3PCTA

Structure of the class c acid phosphatase from pasteurella multocida
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
251
structure length
246
Chain Sequence
NQQAVEQANQAKLQQQVAMGLIWTQQSGEYAALAHQAFNSAKMAFDHAKKKAVVVDLDETMIDNSAYAGWQVQSGQGFSPKTWTKWVDARQSAAIPGAVEFSNYVNANGGTMFFVSNRRDDVEKAGTVDDMKRLGFTGVNDKTLLLKKDKSNKSVRFKQVEDMGYDIVLFVGDNLNDFGDATYKKSNAERRDFVAKNSKAFGKKFIVLPNTQYGDWEGGLDKNYFKGDSQSKLDVRAKAIHAWDGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Class C acid phosphatase
publication title Crystal structure and immunogenicity of the class C acid phosphatase from Pasteurella multocida.
pubmed doi rcsb
source organism Pasteurella multocida
total genus 99
structure length 246
sequence length 251
chains with identical sequence B, C
ec nomenclature ec 3.1.3.2: Acid phosphatase.
pdb deposition date 2010-10-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3pctA00
4BX3A 3K1ZA 4UMDA 5IT0A 1FEZA 4DWOA 1SWVA 4Y3UA 4C4TA 2JAWA 2P69A 4MWOA 2WF8A 4UAUA 4Y2RA 4HGRA 5AVZA 2ZBDA 3AR8A 4RETA 3U7FB 5AKKA 2PQ0A 1EK2A 1T5TA 3U7GA 3FPSA 3OCUA 3N28A 1Z5GA 3KOOA 4UM7A 3WK8A 3BWVA 3N1UA 2P11A 2NO4A 2B1QA 2X4DA 3SKXA 4UMVA 2EAUA 3ZUPA 4J03A 3SHQA 2ZXEA 2Q5EA 1U2SA 3OCWA 5AVRA 3S6JA 2RAVA 5AESA 2FEAA 2I34A 3GYGA 1YS9A 4BX0A 3KDPA 3ZU6A 2VKQA 2HEGA 3ZI4A 1ZOLA 3WK4A 3WKAA 5ALOA 5A3QA 4XE5A 5AW5A 1S2OA 4MUMA 2OYCA 3SMVA 2WF7A 3A1DA 5AIAA 2RB5A 1U7OA 1Y8AA 4UARA 3AR4A 3QUBA 1RKQA 3J7TA 3SD7A 4PNHA 3CNHA 4NAVA 5AW0A 2QLTA 3ED5A 1QQ6A 5AW7A 2HF2A 4CF4A 3WKBA 3EWIA 2FPRA 2ODAA 4Y2UA 2ZBGA 2ZBFA 2HDOA 3U7EB 3WKCA 2AH5A 2DQSA 2YJ4A 4EZEA 2HI0A 4NWIA 4Y2JA 1EK1A 5AW1A 4Y2QA 2I54A 3DAOA 1IWOA 3QUCA 5ALUA 2Q4RA 5ALKA 5ALEA 3OPXA 2C88A 3N5KA 1RLOA 1X42A 3FPBA 2R8YA 1RC8A 1TA0A 4OHFA 3EF1A 5AKYA 2PR7A 4QJBA 2I7DA 2EATA 1CQZA 2JARA 5AK5A 5AI6A 4Y2YA 5AM3A 2C8KA 3RFUA 1RKVA 2G08A 3P96A 5AKEA 5AK4A 2WFAA 2B8EA 4Y2TA 5AVWA 5ALMA 1N9KA 1U02A 3NALA 4F72A 3A3YA 2BY4A 4HGOA 4IFTA 1WR8A 4QQFA 1O03A 3EF0A 4KNVA 1L7MA 3DV9A 4O8CA 1TJ3A 3SKYA 1TJ5A 1Z4NA 1QQ5A 4BEWA 1ZRMA 4KN8A 2R8ZA 4EELA 2IA5A 5AM5A 2YMPA 2GO7A 3ESQA 4NV0A 5FP0A 5AIBA 1ZS9A 1WZCA 5ALDA 4EX6A 3QU2A 5ALJA 4RESA 4I9FA 3AR3A 3AR6A 2CFRA 3B8EA 3HLTA 4ZEXA 3QLEA 3ZWDA 4YIKA 1Q92A 2BDEA 5ALGA 2YMLA 4OCZA 3QXGA 3ZW7A 3L0BA 1RQNA 1K1EA 5AM0A 5ALVA 3WGVA 1NRWA 5AW4A 4HGPA 5AKHA 4B6JA 4FYPA 5AVQA 1Z4QA 2EARA 3NANA 3WK5A 2NO5A 1T5SA 1VJRA 4UM5A 3ZVMA 4CE6A 3OCYA 4GXTA 1RKUA 3MN1A 4XOUA 1O08A 2B82A 4CF5A 1Z5UA 3E84A 3MC1A 4KX3A 4Y2PA 1RRCA 3W5CA 1LVHA 4H1WA 3KC2A 2G09A 2IOFK 1ZD2P 4J2TA 5AKZA 3ZX5A 4Y2VA 4CNQA 4UATA 2FUCA 3WK6A 5AK6A 4L57A 2FI1A 1XP5A 4C4RA 5AK3A 1RMYA 2B0CA 3OCXA 1ZD3A 3SLRA 4KX5A 3ONNA 5JJBA 2IOFA 2I33A 4NABA 2C8LA 3IJ5A 3M9LA 4BEVA 5A3SA 1L7OA 1MH9A 1YNSA 3ZTYA 2BDUA 4GIBA 2WM8A 1AQ6A 2WF6A 2YMMA 5ALTA 2W43A 2OM6A 4XQ0A 2RARA 2Q4TA 1SWWA 3NAMA 1QH9A 2FPXA 5AW6A 4HAIA 4CF3A 2HF7A 3VAYA 5ALNA 1YV9A 2PKEA 4DW8A 3ZX4A 1ZD4A 5AW8A 3NASA 3FGOA 1QQ7A 4EEKA 4EX7A 1S8OA 3UMCA 5AVUA 3WKDA 1LTQA 2P9JA 3W5AA 4AP9A 1J97A 3QGMA 3B9BA 2G07A 1F5SA 3L0YA 2YMQA 4ZEVA 5A3RA 1RLTA 3DNPA 2YBDA 3DDHA 1TJ4A 5ALIA 4YIHA 1XVIA 4OD0A 2W4MA 3OCZA 4HGNA 2ZBEA 2FUEA 3D6JA 2G06A 3M1YA 2JAUA 3U7HB 3ZVNA 2C9MA 2I6XA 2YJ5A 5AVYA 2WF9A 3BA6A 3TLMA 3U26A 1ZJJA 2CFSA 3EPRA 4BNDA 2IYEA 3W5DA 1YMQA 1NF2A 2D2VA 3L8HA 4HGQA 3KBBA 5ALFA 2WF5A 3L8GA 2OBBA 2O2XA 2AMYA 5AHXA 3KZXA 1RPZA 1Z4JA 3OTQA 1CR6A 3E58A 3SF0A 3WGUA 3OCVA 4YCNA 4UW9A 1RMQA 2G1AA 5AVVA 2GMWA 2YY6A 1YDFA 5T41A 3ZWKA 2I55A 2R8XA 3I6BA 5ALRA 4L6CA 3UM9A 2FPSA 3QUTA 1L8OA 5AW3A 3F9RA 1N8NA 5AKLA 4I9GA 1Z4MA 2RBKA 3R9KA 3QU9A 4Y2SA 3I76A 3L1UA 4UMFA 2OA0A 4BKMA 4JB3A 4AS3A 2JAOA 5ALLA 4DCCA 2B1RA 5IS2A 3CZ4A 3U19A 2G80A 1WPGA 4YCMA 4G63A 4IG4A 2CN1A 1TE2A 1XPJA 1T9ZA 3WK7A 2FDRA 4E88A 3HYCA 5AI5A 2JGAA 3N07A 4BX2A 1U7PA 3L7YA 1L7PA 2NYVA 3NUQA 2CFTA 3L8EA 3A1CA 4BNDB 2MU1A 2YJ3A 2HOQA 3AR9A 2QYHA 4G9BA 3IRUA 2AUTA 3W5BA 3AR2A 1VFPA 5AM2A 3ET5A 5AVSA 5AVXA 3WKEA 3MMZA 2HSZA 1YJ5A 3QU4A 4OFZA 3ET4A 3IB6A 3WK9A 4KYTA 3B9RA 5AKXA 3QNMA 2FPUA 4AS2A 1Z4OA 3N8GA 2YFYA 3AR5A 2HHLA 1RLMA 5ALSA 2G0AA 4UAVA 5AW2A 3QUQA 1VJ5A 5ALWA 1L6RA 3I28A 2WHEA 1Z4LA 4XPZA 2AGVA 5IT4A 1Z4IA 4UMEA 5AI4A 5AI8A 5E0OA 3RF6A 2YJ6A 3I1YA 3PGVA 1SU4A 3L1VA 4YGYA 3R4CA 3NIWA 1L7NA 1J8DA 3ZVLA 5ALXA 2ZG6A 4YH1A 4EENA 1Z4PX 4NFLA 1Z88A 1U2TA 5AICA 3UMGA 3E81A 2C4NA 2ZOSA 1WVIA 5ALHA 2O9JA 5AM1A 2W11A 4L6AA 1Q91A 5ALQA 3PDWA 1ZRNA 1NNLA 4UASA 2GHQA 1Z4KA 4UU1A 5AKGA 3QYPA 5AI9A 2B8JA 2HO4A 1KYTA 4Y2XA 3L0CA 2FPWA 5AW9A 2GHTA 3ESRA 1PW5A 3QU5A 3AR7A 2IOHA 3E8MA 3MPOA 5AM4A 5AKIA 3A1EA 5ALZA 3NRJA 1RMTA 2HCFA 3QU7A 5AI0A 1QYIA 2R8EA 4BYGA 3ZTWA 4FFDA 4F71A 5AKJA 2P27A 5ALPA 2MSNA 4KNWA 1RQLA 2B30A 3FVVA 2HX1A 3L8FA 4HYTA 3U13A 2GFHA 3QX7A 2YN4A 1L8LA 1RDFA 1ZD5A 5ALYA 3FM9A 3FZQA 3KD3A 3PCTA 3L5KA 4FE3A 4JDPA 4BBJA 4ZEWA 3PGLA 4YCLA 5AVTA 1JUDA 4UU0A 3UMBA 4DFDA 3R09A 4C4SA
chains in the Genus database with same CATH superfamily
