3CO5A

Crystal structure of sigma-54 interaction domain of putative transcriptional response regulator from neisseria gonorrhoeae
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
136
structure length
134
Chain Sequence
GNSAAIQEMNREVEAAAKRTSPVFLTGEAGSPFETVARYFHKNGTPWVSPARVEYLIDMPMELLQKAEGGVLYVGDIAQYSRNIQTGITFIIGKAERCRVRVIASCSYAAGSDSCEEKLAGLFSESVVRIPPLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Putative two-component system transcriptional response regul
publication title X-ray crystal structure of Sigma-54 interaction domain of putative transcriptional response regulator from Neisseria gonorrhoeae.
rcsb
source organism Neisseria gonorrhoeae
molecule tags Transcription regulator
total genus 33
structure length 134
sequence length 136
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14532 Sigma54_activ_2 Sigma-54 interaction domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3co5A00
5JI2E 1BMFD 4EKDA 2ZI4A 4TYPA 2I1VB 2FEMA 2FMXA 3LO5A 4DLSA 4P0TA 3A6PC 2J0QA 1M8PA 2IYSA 4Q7LA 1JALA 1HURA 3K0EA 5HKKD 2QROA 3MFYA 3AUYA 5HE9A 5E3HA 2WMOB 1F2UB 1Z6AA 2FZ4A 3L0PA 3OEED 1BH2A 3R7WB 1II8A 1Q0UA 3FKSA 4EAQA 5FPSA 1XXHA 2WSMA 2YWFA 1AA9A 2QU8A 2VF7A 2IXEA 4A6PA 2YHSA 3C5HA 3O8BA 3SJBA 1Z07A 1R4AA 2P3SA 2QT0A 4I99A 1M34E 3A4LA 4OBEA 1GSIA 5EP1A 121PA 1F2TB 1G7SA 5HZHA 3B9PA 2ZSAA 3JZAA 3PXGA 4NDZA 4JL8A 3UMFA 5JJKA 2WWWA 1CU1A 1VIAA 1T5LA 3LW8A 3PG5A 4DCSA 3E1SA 3AF4A 4QGAA 3CRQA 3JVVA 4BUJA 3KKPA 2BMJA 4MKIA 3S1AA 1CS4C 4ACAA 1US8B 5LPNA 3KXIA 5FOXA 4TSFA 2DFLA 2ONKA 4M1MA 5F9FA 2F43B 3V4FA 1AIPA 3REFA 1NI3A 1JAHA 1SHKA 1SVMA 4KV9A 2OFWA 5EXTA 1CJVC 2GILA 3CW2A 3IIKA 2GXSA 3AUXA 1CR4A 2V8OA 3KZ1E 1XCMA 1DG3A 5C4MA 3ZDQA 2ZJZA 4ZKEA 1UDWA 4QHTA 1AGPA 4DLTA 3VKGA 2QUZA 2VEDA 2YKGA 2A5JA 1JQJC 2UVQA 2F7SA 4LYHA 2G88A 4BFWA 3KUDA 4DKXA 2J7PA 3Q8XB 4HEJA 1W2HA 4WXPA 3BS4A 4P4SB 1DG1G 4GP6A 4ITRC 4RCYA 2FGKA 4ZCLA 1LS6A 4LV8B 2FNAA 1KI6A 1XB2A 1CULC 4KU4A 1MH1A 4UNRA 3WYFA 2F3TA 3QJYA 1M2OB 3TRFA 5AUNB 2W2VA 4JBYA 1OFIA 5FBVB 2DB3A 1QVRA 4LYJA 2X8AA 1HEIA 2PLFA 4D4MA 4WIAA 3W6NA 2JASA 1ZD9A 5FUVA 4UNSA 1W0KD 2ZI7A 5E4FA 3P32A 2EQBA 4C0BA 4YQFA 2WJHA 2QPOA 4FW9A 3T61A 5L3QB 1ZM4A 4Q1EA 3U3KA 2QM7A 3GEEA 3BH7A 1L4UA 3MJHA 3PUVA 4B3DA 3A1WA 4OQFA 2ZSEA 3CNNA 3B6EA 4H1UA 4PPGA 1Z0JA 2JIZD 4NCIA 5KHOC 1KOFA 