3LA8A

The crystal structure of smu.1229 from streptococcus mutans ua159
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
268
structure length
247
Chain Sequence
SLLKKIYETRDFLTAKGVQKPEFGLILGSGLGELAEEIENALVLNYADIPNWGKLIYGELAGRKVLALQRFHYYEGSMELVTFPIRIMKALGCQGLIVTNAAGGIGFGPGTLMAISDHINLTGANPLMGNLDDFGFRFPDMSNAYTADYREVAHQVADKIGIKLDEGVYIGVSGPSYETPAEIRAFKTLGADAVGMSTVPEVIVAVHSGLKVLGISAITNYAAGFVAVTQQIKEDFKGLVKAILVEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Putative purine nucleoside phosphorylase
publication title The Crystal Structure of smu.1229 from Streptococcus mutans UA159
rcsb
source organism Streptococcus mutans
total genus 73
structure length 247
sequence length 268
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2010-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3la8A00
4P54A 1LVUA 1JPVA 1RXSA 5F73A 1A9PA 1ECPA 4OGKA 4G8JA 1XE3A 1CG6A 3K8OE 4WKPA 4F2WA 1ODJA 3E9RA 4UC0A 4DA7A 1M73E 1RXYA 2AC7A 2ISCA 1JP7A 1SJ9A 4U2KA 1ULAA 1Z34A 1A9TA 5IU6A 3MB8A 1PBNA 4IP0A 5EUBA 2ON6A 4G41A 4QFBA 1YR3A 1JDTA 3O6VA 1Z5OA 1PR6A 5F7ZA 1JDVA 5KB3A 1T8WA 5CCDA 5CCEA 5F7JA 1TCUA 4TS3A 5CXQA 3IEXA 4L5AA 4D8XA 4MCIA 4F2PA 4F3CA 3FB1A 3D1VA 1SD2A 1Q1GA 3GB9A 3OZBA 4NY1A 4WKOA 1LX7A 1OUMA 4PNPA 4M1EA 3PNPA 4JOSA 1PW7A 2P4SA 5F76A 1SQ6A 4WKCA 4D8VA 3UAZA 1A9RA 1RFGE 1NW4A 2QTTA 3OCCA 4D8YA 5ETJA 1LV8A 1TGYA 1VHJA 2OECA 3IOMA 3UAYA 1C3XA 1A9SA 3LGSA 4OF4A 4OEHA 3TL6A 4GLFA 3EUFA 4I2VA 4GLJA 3SCZA 1Y1RA 4WKNA 4DANA 2A0XA 4TTJA 4TXJA 1FXUA 1Y6RA 4GKAA 3NM5A 3E0QA 1RR6A 3DPSA 4X24A 5B7PA 1TD1A 4EB8A 2H8GA 2OC9A 5CYGA 2BSXA 4QARA 3PHBE 4NSNA 4DA8A 1JE0A 3NM4A 5CYFA 3FAZA 1K27A 1PR2A 1JDZA 1JDSA 4BMYA 4QEZA 5EFOA 1OV6A 4M3NA 3FUCA 4H1TA 2AI1A 1NC1A 3O4VA 1A69A 3OZEA 1B8NA 1JDUA 1RXCA 1T0UA 3DF9A 2GUWA 2I4TA 1V4NA 2HWUA 3LBAA 2A0YA 3OOEA 1PR1A 1VHWA 3BSFA 3KU4A 3P0FA 5B7QA 1PF7E 1Z36A 4LNHA 1Z5PA 3LA8A 2IQ5A 2QPLA 2AI2A 3DDOA 3UT6A 1A9QA 3NBQA 1Y6QA 4R2XA 4BN0A 4DAOA 3ENZA 4GMHA 1V48A 5K1ZA 1B8OA 1A9OA 1SD1A 1OU4A 5B7GA 2QDKA 2HSWA 1U1GA 1VMKA 2OC4A 3C74A 4YO8A 4D9HA 1TGVA 1Z33A 3BL6A 1ODIA 4G89A 5F78A 2Q7OE 1RXUA 2HN9A 3UAXA 2QTGA 4L5CA 1ODLA 2A8YA 1V41E 2QSUA 1K3FA 1ULBA 5F77A 1PR5A 2HRDA 1OTXA 2I8AA 3OOHA 5C80A 4LDNA 4DA6A 1PK7A 4F1WA 1QE5A 4L0MA 3KVVA 1Y1QA 4DARA 1U1DA 3F8WA 1PWYE 3OZDA 4R2WA 1PKEA 1YBFA 3DP9A 2OXFA 5DK6A 4OJTA 1RYZA 4YMLA 1RSZA 1TCVA 1V3QE 4BMZA 3KHSA 4M7WA 1T8RA 3FOWA 1RCTE 1U1FA 1ZOSA 4YJKA 1U1CA 3DJFA 1YQUA 4FFSA 4TXLA 5JPCA 4L6IA 4OGLA 3PHCA 3KUKA 1OVGA 3T94A 3GGSA 3OPVA 1PK9A 1YQQA 4NS1A 4ECEA 4F3KA 3KVRA 5F7OA 4R31A 5FAKA 2XRFA 3U40A 5EPUA 1JYSA 2B94A 4TXHA 5CXSA 2PGAA 3EMVA 1V45E 2AI3A 4PR3A 4LZWA 4L5YA 5I3CA 4DABA 4TXNA 3UAVA 3BGSA 1Z38A 4LNAA 1Y1SA 1WTAA 5F7XA 4BMXA 3OZCA 1U1EA 4LKRA 4YNBA 3FNQA 4MARA 2A0WA 4MCHA 1T8SA 3KVYA 1Z39A 4D98A 3PNSA 1V2HE 4OY3A 4TXMA 1Z35A 3EUEA 2RJ3A 1ODKA 3QPBA 4EARA 1JE1A 4TS9A 4QASA 1CB0A 3E9ZA 1Y1TA 4TTIA 3NM6B 4JWTA 3FWPA 5IFKA 3P0EA 1K9SA 4K6OA 1I80A 1VFNA 1PR4A 5B7NA 4DAEA 4QATA 3EEIA 3BJEA 3UAWA 4RJ2A 1T8YA 1YRYE 3K8QA 1Z5NA 4QAQA 1PR0A 3ONVA 1OTYA 3ODGA 4JP5A 4TTAA 3INYA 3MMSA 1N3IA 3OF3A 4WKBA 1G2OA 4TYMA 1NC3A 4KN5A 1ZL2A 1Z37A 1RT9A 4E1VA 4DA0A
chains in the Genus database with same CATH superfamily
2J3JA 1C50A 3ZHTA 1QNLA 4L2IA 1CQJB 1JPVA 1XF9A 2A5GA 2ZXUA 5AXCA 2QRGA 3UGQA 3DFZA 3G49A 1SBTA 2GJAA 3NDJA 1TM1E 3L41A 2IL1A 2I34A 2GZHA 1THTA 2V65A 3DBIA 3TTSA 2HW8A 2UXCB 4HRVA 4H35A 5JALA 2XTZA 3RF7A 5TMDA 1PG2A 7AT1A 1XE3A 2CLHB 3CBGA 1O58A 2AOVA 4LTDA 2BN4A 2VH5R 4N18A 5E6SA 1AV7A 2JI4A 3ABIA 1L5GB 3WE7A 2ZDGA 1ODJA 3DOEA 4UTPA 5LQRA 4N6OA 1Z47A 3H9GA 3Q2KA 4MQ6A 4NCKA 4XE5A 2WC1A 4OXRA 4OXQA 3ZHQA 2QJTA 3VI3B 3OFJA 4ZC8A 3E7DA 1W2HA 3PWZA 5JS2A 2J0EA 3VNQA 1DRWA 2WF5A 3AYXB 3ZQ6A 5DLYA 3AI2A 1C3VA 4NS4A 1JLMA 4CVNA 3QFCA 1P8AA 1V0JA 3Q2IA 3HB1A 1MO4A 2MSWA 3ZW7A 3MUEA 4IINA 4KJXA 3CEHA 5KTMA 2CBGA 3AG5A 1W7AA 1W1UA 4Y30A 1MU0A 2JFBA 2ZJ6A 5AXBA 1PWXA 1GTG1 3ET5A 1C0KA 3FY4A 2MSCB 5KDOA 5F1KA 1YOVA 1OZFA 1GQOA 4FCVA 1V5EA 3ZGLA 5SZJA 2UUCB 4H6VA 1R7RA 3VJMA 3LC1O 1W2GA 2FYTA 3AY0A 2Y1DA 1KEKA 5JCJA 3VO8A 4HR7A 4M1OA 3WWYA 3ZQ4A 1E99A 4FHFA 5TEWA 4Q9HA 3L05A 4OU5A 3ND9A 4TLAA 3I76A 5IKOA 2H4ZA 3KQMA 3CPHA 3I6MA 3CF4A 3OO0A 1R5BA 2OZPA 4FR2A 3V4SA 2BMEA 1I7SB 1DG1G 1YC5A 4AUMA 2RHTA 2QAGB 4LOAA 3A27A 2JK1A 2W2XA 2WUGA 4MUIA 3FYUA 1WVGA 2P6UA 2YY5A 1M72A 4FC6A 3DAHA 3G0OA 5EINA 2ZXFA 1XVLA 4W99A 4N01A 3BAZA 4QYXA 4MICA 5ADUS 2FF7A 3MWKA 4H16A 4BFWA 1N2GA 2C3YA 4TYNA 2NNWB 2ZAMA 3ZIAA 2B21A 3EF0A 5EJEA 4FGWA 4IUCS 3ITKA 4OLJA 1ENYA 3HVHA 3PNPA 5CVDA 4Z4FA 5K0LA 4DV3B 1OREA 3NS7A 4JV5B 5D7BA 4PRLA 3PUJA 1NMQA 2RJNA 5FR1A 2VCEA 5JVDF 5K09A 2W42A 5BV7A 2QBYA 4ZK2A 3RUHA 3HQ4O 1MJFA 3WJ7A 3DVQX 3N8GA 5L4LA 3NBZC 4GI2A 4BUCA 5BW5A 5FUYA 1PEKE 5KCZA 4LZLA 4D9KA 2ZRNA 3OAAA 1E9RA 4FFBA 2FDCA 1ZZEA 1FDOA 4ROTA 4TN5A 5JNRA 3NWPA 5JQGB 3LQKA 4GQIA 3JD1A 1BDMA 1CF4A 3BORA 2FWMX 4FGKA 3P2YA 4U9HS 1L3CA 4CTKA 3WC4A 2H2DA 3WJ1A 4NF2A 4OI2A 4B8YA 4O4JF 3RWMB 1XELA 1RWWA 2ALJA 5DNUA 2WV7A 4J0IA 4D9FA 4MUEA 2IH5A 3RD5A 