1YXMA

Crystal structure of peroxisomal trans 2-enoyl coa reductase
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
297
structure length
297
Chain Sequence
GRSYLAPGLLQGQVAIVTGGATGIGKAIVKELLELGSNVVIASRKLERLKSAADELQANLPPTKQARVIPIQCNIRNEEEVNNLVKSTLDTFGKINFLVNNGGGQFLSPAEHISSKGWHAVLETNLTGTFYMCKAVYSSWMKEHGGSIVNIIVPTKAGFPLAVHSGAARAGVYNLTKSLALEWACSGIRINCVAPGVIYSQTAVENYGSWGQSFFEGSFQKIPAKRIGVPEEVSSVVCFLLSPAASFITGQSVDVDGGRSLYTHSYEVPDHDNWPKGAGDLSVVKKMKETFKEKAKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords peroxisomal trans 2-enoyl CoA reductase
publication title Crystal structure of perixomal trans 2-enoyl CoA reductase (PECRA)
rcsb
source organism Homo sapiens
total genus 103
structure length 297
sequence length 297
chains with identical sequence B, C, D
ec nomenclature ec 1.3.1.38: Trans-2-enoyl-CoA reductase (NADPH).
pdb deposition date 2005-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1yxmA00
4XKJA 4JROA 3QWHA 3I52A 1YO6A 2JFFA 1ZSVA 4BNWA 3H3FA 3LF1A 4GLOA 4BUCA 3DC2A 2G5CA 3OM9A 3D64A 5H82A 4BL5A 3A1NA 4L73A 1LC3A 2VWGA 4CM3A 3PQDA 3A4VA 4NFSA 1S7CA 4AJJA 3S2FA 4GVXA 3ITDA 3QSGA 4IDGA 2E49A 3V8BA 1DJQA 1PL8A 4D44A 4BNJA 4R01A 4J4BA 3ZI0A 1EVYA 1U7HA 2DQ4A 1XELA 2VOJA 4WLVA 3VPHA 5JO0A 2PH3A 2RH4A 2HDHA 2DT5A 4HNGA 3KEOA 4CM4B 1E1LA 2ZB8A 4Z9XA 5IXSA 3EC7A 2VN8A 2PV7A 4IBOA 4BMSA 2NV6A 2YZ7A 4OJNA 1WPQA 4ZQHA 2PKQP 4GQAA 3WNVA 5ICMA 3QIVA 3ZN2A 1IL0A 1UP4A 3GAFA 3KVOA 5IJZA 4JLWA 4PLHA 2B5WA 2E82A 2HAEA 4QO7A 3PHLA 3KSUA 3UW3A 4EGFA 2BD0A 1E1KA 5TSDA 1BVRA 2PZJA 4CLXA 3VH1A 2FPIA 1GR0A 2P9CA 3ADOA 4FOSA 4FFMA 3D3WA 1ONPA 1ZCJA 1Z7EA 3HNPA 4MVJP 3UVEA 2NVUB 3N74A 1MFZA 1P3DA 2C5AA 2Z95A 4FPXA 1K6JA 4E12A 3VZPA 4J7CA 1A4IA 1QYVA 4E2XA 1E0DA 1XQ1A 2AHRA 1W8DA 3D0OA 5L4NA 2WYUA 2EF1A 1HF3A 5I7SA 4ZRMA 1DRWA 3C3XA 1I8TA 2O4CA 4S1VA 3GVIA 3B1KA 3H5NA 1PZFA 2PR2A 3WX0A 4DREA 4KDEA 4YQYA 2FR8A 1UAYA 9LDTA 5KOIA 5IN5A 2AA3A 3C7CB 4B4UA 3WR5A 3FSRA 4Z9YA 3PHGA 2BMAA 4ITUA 4GL4A 1J0XO 3ZHBA 4E33A 3HB5X 1FDTA 3DBRA 2GNAA 2XXJA 4D0RA 3NYWA 1TVEA 1QYDA 2HK8A 3L07A 4GGPA 1GV0A 3GGOA 4QFDA 3AWDA 1SNYA 2Y0CA 3E03A 2X0JA 1CEQA 4I5FA 2O2SA 1U4OA 2NU9A 3NKLA 2NLOA 2V6GA 5FI5A 2QZ9A 4DQUA 1AUPA 1QKIA 3W8FA 2CVZA 4HX5A 1R6DA 4B7CA 4BHTA 1BXZA 4OH1A 3JQEA 5A3VA 2EP5A 5KCZA 4BMVA 5JC8A 2Y1OA 1E3IA 1PJ3A 4CM8A 3JYNA 4PLGA 5BSGA 5ADHA 3EZYA 1EBUA 3CINA 2CFCA 4ESOA 3JTMA 3WG9A 4Y6PA 3U62A 5DP1A 1I5RA 3WIDA 5JCJA 5A5FA 1H93A 2JAHA 1YOVA 3U4DA 3JQAA 4MP8A 3V2HA 3V5NA 1PGNA 1F8GA 2UV8A 3PRJA 2BF7A 2D4AA 1M6WA 4CMJA 4LN1A 3BHMA 1ZIDA 3CTMA 1KS9A 2B35A 4MIYA 3OIDA 1C0PA 2HLPA 2GLXA 4G65A 3PYMA 4W9NC 2J5RA 3CZRA 4WJZA 4AJLA 2JKVA 2QQ5A 4OGWA 4GKBA 3TZKA 2X9NA 2ZYAA 2ZATA 4TRMA 2BHLA 1ISMA 1VL0A 2IODA 1AGNA 1GYQA 1VL6A 3C24A 3WNQA 4CQLB 1KERA 1Z73A 2NACA 1HLPA 4MVJD 3PIDA 1CETA 1H6BA 3RU9A 3W4KA 3ONFA 1QG6A 4BKUA 5I7VA 3UCFA 1PL6A 2JL1A 2Y0EA 3D5QA 1GZ6A 3PWZA 4IXTA 1G0NA 1IUKA 1V3TA 4Z0TA 2PH5A 4AJEA 3AUAA 3NGLA 1A27A 4IZHA 5JXWA 1IHYA 3P5SA 4EBFA 1IYZA 5JAIA 3DHEA 3QVTA 3R6DA 3TZQA 1L7EA 5DBFA 2CF5A 3PP8A 1EDOA 3P2OA 1PIWA 3WTCA 1D4FA 1P31A 4KUEA 2DPHA 1IE3A 1LLUA 4N5MA 3ZHYA 3PLNA 1R15A 3NRCA 1LXCA 3AM5A 2BLLA 1GCUA 3CEAA 3BMNB 4CMCA 3VH3A 3TFOA 3OEYA 2GF2A 1LI4A 1N7HA 4BNYA 1XHLA 4I9NA 4OKNA 4PLWA 2OL4A 4WLNA 2GN6A 4L8VA 3ON5A 3IOYA 3AI3A 3VDRA 3RCBA 5ICSA 1DIHA 2E48A 5AYVA 1PJQA 3U49A 2G1UA 4BKOA 1NFRA 4AG3A 2J3JA 1MG0A 4FFLA 3RKUA 1XU9A 4DTIA 2FWMX 2ZYGA 2D1YA 1NQ5A 4YRBA 1ADCA 3B1FA 1UUFA 1T1SA 3HJAA 3K2BA 3K96A 3WQQA 3JQ9A 1ADBA 2YHIA 3OF2A 4H16A 4O0LA 4NU5A 5KJ6A 4PLTA 2VCYA 4RCVA 1GPDG 2EWMA 4DPKA 2YJZA 3H3JA 1HE4A 5L4LA 2O3TA 1E77A 1H0KA 3PYXA 4CUJA 3IJPA 4KOAA 4KUGA 1DSSG 5CG2A 1C1DB 3CMMA 3VZSA 3FHLA 4R1UA 3P7MA 1FDUA 4LVUA 1RYEA 3INTA 4I08A 4U6SA 4J0FA 4YR9A 3ROQA 2WD8A 4ZQEA 4OSOA 2IDZA 3JQBC 2GZ3A 3BAZA 4JX8A 4R5MA 4BNMA 1QYXA 1GZ4A 4RZHA 4DLBA 3IUSA 4E21A 2WTBA 3F9IA 3DTTA 1I2CA 1P9LA 1TT5A 2P2SA 3L4BA 4IJKA 4CV1A 1LEHA 3E5MA 2Z5LA 4GMFA 1UP7A 2X9GA 3GMDA 4LGVA 3S2EA 5JNLA 4H7PA 4DPLA 5BSEA 1HDGO 5HS6A 3ASVA 1XQ6A 1JU9A 5TNXA 3K9QO 4CM7A 1UZMA 2YDXA 1EDZA 1LQUA 2E37A 1E3WB 1R0SA 4QECA 4XB1A 3STHA 4CMIA 5A9RA 3DMTA 4D3SA 1TLTA 3BTOA 2W2KA 2AQKA 3KYCA 4FR5A 3Q2IA 4D3FA 2V65A 3OECA 1CERA 3MJVA 1ZNQO 4J49A 1HL3A 4CJXA 3BXXA 3ZW8A 1GZ3A 1HLDA 5G0WA 1F17A 3F1KA 4RVHA 3BMOB 2PY6A 4HADA 1VM6A 3PQEA 3DQPA 3COSA 3CUKA 5G4KA 3RJ9A 4FSHA 4R1TA 2Y0DA 1P44A 3O9ZA 4EEZA 1D3AA 4UUPA 1E3EA 3NX4A 5MGBA 1PX0A 1V8BA 5TS3A 1P74A 4IDAA 3TJRA 1E7RA 4L0QA 5BSFA 5JY6A 2O3RA 1U4SA 4TKMA 1ENOA 1LLQA 1MP0A 3DZGA 2HSDA 3DOOA 2FZEA 2GCGA 4K6FA 3WGQA 3WTBA 4PCVA 2RH8A 3HZZA 3ULKA 1QP8A 1HKUA 3GN2A 4IIUA 5LDGA 3WFJA 2VHZA 3ITKA 4PG6A 1LUAA 3OJLA 4AJOA 3I1JA 1NVTA 4CMEA 1J49A 3JQGB 2OBNA 1PJCA 3QQPA 1H2HA 2X5KO 1ONNA 3GQVA 1E92A 3WBFA 2I3GA 2DBVO 1V0JA 5BSHA 2GGSA 4N18A 3PHHA 4IXWA 3ZWPA 4I9UA 5JAMA 2HJRA 3GRPA 4CLOA 1VE9A 1PJ2A 3GDOA 1T24A 4D46A 1XIVA 1ZEJA 4L4RA 5AOVA 1OOEA 3GG9A 4MPDA 3NTQA 1C1XB 3HN7A 1ZK0A 3QWIA 1KOLA 5HM8A 4FOOA 1JVBA 1UAGA 4BV9A 2ILTA 1G0OA 1H9AA 1RJWA 1EZ4A 1V35A 2O4UX 4QX6A 4BO0A 