5CLGA

Structure of pure (n5-carboxyaminoimidazole ribonucleotide mutase) mutant h59n from the acidophilic bacterium acetobacter aceti, at ph 5.4
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
159
structure length
156
Chain Sequence
SAPVVGIIMGSQSDWETMRHADALLTELEIPHETLIVSANRTPDRLADYARTAAERGLNVIIAGAGGAAHLPGMCAAWTRLPVLGVPVELKGMDSLLSIVQMPGGVPVGTLAIGASGAKNAALLAASILALYNPALAARLETWRALQTASVPNSPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords N5-carboxyaminoimidazole ribonucleotide mutase
publication title Structure of a single tryptophan mutant of Acetobacter aceti PurE
rcsb
source organism Acetobacter aceti 1023
total genus 52
structure length 156
sequence length 159
chains with identical sequence B
ec nomenclature ec 5.4.99.18: 5-(carboxyamino)imidazole ribonucleotide mutase.
pdb deposition date 2015-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00731 AIRC AIR carboxylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.7700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold PurE domain 5clgA00
3RG8A 4AY3A 5CLGA 5BORA 2YWXA 1QCZA 4AY4A 2FW9A 4B4KA 1O4VA 3RGGA 3OPQA 5BOSB 4ZJYA 2FW1A 2FW8A 4JA0A 1D7AA 3KUUA 2FWBA 4ZC8A 4YCDA 2NSJA 2FWIA 3ORSA 4YCBA 5CLJA 4ZK2A 5CLFA 2NSHA 5C5DA 2FW6A 3LP6A 4Z7JA 2NSLA 3TRHA 5CLHA 2FWJA 4YCCA 5CVTA 2ATEA 4GRDA 2FWPA 2H31A 2FW7A 5CLIA 2FWAA 5BOSA 4ZMBA 1XMPA 5CTJA 3OOWA 4YCJA 1U11A
chains in the Genus database with same CATH superfamily
1AF7A 3GFSA 3NHFA 3PYLA 3TNDA 2P6UA 5CEJA 5IZCC 4JXJA 3WO0A 4OKNA 1XKXA 4GOMD 3IOEA 4Z3KA 3H4TA 1QC5B 1REQA 2A1TR 4JXKA 2C77A 4HMQA 4YAWA 5HQJA 2ZJFA 5B30A 4QPDA 4OXXA 1RYDA 1BS1A 1T8YA 1U8TA 3OT5A 1GQSA 3PHCA 2XTMA 3BL8A 1FUUA 1PGQA 4X6UA 3SKYA 4KOEC 4AWBA 3LY9A 3WYBA 4YFYA 3WHPA 3L77A 2O8VA 3QNUA 3RKSA 2DC1A 2EF0A 4U7GA 2NUTA 1KI4A 1Y81A 2ECPA 3DMYA 4NY1A 3R6TA 2H3EA 2OFOA 5ICSA 4F9GA 4IHAA 1DPGA 2FPOA 3D6FA 3JR3A 2JGJA 2VUIB 4G0WA 2OCXA 4K05A 2OM6A 5EE1A 3VTFA 1SHTX 3QMWA 4H77A 3NVKI 4WY8A 3SYKA 4NCKA 3FDJA 5DNWA 4A6DA 1QIJA 5HJ5A 2PCJA 4EUNA 1NNEA 1HTWA 1Y8CA 1CR6A 2VZ0A 4OJNA 4F5YA 5DM2A 2KM1A 1ISIA 1RAIA 3LDGA 4FEAA 3NDJA 2WJGA 2X0JA 4YCDA 4QJIA 1JFFA 1AKNA 2PGOA 3LUAA 5DHSA 1OJ7A 4DEYA 3QKWA 1G5IA 1CJBA 1FZQA 5HIAA 1JQDA 4IUCS 3TIVA 4KLCA 2O48X 3HKBA 3NVMB 3SC6A 1Q0LA 2OILA 4D8XA 5HRCA 3OKPA 2HNKA 1FMCA 3H0CA 4XPIB 3PD1A 3DKRA 3GGDA 1NJGA 2WDZA 3AR6A 5IAEA 4UTNA 3KT3A 1WD5A 2CL0X 3PA6A 2PUFA 1WP9A 3T5GA 2O3SA 4OFZA 3IEIA 2EJTA 1P3DA 4IICA 3H2YA 1NQVA 2BCGY 2D8AA 2K6GA 3REGA 2R66A 4HSGA 1YQ9A 3U3OA 1XTQA 3B13B 4X24A 4I1OA 2O3QA 1GQQA 3MGKA 5DBFA 1A27A 5CA0F 1X1RA 4X7BA 3JU3A 2GEJA 2R5FA 2VRBA 3OPNA 5F35A 1POWA 2YMLA 2R5NA 3D1JA 4I55F 4TWBA 5HQ3A 2WSLA 3VTKA 1NUHA 2ZZNA 3ZJVA 2HLDD 1FYXA 1PZEA 5A5FA 3CJQA 4HFRA 5C4GB 3TJRA 5JXWA 4C5AA 1U0FA 2PSFA 1NI3A 2FPSA 3AESA 2VP6A 4ZGGA 3EVZA 4R83A 3O8CA 2Y0BA 3MLAA 2O1EA 4IUDS 4MCJA 3TBFA 3MWKA 5F52A 4BGIA 1FP1D 4XWYA 4BQQA 3NXKA 5JEDA 2C9ZA 2PA3A 3A1TA 1SCUA 5CNJA 1HYEA 5ELLA 1M2OA 1NJ8A 3DL0A 3LQQA 4B1FA 1RLJA 2IK8A 4HYEA 3K9BA 3PXUA 3IA7A 1BVUA 1KFEB 4BMPB 6YASA 5BR8B 4Q37A 4TRMA 3M3PA 1AZTA 2MYUA 5CK5A 3UXEA 4N76A 2PWAA 3P2OA 4U8HA 2MYTA 1D6JA 3D6MA 3LFUA 1P9OA 2I1LA 3RHFA 5IZ4A 2OK7A 2P6MA 1P2VA 2A86A 3I39X 4NU5A 4KBFA 3TUZC 2VBIA 3H2JA 4BZXA 3BDVA 3LRPA 4C6HA 1E7SA 4Z7QB 1THZA 5HBGA 3CUVA 5BUZA 1KRXA 4O2BB 1KSHA 2F9LA 2IYSA 3N53A 3N75A 4X9XA 5TPWA 2YDXA 2ZRDA 1FRNA 1IAVA 2I99A 3U4MA 3TLAA 1DJQA 4ATNA 1V6CA 4ARBA 4P7FA 5JZSA 5KYKA 1NR5A 2WWGA 4KKVA 4CL3A 1Y3CE 3IPYA 2NUBA 5IX8A 4CKBB 4KN5A 2DULA 5CAEB 1W5FA 5EMLA 3LHKA 1Q19A 2VDWB 5E6RA 3TD9A 2CSUA 1K6MA 3ROTA 1FFWA 4B71A 1W9HA 4CCSA 5CB6A 1NVUQ 1XUOA 2PZEA 1S9HA 2XZDA 3FAZA 2FI1A 4KE6A 4PLHA 4IDAA 3JVDA 3COPA 4LXGA 3ULKA 1W6RA 5JNSA 1XNQB 5TEWA 3NASA 4J43A 3A6FA 3IBCA 1U3WA 2QZJA 4MYTA 2G06A 3DCYA 1SC6A 3NTVA 3PF9A 3GY0A 2AFHA 1YJ8A 2Y0DA 3QOFA 4URUR 5B3AA 3B78A 5FP0A 2J30A 3A36A 4TRNA 5HXAA 3T4PA 3TW4A 4V0ME 2RAVA 2CVQA 4MQEB 1PNRA 3VKUA 2CMGA 1RM4A 4LBYA 1K7XB 3ZJYA 3NETA 3R6LA 3T3EA 4KITB 1JBQA 3ESXA 3L1IA 4NZPA 3E48A 3AV3A 4RACA 1GEGA 2CVZA 2N47A 2Z1DA 4R31A 4ENUA 4R71A 5AW8A 1SHLA 4JFAA 4IDQA 1CHNA 3GLHE 4RC9A 3P97A 1L9KA 3T06B 4GMKA 3E6AA 2ODBA 1JFRA 5FFFA 5GGXA 3O8OA 1NOJA 4RSMA 3NVAA 4C5CA 2OUIA 5MF6A 3F97A 1SWVA 1IXZA 4ASUA 3UGJA 3NEAA 3DTYA 4D97A 1L5OA 2X5JO 1XVTA 1CUUA 3RC1A 5BW5A 3GWGA 4MRRA 1ZL2A 2IHVA 2IYZA 5FV7A 3EVCA 2CHFA 3FGPA 3EZNA 3K71B 3CS3A 1PGPA 4G5SA 5HMMA 1R4ZA 3S2SA 4HB2A 4FHCA 1E6KA 3CLRC 1YFKA 4WZ6A 5DOZA 3SF0A 3F5FA 3QHPA 3ZY2A 4YRNA 4GOXA 5DYIA 4B17A 5CDUA 2H17A 4WY5A 2AEJA 2H6EA 2RI6A 2V5VA 1T2UA 2UVQA 1UMDA 1KP3A 2XUZA 1K6IA 3HXOA 1RYZA 1IQPA 3PLRA 4R1LA 3T0IA 5G4LA 1YH3A 4NV3A 3O9ZA 4M7OA 2H7VA 1DLIA 1N3BA 3WGQA 1SY7A 1WZNA 1S5PA 4J0KA 3W6OA 3S40A 4BVGA 1XZGA 1WCYA 2GT1A 2ZE6A 1CFJA 4MV8A 4RFLA 4UBMA 3QW4B 4L5BA 4P4TA 5JV5A 1HDRA 4R01A 5CT6A 2IYXA 5FT9A 2J7KA 1ACJA 2YQZA 2I7VA 5IT0A 3NHZA 1AT1A 2G63A 2UU9B 3X43A 4OUDB 4MUYA 4WBXC 2QA5A 4Z9XA 3ECSA 3D0KA 2E37A 4LJSA 3FSEA 2XE8A 4HWKA 3HC7A 1N1MA 4KQIA 2I4OA 3DUFB 4BMYA 4PRZA 3VOTA 5H9WA 1N2HA 5JS7A 1P1BA 2H4YA 1OV4A 2W4MA 