1YXMA

Crystal structure of peroxisomal trans 2-enoyl coa reductase
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
297
structure length
297
Chain Sequence
GRSYLAPGLLQGQVAIVTGGATGIGKAIVKELLELGSNVVIASRKLERLKSAADELQANLPPTKQARVIPIQCNIRNEEEVNNLVKSTLDTFGKINFLVNNGGGQFLSPAEHISSKGWHAVLETNLTGTFYMCKAVYSSWMKEHGGSIVNIIVPTKAGFPLAVHSGAARAGVYNLTKSLALEWACSGIRINCVAPGVIYSQTAVENYGSWGQSFFEGSFQKIPAKRIGVPEEVSSVVCFLLSPAASFITGQSVDVDGGRSLYTHSYEVPDHDNWPKGAGDLSVVKKMKETFKEKAKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of perixomal trans 2-enoyl CoA reductase (PECRA)
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords peroxisomal trans 2-enoyl CoA reductase
total genus 103
structure length 297
sequence length 297
chains with identical sequence B, C, D
ec nomenclature ec 1.3.1.38: Trans-2-enoyl-CoA reductase (NADPH).
pdb deposition date 2005-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1yxmA00
2I9PA 2IYPA 4UUNA 4FC6A 3W8EA 3GNTA 3AOEA 2GDZA 1HDZA 4BO8A 2Z1NA 2FRDA 1GZ4A 1HDXA 4H7PA 1QXSA 1EK5A 3CEAA 3EDMA 3PHLA 4YEDA 3DMTA 4JGBA 3GPIA 4IQ0A 3TNLA 4G2NA 3A14A 2DUWA 3AOEC 4YJGB 4KZPA 1Q0LA 3EUWA 4W7HA 3ZNPA 4CM4A 2VUSA 1BHSA 3QWFA 3PIIA 3R3SA 3AUAA 1OFGA 1EE2A 1NVGA 4FJ1A 4PZEA 4YT5A 1H6CA 4CL3A 2GZ2A 5TF4A 1SBYA 3C3XA 4MKZA 1NWHA 4Q3DA 4CMCA 3IC5A 2GZ1A 4IXWA 1HYGA 1IL0A 1R4NA 2Q4BA 2EGHA 3SJUA 4J49A 1Z7EA 1B14A 3EVNA 5L4NA 4J9UE 4YQYA 3VH2A 3LC7O 3ABIA 4YJFB 3NAQA 1OI7A 1T2DA 3HG7A 4IS3A 1J49A 2NVUA 3GGOA 4GH5A 3RBZA 1YE3A 3T7EA 3ZDFA 3RASA 5BSEA 4BV9A 5TT0A 1Q2XA 2SCUA 2GGSA 1ISHA 4Z9XA 2DPGA 5I9LA 1ISMA 3QJ5A 1HYEA 3AK4A 3PHJA 1KOLA 3F46A 2HUNA 3ZHZA 2AE1A 3FPLA 3MTGA 1K89A 4CODB 3L4SO 1E92A 1B0AA 4OJNA 4W7IA 5CEEA 3KSZO 1K2WA 3ITKA 4P8RA 1LLDA 4DPKA 1C1XB 4DPMA 2B69A 1V3UA 3G1UA 1NQTA 3AI3A 4NK4A 4WCFB 4FGSA 1E3IA 3AUUA 1E6UA 1GDHA 1KEUA 3CXRA 2JAPA 1ZJZA 1UH5A 2I65A 4XB1A 1VM6A 1LSJA 4EEZA 4DMLA 2PY6A 4IJKA 5BQFA 2YDYA 4BNFA 4IGFA 4Y6RA 1LSSA 4AJHA 1J0XO 4XKJA 4U6QA 4XQGA 1L1FA 2PKRA 2NQTA 1Z82A 4R5HA 4XYEA 3DAGA 3WNVA 4G65A 3ASVA 1XKQA 2BRUA 2BELA 3ZV6A 2YQ5A 2E6UX 3D3WB 3PLRA 3LU1A 5TSDA 4PLTA 2B35A 2P9CA 4BNGA 5KJEA 3VVBA 2O4UX 5A9SB 3ZV3A 3ORFA 4LRSB 4ZA2A 1PJCA 1GTMA 4N5MA 1LDYA 1P74A 3RIHA 1YONA 4D45A 3GVHA 3NV9A 2H6EA 3DBRB 1ULUA 5DCUA 1JAYA 2DBZA 5DZSA 4YRDA 4F6CA 5JC1A 4PGFA 2CVQA 2VYND 3QE3A 4BO2A 5TIIA 3QA9A 4BHTA 1LSOA 5G0VA 3AU8A 4MVJD 3F4LA 5T8KA 4IQ8A 2F1KA 5L7WA 1NPTO 4ILKA 4D79A 4PLWA 5KTKA 3VZQA 4LCEA 3QP9A 1QV7A 3DBLB 3IJPA 3WTBA 4EITA 5KKCA 1O0SA 4Z6KA 4J4TA 1BSVA 2DM6A 2X9VA 3LC2O 2VHXA 4NHEA 2YDXA 2C2YA 4S1VA 2BMAA 4WPGA 4BNXA 4ND1A 3I6IA 3N58A 2YUTA 4WASA 2B4TO 2HLPA 4L4SA 2X8LA 4G5HA 1TT5A 4Z0PA 3DBRA 2VUUA 2J6IA 5A4DA 2C20A 1NAIA 3JD0A 2O7QA 5CDYA 3PPIA 2HMVA 3D64A 1CQIA 3KYDB 2BFOA 4M1QA 4XYGA 4R1NA 4GX0A 7ADHA 2X5OA 3GF4A 4TRNA 2VHWA 3ASUA 5HWSA 4CM1A 1U5CA 3PWKA 5EL0A 4K26A 4Y67A 4DTIA 3C24A 3KYBA 3WGOA 2EP5A 2XF8A 3GNSA 3H65A 2Y05A 4J7CA 4XGNA 1XSEA 3H6KA 4A73A 1SOVA 4CV3A 4NFHA 4NNJA 3PQDA 2AA3A 1QYCA 5BT9A 2PGJA 1HT0A 3EW7A 3ZI0A 5G4LA 5G0UA 4NMHA 3JQCA 5COBA 4KTVE 1ZKMA 1PL6A 1WDMA 4CR6A 1M6WA 3ZWCA 4IDDA 4MVJM 3UN1A 2OMEA 1NQ5A 4GMFA 4ZRMA 3RSHA 3OJOA 1T4DA 1PZHA 5ER6A 5ICMA 2GLXA 1ZSNA 1DHTA 8ADHA 3DTYA 4J4HA 3UCFA 4MO2A 5TJ9A 1EVJA 4CL8A 1GYRA 3V1UA 5JCXA 4BNTA 3JQDA 4W82A 1HSZA 1BGVA 5IG2A 5U4QA 1PJTA 1M2WA 1QV6A 3ZWYA 1ZXBA 3FNGA 3HFGA 5THKA 2PA3A 3GT0A 4MVJH 2J3HA 1R66A 4N54A 1BMDA 1DC5A 4FBGA 2F00A 1Q0HA 3AOGA 3DZFA 1I3KA 4MVJF 1XELA 3PJGA 4I5GA 4B4VA 2VOJA 2RAFA 3ONEA 4FOOA 2C59A 3BZUA 5BSHA 4FGWA 3L4BC 2E82A 3TQHA 2IYOA 1QLJA 1ZEMA 1K3TA 4CMBA 2EKLA 1DC6A 3GG9A 4G81A 5LCXA 3U49A 4PIVA 1NPYA 3ZHBA 2V6MA 5IF3A 3LT4A 3OJLA 4R9RA 1LTHR 3H7AA 1F06A 4TZTA 5GZ1A 1ZZEA 5L51A 4PG7A 4QUKA 4Y9DA 3EY4A 4LN1A 1DJQA 3FI9A 3KBOA 1F0YA 1VC2A 1E7SA 4Y6PA 1PJLA 3S2IA 1KC3A 2NACA 4OXNA 4NJMB 3INGA 1I5RA 2ZB3A 3C7AA 3RVDA 4ZQBA 3O38A 2H63A 4XRGA 3GMDA 3GDOA 3VAZA 2VRBA 4DUPA 4II3A 3ENKA 4CM4B 4IGEA 1GV0A 2AHRA 1I3MA 3ONFA 2AEFA 5T5QA 4EUEA 3GDGA 4WOJA 1XG5A 1HWYA 5I9MA 2R00C 4MOWA 3DFZA 2P2SA 3STHA 1E1NA 3RBXA 3TZKA 1YS4A 3WBBA 2PZMA 3HB4X 4XDYA 1H93A 5JE8A 4MP3A 3T4XA 2RH8A 2CDAA 1GQQA 4BGIA 1ZNQO 1DOHA 1E7QA 3W4IA 1TXGA 4RDHA 4ALLA 2BGLA 4PRKA 4YA6A 3PYXA 5JS6A 1JKIA 1KVQA 4ALNA 1T4BA 3JYQA 1JU9A 1VPDA 1W8DA 3KSDO 4FW8A 4J16A 2A9FA 4PLVA 4FR5A 5CFZA 4OIMA 3N7UA 1YGYA 3DO5A 3NYWA 2AE2A 3JQGA 3BHMA 3U4CA 4CLXA 1B3RA 1FMCA 1EQ2A 3OQBA 4NFSA 3RU9A 3VZPA 4WLUA 3X2FA 1PWXA 3NDJA 3RFTA 1RYDA 2IE0A 2AG8A 4J1QA 3OEWA 2X7HA 4IINA 1W0CA 2WE7A 1KY4A 1P44A 1X0XA 3Q3CA 2CD9A 3OHSX 3PI7A 3RUDA 1N9GA 3K73O 1YKFA 3ZWBA 1JDJA 5T67A 1BVUA 1D1SA 3JYOA 1SO8A 1UXJA 1IE3A 3DZBA 1Z6ZA 3VKVA 2ZIZA 3V1YA 4WLVA 3QVOA 4J6FA 4YJHA 4PG4A 3W8DA 2YYYA 2DC1A 1C1DA 2D5CA 1PIWA 2EHDA 2EXXA 1LA2A 2AW5A 5KOIA 5JDIA 2C7GA 5G0WA 3L07A 4QEDA 3GFBA 3WWZA 5F5NA 1YDEA 4E6PA 2DFDA 2E48A 4BGVA 3MOGA 4JCOA 3UCEA 4OQZA 2FZEA 3AY6A 1C0LA 4DREA 4AJIA 1ISFA 4GLOA 2IODA 3PFFA 1PGJA 3RWBA 3ZW8A 1U28A 2CDBA 3QWBA 2R2GA 3IOYA 1C0KA 1B15A 4XD2A 5T8KC 2O48X 2OXIA 1GZ6A 1DAPA 1WMBA 4TMFA 5U1PA 1X15A 2Q49A 