3PCTA

Structure of the class c acid phosphatase from pasteurella multocida
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
251
structure length
246
Chain Sequence
NQQAVEQANQAKLQQQVAMGLIWTQQSGEYAALAHQAFNSAKMAFDHAKKKAVVVDLDETMIDNSAYAGWQVQSGQGFSPKTWTKWVDARQSAAIPGAVEFSNYVNANGGTMFFVSNRRDDVEKAGTVDDMKRLGFTGVNDKTLLLKKDKSNKSVRFKQVEDMGYDIVLFVGDNLNDFGDATYKKSNAERRDFVAKNSKAFGKKFIVLPNTQYGDWEGGLDKNYFKGDSQSKLDVRAKAIHAWDGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Class C acid phosphatase
publication title Crystal structure and immunogenicity of the class C acid phosphatase from Pasteurella multocida.
pubmed doi rcsb
source organism Pasteurella multocida
molecule tags Hydrolase
total genus 99
structure length 246
sequence length 251
chains with identical sequence B, C
ec nomenclature ec 3.1.3.2: Acid phosphatase.
pdb deposition date 2010-10-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3pctA00
2NO4A 2WM8A 3NASA 2GMWA 1QQ6A 1Y8AA 4XOUA 3A1CA 1WZCA 5T41A 5A3QA 1Z5GA 5AW4A 3QUTA 3FPBA 1YV9A 4UASA 2FPSA 2YJ6A 2IYEA 4BYGA 1WPGA 1CQZA 3I6BA 1SWWA 1QQ7A 1ZD3A 3OPXA 4HGOA 2IOFA 1U7OA 1XPJA 3NANA 2QYHA 2FUCA 5IS2A 3AR5A 2WHEA 3WK7A 2HDOA 2MSNA 5AVSA 4YCMA 2IOHA 2NO5A 3NRJA 5AM1A 4UM7A 5AKJA 3HYCA 3QLEA 4AP9A 1RLOA 1L7NA 1K1EA 2ODAA 1Q92A 2DQSA 4BX2A 3BWVA 3QU4A 2AMYA 5AVXA 4GXTA 2RB5A 3R09A 1Z4JA 4UMVA 3PCTA 3U7EB 3DDHA 5ALYA 3N8GA 3U7GA 4Y2YA 5AVYA 5AKZA 5AKLA 3UMCA 2G06A 2G09A 2HF7A 3ET5A 5AW3A 2W4MA 3I28A 2AGVA 1NRWA 1U7PA 2ZOSA 4NFLA 2RARA 1YNSA 3A1DA 1SWVA 1RPZA 4NWIA 3PDWA 3L0BA 5AW8A 3IJ5A 3S6JA 2GHTA 3KOOA 3U26A 2YJ5A 3WGVA 4EX6A 4NABA 3OCWA 3OTQA 2WF5A 4Y2JA 1ZRMA 4C4RA 4YIHA 3ET4A 5A3RA 2FPWA 1U02A 3N1UA 4KX5A 4HGNA 3SKXA 5ALKA 1Z4PX 4Y2UA 1U2SA 1KYTA 2R8XA 2FDRA 4ZEVA 3FM9A 1NNLA 3RF6A 1ZJJA 3WGUA 2YMQA 3UM9A 5ALPA 1RKVA 5AK4A 5ALEA 3TLMA 2I34A 3A1EA 4L6CA 2WF6A 5AHXA 1ZS9A 4UATA 3ZUPA 1L7MA 4HGPA 5AI5A 3W5BA 3ZVMA 5ALGA 3SHQA 3KBBA 3QNMA 2AH5A 5AK6A 4FE3A 4EENA 3AR2A 4DWOA 5ALUA 2WF7A 2C9MA 4BBJA 4HGQA 3L8FA 4I9GA 3KD3A 5ALTA 2PQ0A 4J2TA 5AW6A 5AVUA 1QYIA 4BEWA 1Z4OA 3ZTYA 4OD0A 2HI0A 4CNQA 3P96A 5AM4A 3WKDA 3B9RA 4EELA 4EEKA 4BKMA 3N5KA 1RQNA 1ZD2P 3E81A 2O9JA 5ALMA 5AW2A 2JAUA 4BNDA 5A3SA 2ZG6A 2YMPA 3ZW7A 1L8OA 2ZBGA 5AM3A 4GIBA 3KC2A 5AM5A 3NIWA 3QU5A 3ED5A 3AR3A 3K1ZA 4UMFA 4DCCA 2ZBEA 4CF5A 2JGAA 3GYGA 2Q4TA 3PGLA 3FGOA 3QGMA 2P69A 4HGRA 4Y2PA 4UAUA 4DFDA 2AUTA 2PR7A 3QYPA 2P11A 3OCUA 3MN1A 4PNHA 2EATA 4I9FA 2IOFK 3I76A 3J7TA 3OCYA 4AS3A 3B9BA 1U2TA 1QQ5A 2CFRA 1RKUA 4CF4A 4QQFA 4EX7A 3F9RA 1ZD5A 2WFAA 1LTQA 1EK1A 2GO7A 2HOQA 2EARA 3L1VA 3ZX5A 4XE5A 1LVHA 4XPZA 3ZWKA 3L1UA 2YN4A 4BNDB 5AW0A 5ALJA 3L0YA 2OYCA 2VKQA 4UW9A 5ALQA 2CFSA 3WK5A 2R8ZA 4JDPA 4UAVA 4KN8A 2ZBFA 4MUMA 2PKEA 2B82A 3WKBA 4MWOA 2G07A 2O2XA 4KNVA 2OBBA 2HCFA 1Z4KA 5E0OA 4RESA 4YCNA 3L8EA 3ZX4A 5ALOA 2G08A 3MPOA 1QH9A 2QLTA 1AQ6A 3RFUA 1X42A 3L5KA 1Z4IA 2C8LA 4C4TA 5AIBA 4OHFA 3M9LA 3SF0A 2X4DA 2B30A 2P27A 3KZXA 2GFHA 1Z4LA 2FEAA 2Q4RA 2YFYA 3DNPA 3M1YA 3OCZA 3QXGA 4UU0A 4BEVA 5IT4A 2B1QA 2JAWA 4UM5A 1WVIA 5ALZA 4H1WA 2IA5A 1RLTA 3U19A 4L57A 1NF2A 3R4CA 3WKEA 2EAUA 5AICA 4XQ0A 3QU7A 1YS9A 4UMEA 1ZRNA 2R8EA 1Z4QA 2D2VA 5AI6A 3PGVA 3EWIA 4Y2RA 4FYPA 5ALSA 4E88A 3UMGA 1RDFA 2C4NA 4Y2XA 3U13A 1SU4A 4YGYA 3E8MA 5ALXA 1ZOLA 2FPXA 2YJ4A 3WK9A 3SMVA 4CF3A 1L7OA 2C8KA 2NYVA 2I6XA 2GHQA 5AVRA 1YJ5A 2B8EA 3DV9A 4G63A 3I1YA 4KX3A 4BX0A 2MU1A 3OCVA 1TA0A 4OFZA 1Z5UA 2W43A 3QUQA 1S2OA 5ALWA 3QUCA 3U7HB 2CN1A 5AVZA 3QX7A 2I55A 2ZBDA 1L7PA 3ZVNA 2B0CA 2JARA 3WK4A 1RQLA 3FVVA 3L8GA 3W5CA 3N07A 5AKKA 1CR6A 3OCXA 4QJBA 5AI0A 2I33A 1L6RA 2I54A 3N28A 3DAOA 5ALIA 2ZXEA 3WK6A 5FP0A 1Z4NA 4AS2A 2CFTA 3W5DA 4ZEXA 2C88A 1S8OA 3L0CA 4Y2VA 2BDUA 4YCLA 1Z4MA 4YH1A 5AW7A 2YBDA 3AR9A 4FFDA 1PW5A 3NAMA 5ALLA 1N8NA 1WR8A 3E84A 5AKHA 3WK8A 3ZU6A 4C4SA 3WKCA 1IWOA 3AR7A 1YDFA 1XVIA 2FPUA 3QU2A 1VJ5A 5AVTA 4DW8A 3MMZA 4O8CA 2YJ3A 4NV0A 5AK3A 2P9JA 1L8LA 3QUBA 2YMLA 2BDEA 2Q5EA 1RMTA 1Z88A 1N9KA 1J8DA 3AR8A 5ALDA 5AIAA 5AW5A 2HX1A 2W11A 4RETA 5AKXA 3FZQA 4EZEA 3EPRA 2OA0A 3QU9A 4IFTA 3AR4A 4HAIA 4HYTA 5AI8A 1O03A 1RMQA 3CZ4A 3L7YA 4UU1A 3R9KA 5ALVA 3IB6A 1VFPA 2HHLA 5ALHA 3EF0A 2G0AA 3IRUA 1TE2A 1RKQA 3SLRA 2FI1A 4G9BA 2I7DA 4KNWA 3NALA 3SD7A 2OM6A 5AVVA 2HO4A 4OCZA 1RC8A 5AKGA 3KDPA 1MH9A 1T5SA 5AI4A 2YMMA 3A3YA 4F72A 2HEGA 4BX3A 3VAYA 5AVQA 4L6AA 5IT0A 5AKEA 3WKAA 4Y3UA 1TJ3A 1FEZA 4Y2QA 4IG4A 5AKYA 1T9ZA 3ONNA 4CE6A 3BA6A 4UARA 3D6JA 3ESRA 4B6JA 3AR6A 1TJ4A 5AESA 4KYTA 1O08A 3ZI4A 5AI9A 4Y2SA 1F5SA 4Y2TA 2RAVA 1YMQA 2HF2A 4NAVA 1JUDA 4ZEWA 5ALRA 2G80A 3HLTA 2HSZA 3SKYA 2YY6A 5AW9A 2RBKA 5AKIA 2JAOA 1RMYA 1RLMA 4UMDA 1TJ5A 4YIKA 2B1RA 3EF1A 3ESQA 5JJBA 2BY4A 5AK5A 5AW1A 5ALFA 3ZTWA 3UMBA 5AVWA 5AM2A 3W5AA 1T5TA 4J03A 5ALNA 3B8EA 3MC1A 4JB3A 1EK2A 3NUQA 2G1AA 3E58A 1RRCA 3U7FB 2WF8A 1XP5A 4F71A 1ZD4A 3ZVLA 1Q91A 2B8JA 1VJRA 2FUEA 2R8YA 1J97A 3L8HA 2FPRA 2WF9A 3CNHA 3ZWDA 5AM0A 3FPSA
chains in the Genus database with same CATH superfamily
