 1UZUA 4KIGA 4F6RA 1RYNA 4BMZA 1BQ4A 1XKXA 1PJAA 5FKJA 4JI7B 2I7CA 3W06A 3BIFA 4DS3A 2WUFA 1PT6A 2NT3A 3SEQA 3AK4A 1OWLA 4HWKA 2JEZA 1ISIA 2JFFA 1JECA 3V2UA 4KI0A 3KJXA 5BR4A 3U6KA 1DAKA 2E55A 3EIEA 3T1QA 2I1VB 1QRDA 2HMVA 2QVBA 4Y9SA 4B17A 5F9FA 4ADSG 1PT5A 1V4VA 1JFVA 1AS0A 3R41A 4RO0A 1WW2A 4YS6A 1ZP6A 4FONA 2YVUA 1YR8A 2YNMC 2I7DA 3ZDCA 3R6GA 4UHHA 2HR1A 5HWSA 3G5UA 4UU8A 3FWNA 4MZXA 1NFRA 4OXXA 4QWWA 4V0RA 1U7UA 1ZOIA 2CDAA 5DFAA 4TTRA 3PUZA 5F2KA 1FFBA 1KP9A 2V98A 4UTZA 2H65A 4C6SA 1JFSA 4LNHA 1FVFA 4L8GA 1CY2A 1L7XA 2WWTA 2R62A 3K1JA 3Q9SA 1MZVA 4EGSA 2XYVA 1USVA 3S1SA 4CPDA 1SIBE 2QRHA 1B3RA 1CVRA 4MWEA 4PS1A 3W1WA 5I7EA 3EQ8A 1RT9A 2IIQA 4EI2A 4F7WA 4CMAA 1NJ8A 3EX7C 2X0JA 4WNCA 4X92A 1CJMA 1OE0A 4GEGA 2CLFB 4LYEA 4JD5A 4WBXC 4W6ZA 4ZYXA 1M2WA 3DEIA 4GPEA 1UK9A 2OBXA 1ZRSA 2F59A 3ELBA 1SBYA 4GZ5A 5AIAA 1S3IA 2I0FA 2X1MA 3ML1A 3IT1A 4ZYWA 3JAWA 1SB9A 4CJXA 1YVDA 2EGUA 4MITA 4X3CA 5B2ZA 2J9GA 1HYHA 3RVRA 3AVQA 3ZZNA 3N7AA 4PC1A 2RJNA 1E98A 3R8CA 2E89A 1A5BB 1L6IA 4AMBA 4KPGA 2B1JA 1HDYA 4Y0AA 1SUBA 1WCWA 1LNZA 3WLSA 3CZMA 5DHAA 5AW3A 3L4KA 1QP7A 1X15A 1ZAYA 4PR0A 2HA6A 3OO0A 1IAVA 4JLPA 2ZUSA 3DTTA 5CFQA 1V37A 1GFZA 3IR5A 4D26A 2FHPA 1HX7A 2ZTLA 5TQ0B 4IZOA 1WZIA 1T4GA 2R8EA 4PAOA 4N3AA 3KSRA 4TGLA 3RTCA 9LDBA 2EP7A 1MX9A 2VP3A 3C98A 2PRJA 1PWZA 1OX4B 2IHYA 3ANNA 1PTJA 3ZHZA 1L8XA 1U7OA 3R9IA 5CG1A 2Z6UA 1H2WA 2EFCB 4FX2A 2DY0A 3FDXA 1I2ZA 1Z4JA 3LCCA 2WLTA 3OIVA 4XXHA 5CITA 1YDFA 3AHHA 3RRNA 3PFGA 3DMYA 2GXSA 2XSZD 3D6AA 4FDVA 1Z4MA 4OL0A 1B15A 2FWRA 3ZG6A 1E89A 4MI6A 4Y2SA 4K6GA 4JJ6A 4PYNA 1EXNA 1DC7A 3MAJA 2VQ3A 3K0CA 4CIVA 4UHDA 2GPSA 3DHWC 3QE2A 3RABA 2LZ0A 1PR0A 2H4XA 2PH5A 1RFGE 4LOLA 10MHA 2Z6QA 1OTYA 4R7TA 2WJHA 1TTPB 4O29A 3S2FA 1NW5A 4IOKA 2CE7A 4MKGA 4O0LA 2B36A 3EVBA 3W2EA 1O97D 4B87A 3NC1C 5IFLA 1SRRA 1TVKB 4G0YA 3DBHB 4B33A 1Z7BA 3DUFA 2ACKA 3D02A 3FYTA 5HFAA 5LLDA 4DDHA 1WUHS 2ZS8A 4BBPA 2ZWMA 1P6UA 2WVHA 2ZPTX 4LV6A 1ST2A 3JYQA 3SVLA 1NUQA 3KT8A 4JR1A 5C8XA 4WXMA 2BUAA 3CYFA 3WLFA 1MB3A 3PDIA 2PTGA 4Z7JA 4CHTA 1Y81A 5LUAA 2XMZA 4AJJA 5LQUA 1W1WA 1YZYA 2F1RA 4ZVKA 1Z75A 3LBIA 4DWOA 5C80A 3AEQA 3B52X 4D56A 5HIAA 3NAGA 4YP7A 2VPYA 3UWMA 2QUHA 3ZXSA 4O5OA 3KTOA 1FRFS 2O1EA 4JGGA 3V8VA 4B2IA 4C7BA 1L5GB 5BQPA 3OX1A 1WPQA 2GHIA 2G9QA 4BB5A 3GWZA 4N39A 4QDOA 5C9ZA 3AF6A 1IE3A 1X1BA 4H7FA 1RAFA 4PBRA 3REFA 1UOOA 4B3RB 2GCNA 3AUFA 5IH3A 2CF5A 5C1OA 5TJHA 3D2AA 4D3YA 4YRFA 4K28A 3KYIB 1AS3A 1JZSA 3C6KA 