1LQUA 4FFRA 1QYXA 4B7CA 4MVJG 4UVIA 3SC6A 2W90A 3HWRA 3MCVA 4MJLA 4Q3EA 3PZRA 5IFLA 3VH1A 1QLHA 1N5DA 2X4GA 3JQ7B 3X2EA 4D42A 4A7PA 3FD8A 5L45A 2Q1SA 1GY8A 4ESOA 4FPXA 5C7IO 2PGDA 3KZVA 2AEJA 2JAHA 4PG6A 2ZB8A 4R1SA 3GNQA 4AL4A 4DBVO 1GCUA 4PFJA 1DIBA 2X0IA 1HDCA 4GX2A 4P4LA 4DQUA 5IAAA 4PLFA 1F8GA 1IUKA 1JQBA 1J6UA 2HO5A 2ILTA 3HN2A 1KEWA 4PLYA 4TWRA 3IS3A 5IJZA 4O1MA 1KBZA 1T2CA 1VJ1A 4JBIA 4Z0TA 1LQTA 4K9DA 1QORA 3R1IA 2DBRA 2OUIA 3V2GA 4TKMA 2EJVA 4KUGA 3D0OA 3V1TC 1VLLA 1BXGA 2DUUA 4MIYA 3PFWO 4GWGA 4GBJA 2OL4A 3AU9A 2RH4A 4WNIA 5KVCA 1YDWA 3OSUA 3H5NA 3WOHA 2P5UA 4AJNA 2B83A 3SJ7A 2XPCA 3D4PA 3NUGA 3OFSA 5DP2A 4Z0HO 3W8FA 4E2YA 3OA2A 2ZCUA 1JA9A 3TL2A 3UAGA 1MG5A 2J3JA 4B3JA 1MGOA 1XCBA 3OM9A 5COQA 1N7GA 1QP8A 3NDIA 4TVOA 3WJAA 4B4UA 4CJXA 2C2XA 1P77A 2NTVA 3B6ZA 3DDNA 5AQ1A 2DVMA 2ZB7A 4UEJA 3ZU4A 4NJMA 1ISIA 1Y8RA 5THQA 3VPFA 3KLPX 3D4NA 3WWYA 2VT2A 3M6IA 5CHEA 1MC5A 3NTRA 3VPSA 1YH3A 1LRLA 3WG9A 1P3DA 3QWAA 1WZIA 5KJ1A 3QVSA 3TOZA 3IP1A 3F9IA 4UVHA 3U5TA 1HTBA 4R16A 2VNSA 3A1NA 2V6BA 2DLDA 3E82A 1ZK4A 4CQLB 1Q7CA 5A04A 1HSOA 2Y67A 3G17A 3D5QA 4RPHA 1YOVA 4FSHA 1VJ0A 3KVOA 1VI2A 5JNLA 1LDMA 2JCVA 1FDUA 2PD3A 3RJ9A 1LLCA 1YB5A 2EKPA 2P68A 4CUKA 2IDZA 3CMMA 1RM0A 3AM5A 3I23A 1ONPA 1XEAA 1XHLA 2FSSA 2G17A 4A10A 2B4QA 3FRJA 4PLPA 4I1IA 1YWGO 3WBFA 1NAHA 1CDOA 4MKRA 5JO9A 1Y8QB 5G0SA 1S7CA 2PNFA 3U4HA 5KJ6A 5JMPA 2FSVA 4ONEA 3FN4A 1AUPA 4IBOA 4WEOA 2QRJA 2PR2A 1GFSA 1H9BA 3LF2A 2LDBA 5L3ZA 4W9NA 5EESA 4CPDA 4ZGWA 3UOGA 5MDHA 2BFAA 4HBGA 4DIOA 2ZQZA 2JFGA 4FQ8A 2X9GA 4IY1A 4RVGA 3FBTA 3M2TA 4DLAA 5A5FA 6LDHA 2ZQYA 1P33A 3RC2A 1GZ3A 1N8KA 1SOWA 4DC0A 5T57A 4XR9A 4A0SA 4BNLA 3NJ4A 4IDFA 3UGKA 1HXHA 2Z95A 1JAXA 4C4OA 3LT2A 1DJNA 2QZZA 1R0SA 2OBNA 1M67A 5K9ZA 1A4UA 4E2WA 5FEUA 2W2LA 1AHIA 2PD6A 2PV7A 4BOYA 1ARZA 2VWHA 3JQBA 1QG6A 3Q9NA 2C54A 3S1LA 4KP7A 1GQYA 5G4KB 1UAYA 1LRJA 2PH5A 4IJVA 1P1RA 3I9NA 2FWMX 2Y0CA 2C29D 4OXYA 4IMPA 3WGZA 5BNTA 4BUCA 1SCUA 1GUZA 2NNLD 2OGUA 3FSRA 1E7MA 1LU9A 3DQPA 1LX6A 3P2YA 1I3NA 4F6LA 3K2BA 1U2GA 3QQPA 2C7VA 3WJ7A 1D4FA 4TRJA 1PSDA 3I9LA 1V8BA 5KIAA 3QVWA 1H2BA 2NSDA 3L6DA 4GSKA 4YAGA 4KOAA 2J8ZA 2X58A 3QWHA 2G0TA 3HHPA 3JCZA 4QO7A 4XGKA 1I2BA 2NV6A 1HRDA 4XIYA 5DCYA 1XIVA 1XQ1A 2W2KB 3GY0A 2P4QA 4WEQA 1ENOA 4AICA 4UEKA 5JBIA 3Q6IA 3PIDA 4J3FA 4INAA 1I24A 1I30A 1Z45A 5JYEA 4CUJA 2HK9A 1O5IA 3FR7A 5KCZA 1U9JA 5CG1A 3KB6A 4K28A 3W4JA 1N1EA 9LDTA 2ZJ0A 2JD2A 1VSVA 1C14A 2YW9A 2FR8A 4Y6SA 5JAZA 3DMTC 4WUVA 2EKQA 2CF6A 3KHUA 1CQJA 4J90A 3G1TA 2GERA 3PZBA 4EI2A 3DZHA 2E37A 3JYLA 4FB5A 1MG0A 4D3SA 2VOEA 1A9ZA 4BO4A 4RF4A 4GLLA 2BD0A 3S8MA 5JMWA 2DKNA 4R69A 3O4RA 1ENZA 4CMJA 3AFNA 1ZO8A 1I10A 3F47A 5A02A 1U3TA 3F3SA 1L7DA 4TSKA 1NNUA 5JYDA 3NTOA 3RFVA 3UCXA 3TZQA 3UFXA 2FPGA 1ZEJA 3R0IA 2DTXA 2X0JA 3DBVO 3D7LA 3RCBA 3KM0A 1RYEA 1F17A 3I5MA 1WLYA 4N18A 2FOIA 2X6TA 1NR7A 3A28A 5B37A 5JW6A 1GPJA 4HNHA 5IDWA 2AG5A 3GN2A 3L4BA 3SX2A 3EZLA 4D7AA 4YB8A 3F4BA 1E3EA 5AXBA 4BGEA 3ZWMA 3HQ4O 5IDQA 2QX7A 4E2ZA 2YZ7A 1OZAA 4IS2A 4OKNA 1P1IA 1XGKA 2DFVA 2GASA 4KQWA 4WCFC 2X5KO 5TJHA 3TN7A 5ILGA 1YQGA 1EFLA 3GEMA 1LDGA 4UAGA 3ZWWA 2FMUA 2OP0A 1Y7TA 3RU7A 3E9QA 1X7GA 4DLBA 4KTTE 4KWIA 1JVSA 3LLSA 1V0JA 2J3KA 4WLFA 2VT3A 3SLGA 3C7DB 5L4LA 5T64A 5I7SA 1PR3A 4XZ3A 4BO7A 5I8WA 3OF2A 4PG5A 1DPGA 1DAOA 1OOEA 2BHLA 2C0CA 4FFMA 4UUMA 5DOZA 4NIMA 1DRUA 5A3JA 5KVVA 4JIGA 4DBZA 1BW9A 2VWPA 4FS3A 2PH3A 3FR8A 3ZN2A 3E1KA 3H2SA 3INRA 4AJOA 3I52A 5IN4A 2CDCA 4U0KA 1F14A 1IPFA 3IJRA 5EINA 2DT5A 2C5EA 5F3RA 3MJ4A 3FNFA 3DHEA 1KEPA 3JQ7A 1ML3A 4HXYA 2Q1TA 5IXYA 1ZH8A 4LW8A 2NU6A 4GI2A 1O8CA 1DLIA 3ETDA 4ZU3A 1B2LA 3HDHA 3NRCA 4CM8A 3U3XA 4MVJI 3UHAA 4EZBA 3DC2A 3MJTA 4K1LA 5EMHA 1R15A 1FDSA 1P45A 4E3ZA 5GZ6A 3JTMA 4RCVA 4EUFA 4NK5A 1V3VA 3AWDA 4A27A 2QHXA 2ZCVA 4D0SA 4QX6A 1OMOA 4BMSA 4ITUA 3WICA 3L6OO 2WYWA 3ZV5A 4N5NA 3L9XA 1NASA 3KEOA 3DMYA 4BO3A 3B1JA 4LMPA 4M55A 3HDQA 1ZIDA 3LT0A 3VDQA 4PZCA 3S2GA 2WDZA 4CM7A 5IXSA 5JAIA 3HFSA 1ZXLA 2B37A 5I7FA 4CM9D 4AVYA 3TF5A 2IXAA 3JYNA 3RJ5A 4CM8B 4WK6A 3TWOA 5I7EA 1FDWA 4TROA 3SVTA 1Q7GA 1E6EA 1RM3A 1WXDA 4DL9A 1H9AA 3NT4A 3P19A 4EBFA 3K8ZA 4M87A 4GGPA 2VN8A 3NKLA 3NGXA 1PEDA 5TQVA 1LBEA 4CLRA 3E5MA 2BH9A 2Q46A 1OAAA 4RZHA 4RLHA 4R9SA 1R0KA 1R4MB 2Q99A 1K5HA 4TRRA 4XJTA 2V7PA 2OOSA 1H6DA 4MDHA 3NDRA 2VHZA 4GX5A 1SPXA 5CPFA 4BB6A 5I9NA 1ADBA 1PJBA 1XQ6A 1DRVA 1HZZA 2OO5A 1EE9A 4KDFA 1QMGA 4F46A 3AY7A 3PYLA 3UICA 4L9RA 3WGTA 5CEFA 1MUUA 4U5QA 3ROKA 3WQRA 2VYVA 4B8ZA 4B8WA 3RUCA 3OJFA 4J7XA 1G6KA 3AI2A 3MZ0A 4BL5A 1YRLA 3VH3A 4I08A 3Q0EA 4OMUA 2HKIA 1CJCA 2VNAA 5B12A 1B8UA 2B5VA 2O3TA 2HMUA 4P4GA 1HL3A 1Q7BA 2Y1FA 3NX4A 2UYYA 4IDEA 4AG3A 4E5MA 2X23A 3UXYA 4YYZA 1I3LA 4QT0A 1MB4A 4CLRB 2JHGA 4IM7A 3JQAD 4JBGA 4WCFA 1HLDA 5A05A 3QW2A 2G1UA 1BRMA 4II2A 1UZNA 3VPXA 4UEOA 5AVOA 3PEFA 1ORRA 2JFFA 4R1TA 2EJWA 3PHIA 4XR4A 1DXYA 5CG2A 3FTNA 4E5KA 2ZATA 5TLSA 3JSAA 1ISJA 2WM3A 3IQDB 2A4KA 2YV1A 1ZJYA 4PLZA 3RKUA 4CV0A 4YAIA 3EHEA 1ENPA 4WLOA 2GD1O 1YJ8A 2D1YA 4HFNA 3ZNOA 1SB9A 3D3WA 3JV7A 3KTDA 2WEKA 2V6GA 2Z1MA 2VRCA 3M2PA 1R4NB 1NFRA 5DF1A 3LQFA 