3R5KA

A designed redox-controlled caspase-7
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
248
structure length
234
Chain Sequence
TYQYNMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQDLLKKASEEDHTNAACFACILLSHGEENVIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKLFFIQACRGTELDDGIQCYKIPVEADFLFAYSTVPGYYSWRSPGRGSWFVQALSSILEEHGKDLEIMQILTRVNDRVARHFESQSDDPHFHEKKQIPCVVSMLTKELYFSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Caspase-7
publication title A designed redox-controlled caspase.
pubmed doi rcsb
source organism Homo sapiens
total genus 81
structure length 234
sequence length 248
chains with identical sequence B
ec nomenclature ec 3.4.22.60: Caspase-7.
pdb deposition date 2011-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00656 Peptidase_C14 Caspase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3r5kA00
2C2ZA 2QLFA 2XYHA 1I51A 3IBFA 2FP3A 1IBCA 1RWWA 4JR0A 3SIRA 5IASA 4NOMA 4QTXA 4QUDA 1RHKA 2QL5A 4PRYA 2FUNB 1RE1A 1RHRA 2CJXA 2HBZA 4D3ZA 1QTNA 1RHMA 4D3YA 2NN3C 3UOAB 3D6MA 1RWVA 3D6HA 1CP3A 3P4UA 3R5JA 4LSZA 3H13A 3H11B 2QL9A 1GQFA 1RHUA 3R5KA 1NMQA 1RWXA 4DCJA 3EDRA 1K86A 4NOJA 3P45A 1SC4A 4N6OA 4IEFB 4AWBA 3NR2A 2CDRA 3V6MA 5IBRA 5LUAA 2XYGA 2H4YA 3EDQA 2DKOA 4PRZA 4QU8A 4HQ0A 2QLBA 3V3KA 4ZVUA 1PYOA 3DEJA 1RWPA 4IYRA 1GFWA 4I1PA 3IBCA 5JFTA 2P2CA 1K88A 1SC3A 1QDUA 1PAUA 3KJNA 5IAKA 3R7SA 3H0EA 4ZVTA 1I4EB 3DEKA 4EHAA 1I4OA 2H51A 2H48A 4FXOA 4D3XA 4N6NA 2J33A 4N7JA 2CJYA 3PD1A 1RWKA 4N5DA 3GJSA 4JR2A 1RWNA 4QUHA 4AWAA 5IC4A 5IBCA 2WDPA 3DEHA 3V6LA 4JR1A 4QULA 4EJFA 1RHQA 3R6LA 3SIPA 5LUBA 4EHKA 4QUEA 2CNLA 2H5IA 4QU0A 2FQQA 4HQRA 5IARA 4DCPA 3E4CA 2XZTA 2Y0BA 3KJFA 3H1PA 4NBKA 4QUAA 4EHDA 5LU8A 2XZDA 5IABA 1RWOA 2C2KA 4M9RA 1SC1A 4AW9A 3R7BA 5LU9A 2AR9A 4JJ8A 1NMSA 2CNOA 5IC6A 1QX3A 2QL7A 5IAEA 3UO8B 4ZVQA 1KMCA 1CVRA 1F9EA 2C2MA 2HBRA 4NOLA 5IANA 1RWMA 4QU9A 4PS0A 2H4WA 1I3OA 4QUJA 1RHJA 1SHJA 3NKFA 3PCXA 4EHFA 3GJRA 2J32A 4ZVRA 1NW9B 5IBPA 3S70A 3D6FA 5IAGA 2HBQA 3V4OA 4JQYA 3OD5A 4FGUA 3ITNA 3K7EA 4NOKA 4QUGA 3R7NA 3S8EA 4JJ7A 4EHLA 4N6GA 4NBNA 1M72A 4HVAA 4JQZA 3NS7A 2HBYA 5K20A 4EHNA 3BIJA 4FDLA 4QTYA 2C2OA 2K7ZA 3PD0A 4I1RA 4JB8A 2H65A 4ZVSA 4ZVPA 4ZVOA 5IAJA 4FEAA 3GJQA 3R6GA 4QUIA 3V4LA 1NMEA 2H54A 4QU5A 3QNWA 4NBLA 1SHLA 2H5JA 4JJEA 2CNKA 3DEIA 4QUBA 5I9BA 2CNNA 2J30A 3KJQA 4PS1A 5I9TA 3GJTA 1BMQA 2QLJA 3V55A 1JXQA 3RJMA 2J31A 2C1EA 2Y1LA 3H11A 5H0IA 4DCOA 4EHHA 2XYPA 1ICEA 4N7MA 1F1JA
chains in the Genus database with same CATH superfamily
1U7WA 2ZJ3A 2OFWA 3PUJA 5AJYA 4AY6A 4C0QC 4R2MA 1IZ9A 3LHKA 4N3NA 5LZ8A 1OH5A 4ESHA 1KO4A 2VC2B 2XUOA 4YRMA 3PXBA 3SKVA 1PDOA 3ZK7A 2QL5A 2YCLA 2Z6AA 1QYXA 3K9QO 3QYFA 3EC7A 1N9GB 1N5RA 3ESDA 1KYQA 3AUKA 3QU5A 3DYBA 4YCDA 3UBTA 2QQGA 2XMGA 1J5EB 5CT6A 1WMAA 4AZ0B 3L7BA 1ZEMA 3O8NA 4KKVA 1ZRSA 1WHTB 2QUJA 2GX6A 2R5FA 2BGTA 4CMIB 1QRTA 2ZCUA 3CR8A 3S5UA 3ET5A 2AK2A 3C8DA 1SU7A 1PEKE 3G5AA 4MUYA 1F8YA 5H3LA 3E3AA 1N6HA 3QH4A 4QBGB 1TI7A 4WDRA 5KJEA 1VPVA 5JNWA 2H7YA 1XMVA 3PRYA 1UBSB 4OQPA 4AUMA 2Q5LA 2I67A 1NXPA 1QVVA 2RH9B 3NOQA 4HMOA 1YZTA 2PR2A 5KUTA 3PT9A 4PLHA 4JJ6A 1FS4A 3QHQA 4M7PA 4ALJA 1NLUA 3M1AA 4EBFA 3NBYC 5HS4A 3S6JA 4YT2A 2QN3A 1H4QA 2I4NA 3N3BC 5CLQA 4JYAB 3WJAA 5B53A 5JTTA 3AQIA 1MORA 3EDYA 3MJHA 1GA1A 2IUSA 2XAAA 3GLKA 4IFIA 4R4JA 4TM7A 5JAQA 2ZUTA 2P6MA 3IA7A 2W8BA 4XGQA 2X42A 3DE3X 3Q5DA 4HDAA 3R4VA 4L08A 4G1MB 1U8EA 3G0BA 3C5EA 4H3VA 5G53C 3WHKA 2GN2A 4V1CI 1FDVA 2LE0A 3J7AC 1E0DA 4OX9B 3H1TA 1D1QA 2IYOA 3V00A 1HZZA 2EBWA 1N2SA 1FC0A 1TO1E 1U98A 2XUKA 3P9SA 2Y0EA 1V8OA 3EXHC 5AKKA 3WLAA 2PZJA 2IZ0A 3IR7A 3X2EA 3OEED 1RPAA 3OKAA 1SKMA 5ICFA 3UPUA 3FETA 3QF4A 1DHRA 2Y1KA 3CVVA 1C29B 4QQNA 2FSGA 4C06A 1P17A 2VKQA 1ZJ5A 2XTMA 2AN5A 4MP8A 2OGZA 4LRXA 2QEQA 1QIHA 3QF7A 4D9KA 1U0EA 5FOWA 4MQ4A 1L3CA 4P2GA 2AG8A 3FRIA 2GFQA 1FL9A 3W9UA 3CB4A 1K97A 4EHBA 1FBNA 3TRHA 3M6FA 5L3SA 4WT7A 2Q3CA 4I8DA 4EJ0A 1MA3A 1NLZA 1Q7BA 2C96A 2G07A 4MUGA 5ALVA 5C18A 4N47A 1RYBA 1Z8DA 2P65A 4JUIA 4BNUA 2JLYA 1BE6A 2J59A 1OXKB 1T35A 2AUTA 3MYYA 4FOOA 4I9HA 1ONSA 4KYUA 3DF7A 4TQ9A 4B47A 2NNWB 4XPIB 3T35A 4BV8A 3VAAA 5ITVA 1QTRA 2AS0A 3FUCA 1EVQA 2WJJA 1EM6A 1NBAA 5KC8A 1NXWA 2LW7A 3M5CA 2RFLA 5D3KA 3SM9A 2RAPA 3M6LA 4EMSA 3BWYA 2B3DA 2WR8A 1V16A 1E2JA 5KDDA 2FNAA 4BEJA 2XVMA 4I36A 2X41A 2J3QA 4R81A 5ECYA 2XSZA 3PNVA 1JFSA 1PL6A 1QKJA 3C3EA 1L8QA 1X0XA 3AESA 4Y2JA 1NXTA 2QJOA 4UJ5A 2JHGA 1KY2A 1NVAA 2X8JA 3HCEA 4Q9HA 2RDMA 1XTVA 2UVPA 4F93B 3HXOA 3VJRA 1EFVB 4LZJA 5L6LB 4OVKA 1G41A 4FWIB 4HXYA 3DMRA 3HYRA 3QVVA 4CCYA 3VNUA 1CUWA 3IP9A 1AT1A 4MYCA 1JLMA 4TUYA 2OT3B 1SKUA 2WU4A 2DBVO 4B6FA 1I6WA 1Q1GA 2C83A 2V6JA 2VWGA 2N1MA 1ILWA 1YAHA 3F47A 4I8XA 2AXQA 2NWQA 4M1ZA 2CWDA 1ZOOA 2HGSA 2HD4A 4I50F 5A6SB 1BQEA 3WGOA 3SC4A 5CFMA 3FXAA 3H4TA 3DC2A 4XH9B 1O77A 4WXPA 2WK1A 3GA5A 4ZGBA 1JPVA 1P7WA 1FFSA 5TQ2A 4ZK2A 3WXBA 3RYCB 1IWOA 4CE6A 3N8HA 1CZLA 1BKDR 1NZFA 3PI6A 3PR1A 3PHLA 3KPVA 2BT4A 3K0HA 5FV7A 5HIIA 5BV1A 4MW6A 4EF5A 3SJUA 7YASA 4C4RA 3FD8A 5TIIA 3VPSA 3VHLB 2Q5OA 3QGMA 4X1IB 1M66A 4NNOA 6YASA 