1O95A 4LMPA 1E7QA 1X0XA 1SPXA 2VYVD 4HP8A 3CXRA 4IJWA 1R4NB 2GN9A 1UH5A 2QIOA 4QFCA 1BWSA 4YJHB 3OA0A 3RJ5A 3GNQA 3K30A 4DQVA 4GI2A 1RPNA 4L74A 3ZV4A 3FRJA 3H6KA 4PZDA 5B37A 2HMWA 2Q45A 3UCXA 3WWYA 5ENDA 2YY7A 1WZEA 4BO9A 2EJVA 1J6UA 1N9GB 2FP4A 3RUDA 1PJ4A 2X22A 4TRNA 3DZIA 1P45A 3RC1A 4C4OA 2VNSA 3RBXA 3RWBA 4GX1A 3UCEA 4A5OA 8ADHA 4FN4A 4B8WA 1U2GA 5A9TA 4W7HA 3H9UA 1Q2XA 2PZKA 3DOJA 4MIOA 1DBVO 3DB2A 4TROA 4YEDA 1R66A 3QE3A 3QJ5A 1HZZA 4URFA 1EUDA 1DAPA 1ONOA 4J3FA 3W4IA 1U8FO 2Q4BA 2ZCVA 5TX7A 3BMQA 3IUPA 4PG8A 4R68A 2QRJA 2DUWA 4XJTA 1DXYA 1IZ9A 1ARZA 3HWRA 5BT9A 4KDFA 5AXAA 1LJ8A 2FN7A 5I9LA 4QQRA 4GX0A 4YA6A 1AXGA 4TKLA 1A71A 1JAXA 5G4LA 2XOXA 4R1SA 1OBFO 1RKXA 1RM0A 4GX5A 5JDCA 2P9GA 1Q7GA 1XLTA 2Y1GA 4PG4A 1E3LA 3E82A 3AU8A 1JWAB 1Y7TA 2GRAA 3MJ4A 1YS4A 2Y1DA 3T4XA 5IZCC 5CDSA 1ISIA 2BFMA 4E5PA 3MJTA 3FNGA 4E3ZA 2H9IA 4R1NA 3LT4A 3DBHA 3NTOA 4ID9A 3NTRA 3GC6A 2NQTA 2OZPA 4RL6A 2JD2A 2B36A 2SCUA 5THKA 4Q3NA 2Y1CA 3AOEA 3DZKA 4AJIA 2D3TA 4QO8A 1XU7A 3L9WA 4II3A 1PQUA 1Q0HA 3ETEA 4XYLA 1O6ZA 4A2CA 1B8VA 4XR9A 4G5HA 1NX6A 3E6AA 3EAGA 4N54A 1GFSA 3OEWA 3WYCA 4PLVA 2VTEA 5I9MA 2V7PA 2FY8A 1A72A 4PLYA 4YQZA 1NQOA 4IS2A 4Q3EA 3WIEA 3FWNA 1HDZA 3OJ0A 3ZHZA 3HADA 3ZGYA 3NT4A 1DPGA 1YONA 4CM9D 4EJMA 5THQA 2GZ1A 4IS3A 1B3BA 2I9PA 4UUOA 4I5EA 4TVOA 3WBBA 2A92A 5EERA 2B4TO 1H6DA 4I5DA 3SC4A 2YDYA 4NR0A 1M75A 2ET6A 3TWOA 3G1UA 5C37A 2ZQZA 4PFJA 4Z0PA 2Q1SA 4FS3A 2V6MA 3QW2A 1OC2A 3LC7O 1M76A 5DBGA 1HWYA 1E5LA 5A9SA 2V6BA 3NT5A 3PGJA 2JFHA 1HTBA 1PJTA 2AQHA 2VTDA 2Y68A 4N5NA 3K8ZA 2I67A 1NHGA 3CH6A 2ZK7A 3A14A 4R51A 3V2GA 4D42A 4FDAA 3BA1A 4Q3AA 2Q49A 2Y66A 3EMKA 4JIGA 4E13A 4U0KA 4BB5A 3RUEA 1E1NA 4YPOA 1PL7A 2BRUA 3EHEA 4XGIA 4DGSA 3IC5A 2CMDA 3AJRA 3E48A 3N7UA 3GEGA 3PLRA 4BNHA 1EK6A 2O2YA 1X7HA 1KY5A 4YCAA 4Y6RA 4BO7A 3HG7A 3TZCA 4CL8A 3GDGA 3EUWA 3WQSB 4GWKA 4H15A 1L1FA 1Y8QA 1K5HA 1WLYA 2Y05A 1NVGA 3ICPA 4HKTA 1FK8A 3ZWBA 5L7YA 2YV2A 1Q1NA 1SOVA 2DLDA 4YXFA 3B6ZA 1M2WA 2DBQA 3D4OA 3IKTA 1JVSA 1RM4A 4NHEA 2HK9A 2W98A 3PXXA 4Q9NA 4EJ6A 2O7SA 3ICCA 2GUGA 2IXBA 3PJDA 4XR4A 3PTZA 4BGEA 1O5IA 1JA9A 4RORA 2H6EA 3CPSA 3CZMA 4RO0A 3L6EA 4CMGA 4PLFA 2CVQA 3KYBA 2AG5A 2AXQA 4O59O 4OOFA 4UVDA 4IGEA 3JQ6A 2YYYA 5JE8A 4Z3DA 5JS6A 5H81A 3RC7A 4J2HA 3FNHA 1IB6A 1P1JA 1RWBA 4BNZA 1F12A 2BGLA 3F6YA 4UVGA 2EKQA 2NVWA 4O63O 4WGGA 3BMCB 1DLIA 4TZTA 5IXYA 5EQFA 2Y1EA 2VUTA 3JQ7B 3INGA 4IPTA 3LF2A 4GAEA 3JQFC 3DEYX 1ID1A 2ZQYA 3RFXA 4MVJG 1B0AA 4Y9DA 1U3UA 1GQYA 2XXBA 1GUFA 4F45A 4HBGA 4E6PA 5GY7A 3GHYA 1ISFA 3BMNA 1D1SA 1QXSA 3GPDG 5F1OA 1AE1A 1JKJA 1KC1A 3RSHA 2IEDA 1FF9A 2W8ZA 2DFDA 2WM3A 4XWYA 5CPFA 3WLEA 3DMYA 4Z0HO 3ZCXA 3FPLA 2VT2A 3OQBA 3L4SO 3AUSA 1DC6A 4B79A 4RPGA 2DUUA 4NJOA 4YJDA 5IFLA 2Y1FA 3DDNA 4DRYA 4QEDA 3CKYA 2CSUA 3D1LA 1AN9A 2Q2QA 3RUHA 2ZB3A 1DC5A 1SBYA 1P33A 4J91A 3DTYA 2X9VA 5CEFA 1DIAA 2OORA 2PKRA 4TMFA 5IG2A 1I10A 2IZ0A 4PVCA 4Z9FA 4DUPA 2HK7A 4AJ1A 1U3WA 5C5IA 4RZIA 3WYEA 2R2GA 5U1PA 4NBVA 1HE5A 4XDYA 5BNIA 3TZ6A 1A7AA 1X13A 1JLLA 2JJYA 3EGOA 3M2PA 4CLRA 5KWEA 4NDNE 4OM8A 1NR1A 1UR5A 3DOCA 4JQCA 1D1TA 3E8XA 3GUYA 4YT4A 3QVSA 2RBEA 3PHIA 1E6EA 3VKVA 2PNFA 1VSVA 2ZB7A 1AHIA 4JBHA 4FIZA 2R00A 5JDIA 1YJ8A 3UF0A 2X86A 4HFJA 2C82A 4WCFA 1DRUA 4ALMA 4JK3A 3AW9A 4E0BA 1JAYA 4P8RA 4N5LA 4XDZA 2OP0A 3DAFA 4TQGA 5IDXA 4A26A 1YL5A 5TIIA 4ZQGA 4BVAA 4L9RA 5LCXA 4HV4A 3AK4A 1GEEA 2AEMA 1IPFA 4M8SA 2HMTA 2D59A 2EV9A 3JYOA 1YQGA 4WOKA 1V9LA 4MKZA 4GGOA 1EE2A 4UREA 2QG4A 2DVMA 3DHYA 5KVSA 2GD1O 2PGJA 3BYZA 2NU6A 3GRKA 1OI7A 2EJWA 4JJIA 3GN1A 4QXMA 1JN0A 4JCOA 1WXDA 4O6VA 3FBGA 1T2EA 1HEUA 3KYDA 4LW8A 1Y1PA 5T64A 4NJMA 2RHCA 4K9DA 4CQMA 2QYTA 3FR8A 4IIVA 4TSKA 1H6CA 3C8MA 2NADA 3ZWXA 5T8KC 4XQ9A 5G0TA 1FMCA 3VTZA 3I83A 9LDBA 1Q0LA 4AJKA 4IQGA 1HDOA 3I9JA 3W6UA 1VKOA 1T2DA 4DC1A 5A3JA 1ULUA 2HO5A 3SLKA 1NVMB 1YXMA 4BGIA 1O89A 2YV3A 4XEHA 5F21A 3UICA 3X2EA 1OAAA 3HFGA 1P1KA 1U5AA 3C1AA 4YT5A 1V6AA 4OHUA 2LDXA 1ZW1A 2NTNA 4I8XA 3F47A 1NPYA 5I7FA 4ZHSA 5JCJD 2X5OA 3BTVA 4NBUA 4CR7A 4E2WA 1PZGA 4P4LA 4UULA 3AFMA 3Q0EA 3JQAD 2J3HA 1TT7A 5IAAA 1ZMTA 4TRRA 4RVGA 4RVDA 2A94A 4P22A 4A0SA 4RLHA 4YB8A 1MA0A 4MOWA 2XF8A 1GV1A 4NI5A 1GUYA 5JPIA 2RHRA 2PGDA 3TN7A 2NU7A 3KO8A 1ZXBA 2CUKA 2W2LA 3O26A 5EPOA 2I65A 3NUGA 4EZBA 4J9VA 1R37A 4BQRA 3GZNA 1PWXA 3R3SA 1KBZA 4O1MA 1QR6A 1I30A 2I99A 1U1IA 2BFPA 1U3TA 2BFAA 3C7AA 2C0CA 3CE6A 3GT0A 1GD1O 1LQTA 3EY4A 2FPPA 3D5TA 5AQ1A 1H9BA 2HQ1A 4IJUA 2VHWA 1HSZA 3UN1A 1N1GA 4BQPA 1VLLA 3WB9A 4U8GA 1HRDA 1NWHA 3GGGA 3KETA 1BW9A 3VVCA 1WWKA 3MWDB 1HE3A 3GY0A 1ZUD1 1KEUA 1N9GA 3QWAA 5L7WA 3AOGA 2FZWA 5BQFA 2AW5A 3HFSA 1EK5A 3IMFA 4R3WA 1WMBA 3SX2A 2D5CA 1Z6ZA 3K73O 4WLUA 3D4PA 3PVZA 4OQYA 4E2YA 1WVGA 1UXIA 3EVNA 4YJFB 4N7RA 1I33A 1LX6A 1N92A 3KSDO 4Q3CA 1DDOA 3EZLA 1GQ2A 1NNUA 3AUTA 3DBLB 5KJFA 3ZNQA 4GKVA 4YBZA 3LDHA 3NV9A 5HA5A 1MB4A 3F5SA 4C7JA 1SC6A 3WGHA 5IN4A 4DIFA 5B4TA 1I36A 1LRKA 2VRCA 3O38A 4BGVA 1XEAA 3ZV6A 1H6AA 4AJ4A 3UHAA 2O3SA 1N1EA 2O3JA 4IINA 4F3YA 1Q7CA 4BNTA 2PK3A 2OBYA 3ZWMA 1QLJA 3AFNA 2FMUA 2WD7A 4D43A 3MCVA 4L4SA 1E7SA 3AI2A 3FWZA 4FFPA 5A04A 2D0IA 