1YXMA

Crystal structure of peroxisomal trans 2-enoyl coa reductase
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
297
structure length
297
Chain Sequence
b'GRSYLAPGLLQGQVAIVTGGATGIGKAIVKELLELGSNVVIASRKLERLKSAADELQANLPPTKQARVIPIQCNIRNEEEVNNLVKSTLDTFGKINFLVNNGGGQFLSPAEHISSKGWHAVLETNLTGTFYMCKAVYSSWMKEHGGSIVNIIVPTKAGFPLAVHSGAARAGVYNLTKSLALEWACSGIRINCVAPGVIYSQTAVENYGSWGQSFFEGSFQKIPAKRIGVPEEVSSVVCFLLSPAASFITGQSVDVDGGRSLYTHSYEVPDHDNWPKGAGDLSVVKKMKETFKEKAKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords peroxisomal trans 2-enoyl CoA reductase
publication title Crystal structure of perixomal trans 2-enoyl CoA reductase (PECRA)
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 103
structure length 297
sequence length 297
chains with identical sequence B, C, D
ec nomenclature ec 1.3.1.38: Trans-2-enoyl-CoA reductase (NADPH).
pdb deposition date 2005-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1yxmA00
2LDXA 1LDGA 2P2SA 3L4BA 2WD8A 1EVZA 1T1SA 3GA0A 3RI3A 1NYTA 3WQSB 2GO1A 2GRAA 2Q1UA 1UXHA 4LVUA 2W2LA 4ILKA 2Y0EA 4NBRA 1R4MA 4M86A 4A10A 3L0DA 1FDTA 2FN7A 2X7HA 1LA2A 4FFNA 4H7PA 2VHYA 4BOYA 2VZ8A 2Q45A 2VHWA 3L07A 1ISGA 1SNYA 1OMOA 1JWAB 4BNXA 2Y1OA 4DC0A 2CF5A 3HDQA 3MWDB 4YT5A 5CEEA 3AUTA 1T2EA 3STHA 1BGVA 3T7EA 5A02A 4CMHA 4CLHA 3KETA 3IUSA 1U5AA 2ZQYA 4GGPA 4K26A 5AXCA 2DBVO 5U4QA 3F9IA 1NR1A 5G0SA 3CKYA 4EUEA 1BG6A 2ZJ1A 3WGQA 4U5QA 5ITWA 2NLOA 3GUYA 2VWHA 4BB5A 2P4HX 4OKIA 3OHSX 4YJFA 4J3FA 4D0SA 3O26A 4WCFA 1M2WA 3L6EA 1HETA 4E12A 1VC2A 3WIEA 1SMKA 4UAGA 3PGXA 5FF9A 4DIFA 4RF4A 4YRDA 2VYVD 1I01A 3BMOA 1PTJA 4MKXA 5B4TA 2VWGA 4Q3DA 5JFOA 5AXBA 2O23A 1A27A 5EPOA 4RQUA 3RFXA 3EK2A 1E77A 3I9OA 1NM5A 1M75A 3RROA 4PG6A 3UN1A 1B8PA 2VZ9A 1XGKA 3D3WB 3F47A 4ZVVA 2B5VA 3NKLA 3PXXA 4YVFA 4L76A 3S2FA 3KYCB 5ITVA 2ZCUA 3DMTC 1A7KA 2R6JA 3HB4X 4TZKA 4A03A 2CSUA 3RUEA 1HTBA 4YT8A 4PZEA 3C24A 3MJVA 3O9ZA 3IS3A 1N1GA 1LDYA 3MJ4A 1LNQA 2ZK7A 4W9NA 2VHXA 5FFFA 5MGBA 2PH5A 3OEWA 3QVXA 4TKMA 3CUKA 5ILOA 2XXJA 3KBOA 1XDWA 5HA5A 4QT0A 2YZ7A 5ER9A 4BS9A 4B3HA 1P9LA 3ETDA 1LSSA 4AL4A 2BFMA 4Z9FA 4INAA 1SCUA 3WBFA 1X14A 3FTNA 1KYQA 1T25A 4II2A 3ZI0A 3RWBA 3SX2A 4PRLA 1SEVA 3RD5A 5A03A 1PL7A 4CM4A 9LDBA 3MJTA 3GF4A 3K31A 4R16A 1HLPA 1EDOA 1Y5RA 3DTTA 3GVPA 3UHAA 3TZHA 2ZB3A 3H9EO 1MV8A 2DBZA 1R0SA 3HDJA 3HQ4O 4XQGA 1TLTA 2HRZA 4CM8B 4NK4A 3RCBA 5BR7A 1NQTA 4BO3A 4XQEA 2UUPA 1DC3A 3WQQA 1YH3A 2Y0DA 3C7AA 1VRWA 2EGHA 4R1TA 1GEEA 5IZCC 1ULUA 3RIHA 3JQGB 1H6CA 3KUXA 2WD7B 1GZ3A 1YKFA 3ABIA 5C37A 4KWHA 1OC2A 3P7MA 3QRWA 2EIHA 3WMWA 5IAAA 3JSAA 4CV1A 2A9FA 3DBVO 2AQ8A 1PWZA 3R6DA 2QQ5A 4MVJD 1N8KA 1LRKA 2NVUA 2HMWA 3D4OA 2VRBA 4E2ZA 3C1TA 1C1DA 1L7DA 4MIOA 2VYVA 5EESA 4BVAA 1E7RA 3JQAB 3RAJA 5DULA 2CVQA 1SEPA 3GRKA 4LRTB 5DCYA 2TMDA 5IXYA 3N74A 3ZHYA 4YAGA 1NWHA 2D5CA 1SOWA 4I8XA 1CRWG 2IXBA 2AEJA 2WE7A 3AUSA 4DPMA 3QY9A 3GOHA 3VZRA 1NFFA 4RPHA 1YS4A 3QW2A 5G0TA 4F45A 1HYGA 4RDIA 3WSWA 2PNFA 1EK5A 2GDZA 1GYQA 1SPXA 1TT7A 4OL9A 1GPJA 4JBIA 1XU7A 4WK6A 4FFMA 3U3XA 3ZV3A 4AG3A 4CR7A 2IZ1A 1UP4A 3GNSA 4LRSB 2Q1TA 3ZWOA 1EE9A 1GCUA 2G17A 2IYPA 1NHWA 4E3ZA 4Z3DA 4WLEA 1RWBA 3DOOA 3H9QA 5L9AA 4CPDA 1WVGA 3INTA 5T6BA 1B3RA 1PS9A 4OOEA 2HK9A 3H4VA 1GDHA 1UXKA 3OSUA 2JCXA 4E5KA 1NHGA 1RYDA 2CDAA 5I7SA 5IDXA 4JP3A 1I3KA 2VNSA 5JXWA 3Q1LA 3S2GA 4YRAA 4ZU3A 4OHUA 3PYLA 3LZ6A 1H9BA 1IPFA 1M66A 4M87A 4Y8VA 4LW8A 3M2TA 1VKOA 1YQGA 2P9CA 1JAXA 2VUSA 2HU2A 3H5RA 4I5DA 4U8GA 4LVCA 3ZNQA 5IDWA 4BNMA 3FPCA 4RVDA 3GH3A 3JQ8A 1ZUD1 3JYQA 2V6MA 3PRJA 2NU8A 4IBOA 3KB6A 4WECA 3ZNNA 2NADA 4MKRA 4OXNA 3FPLA 4B4VA 1AE1A 4F6CA 4Y6PA 3PWZA 2D8AA 4CL8A 2VRCA 2GN8A 3PYXA 4N7RA 4S3MA 4Z0HO 5L3ZA 4MVJA 5K6AC 2OFPA 2PGJA 5AVOA 5HTOA 2D4AA 4B3IA 4NR0A 1VSVA 4GPD1 2EKLA 1EVYA 1VE9A 3JYPA 1U8XX 5BSHA 3SXPA 4PZCA 4O1MA 1TB4A 4NU6A 3A28A 3HFGA 5ICSA 4IDGA 1C1XB 4CV2A 2C0CA 4XB2A 4MDHA 4QX6A 3L6DA 1FDWA 4YR9A 1H6BA 4GMFA 3MZ0A 5A3VA 3JQAD 4TRNA 1PJLA 4FGWA 4XYGA 1NXQA 2I5PO 3ZZNA 1BRMA 1DXYA 3R1IA 2ZYDA 3MOGA 3DXFA 4KP7A 5KVSA 3IAHA 4L73A 3RVDA 3PI7A 3UFXA 1I3MA 3DHNA 3ZGYA 1BVUA 1GADO 3KYCA 4BGEA 1T2DA 1X1EA 2GD1O 1P0FA 4O63O 2VT3A 2NWQA 2V65A 3COSA 4ROSA 2VHVA 1LSJA 5LDGA 3CIFA 3ADPA 2QZZA 2XOXA 4NFHA 4GH5A 1TXGA 2P91A 4YEDA 1YE3A 3BZUA 2IEBA 1MC4A 1QSGA 3QP9A 2WTBA 4YTEA 1V35A 5CG2A 3PPIA 4NZ9A 2AXQA 3A9WA 3BHIA 2BGKA 3TSCA 4CUKA 1GPDG 3GZNB 3VH1A 3IC5A 4DA9A 3H9JA 4U6SA 3W4IA 2B37A 4GQAA 3C7CB 5T8KC 1RKXA 1FMCA 3NGXA 1GAEO 4E2XA 4R3NA 1ZJZA 3R0IA 4J0EA 4W82A 1GZ4A 4CMEC 3OIGA 4PVCA 3WJAA 1GCOA 3W4KA 4AJJA 1RM0A 4P22A 2VUTA 5F1OA 3RFTA 2O2SA 2UUOA 4CM8A 1BDMA 1EQUA 5G0VA 3AOGA 4TMFA 3U0BA 3ETGA 4JN6B 3GN2A 3N7UA 4ZA2A 4J1TA 1PIWA 3FTPA 1YL7A 4IS2A 4IJKA 4QXMA 1DPGA 2Y1GA 3ICCA 2WEKA 1IUKA 4HBGA 3FBGA 3GVCA 1QMGA 5I9LA 5BNFA 4A7PA 3WG9A 3R3SA 5TIIA 3FRJA 3H7AA 3WICA 5JO9A 3OA0A 2VTDA 3AM5A 4LGVA 3GRPA 4K1LA 1CDOA 3ENKA 3AFMA 3I6QA 4PLTA 2JAHA 3TFQA 2DM6A 3JYNA 4R68A 1LX6A 1YB1A 2DUUA 3JQAA 1A71A 4DBZA 4GSLA 1PJTA 4KWIA 3TFOA 4DMMA 4P4LA 4CUZA 3G17A 4BNFA 3UOGA 1XHLA 3DBHB 4S1VA 4E33A 1ZNQO 3WIDA 1NVMB 3LQFA 1U3UA 2H1SA 3K2EA 