1PZGA 3D5TA 2X0NA 1SNYA 2X9NA 4PLHA 4CMEC 1VL8A 5KVSA 1YL5A 2UUPA 3I4FA 5ADHA 3VDRA 4IMRA 3VZRA 4WE3A 1HEUA 1P0FA 3P2OA 1AN9A 3ITDA 2O50A 3JD2A 1HE4A 4NQZA 3VHRA 1DFIA 3FCOA 1DRWA 1AHHA 4YT2A 4R68A 3TDKA 3UW3A 4CMIA 4ZICA 1C1XA 3AI1A 3KYCA 4YT4A 2HMSA 3M1LA 4NH4A 1LXCA 4GWKA 2YY7A 3RKRA 4J4BA 4AJEA 1F12A 1SAYA 3HUDA 4HFRA 4UUPA 4BO5A 1NQAO 4K6CA 1U3UA 3C85A 4LSWA 4J2HA 4XQCA 4RO0A 3ZWPA 1H6AA 2EG9A 1Y81A 1JLLA 4KMSA 1M66A 2VZ9A 4J9VA 3SLKA 3FHLA 2OZPA 3N74A 2CMDA 2NTJA 3RUIA 4CV1A 4KQXA 1X0VA 1LLUA 1A7KA 4XA8A 3NJ8A 1T1SA 4YWJA 2NUAA 1B8VA 4MVJA 4YRAA 2DBVO 1T1RA 4XGIA 3WMWA 1WMAA 1IPEA 1S6YA 2Y0EA 4N5LA 4CR7A 2HAEA 4R3NA 4CMIB 5LDHA 4PZDA 1MFZA 4B79A 3KYCB 3LVFO 1ZMOA 3DBHB 3V5NA 1KEVA 3U9LA 1P1KA 4LVCA 1IZ9A 1NHGA 1WP4A 4FCCA 1GUYA 4IDAA 3DOJA 3MTJA 2IXBA 1GADO 2OFPA 6ADHA 1QSGA 1XLTA 1N1GA 3MJSA 4HNGA 4XYBA 2WWRA 1KETA 1DEHA 3CPSA 3JYPA 4Z9FA 1PZEA 4XIJA 4CV2A 8LDHA 4RL6A 2WYUA 2A94A 1P9LA 5C37A 1YQDA 4YXFA 3JQFA 3BA1A 3H3FA 1U2DA 1Y6JA 4I9UA 2D5AA 2EW8A 2V65A 3VOSA 2VHYA 3O03A 3WYBA 1JW9B 1BVRA 2BKAA 2IZ0A 3JQ9A 1GCOA 3A9WA 4ZD6A 3ST7A 4IUYA 1SEPA 3DOCA 3HDJA 4CQMA 4IZIA 1T24A 2O2SA 5TC4A 1HDGO 3WTCA 4RJTA 2EF1A 1R4MA 4GVLA 1FK8A 1U7TA 1NR1A 3ICPA 2DTEA 5FFFA 4Q3NA 5EJ2A 4LMRA 2YHUA 2PKQO 3BTUA 3GOHA 1ZBQA 1TEHA 1H5QA 3PRJA 1KERA 3WIDA 3JQEA 1G0NA 1ZK3A 2HQ1A 5GMOA 5HS6A 1ZK2A 3K9QO 1GEGA 5L7YA 3WFIA 4BNYA 2NQ8A 4B7XA 1R6DA 1WDKA 3ANNA 5EERA 2RHRA 4R51A 4RVFA 3WS7A 1NYTA 4E32A 1HKUA 4CLHA 5A1TA 1CYDA 1TLTA 2PK3A 2D0IA 1YJQA 4GKVA 4EJMA 4JX8A 3TJRA 2E4AA 3RUFA 5U9CA 2RCYA 2ZTVA 3U4DA 4CLOA 1EDOA 3GLQA 5DDIP 1JVBA 1U8FO 1BW9B 2O3QA 4MVJE 4QFDA 4EEXA 4BKUA 4HP8A 4LRTB 3GEDA 5ER9A 2D3TA 3QIVA 4B4OA 4P38A 1NM5A 2Q1WA 1Z74A 2BFPA 2WYVA 1V9LA 1PJSA 1PL7A 4ZQEA 4QQRA 1PJ4A 5LDGA 3KOUA 3R3JA 4M86A 1DO8A 3U09A 4IIUA 4OSPA 4ZJUA 4GX1A 4H16A 5I8ZA 5KVQA 5BSFA 5ES3A 5C5IA 1DC3A 1J4AA 1PTJA 4CMEA 4BVAA 1TT5B 4DLLA 4D43A 3R6DA 4MP6A 3WIEA 4OO3A 2NU9A 4CLDA 5KJCA 2H5LA 3GK3A 3EC7A 2A92A 3FNEA 4UVGA 2Y1GA 2CVZA 2BFMA 2Q2VA 1V3TA 5CDSA 1I33A 2TMGA 5FI5A 3DB2A 4CLOB 3PDUA 3RUEA 1IHYA 1EVZA 2O2YA 1BDBA 1X13A 3K30A 3VPGA 3G3EA 1VSUA 1K6JA 4PG8A 5IDYA 4D3DA 2IEDA 1UUFA 2AQ8A 2PLAA 1U4SA 2BGKA 1Y5RA 2Q50A 2H9IA 3H9JA 1LDNA 4ZQFA 3QHAA 3E5RA 4FFNA 3NT2A 1Y5MA 4UREA 3DR3A 1P1HA 3DEYX 2G82A 5IN5A 2XXBA 3PK0A 1E1KA 4FD3A 4L0QA 1EUZA 3LF1A 1ID1A 3K6JA 5MGBA 1SMKA 1UXGA 1YQXA 3E48A 2EV9A 4JXKA 4OSOA 5A9SA 1UXHA 4O63O 1VL0A 2CFCA 4HV4A 3D4OA 3WR5A 1A27A 3HDYA 3E03A 3KEQA 4RDIA 5DULA 4AJ2A 4LVUA 3BMCB 4BB5A 4D41A 2RIRA 4HUJA 5JCJA 2J5KA 3UUWA 3JD4A 4HFJA 4JROA 1E7YA 5H81A 4CQMD 3U62A 1DC4A 4J1TA 4YAEA 3WFJA 2CSUA 4IZHA 2Q2WA 5K0ZA 3ANLA 4LK3A 3ETEA 2VYNA 3G49A 3BMOB 4NU5A 5G0TA 3B1KA 3L6EA 1DFHA 5JC8A 4U0JA 5HRUA 4Q9NA 2HJSA 4XYMA 4EYEA 1LRKA 4CM6A 4RF3A 5TNXA 3I83A 2Y66A 5EQDA 4Q39A 5G2OA 1N92A 2GN9A 4YJGA 2OORA 1LUAA 4L8VA 3RQSA 2IZZA 3ZCXA 1AGNA 1UR5A 5HTOA 4AJ4A 3DBHA 4R1UA 3TL3A 5A9TA 4J0EA 3ZNQA 2O3JA 1U3WA 5DT9A 5KWEA 5JFOA 3LLVA 3BMCA 4M8SA 4FFLA 2GO1A 1I36A 3CUKA 4A26A 5BR7A 7MDHA 3LT1A 4R54A 1D1TA 1ZVMA 4BMVA 4ID9A 4Q3AA 5TX7A 1VKOA 2JD1A 3OH8A 4DMMA 1DFGA 3DTTA 2HU2A 4LSMA 4C7KA 2FR1A 3HZZA 1NPDA 2H1SA 2YV3A 4IDGA 4J91A 4YJFA 3RUAA 1B3BA 3DFUA 1GR0A 1JKFA 4IJUA 4CMAA 4A03A 1U3VA 1KC1A 1U5AA 3VTZA 3GEGA 3JQGB 4F3YA 2Y68A 1EEHA 2VWGA 2BI7A 1WZEA 5CAEA 1P0CA 4NU6A 5LC1A 1Z73A 2HK8A 2OBYA 1ZSVA 4XDZA 1UDCA 2YV2A 4UVEA 3ENNA 1PQUA 4PLCA 4BV8A 1B8PA 1IYZA 2W98A 3UKOA 5A06A 4CM9A 3H9UA 1IULA 3PXXA 3V2HA 2WJPA 1E0DA 1RM4A 2D8AA 4DYDA 1Z75A 2NWQA 1H94A 3RC1A 2G76A 3EAGA 1Z7BA 4X54A 3GA0A 2DTDA 1NQOA 3DHNA 3FWZA 2YFHA 3WGHA 3CZRA 2GN4A 4DC1A 4HWKA 4MVJP 4P22A 1PZFA 2FHSA 3HJAA 3TZCA 3PQFA 4QTZA 2GCGA 4YJHB 4Z9YA 1GAEO 4PCVA 4DYVA 2I3GA 3PLNA 1IHXA 4NBUA 3ROPA 4BQRA 4CMKA 5ITVA 2I76A 3Q1LA 5JDIC 1NBOA 1KS9A 4E30A 3D1LA 4OM8A 2VCYA 4QECA 2PKQP 2DPHA 2O4CA 3KSUA 3ROQA 2NADA 1U7HA 1H0KA 1ZUD1 3VPHA 1E3SA 2OP1A 3DWFA 4R3WA 5JDCC 4BNJA 1XWFA 4JJFA 1QYDA 3BXXA 4RORA 2Q3EA 3IUPA 5ICSA 1UZMA 4M89A 3SEFA 4MKXA 3TFQA 1AXEA 4PN3A 3W1VA 4OYRA 3RBVA 2W2LD 1EVYA 5DNAA 4E0BA 5BSGA 4HADA 1Y1PA 3WGIA 1JWAB 4YTEA 3MEQA 5F1OA 4E12A 1GYQA 3DZKA 4ND4A 3I1JA 3JQAA 4ZN6A 2Y99A 4NDNE 1YL6A 2GN6A 1DLJA 1XU9A 1EVIA 4RVDA 2P9GA 3VKUA 3ZGYA 1H6BA 4CQLA 4D46A 3GN1A 3CZMA 4JP3A 1GQ2A 5FI3A 4OKIA 3ZHYA 3JQ8B 4YRBA 5JXWA 1EK6A 1RJWA 1UP4A 5HS4A 2NM0A 2X5JO 3RC9A 4EGFA 4FC7A 4LISA 2YHIB 2BF7A 4J2OA 4DXHA 1V6AA 4A5OA 1D3AA 1T26A 3OA0A 3PVZA 1E7RA 1BXKA 1N2SA 2WD7A 3TZ6A 4P4NA 3ZU5A 4XCVA 3IP3A 2RHCA 1Y9AA 1I8TA 3GH3A 3H4VA 3OP4A 3GQVA 1CF2O 2DAPA 2X22A 3IAHA 3QY9A 4GL4A 1R0LA 1DSSG 5ENDA 3WLEA 2WE8A 1P31A 3JD3A 1UDBA 3FF4A 3M1AA 2NTNA 2C82A 4YACA 2P91A 2O23A 2I3AA 1CRWG 3FBGA 2O3SA 4RZIA 4NI5A 3NTQA 5DBIA 4Q3BA 2QIOA 4RQUA 3JQ8A 3VVCA 2POQX 4FFPA 2J3IA 4MP8A 4BNNA 4BNIA 2UUOA 1E7WA 2EEZA 1IOLA 3E6AA 2Q2QA 1Y9EA 1P1JA 3IMFA 1E5LA 2AMFA 1TA4A 4O6VA 3WGQA 4ALKA 3ZH2A 1WWKA 1NP3A 1LC3A 2E49A 5B4VA 3GG2A 5L4SA 2NU8A 3OECA 4ALIA 3I9KA 5F1PA 2Y1DA 3IIEA 4JJIA 5IZCC 3F6YA 1N7HA 2FPIA 1P1FA 3IL2A 5JY6A 3P7MA 2EW2A 2EIHA 3EVTA 4BO9A 4BS9A 3Q2KA 