2Q1WA 3PWSA 5KVVA 2GN8A 4KQXA 3JCZA 4YACA 1T2FA 3VKUA 4AJPA 1MUUA 1VRWA 1K6XA 3PJFA 1XR3A 1M66A 3F5QA 1NXQA 2V6FA 3LQFA 3O8QA 3K2EA 5FYDA 2P5YA 4RF3A 3LK7A 2NM0A 4ALKA 3ORFA 3VPGA 1PQPA 3NDRA 4G81A 1GAEO 4W4TA 5ILOA 3BTUA 5L95A 4NK5A 4CMHA 1W0CA 2VYNA 3NT2A 4OOEA 1VSUA 1FDWA 4E4YA 1R4MA 3JQCA 4EUHA 4WEOA 3RAJA 1T2AA 2IYOA 4BO1A 1WMAA 2P4QA 3RBZA 5L7TA 5K6AC 2G0TA 4OYRA 4ALNA 2J3KA 4NFHA 4OQZA 2X8LA 4W9NA 1TEHA 5T57A 3VVBA 1PGQA 1SEPA 4IDEA 1PJBA 2I66A 3KV3O 3WGIA 1HDXA 1BRMA 2O3UA 5JO9A 3B20A 4BO8A 3IJRA 1ZZEA 1LNQA 2YV1A 4A10A 2X4GA 4FC6A 2DTEA 1I2BA 1CWUA 1UXJA 4OAQA 1BXGA 4BMNA 1UP6A 4RPJA 4U5QA 4W82A 4ILKA 3WGOA 3GK3A 1YBVA 1F06A 3NGXA 2D2IA 3JQ8A 1PGPA 3KXDA 3L77A 2B37A 4AJHA 2O48X 4Z3KA 2NSDA 3A28A 2G76A 5J23A 1A4UA 4JP3A 5HBRA 1YB5A 3OH8A 5JAQA 4ZRNA 3S2IA 3RQSA 3RUAA 1WDMA 2NWQA 4O5OA 1PJLA 1YJQA 3TSCA 4A03A 4H3VA 1DOHA 5DCWA 4YJGA 2B0JA 4NQZA 1K6IA 1A7KA 4XIYA 1AXEA 2I76A 4UVIA 4WASA 2RIRA 3JD3A 2HCTA 4P4NA 5TGDA 4EUEA 1PEDA 3D4NA 3EDMA 1EE9A 4A73A 2GO1A 1Y8RA 4J4TA 5FFFA 5IZ4A 1KVQA 1EUCA 2QYSA 1DFIA 4RPLA 1Y5RA 2EGHA 5LDHA 3DHNA 2UAGA 3L6DA 4DBVO 1QMGA 4IDDA 1Q0QA 3KSZO 3RFTA 4WCDA 3PPIA 5F5NA 2YHUA 1IHXA 3WMXA 4XJSA 1ISGA 3RIHA 3HDJA 3OICA 4UVEA 2NUAA 3DBRB 3ONDA 4PIVA 3LVFO 3ENNA 3BTSA 3JD1A 1I3NA 4J90A 5U9CA 1GY8A 4JGBA 1VKNA 4XYBA 2I3AA 4JXKA 5FWNA 2EP7A 3FPCA 2YFHA 3S55A 4F6LA 1U8XX 3WSWA 3H2SA 1PTJA 3W4JA 3BIOA 3ASUA 2ZYDA 5F1PA 5KJCA 2C59A 3K31A 5I7EA 5DF1A 2FR1A 4R5HA 4BKQA 1A5ZA 1B7GO 1F0YA 1P1HA 1EFKA 1KY4A 3DXFA 4E2ZA 3RUIA 5LC1A 5C7LO 4KUHA 1DIBA 1ENPA 4I5GA 5T5QA 3V1UA 2VUUA 5DDIP 2PKQO 1KVUA 1BGVA 2X7HA 4OL9A 4WLOA 4ALLA 1Y5MA 2BGKA 2PGLA 4NG5A 4DA9A 5TQVA 1WDLA 3W8DA 1LRLA 5K9ZA 2J3IA 3WMWA 4M49A 1TI7A 3JQBA 4E5YA 1DFHA 3AU9A 5DZSA 1MV8A 4R69A 3ZWAA 1MC5A 2E6UX 1D7OA 2H1SA 4ALIA 5JC1A 4LSWA 5JYEA 3DZFA 2OMEA 3ZZNA 3TPCA 2EKPA 1B26A 1X15A 3H5RA 1BHSA 5DN9A 1SCUA 1K2WA 3JQ7A 2AQ8A 5EIOA 3IKVA 5TT0A 1DC3A 2XAAA 1VJ1A 5EESA 5KJEA 4E5NA 4YT8A 5BR7A 1ZK3A 2VZ8A 3M6IA 4MVJF 4INAA 4PRLA 1S6YA 2WE7A 5DCYA 4BB6A 2DFVA 4FJ2A 4DXHA 1HZJA 1LSJA 2ZTVA 2P91A 3OBBA 4RF2A 2AG8A 4X54A 2Q1TA 2OP1A 3FBTA 4A7PA 1HYEA 3CSDA 5JSFA 4NBWA 3DL2A 5ILGA 2B69A 3KUXA 3TL2A 3VDQA 3PZBA 3WSVA 2AEJA 2UUPA 4GX2A 3LSYA 2ZTLA 3PEFA 1XG5A 3HDYA 3D3EA 3GOHA 4YAGA 4J1NA 3I9MA 1A9YA 1HYGA 3DFZA 4XZ3A 4TZKA 3R0IA 1F14A 4PLCA 2Q46A 7ADHA 4CM4A 2JD0A 3W8EA 2CF6A 3T4EA 5DNAA 3PGXA 4CUZA 3OETA 4E32A 1NAHA 1NFQA 3B70A 5HWSA 3ROKA 1HDCA 5K0ZA 1BTOA 4RF4A 1G1AA 1QORA 3G17A 4ND2A 2C7GA 4LCEA 3V1TC 1CRWG 4LCJA 3UOGA 3PJGA 4J9UE 4LISA 1PWZA 2ZJ1A 4EEXA 4F6CA 1EVJA 3DAGA 2I6TA 1LLCA 4UEOA 3I3OA 2OUIA 3HN2A 2PZLA 5G0SA 5TJ9A 1MGOA 5C7IO 4Y98A 2NVUA 2A9FA 5DOZA 3ZWYA 4NBRA 4J1TA 4PG7A 3IDSA 4B7UA 1ADFA 1UXGA 4IQ0A 4KTTE 1GYPA 1ZBQA 5HRUA 1YDEA 2YHIB 1J4AA 1DC4A 3VTFA 3DR3A 3I5MA 3PHJA 2A4KA 4D0SA 4GPD1 1DHRA 3ZW9A 4FW8A 1GPJA 3JQDA 1LDMA 2EW2A 3QVOA 5ENVA 1C0IA 4G2NA 2Q2VA 5ER9A 2QW8A 2OFPA 2WYVA 4ZQBA 4CUKA 3OJEA 1XA0A 3FD8A 1O94A 3U5TA 2PFGA 1DO8A 1PGOA 4CV0A 1X7GA 4J4HA 1M6HA 4B4VA 5ITVA 1BVUA 3JYPA 3I9OA 3VH4A 4PLZA 5IF3A 1VJTA 2X0RA 4FGSA 3M2TA 3WOHA 1NPDA 5B4UA 3SXPA 3GVPA 1NYTA 1YQDA 5T6BA 3ZNNA 4BNVA 4HUJA 1TT5B 1Z45A 4IJVA 5CPBA 3LC1O 2DM6A 1EFLA 1JW9B 2DPGA 3AM3A 3WICA 4BO5A 3KRTA 2GSDA 1UXKA 1W6UA 4I1IA 3NEPX 3PQFA 1NFFA 3ZWWA 5COBA 4CMIB 1KEVA 2D5AA 2FRDA 3B1JA 4YRAA 2W2KB 1CJCA 4FJ1A 1LSSA 1N8KA 3KYCB 4RVSA 1EVZA 3JD4A 5L53A 1ZK1A 4WK6A 4WECA 3ENKA 3LLSA 4CM5A 1I3KA 1SOWA 4YAKA 3DAPA 1MC4A 1FJHA 4HY3A 1GTMA 4K6CA 3DZJA 3PWKA 3UH1A 1Z74A 3OA2A 4PGFA 3PI7A 2ZTMA 4BNLA 1HT0A 4PG5A 3LT0A 4WLEA 4OXYA 1PZHA 2CNBA 5G4KB 2OHXA 3ZHXA 1VJ0A 4XA8A 2C20A 1QRRA 3MJEA 2C54A 2OOSA 6ADHA 2FR0A 4DIBA 3GDFA 1LA2A 4U6QA 4CV3A 3OHSX 4R9RA 1B16A 3G79A 3QV1A 5IZCA 1QV6A 3DFUA 1P77A 3ZNPA 3RROA 1FDVA 2BELA 2HMVA 4JJGA 4HFRA 3SEFA 2JFGA 1XGKA 2Z1NA 2GDZA 3RASA 3L0DA 2VHXA 2WYWA 2JCVA 2PD4A 1E7YA 1HE2A 2Q4EA 1NHWA 3GAZA 4U7WA 3JYQA 1X1EA 3VC7A 4CQLA 3P2YA 2EG9A 3KHUA 3TOXA 4AJ2A 5JLAA 1NR7A 3SJ7A 1C0KA 4RF5A 3ZV5A 4OXKA 1SZJG 2BGMA 1CF2O 4UAGA 4CLOB 1HYHA 5C3MA 1LDGA 4DLAA 2VNAA 4J0EA 1PSDA 4HWKA 1U9JA 2EHDA 4J6FA 4PRKA 1XKQA 4I9HA 3OP4A 4MINA 1NASA 1U28A 3E18A 1N5DA 4R4JA 1K3TA 3C7DB 3WGGA 3DZHA 1GEGA 3VPSA 1QLHA 2BH9A 2Y99A 4WPGA 1IZ0A 1P1IA 3T7CA 3KB6A 4L4XA 4MP6A 3H7AA 3FI9A 3ZV3A 3U4IA 4FC7A 4BNFA 4ND1A 1CQJA 3RU7A 4M54A 1SO8A 3GGPA 2X6TA 4DPMA 3G3EA 3TF5A 3E9QA 1E7MA 4YAJA 4DYVA 2W90A 4RVUA 4KWIA 4GVLA 4DIOA 2F00A 2YFQA 4NPCA 2P4HX 3H5AA 1I2ZA 1P0CA 2EW8A 5L9AA 4IMRA 1JKFA 1VPDA 4MVJI 4XD2A 4CPDA 4YVFA 3G0OA 1CQIA 4MJLA 4IM7A 3TFQA 1MXFA 2VHYA 1YWGO 2Y67A 1U7TA 1X7DA 4KP7A 2FOIA 5DP2A 5EQDA 5JCXA 5AVOA 3FNEA 3V1YA 4LMRA 5KVQA 2VOEA 4DQXA 3QWFA 4YAEA 1F8FA 3I4FA 1E5QA 3BMQB 3BHIA 5KNLA 1X0VA 3PFWO 4J1QA 3GLQA 3LT2A 4CM1A 2H63A 2VUSA 2G82A 1FDSA 2CD9A 1C1DA 1WDKA 1HDYA 3JSAA 1JKIA 3SLGA 4AL4A 1IULA 1KEPA 2VWPA 5AXCA 2HRBA 4OKIA 2GR9A 4ND4A 1VL8A 2Q2WA 4BNXA 4CLEA 3F46A 1ENYA 3TZHA 4D7AA 4EI2A 1GCOA 4II2A 5TRTA 3INRA 1B3RA 5COAA 3ANNA 3U3XA 1AHHA 3NJ4A 3V2UA 5JBIA 1GL3A 3GEMA 3GG2A 3OJOA 3ABIA 3D7LA 3KOUA 4CODB 