3VOSA 2QRLA 4PZDA 1QV6A 1VL0A 4YYZA 5A9SB 1LU9A 4JIGA 4L4SA 3GLQA 1A7AA 1Z73A 3CINA 3ZU3A 1MLDA 4HNGA 3WMXA 3DOJA 1P1IA 3GVHA 3HJAA 4XYBA 4PVDA 4D79A 5A04A 3I52A 1SO8A 5COAA 2C5EA 3WSVA 1I10A 4IZHA 1GUFA 3KYBA 5TF4A 4JBGA 2NVWA 2DUWA 3EMKA 4GGOA 5COQA 3QWHA 1FF9A 1XWFA 4GKVA 4TZTA 1EMDA 1LDBA 1O9BA 2YHIB 3L6OO 3NT5A 3PQEA 3KV3O 3LVFO 3QLJA 1UXJA 3BMCB 1ZK3A 3W8DA 5EJ2A 1MFPA 1HDCA 2CVOA 4BMNA 3IP1A 1YB5A 1DIBA 1JWBB 3FHLA 2W8ZA 3K96A 4MVJG 3TOXA 1XKQA 4OAQA 1QYDA 4YCAA 4P38A 4RZIA 4QFCA 1HDGO 5IDYA 1WLYA 4EEXA 3ZU5A 1Y81A 3BMQA 5U1PA 7ADHA 4MJLA 4CLOA 2W98A 4IS3A 1Y6JA 1KOLA 1KY5A 3LC1O 4I9UA 4DRYA 2PZMA 1VKNA 5FI5A 1N7HA 5B37A 4XWYA 2RBEA 4YAKA 3VPGA 1RYEA 1GU7A 4M89A 2BH9A 5TC4A 4G2NA 5DZSA 3VAZA 1V8BA 3AY7A 2FZWA 5EMHA 3E8XA 3ZWYA 2ZIZA 1UXIA 4BKRA 5ENVA 2I99A 2C2YA 1JDJA 1RM3A 3VPFA 1T4DA 4B7UA 3QIVA 2DLDA 3WGIA 3OQ6A 1ZMTA 4WCFC 5TRTA 1C1XA 3FNEA 2HQ1A 2QIOA 3JD0A 3WWZA 1E0DA 3JQFA 3OQ1A 2NTVA 4XR4A 4YRBA 1BSVA 3E9NA 2CUKA 2HK8A 3B1KA 4UEOA 2NU7A 2D5AA 2HMTA 4CMAA 4URFA 1LC0A 2BI7A 4W99A 5KCZA 1ENPA 2B5WA 4WLUA 2YFHA 1IOLA 3DOCA 2NQ8A 1ZKMA 2D3TA 3JQCA 3MEQA 4UULA 3RUCA 5EIOA 2CNBA 1LJ8A 1CIVA 4GI2A 4WCFB 3SBOA 4XQCA 1C0IA 2AE1A 4ALKA 2IZ0A 3GG2A 3AUAA 1EBFA 1Z7EA 4W9NC 3V8BA 3GZNA 1Q7CA 5C7IO 3WQRA 3WDSA 1DFGA 3KYDA 4HFRA 3K9QO 1WZIA 1V6AA 3G79A 3PJFA 1K2WA 3JQ9C 1GL3A 5T5QA 3W6UA 3WYBA 4EYEA 1YBMA 2OO5A 3TDKA 4BNIA 2Q46A 2FR8A 2PWZA 3RFVA 1XR3A 1NTOA 2Q4BA 3E5RA 3NGLA 1JAYA 5HS6A 3O38A 4UUOA 4B8WA 1UZLA 5JMWA 4WNIA 2VZ0A 1HXHA 3EHEA 1U28A 5C7OO 4RLHA 3ZN2A 3ASVA 3ZU4A 1BWSA 1OBFO 4OQYA 5I9MA 1X13A 4Y6RA 3VTFA 1KIFA 2I3GA 1LEHA 3EZLA 3FWZA 4M1QA 4GVLA 1VJ1A 4WGGA 4NBWA 5DOVA 4DLBA 3OJ0A 2ZCVA 3RUDA 1D4FA 4C7KA 4XDYA 2H5LA 2HAEA 3EAGA 3JYOA 3QVWA 2HMSA 5G4LA 3RU9A 5CEJA 3LU1A 2Q99A 3H5AA 4BNWA 3RKRA 1X7HA 4IXWA 4OQZA 4XA8A 4R69A 5HM8A 1T2CA 4G65A 2JAPA 1GFSA 4IY1A 5T64A 2WWRA 3P5SA 1KS9A 3QWAA 4HFJA 4Y67A 4UVIA 4TWRA 3KZVA 2B69A 2JCVA 1KBZA 3KSZO 4RORA 4P8RA 4UVHA 3SLGA 3C8MA 1GD1O 3DBHA 3NT2A 3OA2A 4L74A 4R4JA 4UREA 4XRRA 4JJIA 4R9SA 3AU9A 3PDJA 4G5HA 4BNZA 4KTVE 5G4KA 2CD9A 3BAZA 3RKUA 1BMDA 3RBZA 2BFOA 4CV3A 1GUYA 2B0JA 5GZ6A 4GLLA 3JD2A 3B1FA 2NVUB 1C1DB 1XEAA 2VTEA 4J43A 3CMMA 1DIRA 3HDYA 1P31A 5FWNA 4RF3A 4A5OA 1A4UA 4Y98A 2GGSA 1W8DA 3VH3A 3WGTA 1E5QA 3ZWNA 5ADHA 5JLAA 3Q9NA 1GY8A 2YHIA 5KJFA 2EKQA 3BMCA 3JQBA 4BV9A 4RDHA 1ZVMA 4NQZA 1CQJA 1DAPA 2X5OA 1W73A 3RJ5A 1PZFA 4IM7A 4Q3NA 2P4QA 3NRCA 1F8GA 1EFLA 2Y1DA 3VPHA 1NFQA 5AYVA 3ZH2A 3CTMA 1R15A 2CZCA 3HB5X 3NJ4A 3TWOA 3NDRA 5H82A 1VJ0A 3OIDA 1H6DA 4OJNA 3IOYA 4IJUA 3S2IA 2QZ9A 2VWPA 3PWKA 4BV8A 1FK8A 3L9WA 1PL6A 1P0CA 5KNLA 4MVJE 5CHEA 1HWYA 3WTBA 3ZHXA 4HFNA 3MJEA 5IZ4A 3GR6A 3I9MA 1I5RA 4BNUA 3KHUA 4AJOA 3NV9A 3ZWMA 3QWIA 3VHRA 4XYMA 1AHHA 1D8AA 1HZJA 1DIGA 1PSDA 4NI5A 1LRLA 1PZGA 3TZKA 3W8EA 1HDZA 3ANLA 1ZH8A 4OOFA 4ALLA 3JQ8B 3WJ7A 4ZN6A 1EUCA 2I76A 2PD4A 4CMCA 1SB9A 5BSGA 5CP8A 2Z95A 3JQ7B 1B8VA 2YJZA 3GNQA 4KQWA 1UZMA 4AJ1A 1DB3A 1Q0QA 4JQCA 3X2FA 3DBLA 4GWKA 3GMSA 1PGJA 3NTRA 1ZIDA 1CWUA 1NFRA 2BKAA 4GVXA 1TA4A 2YHUA 3ZW8A 5JE8A 1A5ZA 1E6EA 3RC2A 3OICA 3D1LA 4NPCA 3DFUA 3KSUA 2PZJA 2VNAA 4XRGA 4YT2A 2X86A 3GMDA 4FC6A 1E7WA 1OI7A 5GZ1A 5JC1A 3OETA 2NU9A 4O59O 1U4OA 1SAYA 5JBIA 2A35A 2O3JA 4NG5A 4XGIA 2VYND 2O3SA 4GMGA 4BB6A 3N58A 4E21A 4DWVA 4OH1A 1YGYA 2BGMA 3VH2A 4IDFA 4DYVA 1E1NA 4MP6A 2CMDA 2G76A 4ZJUA 4UUNA 1QYWA 3PLNA 4HADA 1U2GA 3IDSA 3JD3A 1QXSA 2YDYA 1NWCA 1E3LA 4KUHA 3DAGA 1XSEA 3IUPA 3I4FA 4YACA 1ADCA 4TVOA 3T4EA 4RJTA 2LDBA 1MB4A 3ZU2A 2PD6A 2GPTA 3OF2A 3KXDA 2GUGA 4IDEA 3QJ5A 3TZ6A 3ONEA 1J5PA 4FDAA 2J5KA 5LCXA 3GNTA 3CEAA 1MG5A 5THQA 3O03A 4P4NA 4E5YA 3JQ9A 2D1YA 1LLQA 2Q2QA 3KEQA 1AXGA 1R0LA 3DWFA 2JJYA 3TPCA 1X1TA 2ZB4A 4IQ0A 2H63A 1I33A 3WOHA 4ZQHA 1NASA 3GEDA 3U4IA 5A1TA 3I83A 3K2BA 3WGZA 1HSOA 5GMOA 1H9AA 2IYOA 5I8ZA 4LN1A 7MDHA 1UXGA 5IN4A 2Y1FA 3ROMA 2SCUA 3H2ZA 1I24A 4OXKA 1EDZA 1B2LA 1QYCA 2YDXA 1FDVA 4I08A 4YXFA 4FPXA 3CZRA 2C59A 5H83A 3G3EA 1SB8A 5ICMA 3LF1A 4IINA 2PY6A 1P1HA 3NTQA 4U0KA 1A9YA 2VRCD 2QX7A 3H9GA 2FZEA 4GX2A 2GASA 1DSSG 1UP6A 2V6BA 4QFDA 4E6PA 1UZNA 2JHGA 3UXYA 4RZHA 1MX3A 1BTOA 3IKTA 4HX5A 3GT0A 2YQ5A 4FGSA 3SJUA 4DL9A 1LSOA 3ZW9A 5JYEA 1PJ2A 4LSWA 1VM6A 2VYNA 1O5IA 5A05A 2O4UX 3C85A 5EERA 2QYSA 2EHDA 1IY8A 1WDLA 2X6TA 4E4YA 5K0ZA 4CMBA 2ZTLA 2O7SA 4N5MA 5F5LA 1YJQA 3D4PA 4LISA 1ZZEA 5TSDA 4WEOA 4FOOA 5I7FA 1OAAA 3I5MA 2XF8A 4R5HA 4GX1A 1Q0LA 3ENNA 5IF3A 2JFHA 4C7JA 2O3QA 4YAIA 1YJ8A 3ROPA 4U7WA 4OYRA 1PS8A 2ZTVA 2ZTMA 1N2SA 4J6FA 4NDNE 3HWRA 3SJ7A 2DBQA 4MPDA 4J9UE 4YA6A 4BNVA 3GK3A 4WOKA 1KVQA 1P1KA 4RV9A 4E5MA 2QYTA 4HKTA 2J3HA 1ZW1A 4EGFA 4KOAA 5LDHA 5KKCA 1LSUA 5B4VA 1H5QA 4N5NA 4A73A 3GHYA 2OHXA 3PHIA 2IE0A 3OEYA 1T26A 4PLZA 5JAMA 4DGSA 1CQIA 4MP3A 5A9RA 4L75A 4DLLA 1C14A 1Q2XA 5JO0A 1JVBA 4CJXA 5DP1A 5FI3A 4A2CA 4RF5A 4XR9A 3AOEA 3JQEA 2PV7A 2OP1A 2OMEA 1K5HA 5JNLA 2X23A 3BMQB 3I23A 4FFPA 3IJPA 3ZV5A 4CLOB 1PGQA 2X0RA 2EGGA 4MVJH 3VVBA 1MGOA 3PK0A 2RAFA 2EKPA 2YW9A 4W4TA 1QV7A 4TRRA 4Y6SA 3JQFC 3JQ7A 1EZ4A 4RVFA 4FFRA 3CMCO 3TNLA 4CLRA 2OXIA 1LLCA 4PGFA 5DNAA 