3OBBA 1VJDA 1DBWA 4TV8B 1IPFA 3BBLA 4C4OA 1QPGA 1OKKD 4FX2A 3G7SA 3EIXA 5GVRA 3V3KA 5DHPA 5EQFA 1D4OA 4M0FA 1R0LA 4WT7A 4F6CA 3B1ZA 3G23A 1PL8A 3JALA 2OQIA 3TVTA 4DNOA 4F1JA 4Z3OA 2Q1YA 3DEHA 1RWBA 4KXFB 2WJ4A 3I0MA 1ZM4A 2Z58A 3KOOA 3WL7A 4I8IA 2GAIA 3KSRA 3FN4A 4U9IS 1SHJA 2FRXA 1TYAE 1Y1PA 4TM8A 2NO4A 3GQBA 4ND4A 4NV1A 3SKXA 3I5YA 3ETLA 4MYCA 3D43A 2WB2A 4A5OA 2FEOA 1L1QA 4LVOA 2WHPA 3G2QA 5KOYA 3S7TA 3RC8A 3T7KA 4L0QA 1OYVA 2WTBA 1BJRE 4K7JA 4Q7LA 1IAVA 4URHA 2SKDA 2Z1MA 2RAVA 3P2EA 4Z9BA 1PZHA 5HK8A 3FOBA 4A7PA 2YUTA 3CNQS 3EFOB 4BC0A 1GU0A 1YQTA 1YVPA 2QTTA 2Z1NA 4UNNA 1S8NA 1XZNA 5DNWA 1P17A 1OAAA 4NBNA 1OZAA 1DAOA 2RI6A 4LQCA 1U0FA 3T7DA 2PKXA 3K5HA 3BEDA 3D6HA 3DVSX 2ODEA 3O3NB 1OLSB 3WGZA 3THXB 3B1KA 4PRYA 4EKGA 4RA6B 3CJQA 3UWPA 1UK9A 4EMBA 3R4VA 2QTHA 2JGKA 1E1QD 4BLRA 3NU1A 1TD9A 1FQOA 2IU4A 3OY2A 4M1WA 1VPWA 1PNRA 2D74A 2P1ZA 2DBZA 3BK7A 4CMIB 1J5XA 2DYKA 3M5PA 3SQMA 3ZHBA 1ZGBA 1KKUA 2LNDA 2ODAA 1JDTA 3E7XA 1IN5A 3RJMA 1VBMA 2UAGA 2ZBFA 4ZYLA 4NYIQ 2A1UA 5DLQC 1Q6ZA 3VNAA 1BDBA 3OZGA 3PG5A 2VXBA 1Z68A 4OAPA 3RLFA 5A2QA 5AUPB 2OV6A 1LDNA 2GI4A 4FEYA 4YN3A 2QWXA 3EGWA 4ES6A 5JIBA 4PFKA 3BZWA 4I4LA 3VTAA 3QUCA 3Q9SA 1OGJA 3QHQA 4ZIRA 4H4EA 2ECFA 1A69A 6Q21A 4TWBA 1F38A 2APJA 4N6GA 3TNDA 2GA8A 4BV8A 1YA4A 4CKBA 3L0ZA 1G20A 4QEKA 2NO0A 1BWPA 1P2VA 2ZRNA 3IPRA 3MAAC 3QM1A 2AOTA 4IDHA 5ARBA 5KJ6A 4Z53A 3CW8X 3SHFA 4US1R 2V7WA 3IBYA 4DCUA 3FTPA 1PJ4A 3EF1A 4BV9A 4OHWA 1SXJE 1TFRA 4I08A 1C0EA 3NHZA 2XWQA 2ZIZA 3OEWA 4LRYA 4CETA 2P9TA 1UP4A 4IMIB 5L3ZA 5LLDA 4ZYVA 4LMPA 2EATA 4FGLA 3SMQA 4HAOA 2BHSA 1X7WB 2BGMA 5EP1A 4K9MA 3NG1A 1R6AA 2ZT8A 5T4BA 2G28A 1P4HA 1ZI9A 3EVZA 4YP0A 3V1KA 1VKRA 5DB4A 5JT1A 4XM0A 1W52X 3UB3A 1L7BA 5AVWA 1QE0A 1P7VA 4MQFB 3DO5A 4B33A 1RABA 1TK3A 1ZOOA 4O1IA 4LSZA 4PLYA 1IEXA 3KTAB 4KQXA 2WR8A 4F2DA 3ZGXA 5ANRB 1FYDA 1DXQA 3PHIA 3HJFA 5J2UF 2AYZA 3FYSA 3QF7A 4ACAA 3MJRA 1FRZA 1IRXA 4MVJM 4RMGA 2W6NA 4CFYA 3I45A 3A70A 2H17A 1VBKA 3HSYA 1IWBB 4X20B 4MJXA 5REQA 5B4UA 1B3RA 1CJCA 5FP0A 3UJHA 4C07A 8OHMA 2WKSA 2F8TA 3DV0B 2AFRA 1SHZA 3KM0A 2W2QA 2H2DA 4TZ6A 4G8DA 3CPHA 4IWXA 3AEZA 5C1BA 4CDMA 2UZ4A 3C3WA 3ZH2A 1ZY2A 3D0QA 1KI3A 4HEA6 1QYXA 2V7GA 4KUEA 1N9GA 2BDEA 2ZQ5A 3GROA 3HPRA 4FXOA 4R0MA 2YH2A 4TVSA 1IVSA 1E5QA 3ZW7A 4M1ZA 3NHWA 1NASA 1P73A 1Q20A 1ILEA 3QVGB 1VP3A 1F3LA 5AM0A 4J1NA 1LY1A 5DPMA 5DYWA 2DQYA 4TYQA 3HBAA 4E94A 3R5JA 2IYWA 3C5HA 1X1QA 1JR2A 2O06A 3S28A 3ON5A 3GFQA 1EK5A 5DNEA 4LDQA 1UK8A 4NZOA 2G88A 3L1IA 4IXNA 2X0DA 4LHVA 2FWBA 2RHCA 1XTIA 2L19A 3J81A 3GBVA 3FTFA 5AJYA 2GZ1A 3MXOA 4QELA 3KKMA 4Y1EA 3C3AA 4FYJA 3W9YA 1SUEA 4U5XA 1JHQA 4K6KA 1C3VA 2NO7A 4F93B 2B82A 3E15A 2C61A 2JHFA 2OAQ1 2H59A 3DBRB 1NVMB 2OESA 1YIOA 3DKIA 4DANA 1U99A 4TTIA 1PV4A 1V35A 4RDIA 1WAMA 3BXOA 2UUOA 3OX2A 4O4LF 1TJNA 4R51A 5HF9A 2RHTA 1NKSA 5IZ4A 3QX3A 2RH8A 2G63A 1CS4C 2GF9A 2RIPA 3SZMA 3QHPA 1L5WA 2DZDA 2ZSJA 3DXXA 5AKZA 2HBQA 4HN9A 4UTOA 5BV7A 2HIMA 2ZI5A 3DYIA 2Q27A 2WKWA 1V8ZA 3I72A 4IIUA 2VS1A 4IGEA 2GM4A 3FWNA 3RADC 5K5EA 1AUQA 5HMMA 4Q9JA 4K88A 2HH9A 5FTKA 3ODPA 3ZIAA 3RROA 3CW2A 2R8OA 4AICA 2H1WA 4BP9A 1ZNZA 4GLFA 2BFEA 4Q9LA 2AKYA 3VPSA 1WCWA 1RI1A 2GT1A 5KSZA 1AS3A 3M2PA 4AWXA 1IN7A 3ONDA 1RYEA 5F3WB 2VQEB 2K7ZA 2Y99A 5LQCA 2ZE8A 4Q24A 1CUXA 4KPUB 4YFVA 3KUKA 2WWTA 1IIBA 4HLCA 5IWCA 4IRMA 3WLHA 3IHWA 3AZPA 1QWOA 4GQBA 1HQCA 4X54A 3PNOA 2C99A 2IYUA 1Y8RA 2OM6A 2G9NA 3QWBA 4CU2A 1L4KA 1IBCA 1Q1GA 2Y2VA 2OBNA 3A1FA 3E9ZA 4FW9A 1Y6ZA 4LXIA 1QO7A 3W7VA 1Q16A 1Y9EA 1EHCA 2RGYA 4BV3A 3F6EX 1IHYA 4G24A 3KLMX 3HY6A 3N7UA 3HJTA 1FMJA 3LT1A 1ZK0A 3IP9A 4KDFA 1B74A 3OAAA 2QRPA 4P5EA 4BKRA 1KAHA 1L3IA 3O9ZA 5LYJA 3K1JA 1EINA 3A4NA 4NU6A 3F3MA 1XO1A 3TUJC 1ZONA 4EEKA 1SR8A 2F8LA 4JSTA 5KDDA 4YCJA 4Z4HA 2VP3A 3EFBA 1C9DB 3AKCA 3NIBA 3T5BA 4F2PA 4G89A 4WKOA 5L40A 3NJ8A 4ND1A 1RIIA 1JG7A 2GFIA 1AGRA 4LEIA 3UJ3X 1BXZA 2BH2A 1W36D 1TM1E 1HLGA 2VDNB 1T4BA 2JZOA 3GJ5A 5BQ3A 4FFNA 1XCMA 3W5SA 1O4WA 1XVIA 4P36A 3HN2A 5EFOA 3CFYA 3W5JA 1CERA 2WINI 3OOYA 4FOTA 2BGKA 4JVMA 4TV9F 1S2GA 2QMUA 1ACLA 4FONA 1PR2A 1F20A 2RHDA 3QE3A 5JLJA 3KU1A 1FDRA 2WF9A 1HK7A 3KB8A 4TZKA 2X3UA 3QKRB 4KQWA 4NR0A 5DOZA 3VC2A 3STHA 4AJ4A 1UPAA 4WXEA 4MQEB 1J8MF 2J0QA 3CJRA 2GXSA 2V55B 3TTTA 1QK4A 3MHTA 1S1CA 3ILSA 2PJZA 3OI7A 4GEKA 3A4YA 4J4BA 4UCXA 3MTJA 4CDNA 3ABZA 3LD9A 2IDZA 3IHKA 1ZMOA 1XTPA 1OW3B 2C9OA 1ITZA 4ZOAA 1V37A 3X0DA 3SCZA 4G5YA 4WV3A 1EGVB 3BQ9A 4I14A 3VPAA 4FK8A 2DFNA 4RADA 3UAGA 2Y6VA 5TXGA 1P75A 1SPXA 1RTKA 1UJMA 2BP7B 3R7WA 2BFOA 5EJMA 2R7NA 3M4YA 4DXDA 2QPTA 3CRRA 4PCUA 2BFFA 3ULKA 4B4WA 4B9AA 1QIHA 1S3SA 1CUVA 2WYHA 2VHTA 4E15A 5KKCA 3QFSA 1PJQA 5G1OA 3V46A 3ZY5A 2VWQA 2JGJA 2QUHA 4E2FA 1JT9A 1N0UA 2F3RA 2TSYB 3S2FA 2C7RA 2QD4A 2WWHA 3U4IA 2IE0A 3T7IA 4A6PA 3O8QB 4MQMA 1BMQA 2I5PO 2XOKA 4BGDA 2VP5A 1B15A 1TJYA 3T1HB 4F12A 2AD5A 3II6X 3Q87B 4HTFB 3W7BA 2PUGA 1DAKA 2I87A 1T6YA 3BTSA 4QATA 1Y7IA 4M1KA 3AJEA 1IE3A 4WJKB 4I5DA 1YQEA 3DB2A 4C4AA 3L1UA 3VBEA 5LZ9A 2BKAA 2A92A 5GJVC 5EIFA 2E82A 4RVUA 4A6DA 3TJMA 1IM5A 3AETB 1LZLA 3L0SA 1X1SA 1DAIA 1SUWA 1TPYA 4QXAA 3VTZA 1LK5A 3BWBA 2DWOA 2I4OA 5D51S 3BWCA 1ISFA 4V0OA 4Q1FA 3TFWA 5TGTA 1AF7A 1K86A 1XJQA 3NXKA 2CC2A 3QVXA 4BMVA 1TD1A 4E2ZA 2GCGA 