3LA8A

The crystal structure of smu.1229 from streptococcus mutans ua159
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
268
structure length
247
Chain Sequence
SLLKKIYETRDFLTAKGVQKPEFGLILGSGLGELAEEIENALVLNYADIPNWGKLIYGELAGRKVLALQRFHYYEGSMELVTFPIRIMKALGCQGLIVTNAAGGIGFGPGTLMAISDHINLTGANPLMGNLDDFGFRFPDMSNAYTADYREVAHQVADKIGIKLDEGVYIGVSGPSYETPAEIRAFKTLGADAVGMSTVPEVIVAVHSGLKVLGISAITNYAAGFVAVTQQIKEDFKGLVKAILVEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of smu.1229 from Streptococcus mutans UA159
rcsb
source organism Streptococcus mutans
molecule tags Transferase
molecule keywords Putative purine nucleoside phosphorylase
total genus 73
structure length 247
sequence length 268
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2010-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3la8A00
1YR3A 3DP9A 3KU4A 4MARA 3OF3A 2P4SA 3DDOA 4LZWA 1Y1TA 4TXHA 2AC7A 1YBFA 5CYFA 1JDSA 4WKNA 2HWUA 3ENZA 1U1FA 1LX7A 1ODLA 1VHJA 3NM6B 3FOWA 3O6VA 4TTJA 3E9ZA 2XRFA 1RCTE 2BSXA 4WKPA 1A9RA 1YQQA 4QARA 1N3IA 1OTYA 2Q7OE 3T94A 1OU4A 1RXSA 4TTIA 4DABA 3FB1A 1JYSA 4YMLA 5F76A 1Z34A 5KB3A 1ODKA 1Z35A 1U1EA 1OVGA 3IEXA 1ZL2A 4QASA 4E1VA 3LBAA 1M73E 3K8OE 3INYA 4F3CA 1T8YA 4OGLA 1PR0A 4DA0A 3P0EA 1TGVA 1ULBA 2B94A 4EB8A 3GB9A 4JOSA 3BGSA 1Z39A 3DPSA 5CCDA 5EFOA 1JDUA 3KVYA 4TXNA 5IFKA 1I80A 1LV8A 5CYGA 4DARA 5F7OA 1TCVA 4R2WA 1OV6A 1A9SA 3OZBA 1XE3A 1PK9A 4LNAA 4H1TA 5EUBA 2QTGA 4I2VA 5C80A 3EUFA 3ONVA 1A9QA 3KHSA 4YO8A 5ETJA 4F1WA 4YNBA 2AI1A 1C3XA 4U2KA 4MCIA 1WTAA 3P0FA 4LKRA 4DAOA 1Z38A 4JP5A 5B7GA 1V41E 2I4TA 3MMSA 4QEZA 4RJ2A 4ECEA 4QFBA 3U40A 1CB0A 2ON6A 1T8RA 1Z5OA 3BL6A 1Z5PA 2HSWA 1Z33A 2A8YA 1K27A 1TCUA 4OJTA 5B7PA 3O4VA 2H8GA 4WKCA 5CXQA 1JPVA 4D8VA 5FAKA 3PNSA 1U1CA 5EPUA 4F3KA 3UAXA 4YJKA 4L6IA 2OC4A 4TTAA 1V3QE 1ECPA 4NSNA 1RXUA 1JDTA 4R2XA 1VHWA 5JPCA 1JDZA 2HN9A 1RXYA 4G89A 3ODGA 1PR6A 1YRYE 1K3FA 4D8XA 2A0WA 1A9TA 4TXLA 3KUKA 5F7ZA 1NC3A 1PR4A 3SCZA 4OEHA 2ISCA 1PKEA 1LVUA 1Y6RA 3OPVA 3UAVA 4KN5A 3KVVA 3FAZA 1TGYA 1OUMA 1G2OA 4L5YA 3OZEA 4D8YA 4OGKA 1V4NA 3PHCA 3FWPA 3OOHA 4JWTA 4DAEA 4BMZA 2PGAA 3F8WA 4L5AA 1VFNA 3EUEA 5F78A 2QDKA 2QTTA 1PK7A 4WKOA 1RYZA 1ZOSA 3D1VA 1T8WA 3E0QA 2OC9A 4LNHA 3PHBE 3OCCA 1Y1SA 5F7JA 1B8NA 4M3NA 4OY3A 1PWYE 1ODJA 1PR5A 4M7WA 1PF7E 1SQ6A 4TS3A 4GMHA 4TXJA 3UT6A 1ODIA 1U1GA 1Y6QA 3OZDA 4R31A 4L5CA 3UAZA 4L0MA 1NW4A 2AI2A 2AI3A 1RR6A 3K8QA 3PNPA 1A69A 1PW7A 4UC0A 1JDVA 3TL6A 4DA8A 4F2PA 1V48A 4GKAA 1CG6A 5K1ZA 3OOEA 4GLJA 1ULAA 2A0XA 3EMVA 5F7XA 1NC1A 4PR3A 1B8OA 4TYMA 1T8SA 1Z37A 4LDNA 1Y1QA 2A0YA 4PNPA 1SD1A 4BMYA 3E9RA 1A9OA 1RT9A 2HRDA 4QATA 3EEIA 5DK6A 1T0UA 1OTXA 4BMXA 5CXSA 2GUWA 3BJEA 4DA6A 1RSZA 4M1EA 4TS9A 1Y1RA 3NM5A 1RXCA 5F77A 3FUCA 1Z5NA 4DA7A 4K6OA 4FFSA 5CCEA 2OXFA 1K9SA 5B7NA 4EARA 3LA8A 3C74A 3MB8A 1Z36A 4OF4A 1QE5A 3KVRA 1PR2A 4IP0A 1U1DA 4D9HA 3NBQA 1SD2A 1RFGE 3LGSA 1A9PA 1TD1A 4G41A 4TXMA 1FXUA 1VMKA 4P54A 5F73A 3IOMA 3UAYA 3DJFA 4NS1A 1YQUA 2I8AA 1Q1GA 3FNQA 4DANA 2RJ3A 1JP7A 5B7QA 3NM4A 1V45E 5IU6A 4F2WA 4MCHA 4GLFA 3BSFA 1SJ9A 2IQ5A 3DF9A 2QPLA 3OZCA 3UAWA 4X24A 2OECA 2QSUA 4QAQA 1V2HE 1PR1A 5I3CA 3GGSA 1JE1A 1JE0A 4BN0A 4D98A 4G8JA 4WKBA 1PBNA 4NY1A 3QPBA
chains in the Genus database with same CATH superfamily
4WASA 4E1BA 5HS6A 3N5CA 3KQLA 4XCQA 1H2ZA 1PQUA 2RB5A 3LT0A 1W1IA 2FMFA 3OFVA 4US2R 4RPKA 1Z4KA 4GKJB 3TSZA 1DGQA 4E5YA 4UTRA 3SSMA 4TTVA 2C4HA 3N6VA 4XXHA 1ILWA 4UM9B 3KUXA 2QXUA 2ZSEA 3D3WB 1M2VA 4ID3A 2WHQA 1QO9A 2Q3FA 2VKQA 3C45A 3HFJA 4AY3A 3HV0A 5J58A 1O77A 1RCUA 5JJ5A 1FA9A 4BIIA 4QSMA 1YH3A 4Z99A 3CWQA 5A03A 4RFLA 5DYGA 1OH7A 2WUVA 3BHIA 4BKMA 2IYYA 3L46A 2VPIA 4ETNA 3KO8A 1W0KD 1KMHB 3E9MA 1WB4A 2FDRA 4E70A 3AUYA 3K15A 1XHFA 5AKGA 1MW8X 3GPIA 3L07A 2GNPA 3NM6B 2LRHA 2W98A 4GL2A 1KMIY 1NE7A 2GBPA 3CWZA 3DOFA 4JL8A 3IRVA 1E3WA 1ABEA 4UBJA 5LXTF 1R9JA 1VCNA 2WICA 3GJYA 5DTQA 5KHAA 2RGEA 1JG1A 2XRFA 4HDRB 4GUDA 2G77B 2XNJA 3C24A 3C6MA 4OD0A 4AYXA 2XRYA 3PBKA 1RC1A 2AYZA 3UW1A 4J2OA 5T5QA 4GSKA 1QYCA 2JGNA 2YQ4A 3HKEB 5F5NA 5CA0A 1T4BA 2AQHA 2Z98A 2FQWA 3E9YA 4ZOLA 3Q0IA 2CXOA 2GUGA 4M7OA 5AIAA 2EDCA 1PV4A 4X91A 3RK4A 3WBFA 3TXAA 3NLLA 2EWVA 1QP7A 1U7ZA 2AWNA 3JWJA 4TQUS 4PCUA 1I0ZA 5JNTA 1ZCZA 2AS0A 8AT1A 4NX2A 2IBTA 1OX4A 4Q1FA 4ZYLA 2NU9A 1RM3A 4MVYA 1VSBA 2PM8A 4EYGA 4UHFA 1XQYA 3LYHA 5E3JA 1SUEA 3VBEA 1ZL2A 4FILA 4FXOA 1W49A 2WKWA 3W7AA 3P27A 2I4NA 4ZAXA 4CF7A 2B5VA 4ZCMA 5KINB 1DJLA 1MHPA 1KK0A 4Q1AA 4DEVA 3ZVNA 5D2CA 1KIMA 5EY5B 5A7GA 2ZLBA 1J0AA 3U1VA 1ZOPA 4S1PA 1CRPA 4D5GA 1L7EA 2OO5C 2JIZD 2C2KA 1V8PA 4HMPA 3UHJA 1R0YA 3PFHA 5AK0A 3FDZA 3TD2A 5AW5A 1ULBA 2IXAA 3GLKA 1L5LA 3R41A 1SIUA 3NYWA 5AOAA 3NHFA 2C29D 5CITA 5ESWA 2GJ8A 4P2GA 3DPSA 2G04A 1ACMA 3HTXA 4L5BA 5K03A 3FYUB 3BTVA 2EKBA 3VH2A 4BYMA 4ER7A 5DNAA 5EFOA 1J21A 4COKA 3M5CA 2HCRA 3AINA 4KAJA 4RX1A 3RC2A 3VXKA 1Y63A 5JUWA 2P4UA 4JBIA 1LNSA 2YN0A 4LQLA 1NQVA 3PB3A 4O4JF 5C0OE 4GR9A 5IYZA 3OCJA 2GR9A 1YZTA 3WYGA 3BRSA 1MXHA 3AIIA 3B6ZA 5HS4A 2ZT6A 1Q0LA 1A0OA 1SVNA 3ZLVA 2QSJA 3ICEA 3CMCO 4WGGA 1USGA 1W1WA 3REQA 3E7PA 3ZDFA 1E2MA 