3R5KA

A designed redox-controlled caspase-7
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
248
structure length
234
Chain Sequence
TYQYNMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQDLLKKASEEDHTNAACFACILLSHGEENVIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKLFFIQACRGTELDDGIQCYKIPVEADFLFAYSTVPGYYSWRSPGRGSWFVQALSSILEEHGKDLEIMQILTRVNDRVARHFESQSDDPHFHEKKQIPCVVSMLTKELYFSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Caspase-7
publication title A designed redox-controlled caspase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 81
structure length 234
sequence length 248
chains with identical sequence B
ec nomenclature ec 3.4.22.60: Caspase-7.
pdb deposition date 2011-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00656 Peptidase_C14 Caspase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3r5kA00
4QUIA 3V4LA 1CP3A 1RWXA 5IABA 1KMCA 1M72A 4DCPA 3D6HA 3KJQA 4FGUA 4JR2A 1PYOA 4QUEA 5I9BA 1NW9B 2H4WA 4N5DA 5LUBA 2Y1LA 4HQ0A 5K20A 3DEIA 3SIPA 3V55A 3PD1A 2H51A 2J33A 4ZVSA 2QLFA 2XYHA 1RWKA 4DCOA 4D3XA 4QU9A 5H0IA 4LSZA 3H11B 1RHJA 4JR0A 2H48A 3D6FA 3R5KA 4NBNA 2H5JA 4N6NA 4PRYA 3R5JA 3SIRA 3GJQA 2H5IA 4M9RA 3R7NA 2CNLA 4ZVTA 4I1RA 4NOKA 3GJSA 4AW9A 2P2CA 4QU5A 4QUJA 3V4OA 5IAGA 2HBRA 4AWBA 2AR9A 3OD5A 3QNWA 3UO8B 1GQFA 5IANA 3H13A 1K88A 1SHLA 3H1PA 3NKFA 3S8EA 3EDRA 4ZVUA 2C2KA 4N6GA 3ITNA 4ZVPA 5IBCA 3S70A 5IASA 3IBFA 1IBCA 3RJMA 2H54A 4N6OA 1RHKA 2NN3C 2QLJA 1NMEA 1SHJA 2XYPA 3P45A 4EHHA 1NMSA 1RWNA 5LUAA 1I4EB 1NMQA 1SC3A 2K7ZA 4HQRA 4IEFB 2DKOA 3GJRA 3PD0A 2WDPA 3H0EA 1ICEA 4ZVOA 3UOAB 3EDQA 3BIJA 4NOMA 3E4CA 4PS0A 5IAEA 1RWMA 2XZTA 4FDLA 4QU8A 4EJFA 2C2OA 4NOLA 1QDUA 1QX3A 1BMQA 1GFWA 4QUHA 5IC6A 4JQZA 4EHKA 5IC4A 5IBPA 2HBYA 4JJ7A 2CJYA 4PRZA 2FQQA 4EHDA 1RHUA 3IBCA 3K7EA 3P4UA 2C2MA 2HBQA 4JB8A 4NOJA 2CNOA 5IAKA 4D3YA 1CVRA 2FUNB 1RHMA 4N7MA 4QTXA 1RHRA 3R7BA 4JQYA 4DCJA 4D3ZA 4JJEA 3V6MA 1K86A 1QTNA 1RWVA 3NS7A 4ZVRA 4ZVQA 1I4OA 2CNKA 4IYRA 4QUBA 4NBLA 3R6LA 2C1EA 3D6MA 2CJXA 1RWWA 2CNNA 2HBZA 4JJ8A 3H11A 3R7SA 1RE1A 2XZDA 5I9TA 5JFTA 1F9EA 2CDRA 2C2ZA 2J31A 1RWPA 3R6GA 4QUGA 5LU9A 1F1JA 1SC1A 4EHAA 4EHLA 2QL9A 2H4YA 3DEKA 4QTYA 4QUDA 4I1PA 3KJNA 5IARA 3DEJA 4FXOA 3NR2A 2XYGA 4QULA 1I3OA 3GJTA 2QLBA 2QL7A 1SC4A 2H65A 4NBKA 3V3KA 4QU0A 2Y0BA 4JR1A 4N7JA 3V6LA 4AWAA 2QL5A 2J32A 2J30A 3PCXA 3KJFA 4PS1A 4QUAA 5LU8A 1PAUA 3DEHA 1RHQA 5IAJA 2FP3A 4FEAA 1RWOA 1I51A 4HVAA 1JXQA 4EHFA 4EHNA 5IBRA
chains in the Genus database with same CATH superfamily
4WBNB 821PA 2PUWA 2VHTA 2AJ8A 3EWNA 2COEA 3MBIA 2J3KA 3HFJA 1KGSA 2ACKA 1KMCA 2X5KO 3NUQA 4LYGA 2XBLA 3DVLA 1MAUA 1NE2A 4QPPA 4TTPA 2IU0A 3IAAA 3QMMA 3TRKA 1MO2A 3F6RA 5KTNA 4OJYA 1IZ9A 4LXYA 1N5OX 3THYA 1IWBB 3RRNA 5LR6A 1XNJA 4B3DA 1BHQ1 1XDWA 4RLSA 5M34A 3RC9A 3C4VA 1JKXA 4P4SA 1YQXA 2GF2A 3JYLA 1NC1A 3MLAA 1VYVA 1Y3HA 2P9CA 3L05A 3PXXA 1KIAA 2GX6A 5DHPA 4K46A 4D9CA 5KO2A 2YFQA 4G6ZA 4O4IA 1KETA 2V1XA 4C4OA 1P0PA 4A16A 1W36B 2NOAA 5I5GA 2WTMA 3QVSA 3HBNA 4Y1GA 1O08A 2OXTA 4W82A 5ENZA 3QFCA 3HWSA 1MB2A 1PJSA 4ZVUA 521PA 1YS6A 3GAMA 3UY4A 2OL4A 3NMUF 4Q7MB 4IEEA 2QTVA 4UBIA 5IM4A 1CW2B 4YPVA 5JZ9A 4JGGA 1P9NA 2GHIA 3EZYA 4LDPA 4BQFA 1QRTA 2WQ6A 3P45A 1MV8A 3RBAA 3HTXA 1HDZA 2XHEA 1R4NA 2I99A 3BA1A 4X63A 1GR1A 3GZTB 3WLOA 5E8JA 1NWCA 3ZQ6A 2YVLA 1KY4A 3KKPA 1S3SA 4URUR 4Y18A 4ND4A 4IW3B 3BWVA 3CM0A 3A6EA 3TRHA 1RLUA 3BGOS 3CNOA 3HLTA 1M2OA 4F4UA 1SCDA 4WHMA 5AHKA 1GTL1 2GVDC 2VPTA 4X93A 4OKNA 4ZWNA 1KQNA 5JPDA 2MHCA 5BYBA 1SBIA 5C53B 2NZ2A 3NYIA 3CISA 1XZNA 2X41A 3NAGA 2GAFA 3FHCB 3MTAA 4JSRA 4YJGB 3VNRA 3WB1A 1AKYA 5L4NA 3GPIA 5LIRA 1Q74A 4UVDA 4FYXA 4DQLA 1GXSB 1QHYA 3TLBA 4DR5B 4WZBA 4QD3A 4P3KA 1U31A 1QZUA 5F2KA 3NS7A 1OFGA 1P7YA 3ADPA 1DEHA 3L6EA 4ZI2A 5KQRA 5KYGA 2OO7A 1KVSA 1RRKA 4E4TA 2E6UX 5T5QA 3B1KA 4X90A 2HQRA 1JKJA 3GN2A 1GPWB 3NOXA 5L3SB 4YMHA 2HV9A 3P9YA 4RXUA 1V1MA 1FB5A 1VIAA 4O02B 1V47A 2CK3A 4A0QA 5J9FA 4BVEA 3NP7A 3C41J 3F9RA 4QWWA 3KKEA 3WQRA 2D1SA 2BUAA 1AMUA 2D62A 3FDIA 3IQDB 5TF0A 2FKNA 4E7OA 3H2YA 3P2KA 1UFQA 1RLJA 2ZQYA 4AWAA 2J0SA 4GBGA 4B40A 1GKUB 4QPDA 1Z33A 5DNWA 3BH7A 3NUZA 1NYQA 1TZJA 3P9PA 4LKOA 2GKGA 4AKHA 4QXAA 2OP1A 3EN0A 5KYUA 1C9JA 1SC9A 3AF4A 3ZTTA 1RCFA 3BSYA 4R71A 2D1YA 4PYMA 4DA6A 1ODTC 3OFND 1RBMA 5A9TA 2PU7A 1OI2A 3IR5A 3Q72A 2MIIA 1ZJJA 7ABPA 2I29A 2ZUCA 5K0BA 3B53X 1SOAA 4OJTA 2Y1LA 1ZD3A 2BY4A 3OIYA 4YR7A 1FDOA 2UZ4A 1X1RA 2D1QA 1JKFA 2O52A 4EBBA 2Z8ZA 1FW6A 1ZN2A 1UBFA 4NSNA 1MAVA 3QUBA 4DCOA 4DBLC 4EMSA 1Y6GA 3BICA 3KR0A 2AOTB 5FJJA 4NABA 3TZQA 3P26A 1PDVA 1WMEA 4C0QC 2WIDA 1V4BA 3IBYA 2WRZA 1D04A 2XDQA 1KOLA 1A8IA 2Q1YA 2YR0A 3H5TA 4WN3A 2EDAA 4J4BA 4HX9A 2KMLA 2NPOA 4A91A 4Z4CA 3S99A 4AJOA 2LP4Y 3ROEA 3KAQA 2F6RA 2Q0XA 5D86A 4K9QA 3U9TA 4CQLA 2RARA 4HWPA 3DV2A 4MQFB 1VL1A 1WW3A 5EP1A 4DTCA 4C7OA 3V7YA 1SXJD 1ULTA 4CEHB 1MVOA 2R48A 5DNEA 1ISMA 4XTCS 3W4KA 2QOEA 1JIJA 3IKLA 4L75A 2WWIA 1W4BA 4E03A 2J8ZA 5AJUA 5DOZA 1U5CA 2QLJA 1FMTA 3ZHCA 2EGUA 5CNJA 1DL5A 1U3CA 1YJ5A 2E87A 4Q4AA 2PR7A 4C89A 1QS0B 1Z0AA 2BGKA 2N1MA 2LKCA 5D5PA 3JD1A 4NF2A 