1ADJA 3PNMA 4HWKA 1AGNA 2JANA 3FLEA 1E2MA 2ZT8A 3OX1A 4BQPA 4RVDA 2D1QA 4Z6KA 1QXSA 2ZYUX 3MFYA 3QWBA 2OCDA 4Z4HA 3DMHA 1P4HA 5H4GA 3EJ6A 1JEQB 2R6CA 3F9CA 2JFVA 3G82C 3GJ3A 4CM3A 4FSDA 2WZQA 4NH4A 2VBFA 5CK5A 1GCOA 3C41J 4FC7A 4DA8A 2CLKB 1LSOA 3RJ5A 1BMTA 2NO4A 1VJCA 2V4ZA 3TQOA 5JZOA 1ZNXA 4J2TA 3OICA 3UT0A 4CIAA 3ONDA 1P4RA 5DTEA 3I5XA 4QICA 4JIGA 4X7RA 2JD1A 1H1LB 2DBQA 3L9WA 3TMAA 2GCIA 3EAGA 3ZWVA 4BO4A 3COVA 1FFWA 4P53A 2P0AA 4UDYX 3RUIA 4U2EA 3LUDA 3U4QA 4BJHB 3HLTA 3VKWA 5KKAA 1YMVA 3AZQA 4I9UA 3R3ZA 4G26A 4JB2A 4MQEB 5C5CA 4QUJA 1CF4A 2WNIA 4UOZA 1JFFB 1C3OB 1OXBB 1NMXA 4TN5A 2VWHA 3CRQA 2YFHA 1G7SA 2A67A 2BUBA 2WNHA 4MR7A 4A5SA 1FRFS 4C4TA 2I87A 3U6BA 1E63A 3LLVA 1SCAA 3TIIA 1WZIA 1TT7A 3OFVA 5COQA 1RAHA 3D0KA 4MLZA 4ZOLB 4AG5A 3AW8A 5KX5F 2VJOA 4WN3A 4IO1A 1QAOA 1EKXA 3D8RA 3COJA 1J9GA 4LRUA 1H22A 3P2IA 2Q7XA 2AJLI 2VDUE 2J0VA 1MN6A 4RFLA 1QCZA 1KDYA 3N1UA 4KGVA 3MWEB 3WLQA 2VP9A 4O1MA 1EFTA 2LV8A 2H65A 2ZTLA 1IYZA 3DMNA 4OQ4A 3WDLA 3K5WA 4BWFB 5LZ5A 2ZJ6A 3EGEA 4GECA 5BWOA 3UJBA 4HLUC 4NENA 2PKXA 1M76A 3A6FA 4NFSA 3VHRA 3LBNA 3SK0A 3PQ5A 5FTLA 2HSWA 2POQX 3L0IB 2W6JD 2HSZA 3ZVMA 3THXB 1KNQA 4LYYA 3N0XA 3ADCA 2ETVA 1E2NA 4RJ2A 2YYZA 3QFSA 1IJFA 1UDRA 3FTNA 3G8CA 3HYLA 4RZSA 2M32A 3UC9A 1C4KA 4M87A 1OFIA 3BGDA 2C20A 1HE8B 2C1EA 4I1SA 4WA8A 1CY6A 2D1RA 4KTVE 2RHLA 3IB3A 3KIPA 4NFYA 3TNJA 2Z8YA 3BGOS 2BSXA 4IGAA 1Y3HA 4PNHA 5BNIA 2HCTA 1NN0A 1JSLA 3BXOA 5AOVA 4MKHA 4EFMA 1L5LA 3GI1A 2IDZA 4Q4AB 4D8UA 3RSHA 1V5EA 4RHEA 5AKHA 1LC0A 2ZRFA 1NT4A 3OX3A 3PKIA 3SBEA 4EG3A 4KR2A 4I3GA 2ZJ5A 3HLYA 1VJ1A 1OVMA 4JNCA 4DV4B 1J8MF 1KORA 4MS4B 5I9MA 2GEBA 4TQUS 3O1HB 4WXRA 4DPKA 1PT5A 1IJKA 3LGAA 3LVQE 4BMNA 4ZN6A 4CQNA 1SJ9A 3ISVA 1QH8B 4ML3A 3SHTA 2CYBA 2E4VA 3IHWA 3KNZA 4O08A 4HQ0A 1Q7RA 1NXXA 1YIDA 1XK6A 3IKJA 3F3MA 2XXJA 3W6NA 1JTEA 2CLDX 2M2IA 4GX1A 2YVKA 1KA9H 2BGJA 3VUFA 1E9AA 1JHZA 1K88A 3AF2A 3KJNA 5JDIA 3FLMA 3AGPA 4EG6A 3RODA 5FJIA 1KIMA 1V3QE 1RWBA 4EYKA 1VP3A 4JR2A 2AZXA 3ZR4B 3TD6A 4GICA 2FUCA 3PF8A 1U2DA 4NG4A 1XRMA 1YZQA 3F4LA 4RTSA 4IJVA 4L4RA 4R1MA 5AO9A 4QRHA 3O84A 1T1SA 5ENVA 3VMFA 4GH5A 2IA5A 1QRUA 1DKPA 2QTMA 2H7VA 4YXWD 4HXEB 5EWLB 2W6OA 5GZ3A 2C59A 2PGOA 3E6AA 2AZMA 5MFPA 2WILA 3B78A 2ZLBA 4K7JA 5EJ5A 3C3PA 2QBYB 2QSUA 1DAOA 1G9SA 3D3JA 3AUUA 2O8FB 1UZLA 5HXAA 4KZPA 3C1OA 1R15A 2C5HA 4ONEA 4DYVA 4H1VA 3MJRA 2I33A 2WJZB 1UZNA 1PK9A 3OESA 2ZXFA 1GNQA 5L3QA 1RLMA 3T99A 2UU9B 1P9RA 2D00A 1ID8A 4X45A 2V0GA 3A9RA 3NHPA 3OM9A 4IOLA 1RVDA 4CDNA 5FWXB 2HFKA 2OV6A 1UFKA 3Q3JB 3A2NA 3BE4A 1QPBA 2Y1EA 1XZJA 4PZCA 4Q37A 3SDZA 2H92A 1AQ6A 1XQ9A 2C31A 2CCGA 3BTSA 5T6BA 4ZYYA 1KAQA 3FNGA 5JZ9A 4DSTA 1C7RA 3AR7A 3PNQA 2G1JA 2JI7A 4OBEA 2W48A 1ZL2A 3OCUA 3ZTYA 5HR5A 4M6WA 2BGMA 3CT6A 1DQRA 3AP3A 1SBTA 2W0MA 3BZWA 4Q9AA 5BSKA 2FEPA 1QYWA 1UT5A 3QUQA 4ALNA 4UASA 3IT2A 4HQLA 1QGOA 2AMFA 3QWIA 1KJWA 5BUCA 5C8ZA 3GJ0A 2IYSA 5EVCA 1TPYA 3QRWA 1MRNA 2JAWA 2PLAA 3A1DA 1ST2A 4PYKA 3IOCA 4XWTA 3Q7SA 2I55A 3A31A 2WJ3A 3M5PA 1FZQA 4AF6A 3BMNB 2C4WA 3CWZA 5C35A 5IJWA 2HMWA 1XCBA 3L7KA 1R88A 4LRYA 1O9GA 2P2SA 2WNSA 1UBCA 2W6ZA 2ZSKA 1OZHA 1XA4A 3LO8A 3FPAA 1OJLA 4I9NA 4RIFA 2MR6A 2ZSEA 3N8KA 4TV8A 1MB0A 3KG2A 5EC8A 1JVNA 1FNCA 4JR0A 1XRSB 3I64A 5A3RA 1KMHA 3J7TA 3IT1A 3I58A 2H2WA 2BF7A 5DLDA 5ADUS 1DKQA 1SQGA 3SMVA 3LDUA 3OZFA 4QXPA 1K2VN 1J00A 1C0PA 5TARA 1IBLB 2HJHA 1BE0A 1XCJA 1O0CA 2W6PA 1ZICA 4DRXA 3PEUA 1CY1A 3CF4A 3KVYA 3W90A 2CBXA 3ER6A 3QG1A 3R5JA 5DW3A 3C14C 1MENA 1YC2A 3ZS8A 4FYJA 3KETA 3KHTA 4UAUA 3OOWA 5BMOA 1P19A 2EW2A 4MTCA 3MTBA 1N8KA 5A3JA 4GWGA 2PBLA 1MAHA 4KR7A 1UZUA 3A7DA 3OA0A 4GEGA 5EUBA 1O87A 2PA0A 2J9YB 3N8DA 4LV6A 4AUEA 3UAVA 1DTEA 3AR8A 3AH8A 2BCEA 3W77A 2G82A 2HUPA 4ZO9A 3QLJA 4OQQA 4CM4A 3QPCA 1J4AA 5DBEX 5HG0A 1EXWA 3R7SA 4RZIA 4LVUA 3VNVA 1ZVVA 1FFXA 4ND3A 1H9BA 1WP9A 1VYTA 2OCXA 5JSYA 4CTJA 2J33A 1OLSB 4HWGA 1LSJA 1SOUA 4LVCA 1QIGA 4WOKA 5GY7A 3QY0A 3UXMA 4B43A 4KXVA 4FNOA 1N3LA 3H5NA 3KQTA 3MHPA 4PYMA 3WK7A 3LHIA 3C3MA 4BECA 2WDPA 1AIPA 2HJVA 3WRYA 2BY4A 2ZBFA 2QDKA 2AT1A 1IEQA 2WIJA 5SY9A 2HWKA 2WB4A 2Z08A 2H5IA 2YQ5A 3QJGA 3UANA 1EWKA 5LB2A 4X71A 2QGFA 5K2MA 2RHHA 3NUZA 1NN1A 1E3QA 3H3XA 5BOSA 3CG4A 3GH3A 3F2VA 3ISTA 3P0FA 5SY4A 5LQNA 1TD9A 1IULA 4TS4A 2ABWA 1W5TA 2G83A 2PKYX 3GNTA 3QOWA 1O0SA 1U3GA 2HU7A 2DFLA 4PR3A 3QEBZ 3PQCA 1OFUX 3PFBA 3U81A 3KQSA 4WSOA 1XPOA 2QMYA 4LCEA 4M54A 5JCJA 2LXNA 4H4EA 3PE6A 4S0XA 3VNSA 5CXXA 3TL3A 3WWOA 1D04A 2CDAA 1DUVG 1FUYB 3EDMA 3OCCA 3VSCA 3W9BA 1DTWA 2JIZD 4MVJI 1ULSA 3U39A 3PCXA 4REMA 1Z16A 3NGLA 3LT4A 3QK7A 2XH8A 1ZITA 4R9NA 3AI1A 3VPHA 5LLTA 1Z17A 1FSPA 2VAPA 5ILOA 3B13B 4ESVA 2VJDA 1RP7A 1R9GA 4K2AA 2FZ4A 4XQ0A 2VO1A 2EKBA 3GRYA 3OEWA 4H6XA 2M6LA 3R7NA 3CXUA 4L75A 4D25A 1JU3A 1QP4A 1W5EA 4JH0A 3VYUB 4AMVA 2R751 2VRWA 4D9BA 3CQ9A 4D4JA 3JWJA 3PD0A 2IU4A 4RXTA 2GS9A 5F7ZA 1JU4A 1MAAA 4DA0A 3FZQA 1ZK4A 5KX5A 3PEYA 1N7IA 2O6LA 5J2UA 2Z98A 2V5AA 5ERXA 5C1DA 4RHFA 4K9PA 3LUFA 4IOKA 2RCYA 2PEYA 1KHHA 4LV8B 3EA0A 2ZJ7A 4YI3A 4Q1VA 5IXJA 3RJ9A 3NJ4A 1HZJA 3GUHA 3MCUA 1TC2A 5B1DA 1F2UB 3SS8A 3I9V1 3OZDA 4G8BA 