2ZTHA

Crystal structure of holo form of rat catechol-o-methyltransferase
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
212
structure length
206
Chain Sequence
DTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEMNPDYAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEKCGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catechol O-methyltransferase
publication title Crystal structures of the Apo and Holo form of rat catechol-O-methyltransferase
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 68
structure length 206
sequence length 212
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2008-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2zthA00
3NJRA 1VLMA 2LD4A 2O0LA 2YQZA 4C06A 2G70A 2ZVJA 2B9EA 3E23A 2YX1A 3PT9A 4BLVA 5LSAA 1L3IA 2FCAA 5E9QA 4RTMA 4BLWA 2G71A 3AXTA 4X1OA 2NXCA 3FUWA 3KPYA 1DUSA 4MQ4A 5CVEA 2PWPA 4L7VA 3R24A 5EZQA 3G2QA 5T6BA 2PXAA 3B7PA 3KQWA 1B42A 4R8SA 4DA4A 2AOVA 2O06A 1G38A 1XDZA 3UJAA 2UYOA 2JHCA 3EMBA 4DZRA 3UJDA 3GU3A 3P2KA 2VZ9A 4GEKA 3CKKA 2PY6A 4Y30A 4PYKA 3ELWA 4M7RA 4OBXA 3FYCA 4C4AA 1WS6A 1PJZA 3GXOA 4EKIA 1HNNA 2P7IA 3BWMA 4OQEA 5KQSA 2IBSA 3AJDA 3CVOA 5EKXA 3LHDA 2BM9A 3SXJA 3TMAA 3V8VA 3KPJA 2AOUA 2IGTA 4Y2HA 2ORED 4YMHA 2QY6A 3M33A 3KHKA 3G5TA 4FS8A 3ER9A 1VL5A 2PX5A 5LQNA 1NKVA 3BWCA 5U4XA 4RTRA 1P1CA 4RTQA 5K0BA 4PYJA 3DMFA 4GOMD 3EGVA 4QVKA 3C3YA 4RVGA 3SVZA 2XYRA 4U7TB 4E2YA 5DTRA 5IH3A 3AWIA 1NW7A 3C6MA 4CTKA 2YVLA 3TFWA 4X41A 1N7JA 3SMQA 2I62A 1L9KA 5MHTA 4PNEA 4X60A 5C9ZA 3FPJA 5E1DA 4AZWA 3S68A 3Q7EA 3SSOA 2YR0A 4LECA 5ICFA 3BGVA 2UZ4A 4GC9A 5CVJA 2ADMA 5E2AA 5E8RA 3CGGA 1O54A 4QTTB 2P7HA 2P3OA 2P41A 2FPOA 1YZHA 3IYLW 4HH4A 2CMHA 2Y1WA 4C04A 1XVAA 3HVIA 4DQ0A 5K0GA 3T7TA 5K01A 3LL7A 4M36A 3PB3A 2Z6AA 4P7JA 2HV9A 2C7OA 1X1BA 2XBMA 4HSGA 2NXNA 1WY7A 3QV2A 5B1SA 1RI4A 2JJQA 2PT6A 3LECA 4QTUB 4ATNA 4C07A 4CXMA 2P3QA 3MCZA 3BGIA 4AUKA 3CJTA 2XYVA 5DLYA 2EFJA 2Y1XA 4PGHA 5E8JA 4QPPA 5GM2A 3TRKA 4UOEA 3KQVA 3KPVA 2IBTA 3DLIA 3G7UA 2ZIGA 3B5IA 3GDHA 4EMSA 1P91A 2P8JA 3DOUA 4CWAA 2O57A 3FPGA 4KIGA 3UWPA 4PYNA 1VBFA 1JQ3A 1JR4A 1X1AA 2HNKA 4OBWA 3DR5A 2B2CA 3EGIA 2OZVA 3TKYA 4YV0A 3L8DA 2GPYA 4GUAA 3EVCA 3OU2A 1Q0TA 3CBGA 3A25A 2ZSUA 3LCUA 3UJ8A 2G72A 1RI1A 4R8RA 1T43A 2AVNA 1JG1A 2WA2A 2IP2A 5CM2Z 5FADA 5FHQA 1L3CA 3FUXA 4C03A 5BW4A 3HM2A 1TPYA 4C08A 4ZTBA 1SKMA 3NVKI 3UBTA 3GCZA 3V97A 5GP1A 3LDGA 3FPEA 3RODA 4KRGA 4BY9E 3DMHA 4YMGA 1ZKDA 3G2PA 2ZWAA 3HCFA 4MWZA 3UA3A 3ELUA 1TW3A 4O29A 4C05A 3P9KA 4H0NA 4QDKA 3JWJA 2BM8A 3EVAA 5EVJA 3TOSA 1I1NA 3VC1A 3SR4A 5FA5A 4E30A 2IFTA 5DX0A 2O07A 1RI2A 2FHPA 5HOQA 4E31A 5K09A 1XCLA 5LQKA 5F2OA 4OA8A 5T64A 3ELDA 2JHPA 1INLA 4LWPA 3EVDA 3FTCA 2AVDA 4M38A 5LQRA 2B3TA 3AY0A 5HIIA 2G8NA 4GOLD 1YFLA 2ZCJA 5E2BA 2AOXA 3LCCA 2GH1A 4HTFA 2ZZNA 2PVCA 5LQAA 5K0CA 3H2BA 3PTAA 3C0KA 4ER3A 5D1HA 3HCAA 2AS0A 3A7DA 5EOVA 3HTXA 4AZSA 2IH5A 4RWZA 4PYLA 3JWHA 2PBFA 3KQOA 5E1BA 2ZZMA 2OXTA 3C3PA 5FUBA 3LKDA 4QVGA 1YFJA 1EJ6A 3HVJA 4RV9A 3PX2A 1NW5A 2P40A 3DXZA 3HP7A 3OFKA 5E1OA 4E2WA 2H11A 1UWVA 4K6MA 2AZTA 1D2GA 2K4MA 5DM4A 1HMYA 2ESRA 1VQ1A 3R0QA 4YUXA 1R8YA 4U7PB 4P58A 1G60A 3KQQA 3R3HA 1QZZA 5DPMA 2G1PA 2DULA 1R00A 3NWBA 2ERCA 2UYQA 3M6VA 5EIFA 3GRVA 2PXCA 2ZFUA 3FTDA 4DF3A 4YUWA 4KIFA 2ZIEA 4PYMA 1YF3A 3P9CA 4CKEA 1KR5A 2QRVA 4EQZA 5GIOE 3FPFA 3KR0A 3LX6A 5DXAA 3BUSA 5E9WA 2ONZA 5FULA 4YUVA 3UJ6A 3O7WA 4FZVA 3UA4A 2DPMA 3O4FA 2WK1A 3FPHA 3FZGA 5CCXA 1UIRA 3HA5A 4DMGA 3EEOA 5EHGA 1WG8A 1KYWA 2VDVE 5KVAA 4GC5A 3IHTA 4POOA 4PCAA 1JQDA 3EVZA 3P97A 3REOA 3DH0A 2PSSA 4CKBA 4DCGA 4E32A 1IXKA 1L1EA 3E7PA 3ORHA 3OE4A 1ZG3A 3TM5A 4KWCA 2Z6QA 4GQBA 2Q41A 3D2LA 2QE6A 4PWYA 5G02A 3KKZA 3I9FA 1P1BA 2V7EA 3OU6A 4FP9A 4IKPA 4RX1A 1M0EA 5FTWA 2AOWA 2QM3A 5HFJA 3ME5A 4RVHA 2PGXA 5F2NA 5HILA 5KS2A 1ZHFA 1NBHA 2B78A 3PFGA 4MIKA 3MB5A 1G8SA 3VC2A 2JHAA 1EG2A 2NYUA 2HWKA 4FSXA 1I9GA 1X19A 1RJFA 2GB4A 4FSDA 4FT2A 5F2KA 1PRYA 5P8WA 3LSTA 4HGZA 4KDCA 1JG2A 3DXXA 2FYTA 3GIWA 2I7CA 5DM1A 3TLJA 4P7GA 3EVEA 4PONA 4X61A 5ICCA 5CD1A 5CVDA 4GOOD 4QQNA 2GLUA 3I58A 4EVIA 1M6YA 3HCEA 4IWNA 4M37A 2UYCA 5GWXA 2I6GA 5HIJA 3NVMB 5D1NA 5DTQA 3BZBA 2NXEA 2PJDA 3A27A 3LCVB 3P9NA 4OA5A 4RVFA 5EQJB 1F3LA 5GOZA 3OZTA 1RI3A 1KPIA 2A14A 4XUDA 5DX8A 3FTFA 2O05A 2AOTB 3C6KA 3KPUA 5FHRA 4F85A 1VP9A 1YUBA 1AQIA 5C0OE 2ZBRA 5K03A 5FCDA 1KP9A 2IIPA 1MJFA 3EVGA 3KPWA 2CKDA 2FK7A 2ZTHA 5BW5A 1KIAA 2VDUE 1KHHA 3LPMA 5DTMA 2YUIA 3LDUA 5CUQA 5EMLA 3FTEA 1XTPA 1EJ0A 4KVZA 2WA1A 5H02A 3OU7A 1D2HA 3T0IA 3BKXA 3TR6A 5IKMA 3KQPA 5EMMA 3KQSA 5KYGA 1BKYA 1NW3A 3LBYA 3M6WA 1ORIA 1RI5A 2B25A 1WZNA 5EEHA 4B17A 3P2IA 5K0LA 2OYRA 4NECA 1JTEA 5LR6A 5EHIA 4Z2YA 5K8VA 1OR8A 1NW6A 1XCJA 1R6AA 4MHTA 4PYQA 3GWZA 1JG4A 3JWGA 2CL5A 1WXXA 5M5BA 3NMUF 3FYDA 5LQUA 2AN3A 5FA8A 2R3SA 3SGLA 1SUIA 3UFBA 1FP2A 3BWYA 5DX1A 4ER6A 1JG3A 2V74B 1O9GA 5GM1A 2PV0A 5FWDA 3T7SA 3BXOA 5ICGA 3PS9A 3T7RA 3A7EA 1XJ5A 2AOUB 1H1DA 2CMGA 3GGDA 2IDKA 1AF7A 3CCFA 4GF5A 4PIMA 1JSZA 3LDFA 1KXZA 1KPHA 3G2OA 4G56A 1SUSA 4HGYA 3DUWA 1WXWA 2OBFA 5LQJA 3M70A 3VYWA 