1KVRA 2RH4A 1HL3A 4YQZA 4B8ZA 3M6IA 4W7IA 4WCDA 4Z9XA 3T4XA 4BL5A 5KVCA 6ADHA 2HLPA 2Q2VA 4OO3A 4QSMA 1BW9A 3WB9A 1N92A 4EW6A 4IIVA 4UEKA 3E1KA 5A3JA 2JKVA 1A9ZA 3FN4A 1JKFA 2EW2A 2I3AA 2PR2A 4NBVA 1JU9A 4NHEA 4ESOA 4EBFA 3PHHA 4J4BA 2FSSA 1ISFA 4PN3A 1ULSA 1YO6A 1WWKA 1NVGA 3W1VA 1WDMA 3UICA 3OFSA 4WASA 1BXGA 1DC6A 1HF3A 4GLOA 4N18A 3IL2A 3LT2A 4QTZA 3JV7A 2J8ZA 4CQMB 4CR6A 1U9JA 4Z0PA 3H6KA 1LI4A 3QVSA 5CEFA 1DRVA 4AICA 4F3YA 3KVOA 3BTOA 4B4OA 3RUAA 1S7CA 1GQYA 3PHLA 3DAFA 4MO2A 4E0BA 4OXYA 4MIEA 1X15A 1NAHA 3GGPA 4E30A 1X7DA 3FI9A 4FR5A 1HZZA 1HLDA 1ZXBA 3FR7A 3AWDA 3VTZA 2WDZA 4ITUA 4LCJA 2UYYA 4PLCA 2JHFA 1E1LA 4O6VA 2X9NA 4GL4A 4IQGA 1DIAA 3ITDA 1PJQA 1YOVA 3I1JA 1PEDA 3MCVA 3GDGA 4Z0TA 1E5LA 5G2OA 3KYDB 1C3VA 4E5NA 2FPGA 3TQHA 4D7AA 1XQ1A 2G5CA 2JFFA 5I7VA 3GG9A 4HWKA 4CUJA 4D41A 2H6EA 3K30A 1WMAA 3C3XA 1E7MA 4BNKA 2RH8A 4GSKA 4JX8A 3VC7A 3DMYA 2P5YA 3HFSA 2POQX 4Q3EA 4IMRA 1K6IA 1ZFNA 3SLKA 3OMLA 4HP8A 4NJMB 4NU5A 3RUFA 3WGOA 1I32A 1V3VA 3HADA 3VZSA 1E3WB 3JYLA 4A0SA 2FRDA 3FBTA 1M6HA 4WE3A 1EVIA 4H3VA 4YPOA 5TQVA 1N7GA 3DHYA 1DHTA 1HDYA 2AE2A 3IP3A 4BNTA 4O5OA 4KDEA 3B20A 1F14A 1ENZA 1ISIA 3NX4A 3GDFA 3QA9A 4XYEA 5TJ9A 2OORA 1ZK1A 1W4ZA 1IL0A 2PGDA 4MKZA 4OIMA 3ZDFA 1NNUA 3SEFA 4J16A 1E6UA 5AXDA 1P45A 2Q1WA 1HE3A 1F17A 3H3FA 3PJGA 2PKQO 4CLDA 2H9IA 2DU8A 2WYUA 2YUTA 3GUCA 1I8TA 2I6TA 4GBJA 3Q9UA 4HUJA 3QHAA 1JW9B 2XPCA 4CLEA 4BO6A 3OBBA 4K6FA 4ND4A 1ENYA 5LC1A 3ZWBA 4QQRA 3JQBC 1U3VA 3WNVA 5G4KB 4CQMD 1UAYA 2JCYA 4DREA 3QSGA 1T4BA 2Q50A 1GZ6A 2BRUA 3A06A 5J23A 4CM7A 1E3IA 1I2BA 1HRDA 4D43A 3ONFA 4I1IA 1DJQA 5C7LO 3F6YA 2R2GA 4NK5A 1DLJA 2PKQP 4R5MA 5TS3A 3WYEA 3E03A 2X1HA 4J90A 1XG5A 2VWQA 4DIBA 2GF2A 5JC8A 1EUZA 2E49A 3F46A 5BT9A 3S2EA 4GX5A 1P1FA 4XQ9A 4EJ6A 3INRA 1PQWA 1T24A 1DFIA 5JDIA 3C1OA 1B3BA 3HHPA 3WLEA 3LT4A 3GVXA 4K9DA 4LSMA 2O2YA 1TVEA 1FXSA 3DTYA 3HN2A 4OSOA 2OOSA 4Q3AA 5KWEA 4H16A 5TJHA 5KVVA 3TRIA 5JSFA 2AG5A 1DOHA 4N54A 3CXRA 1BXKA 3I9KA 4WLFA 5IN5A 1K3TA 4BMVA 1KC3A 5HS4A 1HDOA 4NMHA 4J1SA 4L9RA 3I9JA 1E3JA 3WGGA 1HE2A 4YB8A 4BGIA 3WYCA 1OOEA 1Z6ZA 2A94A 1HSZA 5KJEA 4BKPA 1ADBA 4DQXA 1IULA 1WAMA 4CM3A 1NPYA 2YV2A 2JL1A 3KO8A 5KTKA 1F8FA 4PLGA 4D42A 1U7TA 1ADFA 2Z5LA 4Z3KA 5DOZA 4EZBA 4M49A 2A4KA 1B7GO 2JD2A 2WYVA 4H15A 1RPNA 5AQ1A 2VOJA 5JW6A 2BELA 1PJSA 3ANNA 3NTOA 4PFJA 5A5EA 2TMGA 1NX6A 5I9NA 3D0OA 1G0NA 3PFFA 4ND3A 4XIJA 2Y0CA 3IMFA 4E13A 1Y9AA 1X7GA 1D3AA 5IFLA 2C2XA 2YV3A 3PIIA 3HUDA 1XYGA 4CM5A 4M55A 2Q2WA 3BTSA 1KVTA 2AMFA 4YQYA 1SC6A 2X0IA 1WW8A 4CQMA 2QG4A 3DBLB 2BLLA 2X9VA 4BO8A 5L4LA 1P77A 2B83A 3DZKA 3AY3A 3EW7A 1MXHA 2EP5A 1LQUA 3GZ4A 4DQUA 5KIAA 1JKJA 3W6ZA 4JJFA 3D64A 1U8FO 4RO0A 4TKLA 4N5LA 2GZ1A 1NQ5A 4EI2A 1KEPA 1U2DA 4G81A 5CAEA 1HE5A 1LRJA 2OGUA 5G0UA 3M1LA 1ZSVA 1B16A 1WNTA 1DIHA 1XU9A 5TNXA 3Q11A 3H65A 5A9TA 3PQFA 1QR6A 2E82A 1PS0A 3AW9A 3U09A 3DDNA 2EWMA 1Q1NA 2OBYA 3QQPA 3LC7O 4J0FA 2FR1A 4II3A 3OECA 3O4RA 2ZB7A 4PG5A 4CM1A 1ZXLA 3GVIA 4AJPA 3Q3CA 2CVZA 2GN9A 1R37A 1ISJA 2FR0A 3JTMA 4IDDA 1H0KA 1QYXA 4NJMA 3NJ8A 3R3JA 1VL8A 3U9LA 4KTTE 1NAIA 2RIRA 1VSUA 4PG7A 1T1RA 5CFZA 3PEFA 5EQDA 4CV0A 1E3WA 1J0XO 4A26A 2IRWA 3H5NA 3E6AA 4ALJA 4J1QA 4FCCA 2D59A 5ILGA 5L53A 3AUUA 1HT0A 4JJGA 2HJSA 4QEDA 4BNNA 2G1UA 4IGFA 5CDGA 4CQLB 3AI1A 1L7EA 1ID1A 1WXDA 3UUWA 3M2PA 1AHIA 4L4XA 3A1NA 4Q3CA 1E92A 5GY7A 4BIIA 5EQFA 1Q0HA 3TZQA 4DPLA 3FCOA 2NACA 3L77A 5CPFA 3RASA 3ROQA 3G1UA 5EINA 2FHSA 4DVJA 3AI3A 1GUZA 1V3UA 1R4NB 3UH1A 3B6ZA 4E31A 4Z9YA 4KUGA 4TRMA 1ZK0A 3K73O 4XJSA 1QRRA 3ADOA 1C0LA 3SC6A 2Y1EA 3JD4A 1U3WA 4FFOA 2ZTUA 5KVQA 3RC7A 3T7CA 3KEOA 1P3DA 5CDUA 3D5TA 3HSKA 3Q2IA 1MXFA 2B4QA 3ZHBA 3KOUA 1LLDA 3ROKA 5GZ3A 3IIEA 3MJSA 1LUAA 3U62A 4HXYA 5JMPA 4B4WA 3ASUA 1D1TA 1IHXA 1PWXA 3OJFA 4JLWA 3FNFA 4XX0A 1EUDA 3BYZA 3LF2A 4Q9NA 3F4LA 3S8MA 1E1MA 3MJCA 4TQGA 2NUAA 3UGKA 2G0TA 4NJOA 3KLPX 1U4SA 5KJ6A 5F1PA 1XELA 4UUPA 2HSDA 1LC3A 4Y9DA 3BA1A 5DP2A 1NR7A 3PTZA 2GZ2A 1PR3A 1EFKA 2F1KA 3PZRA 1N9GA 4UUMA 3MTGA 1ZO8A 1I2ZA 2J3JA 2UVDA 3UKOA 5DBIA 1DAOA 2NM0A 3RUHA 3AOEC 3E82A 1RJWA 4R01A 2WMDA 2Z1NA 1FDUA 3ZNOA 3PJDA 4I5GA 4MVJF 4L0QA 4EJMA 3OM9A 3L4SO 3WXBA 4K28A 3NUGA 3EZYA 1O94A 4PLPA 4YJGB 3PQDA 4D3DA 5KJ1A 2C07A 5JY6A 4RLSA 3AY6A 2QRJA 1B26A 2FSVA 5L4SA 3H3JA 3DL2A 4R41A 1M67A 1XCBA 1LDMA 5IXSA 2P9EA 1DJNA 3G49A 4NNJA 4Q39A 4ZQEA 3C1AA 1G1AA 4UVEA 2WJPA 4IIUA 4DUPA 2P68A 3LSYA 3S1LA 4B7XA 1T2FA 1U7HA 3GC6A 3GEMA 2AQIA 3EUWA 4L8VA 2D0IA 1IZ0A 3LLSA 2GN4A 4BGUA 4PLWA 5BSFA 1PX0A 4CLRB 2RHRA 5ES3A 3K5PA 2FMUA 4YDRA 4ZRMA 3WS7A 5MDHA 1KEUA 3QWBA 3D5QA 1K89A 5KJCA 3E9QA 2GN6A 1Z82A 4K6CA 1H93A 3EVTA 4UVDA 2B4TO 4M8SA 2B36A 4PIVA 1ZK4A 3EC7A 4DTIA 4XYLA 5I8WA 1YWGO 5L4NA 4RVUA 3DZIA 3F4BA 1BW9B 4CMJA 1AXEA 2HO5A 4RL6A 5JPIA 3WWYA 4XJTA 5L40A 4BQPA 1O95A 1PJBA 1SOVA 2J3KA 2BI8A 1UR5A 2EEZA 1BXGB 3FWNA 1UH5A 4ID9A 2I67A 1EEHA 1U1IA 4ALIA 2V6FA 4R9RA 4XGNA 2C5AA 3GN1A 3C7DB 3GQVA 4J91A 4E32A 2GERA 3PYMA 2PGLA 5DBFA 2PH3A 5DT9A 4BO0A 3DO5A 1H94A 1HDRA 1ZBQA 2R00C 2YYYA 1TEHA 3V2HA 4BKOA 4F6LA 4R54A 4DMLA 1HDXA 2EF1A 3KM0A 4ZGWA 2C7VA 1P1JA 4D3SA 2Q49A 