2ZIAA 2VYVD 4GOMD 5CNKA 5GAJA 1GLNA 3HB4X 4XM1A 1XZBA 2DKFA 1USIA 5IASA 1OFIA 3GT4A 3PRJA 2REOA 3CLRD 3R3HA 3DLCA 4IRUB 4V24A 4B5LA 4JYBA 4CMIA 4R40A 3CLKA 3FOAA 3N8IA 4KE9A 4KGVA 3OZBA 4YRJA 4AT1A 4YAGA 1PK9A 3JQGA 4WXPA 1G7CA 1VI5A 4H1UA 3WXMA 5HG0A 1XOIA 1JQAA 9LDTA 4Q1DA 2Y9MB 5EXSA 1DARA 1RCFA 4YCLA 4E0BA 4DLLA 3ONVA 4MVJH 4O3FA 4URFA 1F0PA 1ZN2A 2VDMB 3LXXA 3D7KA 3QPAA 5J4HA 3K09C 2WIDA 4BVBA 1FX1A 3FSRA 1XMIA 2AI1A 3JQ6A 4QOGA 4DZRA 1ILEA 1M2JA 4DV7B 3CHYA 3SM3A 3FHJA 1WPQA 2YXLA 4MUFA 1J25A 1ORWA 1VKJA 3BB1A 4KN8A 5B30A 2QORA 3L4SO 3HKBB 4BAUA 2B1JA 2XRMA 2V4MA 1KYXA 1WAMA 1ZEMA 4HXFB 3LT1A 2WJVA 5LDGA 4RJ2A 4A5OA 1ZUD1 4DIUA 1JAYA 4PO9A 2JIZA 3IALA 4BO8A 3JQQA 3TOSA 3A6GA 4PXAA 4HS4A 4Y2XA 2DPYA 5BMOA 3G9QA 1QDEA 4OOEA 3JQAB 1J8DA 2D0OB 4ZT3A 3SMQA 3VYTB 4CNQA 4JB0A 3DDWA 5A1TA 2HSWA 4OAPA 1IDOA 2GFQA 3KFVA 3NRBA 1D6NA 2VQDA 5BV1A 1GRQA 2QP4A 3L77A 2Q4TA 4UARA 3RIHA 1EUCA 1ONNA 1V8ZA 1O94A 1Z45A 1OHHD 2Z3WA 2BOVA 4RSHA 4W9NA 5KVCA 2H63A 4TYYA 3K05A 1GAQA 1H93A 2IYOA 5EZ5A 5AI8A 3E53A 3WZLA 2PLNA 4RGYA 3ND8A 3F6YA 3LXMA 1PLKA 3GLIA 4MB2A 4WIAA 5BR4A 4HUTA 1G5FA 1UBUS 2IDJA 3TR0A 4ES6A 1QYXA 2FX2A 4U2GA 4LQCA 4B09A 1I7QB 3OZXA 3KTAA 3VKHA 2AD1A 4S24A 4K9KA 5B6IA 2VNJA 6ADHA 3ZWWA 1K75A 2XUHA 4X7BA 2IDMA 1FTWA 2DWUA 6YASA 4RTSA 2AKEA 1J99A 3NHAA 4E5UA 4HF7A 2I34A 1ZRNA 2NPOA 1P1RA 2GZMA 3EPRA 4I3FA 4XTRA 5CBKA 5CFLA 2YMQA 4P93A 4FDUA 4RLHA 4GMXA 2XNCA 1F5NA 3NH6A 2DSNA 2FE1A 4RQUA 1UP6A 1IQ0A 1TKBA 2FXIA 3NATA 2ZIZA 4MDHA 3M4ZA 4HZIA 3GMTA 1VE3A 5K4GA 3HABA 4HNAB 1YB6A 1X39A 5KNLA 5BN3B 3HLKA 3AFNA 3DB2A 3GFOA 1K7XB 4D0GA 2JDID 1GZ7A 3ZJVA 1XTJA 5M34A 3HY3A 1E5XA 1U2GC 3MTDA 2NU9B 3CF6R 4GXNA 3ZG6A 4AFNA 4B3SB 2ONYA 1DPGA 2YZ7A 3A4NA 3M6XA 2GAAA 2PUGA 4FUTA 2Q5CA 1QF6A 2OAQ1 3M1IA 3HADA 2YJ5A 2C9ZA 1AHHA 1PZNA 2HHCA 4JLOA 5KVQA 3V42A 1YS1X 3EPHA 3WGGA 3N39C 5B4UA 2D2EA 4RORA 5MFPA 5BW4A 4UCFA 3RKSA 1JQKA 1S96A 4E2XA 1NF3A 4GMDA 1ONBA 3JQEA 1EK1A 1X7HA 3AOEA 4V1CB 5KTMA 4C4SA 3M9WA 5AJXA 2XF2A 5BYJA 4DIMA 1B41A 5C8XA 2HBRA 3S4YA 5K20A 3QLUA 3OOHA 3DCJA 1LRKA 4YCMA 3PQ4A 3DMTC 2GN9A 3WLPA 2Y93A 1WSDA 1ZONA 3K7EA 1CKEA 4N7BA 1F8FA 4IGEA 3VNVA 4P4SA 3AO0B 3X1ZA 4D6XA 4JQSA 1EFAA 2OL4A 4JWKA 4OQXA 2FEMA 1P91A 3AVWA 2V6FA 2H59A 5BR1A 4OU4A 3TLZA 2HMUA 4IH1A 2Q9CA 3THWA 5EHGA 3BE6A 4ZVOA 1QB8A 2PD6A 1GFZA 1VDMA 4MP8A 1IE3A 2Y67A 1K86A 4QO7A 4X54A 5DMHA 2CD7A 3IR5A 3F67A 4OX9B 1U3FA 2HA7A 2WYVA 3VSDA 3ND5A 3ZY4A 1IB6A 3AEUA 3ZE0B 4EG6A 3EFOA 3SBXA 1COWD 3KAJA 3AKDA 3D54D 1KC1A 4N12A 2HTFA 5KREA 4X65B 1JLLB 3QVGA 1S9DA 4KWCA 3E0QA 1YB2A 2AFRA 3G2IA 4DNQA 3ZGYA 1ECJA 4Z4FA 4R54A 2G9NA 5A9SA 4ZHQF 4JT4A 2GTPA 5ALXA 4PANA 3L0OA 5BSFA 1I1OA 4ZO9A 3WMGA 5F5LA 4D0SA 2ONJA 1UBTS 4A2QA 2R97A 1GQRA 2EEZA 1Z83A 4U0JA 5HXAA 2CHFA 1N5RA 2XBUA 4X8MA 1UP4A 3F7MA 3OZGA 5LQJA 4F97A 1QKJA 3N07A 1ODJA 2X6RA 2JNWA 1GAWA 1MIOA 3B48A 1VKHA 2D2IA 3DTVD 1JSLA 5IAAA 4X62B 1X1RA 2F90A 3UT6A 2JCGA 5AKZA 5C31A 1NBIA 4J16C 4CMEA 1PT8A 4Q4HB 2BBTA 3UMRA 5F2NA 4JJEA 1PL6A 5DHFA 4UHJA 7REQB 2PYZA 1V5EA 2HGZA 2XUFA 3CJRA 2QNIA 4OXQA 2C61A 1DMSA 2FSSA 2P2LA 2VJLA 4IJ5A 4RHTA 4D81A 3K2BA 4Q3EA 3NV7A 1BJKA 4EBFA 3L4EA 1X2BA 2AD5A 1HYEA 3JD3A 3VTFA 4K9DA 3LQ2A 2D2FA 3TTYA 3FPCA 3CRQA 4MW2A 2ARKA 2GN0A 4OUDB 1D1TA 2DCUA 4BJ5A 4DMRA 1I51A 3LUPA 4K86A 2WINI 4A1FA 2COKA 3FTQA 2ZS9A 3MAAC 5ALUA 3M3HA 1BHJA 3URMA 3WRWA 1PT7A 3DKPA 3I4LA 3FPFA 3PHJA 3KDAA 1JWBB 2Q0SA 1E9RA 2IFTA 2NVUA 3N76A 3FSGA 4KAFA 5F7XA 3HJTA 1QGED 1VYHA 1YMQA 3AHGA 4JLAA 5EA2A 4BDSA 1EK2A 5KAMA 2OKCA 4OTZA 5G1OA 1FP1D 2PCJA 1GPMA 3JQBA 4LS3A 3FNGA 3KKOA 4J0IA 3SKXA 1OXMA 2XDQA 2I67A 3BD7A 4GICA 4PNPA 3TQHA 1Z7YA 4C6RA 3QVGB 4ZAGA 2VWPA 3TFQA 4W8OA 4X5OA 2HBYA 1DKLA 3Q9NA 4MR8B 1KTIA 4BMYA 4PBSA 4QJBA 2NG1A 2X2FA 4BFSA 5H4HA 1MVLA 4MDYA 4R1OA 4TVBA 4CEIA 2JHGA 1QF7A 2XVXA 4LF8B 2PGDA 1M2EA 2R1TB 3F96A 4JFAA 2FX3A 4G9EA 1OFGA 4L3OA 4Y2TA 1A5TA 4O4IB 4WNYA 1RDFA 2P7IA 2RHHA 2LCFA 3A31A 5HZHA 2FPXA 4DG5A 3TOCA 1RZRD 4E5NA 1CR1A 2R8RA 3MF4A 3NW9A 5I4KA 2IEGA 5EQTA 4DA7A 1CCWA 2XUOA 2JFWA 3F74A 5ICGA 1WMDA 3RRMA 3FXAA 2DR0A 5CCEA 3G2PA 5FX2A 5HJ7A 2ZSJA 4H1VA 1ICEA 4LOAA 3ILSA 2C57A 4NCNA 4MA0A 4ZOEA 1E2NA 5IC4A 3LCRA 3ESRA 4EARA 2IZ1A 3RUIA 3UB3A 2EARA 3PDCA 1HYHA 5J2TA 1EWKA 1Z75A 2J6IA 2WJPA 3FYTA 3HDVA 3LVBA 4BE4A 5E3HA 4EA6A 1QE5A 1K06A 1E18A 2G5TA 3QLVA 2GZAA 2J3MA 4UDYX 5IXJA 1JN0A 4MJ3A 3TKAA 1M5RA 3OA2A 4BGEA 3EBPA 1W5TA 3LTNC 2OG2A 3P1JA 4QXOA 1IPHA 3HM2A 3E3OA 4JVLA 1L9KA 2QX4A 5HCIA 3ROTA 1F2DA 1G0OA 1MX9A 1NI4A 3NDIA 3O1HB 3ROFA 2VIIA 2Q46A 5JZSA 3AGQA 3ZVMA 4XIIA 4JXKA 2ZYIA 3EQ9A 1SFRA 2ZITA 3F1KA 4H9GA 4JLBA 3UAYA 2CBXA 2ZWIA 5LQDA 2QG4A 3HEBA 4O33A 3BC1A 3TXXA 5KKCA 1R88A 3ETJA 5DM0A 1FCJA 1Q1GA 4UNIA 4YGXB 2IIBA 1X7DA 3F6CA 2G1PA 3CZQA 1JP7A 4XUCA 2OWEA 2AQKA 5JAMA 3ETHA 3P9KA 4WCDA 4PG6A 3V7NA 2H2WA 1XO1A 3EIEA 5FPYA 3BWBA 3QI2A 1FS4A 4IIEA 4WT7A 1GQSA 4X8OA 3VJKA 2Q5QA 1XZMA 1EGMB 1L5QA 1WR8A 2XCOA 3Q72A 1N32B 1VSVA 3AI7A 2E7ZA 2X4LA 4V0LA 1QHHA 1JZQA 1OPXA 2QPLA 3F6RA 4MR8A 1FMTA 1VLMA 3L0BA 1YGPA 4JLDA 3BFVA 2MJLA 3PF8A 