2ZTHA

Crystal structure of holo form of rat catechol-o-methyltransferase
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
212
structure length
206
Chain Sequence
b'DTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEMNPDYAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEKCGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catechol O-methyltransferase
molecule tags Transferase
source organism Rattus norvegicus
publication title Crystal structures of the Apo and Holo form of rat catechol-O-methyltransferase
pubmed doi rcsb
total genus 68
structure length 206
sequence length 212
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2008-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2zthA00
1QYRA 2QRVB 2DPMA 4QDJA 4U7PB 1R8XA 1KPGA 5E2AA 3UJCA 2ADMA 4XUCA 3SM3A 3FYCA 4OA5A 3M70A 3OE4A 2P35A 2PBFA 5KQSA 2AVNA 3GRRA 2KW5A 2OBFA 3FPEA 5F2OA 3AJDA 2IFTA 2OO3A 2PXXA 3FPGA 4OA8A 5E1DA 3C6MA 1XJ5A 3HEMA 2C7QA 3HA5A 5FTWA 3TOSA 4A6DA 1FJXA 3SGLA 2OZVA 3SVZA 4C04A 1UWVA 1X1CA 2EJUA 3EVGA 3P9KA 2Z6UA 3R6TA 1BOOA 2Y1XA 3NDJA 4C4AA 3DLCA 4DCMA 5GIPE 2JG3A 5EMMA 5K0JA 4E2XA 3FUWA 4HTFB 4ER3A 4YMHA 3GXOA 5ERGB 1SUIA 3CCFA 5FQNA 5FA5A 4YUYA 5ICCA 1NW8A 5HZMA 2NP7A 5G02A 2YXLA 1RI4A 1L9KA 1XCLA 3S68A 2YUIA 1NV8A 2QM3A 3LSTA 2FHPA 1O9HA 2XYVA 3PVCA 3QV2A 5GWXA 5K0BA 1SQGA 3P9IA 5EMKA 3HCDA 4FP9A 2R3SA 4IV0A 1EG2A 1P39A 4QVKA 1VPTA 2FCAA 5JUWA 3K0BA 3ELYA 3G8BA 3P9NA 3UJ9A 2YXEA 3FTFA 2HMYB 4E33A 1I1NA 2FYTA 1L3BA 3B3FA 3HCAA 4RTJA 4HGYA 2ZBPA 4RTQA 4EMSA 4E31A 4QQNA 1N7JA 4HTFA 4GC9A 3LECA 1SQFA 3A4TA 3G8AA 3GJYA 3HNRA 1JSXA 4OQDA 3B3GA 3HCEA 3LCVB 3OZSA 4M7RA 3TRKA 4RTRA 5K0LA 3MERA 2O0LA 1X1AA 3FPHA 3H2BA 4PYQA 1QANA 3SXJA 4OBXA 4L7VA 1QAQA 3BGVA 3DH0A 5BP7A 2EJTA 1EJ0A 4EQZA 3DMFA 2HR1A 4ER6A 3TR6A 2WA2A 3UJAA 4RTMA 5C1IA 3FTEA 2AVDA 2Q41A 3R0QA 3LDGA 3THRA 4CKEA 2HV9A 3FUTA 5E9JA 5CD1A 3VSEA 4HC4A 4CKCA 4R05A 5FULA 2NXJA 4F84A 3LX6A 1QZZA 4GOOD 1P1BA 5ICFA 5KS2A 2P41A 3KPYA 1AV6A 1KP9A 4KDCA 5HIMA 2QRVA 3UBTA 2AN3A 3R24A 2ZWAA 3G89A 4EKGA 3G7UA 5CIYA 1NBHA 2PLWA 3U81A 2AS0A 3G88A 3BUSA 2JHPA 3EPPA 1XXLA 4KWCA 5ICEA 4OX9Y 4RTOA 1T43A 1VL5A 3G2QA 1MHTA 1XCJA 2PX5A 3AY0A 4PYIA 5GP1A 5K03A 1M0EA 3IYLW 4HRAA 4PYMA 4X63A 4C08A 4P7GA 4HSGA 5DTQA 4RTNA 3ER9A 2P7HA 2GH1A 2CL5A 2QE6A 4R8RA 4Y30A 1IM8A 5LQAA 3CGGA 2P3LA 1FP2A 3BWCA 1BC5A 5K0CA 2UZ4A 2YVLA 3K6RA 5E2BA 4O29A 5EIFA 2B2CA 5C9ZA 2LD4A 5E8JA 4ISCA 2AOWA 3JWGA 5HEKA 4OQEA 4K6MA 3M4XA 1O54A 2GPYA 1F38A 5EMJA 1YZHA 2VDVE 4YV0A 2I6GA 4GOMD 4R6WA 2BZGA 4RVFA 1D2HA 2G72A 5FHRA 1ZKDA 3A7EA 1X19A 4X1OA 5LQRA 1ZG3A 2OPBA 4FT2A 2QYOA 1RI3A 4DA4A 3OU6A 4WXHA 3MCTA 4PIPA 3O7WA 4LWOA 3EMBA 2AOUB 2IIPA 3NJRA 4YMGA 3DTNA 3RIEA 2NXNA 10MHA 4FGZA 2F8LA 4KW7A 5EOVA 2ONYA 4PYKA 1VBFA 3FUVA 4C07A 2Z6QA 2PY6A 5IKMA 5EKUA 5DRTA 1NW7A 3KPUA 4FZVA 3GO4A 3UFBA 2GAFA 5CVVA 1VE3A 3EGEA 4PCAA 2FK8A 3B7PA 3EVAA 4PIMA 3B3JA 4GBED 4KIGA 3JWHA 2G8NA 1X1BA 2EFJA 3C3YA 3CVOA 3G5LA 5EHIA 1M6EX 2IP2A 1KHHA 3GU3A 2O05A 4ER0A 1I9GA 4YUXA 5HOQA 1JG4A 1JQEA 3P97A 3FUUA 3NDIA 1KPHA 1G38A 4EVIA 2YTZA 5HIJA 2BH2A 2OY0A 5DX1A 1KYWA 3BWYA 3EVEA 4AZSA 3A7DA 2G1PA 9MHTA 2GB4A 3EVDA 3T0IA 4ER7A 4DKJA 3BKWA 2Y1WA 2XYRA 3TFWA 2H1RA 2XVMA 4MWZA 1WXWA 4QDKA 1XDZA 2ERCA 2ORED 1RI1A 3GNLA 3LGAA 3KR1A 3NMUF 2C7RA 2C7OA 1EIZA 2AN5A 3M6UA 4EKIA 2YQZA 4ER5A 5FWDA 3EGIA 3ER8A 4Y2HA 2V7EA 4HH4A 4GF5A 3TKAA 1YFJA 4A6EA 4QVGA 2PJDA 5K0EA 1B42A 3HTXA 2YXDA 2NYUA 2XVAA 3DMGA 2CKDA 3LKDA 4FR0A 1UFKA 5DX0A 1V39A 3BZBA 2A14A 3I53A 3P71T 4RWZA 2AN4A 1PJZA 3PLAE 5T64A 3KQWA 4PGHA 5P8WA 2OB2A 2GA9A 1ORHA 1VLMA 1IXKA 3FZGA 3GRVA 5GOZA 2YR0A 2YX1A 4F85A 3MCZA 4Z2YA 1VP9A 5LQUA 4RTLA 3EEYA 3BT7A 3P2IA 5LQJA 2PVCA 3SSOA 1M6YA 1SKMA 1SVUA 1FPQA 5BXYA 1WXXA 5E9QA 3HA3A 1HNNA 2PV0A 3BWMA 3CJTA 4XUDA 4DQ0A 4FSXA 4QPNA 3IV6A 4LWPA 1INLA 1JTFA 5EQJB 7MHTA 2AZTA 3F4KA 4MQ4A 4CTJA 4AZVA 4CXMA 5DPMA 1Q0TA 5DM0A 5BW4A 5F2KA 1G55A 2EG5A 4KRGA 5K0NA 3QOWA 3DOUA 3KKZA 4KIFA 3VC1A 1ZGJA 5DXJA 3DXYA 4IKPA 4KDRA 4QTTB 3BWBA 3CJRA 5FCDA 3SX0A 5T6BA 3ELUA 4YUWA 1R00A 1G60A 3ELDA 5D1HA 3KQMA 1AQIA 5DTMA 2PKWA 4RVHA 3BXOA 2XYQA 4U7TB 4X61A 3D2LA 5CVDA 3BKXA 1XTPA 3T7SA 3UJ6A 3EEOA 3JWIA 4YUZA 1Q0SA 2PWYA 3G2PA 5DT2A 3VC2A 2NNWB 1HMYA 1RI5A 4MTLA 1YB2A 5EEGA 2O07A 3B89A 2ZVJA 3C0KA 2OXTA 2ZIGA 3BGDA 1WG8A 4E32A 3UJ8A 2VZ9A 5K09A 5EEHA 3AXSA 2Z6AA 3NVKI 3HCCA 1U2ZA 1VIDA 5E1MA 3SMQA 1JR4A 5CCBA 3GIWA 4BY9E 1OR8A 2ZZKA 4PYLA 5H02A 5KQRA 3EMDA 1R18A 2AOTB 5DM4A 3T7RA 2PX4A 3E05A 3MB5A 3V8VA 3LHDA 5F2NA 5C0OE 2ZWVA 2DULA 4H0NA 4UOEA 1NV9A 1Z3CA 2IPXA 3TMAA 5CUQA 2IBSA 4G56A 3KR9A 5E1BA 3NWEA 4PNEA 3FRIA 3GRYA 4YV2A 4RYLA 5DSTA 2FPOA 4X41A 4WVLA 3G5TA 2P8JA 2I62A 3M33A 4RX1A 3KU1A 5M5BA 3THSA 3BGIA 5DM2A 5EG5A 3G2MA 3UJDA 3JWJA 1JQ3A 1VQ1A 3NTVA 3TPZA 5EZQA 4AUKA 5FWAA 1JSZA 1RI2A 1G6Q1 2HWKA 5B1SA 2B25A 3EVZA 3KR2A 5DX8A 1F3LA 3EGVA 3KR0A 1XDSA 3MTEA 2PX2A 5FUBA 5GINE 3SR4A 3NVMB 3ANXA 1ZGAA 4DZRA 3KPJA 4F86A 1IY9A 3LPMA 3Q87B 4R8SA 3KQTA 4DMGA 5JR3A 1PRYA 3DXXA 3LDUA 4C06A 2IGTA 4B17A 3A25A 