4NMHA 3FJOA 4EJ6A 2JHPA 3DLHA 2HRBA 2OBLA 3ZY3A 2XLBA 2YVUA 1W5FA 5H5JA 2PZEA 3AIIA 1CRWG 3OCZA 1H4SA 2CVQA 3PHJA 1QIFA 4L72A 3UHAA 2O9JA 2QG6A 4NOMA 4URYR 4UU1A 3RK4A 5EZYF 1GN9A 2MSCB 1G5HA 5AI4A 2J3KA 2AKAB 2O1EA 5F52A 3UB4A 3GGSA 2PL5A 5HGJA 3WDMA 4XD7D 4EUEA 5IH7A 1LLFA 1UXOA 3LY5A 1E4OA 4MGKR 1STOA 1BE8A 3LTEA 4YREA 4CLDA 2P40A 3SY8A 1I5OA 2FPWA 1QGAA 2LNDA 2Z56A 3K0FB 4V0ME 5K3FA 2GCOB 1BMFD 2HNKA 5CDUA 3L79A 2ZZNA 2Y92A 3R3UA 1ZP6A 2XB9A 4G0ZA 3VQTA 3H3JA 1NZJA 1ELOA 4RTQA 5JRJA 3HVUA 3STUA 1YIOA 3BBLA 3G6WA 4RSHA 5JPIA 4BN0A 4M76B 5CH3A 4NAVA 1GGFA 2PMKA 4RF2A 5UKDA 3VSBA 4RK7A 3F5MA 4F2WA 2FE4A 1UDAA 1QDEA 2FW6A 1G3UA 2HDWA 1QGZA 2HO4A 2PH7A 3F49S 1ZY2A 3EYAA 4XPZA 1MC1A 1QZ3A 3EDCA 3OFSA 1L5KA 1W2GA 5DHQA 1EMDA 1H3NA 5KJFA 3QKTA 4FFOA 1T5IA 3HQ4O 2VDWB 2VJYA 1V9CA 3Q3IA 4Y2UA 5EWJA 2O2IA 3GHYA 4PZAA 2F3PA 2UUPA 5FHQA 1Z74A 1LY1A 2KE5A 3DOFA 4Y7DA 1B42A 3HJUA 2G40A 3G7UA 4A8JB 2IOFA 4DLRA 2IGTA 1GEEA 4C7JA 4K1XA 5L4NA 4YAIA 4D8WA 2F8SA 3LDGA 1NTOA 4N7RA 3W5JA 6LDHA 2GPSA 3D7RA 4LYJA 3E0QA 4FS8A 3KD3A 2LRHA 4MR8A 5ALSA 5GGXA 3P26A 1GGNA 1OROA 3QX9A 3TB6A 2Q0HA 5E4FA 5KHAA 4M88A 2H1RA 3IXLA 2Q0XA 2W2LD 1G98A 2P2YA 4DT1A 5A1JA 4YRSA 3DV9A 4KO8A 2H4WA 4NYJQ 1I1OA 1C9MA 1JHYA 1ZSVA 1R6BX 2DRIA 2NSDA 1NNUA 1X38A 3GJRA 3HS3A 4IHAA 2VHCA 2B7CA 2HMAA 2NU9B 5B36A 4CT4B 3IRUA 1TQ8A 5JIBA 3DO5A 4PWZA 4JLSA 3AI7A 4K9MA 4DPLA 3IO5A 1R8QA 4HWOA 4C0LA 1H8ED 3IJEB 2GLUA 1DUIA 2FGJA 3VZPA 5K6TA 1U2ZA 5EVJA 1D6MA 2J3HA 3L8GA 1KYWA 3NHYA 4KRXA 2A5GA 3RS4A 4HV4A 3WLJA 4JKYA 4C20A 4F06A 2V96A 1Z0FA 3EZ7A 2Q46A 1GL9B 3BMQA 3DVAB 3Q3CA 3L7DA 2ZWPA 3QMMA 5BV8A 1K6JA 4JSYA 1W44A 2W2MA 4R40A 1YBHA 3HB4X 1JDNA 2IYYA 3NNDA 3PQ4A 2XEDA 4RD4A 3HV2A 3L1UA 4IY1A 4Q0MA 4JGIA 4WV3A 5KSPA 2CKDA 1JKJB 2J09A 4HDOB 1ZBQA 3I83A 3IRVA 4D26A 2WJPA 3CF2A 1XXHE 3KFVA 3TCXB 5C8YA 4B3CA 3DBIA 3NBKA 4WNYA 3T1TA 3DE5X 2EEPA 4RACA 3VO8A 4E1BA 2FG7C 2QAGB 1J70A 2XGJA 2ECFA 3WKBA 4AIIA 3MD9A 1JZQA 3PYXA 2ZUUA 2B9VA 3ROTA 4LA4A 2F43A 4X6LA 5K8IA 4P7BA 4LDAA 1Q77A 1SKYE 1ULBA 2QW0X 2BV3A 3FRJA 1GZ5A 1C3LA 4FWTA 1FS6A 5JI3E 1XELA 2I3BA 2WD9A 1XKTA 2UDPA 3P4UA 4GMHA 4JOCA 5PNTA 3FDJA 1VE6A 5BVGA 1ODLA 2LDBA 4WNAA 4IHJF 5P21A 3OJEA 4BV2A 1TGYA 2EBFX 4I4NA 1XQVA 4HGRA 4XRGA 3BTVA 2DQKA 3W2EA 4M36A 1KYZA 3GOHA 1FTGA 5D5PA 1EUDB 2I3ZA 5CCXA 1QGED 3IALA 3I6IA 2B3TA 4LGYA 2ZU6A 4XJSA 4CUZA 4Q3OA 3SHQA 1WEHA 4DMCA 1RT9A 2A9JA 2F1OA 4LISA 1IY2A 4F46A 4ODIA 5A9TA 4EB8A 3HA3A 2LCFA 2ZYIA 3S1SA 1CE8B 2XRMA 5AW1A 4KB5A 3HJCA 5GMOA 2XUQA 2C4HA 4CV2A 4ER3A 3EIWA 1CG6A 4ENSA 1UPCA 2B36A 1MF7A 3EVBA 3ICWA 2D0IA 4G5QA 4PO3X 1O5TA 2ZB4A 3GOQA 5ELLA 2NPIA 4C2BA 4DABA 4EGJA 5A4KA 5HZGA 1YB5A 4XRRA 3U9TA 1E9EA 1P9OA 3L0ZA 2OQRA 5A5GA 3DZCA 3P9CA 4WKCA 2WIFA 3OM1A 4BNMA 4QHSA 5IX8A 4D6PA 1WKCA 4UMEA 3O92A 1YKGA 2X1HA 2DU8A 2W93A 5FBQB 5DLQC 4RK4A 1HOTA 5SYMA 3W4KA 4O2BA 4NULA 3DKVA 3C3DA 2CCJA 5ADVA 3D1LA 3P9NA 5BUQA 4C89A 2LZ0A 3NFYA 1HC7A 2IEYA 4UE6A 3TN7A 3P19A 2R11A 2VDKB 5K8VA 1L6RA 1KKLA 3LUAA 2P67A 5U9CA 2EL9A 4Z9AA 3VKVA 2ZE7A 1I2DA 3WFIA 1V39A 4LF7B 2HBQA 1ISJA 1IQPA 1P1IA 4KQ9A 3V4SA 2BI8A 4JVMA 1WBDA 3AM3A 5BYKA 2OFPA 4IDQA 2X0JA 4N6GA 1NXOA 1CHNA 5CVEA 3HDGA 3UHFA 2XOKD 3FUUA 1S96A 2FEWB 3LX6A 4V39A 2DLCX 3AR2A 2NZ2A 4MUXA 2M6KA 3FI0A 3K0SA 4TZ6A 4RADA 3NEPX 4TMWA 3TTWA 3ZCQA 3THWA 3U9LA 2IU3A 3IUMA 2FH5B 2DR0A 3X2FA 1OBHA 4CIVA 2QLLA 2BH2A 4G81A 4DOMA 1SCNE 1W0CA 4IVQA 1T3HA 2ADOA 2WKQA 3FOAA 2ZGVA 2HY7A 2J0UA 1SIUA 2GUGA 3F4BA 2VDVE 4G5HA 3P27A 4NJMA 1FQOA 3FAZA 3VC7A 3J81A 1ORVA 1HYHA 4KIJA 5U1PA 2BTOA 1RQNA 3IEUA 1CTQA 1J24A 3RKUA 1KMIY 4PSVA 5KNCA 4RZQA 1YOVA 2CW5A 1PR6A 1RQRA 4XM0A 1J39A 3TI7A 1F7VA 5AJZA 1Z5VA 1GPDG 2P9EA 3ZHUA 3JZMA 1R2QA 3QFFA 1QAMA 1V2HE 1UPAA 4C6HA 4HEA6 4A6EA 1Z5PA 2EF1A 4YR9A 4K87A 5G0SA 3CW9A 4BNFA 2Q5JA 2VFAA 1N7HA 5G1PA 1AHIA 3E15A 3VR1A 1I2CA 5TY0A 2R8PA 1NUQA 2GEKA 3W8DA 1CZNA 3I9OA 2V3WA 3PC4A 4L73A 1GN8A 1IM5A 3ZQUA 4IV5A 4P3XA 1X39A 5JSQA 1MX1A 3ZD6A 3NUQA 3R0QA 4MS1B 3ANXA 4LY0A 4DLAA 5AVQA 1HX7A 2DETA 1QR6A 2A3RA 4M0FA 4FB5A 3V8BA 1PV4A 3DKKA 3AF6A 4XLZA 3VU9A 1C3VA 1G3MA 1JDJA 1T4CA 3ETHA 1COWD 4FZ3A 2KI5A 3FMVA 1AA9A 1G55A 4B6EA 3VTZA 2GVNA 4C04A 1W30A 3H99A 5ICMA 1IZ7A 2ZROA 3IDZA 5ETJA 5B4UA 1U2DC 4PGGA 2FMUA 1J49A 1O2DA 1ZD8A 4GZLA 2OKCA 3DZBA 3CLVA 2F90A 3CLUD 3SNKA 5C7IO 2A5DA 2QVLA 2ZBGA 1X7YB 2QTBA 3HKDA 2FN3A 1TMOA 1L7RA 1QE0A 4IAOA 3H0EA 3LUBA 5K1ZA 3FSJX 5F5NA 1K75A 2FPRA 2HIGA 4Q24A 1QYRA 1NU6A 4R7GA 5EQTA 3I2IA 1MZVA 2XPCA 3CR7A 3LIIA 1U2SA 1O03A 4WCFA 5CYOA 3P9KA 3WSTA 1YULA 3ZJ5A 1CF2O 1LA2A 2BP7A 2VUIB 3VYTB 1PLKA 4BJ6A 3FVVA 3IHKA 4HQRA 4ARZA 4ARIA 4LFAB 3IV6A 1LQ2A 4DV7B 4IIEA 3IP6A 2C54A 2QMZA 4JJ8A 4D8YA 1OXVA 4HH4A 4OFZA 1PCXA 1TEHA 4ROSA 2IJGX 1W0JD 3JCZA 521PA 4A8TA 2C8LA 4QVKA 5H80A 2VJPA 3VC2A 5FKJA 1VYHA 4RKEA 1MCZA 2QTVB 2VH2A 5BOVA 1PR5A 4F3TA 2DTEA 4Z53A 2LD4A 3DOEA 1UMDB 3FKSA 3H9QA 4H7FA 5BXQC 1X2EA 4YIKA 5EMMA 2GWRA 2X1LA 3VR5A 2WD8A 1XP8A 5E1OA 1M8FA 1UBMS 2XA2A 2NUPA 3WGLA 2WE8A 4MZDA 3M6MD 1GZDA 4X8MA 3H2KA 1FSZA 3LC1O 4ENRA 4L4XA 4Q02A 4D56A 