4U02A 5B3JC 2G1AA 4LJKA 1P7VA 4ZT5A 4CMBA 3BQNB 2YW2A 1ZM9A 4NAUA 1WXIA 1RXEA 2YHIB 2B4QA 2F48A 3IUEA 1PR1A 1UOPA 3QLTA 3R23A 4M1OA 4XIFA 1V95A 2HNBA 2J9GA 3N28A 3PEEA 3TZCA 3U16A 1EUDB 3GEEA 4C7XA 2PWBA 2OPHA 5AW8A 5DYWA 1T29A 2DX7A 1XRRA 3DEKA 2N3ZA 4D98A 4F4DA 4Y6PA 4JIGA 1U4SA 4OSEA 4MA5A 5FTLA 5EZYA 4M89A 2XE6A 2VTKA 4GD3Q 4CF6A 3WL5A 4QUJA 4J9VA 3A1VA 2Q1WA 1TJ4A 3E8SA 3JQ9A 4OSPA 4EJSC 2EIXA 4C04A 1RTKA 4PVCA 2ILVA 2W6JD 2ZJYA 3A3KA 5FBWB 2HM7A 1KSFX 1ZNWA 1JT9A 2BR4A 5HCUA 5JJLA 2JJ2D 4XRRA 4MVJG 5T8KC 1CR6A 4KL8S 1JQ5A 1JFRA 4UKDA 3U80A 4F92B 1GAXA 1IWPB 4HAUA 2G6TA 2NZ2A 5J9FA 3TQSA 5M2QA 3AEQA 3K1JA 4TN5A 3KQWA 2X0RA 4IMIB 3RYHA 4YAOA 3W34A 4MWTA 5BY2A 3G9ZA 2Z09A 1MZVA 2OBNA 3ID6C 2EP8A 4TWAA 1T0BA 4OMUA 4UNSA 3LCUA 5DT2A 3EG9A 3IAS1 5GP1A 2ZIVB 3EXFB 1NUTA 1U1FA 3GFQA 3IEUA 5EXEA 3EXHA 3M6LA 3WB2A 1TAUA 4NZYA 1CD5A 1NY5A 2FFHA 2PMFA 2VHZA 1C3OA 1A8UA 2LVBA 4N47A 4A2CA 4A8JC 4U00A 2H92A 4O1MA 3FZQA 4UUMA 1T2FA 4HQ0A 3S2YA 2ZQ5A 2XT9A 4OLFA 5ENDA 4CI0B 5IXYA 5JV5A 2WVGA 4IXMA 3WOVA 5CDGA 2XECA 1XN4A 4BX8A 3U09A 2JZOA 1WNTA 2P40A 4FQ7A 5AM1A 4BQSA 2XCLA 5CTAA 2PSSA 3DZBA 1XLWA 4UBOA 4BFVA 3CRMA 1YIDA 4EKIA 2HSGA 2OKGA 5CDSA 1DX4A 1OWLA 4FNMA 2ZJ1A 5F12A 5AQEA 2Q5LA 1JTEA 3UJBA 3WSVA 5J43A 4BX2A 4LECA 1XXHE 1OZFA 2VUUA 1ZHOA 3T7JA 4JA2A 4TTIA 1HMYA 3E58A 4X44A 4FD3A 4B85A 1X1TA 2NO4A 2QX6A 3BHNA 3HJNA 4OA5A 1F4PA 2W6ID 3ZE6A 3F4KA 5DLYA 3VSCA 3C6QA 2QZ9A 3HA5A 3BF7A 3VPGA 3OZFA 1MH9A 1K0UA 3DZFA 3QPVA 4XW2A 4Z9XA 3GFBA 2BGKA 4HTFB 3QP9A 1LDNA 3VX4A 1KOLA 3HDTA 4RH0A 2M1ZA 4JMLA 3NWOA 1FFDA 3HU1A 4CNBA 3DPUA 4QYMA 4ID9A 3OFKA 2GVNA 4O1IA 3L9WA 2CSUA 2FWJA 1UJ2A 3MC1A 3DO8A 4NNJA 4Q3CA 3HB5X 2HT1A 4REQA 3BH6A 4M0FA 2CDCA 5ALTA 2OP1A 5JS2A 4C9BA 2ZXEA 1C9JA 4UEJA 3S8YA 3QIVA 3QU7A 4QRHA 3TB6A 3GAAA 1W8DA 2AMJA 4K9SA 3UMYA 3QFCA 3IRUA 4IZHA 4G0UA 1VSUA 2CC2A 3D8HA 1QGYA 1SNYA 1MA3A 2ZYVX 4XIYA 3ICWA 4MWCA 1I1QB 1A82A 4LFAB 1AK1A 2A4MA 1FDOA 4M1ZA 3OO0A 2G9UA 3KT6A 3RAJA 1AV7A 1R3DA 3D3KA 4DLPA 2RGUA 5P21A 4DLWA 3QK7A 1FLDA 1XMVA 4MWOA 4XR9A 1ZN7A 1WVMA 1CR4A 2FVXA 3SY8A 1CR0A 1U7XA 1C80A 2JJ8A 3H11A 3L1VA 2CNBA 4ER3A 4PN3A 4IDDA 1ZD2P 1J20A 3PD7A 1UBFA 1R0XA 4DYVA 1P2SA 1ORVA 3OLWA 2HPHA 1OAOA 2VR1A 3A3PA 4HQOA 1SH7A 3AU8A 4TUYF 3UK0A 4LJRA 3NAQA 2AF4C 4TLDA 3AYXB 1R6AA 3OQJA 1JG7A 1PX0A 3AM4A 1NM5A 5D6NA 4N39A 4E2FA 1X13A 4DARA 4MYRA 3W05A 4MUKA 1DBQA 1EH5A 5A4KA 5K3FA 4DCOA 1TCVA 4JVNA 2BMFA 1ARZA 1YCGA 4HDCA 5DBHX 4DWJA 2BGRA 3S81A 4X97A 4IS3A 5HUQA 1H2AS 3I1IA 3G8AA 4ZQHA 3SOPA 1VHTA 2PUBA 3TUIC 2MT9A 1YE3A 2NU6B 3LA6A 1SVOA 3QRWA 1FP4B 2XDWA 1LU9A 2QTGA 1E7WA 1U4NA 1Q0PA 1ESZA 1T4GA 1W4BA 4YR9A 5L3SB 2GAFA 4WLFA 2JFPA 4OHVA 1SOMA 2POCA 4OI0A 4S35A 4RHCA 4RPJA 4GYJA 3K6KA 3VUEA 3EUFA 1CUCA 3NAGA 4JI2B 3LOQA 4QOFA 1SEVA 2GETA 3BGWA 3PQ6A 1YO6A 3PQFA 1P2UA 5C8VA 1X87A 2J0VA 2VSFA 3EEFA 4S12A 5BV7A 1FYEA 2IHBA 3ZW7A 5AD1A 4ZYVA 4XCVA 3MQ2A 2HV9A 4U7DA 4C2AA 4H2DA 4CUZA 2CXRA 1S6YA 2QRQA 4BRSA 1WTAA 3KSZO 3SR0A 4CUJA 3DBLA 3LWBA 2SHKA 4JLWA 4OCZA 2WLTA 4N3CA 4ZRNA 5EIBC 3HCFA 1JLMA 5K51A 3CH5A 5JROA 3MAJA 4RELA 4DL9A 3IHKA 4L9AA 5B7GA 2RD2A 4ARZB 1SURA 4FMCB 2ZEJA 3ANNA 5FLYA 4R2LA 2B83A 3R1IA 4KSYA 5A6SB 3B5IA 5ITVA 2DG2A 1BFKA 2PKQO 3QVJA 4KOEC 3KJQA 4EOGA 1SCBA 3MTQA 1P4RA 1YQXA 1T8RA 3BL6A 3C6YA 4NTZA 1TKRA 2VSQA 3G9TA 1DO0A 3L0ZA 1HL3A 5DCUA 1Y8ZA 3GARA 3ZU4A 5DP1A 3EEOA 2JLVA 3A37A 3CUSA 2YVKA 2II6A 5I51A 1JYFA 1W85A 3ANXA 4KR7A 2BPOA 4OHBA 2A5JA 4Z7QB 5JFGA 3LXUX 1B7GO 1J24A 1SBIA 1XEWY 2EFHB 2I1LA 3H86A 3K4PA 1OC2A 2XB6A 2FN4A 4G67A 4JASB 1DX9A 5AM3A 1NVEA 5JJCA 4ATNA 4UHHA 1FMFA 2OB2A 2R5FA 1JMKC 1BWRA 4Y2PA 1E2UA 2JA2A 3DZ8A 4E7OA 1M1NA 1XTSA 2F1RA 3RGGA 4AG3A 5LNK6 1NLFA 2SKCA 1NKVA 1MEEA 3P5SA 2SBTA 2WZQA 1CP2A 4R84A 1KFCB 2C8LA 4G0XA 2Z8XA 1Q0QA 2XB8A 1YQDA 4O02B 5A4DA 2RHWA 2HTEA 5D3MA 4JBXA 3ZCQA 3O8LA 3R5XA 3TW8B 3BIXA 2O5VA 1WPXA 4HOYA 3FMPB 1NF2A 5I9MA 3M9XA 5SY4A 4DIBA 3NIBA 2C4UA 2ORWA 1D0VA 2Y3IA 2R7LA 1X42A 3A36A 3K9LA 2E4YA 4J6FA 4H4DA 4HH3C 4MUIA 3FLEA 3RRBA 2CMKA 2CE7A 1BEUB 1BX0A 1GSAA 2ZRQA 3UV6A 1WEKA 3C3DA 1PTJC 5JATA 1PHRA 2DFLA 3OX2A 4XB2A 1YRBA 5ECGC 2X8WA 4CTJA 1Q1AA 3DEIA 3KUKA 4JENA 5K8JB 2FZ5A 2NZUG 3BMOA 3F7NA 5BRNA 4D4JA 1LDMA 3OHSX 1T36A 2WWRA 5JFTA 3VO8A 3DC7A 1CRWG 1D04A 1DOZA 3DR3A 1FF9A 1JIQA 3DNMA 3ND6A 4YH1A 1W19A 5F4ZA 3PPIA 1KP3A 3D4IA 5FNVB 1DLIA 1E2PA 2QL9A 1D6SA 2YWEA 1I7LA 3HNRA 1KH1A 4Q3KA 4CTOA 2YY7A 4HD8A 4DM4A 3NT5A 3OE1A 4LZZA 1O08A 3PI6A 2J8ZA 2Y0BA 1AGXA 3GFVA 1PCXA 1GITA 5TV2A 4DSZA 4NYMQ 3CO5A 1Z07A 1V4NA 4CFSA 5SYAA 1EVLA 4FDVA 2FPSA 3H6KA 2ZRPA 4E09A 3S3TA 1XJCA 3ZWCA 2MSEB 4POOA 1IWOA 4O0LA 2XKJE 1YZUA 2ID7A 3WY9A 3OQOA 4L5AA 1KQ3A 2ZE7A 3TNYA 2HMYB 3CM0A 2IDZA 2R44A 3O92A 5M29A 3Q7RA 3U7HB 2BFOA 4IJWA 4PGAA 1EQAA 3D02A 3PU6A 3GP8A 2Q9AA 1IN6A 3KCQA 5KYWA 4IZ6A 3KS9A 3A1WA 1UPFA 2XCSB 3OEHA 2FN8A 4JYMA 2ZJ2A 4JLJA 2X0KA 4X84A 2CEKA 5I7WA 4XDHA 2R11A 4F9TA 3UMBA 2Z6VA 4HGQA 3FMFA 1G2PA 1GRNA 3ZZNA 3HJGA 2WFLB 1MGPA 1LPBB 1UXJA 1LBSA 2F7SA 2AUMA 2ZSKA 3I45A 4RPIA 4XUEA 1MORA 1WSAA 3ZTYA 4RJLA 3DOIA 3GEBA 