3UJ7A 1FBNA 1AQJA 2B9EA 4FS8A 1EJ6A 1RJGA 2NXCA 3GWZA 5KVAA 2P7IA 4HG2A 2PXAA 1BHJA 5FADA 5EIWA 3M6VA 1DCTA 4MHTA 2PX8A 4P7JA 4X60A 3WSTA 4AZWA 1ZQ9A 2ZBRA 2UYOA 3AXTA 3P8ZA 5DSXA 2OYRA 2WA1A 3ID6C 3DXZA 1TPYA 3UJBA 1DL5A 2XBMA 5KYGA 3PS9A 1R6AA 1AF7A 1EAMA 1JG3A 3HVHA 4V0RA 5FA8A 4E2YA 3T7TA 1JTEA 2C7PA 4JXJA 1D2GA 4QPPA 4GOLD 5E1OA 3SSMA 2PT9A 1NE2A 2GS9A 1G8SA 2JHAA 4PCLA 2CMGA 3FTCA 1SG9A 2ZW9A 3OU2A 4PYNA 3ERCA 2FK7A 3P9CA 5HIIA 2P40A 3LBFA 3DR5A 3FTDA 4FSDA 1NKVA 3I64A 3E7PA 2CMHA 1TW2A 3KPWA 4IWNA 4XUEA 2H11A 2VS1A 5E8RA 5K0GA 3R9XB 1H1DA 5T67A 5CVUA 1ORIA 4BLUA 1KYZA 2EX4A 3LCUA 4E30A 2HTEA 5GM2A 3HVIA 4PYJA 2IBTA 4HGZA 2O06A 5FHQA 3VYWA 3MHTA 3QOXA 3O4FA 3E23A 3GGDA 3C3PA 4E70A 2ZBQA 4M38A 3NWBA 2AOUA 1WZNA 3O31A 4RTSA 3IHTA 1QAMA 4YUVA 5DLYA 1KR5A 3CJQA 1NW6A 2UYQA 4KVZA 5LR6A 3EVCA 1FP1D 3DP7A 3PTAA 3LKZA 1UIRA 2HNKA 3DMHA 4BP1A 4E2WA 1RJDA 3X0DA 3FRHA 4DF3A 5GIOE 3DLIA 2ONZA 3ME5A 2N47A 4CKBA 2GLUA 2OB1A 1NW3A 1ZHFA 5CVJA 1YF3A 2G70A 2BM9A 5EMLA 2CWWA 2BR3A 2VDWA 2UYHA 4OBWA 2AOVA 3KQPA 2PGXA 4RVDA 3ELWA 1KPIA 3CKKA 3MAGA 3MGGA 3HM2A 3OFKA 3Q7EA 1L3CA 1XVAA 1NW5A 2I7CA 2PT6A 1JG1A 1WY7A 3OZRA 3EVFA 4AZTA 1WS6A 5IH3A 5HFJA 2BR4A 2OKCA 4V0QA 2ZSUA 5CVEA 5K01A 1N2XA 2O57A 3RW9A 3OPNA 5LQCA 4CTKA 1YUBA 2P1DA 4PONA 5DM1A 3REOA 5HIKA 3KPVA 5D1NA 5K8VA 4RTPA 1X1DA 2PWPA 3OFJA 4PWYA 4RSRA 3DUWA 2JHCA 3PX3A 3PFGA 2AOXA 3HVJA 2ZZNA 2PSSA 2NP6A 2QY6A 4PGGA 1L3IA 5EGSA 1XDUA 1KIAA 3FPJA 3PB3A 3PT9A 4GUAA 1YFLA 1O9GA 2AOTA 3I58A 3LCCA 4QTUB 2ZLBA 4R6XA 3V97A 3GRZA 2ZULA 4P7KA 2I9KA 3LL7A 1RJFA 3I5UA 3CBGA 3TM4A 1P1CA 3OU7A 3AWIA 5CM2Z 5DRYA 4E2ZA 1I4WA 3UA3A 2IDJA 3KHKA 2B3TA 3P2EA 1QAOA 3M6WA 5EVJA 2ZCJA 3KQOA 4ATNA 4GEKA 2ZZMA 5BW5A 3B5IA 5DTRA 5LSAA 3HA7A 3MTIA 4XCXA 5LQKA 2IH4A 2IDKA 3HP7A 4GC5A 3HVKA 5EPEA 3SSNA 2PXCA 3OZTA 2R6ZA 3FUXA 5K05A 2AR0A 3GCZA 2V74B 5DWQA 3UWPA 5E9WA 4LECA 4DCGA 4GOND 1YZ3A 3IEIA 4PINA 2B78A 1G8AA 4RV9A 2VP3A 4AX8A 3TLJA 3LBYA 3PX2A 4DM3A 2IH2A 2FRXA 1N7IA 2ZIEA 4LG1A 2WK1A 2JH8A 3PFHA 2P3OA 1R74A 4IV8A 3R3HA 5FQOA 4PYOA 2BM8A 3L8DA 4EK9A 5LQNA 4RTKA 8MHTA 1JG2A 3M6XA 2BR5A 3C6KA 3EVBA 3G2OA 3I9FA 3ORHA 1P91A 4P7FA 5DXAA 1Y8CA 5HILA 5U4XA 3CC8A 1KXZA 1TW3A 1SUSA 1VP3A 4RVGA 3HCFA 5EC8A 2ZIFA 3LDFA 4POOA 3DULA 3RODA 4NECA 1NT2A 2E5WA 1R8YA 3GRUA 3OE5A 4QQKA 1D2CA 4ZTBA 1EQAA 5GM1A 5MHTA 5CCXA 3KQVA 3KQSA 4BLVA 4M36A 5EKXA 4C03A 3P2KA 3TKYA 2UYCA 4FT4A 3A27A 3NW9A 2ZTHA 2IH5A 2NXEA 3UA4A 3MQ2A 5EHGA 5EZSA 2ZFUA 1DUSA 1L1EA 2G71A 3OCJA 1RJEA 3A26A 3HCBA 3FPFA 4MIKA 3TQSA 1JQDA 1MJFA 2P3QA 2VDUE 2JH9A 2K4MA 3TM5A 5ICGA 4P58A 3UZUA 2H00A 3GDHA 4M37A 4BLWA 3KQYA 4GQBA 4BP3A 4YV1A 5K0FA 1BKYA 2ESRA 2JJQA 3KQQA 3E8SA 1NBIA 4CWAA 4C05A 3FYDA
chains in the Genus database with same CATH superfamily
5LQDA 4LDQA 1WEHA 1ZITA 1C80A 2QVXX 4WLVA 4N48A 1X39A 3NRJA 3K72B 3CUTA 4GPZA 4POAA 3D4NA 4X92A 4ZC1A 1MB4A 4BTEA 1UXHA 3T1HB 1RAFA 4HLNA 1X1SA 4LYYA 2XTAA 5JZVA 5BYJA 1ZNWA 2R6JA 4Z5XA 3RYFB 1CEEA 2PMEA 2CMDA 2Q6TA 4G0NA 1CV2A 1OI3A 4F93B 5H5JA 5F23A 1HEYA 2FGKA 5JCPA 2IWHA 1NDUA 4IBOA 3FNRA 4UMDA 3RANA 1WXDA 2A1TR 2IW3A 3BJMA 3BEDA 3LU1A 1JJVA 1Z2AA 2JVIA 3NAMA 3P9KA 2R6R1 3RTBA 3CKLA 1A7KA 4YQEA 1P2FA 1RWQA 2V3CC 1F6WA 1MN6A 1ZH6A 2WF5A 1N2ZA 2X5OA 3NDJA 5SZKB 4AKHA 1RQNA 1RJWA 2G0NA 2GEKA 2HSEA 5I8PA 2Q5JA 2QMQA 1QIIA 1T4BA 4H35A 1UOEA 4IS2A 5T8KA 4KITB 1M6VA 5FA5A 5LIRA 4YUYA 3Q40A 3RNLA 3W6PA 2ECFA 3ODGA 4MVJI 3E1KA 4GBJA 5H4HA 5B37A 2IU0A 3UMSA 4R2JA 3CR8A 4A8JB 1XYYA 4TV9A 4Z51A 2N0SA 2ONJA 2BHSA 5EMKA 5HF5A 1VLQA 3QF4B 4E15A 4RZIA 3SF8B 1GKYA 5L3ZA 4Q93A 3P9NA 3UEOA 1RBYA 4F5EA 2VR1A 3PBKA 4DIBA 2UV8A 1QG6A 2ORIA 3PX7A 3RF7A 3KOUA 4R9VA 3RSGA 4GC9A 5HSGA 3LECA 3AHGA 5I4KA 2NXWA 3UFXB 2G9UA 4D97A 1CYEA 5IJ0B 3G17A 2PUJA 4ITVA 1KQNA 4DLXA 1W94A 5ECWA 5K2OA 3OQNA 2WBLC 4KXVA 2ZYHA 5B64A 3UV6A 5I4BA 3U4MA 5L95A 1C3JA 1NG9A 1XZCA 3DH0A 2PJRA 2J9ZB 2AXNA 2HV8A 3DMFA 1PFGA 2G1UA 4PVDA 4RSGA 3A1EA 5JO0A 3H3FA 2J9RA 4S35A 4M21A 3FSJX 1CUZA 5C8DA 5JDIA 1NQUA 4ZIRA 3F6EX 3FUTA 1RWVA 1L5KA 1E4YA 3H4IA 2BBOA 1XNGA 4Q7LA 1XZGA 4FDTA 1ENZA 1LI5A 2ZI7A 3JAWB 4QG7A 3TOCA 4KLZA 2CHVA 3LVFO 4IJKA 3DL7A 2J3DA 2GT1A 4Q4HA 4U5QA 4ZAXA 4D82A 1E1MA 1W0KD 1W34A 2OV1A 5EESA 3BGWA 4R98A 4YI5A 4RV5A 4CUJA 3DDSA 1C5KA 1CY0A 2ZBDA 3H1EA 4CZ2A 4RCYA 3NHZA 3VUEA 1VL5A 4G0MA 4JAVC 5ALDA 3WJ1A 2Q29A 5C81A 2VQSA 1IFXA 4P4UA 1K7YA 4FQ8A 3F97A 2H2HA 3GYGA 3K0KA 4CM9A 1A5TA 1O0BA 5CA0A 3UPDA 3QE3A 3HU3A 3Q7QA 1NVDA 2QT1A 1W36B 2Z2KA 4J6FA 4D9NA 1R4MA 1VGRA 4S2EA 1LQUA 4ZQHA 3DM9B 4BQFA 2H0QA 3OFVA 4M49A 1GUFA 5F51A 4H1HA 1SCUB 2WI8A 1JQBA 3LY5A 5FNVB 5IJXA 3WMRA 4GLJA 2LD4A 3HZZA 4UUNA 1V2GA 1RWXA 2AG5A 3MUNA 3M83A 4GNRA 5TJ9A 4EDHA 1OBOA 3OP1A 4LBVA 3TEMA 1Z8FA 2BHNA 2QVZX 5C52B 2OVBA 5EMJA 4M6WB 1SVKA 3MZ0A 4CBVA 5KMGB 1G8HA 2C5GA 3FIJA 3RSFA 3DLAA 2J7PA 1H2AS 1T2EA 1X0XA 5BRJA 4L72A 1NASA 2JFZA 3AJ9A 4IS3A 2RGAA 3Q8XB 3C1TA 3NYQA 3JQBC 3NH6A 5P21A 1NUAA 4M60A 2AFRA 2G09A 2NXNA 1E3SA 1IK4A 1T9GS 3HG7A 2IT1A 3WNVA 5AHKA 2WPDD 1VBFA 1E1LA 1XDWA 1CDZA 4UHKA 5IKMA 