5IARA 1P5HA 1Y8QA 1Q6YA 3G88A 2J3MA 3SC3A 1M67A 1UXOA 4G1EB 3EDQA 3GT4A 3AO0B 3FHCB 3I2JA 3MWGA 3U0BA 2JI7A 1G17A 3B89A 1PTJA 2CNLA 3MBOA 3RLIA 3DLTA 5C8ZA 1SOAA 3QF4A 1V1JA 3OM9A 4F3YA 1TYBE 1UJ4A 3M6VA 3RRZA 1V71A 2VRWA 3HKDA 2RAUA 1VMDA 1T1JA 1ISRA 2JGDA 1OOEA 1NGSA 1TVKA 2D7JA 2ZAIA 3FDXA 4HNSA 5EXTA 2PANA 3VTFA 1F2TB 3GELA 5I4KA 4Y6OA 2GYWA 4LYAA 3TZKA 5F9MA 2PR2A 1YU9A 1E2BA 5CIWA 4R05A 2VJLA 3UG7A 1CF2O 3KQNA 2PN1A 1KYVA 3EDRA 4RCVA 1TK2A 3PL5A 1GL9B 2J48A 2I3AA 3HHEA 1TU3A 4MWEA 1A4RA 1CJVC 1QFJA 2M32A 2ZRCA 1PTJC 2FMXA 4CEHA 4BMCA 1Z0DA 3R40A 3HEAA 3HH8A 1L6RA 3WIEA 1TLFA 2WHEA 1UZUA 3K9NA 5EXEA 2GCOA 3V8MA 1P0MA 8ABPA 4M88A 4A0QA 5E7QA 1VM6A 1VRVA 1AUPA 1J0BA 1Z13A 3LPAA 2AG0A 1N7GA 1SU4A 2R1TA 3T0IA 1EPUA 1FC0A 1RYZA 3TB6A 3GXBA 5L3VA 2OV1A 2GFQA 1GUAA 3HA7A 4OUKX 3T8YA 3WGHA 5E2IA 3DR5A 3OQMA 5E3JA 2QZSA 2PZKA 1MW8X 2O8BA 4YH1A 4ZICA 5JALA 4Q01A 4HNUA 3KL2A 1P8AA 1YRHA 4CL3A 3WV4A 4LBYA 3BERA 3F2VA 2HJGA 1QLJA 2X9VA 3U1VA 3WYDA 4YJ2A 2GCPA 1UBUS 1YGYA 2IYTA 3WHLA 4YRBA 4Q4JA 2DLCX 4RY9A 1FU8A 4DCPA 4REQB 3HXMA 1CEQA 1EUQA 2QTVB 1D1QA 2ZKIA 5DM0A 3WTCA 4AM8A 4POOA 2BSQA 3F47A 1JJVA 1COWD 4E11A 5CFLA 1MHTA 1JFVA 4V38A 2HA0A 3G7NA 1Z7BA 3P9YA 3C6MA 4KQHA 5CXUA 1NYTA 3AV0B 3PC6A 4PM4A 1VL6A 4KNYA 2QR3A 4UC0A 1FZQA 3S1AB 4IIJB 4BVLA 1XMPA 5H70A 2WY2D 4N5MA 4K6HA 1BHO1 1JIIA 4M46A 1E1KA 5HZMA 1YHZA 3FUTA 4C76A 3MPOA 4CQLB 3DPSA 1FUYB 1DADA 2CZQA 5IJWA 4DJ5X 2BHNA 2QSYA 4UZFA 2PS0A 2BI4A 1E5VA 1A9XA 3VHXA 2TYSB 1GFIA 1H2ZA 1V3UA 5KKAA 1HM5A 4Y18A 4GL2A 3CF6R 4QVGA 1KH1A 5JAOA 1JDPA 2ZAYA 5A05A 4CL8A 3HV2A 2E3JA 1OH8A 1XWFA 3NDRA 4PBTA 1DE0A 1YE3A 2WAXA 3R77A 5IBPA 1ZD5A 2XGSA 2ZR8A 3JQAB 3SE7A 1XVVA 2FWPA 2MR6A 4B80A 2C03A 5JAIA 2JLCA 1T4CB 2GLTA 1TQHA 4LDZA 3SJUA 5A2GA 5ETJA 4FBGA 2J31A 4AN4A 3PQ2A 2XUAA 3QITA 1T10A 2I3DA 1AH2A 2VH5R 1FVHA 2O05A 2YJGA 3SIXA 3HKBA 1EZ1A 3LW7A 3OLYA 3RRXA 1CC1S 2QDKA 4MW0A 4OXNA 3U7QB 2FUNB 3KSDO 1F8YA 2HSGA 1JV2B 2OD9A 3LECA 4D97A 4I4CA 3E5RA 5C8DA 4BX3A 4I1OA 3PXGA 3S68A 4UPEA 1TQ4A 1XDSA 5IT0A 3QOWA 4IHKA 4JSRA 4MW4A 4E1BA 4IX1A 3CUWA 4KGZA 5KAPA 2BMEA 1GRRA 3EAFA 4YMLA 1V5GA 4KXYA 3BMCA 3HWWA 4WJZA 4Y2RA 2W93A 2NTNA 4E13A 4GM4A 5DV9A 4A03A 2OHFA 4WXPA 1G1MA 4OU5A 4E30A 3P2MA 1N2EA 1D2HA 4RETA 2PZGA 3BB1A 1CNEA 1H2RS 3IAS1 4JWTA 2FVYA 3HP7A 621PA 4R1QA 3IAAA 4HADA 4WNIA 5A1TA 2P3OA 4YRSA 3SQWA 4TYMA 3K6JA 5KX5A 4UM7A 3I1FA 4R8SA 2AX4A 2BR4A 2XKAA 2CL5A 3LZCA 2X8JA 5IXJA 3PC2A 3FFXA 2EKQA 1CUEA 4G5RA 3IIIA 3WADA 1QGOA 2X9LA 3B5EA 4FMBB 4O4JB 4DZTA 1TCUA 4EW3A 3DBLA 2J9XB 2FK8A 3U7IA 1IEWA 2MR5A 3BWMA 1QMPA 5G02A 1GCUA 2V4UA 2ZGVA 5ICSA 1A7KA 1AKQA 1ZUIA 1QCZA 1PDOA 1RYMA 2AI1A 3A1TA 4O2BA 4RL4A 4DMRA 2YHIB 5EL0A 5A1JA 4X0EA 5CDUA 1K66A 4Q3AA 2Q41A 3CCBA 1A2QA 5BR7A 2YS7A 5BW5A 5ADVA 3ZDFA 3SMVA 1U28A 2ZIGA 1VHQA 1MLDA 1FDSA 3PNMA 2ECQA 1MC1A 1FYFA 4F3RA 3L79A 1GGFA 4I4TF 1RKQA 3J81k 3NATA 4EB0A 3CNHA 1FFSA 5JO0A 4I1UA 2QVYX 3B6EA 2XA2A 3LC0A 1E4EA 5F2KA 1FRVA 2HBZA 2O2IA 1PQYA 4GMGA 2QMZA 2D3TA 4L15A 1AQUA 3JD4A 1E1CA 3HUFA 1UEJA 4TTJA 1DNPA 2JZNA 4X7RA 4EY3A 4FZJA 3DFZA 2PX5A 2BM9A 1X6VA 3OIFA 1VMIA 5BSVA 5JJLA 1RQ7A 3I3SR 5IAKA 5ICGA 2BFCA 3IUBA 3IOYA 2ODPA 4BB6A 4D3FA 2G1KA 1IN8A 1DEAA 5I8WA 3B38A 1JQDA 1Z18A 4NWIA 1U28C 3TBFA 3Q8LA 5C9ZA 1AZWA 5JVDA 1ULHA 3G79A 4RS4A 1VCHA 4K2HA 3LM8A 4PC6A 1VCNA 3O3CA 3QLUA 3PXXA 5FD8A 2Z08A 2FQWA 1H2AS 2HO5A 3T3EA 5AXAA 1W85A 3KB1A 5CPFA 5IC5A 1EFAA 3KOXA 3V1YA 2IQ5A 2RH9B 4OGGA 1LGYA 5G1PA 5TQ2A 5A4KA 2WKRA 3KQMA 2HLHA 4ON9A 4Y9DA 2Q4OA 2O48X 3PHCA 2GBGA 3PXDA 3GX1A 2A0FA 2Z56A 4GO1A 4UPVA 3V1UA 2Q0XA 4X3CA 3W77A 2R6HA 2YXLA 1SC3A 3TW0A 1U6JA 1RZUA 2QAGB 4EJ0A 1U9ZA 2BFBA 2G5GX 2HMYB 2LPMA 2Y0EA 3H4TA 3L43A 3OFKA 2QIOA 5AP9A 3KYDA 4BP1A 2X6RA 1FVFA 3IAHA 2Z3WA 1CQZA 4GRIA 1SXPA 1KDYA 1RAFA 4B40A 4CQMD 3GFBA 5IYZB 4WZBB 1T3LA 4FPXA 3EUAA 2X2PA 5AJZA 1MABB 1V9SA 1FJXA 2ZRJA 4QX6A 4MUKA 4G0WA 3JAKB 1C9YA 1Y1KE 3PXAA 2GEJA 3PX7A 1A9QA 4ZEMA 4EOGA 2VBFA 5JD4A 4JVLA 4KJZA 1MTZA 1NZDA 2BY4A 4MVJF 1QG0A 1Y63A 4IFTA 4MUGA 5GGYA 2WAAA 1T5IA 4B2IA 5TY0A 4M8IA 4PYNA 1X1RA 2XOEA 4JLVA 1Z4NA 5LZ5A 2OCGA 4BTVA 1FJHA 1T35A 4NH4A 4PU0A 3ZXUB 2IA5A 1WKVA 2HLDD 4DF3A 3BIOA 3ESQA 5AIBA 4XLZA 3RE1A 1AKMA 3ZU3A 2WRZA 1GZ6A 3QMMA 1XA4A 3QU2A 1OAOA 2P77A 4JJEA 3OQVA 1D0IA 2RHLA 1VLJA 3DZGA 2W6CX 4O59O 4E21A 1GSAA 1CHNA 4LV6A 5A4JA 5HRAA 5F1PA 2V3WA 3O73A 1U11A 1TCBA 3ZWDA 2VUSA 1ZOSA 3FCUB 3MQFA 3D3WB 4BJ6A 3R6LA 4ARSA 1SA0B 4L50A 5DX0A 3F6RA 4YXFA 4JLKA 4MKRA 1BFDA 2I2DA 1OPXA 3QXGA 1C7EA 1WB4A 2QTNA 2XUHA 1Z6TA 4RVFA 2A30A 1ISIA 2WVHA 2HK6A 2HWUA 1A96A 3TD2A 4JP8A 3LY7A 3DDNA 3K72B 1KBOA 5E1OA 3GLRA 5E7JA 3C3YA 3S2SA 1PD0A 1N2HA 4CG3A 3LK6A 4ZQIA 3I34X 1DFHA 3CH5A 1K5PA 1I6WA 3D9QX 4Q9IA 3BD9A 4QBTA 4XH9B 1OAOC 3MGGA 4J4TA 4R2WA 2OFXA 2ZZMA 2W6JD 1XALA 1Z0KA 2WOJA 5EKUA 3ZBQA 3UPUA 4ZD6A 2AOUA 3M49A 4HMQA 4Q7MB 4ER0A 1J56A 1Q3KA 3IULA 2PUVA 5JARA 3G8DA 2CWWA 4P7GA 3PITA 3RIEA 1T29A 1J2TA 1N2BA 2DHDA 2KS6A 2BGJA 5KTSA 3HZZA 3NHRA 4D45A 3L8YA 4KK3A 3KB2A 3UJ6A 4H08A 4BB9A 3AI2A 2GZAA 1L2TA 4HWTA 2IT1A 4JVNA 1K4MA 