5HZMA 2P1DA 3EVFA 3HVKA 5CCBA 2GA9A 4R6XA 3ANXA 1XDUA 2ZZKA 5CVVA 3PX3A 4AZVA 1R74A 1G8AA 5FQOA 5K0NA 3FUUA 5K0EA 1SG9A 2EX4A 1TW2A 2EG5A 3THRA 3BT7A 4CTJA 3M4XA 4LG1A 3FUVA 5EMKA 1VPTA 3NW9A 4RTKA 4WVLA 2NP6A 2ZBQA 3HVHA 2YXDA 3KQYA 3TPZA 1VP3A 5ICEA 1D2CA 5K05A 2BH2A 2VS1A 4A6DA 2JH9A 4PINA 1FPQA 1EAMA 3MHTA 1KPGA 5EIWA 2PX8A 3I5UA 4V0QA 2AR0A 3EPPA 5E1MA 3NWEA 3FUTA 2BR4A 2PT9A 1Q0SA 3JWIA 1IM8A 1M6EX 2OB1A 2ONYA 2AN4A 2ZIFA 3M6UA 3DMGA 5DXJA 4EKGA 3EVBA 4HRAA 5CIYA 1X1DA 4QQKA 3CJQA 3BWBA 3LKZA 2NP7A 1DL5A 3BKWA 1NBIA 4RSRA 1Z3CA 2ZW9A 1AQJA 4BLUA 3FRIA 1EQAA 1QAMA 2P3LA 2ZLBA 1JTFA 4XUEA 3IEIA 2KW5A 3RIEA 3TKAA 2C7QA 3HEMA 2CWWA 4HC4A 4F86A 4YV2A 3GNLA 4KW7A 5EMJA 4YUYA 1RJDA 3SSNA 3AXSA 2YTZA 5EPEA 4DKJA 4FR0A 1ORHA 3K6RA 2PKWA 3DP7A 3P71T 3OFJA 3ER8A 3M6XA 5DSXA 2HTEA 4X63A 4IV0A 3FRHA 3UZUA 4GBED 1VE3A 2XVMA 3OPNA 1UFKA 4QPNA 4JXJA 4RYLA 5E9JA 2E5WA 3MTEA 2F8LA 3GRUA 3HCCA 3PLAE 3DULA 5C1IA 4IV8A 2IDJA 2YXEA 5CVUA 3KQTA 3UJCA 1XDSA 2Z6UA 2BR5A 2GAFA 3SM3A 4PCLA 3WSTA 5K0JA 2IPXA 3G8BA 3UJ9A 3MCTA 3ELYA 5DM0A 4DCMA 2OY0A 4E33A 4GOND 4RTSA 4KDRA 3MQ2A 1Y8CA 2ZBPA 1QANA 4XUCA 4ER0A 1DCTA 3B89A 2OO3A 1ZGJA 2PX2A 3HA3A 1JSXA 2JG3A 1N7IA 3Q87B 1BHJA 1JQEA 1G55A 4F84A 1BOOA 3HNRA 3HCDA 2H00A 5DRTA 3I53A 3DTNA 5GINE 4PIPA 1MHTA 4RTLA 4XCXA 5T67A 3G88A 2R6ZA 3GO4A 3KR1A 3O31A 5HIMA 1IY9A 3R9XB 5FWAA 3U81A 4WXHA 4R05A 5KQRA 2NXJA 5DT2A 2UYHA 3VSEA 1NW8A 3HA7A 4HTFB 3E05A 2VDWA 3KR2A 3KR9A 4R6WA 3EEYA 1L3BA 3OZSA 4P7KA 1V39A 4YUZA 2H1RA 3B3JA 2C7RA 2VP3A 3GRRA 1YB2A 3GRYA 3MTIA 3ID6C 1ZGAA 3QOWA 3SX0A 1F38A 2JH8A 2EJUA 3HCBA 2P35A 3G2MA 3LGAA 4MTLA 2IH4A 5EGSA 1XXLA 5EKUA 4E2ZA 3A26A 1RJGA 2XVAA 2XYQA 3PFHA 3B3FA 2NNWB 5K0FA 3P2EA 5DRYA 3SSMA 1AV6A 4OX9Y 1N2XA 5EC8A 2HMYB 3B3GA 2PLWA 3G8AA 1EIZA 1I4WA 2AN5A 3LBFA 1RJEA 3MERA 5EZSA 1G6Q1 3A4TA 2YXLA 7MHTA 1QAOA 2FK8A 3KQMA 2QYOA 1P39A 1BC5A 5LQCA 1QYRA 1FBNA 3KU1A 3MAGA 2QRVB 3THSA 4E70A 1YZ3A 1NV8A 4HG2A 4ISCA 2EJTA 4A6EA 4BP3A 3IV6A 3R6TA 3CJRA 2OB2A 2OPBA 4RTOA 5EEGA 3G5LA 3X0DA 4E2XA 5HIKA 2IH2A 2BR3A 3GJYA 1SQFA 3BGDA 3I64A 1FJXA 5DSTA 3CC8A 8MHTA 3UJBA 3MGGA 3P8ZA 5JR3A 4FT4A 3EGEA 1X1CA 4EK9A 1KYZA 2FRXA 2ZWVA 5HEKA 4RTJA 3EMDA 2C7PA 4YV1A 4RVDA 2I9KA 1SVUA 9MHTA 4ER7A 2HR1A 4RTPA 2OKCA 10MHA 1QAQA 1R8XA 3DLCA 2PX4A 3QOXA 5DWQA 1NT2A 4FGZA 5EG5A 2GS9A 5BXYA 1R18A 5ERGB 1O9HA 3OE5A 5FQNA 1NV9A 4PYIA 4RTNA 5BP7A 4LWOA 4DM3A 4V0RA 3DXYA 4ER5A 3UJ7A 1SQGA 3K0BA 3OCJA 3TM4A 1VIDA 2N47A 3E8SA 4P7FA 3P9IA 3TQSA 1FP1D 5DM2A 4BP1A 3G89A 4QDJA 3PVCA 3GRZA 4AZTA 4AX8A 1U2ZA 2PXXA 4OQDA 3OZRA 2BZGA 3F4KA 2PWYA 3RW9A 5JUWA 3NDJA 4PGGA 2AOTA 5GIPE 1NE2A 2ZULA 1ZQ9A 3NDIA 4CKCA 4PYOA 3NTVA 3ERCA
chains in the Genus database with same CATH superfamily
1KWKA 3C2QA 2YV1A 3J7AC 3BN3A 1XLUA 1L7EA 3O4GA 3DNMA 2L42A 4AJJA 1MLDA 2BEWA 4R2WA 4E3ZA 1DUSA 5JZBA 4D9MA 1T25A 2PWPA 3QY9A 1Z7YA 1HQKA 2O8EB 2IXAA 1PJRA 1M34A 4MEAA 2O06A 2CNOA 2WYVA 4OHYA 1O6ZA 4RDCA 1BCRB 1TUEA 1G8JA 3KZKA 5DE3A 2XUHA 2QT1A 4OH1A 3OA2A 4BNNA 2P4UA 2CF6A 1SULA 2PSFA 3G6KA 3OQJA 4M7RA 1Y8QA 4Q16A 3RTEA 2Z5LA 4F4DA 2D62A 2XUDA 5L8VA 5DNVA 2DERA 4KHPB 1S01A 1HNNA 1UOPA 5KQSA 2E37A 1ZSYA 2V58A 2BM9A 1G291 4IOKA 4MUFA 3ZVRA 4OVKA 3UICA 4G25A 3M33A 3R7FA 4G4JA 3UPUA 1P7WA 3A9WA 3TBFA 2A9FA 5AI6A 3CEJA 3EARA 3V1KA 1V8DA 4ZDWA 1E96A 3WY9A 1SCQA 2XYRA 1JBKA 2HGSA 3EODA 5EIBC 1M2OA 1IVSA 1R9MA 1WBDA 2ATVA 2YN2A 4MVWA 3ZR4B 5CLLA 5T6MA 3D4NA 1N3IA 2LP4Y 1D2MA 3S99A 5KNLA 3FPJA 2Q3HA 3ER6A 5BN3A 1JVNA 2HXSA 1C3JA 3MFYA 5JW6A 5ICFA 5FNVF 4W7IA 3ICQB 1AA9A 2FZLA 4MTCA 4BFUA 3FWNA 1AMNA 5KSWB 1O54A 1Q1EA 2B98A 2ZEJA 4PPYA 3TTUA 2J3LA 3IYLW 5ERYA 4Q1BA 3MRXA 1SEVA 1XVAA 3WLFA 4CV3A 2Z2IA 3WK4A 1UWLA 2GCEA 1FZQA 2Y27A 3MTJA 1X1BA 1H1LB 3PUHA 4ALIA 4ENTA 4AKHA 1PJSA 2VN8A 2PT6A 1A27A 1XD9A 2QUIA 3CF6R 1HG0A 4QTUB 4B48A 5KEIA 1EVYA 4BLQA 4ZVSA 4GBJA 2WBLC 1DAKA 3I30X 1BWQA 5C4GB 4EPYA 4ZKDA 2ZRQA 5JAUA 2GN4A 2HRZA 5IW8A 4S1OA 2ZROA 3AETB 5TRTA 4DLAA 3C16C 1ZDMA 5KHOC 3HBFA 1H2YA 2ZB7A 1JWBB 3FPGA 4XJVA 1MPTA 3FPSA 4LZLA 5AUQA 1JQ3A 2BISA 4FFDA 4Q47A 1I94B 2ZKIA 3QNWA 3EZ9A 3SR3A 3GW8A 3W2HA 3T5AA 1KEEA 2H08A 2O9JA 4ODIA 2V1UA 1OXUA 3DE6X 4KQMA 3DTTA 1Q0TA 5D3MA 1GYRA 3VZSA 1DV1A 3HU5A 1JG1A 4G67A 1PX0A 1I2DA 9MHTA 3LL4A 3N7UA 3CTPA 2IYAA 4TKLA 5E9AA 3RARA 4KXLA 1XZIA 1PT7A 5IZCC 4FPXA 2ZRHA 3JQ9A 2QL9A 2WIJA 2Z56A 5E6RB 4AT1A 1L4YA 3JQFA 1ZKDA 2X8JB 2XUFA 4FR5A 4N7MA 1TIPA 2DEUA 1HE1C 2W7TA 2WPDA 3BL6A 3LS2A 4JU9A 2Z95A 4N47A 1UOOA 4O29A 5EYPA 1TUBB 2J9RA 1YVDA 2R60A 2YV4A 3CUVA 2JFUA 1QO0D 2OQ2A 5WRFA 5KDOA 5LKRA 3MXOA 4HDAA 4FILA 5HZGA 1UODA 1FFHA 2QTAA 4RACA 2GXUA 4MCAA 4CM8B 3A0RB 3Q9SA 1YO6A 4ITUA 5CDGA 2OQIA 1X38A 1FFDA 3NH9A 1ZN8A 1Q14A 5ELLA 4JJ6A 2F3PA 4EEZA 1W4LA 5A0FA 2B3TA 4IDAA 3EFOA 3SKYA 1XZCA 5C37A 4CG2A 3LCCA 1ZW6A 2PD4A 1L8LA 4KX3A 1OHHA 3IO5A 3NHAA 3Q6MA 4FHGA 4AZSA 4PYLA 4HPWA 5MN4A 1EK2A 4XIGS 3A32A 4N65A 2OXTA 2AMLA 3HI6A 3STVA 2B4AA 5CB4B 4HFRA 4N12A 4YGYA 4A8JB 4WZBE 3TQRA 1ZD2P 3VRHA 1U1IA 4BQSA 2Z2JA 3W5HA 4EW1A 3VM6A 1NKSA 4ACAA 1ZOSA 