1JP7A 4IFEA 1RCTE 4LGVA 4MV4A 4Q3EA 3SP1A 1M0TA 2ENWA 4CKCB 1C0IA 1ZAKA 1B8NA 3I0MA 3I1YA 2Y1OA 2ZRBA 3COSA 2AA3A 3QLJA 4F46A 1XTKA 5DSTA 1DPFA 4BJ5A 3R4CA 2JA2A 3CQ9A 4ZOAA 3WAGA 3HBAA 4CG1A 4ZJUA 1J56A 4FZJA 3OM9A 5GINE 5LP1A 4OAOA 1KZ9A 2V6JA 1IWBB 4EL5A 3BRCA 5CFZA 1LWNA 2NVUA 3ANSA 4HS4A 4KIJA 1ESDA 4XWOA 2IEZA 1SO8A 2CNWD 5CCDA 5IWCA 1HYQA 3KSDO 1BDMA 2Y93A 4HKTA 4LOHA 4Y6PA 4RULA 2CHEA 3CN7A 1L8LA 2Q8NA 2P5TB 3JALB 4GLJA 3PSHA 1RU3A 2KWIA 4RQTA 2HV8A 2XYGA 5BYAA 3CF4A 1B42A 4URWR 1SOMA 1YBAA 4UDOA 3DZFA 3OTHA 1GL6A 1KC3A 1G1MA 3OVMA 4F3KA 4ZOCA 3RYIB 2R1VA 1YT5A 3WGUA 3HCOA 3OJFA 3QEOA 3ZGNA 3QBVA 1TJNA 3DNMA 2GLTA 3A3NA 4PO8A 5CGQB 3W06A 1GGNA 2O7NA 3MPOA 4P7KA 2RJOA 4RQBA 4B85A 4JN6B 2EZTA 1IJBA 4L9SA 2AKAB 1AXRA 1G8PA 4RK5A 5JSHA 1KKLA 1UKYA 1XNGA 2NSJA 1ZIOA 3FCAA 5A3SA 1QU2A 3WKBA 5GIPE 4DV0B 1ZD9A 1ZZGA 4J1TC 4KVZA 2QMUA 1G2OA 2EJUA 2W6QA 3JSAA 3K2IA 4MQFA 5AHWA 4B6RA 4JI2B 3D2LA 4MR8A 2YTZA 3W7AA 2Q3EA 4Z2YA 3IQDB 4NBNA 2OBYA 4D6PA 2IIQA 1V0JA 3HGMA 2QZZA 3FPEA 2OCLA 3KVNA 3Q72A 2Y3IA 2XDAA 2PKRA 2AMJA 1PGNA 3PDJA 4K6CA 4LYDA 1N4DA 2R8RA 4B4KA 2I78A 4QUHA 1F06A 1KSJA 1A8PA 1L3CA 1A9OA 2CNWA 2CXOA 2H07A 4MB2A 5TMEA 3E03A 2I2WA 2CLDX 4M8NE 5CA0A 3HJGA 4B9EA 4DDHA 3DE7X 4DTCA 1P6XA 3G2HA 3K1YA 4X65B 5HRUA 1K0UA 1GPUA 3A9UA 4RVFA 1QQTA 1ZESA 4G9BA 5JPIA 3EFEA 2BTEA 3TFQA 4KVAA 3WRXA 3N3AC 1JG3A 3PNVA 1PSWA 4C03A 5BQFA 5JXJA 1E32A 1NXVA 1QWSA 3EWIA 4KKXB 4YHBA 1JDSA 2QLMA 2YVUA 5BOSA 4JLBA 5LMNB 4I5GA 4KXMA 4JAVC 4JJKA 4TTRA 2F59A 4I2VA 1VIVA 3ONDA 4UNNA 4RTLA 5ILGA 4F97A 4YI5A 1NR1A 2ONYA 3BMQB 2C0CA 1DSSG 3A06A 3I6YA 3LC1O 2ODPA 5L3RA 2NQ2C 3KL4A 2Z3WA 3OTWA 1FLNA 4KR0A 1K4KA 1RHMA 1S2OA 2JASA 3FFWA 2XMCA 4TKVB 1JYEA 4XVHA 5D00A 1QGED 4Q9NA 4YMGA 2O7RA 4ZA2A 2A67A 3I2GA 3AETB 1QDLB 2IS4A 3INGA 3GRRA 1FNCA 1MB4A 1NJSA 2ECKA 4FGZA 4XUEA 3HCCA 4QX6A 5DE3A 2QN9A 3NHUA 4M22A 3H4VA 4A15A 1EU1A 5EXSA 3V1UA 2W70A 1KEEA 4LI3X 4E46A 1RI1A 1TQ6A 1H1LA 5ICFA 3BFJA 3EZXA 3FKJA 3MJDA 4UU0A 4Q4JB 1XMOB 3RO7A 1QG4A 1ZLYA 4O8CA 1NI5A 4MA4A 3UWKA 1DKPA 4ZZ2A 1SN7A 2P0AA 3GN1A 4QUIA 1A9QA 1YS9A 2P9GA 4XD7D 5G0SA 2XGMA 1O8BA 5DNEA 4TTVA 4V1CI 5FWNA 2X8BA 2XTZA 3NHKA 1COZA 2XNSA 3KZKA 1MRZA 2NYUA 3MXTA 5DJ5A 5ALNA 3WHLA 4EZEA 1U0EA 5C52B 1Z4OA 5D86A 1KO4A 2OD9A 1KJJA 1EK1A 1RMTA 4TMYA 1M5RA 4LBZA 5KHLB 2ORVA 3K0SA 2XVMA 2PGXA 2JFZA 1M5TA 2HJGA 2ZQYA 3COWA 1C41A 2CXTA 4ZANA 1C9JA 3SE7A 4S1WA 3THRA 2I29A 3NS7A 2Q6LA 2VTVA 2COEA 1HMPA 3IESA 4P93A 4ZK6A 1MW8X 1P7YA 1BDBA 3LBIA 2IF2A 521PA 2VCHA 1ZUIA 4JWKA 4AMGA 4OU4A 1N0VC 2YW2A 4NECA 4DCMA 1K98A 3QVTA 3MCAA 1AGXA 2VSQA 3B36A 4IILA 3IMGA 5CG2A 1IHUA 1BCRA 2QNBA 1J09A 4Z7JA 1Z17A 1YNSA 2WP0A 1EHYA 1AS0A 4GOOD 4I14A 2UKDA 2FRDA 2FZEA 4LTNA 2JD1A 2NGRA 1OY1A 2RSLA 4LQDA 3TRKA 1KDVA 1S8FA 4HVCA 3ZCRA 4F72A 4URZR 3H83A 4BGUA 3DPIA 4BGDA 4JY7A 1W5BA 5YASA 3ZKWA 1QZUA 1F51E 2V7QD 4XD7A 3S2IA 3WBJA 1TRKA 4AN0A 4BFLA 4ZO8A 3NP9A 4YMUA 4J1SA 2VAWA 1LQ2A 5A4KA 3KAQA 1RE1A 3LKVA 4LF7B 4KX3A 1SFRA 2DQKA 1L7EA 1NLZA 2W22A 4OF4A 3IXQA 1OWOA 2FP3A 3OCUA 2ZJ1A 4R1OA 4C0KA 5AJWA 3WDKA 4BNTA 3H11A 3CRMA 2O8FB 4EB0A 1G5FA 3MG9A 4OHFA 2Z95A 5JIBA 1CZOA 1OXUA 1RYHA 4JQYA 5I7HA 4FS3A 2RAFA 4JH0A 2GKSA 3KRTA 4PFSA 5DP2A 5JEEA 2PKCA 1Y8AA 4KXVA 1VLLA 3B1FA 3QGMA 5D3MB 2TS1A 3T3MB 3KC2A 4BO4A 5LZ9A 1AOXA 3E7XA 3EIFA 1UOEA 2ZT6A 3KJEA 3NWOA 4MW9A 2IXEA 3LBHA 3V3KA 4F56A 4E1BA 1Y1RA 1EUZA 1FW8A 1UR5A 4WUVA 1AB6A 3WWOA 1SKAA 4PYQA 4HT3B 5KPJA 1JPNA 4OP3A 1P73A 3TBKA 2VH1A 5DMXA 3LPLA 3PCTA 1FRZA 3IJ5A 2PL3A 3LGSA 1BU8A 1SM4A 3ZLJA 1KIFA 3MUNA 5IVIA 1G16A 1T8RA 4YBRA 3RWMB 4ENVA 5EUMA 3HVRA 4D8UA 3MSCA 1P7WA 2I4TA 4MYHA 3HBFA 4DLVA 5COAA 3EVTA 2FZWA 2Q46A 3ANYB 1FDRA 2HK8A 2JH9A 4O6VA 4BWFB 3GFOA 2J45A 3BA1A 4MVJH 1QZZA 2C5SA 2XMQA 3THOA 5K6AC 3OSZA 2GYVA 2XUQA 1K7CA 1T0IA 2GM5A 1W30A 4RV9A 2YWCA 1Z5VA 2G3YA 2RK6A 3LVQE 4BO6A 2RIPA 3FVWA 3U60B 3GUHA 4Q9DA 4MV1A 4PLCA 4MINA 4J9UE 3M89A 1KZGB 1UIRA 1VE1A 1N5RA 3AINA 3QVXA 3ASYA 3FMIA 1JR6A 3T9DA 1L5GB 3GEDA 1NATA 2ADFA 4I81A 4MQUA 4KAAA 1J49A 1E1DA 4PAMA 4Q3NA 4ARUA 4BFUA 2AIRA 3G0CA 3R77A 2H48A 4J49A 1ESNA 3PSAA 1IM8A 2J6CA 3OJOA 3GGJA 4CVNA 4LDAA 5IUKC 1H2ZA 2DY1A 4RL6A 4CEJB 5FWXB 4UM8B 1RKVA 1HNZB 2ZZMA 3LY5A 3OCYA 1MVLA 4BP9A 1T8UA 5AK5A 2PR2A 1MIOA 1RXUA 3HDYA 5CM2Z 1TJ4A 5EZYA 2DFVA 4X7RA 1O94C 2ZITA 3DZ8A 4KWEA 3TOXA 3ACCA 5C8VA 3FTPA 2AJBA 2NZUG 3KEOA 4X20B 4CM7A 1KK0A 5HKOA 1LVGA 2GD2A 4Q18A 3NNNA 2GLUA 1T26A 4EUSA 3IT3A 4JMLA 5AICA 3UH0A 2HYDA 4GX5A 4YP1A 3KTAA 2NZVG 3FWPA 1E1MA 3WWYA 4B7UA 2OTCA 4R2HA 4EAQA 2AR7A 1A2OA 5EMHA 5FL7D 2EW2A 2QT9A 3F71A 1X39A 2Z56A 2PKYX 2V4UA 3L6RA 2W2QA 4QUBA 4TXMA 2JL1A 5DB4A 3RLIA 1JAIA 2GK7A 2HBRA 2X4LA 1PVDA 4TS3A 4YJ3B 2HKIA 2PSDA 2GBGA 3NGMA 3IQXA 4ARZB 5AW9A 2V1UA 4NMMA 3QY9A 3B89A 4TYQA 1AMOA 4IXTA 5IAJA 1TCVA 1J8VA 1AKRA 2O57A 2P4HX 3HKEA 3QVLA 3L7YA 4QGSA 4ZCTA 2W6OA 1KJIA 2H3HA 4DPLA 1SOVA 1E6UA 4UD6A 3CT4A 1LDYA 1FTYA 2YWEA 4LWQA 5KEIA 4FFPA 3C4VA 4PWYA 3IR6A 4FFVA 5TVKA 5JH7B 3U61B 2IFTA 4I1PA 2HIHA 2Y1KA 3KHTA 4HNAA 1O9HA 1X9GA 3CT6A 3HUFA 4IGKA 2WZQA 3BFVA 4MV3A 3ZVNA 4HG2A 