1KVSA 2HDWA 4JYCA 3HA2A 2GXSA 4Q0MA 4YBRA 1TU3A 1A9QA 4OQPA 5SYNA 1WW8A 5TRTA 1WZCA 2H7CA 3E23A 1WVGA 3GNTA 3F6CA 1P4AA 1YV9A 2NVWA 1ECBA 2F1JA 5HM8A 1FFXB 4R01A 5LMCA 3OZIA 2OQIA 2PA0A 2R60A 1HRKA 1TQ2A 4YMLA 2CYAA 1LBTA 2NOAA 5T4BA 3BVPA 1G20B 1RI2A 2XXJA 3EE6A 4KQKA 1PR3A 3K3PA 2H6EA 2QRJA 3AW9A 4BVKA 1LBIA 1U4OA 2FZKA 3NRJA 5AT1A 3TW4A 1R64A 2CW5A 1KZHA 5EC8A 1QANA 2UXBB 3CVVA 4AP9A 2WHQA 3A28A 1K1EA 4UEOA 1UBLS 2VT6A 2UYOA 3ZHZA 2WW8A 4U2GA 2XKKA 2IE8A 4BX2A 1D0VA 3EG9A 1Y63A 4HT3B 5B6PA 1S1CA 3PWTA 3P9RA 5DN6A 1T6NA 2QZJA 4F7DA 3DDNA 4DCUA 3U4DA 2NO7A 1HUQA 1JT2A 2A2ZA 3BILA 3QVWA 2QW8A 4J4HA 4EF5A 2NTEA 3R44A 1CNMA 3ZC3A 1JJBA 5JI3E 1DBIA 1SVLA 3GDOA 1ZK0A 1AQLA 1NYRA 3NDPA 4N0PA 2C9CA 3LBHA 4F4HA 1QHEA 2OEPA 2UYQA 4PICA 4LF7B 2ZFUA 1U2GC 1TZKA 3DDOA 2OHOA 3TJRA 1XDZA 1QWOA 5H82A 4AXXA 2FCRA 3HDGA 5F4ZA 1OCEA 3TOVA 1C1XA 1ICEA 3VH3A 3PFGA 4YRCA 1X2BA 5HCUA 2M1XA 3FCYA 2YNMC 1RE1A 1GYPA 4MIEA 4LDJA 3K32A 3DZFA 3LPAA 4OHYA 4XXHA 1TCUA 1TX4B 3KOOA 3IUPA 3BAFA 3L4EA 3PFIA 4INZA 2VYVD 1NW7A 3OEHD 4N01A 4NIMA 1GOTA 1LZLA 1VKOA 4U9HS 4PGGA 5AR1A 4AXBA 4BFZA 4EW6A 3PJRA 4D8WA 1N6OA 4W8GA 3ZY4A 1PI3A 3R77A 2DPYA 2BHLA 1NMYA 2XGMA 5CXSA 2D5LA 1S6YA 3D81A 3ECSA 5K3CA 3FFAA 3PQ2A 2Q9UA 4CIXA 1HDCA 4R1NA 5JG7A 4FFVA 3TNYA 5LDDC 1EWQA 5DI3A 4ZT2A 2CXOA 3AESA 3JQAD 4MR7B 4HFJA 4J0GA 1ZJJA 2VYVA 1IY9A 3OEHA 1B42A 1ANKA 4P34A 3HWSA 5IARA 4CEIB 5CM8B 4ZOQI 3HO1A 3IIIA 2ISQA 5D3MA 3TLMA 4M8NE 4YRZA 3HACA 1D2AA 3QKRB 5BR8B 3QLVA 4MCIA 1Y1LA 4K9PA 1XCGB 4O1HA 4G84A 1L7MA 4S35A 4YRGA 3JQAA 5JUWA 4G97A 1X3SA 1ML4A 2Q4EA 3KBBA 2C5FA 4K9RA 4P86A 3T4EA 3TVTA 2WIAA 3KQMA 4RFSA 5HJ2A 4X64B 1B15A 2PWZA 2GEDA 5H3HA 1SUCA 2ZI7A 3KCNA 4H7DA 1VGQA 1UZNA 3C85A 3OX3A 4IDQA 2P6MA 4P7FA 3RHSA 3TR5A 4KLNA 1E3WB 2BFDA 2CUTA 2WA2A 1XRJA 4E3ZA 5AVUA 3B85A 1D07A 1MU0A 2HSGA 1CY1A 1X7XB 1OUMA 3B7GA 5LZ7A 5BXQC 4MULA 3NTOA 1QG0A 2H54A 3VNBA 4TKVA 4RZIA 5C35A 4J94A 4MINA 1P62B 1LDNA 1RBYA 1MTZA 5ED0A 1WUKS 1SPBS 3V7WA 1AMUA 2O54A 5K0EA 1YCFA 1DZIA 1LD3A 3QKSA 3RVLA 3WMXA 1BD3A 1R8XA 2HLDD 2XTNA 3MWDA 2R5WA 4OHBA 2GK6A 1F2UB 1KI6A 2ZZKA 3K1ZA 3NHAA 4TWBA 4WFIA 5FT9A 3ZYCA 8ADHA 1JDBC 3PQEA 3B7PA 4G4GA 4H1HA 1Z6AA 3AETB 2VZ9A 1OWNA 4KJXA 4D3YA 3W9BA 2OB1A 2XVZA 1IBLB 3F96A 4UAUA 1RC1A 4CTOA 4QYXA 1KO4A 2XMZA 1X0XA 3HL4A 4HH4A 1SVOA 3GCDA 4WNIA 4ZYUA 4NOMA 5LN1A 1HETA 4R6WA 5NULA 4Y6PA 4L0CA 4TVOA 2BUAA 1MX9A 4WFJA 4G09A 5HF8A 3SBDA 2IW1A 3ZCSA 1J5XA 4GI7A 5LUAA 1XZDA 5KCZA 1W6RA 5BW8A 4X7BA 4ZQEA 2KBEA 2C8JA 4C88A 4UOZA 2BFBB 4RF3A 4FMCB 4YP7A 1QVAA 5E7QA 2PCLA 1L5KA 4EX7A 3HDJA 2ID9A 4GEKA 1AKQA 2O8BA 1CTQA 2J5KA 2OC4A 3K0KA 4OOFA 1AZSC 4XQCA 1RXWA 3I01A 3SN6A 1SUFA 4IOMA 4D4GA 1NTRA 4JI3B 3BIWA 2DCUA 1J07A 2V7XA 3PQDA 4U0KA 4XPZA 1R6VA 5BO5A 4ZTBA 1PK9A 2YHAA 4P7GA 5B6IA 2V9CA 4PZ9A 4OM7A 1F0PA 1WTAA 2C84A 3OZUA 1WXQA 3VH4A 1XMJA 1JJFA 5J23A 1UXHA 3UMFA 1SIUA 3C24A 1SAYA 4O2AA 5AO9A 3PIRA 4L0MA 2RJOA 4DM3A 1IN7A 4I8XA 3HB5X 5FTLA 1N0IA 4JP5A 1KBQA 4TQUS 1M33A 4ZGBA 2QXTA 2B82A 3WKBA 4AY3A 1SVSA 2HV9A 3QUSA 4FHZA 2I71A 4RE5A 3X3HA 1Z4KA 3VOBA 4E6EA 3A9RA 3DMFA 3PD1A 5AHWA 2EZ9A 1MENA 2DPLA 4BMCA 3ZYZA 4HAXA 4II7A 4PX3A 4I9UA 4Q1CA 5GZ3A 4TZ0A 2X5XA 1V5GA 5JPDA 5TGDA 4XARA 4CG3A 2C7PA 3LIIA 3K0BA 3O74A 4EW2A 3L7KA 4JITA 1H6BA 1GU7A 2W58A 3JQDA 3VC7A 2GR9A 1GSOA 2GAJA 3ZXXA 1G20E 5CLQA 3ULKA 2GZDA 4IVQA 3C3CA 3THWA 1V1MA 5HUHA 1J7KA 1N8KA 2QHXA 1V4BA 4K81B 2FEWB 2X76A 3WRVA 1M6YA 2J4CA 5KSZA 1NQUA 3BQNB 5HE9A 3G8BA 2WWGA 1B2LA 3H9GA 3Q8WA 3GELA 1WVIA 2JGEA 3ORRA 4G67A 1EFLA 2PO5A 3UJ8A 3EOAI 3F9IA 2IV7A 3EFBA 3QEJA 3RVRA 2XBLA 1SHTX 1YB7A 1G59A 2RKWA 4I4IA 4L57A 1CLEA 4C7OA 2P30A 4HVTA 2HCTA 1IIBA 2TMGA 3R4CA 4KGXA 4KAAA 4YMHA 4KH0A 3WKEA 3ZW8A 1MO4A 1W52X 3R3ZA 5IW8A 1Y5MA 4P38A 5DBOA 1LRKA 5KDLA 3MTQA 4DY4A 5IX8A 5KVCA 4PN3A 1ZRNA 3SZOA 1ML3A 1Z15A 3TMYA 2V55B 5AI6A 4F5DA 1QH8B 1XU4A 3IV9A 5EJGA 3SKVA 3FIUA 2ATVA 3L46A 4PG4A 3S27A 2ALJA 3UHFA 2NO9A 1Y1PA 1NQVA 1HT3A 5F7OA 4FK8A 2A0YA 2QRVA 5JH7B 4BC1A 3OA2A 1Z13A 2J0UB 4KQCA 3PPWA 4W6ZA 2JGDB 1G291 1OFUX 4FJ2A 4HR7A 2K87A 4AICA 1KAOA 3OOSA 4C07A 2DKNA 3OICA 5J4KA 4FGWA 1M10A 3R3HA 4GSYA 1GA4A 5DW3A 4MS3A 4DIUA 2D1SA 1TYZA 3TOZA 3QFCA 4U2BA 2E5WA 5U9CA 3ELWA 3NIFB 4WASA 1ZK4A 4NV1A 3KTAA 4U02A 1OREA 2VHYA 4X84A 4S24A 1QRRA 2MU1A 1UC8A 2BWJA 2EVWX 3F7MA 4WTOA 5M3BA 1H2EA 1J4AA 1NQOA 2VHWA 2WYVA 3C87A 4F56A 5FX2A 4MOWA 3PIDA 4PZLA 4PPQA 4EG1A 2C2HA 4B6PA 2DECA 4DJJA 2R79A 1VLJA 3IPCA 1A4IA 3QELA 3DE4X 1DMRA 4JJ8A 3MF4A 1WNFA 1TQDA 1VJTA 1HF3A 3AB8A 3LUJA 3R7NA 3AOGA 5IDQA 1GWNA 2QT9A 3ED1A 4FHEA 4OB8A 4D9GA 3NDBB 4MWEA 1ZCFA 1R0RE 2BFEA 4DC0A 4FR5A 5H81A 4XDYA 4A15A 3A25A 2VI5A 4D9NA 1Z6XA 1EHCA 2A35A 3SICE 4MLPA 1Q2UA 4RENA 5FAKA 2XVXA 1YKFA 1UJBA 1UK7A 2HK8A 4EB3A 1Z4NA 3ZGNA 4C89A 3ASZA 4HS9A 1OWPA 2OV3A 2QJRA 4CUJA 3FPAA 6CHYA 3LUCA 1TVMA 1JKFA 3BJZA 4RIFA 2HCJB 2BDUA 4KFTA 4L6IA 2Y8EA 4ER0A 1Z4MA 3GZNA 3C7DB 4KRYA 5CIQA 2F43B 2C9BA 5F3DA 4AQ7A 3GLRA 1Z06A 3MJ4A 1MXFA 4MO2A 4BMNA 4Q21A 5K8TA 3C3KA 4PO1A 4DWJA 3ERCA 3JVVA 1QZTA 4OIMA 5FBVB 1WR8A 3E84A 1W581 2B99A 1V8FA 2H2AA 2YWXA 4D4KA 3GMDA 3AL3A 2GZSA 3SXPA 1LC0A 3I42A 1NN1A 2FPUA 2EG9A 1PJBA 3GGSA 4DLRA 