3PNKA 4JVNA 3HY4A 3LUFA 3ZQ4A 4UFPA 2FG5A 1N0UA 2PD6A 2YIMA 1DOZA 2X7HA 1HK7A 1PT8A 1A0OA 1XRRA 2CCGA 3G6WA 4HQRA 5I6DA 4PYRA 1UT6A 3ZJVA 5IT5A 5HW0A 1LV8A 2O4UX 1H6CA 1I5EA 1ADFA 1C1YA 3FPKA 3NWBA 3N2KB 3DHVA 5FJJA 3THOA 1KH1A 4KQHA 3P9CA 4OJQA 1ZJWA 5HTKA 2NUTA 2OBXA 5E9WA 5FAKA 3NKVA 1R8SA 1M1YA 4EG8A 3P4XA 2POCA 3L01A 4QYMA 2AK2A 1J0XO 1I4OA 4XR9A 1PJAA 2AWNA 1XQYA 5KX5A 1EP9A 4QELA 4D6YA 3JVDA 2HHJA 2BJHA 1SCNE 2EP7A 3CCBA 1V1JA 3EVZA 3NAMA 3IIJA 3A06A 3FDZA 3E7PA 4EB0A 5B6IA 4MR7A 3AHDA 4QATA 3AFIA 4ARUA 4B76A 4NLLA 3F9CA 3DHWC 3QG1A 3EOAI 3OE1A 2JCVA 4ZT7A 4JJFA 3LBIA 3OX2A 4RVHA 1GVNB 1MO5A 1T91A 2YWXA 3KO8A 3MT0A 3PIRA 3QY0A 5DSZA 4D45A 5KS2A 3B6IA 3MBOA 1AUOA 2BFEB 3L84A 1XZEA 1ADBA 1ZSNA 2RIRA 4CEJA 1IBCA 2G1KA 1VKOA 2ZIXA 2ZSFA 1G8SA 2BONA 4J2HA 4NK5A 2ZSBA 2H2DA 4JEHA 1OD6A 4PG6A 4ZQGA 1A77A 1P31A 2ICAA 3SLGA 3V4PB 3GRAA 3GEGA 3IP7A 13PKA 2I55A 2IYQA 5H59A 2OV2A 4KPFC 1TRHA 2QUKA 2VP9A 3PHJA 4HNUA 3OAAD 4X65B 2OO7A 3RFTA 4X61A 4A0FA 4CM1A 2YBDA 1CLUA 2FMTA 4WACA 3BDIA 4L4UA 1L7VC 2AUNA 1ADCA 4IWNA 1Q84A 4ARZA 5ADUS 2NACA 2R7NA 1JAIA 2X2OA 5EKSA 2L17A 3JXEA 1YDEA 5HIJA 5LKAA 1FNDA 1CV2A 1YWGO 1YQEA 3KQNA 1K5GA 4RK7A 2PJDA 4N5NA 4Z4FA 2Y0EA 1RHQA 4ZOLF 1UQTA 1XQ1A 3ET5A 5GOZA 4EJ6A 5FBVB 2EFGA 5IT0A 4AN4A 3ZU5A 3OOHA 3WBFA 4OX9B 2AOTB 4PFKA 1U1DA 1B6RA 1AS3A 2XTMA 4RPJA 1HFJA 1N6HA 3ISTA 4NZPA 4O2AF 4RM3A 5GV7A 4RELA 3SYLA 3C3WA 1WB9A 4FC7A 2VDNB 3TI7A 1NVAA 3MC1A 4XFKA 1A8IA 3IEMA 1KIAA 4UM8B 2DU8A 1Q21A 4ZYZA 1BEZA 1YR2A 3EZFA 2RJOA 4B09A 2BGNA 3IULA 3AHJA 4DR3B 3BKXA 2WSSD 4MRMA 1ZCJA 2XXBA 3KLPX 3IHKA 4KLNA 3HLYA 3ZV6A 1QGUA 1P2BA 3UG6A 2CJPA 3IJEB 3L0DA 5DNWA 5EHQA 4CM5A 3OZAA 2OYRA 1JLHA 4D3SA 4JLMA 3LCRA 2YVUA 3P2JA 4K6CA 3P26A 3DF9A 4ZRMA 1SO8A 1KEUA 4Y7CA 2O6HA 2AXPA 3LVRE 5TX7A 3WGYA 3H9GA 2PA0A 2QT0A 2XDQA 2NYAA 1HTBA 1SUBA 2UU9B 4N7JA 3KYCA 2FX5A 4ER6A 2BBTA 1XN1A 1YBAA 2IPMA 2Y1KA 1XZBA 1DIOB 3AKCA 3EF0A 3MRSA 3R5HA 2AFRA 3UMRA 1P7CA 3QW2A 2JDIA 3T7RA 2OFXA 4N0DA 1BNCA 3MJ4A 4HPJB 5E7QA 1Q91A 4BBJA 4EABA 1M0WA 5BR7A 1HR0B 4D98A 1RVV1 1JSZA 1YKGA 2G04A 4O4IA 3TKLA 1LSSA 1T36B 1CUBA 3UJPA 2BJVA 5IDYA 3KZCA 2IOFA 4QYTA 4Z9BA 2XKAA 2NWQA 4ZYLA 5LQJA 3MSXA 4US2R 1ATZA 1I36A 4O1IA 4XQGA 3AEQA 3KKNA 2P1DA 2GASA 4I08A 4MZDA 5B4TA 1EA7A 3F7NA 4L5AA 4XW2A 2GJ9A 1CW2B 3IIEA 3IRUA 1K3FA 1FJHA 4CIAA 1Y9AA 5I7VA 2GM3A 2EC5A 4HAXA 4ROSA 5IXJA 1GDTA 1A9OA 2CDAA 2GJKA 2IZ1A 2TMGA 2X0EA 4KODA 2DJ5A 4D4MA 2ZB3A 5K6RA 5ILQA 3WHIA 2G6BA 3Q9UA 3FF1A 3A1FA 4WN3A 4EITA 3CRQA 1XF9A 1FPQA 1K0UA 4BMOB 4DDMA 2MR5A 3FZQA 3W90A 4KPGA 3LLUA 4MQLA 3ORSA 3RS0A 3ZCPA 3AFOA 3L4BC 4FI3C 3Q9NA 3O74A 1YGPA 4CKXA 3MUFA 4DLWA 4V3BA 4H0CA 1HL3A 5HIAA 1TJ4A 3ZI0A 1LDEA 1FFGA 2OR3A 3F7TA 3SZGA 3IBYA 5AVWA 3U0VA 3W2GA 2B4QA 1D7OA 5E38A 1NXOA 1PL8A 1EI9A 1XU4A 4KH1A 1RLOA 1YHYA 2VYNA 1JH8A 4G5GA 5AI5A 3A4MA 1ORTA 3RHZA 3ROFA 4WY8A 3Q8KA 3I45A 2GZSA 4XIFA 3GB9A 3BBPA 1LQ2A 3CX8A 3SSNA 4QJ3A 4CU5A 5EJ7A 3N86A 2AYXA 4GRAA 4WNAA 5L3QB 3RT7A 3L18A 4KCGA 3T7AA 3ZJYA 3DP7A 3NB0A 1YMQA 5ALEA 3RKSA 3MEQA 1TXGA 4QRIA 5DSXA 1VCNA 1SR8A 1CQIB 1RXSA 3TRDA 4OAOA 5G4LA 1YR3A 2QEQA 3MWFA 4JXJA 4KGVA 2PUBA 2I6XA 1GN9A 3GRUA 1IUOA 3U7JA 4P4TA 1OCEA 1ZIXA 2HADA 4HEA6 4F2HA 3NAGA 4ZXPA 1XTSA 1CQXA 5KDDA 2EWWA 3I0NA 3TCNA 4AW9A 4ILEA 1PS8A 1I0IA 4E33A 1QDUA 4LV6A 3VR3A 5IJZA 5B12A 1Y8CA 4WW0A 2ZUSA 2EG9A 3R6LA 3GT7A 4NYMR 2WZDA 4F84A 3I8OA 3GBVA 3PCTA 4YDHB 3HZHA 1TJPB 4ZOAA 5IX8A 1F8FA 1Q44A 2NGRA 1WE2A 2Q5LA 3NIDB 2SKEA 4OM8A 4PIPA 3ESXA 1PV4A 4PTZA 2PBLA 3ZDCA 1CWUA 2GKOA 2JLCA 1DXYA 2WIAA 2XVXA 3UXMA 2PLRA 1T5HX 1XZFA 3EISA 3I9JA 3IE0A 1B2LA 1HL7A 3TD9A 4DCOA 1TM7E 2GETA 1ORWA 4R81A 4FDTA 1NGSA 3RBVA 3SG0A 2B82A 3W3AD 4BMYA 1OGYA 1TVKA 3OZSA 2AL7A 5BNWA 2LVBA 3DBHB 3LPNA 3PDIA 1PGJA 2LPMA 1RPAA 2XMGA 3KT6A 1YB2A 3EC2A 3GRYA 3AF2A 2I3BA 3ID6C 4OQQA 2J09A 2VPPA 4OXYA 4C6TB 1T6ZA 4CN8A 3L7LA 4WTOA 4D8XA 1T1GA 2PMKA 2K7ZA 2XUJA 2ZYUX 4O4LF 4WV3A 3WNDA 3HEAA 3HCBA 4EMBA 5A3QA 5T41A 5EXSA 1N2CA 2C88A 2VRNA 1W0KA 2F1JA 2ZRGA 3K9FC 4GSKA 4HHEA 2DBZA 1U99A 1C4KA 3L8GA 2XYQA 4CMIB 3CU5A 3P2EA 3OIUA 1A98A 4MS3B 5DRYA 1WPGA 2VBFA 3OPYA 1S1MA 1T4MA 3SSMA 1GUAA 4FHFA 4HNSA 4MPRA 5EC8A 2OV3A 1T4CB 4NQRA 2PLWA 5FBHA 2AN5A 4L95C 4F38A 1Y6GA 1A2QA 3CLRC 5D7BA 5EZSA 3CRZA 4EL5A 4C4ZA 3JX9A 1U31A 2XNKA 1PSWA 7MHTA 1R0SA 1V9CA 4W7HA 1SCDA 2JARA 4TWRA 2P9GA 3KU1A 3HKEA 1XALA 1XCMA 5SZKB 4R01A 3MWYW 2PUFA 4YCCA 1EQUA 4YMTA 1I3MA 4TLBA 5DCUA 4YT4A 2ENWA 3IV6A 3R6TA 1P4RA 1ZK2A 2FLKA 1YE3A 3LV8A 5DHUA 4ES6A 1M1UA 4JJ4A 2NMVA 1W88A 2EJBA 2EZTA 3D4IA 3WK8A 4E21A 4LRWA 2GLXA 1UXOA 4P6VF 4GDFA 2YJ6A 2I71A 1B6TA 5ANRB 3BTSA 3PYMA 1WSBA 4QJ4A 4MMYB 5G0TA 5EJ6A 5KOIA 3VAYA 2O2YA 4EK9A 3EN0A 1XTUA 1AN9A 2NU6A 1ACLA 2YHSA 4RTJA 1FFCA 1UMBA 2OXRA 2ZUWA 4TQAA 4BN5A 1XJQA 2MSDB 4W5NA 4ZJUA 2A94A 1Q6ZA 3O8QB 4IM7A 4KMOA 2VNIA 4Z51A 3W9SA 4LA4A 1MUUA 3AIKA 1JIIA 2Q50A 1U2QA 2XNDA 1RPZA 4RHFA 4TLDA 1G5QA 3AEUB 3GUHA 3UK2A 4HWPA 1OH7A 1DXQA 3QPBA 4JYAB 5F64A 2OG1A 4DM3A 2FUKA 1EZ4A 2C9ZA 4ER5A 4YXFA 1R8JA 3AP2A 1E2GA 2CBXA 