4CCSA 1N3IA 4H3HB 4QFBA 3U0BA 4AC9A 2L42A 2R4TA 4MX8A 4NFLA 3SZOA 3R8CA 3GZNB 4JB8A 3WRXC 1E64A 3HJHA 4ZRDA 2WD7B 4DLNA 1BWRA 1J0DA 4QTZA 4M8LA 5A7GA 3SZ3A 4J0KA 4URHA 3CINA 3PUZA 1E79A 3I2FA 1E6LA 1YCDA 4OMCA 4TTTS 5BN3A 4EATA 1PQ4A 2XBLA 3CX6A 4TZKA 1U9JA 3OBBA 1ZN8A 4W1RA 3ZU4A 5ABPA 4FTWA 3R77A 4L6IA 3LBAA 3QELB 5DBHX 1D07A 4CCWA 3U2QA 5DTRA 3KS9A 1XQ1A 4AJ1A 1NUTA 4RVNA 2A7XA 1XXHB 1TEZA 2Y8EA 1PDVA 1PR0A 2P79A 1K0FA 3RFXA 4BQQA 3A9VA 1HFJA 1M73E 4OGFA 2WSSA 3VYRB 1AKVA 2HGZA 3HADA 3D1VA 3M6IA 1IB6A 2CVHA 2XGOA 2NYRA 1VE3A 2HZ7A 1HNXB 2QK4A 3OIYA 2GSWA 5AJUA 5ICCA 3AHGA 4QLAA 1SKYB 2NVUA 3CZPA 3VDMA 4EA6A 3JALA 1S2LA 3I92A 1AZLA 1CJTC 1R6AA 4FMDF 4DCGA 1U94A 4J3JA 1E1CA 2IYNA 2MINA 2Q3HA 3UK2A 3WZLA 2Q3MA 4D0GA 3ZZTA 3UUEA 3K73O 3OP4A 1MQSA 3P9RA 2AX3A 3FIUA 3FF1A 5CCEA 3HP4A 2B69A 2WWFA 3RHFA 4EZEA 2KB0A 2G72A 1E60A 3FPGA 4G0WA 3O3CA 1FLNA 3RVPA 4MAMA 4UPDA 4TKVA 2A9KA 3OCYA 3QP9A 4PHHA 5AM2A 4CTOA 3WRYC 1Z6QA 2J8ZA 1GTJ1 1I4WA 2DSNA 3OUUA 4MRMA 4B9EA 3OQMA 5TF0A 1NVVQ 1QWSA 2P9HA 3KQQA 4HL6A 4RVUA 3U1TA 3WSWA 2OLKA 5KSWB 4AQ7A 3IERA 3NVKI 4PNPA 5B5SA 2CNBA 4M1WA 1IY0A 1ZK0A 3KU4A 1S8OA 4GNKA 4M1YA 5KNBD 2Y27A 3C6MA 3A4YA 3ZQJA 4R01A 1GARA 4PX9A 1EGMB 3ZW9A 4FW8A 4GM0A 5ES4B 3DB2A 1TW3A 2YZGA 1EE2A 2OCKA 3IT0A 2AEMA 4LJ8A 3AOGA 3BCRA 3KQOA 5THXA 4XVRA 2WTNA 3MT7A 3OLCX 1GT91 4QXMA 4YRLA 4EHDA 1LSSA 1NUUA 3SF0A 3C74A 1VHQA 3C3WA 5D86A 3WQQA 3U7RA 3OIWA 4W9NA 4GPBA 3W1EA 1M10A 1SHKA 1YL6A 4CG1A 4ZEWA 2RMKA 1V7CA 5BQ5A 4OK5A 4XSHA 1JN0A 2FF5A 2JAQA 2JFQA 3F5FA 2BC9A 3B20A 2Q5QA 4M86A 3VHXB 3WRVA 5I9LA 2XW6A 3GL9A 3OQHA 1T4DA 2WLSA 4CEHA 5FOQA 4M46A 4BVGA 3R23A 3SXPA 4M7OA 3AM1A 2UVQA 4NCKA 5FH9A 1E89A 3IHLA 3R76A 1NP3A 2EQ5A 3RPEA 1FYXA 4N3BA 2Z6QA 4Z8YA 5DE3A 4BVHA 2WIAA 1W36B 1CP2A 5KYWB 1GTZA 2H1LA 5FQNA 2OA0A 1Z8FA 4BU0A 1VE7A 3ITNA 2YVQA 4MJXA 2H57A 5DYWA 3TZ6A 1A96A 3QEAZ 2AZTA 4H4DA 2YMMA 3JQ8A 1F6BA 4UBLA 5H4HA 1FCJA 3B70A 2P2NA 2RKBA 2EHJA 4WOCA 2DWOA 2I0FA 4AG6A 4CTKA 1OZFA 1XZ8A 3QKSA 4HMQA 3OWXA 2XX3A 3AUXA 1TADA 1FFHA 3GU3A 1NJGA 1JG4A 4E51A 1HM5A 5BR1A 2QP9X 1A7UA 3EEFA 4QUIA 4UEKA 1NM5C 1L5GB 3BB4A 1WXWA 2NU6B 3O3NB 3LY9A 4UDNA 3H2BA 3PNBA 3DEIA 2PK3A 4GSYA 4PPFA 3DO6A 1TUBB 4ZU1X 3TRFA 3PICA 2YWGA 1LPSA 2PJZA 1Y34E 3HNPA 4BN5A 4L8VA 1GZSA 1MTOA 2P4UA 1A7KA 2UYGA 1PT6A 1WXIA 2VAVA 4M9XA 4ND7A 1WQ3A 1P2GA 2J9ZB 4DCOA 1QQAA 2W2XA 4KI0A 1M6VA 2BKAA 2BM0A 2CZGA 4K9QA 4Q4JB 4DF3A 3ONWA 5JYCA 3KQNA 2GEDA 4B79A 1F2TA 3KT0A 1AA6A 1HMYA 3N2GA 5JSFA 2QAJA 4IDBA 5J5AA 4H15A 4M8KA 2BFEB 2RHCA 3DDCA 3JQDA 3NIGB 2HEIA 2ZETA 4M98A 4G6ZA 3Q85A 2BD0A 2I66A 3G88A 4PRYA 4QYMA 3ZQKA 4EPYA 2DFNA 3IIIA 4GYKA 2OKGA 1GRNA 4LZZA 5AOBA 2R8BA 1ZKMA 1EWYA 5CUQA 1OQAA 1LPNA 1A9QA 1MVLA 4JFRA 4MV1A 1EHCA 4RZHA 3T5BA 1E6MA 3FKJA 1TB4A 2BTQB 2DULA 4FR2A 1A1VA 4GF5A 1XDUA 4CN9A 1SD2A 3I9JA 3EMDA 3ANTA 4EY8A 1QP0A 2F48A 1QV6A 3TLGB 2Q1SA 4I4IA 4YMUA 3CEJA 2ZI9A 3H9BA 3IPYA 3BE6A 3VR4A 3L92A 1GL3A 3D6NB 1BGXT 3WMEA 1XLWA 3C4QA 3L0OA 1ENYA 4OGLA 1W8DA 3DPUA 1IM2A 3LUPA 4MVJH 4WZBA 3LT1A 5DXJA 1CWUA 3BKWA 4DWVA 5HOEA 2WF6A 3PQDA 1UBHS 2WHQA 2FYTA 3AEYA 5KWVA 3BE5A 1T2CA 1GVNB 2OXCA 3INTA 4XUDA 1F4VA 1Z35A 2HXGA 5EINA 2Z04A 1Q0RA 3RAPR 1M5TA 4C88A 1J6UA 1S3IA 1WMSA 2WUWE 3CEPB 4DV0B 3WLLA 2B8NA 1EZ1A 1IQUA 1LB1B 1ORIA 2ZUSA 3HYTA 2ANBA 2EXXA 4JROA 1EWRA 1M1NA 1Q1NA 1KEWA 4R1TA 2QN7A 3V1LA 4Z4CA 3CUUA 5CBPA 2B2CA 1CUAA 4NBRA 4QUAA 5LU8A 2SCUB 4R8MA 2HA2A 5HSGA 2DQSA 1GPLA 3RS3A 1I0IA 1TYEB 1FFCA 3O9ZA 3FUWA 5REQB 4HNTA 3PNOA 5L8VA 4B8YA 5HCNA 4F6LA 5DYIA 1W93A 1E2EA 3W8NA 3HE3A 1UFRA 3G6KA 1LNSA 4KI7A 1KZHA 4DMUB 5EE3A 2HJGA 1ZCBA 2EZTA 3LBYA 1U5BA 2CJWB 2CBGA 4PPNA 2REXB 2WE7A 1YZNA 1D2NA 3GQVA 3OE1A 1ETHA 4U6SA 3QFCA 5L53A 3B1YA 1BX0A 3X44A 4EVSA 5A4FS 4GI3A 4DMFA 1CLEA 3HXKA 2QS9A 4S1OA 4F9GA 4DFDA 2DUUA 4QXQA 3T34A 2I2BA 1RTTA 2NLOA 4KQWA 2ZI7A 3OT1B 4LNUB 4LGMA 5IDYA 3SEQA 1LH0A 3CVJA 3REOA 1VYVA 3NM5A 4KV7A 1M33A 4L57A 5CB6A 1JMKC 4OI1A 2ZREA 1NHWA 1SPBS 1R0XA 1ZGBA 1JIVA 1UBTS 3CUYA 4OHUA 5FL7D 5GVRA 5GWXA 5DHAA 2OPBA 1XO1A 5IVKA 2I6UA 2EERA 2Q4RA 2RI6A 2ZBRA 3ADBA 4LOJA 1W581 5JPCA 3DCYA 1T0PA 3D4BA 3KP1A 2R1UA 3KWMA 1QJ4A 2YFKA 4I55A 4MUBA 4Q1EA 2IYVA 4QNRA 3K70B 4HWSA 1T5DX 1SXJC 1YB4A 4U9HS 2BKXA 2RHJA 4D4HA 1CJCA 1ZJZA 1FJ2A 5E8JA 4ABYA 1EWTA 5ECWA 2Y1LA 2Z8YM 3OEEA 4AJ9A 3C6BA 1MDFA 1V8DA 1NONA 2J3EA 5FUMA 2DLDA 1XRNA 1PLLA 1P1JA 3VNRA 3HSSA 3HGMA 1ZUD1 2VSQA 4G4GA 4L0MA 5D5HA 3ZG6A 1ISRA 4DQ0A 4HDCA 1NBWB 1L5RA 1T0UA 5C1BA 4JP3A 4MOWA 3O91A 4EI8A 1DUSA 3D4NA 2FQYA 3JVDA 3QOYA 2Q4EA 4LV5B 4YV7A 4TTVA 1FJHA 4FT2A 1AB5A 4IMPA 2FSIA 4K9SA 1P18A 1RIIA 4NPCA 1F5NA 2GMWA 4CMBA 1DAHA 1Y8RA 4EMUA 3DE4X 1XNQB 1WX1A 4FFWA 2XRYA 2ZRNA 4PW0A 4DIKA 5KPDA 2CHQA 1ZJJA 1EZZA 1QFYA 4IJQA 5H3HA 5LUAA 2A0FA 4LDPA 3SVZA 3GV0A 1IVSA 1XWFA 4JAVC 4P7KA 4CKYA 2YHSA 4OXRA 2OP0A 5FTKA 3BJIC 1KO8A 1A88A 1KMMA 1PK7A 2XD9A 3WADA 1AKRA 1EVLA 1V8BA 4D46A 2JPDA 2PRKA 3WBJA 1A2QA 1LV8A 3RARA 4E22A 3L5KA 5JQGB 3KOUA 3BJMA 4US1R 1FP1D 2FHSA 1R8YA 2JHAA 3TLMA 4R1SA 2GYVA 1V6AA 3Q88A 4FFBB 5E0OA 2O4CA 3A27A 4IFEA 