5EIWA 1E64A 3BJRA 4RPHA 3U7RA 4CT0A 3H1FA 1Z0AA 5JS8A 3JAWB 1LQTA 1JEYA 2AJCA 3A1CA 1PNTA 1YAJA 4IIBA 4QJ3A 1XDDA 2O0JA 2HO5A 1XHLA 2X0DA 2YWXA 1QNFA 3CPSA 1KI7A 3CW2A 3FSGD 3GG9A 4V0QA 4BP8A 4E4RA 5HNKA 3GUYA 1SQ6A 2VZ8A 1MQSA 3LF1A 2G71A 1G7RA 3NU1A 4OP2A 1I33A 2C58A 4Y2HA 4KXUA 5THKA 1QHFA 2A94A 2H4YA 2I7TA 2R79A 4I1VA 4UVHA 1U8AA 4FFBA 3IBGA 4L50A 3TCKA 3G8YA 3A4MA 4BECA 5LMUB 1FZTA 3DBLB 3P9RA 1PJ3A 3AP1A 3IV9A 4L8WB 2YR0A 5FV7A 2I2BA 3GLHB 3DZCA 3I64A 4LBZA 2V45A 1LBIA 2ZSFA 2XZLA 3BULA 4O4LA 3RV3A 1F0YA 2B36A 3IIMA 3IUQA 4RD0A 2FKAA 2QLMA 1D07A 5JE8A 3G1WA 1HT0A 3PL5A 3IVGA 2JA1A 2QQ5A 1F6BA 4G1EB 2ZR9A 4WLUA 3M33A 1QHIA 1QQTA 1GO2A 3LXRA 4K3UA 2GAIA 3A2KA 1KRWA 3K31A 3FTEA 2OXTA 5A1JA 5F9HA 1UMCB 4FSDA 1BW9A 4ALMA 2O19A 2R6R1 4OYLA 1V48A 3NFRA 4A03A 5AI6A 1QV7A 4EW1A 3IEIA 4P7KA 3QXJA 4WCVA 5BPFA 1DKOA 1W4CA 3DEHA 1VPDA 5GTDA 2P3SA 3D5TA 3AB7A 3EWAA 4L02A 4HWRA 3WK7A 2NPFA 3EXG1 1ND6A 5GZ1A 1YZLA 4LNUA 5H83A 1P3JA 3TX6A 4CU2A 2C5BA 3DOCA 1AB6A 5AM2A 2ECPA 4OB7A 1XTBA 4HPJB 3TAUA 3ZZMA 2Z9CA 1TJNA 5JZOA 1Y3IA 3TN7A 5TQ2B 4C0SA 4COOA 5LNK1 1AZWA 2RKBA 1Z37A 2J6HA 4PGGA 4MS1B 4KJZA 2NU8A 2FUKA 2Z58A 3UKOA 3BDAA 1XLVA 3DH0A 2WFMA 2A5LA 3H05A 5AK3A 4B79A 1WP9A 4X93A 1MQAA 3AESA 2WDZA 3FCEA 4J75A 5CHEA 3V1LA 2GTHA 2C5LA 2P5UA 3KJXA 4JX9A 3GJSA 4B45A 4NCBA 3EEIA 3MJHA 4PRKA 1AKTA 2V0NA 1QIGA 4RV9A 1EDOA 1I6WA 2IP2A 2ABWA 2PJDA 2ZRCA 3CRRA 4ZQFA 2R48A 3MJCA 3QOFA 3RS9A 4B6JA 4QICA 1YTUA 1RZUA 2Z0MA 4LJ5A 2JVKA 2O2XA 4PLGA 1ZI9A 1Z7EA 3PF9A 3IA7A 4AMBA 2DCMA 1PV2A 4OQPA 1F3OA 1K3UB 4NQRA 4RLFA 3X2SA 2O6LA 1YZKA 2XYVA 1P7YA 4EFLA 3T8YA 4Y2JA 2FOXA 4QUIA 4TLBA 4UE6A 3LHKA 2HA3A 5CGZA 3TTSA 4UDXX 3MJTA 4YT2A 1KJ9A 5IDVA 1XB2A 2C98A 1SXIA 2HDNB 3RODA 1N57A 1L5YA 4BB9A 1QS0B 3I72A 4LRUA 3PUJA 1QYVA 3G0GA 3ERCA 1POXA 2I2DA 2ZP1A 4FDAA 4MV4A 3VM6A 4CMAA 4Z49A 2V8BA 3MMXA 2PKRA 2YVAA 4MUAA 2Z9DA 5C8ZA 4ZCPA 3PQ8A 2V6IA 3U31A 2Q1XA 3DC2A 2AZXA 4FHCA 1D2AA 1MX3A 4M9RA 2OILA 3IAM6 1C9YA 5CB4B 3D5QA 4LJ6A 1U1DA 3A4LA 3Q5EA 1OYWA 4ARUA 4D6PA 4PN7A 1YGYA 3PDUA 3PFWO 4JZKA 4FX5A 5FFFA 3LKDA 3U3KA 1SIOA 2YBDA 2HXYA 3ON5A 5F2OA 1UAGA 1DLJA 3IYLW 2O9JA 4B0PA 3IAFA 4PZUA 2P9ZA 1EUZA 1AKUA 4TXMA 1Z0SA 2R00A 2JCYA 5KX5A 2BD0A 2NO1A 1XCPA 3WKBA 2X9QA 3TLCA 5KOYA 1HFJA 4L6CA 1U0HC 2P65A 3GI1A 5LIRA 4QU0A 4YRKA 1JHYA 4HQKA 3H2GA 5KWSA 4DV0B 4P5PA 4HVTA 3CJQA 1MCZA 5AK5A 5JSFA 4FYMA 3TLAA 1NRJB 2CHUA 4GGMX 4RGVA 4C5AA 3WNQA 3U4CA 2AFHE 4QBTA 5KNBH 4LYAA 4JEMA 3UVEA 2KS6A 3BN3A 4UAUA 5EOVA 4CCSA 4YHHB 3KZMA 3P52A 2I2CA 1GIAA 4LNUB 5JSKA 3RYCB 5CBPB 2UXBB 2KHZA 1C1XA 1HLDA 3SD7A 4X24A 4RZXA 4NMWA 4UFOA 4D3DA 2A59A 4ZZ1A 1E2JA 5FIUA 4BLPA 2RHCA 3F2IA 4IY1A 2NZWA 5EE0A 5EKXA 4WUTA 4PO1A 4OOFA 4WZBB 3ANSA 3ANTA 5IARA 3WICA 4CMCA 1FJGB 4DC1A 3FG9A 1QIJA 2EBWA 2FEXA 5EP1A 1QC5B 3ROZA 1AIPA 2QU7A 2H29A 3G8DA 4AKSA 1RP7A 2F00A 1CE8B 2PGXA 3H2SA 3RVPA 5JZBA 4R4JA 5AXDA 3PD1A 4LDZA 1X8JA 3VOAA 1EG7A 1NWHA 1TLFA 1K5HA 3A1UA 3EVNA 3GT3A 3GYGA 3PR2B 1C1DA 4WKBA 5BNIA 1NIJA 1WDKA 3D8UA 5EIOA 1XL0A 4NMXB 2GZ1A 2I65A 2O06A 1CF2O 1FUIA 3AL3A 4WSOA 4ZI5A 3ZD8A 1VBKA 3MHTA 1O8CA 3DOEA 1FFCA 1XV5A 2ZUWA 4IQ0A 3JAMA 4OLAA 3N5KA 1AXRA 5F1YA 4YREA 4NFYA 3V55A 1CY7A 4KNWA 5A4IS 5IYZF 1XKQA 4OMDA 3SS7X 1ONOA 3ZY5A 3PGA1 4Z53A 1AK9A 1F4VA 2WD8A 4DIEA 3T4EA 4IQ4A 4FYYA 1FZQA 3EULA 1ODCA 1P5RA 2WU0A 3B82A 2Z30A 4BUZA 1HRDA 4ZZ2A 1I7DA 3AF2A 1E0DA 4KWHA 4QXQA 2JFBA 5EZQA 4CIAA 3ZLTA 2Y77A 3VHXB 1X2EA 5HE8A 3UTCA 1VCMA 5CYFA 1EM8A 5CNIA 2WT4A 1FMJA 1KR2A 2O52A 4PSUA 3TZBA 2KYRA 4WKNA 1ZH6A 4JMPA 1AK2A 2BF7A 3B3JA 4FGUA 3T1QA 4I50B 3HU5A 3RAGA 5KTRA 3EE6A 1U90A 3OIYA 5GADl 4HB4A 2EF0A 3KXPA 1J0BA 3DYBA 3L0PA 3NEAA 4EY7A 3OD5A 1P17A 4MJ7A 4ZCTA 4AKGA 4M0DA 2YWHA 5K2MA 1WVGA 3VR2A 2HD4A 3PQ3A 7AT1A 4BPBA 3ICQB 3M81A 1Q6YA 1GZDA 1KZ1A 3AYZB 4WN9B 1KY5A 4CEJB 3NT4A 5CB0A 5JALA 4KR2A 4PFQA 1E5LA 2H31A 3RWOA 4EL5A 2Y4NA 5IJ9B 1NQAO 2XOKA 3HE3A 2XEXA 1FK8A 1Z68A 2CXTA 2ZPTX 3O5AA 5FQNA 4F4UA 2Y1XA 4ZEXA 1WSBA 2BSXA 3D6HA 1CUGA 1P3DA 2GERA 4TVSA 4X64B 2AKYA 1NTRA 4PCAA 4GYWA 1SCUB 4I19A 3E15A 1ABBA 5E9QA 5IKOA 5ECDA 3W5VA 5CLGA 4WBNB 3DNFA 1MJGA 3ECSA 5T41A 3V97A 1ES9A 1W93A 4GGPA 2O3UA 2ZJ6A 1T5SA 3D3WA 4RE6A 1Q0HA 3JPWA 5HKKD 1HRKA 4X0EA 4A73A 2QM3A 2O8EA 1JSRA 3HRHA 4OXRA 1UDWA 1Z0DA 1NASA 2RGCA 2G5PA 1HOXA 4L0CA 2ID4A 1SA0B 1WU8A 1OVGA 1T4CB 4P0TA 2QVLA 4GU5A 4NECA 1BMFA 2R60A 2AEMA 2G0NA 2ZI3A 4UBKA 2WWHA 5ALOA 3W9YA 2A92A 3WGQA 1JFFB 4DN6A 3UC5A 5K8TA 2ZTLA 3L3BA 1R6BX 2EEPA 2VP2A 1Q21A 2YXEA 1AQ6A 3A04A 4E1VA 3OQIB 3GJ6A 4MITA 7GPBA 1DWOA 2Y1GA 3OT5A 3INYA 3O84A 1FDRA 3PFGA 3THYA 1UDAA 4UPDA 1LWOA 2WHYA 4EY4A 3ZE1B 4ARBA 4ZXFA 4DPLA 2F4VB 1PR0A 1RMTA 3B1XA 4LDPA 3U3XA 1PS8A 1CY2A 2CVHA 4EY3A 1XD2A 2H11A 2BELA 4AK9A 2QRLA 5E8JA 1DFGA 1XJ5A 4Q1EA 4TWBA 4MCJA 1K4YA 3VUFA 2XDAA 2KW5A 4WD3A 2GBFA 1PQWA 3KYDA 3N3AC 1TCCA 2F1OA 2Z57A 4FNGA 3R7SA 5DX1A 2B8NA 1JEYB 5SICE 1LB1B 3OEEA 4URZR 1JHUA 3PQ5A 1YR8A 1S1CA 1CTQA 3H84A 3AEKA 3MMNA 4CLDA 3H83A 3NCTA 3D3NA 3SSAA 1JEQB 2A9RA 2JLBA 1OJ7A 3DGFC 2XCUA 1X70A 3HN7A 3OFSA 2QD3A 4FFNA 