1U4OA 4WFKA 4Z3DA 1NN1A 2Q2QA 2XNJA 4KBFA 4UBJA 4QOSA 1P8AA 3VSBA 1DCKA 1W0JA 2NUPA 1B1CA 3VC3A 2NVWA 3F6YA 1K06A 5AI9A 3AETA 5DK4A 2PWYA 1OC2A 1Q7EA 4WFIA 1Y9JA 3KWMA 1E2NA 1UFVA 1YL7A 5K0TA 1W34A 2W2KB 4MUBA 1H22A 1RCUA 3L1HA 3OMLA 4IRUB 4E7OA 4ETWA 3CVJA 5CVEA 5B37A 4XAQA 3WGNA 1QRTA 1KKMA 1NLFA 1PJ8A 1RWQA 4P53A 1P4AA 2EDCA 3TVYA 2ZJ2A 1SBTA 3TSOA 1T1JA 1C7ZA 1K7XB 2NXCA 2W4QA 1CYDA 4F11A 4LC1A 2DUJA 3F67A 3T1HB 2QK4A 3RADC 2YHUA 3Q5EA 2FN4A 5CEEA 1L7MA 3NWJA 1LSJA 3KJFA 4B46A 1AGYA 1ZEMA 4RU1A 1GSAA 3LKBA 3MINA 4PG8A 8GPBA 3EXAA 4LDQA 2N1MA 4M0MA 1VE6A 3TZLA 5DH9A 2G0NA 2ZI9A 2UUPA 3FCUB 4C30A 3LY7A 3QUAA 4GEKA 1NRWA 2QSJA 3JAWA 1TMGE 3G23A 3AZOA 4GP9A 5AXBA 3K0EA 3R7BA 1QHYA 2ZUVA 2FPXA 4EKIA 3WJ2A 1WKCA 4NNJA 1FW8A 5BPFA 2H4HA 3UAOA 1ZYUA 3I9LA 1BJRE 3ANNA 3MGAA 4X1KA 1OU0A 3TN7A 3U7EB 1ZIPA 2Y3IA 2QNIA 4BQIA 4H4EA 2ZIZA 3BH0A 3R3VA 2J3IA 2X23A 3IEPA 4PAOA 3U49A 3HBLA 4RTRA 1XPUA 5FKJA 4PYJA 5CDHA 3DP9A 4LGMA 4E2YA 3Q8MA 5EIBD 5IH3A 2WSBA 3CNQS 3C6MA 2NVBA 3TFWA 1MC8A 4X41A 4OI4A 2I62A 1YZYA 2J07A 4EPVA 1WLYA 2QN3A 3RYHA 2SHKA 3L49A 5DBHX 3RBXA 1WPRA 1YS1X 2EFEB 1MU0A 2VF7A 4UD2A 1DEOA 2EJWA 2XKJE 4L6AA 4UBLA 1GEGA 1MX9A 4R5HA 1ULTA 1MBZA 1NIJA 5HYVA 2A7XA 2B69A 1XHEA 1KYXA 5KSOA 4WNCA 4JB3A 3T12A 1ZH2A 1N4AA 4BHTA 4B73A 4RSMA 5FL3A 4DJAA 3ST7A 4LBWA 4L4RA 4C04A 4ZYYA 2P6PA 4HH0A 3KJQA 4O25A 5ERXA 2YV5A 1VKZA 1E3QA 3T7CA 3KQKA 3K05A 3JD0A 4F2PA 3L77A 3LVFO 1P6UA 2CLDX 3UMVA 2CFSA 4MA4A 4YECA 1A71A 3Q4GA 2GFIA 3B7GA 3O9VA 1L4LA 3OOJA 1UC5B 4DPMA 1EBUA 3JQPA 4PZUA 3GBPA 3EA0A 1WKVA 1QCCA 3NZEA 1A2KC 2CNWA 1WVGA 4IXDA 3KQVA 2IBTA 1DWQA 2Y1LA 3G7UA 3H17A 3R7NA 3F1LA 4Q4HA 2WP0A 4WSOA 5HDQA 3C5WP 4TS1A 4CWAA 1C4WA 3UXHA 4FS3A 4LF8B 1V25A 1HSOA 1VBFA 1DQYA 3EWSA 3IC5A 3TAHA 4D0NA 4G0QA 2B2CA 4G24A 3ZNQA 3EEIA 1V41E 1D1SA 2ZPTX 2ETXA 3L8DA 4KXUA 3RRZA 4DL9A 1IXYA 2XH8A 4IEEA 3A25A 2CXSA 3KYBA 2JBHA 1AHHA 1RI1A 3LO5A 3RYCB 2CLSA 1CSEE 3RANA 4C43A 3F73A 1U0JA 2VJQA 2HJ9A 4UE6A 4Q3CA 2XB4A 5C8XA 1QLJA 4UJ3A 4AO6A 3KZNA 1X8LA 3X2SA 5GP1A 2QUJA 1O1YA 2C03A 4Y2XA 3DKPA 2ODBA 1X7HA 3DONA 2BFEA 3CF4G 3CMMA 3ESBA 3H8JA 3T1OA 3VO2A 5JZ9A 4NAUA 2I34A 3AYXB 2WWVD 1J2YA 4WAUA 1II8A 1RKXA 1JU3A 2WU1A 4E6PA 2INGX 3HBAA 2ZUBA 5SZHB 1O2DA 2RIPA 1XU9A 1A7AA 5EVJA 3S8YA 1FTYA 1KQPA 1UK6A 1KZ6A 2IFTA 3G49A 3LXXA 5AM5A 1KR2A 1CQJA 2QXYA 3I6IA 4D74A 3S1AB 2YMLA 1ZINA 5BNTA 5D2CA 1EX9A 4IQGA 3KL2A 4H1VA 1XTRA 4XM1A 1L0BA 1DDOA 2QLLA 4LQLA 1JHVA 4MIOA 5ALNA 3SHWA 4RCVA 4OHZA 4IDDA 3A6DA 2YQ4A 3AY0A 4JJGA 5COQA 3JYPA 1E0AA 1C7IA 4OJMX 4DA7A 4IEFB 1AQ6A 1GAWA 5G53C 3UK0A 1HNXB 1ID8A 3E22A 5D1HA 5U1PA 1S9DA 3G2LA 2DH6A 4JNCA 5E1BA 1YJXA 4D9HA 4YWHA 1PUIA 3CR8A 1SCUA 5J5CA 3R09A 1DBSA 1TVMA 1PR1A 3IAS6 3EQ2A 2P2DA 2D2VA 4NMMA 1SVKA 3EDOA 4W99A 4U2DA 3KYIB 3VR4D 1VPWA 4J0FA 1FUUA 2DGDA 2KPOA 3ZZNA 1Q1BA 3IDOA 2ST1A 1XT6A 2NU7A 3WIOA 1AKTA 1BXGA 3GCDA 4G89A 4N5HX 1G5HA 3AYZB 2A0XA 2QENA 4NNPA 3Q7RA 4DF3A 1YF3A 2WD7B 3H11B 5CTJA 2B99A 4TOIA 4RL6A 3DC2A 2RHTA 2NT3A 3UK7A 1DC7A 5F7OA 4C7XA 1LC0A 3SK0A 3PGJA 2XMPA 3BH7A 4KIJA 5FT9A 3ZQKA 5LQDA 1XWIA 4RIGA 3WL5A 4FB4A 2PGLA 4FZRA 1F0KA 4JKYA 4FYPA 4DYHA 1EFHA 3AVQA 2CVHA 1EX1A 1JR3E 3HUDA 1QTRA 1WG8A 1MIHA 2VDVE 2W6OA 5I9TA 3VZRA 2QBYB 1AG9A 2XRYA 1V6CA 3G8DA 3GK3A 2PYZA 3SDBA 3WLTA 3ZWOA 4HZIA 1AD2A 2HF9A 1ZG3A 4H18A 4KLCA 5K8JB 2C07A 4K40A 4M9CA 2YN0A 4EX7A 3AW8A 5FWXB 2HT1A 1HDCA 1KMNA 2DETA 1IN7A 4BQNA 4MI6A 2RGBA 4HK4A 4EI7A 4JQZA 1OU4A 1DRJA 2VJNA 1DJNA 3IQXA 1Z38A 2J6IA 4H35A 5ITWA 1R12A 4B47A 1F7UA 4WCDA 1PFUA 2NADA 3LPLA 5EWJB 4A9AA 2HIAA 3CRNA 1I32A 1RJFA 2CHQA 4NK4A 5JMOA 4M1SA 4GXQA 4LZJA 5DM1A 5K1ZA 2FYTA 3PK0A 2O5RA 4QWMA 2COEA 4Y2VA 4QOJA 5AVOA 1ENOA 3IJ5A 5ICCA 2EATA 5JWOA 1KI7A 4V2IA 1Q19A 1Z8DA 4RW0A 2CFIA 2ZRNA 4UNPA 2HA5A 4PW0A 4E46A 1LPMA 5B7NA 5HKOA 3MAAC 3WNBA 2UYCA 2GWHA 3FYUC 3K9QO 1EK5A 1F60A 1OZAA 3I9NA 4OHRA 5BMVB 3R4CA 3VNRA 3OCYA 2ISSD 4DLBA 2VF4X 4L4ZA 4EUSA 2ERXA 3QA9A 5EQJB 1RXVA 2WVHA 1USKA 5E6SB 4Z9YA 4FX5A 2BZ1A 4Z99A 1UPAA 3DJYA 1I4LD 4O3MA 3HHPA 2RH5A 4DHEA 4FEGA 4GXRA 4C2AA 4XLZA 1SG0A 2IEYA 4I5GA 5IDXA 5K03A 1IBSA 4F3TA 1FNBA 2PO5A 2UVQA 2XEDA 4N01A 4OQLA 5AMXA 1U2DC 3GJ3A 1UBFA 1EZZA 2FXIA 2VO1A 3H1PA 3GFRA 3OCZA 4QYWA 5DTMA 6AT1A 4EJMA 2G5GX 3OJFA 2A78A 2GD0A 2GK4A 1OAOC 3WYBA 1CQIA 2VF5X 3QVMA 1IH8A 2I78A 1L5KA 1NL3A 3RRBA 1QSGA 3TI9A 4D6XA 2H5JA 2KMLA 4JDUA 4X85A 3E4CA 5IP5A 4GGMX 5T4EA 1QHSA 1WXXA 3HO8A 4EFNA 1Q1ZA 2H7YA 2IY7A 2OVBA 3F98A 2R3SA 2XY4A 3R3XA 2XCIA 2JLYA 3BWYA 1OGIA 2BY4A 1NQOA 2AMVA 3A9TA 2HTFA 2PV0A 3HBNA 3OCWA 4UCFA 4ZQEA 5LP6B 4R7GA 1JU4A 2P4SA 5AVKA 3UH0A 3GJ8A 5CT6A 1GSHA 2XQVA 1ZH0A 1C3LA 3AC0A 3NANA 4KHZA 3TB4A 5A2GA 2DBRA 2PUGA 1RPTA 4B7AA 2YWRA 3T7DA 5AVVA 1O89A 3REFA 4LC0A 4E15A 3G2OA 1OMOA 1F2UB 1KK1A 3WI7A 1O94C 1Q7CA 4ARIA 1O6GA 1E7QA 2F1HA 2Y4OA 3AILA 1FP7A 4NF2A 3ENKA 4HB3A 2JGLA 4P3PA 3FKSD 4XB1A 1U4SA 4AWAA 4ABTA 4TKZA 1ICEA 1GPJA 1I4TD 1SG9A 4M22A 5L3ZA 5JDCC 1KFJB 3C48A 3FETA 2JFPA 3TJRA 2PGNA 4Q82A 5EMKA 3DCYA 4F1JA 4GMKA 3DPUA 4WKPA 1KZ7B 5J4VA 3TPZA 