5J59A 1P9RA 5CB0A 1LSOA 3KJQA 4L9AA 2YVLA 4P4GA 1P2DA 3TQCA 2B37A 2NU6B 4RXTA 3OTOB 2ON6A 4YRSA 2UYGA 1E64A 5JHGB 4NX2A 4PSDA 5LQNA 2EWMA 2O8DA 5EMJA 3FPGA 3A58B 2VSNA 4OOFA 5IHXA 4GOND 1Q6YA 4ZVRA 4DJDC 1K88A 1R4NB 5DV9A 5E6SB 3F9IA 4BASA 4ZCQA 4L6IA 1RP7A 4YP5A 5TS3A 3UT0A 3Q2OA 4O2AA 2GCPA 2YINC 5CVDA 4OHUA 4P7JA 1IOWA 3O8LA 5FL7A 4KE7A 4M1QA 1XRQA 1VPTA 4NSNA 2IYUA 4RMHA 2FR8A 1TZ2A 1BXRA 2DSNA 4M8KA 1JEEA 5BSWA 1Q0HA 4BVJA 2FDCA 3HI6A 2OZVA 4D8TA 3GIWA 3F6PA 1M2WA 3H0KA 3NIWA 1EYZA 5TE9A 3CVVA 1GUZA 1H65A 2R86A 5T3YA 1Y1PA 1HDIA 2DFNA 4LEIA 5SYAA 5JWRA 5BMVF 3HVJA 4D4IA 2G5GX 3Q41A 4YP6A 2HNAA 3OU6A 5K09A 5BVGB 4RKRA 3ZXXA 1R9GA 1RWMA 3H1EA 1IOZA 4DV5B 4FE4A 5AKKA 4D9EA 4YCNA 1XP5A 5LOVB 1DG1G 5KQPA 1KMIY 1I3KA 1RC0A 2HHJA 2IPXA 2VBGA 4WVFA 5TNXA 5ESDA 3EULA 3RVDA 3U3MA 3JQGB 1F4LA 3ZHTA 2XZTA 3NWEA 1OI2A 4LF5B 1XEWX 1YWGO 1TM1E 1FJGB 3Q5EA 1FTSA 4F92B 5D5PA 2VP2A 4DWOA 4E7PA 3WS7A 5HGJA 3GVHA 1OZAA 4KQ2A 5FULA 5DBGA 2POQX 2SKCA 5E4YA 2NXWA 2HMUA 2B5VA 3LHFA 2PS0A 1H5QA 3SZLA 1OXTA 3NOXA 1Q5PA 1EX6A 4FKBA 7ABPA 1KVQA 4AZTA 3R6GA 4MDEA 3ISVA 3LCUA 4TV9B 4A1FA 1WXGA 1E2LA 1B0ZA 4G89A 2JCGA 5AJXA 3TF5A 1YJ5A 1UBNA 4A9AA 4TYMA 2C88A 1VRCA 4FYYA 2IHYA 2X0FA 4YRGA 1E2FA 5E3JA 4L0DA 1HT3A 3DNPA 3A9RA 3DFZA 3LKDA 3WL6A 3KR1A 1H2RS 3RBZA 1DXYA 1JHQA 3X3HA 3U1BA 3BS4A 1Y80A 3ADCA 1P0QA 5IXSA 2C7RA 2BI4A 4DQKA 2XT0A 4GPIB 1R6UA 2OXCA 3OCXA 3JQ8A 1IZZA 1S89A 2Z8YA 2IYVA 3HBMA 3PL5A 5K3FA 5JAIA 3G0BA 4W9MC 4JIMA 1WY7A 2YJZA 2NTNA 4KLZA 3QLUC 1Z18A 4LMPA 4Q4DA 4S2UA 3ZJ4A 4NESA 2HJWA 3MS4A 3NJRA 5I5GA 2MSNA 1Z0IA 1FVHA 3FUXA 2WIKA 3K32A 3MWGA 4TV8A 3O1IC 4Q9IA 3T9AA 3OFKA 4MWOA 2O2DA 4FIZA 4EYGA 2DT8A 2D4AA 1ZRSA 1YJBA 3SQMA 3L6UA 1T5DX 1EFTA 4W5NA 3K70C 2GEDA 1LLCA 2C4WA 2P2YA 1EHCA 4B4VA 1B43A 3SF8B 1S2LA 3O4GA 5LYYA 3EZ2A 1WZUA 4HH0A 3RU2A 3MJRA 4CL8A 2ZAIA 2DU8A 4KPUA 1J0EA 4W63A 1NJ1A 1JXAA 1PT9A 1PJ8A 3J80A 5CCBA 4UXHA 3AC0A 2ATXA 1GNTA 1DV1A 4W7IA 5IMSA 1J6UA 1W29A 1ZK2A 2QTCA 4C4TA 4F38A 1T15A 4B31A 1PT7A 2WJYA 4QHSA 4U6QA 1N8TA 3CLVA 5EZYF 5F12A 3OQMA 1IFXA 2V58A 2GF2A 3EQ7A 5H70A 4EAAA 1H23A 4RPHA 1UFKA 1D6NA 1WKCA 1L5QA 4PC1A 2VO1A 1ULBA 4CTKA 4IZ6A 1YDGA 3DM9B 1P5JA 1Z0ZA 3M7IA 4MR9B 4ZAYA 5C5DA 1LEHA 1EDEA 1JBEA 2ODEA 4PPNA 1WW3A 1MBZA 4MV9A 5DBHX 3M6VA 5EJ6A 3QXJA 5EA2A 4IVQA 3MRXA 1AO3A 1E20A 2GKGA 3SOZA 4AU1A 2A5GA 2XQGA 4DDWA 1V8OA 1JH9A 3L4SO 3Q7SA 1U11A 3TKYA 3ZHBA 2WJ3A 1ZIDA 1PT6A 3B1ZA 3DHWC 3QXXA 4OSOA 4S1NA 5H80A 4FQ7A 1P4HA 2B4QA 1TIBA 3EZGA 2A7QA 4A6PA 3T3DA 3UB4A 2C96A 3I2KA 5HKLA 1YCGA 4ETMA 1KVRA 1XK7A 3L7MA 3A7EA 5EXEA 4FKMA 2F3TA 2WILA 1FDSA 1SK8A 5E2AA 4PHGA 4GL4A 5EXPA 4PNPA 3CLUD 4X41A 3HCNA 3PI6A 3T9FA 4RCVA 3UV7A 5LQUA 2PO5A 4BMNA 5GONB 3EXG1 3TSOA 3HEAA 5CJPA 2Y0EA 3B1VA 1ZK4A 3RTEA 1KP9A 1SUIA 3O5AA 1NC1A 3BD7A 2HPHA 4I4CA 2CK3D 1C3JA 2FR0A 3MJFA 2XRMA 5DK4A 2ZJYA 3TQFA 4YRKA 2ACWA 2GBLC 3D4LA 3LC7O 2YCLA 4BDTA 4G63A 4ESOA 1G64A 1GPDG 1TQDA 4F93B 1TUEA 2H1LA 3A6DA 2Z4RA 4G1FA 3WL7A 3B9RA 2OE2A 2V74B 4HQ6A 2YOFA 3NTLA 4MS3B 4REMA 5EMNA 4O2AF 1KSGA 1Z4JA 4D0NA 3AG5A 1LCIA 4D9JA 4EVQA 4UD2A 3EZ7A 4QA9A 3ORQA 4QTUB 4OA5A 3RJTA 4BFYA 2DEUA 4ZO9A 2HR1A 1HTTA 1UF9A 5U1PA 2VJKA 4QRDA 1Z35A 3R9KA 3B5JA 3HVIA 2B1RA 1MXHA 2HSZA 3AI2A 4PFKA 5DULA 2XR1A 3E8MA 5GWXA 4EELA 4NXMB 5ED4A 3RRNA 3IULA 4TTIA 1T43A 3LXRA 3VX3A 3R3VA 3KR0A 4D42A 3NOVA 1WSWA 2V45A 1LK5A 2OCAA 1W4ZA 4HAYA 3ERCA 1ZNZA 4B8WA 1E1NA 2CWWA 5JYBA 1ZN9A 1T2DA 4LRTB 3M9WA 2NU8B 4L51A 4HUQA 5HSGA 2O2JA 3BFXA 3DAGA 4MQ4A 1EWYA 2YXPX 3H87A 2BV3A 3X1WA 3FSRA 5IYZB 2IH2A 4XJVA 2Z08A 3U13A 4G0OA 4R1PA 3TMKA 3ZVKA 4EYKA 4B5LA 3LM8A 4F96A 3JZIA 5FTLA 3E82A 1ETUA 2G17A 3I6ZA 1H22A 1OI4A 1Y9AA 3DLTA 5LCXA 3OETA 2HHHB 4XIGS 3UOWA 4DCOA 2GFHA 4LF8B 4LXQA 4RVUA 2BISA 2CK3A 1KEUA 3K0BA 3OJLA 4PPGA 3U7JA 4B44A 3QMVA 2JJ2D 1HTBA 3EVBA 3TMYA 4C7OB 2D5LA 3CISA 4PYNA 1XJ0A 2OBFA 1A7JA 2XDQB 3K0AA 3L7KA 3QUTA 1P2BA 4UUQA 4ZT6A 3UJCA 3S29A 4EW3A 3U5ZB 1M3SA 3F6EX 5BNZA 2C5AA 2BM1A 2XUGA 1Z56C 4F2WA 4DV1B 4WWHA 3UMBA 3EA4A 3LUJA 3LL4A 4GDMA 4TSFD 4EFNA 2ZDGA 5KSZA 3LGXA 1Q16A 3A2MA 4EHJA 4KW7A 3ZV3A 1P80A 4ESEA 2AF4C 1EEXB 3PF8A 3JZAA 1ZGCA 4LTDA 1TD1A 4NDAA 1B74A 2XRFA 4JVMA 1ORRA 3DJYA 3RS0A 3UEOA 4AS1A 1NI4B 4MKGA 3NTQA 4M0DA 2G8NA 1XL0A 2VH5R 4I19A 2QX9A 3VYTB 1I3LA 1BXZA 2R4UA 3ZWBA 1YXMA 3A6LA 1V9LA 3CNEA 3JQBA 2ISSD 2JEOA 3PEEA 2R8OA 3TAHA 1X70A 4EBFA 1DAOA 2Y9MB 4PLPA 1MF7A 1IUPA 4F9EA 2WHYA 2EZ4A 2BHLA 4NZ9A 2PNJA 4R3WA 3L7LA 4UEQA 4US0R 5CLIA 4PIPA 5FI3A 3U44A 1JI3A 4WFJA 5BSGA 1RVV1 2R84A 2OWDA 4TV8F 5JPCA 2Q2QA 3EZLA 3PJRA 1RTKA 1C3LA 1EUDB 2ZJ2A 3MWYW 3RK0A 2H4WA 2FW0A 2LTAA 1EESA 1R4MA 5ALJA 1XRPA 3HXKA 1F7VA 3D31A 2WSMA 4PLFA 2AE2A 3FROA 3VV3A 4BKRA 7REQB 1JDVA 5CLFA 5EIHA 2BZGA 2PYIA 3N8HA 4FSDA 1PV2A 2JEYA 2JJ2A 3UWPA 4C0LA 3KLPX 4C78A 1KOJA 1WNFA 2F8SA 2PV7A 3PPIA 4X1YB 1Y5LA 2VT6A 1U1GA 3N7UA 1BVRA 4MUHA 3TAUA 1LBQA 2HMTA 1YULA 1T0JB 2WYHA 1M0WA 2Y1GA 4QBFA 4TL7A 1JI0A 5DNYB 2OMKA 1X2EA 3NOOA 2D1YA 1ZKDA 1I3NA 4KGXA 3K2EA 3GLRA 3BXZA 2FLWA 4NPHA 2G0NA 1IQUA 1DU4A 3HB5X 4IGIA 1O0SA 1HQDA 3K8OE 1F0KA 2QUBA 2HCBA 