1XP8A 4YMSA 4L2IB 4BU1A 1MOPA 5IM4F 3WQHA 1XPRA 4IICA 1J42A 2GDJA 2FE4A 1E1RD 5AQ1A 1DADA 4PINA 1BHO1 1Q7GA 1COWA 2PRZA 1MQ8B 4AF8A 1ENPA 3HKEA 4HBGA 3VNBA 1VLJA 3EEYA 1NLMA 2OOSA 1W2WB 1UJ6A 1YR9A 4R2WA 1IAQA 1PNQA 2OLJA 1NR5A 2R751 2NNWB 2WHEA 3QPDA 4FFVA 1FNDA 3TR6A 5C7YA 5BOSB 1A9SA 1QE0A 1S1MA 5K6AC 1FXWF 1SBTA 3I9FA 3M5PA 4N0MA 2WUFA 4D3SA 1OR8A 5EWMA 2GJ4A 5C80A 2RGDA 3F78A 3G8CA 4M86A 1E2EA 3X44A 4MDEA 2AT1A 3CEJA 2G82A 2HRQA 2F59A 4RL6A 5K4HA 1GGMA 3KSAC 1GV1A 1M8PA 3WWEA 2AL7A 1PLJA 3OTGA 1T5OA 3L4BC 4P82A 4RHUA 4LZJA 2JH8A 2IY7A 4P3YA 3TBFA 1NJ2A 5HZGA 4U2KA 2JW5A 1PJQA 1F2VA 3OFNA 1VL0A 4B3CA 3B1WA 3STXA 2O8BB 3IAAA 1MO4A 1UXKA 3BK1A 3QE0A 1NRXA 4O2BA 1TM5E 1OWMA 3SR3A 4BB6A 1HNWB 3L6RA 5KI6A 3C3CA 3MTIA 1SUWA 2LUOA 1D1PA 2I03A 3PQ2A 4D25A 3HFGA 4UVEA 3HO1A 1G2IA 1YDWA 3H9QA 2QMQA 5D01A 3I62A 2OR3A 3FFAA 5IDXA 1BOOA 1UC4B 4M46A 1SIBE 2VEOA 2YX1A 2QUZA 2IWHA 2AW5A 3HYLA 3QHAA 1Z5PA 4AO8A 4E4YA 3DE0X 3TRHA 1GZ4A 2IYPA 4MPTA 5TLSA 2GHQA 5C8YF 2I7CA 3WB9A 5IBPA 1QG4A 2M32A 1E5QA 1FYVA 2W2PA 1T1JA 4MWDA 1W47A 5JNUA 2JAUA 2NO6A 1U3TA 3AEUB 1D4OA 1JPVA 2A1UA 3PXUA 1JLHA 3ENNA 3QNWA 3HUFA 4PX5A 1YOVA 1Y5LA 1YU6A 1KAQA 4RSMA 1CS4C 3DT8A 3B3QA 4L8GA 5EZSA 4FK8A 3TL3A 4AJHA 2UUBB 4LSMA 3RF7A 2AJDA 2WIKA 3DQPA 1U80A 1FMCA 4CETA 2QTFA 4MUYA 4L6IA 5KKNB 3HBLA 1P60A 2XTJA 3HDHA 4U9HS 2JVIA 3VYUB 1NKTA 1SUBA 2QQEA 4NSNA 5CFNA 4URUR 3HSYA 4ZFNA 1T9GR 1L7VC 2XA1A 3ZQJA 2AR9A 1GYQA 3GJXC 1GGJA 2KQUA 3F46A 1TKCA 2BY4A 4IJUA 3RU2A 1E5TA 4XQCA 4D9FA 1SUAA 4O63O 4FIDA 4Q18A 4QGFA 3L1KA 5FFMA 4O25A 1QK3A 3WIBA 1CNMA 4DS3A 4J2TA 1KGDA 5L6MB 4WEOA 3WI7A 1E3MA 1S2NA 1WW2A 3VH4A 3VYSB 3RVBA 3I2FA 3TRIA 1UFVA 3A27A 3QG1A 4DT1B 2HA0A 1TVKB 1XMJA 4K6FA 3GLIE 4BFXA 4EF4A 1NBMA 1GPNA 3M7IA 4G01B 3ND9A 4R8MA 2ZB3A 4P7BA 3HDQA 2V7QD 2G17A 2C0CA 2JEZA 2YJ6A 2X40A 1VRCA 1XAJA 1QYRA 1PWXA 1YB1A 2BDUA 2ZK7A 3QEKA 5K05A 3OQIA 1DFIA 3OURA 4MUJA 4YRQA 4PYQA 3L7JA 4HS9A 4FJ1A 1P7ZA 1XRNA 2ETXA 4M0EA 5GGXA 1FX0B 3FVWA 3O4GA 4RD2A 3C5HA 3NALA 4UVDA 4FLEA 3LECA 5C1DA 5D7NA 1YFJA 3IR7A 3GC6A 5K3OA 4IOJA 1GZ3A 1AS3A 4PLFA 2NV2B 3TD6A 2YWRA 5LVAA 2VNKA 1N5OX 1QUEA 2AMYA 2E6KA 2HAEA 2UYQA 3H9EO 3P9SA 3QYJA 4PG7A 5GOTA 4MMXB 3T1HB 2XHEA 1B00A 1GTL1 3O9VA 3MGAA 4XLTA 5ECYA 1W8IA 5ALLA 1J7KA 1WHSB 3EUEA 3UV3A 4A10A 4AJJA 4V0RA 5SYNA 3N8DA 4MKHA 4Q48A 1YJCA 1HF3A 4MZXA 5B5SA 1JX6A 2PE5A 3RYFA 1N0VC 2GVDC 4BOYA 5A2GA 3K0CA 4LWPA 4TLAA 1WUTA 4YROA 3O93A 5GJCA 4R3UC 1NXQA 2Q50A 4R1UA 1VB3A 3I2KA 4JT8A 5ALJA 3HDJA 1XF9A 3W6OA 3TSWA 1UK9A 3CLSD 3QVTA 4PW0A 5DN6A 1BQEA 3A4TA 5CW2A 1A4IA 3L0DA 2K4MA 2J9YB 2QVGA 3D6UA 4M9UA 4PLTA 4EIWA 4L74A 4J49A 4ND6A 2HMSA 3NP7A 1AKMA 1GU0A 1QOPB 4OGFA 1U3UA 1OGYA 4OHUA 3FYDA 5TVGA 4TV8F 3L7MA 5CM2Z 3VKFA 5KYYB 3FI9A 5U4QA 1O6ZA 4KYIB 1HDIA 4EUNA 2PMCA 2NSDA 3DZHA 1ZUIA 2X5JO 1EXWA 4ALIA 5CLIA 2P2GA 1JA9A 2WAXA 2C31A 1DEOA 5CVDA 4TS3A 2BTQA 3ZNNA 3UA4A 1R6UA 2ZRFA 3C5CA 1KKMA 1G9SA 3IKLA 3LAWA 1U81A 1ODIA 2JZCA 4IVQA 4IIDA 4KVGA 2AN3A 2BJWA 3O4HA 2TYSB 2G6BA 2VCEA 2XUKA 3JVEA 2QT9A 3PTZA 1JFFA 2L19A 4AJ1A 1M1YA 2BBWA 4JROA 5E1BA 3WA7A 4RULA 3QBEA 2P4QA 2BDEA 1SBNE 3MQFA 3SVZA 1B6SA 1EGAA 1VG9B 2Y1LA 3DW3X 2C2ZA 3UUWA 4DWOA 3CC8A 5AWFC 5KQSA 1EWTA 3GBPA 2D5IA 4HUJA 3JYLA 3LLVA 1TQ2A 2C9CA 4C7OB 4G0VA 5D3KA 4DV6B 3KYCB 2P0YA 3EZNA 1P2TA 2BEJA 3GJ8A 2DUUA 1U7DA 2XQVA 1OPRA 2PBRA 2WUWE 5IT5A 1T1GA 1PW7A 4UC0A 3RT1A 3RD5A 4AJ9A 5LXTA 2GBLC 1GUAA 3TL6A 5LA6F 1ZMTA 1TUIA 2Q3JA 1JH8A 1IEQA 1JIJA 2B25A 1M1XB 3IQFA 4O6VA 3GGJA 2QN9A 1OBVA 1ZCAA 2VDNB 4Y2YA 2WJAA 3G17A 4ZZ0A 2IUYA 3HCNA 4LQ4A 2CNLA 3G0CA 3IP7A 1XTZA 1FRFS 2LE0A 1SXJC 1LJLA 2RIPA 2W6PA 3DTYA 3QU4A 1PIWA 4HUQB 4Q4JA 5LCXA 5GPBA 3U5TA 2ZG6A 4BZXA 3BICA 2I87A 1C7JA 1TEZA 1B8OA 1SBHA 4UE3S 3JCZA 2AN1A 4QTTB 1OXTA 2FG5A 2RJNA 2IELA 3FNHA 4GVLA 4MRPA 4RKRA 4BWFB 1NL3A 5JZ9A 1CQJA 1E0KA 2OHFA 4YUZA 1CEQA 1Y1QA 2VJMB 3E61A 4K2HA 4DNPA 1KEVA 1U4OA 1UKBA 5J47A 1HLGA 4IIJA 4DGSA 2XBLA 1NFFA 3AJ9A 4GM4A 3GUHA 4R83A 1Q22A 2IL1A 3FGNA 1Z8FA 1MN6A 1SMKA 2E37A 2GBIA 1T0UA 2SNIE 4GZ3A 3WLFA 4F85A 1N6IA 5JFOA 1RADA 3W9UA 2RHJA 4WKGA 4OK5A 2AN5A 2G28A 3PJDA 1Q0RA 4U7HA 1RWQA 3DCIA 4D92A 5DW3A 2YUTA 3AKCA 5EQFA 2XW6A 3IV6A 1KJWA 5JO9A 1WMSA 1VYVA 4GLOA 4HNSA 3SQLA 3VZSA 1N6KA 1NBOA 2DQSA 3JU3A 4B75A 2B61A 3LZ6A 3RBXA 2WM2A 5IT9A 5A3RA 5H8WA 2YZGA 1W1UA 5F1KA 4X6LA 1X94A 2PA0A 3Q9UA 4XX1A 1G1AA 4OH7A 3BMCB 1J8QA 4V0KA 4KGDA 2CCKA 3T9FA 1SUCA 3DW1X 3EBLA 3EIOA 4BQQA 1SB8A 1VHDA 3MXTA 5EERA 1PJ8A 3KT0A 4G1VA 5EVJA 4GQBA 1A8PA 2P5YA 4OQZA 3EIFA 4J90A 2CFCA 3U81A 4WZ6A 1XZDA 3RARA 3AX6A 4IQFA 4F3YA 3LUCA 4QSHA 3TLEA 4EHFA 4D6YA 3CBGA 2JFGA 3AUSA 1ZM2A 1KI6B 3T99A 2B9VA 3IXLA 4OSOA 5TGTA 3G89A 4DXDA 3OTWA 1PZXA 4G5QA 2NUBA 1MA0A 4UDOA 1JPUA 2YC2C 5HA5A 4FYJA 4FJ0A 1SHUX 1Q5PA 4RCVA 4ZV7A 2JANA 4YWHA 5BQOA 1PK8A 4MJXA 2GZHA 4UVGA 3VDQA 3OX1A 2VPYA 2BZSA 4R8LA 1PX2A 1VE7A 3T1OA 3FUVA 4TL8A 1YZ3A 1G5TA 3UJCA 3WLQA 3A6LA 1OASA 2Q7DA 2FNAA 4M83A 3WV5A 3EW7A 4C21A 3R7LA 3PI7A 4YRGA 3O4RA 2ZB8A 1R0RE 1JEEA 7MHTA 2LGJA 4CDRA 2HXSA 2OGZA 4PYIA 4GPD1 3KAKA 