1YBAA 3O8QA 3VPSA 2E37A 3GGOA 2VUUA 4AJNA 1Y8QB 3ZWPA 1UUFA 3KLMX 1YOVB 1YB4A 3DZFA 2I65A 4FBGA 4GX0A 1EK6A 3F3SA 1ZEJA 5C3MA 2PA3A 2JD0A 2W2KA 4MINA 4IDCA 1PGNA 5CDSA 2X5JO 4NFYA 3SVTA 2EJVA 3PLRA 2V6GA 4CQLA 2B4RO 3JCZA 4BMSA 3DONA 1ONNA 1QP8A 1HKUA 3PGJA 4BO1A 4JK3A 3W8FA 2ZYGA 3I4CA 3AI2A 2C7GA 1B15A 4WLOA 4IMPA 5G0WA 4HV4A 4AFNA 1R4NA 4B7CA 3DAPA 3H2SA 1UAGA 2O3UA 1JVSA 2A92A 1VI2A 3E9MA 5DCWA 5KKAA 3AJRA 4BHTA 4XGKA 1R66A 3BIOA 5BNTA 4CR8A 2NTJA 2FP4A 5B4UA 4BUCA 1KY4A 3CSDA 1LQTA 2VHZA 2Y93A 3ULKA 1NQOA 5HBRA 3ST7A 8ADHA 4NIMA 3FD8A 1H2HA 4LK3A 4FQ8A 2X0JA 4NFSA 3ZWVA 4ALMA 3IJRA 3LT0A 2FY8A 1EVJA 1IB6A 2OUIA 5I7EA 4UVGA 1M76A 4ZHSA 2O4CA 5F5NA 5ER6A 3ON5A 1E7YA 1PZEA 3UCEA 3MOIA 4JGBA 3D4NA 3ZCXA 4D44A 1QLHA 4P4GA 1JKIA 5IJZA 2Y99A 1CYDA 3EYWA 5CDYA 2AW5A 2VN8A 1MG0A 3FNGA 3M1AA 4IJVA 3K92A 4KUEA 3AM3A 1ADGA 3WTCA 5JDIC 1RM4A 3RSHA 4YJHB 2O48X 1EE2A 1QG6A 1K6JA 4U0JA 2HK7A 2XAAA 4GAEA 2IDZA 2P5UA 2EW8A 3WGYA 3AU8A 1UDAA 1ISMA 3WLFA 5JY1A 4AVYA 4EUHA 3VZQA 1F12A 1G6KA 2E48A 4BO4A 1MFZA 1B0AA 3F1KA 4WNCA 2NTNA 4YJGA 3DEYX 1HYEA 2BGLA 2IXAA 2DTXA 1E7SA 2Q1SA 5TGDA 1OFGA 3PFWO 4JXKA 1Q7GA 4XD2A 3NAQA 4R3WA 1HEUA 4MVJP 5JDCA 8LDHA 1YVEI 1Y9EA 2ZATA 2CDBA 3BMNA 1LDEA 3E18A 4J7CA 2YY7A 1HE4A 4IGEA 4NBTA 3WFIA 1ZEMA 1ISHA 3TJRA 2NNLD 4ND2A 5U9CA 3BHMA 3VZPA 1UP7A 2OL4A 3KSDO 2BFPA 4RPLA 3FF4A 4DPKA 2EERA 1P1RA 5H81A 4ONEA 4FN4A 3ZHZA 4MVJM 1AN9A 1TT5A 2WM3A 3HN7A 3GFGA 1ARZA 4XDZA 2ET6A 4B79A 1ONPA 4W6ZA 3GY0A 1PU2A 5BNIA 4MOWA 3K8ZA 3V1YA 2PZLA 1ML3A 4BKUA 1W0CA 1GV1A 2X4GA 3CH6A 1EBUA 1L1FA 3QVOA 4AJKA 1J49A 4RGBA 3V5NA 3P2YA 1XA0A 4FJ1A 2Z1MA 1K6XA 1PR9A 2UDPA 1NP3A 2WSBA 3V1TC 3UVEA 4BKQA 1SZJG 2FOIA 3I9NA 4FIZA 4TROA 4YJDA 4LCEA 1DDOA 3NT4A 4JCOA 3HG7A 1YRLA 4WOJA 1G0OA 1BVRA 1Y1PA 2DPGA 4W7HA 3ETEA 3RJ9A 3V2UA 4QUKA 2DQ4A 2Y68A 4RVHA 3ONDA 4RCVA 1Y5MA 2C54A 4IXTA 1R0KA 4Q3BA 4I9HA 2OZPA 1KEWA 5DBGA 4BO9A 5TLSA 1AUPA 3JD1A 3ZV6A 3HDHA 4CMKA 4CODB 9LDTA 1GTMA 2PFGA 4ND5A 4QECA 1GQ2A 3VKVA 2DBRA 4J9VA 2IODA 3X2EA 2Y67A 3JQ6A 4J2HA 1N1EA 3MWEB 4ZD6A 3PZBA 2AHRA 4WPGA 5JCXA 1E3EA 4I9NA 1Y8QA 3NDJA 4BGVA 1M6WA 2BFAA 3G1TA 2OBNA 3D3WA 5T57A 2PK3A 3V1UA 1Y8RB 2DFVA 3DZJA 3VDQA 4ALNA 3RC1A 4BO5A 1P44A 2EP7A 2Y05A 4J1NA 3G0OA 4Z6KA 1ENOA 3HNPA 1O8CA 4PLFA 2R00A 1XQ6A 3RUIA 3PP8A 5DCUA 1NPDA 1KC1A 4TRJA 4L4RA 3OP4A 1LBEA 4PLYA 1DC4A 1DRWA 4GWGA 2BMAA 3IQDB 2ZYAA 2UV8A 4LMRA 2VQ3A 3EVNA 4DLAA 2I66A 2NQTA 5CG1A 3RQSA 1O0SA 1NBOA 3HZZA 2E4AA 3SC4A 3LC2O 2YFQA 4XKJA 2C29D 3RBVA 4CM6A 1ORRA 1WMBA 1DLIA 5L51A 4LMPA 4DC1A 1LDNA 2PZKA 2GCGA 1DC5A 4TVBA 3DMTA 4WUVA 2X5KO 3E5MA 3TZCA 2HJRA 1W6UA 2GNAA 5THKA 3PJEA 4ND1A 3RC9A 1X0XA 4BO2A 5JCJD 3UW3A 1DHRA 3QE3A 4AJ4A 1VJTA 1UJMA 1PJ3A 1PQUA 4HY3A 2QW8A 2O50A 3DQPA 3E48A 1NVTA 2HRBA 1PZHA 3OH8A 4IDAA 1NQAO 3OIFA 3PHJA 2CF6A 4I5FA 5B1YA 1DBVO 1J6UA 2W4QA 2GLXA 1IPEA 1MP0A 1QKIA 2FWMX 3JQGA 2E6UX 2HMVA 2WD7A 1V9LA 1KERA 3CZMA 3H9UA 5BQFA 1P74A 1GQQA 2GSDA 2W90A 2GR9A 5IG2A 4RQTA 4WLNA 2FPPA 5IDQA 3OJLA 3OJOA 1HYHA 4R1SA 4FW8A 3D3EA 3UCFA 4XIYA 1CERA 3VVCA 3WBBA 3GEGA 1E1KA 1QYVA 4E2WA 1LTHR 1PJ4A 3DHEA 5HRUA 3DZBA 1H6AA 2QRKA 3V2GA 3KTDA 1SBYA 4X54A 2DC1A 3DBRB 2NV6A 4YJHA 2X0NA 3F5SA 3PIDA 1GR0A 4IDBA 3F1LA 1IZ9A 2BD0A 1ZJYA 4IUYA 1KEVA 1B14A 3DZGA 4ZQFA 4CMIB 4E2YA 4J7UA 5IZCA 1UDBA 4PG4A 3ITKA 2AEMA 3H8VA 3I6IA 2CDCA 1YQDA 4I5EA 3FR8A 5L7TA 1Z75A 3AK4A 3Q2KA 3GGGA 3P19A 2EG9A 1P33A 4J4HA 4CL3A 2B35A 3DFZA 2DTEA 1MUUA 4CMGA 1ZK2A 4GKBA 4JBHA 2PTGA 3FNHA 3UF0A 3DZHA 2UAGA 4JNKA 1YBVA 2AQKA 4OM8A 4EUFA 4YAEA 2O7QA 1R12A 4WLVA 4DBVO 2DAPA 1N9GB 4KZPA 3TL2A 1A4IA 4IQ8A 2NSDA 3FSRA 5JAIA 3ZV4A 1VL6A 1PL8A 4FD3A 2F00A 5BSEA 4R1UA 1FJHA 4ZQBA 2VT2A 5AOVA 1PGOA 1C0KA 2EV9A 3GHHA 4QO7A 3Q0EA 5JYDA 1JN0A 3L4BC 2IZZA 3CPSA 1I2CA 1WPQA 3P2OA 5JCJA 3QVTA 5CPBA 1I3LA 4CM9D 4KMSA 3VH4A 3GFBA 3EDMA 4FOSA 1H2BA 3GDOA 4AJEA 2DTDA 4AJIA 2AG8A 5AXAA 4FFLA 3MTJA 4BO7A 2V7PA 2Y1CA 2HDHA 1WDKA 2C82A 3RU7A 1K0UA 1Z45A 4ZRNA 1ONOA 1ZCJA 3LK7A 4XB1A 6LDHA 4NH4A 1JQBA 1WP4A 4PCVA 3HE3A 3NDIA 1PQPA 1X0VA 4RPKA 4YBZA 1B8UA 4PG8A 1GV0A 4BNYA 2OP0A 2ZQZA 5F3RA 2PD3A 3U4HA 1ZSNA 3DB2A 3VKUA 5DF1A 3ZWAA 3W4JA 1CETA 1CF2O 4AJ2A 1YONA 2ZKLA 1R4MB 3OJEA 2CFCA 4NBUA 2Q3EA 4EITA 4KDFA 3QV1A 2D2IA 3EGOA 4U6QA 1XLTA 4F46A 2J3IA 2P9GA 4OSPA 3CE6A 4EDFA 2O3RA 1U5CA 4RVSA 5L7YA 4M54A 3WX0A 1OC4A 5JS6A 5EL0A 2GZ3A 1S6YA 2J5RA 4EEZA 4AJHA 4DXHA 4OKNA 3BTUA 4KQXA 1U3TA 1DFHA 2NU6A 4JROA 2X58A 3Q6IA 1VPDA 4IZIA 3EY4A 1KVSA 1C0PA 1Y8RA 3B70A 5K6AA 4RVGA 4ZQGA 1LLUA 5L45A 3VDRA 5A5FA 2O3TA 3ANMA 4BNLA 1N5DA 1BHSA 1V0JA 1VLLA 1YQXA 2J5QA 2ZJ0A 4CLXA 4J49A 2RCYA 4YJFB 3B1JA 2AEFA 1MA0A 4D46A 3UAGA 2RHCA 3F5QA 2X22A 3L9XA 3TOZA 2JFGA 5KOIA 4O0LA 4WJZA 3D7LA 2DVMA 4RPGA 4E5PA 1JLLA 4FJ2A 4IPTA 1BDBA 4FC7A 2DT5A 3BMOB 2GYYA 2PLAA 1WZEA 3O8QB 3WFJA 4FSHA 1CEQA 3VPXA 1I30A 1YDWA 1YL6A 1I36A 1IE3A 4CM9A 1YXMA 2DFDA 4IJWA 4UEJA 4XCVA 3A4VA 4AJLA 1J4AA 4QO8A 2W2KB 3U4DA 4DQVA 2VCYA 1Z7BA 3U4CA 4FJ0A 3WR5A 2AA3A 1KETA 2G82A 4MIYA 1E7QA 5HWSA 2C20A 3A14A 5COBA 1JA9A 2HKIA 1T2AA 5A06A 3BTVA 5B12A 1CJCA 