1SOUA 4UHHA 4BLVA 3O03A 3G23A 3A6LA 2QVYX 5CM8B 1UM9A 5AI5A 1JHMA 2W9XA 4LBWA 1CUZA 4W6ZA 2BD0A 4C0LA 5M34A 1NN3A 1SAYA 4QFMA 1YJCA 3UB4A 1Y81A 2DR0A 2HD4A 3GUHA 3NTXA 4WCFA 2NXNA 2A1TS 3SZUA 4EYEA 5B1IA 3KXKA 1QK5A 3G89A 3E05A 1UP7A 2KHZA 4XGIA 1EUQA 2O8BB 1N2BA 1T3HA 3KHKA 1O77A 2EFDB 5AVKA 2XLCA 3VHXB 4P4TA 2WZCA 4EW6A 3I1IA 2X15A 3NH6A 1XDGA 1FUYB 3E0QA 3RTGA 3KJZA 1XPJA 4X91A 3NNSA 4O4HF 2RJOA 1GA1A 1L5VA 1AQJA 1Y9ZA 1V37A 1QS0B 1NFRA 3H97A 4BCCA 3NTOA 5IRCD 1BEZA 3DH0A 1YRLA 3UHFA 1YB2A 2V3VA 4QD3A 5K05A 3JR7A 4CXMA 4UBLA 4TMWA 5LZ5A 2JRCA 2XF8A 1JAIA 4MP3A 3U4QB 1JLKA 2IIVA 3INTA 3TBFA 4PG8A 3DEAA 3WK8A 2FWJA 2HPHA 3LLUA 4KRXA 3LMKA 1K8RA 2AH5A 1Q2XA 2HGSA 2JAHA 3KS9A 3OZ7A 3RW9A 2UVQA 3LX8A 4M53A 3THYA 1SOMA 2O4UX 2ZBPA 2FUG6 3MFQA 4LRSB 5F51A 1O87A 5FFMA 1TU0A 4JJ6A 4Y1RB 3SYRA 4MWZA 4JI8B 3BB1A 5HX7A 4E88A 4KOAA 1H2EA 5CLLA 4Y2YA 3SLKA 4LJSA 2BUBA 4DUGD 1FYVA 4G81A 5JS7A 2HSDA 4HF7A 2OGWA 3VVMA 4HJXA 1GPKA 2VTVA 1CYDA 2WTNA 5A06A 4C05A 5DI3A 4RVUA 1RRCA 3A1UA 4ZT3A 4JBHA 1NAHA 1SC3A 1ENOA 2A30A 3ZZTA 4CKZA 4KIFA 4YV2A 1OXUA 2PLFA 5KJCA 1DSSG 3LBAA 4L0DA 4BEBA 2GDZA 5LZ9A 3D5EA 3DP7A 2VJYA 3BKWA 4M89A 4X6LA 5MFZA 5TS3A 3U0BA 4R9NA 4WNAA 4BNVA 3B13B 3RVJA 4EX6A 5F2EA 5HGXA 4JGGA 3BSWA 4EKNB 3IPLA 1LK7A 2CY0A 2KMLA 3NTQA 1RKXA 5BR7A 4M0KA 4LC9A 2D6FA 2FZEA 2OE2A 1BKSB 4XGNA 3Q1LA 2BEVA 3ADKA 2IQ5A 3Q7RA 3T54A 3F5DA 3OIDA 1GO2A 1DELA 3ONNA 1V5GA 4H27A 3WYBA 1DEKA 2ZIEA 3FGPA 2B5OA 3VKHA 2J48A 2PUWA 1NUUA 1YI0A 3C87A 3JPYA 3MVEA 3W7VA 5LMCA 1OZGA 5C7LO 1P33A 8ADHA 4BN0A 3GBPA 1Z6QA 3KWJA 3MQFA 1CR4A 1YB5A 4HNGA 3LU1A 5DU2A 3SEAA 4COKA 4BTVA 1RXIA 4GUDA 1ZKMA 3GD5A 3EAGA 1Z75A 3JU3A 3DW1X 1YL6A 3E5RA 2WUWE 4MQFB 4N5DA 1YQTA 1FDTA 1G64A 3A1VA 3QVXA 3WQQA 4I1SA 1WR8A 1QV6A 3TQRA 1TT5B 1PVDA 3KSMA 3RVBA 2A5FA 4IDEA 1M76A 1NXPA 1WL8A 3DD5A 1EFDN 3EGIA 3PEFA 4RGQA 1Y6GA 2P2ZA 1XMPA 2VHXA 4P3NA 5KYGA 1ZEJA 2VHCA 1U11A 2E9SA 1ZHFA 3VPHA 5AOVA 1GCAA 5A03A 2H2FA 1AH2A 2W83A 5CB4B 4UNIA 1E2IA 3G1WA 2Z6AA 2XYQA 3ZCPA 4C1BA 1ZITA 2FK7A 4GMDA 4KWEA 4MGEA 2XMQA 2RAVA 5E0OA 5JMTA 3H4MA 3L8EA 2FF5A 3GJ4A 4LOIA 4P82A 3TLGB 3OKPA 3C3WA 2EKZA 5KOHA 1ODLA 3V80A 3MBIA 4DSOA 3QUBA 1AKRA 4EHLA 2C31A 1Z4OA 2OORC 4U00A 4US0R 4F4HA 4BO3A 2ZT8A 2HTEA 4GZMA 4CT5A 1KS2A 1YDEA 3DHVA 5I8WA 1WG8A 2XE8A 4LYDA 5D87A 3AP1A 2ZATA 5DBGA 1NR1A 2V7XA 1FCJA 2R1VA 4OUDA 1AE1A 1XNQB 4HAWA 2POQX 1FA9A 5EJ6A 5JAPA 3WL3A 1PK7A 2XZTA 5GWXA 4AROA 1QE5A 2A84A 2W4QA 3AFMA 3GRKA 4MWDA 4NOLA 2BE9A 3VGJA 5SYAA 4A6EA 4C07A 1V3UA 4DOMA 3M34A 4YCCA 3RSOA 5JD4A 1ZFNA 3ADBA 3FDJA 1IM8A 3SC2B 4X92A 2YWHA 1QZXA 2DQ4A 1R8YA 3NGLA 1F6WA 3FSGA 2VP2A 4HVCA 4YXWD 1UJNA 3HA3A 3HFRA 2GB4A 4WACA 4EYQA 4BO9A 3ICVA 4UEJA 1Y98A 2FN9A 5AHKA 5DK6A 2F55A 3KV1A 3V2GA 1DJOA 3VX3A 1VBFA 4NV3A 4XB1A 3PUHA 3B7GA 1IZ8A 3P27A 1W93A 4MV3A 3MCAA 4OYHA 3RRBA 3NRCA 2IHTA 4QU9A 5HZGA 1L5MA 2GVZC 1JIUA 2VUTA 4J7XA 5AHXA 3H7AA 5JAMA 2R751 3NYQA 4AG3A 4INZA 2ZSFA 5T41A 3KTOA 1MFZA 4MV9A 3A4VA 3REQB 2IZ5A 2J3IA 4ZVVA 2YVLA 3TW8A 3MWGA 2RK6A 3AF0A 3PDIA 3T7DA 2Q2OA 1PX2A 1WXWA 3U6BA 4WNIA 2OOKA 2YY6A 5FWAA 4JOBA 3ZI7A 5FLKA 1BOFA 1VGRA 1WVIA 3AHHA 4IRUB 2RK3A 4EJ2A 1B73A 3ED1A 5E0KB 2PUGA 4E31A 1C7JA 3MINA 1KOFA 4G3XA 4U0JA 2G08A 1KIAA 1TQ4A 2XTMA 4H7EA 3KUKA 2C7PA 5CH3A 1DAFA 5TX7A 1JHRA 1XZGA 4A0SA 5FUBA 2VUHB 1K7YA 5FJJA 1T5LA 3VC7A 3IUNA 2PUBA 3ZK9A 1CJBA 5ALHA 1T6XA 3ZCSA 1VBMA 2Y2VA 3IE0A 4C3OB 4ZVNA 1H93A 2H63A 1J22A 4MYDA 4UHBA 3GPCA 1IWBB 1VQ1A 3PL1A 2A9PA 3LBIA 3BC1A 4FKMA 4ZDKA 4UTXA 3U4CA 4FMDB 5KVSA 4M0EA 2Q5OA 1ECGA 2B94A 3QVTA 2BGGA 5LYJB 3Q7QA 1W76A 3ZDBA 2VEDA 4PPYA 4WLUA 3WICA 1DKNA 4DEYA 4OQPA 1SUWA 3THXA 2FPXA 3SYNA 3ZDZB 1XU9A 1X7HA 3BA6A 3V4PB 5JC1A 3VNVA 3P4XA 1VE7A 1Y3IA 3JTEA 1ZH4A 2B7BA 4MJLA 2HHLA 1ZWLA 3PGXA 3THWB 1M1XB 5KVAA 1PG0A 4BEJA 3EXEB 3DAOA 1DZ3A 3KT6A 3LQFA 1NULA 4OMCA 3SQLA 3B5EA 4FJ1A 4D57A 2HSGA 5MHTA 3RSGA 2JVJA 5I7WA 1TMGE 4KXUA 3WL6A 3D6TB 3DHNA 4FUQA 1JT9A 5IP5A 1U0RA 2ZVQX 3BMNA 3GLTA 2PMEA 4MP8A 5HS4A 4OAPA 5KO2A 1LBEA 3SX4A 3FCCA 3GRCA 2WD9A 1EX9A 1ATZA 2R2AA 2RGDA 3FH0A 3K1YA 3OKCA 2COUA 2UV8A 3Q11A 4MARA 4WGFA 5FP0A 1QU2A 1PUJA 2YC4C 3HYTA 4TVOA 4Z9XA 1KDRA 3GFFA 3MAJA 1SBQA 2JGAA 3Q5DA 4DWVA 3PS9A 4DYVA 1B0PA 1YZ3A 3D4LA 2BGKA 3U4MA 4HEHA 1JKJA 5FLYA 4YRMA 3EXHC 3ILHA 4GE0A 2XGGA 1QK4A 4XIJA 4B6SA 2JCBA 4R1LA 4R83A 2P8JA 2VUSA 3AVPA 4CLRA 3G0HA 2X86A 2F90A 2YN2A 3JQFC 4MV5A 4DBLC 3KQKA 3BWXA 4CIXA 5FPTA 4QOEA 5T4HA 1KVTA 1QX4A 4F2GA 1YQ9A 2JLSA 2E5WA 2O2GA 1SVUA 2EKDA 4K6OA 1I80A 4V0ME 4ZJPA 1WY7A 2G83A 3MJ4A 3WAGA 5U4XA 4FR5A 1VKHA 2ZK7A 4POAA 4C6RA 2CLSA 4PVDA 4CF6A 4U7HA 4CMIB 3PE6A 2VYVA 1OLXA 3T1VA 4OATA 3AEUA 3TM4A 5CEFA 4KQFA 2AC2A 1LDMA 3FPCA 3KK0A 4GZ5A 4RY2A 4CF3A 3PEYA 4PCLA 5JS1A 1BWSA 4YUXA 3EZ6A 4M86A 1ZEMA 2JJ8A 3JS5A 3RABA 2QUJA 3CF4G 2SICE 2A4MA 3CBQA 4PIVA 3MMSA 1EVIA 1JEDA 3L43A 4PLTA 4CN8A 3HCDA 3JV7A 4YT8A 4ZDIA 2FEWB 3EJ6A 4MZDA 1MQ8B 1NW5A 4UULA 1KMCA 3SK0A 1J33A 2H5LA 2Y93A 4EMSA 1AGPA 4URHA 1Z37A 1YTLA 3HADA 1JLHA 4P4UA 1FX1A 3ZE9A 4ATNA 3L93A 2QVZX 1P81A 3TZEA 2DHQA 2WJZB 