3Q6NA 3MN1A 4GHWA 4TWAA 2IEBA 1CDEA 2NX2A 1SHKA 2YC2C 5AH0A 3QUQA 4BFYA 3LWBA 4QVIA 2C58A 3HVHA 1EQAA 5GIOE 1TEVA 5MHTA 5A4DA 4KYIB 1SKYE 1XB2A 3OQHA 3OCVA 3V3TA 4FD3A 3IQGX 1RBYA 4JA0A 4PRYA 3ADBA 1OOEA 4FZ3A 4JA2A 1OXTA 4Y9RA 4Q3KA 4QGFA 1YVRA 3GEIA 3NBMA 3PWSA 5BYJA 3H2KA 3LGSA 5KOJA 3FR8A 1UP7A 3K6SA 3IEXA 3MUFA 4ZC8A 2CW5A 4OD0A 3UYKA 2XB6A 1NW4A 1QE3A 2CHVA 2EBUA 4B81A 3L92A 3D6JA 5FPHA 2WE7A 4KQ6A 3ROTA 4IIDA 2B94A 2FMUA 4JC5A 4PHTA 4F4DA 1R74A 4EL0A 2E4AA 2RIPA 1G64A 4CCSA 1ORDA 2ISCA 2M32A 1M75A 5CEEA 5IH7A 4FFOA 4F4IA 3P9ZA 5ALLA 3U37A 4AP9A 2MSDB 2HIGA 4MQFA 4X1OA 1FS4A 2NSJA 2APJA 2GCIA 3DR3A 3M6UA 4RSGA 2Z5FA 3IXLA 1C7IA 1F2TA 2TECE 3LT2A 4J7CA 3TTWA 2GARA 4BE7B 5JAMA 4U9IS 3FUWA 5CW1A 4PX2A 1XU4A 3DD5A 2TYSB 4Q4CA 2OQVA 2WAXA 3RNOA 4EX7A 3IILA 3T99A 5LU8A 4Q1CA 1GCOA 3PX3A 1L1RA 3RVSA 4BP3A 4XVUA 3KQWA 1F5SA 2QG6A 1KBQA 3A3OA 3CZRA 4HWGA 4DLSA 1RJ9A 3QX3A 1N2CB 3LHDA 4NCKA 4R1TA 2XKBA 4RBNA 3RKSA 3ZZTA 2FW0A 1RRFA 4BQSA 3FROA 3IKJA 3LW7A 5AT1A 1EFLA 1AKYA 1NLZA 2GD1O 3DKRA 4IH1A 4P32A 5ALDA 4CN8A 5LQAA 2OCPA 3LA8A 2JKYA 1FFDA 3KLOA 2NT4A 3PQ6A 1TX4B 3D5TA 3JU3A 1NX9A 4KXQA 1KOGA 1VZ2A 1XPRA 2AXPA 3KPYA 3UXEA 3TTUA 4UVGA 4II7A 2ZDQA 1AMOA 1HFEL 4WVFA 3E3LA 2XMSA 4TXJA 2B6NA 1Q0TA 1RJGA 3AJ8A 1C9EA 1KMIY 4EG3A 1II8B 2QUZA 1HEIA 3D6VA 1Y3IA 2A0WA 3FDIA 3IVMA 5JWRA 5JYDA 3ZV5A 1XTKA 1RMTA 4DR3B 3T9BA 4RJ2A 2JKZA 3LUFA 1CUSA 3WGOA 4I50A 2VRCA 1A8QA 3LX6A 5EMMA 3TQHA 4PZCA 1N7JA 1M72A 3ZWWA 4UM9B 3OF5A 4Z0HO 1JKMA 3OJWA 4TT3D 3R7FA 4DC0A 1NBAA 1E6KA 1EYZA 2JJ1A 4YJ3F 3GLQA 4FWBA 4Q48A 2PLNA 1P0MA 2AOTA 1NY5A 1QR6A 1P4AA 1AUOA 2GAOA 3GXBA 4MI1A 3ZHYA 4H16A 1E0SA 3F6YA 2CXNA 5BW4A 3I0NA 2FW7A 3T7JA 4DM7A 2W6NA 1UFVA 2Z4SA 4V0KA 5DYYA 4FR0A 3QYJA 1FXUA 5E6SA 2OYCA 3GBSA 2GM5A 4E4RA 2PGXA 1YC5A 5JIBA 2D06A 2D1TA 3S8EA 1N2JA 3PGKA 4M36A 1T4CB 3H11B 1IH8A 2G1JA 3TLYA 1RBQA 3H3FA 4D79A 3I53A 3MELA 2JF0A 1QG0A 2QVXX 2VJBA 2FUG1 3S5UA 3HP7A 1CNEA 2WT4A 3W5UA 3SC3A 1IZYA 1MT3A 1FDSA 4EO4A 3RW9A 5BWBA 1CQJB 1KPGA 3D4PA 1R4AA 1VCMA 1H4SA 1AF4A 5JQGB 4QFCA 1B8NA 4Q39A 1K6MA 1N1MA 1UR5A 2VP9A 3KXKA 1DAEA 1DJNA 3ZDZB 5HK9A 4IIJF 3I12A 2BM0A 1DVRA 3IV6A 2LPMA 4LCJA 4MTLA 4PYLA 1PD0A 2DSTA 2YIMA 4W5RA 2BH9A 2D7JA 1H0SA 2Q3HA 1CQZA 3KQYA 3TAHA 4A73A 3T0IA 3C6ZA 4KBYA 4B6SA 3K1YA 4N18A 3T12A 3AKEA 3H9QA 5LBIA 3T9AA 4RQAA 2CEAA 1QYXA 2RDMA 2VKQA 5FI0B 4EJSC 2VTDA 4MA0A 1Y7IA 5TF0A 1TVCA 5ARDA 2VTBB 3TX2A 1TD1A 1YHNA 2VYQA 2XRFA 