1YXMA

Crystal structure of peroxisomal trans 2-enoyl coa reductase
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
297
structure length
297
Chain Sequence
GRSYLAPGLLQGQVAIVTGGATGIGKAIVKELLELGSNVVIASRKLERLKSAADELQANLPPTKQARVIPIQCNIRNEEEVNNLVKSTLDTFGKINFLVNNGGGQFLSPAEHISSKGWHAVLETNLTGTFYMCKAVYSSWMKEHGGSIVNIIVPTKAGFPLAVHSGAARAGVYNLTKSLALEWACSGIRINCVAPGVIYSQTAVENYGSWGQSFFEGSFQKIPAKRIGVPEEVSSVVCFLLSPAASFITGQSVDVDGGRSLYTHSYEVPDHDNWPKGAGDLSVVKKMKETFKEKAKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords peroxisomal trans 2-enoyl CoA reductase
publication title Crystal structure of perixomal trans 2-enoyl CoA reductase (PECRA)
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 103
structure length 297
sequence length 297
chains with identical sequence B, C, D
ec nomenclature ec 1.3.1.38: Trans-2-enoyl-CoA reductase (NADPH).
pdb deposition date 2005-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1yxmA00
1CETA 1O89A 1LDBA 4BB5A 1SEPA 4WLFA 5G0UA 3DBLA 4L74A 1KS9A 4J4BA 3EC7A 4FC7A 1UXJA 2FY8A 1QYDA 5TNXA 1QP8A 5CPBA 5G4KA 4JNKA 3T7CA 2NV6A 2V7PA 4IJWA 3ZGYA 3PGJA 2FMUA 2ZB7A 4TZTA 3MCVA 2B4TO 3S55A 1IL0A 4I5EA 1PS8A 4WK6A 1IULA 4J7CA 1QKIA 5JCJD 1HT0A 3UCEA 3H9GA 4YCAA 4R1SA 1Q0HA 5ICSA 3T7EA 3A4VA 1X13A 2OHXA 5IZCA 1M75A 4B7XA 1V9LA 5DBFA 4N5NA 3UN1A 1F8FA 4D3SA 2AQKA 1SPXA 1J6UA 4RO0A 2X9VA 1CJCA 2RHCA 5CPFA 1GZ6A 2P9GA 1DJQA 2NSDA 5JAMA 3E6AA 3BMCB 1PGJA 4F6LA 2DBQA 4TKMA 3S2IA 1PZHA 3A28A 4IQGA 1T2DA 1KY4A 1IPEA 1GFSA 1WDKA 4WASA 4UVDA 4DYDA 4YR9A 5I9NA 1E1LA 4J2HA 3JQCA 4WLEA 1JKJA 3JQFC 3O26A 1V0JA 2ZJ1A 2G17A 4PZEA 4XA8A 1SNYA 3RD5A 5IG2A 3GA0A 4DLBA 3QW2A 1K5HA 3B1KA 1NQTA 3VTZA 1O5IA 2O3QA 1HYHA 5ITVA 3FN4A 3DHEA 1IHYA 4ALMA 5CG2A 2DKNA 5IDQA 3JD4A 3HDJA 4XJTA 4GPD1 3ZV6A 5ILGA 4NJMB 5BT9A 3PK0A 4MO2A 4A7PA 4P38A 5K0ZA 2R2GA 3WIDA 1P1IA 2P9CA 2Y1OA 2PKQP 3NYWA 3WGIA 3GFBA 1RWBA 4OQZA 1VJ1A 4QQRA 4CM5A 4TQGA 2PGLA 2UDPA 3LQFA 5JMPA 1QYCA 2GRAA 2WYVA 2DUUA 4UEOA 5EIOA 3ZWAA 4PLTA 3DAFA 4NBVA 1JVBA 4KUGA 4BMVA 2GPTA 4HX5A 4MVJD 3PJEA 2LDXA 4Q3NA 2IEDA 5I7EA 2C82A 3KXDA 1PX0A 2NUAA 4OIMA 2A94A 3TPCA 1WDLA 2O3JA 3OP4A 1LLQA 1HL3A 3EYWA 3R3JA 3EK2A 2OUIA 2VHVA 5DT9A 1E3EA 3H3FA 5AXCA 3DFZA 4WUVA 3ZV5A 1C1XA 1KY5A 2EV9A 4FOOA 4JK3A 1LQUA 4YJFB 1EQUA 2YHIA 1YRLA 3DMYA 1XHLA 2JD0A 5U1PA 3GK3A 5AXDA 4ZICA 2QG4A 1BTOA 3RUEA 1MXHA 1J49A 1R6DA 2CF6A 2BFOA 4XR4A 1DC6A 4UVHA 4Q3AA 3E9NA 1BDMA 3QWIA 2W2LA 4RDHA 3WQSB 4P22A 1WPQA 4JP2A 5BSEA 3W4JA 2D4AA 2ZCUA 3NGLA 4XZ3A 1W73A 1X0XA 2O3TA 2PZMA 3N74A 2OL4A 4YJGB 2J8ZA 3DAPA 3VTFA 1QYVA 1H6DA 5T8KA 4CQLA 5H82A 4KQXA 4E31A 2JFFA 4EJ0A 3PRJA 3OIDA 1DEHA 3ST7A 3OEWA 4P4LA 3W6UA 4GL4A 2AG8A 4XGIA 3K30A 1P9LA 4W4TA 1NQOA 3GR6A 1U8FO 1D4FA 2HMSA 3W8DA 1E7MA 3W1VA 1VSVA 4UULA 3CH6A 3FWNA 1GR0A 2DTXA 4HWKA 4CQMD 2R00A 3NJ4A 3NUGA 3ETDA 2GCGA 4ZQHA 3AM3A 5MGBA 1PGQA 3MJEA 4IBOA 1GQYA 3TFQA 5BQFA 2YYYA 3OH8A 4QFDA 3O9ZA 1NVGA 3C1OA 1LDYA 3QVTA 4JXKA 1GUYA 3KSDO 3PHHA 3ICCA 4C7KA 1GUFA 3U4HA 2UV8A 3NKLA 4TRMA 1ISIA 3WGQA 4A03A 3E48A 5B4UA 3SX2A 3ZI0A 2A92A 3NV9A 1E6WA 4ND1A 4XYMA 2G82A 3PJFA 2W90A 1IZ9A 2IDZA 1QRRA 3JQAD 1GYRA 2O4UX 5T6BA 2B83A 5IZCC 3KYDA 3ZWWA 3K73O 3I5MA 5F5NA 1HDXA 4Z0HO 1BXKA 5A06A 5AXAA 2FZWA 4JBIA 5CEEA 1UDCA 1A9ZA 3DL2A 3DZHA 3ONEA 3ZWCA 1IZ0A 1U3TA 4MP8A 4J90A 1OC2A 1PS9A 3V8BA 4XYBA 2OGUA 1Z75A 4Y98A 4BNHA 2ZKLA 3ZU4A 5EQFA 4NFHA 1LBEA 4TMFA 3R0IA 1FDVA 3VVCA 1V3UA 4B7UA 4RPGA 4GVXA 2NU7A 1PZEA 2HK9A 2EEZA 2IE0A 5I7FA 2GN4A 2A35A 1ZSNA 3WGZA 2O2YA 3WR5A 5CDGA 1Z74A 2AEMA 3FNEA 5COAA 1YL6A 3RC2A 1M2WA 2D5AA 3BHIA 3KEOA 4NFSA 4AJPA 4ZJUA 1E6UA 1I0ZA 2P9EA 5A5FA 4EEXA 4ONEA 1PQWA 2VT2A 2UYYA 4KTVE 1TB4A 4GKVA 4R4JA 1E7SA 3ZHYA 4BS9A 5C7OO 1KEVA 4WEOA 2FR8A 1GEGA 2WD7A 3ENKA 2EIHA 2WWRA 4PLCA 3F5QA 5DOVA 4WCFA 1Z45A 4XIJA 3RUDA 3BMQB 1LJ8A 3PP8A 1P1HA 2ZTLA 1DC4A 1PZGA 2BI8A 4ALNA 3DZIA 3RUAA 3HSKA 2CMDA 2RIRA 2JCVA 3QWFA 3I9KA 3WWZA 1KERA 4RZHA 2JL1A 3D5TA 4PRLA 1RYDA 4BNUA 3MTJA 1D7OA 2DAPA 3OICA 3WQRA 3MJTA 3OECA 2AA3A 3BMOB 1UP7A 4ROSA 1KIFA 4D43A 4A27A 3ZWYA 5KJCA 1YO6A 2HO5A 2AQ8A 2ZJ0A 3ZNOA 3TNLA 1RM3A 3PEFA 2Q1UA 1JAYA 4GX1A 4LN1A 5F1PA 3NRCA 1R4NA 2Y66A 4MOWA 4I9NA 3M2PA 3KLPX 2ZB3A 1Y8QA 4RV9A 2H5LA 1QMGA 2BD0A 5IDYA 3FSRA 5JAQA 4B3JA 4ZRMA 4IPTA 4MVJF 3RQSA 1BW9B 2JJYA 4PGFA 4PRKA 2POQX 1CRWG 3D5QA 3WX0A 4DPMA 1GADO 3C24A 4CQMB 2JD1A 4HP8A 4TSKA 1IOLA 5DZSA 5BNTA 1QV7A 3BMNB 5DNAA 3P2YA 1N1GA 5T8KC 3H5NA 3KTDA 3ZWBA 1XWFA 1HYGA 2BKAA 4J91A 3HJAA 2HMVA 1C0IA 3CPSA 2NVUB 4YXFA 1EDOA 1PJCA 3GVXA 1JVSA 3UXYA 2VOEA 2PR2A 3JYLA 3QE3A 3DEYX 4NR0A 2R00C 1XCBA 1LQTA 3JSAA 5KNLA 4P4NA 3JQ7B 3KYBA 3JQAB 2PLAA 3H9UA 5FI5A 3VC7A 4PVDA 3IKVA 4L4XA 3QVXA 4RCVA 4URFA 5TSDA 1NXQA 3SLKA 1MLDA 1I2CA 4R54A 4BNZA 3OIFA 4XYGA 4E5YA 1ZFNA 3TN7A 5L95A 3EMKA 1A5ZA 2EKQA 4MIOA 1VL6A 5IN5A 3DZFA 4CM3A 4FW8A 4TRNA 4HKTA 4E13A 4S1VA 3HUDA 3X2EA 3DBHB 4CM8A 1I10A 1Z82A 5TS3A 3ZWOA 3HDHA 4B4OA 1P31A 3P19A 4EGFA 2XOXA 4HADA 2J3HA 1C0LA 3PLRA 4AJIA 5CDYA 5T5QA 2I66A 2DFDA 2JAHA 4FIZA 5B12A 4FFLA 3WLEA 1K3TA 4PLVA 5JO0A 3DBVO 1PEDA 