2P4QA 4LRWA 5T4HA 2WG0A 3KCNA 4KMOA 3U7GA 2HDWA 3MN1A 2OXEA 3HJBA 5J2UB 5A71A 3T9CA 4QA9A 2QVXX 5HFNA 4Y6GB 8GPBA 4JVNA 2V7PA 5B4VA 4FLEA 5M7EA 3AVPA 4RNCA 4GBJA 3JU3A 1Z2CA 1ZC4A 2BUCA 3CNNA 4H6XA 5SYMA 5BN3B 4KR3A 1S3GA 2HT1A 4UAGA 1I5EA 1WB9A 1PR3A 3I5MA 3TZHA 1WVGA 1U0TA 1E9CA 1F48A 2Z2IA 1U5AA 4ARZB 4B82A 4EVRA 3D0RA 5HCNA 4REQB 3T52A 1P19A 2P1RA 2C1ZA 4IZHA 2A7QA 5TC4A 1MLDA 2FUKA 3GRVA 3GXBA 1JA9A 3O5AA 3ZU6A 2HSGA 1V8DA 5CXXA 3C6YA 1MAAA 4NR0A 1N6KA 4BLVA 3GV0A 2L18A 3AHGA 1HBJA 1PJCA 2P3SA 5E1OA 3PT5A 4GI5A 1E1CB 1V8PA 1YZUA 3D2CA 2PEZA 3HP7A 3NHUA 4QLOA 4X20B 1DJOA 1ZYUA 3LF2A 1LPMA 2FG5A 2Z0MA 3OU6A 2CNNA 4MB0A 5E95A 3VZQA 4DPMA 1OVMA 2FFHA 1T9KA 3DLAA 2QLTA 5THQA 1P29A 2BGNA 2ZBFA 3LWDA 4FBGA 4G24A 4HSGA 4L5AA 5F2EA 3N8KA 3A0UA 3SM3A 3SEAA 1FMFA 2ARKA 2C83A 4M7OA 3LPDA 3RBVA 2RDMA 5K05A 4O4JF 3TPCA 5JSHA 3ZWAA 1XZLA 1BS2A 4RH0A 3IP8A 5IUNC 5AM2A 4MUGA 2W2QA 5AVOA 4B3CA 3A3OA 4LGYA 3I6QA 1P8JA 3EIXA 3GHHA 2BKAA 3JQ7A 1QX4A 4MWDA 3RO7A 4O63O 4EK9A 1QHIA 3ILXA 4HN4B 3JWHA 2CFRA 3MM4A 3SJAA 3GIWA 3TFOA 3D31A 4OOEA 3BF7A 3V4LA 2OBFA 2IY9A 1NW3A 4IIJA 2GVZC 3EIOA 2WWXA 5EZ6B 2CF5A 2CXNA 4ZU6X 4ZZIA 3HBAA 4E46A 3V48A 4PLPA 1MB9A 2Z5VA 3SEQA 2J85A 3E5HA 4GKKB 1B2LA 2Q2WA 4UEOA 1E5DA 3RRZA 1P0CA 1KDTA 3CKLA 3JYQA 1IB0A 2ZOSA 2OCGA 2QLMA 2GZ2A 4I14A 1SBHA 1GA6A 1AK9A 4U7TB 2ZYAA 3ZHTA 2W4IA 4OJKA 5AVRA 2Y6VA 1E4YA 1MN6A 3LUKA 4ZVSA 1A9SA 5F73A 5A7FA 4MVWA 3O8QB 1Q1NA 1E9EA 1TEHA 4BN0A 3UAZA 2C31A 1PJZA 4TS9A 1T2CA 2B78A 3E8SA 4ZOAA 3N53A 2F8MA 4X64B 3DGEC 1QYCA 2ZSBA 4HN9A 1G55A 3LI2A 2D5BA 1FDRA 3RKSA 5DM2A 5IAGA 3SBXA 3B6EA 2FCAA 2V7XA 3HNOA 4OI0A 5IANA 4CEIA 2VTEA 2GA9A 3HMQA 2BBWA 1ECLA 3ROXA 2E4VA 4BBJA 4ZVPA 4RTMA 2EP7A 4RVSA 1G3MA 1SY7A 4I6EA 3MQ2A 3QOXA 2G83A 1ZN8A 2XQVA 2Q5EA 3WYBA 5KTSA 3R7WA 2D1FA 4CLRA 3VM6A 1GLGA 4PU0A 3TM4A 4JASB 4RYLA 5GZ1A 1RI5A 4FYPA 1A2OA 3V34A 3CLUD 4TWRA 1UK9A 2C54A 2HOQA 5BW8A 1KVTA 3MWDA 5K6TA 4D6YA 4AS1A 3E9ZA 1I5OA 4YPOA 3TUJC 1CEQA 4DDMA 1YDWA 2BTOA 1P80A 1E32A 2HU2A 2IU3A 3DLIA 1GPDG 1P4HA 1Q7BA 4JBLA 3ET5A 3RS5A 2EL7A 1Z4KA 2H2WA 2I5PO 1GGVA 1HT3A 4KREA 3ZOKA 2OK8A 2WHQA 4TXJA 1QPBA 1LLQA 5B1DA 4FB5A 5BQ3A 5CFLA 3FRIA 2JGJA 5IN5A 2OMKA 5BV2P 5HZGA 2IYPA 2MYNA 1W75A 1IMOA 2W6OA 4ZDIA 1P4JA 5SY6A 3QKTA 2WHPA 3RC2A 4KXWA 2JBAA 1MC1A 3B6JA 5TQ2A 4DJAA 1AKUA 2PANA 2QP4A 2GJ4A 2VNSA 5G3ZA 2IZ6A 4ZGWA 2QE7A 3JR3A 2C4TA 5KJ6A 1PR4A 3EG9A 4LF8B 2ZJAA 2IZ0A 1CUXA 4ZCLA 5ED4A 4GYKA 4QRDA 5M3BA 1L4HA 4I55A 5EJMA 5E8RA 2Y05A 4ZIRB 2JIMA 4PWZA 2WEKA 4G07A 5KCZA 4OQMA 1YGYA 4L0DA 3HKBA 3K5HA 5IDYA 1N6HA 3H11A 1PZHA 2FU5C 2IV3A 1DDOA 1M83A 1VCIA 4FEGA 1D6MA 2WFLB 4TVBA 3P27A 4Y1EA 3MWYW 3WLRA 4OH7A 1YE5A 1ID8A 2AFIE 3KALA 1RKXA 3A9SA 3A25A 2WJAA 5B3KA 4QASA 1I36A 3H0KA 5G1OA 1DAEA 1EXNA 2P77A 3TW4A 3EZGA 4QGSA 1Z5WA 3ND8A 1PGPA 2CHVA 2J3MA 2PKQP 3Q1LA 5G2OA 3SKYA 3V6LA 4DOMA 3RRBA 3LF1A 3KBOA 5D6OA 2WMYA 2XODA 2I9KA 2C4VA 4W9NA 3GRZA 5C32A 1JAHA 3UAYA 1LBQA 4UUBA 2QBYA 5T64A 2QRZA 4EHNA 5I4KA 5IEJA 1S7GA 3W8RA 2CZCA 4N5IX 3TIFA 4OGFA 1HZJA 1RWXA 2JJYA 5CRIA 2O19A 5HVNA 1PTKA 3P9XA 2CVQA 3H3FA 4GI3A 3PUKA 5K4HA 4X8LA 2YQZA 4UD6A 1W2WB 4TTIA 1NJ1A 4B6GA 1GIAA 4EQ6A 2Y1CA 2BT4A 3RAEC 2XNKA 3NATA 3S28A 1GRVA 4RA6B 1WULS 3DOIA 3OSUA 3AG5A 3TLGA 2V55B 4OLAA 1L5VA 1ZI9A 3FUWA 5CDFE 1ZHFA 5FPPA 1K2WA 2IOHA 2OZKA 2OCLA 2NP7A 3AIMA 1QFYA 4ZAWA 3AY3A 4HQNA 3B6IA 4ITVA 3LA8A 3KL4A 4TLAA 4YV0A 2IOYA 1ISHA 1MHPA 4C0WA 4FSHA 3V80A 4NAVA 1AV6A 3JZAA 3AESA 4XQCA 3L4EA 4MTCA 3GFPA 2VXYA 4F8YA 3QEOA 4ND6A 3WICA 1Q0HA 1CQIB 2ZUWA 1BS1A 1SHLA 1WNTA 1XXHA 2NUTB 5CA0F 1ISGA 3IUSA 2NT4A 2DBRA 4RA9B 1GARA 1KZYC 1ZD9A 4Q7EA 1ZHHA 1ZXXA 2NG1A 4N3GA 4EI8A 1XZHA 2FV8A 3GJ0A 1P9LA 1KMHA 1N9KA 3H2GA 3IVMA 3QEJA 3VR0A 2YOFA 5BXQC 3KTAB 4MV8A 1UJNA 2JPDA 5CB4A 1Q3HA 1BE0A 1XDUA 2QN9A 1M66A 2RC5A 2UYQA 1DWOA 4D1YA 3FZNA 4AIIA 1Y0BA 2Q3HA 4N4AA 2N42A 4YCJA 5ERYA 2H1VA 2GEJA 4HPJB 4UVEA 3DFFA 4QOEA 5LQNA 3UUWA 1WZ2A 5HBGA 4U3JA 2ZYIA 1JFTA 1JDZA 3JTMA 4JOBA 3I39X 1OBOA 3MWJA 3BB4A 4QAJA 2FG7C 5EKTA 4D25A 4A1FA 4FOOA 1VCNA 4U00A 1IN1A 1B2RA 1U8AA 4O6VA 2OO5A 1UKEA 5FO1A 2B21A 2GHTA 1EX1A 2VJOA 3LX8A 4IKEA 3L6OO 1J56A 5CFNA 4O4HA 3B2NA 4N3AA 3F3SA 2YV4A 1OHHD 2YHIA 3BIXA 3L6RA 1T1IA 3QVJA 5FOSA 5BT9A 1Y89A 1Z36A 2X40A 3LDUA 4D3ZA 4EI7A 4PSUA 3T7KA 4QXQA 4HZUB 4UZSA 3T7RA 1UKCA 1F2VA 3NVMB 4MB2A 1YZHA 4PG4A 2QQ0A 1KQOA 1NASA 4IJ5A 1Z7YA 3BWEA 5I9LA 3DOUA 3JD3A 4M21A 1E96A 1GFSA 1T8TA 1GSOA 3AEUA 3CINA 2FDCA 3N9IA 4FGSA 4J1SA 5AHWA 3R9KA 5BMVA 1V3UA 4PYKA 1YQDA 3DT6A 2X4LA 1DT5A 3H1EA 3HN7A 2JFQA 2ZDGA 1ZCFA 2CV0A 2Q7DA 1YIDA 2R6GA 4B32A 2QAGB 2XEXA 4BJ1A 4RKFA 1TF5A 1OTHA 4PXSA 4JU8A 5G0SA 4PCUA 3GCZA 2I8AA 3LUPA 3GJTA 5E4TA 1IHDA 1W36D 1TMKA 4AO8A 1VE7A 4NBKA 3OLCX 4NY1A 3I0ZA 1XKLA 1CEEA 4KIFA 1Q1ZA 1DFIA 1MOSA 3WZ2A 3S2UA 1KJNA 1X2BA 2ODQA 2BFAA 1QH8B 4DABA 3ZS8A 5JRJA 1W5TA 1ECBA 3GEEA 5F9FA 1FC0A 3IQZA 1ZOSA 5EKUA 3BC1A 2QZSA 1RJEA 4FDVA 1OH5A 3CZPA 3AUUA 3I3SR 4JI7B 1GRCA 5HTKA 5KHLB 1II8B 2DZDA 2C9DA 3B1VA 1A97A 4G86A 4P80A 1Z37A 2R8BA 1OAOC 4MSUA 1NZDA 1OLOA 4R9SA 