1J39A 1L3CA 4JLVA 3LVBA 4Z0NA 1IIBA 1HF3A 2QT9A 1JNYA 2V3CC 1MFPA 4C7OB 1NIJA 1MABB 3OMXA 5AJVB 4BYMA 3A2MA 4AICA 1ZC4A 4YUYA 1SVSA 1JGTA 1GN9A 3QTLA 1RM5A 3SZRA 1G59A 2WG0A 2JZNA 3IUYA 2I2BA 1Z13A 2ZUWA 2PZBA 3DBIA 4K6FA 5FD8A 4S2UA 3VR0A 4CLOB 4RC9A 5EJ5A 1T36B 6REQA 5EQJB 3SY8A 2H59A 3QFCA 1SMKA 1GA1A 2PVPA 3BRSA 3LWNA 3L4SO 4G2NA 5SY4A 4DKXA 1UINA 4LKOA 2OD7A 3IAS6 4KVAA 5AXAA 4IF6A 1U3FA 3GW8A 1JI3A 2VDMB 4HBZA 2WKRA 4P36A 3QG1A 1M66A 1CUJA 2A3RA 2QX8A 3SIWA 1ZLXA 1FTQA 2XUHA 3WWZA 3PD7A 3SS7X 3VMMA 1GPNA 1HKUA 2Q6IA 1PJLA 3ZE7A 4RS3A 1Z06A 4ZVPA 1J9GA 2ZRNA 2HJ9A 3OKAA 1EU1A 1PFUA 1R8JA 2B61A 5BURA 4D80A 2DC1A 5DGDA 3HCBA 3PHLA 1U7XA 5BSWA 3GZNA 1O08A 5JJIA 5BN5B 3LYLA 3OT4A 4PGAA 2ZIWB 2J5BA 4AXBA 5EE3A 3TZQA 3CF0A 4C3OB 4DEVA 1GRVA 4KEAA 1MC1A 3D4LA 1DKNA 1PS9A 3KQPA 3PUIA 4MW4A 1GZHB 4LRSB 2BGLA 4R9RA 3IEKA 2NV0A 5AW5A 2ZAMA 1QRUA 1G9XA 1SVMA 2PWAA 3M6XA 3O84A 1RWMA 1ISHA 2O7VA 2BI8A 1O4VA 4IG9A 4IQFA 4TLBA 3RB8A 2HDHA 3QVUA 4N49A 3UO8B 1XZKA 2HK9A 1T0JB 3P4UA 1X1TA 3TXYA 1NYRA 2PZFA 4CM9A 5JEEA 5E6UA 1M10A 5DTEA 3ADPA 1NXOA 2G1KA 2FLKA 4HH3C 2Q1UA 4NNJA 1IBSA 2H7YA 2PRZA 2WB4A 1V3QE 3LOUA 3KD3A 1JKIA 2E18A 2FH5B 3PGMA 3QOYA 1EGHA 4REMA 3OEHA 2IV2X 1H0KA 2D2FA 3BZWA 4JN6B 1H2EA 1PGNA 1E92A 5BMVA 1TLTA 4IV5A 1O9HA 4BNNA 1NULA 1SG9A 2HCJB 2D13A 1B41A 3QW2A 4D9HA 3C43A 5KYUB 5AXDA 1I36A 5CA1B 1KIMA 1PIWA 3AY7A 3D6HA 1GUAA 3FZNA 3DCYA 3LPMA 4QZVA 1GUDA 5BQ5A 3ICEA 4TMYA 4WA7A 2R00A 1U2GA 5BNZA 2VDKB 1CXZA 3E3NA 3GP3A 1AQYA 1WXIA 3N2LA 2QQFA 1XMQB 1JDVA 1YQQA 2F3TA 3SQOA 1K5GA 3PNLA 4Z7NB 1TCAA 4RMGA 1UBMS 3MCZA 1R9GA 4HB2A 3AP2A 3MWYW 4IFEA 1U1FA 3L8CA 5CIWA 1W34A 4J0FA 1EAYA 1P5RA 1VJ1A 1AKTA 2ZPAA 3CR3C 3GNLA 3P20A 4KQ1A 3ZCUA 4HVCA 1EE2A 1KI7A 5K0JA 3F9IA 4B4WA 1G4HA 1POXA 4I81A 2WWHA 3AUAA 3GCZA 2O3UA 2V3VA 3DT8A 2RH8A 2X4GA 3C24A 1G21B 4XQ9A 4NSNA 5KNCD 3L46A 4LRUA 2PO7A 2NACA 2IJGX 2ZT7A 1B0ZA 3PFKA 5GJCA 3L49A 2DLDA 4IH9A 3PF8A 3EGDA 4AUEA 4BPBA 3FNBA 1QYDA 9GPBA 3LTNC 4LF4B 1Y1SA 4UEJA 4MUMA 5ITZB 4B83A 1DU4A 3P9CA 2H1OA 1CY6A 2JW5A 2QN8A 3UK6A 5C8ZA 2XUAA 1J06A 1UIRA 3BIJA 4QYIB 4DEXA 2RHWA 1KRXA 1DMSA 1YWGO 1ORWA 2OMEA 1ABBA 3FLAA 3WL8A 1R0XA 2AHOA 3RYIA 2DPGA 4FFMA 4RJIA 4UU7A 1QGUA 3SXPA 1Z0UA 1ZG3A 3PL1A 2EF1A 5IVHA 3LUKA 2WF8A 4L5YA 1VZ3A 3ZXUB 5C35A 2VJLA 2I3ZA 1OGYA 2Z3WA 4ME6A 4PWYA 3T94A 3G85A 3IP8A 3O83A 3QEBZ 2O20A 4IDHA 1KO4A 4CM7A 1UBFA 1Q1NA 2F7SA 3MAAC 4JSRA 4X93A 3UB4A 2H3HA 4NBLA 1RAHA 