2IXFA 2W6JA 3A58B 3UG7A 4MRPA 2F1JA 4M1OA 4QNRA 5DHAA 5EP2A 5GJWC 4XWOA 4C0SA 1TPZA 2GK6A 2MMCA 2IYUA 4OHXA 5EP3A 5J4YA 4A2PA 2ZRNA 4TMKA 4CEIA 1C4OA 4NPHA 2IEYA 4CIDA 4M1SA 3UWKA 4RJLA 2IBMA 5M04A 5EP4A 4K81B 3AP1A 5H68A 4J0QA 1QHYA 3IPXA 4TL7A 1GL7A 4U5XA 4EFMA 1UDXA 2VSXA 3B13B 3QXHA 2DFNA 4CYMA 1LY1A 1FX0A 2JLRA 3VR2A 1A2BA 3RS2A 3Q7PA 3THOA 1QG4A 5CIQA 2L0XA 3EZFA 1J7KA 1SVWA 4TT3A 5JJLA 1GM5A 2VRWA 4R9UC 2EWVA 2R6DA 4Q5IA 3VR6A 3DVLA 5GVSA 4MKGA 2WJVA 1EXMA 2VLIA 2GKSA 3K09C 3RC3A 1U2RA 1F48A 1OPXA 5CJPA 2ZAOA 4O3MA 1B23P 3NDBB 1MO5A 4TYQA 1GG2A 2VHCA 5D3MA 5BN4A 4UJ5A 4BRUA 4Q4AA 5EQTA 5JSZA 3C8UA 1IY1A 5AWFC 1YR8A 3G5UA 1JB1A 2JJ8A 4JLVA 4OL0A 5SZHB 2FSGA 3AKDA 3SR0A 1OH7A 4FXPA 3GJ0A 1HE1C 1RJ9A 1L4YA 4MYTA 4LJ9A 2ORVA 2IS2A 3CRMA 5FOSA 1G41A 4H9GA 3UPUA 2IUSA 4QKQA 3LY5A 4E09A 4JLDA 3W5JA 2GEUA 3FGNA 5JZVA 3I61A 3HYRA 3HR8A 4L5BA 4LJ4A 3WYAA 1A7JA 4JL6A 2Z4RA 2ZRGA 3L2OB 4BZQA 2WSSA 3DL0A 1Y63A 3LXXA 4W5HA 4XD7D 4DUGA 1FUUA 1KNXA 1ZAKA 2AKYA 2W58A 2XXAA 2JEOA 1BYIA 3NBXX 5DO9A 4YXWA 2VPPA 3HU3A 2RB4A 1P2UA 2OXRA 1KAOA 1ZBDA 4ARZA 1IHUA 3AVOA 5KUTA 3Q7QA 4DIDA 1NY5A 4Q9LA 4BLSA 4DB4A 2Z6VA 3TK1A 1OXXK 2OT3B 5F2EA 2WWYA 1PV4A 1U8AA 1D2EA 1I4DD 1KKMA 3DOEA 4DVGA 1U8YA 4MUAA 2N46A 2YWGA 2GK7A 4FINA 2OSBA 1U0LA 2HUPA 1JJVA 1UPTA 2BKUA 4D81A 3K0AB 2RAPA 3FHCB 4HLCA 4G5GA 4NCHA 2PEYA 4IDQA 4PFSA 2NZJA 5FBRB 1Z22A 1UKYA 1OXUA 3BFVA 4DSOA 2QY9A 2C5LA 3ZVNA 3LA6A 4F91B 4PTLA 2W6IA 3J81k 4TQUS 4KBFA 3OAAD 3EX7C 2FSHA 4ZV4A 1M7HA 1DO2A 2GCOA 1OHHD 5JMTA 2JJ1A 3IEUA 2ZE5A 3CUEF 1KI2A 1DOAA 3MAAC 1FPMA 1G9XA 4DLUA 5FR2A 1ZNZA 4Q1AA 3SQXA 1E2EA 5J5CA 3K0SA 5K8UA 2GHIA 1QHSA 2GZDA 5EE0A 2O8BA 3GD7A 2QGNA 2OLJA 2DR3A 4I1UA 4NKRA 1A1VA 1KAGA 1KK1A 3Q5EA 4ACBA 3WMGA 4TQ9A 1SVSA 2FG5A 3ZQJA 2Q0HA 1QG2A 2GF0A 3EWAA 3QPVA 4KFRA 5JJIA 3AB3A 4BFUA 1H8HD 3EA0A 4L15A 1J8MF 3PENA 1M6NA 1Z3IX 5F98A 2IUUA 1OB5A 1LB1B 2ZSDA 4OQLA 4LCBA 4RD0A 4ASUA 4ESHA 3BB3A 4NMMA 2QT1A 1S2MA 1FP6A 2HF9A 1QHHA 2WV9A 3F3YA 3MMPA 4IVRA 1QHNA 1TX4B 4QG7A 5KO2A 4US1R 2QMEA 1E0KA 3GCGA 3H84A 1N25A 4M8NE 1OIXA 1KYIA 4NL4H 4BFTA 1RYHA 1Z0IA 4P4UA 2QZ4A 1Q1BA 4HAXA 4HAZA 1NN3A 4F38A 3RC8A 3HPQA 3LH5A 1X1SA 5P21A 3K70B 1A4RA 1GNRA 4KBGA 5FH9A 5JHHB 3LWNA 2J0UB 3QVUA 2H92A 4G01B 4CEIB 2G6BA 3QE0A 1TUEA 2CLCX 1J2JA 2C04A 3K1JA 4PC3A 3EPLA 1K6MA 1E9EA 3ND9A 