3UTCA 1PFKA 5CUQA 3B2EA 3OIWA 5TB5A 3UY4A 4TVSA 5F98A 3B1WA 3AZOA 3G9ZA 2Q5JA 1GILA 3WVNA 3LW7A 4FT2A 3NVDA 3HDJA 3PITA 2HF9A 2ESRA 2I22A 2PPLA 2C95A 1E2DA 2REQB 1IPEA 1TXGA 4MPJA 2C20A 4RH3A 4UAJA 2HIGA 1QOQB 3WTCA 5H68A 2ZYSA 3EK2A 5F9FA 2BRUC 5B53A 1WF3A 4II7A 1JECA 1JEDA 2XZPA 2F1HA 3NB0A 1J0XO 4F8YA 4Q00A 5EJ7A 2QNIA 1BA2A 3KUCA 3WP1B 1VCHA 1RPJA 2B8JA 2YQ5A 1Z2DA 4FEGA 2P65A 1GGHA 1Q7CA 3DDHA 1C4XA 1UODA 1IHDA 2ZR8A 3VZCA 2HSDA 2F2TA 3IA2A 3AXSA 5I8PA 4HRAA 4IXMA 2O8BB 2Q5QA 3AFNA 4G5YA 5K99A 3NAZA 1WMFA 2RJNA 5DYGA 2Q4BA 1ZD4A 1UFRA 3DOCA 4BLUA 1MC1A 7ADHA 5IVDA 5AW4A 2NUAB 1IQRA 5T64A 3AVOA 4FLEA 4NULA 2IV3A 4G4SO 3EEYA 1N5OX 3ONEA 5F78A 2ATVA 4B83A 1ULZA 2DX7A 3FOBA 2C5FA 2RH5A 4IIEA 2RGWA 2CNNA 2JDID 3E22A 4M60A 1RXCA 2R9VA 2XITA 3V33A 4BY9E 4AY5A 1D2CA 3G6WA 3GZ4A 2DHDA 2GXAA 1EK2A 3DLPX 1U0BB 1U2GA 3F49S 1OLUA 2PRJA 4DBZA 2UVPA 2HLHA 2C84A 3UOGA 4NBTA 2FFJA 3KKLA 3KT6A 4WX2B 4NF2A 3KEQA 5FUBA 5E4FA 5E1DA 3SJUA 3TQTA 4DIEA 1TGYA 1SCDA 3BJEA 2ZM6B 1IJFA 2G76A 3C5CA 4ZXPA 1UXKA 1CDDA 2B8EA 3DMTA 3B6JA 3BE6A 2R00C 2WJ6A 4AIIA 3SZOA 1L8AA 1SB9A 1HYHA 3P96A 4GI3A 5DT9A 2OQRA 1YB2A 3HHPA 4OB6A 2Y1EA 2YYYA 5L3QA 1NVKA 4FSHA 1TM4E 3C14C 1WUHS 4QXAA 4NCJA 3FWKA 4F1KA 1L4FA 4DMLA 5KU1A 3IT0A 1LUAA 2WA1A 2OOSA 4WXRA 3FLAA 1ZCZA 3MUFA 5BUSA 1CQIA 3ZWVA 4EQZA 1W7AA 1GKIA 2FWJA 2YOGA 4ZI7A 2P79A 3HABA 3EOAI 2YFQA 3C2QA 1BDIA 3X44A 3LUCA 3H5LA 3GNLA 3LKBA 4OIFA 3GFFA 2Z04A 2VRCD 2B6HA 2VDJA 3M5CA 3QX3A 1W36D 1EIWA 4RF5A 2ZRNA 3D8TA 2P7HA 3EIEA 4URFA 4HFMA 4B74A 4BNJA 5BORA 4QPCA 3C97A 4EGAA 3FDZB 5JUWA 2JDIA 2PBRA 2ZIUB 2Q3JA 1XU4A 2IUSA 3PX7A 4WA8A 5K05A 4HNHA 4KQ9A 5TQ0A 4HAZA 3KETA 3MTIA 1ZIXA 2G5CA 2SICE 1RJDA 3MBKA 1MOZA 4XQ9A 4YP7A 2WRZA 3RUHA 3W6NA 2GNAA 3CONA 5DTRA 2HJRA 3GFRA 3KOOA 4S2EA 4REQA 5B1DA 2L2QA 3FTQA 1W4RA 2FW7A 1A9XB 3FKSA 4GI5A 2OHJA 3P5BA 5ALDA 5M29A 4LKOA 3AVUA 1DXOA 4YVFA 1CZRA 1OW3B 2AZMA 3H6KA 5KOYA 1FIUA 4TLDA 1ILEA 1TYEB 4V0KA 4FFMA 4DCCA 2ZSHA 1WXFA 4C21A 2VCYA 5CB4B 3CUWA 1HR0B 3IBTA 3HJFA 1AURA 3GLTA 1TOAA 2C58A 3KK0A 4C4YA 2D6FA 2D5IA 4RPJA 1HFEL 1L5MA 5G0UA 4CV0A 3AFHA 2PY6A 3FYSA 5LBTA 3HMKA 4WQMA 4R0MA 3KYDA 3A3OA 3MINB 3MTBA 5CDFA 3HP1A 5D3KA 5EZ6B 3KDSE 3NW9A 3WK5A 5BSMA 4GXNA 2IKSA 1BU5A 3GAZA 4NC9A 1ZVQA 4RE5A 4TUYA 5LB4A 1KJWA 2VRCA 3NHYA 4R8RA 3GFPA 2LVBA 3HWRA 5AIBA 1NVXQ 3IXLA 3NFRA 2PXAA 5KDLA 1IE3A 1Q95A 3U31A 3Q8KA 1S3SA 1ZGAA 4MWGA 4XM2A 3DOEA 5A9SB 4JDUA 3VRHA 2XB6A 3DP9A 4UKDA 3O73A 4YXWA 5J1SB 4DR7B 5EP1A 4AYXA 3C24A 2VQDA 1DT5A 5JISA 2QPLA 5JROA 2QGZA 2QUZA 2IP2A 2DUMA 1G19A 4UAUA 4HN2A 4K9DA 1J99A 5EKXA 5GZ1A 3FCOA 1XFDA 4BLQA 4E2ZA 1YASA 1HRKA 1YBVA 1YCHA 2OBBA 5AJHA 2ZPUA 3BULA 3RM3A 2J85A 2QK4A 3FGOA 1TAUA 2XA1A 4YCMA 1YR2A 1JU4A 4D0GA 4KCGA 1DKOA 3KQLA 3B1YA 3DLIA 1UPUA 1KYZA 2BSAA 4TQ9A 1OSNA 2J41A 4MGYR 4JBNA 4EI8A 1XPRA 1JR4A 3E9CA 2NZJA 1V45E 4Y2GA 3ZHCA 1Q3KA 1ZISA 4KP7A 5KJCA 1IK4A 2F48A 2J0VA 1R8SA 3JQCA 4Z1OA 1S2IA 2G70A 2Y77A 4I9UA 3SYNA 3MJHA 5ADWA 2Q5EA 4KEAA 4WLUA 2BM8A 2OSBA 1P91A 2C2KA 5CNKA 3I8OA 3E0XA 2WR8A 1ZBDA 1P6QA 3GR6A 3AHIA 4DREA 2QQFA 1JQBA 4TT8A 4RA6B 2ZSJA 4N7BA 5A4IS 4BC0A 3OMLA 4OLJA 3NO4A 3KLBA 3LUFA 3KVOA 1C8BA 3DO5A 4P3NA 3LWNA 1F3OA 3SEFA 1K9SA 3QMMA 2GPAA 3L1KA 3PFHA 4FQ8A 5ICGA 5JZBA 1O7JA 1DKLA 1PFUA 3KCNA 3KNZA 2RGCA 3PPXA 4PXYA 1YB5A 2AUTA 3TKLA 3K70B 1DC8A 2JFWA 4MMXB 4X71A 3PQ4A 1FLAA 3WX0A 4X66B 1KJ9A 4LF4B 4E5PA 4YUZA 2ZYRA 1Z38A 6NULA 2WTNA 4N5LA 5FIUA 3TZEA 3EVGA 4U5QA 4Y6OA 3DR5A 3JAWA 2PRIA 3GEIA 1ADCA 4K3VA 3TTVA 1OBVA 4URYR 4V0RA 4P4NA 1A04A 2WWVD 3HKCB 3C5EA 1FP4B 5DVZA 3ZWNA 4L5IA 1XEXA 2ZJBA 2QIOA 4US2R 4D3YA 3WYNA 1GVHA 1QGDA 1SH7A 4B3MB 1O97D 1SUDA 4KH1A 5DTMA 2EBHX 1E9SA 2NU9A 2WE8A 3I32A 4WEQA 2BZ0A 2K2QB 1EJBA 1CX9B 3AH8A 4W7HA 5B1IA 5D6NA 3H17A 2COKA 1QH9A 3BMOB 1NW3A 1LU9A 2I2FA 3VSCA 3H84A 5K3BA 4NMXB 5LXTF 5F3WB 1JEJA 4UBLA 1U6JA 1YDFA 3FVTA 5BT9A 1GG9A 4LTMA 5C2JB 1NF8A 3X1JA 1RQ7A 1JEQA 3RFUA 4Y2SA 1KO8A 3ZGXA 4LYAA 2PMFA 3QVUA 2A94A 3VH4A 1FVFA 1HE4A 2H0AA 5IKOA 1XXHB 1GL3A 3AILA 2NPOA 4S24A 2GBFA 4ZI7F 1U7OA 2ECFA 1AGNA 4QUEA 4RZIA 2FQ1A 1OB2A 3R7LA 3BEOA 3OPXA 2G1UA 4A8JA 1NSYA 4G25A 1JQ5A 4EENA 4OFBA 1VIMA 1K7EB 4K1LA 1TU3A 1N6LA 1T6ZA 2JLQA 3IT2A 4YDHB 4OP1A 2FMTA 1RW4A 2Z58A 4Y2RA 3RUPA 4RSGA 4C87A 2EDAA 3FF1A 2BDTA 3HVHA 4C0QC 3U09A 1GNLA 1P0PA 2GGSA 5SY6A 4CCYB 1LWOA 1L1EA 4KR3A 4IDEA 4R5MA 4ZU6X 4P7BA 2LIVA 1LPSA 2XWBF 1IJKA 4FBLA 3UMCA 2W83A 4G0XA 2BE7A 3KJGA 3N70A 1XVIA 2V97A 2IOQA 3W5IA 3I3OA 3ETLA 1OFUX 1T9ZA 4JJ4A 1EJ0A 4EPXA 3O0DA 4AYWA 5K8JB 1ZA2A 5KVAA 2BDUA 1BRTA 2XE6A 3MLBA 1KFKB 3VVCA 5G53C 2OPBA 4AFNA 5KYNA 3CZPA 1PF7E 1FOEB 3OLXA 3B1XA 3CVYA 1DTEA 2BIFA 2GB4A 1D9XA 3HU5A 4FYHA 3KPJA 2WF5A 1M1XB 1NBWB 4LZWA 2V4MA 1OGJA 4ZKEA 3STWA 3GJYA 4ID3A 3RYTC 1UFOA 2POCA 1J7KA 4RS3A 4TLMB 5DWDA 2I8LA 4MYRA 5D3QA 4HX5A 2FE1A 2GK3A 5HS6A 3Q15C 3RBVA 3UICA 4HDQB 5E3IA 4Q19A 1MPTA 4PCVA 4XD2A 3V42A 3R6DA 2NT3A 4WNIA 4BN4A 2FMIA 1ECGA 1CY6A 3URKA 3W6UA 4TUYF 4LJYA 5IABA 1LVHA 2I1VB 3BSSA 3FNHA 4FE7A 1GAXA 3WDLA 2QD4A 1TA9A 4QU9A 4C22A 4EW6A 5EIXA 2FEPA 4B6GA 2RH8A 3DVSX 1NY6A 