2B8WA 1GNLA 1Y7PA 2GEBA 2GJKA 3E2MA 4CLOB 4RU1A 3ESCA 4RJLA 3L4JA 3QPVA 6YASA 2FSPA 3MINB 1JHAA 2VJMB 3W79A 1Q22A 1I1OA 1T5IA 2ORWA 3I3SR 3V4OA 3NHRA 1G2QA 3ZHUA 4BWYA 4DR4B 3HO8A 1XZEA 1L8LA 1AKVA 3GJ4A 2EEZA 4QVIA 2ZDHA 2RCYA 2PFSA 2JCBA 3DLPX 4AUKA 1JQLB 4M9QA 4ZOLB 4OGGA 3BTOA 3EXHB 5JCOA 3W77A 4Q9JA 4NZ9A 5TMPA 1CJKC 4TMVA 1Z18A 3K9BA 1DDOA 4OLJA 1Z0ZA 4FNAA 5I7AA 1VB3A 4J3FA 1BWSA 3K9WA 4K86A 4U0JA 2OCYC 3GXBA 4HYTA 4JLVA 5EXXA 4PLYA 3W1WA 2R8BA 4Q3CA 5A5FA 4JU8A 4KK3A 4IJVA 2BKEA 4TTQA 1CF4A 1TD1A 1WBJB 2HQRA 3PHJA 4OG2A 3RGGA 3H5LA 3V1NA 3T1HB 1J1IA 3EY4A 3R6DA 1VKNA 1KO8A 4MAFA 1JLLB 1PSWA 4TYPA 3TH5A 3H05A 4P6VF 3SBOA 4G9BA 1XPRA 3WB2A 3DBVO 1RKXA 2IEGA 3JQQA 1R3UA 3U1VA 2BGGA 2RHWA 5IJAA 2PZMA 3OIYA 3L06A 1SUEA 2AG8A 2APJA 2QTRA 2WDZA 1T8SA 1G5RA 2DJIA 3E7WA 3KB2A 3FHTA 3LDUA 4UBNA 1V16B 4LE1A 4PAMA 4C0QC 1SVWA 1XTZA 4CG0A 3WAGA 1P75A 1W4RA 3VZRA 1PL8A 4LJ7A 1GCGA 5JWOA 3H6GA 5DSTA 3I9LA 4N49A 4GPTA 4W9RA 4L6AA 3RSLA 4BV2A 1DARA 3UANA 3WI7A 4E46A 2HL6A 4Z5XA 1DCMA 1GYRA 3NEAA 4PQFA 4ZVMA 4A0FA 4KP7A 4FD2A 1H2ZA 4M8SA 1YQEA 4TLCA 2PX5A 1OXUA 1AB5A 4A0SA 2VWHA 3AINA 3EZ9A 3N2LA 2PKYX 3IO3A 1QIHA 1SN7A 2YICA 1TTQB 1O08A 1UPTA 3HN7A 1GCOA 3GZ4A 2DLDA 4TTAA 2VYQA 1W1IA 4C08A 4YRMA 2ZWIA 4UHBA 2PDAA 3T5PA 1K97A 1ZISA 3JQ9A 1WL8A 2V7UA 5DTMA 5JD5A 3BXFA 4DMCA 1CJUC 2X15A 3UYKA 2FH5B 2Q6KA 2RGNC 2GVZC 3KWFA 2Z4SA 2A0XA 3EA0A 1Z25A 1JU9A 3P19A 2IH2A 1MHTA 1M72A 4JV5B 5EJ6A 1DBRA 5AWFC 4N82A 4V3BA 3S44A 3WC4A 2R7KA 4L7VA 1BE6A 1ESMA 2WTUA 1PGQA 1VE6A 3VR3D 1Q0HA 3EVNA 1HO3A 3NTUA 4WDQA 4Z0HO 2Y1XA 1Z36A 4GFDA 1QV7A 4UEWA 2H5LA 1NLUA 2FW6A 3LQQA 1W94A 4MHSA 421PA 5BMVB 3AM1A 1T5LA 2FG5A 3VQTA 3EVDA 1MRNA 5HMLA 4HNUA 4AZ3A 1WCYA 3GVHA 5K8JB 3KQTA 2F17A 4JK3A 4EUNA 2XBMA 5KINB 1DQSA 1ADCA 2RHJA 5FIUA 1WMBA 1SK9A 2FW9A 3VR3A 1RWPA 1THZA 2AC4A 1DUIA 2WTMA 1SQFA 3OJFA 3R5SA 1ZD1A 3DAFA 4UHHA 1RCFA 1O6CA 1XP5A 3A4LA 3AHJA 1ZGHA 1K08A 3CC8A 3HWWA 4QBGB 4DVJA 3K0AB 2QD1A 1CJMA 3X1KA 3PL5A 2OPHA 1EQAA 1XLVA 5KC8A 4HZIA 3AM5A 1J97A 2BJVA 1U1IA 3DNMA 3JQGA 4HQRA 1F38A 2ERCA 4RJJA 5L6MB 2OILA 5CLFA 4MP3A 4BN5A 2W2MA 4NTZA 3CB4A 4JVNA 1TM4E 4WXEA 4ZN6A 3A6HA 1W6UA 4MUEA 4BP9A 4YUZA 3MGKA 1JTFA 1ZR4A 2GVDC 1FDIA 1YVRA 4WLVA 4EA9A 4PNEA 4CL2A 2J08A 5HK9A 1A50B 5EGNA 2XQJA 3A4NA 4HRXA 4MV7A 5H70A 2BZSA 4DANA 2O06A 3QUTA 3RS3A 4GLOA 4XKJA 1JIIA 1ND6A 2GEKA 3R7DA 2Q27A 4NENB 3AERA 4V02A 3RYFB 1RJGA 4ALNA 4EW3A 5K99A 1WU7A 3HXMA 1ARZA 4HF7A 1I4DD 1PT6A 4ZZ1A 3HYNA 2D8AA 2C9ZA 1BQEA 1DP4A 4OAPA 2Y9MB 4XIYA 4WX2B 3Q98A 4NY1A 2ZUSA 3DVQX 1E63A 3RT1A 2DX7A 3W4JA 1E9VA 3H4TA 3MLEA 4HKTA 2OGZA 3VPCA 4J0FA 1COWD 1XZLA 4FZ5A 3ASYA 2BR4A 2CXUA 1RLOA 1QNLA 2GPWA 3PG5A 1TM7E 3Q6NA 2PL3A 4CM8A 3EG5A 3MLBA 1XFDA 4PTZA 2Y1GA 4ZJUA 2GPSA 1DB3A 2AC7A 3G2JA 4Z6KA 2QTZA 1PN3A 1M76A 4RV4A 1YSCA 3GJ7A 5ETJA 3OIFA 4BXOA 3M1IA 3H97A 4E1AA 1COWA 3UJHA 4EHDA 3WIVA 1C9EA 1KVTA 2NO0A 4HQLA 2C4HA 4Y2YA 2PUDA 3F4KA 1UEXC 4JJZA 1FSZA 4I99A 2GFQA 1P1HA 4HVCA 1YASA 4E5PA 3CXUA 5AHKA 3DLCA 1EIZA 3ET5A 5F52A 1WP4A 4NF2A 5C1IA 3WL4A 4OSEA 1EU1A 2GYWA 1U3TA 3ICCA 2WK1A 1KL7A 2WT9A 4NMXB 4LX8A 4XZ3A 3UUFA 3NV7A 4QGBA 5DYTA 4QOFA 3LHSA 4KAXA 2Z57A 4CIYA 1QK3A 1M2VB 1QDLB 3PDWA 4EKNB 2ECQA 2UYYA 4REQB 5DHRA 3S3TA 1VPWA 5JS7A 2EWMA 5F2KA 3QOWA 3MCWA 4CL8A 3V7YA 1XP8A 3PDCA 1WRBA 4O4IA 4CCYB 4W5NA 1Y7TA 3M3HA 5FYDA 2IBMA 2HY7A 1VHJA 3JATB 1VI5A 3ND6A 2QG9A 3GZJA 3FPKA 2UZ1A 3T41A 3LHKA 4B79A 5JV5A 3V8VA 5HRUA 1ISMA 1NP6A 1OAOA 1V4NA 4NZZA 2C3UA 4WNAA 1OX4A 3LQFA 4MMZB 4C01A 2PUVA 1TF5A 4QKQA 2R8XA 2YVAA 3TPZA 2C2WA 1GG2A 4F91B 1M2OA 2GRUA 2J3MA 4XUGB 4GUAA 3STWA 1FTYA 1L5ZA 4WK6A 1VMEA 2LWIA 4LF5B 3P4XA 3A1VA 1VG1A 4B7XA 1L2TA 1ZHHA 2RHTA 2PQMA 4MKRA 4U6QA 5LM3A 4MS1B 1YRWA 1ISFA 3KYDA 1H3NA 1DAPA 2I9PA 2FK8A 5ILOA 1Y3BE 4AY2A 3NGXA 3CLRC 3IQFA 2WLTA 3AF3A 2C8VA 3W5BA 4WJLA 4JLNA 1E6UA 1CXZA 3EGXA 4FYYA 5AOCA 4JP3A 3V1YA 2C29D 1XB2A 3SX4A 2IHVA 1GILA 1U0FA 4WCVA 5LLTA 3QMPA 5KJCA 2HKIA 5ILQA 5KREA 2PD4A 1RRFA 4DWOA 3PKZA 4OVKA 4NDZA 5EIHA 2J87A 2VNJA 3QEOA 2D0IA 4URFA 1GV1A 3QXSA 1ZJWA 1TVCA 3RU3A 4DV3B 5E6RA 3OM1A 2FSHA 2ZB2A 4DJTA 4RVCA 4L4UA 1PR2A 4BB6A 3LOPA 3R8FA 2B5WA 3AJEA 1VHLA 3CNLA 3EBLA 2HH9A 3N2KA 2NU6B 1XZJA 2NLOA 2OBXA 1JI3A 2IZ0A 5CTJA 1ID1A 4L16A 5JNWA 2G8LA 4TVKA 2VXBA 3WWCA 5C5DA 3K09C 1TUGA 1YR2A 3M4ZA 4Q7QA 3U7JA 5JXHA 4JLAA 5D6OA 2Q5OA 1F2VA 3A8TA 4CL3A 2FZEA 3KC2A 2HJRA 4GC5A 2QQEA 5D3ZA 5IK2D 2XTMA 4RGVA 5JNTA 2VRBA 3EXHC 3II6X 4JU9A 4ER7A 2P90A 3GN1A 3TUJC 2EX0A 4OMCA 4FI3C 4Y2PA 2AQHA 3Q6IA 1GL3A 2JCGA 4ZTUB 3IPAA 3SDBA 3OQ1A 4IYJA 1VGRA 4RFVA 1TQHA 1J2TA 5BQFA 1VCOA 2GNOA 4C4OA 1DO8A 4TMFA 4MV6A 4P98A 5IK2A 4B4VA 1Z38A 2OCLA 2ZYIA 4CTNA 1I9GA 3J7TA 3QPWA 3W5UA 2P91A 2Q4BA 2I6FA 1Z0JA 3DS8A 3QIVA 4XD2A 2WG0A 4A91A 3KAKA 3ZUGA 4MVYA 5BNFA 2WJ4A 3ROMA 4HN9A 4BLVA 3HZOA 1VIAA 2I2FA 2FQYA 1KOFA 1T8TA 5TV2A 4P5EA 2JJ1D 1WF3A 2A1UA 3B6IA 2J3QA 3HJBA 1KYYA 3Q72A 4D81A 1DAMA 2VATA 4MW5A 1GDHA 2ZTMA 3I61A 2O7NA 1RYMA 3QHQA 3QW4B 3OCCA 3LO5A 4XPIB 4MMYB 4RACA 1WMDA 3WNZA 4MARA 3CEAA 4C6TA 4DMRA 4F4DA 3MMXA 1V37A 4UPDA 