1KDOA 3NC1C 4C0AC 4FMBB 2F1HA 1XTRA 2ZI3A 1NRJB 2G77B 5J40A 1FX0B 4A8JC 5HTKA 5B30A 4DB2A 4C9BA 4IXNA 1VYUA 4OK3A 5FPHA 2QN6A 2EFCB 2HLDA 2VHTA 2YV5A 1JR3A 4KO8A 1ZIOA 3CF0A 1RFLA 3RS7A 2O8FA 4JT2A 2ANBA 1ZNWA 2FA9A 5GVRA 5TY0A 2YWHA 2MMGA 3TE6A 5HR5A 1G18A 1OYYA 1ZC4A 5TARA 1W44A 4PX9A 2JCSA 2FFHA 2GJ9A 3AGQA 1BKDR 3BFXA 5D3MB 3DZ8A 1OJLA 4JBWA 4JVNA 5JWHA 1AZSC 5KSZA 3WMFA 4GI7A 1NVVQ 4DLRA 5JSZB 2FF7A 4HLQB 1AZTA 3BXZA 4Q1FA 1S3GA 1KI3A 2C03A 4B3CA 4UXJA 2J5XA 1Q20A 2HEIA 4KITB 3U4QA 2JDID 3RRZA 4NE2A 4KSCA 5ANRB 1KO8A 4TL6A 2H1LA 1JBKA 1VTKA 1RKBA 1DTSA 2GEDA 3D8BA 3Q3JB 1NN1A 2G0NA 3T1VA 5HKKA 3AVXA 2GZAA 2BBWA 3TSOA 2ZR0A 4CF7A 3BD9A 2XXAB 2WTUA 3PVSA 1ZUNB 3OEEA 4OQXA 1W36C 721PA 4XVQA 4ARZB 1B0UA 1GKIA 1XWIA 2NPIA 3VHLB 4TMXA 4IEEA 1BIFA 3THYA 3IGFA 1NG9A 2J46A 5HCIA 1XMJA 2PX3A 2OZEA 2Q9AA 1U98A 1NLZA 2HJGA 3WHKA 2QP9X 1WDTA 2IEZA 1KO4A 4WZ6A 4NYJQ 2WICA 1N5IA 1Z2AA 1GL6A 2ZE6A 2CMKA 4C2TA 1Q1QA 3K9HA 4LHYA 2BJWA 3QUSA 1HQCA 1JNYA 1VDZA 4Q9HA 5EUQB 3ZVLA 4R2HA 1E9AA 2OFOA 4PO8A 4X8MA 2ATXA 1DADA 2A5YB 2GCNA 2RGNC 4PR0A 4CVNA 2HYIC 2ZYTX 4QHYA 1R6BX 3CH5A 2R6CA 4D0GA 1ZD8A 4PSVA 1GILA 2QAGC 3FE2A 3NVAA 4DIEA 4KFTA 1E0JA 2HDNB 3K70C 3UWOA 1LF5A 3T35A 2ZPTX 5DI3A 1X8LA 4FCVA 1TF5A 3ADCA 2O8BB 3OHMA 1YE8A 2CL0X 3TH5A 3FB4A 3TLXA 4WOPA 4EPRA 3VR4A 4RD2A 5FTJA 4R71A 4NCKA 3B1WA 3K9GA 3PQCA 4P3YA 3GFPA 1T3HA 4N0DA 3QEOA 5EE1A 3RRYA 3THXB 1HUQA 2QP4A 2XTMA 1G20E 3EPJA 2WZQA 3I32A 1AKYA 4TMWA 2C98A 2ZXUA 3NHBA 3LBIA 5DGXA 2Q3FA 2QSZA 2IYYA 4B3BA 2IF0A 4PHTA 3GFTA 1L2TA 4EJSC 1PZNA 1QHHB 4RD3A 521PA 4AC9A 5FPTA 3TUIC 4PSAA 4ERNA 5KNCA 4CW7A 2R8RA 1RRCA 4TZ6A 2IT1A 3W3ZB 4PHGA 2AXPA 1W0KA 2A9KA 4B48A 4DDTA 3C14C 4OKSA 4TL9A 1S1CA 4HDQB 1LW7A 1I4TD 1ZRHA 5DIFA 4DT1A 2YINC 4DSNA 2IYZA 3EC2A 3LRPA 4Q4LA 1P72A 4DHEA 4I4LA 4Z51A 2ZRBA 1U0JA 4NYIR 1SXJD 2CCKA 3VAAA 1SZPA 4MKHA 4E5UA 3W5IA 4CEJB 4A9AA 4AKGA 3LBHA 2FEOA 1KSFX 1NJFA 2JIZA 5EZ5A 4ZDIA 1DPFA 4PANA 2Z0MA 2PMDA 2ZI5A 3NXSA 1K5DA 3DPUA 3ASZA 821PA 1ZCAA 2DCUA 4DC9A 2C77A 2BV3A 2NG1A 3V00A 1VG8A 1EK0A 4V0MA 3U3MA 5L3VA 4RZ3A 3VX4A 4F4JA 1UBGA 4B3XA 3EXAA 4AKIA 2JLXA 1S1MA 1Z28A 2BBOA 3I4LA 4C30A 2ATVA 3NEJA 1E2NA 1P3JA 3B5JA 4F4CA 2OFXA 5KNDA 3SU8A 3BB4A 1XTKA 1T8UA 1KKLA 1R0XA 1OB2A 2ZYVX 1Z0AA 2OBLA 3ZLJA 1R0ZA 2J7KA 4B43A 2JA1A 2OV2A 5EE3A 1TQ6A 4ILEA 5BN5A 