2NN3C 1MR3F 1TA0A 3QEBZ 2XGSA 4U7DA 3DDUA 4YRGA 3UB3A 2NAFA 3AY3A 1SQSA 1XDBA 3KDSE 4MO9A 3TLXA 3IP9A 4JKOA 5EAIA 5LOVA 1YCHA 2BMDA 1HDGO 2CNWA 2ZVPX 1AC5A 3AI2A 3I0ZA 5IK2A 1C4XA 1NLFA 3SBOA 1JE1A 1MV5A 5HOQA 1U0RA 3SYKA 1P7WA 1VG1A 2L19A 2E3JA 3CRRA 4EUKA 4EVIA 1G3UA 1KS9A 2DR2A 3I37X 3HFGA 5EJ9A 3GGCA 3EZ6A 2X1HA 2W6ZA 1VCOA 3FFWA 1GCGA 1WA5A 3V3KA 4QDKA 2HZBA 1FRNA 1XDZA 3T6KA 1YJQA 4DZTA 3BWXA 1R0SA 1RM4A 4CM1A 3CX8A 2I54A 6AT1A 2J87A 3OZWA 2VSFA 2H2FA 2OWEA 3D3WA 2YRFA 2C9ZA 5G41A 4ER5A 5F33A 3G9QA 1J0CA 1RYHA 5CR9A 2PUBA 3ZEAA 1DAMA 3K96A 3KVYA 4ZQBA 1IHXA 2D54A 1MDFA 4JBIA 4C01A 5DNWA 4NTZA 1C7IA 1QMPA 1UFKA 4ZT2A 2FX2A 1ZUNB 4L73A 3RSHA 1Q50A 1GGKA 3HSKA 4CW7A 1M5TA 3S28A 1NW9B 2NADA 4JQOA 1MB9A 1VLMA 2QG9A 4QBGB 2A0XA 3T7AA 3VTKA 3H2SA 2IIVA 4NS4A 4FKZA 4RHFA 2VHCA 1AUVA 1Z6AA 4JJAA 5H1YA 4NJMA 3S2YA 3M6FA 4II3A 4DIMA 3W3ZB 2UDPA 1NG1A 2QTHA 3BMXA 1Y3HA 2CLOB 2WIGA 5J4LA 4XUDA 1XQ1A 3N2KA 1CRQA 1T4CB 3I72A 4AZ0A 2WMNB 1JR3E 2I2FA 3S2IA 2F64A 3TRIA 3GDFA 5C80A 4N7MA 2NV6A 2XDQB 1B93A 5CX1A 4TM7A 3VYUB 5A4KA 5KYKA 3PJGA 4FWIB 3VTFA 5K0NA 1EFDN 1M0TA 1UJCA 1R50A 3UXYA 3QOWA 1G42A 2BE7A 5HPYB 3KFVA 5FOSA 1FSGA 3F9RA 5CU7A 4DN6A 1AS2A 2XCUA 1ZY2A 1XQWA 1NFRA 3P7MA 4JSTA 4YUWA 1R00A 4Z3KA 3WAGA 3DDCA 3ELDA 5AVZA 4HFMA 5DTMA 3D2LA 3DBLB 1E92A 3AZQA 3G0CA 2C7GA 2JGMA 2VDRB 4N8EA 4WXEA 4XX1A 2NIPA 2DWCA 4BDTA 1R0LA 4F1JA 1I6LA 2F8SA 4H59A 4AKEA 4DS3A 5K4GA 1NLYA 3F7TA 4O4JB 3AETB 3ZWDA 4RE6A 2QTTA 4XPZA 4Z2AA 3K2QA 1S3SA 1TYEB 4GP7A 4LY6A 3ROTA 4UNSA 5DXFA 1BMFA 1U2ZA 2DHQA 1LVHA 4GGMX 1ISGA 1KU6A 4IJMA 5ECDA 3AP2A 2ZZKA 5DHPA 2EC5A 2G0AA 1DWOA 3D8NA 5JBIA 3AEKB 3TIIA 3UWDA 3ZNPA 1AKMA 3ZX5A 1T15A 4CMKA 3WGHA 9LDBA 3W4JA 5CUQA 5REQA 1XTZA 1B6GA 3I5MA 4GE0A 4MKGA 2UZ0A 1NLMA 2O3JA 1GQSA 3M8KA 4OKNA 4EY5A 2A5YB 4WVLA 3FOFC 4U4AA 4L4SA 1LSJA 3V1YA 4PZEA 1HT1E 2VZEA 1YZUA 3MRXA 1KEKA 1XLTA 2G67A 5ARBA 1NXOA 3P1JA 1DAFA 4IJQA 4D6PA 2NV0A 2P9HA 4G89A 3JWJA 1RLMA 3O9MA 3I6BA 4NJEB 4RQTA 4I99A 4OSEA 4GDFA 2NO1A 3NHYA 1G6Q1 4MOWA 1QOZA 1JA1A 3U7EB 2NACA 4R1TA 2X8WA 3AF2A 3JVEA 3PNBA 2I6TA 2WMDA 3TYXA 2DZDA 4PO1A 4BO8A 2BFFA 2GJKA 2DKNA 2PX2A 5BSRA 4O25A 3NVMB 1KMIY 2R5NA 1E5DA 3GEIA 3KB1A 3TS1A 3VR2D 2FVXA 2FWMX 1M1YA 3F3MA 3NEAA 3AONB 2O7VA 3UH1A 2DBRA 5JC8A 4QBKA 1IL0A 3OTOB 2X3YA 1HDXA 1QHXA 3NDPA 2C2YA 4G41A 4REQB 4URYR 2ZBEA 4FS8A 4LZLA 2Q4TA 3ABOB 2IYPA 1G291 5K3SA 1ZVKA 4TRMA 5ALNA 3N75A 2G08A 2HDNB 1GA1A 4ARSA 3G0HA 1FVFA 3U4QB 3DEHA 3ML1A 5ALHA 5FUQA 2IXFA 3P8ZA 1YL6A 1LFAA 3F3YA 3OAAA 2CLFB 4IR7A 4WLNA 5ESXA 5MGBA 2PX0A 1GZSA 1Z5UA 3E9DA 4QODA 5EHNA 1ZM9A 2GXSA 3HZOA 3FDZB 2Y0PA 2D7CA 2VQDA 5AKXA 1FPMA 3T9AA 2FWIA 4QUBA 2NUAB 4HZUA 4UASA 1NC3A 1ETUA 3H5AA 2Y71A 4FOPA 3ISJA 3D6FA 5CG2A 4EJSA 2Z5GA 2CF5A 1P62B 2JHAA 3L49A 2NVWA 4W5HA 3ZCPA 4XR4A 1WV0A 5EIEA 4Q1AA 1XU4A 4KLCA 3IQWA 5HIIA 1U0HC 4D57A 1T2NA 3RRNA 1NOKA 5KNDA 2BGIA 1KEZA 1TC2A 4MZDA 1EUYA 1LWNA 2I1WA 2GSWA 1RD4A 4N76A 3WL6A 1S8NA 4WLUA 1N9GB 1XTRA 3HN7A 4EECA 4EYQA 3THWB 1TVMA 1GTL1 1ZU4A 2BZSA 5L7TA 1N32B 4BLUA 4AAYA 4IF4A 4MA0A 3AC0A 3WFJA 1JDJA 6Q21A 3E5NA 2EZ9A 1FP4B 1Z29A 3IHLA 1J8YF 4NYIR 3V00A 3E8XA 2UAGA 2ZBQA 2PKCA 4HDQB 4ASUD 1QGUA 2X7HA 3GX1A 1EX6A 1EGQA 2QT9A 4GO1A 3TOVA 4RA9A 3UCXA 4JELA 4F71A 2Q0SA 5AK3A 4TN1A 3WVNA 2H0AA 5TS3A 1SCKA 2VYCA 3QXSA 3V7UA 4A0SA 2V7UA 1ZD5A 2A35A 3PENA 4KWEA 3EGXA 2LVBA 2BJHA 1SA0B 4CTNA 1Q1GA 5GIOE 3OIFA 4Z0TA 4TZ0A 1ADFA 4FLMA 1PU2A 4LJSA 4YO7A 2W71A 3FVRA 2QTFA 1EG7A 1TF7A 3G7NA 5A9TA 1DOAA 5JQGF 2VK8A 4JVSB 3D9QX 1U9JA 1JPUA 1XVVA 2J3QA 1RLUA 2WT8A 1LS1A 3HJCA 3QVUA 3H2IA 2A5DA 1XN1A 4ZOEA 1Z5WA 3JVDA 1C7QA 2R66A 3SDZA 1TYCA 2PFSA 4MRMB 4DCNA 5IT4A 4WK2B 3ANYB 3HYTA 1XZKA 1I4DD 1AURA 2ZJ4A 4J94A 4CEHB 4BV3A 1CNFA 2F1KA 2IXBA 3HM2A 3PEYA 1Z6PA 1R5BA 5BR7A 3DDHA 1E2BA 3GY0A 1QNFA 1WS6A 2BONA 2Z2ZA 4B3XA 4KK3A 1PQYA 4G9BA 5CFLA 1QVRA 1MEJA 1QFSA 3BQMB 4CVNA 1N2XA 2O57A 3RKRA 1SVNA 3QNMA 4WAUA 5K01A 3FVQA 4WCDA 3AF0A 1DC4A 3N2IA 3PVZA 4BMZA 3R9WA 4FN5A 3HRHA 4X93A 1IN7A 1YGPA 2OO5A 2ZRMA 1UOPA 3EDOA 5I9TA 3TNLA 4W9NC 2C84A 3TQRA 3W9BA 2GPAA 1W87A 1GLNA 4JT2A 2IE0A 4K9NA 1ORDA 2ZGVA 4JEMA 4JZKA 4BRSA 2Q5IA 4AKSA 3BWEA 4UNQA 3W34A 3D54D 3D8RA 2VH2A 1GR1A 3H3XA 3OZVA 4KQ6A 1A1VA 4L5CA 4R7ZA 3RF6A 2QI9F 1T4GA 1NYTA 8GPBA 4CLOB 1Z0ZA 1SC3A 2WVHA 2X1MA 1CEXA 2VJBA 3IMFA 3WRVA 1U7DA 5KJCA 1G64A 3H8JA 2X58A 1Q95A 3R3VA 3UKOA 3WFZA 2DWUA 2FFAA 3KHTA 2O2HA 1L0BA 4HUTA 1KDPA 3IR6A 1FVHA 1VL6A 3KHKA 3AWDA 5A0VA 1IOZA 2O1WA 3ILHA 4F45A 3VKGA 2AYYA 3GQBA 2ZZMA 3TZKA 5BV1A 4NXNB 2Z6VA 4HDCA 1QC5B 4ERNA 3F6RA 3HVKA 4FFPA 1J8FA 3TXAA 2PXCA 4EY6A 3OSUA 4ALJA 1E6KA 5AVWA 1QIDA 1OJLA 1TCCA 1W1IA 2AR0A 1ZH8A 1QJ4A 3AY6A 3KQNA 3ZTYA 1IUOA 2F17A 2RGNA 3JQGB 1LK5A 2VTDA 3IDZA 4EUFA 2WQ6A 4MRPA 4R51A 2GR9A 1K27A 3BTUA 3DZBA 4WECA 5GONF 5B7NA 1APBA 1YZFA 2XXBA 2RBGA 3FMGA 1RWMA 3JWPA 4MGKR 1ENPA 1EXWA 1Q3KA 2R48A 3R3HA 4RS4A 1OOEA 1SGWA 1PK9A 3JQ9C 4IXMA 5CIWA 4A0RA 2BFPA 2ORVA 2XD4A 1NN5A 1Z0FA 2AI1A 3MTBA 4IO0A 4WX2B 2Y6UA 1OH6A 2ZRNA 2EFEB 3PYXA 5DXAA 4BFUA 1A9ZA 4QASA 