2ZT7A 4OF4A 4D57A 3KJHA 3WAKA 3WL8A 1GTL1 3B6ZA 4A8HA 4G67A 3QIVA 2Y68A 1NA5A 5AK6A 3UATA 3TSCA 1Z2NX 4AX8A 3X1YA 4PXAA 5C5CA 3MTGA 1JWAB 4DCSA 1LPPA 1HRKA 3WL6A 1V8OA 1I3KA 1UKCA 1AB5A 4MHSA 5BYKA 1MT3A 3OZBA 1WETA 4BPBA 2GPTA 3ERCA 2QIPA 4MICA 2OHJA 2RD2A 2KLHA 4QUHA 5JS6A 1FYXA 4P8RA 3V97A 4FGUA 4FSDA 2WJHA 3IEUA 3RVJA 3NJ4A 1GEGA 1JIUA 4YRRA 3TMYA 4GXQA 3UMVA 3D2LA 3JVIA 3KAQA 3F6BX 3JATB 1GPUA 5JPIA 3O4JA 4NIMA 2PGOA 4C0HA 5A4DA 1UOQA 1WZNA 1U2DC 2PQ2A 4DGSA 1S2DA 2CLEB 2JFPA 3HKCB 3IBTA 1UWKA 4ZPJA 5AVOA 1Y1QA 1DUVG 1OWLA 4P7KA 2R5WA 5HQ3B 5DHRA 5FYQA 3QA9A 2DAPA 5BSRA 1Q7TA 4KSCA 5IRCD 3MCTA 1KXZA 3LTEA 4FJ1A 1P4AA 1SOMA 3QJGA 4DDMA 3AHGA 2RB4A 2QLMA 3GEPA 4JYBA 3T9EA 2C54A 1A9RA 1XRQA 5GM2A 1ZLYA 3L4SO 2I65A 5FULA 1Z5PA 3JQ6A 5BNIA 3AG5A 5L9AA 1X38A 3H9BA 4ANFA 1CP2A 1VL5A 3NX4A 1K6EA 1QC5B 3GVPA 4WZZA 1Z25A 1NVXQ 3AV3A 1QE3A 2NU7B 3B48A 3K4QA 4OHBA 3SSNA 2QX9A 5FADA 3VR5A 3TWOA 2VEDA 3L6RA 1T9KA 1EXWA 4MGKR 1YWGO 2BF4A 5P8WA 5JNTA 5IDQA 2W0SA 2BKLA 1A72A 3ECCA 1RXSA 3CTPA 5BSMA 1YC5A 1BE0A 4JDUA 2FPGB 1M2HA 3HBNA 4QO7A 5DEOA 3RUEA 1ZIPA 3WMWA 3TXAA 2CEKA 4WERA 2YZGA 2UYHA 4P22A 2HZ7A 2DQKA 5IXSA 2M1ZA 3ILVA 4YONB 5LCXA 1FX1A 1EIZA 1NJ5A 3MA0A 5JZSA 3R7LA 4DPMA 3PTLA 3JXEA 3WJAA 1CXZA 3EEOA 2HU8A 4YWJA 3IUNA 1G9TA 3L8HA 1OV4A 3VSDA 1DKLA 1JBEA 3SQDA 3L84A 2HA5A 4E14A 4Q5IA 4RK6A 2O2XA 3GJ7A 5JD3A 1IC6A 4B3DA 2E87A 5C5DA 2E4ZA 2GF0A 1CPYA 1Z6XA 1LLUA 4B1FA 2RKBA 3GAAA 4AJKA 3B82A 5CLFA 3E7WA 5DT2A 1CY6A 1HMPA 5BRAA 1GFWA 2XDQA 1G21E 3FCXA 1JHOA 2BCGY 3PPYA 4FZ5A 2O2EA 4ZARA 1T34A 1PJSA 4HDNB 2V3VA 4MTCA 2H3HA 4FDUA 1MXHA 1PW7A 2UUPA 3VVLA 5T41A 4C7XA 2EWMA 2X1HA 1MENA 4IJWA 1M1YE 1GR1A 1USUA 3TVDA 1FTGA 3ZIAD 1T2EA 3ANSA 1SBTA 2HQRA 3FMIA 3PUKA 2MDTA 5LP1A 1RJWA 3UMYA 3D6MA 1JKJA 1V5IA 1R5BA 3WIDA 2H1IA 1PX2A 3QPVA 4IW3B 4UUAA 4DZRA 3RVQA 2WIJA 3OZFA 3QG1A 1XZEA 4Y2SA 3RHZA 4DDUA 5HWSA 2ZJBA 3O93A 5HGXA 2XUFA 4JJFA 2NZ2A 3DT6A 1K7YA 2ENUA 2ID7A 3Q7TA 4GE0A 5I8ZA 3ZBTA 3OVMA 4MWZA 3F4KA 2IYPA 4D56A 2VKTA 3LLMA 1QIKA 5KNDA 2H2FA 2D5IA 4I99A 3M5WA 5CT6A 1YR3A 1KFEB 2AZDA 2PT5A 3DWFA 1IY2A 1HE4A 3G13A 1REQB 4PFSA 2F3QA 2VTVA 4KMMA 2FDRA 3DW1X 5GIPE 4HY3A 1C8LA 1PCXA 4BX2A 1TKCA 3OAAD 2GS9A 5D85A 1U3UA 4HDAA 4CW7A 3OE5A 2YXNA 1Q1NA 1V8BA 2YHAA 3A6EA 3BH0A 4RDHA 4DCMA 4R2KA 2B37A 3BRQA 1KKLA 4CBVA 4K6FA 1AS0A 3L4EA 1J49A 3FJYA 3K1YA 5DM4A 2OKGA 3KB6A 3W5BA 1U8ZA 4MKGA 4D74A 4Y2HA 2AXNA 3FNGA 3LKBA 4JGGA 4W8GA 4C06A 5J5CA 1Z06A 4Q34A 1NYLA 4CMBA 3VKWA 1U0TA 3E7FA 1VMAA 3IESA 3I4FA 4RE6A 1W8DA 1SVWA 1F1BA 1GQQA 5DDIP 3ZWYA 4FX5A 5DN9A 1TAGA 5JZMA 4HNAA 1JEEA 4I5EA 2AZMA 3M3DA 3QNMA 4EHLA 2QX7A 4ABYA 4YMGA 2FPUA 2ZVDA 5HDBB 1R8YA 3IKTA 4UXIA 1VE5A 1XGKA 1E3SA 4RIFA 1XA3A 3A28A 2GRAA 4LYFA 4LOIA 1GGMA 1UIMA 4XD7A 3UZUA 2P62A 4G0VA 4DUGD 1K63A 5LDDC 4DYHA 3MOSA 3NQ41 4RGBA 1XDZA 3EZ7A 2OYRA 1JT2A 5CNKA 5JSQA 4TYNA 2OMKA 1QAQA 2H1RA 1XXHE 1A04A 1PRYA 3RBZA 3RYHB 4E4YA 3U4MA 5KU1A 2Y27A 5DW0A 5DNCA 2DKFA 4ENVA 2HQSA 4J9UE 4ACBA 5F4BA 3B6KA 3WDLA 3VSCA 2G5PA 2NU8A 5J47A 1C1DA 1PP4A 3LW8A 1M75A 2YW2A 2X9NA 3CSSA 3FF4A 4G97A 3C4JA 4QFCA 1Z63A 2AEMA 1MRSA 5JJIA 3NRBA 3LA6A 3HCCA 1FNNA 5GM1A 4BRWA 2PLAA 1EFPA 1J5EB 9ATCA 1E98A 1JHRA 3HEMA 5G4KA 1A76A 1GCIA 1ORIA 4XGNA 3VOBA 1N34B 2PQMA 2ZAOA 3KP1A 2X0FA 1O57A 4KO8A 4DV6B 1KMIY 4JYCA 4V0QA 3INGA 3R9XB 3IDFA 4OL9A 2J1LA 4RVNA 2QMOA 1ZUNA 2BLNA 3TSOA 1SVOA 3D4OA 2XMQA 3E6AA 1MAUA 2Q1SA 4LS3A 4BLVA 1BDHA 1Z15A 1KQFA 3FGNA 3D0KA 4KSYA 3OKAA 4BX9A 2QU8A 3ANTA 4DRYA 3KS9A 1PVDA 3L0CA 3PKZA 2D2EA 3WQBA 5EQDA 2QVLA 2PKQP 1DI0A 4HXEB 1MX1A 5F78A 3RO7A 1E9EA 2C92A 2XE4A 4KITB 4ZVNA 5KOHB 3EGCA 3K1TA 2BIFA 2FLVA 1QQBA 1M34A 4IIVA 2HREA 2C1EA 3DE4X 4BQOA 2ZWIA 5AI0A 5HM8A 1ZA2A 5FT9A 4C30A 2J5RA 1P7CA 4BYGA 3A1SA 3N75A 1CZUA 4QL3A 5KNCA 5BQFA 1E7SA 4FCTA 1YC2A 3SEZA 2RH4A 4MMYB 4EYEA 1AURA 4D4HA 1P1BA 1JAYA 1OBVA 1I1NA 3OCJA 4IILA 3GLIB 1ZAKA 2CMHA 4C6TA 4UZSA 3DZHA 3B3QA 1OFHA 3NHYA 3V4RA 2BKXA 3MRXA 2IXFA 4F2WA 4X94A 2QG6A 1M0SA 1MJGA 2WNHA 3OJXA 1Q0HA 1U2QA 2WT4A 2O3TA 4DCVA 2J59A 4NNPA 4ZEWA 1HNZB 1MF7A 3PGLA 3N2NA 1ZX1A 1WXQA 4P08A 5FQNA 1JUDA 2VYNA 4Z99A 4XTRA 2IYRA 2JBWA 1AO0A 2I2WA 1U90A 1UJBA 2JCBA 3C7KA 3KXLA 3R09A 2F9MA 3I1IA 1SAYA 3RTEA 1Y5LA 1SC9A 1R5OA 1Q77A 4BKUA 5C51B 2TMDA 4UMDA 3U9LA 1E58A 1VJGA 3KSUA 1E9DA 2ZPAA 5KYTA 5E2BA 3CRVA 4AN0A 2E1RA 4QREA 4Y9SA 3X2SA 1A5TA 2A3NA 2H1VA 3BCHA 2B69A 2HF9A 2CSUA 4MUAA 5BQ5A 4OQMA 1DQNA 2D0IA 4CZ2A 1ZWLA 5KTPA 1K6IA 4BXOB 4UTPA 3A0RB 5BRJA 1NMYA 3EVAA 3SF8A 1NY6A 1Z17A 2O8FB 5BO5A 3HABA 2XNDA 2P6OA 1X8KA 1MN6A 2BKVA 3KLNA 2WA1A 1BQEA 3LHFA 3CGGA 4PQFA 5F5NA 3JRWA 3E61A 2HXGA 3PNPA 4KLNA 2VJAA 2WI8A 3C3XA 4J03A 1UJ5A 2O07A 4ZT4A 4BZQA 3RC2A 2ZJFA 3EXIA 3FGZA 2QTMA 1JHMA 2VG8A 3JZDA 3OCWA 3D2BA 4ZHQB 2ZVJA 3AIOA 2BV3A 3GVCA 2PL1A 1AXEA 1GLGA 2FQYA 3QQ5A 1XQVA 3UXMA 2X0NA 5KPDA 1TM3E 3H99A 1LNSA 2P3LA 3G2HA 5FL3A 2RCNA 3GUVA 4JOSA 1M8GA 4KH1A 4NQRA 5E6RB 2P6MA 1HTBA 2IH2A 1XMIA 4Z4FA 3SN6A 4F3NA 2VCYA 3WLNA 4OG2A 1E9RA 4QIHA 3CQ9A 1J4AA 3EZGA 2W6OA 3LY8A 1E96A 1KZYC 4M0UA 1HDEA 4U7HA 1QQAA 4PSCA 