2EXXA 2ZB8A 4BNJA 3TN7A 4D0RA 1F0YA 1ZSYA 3ORFA 4WEQA 5CDTA 1YL5A 1BXZA 4FB5A 1Q7BA 3KRTA 4OMUA 4XEHA 5TX7A 2VOEA 5EN4A 5JAZA 1O89A 2WYWA 2FPIA 4TSKA 4PLVA 5T8KA 5DDIP 1OZAA 1NPTO 4CMEA 1A72A 1UDCA 3I9LA 3PDUA 5FEUA 4R1NA 1QORA 1F06A 1JTVA 2AQHA 1AGNA 1V3TA 2W2LD 3K6JA 3LT1A 3U49A 2BF7A 4CM4B 4JP2A 4D45A 1Z74A 3DBRA 1ZMOA 1LXCA 2YQ4A 3AFNA 3IKVA 4DIOA 4ZICA 4PRKA 2Y66A 4B4UA 4FS3A 4R51A 4BNGA 1DO8A 3LDHA 3ZWCA 4MP8A 4OGWA 1D1SA 4CMIA 1PJCA 3ZWWA 3ZWXA 2BHLA 3NEPX 3INGA 1I3NA 3TF5A 3I3OA 2X8LA 5K9ZA 3BXXA 3DR3A 3LYLA 2XXBA 1QLJA 3BHJA 2Q4EA 4MVJI 1Y7TA 5A4DA 2HCTA 2ILTA 1E3SA 5A9SA 2DKNA 2EJWA 3S55A 4BQRA 2QHXA 5C5IA 4PLHA 4RPJA 2IEDA 2CY0A 3JQDA 1TI7A 5JDCC 4WKGA 4J7XA 1R16A 1R6DA 2YV1A 3GPIA 4D3FA 3PWSA 4B3JA 1FDSA 1E6WA 4A27A 3PVZA 3ZNPA 1DEHA 1GYRA 2I9PA 5TT1A 1RM5A 4EJ0A 2DPHA 4YAJA 3QWFA 5T67A 5FYDA 1I0ZA 4YWJA 3GAZA 5DN9A 3GAFA 2NVBA 2HMUA 5TT0A 3UCXA 4BNHA 5ENDA 1DRUA 1EQ2A 3WNQA 1YDEA 4RF2A 4HNHA 3NYWA 3ICPA 5JAQA 1O6ZA 2J6IA 3OQBA 2PKRA 1KVUA 3PHGA 3AM4A 1PGPA 1IYZA 1XIVA 2HUNA 3BMNB 4YT4A 4J4TA 2X9GA 3TL3A 5L7WA 5F1KA 3GPDG 2WE8A 1MC5A 3LLVA 4XZ3A 5L95A 5F21A 2JD1A 4HFMA 1GEGA 3DC2A 1D7OA 3U5TA 3WGHA 3RBXA 4C4OA 1GYPA 4J2OA 1TT5B 4DYDA 1IHYA
chains in the Genus database with same CATH superfamily
1KQNA 4G9EA 2KB0A 1RWPA 2WD8A 1EVZA 1CZOA 3GA0A 5FYQA 3RI3A 4F5YA 4F3CA 1K66A 2CJPA 3E1GA 2JIPA 4G5RA 4LVUA 5E0OA 5TMDA 1OZ0A 3RRBA 3WGKA 4HAVA 1RXIA 4NBRA 3OD1A 4YV0A 3IHLA 4PHGA 3GLGB 1Z6QA 2BEWA 5B3AA 2P2CA 3I04M 2ZRGA 1YK0A 2YS6A 3AJAA 3L4KA 3OF3A 4KN5A 3I9V6 3B36A 1LA2A 2HDNB 4BOYA 2VZ8A 4DB2A 5CXUA 1MOQA 1RLOA 3MMZA 3T7JA 4KB5A 2VHWA 3T5CA 3CLSC 3L07A 2EZ9A 2J08A 1JWAB 2FPWA 3PFIA 2Z4SA 4M8IA 4XIFA 3LS2A 3T3NA 1HNZB 2HDOA 3KKEA 3AHDA 4F92B 2IY7A 2KWIA 4Q9HA 4CLHA 1YZQA 2AZDA 2PZFA 2ENUA 1M5UA 3OI7A 1CK4A 2IUSA 2WAXA 4K26A 4LMAA 4OB7A 3HCPA 4TTPA 4NLLA 2X8BA 5EOVA 4Z1MD 4TMYA 1BMFD 2XX3A 1T9KA 3B51X 4AMYA 2GESA 1JA0A 4DUZB 5DLYA 2Y1WA 4U5QA 4LXGA 3ZKAA 2B7CA 4WZBE 1JBQA 2AFVA 3FPBA 4W1PA 1NY6A 3BGDA 4N8EA 3Q6NA 4BB5A 3OHSX 2JJ2D 4HD8A 3ZQJA 3KK0A 3O26A 4WCFA 2FLVA 3A6HA 2ZSFA 1E4EB 1F6DA 1HETA 4E12A 1W88B 4EYKA 3R5JA 1SMKA 2OCGA 4UAGA 3IP7A 3LYHA 4MWOA 4TYWA 2G28A 4YRDA 1MQSA 3LCUA 2OV2A 3BMOA 3WC4A 4L0CA 121PA 4LOHA 3JWPA 4U5XA 5EPOA 3RFXA 1UMDA 3QXJA 2FN9A 1E77A 1BNCA 1NM5A 3K1JA 3QOWA 1GPKA 4EAQA 4PG6A 3UN1A 2ZROA 5IC4A 4MB2A 5KSPA 4A2PA 4AQYB 4WK0B 3EXFB 1OI2A 3MMPA 4ZVNA 3RYHA 4BLWA 4F3TA 1CUVA 2CB9A 3IEVA 2Z3WA 4O8CA 2Q6KA 4UMVA 1P9RA 3LHSA 2XMCA 1TUBA 1KSHA 3CLTC 3KUKA 3RU3A 4GDFA 3G2PA 4M1WA 2PJRA 3NLLA 4QJ5A 3BIFA 4I4TF 4A03A 5IUNC 1RJDA 1T0UA 2HA4A 1XP8A 1S2IA 4CYMA 1GZUA 3BSFA 3IULA 3RUEA 1N5MA 2PRSA 2XE7A 4YT8A 4RHXA 1JFSA 3C24A 3MJVA 3O9ZA 1TKCA 2MWMA 1OFIA 3KP1A 3BH6A 4OP2A 5L6LB 4NCBA 4DMFA 1DTWB 1S3IA 1N1GA 1OD6A 3MJ4A 4M38A 3EGDA 3BULA 5HM6A 2HV9A 4KVGA 4LV8B 1A8HA 5EEHA 2C88A 4X24A 4Q9JA 5FFFA 2PH5A 5MGBA 1QS0A 3QVXA 4J1TC 3A2MA 4UARA 1KR2A 5EWLA 2IS6A 3BORA 4S04A 2C2MA 2G63A 3OQOA 1G3MA 1I13A 1PI3A 3LOQA 3K5WA 3L7DA 4K6MA 5I4BA 1VLVA 1D09A 1E20A 1P9LA 1BKDR 3ETDA 1G20A 2BFMA 2VZLA 2NUTB 4KXFB 4Z9FA 3W5DA 3WBFA 1N5OX 2NZWA 1OV6A 4BDTA 4IO0A 3PSHA 5JFTA 3ZI0A 3RWBA 5CB4A 1WTCA 2FPXA 3RD5A 4CM4A 3A0RB 3C74A 4I8IA 1D7AA 2FEXA 3GF4A 9MHTA 2H1VA 2NO0A 2Y92A 2PQ6A 2YJNA 2AZMA 3U1TA 3VR0A 4F60A 3PTAA 4CEHA 1UMKA 4OHXA 2ZB3A 5FUYA 1OB2A 1L4EA 4AKGA 4QATA 5CM8B 3L6CA 1B0PA 3BILA 2G6BA 3KOZA 3RGGA 2ZIVB 4RK7A 3D7RA 4N6GA 3UMYA 3RCBA 3IT0A 3KVVA 1R9NA 3GEBA 3LJKA 4IZOA 4IP0A 2JLXA 3WYNA 2XCOA 3PPXA 1M8JA 4ND7A 5E1OA 1PDOA 4JKIA 3D2AA 1R7RA 1XLWA 2EGHA 4HEA6 1GEEA 4R1TA 3OHMA 3U16A 3L8CA 1T2NA 2YXPX 3KUXA 2FZ5A 4FHGA 3D7KA 4N4AA 4BCDA 2F17A 1YKFA 5C37A 1NV8A 4P3PA 4YQEA 3HY6A 1CP2A 5IAAA 2KLHA 2A9FA 4BX2A 4UUQA 2X9LA 3TLCA 1T4GA 3P0IA 3I8OA 4DRXA 2PBFA 3R6DA 4F8EA 2ID8A 2TS1A 3MVEA 3I62A 3AVYA 1Z0UA 5JJLA 3MN1A 1VQ1A 2HMWA 3C1TA 1C1DA 1L7DA 3TH5A 4F5WA 2X2EA 2X8JB 1F2DA 4RL4A 3LKDA 3N8GA 3QHQA 4EHNA 1VKZA 3JQAB 4D97A 2GX6A 4QODA 5DNCA 1HFKA 1L7OA 2CVQA 2IW1A 4EUKA 3TXAA 4LRTB 5DCYA 2GLTA 5L3RA 3ZHYA 4IIJB 4R6XA 2B6NA 3HJCA 2QLFA 1JRLA 4I8XA 4IEIA 2WHQA 1CRWG 2OV8A 1EWTA 3HP1A 2WE7A 4DANA 3CONA 3OPXA 4HZGA 1J07A 4S0XA 3VZRA 2C98A 1NFFA 1WPRA 3OOYA 3ZLTA 4TMVA 5K4AA 3EFOB 1A7UA 1QQ5A 4WDQA 1H9CA 3WSWA 1BOOA 4RE5A 3TRKA 3EXAA 1Q14A 1TT7A 2AN5A 1GPJA 2XKAA 3B48A 3L6UA 3L8YA 4WK6A 4FFMA 4P80A 1E5DA 3QW4B 4JXZA 1M1XB 2IZ1A 3FDIA 3GNSA 1CUZA 4ML3A 5FUQA 3MWKA 4WV3A 2PUCA 5B57C 3GIWA 3ZI7A 4KN8A 3GPBA 4WKOA 3P0HA 5KU1A 2QVXX 3CR3C 3OESA 4Y6QA 1MTOA 5CM9C 5LJIA 4NYMQ 3DOOA 4D8WA 3BG5A 1WM1A 1ZUHA 5L9AA 4D9EA 1W93A 3INTA 2IYZA 3Q41A 5T6BA 5F2EA 3SQMA 1B3RA 5KPDA 4ATNA 4N6NA 2WUGA 3SC3A 2QPAA 4ESHA 3HTXA 4Z4FA 2JCXA 3MQFA 4DY4A 1NHGA 3SKVA 3GFPA 3LPDA 1E64A 2IXDA 4NV3A 3WRXA 5I7SA 3PNQA 5IDXA 4HWRA 1H65A 1CP3A 2DZDA 3M9WA 2QQGA 2ZDHA 4KE7A 5ETJA 1M66A 4FK8A 5IC6A 3ZZNA 3W2FA 4IJ6A 1VKOA 1U5BA 1KEKA 2DPXA 3QBEA 2HJWA 2P9CA 2YWCA 2K7FA 2IK8A 4LVCA 2XCLA 5IDWA 3MWDA 2C4KA 1ECGA 2HFJA 3JQ8A 4RVDA 3UAZA 4D9CA 3DDZX 2NU8A 1X86B 4PYMA 1KA9H 3KB6A 4XDHA 2FWAA 2OT3B 2QY6A 5EIEA 1QZTA 