3OIYA 2ZU0C 2R44A 3W8RA 1WBDA 4DSUA 2QPAA 1QHXA 3C15C 4JKIA 4QBGB 4AY2A 2WWGA 4AYWA 1QRAA 4M9SA 2WOJA 1XCPA 4MYUA 2ASEA 3U4QB 2ZIAA 3GEIA 1Q21A 2V6JA 3FFBA 4Q4HA 1YZQA 5JEDA 4BLRA 2VP0A 3IPYA 1GRQA 4LUCA 1U90A 1TU3A 2BCJQ 2FGJA 5DN6D 3GJ3A 3BH6A 2Q6TA 3CO5A 1N6NA 3TUZC 1RC8A 3T06B 3W34A 1TF2A 1X1RA 3OEHD 3O8RA 1NIJA 3TR5A 4HSEA 1U9IA 4RD1A 1OW3B 2EFHB 2ZJAA 5LD2B 1KMHA 2CLSA 2DFKB 2J0VA 4URYR 2JLZA 5JECA 3I73A 1BO6A 3EWSA 4HB2A 4XVRA 3BERA 4FMCF 1OFHA 4Q7KA 2TMKA 1GP2A 3I92A 3V9PA 1N6OA 2GF9A 4AYTA 4QBHA 1NVVR 5JEEA 1O87A 4U7DA 4ZIRA 4F93B 1RPZA 4LV6A 3SDZA 4LC1A 2XZLA 1JAIA 4LBYA 4Z54A 5HE8A 4XD7A 3THYB 3PV0A 4L8GA 4NYMR 4II7A 1OH8A 4AURA 1T0JB 5G3ZA 1DAHA 4CEJA 1P4SA 1XNJA 1QVAA 2KE5A 5H1YA 4P33A 3ZIAD 2BDTA 5E95A 2HXSA 4C0QC 1X8JA 1ZU5A 2AXNA 1G8YA 2OUKA 3IBYA 1F5NA 4UXHA 3WXMA 2XSZD 5FTMA 1WF3A 4A0FA 3MWYW 1ZM9A 3CRVA 5CB8A 5C2JB 2W0MA 2G3YA 1XD2A 4PHFA 5JLJA 4E22A 1G1MA 1E4YA 1KTVA 1OFUX 3TUJC 4OHWA 2CHVA 3MSXA 2ORIA 4R2IA 4ZI2A 1C9KA 2ZUCA 3NDPA 1D2NA 2GNOA 3GJXC 4C7OA 3E70C 4OHVA 1P75A 5IK2D 1E9FA 5KSYA 2OEPA 2RGGA 4PQRA 1E0AA 1SVLA 2IL1A 3KFVA 3LVRE 5HZKA 1ONBA 3OAAA 5DI3B 1JPJA 3CB4A 3CONA 4QNMA 1IY2A 3TW8B 2O0KA 5EXSA 1OHHA 4LBWA 3A4MA 3M6AA 3KQKA 3HYTA 4NYJR 1DO0A 5CJ2A 3SEAA 4B32A 2V55B 4YLGA 2ZR9A 1BOFA 1NBMD 4XWAA 3EPHA 2ZETA 1WCV1 4HAUA 1IJFA 3QF7A 4HI0E 2ZJOA 5E7IA 1P2SA 5FOVA 4S2EA 3G82C 3B8HA 1XRJA 5FOUA 4IOKA 4YDHB 4YMTA 2ONJA 1R0WA 5KYKA 1QDEA 3CNLA 1IN8A 4V0ME 4QC2A 4IJMA 3K53A 2B7BA 3GLIE 4PO9A 621PA 1P5ZB 1UADA 4JMPA 5F3WB 1A5TA 2PT5A 2CL7X 4MUBA 4EFLA 1H8HA 3KQNA 4PC1A 4OI4A 2ODBA 3OFND 3BE4A 3EC1A 4IHQA 5H70A 4CZ2A 2DHRA 1FP7A 2W0SA 4BRWA 4X8HA 1LVGA 4FI3C 1FQKA 3SYKA 4IW3B 5KSOA 2X2FA 3RDPA 3RWMB 2W00A 2ODEA 4GOKA 1PLLA 1Z6TA 4U00A 3O47A 2X19A 1XD8A 2VP5A 4F7WA 1U81A 3SBEA 1YRBA 3MJRA 1CTQA 1II9A 1Z08A 2C8VA 3LFUA 3QKUA 5BW8A 2FJUA 2G0TA 5CITA 3AF3A 3IHLA 2ZRDA 4G5RA 3SJAA 2QMUA 4I1OA 2F1RA 2BKEA 4JJZA 4TYWA 3LQQA 4KLNA 1G7CA 4LJAA 1E2PA 2CEAA 2BOVA 3BBPA 5KDOA 1XTJA 4JZKA 1N6PA 5FUXA 3GLIB 4GL2A 4IFBA 4Y0VA 2XJ9A 4Q1BA 2EW1A 3B85A 3EZ7A 1N5JA 3CZPA 3IILA 3TR0A 4DDWA 2BM1A 3GMTA 4Q48A 3B7GA 1DELA 1KSJA 4HUTA 3BB1A 4M0LA 5FUWA 1VCOA 1XEFA 3T1QA 3BH0A 3IUYA 4M22A 4Q00A 2QBYB 1M7BA 2KBFA 2ERXA 2YOGA 2WMNB 3D31A 3QKTA 4OYHA 2HXYA 4A36A 1VG9B 2XTZA 4LC0A 4S35A 3SNHA 4BLOA 3HP1A 4Y0AA 2JGNA 