4EPTA 1Q20A 3OOSA 4WKGA 3A3PA 1UJ2A 3LW7A 1KY3A 5ALYA 1QVRA 2OBFA 2XVYA 1OZAA 3LQQA 1MIHA 3L49A 3CUEF 1ADCA 4AUKA 4GU5A 2AR9A 4LWZA 5CDFA 2HIMA 2JCBA 2HWWA 2Q07A 2YWJA 1Q21A 1IWBB 4G23A 4KV9A 4O2LA 2H8KA 2IYUA 4DMMA 4ZZIA 4WGGA 1NFQA 4MYTA 3LDHA 3W7VA 1XVIA 3HNRA 4O4HB 4O4LF 1E59A 4OFWA 4P3PA 4ZI7B 2A59A 1XK7A 2QN9A 3CNQS 4YCSA 5LQRA 1CR2A 1KEEA 1PJ2A 2VSOA 1XFAA 4Y7CA 5AHRA 2MWMA 4IGKA 3RS2A 3PUXA 5K0TA 2IPMA 4QFCA 3DM9B 2IOHA 2G6BA 2HA0A 2V9ZA 3C85A 3V4FA 1XVVA 2IT1A 5TF4A 2UZ0A 3UCEA 5EQFA 3A26A 4YV0A 2JRCA 3GRPA 1KQPA 1X1CA 2B2XA 3IIMA 4Q3CA 1US8B 4KAJA 4DLTA 1KBZA 2FJ0A 4JJ7A 4RV4A 5KI6A 2D2XA 3OLXA 1SUWA 2IHTA 4QJIA 4F4UA 1G64A 4U9UA 1FQWA 2IXDA 2GJ9A 3DUFA 2GPYA 3LQ4A 1G6HA 2LVBA 4S12A 4GMKA 4BV9A 4EY5A 4XWOA 4IEEA 5A0TA 3PKJA 2GZSA 1U1FA 3CX8A 4MA0A 5AQEA 1YQEA 3CH6A 1TCUA 2UZ1B 1C2YA 1J06A 3A1FA 3TEMA 3N2EA 3UMBA 3D1JA 4B5KA 3ZWMA 3C39A 4QU5A 2EGHA 2EGUA 3WLIA 5CA1F 3OPYB 1PT9A 1JEJA 3BMOA 3OWOA 4BNZA 5HZKA 2VF8A 3TZHA 4FYXA 3ILYA 1T8YA 1OX5A 3GLTA 1QU2A 2CF5A 4QC2A 1JXQA 5AJVB 3KB2A 1P5FA 5D2CA 1GCAA 3A4LA 4B87A 4II3A 2EG9A 2ZJFA 4YC7A 1C14A 1PZMA 1R0SA 3H42B 3M70A 2M6SA 3DMTA 1UBUS 3BYZA 1CR1A 2YV5A 3DC7A 3O1IC 1HR0B 2HSGA 2PGNA 4LXGA 4D8VA 1R66A 1VTKA 4JP2A 4R1QA 1FMFA 1BFKA 5FI3A 5JNLA 1E3SA 3JVEA 2YJ6A 2GBFA 3I28A 4BMYA 5IJAA 5JY1A 1Q7GA 4DC0A 1QHHA 1UMKA 3EGDA 3T5GA 1FLDA 3V8PA 2QOEA 3LUCA 5CLHA 3QUCA 3DFZA 2FGKA 1XNGA 1EAMA 2QYOA 4CKZA 2JARA 1NJSA 5FWAA 4ASUD 3GVIA 4GXRA 3EFOB 4KVFA 1WUYA 2D1TA 1JG2A 3E05A 2YWCA 3PX2A 4KE9A 5GPBA 5JT1A 2DZDA 3ROQA 2DCUA 4RETA 5JQWA 3G5MA 4IJKA 5EYPA 4IYRA 3ZV4A 3L7OA 3S55A 1GFWA 5ALGA 1ZAYA 4WWHA 3FYUC 1F0KA 1H2AS 1X13A 4A3SA 1TQ6A 5DF1A 1Q91A 2NSYA 3H4VA 4IBOA 4GSLA 4F5WA 2VF2A 2CXUA 2R5WA 4ZYVA 1M2GA 1LZKA 2B6NA 4PO9A 1XEWY 3DULA 3PTZA 4QBTA 1OB2A 4ZIRA 1AKEA 1C8VB 2WMNB 3T54A 2XE4A 1EUQA 3HUEA 5F4BA 1V35A 4DJTA 3HBFA 3BL6A 4HVLA 1YI8A 2YHUA 4QOSA 3T9CA 3ZY4A 2ODNA 1Z07A 1FPQA 1NURA 2Z1DA 1DGQA 3C5HA 4V0KA 5DH9A 1SO8A 2QZJA 1ZMOA 4TS1A 4D44A 1NVWQ 3IKTA 2UUCB 1QKKA 3WGQA 1JILA 1ZN9A 5CFQA 2Y1CA 3L0YA 4ARAA 1DMSA 2GZDA 1Z62A 2WHRA 5L7YA 1A98A 2ZS8A 5LJLA 2FPXA 3G8AA 1SIOA 1ZL0A 2PGIA 5KYYA 4GKJB 5E7IA 1RS0A 3CLHA 4OPMA 1ZK3A 5LZ7A 4J0GA 1CQJA 4BQIA 5BWNA 2CB0A 3F78A 4JWTA 1WTAA 1E9BA 1RACA 2A30A 5G3ZA 3PX7A 1D6JA 1OD6A 1VM6A 1Q0TA 2AFIB 5AIAA 5L6MB 1CF9A 4ED9A 5JYDA 3DBLA 4LGVA 2V1UA 4MKGA 1JEAA 3I53A 4OJKA 4P4LA 4NH0A 2IZ7A 3WWYA 3PC8A 1QONA 1B14A 3FTPA 1Q74A 3QIAA 4G9BA 4FEYA 4LF5B 2QM8A 5ITZA 2OV2A 2BM1A 4UUAA 1ORRA 3U7EB 1G63A 4DMKA 4YXWA 5JECA 1UQTA 3UY4A 3AVPA 4EW6A 4PZPA 4ZGGA 4PHFA 3KUUA 3L8YA 3LI2A 5JBQA 4Y6PA 4PS1A 5K51A 1I2AA 5CH8A 2JH3A 1FTQA 3RSSA 3IV9A 4QECA 1NZDA 2BZ0A 3G9ZA 5TJHA 3QVGA 1BKYA 4II7A 1AS0A 5LQAA 3IBCA 1T2AA 3IEKA 4AAYA 2A92A 2W6ID 3KAQA 4PNZA 5HA5A 5HJ2A 4ZVNA 3ZK9A 4GGMX 3LTNC 4E3WA 2P2DA 2A9PA 2A94A 2RB5A 2ZRDA 1E2UA 2X2EA 2G76A 3CM0A 1BW9A 3GDFA 3P0IA 5GJCA 4OKIA 4HGOA 3T3EA 4N54A 1D0IA 5GP1A 2OCGA 3KZ1E 3P32A 4QATA 4ZC1A 3BRSA 3ZWWA 1GLGA 4R71A 4HTAA 4LY9A 1DC8A 5CVDA 4Q9JA 2Y77A 1J0AA 3FPHA 4AY4A 2ZEJA 1WCV1 2FFBA 1SQ5A 3KTOA 1WXQA 4K3VA 1P1FA 1USIA 1EFRD 2QM7A 2R96A 3O8QA 4IZOA 3BHJA 3G89A 2RGWA 4W5HA 1RLJA 4D4GA 2VZEA 2XI4A 1DRJA 3NYRA 3A25A 1OI3A 5LJIA 4MUKA 2PWYA 5K09A 3W6PA 5B58C 4CDGA 1SKAA 2MHCA 1RM0A 4Q12A 5AJTA 3UV7A 5C51B 3ODGA 5GIOE 1WZCA 3ZDXB 4I1PA 3VV2A 5LD2C 3ZHXA 1RRMA 1Z4LA 2QORA 3E22A 5AESA 4OUDB 1K7XB 2R9VA 3IQEA 4YMSA 3ZKAA 4TZTA 5DHUA 3DEKA 5LP6A 3EVGA 2O4UX 4W9NC 1P5HA 4OMUA 4BKUA 1U0FA 2OAEA 1Z29A 4DSNA 3PSAA 3O8OB 4JVSB 1DCKA 2FWIA 4CLRA 1SHZA 1AZTA 3CVWA 3K09A 1DIOB 4Y1GA 4D0NA 3JQ7B 3ONNA 4IGFA 2DWCA 5FBVB 1CUSA 4C4YA 4EHKA 4FQ5A 1ZK2A 3RWMB 2BFBB 1QH9A 4X0EA 2E4ZA 5CGZA 2IYQA 5F9MA 4HRYA 4D96A 1JR4A 3BL8A 1OKKD 3FB4A 4IM7A 5ALTA 1WDKA 4KRGA 1YA4A 2OHGA 1TVEA 4C87A 3GX1A 5T6MA 3WWCA 4YQFA 5IH3A 1A9PA 3F96A 4TMZA 1YFZA 4YRTA 3N5CA 4CKCB 3IPXA 1FTNA 1AUVA 1GKUB 1E1MA 1XMJA 2HK7A 2XR1A 3DMGA 1L1RA 3N8GA 1UCFA 4ZREA 5FIUA 3V32A 2CUTA 3KKEA 3U4HA 4CF3A 3ORYA 4LJ6A 3MCTA 4Y2PA 1QFZA 2QVXX 5ITWA 5JXWA 1UPXA 5CYFA 4OHOA 4O4LA 3ULKA 4C6TB 4JMLA 1M2WA 1Y6FA 4FZJA 3LK7A 1C2TA 2L69A 3TSYA 3W5SA 3BDVA 2KW5A 3FLBA 3MOIA 2C7OA 1YT5A 3NU1A 4JLBA 1MNQA 2JI8A 4MV0A 4MWZA 3HDYA 4QYXA 4MROA 1PF7E 2HPAA 4D4KA 5AHKA 1MO5A 3EXEB 2BCGY 5CH5A 2JS7A 4ER6A 2HYIC 1D5WA 1O4VA 1RSZA 5HQJA 1XCGB 3AFMA 3REQA 4L4YA 4YRCA 1G0OA 4M1MA 3UHOA 1W36D 4RD0A 1TA0A 1WPRA 5FUYA 1VXRA 3S2GA 4RULA 1UFQA 4GLOA 3PDHA 2Q1WA 4CLEA 3T41A 1MH9A 2CHEA 2E87A 3GN2A 2O8BA 2QT1A 5I9BA 3L8CA 5CHEA 5GONB 4FOTA 5JCZA 5IKXA 3QZUA 1L5HB 1Z2EA 5DHPA 3WWZA 1QWOA 5KYGA 2MTBA 5JW6A 2B83A 4JKIA 4YAOA 2M98A 3WAJA 3TF5A 3ODPA 4MDEA 2AKEA 4II2A 2PXCA 3STWA 1ABEA 3KKQA 3ND5A 5CA1A 3DDHA 5B4TA 3NYQA 4FBMA 4EYQA 2R44A 1ZR2A 2I2AA 2C8JA 5FADA 3P9PA 3RQIA 4X5OA 3HPRA 3HB7A 1PSWA 2ZYGA 4RY8A 1QBGA 4LXIA 3BH7A 3B9QA 4CKWB 4DRYA 4LJ9A 2AYXA 5HE9A 1KFKB 1DQSA 5FLEX 2J9FB 1IN5A 2R0QC 4LHWA 2FEXA 4GXQA 3F0TA 3ELDA 3U26A 4ND2A 4TV9F 4RMGA 1R0ZA 2WPDA 3PVCA 5CA0B 2QL9A 2PD3A 4O02B 4L9SA 3TR6A 3U44A 2X22A 1DTSA 3VVBA 3EK2A 4X64B 3OTGA 