4B6QA 5BQXA 4V0SA 2ZRQA 4Y9RA 5JISA 4L0CA 4F7DA 4KHPB 1M8PA 3QNUA 4C6HA 1Z0JA 2VR1A 1LJ8A 1MGOA 1PEKE 4A82A 1NQVA 1J99A 2XNSA 3LV8A 1BOOA 1T24A 3C1UA 4Q93A 1TQHA 1VPVA 1ZR2A 1ZSNA 2BM8A 4L6IA 5DRTA 3R5KA 1TPZA 4L74A 3I9KA 3N70A 1SZJG 1KAOA 2PGJA 4L0QA 3GMIA 2XNDD 2R6HA 6REQB 1PSWA 1QU3A 4HOYA 3N05A 5AJXA 2QUIA 3G13A 3RSGA 2WA2A 3SDZA 3RK4A 1ZH4A 3CKMA 1O57A 2F43A 1C30B 3GA7A 3OAAA 4ITUA 4Z9FA 3JR7A 2O20A 3WL5A 4EG1A 4X6LA 4C76A 1ZONA 4NMWA 2HNAA 4EEKA 3TL6A 3UFXA 4JLJA 4B6PA 3SIWA 1F14A 2F1RA 2OBXA 2Q9BA 3HCOA 2PMCA 3FDZB 3RJMA 3NGLA 3KDPA 4BJ5A 1M0EA 1NJFA 3F7NA 2PPLA 3P5SA 4MNTA 1KVUA 2F3PA 5SV2A 5TE9A 4GLJA 5E1DA 2VYVA 3WWOA 3CPJB 4F4FA 2JA2A 3PTLA 3PWSA 4DLUA 3TTUA 2QTRA 5JXHA 3PD0A 5KAMA 5IKEA 1UBEA 5G40A 3T9BA 1ZZGA 5AP9A 4DA9A 1XK6A 3I8XA 2XNHA 3ZGXA 2LW7A 3HWRA 4ID3A 1YIOA 2O3UA 3JATB 2HMUA 4Q24A 3S0JA 1U6IA 4Y9DA 4R2LA 3QFRA 5KQPA 1ZEMA 3UHPA 3O2QB 8LDHA 3U7IA 4DSZA 4KWCA 2XKJE 2CJFA 2O5RA 4RADA 4TLEA 1E69A 3RC1A 4BO1A 1GCAA 2CMFA 2FVXA 3GUZA 3PLNA 1LBTA 1WMSA 4LV8B 5ALKA 4NH0A 5DV9A 4BASA 1NJ8A 2AJLI 3WIUA 1K7EB 4ROSA 1MOZA 2CVHA 3UZUA 4AMVA 3EASA 2RGNC 4UREA 4UNPA 2OV1A 3F7TA 3IIEA 1W76A 2MMCA 2HRZA 1THMA 4YJKA 1UWLA 1XRQA 4G1EB 5REQA 3TKYA 3V4PB 1DELA 1KJZA 2QUAA 3AKDA 1JVNA 3SD7A 3WA6A 2PL3A 2X2PA 3PCTA 3KBBA 4L9RA 4RF2A 3F90A 2AKYA 2BBTA 2AN5A 1Y1SA 2GRAA 2XJ4A 3JVUA 4FONA 2AEJA 1UT5A 4HDNB 4PV7A 4U7JA 4BKOA 2R8XA 5KI6A 2GAIA 4B5KA 2W90A 3Q8LA 1F5SA 1DLIA 2V7QA 3GLFE 1JIIA 1T9ZA 4H15A 2ECOA 3OU7A 5E6UA 3QWBA 1M1YE 3DOEA 1TCCA 4JU9A 2QQEA 3DL0A 5JO9A 2ZJ2A 4EO7A 3FWHA 3AVWA 1U11A 2JGRA 4R1UA 1EX9A 4ES6A 3ZUGA 5AW6A 3NWEA 2CMKA 1AU9A 1DP4A 2RAPA 2QL7A 3W3ZB 4KNWA 4LXXA 3U7QB 4ZCRA 1KZ4A 2G9RA 3KSBC 3KJFA 2ZSJA 1XAIA 1CS0A 2F17A 1S1CA 3BXFA 3PUYA 4I1UA 5I9MA 3OQOA 1N1EA 2CNWD 3OKPA 1P75A 1H2EA 2EW2A 2ZJ5A 4KLZA 1NFFA 1LQTA 1H85A 4XD2A 4V0QA 1KYIA 2B0CA 2CW5A 3U4IA 4P7JA 3NEJA 4MGKR 2IPXA 4NU6A 2G82A 3UT6A 3GOHA 4KVGA 4DV1B 4PFSA 3TGWA 1PU2A 3TQSA 1NKVA 4D99A 1YS4A 5IZCC 1UKBA 2VJPA 3C5VA 4L22A 1KFCB 2RGUA 2BHTA 2AZDA 4MW6A 4UUMA 2BLNA 4W9RA 5K20A 3FHJA 3NTQA 3TGLA 1XCBA 1SG0A 1Z2DA 2IYOA 2AA3A 2QTAA 3DC2A 1ESZA 1A9QA 2J3QA 2LRHA 3ANSA 3LT1A 1E5VA 4AD8A 3X3HA 5DCYA 4L2IA 2BSAA 3IMGA 2WMNB 3KLBA 2C5BA 2ATVA 2FWIA 3C4JA 3Q5GA 4HXEB 5DBGA 1T5BA 1XNGA 1YQGA 2O2SA 1OI4A 1SOWA 3D81A 5T3YA 4KOEC 2WB2A 5AR1A 2GTPA 2WG2A 3B38A 2GPJA 5CCEA 1KXJA 1T2VA 4C2TA 1RQLA 1A72A 2Y1OA 5AKHA 2J6IA 1OT3A 1QYVA 3OY7A 4IUYA 5DLPA 3ZWQA 2GN9A 4P53A 1CV2A 3ODGA 2WIKA 3PHIA 3RC8A 3QUQA 4QEDA 2QRMA 3G2NA 3HDHA 4GZ5A 4P4LA 1RQPA 5SZIA 4OSOA 4GMFA 3U19A 3QX7A 1MNQA 2AJCA 3CCCA 2QKYA 4RFLA 2ZJYA 1YF3A 2I67A 5L3QA 5A3VA 3ZDCA 1E60A 1WMDA 2G08A 5CLFA 3TEJA 2X8WA 1BXGB 1DAFA 3Q0EA 2C96A 1QVVA 4UQOA 4YAOA 5ARBA 4UQLA 4IV0A 1N1GA 3DBHA 4RPHA 5MN6A 1WPRA 3OWOA 3E84A 5JI3E 2GCIA 2QZ4A 4UTRA 1X77A 3L41A 1RADA 4D2IA 5IDVA 3BORA 3CVXA 1KPHA 4IRUB 1FZQA 3GLHA 1HYBA 2JIQA 4PVDA 1S3FA 4PF1A 5J40A 4CF6A 3IESA 3W78A 1TM5E 4H4DA 1QF9A 1G7TA 2XAUA 3D8BA 5GV8A 4U2CA 3U7JA 2B94A 1EIWA 4IDQA 2COKA 1N6IA 3JTEA 1MD9A 2C61A 3O8OB 1Q6YA 4MMZB 2XE4A 1QQTA 1EDOA 2WWFA 1ST3A 3K9NA 4ZVQA 4B4OA 3CPHA 4IH9A 1EG2A 2FMFA 2ZI4A 3HRIA 3DTNA 4KVFA 3IKMB 4G5OA 4TUYB 5AJYA 4YP9A 3VFDA 5KQGA 1R0KA 3JPYA 4AF6A 1E2JA 5ER9A 2Q5JA 1IULA 5EWMA 1NT4A 4JGBA 4LN1A 2PZJA 3KZ1E 1S2MA 3EZLA 3I23A 5BYJA 1RZUA 1QIDA 3QBDA 2HK6A 2ZJ8A 5HIJA 5ES4B 1EPUA 4PZYA 2JGDB 1SC1A 4JEIA 1CFJA 1W9HA 1Q11A 1XJQA 3UQYS 4BATA 4TV9B 4A8JC 4DDKA 4DVGA 4PZCA 2A5JA 1ZNYA 2G25A 2QLLA 1ZK0A 4HHEA 4XB1A 3ULKA 3GEHA 3WV4A 5EHXA 2O2DA 4L7VA 4ZOBA 5DW3A 2GCOA 5CVJA 4HRYA 2DYKA 5KWJA 5J58A 1YKSA 2HWKA 5EIOA 2JI6A 4NS4A 5IEBA 3U3JA 5B1YA 1C0PA 3D3NA 3EQ2A 3M4YA 4IKOA 4RHXA 5AK6A 2VQEB 4RKWA 1SURA 5D6NA 4ARCA 4I4TA 1Y9ZA 3DFMA 1K8RA 4L3OA 1Z5GA 1KI3A 2AOXA 2PAFA 4QPCA 4W1QA 4OD0A 2QZZA 4GYWA 2IIBA 3SHQA 4PZLA 3CLTC 2WWTA 4RESA 1L1EA 1FRNA 1OLUB 5LKAA 1IEWA 3RNOA 2YWCA 4ERXA 3FWYA 2F1KA 2WVJA 1WKCA 4Q9JA 4UU7A 3NHYA 4CQMB 3DD1A 2H1HA 3DBVO 2BGTA 2FW8A 4EPRA 3KQUA 1KI7A 2Z83A 3STTA 3ZK7A 4OM7A 3TK1A 4B71A 1ZXBA 5JV5A 4DARA 5F3RA 5PGMA 4PC3A 1GPBA 3AI2A 4NENB 2H0AA 4HNAA 5CK4A 4ZC8A 4ZO6A 4XD7A 3CXRA 1VE3A 3OE4A 2F1IA 1TYBE 4YJHB 4XRGA 4PZ9A 1ST2A 3OM1A 2PVCA 3TDKA 3USZA 5KOIA 2F1HA 3CVWA 4TV8F 5JC8A 3AY6A 3LW7A 4AKGA 3ST7A 5FQOA 1RNLA 2ALJA 4AM8A 3RODA 4XCXA 4OOFA 4H1UA 2NU6A 3RJ9A 3ETNA 3BXOA 3DP9A 3FWPA 3PBKA 1GP2A 1G5IA 2GM9A 2UAGA 1PT8A 2NU8B 5K0ZA 3LCCA 4F45A 3H5OA 1CUUA 4ZHQA 1GADO 3I6YA 1PV1A 3H6HA 2JVKA 2ZSDA 4ZJYA 3QPUA 1W0KD 1NRIA 1Y3AA 3ET4A 2QTCA 1P1CA 1NAHA 1T1JA 3RABA 1AGNA 3PUXA 4P5DA 5KKAA 4K9PA 4YUXA 3K9QO 1G6KA 2EKQA 2H18A 1UMKA 4FWBA 2JFZA 4OX9Y 1XA4A 1KFJB 1PGQA 4CM1A 5KSPA 2XQGA 2HJVA 1EBUA 3EBOA 5JWOA 5BSWA 3GVCA 5I8ZA 2CLKB 5ESXA 3BS4A 3ZKAA 4KDCA 3OF3A 4WCVA 1WMBA 3LPNA 3GT0A 3ZZ0A 2A0UA 2IHUA 1T1GA 2HU8A 1Z3IX 3OCWA 1E77A 3F3MA 4MPRA 5HIMA 2NLOA 1I2AA 4C3OB 5IYZA 5ILOA 4JVSB 2HC9A 4FMDF 4QWMA 1NXWA 4NNJA 5E9AA 4K05A 4B3JA 3K9WA 1DQSA 3MWGA 3JQGA 5J43A 2QR5A 2PUEA 3OLZA 1SBZA 1U81A 5F21A 5E2IA 1SH7A 2G09A 5I48A 3BQMB 1UPBA 4IOJA 1L5WA 2J4DA 