4MRSA 4GDFA 3QNUA 2AK2A 1XU4A 1ZM3A 3KKMA 4NCNA 1HH4A 1WE2A 4FMDF 1AQUA 2V1XA 2VO1A 1ZYUA 4CEHA 1NY6A 2YZ2A 4M1TA 3BRWD 2AFHE 4RFVA 4LYAA 2Z4SA 4D25A 5TB5A 4OHYA 5JCPA 5FOWA 4Q4HB 3FYHA 4TMTA 5KSPA 3LVQE 2GETA 4HDCA 1GNPA 4URZR 1KZ7B 4GFDA 1E1QD 5IRCD 1M7GA 3K0CA 3EIHA 3PUXA 5JRJA 2OESA 2IWRA 5FL7D 1UEIA 2RMKA 4B2PA 3TQCA 1R5OA 2QMHA 2JDIA 2B21A 2ERYA 4M1YA 3RS0A 1AS3A 1KMHB 2XX3A 1XJQA 4JSTA 4PZZA 1S96A 4Z1MD 2GESA 1W4AA 1JJ7A 4GZMA 1ZCBA 4D26A 5JS8A 1UKEA 2CXXA 5L3SA 4WXRA 5GJBA 1P61B 2ODNA 2HJVA 2QPTA 1KK0A 2EVWX 5AJWA 4M9ZA 3QF4A 4ZIRB 1NKSA 2C99A 1P62B 1GUAA 2FV8A 3W3AA 2H16A 2C9OA 4F92B 3QENA 1UAAA 2ORWA 4XTCS 3DKPA 5J4HA 4LV5B 3WNDA 4QRHA 1XJ0A 3FMIA 1EX6A 2LWIA 4RCZA 5DISB 2HV8A 1E2IA 1N0VC 1II0A 1OLOA 3H4MA 4ZO4A 4OHZA 2IXGA 1XXHE 3TSZA 4Q1CA 3T12A 4BLPA 1PUJA 1RE0A 2H57A 1TMKA 2ZRCA 3QBVA 4LOAA 4BE7B 2Q9BA 4DLVA 3P4XA 1KY3A 2FE4A 3QQ5A 3U44B 1ZINA 2PCLA 4OJKA 1KO7A 1N6LA 2WBLC 3BORA 1KO1A 3LV8A 4AKHA 1HT1E 4MGKR 2WIAA 1DS6A 2YOHA 2B8WA 3A8TA 2GJSA 1TEVA 3Q9LA 4LHWA 4MKFA 3KXLA 4O0MA 3X2SA 2YVUA 4B3FX 4TWZA 2GA8A 4C7OB 1G3RA 3TQFA 1VPLA 1NP6A 2GBLC 1ODFA 3C4JA 4LY6A 4QGGA 3EASA 4CT5A 3KFXA 1YR7A 3AP3A 5FTLA 4PAQA 3ZVMA 4O2RA 4AIIA 2IYXA 2R65A 1N6RA 4GNKA 3ZQ6A 5BXQC 1YZUA 1AJEA 2ZSBA 5H8WA 3O8DA 4GOXA 3U61B 3TSWA 1NG1A 2JLWA 1CJMA 4MYCA 3CWQA 3LNCA 3ZVRA 5CLQA 1E4VA 1II8B 1CEEA 1MRSA 4FWIB 1XXHB 1UFQA 1DAGA 3C7KA 2CCJA 3ZS8A 1U0HC 4AG6A 3DM5A 2QTFA 1Y3AA 4IXMA 3EPKA 3VMFA 2JLQA 4G5QA 2QGZA 4PQFA 5DYIA 4OI1A 2B7CA 3LXRA 5AUOB 4IOJA 2VF8A 3ZGXA 2P6NA 3OE7D 3G0HA 3SBDA 2PMKA 2P6UA 3U5ZB 2BIFA 3Q72A 1DBSA 4QBIA 1G16A 3AQ4A 3QEJA 1XEXA 3R9XA 2V9PA 1Q1EA 5JS7A 3DHWC 5L3RA 3ICQB 2FWRA 2HCJB 2ZREA 4LK2A 2FOLA 3S1AB 1J99A 2XOKD 2O8CA 4QGFA 5F9HA 3ZJYA 1G7TA 2R6GA 2A5FA 3HU2A 4V0OA 4WW0A 5E7JA 1Z0KA 3OIUA 3QKRA 3SFZA 3ND8A 1GL9B 4IDOA 4HAVA 2VYFA 2ODWA 3KTAA 4E07A 2QL6A 3SFVA 3L8ZA 4N1AA 5E7MA 3BFKA 1Z63A 1WBBA 4HLUA 4M21A 3F8TA 1SXJA 2EFDB 2ZJYA 3AH8A 3M4YA 4DLZA 1HY3A 1RW4A 4E03A 2CK3D 3QSYA 3EARA 2UZ3A 1KJWA 1G3QA 2E1RA 5DSZA 3L43A 1KI6B 1H65A 1SKQA 2IYLD 1XTIA 4AYXA 1I2MA 4G5SA 1E2GA 5HPYB 3T5GA 4NYIQ 2A30A 4RKFA 3X1YA 2JLVA 5IDVA 2F6RA 1G3IA 1XMSA 1U8ZA 1TU4A 2FSFA 4GRAA 1E69A 4LDJA 3TIFA 2DWQA 1KO5A 1IBRA 2PLRA 2WJYA 2R9VA 3R9WA 3U3RA 3TVDA 3H2YA 4BFVA 1GTVA 2AFIE 2KJQA 5EUMA 4AD8A 2W83A 3KXKA 4Z8XA 