4MKRA 2QPLA 2PYZA 4F6CA 2PANA 3BCRA 3IUQA 3F3YA 3OP1A 3Q0TA 1L7PA 2GN8A 4N7RA 2CXNA 2PMDA 3FOCA 4MR8B 4Z0HO 2JLBA 1SUFA 2IUYA 1KMHB 4P53A 1DV1A 1QGDA 3WNCA 1TZCA 4AP6A 3BJRA 2OFPA 1B73A 2PGJA 3DAOA 4YRZA 5HJ5A 4FYYA 4D0GA 4JI3B 3QEBZ 4B3IA 4GMXA 3N2IA 1VSVA 4GPD1 4LAFA 5H7XA 1EVYA 4MUYA 5LZ9A 3JYPA 2PQMA 4RTNA 1Y0BA 4ARSA 3SXPA 2JAUA 3F8WA 3K9CA 4PZCA 3SM3A 1H23A 2GF9A 4NU6A 3HFGA 3G9TA 1IJFA 1ULHA 1I4WA 5ICSA 5A6SA 1LZLA 2UXCB 1J8FA 3AF2A 4H3HB 4LBYA 4QX6A 4BN0A 1X87A 2HPZA 2X77A 1H6BA 4GMFA 3MZ0A 4X6UA 3WNZA 2LZ0A 4MUAA 4FGWA 2WT4A 1W30A 4JKYA 4GWLA 5AJUA 5AJVB 2O2IA 3R1IA 4ARZB 3MOGA 1Q1EA 3DXFA 2V97A 1RWMA 4KP7A 1XL1A 5DNEA 3UFXA 1I3MA 1QAMA 3ZGYA 1FZQA 2GTHA 2W43A 2ZP1A 1G16A 3NWEA 2OO5C 4I3GA 4QTXA 1MZVA 1T2DA 4Q82A 3KJNA 3KALA 1X1EA 3PX2A 2GD1O 2P62A 4TWIA 3COSA 1P7YA 3CIFA 1VYUA 3NPAA 4FYHA 3ADPA 4JOSA 1DJPA 2C8JA 2O57A 3FGPA 1CQZA 4NKRA 2DF8A 1DAKA 3LT5A 3BZUA 3D5EA 2IEBA 1QIHA 4YEDA 4CIWA 2BV3A 2WTBA 3M34A 2K2QB 3PPIA 4FVTA 4NZ9A 4YJ2F 3UXMA 1D9XA 3UHOA 5BV0A 3BHIA 1U3DA 1V8FA 3C5VA 3IVRA 3A0UA 5FTLA 2BGKA 2RMKA 1TRHA 1GPDG 3PF8A 2GJSA 1TL7C 2IEZA 2NSLA 1R6AA 2WJVA 4L9AA 4U6SA 1ISRA 1V16A 3M4NA 4HZUB 2JKYA 4KGZA 4OLFA 1RXSA 1GAEO 4RM3A 4R3NA 2EOAA 4B9AA 1IN8A 1A2KC 1MC1A 4FX2A 4J0EA 1GRRA 1W5BA 1NURA 3ZC3A 2G72A 5LQNA 4US0R 1C80A 1DAMA 3EEIA 5BXQC 3W4KA 1KDZA 1EWQA 4Y0NA 1YK1A 3ZD6A 2XLCA 2WTAA 1SQFA 1ZIYA 3C15C 2CBXA 3WDKA 2O2SA 4IGAA 2L17A 2ECOA 3QPUA 4HTFA 5G0VA 3AOGA 5LYJA 3D0KA 4FNAA 4QRHA 1X3SA 3UEOA 4P3OA 4JN6B 2OO7A 2BTQA 3BJZA 4FNGA 1YL7A 4WADA 5BR1A 3W5HA 3B3GA 4QXMA 2O8FB 1GNVA 1QFSA 2YWEA 4BDSA 4D8VA 4A8JC 4YLEA 1COWD 3FBGA 1LPNA 1QMGA 1ZUIA 1OXKB 2ZULA 3F98A 3GVCA 3VKFA 5I9LA 1XUOA 4K2HA 5D7BA 3SYLA 1RWQA 3ZHCA 4A7PA 3R3SA 4UKDA 1ULZA 2IHZA 4P54A 4EVIA 1CZKA 4KAJA 3EIHA 1F6WA 1W4BA 5NLLA 5JO9A 3WICA 4DXDA 3N86A 2JZOA 2OOKA 1I0IA 1UFOA 3AM5A 1W0JD 1N32B 4ROTA 3VUEA 1QOQB 2FN8A 3UJHA 1X7XA 2A30A 2OHHA 1PT6A 3OOSA 4LHWA 4X97A 3AFMA 5K8VA 3M3HA 5M7EA 1C41A 1ZGZA 4MTLA 3RVNA 3U7RA 4ZO8A 2JIQA 1RACA 2DM6A 2EJBA 3JYNA 4R68A 1LX6A 1YB1A 5EP1A 1Y1SA 5FTWA 2YIDA 2EQAA 3L7CA 1M2HA 4HNAA 3UMJA 4DMMA 3ETJA 4QNNA 4ECAA 1BU8A 1MKYA 1YCHA 2BBWA 3TYXA 4DLXA 4M9SA 4HUTA 1RYHA 1XHLA 2ESRA 2YFKA 3ROGA 2ZRPA 4Q4JB 5FADA 1B00A 3L92A 2PT7A 1I6LA 1KP2A 4QYIB 1U3UA 4UNIA 3VOSA 2QRLA 1RS0A 4EGAA 2WWHA 4PZDA 3ROXA 4B76A 1QV6A 1T43A 4ND8B 1U8EA 3W34A 5A9SB 1RZUA 2P9BA 5BQ5A 3M5CA 2MSEB 1N3LA 3AEQA 3GLQA 3TAUA 4AS3A 2CXOA 2HSJA 3Q7IA 4DR1B 1P1BA 3QFHA 2R8OA 3D6MA 4PC1A 1PRYA 2OKGA 4AIRA 4YMGA 1FU4A 3GELA 3HXKA 3WMXA 4C4ZA 4ENWA 1BVYF 1P1IA 3GVHA 3AONB 3O3CA 4MJXA 1UL1X 1OJ7A 4XYBA 5A04A 3I52A 4IV8A 1HNXB 4MW9A 5COAA 1QTQA 2BIFA 1E0JA 2WKSA 2HHCA 1C2YA 1TZJA 4IZHA 3KYBA 3O6VA 3NU1A 2NVWA 3EMKA 3KTAB 4GZLA 1C4OA 1MNAA 1B6TA 1M1YA 2PUWA 4GKVA 4LK2A 1UBOS 1EMDA 4R1PA 4TZTA 2XBMA 3PEYA 1PQ4A 1V2GA 3X1XA 4B73A 4F8YA 2W2PA 3PQEA 3LVFO 1SHJA 3QLJA 4MXDA 1ZK3A 2I71A 3WLHA 4OQ4A 3S27A 4MUGA 1Z8FA 2P3QA 5EJ2A 4AB1A 1HDCA 4O4JB 3ZDRA 2HIGA 4BMNA 3U39A 3WO1A 3I30X 1SUDA 3K96A 4K8OA 3RR2A 2ZIXA 1QYDA 3NBYC 3SLRA 4KKVA 2CHFA 3I6ZA 1HDGO 5IDYA 1WLYA 5D1HA 3BD7A 1M2FA 1Y81A 1EH5A 3H17A 3LIIA 1THTA 1GNQA 4CLOA 2HU7A 2PX2A 4HWPA 1I3OA 2XNJA 2PSSA 3G0CA 1KOLA 1N78A 2X5XA 3QU4A 3R8FA 1MB2A 1QCCA 4WCVA 3U7QA 2P6OA 1H3NA 4QWMA 3QELB 2PZMA 4DRYA 1A2OA 5HQ3A 4WXYB 4XGQA 5EZYB 5FPYA 1PNRA 2XQFA 1M3SA 1Y6ZA 4LXUA 4XWYA 4AI6A 1V5FA 3TLYA 3PUYA 2QNRA 3FCYA 4IVPA 5J4KA 1RWNA 2K4MA 4DAEA 3AY7A 4BMPB 4OU5A 4KYIB 4LGYA 1RAGA 1BD4A 2CXQA 3L02A 4NCKA 4OFBA 1FFXA 1Z0FA 3E9EA 2VHTA 2AN1A 2ZIZA 3RVQA 1FB5A 4BKRA 5BUQA 2Y9MB 1MAVA 3CWZA 3T7RA 2P30A 1RHKA 2XYHA 3CN9A 1EX1A 1NMYA 1QOZA 2ZJYA 2SKEA 4WCFC 5TRTA 1OFUA 4QDZA 4B45A 4XVCA 5JVDA 5EZ6B 5U4XA 3WWZA 3SEZA 3AC0A 4MV5A 2VNJA 2CSXA 3ISVA 3ZJ4A 1QVZA 1EUCB 2JI6A 3IDQA 2GCEA 2DFNA 4I14A 4I0WB 4M9RA 4GOMD 4ZCIA 2VPXA 4QHYA 1BSVA 1HA3A 1TQHA 2N1MA 2XLBA 1KOFA 2D2FA 2VSNA 4UEOA 5FP0A 5BN3A 1NM5C 1QHNA 2D5AA 2HMTA 3DV0A 1VCMA 3F4KA 3F78A 3L93A 1JDZA 4AO8A 4URFA 3B9QA 1LC0A 5EUQB 3T9DA 3RTAA 2IEYA 2VP9A 4W99A 4IRMA 1ECFA 1CE8B 4WLUA 3IVGA 1ZHHA 5FX2A 3K1TA 1ACMA 1I7LA 1V11A 3REQA 3UV7A 2D3TA 1Y4AE 1E79D 2MU1A 4LWZA 4NFLA 4POOA 5AVRA 5FBKA 3MTDA 3K3PA 2DEUA 3HCNA 1DU4A 4GI2A 4Q4HB 5FUMA 3N07A 4JZYA 4PZAA 5LVAA 4H4EA 3WIBA 1C0IA 4GYYA 4MTCA 2VF7A 3G0GA 4ALKA 4KVFA 1MU0A 3AHIA 3G7SA 1YULA 4H7FA 1KKMA 3MB5A 4MUFA 1Z07A 1LBIA 1NF3A 2NV0A 3LQ1A 4KSCA 5KINB 1Z7EA 4NULA 3GZNA 1EP2B 1Q7CA 2O2JA 3WQRA 3O84A 3JWGA 3KYDA 2D5BA 3KZOA 3PFKA 3R6WA 4HFRA 2GVZC 3K0FB 3WL3A 2KLBA 5K3OA 2R4QA 2IHVA 3OPNA 3PJFA 1HOTA 3N2YA 1ZONA 3W6UA 3S7TA 3WBJA 1BA2A 1W29A 1Z7YA 4IJQA 1K6EA 4OQQA 2GN1A 2P9TA 2Q46A 2FR8A 2PWZA 4I50F 3RS8A 3HKDA 2VP5A 3JWEA 1XR3A 1ZWLA 2R7MA 1CZHA 2OV1A 2Q4BA 3E5RA 2X8AA 1T8TA 3AFOA 3LDFA 1TF7A 2ILVA 4RK6A 2DWPA 4Z7NB 4B8WA 2ZRCA 3IXLA 5JMWA 1W44A 3FAZA 3W04A 4Y6GB 5JAPA 2ZIEA 1L7RA 4QGFA 1KO4A 3V1MA 1BWSA 3BB4A 3HDVA 1LV8A 2PMKA 3RG2A 2GCIA 5I9MA 1G21B 4YRKA 5C8ZA 4DCCA 1LEHA 5KKNB 1OUMA 3FWZA 3WLMA 3SVZA 3KXKA 3NR2A 3OE7A 2QTZA 4IF4A 2IHYA 4BLRA 5HR5A 1GCIA 1K1EA 2YZKA 4QYTA 