3W78A 3KQPA 2JFFA 1CNMA 1U8XX 1W73A 4KYIB 4U63A 1D8TA 5CM2Z 3TOZA 4BRSA 2QRMA 4AJ2A 5DMHA 3B9BA 4DG5A 1ORWA 1YH3A 2J3JA 3N70A 2WJYA 1PG2A 2ETXA 2GB4A 2X8AA 3I6QA 5H9VA 2PYZA 1P6QA 2IEBA 3QBVA 3DDSA 3WV4A 2IXEA 1IXRC 1ZW1A 2Q2OA 2QP3A 2WABA 3LCJA 4NKRA 4ALMA 5CITA 2FHPA 4AKHA 3KOYA 3TW0A 5E6SB 4RPJA 2A0WA 5WRFA 3IOBA 4BGUA 3WY9A 1XMQB 1LRLA 5EMKA 5BWLA 5K4AA 3TZQA 3MFQA 1OU0A 4QNNA 1XV5A 1A9TA 4ZOBA 3EULA 2FETA 3LOQA 4V0OA 1U2GA 4WFKA 3F6YA 5G40A 4G5FA 3TSOA 3GEHA 5KSYA 5I7SA 2O05A 3DOHA 1E7MA 1JHVA 2QTCA 1UXIA 3STYA 2GRUA 2NUAB 2W2TA 2O2ZA 3DTVA 1WXGA 4URWR 3JATA 2P9GA 4XJVA 5FBKA 3W8RA 2WTXA 2JEYA 4REOA 1XZKA 1SCKA 3VTFA 3ZD7A 1TQDA 4XD7A 2IEZA 3BB3A 5BR7A 3QEMA 1IB0A 3B12A 2O5EA 2QPLA 3PU6A 1HGXA 4M89A 1VRCA 4E4RA 1I1HA 3SQXA 1D4FA 1I7DA 4YN3A 3K6KA 4BZXA 3W6ZA 1BMFA 2J4DA 3WNBA 4C7VA 1JDUA 1U4OA 2C82A 3IESA 4Y2VA 5A9SB 1G4UR 3QEJA 5CPFA 1XEFA 4JYPA 3IBYA 3W2GA 1ACJA 4QLBA 3KYBA 3GLRA 1FUKA 2WAOA 1P9WA 5AVXA 1H2YA 2PL3A 4W4TA 4J91A 4X85A 1B16A 4OQEA 5FBWB 2R8YA 5BYJA 3NXKA 4JT2A 5H68A 3ZKWB 1HEUA 2B4RO 1WHTA 4UZEA 2G7MC 1LU9A 2QR5A 2FKAA 3PX3A 4IHKA 5DGTA 4U7DA 1IHDA 1NY6A 4IDOA 2AZDA 3ZHCA 3EVEA 3M5WA 1FXUA 3L82B 1KU0A 1SVKA 2HNBA 2XKAA 1VIYA 3AY6A 4KVAA 4FEAA 4YGXB 3UWOA 5EZSA 3QUSA 1QZUA 3VO9A 4G1CA 4US2R 2PS9A 4E31A 3NCTA 1XQ6A 4Y1EA 4DKJA 3D6VA 4X6XA 2Z6VA 3VC1A 2IH5A 1UK7A 1XD2B 2B0CA 4MB2A 5C1OA 2WFMA 4IXNA 4X44A 2OZKA 1MAWA 4XOUA 5HZHA 1J2RA 1NUPA 5IJZA 5CLLA 4R5MA 3H11A 5B37A 3TR0A 4ARCA 3KWFA 4EA9A 3EXG2 4Y0VA 3LHDA 5DCYA 2W2LA 3K1AB 4K9OA 4TGLA 5LMCA 3ILVA 4NZMA 2VTBA 2VYCA 4WASA 2R48A 3R7DA 1UP7A 5IKMA 1F6DA 3K70D 4CL3A 3HNOA 2ZUBA 2GN8A 3RASA 3UJ3X 1E9DA 3TW6A 3CCBA 3ZX5A 4R1NA 3U7IA 2CZQA 3P0RA 4MYSA 1IN6A 4O33A 1NJ5A 2W58A 1NV9A 4P0QB 4Y9RA 4IL5A 4WKNA 1NASA 1XU4A 3KKMA 2GCEA 3I52A 3U48A 4EI9A 1H8EA 3SJCA 3TCKA 2ORIA 3MAGA 4XD2A 4EJSC 1ZPDA 3F6SA 3V9AA 4NAUA 1QLWA 2DBZA 3JRWA 1Z68A 3D5QA 3N2LA 4Q4HA 4BNIA 1XZIA 4RXMA 2DKOA 3DP7A 3VR3D 4OOEA 4RZXA 3BORA 4B32A 1TK9A 2PNFA 3B6EA 3KV3O 5CB4B 5F7XA 2JF0A 2Y1OA 1CV2A 1EX1A 4D2IA 4ZA2A 5IW8A 1UQRA 1ZAKA 1U7OA 4MCHA 5B3AA 5D84A 1P7PA 2IEAA 5AVVA 4WL0A 2WHPA 5DWVA 2NP6A 2H08A 3LX8A 1J2JA 1JB1A 4MH0R 4CN8A 1PI3A 3QVJA 2ACVA 2XTZA 4DC9A 2JJ1D 4IIUA 2P4HX 4EW3A 1UJ5A 2ECKA 3DDWA 2X19A 5BRNA 4OB7A 3H5RA 2JJQA 1K2WA 4KAXA 3JW8A 4ZVVA 4YALA 3ORFA 5CTJA 3T06B 1X80A 2A1UB 1D1TA 2FEOA 3AJEA 3PTLA 3CLRD 3N6RA 5KVQA 2B4TO 3RTEA 4C0AC 4M9SA 3B1JA 1P75A 4YAEA 1DAEA 1BOOA 3DAGA 2YMPA 1F38A 4IPTA 4QE3A 3RFCA 3A6ZA 3RS9A 2VNIA 3M6AA 5CHYA 1OPRA 2AYYA 4IMIB 5KQGA 3BXPA 3HFRA 3DQZA 4CM1A 1TT5B 5LIPA 2CUKA 2HQ1A 4N4AA 2C7QA 5A4AA 1F14A 1ORDA 3GGOA 1YHZA 1NXSA 2AXEA 3PITA 4FHFA 4ITRC 5B1EA 1E2LA 1DMRA 2VUTA 1HNNA 3FY4A 3LK6A 3UH0A 5BORA 1ZCAA 1W6UA 2XXBA 1WPXA 5DX1A 1LDNA 3A10A 4G63A 3TTXA 4U7JA 2X5KO 3DAHA 5E2BA 5JS8A 5LDDC 5A6SA 3A9UA 2NSJA 1QIIA 1SCDA 3DQPA 2IUUA 4N0EA 4R7ZA 3DSRA 2W2QA 4LXHA 3ZJUA 3LP8A 4ZOCA 4ZPXA 4P7GA 3T3PB 3RYCA 5K20A 5SZKB 4DV3B 3GVXA 2D1FA 3ZH2A 3DW1X 1U0LA 4KN5A 2YC4C 4XSGA 5DNEA 4KN9S 3LY8A 1SB9A 4R1OA 5CVUA 2OYSA 3C3KA 4DDUA 1UXKA 1DBSA 2MMGA 1NQXA 3HEBA 3A04A 4KQFA 1PT8A 3CY6A 2HZBA 1HURA 3K1YA 3SE7A 4L22A 3FH0A 5FBHA 5FPYA 3QEKA 1PFWA 2DG2A 5F2KA 4N3GA 4TVOA 4EYSA 2X2PA 2ZAYA 2Z9CA 1YJCA 1GNPA 3OQVA 1P4GA 4J4HA 4RSRA 4DWOA 1SRRA 2XYPA 3JY6A 4AY3A 3MCZA 1DIRA 3VVCA 1XL0A 2HH9A 5K0BA 2B8WA 2JVKA 1A95A 1JKMA 4B7AA 1PG0A 3SLKA 2JD0A 2QTFA 3EWIA 3MIIA 3U7JA 3T1QA 4E12A 1MXFA 2GVZC 1OH6A 1PGQA 2PD4A 3AUFA 3P8ZA 2CFRA 4QXAA 1T2VA 3L93A 4WY2A 3HJNA 3JPYA 4G86A 4MUHA 1ECGA 3MG9A 4L9WA 1KDOA 2E21A 3D3KA 4OYLA 4X6YA 3MMZA 5IKOA 2EZ9A 1H1LA 4HKTA 1T2UA 2Z5VA 3IP1A 3ZDDA 3BHNA 3IR5A 2FPOA 1Z63A 4RY0A 2A7QA 2X7XA 2Q8PA 4DQXA 1TKBA 3ZHOA 3A4VA 4BZPA 2OD9A 4YUAA 1V6SA 2XKBA 3LW8A 5PGMA 2XOKA 5JCXA 2CLLB 3BILA 2ZT5A 3AM5A 3V1KA 3K0EA 1C9YA 4B75A 3PYLA 3AEZA 3C3BA 1B74A 1MRZA 1TDJA 1JIKA 1PSDA 1Z5UA 3JR7A 4XYBA 5JE8A 4TV9A 3UWDA 3ZN2A 2QLBA 2CMKA 2GNPA 3QVKA 2C5BA 4H1TA 1C4OA 3D4PA 1H2RS 1JSCA 3E58A 1TAQA 2VJKA 3HG7A 1F17A 3U80A 2VHZA 3DXXA 5TMBA 1DU4A 3HB5X 1D2HA 1SUDA 2NOAA 4W1QA 4V0QA 5I7RA 5K9ZA 3DLAA 3I3OA 2Q3FA 4RSGA 3LL7A 3NWBA 4TTIA 2IBSA 4QBKA 4NBTA 1ZU4A 3L9XA 3UN1A 1I7PA 3UCFA 2WZDA 1V6CA 2CFIA 2NQ2C 3A0UA 1PDWA 1PNVA 1UINA 1ZUHA 1KDZA 4AUNA 2VQEB 2PVPA 3B3GA 3BK1A 3SDBA 1NAIA 2QGNA 4HDNB 4AECA 4PO1A 3BXGA 3WYGA 1SKBA 4BNLA 4G5RA 2XCUA 1KQFA 1OLXA 3R0JA 2IY8A 3K9HA 2C4TA 2Y0BA 3LWDA 4X20A 4EHIA 2R62A 1DEXA 3DMYA 4M9RA 2ACKA 3OU6A 5ICGA 4EELA 3JQRA 5L7WA 4QGFA 2LR0A 3TINA 3A3OA 1MT0A 5FAKA 3INGA 1DZIA 1P3JA 1XQYA 2JZCA 1EFPA 2V1XA 3PDIA 1U2RA 3VDQA 3KELA 3TO5A 4BKQA 3EZFA 2QD3A 5IM5A 1QCYA 3W5UA 2B5WA 2FZGA 5IU6A 3UGJA 3WISA 1VPEA 3AUAA 3KCQA 4GRDA 1EG7A 3HCPA 2W8BB 1IXYA 1XB2A 3N8NA 4UUNA 4JOQA 1T3ZA 4LDRA 4Q4AA 1LJLA 1AU9A 4PPQA 4OD0A 3ZWOA 4Z3KA 4C22A 3HXQA 2PCLA 3GJZA 1GRCA 5LMNB 4G85A 5A3QA 3DE7X 4MRNA 2VYQA 4QAJA 2PE5A 3K9WA 5KCZA 4MS4A 2WHEA 3HRHA 4A2CA 4PC6A 1JFLA 1MT3A 3VPFA 4FU0A 3Q9NA 4OMFG 3PJGA 2VVTA 2BZGA 2X8BA 3WGVA 1QH8A 5JO9A 1X15A 3QF4B 3SJAA 3IPRA 4DNOA 4KDEA 4IIJA 2G36A 1P2TA 1G5PA 