4JP2A 2CWWA 1XELA 3W2IA 3WGUA 4LJ8A 2P9JA 3KPYA 4Q3DA 1E8NA 1DTWB 1M6HA 3T0FA 2Z83A 4L3VA 5IT4A 3DF9A 2K5UA 3AY3A 2FG6C 3LQKA 3WP1B 2IXEA 3QFRA 4X41A 1Q1QA 2XEDA 4IIUA 1CUXA 3LBIA 3UWKA 3C3WA 1WVIA 2ZB4A 1LZLA 3NNNA 3WKEA 1POWA 3KQSA 4CLXA 1XTIA 2B2CA 3BILA 5B53A 1OLSA 3LDFA 3O2NA 3EC1A 4X90A 1JKIA 4NCKA 3GGSA 4E13A 3PE4A 1JYEA 2VHCA 3NDJA 2JGAA 1WOMA 2A0KA 2REQA 4G8JA 4BNMA 4BNUA 3EYWA 3QE4A 3VYVA 4CIYA 1IXYA 3AVUA 2J4FA 5IG2A 3LC7O 5GQSA 2DFPA 1FFBA 4PQFA 1YZYA 2VDJA 4G85A 2GD6A 1G6Q1 1SBYA 1V71A 2G0TA 4CG1A 4IHAA 4OJQA 3ZOZA 2GYWA 2VBCA 4BQNA 2E5FA 2LP4Y 3CW8X 1N92A 1E77A 3KD3A 5FF9A 3OF3A 3FHCB 3NG1A 2VJBA 4E12A 1EQ2A 3TTTA 3N2GB 1Z73A 3P19A 3S1AB 3TAHA 3KOZA 3LTEA 2CHEA 2ZJAA 1IN1A 1GQ2A 2IXFA 2XYQA 2BM0A 4K9OA 1V3TA 1PWHA 4P35A 3Q5DA 2C8VA 2I54A 2HHLA 1ML4A 1H2YA 2YOHA 3PWSA 3TG8A 3KB2A 3WMFA 2QF7A 3E7XA 1EMDA 1QAQA 3ENZA 3TRDA 3ZYZA 4X60A 4B6PA 5BOSA 1KAMA 5I8WA 4NE7A 1AHPA 1B15A 2AFHB 2DLCX 4UFPA 3NC4A 5DGHA 4TYNA 2QA5A 5F5XA 3F3SA 1N9ZA 4Q1BA 5AVSA 3I53A 4ENRA 5LYJA 4YCNA 1OXKB 3W4JA 1N7HA 1G0NA 3DMTA 1LW7A 4UZSA 5TF4A 4HDKB 4EK9A 1IXSB 3WOHA 2JLZA 4MW0A 4N3GA 3CUWA 1ULHA 1W9HA 2CJPA 4IIGA 1P2GA 5IUKC 3D6TB 4IVPA 2LDXA 2W2NA 2WKSA 2QPTA 2P9CA 4LVCA 1N0WA 1YMUA 4OGGA 4EAQA 5JVDF 1BFUA 5KMGA 1SGWA 1GG9A 3LVRE 1DCFA 1GPAA 3FN4A 5HJ2A 2CVQA 1U2RA 2FPPB 3HBNA 3L7BA 3SYLA 1AKEA 3LC1O 3C1TA 4DYDA 1K7FB 1IBLB 4JLKA 4OHMA 1KI4A 3H7IA 1ZGJA 2HCBA 3JALB 1NVTA 4M53A 4N49A 4TTRA 4Q34A 3E2PA 4DABA 1G6HA 2QV0A 3T3MB 4CE6A 1AZLA 5KTNA 3EHEA 1TFUA 1UMKA 2D3TA 3UHFA 4S1OA 4N3BA 3QFFA 1DKMA 4FMDB 5ADWA 5ELXA 4DBZA 3QKIA 3I34X 1W5BA 5ALQA 4II2A 5CLJA 2JIPA 2I9KA 4MRVA 3VHLB 5JTTA 5H59A 3I73A 2HMAA 2GYYA 4HSGA 5CDFE 2H5EA 4B2LA 5L3VA 2NXWA 2FEPA 1XWWA 2QAJA 2R87A 5BSEA 1DJNA 4LI3X 5C7OO 2YN4A 3P4YA 4RE5A 3IQWA 5E2IA 3NHSA 3K8OE 2PU5A 1RM0A 2W2QA 3SX4A 3ONWA 1QKKA 4NBKA 3JS5A 2FJPA 5LMZA 5CVTA 4F3CA 1VGVA 3LYLA 2C83A 3HCRA 3MWKA 4WY8A 5FOXA 1P0QA 1P0FA 2W11A 3LPCA 2QRMA 5I48A 5F23A 5EJ6A 3IMGA 3K8YA 3N2GA 4HRAA 2IPLA 3ANMA 3BVPA 1QONA 1HTTA 1YCHA 1ZOLA 3RU3A 2OO5A 1O58A 4IJVA 1WW8A 1ATIA 1VKRA 3QA9A 3QMPA 3I76A 4GS5A 5K0JA 5JYDA 3I4CA 5CA0B 1VKOA 2VK2A 4DRZA 4LHYA 4KHZA 1JEOA 1KNQA 1SRQA 4K9PA 3WNBA 3RK1A 2MSNA 1MMFB 4LYGA 3A58B 3QQ5A 1E1MA 5GVRA 1F8GA 2RHDA 3A26A 1JDUA 4CQMA 3I61A 4HDRA 1X86B 2FFAA 4L85A 3NAZA 3P8ZA 1V5GA 3PX3A 4CW7A 2B4RO 2OP0A 3LQRA 4GX5A 2OSBA 3DE2X 2YDXA 4EABA 4O3MA 2NYUA 4IXTA 1RBZA 4PZ9A 4ZT7A 1OIXA 4M99A 1I80A 2NU7B 1ZPDA 4M8KA 3RDPA 3OEHD 1LV8A 2FSHA 2ZI4A 4LSGA 4YB8A 5GY7A 5EJ5A 4BWGA 4NZMA 4TMVA 4G2TA 4OKSA 2I4MA 1P5FA 1QTIA 1R5OA 2P8JA 3Q3GE 5AW7A 2ZUEA 4PC6A 3V4FA 1OXSC 2QTHA 2VXCA 3RWMB 2HYIC 3LO8A 3Q3HA 1F4LA 3CIFA 2W58A 2CUTA 3L1UA 4CCYB 5HQTA 4OHWA 4AROA 3ZVKA 1XPOA 4FZJA 4PAWA 3DT6A 3Q11A 1VRVA 3JD2A 1DTWA 2P35A 4TOIA 2HF7A 2H4HA 1W5FA 3AFMA 5IW8A 4DZZA 3O95A 4ACBA 3P9IA 1I10A 8GPBA 4RZUA 4PPQA 4RESA 5CP8A 3W2FA 1YIOA 2IH2A 2W42A 2RHGB 4DVGA 2CHVA 3C85A 3HHPA 3OWXA 1NUQA 2I7XA 3DZIA 4Z4HA 4JHLA 3PKJA 1QLHA 1EE1A 1RYFA 1TK2A 1H05A 3OQ1A 4GLLA 1SU8A 1P31A 2PL3A 4HDNB 5DASA 1JJFA 4B7AA 4KV9A 2Q3DA 3UQYS 3SQWA 3SC2A 2WMNB 4O08A 4X3CA 2DE0X 4XAQA 8ADHA 1IBRA 2O2SA 4DZTA 4UATA 5ITSA 4JCCA 5IJ0B 2FG7C 4EUSA 4DR5B 4G09A 3D4LA 1EFRD 4HG2A 5DTEA 3SEFA 5A5DA 3G6WA 2RGAA 3I5UA 5DDIP 5L3ZA 2O57A 2J9FA 1SK8A 2R1VA 2XNHA 5EKTA 1K6MA 4RKFA 2E5WA 4OBWA 3DE5X 1Y7IA 3RSZA 2EBFX 4ZT6A 2BWJA 2UVPA 4I4IA 4GOLD 5FBHA 5FI3A 1UPBA 4B3RB 4REMA 4CLHA 3O8RA 5JMWA 2B0JA 2HUNA 3T6KA 1K98A 4EG7A 2NO9A 4GWKA 2CD9A 2CKDA 3EMDA 4K6KA 3ANYB 4I14A 4RZHA 4QQFA 4ZVVA 5CXQA 3K5HA 4DCMA 3HRKA 3ABQB 5CYOA 4LBYA 4ZOAA 3WNCA 1X1SA 2PX4A 4MV1A 4QQNA 5D5QA 3Q7QA 3VOTA 5CUQA 5C1OA 4F3KA 2NU6A 3R8FA 3SJCA 1AA9A 3UWSA 3FBWA 4BXOA 2RAVA 3I6YA 2HA6A 3IV7A 3KZCA 1SPBS 2AN4A 4JITA 1C0PA 3TJZA 3L6BA 2BC9A 3G7NA 1PQYA 4INOA 5EXPA 1ECPA 2JGIA 1KZ4A 1BJRE 1MIHA 2BKAA 2WSYB 3CT4A 2VXYA 1UBLS 1QAMA 1C7RA 3K9NA 4V3CA 1GILA 5AKLA 3RSSA 2HOQA 3KG2A 2Q8NA 4BX0A 2PRYA 5ENVA 2ZYAA 1IB0A 4MXDA 3ZV6A 1N2SA 1KERA 4PZPA 4BNLA 3OKPA 4KFUA 1WPGA 1VSTA 2J07A 2WG2A 5TGZA 1E2DA 4B8YA 1JWAB 4CM9D 3MJSA 5IN5A 2KLHA 4QM6A 4P8RA 2GCNA 1AO3A 3GJRA 1FOEB 2QMHA 3DKKA 3FW1A 3IVXA 1OXUA 4R01A 4TRMA 4ZO6A 4TXLA 2WSIA 3DO5A 4EKGA 1N6OA 4Q4LA 2XMCA 1TEHA 2CLOB 2Q2OA 1PR4A 2IYTA 2ATCA 4H0NA 3V7UA 2J0SA 2J9RA 4M0UA 4U9UA 3DBOB 3G2NA 4XEUA 4DCCA 4AQYB 4U9IS 4TZ6A 3UUFA 2DH5A 3IDQA 3RKUA 5KWIA 2A30A 5IVDA 3AERA 3R3JA 5C7LO 3DAPA 4LN1A 3TAXA 3TSOA 1AC5A 4B74A 1XR3A 1XKTA 4Q39A 5A4FS 4V0SA 4D44A 2DBZA 1JHOA 2FZ4A 3E22A 2PGNA 3P9ZA 1O96B 3BWMA 4HLUA 2EG9A 4HEA6 1Y37A 3AI3A 5JH7F 3I9NA 4QTXA 3T95A 4XR4A 3T4PA 1P1JA 2ID8A 1UBGA 1AB5A 2AUNA 2R8OA 4LWZA 4K05A 4O4LF 4AZ3A 4KBYA 3NAMA 1BRTA 4IUCS 1EKXA 4MYCA 2F8SA 3E5RA 4YECA 2HQ1A 3SHVA 4YGYA 4BASA 1N5KA 1VFNA 2ZIXB 3ABSB 2V7UA 4YAFA 4ZT4A 1FB5A 2O8CA 4MICA 1J2EA 5AT1A 1ZD1A 4OQNA 5IK2A 2TSYB 1TO1E 5JAIA 1I5RA 2XBMA 1WNFA 2A7XA 2CUZA 4XWAA 4D99A 2I6SA 2O50A 3WDLA 2VA8A 1E3WB 1GPH1 4N9WA 4YQYA 1OI7A 1Y98A 5IC5A 4CEIB 2Z1DA 2YVLA 1JXAA 3Q2KA 3UT5B 3L6DA 5JVDB 3MGGA 5CK4A 4GPEA 4GX0A 3RABA 