2YXDA 4NY1A 5AICA 1VP3A 4YYEA 5E2IA 3W6ZA 4CKWA 1PNVA 4CF5A 3PXAA 1MRSA 3B1VA 1ZCAA 1UP6A 1Z22A 4FOOA 2VLIA 1NI4A 3V48A 2J5KA 1WNTA 2YOHA 1QHHA 1PEYA 1RWNA 3E7DA 1X8KA 1AKEA 3E18A 3OCCA 2RHRA 4Z0NA 3VA7A 1UBNA 3PHHA 4FGJA 1IATA 1KAEA 2IJGX 4JA0A 4J0HA 1KO1A 1TTTA 4JYPA 4TQ9A 1V8FA 3GWGA 4IILA 1YJCA 3C41J 5IJ0B 1GPMA 4NX2A 1AQJA 1Z62A 2D0IA 2IZ7A 1JPJA 5ALGA 5DNYB 5HF6A 1RCTE 3VTKA 3USCS 3DAPA 1BW9B 2TS1A 2C7QA 1MNQA 2EERA 3FSRA 3WGIA 2OZPA 2XA9A 3M82A 4FGUA 4PRZA 2YZNA 4BATA 5FH9A 1KSHA 2XODA 1YJ8A 3E5HA 4QXQA 2EKQA 1HDZA 4EPRA 5A9SA 5AHOA 1Y5LA 2FMKA 1FSFA 4K7JA 5BN4B 3RC7A 4G1FA 3JV7A 3OJWA 2VJMB 1MXHA 1WD7A 4II2A 3ANSA 3QIAA 1HI9A 1T8SA 1VE3A 1O08A 3DWIA 3PG5A 5TPZD 3MYYA 4XWWA 1P5RA 1ZN7A 4I55A 2FZVA 2PS1A 4JLUA 4MV1A 3DLPX 1H9AA 3L8ZA 3NV7A 3VX4A 4IV8A 1WW2A 2QU8A 4QU5A 1G4HA 1K8QA 2XR1A 1FFAA 3AV0B 3F3SA 3RVQA 3LBNA 5HKKD 1FVOA 1BDJA 4G36A 1NJ5A 2IYPA 3DLTA 4ERNA 1LU9A 5F9HA 3HM9A 2Y0BA 2NZ8A 2HA3A 3N2GB 1QOQB 2PKRA 3DZHA 1VPVA 1VGRA 2AIRA 5EIOA 3ZC3A 4B4UA 1ECBA 3CUYA 1G55A 2IOQA 3AHFA 2ODPA 8ATCA 4A8JC 1XYGA 2F3UA 1MAVA 3OIVA 2ZYSA 3B1WA 3UK1A 3U5ZB 3B60A 3DAOA 1MXFA 5BT9A 1J0EA 1UKZA 4ZI7B 4HATA 2G1JA 3GDOA 4JGIA 1E1RD 2PVSA 3U56A 4B6SA 1PGQA 5BQPA 5FTMA 2VRWA 1TO2E 2OAEA 1YZLA 4CMAA 3EEYA 4HDQB 1GL3A 1TK2A 5EMHA 2AR7A 2WD8A 1WP4A 3S0JA 1R5JA 1M0SA 1SD5A 3RAJA 4PO1A 2JFBA 1B0UA 1QE3A 2CE2X 5C8YF 2FUNB 3TXAA 5BQXA 3LT0A 2DHEA 2KI5A 2ZAMA 5T57A 5THQA 3M4JA 2CXRA 3QA3E 2X6TA 4RO0A 5ALXA 5EKUA 5JNTA 4BO3A 1L5GB 1RJGA 3K6SA 3MILA 4G23A 4J8PA 2VYVA 3PFHA 2EV9A 4UUMA 2O7NA 3X1JA 2GUWA 1QR2A 2W43A 3OLXA 1IJEA 4NR0A 3IO3A 3ZGXA 1FX0A 2C5AA 4BECA 1FYDA 1X0XA 3UW3A 2HMYB 1GTMA 2PIDA 4F5DA 2QMQA 5BOSA 3QWAA 4LGVA 1V6AA 5JSUA 5TS3A 3CLRD 4X6UA 1NVMB 1UMCB 2M1ZA 2NZUG 2XE7A 3A4TA 2Q9BA 3FLEA 3IJRA 4B4WA 5AW8A 1KTIA 2R1TA 1V8ZA 3CRW1 4EELA 1OA1A 5EE0A 4ENUA 4G4IA 5DJ5A 3TZKA 1HLFA 1Z4LA 2X77A 4E70A 1YZ3A 1QLWA 1TA0A 4ISCA 5CEFA 1TYAE 1Z25A 2EJTA 1Y6FA 2XGJA 2OCPA 2XUOA 3DVRX 4Q1FA 5DK6A 4Z5XA 2JJ8A 5HIKA 1NBME 2X5OA 1AC5A 2ZRFA 5KU7A 3QEMA 5FV4A 4IOJA 4OY3A 4AJ9A 1LF0A 3FYHA 3IIKA 1QO7A 3PC4A 5BRAA 4X24A 2GF9A 3QEKA 1F48A 4KV7A 4A03A 3TUZC 5DYGA 4RZQA 1MEJA 2H8GA 2X76A 4H27A 1QHXA 3VV2A 4C0QC 4YPVA 1AA6A 1GZVA 3OBIA 2XSZA 2XKBA 3H3XA 3QU2A 4NI5A 3ZHBA 4BJ1A 4DIEA 3OQIA 2GBCA 4MSUA 5DLDA 4DJFC 3DBIA 1R4ZA 2PZMA 4MYCA 4OK3A 3OQBA 4AJKA 4EFMA 4C4YA 2DLCX 4QE3A 1G9SA 2I03A 1VL0A 4FTWA 2CDNA 2OKGA 4PTLA 3ENQA 3OE5A 4X84A 5G3ZA 3TW8A 1AGPA 3WK9A 4QLBA 4JR0A 3LDHA 1GNVA 2PK3A 4MA5A 4V0RA 3DXYA 1QK4A 3O8OA 4O3FA 4ZYVA 4QOGA 2C2OA 3P9IA 3TQSA 1A8HA 1JEQB 2REBA 3WYDA 4G84A 5JSHA 4R69A 3RV3A 4I2VA 1Q7RA 1Z8NA 3DV9A 3PHCA 3IL2A 2BZGA 1XKXA 5JUWA 1HDXA 2WI8A 3ZWPA 2JIZD 2P5YA 4PGGA 2E7ZA 1CE8A 4DLNA 4TWIA 5JWRA 1ZQ9A 2HA0A 4WL0A 5BN5B 2XGGA 4A26A 3VR5H 4ARAA 1UQUA 5LDGA 4BGEA 5K3EA 3CGWA 4YRFA 2G70A 3GZJA 4TTQA 2DWCA 4QBIA 4U2CA 4BLVA 2C78A 4Y2QA 2YBEA 1XNHA 3GUVA 3C5CA 3CVWA 4MQ4A 4BOYA 4OLJA 1NFRA 1UFQA 2V55B 3SDZA 1NJGA 1A3CA 3DC7A 3PZRA 4N0EA 4Q5IA 5AKJA 3HUFA 5HHTA 4DA4A 2BLNA 3Q3GE 4O5OA 4AJOA 1XJWA 4RZ3A 1FIUA 1XDZA 5JNUA 2R1VA 3BMNB 1EGVB 3DVAA 4DZRA 3IAFA 1BJTA 3GU3A 4B6FA 2WM8A 3EXHB 1SQSA 3QI7A 4YREA 1D2AA 2V7WA 1FQKA 3JQDA 1OWOA 3ND5A 2D0DA 3OBBA 2AFVA 4TWBA 5KNCD 4NS1A 4OQEA 1YQUA 1FNNA 2I2WA 2G0AA 1WLSA 4ZI2A 1WF6A 3LYUA 3D5TA 4PAMA 1N6OA 1T5TA 3KHKA 2IEAA 5L7WA 1VL5A 2YINC 4B2LA 2GM4A 1CRWG 1C2TA 4X91A 4S0ZA 1XUOA 3W04A 5A7FA 4ZZ2A 4M1QA 1Z6QA 2NQTA 3STHA 2K7FA 3QKSB 2EOAA 2YVLA 3CQ9A 2QL7A 1TD1A 4ESVA 1A97A 1EM8A 1N2EA 4I8DA 1V9LA 4JEUA 1L9KA 4QYXA 4UUAA 3K0SA 4CT4B 4PNEA 3FMGA 5EJEA 2FSVC 4BO5A 2BHSA 2PSDA 4BP9A 1I7DA 2VPXA 3K2BA 5JDIA 3F78A 1CUGA 1NYTA 3HXLA 1QIKA 1TA9A 4G5YA 3HXKA 1G9TA 3VDMA 2KWIA 1NULA 1RFGE 2QNBA 1V37A 4DDUA 2CMHA 1H23A 1NNSA 3GFPA 3H7AA 4RF3A 2WJYA 2Q9CA 3PB3A 2WYOA 4BO6A 1RRVA 4A6PA 4IBOA 5HZHA 3ZDDA 1K8ZB 5FWYA 3ETDA 4MW0A 3GD5A 1A9RA 3GGSA 2OK8A 4CG0A 5LNK1 2GYWA 5IBQA 4BLRA 4C7OB 2MYTA 1Z83A 3WAGA 2XXAA 3ITDA 3TCKA 4CQMB 5AVZA 3CJTA 1UJ6A 4NJOA 1MEEA 4AKEA 4YASA 4MVJH 1Y6JA 1G16A 4Z2AA 3T1NA 1Z06A 4U9IS 2X1LA 1GL7A 1IWOA 2XGSA 3NBYC 1XVIA 3LTNC 1J2UA 3IPXA 1N0IA 1JR4A 4L50A 4BUZA 1FXWA 3TL6A 5D6OA 3UB2A 3MQ4A 4OJNA 3EMKA 1VCMA 4HQOA 4P3KA 2FPKA 3KQLA 4GUAA 4IQ8A 3NHSA 3GLFE 1OIVA 2ZSUA 3L41A 3S40A 2VA9A 3EF1A 1XRNA 3L0BA 2B1IA 3ZK9A 3ZZTA 5AHXA 1PBTA 5F3DA 3PJFA 2GPSA 3EXEB 2C2YA 1U9YA 2CD9A 2JAOA 3BXHA 4Z4IA 4S1NA 4LJ8A 3SQOA 1P2TA 3GCZA 3OT5A 3LIPA 1HURA 4O4HB 1L7NA 1RM4A 3DMHA 4OD0A 1PYDA 2PPLA 3WX0A 4RCZA 3LJKA 5FL7D 5TQ0B 4MQBA 4JT9A 3LPAA 4E51A 3WP0A 1TW3A 1G7SA 1UM9B 3OVMA 1A1VA 4EEKA 1L5QA 4Q1VA 3ROXA 3EVAA 3OJXA 3VC1A 1RR6A 1F8UA 3O8NA 5IJ9A 2WTEA 4N3BA 1C1XA 1RI2A 4R4JA 1LRJA 1T9KA 2IHTA 3IMKA 4J3NA 1XMQB 1Q0QA 1AKNA 3EVDA 3R9XA 1ZW1A 1L5HA 3W06A 1SD1A 3NP7A 1RMYA 5LLDA 3FDXA 4P34A 1WXFA 5JADA 5K8TA 1PDOA 3HQ4O 4WBSA 1L5WA 2ZI5A 1NRXA 1ONOA 2VNJA 2W71A 2A4KA 1OIWA 2RCYA 3LLMA 3TZCA 3HHEA 3QBJA 4P2BA 4YALA 3ZOKA 4BNXA 3HCAA 3EBLA 3EZYA 4AFNA 1E4VA 2QRJA 4ZHQA 1GHTA 3DE1X 3N53A 1WXHA 3UAZA 4RPCA 5FORA 1EG7A 2LW7A 