4WCFC 1NPYA 3GNTA 1EEHA 1AKEA 2PIDA 4JP1A 1WP4A 3R6GA 3LPMA 3ABIA 2REQA 1VKNA 4RTRA 5AW5A 1MX1A 2NSJA 3LX5A 1PKXA 3Q87B 1FY2A 2ODEA 4ND1A 3KKLA 5ALNA 3KQNA 1TZMA 4A0SA 2MJLA 5AICA 2W2PA 1GNTA 2H7VA 3LQFA 4D57A 5A5DA 3CPEA 4NLLA 1KH3A 2ZBDA 1MAHA 1TUBA 4RF4A 3VO8A 1IBKB 1UBNA 2QVYX 3QVXA 2ZYVX 1KEEB 3LFUA 4DN6A 3I53A 3CB4A 3UMRA 3DXXA 2OVBA 3TIVA 3ZCTA 4DRYA 3UPUA 1EM6A 3P5BA 1T8UA 3TFWA 4PIPA 4EG5A 5HOQA 4Y6RA 3PHGA 4BN5A 2ZS7A 3I4FA 2HCRA 2V7BA 3TQOA 3B2QA 5F2OA 4ZVVA 2ZSAA 3DPIA 2AMYA 1NF9A 3LDFA 2QPAA 1WUJS 3E8MA 2DUWA 3C15C 1HRKA 3PQEA 3QWIA 3UHOA 5JZMA 5HJ2A 3FFXA 1RJWA 5IULC 1LDNA 5DK6A 1CDEA 1H9BA 4TKLA 2P0YA 1NI4B 1RBQA 3DBOB 1ITZA 4M76B 1G21B 2YWEA 3ADOA 4QLBA 1XROA 1L7DA 4BBZA 8OHMA 3MHPA 4YACA 1X7DA 1XALA 2NM0A 4OI2A 4UARA 1RHJA 2FLVA 2AGVA 4GT1A 4Z5XA 2QTFA 4LJSA 4ATNA 2Z43A 3DE3X 5AIBA 4DC1A 1SCQA 3VISA 4PIVA 1R50A 2YHBA 3T5BA 2QSUA 2R9VA 1KJWA 1PS0A 2QXYA 5ADUS 1GGJA 5JO0A 5DMXA 1XEFA 3TCKA 1ENOA 1K88A 2DGDA 2R00A 2WV9A 3CSDA 1DOAA 4RK1A 4RVUA 1HOTA 4YIKA 3IEKA 3SWWA 4PGAA 3ZH9B 1H4SA 2PNFA 3IPAA 3GBVA 3N8NA 4G4IA 8ABPA 1XPJA 1Q7EA 3ZIDA 3T0IA 3UC9A 4RULA 3TB4A 1WX1A 2GZSA 3FSGA 5EYPB 1SVNA 4R8RA 3HKEB 2BRUA 5I8WA 3NXSA 1FYEA 4PYNA 3NWOA 2P75A 4RW0A 1TIPA 1NHWA 1SNYA 2YXBA 5MN5A 1S1MA 2FEXA 3HLYA 2XI4A 1KSHA 5BUCA 3IE0A 4W1SA 4C3ZA 2PUCA 5B1IA 3AF3A 3A4LA 3KPYA 5LWHA 4E08A 2ZJZA 5DSZA 1PFQA 3AHFA 1PK9A 1SCKA 4JT8A 4LGVA 2HFJA 4YO7A 2BISA 3KHSA 4GX2A 3SX0A 5AUPB 3WNCA 5C18A 3M9XA 2PWPA 4G3XA 4HGRA 1D2GA 1D1PA 3ND7A 4KO2S 3KHKA 1F0YA 1OYVA 4TXMA 2QX4A 2ZR7A 3WR5A 3U4HA 3ZN2A 4BU0A 2EKPA 2PIAA 5IVHA 3AETA 1G5HA 1R8QA 2HREA 1IJBA 1NSFA 2ONKA 4ZO7A 1AS3A 3C24A 2XF8A 1QCYA 5HMMA 1WDTA 4P7FA 4H7JA 2VWQA 5AVSA 2EP8A 1D9ZA 4OHRA 5SZKB 3VDXA 3ZGYA 1K5GA 4A9AA 3T5AA 2VPIA 1YWGO 5KNDD 2GRJA 3IAXA 2OK7A 4E07A 1WQ1R 3V8QA 1TPYA 3LBNA 1I4LD 1ZA1A 2CFCA 3L3BA 3QG5A 2V8OA 3WKCA 4EW1A 2VT2A 3KEGA 3LKZA 2GYVA 5KC8A 2J0QA 3WMFA 4GIBA 3EARA 3OE7A 2FFQA 3QMWA 4Z49A 4KK3A 4MS1B 3NWPA 5AW0A 2C8KA 3A1UA 3M2TA 3RRJA 4QGBA 4PFQA 1VG8A 4RIIA 1WUHS 3GGGA 1R1DA 4WVFA 3WXBA 4C0SA 5EJFA 4GZ6A 1QWSA 5CEJA 3CFYA 2VHJA 4J9VA 5D3MA 3FIUA 1G1MA 3G5MA 3T7IA 1SIBE 1SOVA 5KOHB 3GLGB 4FGZA 1I94B 1OXUA 4GWKA 4E5NA 3I0MA 2XIQA 4HAVA 1Q0UA 3UPTA 4JGIA 3BK7A 5D5QA 3EXHB 1BVRA 3R4CA 1G3RA 1NV9A 3Q7PA 5DSXA 4RF5A 3R3YA 4QC2A 3LVRE 4XVQA 1EUDB 1VJ0A 2PD3A 3EZ9A 2JG3A 2DBZA 1CFZA 5J4KA 3AHHA 1U7DA 3HN6A 5C5EA 5KNCH 4MZDA 3DE6X 3HGQA 3ZWKA 1T4GA 1G6HA 1JNXX 4DB4A 4C4AA 4IOLA 3C3WA 4MS3A 2Q1WA 1JDPA 3MT7A 4QBFA 2VAVA 1KSFX 2Q99A 1HT2E 3KJIA 4M22A 4R1QA 2FOLA 2G40A 1TRKA 5IJWA 2YZKA 3DM5A 4IIEA 4V0NA 2WWRA 2ODPA 1RI4A 2OP0A 4BAGA 2A1TS 4MV6A 4CT5A 3G1WA 2WJGA 1EWRA 3NIGB 5CVEA 2A5LA 4H60A 4TRNA 3TCNA 1DXHA 2JW5A 2FZCA 2VYNA 4IV5A 4JH0A 1BCRB 1U65A 5DM4A 2JAQA 4EVIA 4JHXA 3PKIA 1LF5A 2Q9UA 3A05A 4ZALA 3KKMA 1GFIA 4PCAA 4WZAE 4WNYA 2FLKA 3H1PA 3MUNA 3NVAA 5FNVA 4BLSA 3ICCA 4OHBA 3IJ5A 1WL8A 2LD4A 3MS2A 4UHEA 5IW8A 3TLAA 5M5BA 1FS6A 3KYJB 4QGHA 3ITKA 2VUTA 3OX3A 1OA1A 4KYTA 6ADHA 1IY0A 2C9OA 2FEKA 3I01A 3UN1A 4ALJA 4B7XA 3L8DA 5B6JA 1U7TA 2ZJ1A 4JYZA 4KFRA 1UODA 2K7ZA 1WABA 2PGIA 4PYQA 5KYYB 2FRXA 3H9UA 1C9KA 1OASA 1Z16A 4ZAVA 3EXIB 1CHDA 3MWLA 4GKAA 3ZY2A 4LF4B 2C7GA 1ND6A 3MXOA 4YP7A 1CY8A 2HCBA 3G89A 3L8YA 1CQZA 3B1JA 4LUCA 4Y6OA 3WG9A 3KAJA 3I6MA 4N12A 4JLSA 4KLAA 2O5VA 4RIHA 3TL3A 4EFKA 3FKQA 4YJ2A 4D8VA 1J5EB 1LUAA 2FQQA 1Q0LA 1G8PA 1U0RA 2B82A 2OAGA 2OCDA 2XT0A 3IAEA 2OLEA 4FC6A 4OJMX 4ZAZA 4XLZA 2JFWA 2NO7A 3AK4A 1FVOA 1ZM2A 3M4JA 4Q16A 5TSDA 3WRYA 4MKRA 3LSYA 3ZNQA 4EGAA 3RLIA 1RAGA 3VR5H 4MLCA 3IHLA 4XX0A 2RH8A 3DDOA 4JJZA 3ZJYA 4BX2A 4D43A 4AG5A 2I2CA 1X1BA 2GEFA 1H94A 4LPKA 4Y6SA 3RF7A 3SXUA 3GVIA 4PC7A 3WWDA 4DSAA 1R27A 1B74A 1C29B 2A9JA 3MJFA 2BFCA 5T4FA 4BFXA 4B3TB 1TO2E 1D6JA 3T7AA 4DCUA 2QRKA 2VDOB 2J5BA 2ZIWB 4F4DA 2QRLA 3HACA 3BN3A 2UUAB 1TADA 2QJRA 1F12A 1JQAA 1G4UR 1RAIA 3OI7A 4URXR 3G8DA 4QYIA 4EF4A 4RJ2A 1EMDA 1X7WB 1ZXLA 3BJEA 2XCLA 1GTG1 3JQFC 3SYKA 4WE3A 3ADDA 2ZXEA 3V3KA 3N0VA 3AEKA 4NG5A 2B5WA 1GFZA 5E6RB 5EZYB 2V98A 3UH0A 3N6VA 3TUZC 1A7AA 1NUQA 1R0XA 3OFNA 2WY2D 1GL6A 1O6BA 3T0GA 4DXHA 4DLBA 2QORA 3QH4A 1IL0A 1GG2A 3ZG6A 1I0IA 2VOJA 4AQ7A 4UVIA 1JT9A 2P9QA 3AYZB 4FYIA 4M83A 1TEVA 2G8NA 3BEOA 4BLTA 5DCUA 3EG5A 2GJKA 2X9NA 1A8UA 1O94C 4Q9NA 3SDBA 1JE0A 5JNWA 3CRW1 3BCSA 5BQPA 4C4ZA 1QYWA 4C5AA 4GKJB 3LS2A 1XZEA 3WKDA 1YZVA 2ZIAA 1TM1E 3N2YA 3S2EA 4X66B 4CIVA 4XQ9A 1O96A 1UXKA 4YUAA 4YT8A 1GL3A 2HX1A 1J21A 1WU8A 4P4GA 4S24A 1V41E 4RJTA 2ZBEA 1G3IA 1KZ7B 1XMIA 1XX6A 3Q0IA 1OLSB 1R6XA 5AJVB 4GOND 1ZWKA 5F7XA 4S04A 4M1QA 4R98A 4J91A 1KMQA 2IODA 3PHLA 3EGCA 2YOHA 3F6YA 4FFNA 2YY6A 3BQNB 2BEUA 4YT2A 1SXJA 3AQIA 3LBAA 5GONF 4OHMA 2GDZA 2IYTA 2MT9A 3LXMA 4E31A 3UT5A 2I7TA 5FUMA 1OF1A 4RS3A 2EHJA 1C7ZA 2AF3C 2CWWA 1P0MA 1RXSA 2SKCA 4N6GA 3RUDA 2PM8A 3WC4A 4G97A 5BN5A 4X85A 1GT91 3PS9A 1NF3A 5EIBD 3MB8A 4IDFA 1GUFA 5TGDA 2EEPA 1SKYB 1GQRA 1KYQA 2E0IA 3WWEA 4Z4EA 4XQGA 3W77A 1NIJA 2A9RA 5BUZA 1SHJA 1L7OA 2ZB4A 1HEUA 5FH9A 1EKXA 1NMQA 3MLBA 2OBMA 4F4CA 1RYMA 3A7DA 3GJYA 3B70A 3UPDA 1Z4OA 