2M32A 2O23A 1F1BA 3FMGA 3RU3A 2J59A 2ZIXA 1Z33A 4GPAA 3N76A 3GA5A 3ESZA 1JJBA 5IC6A 2IBMA 5EHXA 1L7PA 4D02A 1XYYA 2GCIA 2PS3A 2WFLB 3AM1A 1JWAB 4MP3A 4OH1A 2YN0A 1ZHOA 1K8RA 1PL8A 3AEYA 1PLKA 5I7VA 2WHXA 4RNDB 1VG1A 3EIOA 4DVGA 2VYQA 4D26A 4DLLA 4M1KA 1U1EA 3O2NA 1SC4A 2ODWA 1O9BA 3R09A 3G0IA 2J33A 3A4YA 4JLAA 1Q92A 4GO1A 4UM5A 3E7WA 2P9CA 4HLNA 1QRAA 1K5HA 3RG2A 3AL0C 3JWEA 4EB6A 4IAOA 3WY9A 1D8AA 1VE3A 2J1LA 2KMLA 3VPDA 2Z2XA 1WAMA 2BTQA 4FXPA 4OATA 2C2OA 1VDZA 3UM9A 1ORVA 4LK3A 1V9SA 5TPZD 1EKXA 1UPFA 1BQEA 5AVZA 1AGYA 4A2PA 4C3UA 4LDJA 1QVVA 3JVEA 1Q3HA 1D2RA 4GM4A 3C6KA 4J6FA 1RT9A 2BKEA 2DHQA 1JT9A 1R4AA 2ASVA 4JLSA 1UPAA 1EFPB 1T4CB 1YFLA 1U2ZA 2E55A 1JLHA 5I8ZA 3A32A 2HX1A 1C1HA 2B9VA 2QJTA 3K4HA 2VJMA 3VDQA 3L0CA 1WY5A 3PQ5A 1DJLA 1ORHA 1QLHA 1G8SA 1EFCA 1G5QA 2ANCA 2G77B 1Z5PA 3OM8A 3CLKA 4XM1A 3FYTA 3MT7A 3UUFA 1RM5A 3HB7A 4XQCA 3P2YA 2ZBVA 3RSQA 4YV0A 2QRZA 3SR3A 4V1CB 3E5MA 1Y7TA 3IAHA 1ZJ5A 3EYAA 4WIAA 3GLIB 2CHVA 4R8LA 5T6MA 3PT9A 1KF0A 1YOVB 4ZCIA 5J2UB 4XRGA 1OZGA 1F20A 4GR5A 4Y6QA 2B9EA 3BX1A 3FR8A 2CT8A 3UKJA 4S05A 1V9CA 1Z22A 2A5DA 2QDXA 2RDMA 3AL2A 4WKCA 1UZAA 2FFHA 1W85A 2OHXA 3IKJA 5BYBA 4LXTA 4LDQA 2OCKA 4K3UA 1VBMA 1ORIA 3EWSA 1E5VA 1G6HA 1MO2A 1UC9A 3PDUA 4M1OA 4RF4A 4Z99A 1H3NA 4DIOA 4YAIA 3VPGA 1J8FA 1JMKC 3KKNA 4PO3X 3R0ZA 1MQAA 3I64A 1OFVA 4ECEA 3B6ZA 4C6SA 3I9OA 2Q1XA 4ER6A 2FPPB 3DKKA 5EJEA 2P9QA 2VNKA 3Q3HA 4M36A 2PGIA 2CV2A 4FDVA 3CUSA 4CUJA 5B4TA 4BHTA 4OMCA 3AERA 1T9GS 1NR7A 4O0LA 4E12A 5AVOA 1FX0A 2G1KA 1GAQA 3PNPA 4XWKA 3ORSA 5FI1B 1FFXA 1BMQA 3L0ZA 2OV6A 1VLJA 1GKUB 4WDQA 3AO0B 2AYZA 4F86A 3MB5A 2GTHA 1JHAA 4RZQA 1OA0A 2AQHA 1J7JA 1LI7A 4NZZA 4TLCA 1NHWA 2QR3A 1O5IA 2QTBA 5LMUB 2HQOA 5JWHA 4O4LA 1C29B 3QVGB 1QMGA 1Z88A 4RFVA 2CL6X 3I52A 4Q3DA 4G5FA 1D1PA 1NSFA 1E9EA 3V2UA 1G8FA 3RTDA 5INTA 4MW2A 1F1JA 4B4UA 1R7RA 3DMPA 2D13A 2FPRA 1NLYA 4XE5A 1M8PA 1P19A 3X1DA 5BSVA 1DFIA 1N2CA 1ZY2A 5JAUA 1M7GA 5JMPA 3WGMA 4RLSA 1QB8A 1P7VA 2QD1A 4AECA 4OSEA 4NBKA 4DFDA 2UV8A 2EL7A 4C3ZA 4V2IA 3FCEA 4QYWA 4YCSA 2FLKA 4D25A 4WCDA 1STOA 3IAM1 1C7EA 2WABA 1GP2A 4M38A 5FAKA 1MX3A 4DZRA 5G1PA 3KSAC 4R5HA 2PLNA 4JSTA 1IRXA 5CXSA 5E4TA 3FRIA 1EVLA 4V3BA 3R3UA 5AUQA 4GH5A 4AP9A 3SI7A 4LNUB 1GU7A 1WXDA 3LPCA 4KK3A 3GLFA 2FN9A 3QBEA 2JGDB 2AJCA 1UDXA 2EBUA 2GAIA 1VMIA 3L0OA 4E5UA 2BHRA 4HTFA 3WKAA 5DN6D 4QHYA 1ONBA 2PDAA 3R44A 2WG2A 2VKTA 2XA2A 4YAGA 1JALA 3G17A 1JJAA 1Z7YA 4JT9A 3X1ZA 1CFZA 4RAQA 5CIYA 5CLJA 4I1YA 2QG4A 4DWJA 3QPAA 4DLUA 1M1YA 4HDCA 2DWOA 5C8ZA 1UDRA 4H18A 2ZRFA 1IVNA 1YDHA 1UXOA 4ZOEA 3LX6A 2EAUA 2YXNA 4B2YA 1P0CA 4KDRA 1EVYA 5AKIA 4BMVA 2YQ4A 5ESRA 1RBZA 1SZCA 3U19A 1HT0A 1XRNA 2CXQA 3V55A 3U3DA 2W2TA 1J9EA 1BO6A 4M1EA 2ZDHA 4IJKA 2GPNA 1J21A 4ITVA 2ZYTX 4AJIA 4E2XA 3L1HA 1DC3A 1KHTA 1HDYA 3UGQA 3VNSA 4HRXA 1BYIA 1RJ9B 1E4EA 5CJ2A 3WK4A 2VVTA 4ZHSA 5A4FS 3LZDA 3TDMA 1IZ9A 1YUBA 3C8HA 3QVSA 4FW9A 3SSNA 1XXHE 2ODNA 3T5BA 4HQLA 2GN6A 1HDZA 3ESYA 4MVWA 1DXHA 1DQNA 2VEDA 1U8EA 3W8FA 2DLNA 4L95C 3S3TA 4LJRA 5IRCD 5C4IA 2BBSA 2MMCA 2X6TA 3HKDB 1TCCA 5KAPA 1M2HA 4FQ5A 4RLFA 5HIJA 1X42A 3FJOA 5TS2A 4BLOA 3SMQA 4EOGA 1Y3AA 2BMJA 3WK6A 1TO2E 1QF6A 1D0VA 4YMSA 3T7CA 1OE0A 4Z49A 3K2QA 3N39C 2X1LA 3SJCA 5M34A 2XUIA 4DL9A 1NFFA 2R8EA 4AY3A 4EPRA 5DN6A 2AN1A 3SK0A 2HZBA 1WB6A 1DELA 4EG4A 4B3GA 3DBIA 2XI4A 2ANBA 3DW3X 1FS6A 1P44A 2QPAA 3NHRA 5F3RA 4BNDB 4CMHA 2W2LD 2ZREA 4FYXA 4R8SA 4ZXFA 3GCXA 1DC4A 3TIFA 621PA 2YYZA 4O4IF 2GJKA 5GJWC 4BMOB 1LPNA 1MENA 4Y3UA 4NABA 1SVNA 2IPAB 4JZYA 5G40A 4KDFA 1PZGA 2NAPA 2HWKA 4NH4A 5AK4A 3R5KA 5DLPA 4Z4CA 1I3OA 1X7WA 5E0OA 3RVQA 2FLVA 1HT2E 1T8SA 1E6WA 4HBZA 3Q0IA 4HWTA 4HXGA 3UB2A 1VSUA 3RD5A 1OXMA 3WGJA 1TE2A 1ADBA 5LLDA 2DFTA 1EGMB 1BJRE 2I1QA 4MJXA 5JRZA 5E9AA 1FFAA 2JGMA 4WNAA 5I9SA 2GZDA 3ET5A 3GLVA 4H1VA 5ER9A 3IALA 4EKGA 3UJ3X 1X7XA 3LHIA 4OGWA 3G1WA 3BWCA 2YXLA 4XPZA 3SX2A 3I83A 2OY0A 2W7TA 3UATA 3DGEC 4AMUA 5F23A 4P5EA 3AP2A 4WESB 3JQ9A 1OX4B 4V24A 2W71A 1PO7A 1TIPA 1E6EA 2DKOA 4QWWA 3FN4A 3GX1A 3TLJA 1G7SA 2IZZA 3JVVA 4BIIA 5HFAA 1IUNA 2GHRA 4YUAA 2VHJA 5F76A 4A0FA 1GEEA 2FUKA 4J6EA 4P8RA 2PT7A 5SICE 1QKIA 4JFRA 2W2LA 3ZDFA 3ZHUA 4BLRA 4ERXA 1BWSA 3IUSA 3L0IB 5B7PA 1D2MA 2A57A 3B51X 3L6OO 4Q1EA 3EVNA 2KBEA 1WEKA 2ZOSA 4I8XA 4LDRA 1XQXA 4OI1A 2CD7A 2VQEB 2CZCA 2O4UX 3I92A 4XQEA 1EJ6A 2AXNA 2XOKA 2RK3A 3E8XA 3NGLA 4NL4H 4DSZA 1TEXA 3BUSA 3U1VA 2R8PA 1OAKA 3VR0A 5IFKA 1XMQB 4WNYA 3CW2A 1VMAA 3CNNA 4HTAA 4C4ZA 3OWHA 1MVOA 3A3PA 4IX9A 2FUEA 2MSWA 4O4LF 4DMKA 3T3HA 4F5WA 1K08A 4X1IA 4FILA 1DL5A 1JNYA 4ZODA 3ZQKA 3C5VA 2WMOB 5CPBA 2DH5A 1E98A 1GCAA 1SD2A 1FFDA 2FRVA 2RIRA 1U90A 3LYUA 4JQSA 4KO3S 4NZMA 3VVLA 4B6OA 4GGPA 3LBAA 1DEKA 5FL3A 1I24A 4FTWA 4B4DA 4B3XA 3NDPA 3GFBA 4A5OA 4E5YA 3X1XA 3IHLA 4JT4A 5ES3A 4Y18A 3V97A 1AMNA 2XMBA 4OQMA 1S01A 2W93A 5ALHA 5TEVA 3RAPR 3OQHA 4AX4A 4BMXA 5C35A 3CFYA 3UT5B 1NV9A 1WQ1R 3C8UA 1J24A 1W4AA 2CUZA 3BN3A 1BIFA 1GL7A 5M04A 3Q3EA 4FGKA 2CC2A 1YAJA 2BKLA 3QITA 5CEFA 2HQ1A 4RA9A 3V2GA 5I3ZA 2NLOA 1X8LA 2W2PA 1V4BA 1LNQA 1PFYA 2P2LA 4J0IA 3GLIE 5GV8A 1M2KA 3IHWA 4UUNA 5EP2A 1QBKC 1QQ5A 5C31A 3LH5A 