3M5CA 2NZJA 1AKYA 2HCBA 4BWGA 2ZB8A 1KO1A 1PT5A 1KNXA 1LPPA 4HZGA 3IUSA 3JASA 1Q7CA 3NIGB 4BWVA 3QUAA 3ZIDA 3NXKA 1E2EA 4Z2AA 4QXRA 1K6XA 2ZWIA 2DFVA 3IT3A 5TGTA 2YYSA 1F7UA 4YQEA 3TIGA 1Z25A 1ORWA 4CV3A 3NYWA 3NANA 4LPKA 5J3JA 3IAHA 5JC8A 1I6KA 3GVHA 1ACMA 1T34A 1W30A 2C2XA 1J2YA 1R12A 3I42A 4I4TB 4KK4A 4NQZA 2QD4A 2E49A 4QPJC 2YV2A 4U1RA 3ICEA 1P1KA 2UU9B 5K7SA 2YQZA 3KUDA 4WKPA 1H05A 4D6YA 5BR1A 3BERA 2NPOA 3B9RA 4UBJA 821PA 3HUUA 4CMEA 4NCAA 1SBYA 1Y1LA 2OQIA 4HDCA 2QX6A 4ZZ0A 3BMCB 2D5CA 2DUWA 4ZXPA 2QRMA 2BT4A 3EZ9A 4EJSA 2QRJA 5JAHA 1RXYA 4IS3A 3TPFA 3VSDA 4K6CA 3BZWA 2XYHA 1AC5A 3V1NA 3C1UA 1NVTA 4WLFA 4ND8B 5CVTA 1SNYA 1KEEA 1GXSA 2WT4A 1X7YA 5G4KB 1E9CA 1WHSB 4M2LA 1V8BA 3N28A 3PEVA 2CXXA 4G67A 4U9IS 4EHKA 4LECA 1IY0A 1OXMA 2R8ZA 2XOXA 3CLRC 3PB3A 4IX1A 3TRHA 2GNOA 4QGFA 3CLHA 1YZKA 5IU6A 3LT2A 4PG4A 1CY0A 4JC8A 1VGQA 5CW1A 4EF4A 5AVXA 3KQLA 1FTYA 2IBTA 3GJ5A 1TYDE 4JJEA 4I9GA 1YE5A 3DKKA 3E7XA 1YRHA 4RX1A 1W34A 1E1LA 1Z06A 1R4MB 1T2EA 2C95A 3C24A 5IMBA 3K9FC 4RABA 3TMKA 1I2MA 5NULA 4FW9A 4X8MA 5LXTF 2P2DA 2WKSA 4MLCA 4Q9DA 3O92A 4REMA 4D4IA 5CLJA 2BIFA 2DE0X 2EZ9A 2GLXA 4AG6A 5CGZA 2H17A 2Q0HA 2R6FA 4MVJF 5CMLA 2FB9A 1ZN8A 2OCYC 1M6EX 3F8SA 5EZYF 4BFSA 1TOAA 1D7AA 5CXQA 1U7TA 3S99A 1ZN7A 4FQ8A 2GMWA 1E5DA 3C6QA 1MP0A 2D1SA 2G5CA 3W1EA 4BQQA 1RYMA 2R8BA 4JSRA 4QNRA 5JROA 4PO1A 3SYTA 3LF1A 3UJDA 4O2LA 4G0YA 5U1PA 1UPFA 1QH9A 2ACKA 3BCUA 3FVWA 1QOZA 2OO5C 3GCXA 3OM1A 1GQYA 3G6WA 2CZGA 3T3MB 5KIAA 4DKJA 5TQ2B 4BPBA 5LA6A 1KBOA 2LUOA 1HM5A 3GEEA 1SD2A 1ISMA 2NQ2C 3ANTA 1JSXA 5AJZA 4CT0A 4MQ5A 4KWTA 1E1RA 4AY2A 4RPCA 4DY6A 3PUWA 4WRRA 3ZHCA 3PSAA 3ZWDA 5CA1F 1FTNA 1HT2E 3PYLA 2GYYA 1S2MA 1YQXA 1WZ2A 4TMZA 3WGZA 5BNIA 3GEDA 1N9GA 1ZMTA 2D59A 4JOSA 1ADJA 3LUHA 4G5YA 2P9JA 5G0UA 1GPYA 2EQBA 3OICA 3HXTA 4FYXA 4J9UE 3RRXA 2VAMA 1GGJA 3FTPA 3SQWA 4JB8A 4LSZA 3MJSA 3KQNA 2FKAA 4ENQA 3JQ8A 4YAJA 4AKGA 2O57A 1GFWA 5F76A 5AICA 3ZY6A 1NBOA 1SQ6A 2W8BA 1LLUA 1W88A 2JARA 5CEJA 1NWCA 1YB6A 2XEDA 3WV5A 3P94A 1JSCA 3RS4A 4YDRA 1C29B 2IZZA 3RFCA 3T3IA 1QBGA 1UR5A 2QTTA 3F3YA 3R9IA 3SXUA 3FRIA 1U0EA 5BVHB 2YXNA 1Y4DE 2P6RA 2YV5A 1WX1A 3OH8A 3PC2A 1V16A 3QU9A 1VKRA 2CUZA 1TJPB 3HXOA 2ZTLA 2OMKA 3ZHBA 1LBQA 3C3DA 4UUBA 3H2IA 4R71A 1WBBA 3SDSA 1BN6A 2WYWA 4RKQA 2I7VA 2K4MA 1PWEA 4BX2A 3J80A 5LLDA 1C1DA 3DNMA 3QFRA 1QP7A 7YASA 4ZVSA 2GF9A 3QX9A 1RJFA 4LDPA 1ZUNA 4O4IF 2Z3WA 4CR7A 2I1WA 4IIBA 1MDFA 5L53A 4MGKR 4W9NA 1JJBA 1M34E 4NR0A 3VR4D 4E6EA 2YNMA 4GC9A 1SXIA 2IY8A 1BGVA 2CCKA 3BDAA 1U5BA 1U8EA 2DTDA 4AMVA 3EVEA 1YBMA 4MW1A 2NVOA 3PXEA 1RJDA 3BD9A 2DYKA 1QGAA 3O5AA 3QXXA 4RK4A 1T6BY 4CLEA 1TUBB 3USZA 3N2ZB 3KVOA 3CQ9A 1AMOA 3ESCA 4V0OA 2ZIUB 2Y92A 1CW2B 3ROQA 2V6JA 2Q1WA 2NVWA 3H1GA 1TU3A 4HMQA 1NVFA 1TZMA 3RK1A 5B7PA 1N9KA 1PNOA 1MKYA 1QF7A 5ICSA 6AT1A 1EZZA 1GG8A 4RYLA 1T4CA 1U3TA 2R66A 4KXVA 4RELA 5IVDA 1VDZA 4BMNA 5K3FA 3LZCA 2TYSB 4QDUA 1JE0A 3T15A 1CR6A 1STOA 2G9UA 1P4RA 5EPEA 2BFEA 3FAZA 4YJGA 1KTVA 2IQIA 1XMIA 4AXXA 3D3EA 1OHHA 4K3UA 3MTQA 5IJWA 4OP3A 4HNAA 1M6VB 1BCRB 2BHSA 1J23A 3WWPA 3OTWA 4FLMA 1QFXA 1KI7A 4I66A 4AU1A 1Z63A 5F9FA 4XTCS 1LBIA 2RGXA 4JYCA 1B8VA 2ZI6A 3OZEA 4NU8X 3CKYA 3K3PA 4MRMB 4YRAA 5JFTA 4ZYTA 1P9RA 1CPYA 3R09A 4M9ZA 3EC1A 3OF2A 4TLLB 1XDSA 3HZHA 3VRHA 1J2TA 1GUYA 3I9FA 3UB3A 3SXJA 1T2FA 2VQSA 4BO4A 3EPRA 3UMMA 5CCXA 3EMKA 1XJ5A 2PSFA 2I4OA 2FFJA 4HUQB 3LD9A 4NMMA 4HWKA 3IIEA 5FA5A 3QF7A 4XCVA 3WLMA 2H7CA 2MYUA 3PQCA 1TEXA 3G5UA 1RMYA 3KU4A 4Q4JB 1YS9A 2ILVA 1CNEA 3GJ0A 5B7QA 1XDBA 4NABA 2VNKA 2XZDA 4CM4B 3VYWA 5F4ZA 1KO8A 3MWYW 2QYHA 2JI9A 3QPVA 1MAVA 3EB9A 3V3KA 4CIAA 3CH7A 3M81A 5CRIA 2QOEA 5AK0A 2F7SA 3KT0A 3M3HA 4YQYA 5E2IA 1YFZA 2PZEA 3A2NA 3OQ6A 1MFPA 5E1MA 1MA3A 5M7EA 2YV1A 3T3PB 1JAYA 3AERB 3ZJ5A 3QKRB 2QJWA 2CCJA 3CG0A 1AVTA 2D3TA 2PGXA 3OQIB 3WSTA 4CM9A 4EPYA 1SA0A 1Q7TA 2QL5A 5ENDA 1C1XA 4PLWA 5CU7A 2W8ZA 2V9ZA 2D0OB 2QSYA 2ZYAA 2AWOA 3GNSA 1NP7A 1WETA 2VBIA 2XOKD 2W0SA 4PG6A 4KQJA 5KREA 2ZBGA 2EWWA 3LDFA 2VNJA 4HY3A 3U0VA 3RKUA 1L5OA 4K9QA 3ADCA 1OPRA 1X1AA 2BBOA 4YALA 1H69A 1FRFS 1HTBA 2OO7A 3TNFA 4EO4A 1HH4A 3WLTA 4YP5A 3UJHA 2RH4A 2ZRQA 3Q6NA 4L8LA 3CX7A 2I3BA 4OOFA 3RADC 4G89A 3I5MA 4OQZA 4KI7A 5C34B 3R7AA 2RGGA 4CF7A 3I72A 1XVUA 4FDTA 4MO2A 4YONB 4HI0E 5J2UA 1ZJ6A 2WLSA 3FSEA 4ARCA 2P91A 5ALZA 2P3OA 4OQFA 3BWCA 5G3ZA 4K0KB 2ZI7A 2FSUA 2IRWA 2YVQA 1GG9A 1M2EA 1U6IA 1KK2A 3D0OA 3F0TA 3PNKA 4IOLA 4YIKA 3TNLA 3U37A 1BYUA 3ESBA 1YU9A 1AKNA 2HH9A 3P20A 5E1OA 2C7BA 4D79A 1ZCFA 3WTBA 2XAAA 3PZRA 4L57A 3KEFA 4O25A 3S5UA 1LDEA 4TPKA 3M9XA 5JNWA 1P9WA 1TXGA 4HQRA 1PZEA 2MHCA 4R81A 4FFLA 4ZZ2A 3I28A 4V38A 5KI6A 2XRYA 2H2HA 5H82A 3D7LA 1TM5E 3L7DA 2AQIA 5J2TA 2UZ1A 1DXOA 3EY9A 4Z51A 3GH3A 1RC0A 5TIIA 2EBUA 4LJ9A 3JD3A 3M89A 4B0OA 4BDSA 1FLDA 3RVNA 4Z1MA 2NXJA 3I6YA 4X0EA 3U81A 1P9NA 3E81A 1PDVA 1BN7A 3RS9A 2ZJ7A 2FHSA 2R48A 1I5OA 3HKBA 2H1OA 5KQSA 1NLFA 2ZSDA 2YFYA 1L4FA 2DQYA 3C15C 3HYSA 1KJIA 3L0ZA 1JR2A 2JFPA 4KE8A 4OG2A 4IDHA 3KJFA 4L5JA 4UMEA 3ZXSA 4DWJA 4O1MA 3W4IA 5REQA 3VDNB 4DUPA 4DWOA 1LRKA 1PWYE 2BHRA 2QN3A 4LV6A 5BR8B 2E5LB 4H6WA 