1OXVA 1X6VA 3AF0A 2RGEA 3VR3A 5AJZA 2IHBA 1Z83A 3KJEA 2I4IA 1V43A 2XGJA 3MWLA 4RFSA 2ZI6A 2REOA 3U7EB 5FL3A 3GLHA 3JVUA 1JXOA 4UNPA 2EFEB 1MKYA 2CVHA 3KB1A 2P2LA 1XDBA 4Q01A 4Q7JB 2OAQ1 1DE0A 5C46F 1E9SA 3CX8A 3SI7A 2QTHA 4D80A 1ETUA 1NLYA 1NMZA 1OXSC 1ZNYA 2PCJA 4KYIB 1W48A 3KKQA 4G5OA 2IC5A 3MD0A 1N0WA 4R98A 4ZI3A 2BJVA 2D2FA 2RGCA 3K9LA 2GXUA 2RKOA 3PCRB 5DN6A 2W2XA 2VP9A 1E3MA 3ZZUA 1FL9A 2FPMA 2FN4A 1W0JD 3CZQA 3WY9A 1U94A 4F4IA 1RRFA 3EIQA 3OEHA 3BK7A 2PZFA 3KQLA 4X8LA 4C3ZA 3QY0A 4QGHA 4XOIA 5TV2A 4A92A 1KIMA 2FPLA 3U60B 4QJ5A 5CM8B 5J4VA 3HWSA 3UANA 1T6NA 2GJ8A 1HE8B 1Z29A 2AWNA 2QE7D 3K0FA 3ZH9B 1TNDA 4NONA 2OCAA 1XMIA 1W36D 4C0JA 2NQ2C 4ZCIA 1R8QA 1TF7A 4B74A 1EFTA 3IO3A 3VKWA 5FI0B 1E79D 3A1SA 1CR1A 5FR1A 1KDPA 2SHKA 5HCNA 1CF4A 4QHSA 3U3OA 2BEJA 4M9XA 3HDTA 3L82B 1T3SA 1W5TA 3EW9A 3LLMA 2DFTA 3ZIAA 1UBEA 4B2LA 1P7CA 3SQWA 1KZGB 2EU8A 1LTQA 2ZRKA 4BZXA 3U7HB 4Q4AB 1G6HA 2F9LA 2H18A 3CIOA 2KBEA 3FPAA 4A0RA 3QOFA 3SE0A 2B6HA 3PJRA 3KX2A 4YMWA 2XSZA 4DLXA 4YMUA 4QM7A 1N6HA 3WRYC 4D0NA 5BYKA 1RJ9B 1VG0B 1DVRA 2GEVA 2LCFA 5CLLA 4AKEA 2BMEA 1G7RA 4B44A 3QPUA 4JVMA 4NYMQ 5KPDA 1KI8A 1ZIPA 3MWKA 5DI9A 1QF9A 2ZE7A 4FIDA 1BMFA 2D7CA 2YNMA 2YYZA 2VP4A 1G64A 5IK2A 2RHMA 3P4YA 1JR6A 1IAQA 1VMAA 3K70D 5C1BA 1E98A 5G53C 1F60A 4QJ3A 2IYQA 1YVDA 2MSDB 2GVDC 2JLUA 2P6RA 3IEVA 3N2IA 3BAFA 3WHLA 2YJTD 3TJZA 4AWXA 1NBMA 1P6XA 1QZXA 4AI6A 1SVIA 2VL7A 3EAQA 4HB3A 1UEJA 3R20A 1XPOA 3AVWA 2V4ZA 3T15A 3B1XA 5A4JA 3UG6A 4CRWB 2CE2X 4ZDWA 1XEXB 2ZSFA 3NBZC 2MSEB 4YONB 1OIVA 2ZVPX 2NGRA 2PEZA 4WA7A 1A82A 2PT7A 2CL6X 1AS0A 1OYWA 2OG2A 2IYVA 3M0EA 2O8CB 3EZ2A 2ZITA 2GJKA 4KODA 4P31A 4HDOB 2V7QD 2BM0A 3QKRB 3P1JA 4BLTA 3AGPA 1G8FA 1U99A 2PX0A 3EIEA 3OFNA 2J1LA 5TVKA 3SHFA 3VHXA 1SKYE 2A5GA 2PZEA 4FMCB 4JVLA 3ICEA 3KTAB 2W2TA 1G6OA 3IHWA 1Q3TA 2GCOB 3OESA 3THWA 1E2DA 2VP6A 4A6XA 2REBA 1P9WA 1K8RA 2WWHA 2QG6A 3FMOB 3H86A 3ZZTA 2PBRA 3GJ7A 2O8DA 4DCTA 6Q21A 1YHNA 1EX7A 1PUIA 1GKYA 1E96A 3SJZA 3K8YA 3I3SR 3KKOA 2BMFA 1R2QA 4IFEA 1IM2A 1R5NA 3NBYC 2JLSA 3HJNA 4N3NA 3GJ5A 1J8YF 3WNCA 2BHRA 4XIGS 1Z2CA 1NVXQ 3RANA 4JVSB 4US0R 4BPBA 1J90A 1KDTA 1LF0A 4Q1DA 3ADDA 4A82A 4PZYA 3SC3A 1A2KC 2ZYWX 1M74A 4O25A 1NSTA 1JECA 4OK5A 1MOZA 2ZYUX 1SKYB 1PVOA 4PC7A 1QBKC 3T1TA 3SYLA 1NN5A 1E94E 3E5HA 4JYBA 1GOTA 1F2UA 4TLCA 3T1OA 1UJ2A 1WXQA 1AQYA 2ZRAA 