5DK4A 3NB0A 3OQOA 1Q20A 5KNBA 1D0IA 2I1LA 1LDMA 1O54A 2BR3A 4ZT3A 4BUZA 4LXYA 4G0WA 3NAMA 4HAVA 1QB7A 4JBIA 3SSMA 1CZKA 2E4YA 4DKJA 1K0FA 4YK7A 3Q8KA 1TRHA 1JEDA 5FLYA 3KYBA 5BUCA 4XQGA 1IN6A 3LZDA 3V8RA 1ODCA 3UJ8A 4FGWA 3AR4A 4DCMA 3KUCA 1ISMA 2XQFA 2DBQA 3UT6A 4ZYVA 4FZ5A 1IFXA 4HEA1 3L1JA 4RVHA 5JCXA 4WBNF 2V45A 3AZQA 5E2AA 5FLXA 5E3HA 2DM6A 1OFTA 4A4DA 5EESA 3JQ7A 1VBKA 4HVLA 4LX0A 3HHPA 5BT9A 3KL4A 4OPMA 1GRRA 5JSQA 4TUYA 4EA7A 3M9XA 4RWZA 5E0KB 2AYXA 5DSXA 2BFOA 5EJIA 4Z7QB 1RVDA 2GRUA 4ZRNA 3GFOA 5FL3A 5BR1A 2NGRA 1BEEA 4FHDA 3D1LA 2BFCB 4BCBA 1HYEA 2ZBRA 1V47A 3FIJA 4I4CA 5CX4A 5EIEA 5GM1A 1C1XB 1GUZA 1NSYA 1JB1A 1T8SA 1UFKA 2DBYA 4QNNA 4X8LA 5DPMA 3SC6A 4DIBA 3C2QA 4YX9A 3ZOZA 2J9ZB 5E1MA 5KQGA 1J4AA 2IIPA 1I13A 4YUVA 5HP4A 4UBJA 1NUUA 1PZMA 1ZICA 3UT5B 4JI8B 3LY9A 1OC4A 3DT9A 3LXUX 3F73A 3QJ5A 3W5CA 3QWBA 1UKEA 4N65A 4NR0A 5CT5A 3RQSA 5FWXA 2Y68A 1GPMA 5YASA 4DEYA 4H0NA 4UE3S 1VG1A 5I9NA 2I8CA 5FBLB 2ZVPX 2ZVQX 1J20A 2XYQA 2C96A 3FTCA 4NEHB 2AD1A 2JANA 1ZJZA 4GVLA 2AKEA 3PRKE 1WB4A 2JI7A 2RGGA 4CI0B 2HD4A 3K8ZA 1TCCA 1JJBA 4DSTA 3VTZA 1OX5A 3A31A 4FINA 1ZIXA 2IXTA 1EFCA 1I7NA 4ND4A 5FWDA 1YBFA 2I62A 3CZ5A 5IAJA 1FX0A 5LMUB 3WKEA 4O25A 1Z35A 3B9QA 3CSDA 4QARA 4AROA 3WFZA 5HR5A 1A9PA 2CUNA 1IPFA 5LOVA 2QM0A 4RTMA 2C3PA 1BS9A 2J30A 3TSCA 4IDOA 3ZQ4A 2B4RO 4AQ7A 3OBBA 3DE7X 3SAJA 3BHNA 3FFAA 1LB1B 3P0EA 3QU5A 4MWGA 4HN9A 1XVTA 2HSWA 4KACA 3GPIA 4UAUA 1ZEJA 3AF0A 4RTOA 1L1FA 3ZLBA 4DIKA 5BOSB 1EXDA 2PZEA 4NS4A 2ZIAA 3G7UA 1A82A 3KVYA 4YP0A 1BH6A 1L4FA 3NKFA 3OFNA 4ZVTA 4BFLA 6GPBA 5LLTA 2XCTB 5C3MA 1YKGA 2RHRA 4LSMA 1IG3A 4P58A 3CE9A 1VJ0A 3H7IA 3KEGA 4UJ3A 5C2JB 4YXWD 1FNDA 3TW4A 3QNMA 4PYMA 2IHVA 3JQQA 1FTYA 3VMFA 1UOEA 3R20A 1BU5A 1L4MA 4IIBA 4LY3A 2DHDA 2HLPA 3LO5A 2EERA 4GLLA 2BUCA 3G7SA 2AI1A 3OZWA 3O38A 3P9PA 4WOPA 3PNOA 1LGYA 4P3PA 1G2OA 1YR9A 2J08A 2AMLA 1GJRA 1YXMA 1BDBA 2BP7B 3BH7A 4IWNA 1UJ4A 4RVSA 4Y2XA 5E3JA 3ZWQA 2GR9A 3LD9A 1OGJA 2V54A 3BSSA 1XPUA 3ES9A 4ZZ1A 5HM6A 1L5OA 1UAYA 3A1VA 3JWPA 5MN5A 3U4HA 4RIHA 4CODB 4EA6A 1PHRA 3IJ5A 3ADCA 1N8NA 2F3SA 1E9SA 1VJGA 3ELDA 2DWOA 2PS0A 3QLUC 4MS4A 5CVEA 3PC8A 5J5VA 3W2TA 3ZVRA 2W2OA 3GMIA 5CM2Z 2Z04A 3G9ZA 2WM8A 5EWJA 3W1VA 1LPSA 4MHOA 4DQUA 1KI8A 1XRJA 1ZVKA 4D3XA 3FA2A 4WNYA 3TZHA 2C84A 1RXCA 4B3HA 2YKGA 1A50B 2JASA 3VHQA 5D3MA 1T5HX 1SCQA 1K3UB 3O95A 4RA6B 1CUYA 3RS9A 3VZQA 1GDDA 1N8TA 5JS1A 1ND5A 1AXRA 4H60A 4BZPA 1QH8A 1NN0A 2QSJA 2AOUB 2AT1A 2H4JA 