4NHOA 2HQOA 3DPUA 4MUMA 3GN1A 4B2IA 1ZI6A 1QJCA 5DXJA 1TCBA 3X44A 1TECE 4DRZA 3V4LA 3H19A 1P5RA 1DIAA 3N0VA 4QXQA 3HGMA 4ZI7F 5JFGA 3TD2A 4C4ZA 2W2TA 3SQOA 1I2BA 4K1LA 4BNTA 4AJPA 3ZKWB 1DFGA 1Y5IA 3S7TA 1EP1B 4B40A 2CFIA 5KYUA 4QLOA 3FCUB 2JIZA 1M1UA 2YTZA 3EGOA 4B6OA 1RBYA 3COPA 1X1BA 1WB9A 4B31A 2JDID 2VDRB 2QZJA 4KLRA 2R6GA 1IRIA 1X9IA 2O52A 4BMDA 1E9AA 2XWBF 3FZGA 3L7OA 3LQ1A 5BXYA 1JALA 1RZUA 1SGWA 5DGDA 4EG8A 4MITA 3UCEA 2FFRA 4J90A 4NHEA 3GI1A 4ZTZB 5I9SA 1YRAA 3U80A 2EGGA 2FJUA 2HF8A 1J70A 2HF7A 4H59A 3AY3A 2H31A 3AEXA 1DC4A 2QN9A 5ARDA 3N75A 2HT6A 4OGLA 5AR1A 3LF2A 4J6FA 1JIXA 2WHPB 4PLYA 1NGSA 3W8NA 3H2JA 3UAOA 1YRBA 1C9MA 4CNQA 2MU1A 2WW8A 2BFDB 3WA6A 2BR5A 4F5YA 5KWVA 2GN0A 2IH2A 4M9SA 5HZHA 4RQUA 1V95A 3QFFA 4KQ9A 1YR2A 5ES3A 3O1LA 3QEAZ 4HDRA 3GRFA 3ETEA 5LWHA 3A26A 4YCDA 3VOTA 1OLOA 5JZVA 1B93A 4GVLA 1ACJA 4B4VA 4IKOA 2DWCA 2VJOA 3JX9A 5A4AA 2AFRA 4NE2A 2ADOA 1TC1A 1ZIPA 5CPBA 1WCXA 5GQSA 2ZAGA 1N1MA 3L77A 3TRDA 4FP9A 4PLZA 1X0VA 4EITA 3MAGA 4C3UA 1P39A 2AVNA 5CXSA 4Q18A 4O2BB 1I6MA 4IGEA 3VYVA 1RAAA 3IMKA 3SZOA 4UMVA 2GZRA 2QN7A 3QLUC 4FEYA 4JI7B 1X39A 1IQ0A 3D6JA 3NHBA 2HBYA 3PDWA 2ONJA 4EL5A 5KOYA 2DUMA 2YHBA 4IVPA 1VA5A 2GBLA 1U5CA 4LJ6A 3BWEA 2D2IA 4RPKA 1UDXA 4KYUA 1E6KA 5AJVB 1NE2A 2ZJ0A 1P9LA 4ZGWA 1QE3A 1UOOA 5LIRA 3HXPA 3PT5A 2WMOB 3U17A 1OGIA 3HKEB 2V7UA 2WUFA 4M83A 1L7MA 2PWPA 4A10A 5A3RA 4FMBB 1OLUA 1K97A 1O96A 1LNQA 4R2IA 5D5QA 4S12A 3GH1A 5AJWA 1UKBA 3MXTA 3V33A 3ID6C 1IVSA 3CRMA 1VE1A 4OK5A 3PDUA 2JGDB 4GX2A 5FYDA 1CDEA 3IQZA 5JW6A 4EWLA 1BIFA 1P1JA 4C0JA 1E2MA 4QYMA 5DM70 3UH0A 1SQFA 2AMLA 1R5JA 3IP8A 2LCIA 1NQVA 4EJ0A 1JE1A 1N0VC 4TS9A 3VO1A 3ZTWA 3CE6A 1SELA 3TE6A 4QPCA 4BJHB 2IHVA 2BWJA 2JFOA 2OENG 1IN7A 1GGKA 2ZI4A 3DMPA 3FSRA 4LX8A 4NMLA 4C7VA 1EVKA 1R15A 4MEBA 5H59A 3VV2A 3CCBA 2P1ZA 4H7HA 3TLBA 1T9KA 1G63A 1K7CA 1QVAA 4LYGA 2D13A 4ZU1X 1LD3A 1NVMB 1O97D 3DE1X 3O2QB 3GGCA 4FYJA 5IFKA 4C6HA 4C4OA 4L4SA 2ZJ1A 3MEQA 2OHOA 3PQ4A 4Y2SA 5ARCA 2W2LD 3IP7A 3SZLA 3X1YA 1ZUWA 2H7YA 5DP1A 2O1SA 4NH4A 4FB4A 1SBIA 1G8HA 3KFXA 3PRJA 4RV5A 4UXHA 1I6LA 1R64A 2WWHA 5DH9A 3Q3JB 5IBCA 1WCYA 5JAIA 4BXOB 1CVRA 4GRDA 2EP7A 4IFBA 5TRTA 1ZMXA 3WOVA 3EEIA 1FS6A 1SUSA 3H1AA 4L7QA 2BEKA 3TVDA 4I50F 3G8CA 1GTVA 1SU8A 2ID4A 3O3NB 5LP6B 3RLFA 3R3UA 3QW2A 1AKEA 3QIAA 3UMFA 4IJQA 3I9V1 1OI4A 1YFJA 3AW8A 2GRUA 2I87A 3HCEA 2IPNA 2RHGB 1JILA 2I4IA 1RW4A 2JIMA 3TL3A 1N3IA 1WU7A 2BY4A 2RGUA 4HPWA 1A4UA 2GD2A 1ZVVA 1GU1A 2P1DA 2JA2A 3G2HA 3KUUA 2R6DA 3KJXA 4H1UA 4ZJZA 1JFTA 2O1XA 2ZR0A 2QE7D 1OE0A 3WGNA 5H9WA 2C7OA 1TFUA 2HF9A 1DE0A 4HDNA 1T2UA 4NFLA 5LBTA 3DOCA 1EK2A 1V9LA 4BQRA 2NM0A 2EYUA 1JZSA 3HVRA 2OG1A 2KB0A 2XSZA 1CZOA 3DPIA 4KAFA 1NURA 4LRQA 2Q45A 4NNPA 5B1YA 2O54A 1LVUA 2GVDC 2VWQA 4HC4A 1W85B 1G19A 1PCXA 3VV3A 1EP9A 5TQ0B 3W8DA 3D9QX 2CUTA 5DLQC 3CVYA 2W22A 2BH2A 3I8OA 4RPJA 4IMIB 3BB3A 4C4TA 1XAGA 4KTVE 3RC9A 3UMRA 3F97A 4G1CA 4I36A 5C5IA 3ETLA 1W0JA 2Y0DA 4MVWA 2OV2A 4ZOAA 4ZQIA 1S3SA 3P2JA 4EHIA 1TW2A 2IE0A 2REOA 4GOLD 4NESA 1TK9A 2GCOA 3MLEA 1JBQA 1R27A 3QPCA 2IZ0A 5IC4A 3IDQA 2R7KA 1QH8B 3AVQA 3HCRA 5JXGA 4YREA 3ADDA 4H77A 4ED9A 1E2JA 4EVRA 3IDSA 5DYWA 1W4RA 3TYXA 2PSSA 3JQ9A 1WUYA 4X64B 1GA4A 5IF3A 1TCCA 3KEMA 1WMEA 3DV0B 3TDNA 3NBAA 1GUFA 4LE2A 4RLSA 4KPFC 2QG4A 4LDQA 4DCPA 1GQQA 3A6ZA 3WXMA 3L0IB 3EXIA 1W5SA 3OLWA 1XALA 1S3GA 3SBXA 1OX6A 1WE2A 3R5JA 4C7MA 2AFHE 4B4KA 5EUBA 3FE2A 2IYXA 3EFOA 3UC9A 5AXDA 2PR7A 4UHEA 1LA2A 3LFHA 1J8MF 1VJTA 1LH0A 3RU2A 3M4YA 2G17A 4CM1A 3AKDA 2I6GA 3O4GA 2AC4A 3K0KA 3IODA 5IAGA 3DTVA 2PO7A 2QY6A 3HNPA 2RHMA 4TMFA 4AZ3B 3AH8A 3GNTA 5TR9A 1N2XA 3P5SA 3VKVA 5C4MA 2X23A 4GI3A 5I7VA 2EFJA 2RCYA 3GGGA 4GUAA 3TLKA 3MS4A 2P8SA 3N3AC 1G38A 2FCAA 3JQBC 2R25B 1TD9A 4IHJB 4URUR 4F86A 3HI6A 5KTYA 3GLFE 4NBRA 4DW8A 3MJCA 4F56A 3IVXA 1J8QA 1T0JB 3O4RA 2I29A 1Y3DE 3TFQA 5IG2A 1JIIA 1LWNA 1H8ED 1R9MA 2B30A 2NW6A 2VPIA 2ZETA 3EYWA 3LVRE 2JJQA 2MT9A 4LV8B 4AO8A 2DPYA 1UQTA 3JR3A 1X7GA 2H3EA 1HE8B 2P78A 3ICPA 4PYOA 3UZUA 3GDWA 3HVKA 4QM7A 1PLLA 3HA5A 1CS0B 3ZH9B 5LOVF 4EL0A 3AHCA 5ALXA 3D1VA 1U6JA 3AI1A 4BGDA 3S27A 3QE0A 4C5AA 4HAZA 3T5CA 3L4JA 2VDJA 1UKYA 2XQGA 3H2KA 1K68A 2JHGA 4Z0TA 1XF1A 2GPSA 1LX7A 1G20A 4RPGA 4ZVQA 1NOJA 1J07A 1UDAA 3DE2X 4UEQA 5ICCA 2ZRAA 4RCVA 4YMHA 2PJZA 3C3KA 4R9RA 1T8PA 2NU6B 3RRJA 4YK7A 4IIXA 1BD4A 5MN4A 1YR6A 5EIBC 4I14A 2EWVA 5CH5A 3T7SA 3QF4A 1A5AB 3UJ8A 1E58A 4LJRA 4K28A 3E9EA 5JYDA 2DSNA 4RAQA 4OLBA 1U8CB 2I1QA 1U7DA 4P33A 4MS1A 4DT1B 1CFJA 1EFHA 1F8UA 1HDRA 3D2CA 3KTAB 3MCZA 5MF6A 1JDPA 3BIWA 4G36A 1YCHA 2X2EA 4I2NA 2ZQZA 1K6JA 2PRSA 4MR9B 2PKQO 4RAOA 3N07A 4E5DA 3TSAA 2FRDA 2XGSA 4BZQA 3CUSA 2BEJA 3P52A 2Y27A 2VK2A 4U5XA 3RTDA 5JBNA 3F49S 3Q3HA 4BIMA 2ZM6B 4NVRA 4DQKA 4ARVA 3RVDA 1YQGA 2C99A 5CDYA 4QEKA 3OA0A 4YAFA 3I9OA 1GAJA 1KI6B 1T3GA 4KIWA 4UXIA 1EA5A 5CNMA 3UHJA 2H3HA 1IJFA 1IH8A 4D99A 2YCLA 3TQTA 3TL6A 3C7CB 3MCUA 1WQ3A 5F1PA 4W7IA 1P74A 1FUEA 1Y1RA 2G9RA 4YR7A 1GAXA 3AUUA 2FKNA 4LS3A 4X3CA 2ZJZA 4HJRA 4TTJA 3W4KA 2WSMA 3WYEA 2HTFA 1PJLA 3BWBA 4IZ6A 4C76A 5TPZD 2Q3MA 1JXOA 2NQTA 4Q4LA 