1EGAA 4EJSA 1EVEA 3T06B 3ZWVA 4XQEA 3PX2A 3OIFA 2O2HA 3HDVA 1L8XA 3EIWA 2HSZA 3C87A 1A8SA 2WTUA 1P77A 5IDWA 1P17A 1JKFA 2IV7A 4OGGA 5AHKA 3ZNNA 2V96A 2XQJA 4TRNA 4E1VA 1I7SB 2IEZA 2QRGA 4EVQA 2CLOB 3Q1KA 1AKVA 4BCCA 3RFVA 4IXMA 3JQGB 4A1FA 3EDCA 4F3RA 5EJ5A 3U09A 4UZFA 1R00A 2CMFA 4LXXA 4Q9DA 1MX5A 1P7YA 3JSAA 4F8JA 2QI9C 2M2IA 2ORYA 4GQAA 3WJ1A 1AHPA 2EKLA 4WUTA 5FBQB 1JEOA 5TGZA 3ZTYA 3BMOB 3CRVA 4HXEB 4ZQHA 3UJ6A 4LI0A 4ND4A 1QF6A 2EF1A 3ONDA 3GAFA 3CHYA 2V4UA 1ZRMA 1OILA 5JARA 1QHIA 3MWKA 1B2RA 4J0IA 2OXCA 3SLKA 1TM4E 3FCYA 4FQ7A 5HF9A 3ZYCA 3N2IA 4US1R 1JEYA 3CPEA 1OX4A 2V6BA 3FB4A 5CB6A 3MWJA 3GJRA 5LYYA 2I66A 4NICA 1H66A 1P0QA 1UXIA 3FWYA 3KSRA 1OH8A 4NMHA 1L1EA 3I8XA 3GZ4A 2X4GA 1ISSA 1QQ7A 4TMTA 4HS9A 4MR9B 4YJHB 3GJ0A 2CLKB 4H4DA 4IGKA 2OCXA 5AK5A 3H65A 4FW8A 5AESA 5JQGA 1X42A 1LBQA 3T4XA 3TVTA 1E9FA 1KZ1A 4MI1A 3N59A 3EY4A 4QRHA 3PKJA 4M0CA 3PFGA 2W6PA 1M34E 1WIWA 3PGXA 3IOCA 1QGED 4IJWA 2BFCA 4ND2A 1WW3A 2AF3C 1I2ZA 2NYUA 4JA2A 4TMFA 5KSPA 1DAIA 4BQEA 4N8EA 3LW8A 2PWZA 3ODPA 1NXTA 3BTVA 5FOUA 3ZCQA 4BX0A 4UUPA 4ZVLA 2VP6A 3HB7A 3CA8A 4WXYB 5FTKA 3RVNA 4ZOCA 1TYZA 4HAZA 1JEEA 4HYEA 1RW4A 3DW3X 3RASA 4YMWA 3BILA 4OXKA 5EKDA 4URVR 2P4HX 5CK5A 3R23A 5F52A 2FQ1A 2VC2B 3ONNA 2ZS7A 5LOVF 1AHIA 3GJQA 4US0R 1VBKA 3V4LA 4C3ZA 3NM4A 1QB7A 3P9NA 3MTGA 3KHTA 1IU9A 2GKSA 4P1ZA 4UW9A 5EE1A 4YRCA 3BIXA 4DV5B 4JUCA 2OHFA 4G1EB 4LMBA 5SZJA 4DQKA 1IM5A 2O05A 2WM9B 1RIFA 4IJMA 4LRTB 1KXJA 3RBAA 1EWYA 4IDNA 3TF5A 2BCGY 5EQDA 1MJFA 1CT9A 3LHFA 4U2KA 4GX5A 3I5AA 3ZX5A 3PICA 3RRYA 4AULA 3ZGZA 2YUIA 3BS4A 3COJA 4PPQA 3U7IA 5IKMA 2ID8A 3GA5A 4RXTA 3DMPA 1Y7IA 5H02A 5T5QA 3RNOA 3TR6A 5KYGA 4IXWA 2CJWA 2NZWA 4MYTA 1QU3A 1ZNZA 3WBJA 1DTWA 3IV7A 1Y63A 4OQZA 5EEHA 4OUKX 3P2IA 1EVLA 3KVRA 2ZJZA 3A6ZA 3SZRA 4WKBA 4C21A 4YP7A 1GD1O 1N5KA 3CSSA 2UVPA 3WWYA 1N6KA 2ZR0A 3D4LA 2AN3A 3B85A 3IESA 1KHTA 1E3DA 3JR3A 5DX1A 5L9AA 4UFNA 1NJFA 2DUWA 3LX5A 2B5VA 3ZWKA 1IBKB 2REXB 1K9SA 4EF5A 3QWBA 2ZJ7A 5JJIA 4MLDA 2ORWA 4CMHA 1AF7A 2RGXA 2VXOA 1D8TA 5H5JA 1C8KA 4GM0A 3RUEA 4Q7LA 1QF9A 2VKTA 2AI2A 4DLYA 3HJHA 2VP0A 1VG1A 1Y4SA 1GNSA 3DUWA 2VP4A 3RD5A 2HYIC 1O94D 1RQRA 3D7MA 1VHTA 1ULUA 3X2FA 3EB9A 4WWHA 1YRHA 4RF5A 1S2OA 4D99A 4DIKA 2O3TA 3OOWA 1FFBA 1ZVVA 3JALA 2RD2A 3FUUA 3GFOA 4JROA 3RT1A 4C4OA 1AIPA 2R4QA 2R48A 3H13A 3KB6A 3KDPA 3OC0A 5LXTF 1LJ8A 1IONA 2C1EA 1S8AA 3PR2B 1OWLA 4N18A 4F4JA 4DN6A 1Y80A 3WZ2A 2BSXA 4DNXA 4ZU3A 3SZ3A 3LO8A 1R1DA 1JJBA 2JI7A 1DX9A 1O9BA 2OD9A 2XB6A 3W5UA 4CVNA 4EQ6B 3UF0A 4DEXA 4UC0A 2PTGA 5TQJA 3EIXA 2A9JA 1GZDA 4MXDA 5FYDA 3VTZA 3ZCVA 4EKGA 2IXDA 3EVBA 4LHYA 3THWA 1SU7A 4BU0A 3UJNA 1HYQA 1YFKA 4UASA 4XRGA 1NF9A 3II6X 1GCGA 4ECEA 2FWMX 1NBIA 1EU1A 2Q5JA 1X80A 3AV3A 3I6QA 2GA8A 1CUXA 3WK6A 4KYIB 4XQ9A 4K0KB 3DMYA 5TMEA 4XUEA 3UWDA 3E4DA 3V5NA 3WZLA 1ADYA 3W5JA 1OFIA 4EPTA 3BDAA 1TAQA 1WDMA 1RJDA 1W85A 2HU7A 2FPPB 3O0DA 1XNGA 1VJDA 3ROTA 5BQFA 4Q24A 2OV6A 1JKJA 1FYFA 3E7WA 1NKTA 4HQLA 4FI3F 1S4MA 1VE7A 3W8RA 5JC8A 3V32A 3LAWA 5AKKA 2C2XA 1H05A 3RSLA 1OAAA 4Q7EA 5DMXA 2ZUEA 2OL4A 4MUGA 3C4QA 3FHTA 1NUSA 1RLIA 3MK31 1ZU4A 2FPIB 2RG7A 5C1IA 5IYZF 3OEHA 1Z2EA 2UZ1B 4Z1MD 5FUVA 1YULA 1G4AE 2NQ8A 3FVTA 3MCTA 3HDJA 1XNRB 1CJBA 1RXEA 2B5WA 3D0OA 3E9QA 3PQ7A 4QO7A 2W2LD 4TSFD 2A7QA 5G0UA 5HX7A 1YVUA 4JP3A 1ZUNB 4RCYA 1P2DA 3O9MA 4HGRA 4RQAA 4KQ1A 1FP4B 4X1IB 4G9BA 4FCVA 3GT4A 4CLDA 1KY4A 4MUKA 2ABWA 3OWOA 1M1YE 2DQKA 1E6LA 4NBUA 3V2GA 4PC1A 5EERA 1C3XA 1KRHA 4NYIR 1SK9A 3D4OA 4UM7A 1ISIA 1RHUA 2ONKA 5DT2A 1LW6E 4RMHA 1YASA 3H19A 4TTIA 4ZAFA 4YUAA 4X00A 1NZDA 5D01A 3KEGA 4E2FA 5L6LB 2A2ZA 4TMYA 1JJ7A 3GDGA 4KYUA 2PUEA 3W7AA 4IH4A 4QT0A 1LLFA 2G76A 3QOWA 4ZZ1A 2PGJA 5CVTA 4C7JA 2HD4A 1YZTA 5T7BA 2O2IA 2FMHA 2PWBA 2B5OA 2Y0CA 3G9XA 4NU8X 4DC9A 1XYYA 3LHIA 3NHRA 2JRCA 4URHA 3PF8A 3EWAA 4OH7A 1JNXX 3OM9A 3GJ5A 2O2DA 5JD3A 3UWOA 3ZVKA 3ESRA 4R0VA 3N3AC 1HNZB 2ZR7A 5IKOA 1S96A 3UGJA 3SR0A 1MAUA 5B1IA 2E4YA 3WYCA 2FSGA 1IAVA 3QLUA 2RKOA 1NUUA 1ZNWA 1GDDA 4XGQA 3D3JA 2ECKA 1RSZA 2QVGA 2HK6A 2IDZA 2OOSA 5JROA 1E7WA 3SIXA 3EX7C 3O91A 1FDSA 3THSA 9LDBA 4RVCA 5LJIA 4C0KA 4CM6A 2DJIA 2OPBA 4TGLA 3DV0A 4IYRA 1KMHA 4DTIA 1U90A 1P33A 3K73O 1ZJ4A 3QKSA 3R44A 4GZLA 4A5SA 1SC3A 1MENA 4IYJA 1CJTC 4GLBA 3RG2A 2ZVPX 4IIJF 5G4KB 3EXG2 3AUKA 3W79A 2KLBA 3L2OB 3P5SA 1PG0A 3D3QA 1U7OA 2EIHA 1NLMA 2FRXA 2ZWVA 4IDHA 3RG8A 4C4SA 5K8IA 4QJIA 3SQXA 2ZRDA 2IYYA 5EZYA 1M7GA 2G1PA 4YBZA 5I7WA 4K3VA 3RUFA 3QKRA 1IBRA 2DBVO 2R8RA 4CF6A 1LBHA 4Q7KA 2W5UA 1EDBA 4HD8A 4Z7NB 2AFIA 2F17A 5EZ6B 2RBGA 3U2QA 4H4CA 1RC0A 5FQNA 1NV9A 4WPGA 4AY3A 3KYJB 1FTQA 4PLYA 3JD2A 4B45A 5K99A 4BTEA 2P0AA 2LIPA 1CUAA 2O5EA 2QR5A 4YQZA 3G89A 2Q9AA 2QIOA 3RS4A 4XYEA 3IT3A 1ZNXA 4U7GA 3EJ6A 4XDZA 4DMLA 2FA9A 2I2DA 4RJKA 4JMLA 1W5FA 2CJXA 1J0AA 3WIDA 3AVYA 1G7TA 2VAPA 2YOGA 3MTBA 3QI2A 3K1YA 4POAA 5IAJA 3BXPA 4O02B 1MQ9A 3OCUA 2QG9A 3FCXA 3LT2A 1G5PA 3UAGA 1MHPA 4B3CA 1KORA 3CF4A 4TL8A 2OOKA 2FN7A 3W6UA 4Z3OA 2YQZA 1L1QA 1ZM2A 1FSPA 4G1BA 1FXUA 5ALJA 3GFVA 1Z8FA 4JHLA 4ECAA 2HU5A 2OEPA 2DCUA 3C3EA 4X1OA 3I5XA 1EK0A 3G5MA 