1V8BA 5G0VA 3TZKA 3X2FA 2ZB4A 3PXXA 3LLSA 3EVNA 3C7AA 2GN9A 2X8LA 2O3UA 2QQ5A 3GPIA 4GX0A 1NR1A 1QORA 5ER9A 5L4SA 4PLGA 2XXBA 1EK6A 3C8MA 2YDXA 1B26A 2FSSA 1EVYA 1PSDA 2ZTUA 5JDIC 4J9VA 1K2WA 2QRJA 4EDFA 1W4ZA 4BB6A 3E5RA 4OHUA 3UUWA 4OXYA 4GX5A 1K6IA 1TA4A 4WCFC 4DYVA 5JNLA 4CUZA 5DCUA 1UXGA 2DPHA 4X54A 5DCWA 4BGVA 4ZA2A 1R66A 9LDBA 4RVUA 3GG9A 4B3HA 4MPDA 4RF3A 2E49A 1R37A 3QVWA 4EUFA 4AJHA 4HV4A 1P1RA 1LRLA 1NTOA 5B1YA 2ZYDA 2CDBA 3H65A 5A9SA 1LTHR 3GVHA 4CLRB 3ROPA 5JXWA 1CYDA 1LX6A 4D41A 1E1MA 3H9QA 3I9JA 5JFOA 2DBVO 2W8ZA 4XD2A 3WBFA 4H3VA 3AM5A 1LXCA 2HMWA 2BRUA 3D7LA 4WOKA 4WJZA 3RC1A 1TXGA 3MOGA 5G2OA 4B8WA 2EGGA 2ILTA 3U4DA 3FRJA 2NVWA 5FI3A 4IDBA 2VYNA 3BZUA 3QQPA 2Z5LA 3VDQA 3PWSA 3F1KA 3OQ1A 4RQUA 4IM7A 4AJJA 4PLWA 2X23A 2LDBA 1P3DA 3GGPA 2OO5A 5LC1A 5KOIA 1DHRA 3QHAA 4J1SA 4BV8A 4Q3CA 1NWHA 2VTEA 2ZYAA 3TWOA 2HUNA 5A5EA 3DBLB 2WEKA 4FFMA 2EWMA 4O6VA 5JPIA 1YJQA 4K6CA 2QRKA 1GQQA 3PIDA 1E1NA 1SBYA 5G4KB 1ZO8A 3ANMA 4L73A 1FDSA 4YAJA 3QIVA 1HEUA 3IL2A 5ER6A 1X1EA 2FN7A 4L4RA 5A1TA 2JFGA 5IJZA 1Y9AA 2Y68A 2VOJA 4MVJE 2DUWA 2PH5A 3T4XA 4NIMA 4NK5A 3ZZNA 3DZJA 1Y81A 1QSGA 3ASUA 4NBWA 1A9YA 4KDFA 3AU8A 3RKUA 3PZBA 1XKQA 2FRDA 1ISFA 2J3KA 4ND4A 4OSPA 4DVJA 4FC6A 1A72A 3K9QO 1SAYA 5L40A 3OJOA 3WJ7A 4BUCA 3NT2A 1A7KA 1UH5A 1XR3A 1OOEA 1VSUA 3NGXA 5KJFA 4GMGA 1E6EA 2C5AA 4CJXA 3RKRA 1S6YA 5EQDA 5J23A 3AW9A 3GEDA 1DRUA 3GT0A 1YB1A 1PJLA 5LDGA 3UGKA 4YAEA 1ENZA 1UP4A 3I83A 3R6DA 4E5KA 4BOYA 3ROMA 1QXSA 1I2ZA 3KETA 4LCEA 4PG5A 2GNAA 1E3JA 2WDZA 3P2OA 2EG9A 4MJLA 1Q7CA 1SO8A 2DT5A 3V1UA 3ZNNA 4DMMA 3G79A 4DPKA 2BH9A 4GX2A 3ZW9A 2NTNA 4IJKA 2Y1DA 1ZSVA 5COBA 1OC4A 3HN7A 4CLOA 3OEYA 1R12A 1XA0A 2AG5A 2E6UX 3MJCA 4DBVO 3ZN2A 1VL8A 4ZQFA 4ALKA 2OBYA 3DDNA 4B4UA 4ZQBA 3DAGA 1X7DA 4DPLA 3R3SA 4AJNA 2VYVA 3IJRA 1E5QA 4MVJM 3SC6A 2OZPA 3L0DA 2X22A 3H3JA 4TROA 4XQEA 2VHXA 1EZ4A 4BGEA 5I7VA 1BHSA 1JTVA 1QLHA 3FNGA 4L0QA 3SXPA 3ZHBA 5AOVA 1GCOA 3AOEA 1ARZA 4RLSA 4NU6A 4RF4A 1LDGA 3WYBA 3DC2A 4LCJA 3KZVA 4NHEA 3CINA 2PK3A 2WM3A 4PG7A 4YACA 3FCOA 4E32A 4XYEA 2P4HX 5IN4A 1H6AA 4FJ2A 1C1XB 4IDFA 4TVOA 3DO5A 1I33A 4RORA 4BHTA 2J3JA 2YHIB 1MFZA 1EQ2A 3COSA 4QSMA 1DC5A 2GSDA 3I52A 2Q2VA 3F1LA 4HFNA 3LC7O 2EP5A 4YDRA 5KVVA 3RCBA 1Q2XA 1JU9A 4CM9D 5FWNA 3Q9UA 4KMSA 5GY7A 4MDHA 4EUHA 3ON5A 4LMPA 4GKBA 1HE4A 3C7CB 3UICA 3SVTA 5CDTA 2H6EA 2UAGA 1MC4A 5T57A 2Y0CA 3E8XA 5KJ1A 4BNFA 4M55A 3ZNQA 1YB4A 1U3UA 4GAEA 3PYXA 2Y1FA 1GV1A 4R01A 1PZFA 3L9WA 4CQLB 1Y5RA 1ZZEA 1JDJA 2CDAA 3E18A 1VE9A 4CPDA 1WWKA 3VDRA 3WGOA 4CUJA 1CIVA 2NWQA 5MDHA 2VWPA 4K6FA 4FJ0A 4BKPA 4JJFA 4A73A 3V1TC 4XKJA 3I9NA 3VKUA 3KBOA 1GZ3A 1F17A 5IAAA 3WMXA 1PGNA 4EJMA 2V6MA 3UAGA 3PI7A 2QW8A 3U4IA 2FR1A 4OGWA 4Z9YA 1EE9A 3WGHA 4D42A 4E12A 2D2IA 3DQPA 4QXMA 1B14A 4F46A 2CSUA 2GN6A 4IIVA 1D3AA 1Z7BA 1DIHA 5HS4A 4MKXA 1ZVMA 3GZNA 4KTTE 4B4VA 1EK5A 4D3DA 1EVZA 2X0JA 4JX8A 1P77A 1TT7A 4ZVVA 2XXJA 3OJFA 4RVHA 3PIIA 4CM4A 1KEUA 3KYDB 4WCDA 3NTOA 4D0RA 2V6GA 3O8QA 4XGNA 1CWUA 3RWBA 2PD6A 3RFXA 3OQ6A 3GF4A 1Z73A 2HKIA 1HDRA 1DLIA 2HU2A 1SMKA 2OMEA 1I8TA 2Q4BA 1LSOA 2D59A 5FF9A 1U7TA 1PQPA 4OXNA 4AJKA 2PTGA 4E2WA 3F4LA 3PYMA 4O63O 2G1UA 4YA6A 1MUUA 1ZK2A 2NTVA 1E7YA 3WFJA 3EGOA 3IIEA 1YL7A 3L77A 5KIAA 3LT4A 1GZ4A 2P91A 4E21A 1JKIA 1E7WA 2SCUA 4Z3DA 4BO7A 4ALJA 1LLCA 1N2SA 3RUHA 3ITKA 4BO3A 2PV7A 1GL3A 3ADOA 1WMBA 4HFMA 4I5FA 1PJBA 1E3LA 2VNAA 2YQ4A 4OH1A 3U09A 4RVGA 4U0JA 4J6FA 3VKVA 3AWDA 4AVYA 3LU1A 3IOYA 2WD7B 4R5HA 4RJTA 2QRLA 4WCFB 3I6IA 3P7MA 1T4BA 1NBOA 2YW9A 4D46A 2EKPA 1Y9EA 3EZLA 3UVEA 2Y67A 3AOEC 3E03A 4UEKA 3AK4A 4BGUA 1F0YA 4LRTB 2DM6A 5A3JA 4IXTA 1Q0QA 2VZ9A 1H9AA 4BNJA 1LLUA 4R1TA 1YDEA 4R3WA 3GG2A 4AL4A 2DTEA 1DFGA 1DIBA 1HWYA 3NTRA 2X1HA 5FYDA 4P8RA 4CLEA 4W99A 4MP6A 4PN3A 3C85A 3GOHA 5GZ3A 2IXBA 5KCZA 2EERA 2ZYGA 1DO8A 2DBRA 4J43A 2C2XA 2EHDA 3GNQA 1NPTO 4JCOA 3TRIA 4KOAA 1KVSA 4XB1A 1QYXA 4E2XA 1YJ8A 5GZ1A 2IYOA 2EJVA 2OP1A 3GPDG 2A9FA 4OYRA 1AXEA 1O94A 2WTBA 4OKIA 3HQ4O 1HLPA 1Y8QB 4PG6A 2JKVA 1CEQA 1GYQA 4BNMA 4BKOA 1O9BA 3JYPA 1DB3A 4YVFA 4ZGWA 2B5VA 1I3MA 3UCFA 1ISJA 4HFJA 1WXDA 4Z9FA 1WAMA 2BHLA 1NYTA 4WLUA 3VOSA 2H9IA 4CMEA 3WWYA 4IMPA 3WDSA 3SEFA 4PG4A 2HJSA 5C7IO 1KVTA 1VM6A 1MB4A 2E37A 3E1KA 1PL7A 2YQ5A 3H4VA 3KO8A 2RH8A 4BGIA 4E6PA 2Q1TA 4BNTA 4ALIA 2Y1CA 4LISA 5A9TA 1AXGA 4CM7A 3L4SO 3G1TA 1OAAA 1GU7A 4RL6A 3WBBA 2B35A 2HQ1A 4BO5A 3BA1A 1MG0A 3JQBA 4GSLA 4UVEA 1GUZA 3LLVA 4U0KA 3WTCA 3G17A 3U4CA 1T4DA 2YV1A 1OI7A 4CMCA 1K6XA 1B2LA 4IXWA 1AHHA 3GMDA 2OOSA 1AHIA 2PKRA 1TT5A 1GV0A 3I3OA 3QP9A 1FDTA 4OOFA 2GUGA 3H7AA 5C7LO 3TL3A 5IFLA 5GMOA 1X7HA 1MV8A 1I2BA 3KYCA 3TZCA 4CM8B 2I9PA 2F00A 4AICA 3ZU2A 3K96A 3ENNA 2NVBA 4I8XA 3IS3A 1YONA 1XIVA 2EGHA 2ZQYA 3EW7A 4OQYA 5TJ9A 2Z1MA 3ORFA 1KOLA 1CQIA 3BTUA 1HLDA 1Y8RA 3HB5X 3V1YA 1PJ2A 4BMNA 1YE3A 5TLSA 3BMCA 3RU9A 4YPOA 1DRVA 5JW6A 5L7TA 4RDIA 2VTDA 1MX3A 4QECA 5TC4A 4ND5A 1YH3A 1C1DA 4XYLA 1UAYA 2P5YA 3MJVA 5KJEA 1PS0A 5C5IA 1ISHA 1XU9A 1Y7TA 3JV7A 1D1TA 1A7AA 5JDIA 2D0IA 2WYWA 4G5HA 3PJDA 3UW3A 4BKRA 1RM4A 2G0TA 1E3SA 1ISGA 5HWSA 4D45A 1ZUD1 2RBEA 1MFPA 1XSEA 5G0TA 1SB8A 