4UU8A 4O02B 1LJ8A 5T4EA 2BGMA 2YS6A 3TMAA 3WLSA 4Z7OB 2O8CA 1WSWA 4V03A 3DB2A 2CNWD 1VL8A 1NVVQ 1JBEA 4XTRA 4BVAA 5LWQA 3RNOA 3PUVA 4EB8A 2H8GA 4KN6A 2B8EA 3WK7A 3FDFA 3H3FA 3MJEA 1EWKA 5D3MB 4ZAWA 3U3XA 1N6NA 1MRZA 1NBME 1S7GA 2IODA 3GW8A 4AYWA 1XFDA 1XZEA 3FVTA 3H9UA 2R6CA 4HEJA 4CQMB 4LSMA 4D92A 2QR2A 5IPFA 4PGMA 1G8FA 3L0OA 1VJCA 3IPXA 4HX5A 4NBLA 4S05A 2VZ0A 4RMNA 3NEYA 3JAWA 2QM3A 1W5AA 3O0DA 1Y82A 2GVNA 1DU4A 1DQPA 1Q11A 3DBLA 3LCUA 3A9WA 3NJ4A 2FG7C 2C1XA 3MWFA 4GH5A 1Z3IX 1WUTA 1MNAA 4H08A 1JPNA 2DTXA 4EY8A 1HMYA 5TVKA 3M4NA 2A9RA 1HQCA 2C8VA 2HJVA 2Y1GA 1GZUA 2ZBUA 4AP9A 1H6AA 2B4QA 1J1UA 3IUMA 2DQSA 3ESDA 2Q4RA 4FINA 1YDHA 4QYSA 2AQ8A 1O4VA 3PPVA 1Y33E 5BV0A 4G37A 5FFFA 2ZR9A 3EUAA 3UJ6A 2VBFA 1UK6A 4CV1A 2B35A 4KODA 2XY4A 1THMA 2ZVPX 4HRXA 1F17A 4JEUA 3SFZA 2C5SA 5E3HA 1Q0HA 2R11A 3E5NA 1ZOLA 5FBQB 3X1JA 4WBNF 1NBWB 2DBZA 3VBEA 4WEQA 1G55A 4KLNA 1O03A 3JCZA 1B2LA 1QV7A 3VJLA 5JNVA 4S0ZA 1N57A 2QN1A 4RV9A 3NT2A 1JEAA 5H02A 4TUYF 3GJZA 1IOVA 2ORYA 4TZ6A 2E1PA 2PWAA 2YXPX 3R4VA 2FZ4A 3NALA 1NAIA 4JJ4A 3E2IA 4ISCA 3VU9A 3AR8A 3WHPA 3CIFA 4UVEA 5CFLA 4DIMA 1I4TD 3MK31 4HAUA 4LJYA 4RQAA 2GR9A 3C7AA 2IOHA 3CUVA 3OEEA 3TRIA 1NYTA 1P1CA 1Y8RA 3ITNA 1E3TA 2NVUB 1R9NA 1DBIA 1TLLA 1EB9A 1BS1A 4G07A 4YT5A 3NBQA 4RETA 3AVXA 2P11A 4K6HA 1PRYA 4X8HA 5BV8A 1KJYA 4O1IA 2I4LA 4TQ9A 5DN6A 4UDNA 1L2TA 4RIGA 4TKUB 4GF5A 4GSYA 4X84A 3TQCA 3KJNA 2C0QA 4XQ0A 4KIGA 1OBVA 5HE9A 5JVDA 2GSWA 5GINE 4ER3A 2PVCA 4P4SB 1B8OA 1KGDA 2R44A 3KEOA 4LZJA 5LKRA 1XZBA 3ET4A 4C2TA 1RU3A 2FPIA 1DDGA 1YAJA 5I47A 1DXQA 3IH5A 3EGVA 4U3JA 1FBNA 2FZVA 1FL9A 2ZIVB 3O2NA 1ESCA 1TTQB 1GGNA 3Q0EA 4J6EA 1L1RA 4QTUB 5A3SA 4GG1A 3QRWA 3GZNA 1YKFA 4O4JA 3IAS6 4X7BA 3O84A 1PI3A 2X2FA 3OCVA 1D2NA 3PXGA 1KPGA 5FRDA 1FFCA 2DFPA 4B79A 5FTLA 3A9UA 2RBEA 4AYXA 3S68A 4NXNB 1S2OA 4L76A 1EVEA 2W6JA 1M1YB 3N2YA 1Q12A 4WK2B 3GRPA 3W06A 1JI0A 1SY7A 2RB5A 5AVJA 3AVWA 4G0QA 2QSUA 3QVMA 2XT6A 2H4FA 4XJTA 1N5DA 5D8DA 3KOMA 1W1IA 3ZS8A 3T4EA 1I2ZA 1Q21A 1DFHA 3OSZA 1NJ8A 1P0QA 2WUEA 3DE4X 3OY7A 4HAVA 5EIXA 2C4KA 2I8LA 3OZVA 4RE5A 1DP4A 1C30B 1NZFA 4Y3UA 3V4ZA 4KMRA 4BP8A 4M9CA 3RREA 1Q0LA 3OOHA 1AZLA 4I9UA 1QMGA 3QM1A 5KNCD 3E3NA 2OD7A 4NDZA 4O4HA 4PZUA 4CKBA 3GXBA 3TOVA 4LMPA 1NUAA 1VI2A 3EK2A 1YZLA 3V8EA 4ZDJA 1T1IA 2HB6A 3EWNA 4PU0A 2PBZA 4C03A 3OD1A 2MSLA 4DARA 4MHTA 1Y3BE 1IK4A 2BFCB 1XT6A 3BTSA 5A1TA 1KXJA 1U0OC 4PCUA 4UHCA 3EIQA 4GEGA 3LI2A 3L4KA 3K0HA 1ZD8A 1EFUA 4QVKA 2HAEA 2IC5A 3SP1A 3ABQB 2OVFA 1EAMA 4S2EA 1RYZA 5CR9A 4N40A 3P9PA 1A97A 5IDXA 2QRUA 2FSSA 4LVOA 4J0FA 4DM4A 1CP2A 1YOBA 2PH1A 2SKDA 4DJFC 1L1QA 2JZNA 3P8ZA 4OQYA 4B3MB 1CEYA 3LO5A 4BNMA 3F74A 3U1BA 5BOVA 5FPQA 1X7WA 3FOWA 5CK5A 1DTSA 1ZOSA 1QTIA 2RHDA 1MIHA 3FUUA 4GYKA 1BU8A 4TLMB 1NP6A 3K9LA 2X0KA 3RSSA 3M5WA 2BEUB 2H1LA 3HNOA 3I2JA 3COYA 4EENA 1DKPA 1WPQA 4IH9A 4C0QC 1VECA 2XWSA 2G40A 5EC8A 4E5NA 3RU9A 5YASA 1IU9A 4P7GA 2BI4A 4EMUA 3B52X 4RHYA 1GPDG 1T29A 1EM8A 1ZRNA 1C9KA 3BWVA 4R1QA 1PEYA 2JEYA 3CNEA 3L02A 3NWOA 4JJ8A 2B9VA 4UUAA 4D5EA 3A6GA 1JDBC 1OBHA 4IV0A 3WLNA 2P9CA 2G9VA 2K5UA 4D4KA 2OHHA 4HDMA 3L8CA 4QREA 5I3ZA 3U2QA 1C0LA 1CDZA 4LF9B 3ROMA 4ND6A 1V5FA 2ASEA 3C6YA 3EG5A 1Y8ZA 1SHJA 1RWMA 1MJGA 2GJKA 3QW4B 3NFRA 5IN4A 1IY9A 3QJ5A 1GGFA 2W48A 4WCDA 4R7GA 4GKBA 2C7RA 3JZDA 1JS1X 1YJ8A 4OJYA 4WERA 1KFCB 2VBGA 1YIOA 3NOOA 3NYRA 3PUYA 4JYMA 1J49A 4X3OA 2AT1A 4E5PA 1EUDA 1R6VA 3PQ8A 3A25A 4WBXC 1VYTA 2EYQA 2Q50A 1R0WA 4PAGA 5FF9A 3WG9A 1M54A 2I62A 2O7NA 3H13A 4RVDA 3WGUA 1A5BB 1EGVB 5G2OA 3EGXB 3GT3A 5FUXA 2PKXA 4M87A 3UB2A 2GXSA 4ZA2A 4GHWA 2E21A 2Z56A 3I1JA 4MPDA 2XUZA 5EL0A 3A3YA 3ZWAA 5K45A 1EWVA 2X4IA 5IABA 1WXHA 2IXEA 2FSPA 3FCOA 4ALLA 3JYHA 3H6KA 4BNZA 1XLUA 2CWDA 2H5JA 3DEZA 1EJ0A 3HKDB 1RP7A 4WA8A 4GZLA 1SCUB 5K3EA 3VH2A 2PM8A 2O8FA 3EGEA 2IPXA 4RTJA 5C53B 1PTKA 2HO5A 4C29A 1XXHA 3VXKA 4H2DA 1FNBA 3EXG1 3CU5A 3QKTA 4CUZA 3GT4A 1U1EA 4H3VA 1UBMS 2WU8A 1VLJA 3B82A 5EMNA 5LZ2A 1ZK0A 3O82A 1IEXA 2WHQA 1WZCA 4G0NA 3N2GB 1ISGA 3JXEA 4REOA 4DDKA 1BXRA 1THGA 4Y6GB 1T1JA 1CQWA 1ORIA 1CIVA 1QRDA 1X2BA 1Z6TA 3I64A 4PX9A 1YSCA 3K9BA 5FO0A 4LQCA 4LF7B 3PJEA 5COAA 5IHXA 3T4UA 4RF2A 5B36A 5KNDA 2HQ1A 3HU2A 1XMVA 2NZ2A 3KG2A 4ID3A 3D54D 3GLGE 2F67A 1DCKA 4YP0A 3IEUA 3L1JA 1UBOS 2IVZA 3L0BA 2RKBA 1SB9A 3A28A 1DDOA 1J0AA 3D4OA 1EINA 2I6UA 1M6YA 3ANLA 4FDMA 4I19A 4QASA 1EJ6A 1F4VA 3IELA 1CB0A 1BXKA 1IZZA 4IG4A 1P2DA 3FHLA 3IULA 3KXLA 4S1VA 1NW8A 5JXIA 2RE8A 3B53X 4AXBA 1N0HA 4TTIA 4A26A 3NM6B 4LXYA 4D8UA 4TKVA 4RK0A 4YCNA 2RGAA 2D2VA 3A10A 1D7OA 1DAPA 1K3TA 1O8BA 2JGMA 2QLMA 3NEJA 1L5LA 2P5UA 1CWUA 1TPZA 3G8BA 4QTYA 1SC6A 3M2PA 1OPXA 3TAXA 1YHZA 4P4GA 2WY2D 3GUCA 2ZRDA 2PGIA 4NOKA 1X1TA 2Q8PA 3KR0A 2F2TA 4KR7A 4OJQA 2H1VA 1HLDA 1AO3A 2ZRGA 3IVAA 3Q8MA 3RVOA 1AKMA 1P29A 2ZU6A 4RTPA 4UUNA 3JQAD 2EW2A 3F6SA 1L8AA 1Z5NA 1SKYB 3IJPA 1BH2A 5GONB 1OXVA 1TO1E 2GPWA 4GLLA 1VIAA 2FP3A 4I0WB 2VYND 4JP5A 4TTAA 1F9EA 2BR4A 4CL2A 2X0IA 3B1ZA 4KO4S 3LT4A 1ZAYA 2GAJA 3OBBA 2QMYA 4OXIA 2MTBA 3AFGA 1RBQA 1O54A 2J5RA 4TKLA 2CNBA 2QVXX 5EFZA 2O2XA 3U3KA 4KIUA 4DCOA 5AJUA 1JIJA 