10MHA 2P2DA 3LBIA 3V9PA 3WLHA 4AZ0B 1XZMA 2XECA 2X8JB 3A14A 1FVXA 2PFSA 3G8CA 3PDCA 4JDUA 1WCIA 1PBTA 4P3YA 5IX8A 1X13A 2WC1A 3N2ZB 4FEYA 3JQ8B 1SCUA 2PSEA 4DLVA 5K45A 1NE7A 3G0HA 2XH8A 1R18A 2XGOA 1NXOA 2BZSA 2VC2B 3N0TA 2BHSA 4NVRA 5JBNA 1YB4A 2JIDA 3IBCA 4P3NA 1HDRA 5I6DA 3LK7A 5DBIA 3CZAA 3R2JA 3RAPR 3OCXA 3QXSA 2HR1A 1CVIA 4KI7A 4UMDA 3T94A 3D64A 5ARDA 5DX8A 4IIXA 4E30A 2VFAA 4ZXFA 2X9GA 1ULHA 1VG1A 4NS1A 4XGIA 4PE5B 5DNVA 1MCZA 3AI1A 2B7CA 3E5RA 3HYSA 4LNHA 4O5OA 5J63A 4EPWA 3AVXA 2ACWA 2UUCB 2WUGA 1YKGA 1U4OA 5J5AA 4FFVA 2DR2A 3DCNA 2GFIA 3UGJA 2NSYA 2IIPA 1UIRA 3VJMA 1DBQA 3Q15C 2O4UX 3D7NA 4ZHSA 3WLTA 1OPRA 3DCJA 3MBKA 1ORWA 3GROA 4LZWA 4Q9HA 3QVGA 5F1PA 5JS7A 5KKCA 1DUVG 1SCJA 4NDZA 1F7VA 1Y1LA 2DH6A 2JFYA 3L8ZA 1ZUNB 3EVEA 4TL8A 3T5GA 4OXYA 1QHSA 4YRSA 3EC7A 1AQIA 3FPBA 3PJEA 3VV2A 1PI3A 4FT4A 1VGQA 2MYPA 3DDZX 2EJBA 1YASA 421PA 1FFXA 1NQ5A 3FYUB 4ASUA 4UOZA 1DG3A 4WPGA 2MSCB 1ELOA 5FYQA 5FI1B 1SHKA 1X80A 4EOGA 2HHLA 3M6XA 1CY1A 4M9SA 1JHXA 2TMDA 1VL8A 1M2FA 4EZEA 3SK0A 4IM7A 3KLPX 2JCGA 3D6TB 3HKDB 3A4VA 4IF4A 5BSMA 4PO1A 3T8YA 5AXDA 1AKVA 3AC0A 1TOAA 3WO1A 5CIYA 4NCIA 2BHRA 4J2OA 4JOCA 3AOEA 3ZVLA 4HXFB 1QGUA 1H2FA 4B3MB 3V2UA 3UW3A 2HK9A 4G81A 4YRBA 1BROA 3OJLA 5H0IA 4O2LA 1JQDA 2JFOA 2XVMA 1T6BY 3Q3CA 3JWPA 3L7CA 2GPNA 4JR0A 4H31A 2AWOA 4BEJA 5KU1A 5AJTA 1KNQA 1M6WA 1ULAA 2X8LA 2J3DA 5TS3A 2AJBA 1BCSA 2EEZA 3G0IA 1E2BA 1TO6A 1Q7RA 5CM2Z 3DHVA 1EM8B 2L2QA 2VZEA 4NXNB 4BNHA 1VGRA 3KG2A 4NYIR 4QTUB 3CEPB 1E79A 1LRLA 3VI4B 5JMPA 3WY9A 1K97A 1RXWA 3KLOA 3R0VA 4BGVA 5KJCA 1ADCA 3ESZA 5JW6A 2QQGA 1C4WA 4HXYA 4IWNA 3PXEA 4O4LA 3ZX5A 1QYIA 2GN2A 1FA9A 3BJRA 4CU5A 2I3AA 4NMHA 1M6HA 3D3WB 5K3SA 3AR2A 3HY6A 4D98A 2QR2A 3PHBE 4N9WA 5AKXA 4EM6A 2FDXA 3WLKX 5K8VA 2Y8EA 1B93A 1L9XA 3RS2A 1Y3FE 2Z3ZA 1QONA 3RRXA 3V1NA 4ZDJA 5HZKA 1RM4A 3DTVB 3BDAA 4LE2A 4Z4FA 5B6IA 4DWVA 5KYTA 1E2NA 1Y9AA 4FMCB 4UUAA 4EJFA 3NDIA 2C58A 4OAPA 5K01A 3AFMA 1TXGA 5LA6F 4K6KA 1RRGA 4X65B 2QMYA 1JDVA 4JUCA 3X1KA 1IHXA 3AXSA 4B17A 1FNNA 3K4QA 3ELUA 5I7VA 2NZWA 5SY9A 3B8HA 1JHYA 2XQJA 3GUHA 4PANA 4BKPA 1F60A 5CW1A 1RPNA 4LHZA 2BI7A 1ADJA 2FWNA 3BMOA 1OIXA 2P9TA 3NHFA 4JUBA 5EWJA 3ASUA 3TQCA 2ZG6A 1Q83A 3F5SA 2HJWA 3VNVA 1NPTO 4GR5A 1IAQA 2A3RA 2FTKE 4MPDA 4CNQA 1ZM9A 1JBEA 3MINB 4OU4A 2NZ8A 3D2AA 2JBHA 4KPUA 2O0HA 4ZT3A 3LBFA 5B55A 1J9GA 2JZCA 1X1DA 3F3KA 1PZXA 1VE5A 1U9YA 1DWUA 2RK6A 1YB7A 4U5QA 4CDMA 2R7LA 3GPBA 1TZBA 1YI0A 2R8EA 1XDDA 5K8LA 2OYRA 3VPGA 2VF2A 3JRXA 5D5HA 3M4NA 4AJ2A 1YULA 1WUYA 3L0IB 1SR8A 4R41A 4D4MA 1E2IA 2PYIA 4DM3A 3A6GA 3OIGA 4EFDA 4YCDA 3EUFA 1EGQA 4KWIA 4YFYA 4A2PA 3JCZA 2UUOA 2V9CA 2ZPUA 3T15A 4NNPA 2J9XB 1CZNA 2VAWA 2EFYA 2VQ6A 4DV5B 2C88A 4CG0A 4UVHA 4XGKA 2I62A 3EF3A 1GNRA 2DPHA 3LL7A 3LQ2A 2FPIA 4JITA 4IOKA 4Q9IA 3SVZA 2QV0A 4FLFA 1M2NA 4BFWA 4H1HA 2VPYA 2KWIA 3GFRA 2OTCA 3B6ZA 3K0AB 3LUAA 1ESEA 1E9DA 1TUGA 4CBVA 1ZL2A 1RZVA 1M0SA 1AIPA 3EQZA 2WLSA 3WBKA 1T4CB 1W30A 3SLKA 2OPBA 4AWXA 4H17A 4OL9A 3BG5A 5JUWA 4J0FA 2YIMA 5A9SA 3KB6A 4ABTA 1E63A 3M33A 5LIPA 4FFBA 1HTWA 4OHWA 4X3CA 4V0LA 1PJLA 5MF6A 2C3YA 3FFBA 4S1WA 4XYMA 1M0TA 3DVAB 3M6IA 4K88A 5TEVA 4GI1A 3R5SA 2QDXA 1QBKC 2MSNA 4K9SA 3GUVA 2C3MA 1PJRA 4KMSA 4OQEA 4NJMB 3TZBA 1Q0PA 1V8FA 3AZOA 3KUDA 4QVKA 3VAZA 5IJ0A 2ZVPX 4IXWA 4O4IF 5FPKA 5LMUB 4AY2A 2GN0A 1PS9A 1MG5A 4PSKA 1E0AA 1BFDA 1PR1A 2AX3A 2X76A 5B2ZA 1XD2A 5GVRA 1C9YA 1BSVA 2RB5A 2FPXA 1XEWY 1TQDA 4TS3A 2FN7A 4AY3A 2R79A 1BYIA 1HSZA 3P2JA 1S8OA 5DSTA 1GDDA 2XWBF 4Y2QA 4NEGA 1TGYA 5BPHA 3VXKA 1KAHA 3ZDEA 3SDSA 3FNEA 2PWYA 4LYJA 1CUDA 4G89A 3TMKA 5IM4F 2OZVA 3H19A 3G85A 4ZXPA 3QPCA 4G5FA 3KYCA 2O0MA 4QOIA 4D9IA 1JU4A 3DZGA 3NX4A 3BIOA 4ENVA 3C3JA 2C20A 4XR9A 4ZARA 5LQSA 4F11A 4FYYA 4QUHA 5ERGB 1JHDA 1W94A 4WN9B 3CQ9A 2ZRAA 1XQ9A 4GDMA 4KG7A 5AKKA 4BIIA 3QUTA 1QB8A 2P2ZA 1NLMA 1JG1A 2XUDA 3DT9A 3D4OA 4LDJA 2PEYA 5FBHA 1II0A 1U3GA 3GCGA 4KV9A 1L8AA 1WU7A 1KQGA 2X0FA 2RCNA 3PNBA 1VSQA 2Z4SA 4HDRB 1D5CA 2A5YB 3HH8A 3GLRA 4OK5A 4X84A 3U62A 4EG3A 4EKEA 3QELB 4OXQA 3TX2A 4UHHA 3RYIB 4POOA 1MQ8B 3UWKA 1ZBQA 5IXSA 2I6XA 1AB5A 3N87A 4LJYA 3UK1A 4AJJA 3PHJA 3VZDA 3QEAZ 4UZFA 1Y7HA 1I9CA 4G5SA 3L04A 3R3JA 3AUTA 1ZIYA 2PZMA 4JYBA 5JDCA 1XWFA 4H7DA 2BF7A 3EQ8A 5I7UA 2XYQA 1G19A 1H66A 1F8FA 4NEQA 1U2QA 1U3FA 1U0GA 3QLUA 2BFWA 2GLTA 3ZD7A 2NPIA 1A50B 3RFUA 3ZWYA 4MVJG 1D0IA 1XRPA 1JR6A 3ED5A 3L1VA 4G01B 3H4IA 5D84A 4EGSA 2OKGA 3OT1A 4ENPA 2IX3A 2H31A 2FZVA 4KPGA 2R4TA 2VZ0A 1PKEA 2NW6A 4IL5A 3SE0A 2GM5A 4EJ6A 3FAKA 1E9FA 1KR5A 3FN4A 2QRNA 1XDBA 4Y6PA 5K1ZA 5IU6A 1THZA 2WIJA 2VHEA 1T5DX 4INPA 3T35A 4ETNA 1V37A 1IK4A 1HE1C 3VHLB 1M1UA 1HMPA 4IVRA 3M7IA 2P9JA 1S7CA 1IOZA 5EINA 2WU3A 3EZ7A 1Z4JA 3MJCA 3FFTA 4ZQGA 5J3JA 4TMKA 4Y8VA 2FUG1 1DKRA 2G7MC 4ZEOA 3ZDDA 2NTNA 1U9JA 9ATCA 1MRNA 4PCLA 2GEVA 2JJ2D 3FWZA 2HY7A 3BBPA 1NXSA 1FQOA 1VSUA 1IZ8A 3BIWA 4OUDB 2E85A 5HKOA 1VKRA 2XNDA 1UPCA 1L4EA 3IP5A 1CB0A 2DQSA 1TX4B 1R8XA 8ATCA 4AJ9A 4Z4QA 3FPKA 1UFKA 4PEVA 2CZQA 3OHSX 5C7LO 4DCVA 1VHQA 5FA5A 2X7XA 2R7NA 1GXSA 5AKLA 1HYHA 1I6WA 3N3AC 4E2YA 4XRRA 1R00A 4COOA 4G41A 2GJ9A 3ZE0B 