2IZ7A 3KUDA 3T7SA 1IQRA 3EGXA 3U39A 3LT4A 1U9CA 5CIYA 3LUGA 3LO8A 4N7RA 4WLOA 4DY6A 1O58A 1X8LA 1MO4A 4TXHA 1E3DA 3GJ3A 3WKBA 1YDMA 4JOQA 4JQSA 3L40A 1AF4A 4KQMA 3UKDA 3B1VA 1YA6A 1TU4A 3MCAA 1Q1BA 2HDOA 1E3IA 2IYAA 2C2MA 2H2HA 4XCVA 5EWLB 1JHPA 1ZJ4A 1QIGA 2YJ4A 1F2VA 3RIMA 2AFIE 3RTCA 3EGDA 2I4LA 2OXIA 2ZRGA 3T7RA 1H2FA 3LRTA 3GT3A 5IWAB 2VJPA 5DIZA 3G59A 2C3PA 5B7PA 1N3YA 4G1BA 5DN6A 5C35A 4MJLA 3RD5A 4AQ7A 5EWMB 2AR7A 1BMTA 5ILGA 4CLEA 2R2AA 1TTPB 4MGIR 4XFDA 5I7OA 5DLEA 2PUHA 1G7TA 2P9GA 1RQXA 1XRNA 4N4AA 5IJ0B 4DLKA 2GK4A 3DS8A 2JD1A 2Q9CA 3IC5A 1X92A 4O4IA 2DWCA 2SECE 4RF4A 5CCDA 1RPAA 3RS0A 3TEFA 4WSOA 5FI5A 3U3XA 1DT5A 5I7EA 4ZTBA 4DR7B 2Q6IA 3I5XA 3FPFA 5LZ7A 3X1JA 1DIBA 4U39A 3TRIA 1JKXA 3IP7A 1EXMA 5H8WA 1QGZA 3ANNA 3GQVA 4Z9YA 3RM3A 3IELA 3SLGA 3B3JA 3VVMA 2QVBA 4Y2TA 1FW8A 2ZRLA 4BNYA 1JF8A 1XFAA 2VSFA 4BB5A 3H11B 4Y98A 4F72A 2Q29A 4FNGA 3GLFA 4IIEA 1DUSA 3N53A 1AM4D 4CMGA 1YXMA 2UVPA 1O03A 1Q7RA 4WCDA 1PFVA 4QXMA 1TJ3A 4AJLA 3KTDA 1ZOIA 4J76A 4WKCA 4XI9A 1GZUA 1MPXA 3N6VA 3KQKA 4NE2A 1RW4A 4GDFA 1TMOA 1X7GA 1J1UA 1ODKA 1OIVA 5LOVF 1BDIA 5TEWA 1D4AA 4PONA 1SGWA 4E1AA 1LPMA 4TKZA 3AVWA 3CX3A 1UC4B 2ICAA 1V0JA 2CFIA 4DY4A 2JJ2A 3F7TA 4QUKA 4V2IA 4X61A 3RSSA 2PNFA 2BTQA 2ZU0C 1WXHA 2B1IA 3MJCA 3P97A 2B4QA 3KCNA 3SEFA 4GSLA 4K9KA 2C4KA 3Q40A 4QHYA 4RQAA 1UFKA 3W9UA 4I66A 1TB4A 4KLAA 1IB6A 1FFHA 4OCZA 1HFKA 2X8LA 2JLUA 2BE7A 3PFCA 1OH6A 2GARA 1DJMA 4M0DA 2DETA 2V6FA 2CXTA 1MU0A 1A9YA 1F2DA 1GYQA 3N58A 1UMKA 2X58A 3UFBA 5DGHA 4CG2A 2VDOB 1VI2A 4FYPA 3K2BA 3F8SA 2Q2QA 4OKSA 2GTHA 1WVGA 3PSHA 5JS7A 1OD6A 2OKCA 4EPXA 3AK4A 4LC1A 4RHTA 3U49A 3ZHRA 1USVA 3OCYA 2CHEA 2ZU6A 3H5AA 1CVRA 5EE9A 3KKNA 3L05A 2RGRA 2CYBA 2WJ3A 5E6SA 5ENDA 4MKHA 4MRMB 4FE4A 4Y2PA 3IT2A 1MVLA 3EEBA 1SG9A 2VQFB 2YWXA 2HUPA 2IU3A 3KC2A 4C0JA 4MV6A 3N2GB 4M9RA 2IOFK 1OR8A 4YP6A 3DM5A 2QQFA 3NEAA 4JITA 2WU8A 1SZDA 1I33A 1NP6A 4FT2A 5SYAA 1M54A 1N7JA 1WKBA 1YZ3A 2XSZA 2ZITA 3LRXA 4QHSA 5A06A 4IH9A 2ZB7A 3C24A 4UUMA 1MIOB 4ZVLA 5BW6B 5TQ0A 1NUSA 4EF6A 1YQXA 2R6R1 5AK3A 4PYLA 3UJBA 3N5CA 3SG0A 4K5QA 1XYGA 1K3UB 1ATIA 4RHXA 1OFUA 4LWPA 1X3LA 1RWKA 3V42A 5HKKD 1N6PA 4MAMA 4CUKA 4Z51A 4OJYA 3FJ1A 6ABPA 2O8EA 1VL8A 2H4YA 5B6PA 2J6CA 1YNSA 2MYUA 3IX7A 5T4HA 2AV6A 2F64A 2VK4A 2WM8A 4K9OA 1QKIA 4RTKA 1NNUA 3IBGA 5I3CA 2OK7A 3FIJA 3BD6A 3GGJA 3ZJ4A 4XQ0A 1FP6A 2FQQA 2A9JA 3G49A 2H1OA 3SYMA 3OX3A 1CR1A 4O4HF 1OV6A 3C6KA 3JYHA 3K2QA 1FS4A 1JHZA 2P91A 2JASA 3BHIA 1T3ZA 1Q3TA 3IVXA 4TS1A 5DLPA 5PGMA 2E37A 4ITVA 3HJUA 3HNOA 2AXQA 3A1UA 1CUZA 4CVNA 1RYHA 2BW0A 2XMZA 1V39A 2I9PA 1U8YA 1ZD4A 5AW8A 3MEQA 4M60A 5K0BA 4KPYA 4F8EA 2E18A 4JBXA 2O6HA 1WS6A 1Q12A 1Y81A 3HUDA 3NHBA 3TQSA 3GA5A 3PPVA 2XCQA 4F86A 4DMMA 1T3TA 1KETA 2FN9A 4FZ3A 4DMGA 3OQNA 3UPDA 1AC5A 5JPDA 5ILOA 4M1YA 1M6VA 1E6WA 1GN8A 2LUOA 3TW8B 4ZAFA 1GZVA 2C8JA 2M2IA 2W22A 5A3RA 1MVNA 1C9NA 2VDPB 4XIIA 4K05A 1E7WA 1P1FA 3ZZNA 4RAQA 3U4GA 5J2TF 2W6ID 4D0SA 2YVAA 5JQGF 1Z6AA 3NVKI 1E1RD 2Z9CA 3O7WA 4NV3A 1RHUA 4P92A 3T7TA 3L1JA 4EA7A 2C31A 3ML1A 4K3VA 3KWJA 2C9MA 2AW5A 2QL6A 5EJ2A 3ZDEA 1C7IA 3B1FA 3ZHQA 1IOLA 3W34A 4JYAB 4EG0A 2PWBA 3L5OA 2F59A 2GCNA 3VO8A 1JG6A 4EL0A 4AJNA 1XKQA 2HSJA 3ITDA 2HT6A 5HIJA 3ZDXB 4RTOA 2PZAA 4GQAA 4DCNA 1VXOA 4FKZA 4FS8A 1T3HA 4MP3A 2I3BA 2JGIA 3GEIA 4DILA 1MEJA 2CMFA 5J4LA 2VIIA 4RO0A 2IWHA 3RJZA 1AY0A 4Q6WA 2Z2IA 1K98A 2PYDA 3CNBA 5CXXA 3V80A 1P81A 4LHZA 3VC1A 5BWBA 3DR3A 1D4FA 1LS6A 3BMNB 4LNHA 1CR6A 4FP9A 2Q3MA 3KKKA 5KYUB 2C9ZA 2QQGA 3TIXB 3DVAA 3SI7A 2Z95A 3MUNA 2NX2A 3R44A 5HG0A 2E4YA 1NTOA 2GESA 2BN4A 4IDBA 4R3NA 4DAEA 1P1KA 4WI1A 4NVRA 5K0GA 2FHSA 3MOIA 3UB4A 1KEVA 1XD8A 2FPSA 2P9BA 4FFOA 2IS2A 2V58A 3PC4A 4B5LA 3KYJB 2HPHA 3H05A 4UBIA 4D4KA 2RSLA 4CKWA 4OLHA 3P94A 1NG1A 1TQDA 4RIEA 1JEYA 2NSDA 3UWDA 2UYCA 4KFRA 2QTBA 5AKLA 3QVSA 4PLZA 4DG8A 3U3DA 3GD5A 4HNHA 2ZTSA 1NNI1 5JSFA 4WESA 2R1ZA 1BVRA 2J0UB 5DCUA 2FY8A 4LSWA 3IKVA 4JB3A 5ESXA 3FE2A 4ALKA 4AS3A 2JAOA 1IK6A 2PZLA 2FEMA 4CN9A 5LU8A 1S1MA 4B6SA 3K8OE 4BJ3A 1BX1A 2GUWA 3U19A 5DI3B 2NIPA 3BOSA 5HTKA 3WB0A 4EO9A 4QODA 4LXXA 3NT4A 3M3HA 1JG4A 4NMMA 3CKKA 4G63A 4KXVA 2QN1A 2QJOA 3KQTA 1TW3A 2JB9A 4GL4A 1Q22A 3WWOA 4LWZA 1FLAA 2Y9MB 1MQSA 4OB8A 4CLDA 4CF7A 1YR6A 4FJ0A 4B2YA 3A14A 3K5WA 2RH5A 2ZSIA 2FWNA 3G2PA 3VO1A 4N1AA 2YY7A 5BVHB 3RU7A 2ADMA 2NP6A 1L5MA 3ZNQA 5JBQA 1AGXA 1LRLA 1QVZA 3LS2A 3GCDA 1GTSA 3O3OB 1M8JA 3RUIA 1TYCA 2OCAA 5KSPA 3AR2A 5I8PA 2JLBA 3DFUA 1IRIA 5DYIA 1IM8A 3V9AA 3AY6A 4BNMA 1FSZA 1GFSA 1NX9A 1E59A 1QLHA 1X1BA 2VUTA 1LK7A 2ZUCA 1BMFD 3DLAA 3GPDG 3LU1A 4JROA 4NICA 4TKUA 5CLQA 2IYLD 4J7CA 1BCSB 4QFBA 2P30A 3QVOA 4Z8XA 4YV7A 1A2KC 3DL7A 5CFNA 4YUAA 1HDIA 3R6DA 4GF5A 4FTWA 4PCVA 3V32A 1M8KA 2C0CA 3OQIA 4MR8B 4QYSA 4JLOA 3TTWA 3LX6A 5DF1A 5BNWA 1E4YA 1NXVA 3ANLA 1A1SA 4KLZA 4X1KA 1RXCA 1WDMA 4UEKA 4YMIA 4Z1MA 2D7CA 5M7EA 2J7PA 1DC5A 4W1QA 3B3GA 1YCFA 2VA8A 4GKJB 1EQAA 2CJPA 3JQ8B 3NBKA 3WRVA 1RKXA 3C8ZA 1Z4IA 4UMEA 3ZOKA 4XVCA 3NDBB 4QFDA 4AWBA 1NYRA 2OBYA 1EFUA 2IXAA 4QYIB 1QHHB 4YGYA 5HIIA 3PFNA 3TTUA 5B7QA 3O84A 1RPTA 3KPUA 1UWCA 1VG9B 2WYVA 4G1FA 