4K1LA 3ETEA 4DA9A 3ICPA 1KBZA 3L6EA 1ZEMA 4AJ1A 4J16A 5COQA 3H6KA 3F3SA 4LVCA 3SJ7A 3VH3A 5LDHA 1M66A 3R1IA 4EITA 2QZ9A 3Q2IA 2QHXA 2VCYA 1JWAB 3INTA 3DBRA 2YY7A 1J4AA 2ET6A 2HK7A 2XAAA 2Y93A 1GPDG 4E2ZA 2IZ1A 4XRGA 1K6JA 5JAZA 4YJHB 1T2EA 2Q1SA 1DSSG 3LC1O 3A14A 5JC8A 3WLFA 1LRKA 2B5WA 3U0BA 2AE2A 2O48X 3WOHA 3WJAA 1PQUA 3CTMA 5ENDA 5A9SB 4KUHA 4IINA 3PFFA 3QSGA 2X5JO 3K2BA 1LEHA 1MA0A 1P0CA 2BGKA 1YDWA 4GWKA 3ZW8A 2W2KA 3EHEA 1IE3A 4YB8A 3GDGA 1ADGA 2BELA 4ZHSA 1LU9A 2I6TA 3KV3O 1OFGA 2B0JA 3B6ZA 4MVJG 2HLPA 1UDAA 4CR7A 2FPGA 3GH3A 4B3IA 2BMAA 3UCXA 1E7QA 5CDSA 4D0SA 3T4EA 3JQ8A 5JCXA 3Q11A 3A1NA 3DMTA 3ZHZA 3G1UA 5JAIA 3UH1A 3ETGA 1EBUA 2P5UA 2NACA 2VRCA 4IQ0A 5IXYA 3K6JA 1LA2A 3UKOA 5K6AA 1YOVA 2WJPA 1BRMA 4QTZA 2PGJA 4E5MA 1GEEA 3AFMA 3AY3A 5TRTA 5L9AA 4L75A 3HWRA 1HKUA 3AM4A 4PZDA 4CMEC 1WDMA 2PNFA 4R1UA 1X1TA 1RYEA 2E4AA 1U4SA 1H2HA 3STHA 1YGYA 4UEJA 1FDWA 2JHFA 3GN1A 4J4TA 3ULKA 1GTMA 1NNUA 1HZJA 2QX7A 3NT5A 3GEGA 1HDCA 1PU2A 1Y6JA 4R51A 5HBRA 1U2DA 4OMUA 3ROKA 2Y0DA 4YYZA 4TKLA 1D8AA 4LSMA 4BO6A 4QEDA 1Z7EA 4N5LA 2PGDA 4GVLA 3VZSA 3WIEA 5ES3A 2WD8A 4Q3EA 3H5AA 1KC1A 4G65A 4I9HA 4OKNA 1UP6A 3LT2A 1NAHA 4N5MA 4O5OA 3JQBC 5JDCA 2OORA 1FJHA 2EW8A 1F12A 2HJRA 4XGKA 3OSUA 2JFHA 1LDMA 5L45A 1NPYA 5H83A 1VC2A 1XEAA 2YJZA 2ZK7A 3GDOA 5G0WA 4AJOA 2IZZA 4TZKA 3RBVA 2FHSA 4N54A 1NFFA 2X7HA 1HDZA 4RVFA 3V2HA 4FFPA 3RI3A 1N7HA 4YT2A 1GDHA 3OA0A 3TOZA 1BXZA 1QV6A 1QG6A 1PJQA 3AJRA 3CEAA 4YRDA 4GGPA 4CLOB 4DMLA 1DIGA 2X58A 1MGOA 4J9UE 3G0OA 3VVBA 1NAIA 3FF4A 2Z1NA 3UOGA 1NHWA 4J1QA 1N1EA 1JKFA 4JBHA 4G2NA 2P4QA 4DRYA 4EJ6A 1P44A 3K2EA 1KVRA 1DFHA 3JCZA 1M6HA 4Z3KA 2GZ1A 5TJHA 4E4YA 4JJGA 1N9GA 3QV1A 3ZWVA 3KHUA 1ZMOA 4JROA 1ID1A 2GYYA 2ZIZA 3PLNA 5F1KA 3IJPA 1E92A 1AUPA 1N7GA 2AW5A 2X0RA 4AJEA 4FB5A 1K0UA 1RPNA 3F46A 4LRSB 4IS2A 4RZIA 4MVJH 4C4OA 3QVSA 2PY6A 3I4FA 4W7IA 3EY4A 1P33A 4Q39A 4FFOA 1HRDA 4R16A 2GGSA 3VZPA 2D5CA 3PHIA 1E3WA 3C7DB 1UZLA 3WGTA 1UJMA 2EP7A 1ML3A 3WSWA 2V6BA 3WSVA 3KSZO 1NASA 4YT4A 4WNCA 4BNLA 1P1FA 3CE6A 1U9JA 4J1NA 3CZMA 1SB9A 2FPIA 5KVQA 5JY6A 1X0VA 2D1YA 4D44A 4RLHA 3M2TA 3TSCA 3BHJA 4YAGA 3WXBA 2Q1WA 1PGPA 2PD4A 4E33A 2A4KA 3EZYA 3ROQA 1RJWA 2HRZA 4F45A 5A05A 3AUSA 4MIEA 1VI2A 1U7HA 2D8AA 3PPIA 2AEJA 3K31A 4IIUA 3KLMX 4BNYA 4BNGA 3JD3A 4M1QA 3F6YA 4DLLA 1X7GA 3HFSA 2CF5A 1B3BA 3V5NA 4XWYA 3SLGA 3BTVA 4RGBA 1RM0A 2W2LD 4RF5A 5DP1A 1VKNA 5HM8A 4UVGA 4L76A 3C3XA 1CF2O 4CODB 1H94A 1PJ4A 3RBZA 2XF8A 2ZCVA 2FP4A 2J5KA 4UUNA 3WTBA 3DOJA 2IODA 3PWZA 5TX7A 3MZ0A 1KC3A 4CMHA 3DMTC 3DWFA 2QZZA 3D3WA 3GGOA 3DR3A 1PJTA 2XPCA 1SZJG 3S8MA 5JBIA 4GGOA 3TL2A 4BO4A 2WE7A 4WE3A 1UXIA 4BQPA 5K6AC 3GNSA 4LSWA 2TMDA 4U6QA 2RHRA 1XDWA 4JJIA 5TGDA 3VPFA 1KVUA 2HK8A 5T67A 3JYQA 1ZK4A 3TZQA 3UFXA 2UVDA 2NU8A 1HXHA 1X14A 3NX4A 4A0SA 5C3MA 1IPFA 2BLLA 3CXRA 2DFVA 1HF3A 3VPGA 6LDHA 5L51A 3HG7A 3MWDB 2OP0A 4YT5A 1NVMB 2UUOA 5T64A 2AXQA 2P2SA 3PVZA 2FWMX 4MVJI 4NQZA 4IY1A 1H93A 1KYQA 4J49A 1HZZA 3BMNA 1SCUA 3GZNB 1VPDA 4BO2A 4GH5A 4IMRA 1H6BA 3DXFA 2IZ0A 1PGOA 2C5EA 2RAFA 5ITWA 3RUIA 1GCUA 4A5OA 4CM4B 4GBJA 5U9CA 1H5QA 1LNQA 3N7UA 4GSKA 2H1SA 3O8QB 3PDUA 3GRPA 1YXMA 4NDNE 2BGLA 3VH4A 4E5PA 4FR5A 1ULUA 4L4SA 1ZNQO 2DLDA 4XDZA 5JDCC 4FQ8A 1FK8A 4UREA 4CLXA 2PH3A 1ZBQA 1MG5A 5F1OA 2VN8A 3FR8A 1AE1A 4YEDA 4BL5A 3W6ZA 1O8CA 1BVRA 4N7RA 4B79A 2Q2QA 1V3TA 2B37A 1NVTA 2FR0A 1HSZA 4H15A 3WMWA 3EUWA 3WNVA 4D79A 3HFGA 5IZ4A 4E5NA 5KVSA 5L7WA 1DPGA 2CNBA 4LGVA 3QVOA 3VH1A 4CMIA 1NWCA 3F5SA 1DFIA 4BO9A 3ZV3A 1P45A 5IXSA 2HDHA 4NBTA 2NU6A 2X86A 3ZDFA 2JAPA 3Q0EA 2VT3A 5G4LA 2EXXA 2Q46A 1NFQA 3DONA 1XGKA 2VUTA 5G0SA 4BMSA 2YFQA 1YBAA 4NI5A 5EESA 1DIAA 2I67A 3JQDA 1A4UA 3H9JA 3LYLA 5BSHA 4BIIA 4RVDA 1FDUA 3HDQA 1JQBA 3L4BC 4IDGA 3PWKA 3INGA 4DUPA 1DIRA 1EUDA 4QT0A 3CMMA 4CLHA 2R6JA 3KVOA 3LVFO 3IKTA 2PFGA 1SEVA 1YBMA 1ZJZA 2CVQA 3AI2A 3I1JA 3LF2A 4W9NA 1NQAO 3S2FA 3D3EA 4HNHA 1DXYA 1G0OA 4WEQA 4XEHA 1UZMA 4GLLA 4UUPA 5IDWA 5JE8A 1NFRA 1DDOA 1ZSYA 2Y1GA 4CR6A 1IB6A 1F06A 1P74A 1WZEA 3QLJA 1HDOA 4K26A 5EL0A 1Q1NA 4U8GA 2JD2A 5AVOA 1ORRA 2HMTA 4NMHA 2X6TA 4OSOA 4XRRA 2V6FA 3KRTA 3TFOA 3AU9A 5CHEA 3AY6A 4R41A 4RPHA 3FD8A 3IP1A 4FJ1A 4BVAA 4CR8A 1LRJA 3GVCA 3QJ5A 5CP8A 1B8VA 3O38A 3QRWA 5CAEA 2ZTVA 5GZ6A 3U62A 3G49A 1GQ2A 1PR9A 1R4MA 1H2BA 3GVPA 4J0FA 5F5LA 2NNLD 3IMFA 1IY8A 4BO1A 3FTNA 2BF7A 4ZU3A 3ZWXA 4BKUA 2B36A 1FMCA 1R0SA 4QX6A 4C7JA 4U6SA 2IRWA 3JQ6A 1EEHA 1PL8A 2AEFA 4M54A 1F8GA 3L6OO 2ZATA 3E5MA 3RJ5A 2BFAA 7ADHA 1FXSA 1PJ3A 3DZGA 3GDFA 2NU9A 1DLJA 2HRBA 3PFWO 3O4RA 3CIFA 4AJ4A 4WECA 2X5OA 1FF9A 3GUCA 3GY0A 1I24A 1M76A 3ZHXA 3WGGA 5K9ZA 1I01A 2VZ0A 3OFSA 3U3XA 4JQCA 1ADFA 3GRKA 5CEJA 2CD9A 3SC4A 3PYLA 3TJRA 4F6CA 3HZZA 2B4QA 2YHUA 4FD3A 4GMFA 2VNSA 1QYWA 4PLZA 2IYPA 2YV2A 1LSSA 3GHHA 2O50A 3JQ9C 4QO7A 5CG1A 2AQIA 1BDBA 4UUMA 5KKCA 1EDZA 3IUSA 3KSUA 1TT5B 3CKYA 5ICMA 3RBXA 3D4NA 4XX0A 4IUYA 1ZIDA 2O23A 3FNHA 5A04A 2B4RO 2O4CA 4HBGA 4YRAA 3NT4A 3KYCB 3IC5A 5KKAA 2PZKA 2VUSA 3RASA 4CL8A 4CMGA 2VWQA 3FNFA 3U5TA 2Z95A 1ZK1A 3M1LA 2X0IA 3GC6A 3ANLA 5HS6A 4O0LA 1XYGA 2DC1A 3M6IA 3OJ0A 1VJ0A 3FHLA 2CUKA 