3E7WA 3IBCA 1E18A 3INNA 4LYAA 4XXHA 1DAMA 2DBYA 3UWSA 4YAGA 3OT1B 2XCSB 3O4HA 4BO5A 4EQZA 3C7KA 2GS9A 4IHQA 4KYVA 4MSUA 1OTHA 1R4AA 4YCBA 3QVSA 4P54A 3S3TA 1RXSA 4CKCB 1SCIA 2AKEA 1CUYA 1PZGA 1QHEA 2FE4A 4R54A 5L4SA 5AM1A 2IV7A 4CKXA 5ITZA 1B00A 5L3ZA 2WQZA 4W8HA 3TJRA 1F0KA 3RE1A 5AVZA 1ODCA 2QMUA 3FKJA 4EFKA 1FOEB 3MJTA 1A50B 2XCUA 3PZBA 2IPLA 4F91B 4EO9A 1T4BA 1KRXA 1DIRA 2OORA 2Q29A 3UUWA 3SIWA 5ABPA 5IANA 1DVRA 1WQ1R 1RACA 4HS9A 4V24A 4ZRMA 3CWZA 3B1KA 3B78A 3LUKA 2VKQA 1VFPA 1KERA 3TK1A 2O5VA 2HJRA 2GBGA 4DA7A 5FPSA 3T12A 4BP1A 1GRRA 1TVEA 5BNZA 4XWGA 1L3IA 5DV9A 5CNJA 2HHAA 5DBFA 5DRTA 1CS4C 3ORQA 4JY7A 1Q50A 1VPLA 4QOHA 1I4DD 2AC7A 4LTNA 4XGRA 1FW8A 5BUZA 2C3OA 1NMZA 2SECE 5EVCA 3OKFA 5BXQC 2JBAB 3Q3IA 4HNVA 5P8WA 2BLNA 1E4EA 4KO8A 2BFWA 2ES4A 1XTPA 4P08A 5AW8A 1EYZA 2IY7A 3QBEA 1IOZA 2Q1YA 2FRXA 3UNXA 5C8YB 1MT0A 1J21A 2BHNA 2BJWA 3TCKA 2FW0A 2FUG1 2C9DA 2GK4A 2AKAB 2ON6A 3H86A 2XWJI 1HWYA 1Z29A 2AZ4A 4QYIA 3OPYA 1PTJC 1US8A 1NMYA 1D0SA 2XUKA 3F6RA 3G2QA 4KOEC 4EYOA 3R5HA 5MGBA 1N36B 2WRZA 3SC3A 3TMYA 4DR4B 4PM4A 1RRGA 1GTZA 1D1PA 1JDVA 1T8WA 2C4WA 3ZDRA 4BUJA 4A8JC 1JR6A 3IQEA 3OOWA 1RDFA 1DBQA 1OYOA 3PR2B 4WJLA 2W6ZA 4BS9A 4YRDA 2J3HA 3OEHD 5JG7A 1SXPA 3W78A 4EELA 2AW3A 4W5TA 4U4AA 1FPMA 1RHUA 2QX8A 2VEOA 3I5XA 1C4XA 1TKAA 2JZOA 3OCJA 3W2TA 1RPAA 4X5OA 2IUSA 1TKRA 4F2PA 4C7XA 3CRRA 3ZZUA 1I3CA 1ZCJA 1VCIA 3IVMA 4KHZA 4Z7QB 1J2UA 1I3KA 1QZZA 4U0KA 3DMDA 3NTRA 3SU8A 3ND7A 1H66A 1RKQA 1BQ3A 5ALVA 3UG7A 1N33B 2IY9A 3NT5A 1KF0A 1RVDA 2JIRA 3R41A 5CBPB 2L2QA 3OQMA 2QP3A 3PP8A 4BGVA 3VSEA 4GL4A 4KXNA 4B82A 3BX1A 4BO8A 3GN2A 5E1BA 2FOIA 4ZT7A 3IMCA 1WV1A 2Z57A 1WF3A 2KPOA 1OXTA 2M9MA 4D9BA 1DBRA 1NW7A 1XP8A 4M7RA 1ORDA 4RQTA 1DTWB 1O4WA 2R00C 3K2IA 5EWMA 1I3OA 3NH9A 1I3LA 1XCPA 3FZNA 3WLKX 3COWA 4OHZA 3X1DA 2C83A 2FQYA 4PX3A 4NI5A 4Z0HO 1Y0BA 1NI4A 1P19A 4QUIA 4BQEA 3OFND 7REQB 4KN8A 3WLHA 5JSHA 3BA1A 3W7BA 1BKDR 3ROEA 4DM7A 3A1CA 3N0RA 9LDBA 3NW9A 4NPHA 3H6GA 5HPYB 2XYGA 3OJ0A 4EGQA 1RFGE 2G0NA 4ZZ1A 4IMPA 4H4EA 2QRVA 3MRVA 3ZKAA 1XEXA 1V8DA 1WDKA 1NSTA 1O1YA 3MMNA 3OLYA 3PJDA 1KI8A 4FYKA 1RC8A 2IJGX 2KYRA 4FBGA 2WINI 3SOPA 1SKUA 4TQGA 1FJHA 3FPHA 4BGEA 1T6ZA 4JLUA 1GZVA 2PX6A 3JARB 2ZREA 1GU0A 3IB3A 1SHZA 1OU0A 4XI9A 2RMKA 1Z3CA 3BCHA 3BUSA 3GFSA 1W0CA 4DLPA 4HNQA 3IEKA 1JEOA 1S2DA 2ID7A 3ENWA 3OOJA 3Q15C 3UV6A 3CJRA 3H84A 3HCOA 3ICOA 5DLEA 4B3XA 3W5CA 2CHGA 2Y9MB 3EUFA 3Q9LA 4BO7A 1J06A 1RKUA 3GYBA 5EE9A 6LDHA 1O2DA 1C7ZA 2IX9A 5AJXA 2VQ3A 3QXGA 1HV8A 4CDGA 2A0XA 4RKFA 1D2RA 1DIHA 3BL8A 4IF4A 1HGXA 2XADA 2IU3A 3HU5A 4JQYA 1L7QA 3C3EA 4JSYA 1D0IA 5LUBA 5EHXA 4WZAA 1F06A 2WJ4A 2VZEA 2PZBA 4MKFA 4X24A 4Z9AA 3WIUA 2BF7A 2CBXA 4IFIA 4KL8S 4IY1A 1PU2A 1MQAA 3BMOA 3C2QA 3CX8A 4XDGA 5HBGA 5JAZA 3WDMA 2HKIA 3EXHA 3PC3A 1T36B 1JXQA 4O59O 3TM5A 4NSNA 1OH5A 3W3AA 2OSBA 3WMGA 3FVVA 4X6UA 3JQFA 4S0XA 4EFLA 3ASVA 4R8RA 3WYGA 1SXJC 1HORA 3FX2A 3RAFC 1MOZA 4OJMX 1FJXA 4OO3A 4WN9B 2CV2A 1YQEA 2QRHA 3N2EA 3LPCA 3KPJA 16PKA 1I3MA 1ZMBA 1EXNA 2BBWA 1GQFA 2C2YA 2DRIA 2MDTA 4L9SA 5TY0A 4IV8A 4GZ3A 4AJ4A 5F1OA 1AUOA 3SSMA 3WIBA 3SHTA 2WPDD 5HE8A 4JGIA 3WKAA 3E1KA 3CWCA 4B7ZA 2O0KA 1N6LA 1ZN9A 3HB9A 4HAOA 1PQUA 3I4CA 3PFFA 4B81A 1ST3A 6REQA 1GZ4A 1UF9A 1CRWG 2NUPB 4PYLA 4XR9A 3U5TA 1W5EA 4C3ZA 5TQJA 3OMXA 2QUAA 4MVJA 5EMJA 5DT2A 3NMUF 1R2QA 2E4YA 2WMDA 3OOEA 4NL4H 3KKOA 3ZCRA 3BXPA 5C1DA 1S4QA 4BKMA 3WYCA 4N6GA 3E9YA 4YRLA 1COZA 1YJAA 4MH0R 4Q7QA 3DZGA 1WTCA 3GEHA 1AIPA 1UMCB 1D1TA 3G1UA 1L8LA 3FXAA 3AKZA 5IBQA 4RMGA 3FYHA 3IBFA 4DCUA 1SURA 1AGRA 4IJ5A 1KC3A 2LIPA 5DCYA 4XUCA 3DAFA 3DDOA 4LQ4A 4WZ6A 5TB5A 3RAJA 4XYLA 4E7PA 4JXKA 3IA7A 4NAUA 4AIIA 1H23A 1FRVA 3OCXA 3EN0A 2I2AA 1U3CA 2F62A 3CH5A 3B20A 4NCNA 5E8RA 1E2DA 1HE5A 2FK8A 2XA2A 3WWZA 2IUTA 3ASZA 3S29A 4AECA 5B4TA 5LFAA 3EASA 4U6QA 4W5WA 2JBHA 4DMFA 4JLMA 1QTRA 4ZI3A 2IZ6A 1NBMD 3MGKA 1UJ2A 3M82A 5AK5A 3HFJA 3IX7A 3SF8A 5B7GA 5JNSA 4M6WA 4GR9A 3V2HA 1R6AA 2YVUA 5LZ8A 3WHKA 4FHDA 2YWFA 3KKEA 5BYJA 2YMLA 1Z4KA 2P9ZA 4GQBA 2G0TA 3Q5EA 3L46A 4OBBA 3CGWA 3GNQA 5B6PA 4MCJA 2P2CA 4J0QA 3A6PC 1ODIA 2ZWMA 1XLVA 4ITVA 2HPAA 3I73A 4NFSA 4B8ZA 4JXXA 5AK4A 4JC0A 4A6PA 2F1JA 2WIFA 3RT1A 3D02A 2OBLA 3L6EA 4RIFA 3UTDA 1XPOA 2ZJ8A 4YMSA 3TEJA 1CY6A 1IAQA 1E6EA 5K8TA 4PX5A 5AW4A 2EZ4A 4JKOA 3QZUA 3CF6R 1KO7A 3SHQA 3G13A 3G8YA 1PJ2A 2AJTA 5CT4A 4O4IA 3ILXA 4GKJB 3SSOA 1WVMA 4OYYA 2G9NA 3G17A 4FOPA 5H0IA 3I5AA 3WK4A 2NO9A 4IW3B 2JIBA 3FMGA 3LUGA 4MHOA 4TS4A 4AQDA 4ARZA 3R7DA 4RD1A 5L4NA 2HYIC 5KAPA 3U3MA 1YU6A 2O7VA 3BXXA 3WQRA 5BWMA 4TM8A 3EVDA 1I0ZA 4E15A 4J1SA 4R9UC 3CUUA 5M5BA 4M0MA 3IERA 1L8QA 5IT0A 4IEFB 2DHEA 3KKNA 4B3HA 3G9TA 1ZGZA 3A2MA 4HH3C 4JIGA 3HG7A 1XXLA 5LR6A 1PBTA 1FP4B 5GJVC 1U9IC 1XROA 1ZNZA 2PXCA 3KZMA 3GMIA 2WAMA 3EUWA 2NG1A 2PKQP 5IARA 1EJ2A 3RFXA 4CUKA 4HT3B 1OAKA 1WZEA 3GWZA 5CT5A 4PQRA 1D09A 3DBVO 4DQ0A 4CPDA 3ZI4A 5F3WB 4IDBA 1V8OA 4QUHA 1EH5A 4GI5A 3H17A 2NAPA 2B1RA 2ZRBA 4XIYA 3CEMA 1TJ4A 2NO0A 2OO5A 2EFHB 3ZV7A 3CNBA 1ESEA 1LCIA 1KP9A 3BXOA 4YRJA 2HRCA 4RZHA 1XTSA 4UZFA 3PGJA 3UXEA 3E4DA 5IJ0A 4JYPA 4J7UA 3RVPA 2QD2A 