4BXOA 4Q82A 4AWBA 5L3RA 1NXQA 3C3KA 4RHFA 3P9QA 2VRBA 1D2MA 2J3IA 4MX8A 5FA8A 2CJPA 4QG7A 1YRAA 4IUBS 1HG0A 3AOGA 3QPAA 3L7MA 3QJYA 2O23A 3CCFA 3IA2A 1FSZA 1NONA 3OMLA 4H77A 3THSA 1WDKA 3CU5A 4DXAA 3IP7A 2AG1A 3RC3A 5L3SA 1ES9A 3ANMA 3G2LA 2EDCA 3VNAA 3RHFA 5JEDA 1XELA 5JJIA 2HMTA 1WCV1 3OSZA 1NY6A 4NAUA 1S2NA 4YWJA 1ANKA 1GZSA 3M6AA 4KDFA 1LPPA 1NT2A 5HWSA 3CB2A 3HA5A 4P5EA 3R41A 3KTFA 1K6JA 2JVJA 3PENA 5ECDA 3OJEA 5ERXA 4A8JB 4ZDKA 3H04A 4JBNA 3QZUA 4R68A 3IQWA 4YQEA 1AKWA 2ZZKA 4JLUA 4B4UA 3KE8A 4ER3A 5D1HA 1PSDA 1E1RD 2ZWMA 2HN9A 4WXMA 3EC1A 1QV9A 1LBEA 3RPEA 4BVHA 4BNIA 4JJ7A 1PG0A 4V0MA 3GP3A 5IXJA 1JYEA 2I4RA 3UK2A 4IBOA 3VU0A 1MX5A 3WGTA 4LW8A 3I9V1 5EE3A 1XMVA 1OGYA 4OLJA 5K4AA 5IJZA 4G8BA 3DTYA 1FTGA 3HA7A 1YJXA 3PGA1 1BHJA 4AYWA 5EESA 2ZYDA 1Z4LA 5FHQA 2XB4A 3N6XA 2ZATA 3W90A 2G9ZA 4CF5A 5HRUA 4R1NA 3TECE 1MH9A 3BA6A 2HXSA 1PJTA 3RTDA 3JY6A 3SXPA 3NW9A 3QJGA 1U9CA 2GPSA 5CLGA 3ND6A 3RIHA 3CR7A 3UMGA 5JADA 1GTJ1 1RQ7A 3QW4B 5K6RA 4OYHA 1QLJA 4HGOA 2IKSA 2AOTA 1ZD5A 2AN4A 3BMCB 1RYHA 2A9VA 3LT0A 4JC0A 3ZXXA 5I3CA 1KQPA 2GTIA 5IKMA 2Z9CA 2LTAA 2XUFA 2OC4A 3O3MB 3A4TA 1US8B 2RH5A 2ZUFA 3VHXB 1Y3BE 1KF0A 1X1TA 2YOGA 3N7TA 3HFRA 5FT9A 5HMLA 1TI7A 2ZT8A 1E3MA 1NQTA 3MUEA 3EXFB 1XAGA 1GA1A 4E5UA 3BHIA 3CSUA 3CMCO 5A1TA 1JXOA 2D8AA 4MQFA 3I58A 4X41A 4HEHA 2B7BA 2Y0BA 4OB7A 4CEHA 3DVRX 3I6ZA 5LB2A 3WLSA 3C0KA 3FLEA 3PX3A 4A6PA 5KYKA 3KOZA 4B9AA 5ETJA 2GBIA 4UCXA 4K9NA 4BWVA 1RYNA 2Q45A 4CFSA 2XMGA 2E9SA 1UZLA 3AUYA 4BNNA 2AEEA 4Y2XA 2DPMA 1QS0A 3IOCA 4CIYA 4CKWB 2I4LA 5K8JB 1MHTA 2G5CA 2J87A 3T4XA 2E4AA 1W47A 2VHWA 1KFBB 3H9CA 4C01A 1BX1A 3CNLA 3OLVA 3LLVA 4NBWA 4N5HX 2CXXA 3PC8A 4ODIA 4NYIQ 4IIJF 4MR9B 5B2EA 5TRTA 3DMRA 3AFIA 4FC7A 5C4GB 4N8DA 3FHTA 2BFPA 3TXXA 3WHIA 1SK9A 1OPXA 3TOSA 4CV2A 3ERCA 1JVSA 3TOVA 3GCDA 1C5KA 1G6OA 4KQMA 3OZUA 4RH1A 3OKFA 4X8HA 5DP2A 2XMZA 1KDVA 3RV4A 4REQA 4ARZA 4QDKA 4ZVLA 1T25A 3WNQA 4IEIA 4PLYA 2PO5A 1N8NA 4FE3A 5LJLA 4C07A 4DV2B 2JIOA 3OT4A 1JDBC 1Y1RA 4I5FA 2AFHB 4DMHA 1HGXA 4A23A 4AMZA 1ML4A 1E1CA 2A9OA 2BZGA 3EIWA 4X20A 2A59A 2GD1O 2R4UA 3F8TA 3MJEA 3TNJA 5BUSA 3A37A 3MJTA 3T7SA 2HYDA 4G0YA 1FS4A 3ROTA 1AB6A 3WDLA 3OIFA 5GONB 1WVIA 2B8EA 1J2RA 2HA0A 3RVDA 1YBMA 4H08A 1HM5A 1F06A 3EB9A 3VSBA 3FPCA 3UXYA 1H8HA 2HRCA 4L9AA 5CDYA 3W5JA 5IH7A 4B6OA 2I91A 2AN3A 3I92A 2E3JA 3F2IA 1XPRA 2DWPA 4MI9A 1NDHA 5EERA 1AJEA 2XDYA 3CLRC 3IIMA 4X8OA 1HXHA 3G9ZA 4YRKA 4Z0NA 2G0TA 4GU5A 1C8LA 4UTZA 4TTVA 4MRRA 3VR6H 2GK4A 5L6MB 3W2FA 3ENVA 1T9BA 4JY7A 2V58A 2H2DA 1J2UA 1H2XA 4UBMA 4ALLA 5JS1A 3MD9A 2A9QA 1H8EA 1WG8A 4U2EA 4EY4A 4H7EA 1ODFA 1CY0A 3L7IA 3L7NA 4D4KA 2QT9A 4ISCA 2DB3A 3OCJA 1WSBA 5LBTA 1NKSA 2QNBA 3CZMA 3GD5A 3G2KA 2GQ0A 4HTAA 4LSMA 4RGBA 4QTXA 4DCTA 1NUAA 4JQYA 5C2JB 3PQ6A 2LCQA 2DHDA 2KJQA 3IV7A 3CSSA 4ZTUB 3A2LA 3GPDG 2ILVA 5G02A 1JIXA 3DHYA 3TI7A 3VDMA 1EJBA 1HDGO 3O8QA 5E2BA 3G2MA 2C4KA 4HQOA 5LZ4A 2EF0A 4HAYA 4I55F 1LZKA 4OEHA 5KEIA 1G1AA 1JU3A 3E7XA 5JZOA 1GAEO 5LD2C 4M0MA 3EQ9A 4MQ6A 2H2AA 4OIMA 4RIFA 3IO5A 4F3NA 4A5SA 4Q9DA 2C7VA 2IYQA 1JLLB 1UDAA 2ZBPA 4F4IA 1ZR4A 4ZOEA 1N7IA 1TU3A 2R1TB 2JLUA 2RG1A 1V16A 4JMPA 2RH4A 4QNNA 2F3QA 3NT4A 1CUJA 4DA4A 1A76A 3NHLA 5ITVA 1YACA 1RABA 2QUKA 1Z29A 3ZW8A 3VAYA 4WEOA 3AM1A 4JL8A 5A0FA 3ZDFA 4DRXB 1WB4A 1UDWA 2N9UA 3FYSA 4EIWA 4MRPA 1JHMA 2QMUA 4ZK6A 2EFJA 5T67A 1QIHA 3H9QA 3B13B 2JFXA 3GFVA 2RBGA 3CF6R 3D6HA 3H4VA 1R16A 2AF4C 1OW3B 2BYTA 3EYWA 5JR3A 4B7UA 1H2YA 2PLNA 5JIBA 5EJEA 2P6OA 1UM8A 1P5ZB 3R23A 2O14A 4JOSA 1FU4A 4N3NA 3R75A 3ZU5A 4Z1MD 2J33A 1DQPA 2B9EA 2JGFA 2ZAYA 3HHPA 3NEPX 2ZAOA 2W83A 4I9UA 4FDMA 3PXGA 3WK7A 3M6MD 1S6YA 2MSWA 1T2FA 2YV1A 3GRCA 1Z4IA 1U3VA 1Z15A 3IOBA 1Z28A 4V1CA 2R6JA 3IEVA 3EGVA 4MMYB 5C8ZA 2X0NA 1UOEA 2I6SA 5FOTA 5JY6A 2Q41A 3CN7A 3ETEA 1O95C 3DAPA 4KQ2A 3UGQA 1YB5A 4ZCSA 4MINA 3FSRA 1R10A 2IZOA 1M74A 3AUAA 3BCHA 3IHKA 3PK0A 4J3JA 4AL4A 5AW1A 4ZJUA 1IVSA 3F5DA 4ZIRA 3DNFA 4RQTA 2FPSA 1INLA 2VAPA 3HVKA 4S05A 1J8DA 1OU4A 2WFLA 4OXIA 5ARCA 3W8DA 1I7DA 1W0KA 3GNSA 4GWLA 4HKTA 1PRYA 1A2BA 1CJVC 1ISRA 2A33A 4IQ4A 2OENG 2Y66A 3Q12A 3QLJA 4PO3X 4R1TA 5EJ9A 4NC9A 4TYYA 1CF4A 3NM5A 4OBWA 1JMVA 1Q2UA 4BDTA 1I4EB 1JEEA 4E2WA 2Z2ZA 1PWYE 2NV0A 4A4DA 1FJ2A 2AUNA 1NMYA 3BIJA 3E4CA 3R8XA 1AKNA 1TTPB 3L4BA 3JASB 3N0RA 5F7JA 1KBZA 1R6UA 4LDRA 5CB4F 4AK9A 4YB8A 3I3OA 1YVDA 3IEUA 3BZUA 4Q9AA 3WSVA 1Y6ZA 2N1BA 5JVDB 1SFRA 2G1UA 4RY9A 1QZXA 2O06A 4FFDA 2Q1TA 1PZFA 3VSAA 4MV4A 3W2GA 1B0UA 4HLUC 5EIWA 3T5MA 1TJNA 2NXWA 1C3JA 3ZV4A 5CFZA 5LA6B 2PGAA 1PFGA 1EJ6A 1EX7A 3GWZA 3CF4G 5AM0A 5A4IS 1F1BA 4OHCA 1VCOA 1QV6A 1JAYA 4DCJA 2I4NA 3IR7A 3HXMA 2B1GA 1R3DA 3I9JA 2HMYB 3KU4A 1KDRA 4RA6A 4CG1A 4O4HF 2WILA 4ZAGA 2BTEA 3PJFA 4WSOA 2FI1A 3CUKA 5C7OO 1VJTA 2PYZA 3Q88A 1ZP6A 5H3HA 5C5DA 4AKIA 4EO9A 3O74A 1D6NA 5DN6D 1W5BA 2LIPA 4Q4CA 3ESBA 1B23P 2ZRHA 3HNRA 4IDCA 3QU9A 5TDHA 3R5HA 4ZMRA 4DIKA 1CZLA 5BMVF 1MPTA 4M36A 1DKQA 1CQIA 3Q6NA 2PZFA 1IE3A 2PV0A 3R9XB 3KDAA 4EPTA 4IHJB 4PPYA 2HRRA 2J4CA 3A0RB 3Q9LA 4RA9A 1B3RA 3A27A 2QL5A 3PCXA 3I6IA 1NVVR 3WRXA 2V7WA 1I7LA 3TAXA 1GGKA 4A3SA 2HZ7A 