3R7WA 3W6OA 2VBCA 1YU9A 1TAGA 5AUQA 1T0HB 4HLDA 1JR3E 4ZDJA 3ZD7A 4RFSB 3GLHB 3B2EA 4HUQA 4ZKDA 4EPVA 1AN0A 2IS1A 3DDCA 5K8TA 2F55A 2HYDA 1K5GA 1XX6A 2GRJA 5UKDA 2ZJ8A 1MO4A 1KI4A 2RGBA 3AV0B 3FVQA 3K09A 4LJ7A 2XAUA 3GLGA 3AVPA 4B76A 2ZRJA 1DAIA 2VH5R 4V02A 4GBMA 3FKQA 3ETLA 1ZU4A 4KXFB 4RSGA 2GXAA 2OO7A 2PL3A 2QQ0A 3MLEA 2BBTA 3PFIA 1E1QA 3PIRA 3PUWA 4I1VA 3TBKA 1W5SA 5DH9A 4RKEA 5FL7A 4LWZA 4B35A 1ANKA 4YMSA 4OK6A 4KSBA 1LS1A 4LHZA 2GAAA 2QSYA 2F3RA 5EE5B 4LJ6A 2DPXA 4LPKA 4Z1MA 3RVBA 3UKDA 3VTKA 3RAPR 2F43A 1W4BA 1AS2A 1GRRA 4HB4A 5K8IA 3K0FB 4JIMA 1WP9A 2R62A 3FHTA 1X86B 4IRUB 2ECKA 4EFNA 3BWDD 2ZJBA 3GEHA 3B9QA 1RRGA 2WWIA 3KDSE 1HYQA 1E2KA 4QM6A 3BC1A 3SS8A 1TQ2A 2VIIA 4A0HA 1TEXA 3P20A 2O8FB 2AR7A 3TVTA 3DM9B 1X3SA 1G8PA 3LAWA 2QM8A 4C4PA 3L0SA 2ZANA 1IN5A 4JLOA 2FFBA 4OI0A 2AWOA 2P67A 4P4SA 1NBME 2WM9B 2WJJA 1ZUHA 1ZM7A 2YC4C 2C95A 2V54A 4PPFA 2O0HA 4RY2A 3IIJA 1MO3A 3I1FA 1SVKA 1HA3A 4GT1A 4JYCA 1V5WA 2Q9CA 2OBMA 1G3MA 1E9BA 1GZSA 4ZDKA 4TTRA 4KYUA 1T8TA 2BVNA 4ZPXA 1CR0A 1Q44A 4RD6A 1E2FA 1X8KA 3NHAA 1E9DA 3SYNA 5L3QA 4NZYA 1HT2E 1W47A 2NO6A 1Z5ZA 4BEBA 3N70A 2QA5A 1PLJA 1R7RA 1FZQA 4LZZA 2ZU6A 3L8YA 5JWRA 2VHJA 1IQPA 5J47A 1OH5A 3DZDA 3VQTA 2V3CC 1CXZA 2CJWA 3ASYA 2FH5B 1G8HA 1KGDA 2GTPA 2XJ4A 3LX8A 4DDVA 2J9RA 4TL8A 5J4LA 1KK2A 1KY2A 5AJXA 4TMZA 4BFXA 1G5PA 4JLKA 4HZIA 4P32A 2FU5C 3SHWA 1GWNA 4YDSA 1T5IA 5JI3E 3CX6A 4R7ZA 3X1WA 2ZRFA 4DCNA 2ZRPA 5B58C 5KDDA 2D74A 3OE7A 3OZXA 1XEWX 4PQYA 1Z47A 4UNNA 3BIFA 2XTNA 4QFMA 5IT5A 4DWJA 1E2QA 2OLKA 3N5CA 3V4RA 2B8TA 2KI5A 5EZ6B 2XOKA 1VYVA 3D3QA 5LDDC 2H17A 3THWB 1Z6GA 2OXCA 4KAXA 4O2LA 3AVUA 1RYFA 4LHXA 2ZAMA 3VNUA 1BYUA 2H5EA 2ZEJA 1COWD 1EFRD 1IY0A 4IOMA 5KDLA 5TDHA 3VU9A 4A2QA 1GFIA 3QG5A 3R8FA 1H8ED 4XTRA 2VHUA 2VQSA 4US2R 1IXRC 3GLGE 1D5CA 1G4UR 4KLZA 2WWFA 2HF8A 1XCGB 4XH9B 1L7VC 2AN9A 3LQRA 3QIAA 3R9IA 1DEKA 2CK3A 3RABA 1R8SA 1E1RD 1P9NA 1F6BA 1W4RA 2H7VA 3IQWA 1AK2A 1UBCA 2OAP1 2QENA 4B3GA 1CRQA 3B82A 4KFUA 2IX3A 1MABA 4MDFA 1T3LA 3AEZA 3MGCA 1S9DA 1IXZA 3B1YA 4NP6A 3A37A 3HR7A 4B47A 5IF9A 4MGIR 4A8JA 5KU1A 1E9CA 1KI1A 1DAMA 1D9XA 3ADBA 2WOOA 4PSKA 4LJ8A 2CNWD 1NJGA 4RD4A 2C2HA 2IS6A 3CLVA 2NOAA 4AK9A 4DT1B 4V03A 4HUQB 4ESVA 2HCBA 3LX5A 3CPJB 3AKYA 1DARA 4CDGA 1D9ZA 3GLGB 2KSQA 1YR9A 1N5LA 4M1KA 1GKUB 3ZZ0A 4BFYA 1JI0A 4IVPA 1ZNXA 4IDPA 1UF9A 4KVAA 