3PDUA 5T67A 2J8ZA 3ZU2A 2C7VA 2I5PO 3GH3A 4YT2A 1ZKMA 5IDYA 4BNKA 3BZUA 2GASA 1E3WA 1ZK4A 3DBHB 3KEQA 1LDNA 3QY9A 4JN6B 3QVXA 1EQ2A 3EVTA 2UUOA 1Y6JA 3Q2KA 4MKXA 3HDQA 4UUNA 2GERA 2W4QA 2X5JO 4WUVA 5C7OO 3L9XA 4WEQA 3ZU4A 1NAIA 2J5QA 3AUUA 5TT1A 4KWHA 1ZEMA 2BFOA 4P38A 2Y93A 4CR6A 2FPGA 2CDAA 4J2OA 4CQMD 4B4WA 2GYYA 2JAPA 4Q39A 3BMOA 4D41A 3JQFA 3A06A 1DB3A 3H9JA 1PGJA 3M1LA 5CAEA 4YYZA 5COQA 3C1TA 3HUDA 3GVHA 4OO3A 2HUNA 5G2OA 4BGUA 2TMGA 1GYRA 1E7WA 4FFOA 3WJAA 1XYGA 2X23A 2D8AA 1MFPA 3WGYA 3RKRA 4LRTB 2E4AA 4B3HA 1NM5A 3ONEA 1I32A 1I3LA 2JHGA 4IDFA 4D3DA 2AMFA 2C2YA 4DVJA 5CEJA 4FFNA 5DBIA 3E5RA 3JD2A 3TRIA 4XQGA 3ZNOA 4MVJM 2YW9A 2J6IA 5KVCA 4K28A 4FD3A 1T1RA 4ONEA 4K26A 3JQGA 4M55A 4M89A 5AXDA 3GFGA 4B8ZA 3SBOA 3I9KA 3KLPX 4ZD6A 1P1RA 4Z6KA 4HFNA 5TJHA 1NQAO 5A9SB 5MDHA 4MIEA 4NBTA 4XB2A 2DBRA 1T26A 5IDQA 3MTGA 3ZU3A 3LYLA 3QHAA 4A27A 3PJEA 1BXKA 1PQWA 5AXBA 3LLVA 3S8MA 5CDYA 1ORRA 1QSGA 3S2GA 3E1KA 1TXGA 3GMSA 2W2LD 3Q9UA 1XWFA 1YGYA 1SEVA 1C1XA 4BO6A 4EITA 4NIMA 1SB8A 1UDAA 4BKRA 3JQ9C 4ZA2A 1J5PA 2WJPA 4UEJA 5DULA 4YRDA 5GZ6A 2O7QA 4TVBA 4W6ZA 1NP3A 4R9SA 1GDHA 1O0SA 4Y8VA 3F3SA 3PIIA 3WXBA 2IEBA 1I24A 3IP3A 5FF9A 1DJNA 1P0FA 4PLPA 3ST7A 1R4NA 4YJHA 3ETGA 1YB1A 3GR6A 4XGNA 1GUZA 3VPXA 1Y8QB 3RBVA 4DL9A 3EYWA 5A1TA 2DAPA 4KTVE 4BNUA 1DHTA 3K5PA 1EBFA 5JMWA 1R0LA 3WYBA 1X1TA 3O4RA 4NK4A 2B4RO 1LDYA 2PD3A 1PU2A 2AE1A 2R6JA 1HDRA 3L4BC 3S1LA 4XIJA 5HTOA 2DU8A 3DZBA 4TWRA 5B4VA 2GN4A 1KEWA 3Q6IA 3OQ1A 4GMGA 1B14A 4JBIA 5L40A 2BI7A 2P9EA 5JYDA 1EQUA 3GVXA 4KQWA 4WKGA 4BNNA 2HMSA 4MVJA 1P1FA 3DMTC 3M1AA 1M67A 1Y9EA 3WQRA 1Y9AA 4Q3DA 4MP3A 3RUFA 3X2FA 4GWGA 2VRCD 4ZU3A 2CY0A 3VOSA 3VZQA 3FR7A 3IP1A 3C1OA 1WNTA 3GFBA 1T4BA 4IUYA 3ETDA 3VAZA 1GADO 3PK0A 1PR9A 2G17A 5T8KA 4BKPA 5JY1A 4W7IA 1BDMA 3LZ6A 2C2XA 1OMOA 1ZSYA 1JQBA 4Q3BA 4DWVA 5CDTA 3ZWOA 1YBAA 3GZ4A 3VPFA 1XDWA 4EW6A 1LSOA 1C3VA 3ZWVA 3LU1A 3PYLA 1DIRA 2Q1UA 1YE3A 3NAQA 4PN3A 1YQXA 3U4HA 1O9BA 4Y6SA 3F4BA 2CDBA 5L3ZA 3EK2A 2QHXA 1BDBA 2JCYA 1B8UA 3DWFA 5B12A 2X0NA 2BKAA 1U2DA 2IZ1A 2P5UA 2EKLA 1EUZA 1UXHA 3AY6A 1SMKA 2VYND 3OQ6A 4ZJUA 1OFGA 1YH3A 3KTDA 2NNLD 4CMEC 3WGTA 1V3UA 5JAZA 1XCBA 5F1KA 4ZICA 2NVBA 4ALJA 3A9WA 4M1QA 3JYLA 4CLDA 1VI2A 1RM3A 4J7XA 3EW7A 1E6WA 3HHPA 3CMCO 3MJCA 1GU7A 4LVCA 1JWBB 6LDHA 3LT1A 1U3VA 3H9QA 5CP8A 4BOYA 1KVTA 1YVEI 4FGWA 4FB5A 4CLRB 1C0LA 3RC2A 3N58A 4EYEA 3ZU5A 3JV7A 1H94A 5JFOA 1DEHA 2Q99A 5EINA 2FSVA 3TDKA 1E3JA 2B5VA 4DYDA 2IZZA 4JNKA 2DC1A 3WS7A 3H2ZA 1PR3A 2BI8A 3GPIA 1B2LA 4XCVA 3QLJA 4WCFB 1DAOA 3QP9A 1EEHA 3D3WB 4PZEA 1YDWA 3WGZA 5IDWA 1O8CA 4KZPA 4RDHA 4HNHA 2PD6A 1H2BA 3Q1LA 3U4CA 2JD1A 2ZTUA 4GLLA 1QYWA 2X58A 3VHRA 4XQCA 1MLDA 4E5KA 5GZ3A 2GPTA 2JCXA 3HQ4O 3LC2O 4QUKA 3H65A 4W99A 4BIIA 3I6IA 2FHSA 4YAIA 1ZH8A 2FSSA 3PFFA 3QWBA 4IGFA 5EJ2A 4HFMA 4XGKA 5ITWA 1T2CA 1ZFNA 4QTZA 4AVYA 5ER6A 2PWZA 4IMPA 1YKFA 3P19A 4FFRA 2IYPA 4NNJA 1PJSA 4RPHA 5F3RA 4BS9A 3KZVA 4WOJA 3ZWCA 4WLFA 1LTHR 4XRRA 2C5EA 2DKNA 1NPTO 4D45A 3GEDA 3OFSA 2VRBA 3DO5A 3FTPA 3KYDB 3R3JA 4BO4A 1Z75A 4CV2A 4E5MA 4EJ0A 3VZRA 3HE3A 1W73A 4NJMB 1JTVA 5FI3A 4CQMB 4AICA 1V3VA 3GNSA 1MG5A 2TMDA 4RPKA 5BNFA 4DMLA 1A9ZA 1Z82A 3E9MA 3F4LA 2EGGA 4L76A 4MVJE 3MWEB 3ROMA 3E9NA 4YTEA 2DTXA 3H9EO 4RVFA 4PZCA 1K0UA 4TRJA 2AE2A 3SC6A 4E30A 1PZEA 1WZIA 4IQ8A 4EDFA 1Q7BA 1D8AA 1PS8A 4BNGA 2VT3A 1I0ZA 2YQ4A 3WFIA 3ANLA 5JDCC 1CDOA 1BSVA 2CZCA 2PA3A 5GZ1A 2PLAA 1KETA 2WEKA 4CL3A 3QRWA 3QVWA 3MOGA 4RGBA 4RDIA 5DOVA 4R16A 4CM8B 1UZLA 2WMDA 4YWJA 5CFZA 2O3QA 3NJ8A 5KJ1A 4ND5A 3RD5A 5I8WA 2H5LA 2DBZA 5KTKA 4J43A 4AFNA 2ZCUA 4IY1A 4P4GA 1U5CA 3GF4A 2PTGA 1ZVMA 5K6AA 1SAYA 2QX7A 2VZ9A 3Q3CA 1E3SA 1YOVB 8LDHA 3H8VA 1ZJZA 3JQAB 4QSMA 3ZH2A 4CMAA 4RQUA 3Q11A 2HJSA 1LSUA 3AOEC 1HXHA 4Y67A 4DC0A 3UGKA 3BMCA 1KC3A 4NH4A 1ZSNA 2IE0A 1LC0A 2IRWA 4MO2A 3GZNB 1DRVA 3FTNA 5A05A 3UUWA 1ZO8A 4B3IA 4F46A 4GSKA 4LRSB 3TNLA 3SVTA 1UDCA 3K6JA 3WLFA 5A06A 5KIAA 2VYVA 1IY8A 3GA0A 3OIFA 1HETA 2F1KA 3G1TA 3NDIA 1BW9B 4CR8A 1FXSA 2J5KA 3KM0A 4XYGA 2Z1MA 3HDHA 4ZN6A 1Z7BA 4DMMA 3IAHA 3ROPA 5I9NA 1ZK2A 2P68A 4OMUA 1NWCA 3OIGA 3R1IA 5CDUA 1UJMA 4CMBA 5CHEA 3FN4A 4L75A 2O23A 2RCYA 3I9LA 2GZ2A 2QRKA 7MDHA 1UDBA 2YUTA 3WDSA 1TB4A 2IXAA 4ROSA 1IOLA 4EUFA 2EIHA 2UYYA 5EMHA 3DBVO 5L51A 1N2SA 4NZ9A 3WJ7A 2O50A 4CMKA 1RM5A 3FNFA 2NTJA 3O03A 3ZDFA 4C7KA 2Q3EA 2WSBA 4MDHA 1ULSA 4YDRA 3ADPA 5H83A 5EL0A 2LDBA 4BO3A 1ZMOA 2WD7B 4GH5A 3PZRA 3QA9A 2OGUA 4D79A 2JHFA 4FBGA 4B7XA 5A5EA 4UUMA 4BV8A 4KMSA 5A4DA 1LLDA 3HB4X 4U0JA 3UXYA 4RQTA 1GQQA 1RYDA 1YB4A 3AY3A 1T25A 3KBOA 1ML3A 4NFYA 4BO2A 2X0IA 3BHJA 3O8QB 1NTOA 4R41A 2AQIA 2VZ0A 2HRZA 4J16A 4B3JA 5BNTA 1W4ZA 1YBMA 2HU2A 5G0VA 1ISJA 3JD0A 2XPCA 1LU9A 5I8ZA 5CG1A 2DTDA 1HSOA 3GHHA 4OXNA 4M87A 4XYMA 5G0UA 2ZJ0A 4ZGWA 3NDJA 2NQ8A 4CLHA 5EN4A 3UAGA 4UEKA 1R4MB 2POQX 1NQTA 1Y81A 4FQ8A 5F5LA 5DCUA 5GMOA 4NU6A 1K89A 3IS3A 1KYQA 3UFXA 2UVDA 3WWZA 3IL2A 2VQ3A 1I3MA 5A02A 3ANMA 1OC4A 2ZKLA 4MKRA 3H4VA 4FCCA 3OSUA 3T7EA 2WWRA 3AY7A 3RUCA 3MTJA 3TL3A 3ZWNA 4K1LA 1BXGB 4QT0A 1SB9A 1ISHA 3FF4A 4MVJH 2NU8A 2AEFA 2WE8A 3JQ8B 3I23A 3OJFA 3RVDA 