3DDCA 4Q1CA 4CYMA 1J9ZA 1T9GS 1GARA 5BPHA 5EUQB 1G6Q1 2VDWA 4AS3A 4B3JA 1QO0A 4CG0A 2B98A 2QL9A 2A7QA 3AHFA 5IC5A 3AHIA 4QO7A 4KJZA 1MTOA 4GU5A 4IJMA 4LA4A 2HA3A 3QXJA 1CZHA 5AWFC 1IJKA 3VR1A 4C2AA 4C4XA 2ABWA 1YR8A 2WE7A 1KKLA 1QVVA 4KX3A 1KA9H 2VT2A 4MWSA 3BH7A 2CFTA 3IKLA 5C52B 1X9HA 3OX2A 2FPLA 4H6XA 2XYVA 4UPDA 1D5CA 3EWIA 4NYJR 2J59A 5L40A 3FRJA 3SBDA 4B6QA 4WUVA 1GHTA 3KZNA 4OQNA 4MS3B 5CM9C 2ODTX 4ESOA 5TT0A 3T7IA 5TS2A 2GPBA 5BWCA 3AV3A 3F96A 5JPCA 1B3BA 1UDBA 3PGA1 1RI3A 2G4VA 3SJ7A 4F84A 2NTJA 3DEIA 1ORHA 3QELA 3H1EA 1YRWA 3PHCA 3T5MA 4MKHA 4BO2A 2O7RA 4YMTA 2PL1A 4HKTA 4BAUA 1U0NA 3JVVA 4ES6A 1WULS 4PSDA 2AK2A 5BUQA 3DF7A 2BGJA 3V32A 4RTNA 2OZKA 3WXBA 4EF6A 3EVNA 2HDHA 3ZV6A 421PA 2X8WA 1H4QA 1HSOA 1MMFB 3BWDD 3ZWBA 4BWYA 2ASVA 3OQJA 4A0FA 2N42A 2WWRA 4G1VA 4RXTA 2PGLA 4MINA 4B5LA 5I48A 2RHHA 1XVVA 4UE3S 3RKRA 2EARA 5K6TA 1NF8A 1GZ3A 3BZBA 4NLLA 4YAKA 4L3OA 1TMKA 3FDZB 2ZULA 3KSRA 4C4YA 4HVLA 1ECJA 3IXMA 4Z4QA 3C43A 2OV8A 3IBSA 4EZEA 10MHA 4D1YA 3KYCA 5I3CA 3M6AA 2FPWA 5AI8A 1M2KA 1QWSA 1UL1X 3UGJA 3H05A 2GTHA 4HGOA 4CKEB 3L8DA 5DNDA 4NNJA 3RYHA 1CJMA 4EB6B 4KPEC 1AD2A 4DYHA 3PXDA 3T9BA 2GPTA 2BKUA 3X2EA 2TS1A 3WGYA 2BFBB 1VPDA 1XZQA 1VL2A 3R0IA 4DBVO 1OCEA 1CDDA 4IXTA 4MS4A 5DSXA 4ER6A 1DC8A 4F9EA 1IPFA 4JJFA 4ZYZA 4N47A 2LPMA 5LQAA 2QORA 2WF9A 4K9RA 1CXZA 1UMBB 2CMKA 3CPJB 3JQ7A 3N8NA 1GNPA 2L69A 2Y66A 3NHSA 4PWYA 3A4NA 5JSYA 4CT4B 1CULC 1MLDA 1T8SA 2WBLC 4Y6LA 5EP2A 3I52A 1JV2B 2ZS9A 5E3JA 1BCSA 1XTUA 1LF0A 1V2HE 3ETJA 4L73A 1EG7A 3CLTD 5D6OA 5IBPA 3WLLA 1UT6A 2P9FA 4YIHA 3EUEA 2RJ3A 4PN7A 3I58A 4XPZA 4OD0A 2PPVA 2ZJBA 4X62B 4GBMA 1GGVA 3QPBA 5TPWB 3V42A 3KCQA 1VHLA 3H8SA 2AOUA 2HCRA 2PX3A 3ZH2A 5LQCA 2PE5A 3N8KA 3NOQA 4MPRA 4ZRNA 1ML4A 1OC2A 1NF3A 1C3OB 2ECOA 3EOBI 4FCTA 4CNBA 4EGAA 2F6RA 1IATA 3SR3A 1BX1A 4XCQA 2J9FA 3G2NA 1FDRA 1XTIA 3RSCA 5LDHA 2O2JA 4EF5A 2OSVA 1YA4A 1F5SA 3EIXA 3P0EA 4L4UA 2CDCA 2WSSA 2A1UA 4MCAA 1EJBA 4YECA 1THZA 4ZDWA 3STXA 2GM4A 1KFKB 4MIEA 1A82A 3V46A 1Q0SA 5BYKA 1ODSA 4BGUA 3EEFA 3SBEA 1FXSA 3UK7A 4EHJA 2CF5A 1XTKA 3IP9A 3K70B 1YHYA 1X42A 5C8DA 1JDJA 2AFVA 3HL0A 3JRNA 3TJZA 5EE5B 1LK0A 2ZRPA 3LWBA 1ND6A 1QKIA 2X0JA 3VOSA 4Z4CA 4EA7A 1FS4A 3O8LA 3TECE 1ABFA 2AOTB 1E0JA 3GPLA 1GKLA 2Z0MA 2ZYDA 3MBKA 2G5TA 2ZI5A 1IG3A 1CUCA 2A9OA 3OFVA 1F2VA 5FI0B 3PWTA 5CDUA 3EA0A 3GLVA 2Z5VA 3PUIA 3CFYA 1K0FA 1OZ0A 4YJHB 3UJ3X 3K6SB 1RI1A 1ZCZA 1M1YE 1HT3A 1XYVA 2IEZA 1E64A 1JG1A 4RFLA 4FYHA 4D6PA 4DLAA 2NOAA 3IHWA 2GH1A 3Q7PA 1LTHR 3TIVA 4G63A 5CD9A 2ID8A 4P98A 2Y68A 1ZR4A 4Z4GA 1CZNA 3VQTA 3BG5A 5AOCA 2FR0A 4RE6A 2F43A 1OGYA 2QAIA 4M1TA 4EI2A 1NFFA 3IQDB 4OVKA 3ME5A 4DIEA 1KHHA 3OIUA 5AW6A 3QA9A 1G8MA 3C5EA 3VFDA 4R0VA 1RRKA 1R3UA 2N1BA 1SEPA 1VBKA 4FONA 1B6RA 1WXIA 1VIVA 5G0TA 4ZWNA 1IZ7A 3RVRA 1J24A 1TYCA 4DDUA 1TE2A 3AF4A 2NU9A 3LPLA 3KC2A 5T64A 2QD3A 3DFKA 4AJKA 3L04A 4PYMA 4BJ3A 1JKIA 5TGZA 1PYGA 4JR1A 4MQ4A 5K01A 3IKMB 1R6XA 3K8OE 2L82A 4LVUA 2X8JA 5EZSA 4IF6A 1G6HA 2O05A 4FOOA 4F4DA 2J7KA 3NC4A 4G5OA 3MWEA 4RADA 2JFQA 1K4YA 3PPWA 4ZO9A 4AB1A 3V1YA 1P3JA 1JA9A 3V8RA 1UBUS 1CRLA 3QV2A 4HG2A 1J8YF 3WO1A 3SSNA 1Z12A 3FNRA 4G01B 3H0CA 4I6EA 1BE6A 4WCVA 3O8BA 1ANKA 4R5HA 3GIWA 3OIWA 1HLFA 2WKQA 3FNGA 4G0PA 4FFOA 4IOKA 3FPFA 1RLOA 4JR0A 4P6VF 1A4RA 2WVJA 2BGRA 2X40A 3N1UA 5KMGA 4FE4A 2P9YA 1ZH2A 3TZCA 5IS2A 5C8VA 1MCZA 4IP0A 3VDXA 5KTOA 4BQOA 1C1HA 3BMQA 3KOXA 4FBLA 3QMWA 2AFIA 3NHJA 1M10A 2OV6A 1U4OA 2P9EA 5FB3A 4XPIB 4P83A 1UDRA 3BMXA 1UBTS 4ER7A 3KJGA 4KGDA 3RSZA 4KFCA 5CCEA 2YDYA 3PRYA 1J5EB 2XKKA 1X7ZB 3ZS9A 2V1UA 4YAOA 1JG6A 3QNUA 4XFJA 2JCSA 1L5YA 2ZJ5A 2Z30A 2MMGA 3FIUA 5DXAA 2NUAA 2DWPA 4R3NA 1F51E 3H2YA 5EXEA 1TEZA 1M6WA 2CXNA 3SJCA 1ZSYA 5HIMA 2UVPA 2WD7B 3A8TA 2QYOA 3OA2A 4UAJA 4UBNA 3Q12A 1ZGCA 3EVBA 1FFWA 1RTTA 3G2JA 4BWFB 3KELA 1NVAA 4XGKA 2X6TA 1NG9A 2VHJA 3PQ5A 5CX1B 2FPRA 5JCJD 2XZPA 1RHQA 2QQGA 5JSZB 4WLOA 1KVRA 4RESA 1ZH6A 1KAMA 3WSWA 3ML1A 1MOPA 1JQBA 3EA5A 3IAXA 1JTEA 4IDFA 3C5VA 4KLCA 2QM7A 2ZVJA 3O90A 4OHXA 4Q7JB 1B1AA 1CF2O 2A35A 1X7DA 5GOTA 2OQ2A 4YRKA 1YMUA 1KK1A 3BICA 1Y37A 4UTRA 4BP3A 1M2FA 1UFKA 2FFBA 1QBKC 2GEBA 4LC1A 3BHJA 2OBFA 1M75A 2XDQA 5KX5B 3F4KA 1E5QA 4PZEA 3U7HB 3X1KA 5EE1A 3KJQA 1IZ0A 1I9GA 3IIMA 2W2KA 4E12A 1MQSA 5KNDH 1V11B 4Y9TA 4F5ZA 4B1FA 5DN9A 2XCIA 3ZIAD 3A4YA 4XYGA 1VP3A 3H9BA 3SR4A 4PYJA 4BP9A 1GAQA 1VRWA 1RMQA 3KB2A 3HNRA 5IYZF 1EWQA 3PRKE 1AN0A 1GRNA 1TPYA 1OAOC 1A9RA 2XQVA 3QSGA 4IV5A 4AW9A 5J5VA 3E5MA 3BREA 4DV6B 1KYVA 4CQLB 5HFNA 4HDSB 3AEKB 5AM3A 3NONA 5JS8A 1M1ZA 1Y7TA 3A3PA 4EGCB 3OAAD 3I23A 4N5NA 1V6CA 1SVWA 2QVLA 4X44A 1NF9A 3OWHA 4WJZA 4Z2YA 2XUDA 1N8KA 5DBEX 3RS5A 4PYIA 3Q7SA 3W5AA 2FFAA 3LVQE 3WLAA 3R77A 4OEHA 5DM60 4QWMA 5FULA 1FDUA 1G42A 1KI1A 2J6HA 1KEZA 1A8HA 1E6UA 2WG1A 2WYOA 4I2VA 4OV6B 3T8YA 1F5NA 4Z5XA 2JLYA 2BM0A 5CNKA 4MAAA 2D62A 2DVMA 3PKZA 1HF3A 1OROA 4N7RA 3WWCA 5IVPA 2UUAB 4G5XA 4E70A 4US1R 4JROA 4FYVA 4Q3OA 3RBAA 3E22B 3IMFA 4OB6A 1KNQA 1F2TA 4MJXA 1E1CA 5JJLA 3R6DA 1ZOIA 4QOIA 2CFOA 4PBRA 2VA9A 5KKAA 1XRQA 4KKXB 4NEGA 2OYCA 1ADBA 1AXGA 3RBXA 1Y3HA 2Q3HA 1VYHA 