5HE8A 3SAJA 4KQCA 1J2EA 4D25A 4HDNA 4LX8A 1IK4A 4EGJA 4X3CA 5JVDA 2EJVA 1E0DA 1BQEA 2Q9UA 4WIAA 5LP6C 4O4HA 4RA9B 1FDVA 3DDOA 3AF1A 2QMHA 3GV0A 3A05A 4MAMA 5JALA 2BDTA 1GGKA 4RABA 4YJ3F 4LOKA 1G66A 4D79A 2PY6A 4W82A 2JKVA 3NKLA 1F14A 1UC9A 2A1TS 3PE3A 2HWYA 3PFIA 1VCOA 2ZJ1A 3AVOA 3BGOS 4GRIA 3CS3A 1B1AA 1A4IA 3D3KA 1W9MA 3JATA 3KXLA 1MVNA 4IR7A 1KOJA 3IVCA 5FTJA 4B7CA 2CNBA 1J6UA 2FZGA 3TLZA 2PX5A 3FWKA 3GARA 4GWKA 1Y6RA 4PM4A 4BVBA 4AY6A 2OECA 3IUJA 3GELA 3L1UA 3W1WA 1F12A 3WO1A 3A6HA 1ECCA 5IF9A 2WHPA 4X20B 2VHTA 1QDEA 5E3IA 3TRIA 2A3NA 3E7XA 4FMBB 4RE5A 3PFBA 4LWZA 1SBIA 3IPYA 2WDPA 4PO3X 1EP3B 1P3Y1 3THYA 2C5HA 1C8VB 3E2PA 1WWKA 2VPYA 3I37X 5FBRB 1L8OA 3S68A 3DCIA 2GERA 2BMFA 1KK0A 1TUIA 1YBFA 2F3TA 3O9ZA 4GC9A 3MF4A 4OJYA 4G8CA 3FR8A 4OHVA 4REOA 4R9NA 3PXGA 3ZZMA 4ZJZA 5HNKA 4N4AA 3R3JA 2QUAA 3BZWA 3I9KA 1MDFA 4YGXB 4NHEA 5F7XA 2NPFA 4H31A 3AHEA 4JJEA 2A88A 3AJRA 1TO1E 1Z9BA 5K0GA 2P6OA 2FFRA 1G4UR 1QPGA 2FQWA 2Z30A 1XELA 3PGMA 2BKVA 4K6KA 4MS4A 4IJQA 3VR5A 4RJTA 3MRTA 2XRFA 5A4IS 2XD9A 1Y1TA 3ED5A 2WIGA 2PFKA 2WE8A 4PO8A 3D0QA 4FR2A 4YR9A 2GN6A 2I7DA 4HTAA 1VJTA 4W9RA 5CPBA 4FYKA 3T3IA 4EPXA 3NDBB 4AF7A 3HKDB 2WB2A 1NX9A 5FI5A 5DLYA 4DCPA 2NIPA 5M34A 1Y8ZA 1N4DA 2RHJA 4X92A 3FLMA 2IYLD 4GKAA 4QTZA 4EB6A 4UM9D 3VVCA 3TJMA 1FU8A 1P91A 1U0EA 1QP8A 3JAKB 5DN6D 2I91A 2DM6A 1RYMA 4WECA 5A6VA 3E2IA 5IH7A 1H65A 1L5YA 1U8EA 2FQQA 5ED4A 4LJSA 3RTBA 2V4MA 1FDWA 2X3FA 2Y1DA 3IKMB 3O82A 2OZVA 4Y9UA 3TKYA 4XTRA 4RXUA 3SIWA 1LK5A 3OEED 4F9GA 3KLOA 4UEQA 5SY4A 3UJ8A 4M9XA 4Y3UA 5FFNA 4YJHA 1BSVA 2DF8A 3EBPA 2VI5A 3OUZA 3UAWA 1CETA 1ODIA 2B20A 4X9XA 1WPQA 3N1UA 3HDHA 4HL6A 1WDTA 1PHRA 2FR8C 4DLXA 4EFDA 1QOPB 5CEJA 1T2VA 2WSLA 3ICPA 1EE1A 1G20A 4AU1A 5KNDD 2YCBA 2ZWAA 4HO1X 3UA3A 1FMLA 4Y2RA 1EIWA 4F56A 3ZWDA 1FQWA 2H7CA 5EHNA 5L40A 2XAAA 1NURA 4EUKA 4NENB 1N2CE 1E79A 1GPNA 3JWJA 3QVSA 3ZIDA 1N9ZA 4BB6A 4BS9A 1BHQ1 1I1NA 5CFZA 5ALPA 3JASA 1A9TA 3LKVA 2PMDA 3NPMA 1CUYA 4M1YA 2QORA 3F6PA 3IEKA 2J3EA 2WKQA 1VPLA 5COAA 3DQZA 5G40A 5J1TB 5J2TA 2H5LA 5T8KC 3LP8A 2P9HA 4XVUA 1YOBA 2DHRA 3M5CA 3KRTA 5LQRA 2WTMA 2MOKA 1A8PA 1Z5OA 4OHBA 4Y1RB 1DBPA 3KL4A 5FNVB 3WRVA 5BSRA 1TU0A 3LYHA 4QUKA 4HAWA 5CYOA 1UK7A 4RXMA 3RBZA 2AOXA 3USZA 3KZOA 4C3VA 2WMOB 4FYIA 5DOZA 1Z26A 1YS7A 1KFCB 1SKUA 3WQRA 4S1VA 2ODTX 2QXTA 4NOLA 1EWVA 1JV2B 5AKGA 2PBFA 5LCXA 4OHUA 1XTKA 2FPGB 2NSLA 3L40A 4MVJA 4NFLA 1E1QD 1QJ4A 4MVYA 3UHOA 5JJBA 1WETA 1H6AA 1QYCA 4RV9A 1C0LA 1YU9A 3D4PA 1S2MA 1XJ0A 4RPKA 3O1IC 2PFGA 4C01A 1CEQA 1NYRA 3MA0A 4PX2A 1HFWA 1HMYA 3PGLA 4P5PA 4U7HA 4ENPA 1F6DA 5KVVA 3WTBA 1NA5A 2REQA 4NBVA 4YUXA 4KRYA 2FSPA 5JO9A 3P9XA 4OLBA 3CEPB 5B58C 4WMLA 1XRPA 1NF3A 3V7YA 4ROTA 3L1IA 2ZIEA 1FJ2A 4M8IA 1DKOA 5ELMA 4OMUA 4Y2GA 4W1SA 3RPEA 4CQLB 2QRVA 5EJ8A 3U5TA 4Y2SA 4LXIA 4L02A 4AUNA 1RLTA 1XEWY 8ABPA 4AS1A 3FMVA 2WLTA 2GN8A 4HEA1 3AW9A 4R71A 1ZOLA 3I01A 2XZDA 3ICWA 5CCXA 5HM6A 3UMFA 2E49A 3M2PA 3A3OA 3O4RA 1LNSA 3O3OB 5AT1A 4Q19A 3Q6NA 3ND9A 3FCCA 5IAAA 4K6FA 4CKBA 3U3KA 4F3CA 1OJ7A 1QZTA 4OHMA 3SZOA 4ZCMA 2RB4A 3A9VA 2CNNA 3Q0EA 2V6MA 4TVKA 2VHYA 1AGXA 2Z5GA 1SOUA 1OKKA 1T5BA 1II9A 3KZVA 2HDWA 4JELA 5GJCA 3SNKA 5A5DA 2I3AA 2KS6A 3OIDA 4I9HA 5K51A 4BMVA 2KYRA 4HNRA 2GJAA 1GZ7A 4M7WA 4CHTA 3OETA 1C7JA 1EE9A 1JEJA 1W2WB 1CUSA 1ZGZA 5HILA 3FJYA 4ZI5A 5M7EA 2IEBA 1W5BA 4LNAA 3OFND 4P38A 4MW2A 1UPCA 3ONVA 3LF2A 5IM4A 1QTQA 5ES4B 2HWKA 4FSXA 1II0A 5F2KA 2BFFA 1T5IA 4GM4A 4XX1A 4CQJA 2GXAA 2VXYA 1MQAA 1XJCA 3ZE8A 4HNVA 1IQUA 2I7CA 2Y4NA 1P2UA 2P6UA 2RGCA 1KJ8A 4C29A 1XG5A 4EATA 4KN9S 4TTRA 3K30A 3NFRA 5IULC 3GFTA 1OZHA 4XR4A 3FOAA 1Q3TA 3UTDA 1B26A 4ZICA 5GWXA 4YY3B 1E5QA 3O94A 1DGQA 3WA7A 2FSSA 2CXTA 2O1EA 1DZ3A 1QQ6A 2VJPA 3OA0A 3WL4A 5LZ7A 2AEMA 4Q0MA 4DUYB 1GNTA 2G88A 4XUDA 4TYPA 4QXMA 4MDYA 3C7DB 2AFHB 4B8YA 4DB2A 2IK8A 2ZVDA 3EXHC 5DWVA 4O4JA 1E94E 2QF7A 3E82A 4F12A 3U4QB 4FVTA 1THGA 2HX1A 3BK7A 3JQ9C 4ZT2A 1KHHA 3LPMA 5KTOA 2HJRA 1RYEA 1T2CA 3JQFC 2QIPA 1XTPA 4X62B 3TX6A 4R68A 1Z5PA 5FO1A 5AM0A 2VTBA 2C5BA 1SELA 3C1AA 3M6WA 3OSUA 2NTEA 4QC2A 2XMBA 2EW1A 5K0LA 2ZS9A 3D1VA 4I3GA 3NIFB 5G3YA 1UDBA 1G1AA 3PENA 1XCJA 1NR1A 4PLPA 5LU8A 1JE0A 2I3DA 2ODWA 2IYNA 2QQFA 1BHSA 1RWXA 2Y93A 4HCJA 4JOQA 4NYMQ 2YRFA 4XPIA 4B0OA 1ZA1A 4D7AA 3WK7A 1C30A 4MUEA 1IMJA 1E2FA 2V74B 4BNFA 4F60A 5DBGA 1MABB 4HNTA 1E7SA 4CM3A 3A8TA 5A5GA 2QDXA 2VQSA 1QG2A 3A7EA 3KEMA 4PBTA 1KDRA 3IPRA 4XJTA 1GRRA 5BR8B 4DR5B 4X1IA 1ZICA 4E4RA 5KKNB 3VJMA 2YYSA 3DUFB 2FP4B 1BS9A 4RK5A 8OHMA 1KO5A 2BCEA 4Q3AA 1UDAA 1Q0ZA 3M2TA 1ZS9A 3EK2A 1KMCA 1CY8A 3GVXA 1GPH1 1SHJA 2R79A 3WNVA 1PQYA 1BRTA 1JHQA 2IPAB 2JW5A 2RGGA 3KQUA 1XCBA 1WXIA 2DQZA 4HEHA 1X7YA 5IC5A 3ESQA 4WEOA 4EHNA 3MUEA 3HR7A 2B34A 3HV2A 4KWEA 4LYHA 4BDTA 4C89A 1D9XA 2EG5A 2QQ5A 1X9IA 1HLDA 4MS1B 3ROMA 2DMRA 1X94A 3NHLA 3FUVA 4GYYA 4BMSA 1TE2A 2CXXA 3FGNA 1U5BA 3OMWA 3OX4A 4AURA 3HVHA 1T13A 2JFOA 1CUHA 4XH9B 2A9QA 1ESMA 3QFTA 1MC5A 4D82A 1G2OA 4XRRA 1TMOA 4Q3EA 2EYQA 1IQRA 1SU4A 3MJFA 2GQ0A 2G82A 3GAZA 4V0QA 5GY7A 1TEZA 1G63A 3E8XA 4ZOLB 1J22A 2XTAA 2OB1A 3IR7A 2RH8A 