1D4FA 3RUDA 4EJFA 2VQFB 1VRCA 4LJRA 3VHXA 3TLBA 3ZWDA 4X61A 3BWXA 2MYNA 1Z0AA 4FYWA 4ZEVA 4X7MA 1JH8A 5ALHA 3RU9A 5CEJA 3LU1A 1E1CB 5EJAA 1BJRE 1EFPB 2XNKA 2YH2A 3I2IA 4EF4A 1KFCB 5KOJA 4OQZA 1KY2A 4V1CB 3DE4X 1GFSA 4IY1A 5D3MB 2H3HA 3OT1B 1VYTA 1KS9A 2PFSA 1ONBA 1OIXA 4UVIA 1T6XA 4RSRA 2A4MA 4TWRA 3KZVA 3X43A 2YVAA 5A4IS 4EG6A 2C2GA 2JCVA 3LDUA 2VH5R 1WNFA 4XAQA 3F9CA 3TUJC 3EGXA 3C8MA 4MW6A 1DQRA 3EPLA 3C8UA 4XRRA 3W3AA 2E87A 4EFNA 2V1XA 4G97A 3PDJA 3Q87B 2PE5A 2QBYB 5AW0A 3HR4A 4Q4DA 2BFCA 2V7EA 4KTVE 1Q2UA 3A4IA 4P4SA 5EXDA 4FT4A 4UDXX 5G4KA 3SXUA 4YR7A 3ZG6A 2RHMA 4D82A 3GRCA 1OR8A 4FMDB 2ZWVA 4CV3A 2B0JA 2IPAB 2Q0XA 3HBMA 5GZ6A 2RB5A 4B2LA 3B1FA 5BP7A 4BQFA 3QYFA 3QFRA 4GLFA 3V3TA 1E69A 3EE6A 4CGZA 3L8EA 1B1CA 3K32A 5TPWB 4J43A 4WFKA 4MMXB 2H85A 3OTWA 4PC6A 4ZIRB 2AJLI 3HDYA 1QZUA 2BT4A 4NTZA 1P31A 3JATB 3FLEA 3RTEA 2F8SA 3EZ2A 4RF3A 4BBAA 4CDGA 1W59A 1G19A 3M4ZA 2W6ID 4PFQA 4KWCA 2OFXA 1Z15A 3ZWNA 5TEWA 2A0FA 5ADHA 1JHVA 3UH0A 1OX4A 4UAJA 3Q40A 3TCXB 2ZJ4A 3HA7A 4TSFD 1KMCA 3BKWA 3BMCA 4RDHA 1ZVMA 4NQZA 1U4NA 1CQJA 2B2XA 1QB8A 2GFIA 3NAMA 5FL7A 4C0AC 3DFFA 3AIMA 4U3JA 4IM7A 2O6HA 2P4QA 4I55F 3WRXC 1F8GA 1EFLA 1OGIA 1O1YA 5IJAA 5AYVA 3ZH2A 2G88A 5CVTA 5KNDA 4RTSA 1EFHA 4M1OA 1G8MA 3NDRA 1A69A 2QT9A 3DL0A 5IULC 4OJNA 2FFHA 4PC2A 3TIIA 3EQ9A 3IOYA 5HZKA 3ABOB 1AKEA 2HWYA 1US8A 2IU4A 2VWPA 2FWNA 4L8WB 4AN0A 1CX9B 3L9WA 3Q10A 1UFRA 4Y0VA 5EJ8A 1FSPA 1UKCA 3WO0A 3AVVA 4RY8A 1X1AA 4J29A 3NIGB 4MVJE 1H4QA 1HWYA 1Z0IA 1GG9A 5IT4A 3Q3GE 4YV2A 3GR6A 3JRWA 1A88A 1I6MA 3QU5A 2FEOA 4YLYA 4D92A 5BXYA 5FO0A 4TV8B 2CZGA 2FCRA 2JK0A 4QOJA 3ZWMA 5C18A 2ZZKA 2IYLD 3RIXA 3SQOA 5LP6B 5AD1A 2WZCA 3FXAA 3GFOA 3UB2A 4REOA 1D8AA 4FU0A 3MHTA 4URHA 1JMVA 2DQKA 2IEGA 2C9DA 1V6SA 1JIJA 1BHQ1 2WW8A 1LRLA 1PZGA 5HPYB 3IV6A 2HRCA 2QUAA 1HDZA 2YZNA 4C78A 3NBMA 3E81A 3ANLA 1LBTA 2HB6A 5A7FA 4ZV7A 4ALLA 2IPNA 3EF1A 1TO6A 3K0AA 2A1UA 1SB9A 3GWZA 4G0ZA 3NBXX 1G4AE 5CP8A 1YCFA 2WMOB 2Z95A 2CBZA 3JQ7B 3OEEA 2BEVA 2YJZA 2HZ7A 3FKSA 4G84A 2YJ5A 1WHTA 5HIIA 1Q0QA 4JQCA 3X2FA 3BKXA 4GWKA 1SUWA 2GKSA 5FFMA 3P32A 5BOSA 3UPUA 4TTRA 5ITZA 3D6AA 4DCMA 1O54A 4Z86A 2C8VA 2E5LB 1DJOA 4GEKA 1E6EA 2P4UA 1R1DA 3W9YA 2D2VA 1I2MA 3WGJA 1PE0A 4ZT7A 1C7RA 3GGDA 3W78A 4RPIA 3AVTA 3EGIA 2X86A 4DABA 4YGYA 2D5IA 5K0BA 4G5SA 4BGDA 3U5ZB 4S12A 5GZ1A 2JVJA 5ALLA 1YB7A 1U4OA 3W5BA 3EQ2A 3R3YA 2O3JA 3O2SB 4XGIA 2W6ZA 2P0EA 3E8SA 1FFBA 3WYGA 5IWCA 3WHPA 4Q18A 5LQAA 2VH2A 3D43A 3FUUA 4KDCA 3VC3A 2BGMA 2ENWA 5HUQA 5GINE 2AUMA 3VH2A 1RAAA 5IARA 6REQB 4K9NA 2QA5A 2BFNA 2IQIA 4D9FA 2R62A 4DIEA 1QYWA 1ZC4A 3B3QA 3FPFA 3PLNA 1XXHB 4L8LA 5FPTA 1U2GA 1RAEA 4A8PA 1NVKA 2OTCA 1EZZA 5B1SA 4OI4A 3MT0A 5DHRA 2C2HA 2PX6A 2AOVA 2QMUA 3DAGA 3HKBA 2G08A 4B1FA 1P5RA 1Z2EA 4HG2A 3QF4A 1OAOC 5EHXA 1RBMA 1OIVA 5FV4A 2FW8A 1H2WA 2GPTA 2PD6A 3OF2A 5BSMA 5A7HA 5DM4A 1S8NA 4Q3OA 4IDEA 4AXBA 1UJBA 3B9PA 3ONEA 1IQ0A 2D3WA 4RHCA 4BZQA 2CNNA 4FDAA 2VIIA 1NATA 1RHMA 5DLDA 5DWDA 3IXMA 1ZH6A 3G8BA 4EKDA 2HQRA 1BHJA 3ILVA 3O03A 4OJMX 3GA7A 2LWIA 3JQ9A 1T10A 2C2WA 3DWFA 4AQDA 1X1TA 5M04A 1I33A 1XZLA 1EM8A 4ZQHA 3EBOA 3R0XA 4I1RA 4PM4A 3T1OA 3ZU6A 1H8HD 5LQCA 3REOA 4M8LA 3LYUA 3RK4A 5KYNA 2X6QA 3D8NA 3ZH9B 1PR0A 1DS6A 1WVIA 3ID6C 1H9AA 4LN1A 1QTIA 2VDPB 2NUPA 4HMOA 4MGYR 4UHCA 4S0ZA 2I7DA 2QJRA 1LS1A 3LK6A 1GA6A 3H2ZA 3D2BA 1JZTA 4LDNA 4QDXA 3TL6A 4D9HA 3LAWA 2IHNA 1M8FA 2QN3A 1VIDA 4AZVA 4DR6B 1T9CA 3I37X 4MQMA 5CA1F 4QEZA 4NPAA 4FPXA 2I6QA 3ZWQA 5FL3A 4WQMA 2C59A 1XEWY 5C4IA 2AB0A 1RLJA 1TF5A 5JJKA 1SB8A 3M5DA 5J4LA 3V1LA 5ICMA 4IINA 5F3WB 5ERYA 3NTQA 4ND6A 1RHRA 2Y4NA 4M9ZA 4MGEA 3H9GA 3T7DA 3GLIA 2GASA 1DSSG 2H1HA 4N3AA 2DFKB 4G0NA 3U80A 2Q6LA 2JHGA 4RZHA 1MX3A 2Q5OA 4UMFA 3HXTA 5KNDH 4DL9A 5ULLA 4WFJA 3IBYA 2O0KA 5EIBC 2C99A 2JGJA 4I4TB 4N0DA 1Y63A 4RHEA 1O5IA 2AJTA 2BZ1A 2INGX 4ENUA 2PJUA 1XL0A 4JJ4A 3NNNA 3QX7A 4QNRA 4GSYA 2WIBA 1WDLA 4PPQA 2OPHA 4NS1A 3RIYA 5DNWA 3SN6A 4DUYB 2ZTLA 5FPSA 4OXRA 2EFGA 1TADA 4N5MA 5H16A 1E0SA 5F5LA 4TV9A 1AVTA 3D4PA 4TTJA 2JH8A 4LISA 5TSDA 2XD9A 4AKIA 5B6PA 4Y2XA 5I7FA 3JZIA 5AESA 3NM4A 4LX8A 1PWHA 1UK8A 2XF8A 3CF0A 2HWUA 3ENNA 1NRIA 3OM0A 1MD9A 2O3QA 1PR6A 3G2KA 4IHJA 4BMXA 2X15A 2O5CA 4U7WA 4BZPA 3E9RA 1VE6A 1NUAA 2ZTVA 1Y8AA 4MDEA 3UK6A 1TIPA 2ZTMA 3PD7A 4IWYA 3D1VA 5I6DA 5BQOA 3UPTA 4HDQB 4JT9A 4YA6A 2O8EB 4XWTA 2UZIR 3OY2A 1P1KA 1U7UA 3PTLA 2QYTA 2J3HA 3A31A 1ZW1A 4RADA 3P4XA 1DUSA 4KOAA 4AF7A 1DDIA 4R2WA 1A4RA 5BUZA 1P6UA 4A73A 2IE0A 1T26A 5SZIA 2VNIA 3ZDQA 3C3AA 3RARA 4DGSA 3LUGA 4R2IA 1G6OA 1YFJA 3QUBA 1C14A 1C9MA 1SBCA 2JIDA 2JHAA 1JVBA 3S70A 4DLSA 4NWIA 5DP1A 5DN6A 5FI3A 4A2CA 4ZJPA 5AK6A 4XR9A 3JS5A 4CG0A 1E2GA 1OLUB 2OKCA 4WXEA 1FEZA 1SG0A 2RH5A 1Z0KA 3A1EA 5M3BA 4X9XA 2QVBA 5T41A 1PJAA 2YCBA 3DMGA 5JNLA 3GW8A 2X0RA 2EGGA 3OE5A 4MVJH 1HE8B 2IYUA 2JEYA 1M0TA 1RI1A 3LYAA 4RFSB 3FCXA 1OTXA 2YW9A 1H5UA 1QV7A 3A2LA 4K7JA 4W4TA 3UGTA 2P7HA 4IHKA 4HDNA 4U4AA 3ROEA 1UBUS 3I6MA 2BR3A 2HA3A 5CVUA 2B9VA 2AG1A 1LNZA 2IYXA 1O08A 3QU9A 1UAAA 5DNAA 4RCZA 1KVRA 3VOAA 4JJAA 4F12A 2BKEA 3LOPA 2QDKA 3P9QA 1USWA 4YQZA 2J67A 4WCDA 3KKQA 4AZ0A 