2HKIA 1X14A 1WAMA 5FEUA 3W1VA 1VC2A 4R3NA 4CM9A 2WDZA 4JBGA 3FCOA 1R12A 5L4SA 2VWHA 1BMDA 4UVHA 1DLJA 2X1HA 2ZB4A 4PVDA 4WNCA 1LBEA 1QV7A 4IDCA 1E6UA 4XQEA 3IIEA 3AI1A 3I4CA 1ZXLA 1C14A 2PZMA 3Q9NA 5TLSA 4YJGB 2B4QA 4NMHA 4S3MA 3RI3A 1EMDA 4XYEA 5A03A 2CVOA 3IQDB 4ND3A 4FJ0A 3G49A 1OZAA 1Y8RB 1JDJA 3TOZA 2YQ5A 3PDJA 3MJSA 1L7DA 1N7GA 1UZNA 4DLLA 2UDPA 1MXHA 4HXYA 4RV9A 4XRGA 1YL7A 3MEQA 2B83A 3K92A 4GSLA 1B8PA 5ES3A 1CYDA 1YRLA 3GUCA 3H9GA 4CM6A 1KVRA 1B15A 4LSMA 3MZ0A 4AJNA 4IZIA 4DBZA 3U09A 1WP4A 5JW6A 3I6QA 1LRJA 1G6KA 4JJFA 2EEZA 3F1LA 1R16A 4J1SA 4B4OA 5HS4A 3AM4A 4LK3A 2EERA 1LDBA 1EVIA 5KKCA 2HMUA 4OIMA 3HSKA 4RJTA 2EXXA 1T4DA 2C29D 4ZQFA 4E31A 5JMPA 2R00C 1DIGA 4GBJA 5JDIC 4M86A 2C07A 4WCFC 1LDEA 1MX3A 2NTVA 2A35A 1YL6A 3L6OO 3VH2A 5B1YA 3SJUA 5CDGA 4OSPA 1KVSA 1NBOA 3UKOA 3DONA 2RAFA 5L45A 2QRLA 1QYCA 5U4QA 3KLMX 4YJFA 1KIFA 5TC4A 1XSEA 4IDBA 1BG6A 1H5QA 1R0KA 2CDCA 5TF4A 4RLSA 2Q50A 4JP2A 3RFVA 1ENZA 3CIFA 3MOIA 5CEEA 1IPEA 3DBLA 1PS0A 1ZJYA 3GNTA 1PS9A 1TA4A 2VHVA 1E1MA 4R54A 4WNIA 3W6ZA 5KKAA 2QZZA 3TQHA 2VWQA 4WE3A 1I01A 2ZIZA 3OMLA 4ZVVA 5DT9A 3U0BA 4XX0A 4J7UA 1CIVA 1ADGA 2OO5A 1WW8A 2OXIA 3I9NA 4BNIA 3U9LA 3C85A 3GVCA 1DFGA 3RC9A
chains in the Genus database with same CATH superfamily
3AESB 3TX2A 4JLDA 2NZ2A 3I52A 2NYAA 4WKOA 1YO6A 2I2AA 3L1JA 4OHFA 1ZSVA 2QYOA 3CN7A 4MITA 3T4PA 3WK4A 4BUCA 1KGSA 3JAMA 3KD3A 1V5FA 2H52A 3Q8WA 1OX4B 3IVRA 4HGYA 4EX6A 1I9GA 4K9SA 3U4AA 4AP6A 4BL5A 4KITB 3A1NA 3THYB 4TM8A 2NXNA 3T5DA 3AIMA 5DISB 3UJCA 3VZBA 1DDGA 2CLMB 4MCHA 4CM3A 2OWDA 1S7CA 4AJJA 3H4IA 3TQRA 5DSZA 1UT8A 2MSCB 3SK0A 4EO9A 2QTCA 1QE0A 1U8ZA 4H1UA 1SGWA 2QD3A 2XITA 5AKKA 3R6GA 4ZT6A 2AUNA 4GVXA 2PQMA 1Q6ZA 3ITDA 4PW0A 5CT9A 3SOPA 3R0QA 3V8BA 1DJQA 4WXMA 3WWDA 4V38A 4BNJA 4J4BA 2OCGA 3RRBA 2B98A 4HS9A 1U7HA 2DQ4A 1P61B 2VOJA 5JO0A 4O25A 5AK4A 3NTXA 2RH4A 5EQJB 5JR3A 2DT5A 3JXEA 4TVKA 4X7MA 4ASUA 1TYDE 1K8RA 4DQLA 4RHFA 1P75A 4ABYA 4QYXA 2XNKA 2O2JA 5IVPA 5C18A 2M32A 3DW1X 5IXSA 3LCMA 4BLUA 4BX0A 2J30A 2XAUA 3A4LA 4TS9A 1E4EB 5FOSA 3QIVA 4HXFB 4RVCA 3O83A 3ZN2A 3GAFA 3C1UA 3LFTA 3LOPA 4X24A 2IYEA 4M37A 1EWTA 1RS0A 2B5WA 2IUEA 3EGDA 2WDPA 4J0GA 1XTVA 4LXXA 1RXVA 3UW3A 2PX4A 2VQ6A 1E1KA 2PVPA 1GUDA 4PZAA 2CJFA 3WLMA 2BE7A 3ZVMA 1JDSA 4Q00A 2P9CA 2N42A 4YPVA 4QQFA 3OZXA 2YRWA 1ONPA 1Z7EA 3UVEA 3S2SA 4Q4JB 3PVSA 4MGEA 2DCMA 5AUQA 2RKOA 1MFZA 1P3DA 2BTOA 2C5AA 3R0JA 5HUJA 4C4ZA 4E12A 5JI2E 3ESRA 1T8PA 5LFAA 3LBYA 4WESA 5LD2B 2WV9A 1M2HA 4Q66C 4KRYA 2OQVA 3L1UA 4E2XA 1XQ1A 2RBKA 4EOGA 3QE2A 1D5CA 2PSJA 2A0UA 2VAWA 3TTSA 4ZRMA 1DRWA 3C3XA 4UU8A 3QELB 4PFSA 3N2YA 3GVIA 1WSBA 4IX1A 2JK0A 1HURA 1ZW6A 4AWAA 3TAXA 2YYZA 1OA0A 2PWBA 3H87A 4KDEA 4F96A 3LX5A 1FZQA 9LDTA 1TTHA 3MIIA 1KYYA 2FUCA 2AA3A 3C7CB 3VTKA 1TKAA 3WR5A 1I4DD 1L6IA 3PHGA 1AO0A 2ZIFA 4M9SA 3EZ7A 4AY2A 2OHFA 1NBMA 2DPYA 1TVMA 4EO7A 1P7WA 1FDTA 1X70A 5AJHA 2RE8A 3L2OB 3IULA 3SZLA 3MD9A 3ECAA 2VAXA 4L22A 1DBRA 2WUVA 4FYKA 3WIUA 1IVSA 1GV0A 1GKUB 2WA1A 3GGOA 3AWDA 3PC2A 4QFDA 1L5KA 5HZMA 3J81k 1K3UB 4HN9A 2B8NA 1ADJA 2M1XA 2GXSA 4MQFA 3UYLA 5A4IS 2CL5A 5C52B 4H2DA 1OH7A 3IMCA 4JQSA 4DUGA 3NKLA 4CVNA 4DQUA 4QYIA 1YJ5A 4PX2A 1QKIA 3W8FA 3ROZA 2IX3A 2GI4A 3H1BA 1K3FA 2PX2A 3OWOA 5K8JB 4H27A 4OH1A 3GYGA 5FBRB 4WA8A 3IAM6 4P9NA 4D9GA 5H1YA 1SUEA 2JIOA 2Y1OA 2JVIA 1PJ3A 5KC9A 1V26A 3EZYA 5DLEA 1VHTA 1VFPA 1HL7A 5JWHA 1PZMA 4KACA 3GJXC 1ZBDA 4R9NA 3WG9A 4QBTA 1K5PA 3ABRB 3QEOA 4D3YA 4E07A 5HIKA 2WWWA 4HB4A 3QQ5A 2JAHA 1KMMA 1YOVA 3GT4A 3WKBA 4NS1A 2VPQA 3JQAA 2WV7A 2QORA 1PGNA 1EH5A 2HRQA 2IEAA 3K2QA 5F3WB 2VAMA 2UV8A 2GAFA 4E4RA 3PRJA 2H4ZA 4LV6A 1BO6A 4TTAA 4B3DA 5ELXA 1L4LA 2F59A 4CBVA 1G98A 1UBFA 3CURA 3H13A 3LKZA 4GYKA 4W5JA 3EG9B 4IJ6A 1QGDA 2AVNA 2JKVA 3GPBA 4EHKA 2QQ5A 4GR4A 4OGWA 4GKBA 2ZATA 1RC8A 1T1JA 2EZ9A 1WHSB 2I8LA 4JLAA 1VL0A 2OWEA 4X3PA 1AGNA 1GYQA 2H4FA 1A95A 5D1HA 3UQZA 5AQEA 2AZXA 1U3DA 1TQ6A 2I1WA 2FW0A 3C24A 1LH0A 1Z73A 1IB0A 3SICE 2B1GA 3ND6A 2KM1A 2G09A 1V48A 2RH5A 2AW3A 4QPNA 2JL1A 2Y0EA 1C7QA 2QTGA 5K7SA 3C43A 1VLVA 2HYDA 1T4CA 5JMOA 5K03A 2AX4A 4KGVA 4QYSA 4XARA 3R7BA 2PH5A 1WB4A 3EXFB 2VDWA 3DFKA 4G1VA 5JXGA 3AERB 5H8WA 2O20A 2PT6A 4E88A 4EBFA 2GVDC 1V7ZA 3DHEA 3R7AA 2XHEA 3R6DA 3TZQA 1DKOA 4WY8A 3TUZC 2G1JA 4AC9A 2A57A 1W4BA 3ZCRA 2H4HA 4BN4A 4A9AA 4BWYA 5FO0A 4EZIA 4C9BA 4GRAA 3K35A 3MBKA 2R7KA 1YS7A 3I5XA 1DJLA 1NQXA 2GAJA 1D4FA 2DPHA 3IEIA 1A97A 2AOXA 2X1MA 1J5EB 3PJRA 1QHGA 4A23A 3TVTA 1L3BA 1R15A 1TK3A 2A59A 1PNTA 3NRCA 3UWOA 1D2RA 3KSMA 5IVHA 2AUTA 2BLLA 1GCUA 3A1WA 3BMNB 3CEAA 4H1VA 4OHKA 2DHEA 4PZ9A 2GF2A 2HBYA 4CMCA 1Y1LA 3U0VA 4LWQA 3KJEA 5DM60 5JFTA 4NCBA 1XHLA 1OB2A 4MSUA 2BE9A 5FT9A 4KQKA 3TQOA 4L8VA 4GC9A 5AVKA 4A92A 5LQMA 1ISRA 3RCBA 2GAIA 1NV9A 2HMYB 1CY8A 2YJ4A 3DXXA 2G4VA 2F43A 4IOJA 4H59A 5TB5A 3U49A 2CDRA 5EIXA 4I9FA 4TQUS 1JEOA 4P32A 1NFRA 4BKOA 2JJ2D 3K0AA 1AA9A 3AVTA 4GOOD 1E66A 4NZZA 4L78A 3SZ3A 2OKGA 4EKYA 3IESA 1MG0A 3O8NA 1SUWA 1E2KA 5H5JA 5SICE 2DPMA 4FEYA 2WU1A 1PW7A 5JQGB 1XF9A 4BP1A 3T3OA 1EDEA 1NQ5A 1F3LA 3U7QA 1PTJC 1DP4A 5AFSA 2KLBA 3B9BA 3I45A 1KHHA 3HJAA 