3P96A 1IONA 1W4RA 1W35A 2E21A 2WJ3A 3C4QA 4IFEA 4Q7LA 1Y5RA 4X92A 1C4KA 4CL3A 2JLYA 2QEQA 5K8LA 3SQXA 1R0SA 4RGQA 1GAEO 3E2MA 2BF4A 1A5BB 3P0JA 4HDMA 2X0NA 1JNXX 3A9RA 3EGOA 4L8LA 3RCBA 3RBAA 2BTOA 2NZJA 3EA4A 4QDJA 4TWZA 3ZZTA 3D4PA 4F45A 2ZQZA 3MBIA 3ZBTA 4RTRA 4G97A 1KBOA 1M0TA 3OSZA 1SK9A 3D2CA 3P97A 1WCIB 1DTSA 1OFUX 1XMSA 2HNKA 3LBYA 4FN4A 3USCS 2VUIB 3BXPA 4XOUA 4A5SA 3EGVA 2E4UA 3IQXA 1Z0UA 3LZCA 2BFCB 3O9ZA 4LY0A 5DHSA 1FDWA 4IJ6A 2PX0A 3N7UA 4ZREA 3ZR4B 4CRWB 1JBQA 4CL8A 4NBLA 1I3NA 2AFVA 4DWWA 1R0CA 1V9LA 4ENUA 3DDZX 2GH1A 2FUEA 5BUCA 8ABPA 2CZGA 1D3AA 4BLVA 1RTTA 2VYFA 3IJRA 2HK8A 1O6FA 5IULC 1IXKA 2R7AA 4C7JA 2O4CA 2D8AA 5GJBA 3O7MA 2WTEA 3Q8WA 3W3AH 4INZA 1PFKA 2XT0A 1D6MA 2C95A 4JELA 4C4YA 1RHRA 2ZJ0A 3QY9A 2P0EA 1VGQA 4R8VA 4U2DA 5FB3A 2J6BA 5IAJA 4CR7A 1Z3CA 4ENSA 4QEDA 4CM4A 1U9CA 3RJMA 4RETA 1A4XA 1WXHA 3CR3C 2Q4OA 4GI7A 5T67A 5BT9A 1LDGA 4ZQIA 1FYXA 4BMVA 1TW3A 1DIOB 1E20A 3QWHA 4PQRA 2V1XA 5IEBA 3VPXA 4DDKA 2QUAA 1ZJZA 5CU7A 1A3CA 1T26A 3MS2A 3R6LA 1ULAA 1U0EA 3KQKA 4EY6A 4PZDA 1OIVA 3KB8A 2OGTA 3M3PA 1XEXA 3MEQA 1OZHA 1N2BA 1H2RS 2WIGA 1SXPA 1KAGA 1UDBA 5DHTA 4OMFG 5H3CA 1KEKA 1TIBA 4BQOA 1WXFA 2FZCA 2XMDA 4R41A 1OLSB 1R9MA 2FR0A 2O2ZA 3BZWA 4I1SA 1FP4A 1NZJA 4YDHB 4TUYA 1TX4B 4QEKA 1NRWA 1QCCA 2VH2A 4QJ4A 4LC9A 3GXOA 3UGQA 4JP3A 4DQKA 2PUEA 2IF0A 3JQBC 1XDBA 2GM5A 4LJSA 1QIFA 2ZRIA 3DO6A 4RGBA 5CYPA 1OI3A 1UM8A 2JZNA 3E9RA 2PY6A 1A9OA 1SCKA 1NHWA 1X15A 4OUDA 1ODTC 2O3SA 2FOLA 3QPWA 3CNEA 4K7JA 4X95A 2CFSA 4DBLC 4AY5A 3WAJA 3AJRA 3KTFA 3TPZA 3ZWNA 2WIAA 4ZODA 1WRBA 3PC6A 1A98A 3ZDDA 4S1WA 2ZRBA 3WLNA 2XUGA 1SXGA 1JNYA 2PMBA 1VE6A 3RSHA 4P4UA 3FI0A 2QQ0A 4FU0A 4D8TA 3FGPA 4HDNA 3PICA 3FCSB 5LXTB 1GTZA 1X0VA 4YC7A 1UXGA 3AI1A 5EJ7A 3IUJA 4F1KA 1M6VA 3RRFA 1TPZA 4QDZA 3E0XA 2LWIA 4JEUA 1Y4ZA 2OZPA 1EE9A 1M0EA 3KOWA 4J3JA 221PA 1L8QA 3GBSA 3E8XA 1Z36A 1VIAA 2C9BA 2GPTA 2JLUA 3RADC 3H9GA 4A8TA 5AI4A 1RI4A 1Z6TA 2QW0X 3L1IA 5TPZD 2MYTA 3L1JA 4IP0A 4N5HX 2NVOA 3HA2A 4TZTA 2PUHA 4D9HA 4YPOA 2ZYRA 5C5CA 3BZUA 5AVKA 2IV3A 2OBYA 1U9IC 1ONSA 1Z0FA 2G72A 3OX3A 4MV8A 4YJGA 3DHEA 1H4QA 3W9BA 4WVLA 3I05A 5GM1A 1ZH2A 1XU7A 2J41A 3AXSA 4J0QA 4ZPXA 4YV7A 5ADVA 3LBNA 2BM9A 2QROA 1D2RA 4YV0A 4CBVA 2O48X 4OVKA 3DE7X 3AESB 3LVQE 4G26A 3LY5A 5BQFA 3TQCA 4AO6A 2IUSA 3WXBA 2UAGA 3O2QB 3D0OA 3RVLA 4BE9A 3DLIA 3ZWXA 3KYIB 5LP6F 2GPNA 2WJYA 1FUEA 3RC8A 5IX8A 4BVLA 4M1SA 3NBKA 4M8SA 3KM0A 1OBCA 1MZPA 4KDFA 3KETA 2OFWA 3GU3A 1SUFA 5E7JA 4JR1A 1HDXA 1QFYA 2HJSA 3IQDB 4ENQA 4GQAA 3U48A 2FHPA 1J6UA 3OZTA 4F1JA 4M9CA 4LEIA 3V9AA 4JU9A 1GD1O 1NMYA 2IQ5A 2CJFA 3OD1A 1MAUA 1L5SA 1QZ3A 3OZCA 3X1DA 5LQNA 5LSAA 2OECA 4IUDS 2H7VA 2HGSA 1I5OA 1S2OA 3IBYA 1NONA 1QQ5A 1KAOA 5GV7A 5AFSA 1OZAA 4QAQA 4NICA 3T3GA 5AW6A 3K6SB 4DQDA 4H17A 4TUYB 1TL7C 5T64A 5J2UB 3EGDA 1GCOA 1NVDA 1G19A 4KX5A 4EW3A 1IBMB 2JGFA 4ZMBA 4RVFA 3R0QA 1EFHA 4FHDA 4KIFA 4MI6A 4DJAA 4R9RA 4EVIA 5LA6B 2IE0A 4G0MA 2V6MA 3FB4A 2QW8A 1IY2A 1JKJB 2WP8J 3FZGA 3OQBA 1PNRA 3MTGA 2PEZA 1RRKA 4YAIA 2W0MA 2UUPA 1T6ZA 3QHPA 1F2TA 1CJTC 4YJFB 5FXMA 5L7YA 1BXZA 3ZKWA 1C7QA 4MIKA 3ZXSA 4EF6A 1CE8A 1P0CA 1PO7A 2CCGA 3IOCA 3KYDB 3M8KA 2XSZA 3CUUA 1WLSA 1HFEL 1Q3KA 4FYKA 4ZANA 2ASEA 2VI5A 4YR7A 4CKEB 2FR8C 3K8ZA 1H66A 1NPTO 1RWXA 1RZVA 3ER9A 4FC7A 3SC3A 1MJNA 3TECE 2X5NA 2VZEA 1N3BA 1FDUA 1WDWB 1ZXXA 2FSUA 1M6VB 4PGHA 4WNAB 3EIUA 1HYBA 2AWOA 1C1XB 5EIHA 3ORFA 2WD9A 1VL1A 4HSEA 4NJMA 4UTNA 4D7AA 3BGIA 3RVNA 1ISFA 1UMDA 1CQWA 1ZG3A 1LBTA 3WRYA 4F5DA 5JOQA 1L5MA 1ZGBA 2XE4A 3DP7A 1M7HA 2ATEA 3RS5A 2YCLA 3C1OA 3ZIUA 3I2YX 3Q9LA 3GLFB 1K9VF 2VNHA 3EMKA 3TQQA 1QYIA 2QLJA 2JLXA 4POAA 3PC8C 4FMCF 3DD1A 1P62B 1G3QA 2YWFA 3MS7A 1AS0A 2JVJA 2PPVA 4TKMA 1ZGZA 4B2PA 2ZTHA 2GA8A 4NIMA 3V00A 3PSAA 1XGKA 2A58A 1E9DA 2WU4A 2ZE5A 4GZ6A 4O4HA 4D46A 4WY2A 5FRDA 1DKRA 3DMHA 1IEWA 5KYWB 1RYEA 5BSTA 4A6DA 1PHPA 4HGPA 3AEZA 3MUNA 3LRXA 1SZCA 3W8FA 1MD9A 1NW9B 4ZJYA 2HIGA 1CF9A 1DI0A 3I30X 1RZ3A 4BV9A 1A7JA 1B43A 1E63A 3OIWA 1OXVA 1P7PA 1Q15A 5DXJA 4BX3A 4MV0A 3RRJA 4UD6A 4FE3A 3T41A 1TIKA 2ZBEA 5CVEA 4ZU3A 2H5JA 1M33A 3O26A 1VZ3A 2Q7OE 5BSKA 4OX9Y 3C7KA 4N03A 2EW1A 4RTPA 2V9ZA 3COPA 3CX4A 1M1UA 5DT9A 3VPCA 1GJRA 1WMBA 4MOWA 1Y3DE 1H2HA 1V7CA 1N2CB 2KE5A 3DMYA 3O0DA 3VVLA 4LV8B 3CF4A 4PV7A 4BHTA 4YQFA 1UBJS 1LVHA 2ZXUA 2XI4A 2YWDA 2GYUA 1HGXA 1THGA 4KXYA 3WKCA 4BKQA 4I3GA 2ZJ4A 3WL3A 5FPKA 2NQTA 4YMHA 2DTDA 3N2NA 3UK6A 1M73E 3IE0A 1PR3A 3VDXA 4RY2A 3AZPA 5GONB 2BMVA 3EGWA 3NT2A 4PLWA 3REOA 2OCKA 4J6EA 1OI4A 3I2GA 3FKSA 2B9EA 2XTNA 2WPNA 3CTPA 4DMUB 2IHJA 1V26A 1Q16A 4DJ5X 1O87A 3DQZA 1ZSNA 4LY9A 1UZAA 1KI2A 2PS9A 3QBTA 4RTNA 4L4RA 1FNNA 1R6VA 2E3JA 3N2KA 4RL4A 5FD8A 4MV9A 2GN8A 2ZOSA 4HGZA 4BEVA 4YXWD 4AUNA 3KQVA 2OAP1 3NTVA 3OPYB 1C7EA 4I4TF 4ALNA 2CXHA 1GUFA 3QTBA 9LDBA 1LPAB 3IDOA 3LLUA 4RJKA 3SX0A 5KSZA 2IEAA 4HN4B 4PNHA 3HLTA 1FVFA 3THXA 3U3ZA 1XVUA 1OREA 2PX2A 4IL5A 3ZLJA 4KGXA 1CJSA 1F1JA 2ADOA 5LQKA 4MCAA 1R8YA 1TB4A 5DN6D 1RKUA 3QKRA 3ZXIA 4DJTA 1V11B 2N75A 3IIKA 2P62A 1GEEA 4KXXA 2VUTA 5AK4A 2Y6UA 4L27A 1RAGA 3I5YA 3ADOA 4YI5A 1FJXA 1KWKA 1JDPA 5EWJA 