1HGXA 3H87A 3I73A 3N74A 1YUMA 4S04A 1XF1A 3F1KA 1T2DA 2JAHA 3GLVA 4MJ3A 1YAHA 1WB9A 1WPQA 2H4WA 3GJ6A 2QZ9A 1HKHA 3PJEA 2XDYA 1GGVA 3A4TA 3P4XA 3CBQA 3R3WA 2Z8YA 4S3MA 3W6ZA 2H1LA 4DUPA 2PMFA 4U2FA 3A27A 3ORRA 4ZQGA 4KBYA 3OWOA 1RJ9B 4OA8A 4WW0A 5IM4F 3G0BA 4RD0A 5KTNA 2PX0A 3B70A 4RIGA 1DS6A 4IIYA 4B5KA 4DOMA 5EZ5A 2J5KA 1IDN1 1MA0A 1HYEA 1M0TA 2GHQA 2VVTA 3DE5X 2X3YA 3I6YA 1Z4KA 4KYVA 4B85A 3V8PA 4H6PA 3T1VA 1SD2A 1GARA 2IITA 3M8KA 3QEAZ 1ZZGA 2JJYA 1WMFA 1M2OA 2MSDB 3PNKA 2LGJA 1IM2A 2A14A 4KGDA 1JA1A 1Y7HA 4CRWB 1COZA 4WZBE 4FYHA 5B36A 4GM1A 1TTQB 1IBMB 3P0HA 1LRJA 2PM8A 3MTQA 4R8RA 4TUYA 4M38A 3T3HA 2FVXA 4H1UA 3QU7A 2NUTA 2BUCA 3O1LA 4IIHA 4X65B 3V1NA 5EQJB 2C0QA 1J42A 1Q2XA 1TC2A 2YWFA 5ALPA 1HL7A 3ROTA 3KT3A 1KVQA 5KNDD 5T6BA 1CUUA 1RQLA 2WA2A 1SXJD 2VN8A 4RDXA 4G9EA 5EIBD 1T8TA 2ZIAA 1IXRC 4KQ1A 3ZUGA 3IKMB 3JCZA 3HACA 1MAWA 3QLVA 4G36A 3H1EA 5EZYF 5L3QA 2D00A 3KEGA 3PFKA 1ULSA 2X19A 1A2BA 4YFYA 3UMFA 3FI9A 1W7AA 2ZUVA 4P7BA 1YCDA 2YIMA 4C0KA 4N41A 1R15A 1R5JA 4ZRDA 5COQA 4F85A 3OZVA 4LJ8A 5FHRA 4GBGA 4NBRA 1QV6A 2QDXA 3PXEA 4B6OA 4BBAA 221PA 2BBTA 1Q5PA 1TLTA 3MMXA 4O2AF 1YR9A 4NZZA 2FG6C 3SP1A 1LNQA 4C4SA 2WHQA 4D9JA 3ZXSA 1TA9A 3V8QA 1BD3A 2TRSB 1RRKA 3I6ZA 3LHIA 1XK6A 3CS3A 3SEAA 2PL5A 4C0AC 1TT7A 2GPYA 3FOAA 2O3QA 4EDFA 4RTSA 1A1VA 3QLVC 3BHMA 2PUEA 2JEOA 3ROMA 1X7YB 3W8DA 1JPUA 2X2FA 1UQTA 3P2YA 4PG5A 3RU9A 4MIYA 5E1BA 4DIMA 3U7FB 1OLUA 5CDGA 1OFVA 4KG7A 4C87A 1T5TA 3ZWBA 4YK7A 1OY1A 4R40A 3TPFA 2IEYA 1S0UA 3OX4A 4JASB 4XD7D 1WOMA 4QVKA 5K20A 4I5IA 1QDUA 3RB8A 1YHNA 3KOUA 1FQJA 3H2GA 1VHWA 2AQ8A 5B6JA 3GRFA 1OYOA 1B8OA 2HUNA 4UEQA 2J4CA 4WX2B 3UTDA 5H3CA 3W2TA 1C4KA 2Q1TA 4LPKA 4D0NA 4YC7A 1SXGA 4QUDA 1D1PA 4J29A 5TS3A 3SBXA 2EX1A 2BH9A 1Y6RA 2PWYA 4K9SA 1OCEA 2M1XA 1EUCA 1ZITA 3EEYA 4RTLA 4U2GA 5FYDA 4OGFA 2YQZA 4XM1A 5BWNA 2GM9A 2Y3IA 1Y98A 2ZT6A 4LZZA 4QNMA 4C4ZA 4UEOA 2XYRA 1XZHA 2JKZA 1BE6A 4XOIA 4B7ZA 3D0RA 5CT5A 2P5YA 3RS3A 3TZ6A 1IHOA 3WOHA 3P9XA 2FEXA 3KTOA 4BQQA 3OG9A 3IMFA 3M5DA 1YF3A 3IAM1 2OYCA 1VFNA 1C41A 3ZXIA 4GZMA 3PNYA 1NZFA 2FPIB 1U7OA 3O8DA 1K4KA 3GIDA 2C2KA 2V97A 4P58A 3AM3A 4CIWA 3AF1A 4ND3A 4CIDA 2QRHA 1B3BA 3Q2KA 4PQRA 3E3MA 3Q5EA 5DNAA 4QOSA 5JBNA 2AMVA 5HUQA 1E3EA 3VOAA 4G0XA 4PLTA 1AMNA 3GJSA 1DC6A 4MYRA 4MW6A 3T0FA 4A6XA 3FUWA 2A7QA 5F51A 1TUEA 1VTKA 2PY6A 3OMLA 4P33A 1YONA 3Q6IA 2EJWA 3ZEAA 1PGJA 4FINA 3SNHA 3A32A 3PPXA 4LHEA 1GQ2A 4ZC1A 3ZWAA 2OXTA 1KGDA 1XDGA 2CVPA 2E4UA 5FBQB 4F3TA 4RMJA 2JBAA 4C3UA 4QGSA 4KWTA 3AF6A 3EISA 3NAGA 3PYLA 1XEFA 3KOMA 4TL8A 4P4TA 2YVUA 3OM1A 3P8ZA 4JIGA 1HV8A 3HB1A 4P93A 3QK7A 4Q82A 3VZRA 5GINE 1A3CA 1KOFA 1TJPB 4M9QA 2C88A 3QKSA 4R1LA 3SIPA 4CFSA 1AHNA 3V2HA 5KYGA 3ZDZB 1H6CA 5EMMA 1YSCA 3H83A 3WRWA 1P39A 4CNBA 4ERXA 3ZIDA 3Q0TA 3RG2A 1ADBA 1TF2A 1Y1SA 4ITRC 5C4GB 1JU9A 3QP9A 4F96A 1YQ9A 4HRXA 2GD6A 3N2KA 3DE1X 3LDAA 5KHAA 1WDWB 3HU3A 2Q5FA 5TT0A 5D6NA 3FYTA 1H2BA 5AK5A 2ANCA 3AEQB 4L7QA 3V6MA 1DRUA 2P9YA 4OJKA 2PGAA 3MUEA 3U56A 1U9YA 1GPH1 1ZCZA 3PHBE 4JUCA 5AKEA 3EEIA 3ZZUA 1QGDA 1C7QA 2B83A 2HF8A 2PVPA 3QOYA 3I32A 4X66B 2BEWB 1HOTA 1II0A 1R9GA 2JLSA 1N2OA 4OV6B 3VNQA 1SHUX 1HUQA 4ENWA 1J1ZA 3UXEA 4ER5A 3ZCUA 4AFNA 3RABA 5JFTA 3GMDA 1OLSA 1JNYA 1KJIA 2VJQA 4OBXA 3CH7A 4QAJA 4TOIA 4A92A 3A9UA 4ZGWA 1TEVA 1TJ5A 3RRNA 5D01A 1DEKA 2F62A 3K0AB 3G6WA 4WBSA 3EMDA 2GAOA 2DX7A 1Z2EA 5JMWA 3M4NA 4JJKA 2CLSA 2YVQA 2XNHA 3MS7A 4H31A 4OH1A 5JFOA 5JE8A 3T9CA 1ZNQO 4P0TA 1I1HA 1VE9A 4FHFA 1FS6A 1Z6QA 4O63O 4LPSA 4ESOA 4H2DA 1R8XA 1M73E 3CLUC 3ELYA 1LBQA 2QB5A 4PG6A 4DJAA 2QORA 2QN9A 3OD5A 4B2PA 3V4LA 2Q62A 2QRLA 4R31A 4BCBA 3R76A 4HT3B 4FZVA 4IDGA 1IJKA 3IV6A 3WFZA 4JYZA 4YO8A 2VP2A 1P7PA 2QSZA 1H2XA 1N9ZA 1UZNA 3MRSA 4W9RA 5J5AA 3ACBA 1XTQA 1NRWA 1P2DA 1HOXA 4WK4B 5LQUA 4X63A 3HXPA 5ECYA 4FUQA 3VNVA 3AF0A 2DUMA 3PVZA 5EWJB 3QYFA 5KOIA 4QRHA 5F3DA 3TLGB 1V2GA 1GNRA 1WPRA 4UOZA 4E3WA 2JF0A 2DR3A 1FX0B 3ZHUA 4ZU3A 3IODA 2O8DB 1VIAA 4B3MB 4GWKA 1QR6A 1UL1X 3DFMA 4PZ0A 3CR3C 1Y4DE 5CBKA 5CCEA 3AHCA 1I4WA 1QANA 4GLBA 2ERXA 4GVLA 4H16A 1DZIA 2VF7A 5FUQA 5KCZA 4HAZA 3G5MA 2E5FA 1NDUA 3DE2X 2X5XA 3WLAA 2XW6A 3C7DB 1E20A 3I9KA 4J2TA 3R3ZA 3JRNA 1XLTA 2F55A 3AU9A 1GJRA 4X91A 1PL6A 3F74A 3KJXA 3G2LA 4YT2A 2GLUA 1ZLXA 2WU1A 4UHHA 3PGXA 2A5LA 3FNQA 4IXMA 3W78A 3IURA 3H5NA 4O2RA 3UK6A 2IH4A 2QEQA 2X40A 4IAOA 2CLHB 4C29A 1ODIA 3COVA 3DP9A 1VMKA 1LEHA 4IWNA 3R7SA 2P40A 2XEXA 3OFVA 3DAPA 3B36A 1BDMA 4R68A 4F45A 5P21A 5B3LA 1G5QA 1L4LA 5A9SB 2WFLB 4OQDA 9MHTA 1NVUQ 2OXFA 4EPWA 5F2EA 3BULA 2ZUEA 5J2UA 4N0EA 4LOJA 4HYQA 1L1FA 5H3HA 3QXHA 1GQRA 1JQ5A 3ZTYA 3HCRA 1M8PA 1J2UA 1GPKA 1W88B 4KP7A 4M3NA 1XLTC 1YL5A 3QFCA 5T57A 2GD0A 4NTZA 4PW0A 4OHCA 4QGHA 2ZS8A 2RARA 3A7DA 4UM9B 2PBFA 4O8ZA 1XTBA 5JAQA 5LQAA 2J4FA 2VWHA 3GZNB 4NRDA 5CT8A 4HVCA 1NOKA 4ZI7F 5FLEX 4NU5A 2I3ZA 1L7RA 2CVFA 3D2CA 3VAYA 4RKQA 3TEJA 3VU9A 1G55A 3M33A 3WHPA 5LZ2A 4DIKA 4PO9A 4XGIA 1V1MA 1XX6A 1L5KA 2XADA 3SKVA 3CUUA 4IMPA 4WD3A 2PS1A 3ZHXA 1JLSA 5EJIA 2UZ0A 5K01A 3UV7A 2NPOA 3LQYA 4D8UA 4HAYA 2VPTA 4A23A 3ROXA 4EM6A 4PPFA 2VO1A 3W3AD 2OCKA 2X5JO 4XDYA 3SFZA 4B3FX 