2IOHA 2J3EA 2LWIA 2RKOA 4IP0A 2VA8A 4MUXA 4UE3S 1KVSA 2Z0MA 4AM8A 3L5KA 4QAQA 1ISMA 4MJLA 1XTIA 2IDMA 3TGPA 1KU0A 4JI3B 3P4XA 1QIGA 2OLEA 3HP4A 3A1WA 4TMFA 2JIOA 3T9EA 1XHFA 3VH2A 4B09A 4X8HA 1FU4A 1DB3A 3TO5A 5BQXA 3ZJTA 3DTVD 3V2HA 4RANA 4B2IA 2Q4OA 5AMXA 3R3WA 2J0QA 1HQCA 3SMVA 2FOXA 1L5WA 3T7SA 2NSHA 1P2SA 4ZQBA 3ZVMA 5KSYA 5FWYB 3ZX5A 4CF5A 1N7JA 4J3FA 4NIMA 4NJEB 5EI5A 2QBYA 3O3CA 4MW1A 5JZVA 2OCDA 1KY3A 2ZYIA 3IC5A 1RAEA 1M66A 3QY0A 4ZOLB 5D1HA 3W1EA 3WA7A 1XAHA 1OFIA 1AY0A 2PS1A 2BEUA 1NNSA 3EPHA 4AKSA 3DH0A 4IJQA 4PLVA 2X4DA 5I9TA 1FNDA 4EJ2A 1T0BA 1NF2A 3R40A 4Q82A 4FMBB 3CCFA 3DBHA 5AHOA 3R7SA 3NHSA 2NO7A 3GT4A 4HGOA 3EPKA 3P2KA 4D92A 1RWPA 2GAFA 5AW1A 3TM4A 3WRXC 3ZHZA 3TGWA 2P1ZA 3PIIA 1NX9A 1NDQA 2MR5A 1CT9A 2HJHA 1HK7A 3G2JA 2V55B 4HDOB 3PQ6A 5FEUA 2ZUFA 3O91A 1RCFA 3IHTA 4DDUA 3THWA 4JROA 1U99A 2O2EA 5IJZA 2Z6AA 1L7MA 1PWHA 1ZU4A 3R7WA 3QNWA 3ZTWA 3DKPA 1JIJA 2QTTA 2LDBA 4D82A 4I55B 3RODA 2QM7A 5KMGA 2O3RA 1C7ZA 1MAHA 2ZI5A 1ZL0A 1I14A 2ORED 7MDHA 2OO3A 1G2PA 1S0UA 2FDXA 3BSYA 3OZCA 4OXIA 5AUNB 3DTVA 4LFBB 1J9GA 3ZWMA 3OJ0A 3TSYA 1E58A 4YO8A 2QTZA 4I50A 4PFJA 1D1TA 4L08A 1GNSA 3AEZA 4AJ2A 1QR2A 3JARA 4JYMA 3UWDA 4O3MA 5KINB 1G4UR 1R16A 3OX4A 3UMGA 2WHPB 1KU6A 1RFGE 2P0YA 3TQOA 5JRJA 5ALLA 2QU7A 5FJJA 3WGTA 1LPMA 1JT2A 1DI0A 2GXSA 1W48A 3CRVA 2PRSA 3RKRA 4M6WA 1JEOA 4CF6A 3EW9A 1E8MA 2EVWX 4WLOA 1UJ5A 2GHQA 2I5PO 2P2SA 3IODA 2X2FA 1FXSA 2RGEA 1UMKA 1DAPA 3GRYA 3ISJA 4JUAA 3EISA 2HXYA 4PG4A 1AQJA 2W0SA 2OXTA 5BSUA 2PZJA 1Y1SA 5IN5A 5CXXA 1FUKA 4MROA 1YU9A 1ZU5A 2P62A 2QPOA 2ZRKA 2Z09A 2FG5A 1O5OA 1NYQA 4JIGA 3WB1A 4UTRA 4OLAA 1B2LA 3CRZA 1E3MA 3ZW8A 5FTWA 4Z0TA 4AUEA 1PTJA 2GF9A 4ND7A 3AF0A 5CA1A 1C1XB 2XXBA 3BILA 3NYRA 3FFXA 5HDQA 2TMYA 3RV3A 4Y2TA 5KYTA 1GNQA 1HYGA 3TS1A 4D9NA 2ZJ8A 1JJIA 1R9JA 3IP9A 2QGNA 1EDOA 1SU6A 1C9KA 1YQDA 3GU3A 2VJOA 4XB1A 2QN8A 3BZBA 3THSA 4C1BA 3OTQA 1PD1A 4JT2A 4MYSA 3MTEA 5EYPB 3ZTTA 1U81A 2CJPA 4AP5A 3BQNB 1TGVA 4QGBA 3OLZA 1D4OA 3STTA 3BIXA 4UBIA 1L9XA 4Y30A 4I8IA 1T6YA 1U3VA 5HUJA 4OJKA 1UAGA 2IU4A 4MS1B 1HX7A 3TK1A 1PR4A 2CY0A 3P0IA 4IUBS 1SCAA 4OQZA 1PJTA 2R3SA 5JJCA 2FRDC 1W8IA 3KV3O 1JB1A 2VK8A 3H8JA 3HGTA 4X3CA 4DV6B 1VI2A 1NT4A 4WZBB 3DHNA 5ECYA 3AEQA 2V3CC 1I7PA 3TH5A 2BFDB 3GMIA 5T3UA 1JJ7A 1PHRA 4MITA 2PANA 2AG5A 1VSTA 4M53A 2PH7A 5JXHA 2WWWA 1OMOA 3AHEA 5J63A 3L0YA 4ZAVA 3AHFA 4P4SB 1V7CA 2AW3A 3IP3A 2VSXA 4QBKA 4WK6A 2EFCB 1RLIA 2CSXA 1DC5A 3F3SA 4QGFA 3WK8A 1PW7A 2X8JA 1MB2A 5JSKA 3WLEA 5LP6A 5JQGA 2WW8A 2PL1A 1JEYA 5KTNA 4C20A 1DJNA 4RY2A 1QJ4A 2JFXA 4D4KA 3PHBE 3TUIC 2ZYWX 4RHCA 1VPDA 2XE7A 4M3NA 3DYIA 4MAMA 1WMAA 5JNVA 1QYDA 3DBVO 3AM4A 1GPWB 4I4TA 5EVJA 3OIGA 1H6DA 2N0SA 3NAMA 4R7GA 1Z39A 1PHPA 4E03A 9MHTA 4UTXA 1SKYB 4KB5A 2N42A 2PWPA 5I47A 2MIIA 4MLDA 4KJXA 1NXSA 1Z12A 4HF7A 4LOAA 5FI0B 2R85A 3ZN2A 2EERA 2D5AA 4WA7A 1E3WA 1KXZA 4J1NA 2IT1A 2NUTB 3W4KA 1F2TA 3LUKA 3QA3E 4NZOA 3VR6A 5JTTA 1VKHA 1KEKA 4KIUA 1MOQA 5LNK6 1YHYA 1QXSA 3DFIA 2RHGB 3F0TA 4XTRA 1KQOA 1E1QD 3QUSA 2WQ7A 3BCSA 1PI3A 3DDOA 5CXQA 4CKWA 3BCHA 1SXIA 3S5UA 1PYOA 1MORA 1WF6A 3DXZA 1H0SA 3OU7A 2VR1A 1USIA 1KBQA 4X1KA 2YN2A 3W9BA 3EIWA 3EZYA 3LVBA 3L06A 4NCIA 5AP9A 1JFFB 2FMHA 3PHGA 4GF5A 2CNLA 5BUCA 1OC2A 3IPLA 1ZWKA 4DQLA 3RVPA 3TX2A 3WB2A 1PQWA 3WGYA 3A11A 5LQDA 2DB3A 5TMDA 1X80A 2G80A 5JD3A 3HKBB 1LJUA 4MJ7A 1G63A 1RAHA 1QF7A 1P6UA 4YX9A 4M1SA 3KO8A 2PZGA 2HWXA 2FMFA 3U16A 2AFIA 1V48A 1LW7A 4K46A 1D4ZA 1IZ8A 1JDBC 2W8BB 1GG2A 4NMWA 4RMJA 1V11A 5C8DA 1ZEMA 3KZXA 1JKJA 4UATA 5JAMA 1OIWA 1Z73A 2HA2A 1L6RA 3NTUA 2QX6A 2B78A 2CCJA 3TW8A 4Q4CA 2FQWA 2Z1NA 1ISHA 2J87A 3EF3A 2UYYA 1Y98A 5HQ3B 4CMIA 1E2JA 2OHVA 5EHIA 4F8JA 1BD4A 3L0SA 2ATIA 3DQQA 3AR8A 3AESB 4MR7A 3T7JA 1T13A 1U2EA 1C1DA 4OOEA 4WOPA 1U1DA 1LBEA 1VJ1A 2Z4SA 3F5SA 1E1QA 4I50F 5ECGC 2D0OB 3C3BA 1YB7A 5KYVA 2BN4A 1KTIA 1UINA 1JJFA 1NJ5A 2R60A 2IPMA 2QMQA 2XKJE 1SCUB 2R4QA 2YZ2A 3CCBA 4IOJA 4CRWB 2ID7A 1E0DA 2D7DA 4UHJA 1PX2A 1PEKE 3AKEA 3PYMA 5K45A 1IOVA 1G8MA 4BRSA 3LWBA 2DPGA 3BTSA 2HA5A 3I34X 3K2BA 4IS2A 4A7PA 1IATA 1K75A 4BKOA 5BV2P 4MS4A 2VJPA 3F7MA 3QMPA 3RQSA 3ZE0B 2XB4A 4KG7A 2CV1A 5EE3A 4PG7A 3S2EA 3ZNQA 3MOGA 3MWEA 4IV0A 2BJVA 3RKUA 2A9FA 5GADl 4L0MA 3E5RA 2HEIA 3CY6A 3R5TA 4RL4A 2P5SA 3RIHA 3ASVA 5IEBA 2WU8A 4H4CA 3R5HA 3UW1A 5TPWB 2FV8A 3Q3CA 2YUTA 5FHRA 3QKSB 4D56A 2J4FA 4EPYA 1CPYA 1A97A 2E4YA 3HA2A 3VU3A 1Z8HA 5T8KA 1X3SA 2B2CA 2ETVA 2CNKA 4UQOA 2GOYA 2C2MA 3DQZA 4XB2A 5CA1F 3Q6MA 4LS3A 4TWZA 4WASA 1G66A 1S2NA 3KS9A 5E6RB 3LDUA 3RBAA 4BV8A 1JHDA 3QWIA 2C2WA 2LCIA 4ZCMA 5ECDA 5FLXA 1H0HA 2E4WA 2UAGA 2AMVA 4OHXA 1OLXA 2QKYA 3D7KA 3IB6A 5LKRA 1LSJA 2PZ8A 4FGSA 3LGAA 4MV0A 3ROQA 2L69A 2CEAA 4O4HF 4BZZA 2AFHB 3DMHA 2PGAA 3CZQA 1DHRA 1F0YA 3NU1A 2BGJA 1G21E 4OI2A 3OM1A 3RJZA 5KBYA 3GEMA 2QRJA 1HE2A 2M98A 3EOZA 4PX2A 2ZSBA 2FR8C 1DBWA 1RWOA 1SU8A 4V39A 3W77A 3AJ9A 5A0TA 1ZR2A 4JLUA 3A2LA 3MGBA 1ZGJA 4OHBA 1XNRB 3PR2B 2Y1CA 4YP0A 2Q5IA 4Z6KA 4UZEA 1QKJA 2P35A 5UKDA 4G4SP 3REFA 1C0LA 1RKUA 1X86B 2ST1A 4Q4HA 3OMWA 2Q5HA 1WXWA 1DUSA 2OV1A 3W5UA 3I5UA 1I4TD 1WW2A 1ISPA 1DCTA 4QTTB 4F2GA 5DBIA 3PPVA 