2R6ZA 5K6AA 2UYHA 1NP7A 2R85A 4BAGA 5KOJA 4C0HA 1PVDA 2F6RA 3NTRA 3R6TA 2NP7A 2JJ1A 1XNQB 4DPMA 4KK4A 4DQKA 1FUIA 5C80A 2Y05A 3HWX1 2O2XA 4YHBA 4B6GA 3ACDA 3KAPA 3RC3A 1BXGB 4UE3S 2V6GA 4BNGA 2WIGA 4YQFA 4RESA 2Q5HA 5F2EA 1M5TA 3O95A 2PRKA 3WMEA 5JDIC 4G2TA 2V4MA 4EH1A 3ZWVA 3RVMA 4JOBA 2NUPB 3CLSC 3HKEA 3L0ZA 4BX9A 4DIDA 1JHZA 1KDZA 1KJYA 5AXCA 2H51A 2ZJ1A 2IZ6A 2QIPA 4I0WB 2CBXA 4Z86A 3GP8A 1UZAA 3FJOA 2MYTA 1XQ9A 3CEJA 3FHJA 1NLYA 4J0JA 4OH1A 4UM9D 1JSXA 4K6HA 4X97A 5JSFA 4ARZA 1KDOA 4LY6A 4P80A 4Y1EA 5B5SA 5KPDA 4BY9E 3TPFA 1SQSA 2P27A 3DEAA 2RBGA 2B37A 1NC3A 2J0VA 3DNPA 3M1YA 2BHRA 3QXGA 2O2SA 4P4NA 1LBQA 3T9AA 1X3LA 1BIFA 4LRXA 2VA9A 4YTEA 1G7SA 3K2IA 4ZZ3A 2JASA 1T5BA 1H4SA 2JAWA 3E0XA 1T1GA 4NBWA 1YA8A 2UKDA 3CX8A 4PQEA 3WGYA 2QGNA 3SM3A 3GEBA 1AXEA 1YZKA 2C4MA 3G68A 1CRPA 1NUPA 1S8FA 1XJ5A 2YWBA 3Q9UA 2B5VA 5DULA 2NSLA 2ZT7A 1NF2A 4LZAA 4TWZA 1ZRSA 5BN5A 4YP0A 5SZKB 3ADDA 3VV3A 3WGTA 2FYTA 2Z4RA 1T4GA 2Q2WA 1GUZA 4ITVA 4TKZA 3QU7A 5GJVC 1KTVA 1K5DA 2VO1A 1K4KA 2RDMA 3IP1A 4K6OA 2A84A 1XZCA 3RYIA 4LZLA 3P9ZA 3UMGA 5KU1A 1YD7A 1E5VA 2JHAA 4BN4A 4H6WA 2X0RA 4M7OA 4YGYA 4FDVA 1OQAA 3LX6A 3OE7D 4U2EA 1T9KA 4PAOA 1KTIA 2DTEA 1RWOA 2E18A 5EZ5A 2GCOB 4U39A 3B78A 2M6KA 5CBKA 5DOZA 1MGPA 5DW0A 1YU6A 2GPAA 3BE5A 3X43A 1L7OA 5F9FA 2GZ1A 3LY9A 1BS2A 2Q9AA 1PWXA 3CZPA 2AOUA 3NFYA 1MVOA 4ZXFA 2QT0A 2YINC 4HDRB 2VQEB 2SECE 3IMFA 3TLJA 1E62A 3ISJA 1NBME 2GLTA 4EPVA 5JSHA 5LVAA 1KAQA 1XOIA 2PUGA 3OE7A 3WADA 2I91A 2QUKA 4BJ1A 2OC9A 2ARKA 4BX0A 2PGDA 3E9ZA 3OCVA 3GIDA 4M9UA 4N5LA 2OV4A 1S2OA 1Z5WA 1ESZA 5ENZA 3QOFA 4TV9B 4KFSA 1Z16A 2A59A 3COSA 2CN1A 4YVFA 4I55F 3EHDA 2ZJ4A 3DFMA 3IVRA 4FIDA 5TQ0B 4EJ2A 1K8ZB 4TYYA 3KJHA 2J7PD 2B9EA 3L8GA 4D25A 3NATA 3EIWA 4QFDA 2Q2NA 1SBZA 1T9BA 1BKSB 2NM0A 2EOAA 4GRAA 5IAEA 3HM9A 2WTXA 3MWEA 4Y1RB 5AXAA 1Z2EA 3M70A 2L19A 3NI2A 4MUBA 2GZ3A 1XVUA 3C6MA 2AFHA 3ND7A 3DAOA 3L92A 3IUNA 3JW8A 4O08A 5COAA 4AS2A 3VHXA 3W5DA 3ADCA 4ZEXA 4CNQA 1YQXA 3JYQA 2Q5JA 4HX9A 3A1TA 1U2ZA 2C96A 2J7PA 3KYJB 3W04A 1NE7A 5FPKA 4YH1A 3T0FA 4FFDA 4K6CA 2IYQA 4R84A 1E2BA 4AKIA 4DXHA 2G72A 2ZWPA 3NNSA 2AWNA 1FU4A 2ZULA 1LNQA 3R5KA 4H1TA 3X44A 1F20A 5AKHA 4C5AA 1V26A 1YFKA 2ZRCA 1MIHA 3VPFA 4CKBB 1D04A 1I6LA 1GFZA 1VE5A 1CK4A 1XALA 2R1TA 5CA0B 2CHVA 1YDFA 5KQRA 4IXDA 5HW0A 4NMHA 1LFDB 1AA9A 2CYCA 1XLWA 1M8KA 3QJ5A 5DHSA 5ELMA 4WY2A 3BD8A 3TL6A 3BSFA 3WGOA 1C9MA 1U63A 3D4IA 4QUGA 4R2MA 4XR9A 3PGMA 2BRUC 4AN0A 1DBSA 1C5KA 1QBGA 3GLSA 2O8CA 2PKQP 2X13A 3RSHA 3DZ8A 4ZK2A 5EINA 1IFXA 3TZCA 5K0BA 3LDHA 3UOAB 2ZPAA 2WINI 2B3TA 2M98A 3GK3A 5JDCC 4EZEA 4GP9A 2OA0A 1BDHA 4RBNA 2IJGX 3AR4A 3A7EA 2OHVA 1GQYA 1HE5A 4QT0A 3RE1A 4GKVA 5KSYA 1U28C 2IXBA 1L5OA 4CIWA 2P9EA 2IVZA 4OYHA 4UTVA 3IB6A 5IJXA 2JI8A 4G07A 3S28A 2CE7A 3USZA 3KG2A 4PR0A 4HLUA 1DAOA 5EJ8A 3BERA 3HFSA 2FPGA 8GPBA 5CDHA 1EHIA 3P9QA 1KAGA 1RHQA 3SIPA 3FFBA 4EHJA 3GFTA 4MIKA 3PA8A 3QNWA 3CG4A 5I9BA 5CU7A 4BVLA 1DO0A 4UHCA 1OKKD 2V74B 4C78A 4PYMA 5AI4A 2ZROA 2LDBA 4OQLA 4TXMA 1YVUA 2PLAA 5CEJA 2VF5X 4HBZA 4FJ1A 1XYYA 4V0MA 4F6RB 13PKA 1DX9A 4IOLA 4OJNA 2FEKA 3O3CA 1YQQA 2J09A 2XHZA 3CONA 5GONB 2P0AA 2QQFA 3SQWA 1LX7A 4A4DA 3U6BA 4EGSA 4IO0A 4UJ3A 3AVOA 2EQ5A 1PQPA 1XRSB 4R2XA 1B6SA 3LX8A 3ENNA 3PBKA 5AKYA 2YZMA 4AJ2A 1SXQA 3EB9A 3ZVKA 2EX4A 1KQ3A 4WEOA 5DWQA 4CMEA 3EYAA 1MA3A 1Y8RB 2QTCA 5EPUA 2JLWA 1VMKA 1U6JA 2Z6UA 4LWZA 1A7JA 1R0ZA 4TZ6A 3EGVA 2NX2A 2NU7B 5FTMA 3TQSA 2QAIA 3L7AA 3L6UA 1RXEA 4KO8A 1SY7A 3Q3IA 1I6KA 1F5SA 1KNXA 1XA3A 1OYOA 1SIWA 4NVRA 2HHCA 4Y2TA 2OFFA 2Q46A 1WMSA 1HPLA 3C5WP 1YK1A 1V8DA 4IRXA 4OA8A 9ATCA 2VDLB 4IVPA 1C41A 2AA3A 2X9QA 3HZZA 1OAKA 1JG1A 621PA 2G80A 1FRQA 1I7NA 4EKGA 4JI8B 1J8FA 1OB5A 1PJZA 2YY6A 1OBFO 1NI5A 1NSYA 5LQMA 3SWWA 1PLKA 1B76A 1WG8A 3FI0A 3WAKA 2FNAA 2P4QA 3KKQA 1TEVA 3K6SB 2O8DB 3H5IA 4E07A 3DMTA 1U8FO 2YN0A 2J6BA 4C03A 2JD1A 1JFLA 1Z5PA 5JJBA 521PA 4J76A 1HYGA 1II9A 4EHFA 4PLCA 4W5RA 1YVEI 4E21A 5FLYA 3I92A 4F2WA 5AVWA 4JJAA 3VU0A 1Z0DA 2BBTA 5ITVA 4G37A 2JJQA 3NBMA 5K3OA 3L6DA 3FUTA 1DMSA 3P0IA 4GGOA 3E35A 3WB9A 1CZUA 1WY7A 3DB2A 4IDFA 3I9KA 4F7WA 3SHOA 3UGKA 1OV6A 5LYJF 3PFCA 4DNQA 3FKQA 2P65A 1IULA 3I2FA 5FR1A 3KHUA 2LUOA 4BP3A 2D0OB 3NIGB 2VC2B 4F71A 5J9FA 4IUBS 3H13A 4NZOA 4JJ6A 2LNDA 1FY2A 2C5SA 4D3DA 4YAEA 4ITRC 4ZARA 5BRNA 1FNNA 1RPJA 2AMVA 5G2OA 3EZFA 1BFKA 1Z8HA 4Z4QA 3CRZA 3PZRA 1JR6A 5IAJA 2EJBA 4WPGA 3BCRA 3C4QA 1SUWA 3C1TA 4TMKA 3WYAA 2Y76A 4IXMA 5AM0A 2OGUA 3HKBA 2ZM6B 2GA9A 2P9HA 1G18A 1XL0A 3OLCX 3T9EA 2ERXA 4FWBA 3VU9B 2W2OA 4XOUA 4HEA6 1EDEA 4D4LA 4H16A 4M7PA 5T41A 1EM8A 1EBFA 2JAHA 3A4VA 4NU6A 4DUYB 3WA7A 3DP9A 5AW4A 1TJNA 1H2BA 2BFNA 1EUYA 1BRMA 5EUMA 1TRHA 3CNOA 5CM9C 2AKYA 1P73A 3B82A 2WTBA 3KUDA 4CJXA 3LQ2A 1C4KA 2Z30A 3BMOA 2QG6A 1ZAKA 2WWHA 1P5FA 4BNNA 2VAXA 4RORA 4MRRA 4H4EA 2IOFA 4AP5A 1AMOA 5CM2Z 1T8YA 5ER6A 4D8YA 1DG1G 1KMHB 2R11A 1CUXA 3V8NA 2R6R1 5JZVA 3U3OA 5JZSA 1R1DA 2MSNA 3HHEA 3MJRA 1KYQA 2P6UA 1MAVA 2I3ZA 5L7YA 4MWTA 3RU9A 4B3DA 1VP9A 1NR7A 3F2VA 4YCMA 1PZHA 2XYRA 2PJDA 4N5IX 4UM7A 1DEAA 2DSNA 3EGDB 2VDKB 4FZJA 2XOXA 4A8JA 5LZ4A 3O3MB 1RRPA 1UJNA 