3K2BA 3QFRA 5A4AA 4W5NA 4X9XA 4EELA 1JR3A 3Q6MA 1IBCA 4O0LA 2ZBGA 1I7LA 1OPRA 2FPKA 2VCYA 2BTQA 4RCVA 1A9QA 4JYAB 4R2JA 2NSJA 4RXMA 3G2LA 4QDJA 1GPDG 2GZSA 5DV9A 2CYCA 4DPKA 1ABBA 2YJZA 3PDCA 1NMZA 2OVFA 2QN8A 1NUPA 5HW0A 2VPTA 3CGGA 5KNCH 3IJPA 4KUGA 3W5JA 1A9PA 1BWPA 3A6JA 2PO5A 5CG2A 2LUOA 4AAYA 2VNKA 4FFSA 2XOKD 4R1UA 1RYMA 2JBAA 1QG4A 2HJGA 4LVUA 2A58A 4J0FA 2BFCB 3VFDA 4YR9A 3ROQA 2ZSAA 2V74B 2WFMA 2WD8A 4RGVA 5B53A 5KI6A 4YUWA 4JEHA 4BFTA 1CBUA 4HWSA 1AHPA 1XZQA 1COWA 1QYXA 3ZCPA 1GFZA 2ICAA 4C6TA 4G97A 2WTBA 4BXOA 2X5XA 3F9IA 4UM7A 1I2CA 1P9LA 2P2SA 1ANKA 3QMWA 3R9IA 2V03A 2Z5LA 3KFXA 3G6WA 3WE7A 1GNSA 2I4IA 4H7PA 1SKAA 3FDZA 1HDGO 3ASVA 1WLSA 4LZNA 2XR1A 4NE7A 5DIFA 4CM7A 5LWHA 1NLUA 1EDZA 1LQUA 3E9DA 4M7PA 2SKDA 1CUVA 1R0SA 3A25A 3KTAB 1WOYA 3O92A 2GEUA 4QECA 3STHA 3UTCA 2BSXA 2ZYHA 3THSA 4D3SA 4G0MA 4P82A 4C5BA 2W2KA 3B36A 4QGBA 1IXSB 3BXZA 2RB4A 2NTEA 3Q2IA 2C7PA 4D3FA 2HPVA 2V65A 4L50A 4LIPD 3V8VA 3EZFA 4S2EA 1NR5A 1CERA 5ED4A 3U7EB 3UUGA 2PSEA 1ZNQO 1XNHA 3GGSA 1XZBA 3ZW8A 5INTA 1JILA 2FG6C 1HLDA 5G0WA 3G7UA 3OLVA 1YS6A 3D6UA 4MS1B 4R2KA 4JX9A 2BFDA 2FFQA 3PQEA 5EVCA 2VSOA 3PGMA 2R1VB 3G2PA 4JKYA 4MNTA 4TT3D 5G4KA 5CAEB 5LBIA 5FLEX 1VKRA 1CUHA 1T6BY 4GOMD 2WM8A 3L79A 3T5BA 4R2IA 4HWPA 5IULC 2W6IA 4Y2TA 1R6TA 1P74A 2V7QD 4F2HA 2WAAA 4EGSA 4B6SA 1MABA 1QP7A 1ENOA 2ZGVA 4K6FA 1K75A 2FZEA 3WGQA 4G25A 2RH8A 4MS3A 1MAVA 5K8UA 2AEEA 3S28A 1P9NA 2PKWA 1QP8A 3BH7A 4IIUA 4J0DA 3SEQA 1C4OA 2FK7A 4Q47A 3HACA 4HD8A 1NDHA 3M6LA 4TSRA 4PG6A 3G7NA 3HNRA 1E3QA 1NVTA 4V1CI 3VI3B 1M1UA 2WFLA 3JQGB 1MORA 1H2HA 3OTGA 1ODFA 2VT7A 3ED1A 5CBPB 3MRSA 3U7HB 1ONNA 2FGKA 2VXOA 3GQVA 4RQBA 2PQ2A 2YL2A 3EH1A 1V0JA 3KKNA 1I2MA 3LUFA 3ZWPA 3F74A 1VIMA 2OV6A 5A6SA 2A5LA 1VE9A 5HHTA 2GK6A 3AHJA 1T24A 1ZN7A 5BRAA 2A2ZA 4QBHA 4JB8A 1ZEJA 2FRXA 2ORIA 3DYIA 4GXQA 4L4RA 1TQ8A 3T3MB 4XWTA 4I3HA 4MPDA 5C8YF 3NTQA 4ARUA 3FCSB 3X1WA 1Z4MA 1ULZA 3BAFA 3R7WA 5KAPA 4NABA 1H2XA 3A9UA 3JVVA 1LFAA 1B6RA 1G0OA 3RSLA 3T1NA 5BWMA 4BRSA 1SELA 1EZ4A 4AN0A 4B83A 3UAWA 1PJ8A 2O4UX 4H17A 2QVXX 4QX6A 4YCJA 3EXIB 1FXWF 5EIBD 1ZOSA 2CJPA 3OZWA 4EY5A 5HQ3A 1Y98A 2H85A 5BSKA 1FFDA 5FNZA 2QIOA 3B1VA 3PVCA 4QFCA 5AO9A 3A1VA 1N25A 1QG2A 2IL1A 2QDKA 3GNQA 4C0SA 8ABPA 4OX9B 4YRQA 2VI5A 5EGSA 4JI8B 1N0VC 3FRJA 2J67A 3H6KA 4PZDA 2HMWA 3ELDA 5KAMA 3UCXA 3NETA 4N49A 3V48A 1XQVA 6GPBA 3LY9A 3UK1A 4V0LA 2EFDB 3ROXA 1S2NA 2Q29A 1ZAKA 2OCKA 2FUNB 2PX3A 3BGDA 4FBMA 4AX8A 2AWNA 6PFKA 2HN9A 5CNJA 4JLKA 3NAMA 5K8TA 2X22A 3ZDBA 4G1MB 4GQBA 4TRNA 4GL2A 2YWBA 1AZTA 1PHPA 1V9CA 2YRFA 3KB2A 2WSYB 3JZDA 2A84A 4PPYA 4ZAXA 4MR8A 4C4OA 3B6JA 3KALA 1MOQA 1YMUA 3P97A 4G9GA 2MSLA 3WYDA 4OAOA 1ZRSA 2VP0A 5EHXA 1JDNA 3VJLA 1AK9A 1ESDA 3DPIA 1HT1E 2PRYA 3FCAA 3RVOA 1KP3A 3H9UA 1Q2XA 2PM8A 2PZKA 4TX1A 1FFBA 3DOJA 3WA7A 1GAXA 5H80A 4MIOA 1R5BA 1Y6GA 3RS4A 1JDZA 3AY0A 3LW8A 5GIOE 1E63A 1X80B 3A04A 1PF7E 3FUXA 1EP1B 3KYIB 3Q88A 2OGTA 2RGGA 3RNLA 1TJYA 4C7MA 5JYCA 3A3NA 1ZRNA 3BMQA 3IUPA 4PG8A 3OFJA 1DTWA 1X1SA 1W9MA 2QRJA 2XMPA 3F5DA 4NOLA 4U7JA 4TGLA 4DB2A 3CWZA 2R8XA 3UMYA 4DAOA 5JBQA 2YICA 1YIAA 3TTVA 3V3KA 2VF7A 1PYOA 2FHPA 4GX0A 5KOJB 4RTRA 1AXGA 3OCJA 5C7YA 2BR5A 3FHJA 4TKLA 1NXSA 2Z1DA 3QTTA 1RHUA 3O3CA 1P4HA 2KYRA 3OPXA 4GX5A 4I55F 4R1SA 5ERXA 3FM9A 4B7AA 1IY1A 5JDCA 2PX8A 4F1KA 1XDDA 3VU0A 3P2JA 5JWRA 1QK4A 4I55B 4PGGA 2XJ4A 1YS4A 1YVUA 4B45A 3W90A 3OQMA 2Q1YA 4LGCA 1AC5A 2G63A 4JJ7A 5F2OA 2WTXA 1ECCA 3TUJC 2G0NA 2BFMA 3NDPA 1N2ZA 4FK8A 3MJTA 4OK6A 3ROFA 5TQJA 3TLEA 3TW0A 4QUGA 4CFSA 2A88A 3PGKA 3OLWA 1AU9A 4MR9A 2G9QA 4LHSA 4NVRA 4R1MA 1EXWA 1W5FA 2H2GA 2VNJA 3UATA 1KFKB 4UBOA 3LUKA 2VHCA 3P9PA 1HNNA 3JASB 3FETA 1VE3A 3NR2A 5THKA 3CUSA 3HXMA 3EX7C 3LNCA 4AY6A 2JEOA 4UXIA 2FJPA 3JY6A 4TKUB 3K8YA 3KHSA 3AOEA 5HK9A 1D2AA 4YREA 1GPBA 4TYWA 2PRIA 4TTTS 3L9WA 2ODWA 4GKJB 1ATIA 2O7RA 1Q0HA 4HLUC 4IIBA 3UG7A 1B8VA 2BUAA 1Q7EA 2V7XA 3I01M 2GPJA 5H4GA 1ZYUA 4HG2A 5EQTA 4OP3A 3F6RA 1NX6A 3E6AA 4N54A 1GFSA 3PD1A 1QE3A 2VTEA 3GFPA 1SCBA 4UXJA 4MW6A 4TWZA 1I0IA 3NHRA 2GWHA 5LU9A 2IPNA 1CQZA 1A72A 2XUDA 5H70A 3KQKA 1YRBA 4Q3EA 4M1KA 5EXDA 3FWNA 1HDZA 4Q34A 2XGMA 5G1OA 4LTMA 3ZHZA 3QYPA 3HADA 4ZT3A 3ZGYA 4EW2A 4EJMA 2F3RA 1AUOA 4HX2A 3JARB 3O8BA 4Y2JA 5THQA 4EBBA 4TVOA 5IEBA 3VX3A 3WBBA 1EX7A 2B4TO 2I55A 4HDOB 4Y9RA 4KQEA 4EB6B 1OH6A 4M3NA 4NR0A 1M75A 1R9MA 2VK1A 2ET6A 2QN9A 3G1UA 3L1VA 1AV6A 1W8IA 3PNKA 1S4MA 2R87A 4OB6A 5F7ZA 3HC7A 4E7PA 1HTTA 4CNQA 5AHWA 3U80A 3QHPA 1L7BA 4Z7JA 4ANFA 1NN0A 2YMPA 3D8HA 3MUEA 3NT5A 3O5AA 4O4JF 4MRVA 2VP4A 2ZWMA 1HTBA 2QF7A 2ZE7A 1RLJA 4N5NA 1NGSA 1Z7GA 2Z43A 2ISSD 5M04A 4HLDA 1PI3A 4O4JB 5ERYA 5I6DA 3PE4A 3SE7A 4FDAA 3NASA 1ZHOA 2MYPA 3I2FA 4MW1A 4Q3AA 2OXEA 5EKXA 2W00A 3IUQA 4GI1A 3LWZA 4C3VA 4RZXA 1E1NA 2PFSA 2HLHA 1SY7A 1Y3AA 1M5UA 2ZTSA 4BBAA 4MI1A 4B6QA 4HGPA 4EG4A 2ZUDA 2PXHA 3FGZA 3IC5A 4XCQA 4F97A 4BWGA 4F9FA 3FPJA 1WZNA 2ZI4A 3TS1A 1F38A 1EK6A 2K5UA 3DSRA 2O2YA 3H97A 3RV3A 4LQDA 4ARBA 4C76A 1UK7A 1H69A 5DTIA 5H9VA 3GDGA 4E1BA 1C29B 1ECFA 2JZNA 5LLDA 3KKKA 2YFYA 4LRUA 4I4NA 4PWYA 4BU0A 1PJZA 4GWKA 2BFEB 2W6MA 3M0EA 4H15A 