3SZOA 1AKQA 4XCQA 5EHQA 2C94A 3GW8A 5C4GB 5JJCA 3U3XA 1COWD 1YQDA 1M2OB 3QNUA 2PUDA 1EQAA 4ND6A 5B3KA 1I7SB 3O8RA 2YJZA 3WGMA 4YAKA 4J1TC 3D7LA 2IH5A 1US8B 4LY9A 2PZKA 3ST7A 2BEVB 1G9XA 4B9EA 1DAPA 4KH0A 1IRIA 1K75A 1RJEA 5JS7A 4HX2A 4RHCA 3Q2KA 1N2CE 5JMWA 4DQDA 5AVYA 1UUFA 2A30A 2JGAA 2PMBA 2X2PA 4C14A 1E4OA 2QLTA 2OCYC 1USWA 2P6MA 2R00A 4ETWA 2P4SA 1DC5A 5AOCA 2HIGA 3BQNB 3LP6A 3Q3GE 3OCXA 4NOKA 1U3DA 4G8DA 3H16A 1DHTA 3GD5A 1POWA 5F7ZA 4M1QA 4K8RB 2IP4A 1PG5A 4Q3DA 4C6TA 2Y68A 3QFHA 2R47A 1O3YA 5AO9A 3CUSA 4XTCS 2E1PA 3KWMA 3SM3A 3VXKA 3WL5A 4OA5A 4FYXA 4PFJA 4XJSA 3ZOKA 5CDUA 2AEEA 2H6EA 2WIFA 2O7QA 4AU1A 3E6AA 2J4DA 5EQTA 3FPEA 1BW9B 3FGZA 1B8OA 2N1MA 3OLXA 4IDCA 1AQLA 4WOBA 5TPZA 1L7EA 2D0PB 3D6JA 4LFCB 3DFMA 3L8MA 3UAZA 3VX4A 1DRJA 5CXUA 1BCRA 4YJ2F 3NCHA 4P8RA 5JD4A 2LPMA 5KTNA 4AKIA 3DB1A 1P72A 3B7GA 1BOOA 1D4ZA 3GRFA 4ZXFA 2Q2VA 1K0UA 1R12A 2FUNB 2ODPA 4H60A 1J2UA 2A9FA 4EIWA 5CFQA 1V7ZA 5KNCH 5DBEX 3EG9A 5GVRA 2P2ZA 5EMMA 4JLSA 1DXOA 3IAUA 2RH8A 1YOVB 5I51A 1ZGZA 2Y9PB 1T1SA 1XZQA 4KOEC 1UAGA 2NP7A 5BT9A 5AIBA 4RZUA 2AFIA 4K3VA 2QM3A 1S8AA 5HUQA 2POCA 5J4KA 3HXTA 2RGDA 4LJKA 1HR0B 1V1JA 1YHNA 4MS1B 2PUAA 1TZ2A 1FTNA 2B30A 2F3UA 2RC6A 2O2YA 3UJ9A 3UENA 3KEQA 1Y80A 3EXAA 3O84A 1VCIA 5TJHA 1WW8A 5JQGA 4RTQA 2QPOA 1PR3A 4IUCS 4QQNA 2PH1A 3RYHB 4BE4A 2BP7A 1ISJA 3DL2A 3JQ8B 2QV7A 1TA9A 3W5IA 3SQWA 2IPLA 4KKXB 5FBVB 1NIPA 2J3EA 1ABFA 3GMSA 3KRTA 2W98A 1IE3A 2J59A 2XMCA 3MERA 2HXYA 4NH0A 4BUZA 1KERA 4C29A 1A9YA 3CIOA 5DYIA 1KAHA 5BY2A 3DAYA 3O74A 2QX6A 4BAZA 4RIGA 5FPQA 2QE7A 2HWXA 3A06A 3L77A 3N86A 4MQFA 3KYDB 3N2ZB 5CYGA 5FOVA 3OQOA 1ZL0A 4EZBA 3UJAA 2OHXA 2DPYA 1V1MB 3GFQA 3NX4A 3RC3A 3T1NA 1NUTA 1HDYA 3W5BA 2GDZA 1OBFO 4MV1A 4R9NA 1U3FA 1SIBE 3OIYA 3WY9A 2PV7A 3UOAB 2WJ3A 1GKLA 2E55A 3OY2A 3H5TA 3IT1A 3M9LA 1OI4A 3CEHA 1KVTA 3D8BA 3NWJA 5KKAA 4GSYA 1QTQA 2Q7XA 4OU5A 1NBHA 4H16A 1Q20A 2AS0A 1MABA 3F9IA 3N2LA 4HATA 5G40A 3EPPA 3RUAA 4TV9F 3EYAA 2GBGA 3F2VA 2I4IA 2XQVA 2VRBA 2VSOA 1ZYUA 2PNFA 2BGMA 3HBMA 3AL2A 1GOTA 3AR9A 2R0QC 1T35A 1FSFA 1M73E 4TLEA 5IN4A 3IP8A 4JDUA 1JV2B 1N1EA 5HRCA 5CAEA 2PIAA 1U8TA 1LDYA 1NVAA 3JYLA 2V4ZA 3ZU5A 2EJWA 2GHIA 3F6CA 5ELMA 3UK1A 5K8IA 1FJ2A 4B46A 5AKGA 1P3Y1 2HA7A 2QMYA 4IMIB 3AVYA 4MPDA 1VFNA 4M1EA 2HGSA 2Q62A 2R1VB 3FY4A 4MPJA 1Y7HA 1LWOA 3H5IA 1GFZA 1YD7A 2OENG 3BJRA 5DCUA 1CE8B 5KSZA 1D0IA 3LO5A 2EKZA 2JFWA 3A4LA 2Z4SA 5DFAA 3DR3A 1J25A 1IVSA 1HV8A 4W6QA 3JZIA 4WXYB 1NLZA 2DUNA 2NVUA 5H80A 3SF0A 3W5HA 4BN0A 1DMRA 5KDDA 4LV6A 1UODA 2G72A 1N0IA 3A7EA 3TUJC 3CB2A 4MI6A 2H1VA 4JT4A 1E7SA 1DO8A 1J39A 4CUZA 1TMYA 5LN1A 1Z36A 4WXRA 1KWKA 4N65A 2AOUB 4GMHA 2O59A 5JXGA 5B1DA 1C7JA 1U7HA 3I42A 2Z6QA 1IAVA 1U6KA 1SD2A 4PYKA 4C4XA 5LD2B 2YHAA 2IQIA 3HKBA 1V96A 4MI3A 1VYHA 3CWZA 4TMZA 5DT9A 3SYNA 4ZGBA 4EYEA 5JO9A 1HKHA 1KO5A 3RBAA 4GT1A 2QSZA 3B3JA 1FQJA 2KB0A 4KIGA 4Z7OB 2GZSA 3K0FA 4Z1MA 3E9YA 3E22B 3LUJA 4Y9TA 5EJIA 3B6EA 4C7KA 2HF9A 1UBGA 1B1AA 3N76A 3I2YX 3WLOA 1GWNA 9MHTA 2E4ZA 3Q98A 2VP2A 4FGLA 1MZPA 1JHZA 2NZVG 3BH0A 2H1RA 6YASA 1N33B 1TM3E 2GEUA 4N5MA 2LCIA 2P9TA 2L82A 2X6QA 3AI7A 2QX7A 4C3ZA 1EIZA 1XAHA 4LBYA 2ZJ2A 2H59A 3CMCO 1RLJA 2O48X 4PPYA 5DBOA 5HE9A 3CH4B 1XALA 3D7NA 2H4WA 4UBJA 4Y2HA 5ILGA 2D4AA 2SKDA 3CNNA 3OQBA 2ECPA 2I78A 2HMTA 1FFYA 4EYSA 3RIMA 4K9LA 3ABIA 3LXUX 4OHPA 1JX6A 3RGGA 3ZU3A 4MVWA 3UWMA 2VDPB 2QTLA 3Q3HA 4FC7A 4RO0A 2OECA 4F04A 3V2IA 4QC2A 5ITSA 2HF2A 3S0JA 2PH3A 1RKQA 2CL6X 3FB4A 1FMTA 3V6LA 4WNAB 4ALMA 2DKOA 2Q28A 4HNVA 4DLKA 2AJCA 4D41A 5A6SA 3ILVA 1EB9A 3DJFA 3QOYA 4DV7B 2CMFA 3KT3A 4RM2A 4UJ5A 1V47A 5G2OA 2ZYDA 1U65A 1FDVA 3KQUA 4PSCA 1CT9A 2F7SA 2NZ8A 4ZALA 4HWGA 2XMRA 2WHPB 3PSAA 4PVCA 2R1TA 1IIBA 3WA6A 2EG5A 3QJYA 2WPNA 3KX2A 5SZJA 4IM7A 3H87A 3QXGA 3NNDA 2V9ZA 4TT3D 2ZIVB 4JSYA 3QA3E 5DN6D 5IU6A 1A2QA 1JIJA 1G60A 3GMIA 5FOUA 3JVUA 4EA8A 2PKWA 3RC7A 3ZLVA 2OT3B 1GXSB 1Q5PA 4DVGA 3QVVA 1Q7CA 3ZU4A 3EEOA 4X6XA 4EF4A 4J43A 1Q0SA 1WMAA 1WZIA 2Q9UA 2F1IA 2QN8A 5JYEA 1ZVVA 4ZA2A 1L4BA 2QI9C 3ZV4A 1ZD2P 2WHRA 2FZ4A 2A78A 2BF4A 2ZATA 2II6A 3NIGB 5JC1A 2ZIGA 3U26A 3LHSA 4LXIA 2ZG6A 3PPYA 1D4FA 3VR1A 1VBMA 5K09A 4C4TA 4X20A 4D6YA 2H2IA 2A1UA 3KOMA 1VKNA 3ZGXA 3CUKA 4RORA 2IPOA 4G1EB 1LI4A 4DAEA 5I48A 4M1YA 4V2UA 2TMYA 4P38A 1WMDA 3K1JA 4ZVNA 3S8YA 4DQUA 1AKYA 3ZH2A 1LS6A 3LAWA 4RZSA 2DULA 1EWQA 5FB3A 3OAAD 4NDNE 3VSDA 1U0TA 1P8JA 3ICVA 5DOZA 3S2EA 4TKMA 4M2LA 5BO5A 1X7WB 3WGGA 2OCGA 2Z43A 2FPOA 3P0HA 1BCSB 4X1KB 1E2HA 1N2HA 2YHIB 1DZ3A 4DM4A 5MFZA 4N03A 5CB4A 3ZDDA 1C9MA 1KKUA 2GZRA 2XNDD 5J5AA 3RI3A 4E6EA 1P0IA 4WRRA 3K1YA 3ETGA 1MX5A 4RANA 5ITZB 4FQ7A 1DBVO 2X8BA 5IAEA 4AUKA 5CA0F 3CZRA 4MKXA 3QPDA 3UUWA 2FN9A 3AUUA 1RMQA 1TJNA 4R8LA 4X3CA 2ZS8A 2CCJA 2JIMA 4IHKA 4JC5A 4B45A 5FDFA 1DE0A 3AF3A 2ATEA 1OU4A 3DS8A 2IYZA 2Z30A 3L01A 2ADFA 4JLDA 1SZJG 5I01A 2R79A 5EIAA 1ARZA 1C3VA 2IZOA 5A3SA 3T1QA 4YRNA 3KUCA 2ZRAA 5GZ1A 2C29D 3DZJA 2WAOA 1Y8AA 4X24A 1OB2A 2J31A 1DX4A 1E6UA 2D5CA 2GNOA 3EW7A 3W5JA 1VGVA 1RZRA 5I9LA 2PWAA 3C4VA 2HC9A 3FVTA 3VYSB 1DQPA 1ILWA 2EJCA 2V9PA 2WF8A 2ZYRA 1IB6A 2XSZA 