5F5LA 3JD1A 5EN4A 3OQ6A 1HETA 1MLDA 3ZHXA 1HDYA 5TT1A 2FP4A 1EBUA 3TRIA 1UZLA 2HDHA 3DZGA 4M54A 1MC4A 1ONOA 4QSMA 1SZJG 4YPOA 4CMHA 3QVXA 1QYWA 3TZHA 4R01A 3OBBA 1Q1NA 1ZSYA 3FTPA 1Y8QA 1MXFA 2VZ0A 4D0RA 9LDBA 4NZ9A 1I01A 5TRTA 1UXKA 3PP8A 4E21A 1HE5A 3I4CA 1X14A 1OBFO 2ZYDA 4XEHA 3F5QA 3BTOA 1GYPA 1KY5A 2CVOA 2Q1UA 4FJ0A 2GN8A 2GPTA 2TMDA 1C1DB 3BHJA 5KJFA 3MJEA 3ZWAA 1PGQA 2QG4A 4ZRNA 4B3HA 3WLFA 1DBVO 3CSDA 4BMNA 3C8MA 2QW8A 3L9WA 1C0PA 1C3VA 1RWBA 3KV3O 2B4RO 5HA5A 5H82A 3QVTA 2D4AA 2AQKA 4YDRA 4BGUA 2ZB4A 4NBWA 4NPCA 3RFXA 1L7EA 4ND2A 4OH1A 3TPCA 4BKPA 1M76A 1XDWA 3OETA 4YT8A 5L40A 1I2CA 2W4QA 5B1YA 4WJZA 5CEJA 4UVDA 3PYMA 4U7WA 2BLLA 2JD0A 2G5CA 3GAZA 4XWYA 1O89A 4WLEA 1R12A 3GVXA 1NX6A 5K6AC 3BMNB 1KVRA 3BHIA 3GUCA 3AFMA 1RKXA 4JN6B 1SC6A 2GUGA 1DIRA 3K5PA 3DZIA 4GQAA 4MIOA 4DRYA 4EW6A 4CR8A 4F45A 5DOVA 2AQHA 3Q9UA 3AUTA 4B7UA 3DAFA 1ZK1A 4NFYA 5JSFA 1ADCA 1WNTA 2PWZA 3MJVA 4JK3A 1E5QA 3OIFA 3ZV4A 3Q11A 3JQFC 1AE1A 1MXHA 5IZ4A 1X1EA 3F1LA 3OQ1A 4WLNA 2HMWA 1TI7A 2LDXA 4NJOA 2ZTMA 5BNFA 4BIIA 1HLPA 1LDEA 1RM5A 3O8QA 1QRRA 1X1TA 4CM3A 4GAEA 2ZTLA 3MOIA 1ISGA 3AUSA 1YO6A 3TSCA 4BNMA 2B36A 3K31A 2EERA 2YQ4A 4UUOA 2CNBA 1NXQA 4BNWA 1KYQA 1RPNA 2O3UA 1WPQA 3EGOA 2Y93A 4E33A 4TVBA 3GAFA 4OQYA 1WVGA 3JQAB 1BG6A 3HB5X 4I5FA 3BMOA 5A9RA 1DB3A 3BMQA 3W4KA 2QRKA 3GRKA 2ZJ1A 4YJDA 5HBRA 2RBEA 4OOEA 1U4OA 5AXDA 3RC7A 3FNHA 4DQXA 1UAGA 3RUHA 1G1AA 2FR0A 4CUZA 2V6FA 5JAMA 1QKIA 3OMLA 2PTGA 1VL6A 3CE6A 3RI3A 1F8FA 4FOSA 4BO6A 4URFA 2GNAA 5DBFA 4E5NA 5ITWA 4AFNA 2I67A 4WOKA 4MPDA 2Y0DA 1TVEA 4NG5A 1LJ8A 3CKYA 4BNZA 3PTZA 4JBHA 4RPGA 3ADOA 1EBFA 2JHFA 3C7CB 1JKJA 3WXBA 1MA0A 5CDGA 4ND5A 3B1FA 3WNQA 3EYWA 2Q4EA 1LI4A 4IDCA 1FF9A 2GF2A 1PGNA 3CINA 2YFQA 3KLMX 5C7LO 4GKBA 4L4XA 4Q3CA 1A4IA 2B0JA 1LC0A 3PDJA 5KKAA 1X7HA 1PWZA 3L77A 3KETA 1E6WA 2FY8A 3I9JA 4AJKA 3VH4A 1BXGB 1B16A 3H3JA 3ZNNA 5JDCA 4QFCA 1CERA 4YBZA 1EDZA 1YBAA 5TS3A 4LGVA 4W99A 4DIBA 3LC1O 4JQCA 2ZK7A 2VQ3A 1A71A 1W73A 5A03A 2WD8A 4IPTA 3WGGA 4FIZA 3A06A 1XA0A 1ADGA 5F21A 1JTVA 2HMTA 2WTBA 5DN9A 4R4JA 3L0DA 1DDOA 5L95A 2JFHA 1HE2A 2UDPA 3GPDG 3WQQA 1ULSA 4E5YA 1QR6A 3ONDA 2BGMA 2IEBA 3UVEA 1MFPA 4IXTA 4U6SA 3DHYA 4A2CA 4RQTA 1MP0A 1D7OA 4EJ0A 1SEVA 1ZFNA 1YXMA 3MWEB 1EFKA 2FPPA 2PGLA 5F1KA 1VE9A 5JCJD 1PQPA 1D8AA 3AM3A 3S2FA 1Q0QA 3GMSA 3GZ4A 5HM8A 1IY8A 3GVIA 4BKOA 4W9NC 3ZW9A 5B4TA 3NGLA 5J23A 3MWDB 3DAPA 1A72A 4CM5A 4OL9A 4NBTA 4BNHA 2QQ5A 4I9HA 3ULKA 1XR3A 5JLAA 3K96A 3EMKA 3OIDA 4ALMA 3BTSA 4O0LA 5C7OO 2HK7A 1ZCJA 4DIFA 3IUSA 2GZ3A 5K6AA 1WDLA 1YB1A 2ZKLA 1K0UA 1UXIA 4AJ1A 4RGBA 4QO8A 1O9BA 3HSKA 3DXFA 1OC4A 1E1LA 4KUHA 1JWBB 1A7AA 1U1IA 4IIVA 4OHUA 4CMGA 1PJ3A 2Q45A 3VTFA 1I2ZA 2EGGA 2PD4A 2J5RA 2JCYA 3C1TA 3B70A 3JQ9C 4HFMA 3WYCA 4MINA 4EJ6A 4TZKA 4U8GA 4EUHA 4OOFA 4H15A 3PGXA 1MV8A 1U8XX 5DCWA 1PJQA 2ZYGA 1HDRA 3PJDA 4N7RA 3HADA 3JQBC 3LSYA 1HE3A 4MIEA 5CDTA 3E9NA 3AJRA 4RPLA 3INTA 5CDUA 2QYTA 4ZHSA 2AQIA 2NVWA 2NLOA 4JP2A 1M6HA 4XX0A 1LLQA 3PGJA 5DP1A 4BO1A 4WNCA 1NFFA 3GZNB 1YL7A 1GL3A 2PZKA 1EMDA 4YCAA 3C1AA 4NBRA 4WGGA 5GZ3A 5L53A 3QSGA 4E13A 2HCTA 1GV1A 1YOVB 3I3OA 3GDFA 1BTOA 3BYZA 4RV9A 3H9EO 2PZLA 3T4EA 4BKQA 4B3IA 1AXGA 2PFGA 2VUTA 3O8QB 4BNUA 2C5AA 4R41A 4LCJA 2NVUB 2UVDA 3ZZNA 3QLJA 1GUFA 5JPIA 1NTOA 4IQGA 4HX5A 1E77A 4EDFA 4FN4A 1T2EA 4ZQGA 1IB6A 1FDTA 2W2KA 3QWIA 4J0FA 4FDAA 5EQFA 5I7VA 3U4IA 4B4WA 4L75A 2HSDA 1LNQA 2VWQA 3HE3A 4L76A 1XYGA 4XB2A 1O95A 1E1MA 3ZWXA 1TT7A 1BDMA 2HRBA 4TRMA 5B4UA 5ILOA 4O5OA 5H83A 2GR9A 4DA9A 1KIFA 2UV8A 4TKLA 2Z5LA 3TFOA 3I6QA 3DZJA 3KRTA 1H2HA 2JKVA 4TQGA 1LDBA 4GGOA 4C7JA 1WAMA 1X7DA 2I5PO 3BMNA 4BNKA 5FYDA 1OC2A 1BWSA 3DONA 3G0OA 4IDBA 3T7CA 4ZQHA 3ZWVA 1PS0A 2WSBA 1K6XA 5JAQA 4CLEA 3ZWOA 5G4KA 1E3JA 2X1HA 2C07A 4XQ9A 3SBOA 1NFQA 3EK2A 4Z3KA 1XU7A 2QYSA 3F1KA 1CEQA 2XAAA 2JJYA 3GVCA 1A9YA 1IZ0A 1JN0A 2DQ4A 2A35A 4YQZA 4J1SA 4NR0A 3UF0A 4QXMA 4RF5A 3RAJA 3SC4A 5C3MA 3W6ZA 5L7TA 3LK7A 3GGGA 3HNPA 4BKRA 2JL1A 3H8VA 4XYLA 3NT5A 2OHXA 1NWCA 2EP7A 3KXDA 3GGPA 1G0OA 3ICCA 4AJJA 4Y8VA 5IDXA 1GPDG 1KVUA 1PS9A 4RF2A 2I66A 1LEHA 5JY1A 4W6ZA 4YAKA 1N9GB 1M75A 1V35A 3BMQB 3E8XA 4YVFA 3LZ6A 3ZU2A 2X86A 2Y1EA 1E3WA 4S3MA 1J5PA 3B20A 1NHWA 3AW9A 5GY7A 4RVSA 3FWNA 4I5EA 4GSLA 2CY0A 1C0IA 3RROA 1ZMTA 1DHRA 1HDOA 4BNVA 1VRWA 2EWMA 1UP7A 3AY3A 3PHHA 3PJFA 4RVUA 1GU7A 4D3FA 3ROMA 1FDVA 1SB8A 2VTEA 3WSVA 4DGSA 3W6UA 1CETA 4ZVVA 3MJCA 3WYEA 3IKTA 3GR6A 3WX0A 4E5PA 1KVSA 1ONNA 3DL2A 3KO8A 1QYVA 3GFGA 3OEYA 2D59A 2PZJA 3H5RA 3H9GA 2WMDA 4HY3A 4WCDA 3QRWA 5DBGA 4YR9A 4K6FA 4RVHA 4O59O 3QV1A 3I9MA 1ENYA 1BXZA 1DIAA 1KVTA 5CP8A 1PQWA 2VHVA 3U0BA 2NVBA 2DBQA 3WGYA 2R00A 4JLWA 5IZCA 2AXQA 1PGPA 3ON5A 3PJEA 5A3VA 1E3WB 1B7GO 1LSUA 2GYYA 4BO0A 3VZSA 3GRPA 1VJTA 5EIOA 1W6UA 2IZ1A 2XOXA 2J5QA 1VKNA 1HZJA 2VRCD 4CQMB 3WB9A 4FJ2A 4E2XA 4I9NA 2ZYAA 4E31A 2FZWA 1R37A 2O7SA 3K2EA 1B26A 4DPLA 4HKTA 4H3VA 3ETGA 1ZW1A 2HRZA 4J43A 4UULA 5TGDA 1TB4A 1GD1O 3GHHA 2O3RA 1PJ2A 2P5YA 4ALJA 3K92A 4YAJA 2UAGA 3H2ZA 2P4HX 1PL8A 2X0RA 4Z3DA 2GRAA 4DQVA 2I99A 3E9MA 3O26A 4RLSA 3OJ0A 2IRWA 3LYLA 1CWUA 4PLGA 3O9ZA 4RPKA 