1M8GA 2FEKA 4AJLA 4EGQA 2I6XA 2PYIA 3OUZA 2W6NA 3TOCA 2YMLA 4EIWA 4XM2A 4M0DA 4ND8B 4ID9A 9ABPA 4HPJB 1Y6GA 5EXSA 3ROMA 5I9TA 1DV1A 5HX7A 1LW6E 1Z8HA 1K8RA 4M0CA 1IC6A 1P8AA 3KTFA 1YS6A 1ML3A 2C5AA 1EDOA 2OR3A 2WUFA 4BO5A 1YRWA 3NVDA 1D2RA 4FLEA 4MQFB 5DI3A 1UIRA 1VI5A 1CS0B 1OWPA 4GD3Q 5F1PA 3I37X 4MA4A 4Q9NA 5E4JA 5KYKA 2H2AA 5EWLA 1WG8A 4JX8A 1TAGA 2Z3WA 4DUYB 1BXZA 1SG9A 2ECPA 1TCVA 1YKFA 2QVGA 1L7QA 2ZB8A 3F1LA 3ND9A 1W48A 4C1NA 3BMXA 2O8FA 5K8JB 1KEPA 1Z12A 1YZUA 1ZX1A 2QUHA 2ST1A 4TLMB 4D43A 4LBWA 1V16B 5C32A 1FW6A 4DIEA 1FTYA 4IOJA 2M9MA 1XN1A 2QM3A 4A23A 2HEGA 3ELYA 1A71A 2P91A 4O63O 4EAQA 2HLNA 3AESB 2CXHA 4OYHA 5FWXA 4XB2A 2X8JB 4J75A 1Z0AA 4QEKA 2UVPB 5FPTA 4F2HA 5FNVA 3RH0A 4CCYB 3AV0B 3K09C 4MVWA 3A9SA 3ROFA 3EUWA 4TUYB 2JLZA 2Y71A 3ASUA 3WMRA 4A6PA 1H2BA 3CW2A 1ZM7A 2J08A 3KQVA 2G63A 2ZR9A 4H9GA 2D59A 1N2OA 1RC1A 2JDID 3WJ1A 2KLBA 2VYVD 2RGGA 2ACEA 4L51A 4GRIA 3B3QA 4YRBA 1KI6A 2CK3D 3IQXA 4G4SP 2R3SA 5TQ2B 1ZCFA 2QRQA 1VL8A 3E1GA 1BXGA 2EOAA 2JFNA 4TROA 4UXHA 1UBFA 3RC7A 3TEJA 1ULZA 1DT5A 1K8XB 1W88B 3F6EX 4MYDA 4CF5A 1YR8A 4GWLA 4PWYA 1OA0A 2BDUA 4CV3A 1JQ3A 2EL7A 4OQLA 2O7NA 2XNDA 2IHKA 4I4LA 2P9FA 4DREA 5I7EA 3BMNA 4DILA 4E2XA 3RUFA 2J87A 5H83A 4OM7A 1GYPA 4JYBA 2J7KA 1RYEA 4B9AA 4ERNA 4PZ9A 3RS0A 1T6XA 4MPTA 1Z7GA 1YZLA 3OWHA 4PVDA 1CUGA 3UT5B 4YMLA 1JDVA 5DIZA 4PS0A 5FB3A 5DISB 2G9RA 1F8XA 2R66A 4G3XA 2ZSBA 4TSKA 3IKVA 1OJ7A 4J1QA 3LXRA 2P62A 2J32A 3G68A 3RIYA 3U31A 2JLWA 2DF8A 2AK3A 5M7EA 3EFEA 3K1JA 4E07A 3A1SA 4DHEA 5DJ5A 1P2UA 2YIDA 3MPOA 3ZZ1A 1JXMA 4WBNF 2BFNA 4LF8B 5DSXA 1MC5A 3OX4A 4UTPA 1HY3A 1K6EA 2FX5A 3DBHA 1T9GS 1P4SA 4KQ2A 3SHOA 1I2BA 3FCOA 3U4QB 3VI3B 3AW9A 3LC2O 3B9PA 1EEXB 3OH8A 1XFDA 3SQOA 4XVCA 2HV8A 2UUOA 1E9FA 1XROA 4CL0A 3RVKA 3TQRA 3CLSD 4L5IA 1QTQA 3RC3A 3E48A 4QPPA 1TJNA 2X0FA 3BEOA 2XCTB 2D3WA 5COBA 2QI9C 3E3LA 2JA2A 3CW8X 4ENUA 4W5TA 1MIOB 4MVJP 3KXKA 5LLDA 5FV4A 1F4LA 2EQBA 1XTTA 5CD1A 1DQPA 1LBIA 5GZ6A 5TMDA 4NCHA 3BWXA 1AKTA 3RF6A 1WVMA 2A78A 2O2CA 2PSJA 2VPXA 3FZGA 4LECA 5E3JA 3SKXA 3WIBA 5FHRA 1U2PA 2V55B 3HU1A 1RNLA 3OTQA 1JTFA 1AS2A 2NXCA 1RRCA 3ETDA 5BN4A 1I4TD 2CFTA 4NENB 2K7FA 3ILXA 2AF4C 1NX6A 3MM4A 4OHXA 1M2OB 2O5CA 4BVJA 3BWCA 7GPBA 3EEOA 4FJ1A 4ENVA 1Z0SA 3WMXA 1WF3A 3QFTA 1IFXA 3M33A 1WCYA 3IVRA 4MKXA 4JLKA 2FPUA 5EIWA 3NRCA 3IKMB 4UFPA 1XLTC 4EB3A 4OQYA 3IUEA 5M34A 4Z4IA 4M1OA 1E20A 3P45A 2HXSA 4G0OA 4MQMA 4HR7A 4MP3A 1BYUA 4LKRA 5ARCA 1XL1A 3Q4GA 2J4FA 4RIHA 1DXOA 2RGRA 4CL8A 4LSMA 2CXRA 3CYFA 3ANSA 3FLAA 1RXCA 3I76A 2GN1A 3MQ2A 3NBMA 2FP4A 5IJ0B 4KXFB 1OAOA 4FINA 3RCBA 3DEYX 4IMJB 2YWDA 4Y2TA 1IPEA 3CS3A 3V8NA 1KK0A 1UJCA 2A0KA 4YX9A 2HMUA 2DKFA 1I4EB 3FFWA 4DSOA 5CW1A 3FPJA 2ECOA 4HUJA 1DG9A 1MO6A 1MQ8B 2VT3A 1Z0KA 2A1TS 3AIMA 4G1FA 4JGBA 5E0KB 4IUBS 3LRXA 5EFZA 4CF6A 2OCYC 4D81A 4G9GA 2C04A 3K0CA 3GC6A 4NQZA 2RC5A 1N92A 3EZGA 3OPMA 4U2KA 3PFNA 2E5FA 4HUTA 3E7XA 1P2VA 3QKWA 2Y66A 4URXR 1RR6A 2ZUVA 1CIJA 4GQIA 1Q1AA 5BSRA 4BYMA 2VTVA 3VI4B 3WB9A 2H17A 3MCVA 3KBOA 1ORTA 1F2UA 1YA8A 2CMGA 2RC6A 3I30X 1IVNA 2XF2A 4G2NA 2GETA 2FRVA 3DV2A 2C4KA 1SOMA 1RZ3A 1TF7A 3ENKA 1R10A 4PGAA 1O89A 3KEFA 2Q62A 3NT4A 2QMQA 4HFNA 2QSYA 2JEZA 3O4RA 1QE5A 1FXWF 4Y9UA 4CQMB 1TJ4A 3R6WA 4N0DA 3OEHD 3WQSB 2V6MA 3I2JA 1TO6A 3PQFA 2GM4A 1JQAA 4WOPA 1Z0IA 4HDRB 1MO3A 2J5BA 3ITDA 1BXKA 4H31A 4UATA 1XTUA 3T15A 4V38A 1J21A 5TE9A 3DYIA 4EK9A 6ADHA 1QRAA 2R6R1 5IZCC 2Q8NA 3G7SA 4HXFB 4YH1A 1QG4A 1D5CA 3EIQA 4P58A 4PPGA 5AI6A 3FWYA 3K0FA 4L8YA 2W11A 4XCXA 2ZXEA 3TIGA 3Q3VA 3SP1A 4B0PA 1KC3A 5L51A 2EEZA 2C2OA 3KT3A 4M0PA 9ATCA 2QYTA 3QV2A 5HQ3B 5M29A 3BIWA 1R0RE 3WL7A 3O5AA 2G09A 1K3FA 2JGFA 5B3JC 3QY9A 1E1DA 2PMFA 2A9VA 5COAA 1S3GA 4TYWA 3AHJA 1TTTA 3VR5H 4X61A 3MMXA 2WICA 3N7AA 3W3AA 4HEQA 5KYVA 5KYTA 3TLYA 4BMCA 3NV7A 3LUJA 4K8RB 4UM8B 1RE0A 2YNMC 1GAWA 4PFQA 1KTVA 4QNMA 4ZK6A 2AHRA 5BNZA 1N57A 1I2ZA 1CULC 3KQLA 3HVKA 1Q11A 1RJGA 3V7UA 4A8JA 1SNYA 3I4CA 1PX2A 3MQFA 4TS3A 1U3DA 2HTEA 2AW5A 4JHXA 2WYWA 5AXAA 3ACCA 4QUDA 3W1VA 1V5IA 3G2MA 1H1TA 4AX8A 1FMJA 2JASA 4DNXA 4EVQA 3ORQA 4EG8A 4JEIA 1O3YA 2IIBA 1DCTA 1C0KA 2WAXA 1LVUA 2XHZA 1USKA 3M6XA 4DLBA 4F8JA 2QJTA 4JDPA 2NTEA 3S8MA 4CL2A 1K7YA 1F0PA 3UXEA 3TLBA 4B33A 2GEJA 4IO0A 4TV8B 2QLNA 1XF9A 4FFMA 1DJQA 1BQ3A 1ZXBA 2RGNC 4MKZA 1G20E 1GU1A 3FFBA 5JDCC 2XYGA 5FL7A 2E5LB 3A3KA 1GG8A 3ZWYA 3BBPA 4A2QA 5TPZD 3TBFA 2O8CA 2NU9A 4L07A 3MSXA 1B6SA 2W6CX 4CV0A 4GX5A 1J33A 3CKMA 4DRXB 4DBLE 2FUG6 4HSGA 5AW8A 4HATA 2OAGA 4O5AA 2Q49A 5EJ8A 2N47A 2OG1A 3Q12A 5ED0A 4AZTA 4ENPA 3NOXA 1UKVY 2CLSA 4RTKA 3GD5A 1EVIA 1HORA 2COUA 3RSCA 1I5RA 3WICA 4R05A 2DT8A 2AJDA 2DUWA 2PMDA 3L46A 4PO8A 4CMEA 3DVAA 3W2FA 4AT1A 2QRUA 3RFTA 3D81A 2AZ4A 1U02A 4CM4B 3BWBA 4FYWA 2ZYSA 4WFQA 3L1JA 2ODAA 4KPFC 4PX5A 2ZYVX 4P82A 1FFXB 1XVTA 2WC1A 1CY7A 1G5TA 2P68A 3TZKA 1JA0A 5F23A 5K5EA 2VK1A 4DQUA 1MQAA 2EKQA 2FG5A 4M9QA 1MTZA 2FK7A 3MWJA 3O9MA 1LRKA 1ZUNB 4RC9A 3TW8A 4KDRA 3ZBPA 1H2EA 5CGQB 2F1KA 3AF5A 3GRKA 2WTAA 2X9LA 5G41A 5CIWA 1BRTA 4MWEA 3R0XA 5IBQA 2CHGA 1BC5A 3PLAE 1ECBA 3EE6A 5HP4A 2I4OA 5HIMA 1Z88A 4XM1A 1BFDA 4F3CA 