1Z33A 4G8BA 3V8QA 1RFGE 3QY9A 4BO8A 1MTOA 2I2CA 4MV3A 1Z5OA 4J0EA 5KC9A 1VPTA 5LYJA 4KN5A 1FZTA 5KZMB 3H5OA 3W5SA 2R86A 5DM60 4PZAA 4BQFA 1IRIA 1SUSA 1AB6A 3BWBA 4QO7A 4DCJA 3KJZA 3M7IA 4BV8A 4DR7B 5HMMA 1ZM2A 3FYTA 3OZTA 2ZUBA 2P1ZA 1JXOA 4WVFA 5AKZA 2D2FA 5IJ0A 1D2MA 4H7HA 3TIVA 3TKAA 4YJDA 2WHRA 2VEOA 1PT9A 4YXFA 3UWSA 1C7QA 3SYLA 1DBVO 1V96A 1Z39A 2AGVA 1X9GA 5LNK1 3RAGA 1Z5ZA 5TMDA 1UAAA 1I0IA 1YNSA 1ZU4A 3BSSA 5DBIA 1PS0A 1PL6A 3WMFA 4BFSA 2Q3FA 5I7EA 3KQUA 5KI6A 1P2UA 1ZK1A 2D1QA 1OSNA 4TXLA 4KITB 3X1XA 3BD9A 3KZOA 2XV1A 2JW5A 1NOJA 4A10A 5L4LA 1GKIA 1XQYA 5I4IA 3AWIA 2QG4A 1VCMA 2BFOA 2VJLA 3BGOS 4RCZA 4YWHA 5L51A 1XWWA 5IBCA 4G0PA 4E7OA 1IZYA 5KWEA 3I04M 1GQFA 3WZLA 1HE8B 3GBSA 1Z12A 1N9GA 4XVQA 4BQQA 1QXSA 3ZV5A 2FQXA 1J9EA 3OCWA 3OTQA 1QP0A 1HI9A 1M34A 3FYUA 4IJ5A 4QOSA 4XAQA 1SOVA 3ET4A 4HZUA 4DCTA 2XGGA 4EJMA 2M6RA 3LCCA 3N1UA 4B6FA 2BMVA 4W7HA 2VWQA 1RWQA 1XTTA 2HM7A 3KELA 3P7MA 4ZAVA 3V6MA 3VH2A 4EIWA 2WP8J 1RHJA 1XU7A 3RCBA 3VZCA 1WQ4A 1TUBB 2H8GA 4F60A 2PBFA 2OAQ1 1TTPB 3D8HA 4MVXA 2CHFA 5AJYA 1XTKA 1DCTA 4IUDS 2OV6A 3UM9A 4EJFA 3VFDA 2D06A 3ILXA 1UT6A 1L7VC 1OF1A 4ESHA 1PNRA 2A78A 4PTLA 1T4CA 2NZXA 1P1FA 3A1EA 1IY8A 3AYXB 4UAJA 1EE9A 1POWA 2B4QA 4EI8A 3PFHA 3GGJA 3PXUA 3H0KA 1Y80A 3N7TA 5IC6A 2VCYA 3BL5A 5K9ZA 5K05A 1HBJA 4DA4A 2VF2A 5J2UB 2PGAA 2R87A 4E3WA 3PNVA 4FR0A 3VJLA 3L07A 1VTKA 2I0FA 4OHMA 3LCVB 1H23A 1MQ9A 2PEYA 2IXGA 4CWAA 3D6TB 4Q3EA 5FOXA 2V65A 1G6KA 2NZUG 3OLZA 5HS6A 2XUAA 2PQ0A 5TPWB 4C7MA 4DIFA 2WJYA 3EUWA 1QORA 2CKMA 3ELBA 3JQ7A 1Z3IX 2D1RA 5CVEA 3MVEA 1HH4A 4NFHA 3L77A 3FYDA 3L6OO 5FPPA 1K89A 4BGUA 2G76A 3TVYA 1QRDA 4XWKA 1OXTA 4JP8A 2DUMA 2PCJA 4NJMA 4TT3D 3AZPA 1NJGA 1U7ZA 3TLZA 3QMVA 1E2DA 5ALMA 1S02A 3IQDB 3ZY2A 2AK3A 6REQB 3GVCA 1EJ2A 5JATA 5D5QA 1YQTA 1LW7A 2ZR9A 5A3SA 9ABPA 2FEXA 4PSCA 1QIGA 4JT4A 3IC5A 1QGDA 1TAGA 1L8OA 2VA8A 4GOMD 4BVBA 2JGRA 3DTNA 3NIWA 4UXJA 5G4KB 5SYMA 3L40A 5H7XA 1QZXA 3TZBA 5H9WA 4TT3A 1MVLA 3FGOA 5E4FA 2P69A 4OXNA 1ZM3A 3D3WB 4O3MA 3O84A 1GPH1 3A6EA 4HFNA 4OV6B 5L40A 5JZOA 3QYFA 5LYYA 3TB6A 5F9HA 4LECA 5K3FB 1UODA 2GNAA 3R7WA 3NB0A 4HUQA 4C21A 2ZAYA 3GH1A 4WUTA 1K27A 3BJRA 4YMUA 2WJVA 1KS2A 4BJ6A 1RFLA 4FINA 3ROKA 3PXDA 3WZMA 3ZHSA 4BLPA 5IG2A 3PLAE 3QA9A 3ZNNA 3PXCX 1GR0A 3B13B 3PA6A 4YCDA 3ZH2A 3DBHA 3VU1A 3FD8A 4OP2A 3FPGA 3GLIA 4GMXA 3L0DA 1TLFA 3DM9B 4TTSA 3L1JA 2FWMX 1XZFA 5K3AA 1WLSA 1IYZA 4DIMA 4RH1A 1NXQA 4FB5A 2QVXX 4OI0A 3ZPXA 4B82A 5J5AA 1P4HA 4FW9A 5IM4A 1FFYA 4C29A 1G3IA 4O4JF 2NZYA 2YCBA 4X00A 3JU3A 3LXXA 5C0OE 4RTMA 4BNYA 4B7AA 1BE8A 3FSEA 1CUYA 2ZUUA 5ALQA 2CFSA 4JOCA 5U1PA 4XDZA 4YC7A 1GN9A 4JDPA 3UG7A 1K2VN 4XVUA 2FN3A 1KHHA 4RKEA 3Q2IA 4OL9A 2WM2A 4XYMA 4B6RA 2R96A 1D2NA 1ZZEA 1EK5A 5BSFA 3C6XA 1JNXX 5CEEA 2N9UA 2HGZA 1NULA 1OLXB 3H7AA 4FSXA 4YIHA 1ZC3A 3RFCA 2FN4A 1R0KA 2R751 2KLBA 2VHZA 4OPMA 2N47A 4X3CA 4A6DA 2F8SA 1W19A 2OQRA 3GRRA 3ELYA 3KZ1E 2ZREA 1S3GA 1E96A 1XK7A 3M3PA 3EZGA 3GQBA 5EE1A 1X8XA 3IL2A 2PH5A 5KQLA 4I14A 3TG8A 1E1NA 2WWIA 4JI7B 3G88A 5LZ8A 4Y7DA 4Z8YA 3FB1A 5KYYA 1JIUA 1I4WA 3MPOA 2CF6A 2PUEA 4PRLA 1CDZA 2R5FA 1P5JA 4KB5A 1FXUA 3L5KA 4YDSA 5JS1A 5AIBA 1GPBA 3N8KA 4BAZA 1L3IA 3B3GA 3L7IA 1X7GA 4BIMA 2N1MA 2EYQA 1TOAA 3ONFA 4LRYA 1F14A 3BMNA 1GJRA 3GPBA 4BKUA 3P4YA 3PE6A 4L1KA 4FOSA 1C1DA 3U16A 3S1LA 1NONA 1DEOA 3KXKA 4CKZA 2H7VA 1FS5A 1JAZA 1EDDA 2WLSA 1P45A 3RVNA 4EO4A 1Q1GA 3P2IA 5A3JA 5JEDA 2DH6A 3HB4X 2QTBA 4F9TA 1RD4A 5AUNB 3KOYA 1UWKA 1YHYA 4P2BA 2GK3A 2E87A 3Q3GE 5ALXA 4NSNA 5A5DA 4RH0A 4XQ0A 1Z2PX 1UPFA 2ZRFA 5JXJA 5TE9A 2KE5A 4U7FA 1F8FA 3T54A 1Y5IA 2PKCA 2C4NA 3PL1A 2A33A 1A1VA 4IPTA 4YAIA 4KQEA 2IEBA 3FOBA 3G2PA 3JD3A 3OTIA 2YL2A 4BLQA 2CLIB 4JT8A 2P67A 2WKPA 4PVCA 1Y5RA 4QSMA 5LDHA 3ABRB 1B8OA 1I13A 1LPNA 2A67A 1DXQA 5KWIA 1SKMA 3I05A 4GPBA 2C2YA 1KIAA 5DT9A 4LSZA 1ZZGA 4E2ZA 4RXUA 1X7YA 4OXYA 2P9TA 3SJ7A 4YAUA 3HADA 3U6KA 5A9SA 2JDID 4QRDA 1LS6A 3F3MA 1EK6A 3IP8A 1U7DA 5EY5B 1D4AA 2CXXA 1PLJA 3GWZA 1RWVA 1SZDA 1VM6A 3G8CA 3S1AA 4OFZA 2VHXA 3WYEA 4CKWA 1DOAA 1PZFA 2OBNA 4IFIA 4J0DA 1T2DA 4JVSB 5DYGA 2B7BA 1VJDA 1SVUA 2XZPA 3M5DA 3WFJA 3L4KA 1W85B 1JL3A 1ISRA 4OUDB 4OP3A 4RX1A 4UTZA 5FPHA 1E98A 1VPEA 4NCNA 4TXNA 2JDIA 1Z26A 1DFHA 2E55A 4EVRA 1CRZA 3KLBA 4EHHA 4X20B 4H2DA 2PX8A 2IWHA 2ZI6A 3MGBA 2G82A 2Z08A 4XIJA 1NVVQ 3T5TA 1PG0A 2IHBA 5IKMA 5AI0A 3L49A 1YE8A 1N0WA 1QX3A 3KT6A 1YZ3A 2CF5A 5CR9A 1WXFA 3V2IA 3CVXA 2DHRA 5D6NA 2CVOA 1F1BA 4IDCA 3KU4A 5ELLA 5F1PA 3QE2A 1ZOOA 4XD7D 4OLHA 4B87A 5D01A 1ZVMA 2H1VA 5D2CA 1P1RA 3I1FA 3ZWBA 5C2JB 2ZUEA 4QTTB 1XRMA 3B9QA 3AR9A 3GD5A 3NEJA 3OP1A 1NTOA 1PW5A 2QRLA 3TQCA 1LDMA 4TXHA 4P53A 4YV1A 2RGAA 4U9IS 3IH5A 1IK6A 3ZU6A 4ALKA 3NYQA 2JH8A 4KXXA 2HAEA 4KV9A 2B69A 4XD7A 3MSXA 3WLRA 1Y82A 2FPPA 4MXDA 5LQCA 4RTPA 1IPHA 1EUQA 3OCJA 4RPGA 4X45A 3KXIA 3HBMA 3M6WA 1U11A 2Q49A 4BFXA 1E2PA 1UIRA 1SA0A 2EXXA 3HNPA 3CUEF 2P9JA 2JH3A 3HVIA 2Q1YA 1V5IA 4HNQA 1TC2A 1HT1E 4M0MA 2J8ZA 5K3SA 3JQFC 4K8RB 4CCWA 1RMTA 2WYWA 2VQ6A 4DXDA 2DTXA 3JQEA 4GE0A 4LGYA 1FIUA 4IL5A 3PDIA 4J43A 1T10A 1ZM7A 2M9MA 2YVKA 2I8CA 3RJ5A 3BYZA 5B7GA 4CDNA 2ZVJA 