4B8ZA 5KVCA 2HF8A 1XMSA 3H5OA 2IS1A 4JYZA 1Q7RA 2Q2VA 4J7AA 4A16A 4QSMA 5CXQA 2HA7A 4MEBA 5A3JA 2CJWB 1ZNXA 4NBVA 1JKFA 5ALXA 3SVLA 1ZPDA 3OFNA 4KQEA 3B52X 5EWMA 1KIAA 2GEKA 3LHKA 5DM1A 2FSSA 3T38A 2KS6A 1SCQA 1V8DA 1YO6A 5E95A 4PN3A 5CUQA 5JRZA 1WDMA 3UICA 3U19A 2QXYA 3G82C 3LUBA 3OFSA 4PYJA 4EQZA 1DC6A 4MUXA 2PX8A 4N18A 1GDTA 5ALEA 2H11A 4R7TA 1XZQA 3GQBB 1U0NA 2JGKA 4BP1A 4PBSA 2XNCA 4X7RA 5GTDA 5ESXA 4BVKA 2IV7A 4E94A 1J70A 5EXTA 4G36A 4CR6A 1R74A 4Z0PA 2OENG 3HRHA 3H6KA 2Q3BA 5CEFA 4AQ7A 2BUCA 2C1ZA 3KVOA 3BTOA 1FXWF 4C6HA 5K0EA 5K03A 4KACA 4UHEA 4C14A 3RUAA 4B40A 2FR8C 2X1VA 2C9YA 4E0BA 3VR5H 3NIDB 1WQ1R 4JYBA 1X15A 4W8OA 1NAHA 3BWYA 1X7DA 1J2RA 1USIA 5K99A 4LDAA 3VTZA 1HLDA 3AWDA 2IYQA 4B0PA 4LCJA 2UYYA 3AYZB 4P3NA 4ENRA 2PSFA 3EVBA 3PFHA 1Q92A 1TK9A 4GL4A 1JDBC 1N6LA 4IQGA 4EFLA 4YUXA 1YOVA 2VUHB 4OLHA 1Q16A 5DYGA 2JH3A 4JP8A 4GI1A 2Q2NA 4BAZA 1TE2A 2WZDA 4YP9A 5G2OA 3SYKA 4LYGA 3NHLA 4INPA 2O1EA 4BWFB 2WWTA 3MW8A 1ZH0A 3TQHA 3ZY3A 3IAS6 1ZM4A 3O74A 4MRSA 3I0MA 3S1AB 2D5LA 2ODQA 4CUJA 3VGPA 4KBFA 2W0MA 4DLZA 4UOEA 1Z17A 1B6GA 2QI9F 5ALFA 5JXGA 3FUCA 1YS2X 3G5AA 2GH1A 2P5YA 2POQX 2IX9A 5GJBA 4I6JA 1NTRA 1JIVA 3COWA 3IR7A 1LF0A 2GKOA 2II6A 2O8VA 5E4TA 3SE7A 3OIVA 3LX8A 3SLKA 2FP3A 3UMSA 3FTQA 3OMLA 3L8FA 1ADJA 5DFAA 4EIWA 4NJMB 4NU5A 4HAXA 3OPYI 1W47A 5M29A 4YO7A 2YN2A 3DBOB 4BCCA 4C3OB 3LBYA 3HADA 1V3VA 3Q3HA 1EAMA 5C31A 3C3EA 4A0SA 3IIJA 3DVLA 4MICA 3FCCA 2H18A 4DJ5X 1WRBA 4OPMA 5K0GA 3RRZA 2ZUVA 3T4PA 3CSSA 2BP7B 2ICAA 4QLBA 4JUFA 3RFFA 4K9KA 1DHTA 4L51A 4R7ZA 4BNTA 2GPJA 5LQSA 1Y48E 2WF9A 3AYXB 3GBSA 4DZZA 1UBLS 1ENZA 1ISIA 3I42A 3UJCA 2PJDA 3CCFA 4NBLA 3UMFA 2VEOA 5EXXA 1KHTA 4DFDA 2OORA 1KDOA 3D3QA 4GIBA 3W3ZB 1G8KA 4H1HA 4MKZA 4J16A 3FMPB 3FOFC 2OLEA 1HE3A 3H3FA 3OO0A 3G0HA 3WLSA 3CUEF 2H9IA 3HPRA 4FGUA 2YUTA 4OHVA 2I62A 3NYIA 4MROA 4GBJA 3JSXA 2PAAA 4LDQA 4YJ2B 3QHAA 1JW9B 1S8FA 2QR3A 4D3XA 2UXDB 2BE7A 2JHCA 2V98A 1ENYA 1XZGA 2FRXA 2KI5A 2OYSA 5LC1A 2XA1A 4UBOA 3ZWBA 2JATA 4HDRB 1A2BA 1GAWA 1DWOA 2VRNA 4HXGA 1MJGA 4F2PA 1BDIA 5H8WA 2GXAA 3QSGA 2E4UA 1PNQA 2KBEA 4YGXB 3W06A 3WHIA 4GLBA 2Q50A 3HKEB 1S89A 3FIUA 4EGQA 4FHDA 5K8IA 4B44A 5MFZA 5HP4A 2F3SA 4MQUA 1I2BA 2QZJA 1KI7A 2LIVA 4C0WA 3ZQUA 3PC4A 2FN4A 5C7LO 4FN5A 5A6VA 2R2GA 3DZ8A 3USZA 5CFMA 2ZRIA 3N53A 3WYEA 4W5OA 1QWOA 2E0IA 2ERXA 1T0JB 2JKZA 2VLBA 4C4SA 3SPXA 2GF2A 2AV6A 2VDKB 4UPEA 2HO4A 2Z8ZA 4J0IA 2V54A 4DSNA 4GS5A 4LXXA 2C2KA 5E7IA 1ZNYA 2Q9UA 5F2KA 3K71B 4BAGA 3RU2A 1T24A 2VAXA 1OCEA 4BFZA 4EY7A 5JDIA 1JE1A 1B3BA 1KH1A 3WLEA 4G0VA 4PTYA 1TM3E 4K5QA 4UCQA 5HYVA 5C0OE 2JEZA 4JDPA 3DTYA 2XUIA 4MWSA 3FI0A 3HN2A 4Q3KA 5CU7A 2HQBA 5JNVA 3HXMA 3I1FA 2GCNA 3V8NA 1PSWA 2FH5B 1R0BA 2ZU6A 4H16A 4Q3AA 5AM4A 4BWVA 5B6JA 5ED4A 5EP3A 2AG5A 2Q29A 4BLTA 1DOHA 3B38A 3Q85A 4DS3A 1J00A 1X19A 3NHJA 4UBIA 2SNIE 2CFRA 2XMZA 3G1WA 3CXRA 1BXKA 2N42A 4WLFA 2ZW9A 3ZQ6A 1Z35A 1KYVA 3P71T 1CS4C 1K3TA 2F3PA 3DYBA 4BMVA 1DTSA 3LUHA 3MUFA 1HDOA 3ITEA 4JEMA 3DOHA 4J1SA 4NMHA 3DPUA 4RAQA 4TTQA 5AW8A 4M1ZA 5KNBD 1QQBA 1N8NA 3D7MA 3UT5B 4RTOA 4GC5A 1D2GA 4Q7LA 4Q16A 1OOEA 3WYCA 2YYSA 4MIKA 1QDLB 1UIRA 1EFCA 4FMPA 4PYOA 3BRCA 2Y2VA 4BKPA 1YSCA 1KAEA 1VG1A 1ATZA 2H08A 4DQXA 3VR4D 1WAMA 2H5JA 2JBAB 1EGHA 1CJMA 1NPYA 2H4JA 2P5TB 2YV2A 5EUCA 4G0YA 5KTKA 1FNBA 3JQQA 3WP0A 4CBVA 4BXOB 2FUG1 3AY0A 5DNVA 4ENVA 3R6TA 4LSZA 2Z5LA 3RVJA 3U4AA 1UBRS 4FYKA 2XEDA 1CF9A 1EFVB 3QXXA 4IVNA 4YDSA 4HNTA 4J0QA 4LC9A 2BUAA 2L82A 2QQEA 1RRMA 1WCYA 1PJSA 1W35A 2BELA 3MUNA 1AB5A 3NTOA 4FZ3A 2TMGA 4NENB 4DNQA 5A5EA 2GM5A 1JGTA 1O0CA 5J5VA 2JVKA 3AV0B 1VHDA 1BH2A 1H8EA 4M7WA 4X71A 5BWBA 4EMSA 4ME6A 4TVSA 3H1PA 2XR1A 5IFLA 3GH1A 3PIIA 3HUDA 1XYGA 2ZRFA 3O8DA 1SC6A 1QP0A 2QG4A 4DLKA 4CG3A 3BD9A 2VLIA 4CNBA 2IVFA 1DUIA 2BLLA 4Z54A 3A27A 1YR6A 1VL2A 1A97A 2W2VA 5HF5A 2HXYA 1T4MA 3VX4A 4AU1A 1AGYA 2QYHA 2CMHA 1H2ZA 4NONA 2X7XA 2H07A 2P90A 2OXRA 3AY3A 1U2GC 2Z83A 3E2IA 3EW7A 2IIPA 3GZ4A 3P94A 2FFJA 4HDAA 3W90A 1CUBA 1NZJA 1VP3A 1IEXA 1XCOA 1ZOPA 4RE6A 4OJTA 4WNAA 1U8FO 4IV0A 1XPJA 1NQ5A 3CRMA 3P2IA 1KEPA 1U2DA 1XCPA 3AR2A 1RTKA 1ZJ5A 2NU9B 3SKYA 4B71A 2OGUA 5G0UA 5CAEA 5ENZA 4KFCA 3FMGA 3M1LA 5IDVA 1ZSVA 3ZDCA 4CEIA 1ISSA 2ZUEA 2B3TA 1V4BA 3Q8KA 3RIMA 2W8BB 4UM7A 2WJIA 3F7TA 5A9TA 1TJ3A 5EMLA 2PS9A 4HUQB 1T91A 2AN4A 3S5UA 3FYSA 4E15A 3CGWA 1Y1QA 1PS0A 3DDNA 1YJCA 1J56A 4P83A 1Q1NA 3QQPA 2WWYA 1EBBA 4EF5A 4REMA 1TJPB 3DE1X 4MCHA 1YRYE 4PG5A 1FC0A 1XVUA 3KHTA 2PKYX 1E9DA 3FGOA 1E61A 1FYWA 2WM9B 1LI7A 4F2WA 5CVDA 1NA5A 1TVCA 9ATCA 1T1JA 2CVZA 3FVWA 5ALRA 1KIMA 2FSHA 1ZY2A 5I9SA 1QYXA 2CLDX 4LVOA 1UWCA 5AW5A 3DE3X 1VL8A 4AWXA 5C1OA 3MG9A 1NAIA 4KTTE 2D13A 3OCVA 3LP6A 2RK4A 4C20A 5J63A 1J0XO 3HWSA 3O8BA 5BN4A 4YP1A 1PWYE 3LKBA 4RV5A 4ALJA 4J1QA 2FOXA 5AM3A 1G6Q1 1XCLA 2HREA 4P92A 4YCDA 3TTYA 1HT0A 4JJGA 1QBKC 4PSDA 2HJSA 1SVIA 4QEDA 3O0DA 3DLBA 1DXHA 3ELDA 4LV6A 3LOUA 2G1UA 2I2DA 1JHYA 4O0MA 3AI1A 1Z26A 2DRIA 1UMCB 1Y5NA 1C29B 1WXDA 3OX1A 2RGRA 1E9SA 1PUJA 1AHIA 2XWSA 3CX6A 3DVSX 1E92A 3DW3X 5LUAA 1Q0HA 1QUEA 1N75A 4DPLA 2GK3A 4ZZ3A 2XYGA 4KXWA 4DA8A 4TKZA 1C9DB 1SPBS 3RASA