3ICQB 1V2GA 1JHUA 2QX4A 3ZJ4A 4JXXA 1K5HA 2DPLA 3T8YA 3I01A 3TRDA 2WF9A 3ICPA 2X7XA 4R1PA 1XTTA 3HMKA 4K6OA 1FFCA 2H16A 5DTEA 4AKTA 1Q1NA 2DLDA 3ZWBA 4YXFA 3B6ZA 1CZOA 4UE2A 1LNSA 2WA2A 4TT3A 4IIJF 2QN6A 1JVSA 1RM4A 4DNXA 3SIPA 5KYYB 3ICCA 4MB6A 3UG6A 3K53A 2IXBA 4FFWA 4IIJB 5WRFA 1IJEA 2JLUA 4H6XA 4WOBA 1O5IA 3GIDA 4BGEA 5GZ1A 3N2EA 4TTRA 3UUFA 4WV3A 3PLAE 2Z57A 4OYYA 3L6EA 2PUBA 5JNTA 4BV3A 1H1LA 1LPSA 1U9CA 2Y9MB 4P35A 5EXEA 5FUBA 3QEBZ 1M1YE 3WRXA 1XX6A 1R4ZA 3JQ6A 1VYVA 2YYYA 2NV2B 4HQLA 5JE8A 4Z3DA 5TVKA 2J5BA 2EJCA 1BWQA 2WILA 3L0SA 4DLPA 5KB3A 1MNAA 4ZZ2A 1CUWA 1H5UA 3HGTA 4J2HA 1KZHA 1D04A 1UK6A 1NXVA 2C2MA 2BJVA 3L0IB 3LI2A 5KOYA 2EKQA 2FU5C 2Y1XA 4JLVA 1ORHA 4EG0A 4ETMA 1X7YA 1QRSA 3RYHA 1D4ZA 2EL9A 2YZKA 1EP9A 3F67A 3INGA 1YK0A 4IPTA 3FVTA 3ESAA 3LF2A 4CXMA 3DEYX 1UAAA 5BOSA 1J00A 1ZMRA 2ZQYA 1NI5A 1SKQA 3PUZA 3CKKA 3FVVA 3RFXA 3WK6A 2C7RA 2DLCX 2MMCA 2WNSA 3AL0C 2XXBA 3AIOA 2B0CA 4FT2A 3P0EA 4IIGA 2A9OA 2HF9A 1AK2A 2DETA 3EC1A 2HPZA 1VPLA 5G40A 4OHPA 1JKJA 3VNVA 5F98A 5LKRA 2YNMA 3QKWA 4ZQCB 4Q4HB 2P2YA 1UZAA 3R9XA 1K7SN 3TZBA 5CDHA 4MQ5A 1G4UR 2ZSHA 3RS3A 2DWPA 4B79A 1HRKA 2QXTA 3QNWA 2R6GA 2RK6A 4RPGA 4NC9A 4GR5A 3WAJA 3L40A 2DUUA 4F1JA 4ENUA 3KKQA 5D3QA 4B46A 4RV4A 3D0KA 4QJ5A 4DRYA 4PYOA 2C0QA 1MA3A 4FZRA 5E3JA 3BCRA 1AN9A 2BKVA 1L4BA 3MINA 4MWSA 2FMXA 2BEKA 1P2FA 2KX7A 3KZXA 1DC5A 3M5CA 4P3NA 4ASUD 4WNAA 2YXLA 3A0UA 5E8RA 2R84A 3HCEA 4QJBA 1BCRB 1SIUA 5EKDA 1SU7A 2OORA 2PKRA 2YV5A 3PUYA 3S2UA 4B2YA 5IG2A 4DUPA 2H1LA 5JPCA 4TUYF 4OLAA 1U3WA 1TJNA 4EI9A 4QT4A 5AW0A 4HDAA 4MEAA 3QEAZ 4QBFA 4DANA 4W6QA 4YUXA 4INPA 3ENQA 1U0JA 3ADBA 2ISQA 3TZ6A 4RM2A 1X13A 2WVAA 1L7QA 2A9PA 1PFKA 4G0OA 2ZJ4A 4EI7A 4A1OA 1E3MA 2ZUEA 3E8XA 3GUYA 1GA6A 4YT4A 2QRPA 4FYMA 4DSNA 5GV8A 1H4SA 3BERA 2WVGA 1SIWA 4JH0A 3L7MA 3GB9A 1L9XA 1AHIA 1AIPA 2P79A 1YJ8A 3SI7A 4ODIA 2X86A 4HFJA 3VKHA 4WCFA 1L1QA 4L6IA 3TIVA 4KQFA 2NUTB 4ZRDA 1TU4A 5I3ZA 2O2IA 3AW9A 3QBJA 4S1TA 1H2FA 2BGJA 1O58A 4UXHA 4N5LA 4CFZA 3NBMA 4DT1A 1GAQA 1Q44A 3E0XA 1G9SA 1TPZA 4YJGA 1FP4B 4L9RA 3L3BA 5LCXA 4NZYA 3D7KA 3SFZA 4LXHA 1OLXB 3FOBA 4ZTZB 4M8SA 1IPFA 5C4IA 1WMEA 1ORTA 1XRQA 2HMTA 2QJTA 3JSXA 4J75A 2AN5A 3OLYA 1WMSA 2YC4C 4LZZA 2PZBA 4WOKA 2JCGA 4GGOA 4ZYXA 1N36B 1CHDA 1SJ9A 3LZCA 3ZE0B 2WABA 2X19A 1NBMD 3QG5A 3U5ZB 1EFRD 5AHKA 1OXKB 1OI7A 3JRXA 1LK5A 4JJIA 5ECGC 2YMLA 4CMHA 1JN0A 3TLYA 1HK7A 3FBGA 3UFXB 1CE8B 3HWX1 3K15A 1FC0A 4E22A 1XOIA 2FQWA 5C8ZA 1EZ1A 5HJ2A 5T64A 3KVVA 1Z36A 4CQMA 3R5XA 4K9DA 1Z06A 2QYTA 3FR8A 4TSKA 3WIBA 4CIAA 3EVFA 3NMUF 3NHFA 4RKYA 1H6CA 1IN1A 3C8MA 3VOTA 3HYLA 2FQ1A 5JZ9A 3ZI7A 1FOEB 3T3DA 3HJBA 4Y9UA 1TF5A 1UPXA 3KR2A 5T8KC 4HAWA 4J8PA 4Z4IA 2PGAA 3T6KA 4G5XA 2W0SA 5BXYA 1Q0LA 4N3CA 1CUDA 5KHLB 4Y2XA 3ZVNA 3C7KA 1T2DA 1ZICA 5SZHB 3TINA 5E6SA 1V45E 3SLKA 1NVMB 1ZH0A 1AKEA 4BGIA 1HY3A 3O73A 5F21A 3UICA 2I33A 3X2EA 3MPOA 3GLRA 4KK3A 1E2PA 5EXPA 4C7XA 5LP6B 3C1AA 5E6UA 3KQHA 2BTEA 1ESCA 1O5TA 4ZPXA 4E46A 4I8XA 4Z1MA 2P78A 3LBAA 3C74A 1NPYA 2P40A 3ND9A 4I6GA 4JOQA 5DYNA 3W79A 4CIVA 4AKSA 5I7FA 5KTNA 4NCAA 4UULA 1GZSA 1T8UA 2ZPAA 1XZGA 1VMEA 4KQ9A 4BFXA 3JQAD 3L5OA 3HVRA 2J3HA 1HE1C 3RR2A 1N3IA 3FY4A 4TRRA 4UKDA 2A94A 4OHZA 4I4TF 5CLFA 4IVQA 4UBLA 1W36C 3E3AA 2IY9A 1DXOA 2PKXA 3DPSA 3N0XA 1F2TA 3NUQA 4I4TB 4MDFA 1Z0ZA 1AQJA 2HEIA 2W0MA 5EIEA 2R8EA 2NU7A 2R25B 4PO1A 1NI4B 3OQPA 1H22A 3TRJA 1NP7A 2GOYA 2W42A 3GUVA 2QL7A 4EZBA 1G3RA 3BIXA 4J9VA 1R37A 2B94A 1KBZA 2AKYA 2PBFA 1I30A 3SVLA 3CE6A 5GGXA 4XWWA 1QDEA 1RI5A 2B7BA 3DVSX 1LQTA 4NBSA 4P5EA 1YA6A 1YT5A 2Q5FA 2HQ1A 3EF1A 3FVRA 1UBOS 3EFOB 3TL6A 1D0IA 1M33A 1B6SA 1KDYA 5LJIA 3BIJA 4KFCA 4C14A 1GNPA 4QHTA 1VLLA 1AMOA 2HBRA 2B61A 4DDWA 1HRDA 1VPVA 2C5HA 3AYXB 4C4YA 2C8LA 1HMYA 1NSTA 1KY3A 1SCDA 1HE3A 1IUPA 2MDTA 2WB4A 2XYVA 1ZX1A 3QWAA 3AOGA 4K8OA 5C5DA 4ZMBA 4RE6A 4XGRA 1UZUA 2RFLA 3HFSA 3NM5A 3DP9A 1WF3A 2KMLA 3C4VA 5KMGA 1I94B 4HAUA 1Z6ZA 3I9V1 4ML3A 1XJ0A 4G9BA 4BIMA 4E03A 1ID8A 1U0LA 4OQYA 1ABEA 3AZOA 4P34A 1YRYE 5GWXA 2PWYA 1XTSA 2C04A 5EUQB 4D5EA 5CA1A 3RADC 3D3NA 1N92A 3KSDO 5F12A 2Y1LA 4TLMB 1H2AS 3CRZA 3UK7A 1GQ2A 1ZGJA 3FTEA 3AUTA 1JG3A 5KJFA 3IXLA 4LC0A 2PRSA 3QVVA 3ZKWB 2H18A 2H9AA 4C7JA 1FLVA 4BNDB 2O8CA 3M4YA 3TO5A 1CQJB 4YUYA 1VLJA 3DEAA 2A30A 4D4LA 3DH0A 4OUDB 4X60A 4BGVA 3EUFA 1TFRA 2WG0A 5F2EA 5TV2A 4XX0B 1N1EA 1SWWA 2O3SA 3U19A 4NYIR 3SZRA 4EA6A 5C5EA 5HE9A 1U3CA 2WKPA 1JPNA 1FE8A 2R2AA 3BRCA 3MRVA 3WLKX 1XN1A 4G26A 3R5TA 3AFNA 2FMUA 3CWQA 1XZNA 4R0VA 4D43A 3ANSA 5K0CA 4MHSA 2O5VA 3EEFA 1DEXA 3H2IA 3RIYA 1JR3D 2GN8A 4YP6A 4CCSA 4W8OA 4ZARA 1M5RA 4PHGA 3OX2A 1KYVA 1VRWA 3AHGA 3TQTA 3K9FC 3PHCA 1M66A 3ETJA 1NXQA 3HY4A 3KWMA 1WMFA 3LQFA 3O8QA 4LDQA 3CV3A 2P5YA 1T0BA 4MRPA 2J3LA 2DR2A 1U7PA 3ORFA 3VPGA 4PBTA 4BC1A 3VHXA 4M0EA 1SA0A 5HRCA 4HPJB 1GAEO 2IZ5A 3G9XA 1P0IA 1XLWA 3L41A 4P3KA 2I1VB 4NL4H 1RHQA 5L95A 4OVKA 3U7RA 1W0CA 4E4YA 3NHLA 3B9PA 1R4MA 2AVDA 3FYCA 1I6LA 3RSFA 2FLKA 2X3YA 3WL4A 4TXJA 3F8TA 4FYWA 1G21E 2IJGX 3FZEA 4W5HA 5ALYA 5GOZA 1ZVVA 5TS2A 1COWD 1IHPA 2YBEA 5L3QA 4ZOEA 4L8LA 5IFKA 2G0TA 4TV8A 2GESA 4OLFA 1XZ8A 4OQZA 