4RA6A 1Y37A 1NMXA 1MC4A 3INRA 5BWLA 3S4YA 5FR2A 3DKIA 3AU8A 3E9QA 5AOAA 1XMQB 4KBGA 4M1EA 1N5OX 1NA5A 3BGDA 2QKYA 2TRSB 3U0VA 5IKXA 2V7QD 5FWXB 3EXIA 1RYNA 2ACKA 2J6HA 2AQKA 4ZA2A 3WDSA 1XYGA 1WQ3A 2WU4A 3CIOA 3GJ6A 3QE0A 4AJ9A 4M0PA 1ZG3A 2QUIA 2HO4A 1RYDA 2X19A 1GKYA 4RPLA 1ECJA 4QG7A 1YF3A 3WGHA 1FU8A 3DKPA 1J1ZA 1H6AA 2Q2VA 2OCGA 2DERA 2GS9A 3KVNA 1EVLA 2HEGA 3HN2A 3VA7A 2XODA 3MHPA 4G65A 5LCXA 7YASA 1J24A 2V7QA 4CFZA 1U0SY 5TEWA 1DDGA 3KPJA 4GPEA 1KR5A 1MBZA 2J9GA 2MINB 4JX8A 4UAGA 4UFPA 2I1LA 3IIEA 3NCTA 4Y3UA 4CN9A 2EJUA 4N03A 1OLOA 4MUGA 3OPNA 4YRSA 3DLHA 3BHNA 3K4HA 2JI9A 1AJEA 2MTBA 2I87A 1I4EB 1PE0A 2J5XA 4B2PA 3HVHA 5KYVA 4IV8A 4L27A 2Q28A 2ZIGA 2F64A 3CSUA 3AR6A 2JLBA 1JQAA 1QB7A 2YV5A 4CQMB 5B3LA 3UW1A 1PK8A 3ER8A 1S8AA 1SC9A 3ESDA 3EDRA 1O3YA 3CRMA 2PD3A 4I46A 3DOUA 1L1QA 2VT3A 5DRYA 1AS0A 2R66A 4JUIA 1SURA 1F2DA 3UTCA 1ZITA 1P2TA 3DPUA 3SGLA 1SUDA 2D4AA 4BGEA 2EBUA 4UEJA 1ATZA 1KGSA 1PFYA 4NKRA 1K0FA 4HB0A 4ZCSA 4JFAA 4C0BA 5IVHA 2O19A 1UJCA 1OXSC 1P39A 1XZGA 3DXZA 3U7QB 3NRBA 3UZUA 4FQ7A 5LU8A 3OFKA 4XTRA 1AQJA 2DHDA 5CUQA 3U48A 1YCDA 2E85A 1KMIY 1UKZA 3FDFA 3HJTA 3NRCA 4MGYR 1C1YA 2DR0A 5IJZA 4Y30A 3LLUA 4XJSA 3O4FA 5CT6A 3ZOZA 4AUMA 1FMFA 2Y1KA 3MLAA 3OSZA 4HRAA 2RGRA 1OI7A 1EVQA 1GL9B 1JS1X 3OQMA 3KKKA 3EYWA 1C0PA 2X4LA 3HRHA 3KDSE 4MJ7A 5I7WA 3TFOA 1DL5A 1I7DA 3HCFA 4QUDA 4Y9DA 1UFQA 1WPXA 4LWQA 4ZI3A 5DM70 3GYBA 3LFHA 3OOHA 4CM9A 4A8TA 2YWFA 1IZ7A 1JB9A 4V2UA 2PNJA 4L73A 2JIBA 1G20A 2WU3A 1G6OA 1ZGAA 3E3OA 2XRZA 4YA6A 3T7TA 5MF6A 1U2QA 2WF8A 3BMQB 5K1ZA 3A36A 1U81A 4QHYA 2NUBA 1ZD4A 2BD0A 1QIDA 1RI1A 3SHVA 4UNPA 5FXMA 4RJTA 2VAVA 5CFLA 3OLVA 3DEHA 4QAQA 4BNUA 2P4UA 3PTAA 2J3KA 4IIBA 3R3WA 1XCBA 2LV8A 3HWRA 2Y0EA 2VOEA 3CVWA 4F1KA 1I3NA 4BRSA 3PQCA 1WXWA 2BF4A 3N5CA 2WAXA 4YJ2B 5EJEA 5DRTA 4YYEA 1A88A 1R00A 4R71A 3K2EA 1IMJA 2ZSJA 2AD5A 3IKMB 4IAOA 1B4DA 3DXYA 4OMUA 5F7ZA 1V8PA 1UPAA 2F48A 1NN0A 3N0XA 2GJAA 3EA5A 2DBRA 4IV0A 4P84A 1YUMA 3CF0A 4KXQA 1KSFX 3HS3A 2J3IA 1DBPA 4KE8A 5J4YA 4JUAA 3ZQ6A 1KBOA 5F23A 4RYLA 1W5BA 4WCDA 3D2CA 1SD2A 3EULA 2XB2A 3U44B 4FFWA 4QJ4A 1UKAA 3QBDA 2QYHA 1GVHA 4UUNA 3RS5A 4D26A 3AR5A 4C4PA 2PQ2A 4YCNA 4RK6A 3ABQB 1AY0A 5DWVA 5FA5A 4M22A 4R54A 3ZW9A 2PU5A 3OJCA 4QUBA 4LSMA 3OFJA 4KE6A 3WGKA 1MZVA 1V5FA 5L8VA 5K0CA 1ZNQO 1TAUA 2B98A 2XB6A 4RKQA 3TI7A 2Q62A 1IHXA 5BNZA 4FLEA 1MQ8B 4IWNA 2HQBA 3DE7X 4IH9A 3W78A 5BR1A 5FUQA 1A71A 1TNDA 3V1KA 1T36A 2RB5A 4JLSA 4CODB 4RF4A 3VMMA 1V11B 4FB4A 2XCQA 1GAXA 4MR7A 4ZT6A 1CR2A 1TJYA 4JXXA 3CX7A 3HU1A 3L0IB 4D98A 4CEIA 4DSUA 4N48A 4R83A 1MAUA 3HXLA 3L8ZA 4JT2A 5KVAA 3TIIA 1ZGZA 4PFJA 3QKRA 4YMVA 2BL4A 2FG7C 2A0WA 1A4XA 1KO1A 2XUFA 3C8MA 3STVA 1A69A 4BLTA 2FMKA 1AUXA 3C5VA 2C7QA 4FMCF 2ZT8A 4X8HA 1M2WA 3ZWAA 4B84A 5K03A 3OTOB 2C00A 2CYBA 4DR6B 4NK5A 3USCS 3MZ0A 2I22A 2YYZA 3EGIA 4UPVA 2C61A 2X7HA 3A4YA 1BDJA 2V0CA 2HJGA 2XQVA 3GA5A 4DKXA 1JDZA 5CLJA 5BSEA 1ZW1A 2YIMA 2XAUA 2A5DA 1E3WA 2FPOA 2FJPA 4RLFA 1REQB 5TPZD 4DCOA 4UUOA 2IEYA 3BT7A 3CO0S 2F1KA 1CUEA 2NVUB 1M8JA 1MB9A 2FXIA 4JD5A 2OBFA 3O4IA 5CXXA 2VK8A 1SBCA 4L75A 1X7XA 1Z5VA 1N2GA 5F33A 2PZEA 2RGNA 3FCAA 5IASA 4MEJA 3U4IA 4IUCS 3RKSA 4LF9B 4RIHA 4BNJA 3R3UA 5IEBA 3LVRE 4WLFA 3HBNA 1Z17A 5LQJA 4R7TA 4XLLA 3LYLA 4KQJA 3DBOB 1U6KA 2C4KA 1Q17A 5EMHA 5TPZA 3DEYX 5I3CA 4P54A 2HJSA 3UK1A 3ZOKA 1F2UA 1ZYUA 1IY0A 2AJTA 2J5RA 4XEUA 4ZCRA 4WK2B 3GNQA 4CHTA 1TK3A 2O50A 3R3XA 1TM2A 4WERA 1ZRHA 4F8JA 4PYIA 3QK7A 1NNUA 3IR5A 3CINA 4RD4A 1YDHA 4CM5A 4TYNA 1VCNA 3ZVMA 1E79D 4HQFA 4EG7A 4CEHA 3TNFA 5CHEA 4IOKA 2II6A 3HDYA 4AKTA 1BHSA 2REOA 1W7AA 3LHIA 4ZKEA 2RI0A 3BFKA 4GLLA 2CB9A 1UK6A 3WGNA 3NX4A 1U9CA 1R0WA 4JUBA 4GXQA 2QZZA 4QUEA 1F0NA 3EOBI 4S1NA 3KEGA 3QFFA 3T5MA 4D2IA 1N2JA 2OZLB 2BFBA 2BTOA 1BXRB 2I2AA 2WMDA 3EVEA 4GSKA 4IKEA 4IKOA 4ISCA 4C22A 1Z4OA 2QJFA 3N86A 1E79A 4YRPA 1QAOA 4OHPA 1ZY2A 4IJQA 2AJDA 2X8BA 4NZPA 1OX6A 1JVBA 2XB4A 3LXRA 4I6EA 4MYTA 2WT8A 4L8FA 4BPRA 4GPIB 4Q3OA 2EJWA 3IERA 4R9NA 4CQLB 4Q6WA 1RKBA 4EK9A 2WG2A 3B2NA 1SHZA 1EXDA 2IXEA 1CEXA 1U99A 1GD1O 4Z53A 2H3HA 3MJEA 1LFAA 2HU7A 3U5ZB 3TIXB 3GJTA 4QBIA 2OSVA 1JLMA 2ZTHA 3BXPA 4OFXA 1BJTA 2JGAA 2Q4TA 3K8ZA 4B34A 2GD2A 3IT3A 3ZDBA 3D7MA 5JH7F 3NC4A 1E3DA 4LMAA 5FUVA 2KSQA 4GH5A 4PLZA 1IOZA 4W5JA 3CWZA 1GXSB 1NBHA 1IJBA 2XMDA 4MYRA 4A36A 4TSKA 3GI1A 4C3OB 2FWRA 1BX1A 2HDHA 1KO7A 1NIJA 1QG4A 2OORA 3DZBA 1K7SN 3HCRA 1GGHA 4N0MA 1J09A 1E3TA 5KB3A 2HT1A 4N3NA 3LPLA 5C8XA 3ONWA 3THSA 1OGJA 1A8PA 1Y9EA 4MICA 3H75A 1E1DA 1WPQA 4PPFA 3DD1A 3O2SB 5F73A 3RBZA 3K9HA 3TRJA 2CLSA 5FOUA 1E8NA 3KJQA 1U2TA 4NEGA 4P92A 3P5BA 3J81A 2CNLA 2HREA 1RKUA 3I4FA 2L18A 2RAUA 3BEOA 3ZS9A 3R3VA 3P4UA 3F9RA 1ZD5A 4FDMA 4AROA 5L3SB 3EDYA 4H7PA 5H4HA 2EARA 1S5PA 4AF8A 1B8UA 1JTVA 1IBMB 2X0NA 2H5IA 4GZ3A 4P3PA 1BGWA 1H2FA 4RSMA 2HQ1A 3ESXA 3B6MA 1JAIA 4WY5A 1AKMA 2ZXUA 1BH2A 2P35A 4KYUA 1X1RA 3GFQA 1B8PA 3GLUA 5ALJA 4RVOA 1C3LA 4UD2A 1M7GA 5EKXA 3X0DA 1CEEA 4QARA 1UP6A 2PXAA 4QEZA 4XYGA 3NWJA 1X9IA 2IOQA 3K8QA 3Q41A 4BGIA 1ZIDA 4V03A 2HF9A 4I3GA 1CUWA 1F4VA 3SNKA 3BJEA 1Y1RA 3GDWA 1RAEA 4OHRA 4U6SA 4KRGA 3GLGB 