1F14A 1Y8RB 4KDEA 3ZV4A 4CMJA 2V65A 1B16A 3RFTA 3BXXA 3NTQA 1ZH8A 4OJNA 5A02A 4TRRA 1C1DB 1ULSA 1YWGO 1ENOA 2Y99A 1R0KA 4Y8VA 4A10A 3H5RA 4CV3A 1EBFA 4MINA 3EVTA 1BXGA 2ZTMA 2CDCA 2E82A 2JCXA 4BNKA 4OO3A 4CM6A 2J6IA 3PHLA 1LSUA 3U9LA 1G0NA 3RFVA 1T24A 3I9MA 4DLAA 3CMCO 1QR6A 3G3EA 3TQHA 3RVDA 4DQVA 4PZCA 4I5DA 4FBGA 2I76A 4L9RA 2BI7A 4DQXA 4EYEA 4W7HA 3B1JA 2PKQO 4EI2A 3DBRB 3I9OA 4YTEA 1Q0LA 3LT1A 3NDJA 4DC1A 4W9NC 2AQHA 5ENVA 3H2ZA 5IDXA 2C54A 4N18A 2O2SA 5JLAA 4H16A 5AYVA 1WW8A 5L7YA 4OOEA 1DOHA 1JWBB 1YQXA 2O7QA 1TEHA 3WG9A 1JLLA 1MC5A 1KEWA 1R0LA 1G1AA 4BNXA 5LCXA 1O6ZA 3DHNA 3JQEA 4AG3A 2W2KB 3JQGA 3MJ4A 3ZWNA 3F4BA 3ONDA 3AOGA 4Y9DA 1RKXA 1UUFA 1R4NB 1GY8A 1NHGA 1U4OA 3LDHA 3ZU5A 3H2SA 2F1KA 4Q9NA 2GD1O 4NG5A 3AUTA 3WFIA 1ONPA 1ZMTA 3JQ8B 3JD1A 1J0XO 3DTTA 1UXHA 4G81A 4LVUA 1U5CA 4XCVA 3A06A 4CMKA 2I99A 1T2AA 2VUUA 4HUJA 5TIIA 5BNIA 5ILOA 2VYND 3OETA 1YOVB 3D64A 5DOZA 5F21A 2DVMA 4JGBA 1PWZA 4MP3A 1T26A 3GLQA 1EE2A 1N8KA 1T2CA 1L7DA 1S7CA 3GFGA 3RAJA 4ZD6A 2GR9A 1JN0A 1D1SA 1NP3A 1N5DA 3E9QA 1PWXA 4ND3A 1VJTA 2C29D 1YS4A 3TF5A 1LDEA 4RF2A 1I32A 1VRWA 2VWHA 5L3ZA 3HDYA 3H9EO 4HNGA 4I5GA 3GMSA 4BO8A 3ZWPA 4M86A 1ISMA 2VHZA 1ZK3A 1EFLA 4JBGA 3VAZA 2Q3EA 3KUXA 3MOIA 3VPXA 4CV1A 1WP4A 2C7GA 1X15A 1Y5MA 3GZ4A 1GYPA 1HE2A 3GN2A 4PLFA 3TDKA 3MTGA 4MKZA 2D3TA 5DCYA 1R15A 2BFMA 3D4OA 5DULA 4P4GA 3SJUA 4UUOA 1YQDA 1WNTA 5I9LA 5DDIP 2Q4EA 3I4CA 2BGMA 2O3RA 3OA2A 4HXYA 3KB6A 2YDYA 5KWEA 4R5MA 1P1KA 2HSDA 1M6WA 3AI1A 2CVZA 1OZAA 3DTYA 3HNPA 4KWHA 4DQUA 2FOIA 1W0CA 5JY1A 4OXKA 3CSDA 1HDGO 1ZXLA 3RROA 3VHRA 4LW8A 3AY7A 1EMDA 3K8ZA 4K28A 4JIGA 2EKLA 3JTMA 4W6ZA 4BV9A 1B3RA 3PQDA 4IDCA 1LDNA 1B0AA 4J4HA 4Y6PA 1C3VA 4K9DA 3GVIA 4B8ZA 3H8VA 4D3FA 3FI9A 2O7SA 4DWVA 4BNIA 4E0BA 1W8DA 3DHYA 3WNQA 1BMDA 3LT0A 1ZK0A 4FS3A 3WYEA 2GF2A 5U4QA 8LDHA 3K92A 5DP2A 4M8SA 1AN9A 1LUAA 1YQGA 1N9GB 1U8XX 4S3MA 3VZQA 2VYVD 3ZCXA 5JC1A 1XLTA 1C0KA 3UHAA 1HSOA 4Q3DA 4ITUA 2FPPA 3ITDA 3OMLA 2GASA 4IDAA 4R1NA 3RJ9A 1QLJA 2GZ2A 1A27A 5JS6A 2AHRA 3BYZA 4CUKA 4CV0A 3IDSA 3HN2A 3OJEA 2W98A 4II2A 5I9MA 9LDTA 5KJ6A 2IEBA 5EERA 3QA9A 3U49A 1E3WB 1XELA 1LLDA 4NJMA 3PTZA 1LC0A 3JYOA 1ZXBA 1EUCA 4M89A 5H81A 4CLDA 5C37A 2I5PO 4L8VA 4W82A 2PA3A 3JYNA 3AUUA 3FBGA 2X0NA 3FTPA 3SBOA 3TZHA 5A03A 1BSVA 1DAOA 4Z9XA 3QWBA 3NDRA 2GN8A 4BKQA 3LK7A 4NU5A 2J3IA 1ADBA 4YQZA 4J2OA 1ENYA 1ZW1A 4KQWA 1U3WA 4JN6B 4PCVA 3E82A 4WNIA 3V2GA 1B8PA 4QUKA 1HTBA 4I08A 5TT0A 4F3YA 1U1IA 3LF1A 1DHTA 3E9MA 3FBTA 3WS7A 4PLYA 1LSJA 1YBVA 2C7VA 1O95A 3BTSA 3DZKA 3NJ8A 3BAZA 4R9SA 2QYTA 3Q3CA 4MKRA 5JO9A 2X4GA 2VZ8A 5B4TA 5I8WA 1PIWA 2VQ3A 3QWHA 4NJOA 4WGGA 4IQ8A 4CMBA 4TRJA 4YJFA 2WSBA 5DF1A 5EPOA 4CM9A 4J0EA 1ADCA 3GGGA 5DBIA 4FFNA 4NPCA 4ILKA 1T1SA 1PL6A 1KETA 4Y6SA 3QWAA 3Q9NA 3BTOA 5A9RA 5L4LA 2NLOA 1ZKMA 5IF3A 4R68A 4EZBA 4AJ2A 4YRBA 2G5CA 3D3WB 3PGXA 1DAPA 2DPGA 1YL5A 1UZNA 5L4NA 3RC9A 5DBGA 5CEFA 3ZNPA 2OFPA 1VKOA 4IZHA 1C14A 1WMAA 1H6CA 4E3ZA 1TI7A 1NPDA 2PZLA 4YJGA 4B7CA 1OMOA 5L53A 2PZJA 5JSFA 1WVGA 2C0CA 4OAQA 2Y1EA 3VPSA 2Y0EA 3W4KA 2PD3A 3B20A 2TMGA 1P0FA 3DOCA 4XR9A 2Q50A 4Q3BA 4XQGA 4DIOA 3C1AA 1BVUA 1LC3A 4QO8A 4IJVA 1DRWA 5B37A 5FEUA 1JA9A 3K5PA 3PJGA 4FPXA 1GAEO 4YQYA 4IDDA 4ESOA 5CFZA 1I3KA 1CDOA 3Q6IA 3VPHA 4RVSA 1NX6A 3ADPA 5JCJA 3I9LA 3W8FA 2FSVA 3RUCA 3IQDB 4BNVA 4DGSA 4UVIA 2VRBA 2RH4A 3INRA 3CZRA 1NM5A 4XJSA 4GQAA 2QIOA 4JLWA 3HADA 4J1TA 3F47A 3I6QA 3W8EA 3HB4X 1I36A 1R16A 3HHPA 4EUEA 3JD2A 1TLTA 2GO1A 1HE3A 4PLHA 5F3RA 3ZH2A 4WLOA 1E1KA 4ND2A 1H9BA 4FOSA 4CMIB 1KEPA 5JYDA 5HRUA 1EVIA 3ASVA 4Z0TA 3N58A 3NDIA 4NBUA 5FFFA 1YKFA 4Z6KA 2VWGA 2I3AA 2QYSA 3ABIA 5I7SA 3L4BA 2X5KO 4ZQEA 5THKA 3WYCA 1E77A 4YAKA 3D0OA 1M67A 3FPLA 4PLPA 4WLVA 4BO0A 2I3GA 4U5QA 1BWSA 4IDEA 5EJ2A 1HDYA 2FZEA 2C20A 1E7RA 1NR7A 1CQJA 2HAEA 4WKGA 4Z0PA 5I8ZA 5BSFA 3F9IA 4FGSA 3IUPA 1L7EA 3BIOA 5BNFA 3PHGA 2DQ4A 4FGWA 4O59O 2UUPA 3OIGA 4GLOA 2WMDA 1PR3A 3EDMA 1MP0A 4EW6A 4ZN6A 4TVBA 4A26A 5JMWA 2HMUA 4YJDA 4BNNA 3IP3A 4CV2A 4PG8A 3WGYA 1U2GA 5EINA 3L6DA 1P1JA 2DBZA 5TT1A 4MVJA 1KVQA 3KEQA 5B4VA 5EMHA 3W4IA 4I9UA 5A3VA 3OJLA 4DC0A 4R3NA 5CDUA 1XQ6A 4GI2A 3PQFA 4U7WA 3GQVA 1I3NA 2C2YA 4II3A 4EEZA 3BMQA 4A2CA 1WZIA 4ID9A 3WQQA 1AGNA 1GPJA 5KVCA 1T1RA 3NEPX 4YT8A 1R4MB 2DU8A 3RSHA 2YFHA 3GAFA 4D7AA 4XQCA 4YJHA 3FWZA 3AI3A 1YB5A 2X9GA 3PQEA 2AE1A 3BHMA 4ZQGA 1IHXA 1B15A 4KWIA 1U28A 4KUEA 4LMRA 2O3SA 4UAGA 3L9XA 3AUAA 1MXFA 4RPJA 3BMOA 3RIHA 4WLNA 3S2GA 3GNTA 4JP3A 2PWZA 1UXKA 1XG5A 3LSYA 1DBVO 2BFPA 4J3FA 4XQ9A 3TOXA 3AFNA 4HY3A 5JYEA 1B8UA 4FDAA 3QY9A 1YVEI 2YZ7A 4H7PA 3GHYA 4ZRNA 4OL9A 5AQ1A 1BG6A 2CVOA 2WE8A 2W4QA 4XB2A 2EW2A 5HTOA 5TQVA 1O0SA 1BW9A 3UF0A 1VL0A 1JAXA 3MEQA 4DTIA 3B70A 3JQ9A 4IGEA 4DIBA 1UR5A 3RUFA 4CQMA 2GERA 2AMFA 1XU7A 3ANNA 5THQA 1SOWA 4INAA 1SC6A 4WOJA 1GD1O 3Q2KA 1A4IA 3PDJA 3ZWMA 1HETA 2YV3A 1G6KA 1BGVA 2NVUA 3HE3A 4NK4A 2NQTA 1E3IA 1ENPA 1WLYA 1SOVA 3RC7A 5EN4A 4XDYA 1K89A 1UAGA 1T25A 2B69A 2I65A 4EBFA 2GLXA 4CM1A 3IAHA 1Q7GA 3JQ7A 3MWEB 3JQAA 3OQBA 4CMAA 2DTDA 3FR7A 2CY0A 5A4DA 3L07A 3DZBA 4KZPA 2Q2WA 1J5PA 1I5RA 1OBFO 1PTJA 4DXHA 1E0DA 