1DIHA 2ZTUA 3NEPX 4D44A 4Y98A 3BAZA 3PQEA 1A5ZA 4XJSA 5BNIA 4OXKA 3Q2IA 1ADFA 5A5EA 3CMCO 1MX3A 3GZNA 3P5SA 3G79A 2GSDA 2P9EA 3F5SA 2B5WA 2CUKA 1GEEA 4AJPA 3RD5A 2YJZA 4GMGA 5T6BA 3C1OA 3ZU3A 4ND3A 1EUCA 4RPJA 5FF9A 1I0ZA 5ENVA 2I6TA 4JNKA 1O6ZA 2YHIA 1K6IA 3WDSA 2D2IA 2HJRA 2ET6A 1I32A 1WW8A 3GUYA 3H9QA 3WMXA 3IKVA 3V8BA 1Y8RB 2WD7B 3IDSA 4M49A 3TOXA 3BTVA 1T25A 4GPD1 4JJGA 4XQEA 4DVJA 3OIGA 1HYHA 2Y1OA 3ANMA 3I9OA 3FPCA 2FN7A 2VYVD 3GVPA 2R6JA 2Y1CA 1UP6A 3CH6A 4AJLA 1O94A 4R5MA 3KUXA 5AXAA 1PX0A 3A4VA 3DBLA 3BIOA 3CIFA 5AOVA 5AXCA 4KDEA 1R16A 4J1NA 1ZK0A 3PHGA 1YVEI 3V2UA 3ZWNA 4PVCA 1EQUA 3COSA 1PR9A 3JQ6A 5CPBA 2CZCA 3WSWA 3EZYA 4DWVA 4I5DA 3HN7A 4I8XA 4KUEA 2QRLA 1HF3A 4KWHA 4OGWA 4WECA 5COAA 3H5AA 4J7UA 2NU7A 3WQSB 2DU8A 1W4ZA 1EZ4A 4ROSA 2AEMA 3ADPA 4W4TA 4BQPA 4L4RA 1EUDA 1YB4A 1NVMB 3PWSA 1DIGA 4L74A 5FWNA 2XXJA 3SXPA 4E4YA 2QZ9A 3D3EA 4OAQA 1E3LA 3GC6A 3DOOA 3KYDA 2VTDA 5EPOA 1UDAA 1NVTA 5JO0A 3UH1A 3S55A 3S2EA 1T2FA 1YBMA 5AYVA 5KNLA 3GHYA 5L9AA 3CTMA 4IJWA 3VC7A 3E18A 1YBVA 1CIVA 4WKGA 4L73A 2CF5A 1UJMA 2VZ8A 2JCXA 1PGOA 2BI8A 3OICA 3PWZA 4PVDA 4XRRA 2W8ZA 4PRLA 1T2AA 4GVXA 3LDHA 4NBVA 1PS8A 3OJEA 1PU2A 4FFOA 3AM4A 1FJHA 1FXSA
chains in the Genus database with same CATH superfamily
5FXMA 4WY8A 1SXQA 4FC6A 1CRQA 3GNTA 2AOTA 2GDZA 1HDZA 3BHNA 2Z1NA 5JATA 1D2EA 1GZ4A 1QV9A 1WD5A 3AEKB 1W4AA 1EK5A 2LIPA 4B35A 1XT6A 4GPTA 4PYKA 1R27A 1QLWA 4AZ0A 4DA6A 3DPUA 4IQ0A 3U7EB 2L17A 2QJTA 2HNBA 3NW9A 2JATA 1J0DA 3EPPA 1MAVA 3OQHA 2ZJBA 4E1BA 2GYUA 4P3PA 4KZPA 5EJIA 1PWEA 3NIDB 1A8SA 5CA0B 1CJMA 3ABRB 2B1QA 3QWFA 3PIIA 4FLEA 1DXOA 1PW7A 1J2JA 5HFNA 4DLYA 5KHAA 1ZBDA 4PZEA 4PTZA 5ALOA 1F6BA 5FD8A 4YT5A 1H4TA 3HLTA 4C1BA 4FUTA 4CMCA 2RGNC 3IC5A 4GM4A 4IXWA 3RJMA 1HYGA 1R4NA 2W7TA 3V2IA 3SJUA 3SYRA 4NXMB 2IIBA 3FOCA 1N2OA 2RH5A 3R41A 4KAAA 4TV8B 4X6LA 1TF7A 3BZBA 2FK8A 1PE0A 1R18A 5L4NA 5DM0A 2YJ4A 3IT0A 3WP1B 3LC7O 1QZXA 2J07A 3NAQA 3A6HA 1EP9A 1FY2A 1G2OA 3KKKA 2I4IA 3L8HA 3QE2A 1PFWA 3R2JA 4GH5A 3RASA 4CFZA 5JPDA 1NW9B 2JBAB 4LHZA 5TT0A 2GGSA 4KIFA 3GAAA 1NDQA 1Q95A 4LECA 1WHTA 4DMRA 3PHJA 3OESA 2WIAA 3F46A 3UAVA 3THXA 3GLRA 2AE1A 1Z2CA 2OQIA 4L08A 2FPXA 5FPTA 3VHQA 4CODB 3ROXA 1MC8A 2WFLB 1B0AA 3AJEA 2R1VB 3DOFA 3KZ1E 3R0VA 1BHJA 4M2LA 4DCNA 3MUFA 2Z6AA 2H1OA 1CUHA 3KSZO 3OLCX 1T1IA 2D5LA 2BKEA 2WHPA 3ITKA 3O8LA 4Q9LA 5ESDA 2AB0A 2YYSA 2ZDHA 1F2UA 3IUMA 4DPKA 3GLGE 4PHGA 2B69A 1J0AA 3G1UA 3QEKA 4DQXA 3RAPR 4DC9A 1BJTA 4DA8A 2IYTA 4B83A 2HJ9A 1GA4A 5A5GA 1E6UA 5M04A 1KEUA 5IKEA 5KTKA 1ZGJA 1UH5A 4XB1A 3SSMA 1EK0A 2QMOA 4XSVA 1S01A 2X9QA 1P17A 2GM5A 2BGNA 2P79A 3E15A 5EP1A 3NP7A 1M74A 2AVNA 3GT3A 4EEZA 1BKSB 4OX9B 2HT1A 2XECA 4UD2A 4Q82A 3EXHC 5EPUA 3D6JA 5JU6A 4PZLA 1LFDB 1PI3A 2HWYA 2OGTA 3ESAA 1UDXA 4YI3A 3H6GA 1LSSA 3QXJA 4Y6RA 1VGQA 1MX5A 3LQQA 1Z36A 2M1XA 4TN5A 4ZAXA 4QYSA 4Q1CA 3ZDRA 3KVYA 4Q02A 1CZOA 2VAWA 4EFLA 2Q5FA 3DEFA 3PC2A 5SZKB 3TNYA 1YB6A 1AQLA 3PLRA 2IF2A 3K09C 4PLTA 5IAGA 5TSDA 2VATA 1FFBA 2UZ1B 3LGXA 3SYKA 4EPRA 4B40A 1O97D 3EXEA 4E5UA 2P9CA 4BNGA 2QEQA 3CKMA 4FEAA 5JZ9A 3R7NA 3ORFA 2C95A 1VJDA 3FTCA 3LQ1A 2QLFA 1ZRHA 5CM9C 1WVIA 2BM9A 1ZONA 1REQB 1WTAA 3D4BA 3IUEA 5KOHA 4LYYA 1CK4A 1GTG1 1KMIY 2YASA 3RIHA 3GVHA 1PWYE 2H6EA 3DBRB 1ULUA 1ORIA 4MKIA 4PINA 2DBZA 4O2AA 4U7GA 4V3BA 4YRDA 2F1JA 3LCVB 2X2PA 1X80B 3WDKA 4BO2A 3ZD6A 4IV5A 3QA9A 4PYQA 4BHTA 3IAUA 2J45A 1LSOA 3NIFB 1CUXA 1PWHA 2B1RA 4IQ8A 4XWGA 5J2UB 1F1JA 3JVDA 1FXWF 2ZRFA 4IXDA 4Q7LA 3EF0A 3N2KB 4QAJA 4D79A 3U80A 5M2QA 4OA8A 2O5CA 3QPCA 5IVIA 2XKBA 3GJYA 1W1UA 2O2JA 3E5NA 4BV3A 1I80A 2P2LA 3QVVA 4EITA 1SCKA 2ZRQA 5A6SA 4FGZA 2VCHA 3AT1A 5IW8A 4KAJA 2QAGB 2X9VA 1IU9A 2DPYA 5CFPA 3BERA 4JOQA 2PZFA 2AXPA 3DKIA 2GO7A 4KO4S 4L6AA 3ANTA 3H9CA 4MVYA 4WK4B 4LJAA 5F51A 1SXJE 2BMAA 4WPGA 3N53A 4X95A 3EUAA 5HSGA 3I6IA 2OOKA 3H1EA 3P26A 4I6JA 4U6NA 2BM1A 1L5KA 5J4LA 2YUTA 4WASA 2B4TO 1GPKA 1PVVA 2X8LA 2Z30A 3MMNA 3MT9A 3SXJA 4B31A 4EWLA 3DBRA 6PFKA 3NWPA 2SICE 1BD3A 4O4HF 5A4DA 2ZVPX 3USZA 5BQ3A 1L7MA 3SWWA 1ZGHA 5F76A 3SY8A 2NXNA 4MEAA 3PPIA 2IZ6A 5CDYA 3D64A 4Q34A 1XPJA 5CBPB 5JZMA 1GOTA 4BC1A 1VRVA 3WBJA 2NO5A 4NCXA 4GX0A 2HA7A 2NAFA 2RKBA 5HG0A 1H9CA 2A5DA 2VHWA 3USCS 3V7WA 4IIHA 4UOQA 1QDEA 2H08A 1I6KA 3ND6A 4QBGB 1JAZA 3VZDA 4WUTA 2YQZA 5KVAA 1H69A 5J2TF 4DTIA 4K26A 1T5SA 4Q1BA 2EP5A 2GM3A 2QN1A 1XD9A 5HJ7A 3UT6A 3GNSA 4G84A 4XGNA 1WDWB 1ORDA 2VDMB 4JHXA 4A73A 1RWKA 2NUTB 1SOVA 2XWQA 3OU2A 4CV3A 1JS1X 3AKYA 3JALB 2XYVA 3C87A 3RRXA 1K8YB 4X6YA 3H2GA 1E9BA 4PM4A 6REQA 2BGUA 1ZXXA 3P9KA 4KO2S 4NMHA 1UJNA 4GKJB 4F2PA 2R0QC 1PRYA 2QROA 4DJJA 4TYYA 1ZKMA 3GMIA 4MMZB 5DNEA 3QI7A 1MH1A 3C4QA 1KJNA 3HWSA 3NOQA 4DA4A 4CR6A 4KW7A 1M6WA 4MVJM 1QIJA 3RSZA 5MF6A 1WUYA 1OX4A 1V48A 3R8CA 5M7EA 2JC3A 4ZRMA 1RQXA 1P19A 1UPUA 2ZBQA 3HWX1 1YR3A 4HB3A 3AVTA 5ER6A 3ZZMA 1RWXA 2C97A 1SBNE 2VXCA 1DHTA 8ADHA 3KQSA 5CX4A 4J4HA 4HDRA 4MLCA 4ZC8A 1J7KA 1D8TA 2R60A 2RHGB 5GONA 2WB2A 4CL8A 4C7JA 1N5LA 2GEBA 3BBLA 4QA9A 2W43A 1HSZA 4D9KA 3CA8A 4EHLA 1N32B 3TMYA 2QVYX 2PSEA 5U4QA 1PJTA 1VHLA 3ETCA 5LD2B 1RR6A 2GTIA 3IDOA 3ZWYA 2ZIXA 