1W0JD 3TE7A 1XPOA 1B14A 1A1SA 1N5KA 7MDHA 1QH8A 3FTDA 1QX4A 1PJSA 3EGOA 1DV2A 3WIUA 3KO8A 1KOGA 1HDRA 4NPHA 1L9KA 3GQVA 3ZHBA 1B23P 1UBEA 4WOCA 4NS4A 2JI4A 2VBCA 4XGKA 4ZOCA 5A9TA 2O8VA 4XB2A 3U81A 4LHWA 5JH7A 2E1RA 2VPYA 4BQOA 3UJBA 4M55A 4F4IA 2QLTA 4JI2B 2BM9A 2IRWA 2J0UA 1W0JA 2R65A 3T3PB 3VC2A 1D3AA 2JGDA 4ZGGA 3H4IA 3VO2A 4ZYTA 1RRGA 1A5ZA 2B6HA 4JQOA 2VBFA 3JQCA 2UZ4A 5I7RA 4MKFA 1MVNA 1TZ2A 2JVKA 3WQRA 4URVR 1CIPA 1T3TA 2AI1A 2PZAA 1CUHA 3UB3A 1SQGA 4ER6A 1ADFA 3ESYA 4MV4A 4ZOLF 3D0RA 3IIKA 1ISIA 2O4UX 1UDBA 4H7FA 3CLRD 4R51A 2BGTA 1Z35A 2P77A 1I4OA 2RFLA 4A2QA 3AL0C 4NU0A 1A76A 3EIXA 2W0SA 2W6ID 3EAGA 4JUDX 3JALB 4UM8B 4R81A 2C2MA 2PX4A 5AVJA 1WO8A 4ZIRA 2IUTA 1GZ7A 4WINA 3LW7A 3S2UA 3VYVA 3EF3A 5THKA 1GZ5A 1R5BA 3B5JA 3NGLA 4LOHA 1VRCA 5DBHX 1Z7EA 5ILGA 1BFDA 1E99A 1VB5A 5TT1A 4FCVA 2I2XB 1A77A 4DHEA 1FFGA 1ZA1A 1DTWB 2VJCA 4XQ9A 1W5TA 1Z6PA 1FDWA 2HNKA 2W6IA 4BS9A 1IOWA 4ZO7A 3U13A 1EWRA 1E6EA 1GADO 2XE6A 2GD1O 4LHXA 1TO1E 1U8EA 1JE0A 4IGKA 5B58C 4DR1B 2ZUCA 4GAEA 1Q19A 1O87A 3IXLA 3NP9A 2RGGA 3EXFB 3OMWA 3ZWOA 4QTYA 2KLHA 2F43A 5DIZA 1NT2A 2HU2A 4N18A 4E70A 2YASA 3GT4A 2OY0A 1C0KA 4JXJA 3NAGA 5EFOA 4E13A 5G0UA 1ZQ9A 1H6DA 4LCBA 5EHGA 2IF0A 2Y0DA 2WD9A 2NZWA 5DBGA 2QX4A 5JXIA 3GCWA 3GBVA 4CLOA 1OFIA 3O21A 2YDXA 3V2GA 3CEMA 3NFRA 1A9ZA 1W4CA 3QUQA 1OC4A 1WCIB 2AJCA 3MINA 2VJMA 3K09A 5FBHA 4Q1AA 2D5CA 3T0GA 1RNLA 1Y1TA 2F4NA 2BV3A 1IEVA 4B83A 3Q88A 2X0IA 1T13A 3KQOA 3QX7A 1QAMA 3G2OA 3IODA 3BKXA 4LW8A 4AECA 1QVWA 4UVIA 3IUMA 2IPAB 2ZRNA 1XZBA 3FVVA 5EQTA 3LSYA 4ZOLA 3U56A 1NM5C 3EXHA 4FKBA 5D7NA 3WFIA 4DCPA 3RJZA 1MB0A 2OXCA 4KCGA 5HOQA 3LCJA 4WKCA 4EZIA 4LWOA 3NWPA 3CKLA 1WZNA 1SG6A 2XIJA 2YXDA 1VPDA 3F6EX 2PZ8A 1C7ZA 3HBLA 2I54A 5U4XA 3VZQA 1XQ6A 1Y48E 2BVNA 3GRUA 3ZDZB 5KJ1A 4OYLA 2YRXA 3Q9SA 1TW2A 2DFNA 4EHAA 1ZXBA 2XVYA 1M83A 2VSXA 1HM5A 4MP8A 3V4FA 1GGMA 2FP3A 3OHMA 2NO1A 3ZD8A 3ASUA 3TD9A 5AW7A 1JLLA 2EDCA 1YUNA 3GVXA 3QFRA 2E6KA 3OHSX 5KOHB 3N8DA 4RADA 4L9AA 2LCQA 5HWSA 1PUJA 1JWAB 1N8NA 1X0VA 2C77A 2QXUA 3QVKA 3V9PA 2PZFA 3VPSA 1L4BA 1M66A 1GTVA 4GW3A 1I1NA 2N0SA 1IN8A 4KLZA 2PMWB 1GO2A 4L0DA 1IM5A 3WISA 1EG7A 3IUBA 5K0JA 1V16A 4YAWA 3QENA 4X5OA 4XGQA 1VJ5A 2Z1MA 4GI1A 2RGDA 2G3YA 2OE2A 3DEKA 4KQIA 3UUGA 4DSTA 3QPCA 4GMFA 1M6NA 4MDHA 5HKOA 1E5LA 1PR0A 2QTNA 5HGXA 3QUBA 2PJZA 1BVHA 1DKQA 3I37X 3EVBA 3K05A 4RVNA 4KMMA 4RLHA 4U8GA 3SIWA 4ZI7B 1EMDA 2F3TA 1CYEA 2FOIA 3CLSD 3ISVA 4BATA 1ZVJA 4D3SA 3AF0A 3ZU4A 2Q3JA 1XHFA 2I4MA 1ZW6A 1K98A 4M89A 3DQPA 3L04A 3QU9A 2Q5LA 3C70A 5H83A 3IUJA 2GSDA 2XBUA 4IEIA 5J40A 4P08A 4WI1A 2CFIA 4B6OA 1MOSA 1ZLYA 5JDIA 4I1VA 5LIRA 2PMKA 3N8IA 4HRYA 1QP4A 1G6HA 3I52A 4MI6A 2G0AA 3IRUA 2WP0A 2GN1A 5BV0A 2I65A 3NALA 5JT1A 1DCFA 2A6PA 3GA0A 2HK7A 3QKTA 1FYDA 4JGGA 4M21A 4MRVA 2INGX 1BCRB 4MYSA 4OHOA 1T6ZA 2EKBA 5ELXA 2YX1A 3COPA 2ZXFA 1HSOA 3ANXA 5FPQA 5CHYA 3C5CA 2PT9A 4N8DA 4CG2A 4P36A 1ICIA 4EOGA 1JB1A 1GLNA 3N8HA 4UTXA 4AU1A 3PIIA 4RGYA 2FZLA 1Q7TA 4WZBB 5T6MA 2XLBA 3QA3E 1KH3A 2Z5GA 2AUMA 1J0AA 4X62B 5BMVA 5A2GA 2EL9A 3FNEA 1RLJA 3Q7RA 3SXUB 3RJTA 2D7JA 5AJVB 3JYLA 4N54A 4CE6A 4JC0A 3HXTA 3JQ8B 1JFSA 3NWBA 3G2NA 5FTJA 5KYKA 1KARA 2SKCA 3JR3A 4FILA 2H4HA 4MWBA 3HUDA 2P8SA 3IELA 1ESNA 4DR5B 5AI9A 1QR6A 4G4JA 2XCOA 3OZSA 3F6YA 3RRNA 3B1JA 4NFYA 3K0AA 3GLGE 2BMJA 2HC9A 4ER3A 1BEEA 3BMCB 2B21A 4EFMA 2R7LA 2A58A 4RDXA 1TQ4A 4ZYLA 1DT5A 1WB4A 1NXTA 4ARAA 2C2GA 2W6MA 3DMRA 4BNTA 5E95A 2H0RA 3OOWA 2RIRA 4LDQA 4QYWA 3SKYA 2R6FA 1N3LA 5AW9A 1ZINA 4ND4A 3UOWA 4B75A 4ZMSA 1EBBA 3Q12A 5JI2E 1J8QA 5I9TA 1AK2A 1SFRA 4HCJA 2CUKA 5H0IA 3R7BA 3SZMA 1NJ6A 4YAFA 3UO8B 2OCBA 1EH5A 3ROGA 4DE5A 2X77A 3LCRA 1FYXA 2IS6A 3T5CA 3UBMA 4ENSA 1NVVR 2WIBA 1SGWA 1QYDA 4NENA 3RYFA 1BTOA 1EJ6A 1Z0IA 3RUCA 1CSEE 3OPMA 4M54A 5K3BA 2O5EA 3L6EA 1X14A 1UPBA 1Z34A 2XCRB 2OAGA 4BTEA 3ETHA 3C1UA 4KO2S 5LB4A 3KQWA 5B57C 1DEKA 1W1WA 1P6UA 4IDOA 4LF8B 2E4WA 2IYAA 1EQ2A 3PQ7A 5C8YB 1UM8A 1I6MA 1VYUA 1GG8A 3KALA 4F5ZA 2ZIAA 2V97A 2B8JA 2NPIA 1M9NA 4BJ3A 1R5NA 3RD5A 2P4SA 5HZHA 1MT0A 3PD0A 4FMBB 4PCUA 1DKPA 4JJKA 2VHTA 1KGDA 3IX7A 5EVCA 4BECA 3UCEA 2CHGA 4YJHB 5KVQA 1SKQA 2GUGA 1WS6A 1TO6A 3O7MA 5K5EA 1P74A 4XM0A 3DZDA 4M6WA 1X7WB 2I2WA 3LUGA 1HQCA 4BNWA 3IULA 1HKUA 1XZHA 2G63A 3BTUA 3E70C 1NVFA 5DK4A 5AD1A 2J32A 1Q1BA 4JT9A 2XQGA 4QIHA 1NBMD 2GUWA 5LDGA 3ZK9A 5A3QA 1OOEA 3N76A 5DZSA 3A9CA 1ZD8A 1UIMA 2OCAA 2C98A 2D5IA 4HDKB 4B81A 5BSHA 4J4TA 3BWMA 4Z4HA 1KP3A 2R6AA 1UJMA 2BRUA 2JGIA 2YJ6A 4LY9A 3OFND 4GR4A 1SWWA 2AFVA 4GECA 2AHOA 5AOVA 3LYAA 3HXPA 4OHWA 4TWIA 4DBZA 2BEVB 2FKNA 1UFKA 1L5GB 4C76A 1M2VA 2G9ZA 3H9CA 4D6PA 1Q83A 1KXJA 1Q1QA 1O9HA 4JWKA 5IS2A 4REQA 3EIFA 3HCWA 4KVAA 1YBVA 1NBMA 4K9OA 5HKLA 5JDCA 3MFYA 1N2ZA 2HEIA 3ZGZA 1CHDA 1RXIA 3WTCA 4CCYA 2VQDA 2OXEA 3GN2A 2Q2OA 4G0YA 1OLSB 4B4DA 4QQKA 1U28A 2IHJA 3HJFA 4QE3A 3OFNA 3QMWA 3JATA 1QK5A 1D5WA 3S55A 1T6XA 4HFRA 3QNUA 1CQIB 4OHVA 1Q92A 2HCBA 4QU0A 2GRJA 2PT7A 1QF7A 1ULZA 4JGBA 4RYDA 2OHGA 3UPUA 3PYLA 5TXGA 3SS9X 1WABA 1NJFA 2FB9A 2XMBA 3R09A 4JHLA 2YFKA 3SF8B 1K7CA 5DASA 3LD9A 5B30A 4PCLA 2CMHA 2ZANA 3DW3X 2AG6A 3SEQA 