3IQFA 5DSXA 5EZYB 3TW8B 3C45A 2FUEA 5K8LA 3TSOA 2OXFA 3UMBA 4X5OA 1AKEA 5HIAA 4GP9A 3WWOA 2XYGA 3G9XA 4LF6B 1SK9A 2ORYA 7ABPA 4DBVO 2PTHA 2IU3A 3S6JA 3LT4A 1IWOA 1XMIA 1Z15A 3RU9A 4J0KA 2V5VA 5K99A 1B8VA 3AF1A 5JRJA 1T10A 1L5HB 2A2ZA 3EG5A 2TRSB 1CERA 3B1FA 3FKSA 2C4TA 3OQIB 4J0EA 4MV8A 1M3SA 4P5DA 3WYDA 4J9VA 4YRRA 4B3MB 1SG9A 5BWMA 3G85A 1AGYA 3GH1A 3UHAA 3EMKA 3GZ4A 2A0UA 3TNJA 3F47A 4OLBA 1HA3A 4OD0A 4TUYF 2J0UA 5B30A 5LYYA 4BLOA 5BQPA 1LPAB 3I64A 1QIKA 1YCGA 2CMHA 1G8GA 1HC7A 1TVKB 1UM8A 3OM0A 4UUOA 2CNBA 1H1DA 4O4JF 3RYIB 4PLYA 2G7ZA 1UC9A 3LE8A 2UZ1A 2ZJFA 2HTEA 1Z4PX 4YJFA 1U0LA 4D9HA 2CUZA 2CXRA 4JJKA 2JCXA 1WP9A 4K05A 1E6CA 2C03A 3ZWNA 3E23A 1NHWA 3Q7SA 4KZPA 5LBUA 1W52X 2HO4A 4I6JA 5DK4A 2JFYA 4S0ZA 1WZNA 1ULZA 4M4SA 4WZBE 4CDMA 1QAMA 4MUYA 3KQHA 4QYSA 2XWBF 1E0KA 4DJAA 1V16B 2ZR9A 2BEJA 2VJPA 2X2FA 4ES6A 4LXTA 2GM4A 2VAVA 4IEFB 3DOIA 4Z0HO 3WWCA 2Z5VA 3IFSA 4NOLA 5CB4F 4FKBA 4IHJA 4PBTA 2CJWB 3U3KA 3TMKA 1XMVA 2BMJA 4R54A 3G2IA 1G2QA 2ZWOA 4N0MA 4RS3A 5EZYF 4C30A 2ZAOA 3Q0EA 4QJ3A 2GQ0A 2Q4EA 1MO6A 2FPWA 1ZW1A 5CVJA 3GJ4A 2HLDD 3NDRA 4Q47A 3ZXXA 1F60A 1EDZA 2UUCB 1WDTA 1YDFA 2RGNC 4G4SO 4B79A 2FEMA 5EWMB 2QQFA 4LSZA 3IUBA 3RJZA 3OFKA 4URFA 3Q7EA 4DNFA 2O14A 4B7UA 3UMGA 1EX9A 2GD1O 2Q0QA 2DBYA 1HDIA 4TXNA 1XLUA 5IH3A 4DZZA 3AW9A 1OKKA 2XJ4A 4V0ME 2W48A 2Q0HA 2PLNA 4PV7A 3OPNA 4R3UC 2KX7A 3MELA 4EHLA 5D1NA 2C2BA 4LDZA 4R0VA 3C5WP 1PUJA 3HP4A 3AERA 2CJFA 4GPD1 3HVJA 4MWBA 4PYRA 4RF5A 3T95A 5JXWA 3VR5D 2QY6A 4AI6A 1P2TA 3HU2A 1JDZA 1QHFA 5IMBA 1LRKA 1F8FA 4G4GA 3OLQA 2SCUA 3EXHC 5FBHA 3E61A 4AURA 4BYGA 4HV4A 5B4VA 1B41A 1ODIA 2DT8A 1JYSA 3KT0A 4QTUB 3MD0A 4WASA 4PQGA 1PV4A 1DTEA 5KTSA 4RJKA 1KQOA 4YT2A 1GRQA 2J4CA 4DSUA 4HUJA 3DFUA 2GJ4A 4JOCA 3QF7A 1QLHA 5HXAA 2GN0A 2O52A 3KZKA 1PZFA 3WIDA 3KV1A 1PYDA 2B21A 3B1YA 2QU8A 2H1OA 5IS2A 3OF5A 3IS3A 4GZ5A 1RXIA 4EHIA 5KVSA 1V35A 3EDCA 2HNAA 1IUPA 1YQ9A 3OE7D 4HHEA 2RE8A 4LX8A 1ZIDA 5JH7B 1ZCFA 4TZKA 3UHFA 4XGRA 3G5MA 1L5QA 2D8MA 3CNBA 2FXIA 3GCZA 1U3UA 4QTYA 5E9WA 3GUVA 3DHVA 4GOND 5EHZA 4H3VA 3LLMA 2IHYA 4OJNA 4NMXB 2XUPA 1V8ZA 1P2UA 2D8AA 4JP5A 3LWBA 4KTVE 1JKIA 2D1YA 5JJIA 5JFTA 1NWHA 2JH8A 4CR6A 4X8OA 1TTQB 5HMMA 1PJRA 1KTVA 3WGLA 1EFRA 3PR2B 4QPCA 1G5PA 1H5QA 3GLHA 3JVVA 1I9CA 2B1QA 2WIBA 4ESVA 3ET4A 3TZ6A 3S70A 4B3JA 4HB4A 4P7FA 2DSTA 3HABA 1HZZC 2ASVA 3P9QA 2KPOA 1Z74A 4BO1A 4Q0MA 1G1MA 4GSLA 4LXQA 4YJKA 4CFZA 3UGKA 4PG7A 2NSJA 1NT2A 4MHOA 3ZI7A 3THOA 2GCNA 2GTHA 3K5WA 5ITWA 4M36A 1UXKA 2JFPA 4C03A 2R65A 4HN2A 4TMKA 1BROA 3PHLA 4RPJA 4K9SA 2B0JA 3KJNA 3R7BA 3KYIB 1L1EA 1VJDA 3U7JA 1X87A 2XMSA 1N6LA 4MIKA 1Y5MA 1IJKA 1U7ZA 4I55A 4MWSA 4G5GA 4D3DA 5KJFA 2QG6A 3O0DA 4DM7A 2G9QA 2ZE7A 4FMDF 3KLNA 1QR6A 4MV5A 3LQKA 3U3RA 4EYGA 3AJAA 1P4AA 4E5VA 4JI2B 2BCGY 4L4XA 4QD3A 1PT7A 2PLAA 3K92A 2IYVA 1QHHB 2VP6A 3HGQA 2WG0A 4CWAA 4ZGGA 1DCKA 3QSYA 3OJWA 3UN1A 1QYRA 2H9IA 3EZXA 1IM5A 3PICA 1M1YE 4UNNA 4C43A 3THXB 1CBUA 1SOVA 3BREA 1PDWA 1FJHA 4KXMA 2VRNA 1RRKA 3KB6A 2Y1GA 3M70A 1QK3A 2WWTA 1RLOA 4NBLA 2ANBA 4I50B 1JEQA 1WMFA 4ANFA 3A1FA 1XLVA 3K05A 4K9KA 3E0XA 4XQGA 1LF5A 2OO3A 4RE5A 3EQ8A 4AUMA 1JALA 1Z8DA 1C30B 2HLDA 2IYSA 4HR7A 4TMYA 5FTWA 1R4NB 2CHGA 1E20A 2VBCA 1TB4A 2QM7A 3SVZA 5K5EA 4Y2TA 5KX5B 2GCIA 2GPBA 2FEOA 3K9HA 3PCXA 3CCBA 3EHEA 3FHLA 4KXUA 1BN6A 4L0CA 2QUAA 2HJHA 4HD8A 4TSFD 3S1AB 1WUIS 3EVNA 2O19A 2H7CA 4MDHA 2SHKA 2ZUWA 2HI0A 1REQB 1WOYA 3VAZA 4FFMA 4BKPA 1Q22A 3V4FA 1I7NA 5AI6A 3ZD7A 1WVIA 1SU6A 3PQFA 1AOXA 1KY3A 2KSQA 4UMVA 4ZPXA 1BG6A 5A4AA 2QPTA 5DP2A 1MKYA 2P5SA 3H9GA 3PQ3A 4MIYA 3ZCXA 2DG2A 5ARDA 3HCDA 2R3SA 3E35A 3ED5A 2HA0A 1VKJA 2A9PA 3FBTA 1ZH0A 3VQTA 4JITA 2YXEA 4WXMA 4E33A 3AUJB 3CRNA 1J0AA 2QSJA 4B7AA 1QHSA 2RBKA 4TQ9A 4TVBA 1SIWA 4ZOAA 4B3SB 2DU8A 1XO1A 1YJ5A 3OM8A 3A6JA 4WJKB 1Y1RA 4I2NA 3V4RA 3V32A 4ZCRA 2ISQA 3TRKA 1AMNA 4KQJA 2CL0X 1XCMA 2PBLA 3GG9A 2CVPA 2XCTB 4ZVKA 1X1AA 3FPHA 1GUDA 1PJBA 1G5TA 1OXMA 2WYUA 3ZJUA 4K81B 1U8XX 4ZO6A 1LLFA 2REXB 4CF3A 3A3OA 4PEVA 4JVMA 1C3LA 2QZ4A 5L51A 1TGYA 4DLVA 2WWYA 1ZX1A 1ISRA 3Q3CA 4AUEA 1JB1A 1VYTA 1IQ0A 3R8FA 3RRXA 5J2UB 3QUBA 1EFTA 1QIMA 3I6QA 4R05A 3B9BA 4PHTA 4MW1A 1JDUA 4D6XA 2N46A 4YIHA 4Y7DA 3ORYA 4DV2B 2YC2C 4PTLA 3OH8A 1GFIA 2HY7A 3OF2A 2JD2A 5GVSA 1PFUA 3GZJA 2F1JA 2NGRA 2O3TA 1RHJA 4EEKA 3BUSA 1WDLA 2XGOA 1E5LA 2PGOA 4LYJA 3E7XA 2APJA 4HDAA 3U3MA 3UAVA 4ZCTA 1ZRNA 4RTOA 5JS2A 1TJYA 4MQLA 2Z5FA 1G41A 3GVIA 3PEEA 3KSAC 1N2OA 1R37A 2PX5A 3FYHA 3WZ2A 2BGWA 3RQSA 4HSGA 1KY2A 2QVBA 4B7XA 3RUHA 4EJ2A 3L0DA 1IM8A 2R8BA 2HRDA 5ECGC 3RDPA 3L7CA 1T8SA 1U81A 1X3LA 3N6XA 4IXWA 1U5CA 4M7PA 5EJ5A 3EC7A 2VWGA 1UC8A 4U00A 3NPAA 1VHDA 2J6HA 3IVRA 4OQNA 1BNCA 2WFZA 1JA0A 3A11A 3MJHA 3P9PA 1FVOA 5I9NA 4B7ZA 4K6MA 4TMXA 3S1SA 4IDBA 2Q2OA 1BWSA 2W6ID 2OZKA 2ECOA 4J29A 3FPLA 1BXKA 3H5VA 3BIOA 1D2HA 2IXEA 2VJYA 1Y34E 2JFGA 3ZDQA 1I7DA 3QFRA 1CZOA 5F1PA 4YACA 4IGEA 4IZ6A 5A02A 4DA4A 3ZWKA 3TDKA 4CEIB 4CLDA 1Z8NA 4JA0A 3ZCRA 1T5BA 1IN1A 4YMGA 2VT6A 2VDMB 3WK8A 4KW7A 4UKDA 4WERA 2X6RA 1U0OC 1DNPA 3IXMA 5DRTA 4CKYA 2QU7A 3AIKA 3GVPA 3GELA 4X3OA 3SG0A 