2EZ4A 3LYAA 2H63A 5KINB 1HYBA 2RH9B 2JASA 1AK9A 2HK7A 3CJQA 2XNHA 2PUAA 4JI7B 5E7IA 4RSRA 4O2AB 5KC8A 3E6AA 1YOVA 2WZQA 3HJAA 4TVSA 1MOPA 1FX1A 3G13A 3KUKA 2I4MA 3F0TA 1EQAA 1BEEA 1QAMA 4M98A 3IKJA 3ZZUA 5KB3A 1QS0A 2KW5A 2O0JA 2CV2A 2O8BB 2XRMA 4RPGA 5DO9A 1N2GA 1QONA 1XRSB 2PHZA 3CPJB 1XBTA 5AXDA 1DPGA 1EHCA 3CZMA 4ZU1X 1MH9A 1XNJA 5DI3A 3QE0A 4N54A 4JYZA 5L3SB 4PN7A 5HUJA 2QSYA 3M5PA 3PI7A 2B30A 3PJGA 5DM70 3ES9A 3NALA 2AUTA 4L74A 1OI4A 3LFTA 1T3HA 1I1QB 3PNOA 3KC2A 4MDEA 2HTEA 2VDLB 3I2GA 3CN7A 3HFSA 4YEDA 4WE3A 2YN4A 1F20A 1XLTA 1EMDA 1GXSB 1TVEA 3LG2A 4CV1A 4GKJB 1LRKA 3PQDA 5LQNA 4XEHA 1VJGA 1D04A 4ZO8A 5B3AA 1IIBA 3EFHA 1GUFA 4JR2A 4YQYA 3DFUA 4IOLA 1YACA 4OYRA 5CDFA 3A6EA 2IDJA 4M8NE 4WT7A 1P4JA 4MGYR 4BNGA 1U0TA 5MN6A 1KJWA 3SU8A 5U9CA 4LRSB 5LPNA 4ASUA 3UEOA 5EQTA 4LRXA 2X2FA 3ABZA 1BRMA 3OUUA 4N1AA 1DCTA 1D8AA 4O5AA 1I0ZA 1ECFA 3D5EA 4OAQA 2EW2A 1X70A 1Z2OX 2YASA 2YJTD 4EY5A 4RQTA 2GZ1A 3NRCA 1D0VA 3ZH9B 4RC9A 1AV7A 5CURA 3V33A 1A2BA 4UTXA 5BO5A 5B1EA 3DO5A 4PSAA 1XN4A 2PSEA 3GO4A 5KKCA 1DJPA 5HIMA 4W1PA 5DGXA 2B61A 4RLHA 4L5YA 2GN0A 1ZQ1A 3LOPA 3ZKWA 1EHYA 2NXJA 1QIIA 3OPMA 4DR1B 4MA0A 4QAJA 2HGZA 3KR9A 3QXJA 3M5WA 3H5VA 2A0KA 1SCJA 3VTFA 1PJBA 2IIVA 6PFKA 3UT6A 5KMGA 3G7SA 5IVHA 5CYPA 2ZSAA 3R0IA 8AT1A 4L2IA 4BGDA 3SE0A 2JH3A 3INNA 2V0NA 1FNCA 1S7CA 5CB4F 3PI6A 3T0FA 5EGSA 4DIDA 5A3VA 2E55A 2H59A 2XHEA 5FD8A 1JFRA 2WTAA 3D3WB 5D7NA 3V46A 4LXQA 1UMDB 4KNVA 1WB4A 3UJ3X 3UWSA 1RZ3A 1LBEA 2O2SA 2ZWIA 4ERXA 5B7QA 5C5CA 2R00A 3QX8A 4Y9TA 1GL6A 1YDHA 2JCGA 3JY6A 4FE7A 4N5LA 621PA 2HU8A 5JZVA 4X3OA 5E4TA 1WV1A 4KXFB 3QMPA 1G19A 4HBZA 1JA0A 4BE9A 1LPBB 1XTZA 4HDOB 3NHFA 3BAZA 3MS2A 5AJYA 3KQMA 4MV0A 1WMDA 4D44A 1OLXB 1PD0A 1VSQA 2TSYB 4NBRA 2F90A 2XNCA 1ZL0A 4QO8A 3IP5A 1KY2A 2IIQA 4UU1A 3CW9A 2C31A 1FYXA 2Q4EA 1FY2A 2GZ3A 2V1XA 4NNOA 4XWTA 4L15A 2YMMA 2IH2A 3ENNA 4RD2A 5FAXA 1TQ8A 2ISQA 3FHOA 3MCVA 1UKCA 2H48A 3IDAA 5CT4A 1PWXA 4EP1A 4G9GA 2XD4A 3CMCO 4MVXA 3I4CA 1NRJB 2W6JD 1WQ1R 4OOEA 4BAGA 4FDAA 1VG0B 3KOOA 4FB5A 4QPZA 4WJZA 2NTYC 3GMIA 1SB8A 2HM7A 2V7VA 1SUDA 3JTEA 2C7PA 5AVSA 4M9SA 4BVEA 4FFBB 1WQ3A 1VCIA 5CBPA 2XA2A 4ZZ3A 1VI5A 1WXQA 3HJNA 5DHAA 5DZSA 2EFYA 5CXQA 1N1MA 2DKFA 1TCUA 1D4AA 4YRPA 2OCIA 1WCIA 2HRCA 3PTLA 4OFWA 2BSAA 4TT3D 3IAS1 4UHHA 3VYRB 5K0SA 1SXHA 4HNHA 1IHUA 2W6IA 4G9EA 1YVEI 3DTVB 3QU9A 4ND1A 4N3CA 2O52A 1Q7BA 1AURA 4LOJA 3AP3A 5IM5A 3F7MA 5KWEA 1E62A 3U4HA 3JYOA 1H9BA 1G18A 1RFLA 2R44A 3KUCA 4KNWA 5DGCA 4BRWA 3ICEA 3FLBA 1KVQA 4OATA 1J2RA 4F21A 5CK4A 3BJZA 3NDIA 2JGDB 4Q02A 5F2EA 4O4LB 4W5WA 4RANA 3P0IA 1DELA 4CM4A 3TLKA 5AM1A 4BV9A 2V8OA 1E7RA 3MJSA 1L3IA 1QM5A 1WPXA 4TUYF 5KYNA 3RSOA 3ASYA 3PF9A 4LBZA 4FU0A 3KPYA 4TM7A 1Z4KA 4TMZA 3KOZA 1NBAA 3H2GA 3AKYA 4JODA 1X1QA 2V54A 3L7YA 4QFBA 2MINA 4TPKA 2OD2A 2G1AA 2AH5A 4ZO7A 3ENVA 3M4YA 2H2FA 4RJ2A 1BE0A 1NG1A 2VSXA 3I04A 1QC5B 1WUIS 2AA3A 1QH1B 4IHKA 4PF1A 3UJDA 2BEUB 5ITSA 3KSBC 3NVAA 4JP2A 4OL9A 3RTGA 1E2JA 5HJ2A 3ZX4A 3H2YA 1T8UA 2GMWA 3TR0A 3M6MD 2C04A 4CQNA 2IYFA 2BMAA 2IBSA 3FNBA 2QGNA 5DHQA 3A31A 2J7PD 2PU5A 5EKXA 5J5VA 6REQB 2J0QA 4LZZA 4WOPA 2H4YA 3G5TA 1ZR2A 1X15A 5FIUA 2QJOA 3L7DA 3P9YA 5FV7A 2PJRA 1UJNA 2FF5A 3I6YA 4J4HA 4C6RA 1I5OA 1JYSA 4Y1RA 3OKAA 4QVKA 2PH1A 3HJUA 4G26A 5DTRA 5IFKA 4WY2A 4X7BA 3G9TA 1NW7A 2GHTA 3NOVA 4DMCA 2D1YA 4RGVA 4XWOA 3S7ZA 3T4UA 3K31A 2VHQA 4H9GA 4CTOA 3R77A 2AF4C 4LECA 3VC7A 1U9JA 1G98A 2GPTA 2WD9A 3P19A 1EB8A 4I4IA 4KPUB 3H84A 3OO0A 2X9QA 3C24A 4ZO6A 4EO9A 2JVKA 1RAAA 4IUDS 1CZHA 1TECE 1WVIA 2VUUA 4Z7QB 4ABYA 2GKGA 5HPYB 5GONA 3A2NA 5REQA 5I7RA 3LL7A 5K8LA 4P0QB 1IE3A 1UAYA 1YZVA 4PSVA 2WVJA 3QYJA 2HV9A 2A84A 1WU8A 3PR3A 2XBMA 3ZVMA 4P84A 1MO2A 3EE6A 1R0LA 1VHQA 1TC2A 1W36B 3SJZA 3WQHA 2EGGA 3PQCA 3UIEA 1NF8A 3TYXA 3OQNA 1ZM7A 3BJIC 4BXOA 2QZ4A 3SJ7A 4I9GA 2HSEA 4D9CA 3GLGB 1NN0A 4FONA 2EP5A 2BTQA 1WCYA 2C83A 2C58A 4ID9A 2DQ4A 4IUCS 4PGHA 4PU0A 5FI3A 5GM2A 3QFSA 3T94A 3BG5A 4FQ8A 4DANA 1FMFA 1PWYE 3STUA 4TRMA 2O54A 2ECFA 2NO5A 1P1KA 2GEBA 4MYDA 3V7UA 1L4UA 4UU7A 1UBKS 2DKNA 2X2PA 5K9ZA 4BP8A 1PR3A 1VJRA 4G5QA 4Q7QA 3LQ1A 1R0ZA 2ZSDA 5KYWA 1M6HA 1PL0A 1XZNA 2VWQA 4HDRB 4JWKA 1K8YB 1JPVA 4B6GA 1P80A 1UM8A 3HFRA 4YJ2F 4CG3A 2F9LA 4TKVA 5JXGA 1SKMA 2DFLA 5JQWA 1ZUD1 5D3QA 4MEBA 3WLQA 1JILA 4JUBA 3K6SB 4LXTA 4UVEA 3LDGA 4OJKA 2PSHA 2VT7A 4W8GA 1E0KA 3AEYA 3K71B 2C4WA 1N78A 1EXMA 4XM0A 3ELUA 2NV0A 1AY0A 3TDKA 1I30A 2GHRA 5D00A 1I7PA 5BVGB 1GUZA 3DSRA 4RV4A 2XB2A 1F0NA 2BH9A 3HUUA 4L4XA 3V1UA 1J9GA 2I80A 4E30A 1SC6A 3DL0A 2C42A 4LYAA 5HMMA 4Q93A 4IJKA 1O4WA 2WF5A 5LIPA 3WZMA 1JIVA 2BMWA 4H7KA 5HOQA 4Q3OA 1EPUA 5HQ3A 2QAGA 4BNKA 1XCLA 4K88A 2Z57A 5ALQA 3W2FA 5F2OA 2FF7A 4COKA 4D9EA 4J49A 1Q2UA 3ELDA 1INLA 5EZ5A 3R7WB 4DT1A 1VXOA 2F43A 1E61A 2C20A 1E6KA 3OLYA 4J0KA 3SE7A 4H08A 1AVTA 3GIDA 2Q6TA 5IK2D 1T9CA 4ETNA 3ZHZA 2CUZA 4YN3A 4I50F 1J9ZA 2HZBA 1D03A 4URUR 3DVSX 3HCWA 1WBJB 3JVIA 4PQFA 1Z08A 1FCJA 1VBNA 2RJNA 1K4KA 1NNLA 4JL5A 4RWZA 1EP2B 4TLAA 4XWYA 4PX3A 5FPPA 1W6UA 3HLKA 1RCFA 2CV0A 2WUWE 3D8UA 2ZZMA 3FJOA 4BB9A 2OGZA 4C87A 1F17A