4BPRA 2QL7A 1CVIA 3VYTB 1IHXA 3OBIA 3HKEA 4LBZA 1QRSA 2R7KA 1QM5A 1SCKA 3KAPA 3MW8A 3ZBPA 1QDLB 2JJ2D 1RLTA 4RY2A 2VTBB 3K53A 4G07A 2WWYA 4ZO9A 3JQDA 1NLUA 1O8CA 3EXHA 4L8YA 5FUXA 5K3CA 4RY8A 3S40A 4ZOLF 4A2PA 1A7JA 2W4MA 3Q88A 4N5NA 3H2ZA 4YO7A 3PEWA 2FRDA 4Q05A 1K89A 2ZRFA 3SYTA 1G3IA 2G06A 2ZUSA 4AJJA 3AERA 1XHFA 1CY8A 2OCDA 1PWXA 4BRSA 1JKIA 5H3LA 3BA6A 3LPCA 1JYFA 5JBIA 5LUAA 2XYGA 1KYIA 4MS1B 3FVRA 3HL0A 1O3YA 1VLMA 2JIRA 5H5JA 3GHHA 4K46A 3BMOB 5FOWA 1LS1A 3A26A 2HU7A 1NF2A 2RCYA 3BE4A 1WKCA 4JJGA 4M1TA 5HFJA 4XR9A 5G4LA 3ZCRA 2PUAA 4GKKB 1UBNA 3IIKA 4PZEA 1NBMD 1HDXA 4L2IB 2R48A 2OL4A 3EXHC 4II2A 3IMCA 4JMLA 1JDSA 1O94A 3CVOA 3KWMA 2RONA 4OFXA 1GPDG 4UFOA 5AJUA 3TLAA 2FRDC 721PA 1GRVA 1UBEA 1ZJWA 2Q5QA 1TM2A 3GLIE 1HT0A 1UKVY 1KEPA 3SF0A 3W4KA 1KHTA 4U7FA 3QNUA 3FRHA 4I1SA 4CV3A 2KYRA 4G0YA 1A27A 5THKA 4QUBA 4IQ8A 5KVSA 1G63A 2I2AA 4D8TA 2RBEA 4GC5A 4YV0A 3LO5A 2GMWA 3FPEA 4IOKA 4MUXA 1KI1A 2XSZD 1X80A 3ONEA 3Q5DA 4OSOA 3JSAA 3GO4A 1AZLA 2J8ZA 2CYCA 4JK3A 4KZPA 2FN8A 4RZUA 3C6XA 3OSZA 2OUIA 2XVZA 3D8SA 1AKTA 2A84A 1JXQA 3LKVA 3KJEA 4BVGA 4XR4A 3VYWA 2YQ5A 2H4JA 1O94C 4Q9NA 3TJRA 1DT3A 1FDWA 1JDZA 4XW2A 3SFVA 1QIJA 3U81A 1Z4MA 3WNZA 3PI7A 1T91A 3R9KA 3GU3A 4EQZA 3C0KA 3KSBC 2Z6UA 4N0QA 4DA6A 4BKMA 1E0AA 3LNCA 3O4RA 1A9PA 4C2BA 4U8HA 1HG0A 1GL7A 1W0JA 2QPLA 3MERA 4MYSA 3EAGA 3EQ6A 2JGEA 4C3ZA 4EYGA 4RZHA 3LCCA 4ZAVA 3MWJA 4E7PA 4I9UA 3O1HB 2CCJA 2ECKA 3QY0A 1D5CA 1SN7A 4MUHA 3TVYA 1JALA 4TT3D 2QN8A 1C1HA 4AKHA 5EZSA 3DMNA 2VEOA 4F2HA 1CJMA 1N0IA 4NK4A 3W8FA 1UFQA 4RPJA 5AI5A 5DLDA 1RQ2A 4TV9A 1G7CA 4I6GA 5IVHA 4WN9B 1Q14A 5A5EA 2HSEA 1DTWB 3L8EA 4Y2GA 3PA6A 2MU1A 2HYIC 3JR3A 2MIIA 3CR7A 4MQEA 1JSZA 4ZXPA 3FCEA 4EHHA 4ID9A 2PLRA 3L82B 1S2MA 1CDOA 1H1LB 5H0IA 2ZT5A 1NM5A 1LPSA 2Z0MA 3EXEB 5FLKA 4X60A 1E3WB 2C8VA 3I4LA 2Y71A 3NEJA 5AVSA 1HSZA 1UXJA 2FWIA 3PQCA 2HRRA 1KMCA 1YB2A 3GRZA 5A6SB 1II9A 4BNFA 2NUPA 3NBMA 1MT0A 4HBGA 2NXWA 5BUSA 2N42A 3BA1A 2A5JA 2Y76A 4QYWA 3KALA 4MS3B 4B7AA 3LHDA 3GFRA 1O95A 2QAJA 4O0LA 1JECA 1E18A 2ZULA 3LFUA 4RKRA 1JQLB 2BKEA 1T0IA 2X23A 2XDAA 3RYTC 1E0SA 4KIJA 4Z5XA 2O4UX 4RCZA 4ZVSA 2IEBA 2Q4DA 4HLUA 4MLZA 4QEDA 4YREA 3UT0A 1ZKMA 2BMWA 3T99A 3RSQA 3AMVA 3I2YX 4FC7A 4ISCA 2GBPA 3WYFA 4Q1CA 2HEIA 2Q1XA 3NAQA 3R6GA 4G41A 5FI1B 3VSAA 4DSNA 4EUHA 2MJLA 2FWAA 3U0VA 3EPKA 1QH1B 4ZYUA 1N5KA 3Q7SA 3TQOA 2YJ6A 4IIBA 4CKEB 2GZHA 3GVIA 3MWEA 3PGVA 2A9RA 2HMUA 2O57A 1BX3A 4HTFA 5GWXA 3K70D 3CSUA 4CM9D 3BE8A 2BM8A 1Y6JA 2DWPA 1R6UA 1L7NA 1MW9X 2FX5A 1KYZA 4L51A 5B6IA 1O95C 3UMMA 5JZOA 3DTVB 2XHEA 4HV4A 3V5NA 4CDRA 3R7DA 4H1HA 4KXMA 1PK7A 3Q8XB 2RBGA 2UYGA 3HB5X 3QKIA 1YVDA 4WIAA 4Z7NB 1TAQA 4JBNA 2C4NA 1GCOA 1Y0BA 3HXQA 1Z8NA 2W11A 4ZYYA 1WZ2A 5FOUA 3IEVA 4HLDA 3JWGA 2DH5A 1BXGB 2O5VA 3FVTA 3I3OA 2IZ5A 4ZJUA 3KZ1E 5ARDA 3G0CA 3TQHA 5IKPA 5A5VA 4FHCA 4YQFA 2JATA 3REOA 2PT6A 2DECA 2XRFA 2ZVPX 3MMPA 4BFZA 4JBLA 2X7JA 3OOHA 5KNBH 2XNCA 4N12A 3QE4A 3E35A 2V1UA 1RHKA 4GGPA 3BL5A 4IQGA 3HGQA 3L6BA 4PYKA 4FXPA 1JHDA 1UKYA 1X7ZB 4HQRA 1PZMA 4YMWA 5DP2A 3H6HA 2D5BA 3OQBA 2PLWA 3KT6A 2FFJA 2MCFA 2QJRA 3ICCA 3CX6A 4CV2A 3E9EA 4FKBA 2FHPA 3KOYA 3W2GA 1FU4A 4FCCA 4LXYA 3FX2A 2H16A 1NVWQ 1HT2E 3PJGA 3HR8A 1C0PA 3KR2A 5EESA 1F2TA 3PUIA 4X64B 3MELA 4IVQA 4NONA 3KYCB 5BVGB 3L9WA 4V0RA 1A5ZA 2IQIA 3I2HA 4OMUA 4E70A 1T9HA 3MS2A 1NJGA 2W2MA 2YYZA 1IQUA 2BSAA 2NLOA 4L4UA 2ZUFA 5B2ZA 5C80A 2E4XA 2RK4A 3PC7A 1GGJA 4LAFA 1GUZA 4AJHA 2AOVA 4D0RA 2ATVA 2P0AA 2QM0A 1RI4A 2WUDA 4G86A 1ORHA 3JYPA 1PR4A 2WUWE 5CDFA 1OYWA 3CVXA 4PCLA 1UAYA 1ZC4A 1Z35A 1G5PA 1GVNB 3SOZA 1HI9A 3STYA 2BJWA 1EVEA 1LTHR 4MI6A 3AHEA 2BBWA 4ESHA 3LCUA 3CWQA 1PT9A 2ZRMA 3CONA 1PR3A 1XDBA 3AJAA 3B7PA 4ALLA 4B7UA 1U1GA 1FFGA 4NJMA 4IP0A 2JBHA 2BMVA 4QYMA 2PKCA 1ZI8A 3CM0A 5BY2A 2IHKA 3U61B 2OB1A 1C2YA 2V9CA 4MCIA 1M1NB 3OHMA 1YRWA 4LJ6A 2YNMA 2IPOA 3A9RA 4G0OA 5LYJF 2IHTA 5E8JA 2FP4A 3BXZA 5EXSA 1M0WA 4FNMA 4DXHA 1T8WA 4JLWA 3U44A 4OH7A 4X8HA 1M7GA 4TWAA 4QU8A 1G59A 4PG8A 2J7PD 1XXLA 2QTVA 3N28A 4G26A 3FROA 5DM1A 4NBTA 3MT7A 3NVDA 1ESNA 4PTLA 3FKJA 3TD6A 3TGWA 3V7FA 5B4VA 2VYFA 1Q21A 3GT0A 3IT3A 1J8YF 1T43A 3MTIA 1R0KA 2XJ9A 3R5XA 3VR2A 1UC5B 4HQ6A 2DU8A 1V45E 3QW2A 1MDFA 1YI1A 2JD0A 3ENWA 5AUQA 4LFBB 4IIJA 3I9NA 4XTCS 4ASUA 5FAXA 5BSKA 2XE8A 2YNMC 1OXUA 2JNWA 2ZIFA 3GGOA 2IBSA 2CEAA 2BKUA 3QE0A 4EVIA 2WZQA 1ULZA 2P9EA 3NBXX 3TL2A 2B4AA 4EH1A 2J7KA 2ZBUA 2DH6A 3BIXA 1A2OA 3DOUA 3HWSA 4HX9A 1EFKA 2OCIA 3AP1A 3N8NA 4KXQA 1NC3A 4M9SA 1Y8CA 4B7XA 3VVBA 5G0VA 1ZOLA 2WBLC 2QR2A 3TRJA 5E3HA 1XELA 3RC3A 2CUTA 5B30A 1TLLA 1QGED 1S2OA 3PKJA 4EW2A 1DBQA 5KWSA 3B5JA 5LD2C 1P9LA 3OHPA 1HFEL 3E2IA 2XITA 3UENA 4B3IA 3A1DA 4CIVA 1CZKA 2RB5A 4HH3C 4P3NA 1IJFA 1JEOA 1TUGA 1I9CA 3OU7A 3RF7A 3RWBA 3SD7A 1T4CA 2PS9A 4LWOA 4F7WA 4DTCA 4LXGA 1AD2A 4LRSB 4LYDA 5CG2A 1UCFA 2P2SA 1KDZA 2RAFA 3FDZA 4JL6A 1F12A 4EHAA 5A0VA 4NSNA 2EP7A 3EZ2A 4OB7A 3LAWA 1HETA 2QTGA 2CBGA 3U7QA 2MSEB 3PEFA 3QLTA 1G38A 3O6VA 2EHJA 1QX3A 2IJGX 1V11A 2ET6A 3I2KA 4IYJA 2RHOA 5TF4A 4EP1A 5CXQA 2DQSA 1ZRHA 3DVQX 121PA 1Y9DA 4ZT2A 4B3TB 4WKNA 2H2AA 4Q4LA 4EF4A 