3GT3A 3RUCA 2Z2IA 4YT5A 1IVYA 3UMJA 2VYQA 4JWKA 5JWRA 5IT9A 1M7GA 1MEEA 4GBED 1V4VA 4P3PA 3G5LA 1ADYA 1O97C 3H1TA 2IP2A 2R85A 1MRSA 3IEUA 4M8SA 4ER0A 3UO8B 2VPXA 1XIVA 4Y18A 4QUDA 4JL5A 3S1LA 2HSGA 1IRXA 4FJ2A 5DF1A 5HIJA 1WUJS 2ZR0A 4KIWA 2Z9CA 1BH6A 4FONA 2VJAA 4XQ9A 5F2EA 1Y6GA 4I0WB 3LWNA 1J8DA 1XJCA 2WPDA 4OQLA 5CRIA 5KC9A 1CUHA 4MWZA 5J23A 2DYKA 5MN6A 3ZY3A 5DN6A 1I0LA 3DCIA 3P96A 3VU8A 3F98A 1DSSG 3K9BA 3L1HA 4P1ZA 4NP6A 4QU5A 5LU9A 4GM1A 1QIGA 4URZR 3UT5B 5JT1A 3QEMB 4E5PA 1J9EA 1WQ4A 1V8PA 1GQRA 1Q77A 2XRMA 4MGZR 4AICA 4UPVA 2PZLA 4NPCA 5BSHA 3HYLA 5ES4B 4YR7A 2P9JA 4G1BA 2FF5A 3WKCA 1HM5A 1XWFA 3QX7A 4PRYA 5GONA 4Y0NA 3C70A 4RJIA 4BO7A 3AVTA 4RWZA 2VRCD 3IAXA 2DR3A 4FMDB 2H5LA 3PLAE 1QG2A 1E5VA 3GFFA 3GT4A 4LQLA 1YB1A 4KYUA 5GOZA 1PJ2A 1DKUA 2EFCB 2YR0A 4NAVA 5FL7D 1KMNA 3AB7A 4IY1A 4U2GA 2OAGA 3NUZA 4P98A 2GK4A 2J5RA 3BL5A 3JAKB 3GLVA 1M8FA 1EP3B 2Z8YM 4ZOLA 3PJEA 1KYIA 3E58A 3HXKA 5BRAA 4R1SA 3CGWA 1JTFA 5CB0A 3OQHA 1RZ3A 2G80A 4WFIA 1NVWQ 4YI3A 4P4TA 1V43A 1SUPA 2NVBA 5FEMA 2PD3A 2GD6A 3ZJ4A 3ZU2A 1V5GA 4YO8A 3ZCQA 2RKBA 1KYYA 5F4BA 4LNUB 1V7QA 2VOEA 4IKPA 2IY8A 2YWXA 3V80A 2I4OA 3IJPA 1OZFA 1QPGA 4G8JA 1ML4A 2EKLA 2VNKA 1RRCA 4N49A 3KQMA 1I1OA 4RABA 3VO2A 3IEXA 4EFDA 3I9NA 1BKDR 3HRKA 1HY3A 4EO7A 5JARA 4OJMX 1E1CA 2PYZA 5KU1A 1SU4A 2FW8A 3FCSB 3NGMA 4BC0A 2D7DA 1CZKA 3WSVA 2E37A 2QPAA 3H75A 3WIBA 4R2LA 5HUHA 4XWYA 4JI6B 3QV1A 1ATZA 5IAKA 1L4KA 1VIDA 3K70B 1ZMRA 4Z9FA 1RZUA 1FEZA 4PYLA 3P94A 4FE3A 1ZJ5A 2ACVA 4XWTA 2AOTB 3B9PA 4F5WA 3U3DA 1YJBA 3DLTA 3BRQA 3LHDA 1G7SA 1CKEA 1DRUA 2OXCA 4JQYA 2V6IA 4BKMA 1WSDA 3C8HA 3WLPA 4YJ2A 1Z3CA 2AWNA 2IPXA 2AKAB 2JLRA 4WK6A 3TMAA 1UJ4A 4ND4A 1PTKA 3C7TA 4GVPA 5A4MS 3Q9SA 2EW8A 4IRUB 3G2KA 4C5CA 3X1DA 3HRIA 3FYUA 3N7AA 4RYLA 3PFCA 1ILEA 1GRVA 5JNSA 3OFSA 1ECPA 1CNEA 1GSIA 1CVRA 3CWCA 4IMRA 3DLPX 2DFNA 5CDGA 3DCJA 3M6MD 4JMPA 5ALGA 2G6BA 3FE2A 5CDFE 2DCUA 2F90A 4N7BA 3N8GA 1V8OA 2UVPB 3AU8A 3AVVA 3UHJA 5IKEA 2GLXA 3CG4A 1LPSA 3BAZA 4QECA 4ZI7F 3IQGX 2CLIB 1YVRA 4B3BA 4U6SA 1NY5A 3QHAA 4QU8A 1JUDA 3FR8A 4JJ4A 3GC6A 4I1OA 1GQFA 4QDUA 4HSEA 2J5QA 4FYWA 1U11A 4CKBB 1FLAA 1ZA1A 1NBOA 4YRCA 1JHPA 2ZQYA 4GR9A 5FV7A 4GPTA 2HRCA 1DCMA 3PGVA 4G09A 1YK1A 1QYVA 4RL4A 1Q19A 2I80A 4C4PA 1U04A 4UEKA 2P7IA 5BT8A 1RR6A 3WKBA 3HNPA 5JDCA 4LCBA 3SX2A 4LRXA 5TPZD 4AZWA 4EX7A 5EHXA 4QHSA 5AVTA 2IVZA 3FZNA 5HA5A 1WU8A 3DV9A 4XSVA 4ZO9A 4EABA 5ITZA 1IN5A 2JGKA 4V0RA 5IN5A 4EG0A 1AKUA 1YT5A 4EA6A 4W8HA 4QGAA 3RHSA 3JD3A 2C7PA 1E9EA 2DE0X 1FTSA 2HU5A 5C7YA 5D85A 1HZZA 2G5CA 4DA8A 1CZRA 2VZ0A 4A5OA 4KI0A 3C6XA 3HBNA 1EMDA 1KFJB 3EBOA 2P9FA 2GS9A 1G5RA 1T5LA 1K7XB 2WT9A 4BNHA 3DHWC 1UJMA 3F5DA 3AOEC 4HYTA 1F12A 4XPIB 5H7XA 1OFHA 3BWVA 3DD1A 2Y92A 3LI2A 1BMTA 2FGJA 3SC2A 3E82A 5CPBA 5JBNA 4J03A 3O4VA 4IDAA 4D0GA 4RZQA 5T57A 3IP5A 3H4VA 1R6VA 2R1UA 2ACKA 2FFJA 1CUJA 3QUTA 4RVOA 4YQYA 4BX2A 4ZODA 4YT4A 1NVEA 4PO8A 2NYAA 3STXA 1R88A 3TLZA 4KHPB 4UHFA 4WEOA 2ZUBA 3RBZA 2WNSA 5AI4A 2XZLA 3L8FA 4Z4IA 4TKZA 3GBVA 2R7KA 3BL8A 3IO3A 5HP4A 1C0EA 2Q6IA 4EI7A 1BGWA 3HR7A 3FHOA 1LLCA 2GZ2A 2VDKB 3CONA 3O1JC 2WYVA 1EUQA 4UE6A 1A2KC 3FOAA 4L50A 1W6RA 5ESDA 1RP1A 1TM2A 5FWYA 3FCEA 5HKBA 3FOBA 3ET5A 3IQEA 1GPH1 5FKJA 1WR8A 4UMEA 5SY6A 4BNTA 1OLUB 3EVCA 4G8BA 2XMBA 3OJLA 1RBZA 2BCEA 1FMFA 1UJBA 1Q0QA 3VH4A 1E2FA 2Y1EA 2TMGA 4HPJB 1A8IA 1T3ZA 5L9AA 3FRHA 2X14A 3ZHYA 3FF4A 3GB9A 1ZWKA 4CKBA 1WPRA 3JALA 3LYAA 3M89A 4H31A 2F3RA 3RVBA 4PSKA 3T1OA 1TKBA 5JJLA 3OOJA 3DKPA 4ARVA 4GP6A 4BV8A 1K63A 3AY7A 2CWWA 5C4MA 4P36A 2JAWA 1NU8A 1KS2A 3BN3A 3GJ7A 1Z26A 4RK4A 1ZUIA 5HQJA 2DERA 4RK6A 1JR3D 2JW5A 3OEHD 1FMCA 4MJ3A 1QQ6A 1IY1A 1MX3A 3K9CA 2Q1XA 4RV4A 3DGEC 4JJ8A 5AW5A 1FYWA 1XVAA 1NW5A 3PKIA 4W1RA 4AZTA 2W2OA 1ZI6A 2PS3A 2VUUA 4UQOA 1SOUA 1PJ4A 4CMEC 4PLCA 3ENZA 1F1JA 1W96A 4FNAA 2ZXEA 4U8HA 5LB2A 3BA1A 4HLUC 4JLUA 4LY3A 5ELLA 2DTEA 4N5IX 4OB7A 1I1HA 4R81A 5K8VA 4RTPA 4R8VA 4K1XA 3V46A 3AGPA 2SNIE 2ZRGA 2IQ5A 4DFDA 4EJ0A 2D13A 4FOTA 1CXZA 1E9RA 1Y7TA 2PSFA 3LUGA 3KZ1E 3OOWA 3QG1A 4K88A 4OXKA 1PR4A 2C1ZA 4MV9A 1QYXA 1L3IA 2A94A 5B1HA 5JECA 5HCUA 4MWCA 3PT9A 4TSKA 3IIMA 1D7AA 3PL1A 4QXQA 1T2DA 2QENA 4Q3CA 4YGXB 2OMEA 1YA4A 1DKMA 2QMHA 2YZ2A 3JYOA 1KH2A 2EWMA 3ZE6A 3EUWA 1Q84A 3K94A 3TIVA 5F98A 1EFRD 4PZZA 3ESQA 2QX8A 1MT0A 1Q3HA 2E49A 1ZHHA 1MAAA 4QOJA 4OI4A 4DG9A 4U7GA 2C3PA 3UW3A 3CINA 2J6CA 1PT6A 1GNLA 1KAQA 2C88A 2FW9A 4GC5A 4IW3B 2MDTA 4OGKA 5B5SA 2DB3A 2ZDQA 3FUXA 4OATA 5A1JA 4I4TA 4ZVSA 2FFRA 4BIIA 3ER6A 3NT2A 3UWPA 3DBRB 4E6PA 2WWXA 3S8EA 2ZT8A 4LNUA 1EWKA 4Y8VA 2V6BA 4S1WA 3A6LA 2H9YA 4AX8A 3C3WA 3L8CA 1NRJB 1W46A 3MJCA 1CUAA 1E1KA 1XGKA 1NDQA 1Q0UA 3INNA 4ACBA 3TFOA 4E5NA 1VLHA 3HUFA 1TLTA 3EQ2A 2HBZA 3IOYA 4XW2A 2TYSB 4ZWNA 5HKKD 1P4RA 1PNQA 4ZOLB 4BP9A 1YKFA 2NTVA 5I4IA 4ZQEA 2J7KA 1R6BX 2JBAA 4R2XA 4IICA 2UXBB 3SHWA 1CDEA 1MAUA 4BN4A 3WL3A 5EXXA 1BE0A 1OLSA 1EP1B 2RG1A 3AUXA 4FBGA 3HCFA 1Y5IA 3T5DA 4MTCA 2C77A 4NECA 5GJWC 5MHTA 4B6OA 1P0PA 5FPPA 3ODPA 4KQKA 5CLLA 1RADA 5CLHA 2CN1A 2WAMA 1ZICA 2RBEA 3U60B 2ISCA 1SAYA 8ATCA 4KO4S 5IJZA 4TTVA 