4ZT4A 1PNVA 4BVJA 1ZU4A 2IOFA 4IWYA 4DV7B 4N0PA 4EG0A 2C2XA 3STUA 3RHZA 4X95A 3KTAA 3F74A 5DBOA 2DMRA 4WECA 3RU7A 1WQ4A 1DAGA 2UV8A 4I08A 1WXFA 3LKDA 4JLVA 5FR1A 5J2TB 5KWIA 2RD2A 1IN8A 3EA0A 2YQ5A 1PEAA 4FGUA 2F90A 3QXHA 1DIAA 1XMSA 3H2SA 3I83A 1DCTA 1NYLA 1E3DA 2C5LA 3SU8A 2VTBB 2IRWA 1G2QA 2FFAA 2B4AA 3QYJA 1ZMTA 1Y5RA 3HJHA 3V2IA 3AEQB 3PIIA 3UF0A 3DHNA 5IF9A 3E53A 5DTRA 2ZBGA 3TJRA 1ZCJA 5DYGA 1U5BB 3N2GB 1N8SA 2I2DA 2BC9A 2Q3EA 3CH5A 1EIZA 3Q10A 1H9CA 2K87A 1FLVA 4Y2SA 1L2TA 3MUFA 5JANA 2RHOA 3PQ2A 3W5HA 4PRLA 4QM7A 2XWPA 3TMAA 5C5CA 5FQNA 5AW9A 1PQPA 4MKGA 3AR3A 5EIXA 3KYDB 4IJKA 4I50B 1Z39A 4D81A 1Z8NA 1D5WA 1PQYA 1T5SA 3K30A 5LYYA 5F7ZA 4FYJA 2X9LA 4H6PA 4YN3A 5BRNA 4KYUA 2A58A 1OV6A 1RLTA 1XRLA 1XFDA 2BGRA 4K6MA 1DIHA 1QIIA 1WXDA 4S1OA 2V6GA 1KTIA 1BDJA 4R9NA 4KFCA 1E7RA 1JEJA 1N0IA 5JNUA 5TQ0B 4X94A 2YVKA 3CRMA 1QWOA 5EJIA 4GMGA 3HNPA 4U0KA 4YXWA 5JWHA 3AP3A 2GS9A 1IM2A 3QOFA 1G21E 4QSHA 2QAGA 4YCSA 1W88A 3DEAA 1O0BA 4X6XA 1F8YA 2IOFK 4RE5A 3G2HA 3EHEA 4B7AA 1FXSA 4D6PA 5CB8A 1H69A 3NTXA 5BNTA 4MVJP 5DIFA 1P7WA 4B85A 2PX3A 3IELA 4MR7A 5ALXA 1QH8A 4E3WA 4Q21A 3HYCA 1T2NA 2VP6A 1LWNA 4U8GA 3W5IA 1ISFA 5E9WA 3ZZUA 3MCZA 2I8CA 3Q3JB 3TZKA 4PAOA 4Q3DA 5C1DA 1R0YA 2G0NA 3HXPA 3ZJVA 5C1OA 5ADHA 5KSZA 4Z8XA 3RFTA 3TAUA 1RWQA 3EAFA 4K0RA 1II8A 3PC6A 3ZTYA 2NVOA 4I6JA 4EGFA 5JBIA 3G0DA 1JFRA 4I1YA 3DL4A 5EL0A 4LXUA 3ZZ1A 4LZAA 4TQAA 5HQ3B 1NW6A 4EA9A 4D92A 4Z9BA 5F7OA 4TSFD 1SXQA 3JARA 3UKDA 4EYGA 3HCNA 3ORSA 4MRAA 1C80A 2TECE 4W5WA 4B8ZA 1WXXA 4RPKA 3E1SA 3IVXA 2JHFA 1OX4A 4BP1A 2BFEB 1RC8A 1EP3B 2BD0A 3WIOA 2VSQA 4FU0A 5EJAA 3URKA 3PFWO 3BEDA 1LSJA 5HF9A 4C9BA 3GUUA 3P2IA 4NBVA 1I13A 2GMWA 2HM7A 2JI8A 3QW2A 5F4ZA 3R77A 6REQA 1F9AA 1CRLA 3HUEA 1YOVB 1ZNWA 4NTZA 2BR4A 2XQKA 3E7FA 4BEBA 3GPCA 1Y5MA 3AI3A 4K03A 4PAWA 4DDTA 1O1YA 2FFBA 2I6GA 3PXUA 3CH4B 1TU0A 4X61A 1C30A 4CUZA 5K99A 1V8BA 2DJIA 1F4LA 4XIIA 1QJ4A 3ZNPA 1AXEA 3Q6MA 5FR2A 1EVLA 1DE0A 1P4GA 2AYZA 1N2CA 2FX3A 2QW8A 2L69A 3FDZA 3NHJA 3ZI7A 1AG9A 3AF2A 3AF5A 4AZ3B 4HH0A 4GF5A 1E6KA 2XXBA 3Q6IA 3RFCA 4CMKA 2HGZA 3FXAA 1P31A 2CD7A 2H63A 2P9HA 1KJYA 1GDTA 1RRFA 4YP5A 4HYYA 1E5QA 5CFMA 1QMPA 3W05A 1X1EA 4BLWA 1RKUA 1ZC3A 3HBJA 1P9RA 4QOHA 1A2KC 1EA7A 2VLBA 3R74A 3TFQA 3TLKA 1Z5VA 3I8SA 5AXAA 1V39A 1DX6A 1RXVA 1O2DA 4JQCA 1M8KA 3AHCA 1B3BA 2OFOA 3UANA 4E1BA 3A9UA 5T7BA 1DCFA 4J07A 1DVRA 3RRMA 1KBQA 4ZYTA 4G0VA 4LF5B 1NVMB 4FILA 2ECFA 2ETXA 4JP8A 2QMOA 4RKRA 5LVAA 4JI4B 1H2RS 1EWYA 4QG3A 1WSAA 2QQFA 3ROKA 3PU6A 3S5JA 1C7RA 5C8VA 5KTKA 1ILEA 1ABEA 3IFSA 4QUJA 5IF3A 1NVAA 1TC1A 2PL5A 4JV5B 4TKZA 1G8SA 1P2UA 1UK6A 2B8TA 1D2RA 2RGEA 1VJDA 3HSKA 4HDNA 3B9RA 3MJHA 4WK0B 3QITA 4XYBA 5EXSA 4G5XA 1YV9A 2JFHA 3QX3A 1B0ZA 1N2ZA 3KQHA 2R7MA 1EFVB 1FEZA 2AC4A 4AVYA 2VA8A 1LDGA 3NU1A 1ILWA 3VMFA 3VGPA 3P7MA 4A8PA 3R4VA 5IJXA 4C7XA 1K1EA 3WVNA 4I9FA 4D3DA 4JBHA 3BYZA 3LO8A 5C81A 1NSTA 3IDZA 4LHYA 3Q9NA 1QPZA 4LISA 3UKJA 1KO7A 4PO8A 1TLTA 5AQEA 1BJTA 3WQBA 1ODKA 1C1XB 4ESEA 1YFLA 3SJBA 4J1NA 1YUBA 2QYTA 3F67A 1EVIA 1K9SA 3E22B 3IJRA 4GUAA 3B5IA 4GL4A 4MIYA 4WLVA 2G1AA 2RGAA 4PAMA 4EMBA 4CXMA 1DRWA 1P5JA 1YR7A 4WLFA 5KKNB 5K8IA 2P6PA 4C2BA 5A3QA 3NNNA 4DIEA 1LVGA 1DIOB 2AUTA 3JAMA 2OG1A 3OJWA 4Q1DA 3ZHYA 4LRXA 4D46A 3VC1A 6NULA 5HW0A 1IEQA 1NU6A 1A77A 4E13A 5A2QA 4YRGA 1THGA 4Y67A 3S8YA 4Z7JA 2AI3A 1V26A 1O77A 2GSWA 2EZ9A 4CCWA 2EFEB 2NTYC 3VPDA 1S5PA 1FXUA 3A10A 2DPGA 1ZNQO 4NX2A 2X7JA 3PKZA 3RRFA 4QDTA 3RM3A 1JECA 2C5GA 3GGJA 1BKSB 1JXAA 2H11A 4AO6A 1U0BB 1DU4A 1X14A 1W49A 1T8PA 4DQKA 1T0UA 3K8YA 3FPGA 1CUBA 1L4KA 3B20A 1UM9B 2ZRIA 1E2UA 2QIOA 1E89A 3KP1A 3FRHA 3IEIA 3NYRA 4XR4A 5FD8A 3ESAA 4UU1A 2Y0CA 1JU9A 1CERA 1Q95A 2ONZA 2G6TA 2J0EA 2ZJ4A 3PDWA 4XYGA 3RSOA 1MO5A 4KH0A 4WLOA 1V4VA 4FEAA 3P20A 1NAIA 4LRSB 3RGWS 1G42A 4YUWA 1LNQA 2RGXA 1J1IA 4OO3A 3ZGLA 2OZLA 1HQCA 2AMLA 1SHZA 5TPWA 5K09A 2PUGA 3OM8A 4QUIA 3C6XA 4B4DA 1BXGA 4U8HA 3IAUA 4OP1A 5IT5A 1V4NA 3CLSD 4RV9A 4K7JA 4I3HA 3AUKA 1E0DA 2CL6X 1C9MA 4JI3B 1E1YA 1YT5A 1LEHA 1P1KA 1JHPA 3DMTA 3F2VA 3LRTA 4N18A 4I4TF 3QK7A 1UDXA 2QB5A 5I9BA 2H5LA 4HJXA 3ZHXA 1PLJA 4YVFA 1OXMA 1ISIA 1YQWA 2TSYB 5F1YA 3TL2A 1IN6A 1BN7A 1HFKA 2OMEA 1WB6A 3OHMA 4JYPA 4U7HA 4YV1A 3LHSA 3H9JA 4M7RA 3NCHA 1YHYA 2Y76A 1K6MA 2COUA 3HC7A 2PBZA 3W2TA 3X2SA 4AKEA 2XD4A 3WRYC 4BNWA 1FSFA 4IIJB 4EABA 1KMIY 2LWIA 3HXLA 4KBGA 3V1KA 4KUEA 3S2IA 5JHHB 3TG8A 5CLLA 2RIRA 1Y4SA 3TLCA 4C14A 2DFDA 3O8OA 4UUOA 5DX0A 2ANBA 5HKAA 1KFKB 1T4MA 1AK2A 4K9LA 2WG1A 2HIMA 1Y4AE 5K03A 3DJYA 4CTNA 1QYXA 1AQNA 5LNK1 4GP9A 3D5EA 2GNAA 4DA8A 4TUYA 3D1VA 2O0LA 2VJNA 2XVXA 4L02A 5LYJA 1ZH6A 4AS3A 5H4GA 3JRNA 3AH8A 1NP6A 5ECWA 1HL3A 5EG5A 4B43A 1ISSA 1UJMA 1TYEB 2HKIA 2JGDA 2NWQA 5AKGA 5J5CA 4TV9A 3U7RA 3L01A 4PX3A 3B2EA 4Q3EA 4UFOA 2BHLA 5F35A 3VZCA 3WP0A 4GQBA 1HDCA 4M1MA 3T12A 3T4PA 2PSHA 3DKRA 3F6BX 3Q2KA 4MRNA 3U7EB 4ZHQF 4DSTA 2OSVA 4RGQA 3GA5A 1HUQA 4YDSA 4B3SB 4DB2A 1MC8A 3Q5DA 2AE2A 1CY2A 3FOCA 1UPUA 2VLIA 4L72A 4R31A 3DHEA 4NYMR 1D2CA 4MPJA 4RKEA 3IT2A 2M6KA 4KJZA 2TMGA 1WXGA 1ISJA 1OFVA 4ZT2A 3VPHA 2XCRB 2BSXA 3EVCA 1REQB 5D3ZA 