1ZXBA 5THKA 3HFGA 4JL8A 4RUKA 5C5DA 5DW0A 2J3HA 3N39C 4N54A 3VRHA 3AUXA 2JEYA 2Q4RA 2F1OA 3D6FA 4FBGA 1E2MA 3DZFA 3ZWQA 3QXCA 3NV7A 3PJGA 4PXSA 3MCUA 2JLWA 1E2EA 1W85B 5AUPB 4MHOA 2FMIA 2ZETA 3MGKA 4BMXA 1ZYUA 4D6PA 5H0IA 5FWXB 1FDIA 3L4BC 4DLRA 4EIWA 1HNXB 4MJ3A 1K88A 1ZEMA 2FUEA 2GPSA 3T1HB 1ZOLA 1T6YA 5DGTA 3L79A 5IT5A 1M34A 1R8QA 1NATA 1XZHA 2VSQA 4G81A 4JLMA 1GSOA 4DEXA 4F5YA 4DGQA 1TM7E 3GYBA 3HCDA 3ESXA 3OJLA 3R3ZA 2FQQA 2L69A 4R9RA 1LTHR 3RRYA 2OM6A 4TZTA 4D4MA 4DIDA 5CD9A 2GHTA 2X4IA 1QH8A 1XDBA 1YR6A 1NRIA 2XQJA 1MORA 4G89A 4Y9DA 2P35A 3FI9A 1IG0A 2VXBA 1JSCA 1DUSA 3DF7A 1AS0A 2BEWB 1Z22A 2DRIA 1PJLA 3TNJA 3SQDA 3RKSA 2JGKA 5F2OA 4CF5A 2NZXA 1I5RA 1THGA 2BE9A 5ILQA 4RY0A 2CNDA 3C7AA 3RYFB 5ALGA 4XM1A 4X62B 1IVYA 1CR4A 1TMOA 4QRIA 2H63A 4UBOA 3NU1A 4ZQBA 2F4VB 2LR0A 3WGKA 3GMDA 3GDOA 4B47A 4EUKA 4FHFA 1L9KA 2W6JD 2CLOB 3NO4A 1IMOA 3PNOA 4JEIA 1JJBA 2PVCA 3O2SB 1NP6A 4MV5A 3NI2A 4EY5A 1I1QB 3LVRE 2D0PB 1DWUA 1JRLA 4WOJA 1HWYA 4TZ0A 1KEZA 2O1XA 4MOWA 2JGRA 3CW2A 3STHA 4Y1FA 1MJGM 5E1DA 2O2GA 3LPCA 4N0DA 2XB9A 3LW7A 1OTYA 4TKVA 5JWHA 2XNHA 3HB4X 4KN6A 1H93A 5JE8A 5A6VA 5CXXA 1QAOA 3T4XA 4WWHA 2IV2X 4ENSA 1E9AA 2R8BA 1TCUA 4MWSA 4B6PA 4YJ2F 3C5WP 1U1FA 3VYVA 1XK6A 1XTSA 3B12A 1DOHA 4JL5A 4XM0A 2PUFA 2FW9A 2PCLA 5HMMA 1TXGA 4RDHA 4ALLA 1PF7E 3QH4A 1E6LA 4WD3A 3M4JA 1O77A 4R2XA 4PRKA 3RU3A 1HR0B 3G7NA 2YCLA 3U16A 4XM2A 4KX5A 3VR3A 1T4BA 2BMEA 1FFDA 3EBLA 4Z8YA 4TUYA 1T6ZA 2EF0A 3I05A 3IKJA 3OLQA 1G16A 2FWNA 2HHJA 4J16A 4PLVA 5AR1A 5U4XA 2BSXA 3MA0A 1WCIA 2CHEA 3N7UA 3QU4A 1NSTA 4OM7A 4C76A 4BN0A 1YVRA 1BJRE 2AYYA 3BHMA 3JQGA 4FYYA 3U4CA 1NJ2A 3OQBA 3WNBA 2AK2A 1A9RA 3RU9A 3VZPA 1KWGA 3DTVB 5EFOA 2XQVA 2QLTA 4LF9B 4HGQA 1JDTA 5EIHA 2B6NA 5FORA 5FBQB 2IE0A 2H8GA 3TQSA 1NBWB 2V7QA 2N1BA 3HA5A 3PQ8A 4J1QA 2LD4A 4K7JA 1SD1A 3SDZA 2CE7A 3MBIA 1MIHA 5T3UA 2CLIB 1KY4A 1P44A 2QM7A 2X41A 3Q3CA 4JYPA 2QL5A 3OHSX 1J21A 4UMDA 4IOKA 3EVZA 5EJFA 1OXMA 3JPYA 1YNSA 4RHFA 2R85A 3ZKAA 1IDOA 2ADFA 4WN9A 2E85A 2ZJFA 1D2HA 3P0EA 3TK1A 3HB7A 3MHTA 5K8JB 1UXJA 4HS9A 1SVIA 2PWYA 3I2YX 4ESVA 1Z6ZA 1H4QA 1RBYA 4DCOA 2QZSA 1ECGA 1E2PA 1DEAA 1GGEA 1I9GA 2C88A 3ND5A 1CQWA 2DC1A 1C1DA 2ESRA 1PIWA 1GSIA 1E9CA 5HCNA 3D7MA 2CNWA 2G7MC 3OZWA 5KOIA 2FMKA 3WWOA 3KSRA 3CF4A 5G0WA 1L1RA 1QGZA 3WWZA 4QYTA 3I2JA 1WQ3A 3T4UA 5P21A 3BK2A 3GLUA 3IO5A 1GQOA 2E48A 1CQXA 4BGVA 1V47A 1BQEA 3HI4A 3KEGA 5JAOA 4TMTA 2PJRA 2B4KA 2Q3CA 3TTYA 3AY6A 3MUOA 4L22A 3NXKA 4FXOA 2IQ5A 1Z6AA 2IYSA 3PFFA 1P72A 4D98A 3WDLA 4XTRA 4DLVA 1U28A 3P9RA 2CDBA 3QWBA 1CVLA 1Z13A 3IOYA 1RHUA 1B15A 4XD2A 4IJ5A 5T8KC 2OXIA 1E0JA 4BLWA 4TMFA 3HJGA 4JUIA 1L1EA 3PNKA 1H2EA 2BFDA 3L7LA 1QYXA 2GLTA 4OY3A 4XCQA 5CNMA 3RIEA 3GJ3A 1TYCA 4LEIA 4MVJG 3SC6A 1K2VN 2G0AA 3MCVA 4Q3EA 2ORWA 2G5GX 2PZ8A 3UMCA 3W3AH 3FHCB 3EOAI 2O9JA 4MXDA 3PFHA 3V4SA 4Z7OB 5JCOC 2DWUA 1IONA 2H1FA 3IP9A 4QGFA 3U2QA 2B4AA 3LIPA 4BFVA 5I3CA 3G68A 2AEJA 2MSEB 1IBLB 4AL4A 1UQTA 4DBVO 5JI2E 3MJHA 3RLFA 4F9GA 5T7BA 5IM4F 3PPYA 2C9DA 1HDCA 1SVSA 3O5AA 4N8EA 4P4LA 4R1PA 3OUTA 4MDEA 2PMCA 3JATA 5DNWA 1E6KA 2CV0A 3DWIA 2CHVA 5AKZA 4LYDA 1PBTA 1DC8A 2IXDA 4UU7A 1JQBA 1J6UA 2BDUA 4K2AA 1CUVA 1KEWA 1DAGA 1V1MB 4O5AA 4QDOA 4TWRA 4YO7A 5IJZA 1R8JA 1KBZA 1Z3IX 1VJ1A 4JBIA 5FNVA 1LQTA 2QX6A 1KZGB 1QORA 1QG0A 3R1IA 2PMBA 1I4EB 2OUIA 1HTWA 1OR8A 4TKMA 1XDZA 2EJVA 3R9IA 3L7NA 4LZOA 1XQWA 1FFEA 2ZAYA 1IWBB 3PFWO 3SFVA 4KVGA 3TI9A 4EG4A 4WBNB 2XB2A 2VP6A 4ZK6A 2OL4A 5KVCA 5LLDA 2NUTA 1B1CA 3I62A 1VJRA 2P5UA 4AJNA 2XUDA 5JZBA 4BFLA 2XPCA 3EDQA 3NUGA 3RSFA 5DP2A 2JW5A 3W8FA 3SOPA 4B3BA 2ZCUA 1M1NA 5IK2A 3UAGA 1XCBA 4WSOA 1GNRA 2E4YA 4DY6A 1QP8A 1Z8NA 3NDIA 4ON9A 3I64A 3WJAA 4B4UA 2HV9A 4X1OA 2QTZA 1JV2B 2W70A 4CJXA 5EPEA 2NTVA 3AJ8A 4RJJA 4C01A 1CJTC 1FLNA 1YZUA 4D0RA 1RVDA 4FYKA 5JZOA 4CEHB 2N9UA 1BWRA 1AMOA 1U8CB 2VT2A 4DARA 3DMNA 3REFA 1II8B 1U65A 3K0FB 2Z43A 1MC5A 3CWCA 4CIAA 5CK5A 5FBLB 1GQRA 3LQ4A 3U19A 1EA7A 1LRLA 2PS1A 2CVFA 4F4FA 1Y8AA 2R4QA 3QVSA 2BKVA 1RVV1 4HDCA 1OLUB 3IP1A 4BIMA 2DFTA 3D5EA 4KYTA 2DQKA 3NEJA 3W7VA 3WE7A 4H7EA 4QPNA 3BF8A 1D0IA 2Y67A 3JARA 1BGWA 3L06A 4FSHA 1ZM2A 4Y0AA 1QYRA 4HS4A 4YJ3A 1Q22A 3QBEA 3KVOA 1J1UA 1RJDA 1LLCA 2XYHA 1NG1A 2BUAA 4E11A 1A9TA 4YLGA 4CUKA 1RM0A 4X64B 1J23A 1G3IA 1ZI8A 2CJYA 3AM5A 3LPAA 3I23A 1OAKA 2WQZA 2PBFA 2FX3A 3Q6MA 3M4NA 4CEJB 1MRNA 4QJBA 4CXMA 3GQBA 1BOFA 4RFVA 1DMSA 1YQWA 1Y8QB 3NNNA 2N3ZA 5G0SA 4YC7A 5F4BA 3ZQ4A 5KJ6A 2C8VA 2FSVA 1QTRA 4I6EA 3BQ9A 2WHYA 1XZLA 2KPOA 1FRNA 1SCUB 3GW8A 4IBOA 1JMVA 1I4DD 3KWFA 3LF2A 3AR3A 3MTBA 4HQLA 1UT8A 4IDQA 5DYYA 5B7GA 1Q16A 5A71A 1Z7GA 2BFAA 3AB8A 2ZQZA 4HBGA 4RD4A 4NEHB 2H4HA 2JFGA 2JKZA 2X9GA 1WABA 4XWTA 3FBTA 5IU6A 3M2TA 4P84A 2ZQYA 1P33A 2B8WA 1ITZA 3CW8X 3RC2A 1GZ3A 2YRWA 1N8KA 1XX6A 1ORVA 3PE3A 5T57A 3ND9A 4D3YA 4DC0A 5HZGA 3FOEC 1SHJA 3NJ4A 2IXTA 1R0YA 121PA 3HY3A 3KQKA 4M9XA 2W6IA 1DJNA 5TE9A 4TVSA 5CVVA 3C8HA 2QZZA 1DEKA 2NO4A 2NU6B 3FVVA 2B7BA 3S1AA 2OBNA 1TM5E 2GVZC 1RWPA 4M7OA 4NC9A 1KYYA 5K9ZA 2C1ZA 1PKEA 2IY7A 1KZ6A 1JHAA 1ULAA 2CLMB 4BOYA 3N87A 1ARZA 1G1MA 4BWYA 1QG6A 2DYKA 2ZULA 5JSUA 1MW9X 