3W6UA 1CJTC 1ICIA 3JVVA 3D2BA 3Q85A 4YAWA 1DBQA 3EH1A 2QUBA 3TE6A 4DCNA 1EQUA 2NO4A 4YYEA 2WSYB 1EB8A 3O2NA 5JNVA 1VFPA 3DGFC 4TQUS 3IQIX 4TYYA 1A72A 2CNLA 3FPFA 1TTQB 3BIOA 4I4NA 1U1GA 1EHIA 1AIPA 4JLAA 4PQFA 5AI5A 2PEZA 3CPHA 4DYVA 4N12A 5IAOA 4G26A 3VR4A 5IT4A 4H18A 2GK4A 1VJTA 1USWA 4DG8A 2D5IA 4ZAVA 4AUNA 4YJHA 5TVGA 5LA6F 1VYTA 1OTHA 2AEEA 3BN3A 1N6NA 3QHQA 2OO5A 3IBYA 4PE5B 4YDSA 5E4FA 2NUTA 3SNKA 4AZ0A 2HPHA 2CZQA 3QFTA 4GYWA 3IKTA 1OLOA 1E63A 3NJ8A 3ZH2A 3PGVA 5EJGA 3SZGA 4V1CI 3JVDA 3ACBA 1EVKA 4XX0B 2V7QD 3OA2A 5GPBA 3SX4A 1A4XA 2AR7A 4DXAA 4Y8VA 1OLXB 2P9ZA 2A59A 4L1KA 1SULA 1TFUA 4ZARA 5E9AA 5LXTF 1C0IA 3P97A 2CSUA 4MW0A 4F86A 3ACCA 2ZQYA 2VWPA 3GZJA 2RGBA 3PUXA 1QIIA 2GD6A 5HIMA 4L8VA 4C4XA 3BGWA 2VPZA 2ZQ5A 3NHJA 5IMSA 4OBXA 1T91A 1YL5A 1RYMA 3AF3A 4FNGA 2QMOA 2XWQA 4RDIA 3BEDA 5D5HA 2XCOA 5G0VA 2FJ0A 1XQ6A 2H85A 3SJBA 4ZHSA 4EKNB 5AW7A 3RSLA 4YASA 2QJOA 4N4AA 1TADA 2QP4A 2RKWA 3OE7A 4S1WA 4UCWA 1DBVO 4XFDA 4G5RA 4JJKA 5D5PA 8LDHA 4G97A 3FNFA 2Y05A 1VYHA 4ZVRA 3JD1A 2HXYA 4F38A 2ERYA 4Z5XA 5KQPA 4Q7QA 2I99A 2CWWA 2GGSA 4LDNA 1I5EA 4YNBA 4XUEA 1N5OX 5JY1A 1PX2A 2GPWA 3E9QA 3I92A 4NE9A 1FP4A 4LISA 1CW2B 4A8TA 5EIWA 5AI0A 4D1YA 2IEZA 2L42A 3ZV6A 4D92A 1UT6A 1JALA 1XG5A 2J3HA 3HJAA 2PY6A 3K9BA 2ZVJA 4ZD6A 3SKVA 2IOHA 3PX7A 4L5AA 4GI1A 4JL5A 4E6EA 3ZYZA 2XNKA 2VZEA 3IP3A 2X2OA 3LKDA 4CEJA 2ZIZA 9MHTA 1MOZA 4L6CA 5EJMA 2QJTA 5TQJA 4I4TF 2NNWB 5IJ9B 3S2ZA 1Q1EA 2DFNA 5D7NA 4CFYA 3WJ2A 3G0GA 3STTA 1A71A 4EPWA 2QOEA 5TLSA 4BDTA 5IYZB 1U7WA 4J16A 4ZCMA 3E7PA 2HA0A 4JJIA 1PJQA 4GT1A 4ZOLB 3VR3A 3GDHA 4CETA 5KYYA 3BRWD 4G0OA 5F33A 3P27A 3N39C 4DTIA 2AE2A 2BCJQ 4A5OA 2C94A 3QMMA 4NH0A 1ZK4A 3CXUA 3DLBA 4NU5A 3AB3A 1IUPA 3GQBB 3T8YA 3VSEA 3N07A 3ZH9B 1DIAA 1N2EA 1CR2A 1T3HA 2BD0A 1OJLA 4KAXA 3UJCA 2UUCB 1L0BA 2VYVD 3SE0A 3EXEB 4YMVA 4KR7A 3CISA 1ISJA 1HNXB 3MFYA 3O3OB 1K0UA 2G88A 2CNKA 2GBFA 4M0DA 3RADC 2P1RA 1BGWA 2OCKA 2MR5A 1A2BA 1PDVA 3BD7A 3PQ5A 1QYWA 3O0DA 1U0BB 1Q14A 1V4BA 2G5PA 1U3VA 1RQLA 2XEXA 3KAPA 3M83A 1FMCA 3NVAA 1HI9A 1DOAA 1QGOA 1S7CA 1U80A 1MO2A 2OVFA 3SDBA 3ZU4A 4DA9A 2BGIA 5CDTA 2IU3A 1D04A 1HDEA 4PC3A 3I2YX 1XSEA 3NCHA 1IHXA 5A0TA 2J3EA 4O1MA 1G4UR 1S8FA 2ONYA 3R1IA 4IDFA 4RK0A 3UJ9A 4ER7A 4HWRA 1SGWA 1LC0A 2XGGA 2DF8A 2QI9F 1KBZA 2PX5A 2VSFA 3WYFA 3EIUA 1M7GA 1ZJJA 2Z8YM 3CIFA 3ELUA 3AOGA 1WZUA 4GM4A 4RY2A 4WZBA 3SJZA 4BKOA 5BPFA 3OAAD 1DKOA 1WQ3A 4RGBA 5HM8A 4FYJA 2PUHA 5IDQA 1LV7A 4DDTA 3WDMA 