1W6UA 2WYUA 3GAZA 4FFRA 4AJLA 2Y05A 3S1LA 3OF2A 4TWRA 3DB2A 3MJSA 2X9NA 2GDZA 4PVCA 4M87A 2NTJA 2EF1A 4LK3A 3OHSX 5KTKA 3JQFA 3KOUA 1UDBA 4RQTA 1V35A 3DBHA 2Q49A 3O03A 1ZEJA 1DC3A 3OBBA 3PZRA 3B1FA 4FSHA 1BXGB 4CL3A 2C59A 1DJNA 3PHJA 5BR7A 1U3VA 1VLLA 2P68A 4J7UA 8ADHA 1ZCJA 3DOOA 1TVEA 1C0PA 1HYEA 1RM5A 1H0KA 2JHGA 1XQ1A 2H63A 2IXAA 2EJWA 4RPKA 4DBZA 3I23A 4J7XA 3S2EA 3D1LA 3TZ6A 1IYZA 3ONFA 1IUKA 4E2YA 4YAIA 1PJSA 3JD0A 3D4PA 1Q7BA 1CERA 4WPGA 5HA5A 2NM0A 2OBNA 4O1MA 1LI4A 2Q99A 4R9RA 4HFRA 3WB9A 3C1TA 3NAQA 4OM8A 1V6AA 3V2UA 2G76A 2J5QA 4MIYA 6ADHA 4ALLA 5AXBA 4NZ9A 2NADA 4MVJP 4NH4A 1L1FA 1Z6ZA 1EFKA 3GEMA 4PFJA 4PIVA 2OXIA 1E5LA 2NQ8A 1ZJYA 3JQGB 3LC2O 4BQRA 1I3LA 4IZIA 5DN9A 2ZB8A 2Q45A 2ZQZA 4RPLA 4Y67A 1NQ5A 3ZU3A 4E30A 3DFUA 4IS3A 4DL9A 2CFCA 1I30A 5BSGA 4R69A 4YWJA 4KP7A 4XIYA 3OM9A 4NBRA 3Q1LA 4YBZA 3GUYA 5ADHA 4Y6RA 4FCCA 2HCTA 4CLRA 4GWGA 2C07A 3VH2A 1U5AA 1EVJA 1V3VA 2GZ3A 4NNJA 4QFCA 3EAGA 1T2FA 3M1AA 3FPCA 2J5RA 3RU7A 3VZRA 2JCYA 1ONOA 4I1IA 1B7GO 2VRCD 2VHWA 3P5SA 1A71A 4AFNA 3KM0A 3LZ6A 4IJUA 4DIFA 2YUTA 4FN4A 2E48A 1ONNA 1N92A 2RCYA 1EUZA 3CUKA 7MDHA 5TF4A 3A9WA 4B4WA 4M49A 1JW9B 1HE5A 4DREA 4BNWA 4NFYA 3WICA 4IGFA 2CZCA 1Y1PA 2VHYA
chains in the Genus database with same CATH superfamily
5FUYA 4N41A 2Y4NA 2VSOA 3S1AB 2XNDD 3C3PA 5AR1A 1SEPA 2V3VA 3I6MA 2BM1A 3U0VA 5FOTA 4R40A 4Q4AB 3LPMA 4E03A 5BN1A 4TTQA 1UXJA 4OMDA 2FY8A 5JADA 1E6CA 4YRFA 3BB4A 2WK1A 5FBVB 1QP8A 1T9HA 3HCEA 4NOLA 1E9AA 4P36A 4GLBA 4JNKA 3T7CA 5HQ3A 4IJWA 3HU5A 1KSHA 3CY6A 3OZAA 4UFNA 1FL9A 1KDZA 3HO1A 4AP5A 2B4TO 1QH8A 3VO1A 4O29A 1IL0A 3S55A 2CNOA 4E70A 4IOMA 1NQWA 2J32A 3P4XA 2XIQA 3IUYA 3H9GA 4MUIA 2KI5A 1SUWA 3CF4G 2WOJA 4XDGA 4YCAA 3V34A 4ARBA 3R0VA 1Q0HA 2P40A 1SG6A 3F8SA 1X13A 4AMGA 5IZCA 4B7XA 5AVWA 4UUQA 4M88A 1EM8B 5DBFA 5A3SA 4N5NA 1AXRA 1OA0A 3SAJA 5J4LA 1CE8B 4A82A 3AYZB 1DJPA 1NJFA 1S0UA 3OZGA 3PDIB 4PWZA 1MAVA 5C31A 1VL5A 4IQFA 2NSDA 5TVGA 1R8JA 3BMCB 1PGJA 4FFBA 2WSSD 4N5HX 4RFSA 5E6SB 5IT0A 2M32A 1IPEA 1A50B 2W6ZA 3EWSA 4HZUA 5L3SA 3UGJA 2Q3HA 1YZ3A 1QLWA 3KYIB 4YR9A 2K4MA 5K3DA 1E1LA 1R0YA 2FEPA 4J2HA 2Z09A 3JQCA 1EFVA 3JQFC 2ZJ1A 3IIJA 1S02A 1C9EA 2G17A 4LDZA 3ZC3A 4XOUA 4HDSA 2ZDGA 2I3DA 3ES9A 2OCBA 1F6DA 9MHTA 3WLMA 2AJBA 3BBPA 1HYHA 1ACJA 2V98A 3NETA 4QXQA 2X6RA 4RC9A 5ITVA 4ALMA 5IDQA 3SQOA 2H1IA 3JD4A 1SXJD 2JANA 3X1DA 2B94A 5F7ZA 3ZV6A 4ZO6A 2P78A 2OC4A 3HV0A 4LHYA 4NJMB 2RHJA 2IHUA 1VBFA 3FSJX 4PX2A 5FQOA 2XQFA 3UJDA 4YCCA 5AT1A 1H3FA 1NBAA 1Y98A 3CH5A 4MRPA 1QKKA 2R2GA 5LQSA 3WIDA 4AP9A 4ZHQF 5JNVA 3NYWA 4UXHA 2ZRKA 1TAGA 2PH7A 1TEXA 5F23A 3GRAA 3GFBA 2HEIA 4OQZA 1VJ1A 2J67A 3L92A 2PGLA 1C9YA 3ENQA 3LQFA 2EFEB 2WYVA 2JLXA 2OQVA 3BWCA 1GT91 2ZJFA 1HOTA 1Q6ZA 3DAFA 2FEAA 5AUQA 2GPTA 4MVJD 5BR4A 1DXHA 5EZ6B 3PJEA 2IEDA 5KWIA 3IP6A 1M1UA 3RANA 1FRQA 3KQQA 4EPWA 2MTBA 5E6RA 1LLQA 3KJNA 5EEHA 5FR1A 2FOLA 5AVQA 4GYWA 1TYAE 4NV3A 1UBRS 1QNLA 1WVIA 5KSWB 1NVWQ 2OCKA 4JLJA 4D3YA 1OE0A 1VL1A 4KH0A 3L0IB 5AW5A 4DT1A 2XNKA 2PUFA 2RGWA 1QDLB 1LQUA 2AUMA 1EQUA 1OV6A 4JJZA 3DCNA 1YRLA 2X4LA 4PC1A 3QEKA 3DMYA 1ICIA 4LG1A 2VHQA 3ML1A 4I1YA 4M7RA 1UJ4A 3T5DA 2F48A 3ZBPA 4ZVTA 3AKYA 4P7KA 3RUEA 1MXHA 3D3NA 3LPAA 2AVDA 4MH0R 4XCQA 1GPH1 3PQ2A 4JASB 3RAPR 1XPOA 4UVHA 3PNBA 3EDQA 4LDPA 4LGYA 1SIBE 3BGVA 1RJ9B 3HYRA 8GPBA 5KC8A 2HQRA 1K2VN 1N2ZA 4RDHA 5AW8A 5BSEA 4JP2A 3K71B 3A1EA 3ZY4A 3W4JA 2HC9A 3BFKA 3U31A 1MH9A 2ZCUA 1WQ3A 2GJAA 1FYWA 2BFFA 3NGLA 1RP1A 4G0PA 4XZ3A 2O3TA 4KYUA 2P67A 5IC5A 4F9EA 1P60A 3N74A 3D8NA 2V03A 4HCJA 2R6AA 4H08A 4YJGB 3U1VA 3PLAE 4M1OA 4P4SB 5DNYB 1BOOA 1M2OB 4PSUA 4K87A 1H6DA 3KKQA 3EEQA 2ZIEA 2JFFA 4FCTA 5F1YA 1Z2OX 5JNRA 1ORWA 4HTFB 3R4VA 5DX1A 4E14A 3CO5A 4GL4A 3W6UA 4GO1A 4CNQA 1IEWA 2VJLA 2C84A 4HAXA 1P9LA 4W4TA 3GR6A 4WN9A 1YUBA 1ZIOA 2F1RA 1FBTA 1D4FA 3B13B 2HMSA 3BIJA 3CUVA 3OFKA 4MS3B 3E23A 3W1VA 1Y3BE 3REFA 3W8DA 3WK9A 3CH6A 3IHWA 1XRJA 2OD9A 2VEDA 4JI1B 3D5EA 5MGBA 3U37A 1T8WA 2DHEA 3ETDA 1PGQA 3MJEA 4IBOA 1GQYA 1YASA 1Z4PX 3EOZA 5DPMA 3UMCA 4DN6A 5CMLA 5BNZA 1IXYA 3I9V6 1GUBA 4PAQA 1LDYA 4JXKA 3WLQA 4FMBB 3PHHA 3ICCA 4R7ZA 5D1HA 1GUFA 5F4ZA 2UV8A 1S5PA 4KJXA 5AKHA 5FULA 2H59A 1XZ8A 2HPHA 4QOIA 1NZFA 1NNEA 3OKFA 4A03A 3ZGXA 3AJ8A 1U9ZA 3ELUA 1EIZA 4IOLA 3SX2A 5B4UA 3NV9A 3CLSD 2X0DA 1E6WA 2CHEA 3GB9A 3P9CA 4Z99A 5FTMA 1NBEA 5MFPA 2G82A 1VMEA 2AN5A 2MSWA 1IZ9A 3PC7A 1NMYA 1QRRA 1DMSA 1QF7A 1VMAA 3I01A 3RH0A 5J4VA 5HM6A 2O4UX 2ZZKA 4I4CA 4AUMA 1UPTA 1M0EA 1J8YF 2C88A 2EAUA 2IYWA 4DQLA 1PR4A 3KYDA 1PBTA 3LXXA 3DWIA 2QVLA 2AL7A 4EG1A 1PR6A 2F3UA 1HDXA 2X1LA 3C5CA 2PRYA 3KVYA 4J6EA 4JBIA 4GOXA 1YB2A 4HWSA 4M9SA 1IZ0A 5CU7A 1U3TA 1ECBA 2LIVA 2O2IA 1OC2A 2Q6OA 4J90A 1RRKA 1GPYA 2R5FA 1K06A 1VI6A 2YOFA 2NQ2C 3ACCA 2C4HA 2XCLA 1STOA 2Y2UA 4GPEA 5KYUA 4BNHA 1G5TA 3FLBA 3FHCB 3V4PB 3OQMA 1WB9A 4JA0A 2RHDA 2XB2A 1L5KA 1FDVA 1V3UA 3FF1A 5I7FA 5JJBA 5TMPA 1CQJB 1WUHS 2GN4A 2A35A 3Q8XB 5FL3A 5IK2A 4AWAA 3M5WA 3WGZA 5C4IA 2O2YA 1Z74A 5E4FA 4ZAFA 4TWZA 3MC1A 4QM7A 1SCQA 2AEMA 2RGDA 3BXFA 4JVLA 3E2PA 4MKFA 5COAA 2HXSA 3C5VA 3HY6A 3WBKA 4AKHA 1SBNE 3Q15C 4AJPA 3Q12A 