2JCYA 1GYPA 4N5DA 5MGBA 2Y77A 5HIKA 2PUTA 1DG3A 3LCRA 1C8VB 1DBVO 1HYGA 1L8XA 1HXHA 1XRSB 2H9YA 4GX2A 4C4YA 1YGPA 5FUMA 1KC1A 3PGMA 1KDVA 4B0PA 3OM8A 2PUCA 4ZOCA 3H5OA 1OBCA 1TI7A 3F46A 4HDOB 4PQEA 4WBXC 1CQWA 2ODQA 1JZTA 3EGIA 1RSZA 4LYYA 4JC4A 2VSQA 4UUOA 3GJYA 4JFRA 3TRHA 4D6PA 4XPIB 2W9XA 4YT5A 3VR6A 1X42A 3EXG1 5CNJA 1LKZA 9LDTA 1JSXA 4PX5A 1S3IA 3U31A 1ZOPA 2YV4A 1NUPA 4F4HA 1NNSA 1RAHA 5EUBA 4QJBA 4V0NA 3W6PA 3AFNA 2C5FA 4CR7A 3L2OB 3CBGA 1YQWA 3JVVA 3R24A 2HFJA 3H1GA 3H16A 4U3JB 1C81A 5G40A 3V4PB 3ZQJA 3FOFC 1LSSA 2DUWA 2B8WA 4NJEA 1QH8B 1D6JA 1E2NA 2YOFA 1ZFNA 3RFUA 2CNKA 1H0KA 1XMJA 5AK4A 5MHTA 3C3DA 3Q41A 2Z5LA 2YWRA 3IQDB 1LF5A 1NBOA 3NALA 1ADYA 3GIWA 3TFOA 5T4FA 1GTVA 4LDRA 4F6RA 4IIDA 2NPIA 4GKAA 2XRMA 5SY6A 5I4BA 5KINB 4KR7A 4EWLA 3ISJA 3D81A 4KNVA 4TL7A 2I91A 3CINA 4XEHA 3QMPA 2GNAA 1O0CA 2WIAA 3OY7A 2VCEA 3UQZA 4OYHA 2C5SA 3IA7A 5CFPA 2OBMA 1KBQA 3O4VA 3OM0A 4PX9A 3VKUA 4ZI3A 3HXKA 2ZE5A 1RXWA 4YAIA 3ECSA 2O8CA 4I4TA 1NWHA 4R2HA 4WN3A 5CTAA 3OE7A 3BD7A 1CR4A 2XZTA 1E6MA 1OWPA 3EA0A 4KQGA 4EPRA 2AL7A 3PUYA 3NJRA 3HDGA 3ZGYA 2OHVA 5SZHB 3CVVA 5EIAA 4EFLA 2OGUA 1AXRA 2FZCA 1LX6A 4XUEA 4HB0A 4KXNA 2YMLA 4LK2A 4IHAA 4KVGA 1XF9A 4XLTA 2P4QA 4F4UA 1ZH6A 2M98A 2GB4A 1OB5A 1FP4B 3QVTA 1HO3A 1ZH2A 3W1WA 2HBRA 1G8AA 4PLWA 1BH6A 2GH1A 2DBRA 4ZODA 1V7CA 3RYFA 4XM2A 2ZCUA 1G3QA 3NANA 5CB4A 3HU1A 1JU3A 5JI3E 2GVZC 4EA9A 3T38A 4UM5A 4XX1A 4FYYA 4LV5B 5LP6F 3ZVMA 2YOHA 5K8LA 3DLHA 1OFGA 1A8PA 1V4VA 2CNBA 3DL2A 4II7A 4J3FA 5IXYA 3GR6A 2PPLA 4YJ2F 4ZQEA 3RJ5A 4K87A 1M7BA 5CUQA 4L4ZA 5JWRA 1P44A 1N2IA 3LXRA 1M10A 1XA0A 2GOYA 2NXCA 4TRMA 1IBRA 3JQGB 3W8EA 4B87A 1BCRB 4FEAA 4A26A 2REBA 5DYTA 1DL5A 5CTJA 3HS3A 4FWBA 5JH7F 2O2SA 3KVYA 2W71A 1EWRA 1TM4E 3ZX5A 1KJYA 1KU0A 3KSMA 4FGSA 1MABA 2A3RA 2Q45A 2WM2A 2Y67A 2WEKA 3F97A 4QPCA 1JA0A 1NU6A 1TT5B 2QMHA 5KHOC 2C9CA 1ND6A 2CVQA 2JFQA 3JAKA 4RVHA 1A7UA 4MWSA 2CT8A 2AB0A 1E8NA 4HFMA 1R88A 2A0UA 3D4PA 5NULA 3MMNA 5LLSA 3EIEA 2WFZA 1EA5A 2RK3A 3OO1A 4XUGB 4ARVA 4RTMA 1ZD3A 1TL7C 2CHUA 4PXSA 2EFCB 3Q3HA 1PKEA 4MVJA 1E7YA 5HJ2A 3GP3A 1I7NA 3ROQA 4E5MA 4PIPA 1UF9A 3NTUA 1M2EA 1QHGA 3HA3A 2JFVA 1QP0A 2WDZA 2I76A 3H4IA 1HEYA 3OPYA 3PS9A 1XMOB 1SBNE 1DARA 3CX7A 4FOOA 5HS4A 2NZUG 2FCAA 2VF4X 2HTFA 2R6AA 2ZM6B 2P6UA 4ZVRA 2O2DA 3D6NB 2N47A 5K3OA 1GG8A 4WZAB 5KAMA 4NENB 3NAMA 1GPBA 1FMTA 2WNSA 1DKOA 2YFKA 3AUXA 1WMBA 1Z9BA 4UFNA 2DFPA 1XTKA 3L7KA 1FSFA 4NH0A 1UANA 1IMOA 3B78A 4I1IA 3FZGA 4OGLA 2XUJA 2IUSA 3BJEA 1GT6A 1MJGM 2V7TA 3ECAA 1ZW6A 4Q9DA 5EIEA 4YQEA 4Z7QB 2OGTA 1C5KA 4A16A 3UC5A 3JYLA 3KJFA 5KYKA 4OLAA 1O0SA 2ZJ2A 3R3SA 1ID1A 4G5SA 1C1YA 1KPGA 1WY5A 4RD2A 3W5AA 2I4RA 4WUTA 3GP8A 2PS3A 5FA8A 1MRNA 1J2RA 3GWZA 1G60A 4NS4A 5JS8A 4JXKA 1EWVA 2PRJA 5HFNA 2PL3A 1ZXBA 3L0YA 5K0EA 5CVEA 3B6MA 3RGGA 2CVZA 3CZMA 3EODA 4KTVE 4YIHA 5I7WA 2E5LB 1JBQA 4WKBA 2WZBA 2FSVC 3FRIA 4HGNA 4M1QA 1U63A 4OHMA 1GY8A 3GCZA 1XN4A 5IKOA 4F3KA 3PVCA 3U7HB 4WA7A 2A9FA 1L4YA 1RM0A 2LD4A 1ULAA 3HVKA 4KE9A 3BRWD 3CZRA 2IUYA 2EW1A 1STOA 1IEQA 3BEOA 4G1UC 4ZCRA 5FOVA 3BXEA 3FYCA 5D3MB 2W2PA 2PXHA 3NP7A 4FEEA 1VHDA 3KZMA 4XYMA 1TM7E 3N2LA 3NHKA 3FUCA 2HA6A 4YR9A 1CZHA 2FGKA 4YAWA 3L04A 4K1XA 2ZAGA 2II6A 3GAFA 4KKXB 1OWNA 3L06A 1GCAA 1NPDA 1VRWA 3JZMA 5CHEA 1EFVA 1QWSA 2C2WA 3L18A 4M83A 3RU3A 2YZ7A 3RH0A 4YLYA 5JPCA 3WS7A 3LRPA 2WYWA 4HKTA 2XD4A 4IVRA 1DAEA 3NONA 4I50B 4AMUA 3JQRA 4OJNA 3AHJA 2G9UA 2XX3A 3LPDA 1H5UA 1NI4A 1ZBDA 5JCZA 4Q93A 4BMSA 2YICA 4AJ2A 4P1ZA 4HB2A 1YDFA 3V33A 3UM9A 2PD4A 2OQRA 4P9NA 2X5KO 2YYYA 4E22A 1ECFA 2Y0CA 3UUFA 1SNYA 3TE6A 4DMUB 4HN4B 2ZS9A 1SKYE 4ZDIA 4JP5A 5BN4A 5C8YF 3WGKA 5CK4A 5TF0A 4E03A 2GWHA 5IEJA 2HSDA 1N8NA 1T8UA 2PPVA 1JFTA 2KBFA 4B45A 1FFWA 1DCFA 2FOIA 5DTQA 5COBA 3T5AA 1H23A 1O4VA 1QBKC 1UJ2A 2JHCA 2QP4A 4EZIA 1UP6A 2IYXA 4IDQA 3FNIA 2MYTA 1W76A 3MHPA 4M54A 5ALLA 3SDZA 1G5IA 4P7FA 1L7XA 2PCLA 2CL6X 3G8BA 3REQB 4WLEA 4C2AA 3DV2A 2Y8EA 4J90A 1L7EA 4UNQA 2NWQA 1M2GA 3D0OA 4I81A 2C4HA 3QELB 4H35A 4BKQA 1WV1A 1HQDA 1T9ZA 2G04A 2NAPA 4EG5A 3DZCA 3EZ6A 4ZVKA 2MMCA 1X1TA 2H4HA 1UFVA 2YYAA 3K73O 2PV0A 2IDMA 4GH5A 4LWQA 4X84A 4GUDA 3VU8A 1NV9A 1WCXA 2IF0A 2R86A 4K28A 3HCEA 2YC2C 4LMAA 2JHPA 3S8MA 4YPVA 3TUZC 1LFDB 3V1MA 4RMHA 1X7XB 1PFGA 4XSHA 3KVVA 4PNZA 3OZCA 2N3ZA 3DOOA 2PJRA 3V4OA 3FZYA 3NNNA 4ZQFA 5JOQA 4IF6A 2ADFA 3MLEA 3MRVA 4BJHB 3IPCA 4TTTS 3ZKAA 2F4VB 4K2AA 5L3SB 1ZAYA 1IZ0A 5JYEA 1E64A 3L7LA 4HQOA 4EKNB 1SCQA 4GECA 4IBOA 2VDQB 2C0PA 4LSMA 1O9GA 2OBXA 2C82A 2HPVA 1EK0A 2Y1LA 4ND2A 3ZEIA 5DCLA 5FJJA 4R54A 6REQA 5DHAA 4PO3X 4TXJA 3EGOA 2A35A 4HDNA 4JBWA 3O1JC 4B46A 3V1TC 3W2FA 5BMVB 3OT1A 1I6KA 4X44A 5ALSA 1GUDA 1NJSA 2Z2YA 3B1XA 1CZOA 5B3AA 5LZ8A 1I5RA 3PZRA 2WG0A 3SY8A 3NKVA 4L3WA 1XBTA 3QYAA 4A15A 3ORQA 1R12A 5EZQA 4ILKA 4UUPA 3TDNA 2KW5A 3H0KA 3WIOA 1IZ9A 1UKBA 1J0CA 2FAXA 4AI6A 5K1ZA 1Z2OX 3K6KA 3FF1A 3KG2A 4ZEOA 4D0LB 1KRWA 4C6RA 2ZI7A 3GMSA 1E2MA 3ZQ4A 3OFNA 4JT8A 1UEIA 3TXYA 4LGVA 1O94D 2L18A 1GD1O 1WW2A 2TMKA 1P6XA 4KQKA 3BFJA 2VNHA 5F33A 4S0ZA 3WGIA 3C8HA 4Q4AB 1J0XO 1KEZA 1P18A 1Z88A 3PFIA 5CAEA 1D04A 4K9DA 5E6UA 3WL4A 2D1YA