2ZROA 3PEEA 3V5NA 4M1KA 3T4XA 4MV8A 1FFSA 1T4DA 1V71A 2EP5A 2OE2A 4M98A 4MV6A 5F5NA 4G84A 4XI9A 2ONCA 1FL9A 5HKOA 3I5MA 4EGFA 3ER9A 3MF4A 1UEXC 2D62A 1PZNA 2DZDA 4DV1B 2RHHA 4P4SB 1E2EA 1R6UA 3UICA 3QELB 3KQKA 3BDVA 3C70A 4JKYA 1QZ3A 3GYBA 4AECA 1P9LA 3MINB 4EYGA 3VFDA 3KR1A 1FEZA 1I10A 1PVVA 4HRXA 3ORFA 3D6MA 5TPWA 3A6JA 3NKVA 3UAWA 4BQNA 3LX8A 1Z2AA 1W44A 1E7YA 2CXUA 5FTMA 1E9VA 3JWHA 3JWJA 5KOHB 1XELA 5FL7A 5I51A 1V48A 5GJVC 3NEPX 4QYTA 2VSYA 2O2ZA 3L05A 1DDIA 4LGYA 4EENA 2VP4A 4QD3A 1GUBA 3LY7A 2I65A 4M0FA 3RHSA 3HYNA 4RS4A 2R6GA 4I9FA 4DCJA 3KQQA 3IMKA 4GG1A 3ZW7A 1XMSA 4BMXA 5KNCA 4IDNA 2PXAA 3OZXA 1WD5A 2J9RA 4NE2A 3VSDA 4KQKA 3RJ9A 3U4MA 4PSVA 2SKCA 1L5FA 6Q21A 1BFUA 4PLCA 3EH2A 2YHSA 5EGSA 4FCVA 4NHOA 1G20A 4DBZA 1OIVA 3RODA 1DEOA 4OB7A 4Z6KA 4QULA 1RKBA 3QYPA 2HNBA 3DMPA 1KAHA 4IQ0A 2F55A 4G5QA 2FPSA 4OQMA 5HIIA 1RRVA 1ZGAA 1DKPA 1SCUB 3MOGA 2IYNA 1XZEA 4BPRA 5KSPA 1E8MA 3RUFA 3WE7A 2HF7A 4DMLA 4PTYA 1IQUA 4HJXA 1NQWA 1OU4A 1NF3A 4F2HA 1DTEA 2UYOA 4HDKA 5BNFA 3ZW9A 2AMFA 1FP6A 1HDIA 3EQ7A 2QXYA 1WULS 2OB2A 4KQWA 4UFOA 3K35A 2JCVA 2ZT5A 3QF4A 2C9MA 3AR5A 3W2FA 4H7DA 3WLEA 4EI8A 4RESA 3X2FA 4IO0A 3E53A 3PNKA 2WIBA 4O33A 3GGPA 3L7LA 1E3EA 4ZU1X 1KYQA 1C9DB 1NR7A 2WABA 1CEXA 2IF0A 1N2GA 1P1RA 4K6CA 4KQCA 5CAEA 2LNDA 2NZWA 3R76A 3AKCA 4GC9A 4QNMA 1TU4A 3ROGA 3WWEA 2BGGA 1RI2A 4AKHA 3L1IA 2C61A 4HGYA 1CHNA 2AZDA 4PAWA 5H70A 2VLBA 1UWVA 5BW5A 1EFUA 4PU0A 3INRA 2FPPB 2PKQP 2SECE 3MMNA 5FPSA 4YAOA 1RDFA 1JU4A 2B92A 3C6BA 5CX1B 2JFOA 3CGWA 4UOEA 4DOMA 1DELA 2A57A 2KS6A 4IG4A 2F8MA 1CY0A 1YI0A 3GF4A 1LC3A 2Q46A 4H27A 3TLMA 4BX2A 3OD5A 4LNUA 1IHPA 2CDRA 2PUJA 3OA0A 4ZAWA 1V1RB 5DHPA 3IUQA 4BP9A 3B38A 2PV0A 3S2YA 2OESA 1I0LA 3FX2A 5AFSA 1KWKA 1H1LB 2JIBA 3PYMA 3RAPR 4BX3A 2CKDA 5EEHA 2YH2A 1DP4A 3OD1A 2QY6A 1FC0A 2CLCX 3D6NB 4OHMA 1XCLA 3UJ6A 1C0KA 2FUG6 4ALIA 3W8FA 5KBYA 2DGDA 3KETA 4MDFA 3WNDA 4JB0A 3PDCA 3LT1A 4CM6A 1WVGA 1PLKA 1XCMA 2GKSA 2JGKA 2YXNA 3VNBA 1YKSA 4ABTA 1FFCA 1PR1A 5F7ZA 5I7OA 2DOKA 4JLDA 4PPYA 2CK3A 5GOTA 1XRMA 1KGDA 1ZM9A 1ZISA 2HDOA 2XX3A 1XKTA 4LZOA 1D6SA 1KYVA 4LV8B 4QATA 2PGIA 1QU3A 3BXXA 4NWIA 3MWFA 3D7MA 1IY0A 4Z49A 4Q19A 4QHTA 2QTMA 1JEQB 2IUSA 4YJGB 4ZJYA 4UEKA 3LVRE 5IHPA 2ZTUA 1EI9A 4CR8A 4DIDA 4KAAA 1GZ3A 4ZTUB 3WXMA 3AY0A 2GSDA 4BATA 4ZOEA 5HVNA 5KQMA 4PVDA 2HA4A 1D2NA 1Z56C 3GEEA 4C4TA 3ID6C 4UHKA 3LUAA 3KZKA 1AGPA 5ED4A 2BVNA 4PF1A 1UBTS 4EEKA 1FVOA 1S8NA 1ZUD1 2ZRCA 2WSLA 2X8AA 3LQYA 4YWHA 