2MYNA 4M0DA 4A6XA 4EB8A 1Y8AA 1JYEA 5FH9A 1KQFA 1ORHA 3EG9B 2YC2C 1ZD4A 2QTGA 2XE6A 4RHYA 1WHTB 4AZSA 5ES4B 5AI5A 3FFAA 2P90A 2W6CX 4JB8A 1TB4A 4KTVE 5KDDA 2R4QA 2AFRA 5M3BA 4XIIA 4NMXB 3VZCA 3RARA 4EYSA 4FHEA 4D8TA 2FR8A 1GEGA 5IFKA 3JX9A 2JAOA 3T8YA 2WD7A 2FPIB 3WYFA 1CEYA 2ZWVA 3FMPB 1XK7A 5AH0A 1PUIA 3C5EA 3FTFA 5JD6A 3UB3A 2ECFA 5BN5B 3BFJA 2WJIA 3BMQB 2OGTA 3KL2A 3PP8A 5GOZA 1KR5A 1ECPA 1P1HA 1CJVC 1IZ8A 3DUFB 3PCXA 2GYVA 4R2JA 3TBKA 1T0BA 5JALA 4ALNA 2BI8A 5AKXA 3JZFA 2GPBA 3MTBA 2O8FB 5FBHA 3PC3A 2WHPA 2BZSA 1CF4A 1BEUB 1U3GA 2OGSA 3QWFA 1XZIA 5KBYA 4L2IA 4HVAA 3SHTA 2W8BA 1Z0UA 3NWPA 3KQOA 2ZDHA 2OZVA 4HDRB 4YQFA 1X74A 1Z0DA 3GUHA 4M7PA 4PYJA 3FX2A 1ECCA 4O02B 2DAPA 2WLTA 1G1MA 1A5BB 1SHLA 2X7JA 3PQCA 4I50A 1BOFA 4OCZA 3OT5A 3WQRA 4K5QA 3K0FB 3ZE0B 3HVRA 3OECA 1D6MA 1L5YA 1G8SA 2AA3A 2OCDA 3AEKB 1P4JA 4OL0A 4RYLA 4UQPA 2JFVA 1T4CB 3U17A 1OX4B 4HUQB 1L5HB 4D43A 4A27A 4B4KA 6ABPA 4UHCA 3I5YA 3T52A 3QJGA 1UK8A 5KSOA 3ZNOA 3MWFA 3PEFA 2YWBA 2E87A 1W93A 4GX1A 5AUPB 1D0IA 4EHFA 3CLKA 3WKBA 2FH5B 4LBVA 4MUFA 3K15A 4IFTA 1KJNA 3OO0A 1F1JA 3ZOZA 1JG4A 1G8KA 3KUDA 1UZAA 1FQOA 3FSRA 2F43A 2ZBUA 4X7RA 3CLVA 3CZ9A 3EVEA 4EGQA 2VKTA 3CUYA 5TV2A 1TL7C 2EIXA 4UD6A 3I1YA 3WX0A 4CKEB 2F90A 3CUSA 4DPMA 4XQ0A 3GJYA 2JD1A 4TSKA 4AQDA 2DBYA 4L6IA 5I45A 4YMSA 3GLIA 3MELA 1SCKA 1N1GA 3FOEC 4A2WA 2PUDA 2G6BA 1PRYA 1XWFA 2PRKA 3SMQA 2NYAA 4KODA 1UMBA 1BWPA 2PL1A 3GEIA 3Q7TA 3R3XA 5GV8A 2VPWA 1TQDA 2ZSDA 4MPJA 1SXQA 4HJRA 2VT6A 2VOEA 3JYLA 3D4IA 3RS5A 2DWCA 3I04A 4O4LF 4OP2A 2C3YA 2R00C 1RRFA 3KXLA 3TQIA 4EUSA 1LQTA 4ZK6A 3C8DA 3G0BA 3NW9A 1SWWA 1WXXA 1L7BA 2J0SA 4P4NA 1CUZA 3JQ7B 2XXAB 3C4QA 5DN6A 3JQAB 5FI5A 5TSDA 3IKVA 1BN7A 4L4XA 4RCVA 2C03A 4F0JA 4PQRA 1NXQA 2EC5A 3PC8C 3HEAA 4FINA 4X1OA 3HK2A 1I4TD 1FOEB 2GT1A 3SLKA 2C78A 3I58A 3JZAA 1CT9A 4AO7A 4BNZA 1XCGB 3NXSA 3OIFA 1PN3A 3NHBA 4NE2A 5ALDA 5KI6A 2VBFA 1AV6A 1PWHA 1WV0A 3EMKA 3BRCA 1A5ZA 2EKQA 3KJHA 2IXFA 4FOLA 4HGOA 1XHFA 3K72B 4LHXA 4TXHA 4B3GA 3DT6A 2IS1A 3N5CA 3TW8B 3H0EA 4DA6A 1N77A 2GEDA 3FWPA 4FW8A 3IXQA 3L41A 2WM8A 4E13A 1O1YA 1SUDA 2X42A 5SYNA 5AHXA 3R7DA 1J2EA 3EVBA 1QX3A 3DBHB 2Q3MA 4UARA 4QTUB 2J4FA 2Z8YM 4XW2A 1I10A 2QSUA 3ZWOA 3P19A 4C88A 1GUDA 2AZ4A 3GLRA 3QVUA 2ZVPX 3MN1A 4HADA 4H35A 4YECA 1G2OA 3AL2A 4RTNA 5LBUA 5CURA 1LBIA 5DYYA 2DFDA 2NMVA 5AW9A 2NUTB 1CUAA 4YP5A 3KWMA 4ZPJA 4RV4A 1ODFA 2CFIA 3IE2A 4FFLA 3TZKA 1PEDA 2YBEA 3FNQA 5G0VA 2ZB4A 3EDCA 2ARKA 3PXXA 2C9MA 3PGVA 1XXLA 3KPYA 3LLSA 3LYAA 3W05A 2GF0A 3PFBA 4F2GA 1X1RA 4BUJA 2DT8A 3L1JA 3O8DA 3PPWA 3DAHA 2QBYB 3GPIA 2VK4A 1Y3HA 3MIIA 4KE6A 2XCTB 4KR7A 1DKUA 1EK6A 1PVDA 1Z2NX 2ZBPA 1EFRA 3BKWA 4HH3C 4B0OA 4EYQA 3IUNA 5DHAA 1JDNA 4BWGA 4EARA 1CR6A 2FN4A 2FGKA 4FEGA 4TS9A 4HRYA 4ZVNA 1JR6A 4HLCA 4MWEA 4Z86A 5IDVA 3T9BA 1JIUA 4JLVA 4QEKA 5C8ZA 4J9VA 1Y9DA 3F67A 4DLUA 4EDFA 2DPLA 1NJGA 2ETVA 5I8PA 1W4ZA 1YZKA 3TYXA 4EMBA 1EFAA 3UUWA 1N6PA 4OXYA 5I7AA 4AUEA 2B1QA 4Q4LA 3NV7A 3HB0A 4DYVA 5JNLA 4F3CA 3VISA 3U16A 2DPHA 3VVLA 1K75A 4AN0A 4BGVA 1W35A 2E4VA 1PR2A 2ZEJA 2IQIA 2ZBDA 3ZDEA 2E49A 4O4LA 2WAOA 5JCOA 2D1TA 4F6RA 3OZTA 5IKEA 2OK7A 4HV4A 1P5FA 5TEVA 4AJHA 4HYYA 5CFQA 2ZJZA 3LRTA 3SF8A 4KNWA 4IQ4A 4NYIQ 4NDZA 5B1YA 3AVVA 1U9YA 3AR3A 3OE4A 2MDTA 2WA2A 1P2DA 2CDBA 3V8MA 5A9SA 3GVHA 3ZV7A 4IV5A 4BN0A 5CTJA 3EBPA 1FP4A 4GOLD 3VKHA 3IVAA 5CDHA 1Z47A 5K0BA 1GKYA 2H11A 4V3BA 4XD2A 1Z5PA 4Y7CA 4H3VA 4HN9A 1EFPA 3UM9A 2XMBA 2XODA 3PL1A 5HGJA 5IAOA 1KWKA 3K8OE 3UG6A 4U6NA 4KQ1A 4WOKA 3MOGA 2B98A 4MGKR 3U1TA 3CYFA 4JVMA 2ILTA 3TNYA 4E7PA 3FRJA 2A33A 3RYCA 5I47A 1LK5A 3QQPA 3ZOKA 3DSRA 3ITEA 3PWSA 4R7GA 1N6HA 4PLWA 1EWTA 1WBBA 2LDBA 1QFZA 2OO5A 2Q5LA 1DHRA 3QXXA 1QC5B 3VSAA 4M4SA 2ZIVB 1NWHA 3TWOA 3QYPA 4UU1A 4W63A 1TPZA 1NJ5A 2XUGA 3GQBB 5NLLA 3DP7A 1V43A 1DKRA 2D0PB 4K6CA 4U4AA 1WZ2A 4GMHA 4I36A 3LY9A 5HMMA 2JLAA 1GQQA 5LSAA 2GSWA 3BIXA 1J20A 4JXJA 2B82A 3EA5A 3WLSA 5G4KB 1SWVA 3IPLA 1WPGA 1KI4A 3PDWA 5CVVA 3X44A 1FDSA 4RZ2A 1WCWA 1ZYUA 1GG9A 1T2UA 2CNWA 2GHQA 2XQJA 2IYNA 3D6FA 1X1EA 3LFUA 5A4KA 1U0FA 5IJZA 3ORYA 5L6LB 1WOYA 2ZJ8A 3K9WA 3C6BA 1HFWA 2O0LA 3T4XA 2D62A 4CDGA 4YCDA 1IY0A 2PSSA 1P17A 1TCCA 1T5SA 3LKZA 4JH0A 1QH9A 1XKQA 1C2YA 1YB7A 1YI1A 3AB3A 4ND4A 5JNTA 3R9XB 3EIOA 4FC6A 3AEYA 4KITB 1T91A 4X91A 1S2OA 2BEUB 1T3SA 1GNRA 1SAYA 2JHCA 4MW6A 5KU1A 1JYSA 3FUWA 3G0DA 3VGJA 2VIIA 3OJOA 4V0SA 3F7OA 1MQ9A 3VNRA 5BWNA 4RU1A 4IVNA 1UH5A 4GGMX 3FOAA 3N0WA 1DPFA 1E6EA 2EFJA 5EZSA 4N01A 3RKRA 5CB4A 2BGGA 3GEDA 2JJQA 4AYWA 9GPBA 4RULA 1WUIS 3FUVA 3TLKA 5FAXA 3FCYA 4CT4B 3KQVA 3CWCA 4K0KB 4HN4B 1U2SA 1NXWA 3KETA 3C15C 4LCEA 4X8LA 1NW9B 1QAQA 1E3JA 2EG9A 3CRW1 4MJLA 1TRHA 2DT5A 4UTZA 3K9GA 3V1UA 1MW8X 5JJLA 5EVCA 2H1CA 2BH9A 1T35A 4GUDA 1XFAA 2Y1DA 1ODIA 3MWGA 4CLOA 5IC4A 4MI1A 1ZG3A 3QE9Y 5L8VA 1AMUA 3T15A 5BYJA 2PLRA 2RB4A 1T0HB 2I6UA 4NBNA 2L19A 2OBYA 1RWQA 3HXPA 3TDNA 4A6EA 2JAUA 4DPLA 4EFKA 1GSOA 3ZDBA 4JQOA 4HAVA 2WB4A 4QLAA 3IJRA 1E5QA 2I87A 1GZDA 2I7XA 3L0DA 2X22A 4XQEA 2Q0HA 3WNDA 4JL8A 1EZ4A 4QGFA 5FA8A 3FNGA 1OZ0A 4A6PA 2CHVA 4QICA 4RESA 1GCOA 4H60A 4WTOA 5E7IA 1J9ZA 3PD1A 