4KP7A 2Z1DA 2GJ4A 2BCEA 4N3BA 2PNJA 2PH5A 4IJVA 2FH5B 3L7OA 1QO0A 4KQJA 4WINA 4WACA 2G70A 1XRMA 2R66A 3GZJA 4WA8A 2ZT8A 2C29D 1SN7A 4UVEA 3TLGA 2YFYA 1Q6ZA 1ORWA 3G2JA 1KFJB 1WV0A 1USVA 3RSOA 1GN8A 4EQ6A 2HRRA 2IYFA 3FPFA 2HPVA 1W5EA 2COKA 2HK6A 3IEVA 2LWIA 3FSRA 1FLAA 1J09A 3P2IA 1ZU5A 1LU9A 4TM8A 4ESHA 5BQ5A 1MIOB 3RS2A 2JHCA 3K35A 3WLTA 4EB6A 5BWLA 4FOTA 2C7VA 1AX9A 3ELUA 4G5FA 3UMGA 2X3YA 5CTJA 4CU5A 5KIAA 1OPXA 5CLIA 1H2BA 4TWBA 1IOVA 1D7AA 1E6CA 2J0VA 4NV0A 4YAGA 2YVKA 1PR4A 3EBOA 3HHPA 3JCZA 2WIGA 1RLMA 2NYVA 3BL8A 4FZ5A 4NAUA 4U3JA 5BV0A 4XPZA 5DCYA 4DCJA 3LCUA 1YJXA 1FNNA 3AGQA 1EG7A 3GY0A 2P4QA 3KUUA 1ENOA 3B8HA 1GGKA 4K9MA 4Q1FA 3QYFA 4UEKA 1VJ5A 3ZDXB 3PIDA 1QF6A 4F91B 1I30A 2GSWA 1U9ZA 2LRHA 3WZ2A 4S24A 4XVHA 1J2TA 2HK9A 2Q0HA 1JHDA 1J1ZA 1I1OA 1XTPA 2QPLA 1WUKS 4B6FA 1UPBA 2YMMA 4TS4A 4B6JA 3WXBA 4XGRA 2RHHA 3FXAA 2P2CA 1UFQA 4I4IA 1QYIA 4Y2RA 2WFLA 5DHTA 4ZU1X 3W7AA 5HHTA 1WM1A 2EFHB 4ETMA 4GR9A 2GHQA 5DB4A 5GVRA 5DN6D 2I3BA 4X7BA 5K3AA 2CXOA 5B3LA 1Z15A 1VCNA 2GZDA 3DMTC 1COWA 1QZZA 4WUVA 1XZQA 3D6AA 4AROA 4RZSA 3BB4A 2CF6A 2BTQB 3KHUA 1G9TA 3KE8A 4JVSB 1C4WA 1N8TA 1QK5A 1RE0A 3PC8A 1TJNA 4J90A 3RSCA 1FE8A 3FOBA 4EK9A 1NGSA 2FUKA 1NN3A 3DCIA 4MQMA 4EI2A 5BN4B 2FG6C 3ONWA 3HJNA 3JYLA 3LY5A 2NUPA 3L7BA 4XKJA 4D3SA 2IS6A 4K9QA 1HH4A 2VOEA 1Z4LA 3Q7PA 4KRFA 1A9ZA 4IRUB 4BO4A 3R7DA 4GMHA 2W48A 3F4KA 1G59A 3QF4A 3GYGA 3O4VA 4UAUA 3S8MA 4YHHB 5BOSB 5GVSA 3KSMA 4CMJA 2ZCJA 2HJGA 3VJRA 3F47A 5EWJA 1B73A 2IDMA 5EYPB 1ZD8A 1T4CB 2A1UB 4G86A 2X8AA 2C2OA 4TSKA 4DR4B 1RW4A 4JJZA 4D8UA 5ICEA 2XDWA 5JYDA 3K9CA 3RFVA 2HD4A 1MPTA 1OWMA 4G09A 4QPDA 3ZE8A 2FSIA 4QOFA 3EQ8A 4KR0A 1ZEJA 3X1WA 2J9FA 4JOCA 3DBVO 1ZHOA 3D7LA 5D01A 4GNKA 3Q2OA 3W77A 2IU0A 1E66A 5ARBA 3IMEA 4BJ3A 1I9CA 4GECA 2ORIA 4IYJA 4M1WA 3RS7A 1E96A 2I2BA 5B37A 3ZLVA 1GPJA 2R5NA 1HFEL 3K2QA 4FGJA 4G1UC 5F1YA 1Z0DA 2WWHA 3FLEA 4LDNA 3GN2A 3M6LA 2BDTA 3L4BA 2Q0QA 1E61A 2RKOA 4LDAA 4PAOA 4YB8A 3F4BA 3JVVA 4EVSA 4QG7A 1MNQA 1QU3A 3G8CA 3FHOA 1QHEA 4QIHA 4EUSA 1MJNA 2QX7A 4XI9A 4ND7A 2BVNA 4G5GA 4PYRA 1P1IA 2E21A 4CT5A 1HGXA 4Y3UA 1XGKA 3GPBA 2ZI5A 3NHFA 1N2IA 1U3GA 2GASA 1LJLA 4EF6A 2AVDA 1GAXA 2PUWA 4EW3A 3S8YA 5BV7A 2WOOA 1PEAA 3W34A 1FFGA 3U6KA 1F7UA 1IZYA 1OYVA 1N1DA 2FMUA 1JECA 1WCWA 2EL7A 2JIRA 2OP0A 5ALMA 4AWAA 3L8GA 4LZZA 2BT4A 4TTSA 1X7GA 4HWSA 5ALIA 3ZE6A 4DLBA 5B7QA 3I5XA 5K3EA 1T0UA 4KWIA 2ZR9A 3LY7A 1HA3A 4I1UA 4ZEXA 3BEOA 3VFDA 3AF3A 4M0EA 4MA0A 1V0JA 2J3KA 1KI2A 1KI1A 2ZE5A 1O7JA 3B85A 5JHHB 1MKYA 2XEDA 3C7DB 5IAOA 1XZJA 4EZIA 1JKJB 2CB0A 1STOA 4P86A 1JX6A 4KXVA 1CTQA 1Z4IA 4EHJA 5DSTA 1XUOA 4QVKA 4AZVA 1QANA 2HADA 5I8WA 4PG5A 4NHOA 1DAOA 2BHLA 2C0CA 2C9YA 1KI3A 1R9JA 4FMDB 2XEXA 3TLJA 3KV1A 3B89A 3OZFA 4DSTA 2R97A 5CM8B 3FCCA 4K46A 2NYRA 4FS3A 2PH3A 3H2SA 5GM2A 4PNZA 4P4TA 3H87A 2A5LA 1AURA 2CDCA 1QRTA 3KQQA 1F14A 2FSGA 3C39A 2DKOA 2C03A 3E9CA 4UDYX 5K3FB 1QC5A 1APBA 3STUA 3QKRA 5F3RA 3U4QA 5ELLA 5GGYA 3MJ4A 1U04A 2A58A 1L0BA 4NOLA 3DHEA 1KEPA 3R23A 2Q1TA 3GJRA 4QHYA 4ZOEA 4R7TA 4R81A 1QHIA 1R64A 1Y6FA 3BGDA 2AG0A 2NU6A 4PR0A 4D6YA 1G8PA 1TW2A 4WMLA 5EMKA 4ZU3A 1P7VA 3MRTA 4NAVA 5BYAA 5C80A 4RYLA 4OKSA 4F06A 1IHPA 3TIXB 3MVEA 1UMBA 2M32A 4EZBA 1DOAA 2WNIA 1VLZA 3MJTA 1DZIA 2YC2C 1Q11A 4QLBA 4E3ZA 5GZ6A 1EFAA 4NK5A 1W49A 3CR7A 1M6VB 1BEZA 1V3VA 3AWDA 4A27A 3BWYA 4BQOA 2OHJA 4FZJA 3P9PA 3JW8A 4CL2A 1OMOA 3KFVA 3WICA 5TV2A 3ZE2B 3TFWA 1NJ1A 3TUJC 1N36B 1CY6A 2YINC 4RIHA 3QFHA 4Z2AA 4V38A 4LMPA 2Y9MB 3HDQA 3MWEA 5DNCA 4DMUB 4ZALA 1W5SA 4PZCA 2WDZA 5TQ2B 4CM7A 4CCAA 3BCSA 5BXQC 4IMJB 1QIGA 3IAM1 1N6OA 1PZMA 2QDXA 1ZXLA 3STVA 3SF8B 4MITA 3DEIA 1OFTA 4AVYA 3TF5A 1TA0A 1HE1C 4G5SA 4H1WA 1JP7A 1R5JA 4CDGA 2CJWA 4I1YA 4J0IA 1Q50A 3AV0B 3OPMA 3OU6A 3PF9A 5ENZA 3G9TA 4OB6A 4TROA 2QD4A 3DUFB 1E6EA 3ED5A 4HQ0A 4XAQA 2H7CA 1RWOA 3E22A 3PGA1 2RHMA 3K6SA 1R6UA 1BZYA 1LPBB 3HO6A 4G5XA 3RAFC 1M2VA 2JIMA 5ARDA 1AF4A 4GGPA 3DPIA 2O19A 2VN8A 3COYA 3CG4A 3H8JA 3NKLA 4F8EA 5HVNA 1KH2A 5JJ5A 4GQIA 4MCHA 1K6EA 5DHAA 2QTFA 4PIMA 3E5MA 2BH9A 2Q46A 4I6GA 4CT4B 1OAAA 2ZXUA 2XMSA 1JHZA 1RMQA 1ZNZA 4Z7QB 5HMLA 1R0KA 1ZOPA 3CNHA 5T6MA 2OOSA 5LXTB 1H6DA 3INNA 3NDRA 4GX5A 5DEOA 3ESZA 3I5AA 4YIKA 3KR1A 3DO6A 1RKBA 4M98A 1XJ0A 3C15C 4X65B 1PJBA 4FOLA 2H1HA 1XQ6A 4ERXA 2QN3A 1DRVA 2ASVA 4MYCA 3AY7A 1QZUA 4L9RA 1YF3A 2VYVA 3MYYA 3OT5A 4A6DA 2EJUA 3N2YA 5B3KA 1OBCA 4GNRA 2P3QA 2ODTX 3HYCA 3C16C 3MZ0A 1NMXA 2ZTHA 2A84A 1XU4A 4KOEC 1YRLA 5DHUA 1FUKA 3ZHQA 1QAQA 2VHJA 1P4AA 4OMUA 3RC8A 1ADYA 1EJ0A 4HXEB 5B12A 2ZI4A 2VDQB 3UJ3X 3U4AA 2PH1A 2F3SA 5DGXA 5DBEX 3HEMA 1FU8A 4UBIA 4I9GA 4E5MA 2UYYA 5FT9A 4U9IS 1HV8A 4QT0A 3GV0A 4EG0A 1CJBA 3QFFA 2JHGA 3R5KA 4Y0VA 3KVNA 3JQAD 4WCFA 4CCYA 3K0SA 3QW2A 4DF3A 3OLZA 3NH9A 3OWOA 4II2A 5ALTA 4JA2A 5IAKA 3VPXA 1P4JA 3E9ZA 3RR2A 2QTLA 2IUFA 2ZSHA 2JFFA 3QPVA 4LSGA 5HGJA 3SX0A 3QUQA 4KLAA 4N03A 4XR4A 2V7XA 5HCUA 3VR4H 4IHJB 5CG2A 3T35A 1Z08A 3DV0B 2IYEA 2WJ3A 4V1CI 1Y3CE 2JVIA 1W6RA 4NE9A 5EJ4A 4ICIA 3PFKA 2W2PA 4HLUC 4QYIB 4CG0A 1SUBA 1ISJA 1DAIA 2YV1A 5ULLA 1L5HA 4ZI3A 3U3MA 4QOJA 2R1UA 4BP3A 3L7JA 4QGBA 