5G3YA 3DXFA 1P7VA 1PJTA 4DV1B 1K8ZB 2DVMA 3VRHA 3B8HA 3VZRA 3NH6A 4IQ4A 1C81A 2ZRQA 4YHBA 5ELMA 1JEYB 1X1BA 1J42A 2PO5A 1L9XA 1EUDA 2NU7B 2PBZA 5FQOA 2HLPA 4X3PA 4CTNA 4AQYB 1GAEO 1U7XA 5ER9A 2V9PA 1DTWB 1RYNA 4WBNA 4XEHA 2H52A 2FSPA 1RVV1 2VRBA 2NO7A 1ZGJA 5JEDA 4TX1A 4G0QA 1CJMA 5EN4A 4H7IA 1Z3CA 1CE8A 4AY2A 1GZ4A 2JI6A 4WXHA 2ATEA 2GTHA 3HN6A 4O4IF 1NATA 1Q1QA 3OOHA 4UD2A 2JGIA 2P27A 1YFJA 2XADA 2ZVDA 3TRDA 3KOOA 1GO2A 1OXUA 1S2IA 3R2JA 2OVFA 4GVLA 1DVRA 2LKCA 3I45A 1T8UA 1LFAA 4DV2B 1M0SA 2XQKA 1PT7A 2BPOA 2H18A 1VPLA 3ETCA 1LS1A 3L7MA 4HOYA 5DYGA 4E30A 1VLZA 1GSOA 3B8EA 2Q3BA 1HLGA 2YYYA 4IZIA 2JBHA 1FRNA 2HLHA 2QD4A 4J1NA 4MK4A 4RANA 2Q27A 4XXHA 3DVLA 3ORSA 4EY3A 2EJVA 3ETNA 2DWQA 4OHPA 4F9FA 1W29A 2AXNA 2XT0A 1DKLA 1BS9A 2BR3A 4GSKA 1PZFA 4I5DA 1KFEB 3R0ZA 1MX5A 3AINA 4TYMA 1YONA 4PG8A 3I61A 2QW1A 2Q41A 2WW8A 2FUKA 1OR8A 3NWPA 4Y8VA 1VGRA 4DCJA 3JS5A 3K35A 2R6AA 2C1XA 2C7BA 2RSLA 2ZAMA 4M7WA 1PL8A 1NW7A 4FD3A 2CY0A 2IHUA 3GWGA 1XJCA 5L45A 4Z4GA 3Q10A 1CCWA 4QTYA 4MW7A 3QJYA 5JLAA 5FDFA 1KDPA 4PAMA 1T1IA 2Y1XA 4MUJA 4RAQA 4TLDA 4YLGA 5H7XA 2FCRA 2G25A 2L82A 2GK4A 4KPGA 3LCCA 3QVSA 1I0ZA 2M1XA 1W35A 2Q5IA 4GX2A 2Y0DA 3I04M 4NEGA 1N5IA 1C9DB 4XWKA 4RHCA 1X8JA 2ID4A 3GRVA 5K3FB 4KQKA 5CFOA 3AR6A 5HJEA 3WAGA 1D1PA 5H82A 5I45A 4I2VA 3UHPA 4YMHA 3B5JA 2Q4DA 3BXXA 3HEAA 4BLQA 1MC4A 1UBOS 1W9HA 5DGXA 1ABFA 2QTRA 3FZNA 1Y7TA 2PS3A 4WXYB 4XDHA 3B2QA 3BC1A 3AVQA 3VR4H 2O0KA 4I1UA 1KQGA 4CU2A 4KMOA 2WYOA 2XCOA 2CL5A 3CLUC 3SIXA 3TQIA 1DKOA 4UEJA 2GFHA 1GT6A 3TUJC 2XNHA 1M75A 5CW2A 4IIXA 2QQFA 3HACA 1GRRA 4ASUA 4BFCA 4XCVA 5EWJB 5C7LO 4CIBA 5JJLA 3MJCA 1JTVA 2WA2A 5LOVF 5KB3A 3WG9A 4OFXA 1FSGA 1G6KA 2QV0A 4LEIA 5DVZA 3WP0A 5FPKA 3RVRA 3DL0A 1TUGA 3SVTA 1L1EA 2YWFA 3BSWA 1Y6RA 1O95D 2DPYA 2Q21A 3IMEA 3OLQA 4LYAA 2AOWA 4G01B 5B1SA 1R3UA 3ZWQA 3ZHVA 1E96A 3FCXA 2G0AA 3G8DA 2QJRA 4MR8B 3E82A 2ENUA 1P2BA 3PLNA 3GRAA 4MR9A 2REOA 5JVDF 5FUBA 4KPYA 1PZNA 2O3SA 3P2MA 2F8MA 4RFSA 4C0BA 5EIXA 1KZ1A 2V7EA 3UJ8A 5HILA 3MELA 1Q83A 2ZI3A 3LXUX 4BNXA 4DT1B 1LJUA 1WPQA 2JCVA 1OILA 1XVAA 3ABZA 2PU7A 3D7MA 5A2GA 5AUNB 5HNKA 1VMDA 2MYNA 4Y2QA 1IZ0A 1G4AE 4HAOA 2AMJA 3FBGA 4JI0B 1LF5A 1BXRA 3MXOA 5AJWA 3BIFA 4J29A 2F1IA 4Q7KA 2OO3A 5SY6A 5EPUA 4G0UA 1V25A 2PGDA 3RAFC 4RTMA 4U2GA 3IMGA 3D4OA 1SXGA 3MQ4A 4FMPA 4PN7A 4MIKA 2WVJA 4U7FA 1VGQA 4BRUA 1EFUA 1MNAA 1QIEA 4YDSA 4KJZA 4L1KA 2JHFA 3GXBA 4G8DA 2W70A 4K3UA 1T15A 3DHEA 5E2AA 3CZ5A 1JR6A 2PVSA 2XB4A 3IH5A 2IUYA 5AVYA 2FB9A 2FLWA 2H2HA 1SUSA 1SZPA 2WJ4A 4O2AA 3LVBA 4FX5A 1TU4A 4NU5A 3Q3EA 4GOOD 4PVCA 4UHCA 1ZHFA 3H86A 5HF5A 1DEHA 2YYSA 3AHIA 3M89A 2QTVA 1F5SA 2WWHA 2XWJI 1TZ2A 3HZHA 1QVZA 1UMDA 4IKEA 1K9VF 4Q93A 4X94A 3W2HA 3JYPA 2ATIA 1G20B 1WQ4A 4OG2A 4X8HA 2VZ0A 5DM1A 2GZAA 1II8A 2VPTA 1VHLA 2FDRA 1IRXA 3VSDA 2FDXA 2VOEA 1KVTA 4R0NA 1K7SN 2AI1A 3E9NA 2F43B 4NNJA 2C07A 1CJSA 2I2CA 2PIDA 3ASZA 4KQXA 1SVOA 5A2QA 4WXMA 5TV2A 5LZ2A 5JUWA 4KHPB 3LUKA 3NHWA 2LKDA 1HUQA 4I6JA 3MOSA 3GEMA 4RTLA 1VHDA 4PAOA 4W5JA 4WNAB 4EGSA 4GPAA 4PZYA 3F74A 3TMYA 2OHOA 4N9WA 5AM5A 3T3HA 5A1TA 2GEFA 1QQ7A 5BW6B 3UV3A 2W6IA 2C3MA 2YN2A 3EF3A 4R1PA 1OV6A 2A1TR 2XWPA 3H5IA 1E1RA 2C03A 5A4JA 2VN8A 3RYHA 9LDTA 1N5DA 5FLYA 1LDEA 3IILA 4FDUA 1WZUA 1KR2A 3RUCA 4XX0A 3QELA 5AXBA 1AV6A 5LM3A 1QLJA 5J4KA 4WACA 3PEVA 4J7CA 5F2OA 4D74A 4M4SA 3R7BA 1TZMA 1YOBA 1XXHA 4L3WA 4JLDA 3K15A 4ZAWA 1WW2A 1NSTA 1MOSA 3GELA 5FBRB 3KAJA 4BWVA 5CIYA 1Z7BA 5MHTA 1EFRA 1JEEA 1EVKA 4WLVA 1OT5A 3RU7A 2QNRA 1DS6A 1R9MA 3LKZA 2GAIA 4V1CB 3UTCA 4EYOA 4ZZ0A 2PUCA 4H7PA 3I32A 3OIVA 4TYQA 3QKUA 5IUNC 1Z2CA 3W5VA 1EPUA 4NY1A 4V0SA 1MBZA 3TJRA 3WHLA 5AVSA 4HGZA 3AEUB 3ZUGA 5IYZF 1O94A 1H42A 1CEEA 1TX4B 4PG7A 3V1UA 3STTA 1EBUA 1NOKA 3TBHA 2VL7A 3TNYA 4I1YA 2EP5A 1AXGA 1QGUA 1UMCA 1ZCJA 5FF9A 4N8EA 2PUJA 1ATIA 1U11A 3P7MA 1FQKA 1XRJA 2HDHA 3OEYA 2VDPB 1ZVKA 3U60B 1HK7A 1GNVA 4WK4B 4QWWA 4W99A 3N7TA 2VT7A 3LOPA 3SJ7A 3F90A 3SF8A 3FZEA 5DNVA 3ZDFA 2IUEA 1YD7A 3WXMA 1PTJC 4YJ3F 1OLUB 5TEWA 4OAPA 3L43A 4PTZA 3PF9A 1H4TA 3NDRA 2DJ5A 1BHJA 4FDAA 1KZ9A 1FU8A 3GMIA 1GYRA 3KLNA 1VE9A 1XKQA 4Y3UA 4HEA1 1RRFA 3DV0B 2IXGA 5LZ9A 5BMVF 4DUPA 1ZI6A 5JRZA 2Z8ZA 1R8SA 3OETA 1N6LA 5A62A 2V4MA 4JVOA 1P1RA 4AI6A 4FNGA 3ICQB 1YR7A 3B89A 4BLTA 1I9CA 5E38A 2MSEB 3UMFA 2IYFA 1AY0A 1U3CA 1XAJA 2OCBA 2J0UB 2QJFA 4NJMB 4TSFD 1ZGZA 3U7QB 4AG3A 3KSBC 3HJRA 3C3JA 2PJRA 3GK3A 3IAHA 2G9VA 1QX4A 1OAOC 1UADA 1YDGA 3IBSA 1GWNA 3AEKA 2HOQA 3E1KA 3K20A 3NORA 2V7VA 4KQEA 3VHXA 5AVRA 2DSTA 4M9CA 3ZTWA 1YOVB 1WBBA 3FI9A 4OFBA 3ZGZA 3KL4A 1R0CA 2D2IA 3R41A 4WMLA 1JIXA 3ZWXA 2ID7A 2QN1A 5I7VA 2QIOA 3A6DA 2IS1A 1M2JA 3R3VA 1MOQA 2HX1A 3IUPA 1C7JA 5T41A 1S4QA 1YDHA 2IP2A 2VQFB 4B81A 3R7LA 4ATNA 2CF6A 1GLNA 2OOSA 3DE6X 1G7RA 2ANCA 1FVXA 1Z18A 2OB1A 4Q66C 3EQ7A 4AO6A 3TOSA 1W6RA 3Q11A 4BLOA 1FMCA 4UCWA 4BNYA 2ARKA 1EEHA 1E77A 3FMPB 4Y6SA 5ED4A 2O54A 2ZIWB 1E3WA 3KVVA 1GEGA 4Z7OB 1U6JA 5E7QA 1BS1A 4FKZA 4Q3NA 4UTOA 3VU9B 3HY3A 1UODA 1R6VA 2ACWA 5IMSA 1YI1A 2C00A 1NR5A 4BNKA 2J0EA 2R1VA 2OMEA 2OC9A 2AF3C 2FSUA 1TXGA 3A1TA 1LDYA 4KXLA 1Q1ZA 5JMPA 4C5AA