3DZIA 2VZ0A 2OP1A 3N74A 4MVJE 4PHHA 5DNEA 5PNTA 1W8IA 2CEAA 1ZOSA 3M6IA 3AEZA 5GVRA 3SE7A 2DWCA 3SC2A 3DZCA 5AW3A 2WB2A 3NPMA 2YWGA 3I28A 3AKDA 4QO8A 3UHOA 3LQ4A 3G49A 2RARA 3KXLA 3PSHA 4UCXA 1BN7A 3ON5A 3OQPA 3PHBE 4HTAA 3VVLA 4EHNA 5EXPA 1RM3A 4B4OA 1Y3IA 2CNKA 3FX2A 1E7MA 1VLLA 4DLXA 2WIJA 3WMRA 2OXRA 3I2YX 1AHIA 2NT3A 3HR4A 3FBWA 1IJFA 1E7WA 1ECFA 1OXMA 1YRHA 2VDQB 2W8ZA 3PPIA 5JW6A 3WAJA 3A7DA 4KL8S 4M0EA 4D74A 3FDXA 3H5WA 1RWBA 3OECA 4K8OA 3CKMA 4ZDKA 3PEVA 2VJKA 2YVLA 5A71A 4JVOA 4TROA 3HA7A 2XZTA 5FPTA 3HH8A 2HA5A 1M1NB 1MX1A 4EGFA 1GFSA 3EEFA 3EN0A 1YBAA 3C8UA 3SE0A 4FFOA 5EA2A 3CHYA 5C7LO 4G56A 1NX9A 3LLCA 1XA0A 2JIRA 3I8OA 4J29A 1WKVA 2NU6A 3ECCA 1G7TA 1AVTA 3I8XA 5FWDA 1E0JA 3WGUA 2OOKA 3K9GA 4B0OA 3M6UA 2WJWA 1ETUA 3HPRA 1FUUA 2CK3D 4CVNA 1X1QA 2GETA 2ZK7A 4U7PB 3RC7A 4AG3A 2PD6A 7REQB 3OM9A 4AMUA 1HMYA 3KV1A 1DXHA 2WF6A 3QHAA 4PLPA 5AHXA 3R7FA 1EGHA 1YOBA 3TSWA 5LQDA 2H0QA 3VGJA 2J85A 4S0ZA 3QVSA 4M0FA 4EKEA 1JILA 1ISGA 1JT9A 4JZKA 1BA2A 1LLDA 1MJNA 1PJAA 2EKLA 2HU8A 4IZHA 1I2CA 1ETHA 3SHQA 1R5JA 3ZBUA 5JAOA 3E27A 2CK3A 4KR3A 3S5JA 3AOEC 3K9FC 1FRFS 1AV6A 1N78A 1E58A 3LXUX 3AILA 3TM5A 1SG0A 2C7RA 4GLJA 1XRPA 4P1ZA 3RSCA 1JLKA 1Y4ZA 3U31A 2B1JA 2WYHA 3TUZC 1CUGA 1IB6A 1QYIA 4NDAA 1EFCA 3F78A 1CUDA 4CQJA 3P9KA 2C42A 4R6XA 4GM4A 1PRYA 1URPA 4MUKA 3WKDA 4E22A 1M2NA 3T1NA 1AUPA 2ZSAA 3B9RA 4FDTA 4P4UA 3C7CB 2DB3A 3NM4A 3M9WA 3CLUC 3R9IA 4GP6A 1JJ7A 2PSDA 1ACLA 2JAUA 2OHIA 1EFKA 1U0NA 3A1NA 3DTVB 4L07A 3ROZA 3TSYA 3WGZA 4QWWA 1EVKA 2YMPA 3EVZA 1NNI1 3EC7A 2XE7A 3KJIA 4OQQA 4PTYA 2ZUFA 1HE4A 1MAHA 4COKA 1JWLA 1ZAYA 5AM3A 3O94A 4W5WA 1AHNA 4AJJA 1I01A 3KWLA 1HFKA 2ZYGA 3G8YA 4JODA 5E6UB 3SLKA 3L8DA 3FPLA 4RHYA 4CF5A 6LDHA 2FHPA 2EHDA 3GYGA 3E5NA 4WLEA 3HFGA 3K15A 1H94A 1PR4A 5G53C 1GCIA 1JHDA 2HSEA 5IAOA 4C1NA 3ETJA 2FMIA 4MW6A 5HTKA 3WLOA 1OFUA 5LB2A 2TECE 4DQLA 2PLFA 1VXRA 1BXGA 2CLKB 4GI3A 4A73A 2H1FA 4KXUA 4QJIA 2X1VA 4G1UC 4YUWA 5BSMA 1Y6FA 3PEFA 2PS0A 1H9BA 4FDAA 1NI3A 2NUPA 2ZB8A 4RS4A 5DLDA 1JQKA 1O58A 3KS9A 1ZJ4A 4MCHA 2VLBA 1VZ2A 4KSBA 2QTAA 1J56A 1SEVA 4JQZA 4QQFA 3U7IA 2W2KB 1U3GA 1S2NA 4D3XA 1VFNA 2RH4A 3CF2A 4H27A 3FCEA 2G77B 4ND7A 3ROEA 5A7FA 4XLZA 5C3MA 4C4TA 5C31A 4DTIA 1DIGA 1RIFA 3K73O 5F5XA 1NKVA 1LVHA 2YKGA 1H42A 3ACCA 3AKYA 1IBSA 3C1OA 5J59A 3TNJA 1UDAA 2Q9BA 4ZRNA 4CU5A 3N05A 2OYCA 2TSYB 4O4HB 4IF4A 3INTA 3KJFA 4IIJF 5ABPA 4FYVA 5K0LA 3OX4A 3B1WA 1Y3AA 3GT0A 3AWDA 4HK4A 3S70A 1CUVA 1N2EA 2FW8A 1W5EA 5TIIA 3NTVA 2WIKA 2VT2A 3OC6A 1E0SA 1R12A 2YZ7A 4FGJA 4UE6A 1WV1A 1VIYA 2NN3C 2VS1A 1E6MA 3NYRA 3RS2A 2VJDA 4RUKA 5JD6A 1ID8A 2DBVO 2PJUA 1F6WA 2GILA 4FM9A 1RQPA 5HK8A 1U0OC 5ECGC 3H1AA 1YQWA 3FZYA 3UIEA 4M1TA 2IP1A 3N2IA 5CFQA 1C0EA 4NCAA 1HE3A 1I2DA 1JPNA 2GCOA 3BULA 5CA0F 4BGVA 4CI0B 3D7LA 4NQRA 2AMFA 2ORED 3BMXA 3KZMA 4EA8A 5HIAA 2HRBA 5HQTA 3RBAA 3KZCA 4WT7A 3S1SA 4IDBA 4PFKA 1SB8A 4QG3A 3T7CA 3ZHVA 1PD1A 4ZHQF 3KVYA 3EEOA 1CS0B 2I7XA 1BH6A 4OGFA 4FE4A 4MRNA 3FE2A 1BHJA 3NM6B 2BUCA 5ARCA 4H0FA 4M1ZA 4UU0A 2Q3LA 5THQA 4ESEA 2VYFA 1T2AA 1XTUA 2FWJA 3G13A 2PXXA 2F1RA 2GN8A 2YHIA 1ZO8A 4P4SA 4NYMQ 3CLTC 4PWYA 5JVDF 3B6KA 3LRPA 4TV9A 2GKOA 3NGMA 1PHPA 1RM5A 3UAWA 4YT2A 3KR2A 2NTYC 2VDWB 4K6FA 5TQ0A 5JTUA 1J33A 1EDOA 1JLSA 2DLNA 2XGOA 1C7FA 1NVDA 3PEUA 2IZ5A 1T9CA 3TJMA 5JNSA 4ONEA 2BIFA 4IVNA 1IQPA 4DLKA 1U3UA 2HWXA 3PGVA 3QH4A 1MD9A 4R0NA 1C9JA 5A7GA 1JHXA 1DQRA 1PDOA 2CZQA 2RHBA 4W5HA 4Y1RA 2DHQA 1OXKB 1SU4A 2Q4DA 1TUIA 2QTWB 4M4SA 2Z1DA 5DNCA 2OAP1 1NGSA 4WJKB 2O57A 4KHPB 3K0FB 5DBEX 4LK3A 3WK9A 3UK7A 5FD8A 1AUVA 1LDGA 4CUZA 3FCOA 3EGWA 2DY1A 4WCFB 5CG1A 5I6DA 3SJUA 2H8KA 4DARA 3RUAA 4PHCA 1FA9A 2B2XA 1QR2A 2B8EA 1UWCA 3TF5A 4LXGA 4CKBA 1ECPA 4YCAA 1F8XA 4E5DA 3L7NA 5CXQA 2D5BA 2ZCUA 5CA0A 4PZDA 5F64A 4CEJA 1RLUA 1W2WB 2NZVG 3IKVA 4XVCA 1TA0A 1FQOA 3SZRA 1Z5UA 1GLGA 3P0FA 1NXVA 2OYSA 4ZHQA 3BEDA 3AI3A 3GVPA 2PUBA 1RQRA 2XUKA 2ZBDA 1WBDA 3ZVNA 3BHIA 4M1MA 5CT5A 5FFFA 5JSYA 3RTCA 4B44A 4BX8A 5F2NA 2IU4A 3ENVA 3LO8A 4FC6A 1DZ3A 4JEUA 4AMYA 2R2AA 3ME5A 4YLGA 6ABPA 1O9GA 2GASA 1IXRC 3PRKE 3AHHA 3EGCA 4BKOA 3RTGA 7ABPA 5HIKA 5JVDA 4ILEA 4L4ZA 4WN9B 1I2BA 3RYCB 3H2GA 2PT5A 2WD7A 3WK6A 4Q4JB 1VHWA 1FYFA 3MEQA 4OBXA 3LKBA 1RPTA 5IVDA 1TT5B 2JAXA 2V1UA 4DEXA 4Y2VA 3LP5A 1L7BA 4YCLA 1ZH8A 2IHUA 1QRTA 4JEMA 2ZI3A 3B1FA 3Q7TA 3RIEA 3SVTA 1VKZA 1F5NA 4IMPA 4YEDA 4RVUA 3PXGA 2OQVA 2ZP1A 4R1MA 1IONA 3R3YA 5DXFA 2FU5C 2WMYA 4QTZA 3CUUA 3KSBC 4LRTB 4KR6A 2XNSA 3AZOA 1ULAA 1W36B 1UQRA 5BV7A 4XCVA 4QBTA 3LH5A 2OK7A 4PG7A 5IXJA 2HN9A 2H4WA 1T9AA 3M4NA 5E8RA 5GOZA 3HJAA 4AWAA 1XDGA 1XCOA 1TMYA 2IPMA 4XUDA 5GONA 4ZVRA 4Q9AA 4UXHA 4YUYA 4P33A 1OXVA 1RACA 2O2EA 4G26A 4IYRA 1JXQA 3OPVA 2A5FA 5C4GB 5C5EA 1WUIS 2AWOA 3I3OA 3RRBA 3WV5A 5CB0A 1LWNA 1Z88A 1U3CA 1GHTA 2VHCA 5K0GA 3CTMA 1L5LA 2CXQA 3DEZA 4MW9A 2X7JA 1AKWA 4Q1VA 1Y8RA 1JSCA 3AEKB 2ZIZA 1NT4A 1R8JA 4O5AA 2GB4A 5JPIA 2TMYA 2NT4A 4EB0A 4N8EA 1TGVA 3ZLUA 5DGCA 1DXOA 1OYWA 4V3CA 2NU7A 1CUCA 5B55A 1Q7RA 1HLDA 1RPNA 2EFJA 4DJFC 2B4TO 2FFJA 2RC5A 4IR7A 5ALVA 1Z45A 3AL2A 2DXIA 1QFYA 4FFSA 1L5NA 3BL8A 3WLQA 1KZ6A 3R24A 5JC1A