3PNMA 1SUSA 4MV7A 5E1OA 4M1TA 1AUXA 1XTUA 5LQUA 5IXJA 1A9TA 4RF4A 2OG2A 2ZI9A 3WYBA 4G09A 4ER5A 1RZRA 1E1QD 1TLFA 5DTEA 5HUJA 3A58B 2ZRFA 2R48A 5LP6B 2V3CC 2RJOA 1FPMA 2HCFA 2N3ZA 3CINA 4WBNB 4CN8A 3AKZA 2JGNA 4U2KA 2QVXX 4PG7A 2IOHA 5EWJB 2I2AA 1U0SY 4MUAA 1DIOB 4U9HS 3ZW7A 4OX9Y 2P4HX 4BC1A 4C1BA 4FJ2A 4EA6A 1CZOA 1NVDA 1T4GA 2GCNA 4NBKA 4TMYA 2GZMA 2GFHA 1SURA 4DCVA 1MFZA 3HSYA 1EQ2A 2NAFA 2BEJA 2YCBA 5ALUA 3T1QA 5I9BA 3T5BA 1DC5A 2VZLA 1RYMA 2HRCA 1OLUB 4FLEA 4EOGA 2Q2VA 3F1LA 1RZ3A 1ZGZA 4HFNA 1GXSB 2OG1A 3DVQX 5SY6A 3OLZA 2H0RA 3PUIA 2BGRA 5EHZA 1T3HA 1WS6A 4V0QA 5LU8A 1CQZA 1NJSA 2HI0A 2G83A 4ZT3A 2HA0A 2AK3A 2VH1A 4Q66C 1XJCA 2CNNA 2QYHA 4WOCA 2IY9A 4I3HA 3AVXA 4MDHA 1P7PA 3ON5A 5D8DA 4GKBA 1TM4E 4TXJA 1S2DA 2QU7A 2JLWA 3W8NA 3OIUA 1QE0A 2B9VA 1MC4A 1NOKA 2UAGA 1E2PA 3LDGA 2OT3B 5T57A 4AULA 4L72A 2YASA 3SSMA 3WV4A 3H42B 1GSIA 4U7GA 5KYWB 1DT5A 2AYZA 1QCDA 2XADA 4DQDA 2FEWB 1UWLA 1Y5RA 4TKUB 1GQSA 1G3UA 3IOCA 1W4LA 1SHJA 3E18A 2OUKA 3HBJA 3OOHA 4ARZA 2V9CA 3V4VB 2RAPA 2OYCA 3OOWA 3WGOA 4CPDA 1ZVVA 4CUJA 3OKCA 3G1WA 4OHRA 4YNBA 1UBJS 1PT8A 2ORIA 3GYGA 4NABA 4TSFA 4AU1A 1NDQA 3VYTB 4YUYA 3GZTB 1TTTA 2QRMA 3RF6A 4ETWA 1CR1A 2KJQA 4BZXA 4BKPA 4P4TA 1LVUA 4JJFA 1EEXB 1V6CA 1ZI9A 4Y2JA 5J2UB 3QHPA 3SKVA 2ZWIA 3VKUA 4X84A 1QBGA 3KBOA 1ZVQA 4K1XA 4EA9A 5I4KA 2PUGA 3R6TA 1CY0A 4I55B 4PS1A 4HQ6A 2QU8A 3I2GA 2C98A 2FJPA 3F7NA 3GA5A 3GO4A 1XZAA 2CHUA 3QA3E 2V6MA 5AM0A 2QW8A 1Y4SA 3NVDA 4KN6A 2JBHA 3CLTD 3ZDXB 1AKWA 3U4IA 5A5GA 1KORA 2P3LA 1BX3A 3FZNA 4L9WA 1P8JA 2D2IA 4NYJQ 1B14A 4C5BA 2GN6A 4GZLA 1QFSA 2PBZA 4XPIA 3R9IA 4K2AA 3FYTA 4QUJA 4QLBA 2OXEA 3CKMA 4DLKA 1KBQA 1TCUA 3MCTA 5GQSA 3U61B 1SK8A 1PJRA 3CX6A 3KR0A 1KYYA 4FMCF 2D8MA 1YQ9A 1WIWA 4BRSA 1L7PA 3A3KA 4P35A 5DN6D 4JX8A 4RS3A 2FRDC 1TT7A 1JHYA 3KWFA 2XXJA 5DYNA 2XVAA 5G3YA 4RVHA 2UKDA 4X0EA 2O2GA 1TVKA 3EEIA 4HMPA 3HABA 4CG3A 4D0RA 1CWUA 5CA0B 3KWLA 4AZWA 1JWLA 3GF4A 4MUMA 4HSGA 4UCWA 5TB5A 3ZE2B 4ZEXA 3M1IA 1I8TA 3EWNA 1N1MA 1ESZA 1EWQA 1H2ZA 3CZPA 3AFIA 3QVLA 1Z4LA 4HDMB 3K7EA 2MINA 2PXAA 3H0KA 3TR5A 4HK4A 1UBTS 3BWEA 1DCMA 3WWDA 2PTGA 2GXSA 5A6SA 2NU7B 2HWWA 2JK0A 4B3DA 3ADDA 4GOJA 1X94A 3VKWA 3CVWA 2LXNA 2BC9A 2NTVA 2Y92A 3AZQA 1I13A 5K8VA 4H1VA 2GAJA 1TZBA 3IIEA 3L77A 3UV6A 2YRXA 3MB5A 5GONF 4BMPB 2P91A 3TW6A 4D81A 4E21A 2AGVA 1BA3A 1E7WA 2KMLA 2VTBA 1QFJA 2SCUA 5K0LA 5B1HA 4CCWA 1L9KA 4XWGA 2H7VA 5IM5A 1LLCA 1S8NA 1N2SA 2BFDA 2GN1A 3DYBA 4B33A 1V8PA 2PYIA 3GRCA 4BMOB 1WMBA 1B76A 4FEAA 4I5FA 3V8NA 3JVDA 2AMVA 1RXCA 1V1MB 4QVIA 1F3LA 1Y1QA 3EH1A 4IEIA 1XLWA 2Q6VA 4PHTA 4V24A 4YMTA 4U0JA 5J1TB 2XGJA 5CFNA 3LU1A 1SUPA 4L0CA 4WCFB 2W48A 1T4BA 5K51A 1BXRA 1QTRA 4NZPA 3VPDA 1E3TA 1NBOA 3HR8A 4X93A 4Y2UA 2EKPA 1XDSA 1ZOIA 1Y9EA 2EZ8A 2N46A 1NE7A 3HCAA 2KB0A 4PPNA 4FT2A 2EX0A 1RBMA 4JLAA 2JA2A 1A82A 1DXQA 1DKOA 4OA8A 3MAAC 2DF8A 2J6CA 1T5BA 5FOVA 3KUCA 3SFVA 1T34A 4KAJA 1OBHA 4OHVA 4R1TA 3A4LA 4FVTA 3BD6A 4AL4A 1PW7A 6NULA 2BISA 4R7TA 4OHKA 4P8RA 4OJTA 1XMQB 4MP6A 4PZZA 4FYKA 3WK8A 2XEDA 4DUGA 2QD2A 1FLAA 1WF3A 1HQCA 1YQQA 2V74B 4JUAA 2IXBA 2WV7A 4R8VA 4X97A 5GZ3A 4DR6B 1PFQA 2BY4A 4F21A 1NPTO 1ZWLA 1UZUA 1FU7A 1N6RA 1MPTA 2GZAA 2KQUA 4KOAA 1OD6A 1XTJA 3TRIA 2B2XA 4A5SA 2QW1A 2LUOA 1YJ8A 3L05A 1YR6A 4YAFA 5KREA 3T41A 1UPCA 2HPZA 4M1MA 5B6IA 3V9AA 3EUEA 3SWWA 2P6NA 1G19A 3SPXA 3WZMA 1Y80A 4JLNA 1O94A 4RS4A 2Z43A 3FRHA 4GKAA 1YQWA 4E88A 1HLPA 5HILA 1J90A 4I7EA 1QIHA 2NPIA 4XUGB 3DAOA 4YVFA 4ZGWA 2B5VA 3KVVA 1I3MA 2FF5A 1CV2A 4DNQA 2ATIA 1WXDA 3E5NA 1XVLA 3LQYA 4EKDA 3PVSA 1GG2A 3PXGA 3WGKA 5EE3A 2ZS7A 1RVDA 2H9IA 4X64B 4CMEA 1IBSA 1KKUA 2GKSA 1M0WA 2OPHA 1AT1A 4PG4A 2HJSA 4C2TA 3R5TA 4B3FX 5LBIA 3LK6A 2XUPA 3FRIA 4E7OA 1J2JA 1MB4A 4BWFB 2IW1A 4GOMD 5EQTA 3DLCA 1G5RA 3RC3A 4DEXA 4E6PA 1EU1A 1U7XA 1Q92A 3CVYA 4O4JA 4AMYA 2BP7A 2NSHA 4KVFA 4ALIA 3EGWA 3P2MA 4BNTA 2Z56A 4G1VA 5LU9A 1J07A 2AI1A 3B5EA 4O08A 1JDBC 2J5BA 3G1TA 3HNOA 5K0FA 3A6PC 4PFSA 2OV2A 2HQ1A 4BO5A 4UQLA 3AQ4A 3BA1A 1J0BA 1CY7A 1ZUNA 4EG0A 3JQBA 2RI0A 1NY5A 1S01A 3WTCA 3G17A 1ML4A 4DCUA 2DSNA 3GLKA 5JLJA 3O8RA 1K6XA 5K8UA 3GMDA 2OOSA 3NHYA 2PKRA 3QUBA 4L57A 3P2JA 4INZA 4B48A 5LFAA 1GV0A 1W7AA 4MTLA 4WRRA 4Q01A 2X1MA 1BYUA 3QP9A 1FDTA 2BF4A 2ERCA 3EIFA 3PKIA 4GZ6A 4OOFA 5C7YA 2X0FA 1MIOA 1TCVA 3TL3A 1ZUIA 4F2HA 4LBZA 1MV8A 4M8NE 4GU5A 4YFYA 3TZCA 4CM8B 2ZM6B 1Q83A 1R2QA 4X62B 5IJ0B 1OHHA 4V0KA 3ENNA 1GLVA 1C30A 4I8XA 3AETA 3ZKWB 4DLTA 1NDHA 2HJHA 3G8DA 4OQNA 2ZQYA 4R2LA 3H5VA 2ID9A 4ISCA 5CDFA 3T94A 4OQYA 5FPSA 2IUEA 2QPAA 3ORFA 2I6GA 3KVRA 3UAVA 3JAKA 3PUHA 4RKFA 5KYTA 2B1JA 1CE8A 3BTUA 3Q8KA 2Q6TA 1Y8RA 2IL1A 4IOJA 5JCPA 1QHFA 4J07A 2H1OA 2A0WA 3IIKA 1P8AA 2B8TA 2ZZMA 4H27A 3BMCA 4L6AA 3HU1A 3U7EB 1MX3A 4U7FA 1ZZGA 5TC4A 1FNCA 3UKDA 3L1VA 1C1DA 1GTG1 2O07A 2P5YA 1D0VA 1YD7A 2M98A 1PS0A 3MJVA 2ZDQA 2VDWB 1P81A 3NXKA 3PC6A 1GPBA 1XU9A 3ND7A 5C5IA 1RXSA 2P4EA 1A7AA 1NURA 3T7SA 4D9HA 1AMNA 3BB1A 4EJSB 4C7OB 2HMAA 1VZ3A 3P97A 1E3SA 2CJFA 5CFMA 3GLGE 4D45A 2P9TA 4NZZA 3M7IA 4RTPA 1RWMA 2I80A 1ZRHA 4KG7A 2R6DA 4OHXA 3BGOS 1OW3B 4Q19A 4ZFNA 3L43A 4GR9A 4Y7DA 5AI4A 3RVQA 