1K5GA 3BWDD 3FPSA 4YI3A 2HMSA 4G1BA 3DLHA 3O8OB 1KDZA 1RPNA 2P0EA 3GGSA 2FSIA 3ZOZA 3O8QA 3EVAA 1NXOA 5JQGF 3T12A 1U63A 2WPDD 3A1SA 3HZHA 3KUUA 1NPYA 2P4SA 1LI5A 3II6X 3AOEA 3FIUA 4NQRA 5EHGA 4CIBA 4IZHA 5FOVA 4B73A 4ZK2A 5FV4A 4MUJA 4I4TF 2UUOA 1IMOA 3DCNA 3PFWO 4IVNA 3SR0A 2X13A 4XB6B 2ZXUA 4RAOA 3TDNA 1H8ED 2QWXA 3PXEA 3KQHA 1SRQA 3VA7A 2QUIA 5C37A 2B1GA 1UMDB 3EEFA 3K3PA 1YDMA 4CKEA 2B4RO 2ZWAA 1LKZA 2M2IA 3FBTA 3QEJA 1QFSA 1V2GA 3NAQA 3V7NA 3UQYS 2FF5A 1FYFA 1GKYA 4EG7A 3ZDYB 3ASUA 2OBXA 2KI5A 1NV8A 1JR3D 4JBGA 2BW0A 3N8IA 2EX0A 5IKMA 3D3EA 4PE5B 1A9YA 2AYXA 3SYMA 4BX2A 3TGLA 5DLQC 5IBRA 1O57A 2ZYHA 1UXIA 3EEIA 3GL9A 2EL9A 3VNBA 4WKBA 4G8CA 4V02A 3WIEA 5HMLA 1O95D 2BUAA 4F85A 1UBGA 2F55A 4H60A 4K9OA 3ADDA 1VL0A 1N6PA 5FOXA 1SB8A 4L9WA 4YACA 2DM6A 2OGUA 4TKMA 4TN5A 3WRWA 2OHOA 1AX9A 1U3TA 2X19A 2XV1A 3NH6A 4JU9A 2WK1A 4V38A 3FPAA 4MPTA 4MKZA 2E7ZA 2AXPA 2QUJA 3PGKA 4WJKB 1YRYE 3RG8A 2GILA 1L5VA 2JAQA 3D8SA 1FS5A 1GQRA 3GLUA 3JYLA 4IIFA 1FTGA 2WPDA 5D84A 1EWTA 1RFLA 1IM2A 5E0KB 1C9EA 1FJ2A 1UJ4A 5E4JA 2R68A 3FHOA 4BVAA 1ST2A 1RHQA 4DXAA 4BLPA 1DT3A 1Z13A 3WXMA 4DIMA 1IM5A 1N6NA 3GHYA 4OLBA 5DNCA 4A73A 2PGDA 4Y1RA 4RDXA 1FCJA 4BFCA 1T9DA 4BWGA 1VL1A 3ZHRA 2O8EA 1H8EA 3A26A 2QVLA 3RWOA 3SHQA 2NO9A 2ABWA 3GYGA 3H2ZA 3V9AA 3C7TA 3ZDBA 2HGSA 4UM7A 5FNVF 3EAQA 3H0EA 2G9UA 2JBWA 1DCKA 2JLSA 1XZEA 3R20A 2X0EA 2NVUB 3FW1A 5KNLA 4QODA 3KSZO 3EVDA 10MHA 1G98A 3U3XA 3GUVA 5LBUA 3OIUA 3S27A 4W5RA 2VAVA 5EOVA 1BC5A 4CL2A 2YCBA 1OFTA 2X9LA 3KSRA 3R0IA 3VR4H 4CMAA 1EXNA 4W5TA 2AN3A 3LPMA 4H59A 1VJ0A 1DFGA 1W49A 2XB2A 4IDBA 5HR5A 5ELMA 1ZZEA 4N6NA 5EUBA 3EXEA 4EL0A 2X2EA 3HQ4O 1GZUA 4F9TA 2XNHA 5LLTA 3D43A 3W5DA 2H57A 2R1VB 2VP4A 4LJ6A 1WV0A 2QX4A 2G1PA 5DZSA 2BR3A 2FOIA 1O3YA 3FOZA 1SKYE 1X1AA 1NLFA 5ALTA 3LU1A 1AXEA 1Y5IA 4YK7A 4HP8A 5AW5A 5IDYA 4FMPA 4XGIA 2BGTA 3VPSA 1BS9A 1H4VB 3WL4A 2X2OA 5BSRA 4INOA 2PNFA 3EUEA 2A92A 1T6XA 4KLRA 5FBVB 1AUQA 2C2YA 1XX6A 3ZHYA 1QU3A 2FWRA 3OOEA 4OQ4A 4MQFB 1CZLA 1J33A 3LCVB 3K9GA 4RD0A 4Q7KA 4E4YA 1L7NA 1OPRA 4MR8B 3S1SA 4UQLA 5KVQA 1PNVA 4TL8A 1NPDA 5A2GA 1UOQA 1S8OA 2HTFA 1JVBA 4ONEA 3FPBA 5JLJA 5AKHA 4BWVA 1USVA 3D7SA 1Q7EA 1SXGA 1JYSA 3KU4A 3TW0A 2ZVQX 4EVIA 2O2SA 3DF7A 1GFZA 3RJMA 2ZCVA 2W2KB 1MLDA 2PX3A 2H08A 2O07A 1P5ZB 3IDSA 2EYUA 1ZM9A 4B9AA 3HCFA 1NAHA 3RHSA 3CKYA 5CA0B 4BAGA 5JAZA 1A4XA 1AKUA 1BMTA 1PJ4A 1SUWA 3PZRA 4KL8S 4W1SA 4EZBA 2ONZA 4PANA 3BXGA 1HM5A 3UGTA 3ZK7A 4BYGA 1PUJA 4MUBA 2EFDB 2GD6A 2E4ZA 3FLBA 3W34A 3GLGE 3FNBA 4P82A 1K3UB 4PHHA 5JARA 3KXIA 1EGVB 1LDGA 3TQSA 4E88A 1PYGA 1KZYC 5BOSB 1GQYA 3AX6A 4BLWA 1BOOA 4C08A 1WKVA 5TF4A 2VF8A 4CEIA 2WVHA 3W9SA 1GRRA 5HBRA 2VDVE 2G7MC 4HAUA 1R3DA 3BD8A 4DC9A 3UK7A 1DBVO 4Q9LA 3B1JA 4UEKA 2J3LA 2QTMA 4YRQA 3WFJA 3RVOA 3GPCA 1T34A 1RI2A 3LOUA 4JB2A 2ZAGA 3L9XA 2H1VA 2KYRA 1VG9B 2C9CA 1IAQA 1PFQA 2HCFA 2N9UA 3L07A 4IMRA 3CLUC 4Z4EA 2PGJA 2XQIA 2ALJA 2VDPB 3OURA 1XA3A 1HWYA 3RF7A 2JFUA 3YASA 3PFCA 4II2A 1L4LA 1X7HA 3MGAA 1P8JA 3D8NA 3I72A 1YGPA 1KEEB 3B60A 2AEFA 1N2GA 1H1LB 4DWVA 1CD5A 4O1HA 3ZWOA 4RH1A 1I9GA 3VPXA 5TARA 3OFND 4WY2A 3SX0A 5FUQA 4F4IA 1N5KA 5G0WA 1ORTA 1MNQA 1NJ2A 2P2ZA 3PNQA 2JIBA 2WJZB 2YHAA 2FQXA 3NH9A 4C6RA 5JMWA 5LWQA 5LWHA 4Y7CA 4RCZA 3D1VA 3OZ7A 4I9GA 5ILQA 3I2HA 4PYOA 4BNWA 5BWCA 2PIDA 2VTKA 4UVEA 4DY6A 1V8FA 3AP1A 2FPGA 1N7GA 1NLUA 2JAPA 2QUKA 4WXPA 4DLRA 2BEVA 1L3BA 5G4KA 2RAUA 1YQEA 4MUNA 1I2BA 5F2KA 5DHAA 1O77A 1V8DA 3QG5A 2BL4A 1H42A 2ZIAA 1XDDA 4PM4A 1T9HA 1GV1A 1VLMA 3JQBC 1V96A 2AI3A 1NURA 2C9DA 4CMKA 2WSBA 4LJ5A 1M54A 5JANA 3DMDA 5ESWA 3ZVLA 5HRAA 3BRQA 1A76A 2RGXA 3HV2A 4WT7A 3CEMA 5AKGA 2G9QA 3U6KA 3LLMA 1DAFA 2P3SA 1QNFA 1OXVA 1VKNA 2AFHE 1B4DA 1U9CA 2R96A 2JAUA 3BMXA 3AHGA 4JBYA 5J5VA 2J08A 5C1BA 4RBNA 4FW8A 1BCRB 2FFBA 4PICA 3G8AA 3TSZA 5JMTA 1QS0A 4FZRA 4IVRA 5AW7A 3WLPA 4DADA 3MTGA 1ZS9A 2WVAA 2XYRA 3VSBA 4AWAA 2GTIA 4AZVA 3L0PA 3IV9A 1KOFA 1YRBA 2JFGA 3OFNA 5KX5A 3ZKWB 3NMUF 2A9KA 4XSVA 1JNXX 2W43A 1JDTA 2CGEA 4EW2A 2ICAA 1J0CA 1RABA 2WSSD 3C6XA 3EXAA 2R44A 2PR7A 4NK4A 3UHOA 1SQ5A 4TVOA 4GX2A 1VPEA 2BH9A 4RGVA 4ZIRA 5DI9A 3H5WA 1TU0A 5CH5A 5DX0A 2GX6A 2QEQA 1BXGA 3SNKA 2P2DA 2QJWA 4G0VA 2WV9A 4WXYB 3R5JA 2IUYA 3JQFA 3EGVA 1XMSA 2H11A 1FNBA 1ACLA 3H11B 2B21A 4RKFA 3S2UA 4F4DA 3O38A 2NXNA 4YRMA 4LV6A 2BZSA 2IYQA 4MVJM 1NN1A 5CT4A 3HMQA 4G36A 4WN9A 1TQ2A 3TQQA 2GI4A 4KXWA 4D96A 3R3HA 2OV3A 3FHJA 4ER7A 3O3MB 2ZRAA 4KHPB 3ND6A 1M8FA 2C97A 2ZYDA 3AUKA 3ZDQA 3G89A 3IHKA 3BJIC 1BEEA 1IIBA 3VAYA 1VJDA 5BQOA 3GVXA 3MMXA 2BJWA 3EBLA 1ZMTA 3KPVA 4FKZA 5DH9A 3SBXA 1H9CA 2ZJ7A 3A3KA 3GBVA 4U4AA 3VU9A 4Y9DA 1NW7A 4W9RA 1TUBA 2YWHA 4WN3A 4ZYUA 4V3CA 2O5CA 4YQFA 2N46A 3QWFA 4BO1A 3DVQX 4RTMA 1AF4A 4MPRA 4PFQA 3TDKA 4GDFA 1G42A 2WFAA 3KSBC 5FPHA 2GDZA 3LT1A 2RGRA 2WLTA 2X3UA 1TJ3A 1EFHA 3D6VA 4XXHA 1KAOA 1DBIA 3AYZB 2F3UA 4S1OA 3QE0A 2WSSA 2WAOA 3UK2A 1EVQA 3K96A 1J20A 1QIDA 3AEKB 4QO7A 2ZKLA 2VDMB 3ZWPA 2VBFA 5CCEA 4IIBA 1D5CA 5BURA 1YS7A 4FR2A 1NRIA 2MINA 3HDHA 4DILA 4QVIA 2ZIZA 4L5AA 4QLAA 2HJVA 4N3AA 3SHVA 1BCSA 2ZU0C 4CTOA 1JDBB 2Q8QA 1WCIB 1UUFA 1EWVA 3WDSA 3GB9A 1THGA 1P4AA 