5FUVA 1ZK1A 1ZUNA 1J8MF 3JY6A 4N40A 5KOJA 3Q3CA 4P38A 2BGMA 2HIAA 2RK3A 3IP8A 3PUZA 5E1MA 3R7BA 2E4VA 3QNUA 1ECBA 5FR2A 3DAYA 1WOYA 3F71A 3HVJA 1UDCA 3H1PA 5ED4A 3MTEA 4LJ9A 1WF3A 4MQEA 1Q2XA 4HJXA 2O1SA 3CSUA 1Y7TA 3LWDA 5IDYA 1KYZA 4JI3B 2AF3C 2VPXA 3RSFA 1KY2A 4MKFA 1BMQA 3DXZA 1BG6A 3M1AA 2DWCA 3HCEA 4N7JA 4UHBA 1IULA 1VPEA 5EGNA 3UICA 4QOEA 5TF0A 1EVIA 3FAKA 4LXYA 1SB9A 4IGIA 1AQUA 5A2QA 4OQYA 5K3DA 4DAOA 4AZWA 3ZX5A 5T57A 1X6VA 2PSHA 5A06A 4QD3A 2ST1A 3UUGA 5IXSA 3GLSA 1QIKA 1KPIA 4K9MA 3RJ5A 5CT4A 1R0BA 3FKSD 2BI4A 3JR3A 4DQLA 1COZA 4QG3A 4PSCA 1QWSA 1RLIA 5TQJA 2RG7A 4UEQA 4BP9A 4LZPA 3DV0A 4KPFC 3EH2A 2XLBA 3VNUA 4B48A 4ND7A 2XUZA 2ON6A 5JCXA 4G9GA 1EZ4A 1IPFA 1EX6A 3OQVA 2BFNA 3PDHA 3PGLA 4KXVA 5EE3A 1MP0A 3X1WA 2F2TA 3R24A 4BO7A 1HNXB 5IAOA 4JV5B 4HC4A 4X71A 3KJNA 1WZEA 1F51E 1U65A 1IFXA 3IPLA 4H77A 4V2IA 4W1SA 5HM8A 1EWRA 1Q1NA 3OIFA 4H7EA 5JXHA 2NYVA 3MINA 3JYNA 1ZVQA 3RC3A 3U3MA 5EIBD 1LNZA 2Q0QA 4CKBA 2NUAA 1OA0A 1Y81A 3UWPA 5K8UA 1KF0A 2QN3A 3ESBA 4OPMA 5AHWA 3CEPB 1EX1A 2Q2QA 2OFFA 4Y9RA 2QZSA 2P9FA 3WC4A 1UIRA 1SG0A 3DR5A 4IJMA 4QPPA 4UBLA 5KVVA 4U3JB 4W5JA 1JR2A 1U5BA 5TMEA 3EXG2 1IC6A 3UQZA 1UFKA 2X19A 3HCWA 2QN2A 3ND7A 4PWYA 4ZYWA 1M8KA 5FTWA 4RD6A 2Q3CA 4HX2A 3SAJA 3ZW9A 4JXZA 1Y9ZA 1BXRA 2W4MA 3QUCA 3L1HA 3LV8A 4YJHA 2AW3A 5H3LA 4BTLA 1QIEA 1IOZA 1Z5UA 4B32A 1PL8A 3QYAA 4ANFA 1AY0A 3I37X 1JDZA 2ESRA 4I1RA 1D2MA 2B98A 1RXYA 2H08A 2X22A 5H1YA 2DC1A 1WUHS 3UY4A 1JLKA 1Z8HA 4QOIA 4BWVA 3T3NA 4I9UA 1TK9A 3QMVA 1HQDA 4BKPA 2UXDB 2HB6A 3AP3A 3RRZA 1D5CA 2XXBA 1K3FA 4BFTA 3DWFA 1CVLA 2PX3A 2JGKA 1E2GA 3ZH9B 1Q50A 2ZKIA 3CO0S 2PZFA 2P6NA 2ZPUA 1V6SA 1MB4A 1R12A 2B99A 4IUYA 5E2BA 1US8A 2H1HA 1NOKA 2PVCA 3DE6X 1QMPA 3SE0A 1S0UA 1DBRA 3SCZA 2AG5A 2JJ2A 4LXXA 1QKIA 3WLJA 3LHDA 1TT5B 3ORRA 1P72A 3TTVA 1GVHA 1KQFA 1PI3A 3IERA 4L51A 1G7SA 2AOTB 1NXTA 1CEEA 1I94B 4JQYA 3UJPA 4CCAA 2HCJB 2PV7A 3JZFA 4M49A 4UJ3A 5EXXA 1L5VA 4IAOA 4F04A 1VXOA 1FYFA 1XLTC 1UBCA 1KVUA 2NT4A 2PBLA 1HH4A 4L5YA 4U5QA 1K4KA 3LE8A 2UZ1A 2OE2A 3MT8A 4KFRA 2EOAA 5T4EA 1KFKB 2QT1A 1FQOA 3NXSA 1DRJA 1NAIA 3CVYA 3BMNB 1KOGA 3NHWA 3ACCA 1EFKA 2HLPA 2KBFA 2QZJA 3SPXA 3CY6A 1P9OA 2B7LA 3CLTC 4P1ZA 4PRZA 4QDTA 4PLPA 3VR5A 1M2KA 2PGAA 2R5WA 1QDLB 5C51B 2W2XA 2PKWA 5G2OA 2JRCA 2RAPA 3O82A 1I2DA 2VHQA 3AIOA 3NIGB 1HYGA 4HADA 4RF5A 3W1EA 3GJ5A 4GX1A 2VK1A 1TVEA 2NZYA 2YH2A 3IQZA 4JLNA 4DE5A 1T24A 2CDNA 2B1RA 3HMQA 2D6FA 3W8NA 1QHNA 1Y8RB 4DBLE 3VI4B 3MTJA 3HU3A 5FOWA 1A8QA 3HJHA 1QX4A 1H65A 5F52A 3DLPX 4F3NA 2Z6AA 4G1UC 4ZMRA 1EHCA 4AY6A 3G5UA 2H2HA 4Z4GA 4A91A 4JT9A 5JMPA 1P3Y1 1JDNA 3KOUA 3NZEA 4Y7CA 2BLNA 5FA6A 4J8PA 1ZIDA 4LJ7A 3IUNA 2GCPA 4WPGA 3H1GA 1F2UB 4K03A 5K0LA 3S29A 1PJCA 5JAPA 1EFCA 3C3AA 4C76A 1GPLA 1HM5A 2GPAA 4QBFA 1B8NA 2IU4A 2AJLI 3CN9A 3HXMA 3SF0A 2PHZA 2FYTA 2V7PA 4I50F 1W36B 1E1KA 2JIMA 1PR5A 3KSBC 2ERYA 1I14A 2WAYA 3M34A 4R1NA 5JDIC 4YJDA 1I0IA 4Z4EA 1EFLA 1QU3A 3SZOA 4RK5A 4CKWA 1RIFA 4F6RB 5HUJA 1V16A 3H8WA 3JQ8B 2Y0DA 4DMCA 4HI0E 4JB8A 2H65A 1NT4A 3B7WA 2XDYA 3DHVA 4XIGS 3H5AA 5JDCC 3OEWA 1CQPA 3W2EA 3AFGA 1I1HA 2E4WA 3MJVA 2OO7A 3R77A 1ZITA 4J7XA 3VJRA 2A67A 4ALJA 1GM5A 1OE0A 2C9YA 2H57A 2VG8A 2QM0A 1J9ZA 3TNFA 1E2QA 3UKDA 1E6UA 3ZC3A 3EODA 1UUFA 1KK2A 1LSUA 3ER6A 2VJDA 4I4TA 2PJUA 2G25A 2VYQA 3W5DA 5EL0A 2WYWA 1NQXA 3D4NA 3H1BA 4KUEA 4H3SA 3B2EA 2O23A 1W36D 5FA5A 5GGYA 2HI0A 4EF5A 4PYJA 4J2HA 4S2UA 4QXRA 4Q37A 3SZMA 5FDFA 5AXCA 1LZKA 3T38A 5EN4A 3D6MA 4NEQA 1CG6A 1YJ8A 2O07A 4GLJA 2WHXA 3OCXA 1YKGA 3VKUA 4BMOB 2AK2A 1WX1A 2ZUUA 3PIRA 3C41J 2J09A 4I5EA 4ILKA 3UBMA 4AX4A 3E05A 1EIWA 1G291 1T9KA 4K1XA 2ZZKA 1KVTA 3DZDA 1PJ2A 3ZNOA 5JBNA 1M54A 1PVDA 4JBHA 1NOIA 1KK3A 3DG9A 3PT5A 4DM7A 5BN4A 3TZ6A 3HZRA 4O2AB 3UMCA 4A15A 5A0TA 1E66A 3N3BC 1RYMA 1C50A 2C5EA 1L5RA 1AHIA 3GLQA 3EC2A 4WZBA 3T3OA 1IVYA 2A1TS 3ZEAA 2UYOA 1QRUA 4A2WA 2HMTA 3UK2A 1I4EB 1RT9A 2B2NA 4HRVA 1NVVQ 4R7GA 1ESNA 3S70A 3UG6A 5CXSA 2XGSA 5AUQA 3PITA 3WK5A 4FB4A 2HO4A 1WETA 1SUIA 4J0FA 1CZNA 1FXWA 4DR4B 1V37A 4U7FA 1Y1RA 2IIVA 2HZBA 5LBTA 2RGXA 3T52A 4CU5A 1PVOA 5C4MA 3NYRA 1YL6A 1ESCA 1MB0A 2D2XA 3GIDA 3ZI4A 4NCAA 1C7IA 1HOTA 1E7YA 1MO3A 5KS2A 3QLVC 4FFSA 1HMPA 1XZLA 4EPRA 2FSVC 2YMPA 4BVAA 3MLAA 5J5VA 2NGRA 2H1WA 3VDRA 1MQ9A 3SXUB 5IKPA 1HKUA 1N7JA 1AKQA 2R9VA 2VPTA 2XTMA 3VU8A 3WZMA 4BFYA 1WL8A 1Z4NA 2PDAA 5CB4F 3BAFA 4MS3B 1NPYA 3LJKA 2B6HA 1P77A 2OYRA 2YJ4A 3QM1A 3X2EA 4GO1A 2WZCA 2RK6A 3C87A 2GJSA 3VPHA 4EP1A 3K9WA 3LBHA 4M21A 1R64A 3QUSA 3VR1A 5EHXA 1KJQA 4MUNA 5KC9A 1T9ZA 4ZC8A 2X1MA 4Z9YA 4IJQA 4BKRA 4ZOQI 5DBFA 1KYTA 4Q93A 3JQ8A 3VPBA 1ZL0A 3V4LA 4XWYA 5LQRA 2C88A 5CFOA 1C7FA 1NN3A 4G2NA 1EVQA 3R8XA 2FN7A 2IH4A 1IQPA 3INTA 3B60A 3H4VA 1SXHA 3ENKA 3TUZC 3G2KA 1I1NA 1K0FA 4B4KA 1NLZA 4P54A 1P2VA 5HMMA 4ZA2A 1DAGA 1QK5A 3C97A 1FFGA 1CW2B 4U6NA 1GN8A 5A71A 5KX5F 1YQUA 2I8AA 3BHJA 3NFYA 2X14A 2GEUA 4MI3A 1CJVC 5G3YA 3THWB 3EF1A 2XNKA 5D85A 2MR6A 1BYUA 4LSZA 5CCBA 1Q11A 5AJYA 4WEQA 3ZD9A 1QMGA 1DG3A 4GKBA 2W9XA 3UB4A 2VJCA 4E14A 1HXHA 3AVXA 4PPNA 5A4MS 3AF5A 4MVXA 3DWEX 3MT9A 3G13A 4E33A 1XEWX 4MR9B 3SS9X