1GU1A 4FSXA 5LYJF 1PUXA 4L02A 1UKVY 1VKZA 1ZEMA 4XWTA 3X2EA 4ZT4A 4AJ1A 4PNEA 3F3SA 3SJ7A 1OAKA 3O1IC 4XFKA 1WXIA 3Q2IA 2WABA 2VP5A 3INTA 1BWQA 2C9CA 3HXKA 3DBRA 3UK2A 2YY7A 3UJHA 2K7FA 5F77A 5FEMA 2WG0A 3H6GA 2HK7A 4HDKB 5LA6A 4BU1A 4E2ZA 5C1PA 1UBEA 4DSNA 4PQYA 4WX2B 4A6DA 5KNBA 3BXPA 1PZMA 4YJHB 5AK5A 3BULA 1C8VB 4BEBA 2Q1SA 3AG5A 1DSSG 2AI2A 1K5DA 4IRUB 2PO5A 1PNQA 1K9VF 2QTHA 1LQ2A 4X3OA 3WLFA 2AE2A 2O48X 3FDFA 4HPJB 1NIPA 2PMDA 2BDEA 2LNDA 2ZJ2A 2FVYA 3KZ1E 4IINA 1YJ5A 4KUHA 3QSGA 4NMWA 5IYZB 2OYRA 5P8WA 2E4XA 2BGKA 1T1IA 1E5XA 1GVNB 2JDIA 2W2KA 5E2AA 2VHUA 3EHEA 4ZAYA 1DZIA 1IE3A 3R4CA 3ZW8A 4EPYA 4YB8A 1R6UA 2MYTA 2BELA 2PYZA 4Y0NA 1LU9A 4YALA 1SCDA 4ZHSA 2JA1A 6YASA 2X13A 5K05A 4KLZA 4OYHA 2VBIA 1VGVA 2OHHA 2QRGA 3B36A 3IKJA 3KV3O 4FB4A 4K81B 5EJ9A 5K3EA 4ZVLA 5H1YA 2HLPA 1UDAA 1A8IA 3BF8A 4X00A 2XBMA 1GA6A 2FWPA 3K5WA 2B4YA 1AGPA 3LIIA 4Q9JA 3BIFA 5JCXA 2R86A 1MAAA 3LL7A 3Q11A 5JAIA 4IO1A 1W4BA 2W2TA 1WMEA 2LKDA 3ETGA 4OAPA 2VRCA 2K2WA 4IQ0A 4MXDA 4RIEA 3K6JA 2VNKA 3OZVA 5K6AA 2WJPA 1QTIA 3IUBA 3GLSA 4QTZA 1L5GB 3AFMA 5CB8A 1ZGHA 1X6VA 1ZISA 4UEQA 3UUEA 1F2DA 4XUEA 1WDMA 4QYWA 2Q0SA 4JI2B 3NANA 3TXXA 1U4SA 4KR0A 3RO7A 1S2MA 2AOUB 2PWAA 2R8EA 3FUXA 5DYGA 3STHA 4AF8A 1O6FA 3BKXA 1TUBB 1KZ4A 1E1RD 3N2GA 3N8IA 1N2CE 1L0BA 2IZ6A 4J4TA 5AKIA 5FLYA 1UBKS 2C0PA 1HDCA 1KDRA 4IFIA 2EF0A 4Q1CA 4R51A 5HBRA 5KKNB 2Y0DA 5GP1A 5EIEA 5F5XA 2N47A 3Q6MA 3D8BA 3UAZA 3NWJA 4MS4A 4WZ6A 1G5HA 1JSRA 1L7VC 1QDUA 4UM5A 5ES3A 3RRNA 1E0JA 1LBQA 1WDTA 5B1IA 3SJCA 2C7RA 3QU5A 4PYMA 1FFWA 4N5MA 4HF7A 3NBFA 2UYOA 2EBUA 3IKLA 4QPZA 4X1IA 1CHNA 1IBRA 1JEDA 4EQ6A 1T8TA 2VDMB 2FPSA 3IEKA 4YASA 2HJRA 3QXGA 1QGYA 2WIAA 4XGKA 5CH5A 1JHAA 1P5ZB 1QU3A 2AFIA 4LBWA 2CD7A 1G3RA 1M34E 3GDOA 5AHKA 2IZZA 5AJYA 5G0WA 4P3NA 3RBVA 3OPNA 1KGSA 2X7HA 4ZOCA 1E98A 1I0LA 2V7TA 1K6EA 2R6ZA 3HBAA 4LVNA 4RVFA 3COVA 3TLJA 4LC1A 5LVAA 4AIIA 1A9XB 3OA0A 3TLMA 4ILEA 5CCBA 2C5SA 1QV6A 3JVEA 4GP9A 4AKGA 1PJQA 5ALHA 1L5SA 2X2FA 5CM8B 5FFNA 1MPXA 2PT9A 2C1ZA 3DL7A 5HBGA 5ITZB 3BWXA 4J9UE 4G0NA 1HFKA 3K0AA 3G0OA 4C29A 3VVBA 1NAIA 1ULTA 1X39A 5EY5B 5K3CA 1O0CA 2BR4A 3EXG1 5EJFA 5HOQA 2DH5A 1VL2A 3BCSA 2LCFA 5FHRA 3GFOA 4AK9A 4DRXA 2HIAA 4MAFA 3HFJA 5DK6A 5JHHB 3SFZA 1KOJA 3L04A 4WCVA 2PZFA 3LRXA 1CUJA 1DFHA 3D7NA 4Q7MB 2VP4A 3EH2A 4DJTA 4Z3KA 3T3MB 2Z5VA 2C7QA 2HU8A 3PSAA 4E4YA 5JD4A 2JFNA 3MG9A 4G5XA 5JPCA 3VBEA 3CUUA 4I6JA 3IALA 4JROA 1ID1A 1YMQA 3UIEA 2ZE6A 3OD1A 2I34A 2AW5A 1AUPA 2X0RA 1RYBA 4Q0MA 2I7VA 4I1RA 3RV4A 1K0UA 2HA7A 3S2YA 1NN5A 3ZVLA 2ERYA 3IEIA 2XCOA 1MGPA 2LD4A 3JWGA 1QG4A 2PY6A 3I4FA 1TCAA 3C0KA 1GGEA 3E8SA 3EY4A 4Q39A 4WVFA 5GM2A 4GZ3A 4FFOA 2WC1A 3HV2A 4R16A 1QHSA 3BOSA 2EDCA 2GGSA 3KUKA 3CB4A 3LGAA 3PHIA 3PNSA 1E3WA 1V37A 1KEEA 4G0WA 4RGYA 1KL7A 2EP7A 4FX5A 4XM2A 3WSWA 3WSVA 5DHQA 3QYAA 5MHTA 2P1RA 2XWBF 1L4KA 4JUIA 5F2KA 3SBEA 4WD3A 2PUCA 3CE6A 1XZQA 1ZD9A 1QO0D 2G5PA 4HN2A 4XVRA 5KNCA 2HWYA 2O14A 4GYKA 1T8UA 2Z04A 2FPIA 2GAOA 2OBBA 3FLMA 1X0VA 4HR7A 4OB7A 4PTYA 5CNMA 4ZCPA 3DOIA 3BILA 5KYWA 5KX5A 5LQAA 1SU6A 3EPHA 2NPFA 3VYUB 4B84A 4DSTA 2FJ0A 2Q1WA 3AUXA 2FX5A 3ET5A 2KS6A 1VG9B 3RS4A 3PQ6A 3ESXA 3VSDA 1ZL2A 4DUGD 3RAEC 4PM4A 1XTZA 5B6JA 3OZIA 4DCTA 2HRZA 4ENSA 2Q29A 3U7FB 2J87A 5ALPA 1VI2A 1U7HA 2D8AA 2G40A 1POXA 2IHYA 4PS0A 4X7BA 3OLCX 4BZZA 1NI4B 1OYVA 1USWA 2YXPX 5C52B 1KK0A 3F6YA 2CF5A 4DIUA 1POWA 3V5NA 2A78A 1CY4A 3BTVA 1O95C 4XWYA 1RRCA 4RGBA 3HBFA 3RRZA 1RZUA 2W2LD 3CH7A 3L82B 1O94D 2UYHA 1DJMA 4L76A 2ZIFA 4ODIA 4HVCA 4GF5A 5ICGA 3PXEA 5I5GA 3R09A 4OBEA 3IEVA 3GP3A 4GHWA 4BVJA 3NIDB 4Y2SA 3TIVA 3DOJA 3PWZA 2WUDA 3WTBA 5TX7A 1YDHA 3AW8A 1FC0A 2W93A 3FWYA 1S3GA 5GOTA 2Q5OA 4BMDA 1D8TA 3SDZA 3GGOA 1PVOA 3HCOA 3COJA 4H31A 4GGOA 1HBJA 1YNOA 4WE3A 1UXIA 4LSWA 2TMDA 3GPCA 4LPSA 1XDWA 4EP1A 5HRAA 3VJKA 3E8MA 1Q3HA 4DLSA 2HK8A 4GQIA 5EHQA 3TLYA 2RFLA 1ZK4A 2YFKA 3UFXA 3I8OA 3OKAA 1Y6ZA 3THSA 4RIGA 3FNBA 1GPAA 2BGUA 3NX4A 4PXAA 4A0SA 5C3MA 5HX7A 3Q3VA 1IPFA 2BLLA 5CGZA 2MYUA 1HF3A 1SBCA 1H2YA 5F7OA 3HG7A 4B3BA 4HNAA 1NVMB 2HV9A 4MWGA 4IY1A 1H93A 4C04A 2H51A 4JFRA 3PC4A 2CXUA 4MDYA 3ZG6A 1G7SA 2XUFA 3CBQA 4B3CA 4BO2A 1U2DC 1JHRA 2ZWOA 1YULA 2IZ0A 2QLMA 1PGOA 4E1BA 5B7QA 5AKYA 3U26A 1QZ3A 1GCUA 1PHRA 4D6XA 1NSYA 2ZT5A 2CLFB 3QKSA 3U39A 1P7VA 2D7CA 2VQDA 1JG3A 3WRWA 2GZHA 3U7IA 1T3ZA 1H5QA 1LNQA 1T10A 1WABA 1Z2CA 2NGRA 4TYMA 4BTVA 4N0EA 4DIMA 3VH4A 4Q02A 3C48A 4K9SA 1ZNQO 2DLDA 5IKXA 4HGYA 4O2BF 4XDZA 3Q3IA 2OORC 5JDCC 4CLXA 1ZBQA 2G0AA 4KLAA 1VLMA 4BL5A 1US8A 4JC5A 1O8CA 2ZJ6A 2XMCA 1CD5A 3AR8A 4JLPA 4R98A 2B37A 1ZJJA 1V3TA 1LF5A 3A1UA 2BWJA 2FR0A 3C6YA 1DTWB 1M2GA 1HSZA 1NJ8A 1YR2A 2YV4A 4LUCA 4H15A 1M8PA 3WMWA 4D79A 2WAYA 2XA9A 1DQNA 3RKSA 1A1VA 3CVOA 3B52X 1OHHD 5D01A 1DPGA 1NULA 1VYHA 1CZKA 3TW0A 4B82A 1W5SA 5JAUA 3QVOA 5BMVA 3RVJA 4CMIA 2XZLA 3Q8LA 1PNTA 1NWCA 3F5SA 4OLHA 3ZV3A 4CWAA 4ZOQI 5TQ2B 4NBTA 2NU6A 2X86A 4KIGA 4L8WB 3IQWA 3TXAA 5KYKA 1IVYA 2BN4A 5DIZA 5CFLA 2VT3A 4O8ZA 3HC7A 3D4BA 3YASA 2Q46A 1F7VA 2L42A 1MZPA 3DONA 1XGKA 2VUTA 3GJRA 5H7XA 2J48A 2YFQA 1DIAA 2I67A 4RTSA 2OHOA 1XN1A 2VQSA 3B9RA 2IUSA