1AK2A 4GM1A 3NBXX 1W96A 2CXUA 1I24A 3HDQA 3OUTA 4DR1B 1PSDA 1N2HA 1IUOA 4FDLA 4OHUA 4QHYA 5BN3A 1XJCA 3LY5A 3PHBE 3RDPA 2IPOA 3NDIA 3CNNA 3EIWA 5BSKA 3RSQA 2G04A 2ZYHA 3M6WA 1SQ0A 3BGWA 1Y89A 3I1FA 3K0EA 3P0JA 2FHPA 3D2BA 1LTKA 2PCLA 2IXTA 4IFEA 1R0BA 2E55A 4TN1A 4OJNA 5L3SB 4ZD6A 4FYYA 2I99A 5ISMA 2Q6TA 1BJTA 1NZDA 2O2HA 4BJ6A 1J39A 2IW1A 3ZZ0A 2EKPA 2GTIA 3PCXA 4NONA 3D3JA 3FN4A 1A7JA 1JFFB 2VDQB 1J25A 3G88A 1A69A 4NCXA 3ZWWA 5EWJB 3TB6A 4UBIA 3ROGA 1DKQA 4F92B 4ESEA 4RA9B 4PSKA 1YBHA 1IUPA 3FUTA 4QPNA 5CYOA 1K7EB 1T0UA 3A1EA 5DEIA 3DF9A 1JU3A 3H2HA 3HYCA 3AR2A 2C61A 1DDIA 3HRKA 2C00A 4ZYLA 3ZC3A 4CI0B 1NQUA 3A31A 1R0ZA 1PT9A 4FPXA 1X3SA 3L6DA 2I0FA 5EJGA 3DXXA 1OX4A 2DBQA 3BEOA 2J0UA 5IKMA 1PF7E 3ENQA 2BISA 4BV8A 4KDRA 1RYBA 1G7SA 3JTMA 2C58A 3IE2A 1X80A 5FO1A 5COBA 2GBIA 3G0GA 5LOVA 1FBTA 1L4UA 5B57C 3MM4A 4L9AA 5JCOC 3AC0A 5FUMA 3TJMA 4FHCA 2BAGA 3SIPA 4AG5A 2JEZA 3OEYA 1W36C 1PSZA 1T1RA 3UXYA 1EI9A 4KXYA 3T9EA 1G5HA 2WABA 1V2GA 1VL0A 4E32A 3V1KA 1BH6A 2B69A 3CR8A 1ISPA 1U9JA 1YVUA 1Z6ZA 1SVSA 5TE9A 4DRXA 4MGHA 3B5IA 3DE6X 3PXCX 4XVQA 3V97A 4QSMA 3H1BA 4QA9A 1FFXA 1CNMA 1EUZA 1QF6A 2JGLA 4A3SA 4EM6A 3O9VA 4JEIA 1R88A 2J46A 3WGHA 1T5DX 4M76B 3I0ZA 4PZ0A 3TOCA 1OU4A 3WO0A 2OZVA 4WVFA 3GG2A 4JDPA 1E3LA 2R7LA 3HVUA 3FG9A 3QUCA 1AURA 4MRAA 2PYDA 5JO9A 2RD2A 1TTTA 3KR1A 4FUTA 5BYAA 2QZPA 2YXEA 1UANA 3LCMA 4IH1A 4B17A 1TGVA 1P61B 1QZUA 2IYRA 2E4UA 1OFUA 1E2PA 2R8XA 5JD6A 5MN6A 2ZIXA 4KMSA 1W49A 4WW0A 2R9VA 2WP8J 1X0XA 3RC3A 1BS9A 3DJYA 4G5SA 3R7WA 5ERGB 1UP4A 1WW2A 2LGJA 3ER6A 2ZRHA 1OYWA 1NASA 1IPEA 1YIAA 3DONA 4HZIA 4IDQA 4M9UA 2PZGA 2GN4A 3HHEA 5D5PA 3WHLA 2AMYA 4IDNA 3SZRA 4PE5B 2VHQA 4L5CA 4DN6A 4G5RA 4RWEA 3WRXC 2WSLA 2H1IA 2A8YA 4NOJA 3TSYA 3QE2A 4UNRA 4BBZA 1NNUA 5A0TA 3FVQA 1DJQA 2B2CA 4LSGA 2I3DA 4TTQA 3U7RA 1QFMA 2Y0PA 4AJ1A 1Q57A 1U81A 3A6KA 2V98A 4WZBB 4ZQBA 2FZKA 4QJIA 5BT8A 4US2R 4K6KA 4N0DA 1QIDA 3DC2A 4PRKA 2BR3A 3I3SR 3C4JA 4GI7A 5D3KA 2H1SA 1W4CA 3AF1A 3H65A 2BMFA 2G0AA 1CUIA 1U94A 2V6IA 1U2SA 4HQOA 3JQBA 3FTCA 4IZOA 3TLCA 4B33A 2B7LA 2GI4A 3ZDAA 3N05A 1B6SA 1N5LA 5EXDA 2Y4OA 3UQYS 3W1WA 4XRGA 3KKKA 2C98A 3K0FA 3NC1C 5F21A 1NUTA 3FYSA 3TPZA 1DJMA 2VXBA 1INLA 2XD4A 4JZKA 4HUJA 1ZDMA 4N39A 4OU4A 5AK3A 4RMIA 5FBHA 3RIHA 2GK7A 4CL3A 1A9XB 1F4LA 1LDGA 1ZI8A 2X6QA 3A9TA 3PXXA 1FFEA 2QX7A 4ZFNA 3PQ3A 1T2AA 3KQSA 3M5DA 3NVAA 8MHTA 3LY8A 3PD0A 1JHXA 4B3CA 2RI0A 1F8XA 1GG5A 2A0UA 4G2TA 4B4DA 3IHKA 1RHJA 4DQDA 2VT3A 4BMVA 4KREA 2YN4A 4NENA 4ZMBA 2ZQYA 1AQ6A 1KEPA 1QPGA 3OF5A 5IX8A 1V3QE 4PYNA 2ETXA 3KHSA 3FSGD 2CVFA 3I6BA 3IOBA 2OZLB 1YS1X 1Z2CA 2HDOA 1QIFA 4ITUA 1KAQA 1U1FA 4HMOA 1XL1A 2AJBA 3KR2A 4NCJA 4EJMA 3S81A 1U63A 4BVKA 2EFGA 3L7JA 1NUSA 3O4JA 5IWAB 2D1QA 2PQ6A 1RQ7A 4RCYA 1L5NA 3WGJA 1B3RA 5ALJA 3WZLA 1EFPA 1EUYA 2XVYA 2IS4A 4Q0MA 4NZMA 1RTKA 2ACEA 2QEQA 2WWFA 3ON5A 4ND5A 3SOZA 5L51A 4P84A 1YNSA 1Z6XA 3EISA 3KQPA 3CR7A 1DX6A 2CFCA 2A0FA 3FHCB 2JW5A 4MVJP 3SVLA 1II8B 3PQFA 4W5HA 3V7WA 1QIJA 2V7GA 2XPCA 3W1VA 4K9DA 5KOJA 4PXAA 3JQGA 5HQJA 5C81A 1SH7A 4CCSA 4KRYA 4P3YA 1FFAA 1ST2A 3STHA 3AM3A 4F9TA 1E3WB 1MO2A 2ADMA 3KZCA 4N76A 4MV7A 2W70A 4C06A 3O8OA 4IIFA 3GMTA 2ZT6A 1OFUX 3HB4X 2LW7A 1D2CA 3OSUA 1LV7A 2UVDA 1I14A 3EH2A 3UFXB 1UPAA 3CUEF 3FWHA 1L4NA 3GA7A 3QVOA 4IHKA 3HHPA 4Y2UA 2XRFA 3AUJB 4BVGA 4X85A 1W581 2Y3IA 4MVJH 2P40A 3LCJA 2HV9A 1JSRA 1U98A 2IYWA 2P62A 3G2IA 1AB5A 4ZCTA 2Q3EA 5DB4A 1J56A 4C0XA 2PZFA 5PGMA 1ZW1A 4ZQGA 4PS1A 3DCNA 4XA8A 1GYQA 1M5RA 4A8TA 4RTSA 1KYQA 1YZUA 4QYWA 4G0XA 1ZS9A 4D0LB 5ALYA 2CFSA 2OV3A 1OF1A 4RLFA 4MUJA 3RB8A 3LDUA 4NECA 3UAVA 4LHXA 4EP1A 5KPJA 3ZWXA 2HU8A 1GLVA 3DMRA 4FFPA 3RTAA 1TW3A 2Z4RA 1Z68A 3HSYA 1Z4PX 2HYDA 3F6PA 2JCXA 3AR4A 2I03A 3MLBA 3TUJC 2X5KO 5HRUA 4Q3CA 1DV2A 1URPA 4YHBA 3NXSA 4L5BA 2HSJA 1ZD2P 4MUBA 4OK6A 5K0ZA 5HNKA 2JC3A 4D81A 1EHCA 1Z39A 4MXDA 2EQAA 4WQMA 4JXZA 3UT5B 3ZU3A 1ZVKA 3IOEA 3QGMA 1D4OA 4BFTA 1EGQA 2O0JA 4FD3A 3LHFA 4L28A 5HBRA 1G6KA 4JFRA 4Z8YA 2PWZA 5M3BA 1QORA 4AICA 4DADA 4DLVA 5I9LA 4FJ2A 5L6LB 2VHTA 4HGPA 5JCPA 1Q0UA 2R79A 5LXTB 4CEIA 1QIIA 3D31A 1EA7A 4NPCA 5LVAA 3CNQS 3F9CA 1UKEA 1G4AE 4Z3OA 3MIIA 2Q9CA 5CH8A 2OO3A 4RF4A 5EZYB 2A59A 5JCZA 1H9BA 1A77A 2EHJA 1ZOOA 2VAPA 2Q5HA 3EPPA 4B6RA 1A88A 1UBKS 2V7VA 1IVYA 3K71B 5BOSA 4CV2A 1H2RS 5MN5A 3KAQA 4B3TB 4I55A 4TRNA 5FWXA 1TVKA 4FT2A 1VFNA 5IDQA 1SCNE 2O5EA 4YR9A 4LCEA 2GXUA 4OKSA 2INGX 2W11A 1J9GA 2AQHA 2VKTA 4MYHA 3ZLBA 2I1VB 2ZTVA 2OCDA 3FTNA 1TO2E 3GZTB 3OCUA 3FNHA 3OUUA 2PS3A 3NVDA 2QTZA 2BZ0A 1JN0A 5C32A 1N32B 1FQJA 4YVFA 1H9AA 2Q1SA 1G1AA 2VVTA 1UWKA 1SKAA 2OHJA 2QTAA 3KNZA 5AI4A 1H2FA 2WOOA 4FCWA 4OXYA 2RHBA 1BSVA 5H80A 4DCTA 2FP4B 2PO5A 1L5ZA 1JRLA 3D3QA 1VLHA 1KI9A 1ZQ9A 4HB4A 3K8QA 4P3KA 4YJ2B 1Q1NA 2LXNA 3DSRA 3VVBA 2FOXA 4Q93A 1ZISA 5CA1B 2GARA 1VE3A 4JU8A 2R0QC 4BASA 3ONVA 1MIOB 3X0DA 1ABBA 3NWBA 3F1LA 4RSRA 4ZAYA 2M6SA 5AVQA 4G23A 2VYVD 1UWVA 3KO8A 1OC4A 1G21B 1N2CB 2H9IA 1QU3A 2JD1A 4UDYX 4DNOA 3KLNA 2Q2WA 1MB9A 1GGHA 4QOGA 4GWKA 5CCBA 3TLMA 1K7FB 5GV8A 3B8EA 1BQ4A 3O74A 1NIPA 3WGKA 5CFRA 3ZE1B 3FB4A 4R8KA 3HZZA 4P93A