2X8LA 1LNZA 2JPDA 3HUTA 1GPWB 1PJBA 2I66A 3KV3O 1XFDA 4M22A 5IYZF 2JC3A 2V4ZA 4UHEA 5CDFA 4IHJF 1LNQA 1T0PA 1N5KA 2YV1A 4KQCA 4A10A 5CCBA 4KL8S 3IQGX 4S0XA 5IYZB 1Q7TA 4KV9A 421PA 1HC7A 1I2BA 2EQAA 3EPKA 4OAQA 3IERA 4F9EA 4HZGA 2Z56A 1XMSA 4RPJA 4U5QA 3LTEA 2FLWA 1FSZA 4BFZA 1YBVA 1A96A 1F06A 1CLEA 2CL6X 2FUKA 3GRYA 4LX0A 3QE9Y 2IA5A 1VHDA 4FE3A 2B37A 5FV4A 2O48X 4LJYA 2A0FA 4Z3KA 1BFUA 4RZ3A 4R3UC 2CV0A 4JP3A 5FL7A 5HBRA 1YB5A 5JAQA 5J47A 3LXMA 1VG8A 4D0GA 2GTHA 4KXNA 1ODKA 2HTEA 1BMQA 3GJSA 3SHFA 5C1BA 4MVWA 2NWQA 1H65A 2GPBA 3CRMA 3QI2A 4E51A 5IKEA 1L5OA 1YJQA 2XQFA 3OQHA 4BUZA 1T0IA 1WUYA 4PCLA 1MAAA 3D81A 1K6IA 1M1NB 3JWEA 2WZDA 4NQZA 4YAOA 3L4JA 1A7KA 2ALJA 2W6ID 1V25A 3ABQB 1C30A 3AHDA 3M9LA 4JVSB 4WASA 3HO1A 2JATA 2HCTA 3JD3A 4OHCA 1W4RA 2VBFA 3D4NA 4Q19A 2QR2A 5TGDA 3EGXB 4N6NA 1Y8RA 4J4TA 1JIVA 4M7WA 4QSHA 1AKVA 5FFFA 1EUCA 1FFSA 2DFLA 5GGYA 1DFIA 3OPYB 4RPLA 4B6RA 5CYFA 1Y5RA 1YZTA 2EGHA 3EEYA 3HEBA 4QRHA 1E2QA 3DHNA 3O8DA 3SHWA 2N47A 2VYFA 1KAGA 4XIIA 1Q0QA 1I9CA 1IHXA 1UFVA 2G1PA 4XJSA 3HDJA 3OIVA 1V96A 4UVEA 3DBRB 3IDQA 4FYIA 4PIVA 1UBHS 5D01A 3GBSA 5F2KA 3LHSA 1I3NA 1GY8A 3H42B 4FYVA 1OR8A 4JGBA 4XYBA 2I3AA 2FFHA 2DWUA 4LBVA 4E3WA 2EP7A 1XQWA 3V32A 1VPWA 1U3FA 1SUAA 3NBAA 3S55A 4A6XA 3U61B 1Z0UA 4PBRA 1LX7A 1U04A 4A8JB 3WSWA 4GUDA 2ERYA 2HO4A 2XV1A 4HPXB 3H2SA 4RD0A 1PTJA 2OAP1 3CM0A 3PQ6A 3EAFA 1YB6A 3T5CA 5D5PA 3TPFA 3QXHA 3VAAA 4CETA 4F4FA 5F1PA 1P5ZB 1FPMA 5KTTA 2A9KA 2P11A 4DZTA 3WRWA 1A5ZA 1BCSA 1F0YA 1P1HA 1U9YA 4L3WA 4D8YA 2ZT7A 3RUIA 5LC1A 4KUHA 2I4NA 5J9FA 1VDMA 2W43A 4HVTA 4YWHA 2VUUA 1UKBA 1W5AA 3QU2A 4X6UA 4WZ6A 3EDRA 2L2QA 4HMOA 3IR6A 3TJMA 2MYUA 4J16C 1MC1A 2H00A 2H3EA 2JKYA 1VMIA 2AFIB 3DYBA 4YECA 4B6EA 4DA9A 2Z3WA 3FRIA 3K0HA 4FHEA 1XB2A 4ZCPA 4CNBA 4L5AA 2H4JA 5K9ZA 1JLKA 3WMWA 4C4SA 4BCBA 1QPGA 4M49A 4X65B 1TW3A 1MV8A 1A9XB 4R69A 3ZWAA 1YQWA 4MWCA 3IIJA 4B3TB 2E6UX 2IPXA 4NV1A 5JAPA 2H1SA 2GXQA 4KLAA 3AM1A 4A2PA 5JYEA 3NKVA 3L0PA 1LTQA 1S9DA 3ZZNA 1TTTA 2HR1A 1GPYA 2ZJ3A 4ER3A 1BHSA 4MA4A 3WB1A 1GQSA 2WU0A 2WHQA 3PTAA 1OQAA 3HA5A 1INLA 1JLHA 4BRUA 1A8PA 4HHEA 2RB5A 2P4SA 5KJEA 4E5NA 3HJRA 1KAOA 3FZGA 3QLTA 1ZK3A 1NXWA 2VZ8A 2CNKA 2WSMA 3VYWA 1D7AA 1E0AA 1HPLA 3HB7A 4BB6A 1Z63A 2OFXA 1Z7YA 2HIAA 4FJ2A 4RSRA 3R23A 2HJWA 3ZLVA 1LSJA 4RF2A 4X54A 5LB4A 5AK5A 3VMFA 4DLRA 2VP6A 4FE4A 2OP1A 2P9FA 3L93A 2DP4E 1TYAE 2IUFA 1P29A 4NBWA 5AI5A 3A36A 5TMPA 1N1DA 2Q5CA 2PBZA 3GL9A 5TVGA 3SBXA 3TL2A 3K70C 3IQXA 3WSVA 1UKYA 2Y0PA 2DBYA 5KOHB 1Z4OA 1VKJA 1ADYA 5JZOA 2P9ZA 4M76B 2HU8A 4KRXA 3SIRA 4JVOA 2ZSKA 2JI4A 4PRYA 3CNBA 2PUVA 3GOHA 5EP2A 1YR3A 2ZT8A 5CFMA 2BGWA 3W3AA 4DJFC 4PCAA 2DQYA 1U8AA 4U1RA 1G5HA 1RWOA 1V43A 4TZKA 3FPGA 1RBMA 1F14A 1RNLA 2H1HA 4UCXA 5ESDA 1MAWA 3QXCA 4YJKA 4BPBA 1YACA 3ZWQA 3ZDQA 5FTNA 3MW8A 1R9JA 3T4EA 4N0MA 3CTPA 3D2BA 4E32A 1SVKA 3E5NA 3GEEA 4XH9B 1W76A 2RI1A 4B31A 5CT4A 1VJRA 4KMMA 4N7JA 2X40A 4KIWA 2Q41A 2XKJE 3DV0A 1CRWG 4N3BA 3BXOA 3X1JA 1ZGAA 2ZRPA 2C9DA 2XDQB 4Y1RB 3CH4B 5C0OE 3PJGA 3ZBQA 4AYXA 4BFLA 3K4QA 4PS1A 1QHHB 2FF5A 4EEXA 3U1TA 3S1SA 1NOIA 2I6TA 1LLCA 3HN2A 2Y2VA 5AK0A 4EPWA 1QZXA 4GOXA 3SXUA 5ALMA 1YMQA 1C7JA 2ZUTA 5JJIA 3ODGA 3WMRA 3ZWYA 4I6JA 4BLRA 4UD6A 4KOEC 4ZVRA 2R4TA 2XEDA 4B7UA 3PFNA 1GYPA 2EIXA 3FNBA 3FNQA 3IAAA 1E5VA 4JC5A 4NE9A 5E9AA 2GB4A 4GW3A 4Y2VA 3VTFA 4RXUA 1IN7A 2VNHA 4JT4A 3EQ7A 1DHRA 2HEGA 4GPD1 4QDOA 4XOUA 3A9SA 3ZHTA 3O7WA 4MW9A 4Z4QA 5HXAA 1J2YA 2GBGA 2Q9AA 3TLGB 3QVOA 3PF9A 4EL5A 2DCUA 4OLJA 5ER9A 4CUKA 4ZQBA 3DUFA 4J0QA 3FD8A 2QLFA 2DHCA 4RADA 2JLCA 4FMBB 1PGOA 4ARAA 4PAGA 2ECPA 3LQ4A 2GLUA 4D8TA 3N39C 2IP2A 1LVGA 2E9SA 3QX8A 2V55B 5EJEA 3RFUA 4DYHA 1GAJA 1QBKC 1SZPA 1W94A 3VM6A 3ND8A 1TOAA 3I2HA 1RLOA 3M2TA 5GONF 5FR1A 2G5TA 4EJSC 2YXNA 1TK9A 3KPUA 4EF5A 4LOKA 1FRVA 4BDTA 4QJ4A 5GONB 1YQDA 2CNOA 4BNVA 4HNSA 3DNPA 3ZD9A 2WKRA 4IJVA 2M6KA 1EK0A 1JXAA 3BWEA 2FOXA 2DM6A 3MG9A 3LCRA 1YOBA 4BX9A 1Z2OX 1Z33A 3PFCA 2G36A 4LF6B 2GSDA 4I1IA 4V1CA 3PQFA 4QTXA 3BZWA 2V7UA 3ZWWA 5EIHA 3AILA 4YRSA 2OO5C 4I50F 5A5GA 4ARCA 2M2IA 1LPMA 4DLZA 5JQGF 2FOLA 1W52X 5FOXA 1W0JA 4FJ1A 5B55A 4I50B 2GPYA 1EVZA 1ZK1A 1KYIA 3E9YA 4YAKA 4PQYA 4R8RA 3EOZA 1PR6A 1Y5NA 2BKEA 1QRUA 3PWKA 3OA2A 3L8ZA 3HLKA 4PGFA 5DHAA 1QWSA 4QPPA 2ZTMA 3C85A 4CF7A 3HXQA 4RK6A 1KDVA 1FFXB 1MDBA 3FNRA 1E99A 4Z4FA 5GM1A 3HCNA 3M5WA 5K20A 4BQIA 2OHXA 2RG7A 3PRKE 1KL7A 2MINA 5EMKA 5BN5B 1XLUA 2IYFA 3C6XA 4O4LA 1P7YA 4UAUA 3UJBA 1PR0A 2FR0A 3GDFA 2FWIA 1PNVA 4C89A 1EM6A 5JSHA 3OHSX 2BGIA 5JBNA 1SOMA 4JLOA 4WIAA 4JYBA 5DGXA 3O2JA 2YQZA 4QWMA 4JC4A 1I2AA 1P77A 1NP6A 3MMSA 1JQLB 4JJGA 4U7TB 4HFRA 2Z1NA 1CRQA 1TF2A 3UIEA 5K0GA 2VHXA 1VIVA 5IMBA 5EE5B 3A05A 1G5TA 3HY3A 1XJCA 3LC0A 2WJWA 3Q5DA 3HCRA 4BWVA 1DKNA 3BXFA 4KQ1A 1OXUA 3NG1A 1GGKA 2IYZA 2V6JA 3VC7A 4C4PA 4Q5IA 5H9WA 3TOXA 5JLAA 2ETVA 2I3ZA 1RWNA 5JARA 5KTOA 3ISTA 1FPQA 3RQIA 2PUAA 3EXG1 4QL3A 1HV8A 2JH9A 2BGRA 3LM8A 4CLOB 1VCHA 1ZPDA 2E3JA 4AS3A 5C3MA 5FL3A 1ZHFA 3MTDA 2I7CA 5FRDA 1N7JA 4EAQA 3N7TA 1XTJA 2C57A 4JGIA 1OASA 1VE7A 2ZLBA 4JJZA 4OQXA 5FBHA 4BASA 3CFYA 4KLNA 1OF1A 5HOQA 3VU1A 3MWLA