2C4MA 1PX2A 3RS9A 5AIBA 1ENPA 2I6GA 3A2LA 3FVTA 2GD1O 5C8XA 3MMPA 4RTQA 4C22A 2ZYIA 2MR6A 3LGAA 4Z99A 2Z3VA 3V4PB 1XNRB 2WEKA 4KIGA 3RS5A 5KU7A 1KQNA 5AKXA 3K1ZA 2R5WA 1EDEA 2BV3A 1JBKA 2QGNA 4ENQA 1NFRA 2WMOB 4IG9A 4JELA 3BT7A 1XVVA 3K05A 3IVMA 2CBGA 3NPMA 1DX9A 3A9UA 5I4KA 1T9AA 3PC3A 4GLFA 4MWGA 2K5UA 3E8MA 1Q7RA 1I1NA 1Y98A 3U9TA 1IOWA 1NVWQ 1Z68A 2BUCA 3OPNA 5SZJA 1CFJA 4P92A 2YS6A 1POWA 2CXTA 3KJZA 1AN9A 3FSGA 3WIVA 2WT9A 3FUCA 4KFTA 5ERGB 3WMRA 4Y9SA 4EY8A 1NW8A 3HUEA 1XPOA 1TJ4A 3GEEA 3JD2A 4UHBA 2HHHB 4JZKA 1TOAA 1KQPA 2V98A 3TCNA 3VHRA 2IF0A 3FCOA 3X1YA 1AHHA 4CF4A 1J2YA 3OZGA 3SHQA 5LDDC 1Z7YA 4FEEA 4AP5A 2NO1A 1C1XA 2DT8A 3EA4A 5JNRA 5HFJA 3AI1A 2ACVA 2W2NA 3KYCA 2PRIA 5DSXA 1YA8A 2AI1A 2XHEA 3BH6A 2OQVA 3MLEA 3PUVA 4U2GA 3VM6A 2LCQA 4CWAA 3JAWB 3HUDA 2KYRA 4HFRA 1QRAA 3PBKA 4JS0A 1W5BA 4ENVA 1U3UA 3IAS1 1XDUA 4Y2JA 3RF7A 4XQCA 1XQ9A 3GJQA 2GNOA 4RO0A 5C2JB 4AYXA 2NNWB 2VSXA 5C8YB 1T5OA 2IUEA 2PG3A 1M54A 3KOXA 1EBBA 4KMSA 2YWGA 1A0OA 3O91A 3RT1A 3L46A 1QHGA 1AKRA 1RAAA 1YDFA 2FJUA 1T8UA 2QT9A 3SE0A 3GLIE 1VSQA 2PJDA 2QM0A 4QGHA 4BAUA 1A04A 5KYKA 1TKAA 2G28A 3C14C 1H2YA 1VPLA 2ZXEA 1X0VA 1DAMA 2X6RA 4XA8A 1H65A 3A4LA 4M7PA 4A4DA 1B6SA 1T1SA 1H3NA 1CEEA 3ILVA 1P5FA 1RCFA 3CB2A 2MMCA 3PICA 3KT0A 4XD7A 4XGIA 2C8KA 1WMAA 3HO8A 3WMWA 2IWHA 4RMIA 4I81A 2VI5A 5AKIA 4KV9A 1MFZA 2OBBA 2NO0A 3NG1A 1KEVA 3AUJB 5B3AA 2AX4A 4FFBB 2WZBA 3JVIA 3H1BA 3G2HA 2QM8A 4GFDA 4LVCA 1X7ZA 2PHZA 4HDKA 4IDAA 3SPXA 4KN8A 3QHPA 4AZSA 1XLTA 1P0QA 2OAQ1 2PBLA 2IKSA 1P4SA 1X80A 4HNGA 4J3JA 2QVXX 3L7AA 521PA 4JP1A 3R5XA 3QOFA 1PZEA 3HL0A 4Z9FA 5AOCA 4AZTA 1ZWKA 1PJAA 1CUWA 1M5UA 4RL6A 3PHCA 3HJRA 2A94A 3IOEA 2V3WA 5H5JA 2C0QA 3BGSA 2PGAA 3H3FA 3IHWA 2BFBB 4H31A 4JWTA 3T3OA 3ZXUB 1ZD9A 1YMVA 2DHEA 2WKQA 3AJDA 4HNAA 3T1VA 1PO7A 2D5AA 3ACCA 1LPMA 4HPJB 3KAJA 3O03A 3VOSA 1SVNA 1A9SA 2GBCA 3OQIA 4HDSB 2MYNA 1BVRA 2QPTA 1Z47A 1J5EB 1VGVA 4ZTUB 1TQ6A 1KF0A 3RADC 1EQAA 4Q21A 1GA6A 1U2RA 4IZIA 5ED0A 4AB1A 2O2SA 5TC4A 3P32A 1TW3A 2RHWA 5ECWA 4RJTA 1K68A 1YRAA 1FK8A 1Z0AA 3LKVA 4UZFA 3UQYS 3FGPA 3HP1A 2IHNA 5C51B 4RWZA 1JTEA 3SSOA 5AKGA 1YQEA 2Q41A 1C3LA 2WWGA 1JIIA 3BVPA 5ALJA 3FGNA 4BMZA 1H5QA 2DHQA 3AR7A 1DRKA 4RABA 3KD3A 4ZANA 1ECLA 1VI6A 1G0NA 4QOEA 1RFGE 4EGQA 1ZK2A 1SVLA 4ZKDA 5HRCA 5L7YA 1D09A 1PEYA 2MJLA 1SCBA 3A1TA 4L57A 3WFIA 4B7XA 4LWZA 1YS2X 1DO0A 1KJYA 4OFXA 3KQMA 4QJ5A 4U2FA 5BMVF 3DOUA 4R51A 4RVFA 2IELA 3ISVA 4C5BA 1NYTA 3RU2A 2VS1A 3WAGA 1HKUA 4CLHA 1TLTA 3E9DA 1GKUB 3EG5A 3PX7A 1D4OA 5HZKA 1KQGA 1XMJA 5ALFA 1WJGA 5U9CA 1FP2A 3QKWA 4DIKA 2ZTVA 4CLOA 3GLQA 5DDIP 1QF9A 1U8FO 1X42A 5BUSA 3KQTA 4LWPA 1GUDA 3ZE0B 5JFGA 3CF2A 3ZK7A 2F4NA 4N3NA 3X3HA 2BFPA 1PJSA 2B7CA 2BHTA 3D2CA 1PL7A 2FDCA 1PJ4A 3N0XA 4AMUA 4JFRA 1Y0BA 1DO8A 1HUQA 3ZY3A 3U09A 4OSPA 2G09A 1T6BY 1TF5A 1EWRA 1YS6A 3AR8A 4KKXB 5ES3A 5C5IA 3THWA 1DC3A 3RGGA 1Z4PX 3BOSA 2R8EA 3N1UA 1PTJA 1U7UA 1CRLA 1HDEA 1IH8A 1OLXA 1TT5B 3EZ7A 4FE4A 5EA2A 4IF4A 4MGZR 3ZPXA 4BVAA 4DLLA 4MP6A 3M3HA 5CB8A 1QGYA 4OO3A 2NU9A 4CLDA 4REOA 2GZSA 3TTWA 5LP6A 1SXGA 1Y7LA 2NZUG 3IBTA 3GK3A 1BD4A 3ZTTA 4DG9A 2NU8B 4RKRA 3FNEA 4AZ0B 2B25A 3HXPA 4X44A 4HDAA 4LHYA 3QMWA 3IE0A 3LZDA 4RU1A 4WA7A 1VE6A 2FFJA 2ZANA 2NW6A 1BE6A 3N7TA 2TMGA 3LQ2A 4JJ6A 5FOUA 4CLOB 4LG1A 3PDUA 4L8YA 1KP2A 5DBHX 5IC4A 1DJOA 1YKGA 4KRXA 2JLUA 2YN2A 3FDIA 4MWCA 2VQSA 1TO2E 1NUAA 2Q2NA 2IEDA 5I7UA 2LTAA 1UUFA 4UU0A 1QFMA 3RWMB 4HAUA 4BLQA 1JJ7A 1PJZA 1MF7A 3BIWA 1KI9A 4KQFA 4ZQFA 5K0BA 4ZRDA 4TYPA 3E5RA 4YYEA 3R09A 5CIWA 3DR3A 1P1HA 1MQ8B 4FYPA 2XXBA 3PK0A 5IN5A 3UMSA 1EUZA 1DUVG 2J85A 2UVPB 1ID1A 5MGBA 3FROA 4Q66C 3EXEB 5AKYA 1TIKA 1X6VA 4IR7A 4P0TA 2Z8YA 5A9SA 3AF6A 1VL0A 3F6PA 3IDQA 1NMEA 4PZYA 3WKEA 1P1CA 3WR5A 3R74A 4RPCA 5D87A 1EFHA 2GBFA 2IYYA 3MIIA 2PJUA 1IJKA 1RAEA 2H0RA 4PXYA 4BB5A 4RY9A 4D41A 1WB6A 5HJ5A 2WTEA 4QYWA 1NV9A 4HDRB 1LQ2A 3MTAA 2FZVA 4QUAA 3UUWA 3JD4A 4JROA 3GJ5A 4YAEA 5KTPA 3WFJA 5K20A 3LHSA 2CSUA 5IJ0B 1SKYE 3C43A 1DELA 1QWSA 3KTAB 1OXBB 4N5IX 3UK1A 1MHTA 2BC9A 5EIBC 1TCVA 3EWSA 5D1HA 1PZNA 5JSZB 2G8NA 4YJKA 5K99A 2RBGA 1DFHA 4EHAA 3O9MA 1C7JA 3E7XA 4JMLA 4KQ9A 5HRUA 1DBPA 3I0MA 1RACA 4L3WA 4M1ZA 4EYEA 2EFEB 1OREA 2BP7A 4PZUA 2WJHA 1MDFA 4JB0A 5CLHA 5TNXA 2NXEA 3CRNA 1GG9A 1E79D 2C3YA 2QN7A 2PVSA 2R1TA 4E4RA 1LUAA 2CVHA 2QNIA 4L8VA 2W6ZA 4MA5A 1MJHA 1UR5A 1X92A 2VH5R 4OXIA 2WPDA 3S4YA 4MZXA 1ULHA 5JRJA 4D9CA 2H5IA 4R1UA 5HTOA 3AVWA 3M1YA 3TL3A 1I13A 4YRJA 3M4YA 3UJBA 3VU9B 1V8ZA 2WFAA 1DJPA 4DLZA 5DT9A 4HX9A 1CY4A 4N7MA 4OBBA 1QOZA 5IMSA 4UHEA 6YASA 4Q03A 7MDHA 4AY2A 1LBTA 1V96A 4R54A 4DV0B 2IX9A 3TLEA 3D6NB 4ID9A 4Q3AA 1VIMA 5ITZB 2JD1A 5B58T 1IN7A 1FYFA 4I1OA 2I9KA 3KQWA 2HU2A 2AZTA 2H4JA 1ZN8A 2YV3A 3KEMA 4ZT3A 3EC2A 3M5CA 1B3BA 3DFUA 3JZMA 2O8NA 1Z6XA 5EXSA 4G56A 1S2IA 4DNXA 1XZMA 2HY7A 1KC1A 2I8LA 5D5HA 4UUBA 1Z4NA 2R7LA 3GEGA 3JQGB 1AG9A 3LPLA 4F3YA 5KYXB 2Y68A 3RUPA 4K0RA 2QRNA 1J22A 4N82A 4IO0A 2ODAA 4H60A 5CAEA 3U60B 5EAIA 1JJFA 2HK8A 3D7SA 2HHAA 1IN1A 1UPXA 3ENNA 1CNEA 1B8PA 3AX6A 1AKTA 3EVBA 5LZ2A 4B73A 1P0IA 1I6LA 4CM9A 2VCEA 1IULA 3KXIA 3PXXA 4KXFB 4LIPD