1GYQA 3HCBA 4GWLA 2CUNA 5C35A 1QMGA 5FPYA 1X8KA 1M10A 4HRVA 4JJ6A 1W7AA 4OGGA 1E3IA 2ZITA 3EOAI 1LY1A 3R6DA 3M4NA 3T06B 3W3AD 1EVLA 1X1EA 2YXNA 3PNSA 5ISMA 1IXRC 2F59A 2OQ2A 2ZJBA 5JPIA 4EMTA 4ABYA 2EVWX 4DDHA 3ROGA 3V1KA 3IJ5A 4B2LA 4Q66C 1I5EA 1V5FA 1XK6A 3ILSA 3NHMA 3FYCA 3OE4A 3TI9A 3U1BA 2XODA 1Z5PA 1U2TA 2AI3A 4MS4A 5J9FA 4LF8B 1NYRA 5FYDA 2C59A 4A6XA 3PNYA 3RRFA 4IINA 1QQBA 2BV3A 3I0MA 2XVZA 4E5SA 2LV8A 2ZIXB 5A7GA 1EXVA 4ME6A 4HVCA 3C6MA 3PPWA 2OZLB 3DYIA 1PBNA 4DQLA 4EKNB 4OQFA 2NTJA 2C2HA 5IEBA 3TIXB 3V5NA 1BQ4A 4CCAA 2GA8A 3CNHA 1Q91A 2EJUA 2R6FA 2OV6A 4N01A 1JA9A 3EVGA 3K15A 3SC4A 2AZXA 4L0DA 3R6GA 1X1TA 3K30A 5HQ3B 3M9XA 5KNCA 1DC6A 3ZK9A 1Y7PA 2W6MA 1DJOA 1N5MA 2G83A 3UUGA 1X70A 5K2MA 4KCGA 4KR2A 5DK6A 3RYHA 1NQ5A 3FUWA 2OHJA 4WDRA 4Y0AA 3GLSA 5C37A 5ERGB 1Z13A 2H2DA 2VJNA 4QPZA 2ID9A 2CDNA 4B34A 2R8YA 4FE4A 1WV1A 1LRJA 3BEOA 1ESDA 4X91A 1D03A 4MS1A 3CEAA 3OIVA 1PKXA 2ZIAA 3IOCA 3GN2A 4RULA 3SNHA 1IJBA 4DBLC 3L7JA 1UBRS 5KQLA 5CDTA 3DM5A 3DVSX 5ALEA 2I8CA 5LIPA 1L5ZA 2R6HA 3ZE0B 3T1YB 1M74A 3QVXA 2Q27A 4L5YA 3ZHQA 3EODA 3N0RA 4HGYA 1DRKA 2EATA 1MTOA 4W7SA 1G5QA 4XX0B 4ZEXA 1F0NA 4CKXA 1WMBA 3GFRA 3DMTC 1X7YB 2IEYA 3JTMA 3A6PC 4JI0B 3PHHA 3S7TA 5DH9A 3K4HA 1HTTA 1XD8A 1VIVA 1J24A 4BMYA 4Q6WA 3NFRA 5B3LA 3EPHA 5LP6B 3C8DA 3H04A 3ICEA 1HQYE 2PH7A 3LT5A 1TGVA 2O8NA 4MVXA 1DO0A 2Z2XA 4YJ3B 2KJQA 2WJPA 2G4CA 2B1JA 3EIUA 5EVCA 5FRDA 2HR1A 2IL1A 2GVZC 4UPEA 2RCYA 4AJHA 5JMOA 4D43A 2C8JA 2WU1A 1E5QA 4HEQA 4O2LA 5C1IA 5T4BA 4MCAA 3K0AB 4ONEA 3TLCA 1H3NA 4I3FA 3D7KA 2P4QA 3LOPA 1ZJYA 3NBKA 3WGYA 3K0EA 4YALA 5ICFA 3UMFA 2CXOA 3B1VA 1D2RA 3A6HA 2NU8B 3UK7A 1ZD1A 5KB3A 1GADO 1BVYF 1SVOA 1H22A 5KYYB 4J1NA 1HFKA 2J5BA 3MA0A 1XEXA 5JCJA 1MJHA 3BXEA 3U0VA 4XGQA 1ZPDA 3KC2A 4ML3A 4K9QA 3SJUA 2G1AA 1GLVA 4S0XA 1PK7A 5AJVB 1Y4UA 1H05A 2GM3A 2HK8A 2R751 2XOKA 2QTNA 1EKXA 2XB6A 3BQ9A 4UEOA 1O6GA 3ND6A 3W4IA 4PCUA 4EYOA 1FZQA 4ZQIA 1E4EA 2WF6A 4Y30A 4WWHA 5ULLA 3UVEA 3SOPA 3OTIA 3FBWA 3IUMA 4GX1A 1KJNA 4FUQA 1FP2A 1G20B 4LRUA 5CNJA 5I7RA 1EVJA 1XT6A 1G3MA 1MXHA 3R4CA 4XVRA 1HF3A 4YMTA 4G1CA 1M1XB 4QHYA 1Q7RA 4RFVA 1QQTA 2WAXA 3JWGA 3U56A 1I5OA 3IQDB 1O54A 1Q1NA 1J2TA 3QKIA 2M9MA 4MR9A 3OIDA 3MWGA 4P3YA 3RS8A 1ULAA 2BJVA 2ZT6A 1H8HD 4X3PA 1E7RA 1YRLA 4M99A 1A71A 2KMLA 1ZKDA 1THGA 2XQKA 4HAVA 4OHKA 4YAWA 5FHRA 4F12A 4YA6A 3M2TA 1RCFA 3L18A 2CSUA 3AEQB 1O03A 4PIPA 4ZU6X 3U16A 3O7WA 2EKBA 3B8EA 1B6SA 1NOIA 3WP0A 1OFGA 2RGXA 3CZCA 5JATA 2AG8A 4JV5B 2PUHA 3TBFA 3T5CA 3KSMA 2OAP1 4YAOA 4JIMA 4EG5A 1NW7A 1ZNZA 3ETHA 3R40A 3GO4A 4MH0R 4B3RB 9ATCA 4PS0A 2QLFA 1W36C 1W47A 1JNXX 2E1RA 2XZTA 4XYMA 3RVNA 3QWFA 4J0QA 2YIDA 1WXQA 7REQA 2H4FA 2O2ZA 4QYIA 4F7DA 4J7CA 3I1YA 1AKVA 1W75A 2P0AA 2V7TA 4ZT4A 4UTPA 5BMVA 5FUXA 1U1EA 2NUPB 1KPHA 4OJTA 3GQVA 3I8OA 1O95D 2JAOA 1MAHA 1YQWA 4UU8A 4UD6A 4P4GA 4DIKA 3T0IA 2CBGA 2ENUA 1JWLA 4A10A 1CG6A 1J33A 2IOFK 5DU2A 4KAXA 4JYZA 3HJAA 4AVYA 1LC3A 1J0BA 1SCJA 2I6XA 4IVNA 3WOHA 3FAKA 5EJ6A 5JTUA 5AM5A 1YBAA 2PK3A 3CKYA 4I5IA 2W4QA 3X2FA 4FN4A 2W4MA 4JGGA 4I55B 2N3ZA 2IHJA 3UMCA 2AKEA 4NDZA 3I30X 2AJDA 3GUYA 3GUZA 3RTAA 1Z75A 4V1CB 2XDAA 3LLSA 2AN4A 2ZJZA 1U9ZA 5P8WA 2VJOA 1ORHA 3DC7A 5C34B 4ESHA 3Q8KA 2LNDA 1VMEA 2W6JA 2LRHA 1G16A 3PC6A 4DIUA 4ENWA 5LQJA 1UK8A 3ACBA 1PGQA 3JQ7A 1KI6A 1WXXA 5JROA 1BKSB 3RVDA 1IY0A 3TR0A 4KHZA 1NPDA 3SM9A 1W1UA 2JLUA 3AR6A 2CFCA 2GN2A 3A1WA 4IVRA 2J1LA 1K08A 4D46A 4F60A 2FG6C 3CURA 1DCFA 3W0LB 1OUMA 1Z4IA 4ZYWA 1V2HE 1VOTA 1G4AE 4A3SA 1KE2A 3MCWA 4Z1MD 3QEJA 4Y2RA 4TMWA 1K5HA 2GKGA 1NNI1 1S1MA 4L9WA 1D6NA 2J30A 3T7EA 4ZHSA 1SA0A 2Y0BA 3BWBA 4PC7A 1PEAA 1SU8A 3L0OA 3CLRC 1L8OA 1XWIA 3KCQA 1E2QA 3IHKA 1NUSA 4UDXX 4V3BA 1YV9A 2WABA 4M1MA 5A9SA 3BKXA 3NKFA 2OK8A 1Y82A 3M5WA 3KG2A 1FTWA 4YUZA 4PC2A 3OT1B 3ROFA 3KKNA 3N7TA 5GZ6A 3O8CA 4MTLA 5F21A 5TB5A 4DMHA 4N41A 4BQIA 1QP7A 5BN4A 5LXTB 2QBYB 1Y9AA 1IZ8A 2V5AA 4S1PA 3GDGA 4NZZA 4B35A 1GG5A 1N1MA 2GN9A 2AF3C 2I03A 2Z5LA 3HCCA 3NC1C 1ZRMA 3EIEA 2DMRA 5EERA 1SHZA 2YUTA 4N82A 1M6NA 2QDXA 5KQRA 3THWA 2ZS7A 5CJ2A 3ZYCA 1RVV1 4CU2A 1BGVA 2IHKA 4FOOA 5BV0A 1JH8A 4F5DA 2RC5A 2G82A 4H0NA 1QLJA 1X2EA 4R2KA 3G2NA 3QRWA 4KQWA 2YCLA 3TMYA 2H5JA 1ES9A 3NT5A 1JE0A 1YS6A 2B94A 2BUCA 4AQYB 2RGWA 3C2QA 3CE6A 3H3JA 4P4LA 3CQ9A 1B4DA 2XT6A 4LKRA 4ARAA 5L4LA 2OG1A 4WUTA 4BNUA 1JMKC 2IYQA 2JANA 2NUAA 3O73A 1QJCA 3OPYI 4TYPA 3NFYA 4KXFB 4JUCA 5IVHA 1J0EA 4BVJA 2G36A 2XIJA 4QYMA 1Y1SA 2YQ4A 2YASA 5FWAA 4YP5A 1TZBA 2ZM6B 1SRQA 3PQCA 1TTTA 3KR2A 3ZJTA 1Y7IA 2CUKA 3PCTA 1KI3A 4MV4A 3TZLA 2FX5A 5DOVA 7YASA 1FQKA 4IZIA 3UANA 1KO4A 1JU4A 3HB5X 3QMWA 1UL1X 2Q5QA 1BS2A 3D4LA 4R8SA 3MQ4A 1E0DA 3PD7A 5AR1A 2IX3A 2NO6A 3UGJA 1R5NA 1DHRA 2B9EA 1COZA 3KXLA 1QYIA 2KBEA 1W0CA 4HLCA 3V8BA 4PSAA 1OIWA 3JASB 2X8JB 5CT6A 4D3FA 1M66A 1RQ7A 5L3RA 4AMUA 4DRZA 1DKNA 2C9OA 3MRSA 2WAYA 3K09C 4IWYA 2OORA 3PIIA 5AOBA 1F5SA 4TQGA 2UYOA 3B2NA 3K5IA 3UK6A 1WTAA 2GESA 4ZEVA 3ID6C 3DYVA 1V8BA 3IESA 3ZBPA 1ZVJA 3O4GA 2FLKA 4NU5A 2W00A 3MCVA 4DA0A 2ZU6A 3ZHVA 1EVZA 1D2GA 3LA8A 4ZTUB 4JEHA 2EYQA 2OL4A 2XW6A 1ULSA 3IMCA 3B1JA 