5DLEA 3HM2A 2EJCA 1GA6A 3UJAA 3D2AA 3G1UA 4CV1A 3WLTA 1IXSB 3USES 1V25A 2Y92A 1G9SA 3R0XA 4UEOA 5AOCA 3QENA 1Z8FA 4B8ZA 5JY6A 1SQ0A 3C8DA 1MIOB 3ITDA 1R8XA 5B57C 1EB9A 1U2GC 2ILTA 3AJDA 4NBVA 4N3CA 1FQKA 5EZYB 3MIZA 2IUUA 5BY2A 5A7HA 5B4VA 2F8LA 3TSCA 3JVIA 2G6BA 5C18A 5K51A 2RHCA 1Z5NA 4RHFA 4QJBA 3D81A 4TXNA 3G9XA 4S1TA 4D4MA 5AYVA 4JR1A 3B3JA 3WQHA 4DNPA 1R0SA 4KQCA 1WHSA 2G71A 3ESDA 3RAEC 4C0WA 5A0FA 3KTAB 4MEJA 2X41A 1AHPA 4G0UA 1N6IA 3F2VA 4MRMA 2ZE8A 4EM6A 3A6HA 4FEEA 2DWCA 1SUAA 4JOCA 4TWRA 4WDRA 3SM3A 4OXRA 3GJQA 1U0TA 4YAOA 3I61A 1SA0A 4FOPA 1RQ2A 4HX2A 4I6EA 1FYVA 1D0IA 3IIMA 2XAUA 4ND4A 5EHZA 3Q8LA 1NVTA 2ACVA 1KC1A 5BR1A 1R00A 4UTVA 3BQ9A 3F1LA 3HKEB 5AXAA 4FOOA 1D6MA 2NN3C 5KAMA 2O2IA 3MRTA 2WKQA 2QDKA 4CN8A 2HQRA 1X14A 1L5KA 4EYOA 1QP0A 1M7HA 2BGKA 2W6NA 1ADJA 2BUCA 3D2BA 3GRCA 1Q1ZA 3HU1A 3VJKA 4E2FA 1QGUA 2GYWA 2PUEA 2PLWA 3A4LA 4HNAB 3EAGA 4XARA 3KPUA 4TWIA 4TWJA 2WF6A 4M7RA 4XLLA 2BLLA 2D54A 2EFYA 2OXIA 5BN3B 4LF6B 3ADKA 1B0UA 4IRMA 4KC0A 1N6KA 2Q5OA 4KIGA 4NCHA 4XASA 3KUXA 4EGFA 4I5EA 1VHWA 4ENSA 3SJZA 2Z98A 1ESMA 2WE7A 2X77A 1IY9A 2II6A 3DOHA 4NFSA 4OQYA 1JS1X 2G9NA 2O8DB 1AN0A 4JKYA 4ENQA 2QI9C 1K7YA 2Z2IA 4RD3A 1T5HX 2J32A 5JATA 3X1KA 4N0DA 3L40A 1HO3A 2R65A 2DMRA 1YOBA 1NZDA 2R751 3HFGA 3WAKA 1AMUA 2JGKA 2FSVA 4O2AB 5L7YA 4BNGA 1QWOA 4ZYXA 2BP7A 1Z8NA 3ETNA 2EARA 1A96A 2X0NA 4TLBA 1XAGA 2OAP1 3NDBB 1UMCA 4EIWA 3N2ZB 2J9RA 1NE7A 1BXRB 2BFFA 3N2GA 1UPXA 4XYEA 5CG1A 4J75A 2P7IA 1JR2A 3SIXA 3UG6A 1ZITA 1T6BY 1KY4A 2CB0A 3FUUA 2WWRA 4QGAA 3WDMA 2IX9A 1FW6A 4R6XA 4M89A 3OCZA 3AXTA 4GBJA 1XHEA 3WNVA 3EXIA 2DFPA 3QI7A 4EDFA 5KX5F 1TM7E 1O6CA 1NVDA 4IXDA 5KYUA 3BA6A 1YC2A 1W36C 1B1AA 2WVGA 2C07A 2HLNA 3GUZA 4G3XA 3IDQA 1X9HA 3AY0A 1E0AA 2QVCA 2FWMX 1CUGA 3DEZA 3EGXA 5D01A 5TY0A 4UAGA 1W2WB 4JP8A 1G5HA 2F1IA 2QL5A 3P2MA 1GLGA 3SC4A 2P4UA 2C9BA 4RS4A 4CU2A 4AS3A 4H0CA 1P4GA 2HNBA 4A91A 3AF6A 3RHZA 4AJPA 1J25A 4S1PA 2EV9A 5ALOA 2C83A 5JJ5A 3M3HA 5AXBA 2ZRPA 5AVJA 4MRAA 1QO0D 1TTPB 2CZGA 4FMCF 5KS2A 4KXLA 4B32A 4GM1A 3WMGA 4EMUA 3UUEA 1JG1A 4XJXA 1XE3A 3H1TA 1JWBB 4DSTA 2W42A 2KPOA 4J0GA 4EYQA 4Q12A 4H0FA 1AQ6A 2OCBA 3RNLA 1E99A 5JZOA 1G3QA 1ZG3A 1F5SA 4C9BA 2C7VA 1DBSA 1PFVA 1QIMA 1YU6A 2QRPA 5T7BA 3UANA 5H8WA 4OHYA 5KYWA 1NONA 2V0NA 1W1WA 4DLTA 5IULC 2IXFA 3IJPA 2NTJA 5KC9A 2P5YA 3O84A 2YZKA 1U7TA 2JARA 5EEGA 1T5SA 5H02A 5J4HA 2XCSB 2ZIFA 4IIDA 2D2VA 2QHXA 2R2GA 3L9WA 4RENA 2G4LA 2X42A 4R9SA 1VA4A 4EMBA 2PD6A 3JQ8B 1IN8A 3BE4A 2WYOA 3D6TB 3TE7A 4DHWA 5CVUA 5K3FB 5DMHA 3BJMA 3H5AA 4G1EB 4X6XA 1KKMA 3PA8A 3ENVA 3G9TA 3UB3A 3PIDA 1UJNA 2WQZA 5JD5A 3MLEA 1M34E 3KCQA 2JLXA 2GAOA 1L4EA 1Z5GA 1T3SA 2D0DA 2VNAA 1NMQA 3FYHA 2GEKA 4TV8B 3TNYA 4EJ6A 4JI4B 3USZA 5HHTA 3LC2O 5B1EA 1A88A 1QCDA 1YA8A 1T35A 5IJ0B 1NU6A 1PNQA 1QPBA 4EKIA 4ZI3A 1Z5UA 3CNHA 4BZWA 3G0DA 2E4VA 1HQKA 2DFLA 5EJ4A 1KTVA 2VC2B 2I62A 2XB8A 4AICA 1PU2A 2JLRA 3G8CA 4AX8A 1QO0A 3FTCA 4NJMA 4JP1A 2QRGA 2CMHA 4N18A 3RVKA 1LI4A 2AR0A 1E2NA 1EXMA 3O03A 4KPUB 4Q1FA 1TCAA 5CGZA 2Q8PA 2EXXA 1ZR4A 1UBSB 3MAGA 2EATA 3F5QA 2CLCX 4FXOA 4F60A 1DX6A 1I33A 1SK9A 2OC9A 1U3UA 2YV4A 4JEHA 1D0SA 1TM3E 4KH0A 4R8VA 3X1MA 3PEWA 2YNMD 5F7OA 1TAGA 4PWZA 4PCAA 2FVXA 4CMEA 4ZPJA 3WLMA 1RACA 4BQNA 2VWGA 3P45A 4HN4B 2X7JA 5LQSA 4DIUA 1SHZA 1LK7A 4DDKA 4G86A 4DE5A 1GY8A 4PSKA 1T3HA 4IG9A 4U9HS 3IRVA 4LY9A 3TRIA 4PX9A 2FPUA 3ZE6A 4WOJA 3TZQA 3Q7RA 5I7WA 1W35A 4BNUA 4Y2YA 4ENTA 1RM0A 5KQSA 1H6AA 2ES4A 4ZCLA 2XRZA 1I4LD 2HADA 3HJAA 4LVCA 4N12A 4UBNA 3V7YA 4D9CA 4J3JA 4B3HA 2N1BA 4HEQA 1CULC 2HPVA 5JJKA 3V8EA 1JTEA 3IE1A 3ITKA 2JIQA 5TIIA 4OHPA 1A1SA 3I9LA 1XZQA 5GOZA 2D59A 1A95A 2WTAA 1PK7A 2TYSB 2ZTSA 4FOTA 4JL8A 4LHYA 5GGYA 2VCEA 2HU2A 3CR3C 4A8JC 2B4AA 2HK6A 2RGYA 3ACBA 3KHKA 1R9NA 3H6GA 1ESEA 1A8QA 1FDIA 2DKNA 5B2FA 2L82A 2L42A 3CVJA 5CTJA 1ISFA 1GU1A 4MQMA 1AZLA 4NENB 5U4XA 1Z2CA 1OBFO 3UMRA 3EXFA 4V0LA 4AT1A 3KQKA 3KVRA 2PXCA 1HI9A 4ZAWA 5LMCA 4OJYA 1WD7A 1KPHA 2ZRGA 3H05A 4MGIR 1UEJA 4AZWA 4BNFA 1DTSA 2HRRA 2K5UA 1EWKA 2C8LA 5F2OA 4FGJA 1ZI6A 2YNMA 4Z0NA 2GERA 3ETCA 2XZOA 1JLLA 1I9CA 2JLZA 4A3SA 2VJCA 5EFZA 4LX0A 2ZZKA 3DV0A 1Z37A 2I4MA 4N9QA 1XL1A 5T4FA 4EY4A 1KY2A 5I8WA 5A1JA 1K8ZB 2AD5A 2OSVA 3EFOA 2HGZA 4DM4A 1VKOA 1EFRD 1W34A 3U9TA 4LN1A 1PDOA 2J48A 4A27A 2YZNA 2Q6VA 5KQRA 1FSZA 4M37A 4URVR 1I51A 2Z8YM 3DPSA 3S0JA 1JSCA 3CWCA 3EEQA 1XTBA 4B3FX 4ARCA 4R7ZA 4XJSA 4RHYA 2C4HA 2PEZA 2XAAA 2AEEA 3HY3A 3LYHA 3LX8A 4KXUA 5HE9A 4AJLA 3EJ6A 2FW1A 2WUWE 2NMVA 4YT8A 2XQFA 1G4AE 3HN6A 4B7XA 3QEAZ 4HAWA 4HJXA 1Z68A 3ZU6A 3BH7A 4TRRA 3EC2A 3VO1A 4LIPD 1UM8A 4K2AA 1H4TA 1MAWA 3WLHA 2QVBA 3EQZA 2WWIA 3GH3A 1RHJA 4HUQB 1ZH2A 4XGRA 4RSHA 2Y76A 3TXAA 1N5MA 2HHLA 4FNGA 4DTIA 2I7TA 5K4GA 4FN5A 1E0SA 1JPJA 3I1JA 5TF0A 1XCMA 1SVMA 1U0RA 3PDWA 4KOAA 4WH0A 5JVDF 5F1KA 4HVLA 1OV6A 5BUQA 4HNTA 4MHTA 2E82A 3N0RA 3RHTA 4ZDJA 3IBSA 3LCJA 1CR2A 2EFJA 2VPTA 5JLAA 4IGEA 2Z1MA 5BSKA 2VYCA 1XLTA 2I65A 4X90A 4MULA 5JE8A 2R6AA 3K8ZA 3CR8A 3T61A 1OLOA 5THKA 3K0AB 1N2XA 2ZROA 3TZKA 1ZI8A 2YY7A 1Z6AA 1QUFA 2WIAA 3DZHA 3HVKA 4GPZA 1ZUD1 3UA4A 4Y7DA 1EFRA 1V43A 1CUIA 1R8JA 1ML3A 2PTG