3UAVA 1USUA 5AUNB 4TZTA 2GUWA 2O05A 3G9UA 1ZMOA 5DRYA 3QSYA 3LW8A 1OLUA 2DTDA 2FF5A 1Z2AA 2YHUA 1USWA 1QNFA 4QFBA 5IYZF 1TM2A 5JSFA 4DLLA 3SQMA 4CF3A 3UV3A 4Q37A 4CQMA 1SRRA 2RG7A 2ZPAA 4IH1A 1NVVQ 3ZLUA 3TRFA 1F0KA 5AESA 5B7NA 4JJ8A 2IW1A 3I9OA 3NM6B 5CHEA 3L7BA 2WHPB 4KRXA 1CJKC 1LH0A 3C3DA 4JENA 2ZTVA 4NENA 3U3MA 1ZS9A 5JFTA 1UP7A 7MHTA 1GPUA 5A5FA 5K5EA 2C2ZA 1TD9A 2PUJA 2W2OA 1RVDA 1SXJC 2WABA 4RANA 5AM3A 4H16A 1KJJA 3IVGA 1WHTB 1NNUA 2WAOA 4XM2A 3A1DA 3T1OA 5F64A 1V1JA 1D2AA 6LDHA 4NPHA 2GKOA 4C0KA 2GZMA 3GJ8A 4BPBA 5BWMA 4I55B 3OHPA 2XEDA 5E7MA 3V2GA 1K7XB 3ENWA 3MT0A 2CZGA 4NZYA 4MKIA 1OZGA 1EVQA 2LZ0A 4PTLA 4Y0VA 3ZS9A 5FWYA 4CZ2A 1ABFA 3E9YA 3B8EA 1K06A 1R5BA 1FYWA 2PWAA 3TW8B 2FRDC 4G23A 3GFSA 3GJ3A 2HA3A 4J94A 2NU8A 3REGA 4N49A 1VM6A 2Z6AA 2VK8A 5KUTA 2AFRA 3O95A 2BAGA 1KOFA 4QX6A 3F6CA 5HQJA 4BKMA 3JQBA 3KDSE 3G5TA 4RKQA 3QI2A 4FBLA 3QU2A 2C29D 2GBCA 2WZCA 4NZNA 1UJ6A 3ECCA 3KJXA 3EEBA 4YIHA 3I1FA 1NRXA 3ABZA 3KEOA 2C99A 1W0JD 1LPOA 2B9VA 1QH9A 1BEZA 2FUG6 1CIVA 1FJGB 2QUBA 1BU8A 4XLLA 5HK8A 2B69A 1RIIA 4L9WA 1NNI1 2E7ZA 2YBDA 1C1YA 5MDHA 2QBYB 4YMGA 1VE6A 3PP8A 3NLLA 3C3CA 3H4TA 4RWEA 1KI9A 4KIUA 4P0QB 3RANA 4HDSB 2MDTA 4IDBA 4XWAA 3V00A 4MTLA 4B0PA 2EX4A 1UANA 2Z8YM 3B60A 4ER5A 1N25A 1GWNA 4PTYA 4DJDC 4IQ0A 5ALFA 3E3NA 3GJSA 3OA0A 3V4OA 5HKLA 1NQUA 4OQYA 4NE2A 4M0UA 5GOZA 4MV3A 1EG7A 5J5VA 2W2MA 3HCDA 3BMQB 5FORA 3TLGB 3PFBA 4ME6A 2WPNA 3F5MA 2WKWA 4HFMA 4LQDA 1GPYA 5EGNA 3U17A 4JYCA 2DVMA 4F92B 5HKKD 2O2YA 3KU1A 1IZYA 2F9FA 3CT6A 3V7WA 4MRSA 4KX5A 2W11A 2Z04A 1HE8B 2IP4A 3JZIA 2EG9A 2IEZA 3EE6A 2REOA 4PQFA 5BV7A 4G1CA 1X42A 1EE9A 1XUOA 3DQZA 5T57A 1NPDA 1KQ3A 2Y77A 4AP5A 1MO4A 4DM4A 3G0GA 1DAPA 4BCDA 3HU3A 3WAJA 3OPYA 1VGVA 3FTCA 1W59A 3HVUA 4MJLA 3UJDA 4LZZA 5E6SB 3NXKA 1QGYA 3SS9X 4FOLA 4OB6A 4EELA 3SYTA 2R68A 2NO0A 3OCYA 3VKUA 3V7NA 5E38A 3DEFA 3M82A 4PG7A 3K4PA 4ER0A 3CNEA 1PWXA 1KOGA 5CCBA 5A3JA 4PZ0A 3THWB 3CJTA 3I9V6 3YASA 5J4LA 2MOKA 5CMLA 3TH5A 3WBJA 3C16C 3A4YA 4U3JB 3DDNA 3SHTA 1UPXA 4CE6A 4CM3A 5BNIA 3A4IA 3WB0A 3WIDA 3O2NA 1DXOA 1N0HA 3H18A 1PK8A 4KSCA 2ZJ7A 3DNPA 4HDKA 5K8UA 1KJIA 1USIA 3H99A 1Q1EA 1IC6A 1P1JA 1FX1A 2JEOA 3KT6A 1SBCA 4WXRA 1GITA 3WHKA 3BH6A 3UKOA 4ARAA 3DZ8A 3ZY4A 2NZJA 2W4QA 2BMFA 4KQGA 4LIPD 3GLQA 1VP9A 2P4UA 1L8LA 1Y33E 4XZ3A 3L18A 3AY7A 4S2UA 3IJEB 4P0TA 2WTAA 4KLCA 2C7OA 4C6TA 2BGIA 3TD9A 4RLFA 1ZOOA 5A6SB 5EKSA 2QD4A 2C5AA 3WK9A 4JLBA 2Q1XA 5EYPA 3H8WA 4RZSA 4BVBA 3K8QA 3FBWA 4DLSA 4L8LA 3GFQA 2I2XB 4L07A 3I9MA 3I34X 2H3HA 2CB0A 4MEBA 4B46A 3P2EA 5AW7A 4JDPA 5CW2A 3BJMA 5CAEA 4HB3A 3SHWA 3U9LA 2IITA 4N40A 1A7KA 1W29A 4XWGA 4PHFA 2RFLA 1M8JA 2FWJA 3FUVA 4W1RA 3R7AA 2F55A 3ZDBA 2EZ4A 2B4YA 4P08A 2R6R1 3NFYA 3JPWA 1QH0A 5BV0A 4F91B 2HQBA 2XA1A 4IFBA 4Q1AA 3PEEA 3I45A 1JMYA 3ZCXA 1YTUA 2NU7B 5JYBA 1EXDA 3P1JA 3QMVA 1H0RA 2GZDA 2X19A 3HJRA 1G5PA 3PL5A 3UBTA 2H1OA 4XJSA 1WUTA 3H5NA 5JCZA 2DM6A 1MDFA 2GXSA 2XUQA 3DF9A 3FZEA 1SQ0A 2IUTA 3G2OA 1I1OA 1UUFA 1NR7A 3EWAA 5ALGA 1U98A 1TECE 3K31A 4CM9A 4F56A 3NI2A 4MW5A 4UE6A 1KEPA 3QXGA 4P3OA 2Q5IA 1Y9JA 3S8EA 3SE7A 4PR0A 2FMTA 2GAJA 3ZWVA 2MR6A 3GCXA 1FU7A 1DB3A 1Y80A 4I66A 1P39A 1T2AA 5DM70 3KQPA 4FW8A 5FNVF 1GNSA 4UBKA 4QRIA 1DSSG 3GC6A 2XMPA 4YK7A 5KYNA 4FJ1A 3V7FA 1X8JA 2GB4A 2G36A 2Q4RA 4MS1A 5DCWA 1FP7A 3O9ZA 4F7WA 3HP1A 4BMOB 2V7TA 1E0SA 4LTNA 2FH5B 2UVDA 3QF7A 5KOHA 3HXQA 3ZV6A 1LF0A 2MR5A 1RMTA 1X74A 2ZTMA 3GLGA 3AJEA 3GG2A 4KQCA 1RQNA 3OUZA 1WETA 3J81k 4HRXA 4RE6A 4EGJA 3EXHA 1PR0A 1RRCA 3KQMA 1ONBA 1YJAA 4ZAFA 3OFJA 1NHGA 1J9EA 5BWNA 4PN7A 1EUDA 3GUYA 4RPGA 4IFTA 2J46A 4ZRMA 3OY2A 5EE0A 5TY0A 4D3FA 4DLNA 1JLSA 5CD9A 4YJ2F 4O3MA 1Y5NA 3WGYA 4TZ0A 3FHLA 3R1IA 3C48A 4EAQA 5HF5A 4HRAA 1QRUA 4YH1A 3WLPA 1NVFA 1V6CA 1VHJA 3IP9A 3NGMA 4NQZA 3FY4A 2OPHA 3C3EA 3SYRA 5DXJA 1VDZA 1XNHA 1YZFA 4B3RB 1E4EB 3MJRA 1X9IA 3E9NA 1X7ZB 3D59A 4JP3A 4A6XA 1OBHA 3A6HA 1IWPB 5FUVA 2KW5A 1UADA 4IHAA 1BCRA 3HY3A 2VHUA 5DWDA 1UAYA 3C85A 4ZOQI 4YHHB 2VZ8A 3VYWA 1ZVMA 2AH5A 3DQPA 3PI7A 5FOQA 4OXRA 3LE8A 1MEOA 3IAHA 4L3WA 1LK0A 2WJ3A 4HWGA 3Q8KA 1M1ZA 1NRWA 4ZRDA 5FOUA 1UJBA 4B6SA 1IN4A 2C4UA 2LBPA 1QGZA 4LX8A 3TR0A 4I3GA 2WWWA 1AT1A 1BAPA 5DGIA 3WBBA 1TJYA 2WFZA 2PS9A 1R5JA 1P62B 3DYBA 4F2HA 1V9LA 1U94A 1WY7A 3QKUA 3HZZA 4PRKA 5JAQA 4OK3A 2JJ2A 4CU2A 4KE8A 5KYYA 3OZAA 2IS6A 3ZDYB 3EXIA 2I9PA 3FPAA 3LQKA 5JECA 3WK4A 1L6RA 2P6NA 4IFIA 4H4EA 4R8LA 3OLYA 5CFQA 4A8HA 3TD6A 1MZVA 5EWLA 3WOVA 2W0SA 3CKYA 3C97A 1G59A 2PTGA 3ESRA 4YDRA 1ZK2A 1SU7A 1YE3A 4CFZA 1JDUA 3P9SA 3LCRA 2FSFA 2Q8PA 2GO7A 4ZCIA 1V11B 2ET6A 1QHNA 2ZAMA 1F4PA 4HR7A 3R9IA 2UXDB 3ZWOA 1DAKA 2Q6VA 2RH9B 3FMPB 1N78A 1J20A 1EEXB 1JQ5A 3GEGA 2BELA 3O93A 4RXMA 4G1MB 4YP1A 4A5OA 3PSHA 5EKXA 2XQFA 1ZJWA 1C1DB 3QVWA 2BJHA 4TVKA 1J2JA 4KQEA 3C70A 2I6TA 1EVJA 2GASA 3F47A 3FCYA 3PGJA 4WIAA 3X1JA 2B98A 4FJ0A 2PRKA 3I2JA 1SEPA 1VJGA 3FVWA 3K4HA 2IHVA 3O3OB 5JDCC 3ZHOA 5JCOC 1FTWA 4PC2A 1VFPA 3DLBA 2H54A 3OCCA 4NYMQ 1HK7A 1VYUA 3KVNA 3A6PC 3O91A 5EXXA 2IF0A 1S96A 3S55A 5A0TA 3EHDA 1L7NA 1UMBB 2PYDA 1S2IA 3OTHA 3QYPA 5LD2B 4CTMA 3DC7A 4MI3A 1N4DA