5IDXA 5BN3B 1RYBA 3KC2A 3DMRA 3LOQA 3OCYA 1H4QA 2IYVA 3EZ6A 5BV1A 2V5UA 2W6CX 1E2IA 3LPLA 4CVNA 4FB4A 1ISPA 4HLCA 3C1UA 1CS0B 1LPMA 4A0RA 4AJ1A 2XB8A 2GN8A 2I2CA 3GHHA 1VL1A 2GPBA 2JAOA 1TJ4A 1XQXA 3KAJA 3NUGA 4N5DA 4GOND 3CCFA 3ZI7A 4MGIR 1BRMA 1YIAA 3HVKA 2NYRA 1YCDA 2Q2OA 2QV0A 2WT8A 2BC9A 3AQIA 3VVMA 3QUSA 3I61A 1T0UA 1P1IA 1P9WA 2L82A 5DYGA 1IY1A 3X1KA 4MV5A 5NULA 4RA9A 5AKJA 4IGKA 2ZJ8A 3SLKA 3H75A 4KDEA 4TXNA 3ROQA 4MO2A 1LBTA 4PHFA 5HYVA 5KNDA 2GRAA 1AKQA 2VPIA 3PP8A 1XMVA 4IJQA 2C1EA 2ZQZA 3QBTA 1OYYA 4UHJA 3TJMA 3H8SA 2AEJA 4P7GA 3N8NA 4IH4A 1V0JA 4RACA 3TQOA 4F3KA 4Q9KA 1U3DA 4P54A 1ZLYA 3EQ2A 3HVIA 3R5HA 5DX1A 1GCGA 2DCUA 4JLNA 4XEUA 4MQEA 3FWZA 4FX5A 2CXXA 3E9ZA 2J09A 3KE8A 3NX4A 2FDXA 5TSDA 4ZCRA 4EJSA 4AYWA 2K5UA 3KXLA 3KM0A 4IIEA 4II2A 2C1ZA 3DB1A 4TSFA 3RRBA 3C8UA 4CZ2A 4EX6A 2H9AA 4RMHA 3CMMA 4RPLA 4Y1RA 1M6HA 1QBGA 2ZBGA 4R9SA 3JVEA 1EIWA 2ISQA 2P35A 4MQUA 4ZQFA 1TGYA 3FZQA 2WJWA 4X85A 3Q1LA 3ZHOA 1ZKMA 2J8ZA 4CHGA 2FCAA 1ZK2A 3PFIA 4U02A 3IVGA 3TFOA 3AV3A 3GJTA 5JS2A 3TDMA 4LXXA 2HLDD 4Q7EA 3IO5A 4QELA 4IJVA 3NHRA 3O4HA 2PLWA 3AHEA 1PFYA 1ZCFA 3R5JA 4HQKA 1QIHA 1YB5A 4KZKA 4XGQA 5FCDA 1OXVA 2HO4A 5SY9A 4YUXA 5THQA 4I5GA 2R1TA 1VE7A 1XQWA 3I9LA 4OP2A 3CEHA 4LE1A 3KKKA 5CPFA 5EMJA 2VJKA 1Y1PA 2VA8A 5ALIA 4UEQA 1QHHA 4L7VA 1ONNA 3C3YA 3OF3A 5DZSA 1XZ8A 3Q7IA 3V2GA 3EEOA 4BMCA 2ZRQA 4H17A 1T1RA 2DFTA 1LSUA 5DBGA 2PRSA 1W93A 3AH8A 4MWDA 3C7KA 1CIJA 2OCYC 4NG4A 4K9SA 3EFHA 4Y2VA 5GONA 2N42A 5KYGA 1CRQA 2BZ1A 2WAAA 3KAKA 3SIRA 1Y5MA 1GKUB 1NAIA 3O47A 5B4VA 2C4KA 1ODSA 1LI5A 4MIYA 1DOHA 5FIUA 3WMWA 5DI3B 3O8QB 2PT7A 3O9MA 5M29A 5JFOA 4MVJH 1ORVA 3AUUA 2VKTA 2Q4EA 4KXYA 4PR3A 1L5ZA 1ZJYA 4JI0B 4GRIA 1FW6A 1TDJA 4TKVB 4AWAA 1Y8RA 3H2SA 5E1DA 4Q01A 1Q95A 1ZWKA 2CBXA 2E37A 3ZHCA 1GZ6A 4COOA 1GIAA 5L3ZA 5CK4A 2OHFA 3GXOA 3I6YA 2AV6A 5SICE 3ZD8A 3H16A 1ZXBA 4H4DA 3OFJA 2G67A 1NWHA 4G86A 4Q7LA 3HEAA 2QMZA 1CR6A 1CFZA 2OCBA 2WJ6A 3JWEA 3L7OA 3QLJA 1ZUNA 1DFHA 4Q1DA 5HBGA 1KQOA 4FLMA 5IXJA 1T5SA 4S05A 5ITVA 1N5RA 4DTCA 2PAAA 1LK0A 1Q11A 3UG7A 3F6PA 1HYQA 2BGUA 2BBSA 2NTNA 2YN0A 3GB9A 4BNYA 5EJAA 2W0SA 4CL2A 3NORA 3QKSA 2GVDC 4TYNA 5P8WA 4C0AC 4DIMA 4O3MA 4WH0A 1P8AA 2M6KA 2D5AA 2Z2JA 2CN1A 5CURA 5CPBA 2IC5A 3VR1A 4QXOA 2UYGA 4JVLA 4L95C 1F1JA 1F8GA 3C3XA 4OK5A 5KCZA 5FPYA 2WIJA 5COQA 4WKPA 5K0FA 2Z9BA 2AC7A 5INTA 1WL8A 3H2ZA 3X1JA 1ZW6A 3T5CA 1PGPA 2WINI 3KOWA 3LCMA 1YTLA 5A4MS 1DQZA 3L7NA 4WZAA 3SHWA 5ARCA 4UM7A 