1Q11A 2YNMC 2Z3ZA 3LWDA 4I4IA 2JGRA 3SSMA 1NE2A 2Z09A 3V8NA 3NAQA 1KKLA 1Z5VA 2A92A 2NM0A 4HJRA 4PPGA 5REQB 2FK7A 3PF8A 1OI7A 3FWHA 3T3HA 4DQKA 4RQAA 1B6TA 4FR2A 4DMCA 2HTFA 1P60A 4D56A 5FOWA 5CITA 2YVAA 3HXQA 1RLTA 4MQMA 3G8CA 4NENB 5DHSA 3QFCA 1FZTA 1L5HA 3O82A 1K86A 3VPSA 1K6JA 4KQXA 4ZJPA 3C7KA 3TRJA 4OFBA 3NZEA 1SO8A 2PR2A 3HVIA 1X94A 4B82A 5CURA 4PX9A 2CXHA 4DC1A 4X1IB 3QEAZ 4RK5A 2GN4A 5AUPB 4BXOA 1L1QA 2G76A 2FOXA 4E70A 3H17A 1E96A 1KL7A 1YDGA 1DQSA 3FSGD 1L7NA 2ET6A 5I8WA 4JI1B 5E6UA 2JEYA 4WY5A 3WBKA 2C96A 5EZYA 4AJLA 3RUDA 1VTKA 2CHEA 1NW6A 1N5IA 3R5JA 2A33A 1DAKA 2UYQA 4Z8YA 3WIUA 1WUYA 2GD0A 2O8EB 2OHGA 1HDOA 4FYYA 4HL6A 2OUIA 4G65A 3VZRA 4HZGA 2WKPA 3P2YA 1SCNE 1JFRA 3PNOA 4NOJA 4E2WA 2XSZD 4ECEA 3U4AA 1XZBA 1KJZA 1P45A 3WV5A 1M75A 1B0UA 2P6NA 1JIKA 4JKIA 3MHPA 3R0IA 4OHRA 5JLAA 3GEEA 2OB1A 3A9SA 5A5GA 5F9FA 1W6UA 1JQAA 1XROA 4HMPA 4XIFA 1YF3A 1I5RA 4RHUA 2J3IA 2YW9A 4NVRA 1C9YA 2OO7A 2PUVA 4F91B 2WF9A 2JRCA 3P4XA 5ES3A 1WXFA 4H4EA 1FNSA 2PZEA 1SR8A 5EJ2A 3L8EA 2P2NA 4CG0A 1N1DA 2OLKA 3A1UA 2NTNA 2JIPA 1DI0A 3H65A 3WMFA 3H0CA 1P7ZA 2QZJA 1JG1A 2FPGB 2JJ1D 3WTCA 4ZPJA 2JCYA 4ZT5A 4YUAA 1TQDA 1K8QA 1T1GA 3V8EA 1DC7A 1NE7A 1FUEA 2F1RA 4B73A 1I3MA 1KK0A 5ALRA 5AVUA 4OUKX 3LBNA 2P62A 3UY4A 3PWTA 2IOFA 3ZWPA 3DB2A 4BNKA 1DJQA 3CYFA 3ESDA 3EZFA 1GTMA 2ZZNA 1E7QA 3ESCA 4RK7A 4WXPA 1T0HB 4Q19A 1YMVA 3EA4A 2GHTA 1KGDA 5IXYA 1KIAA 2F9MA 4GUAA 4BWFB 1NVXQ 3RS7A 1Q7EA 1N5OX 2BEUB 4P3XA 4CN9A 2TS1A 3QA9A 1AY0A 4MJLA 4DMUB 3IKMB 2I9KA 4HH0A 3I28A 3UQZA 2QT0A 3D7SA 3IEPA 4FMCF 3DE0X 4O4HB 3K71B 4Z4EA 3I5AA 4AYWA 2IXGA 3IPLA 1BOFA 1GJRA 2JIDA 2XCRB 1RAGA 4LQDA 4E2ZA 2EIXA 2GBFA 4IH1A 2C8LA 4XIYA 3TLBA 2XUKA 3UA3A 4D44A 5K6AC 2ZCJA 1FF9A 5EUBA 3C85A 4YLYA 1KYQA 3KO8A 3BFXA 4D99A 4XCXA 3K7EA 1DWUA 1ZD3A 2ZRLA 1U8FO 4KE8A 3N53A 2VDJA 1SBQA 2HHAA 4R1QA 4EFKA 4WH0A 4MGHA 4B75A 4FW8A 4CMCA 2EGGA 4LECA 2CHFA 1SEPA 2AR7A 3N07A 2BH9A 3NI2A 2JKYA 4Y1FA 4TS1A 2RGBA 2VXOA 3EEBA 3LIIA 2VNHA 4X8HA 3EJWA 2A7QA 4DHEA 1B3RA 2DFDA 4YAIA 1PS8A 1DIAA 4LZOA 4GHWA 5DYTA 4OHMA 5CLIA 4TS9A 1LTQA 1VKZA 3PL5A 3A9VA 4RD1A 5A6SB 4RIIA 3KUXA 2GCOB 4LV5B 5BSEA 4Z8XA 2QORA 3ZLUA 2BFCA 3B1WA 3L6EA 1PQPA 1RPAA 1JAXA 1SCAA 5IDQA 4U2KA 4UNRA 4RPGA 3RODA 3ZV3A 2IPAB 4YHBA 1E1DA 2FR1A 2QGZA 2G7MC 5JZOA 3R0VA 2EHDA 4ZEOA 3VNAA 1QKJA 3H2GA 3OX4A 4KACA 3GBPA 5EE5B 5KNDD 1XZIA 4FT4A 3HR4A 3GJ8A 2D1RA 3TLGA 3V7WA 2K7FA 1NYQA 1YK0A 2G71A 2V4UA 3ISVA 2OV3A 4MMZB 4BMNA 1X2BA 5KQMA 3NCTA 4IIHA 3QVTA 2HHJA 3AILA 3CEJA 1S3IA 4NNJA 5G1OA 2W58A 5DLPA 4EAQA 4PQEA 5EQFA 1QIJA 4P80A 3GDHA 3V8QA 1JL3A 4LEIA 4RD3A 4AY4A 4BLWA 4CKCB 3SC3A 1NTRA 2ESRA 3ZD9A 2JJQA 3E8SA 3DT8A 2XNCA 4C05A 3FYDA 2B8TA 3NGLA 1LLDA 4F6CA 3WMXA 1U1IA 2GUWA 1OGIA 1PVVA 4XM2A 5ED4A 4YMWA 5E2AA 4ON9A 3DZ8A 3OQ1A 3RHZA 2PBFA 1KHTA 5IDVA 4US1R 4AF7A 4EMBA 3E9MA 2P5TB 3E22A 2WYIA 1J49A 1GFWA 4AROA 1FFGA 3K0FB 2OXEA 3SC6A 4IOMA 1ST2A 1JLLB 4UHCA 1SUWA 3VV2A 2VWQA 1OHHA 1UP6A 2GCPA 3HDGA 3LBAA 3TLGB 4A6DA 2FF7A 4EA9A 4EPTA 3CUVA 4IH4A 3N3BC 1KIMA 3N0TA 1Y9DA 3PC4A 5GGYA 1U4NA 3CXUA 1V11B 2FRVA 4J1QA 5IDYA 2XF8A 4IDOA 1P61B 4LRSB 3BBLA 4RKFA 5D3MB 2B4QA 3UFXA 4ZZ3A 2WW8A 2PLFA 3DV0A 4DDKA 2HCJB 1Z0JA 3FZQA 4Q01A 1T9BA 1EHYA 1KOFA 1U02A 3WHIA 4MUIA 3LVRE 2Q45A 4LJYA 3G8YA 2YXLA 3NAZA 1G17A 2GPSA 2R86A 2R8ZA 4R1NA 4CF4A 3SF8A 4L75A 3RYCB 1X7DA 3ETEA 2H4YA 4EL5A 5AT1A 4CJXA 5AVQA 5BSGA 3H6KA 3WHPA 4EUEA 5AW1A 2V65A 3GH3A 2HQRA 3QYJA 4LNHA 4NDAA 4YRAA 1FQOA 1SHLA 3L7LA 1Z62A 3M3PA 4TTPA 1DFHA 1BVRA 5ESWA 1KY4A 4H3HB 5ILQA 1SQFA 3A4TA 3FWYA 1WCYA 2XUHA 1ZFNA 1PWHA 4AG6A 4MYSA 1EXDA 1YS4A 4M7RA 3MJEA 2ID7A 1U0GA 4IKEA 4B74A 5K0LA 2XWSA 3B5JA 1XHFA 4A2QA 4C0AC 2D2FA 1KJ8A 4GM0A 1QOPB 1JT2A 2EFGA 4UARA 5AP9A 1N2JA 4NBRA 3PIDA 5LM3A 1LBTA 2C2XA 3A70A 4EQZA 3MK31 5BWCA 5IP5A 1PGPA 1V25A 1TIBA 2A4MA 2AL7A 2WJGA 3DHYA 1MFPA 2AXPA 4O2AF 2OEPA 3VU9A 4D74A 4F7WA 2G9RA 1E7YA 1W1WA 3D1VA 4PFKA 2NPOA 3L3BA 3VVMA 4WZ6A 4BE7B 4QYWA 3RSSA 1Y98A 3KLPX 1NZFA 4BLQA 1IULA 3EK2A 3L07A 4LC0A 1E2GA 4NBUA 1JTVA 1QZZA 1VFPA 3KKOA 3WWPA 4XQ0A 3WYFA 1H6AA 1XK7A 4JYMA 4DJFC 5A3JA 3TIGA 3FGPA 1HG0A 2QW0X 4HDNA 2V03A 3LIPA 3W1VA 3ONVA 3PD1A 3IBCA 4H7FA 4Z9XA 4DLLA 1Y4DE 4E21A 3R24A 1M7BA 2HEIA 4EKDA 5CB8A 4AF8A 4ZMBA 2FFHA 1NXVA 2ZK7A 4S1OA 2IHTA 1AM4D 2NX2A 1P4GA 4X71A 2Q5FA 1WW2A 4P54A 3W5UA 2HM7A 4RW0A 3C7CB 1MOSA 4YRBA 4OOFA 1EGMB 3AP3A 2B99A 2VSXA 4N7JA 3A28A 4EGQA 5JY1A 4IIUA 1LJUA 3FHCB 5EJ4A 1RQ2A 1DAHA 3WNBA 1WB5A 3VPFA 1SXJC 3ZE7A 3K6RA 5C5DA 5KHOC 2B2CA 1Z39A 5EUCA 3UQYS 1T0PA 1OZ0A 3EGOA 3K1AA 3H5NA 1I36A 3DP9A 3CEMA 5HCNA 4PAOA 4TGLA 1BVHA 4X62B 4EFLA 1HEIA 1UZNA 2FETA 1NR7A 3ACCA 3WNZA 2QYHA 3AOEA 2D1QA 4EG4A 1OBHA 3WNDA 2VDVE 2XADA 3C43A 3ZDBA 4B47A 2P75A 5JNRA 5DBIA 1I2ZA 1YOVA 3I73A 5CYPA 1BXZA 2BUAA 2FZKA 2XB8A 2XUOA 4WCFC 5EP1A 1SB8A 6REQB 2ZAGA 2I4TA 1XJQA 3OEHA 2PO7A 3FCUB 4DIDA 2CY0A 3TFQA 2AD1A 2RAUA 4O33A 2HA2A 5FOXA 3RIEA 4ICIA 4QG3A 1XQVA 4XJVA 2H1LA 1XD2B 2D4HA 2PY6A 5IJAA 3CLTC 3EFOA 1C3OA 3U39A 3RS4A 3TE6A 1FA9A 4R5MA 1TC1A 2HF7A 5BYKA 3PYMA 4PTYA