1O97C 2MYPA 3F0TA 2I7XA 1YVPA 3BWXA 4QA9A 2BRUC 4MLPA 1GDTA 4ZOBA 3GOHA 3Q40A 1JDBB 4KE6A 1LDNA 1OLSB 1NJ5A 3ZY2A 5FYQA 2UV8A 4MV7A 4L50A 1AK2A 4GE0A 4LZWA 1OV4A 1T5DX 4QGSA 4KP7A 1QRTA 4RNDB 2VG8A 2JS7A 2QP9X 4HEA6 5K8JB 3BT7A 2VNSA 2ZWOA 3IC5A 3M70A 3A4MA 3MXOA 2CVOA 2WHRA 2OD9A 3KTAB 3REGA 3G8CA 1F14A 5FP0A 1NOKA 5EXSA 1FMLA 4R01A 3UB2A 5A3JA 4E30A 1DRVA 1UPUA 3ESQA 4ILEA 1Q22A 3EUAA 5FOUA 1AGRA 2OEPA 3H5WA 4XDGA 4QDJA 4KQIA 3HJFA 1Z5UA 3E27A 4ZYUA 1YRLA 4NU6A 1ZAKA 4W99A 1W94A 1DWQA 2O2CA 3OT1A 3W3ZB 2CF6A 2MCFA 1DQNA 2ZK7A 3PZRA 4FC6A 4HDNB 3SX0A 2ABWA 1U65A 2FZ4A 2HYDA 4CQLB 1KTVA 2ID4A 2VT2A 5HDBB 1YIDA 1YGPA 1TJNA 3HB5X 4K87A 3EE6A 4W9RA 4X63A 4CT5A 1QRAA 2BEUA 3DE1X 4K9LA 5JXIA 1H05A 2C7VA 4Y6LA 5KKCA 3FTQA 1SHZA 5EE1A 2XTJA 4JITA 2OZKA 4ED9A 3J7TA 4JBXA 1A9QA 4F2WA 5KNBH 2G77B 2Q9UA 1E1RA 2I29A 2VH2A 1FU4A 5GV8A 4EG1A 2OO7A 2WUWE 3EWAA 4B7XA 4XIFA 1AUXA 3TZBA 5D3ZA 2VSXA 1RACA 1USIA 2YXDA 1BE8A 2FLVA 3NNNA 4MW9A 4Z51A 5ABPA 5CD9A 3D7SA 3N70A 2X3FA 2CXHA 3G0CA 3JRXA 2CYCA 2HRBA 1XZGA 2RHLA 4BFVA 3D0RA 4GX0A 2C03A 3A0UA 3ZPXA 1RC0A 1V8PA 3NDIA 4I5IA 1QVZA 2FW8A 3O8OA 2H2GA 4P3YA 5DIFA 4H1UA 1V6SA 4YR7A 3C4QA 1WS6A 1OZ0A 1UADA 3DF9A 3WTCA 4ND3A 3VSAA 4FCWA 3R24A 4ZZ2A 1ZVMA 1K1EA 2H1FA 2O7SA 5JC8A 2C5GA 4NECA 1AUPA 4TKZA 4XJTA 1W1UA 5BVGB 3NKLA 1E5VA 5DWDA 4BNFA 4A03A 3KOYA 2MOKA 4MI9A 3IBGA 3LC7O 3ZS8A 4C5AA 3TINA 4A5SA 4M1SA 3R40A 3B1FA 2ZRPA 3FPLA 4RE6A 2YZKA 2R1VB 2REOA 3IUPA 4IDEA 4MVYA 4F3RA 1Z8DA 1OH8A 3GFGA 1FNSA 3F7OA 4ENSA 1GM5A 4A6PA 1X7WB 1Z7GA 1K7CA 2FPGB 4ZT2A 1N3BA 4WI1A 1W9MA 4RXMA 1RKUA 4G4IA 2F48A 2IZ1A 3GARA 2UUPA 5IJXA 2I78A 3COZA 1KK3A 1QM5A 1Z28A 2FE1A 3CX7A 4KWIA 4M55A 4WW0A 1LKZA 4UJ5A 3AHCA 3BBPA 1ITZA 3KL2A 2WFZA 4R7ZA 5DCLA 4L4UA 5J1TB 5M5BA 4O4LF 2P69A 4PM4A 5TMBA 4IZ6A 3SWWA 5A2QA 1ZMBA 2PQ6A 1NR5A 1XP5A 4KFRA 1RRKA 3CFYA 4LOJA 2H17A 4E4TA 3LK7A 3CKYA 3HBLA 2WJIA 1PG5A 1D2HA 3C7CB 4ZJZA 4Y9TA 1LEHA 1PZFA 2F1IA 3JATA 4ETMA 1LVHA 5IARA 4AO8A 5HKKD 4Q18A 3ZE0B 1CLUA 4L75A 4F3NA 1YFJA 3HP4A 4MX8A 5AW4A 3I62A 2IHUA 4PNHA 4EY7A 3LHSA 2B83A 3IT3A 2C04A 1WDTA 3WY9A 1VSQA 1TA9A 3U44B 3IP7A 1P0CA 4YMLA 2CDBA 3LYUA 4TV9F 4RX1A 3DC2A 3AIMA 1Y98A 3FDFA 2I33A 4KK3A 2ATVA 2AC2A 3KTDA 3AB7A 4HQNA 4O2RA 5CVVA 1Q0PA 3NT2A 5BO5A 1CZUA 1NQAO 3MTEA 2QWXA 4X7MA 4C0SA 4RTPA 1HURA 1EG2A 1H3NA 2Z1DA 4W7IA 4XVHA 1NZDA 5B1DA 3WP0A 1KJWA 2A7XA 2VEOA 4IX9A 3FOFC 3NM4A 2QL5A 4DWVA 1O96A 1SOAA 2IV7A 4LQ4A 4TMFA