5AK0A 3RRMA 2XNSA 2I3BA 1OE0A 2B92A 4NHOA 3ZS9A 2EWWA 2C9YA 4QL3A 1EFHA 1SGWA 4KHZA 3X1XA 2ZJ2A 2FPKA 1VG1A 4PZLA 1XPRA 2RH5A 3K0AA 3AM1A 2NZ8A 3NH9A 1NNEA 1KHTA 4OI2A 2NIPA 4B75A 2XNDD 4LX0A 2I1QA 5LD2C 2CBZA 2XEXA 4HAWA 1W0JA 3WNBA 1WRBA 3E2IA 4N0EA 2GDJA 3FMPB 2C9CA 3K9NA 1LV7A 1S3SA 2R6AA 3DMDA 4WZBE 3H1TA 4TYNA 4W9MC 2PZGA 4FCWA 1N2CE 4LJ5A 3UK6A 1XZPA 4URXR 3H0KA 4M2LA 1W49A 2QE7A 4GZLA 4OQMA 4GMDA 3W8NA 1D8TA 3D6TB 3CF6R 2DYKA 4JLAA 3W9YA 2WHXA 3B78A 3RS5A 1E79A 4LBZA 1T91A 5A5GA 2C78A 3U2QA 2O5VA 4DLYA 4RVCA 2OILA 3DKVA 1IN7A 1FUKA 1FTNA 2O0JA 2X77A 5IHPA 4DXAA 1P60A 3FTQA 5B64A 4PPQA 4P4TA 4MDEA 2CHQA 1CRPA 2Z43A 3RRNA 3NH6A 1CJKC 2PJZA 4TMVA 4Q9KA 4G3XA 4DLWA 2ZI9A 5JHGB 1FQJA 3MWJA 2D7DA 3GQBA 1KMQA 2RGNA 4LYFA 2NMVA 1OIWA 1G4AE 3MG9A 2PJRA 2O52A 2CJWB 3QI2A 2XZOA 2QAGA 1ESMA 2DBYA 2ZUDA 3FMFA 2IWHA 1E99A 1YR6A 2VP2A 1ZVQA 5G41A 2NO1A 2J0UA 4G0NA 4KJZA 3TMKA 2ZRIA 4PAMA 2ZJ5A 5TXGA 4JS0A 4UJ3A 3SOPA 3RLFA 4JLBA 3CRRA 4L16A 4RZXA 4FWTA 1KSGA 2Q3HA 4EPYA 1YQTA 3RSLA 3PEUA 4DSTA 1CBUA 2F9MA 2QNRA 2D62A 4CT4B 2JLYA 3NKVA 4OQNA 1KJYA 1E0SA 4V0KA 4Q18A 1SVOA 1C1YA 1FTSA 1E2HA 1JEEA 3L0OA 3U7GA 4M9QA 1QHGA 1XD2B 4MRNA 4POAA 2G1JA 4GSYA 4MQBA 4EJSA 1Z6YA 2IK8A 1S0UA 3Q5DA 5D3QA 1MT0A 3UIEA 3TGPA 5FUYA 2V7QA 4UKDA 5BN3A 5SZIA 4JLPA 1ZW6A 5B2ZA 4LRWA 3HU1A 1GRNA 1I2DA 5FBQB 4WBSA 5LB4A 2ZROA 4QXAA 3UMRA 2AX4A 1P2VA 1W46A 1Q3HA 1FFHA 5C4GB 1S9HA 3VU9B 5EE9A 1ZJ6A 1TQDA 4YMVA 4Z8YA 2LKCA 4LI0A 4Q9JA 3Q85A 3AVTA 1JXMA 3R8CA 2P0EA 3HPRA 4M1WA 2IYRA 2WJGA 1L8QA 1P2TA 3X1DA 3OIWA 421PA 2WAXA 3B1VA 4BEJA 1Q1ZA 1XP8A 2FX3A 2CLDX 2CVFA 1MABB 1XZQA 3FOZA 3O8CA 1R0YA 3IIMA 4EQ6A 2FFQA 4XSHA 3FFAA 1GIAA 5TMPA 1OKKD 3T5DA 1R5BA 4A8JB 3MCAA 2GCPA 3CR7A 1FMLA 5CDFA 1ZUIA 4Q03A 4A2WA 2ZE8A 4EDHA 2WPDD 1E2JA 3A4NA 3EZ9A 1YZKA 3AP2A 4TLEA 4JJKA 1KI7A 4KVGA 3CWZA 2RHDA 4DCUA 3CRW1 4HB0A 3RSOA 2Z83A 4LPSA 3U7FB 5SZJA 2JJ2D 1KNQA 2IF2A 4RZUA 2ZM5A 1Z0DA 3B1ZA 1D6JA 1G5TA 1XMVA 2QRZA 4BFZA 4FD2A 4DBLC 2X2EA 3QKSA 2JATA 4GP7A 4KFSA 3ECCA 3OIVA 4MITA 4PHHA 1DAKA 5ELXA 4Q02A 4PO1A 3ZD6A 1XTSA 1Z6XA 4KI0A 3W6PA 2OCBA 1XD9A 3GLFA 2NO0A 5LBIA 1VKJA 4L9SA 4XVUA 4LSGA 2FSIA 5CB6A 1G8GA 3KJGA 3I72A 2EYQA 2E9SA 4D2IA 5K8LA 2AHOA 2CE7A 1U9IC 4EPXA 1NVWQ 3I8XA 4X8OA 4QOSA 5LB2A 1PJRA 3VNVA 1HV8A 1JEDA 2N1BA 3LBNA 2XB2A 3P27A 1RRPA 1NKTA 4RZ2A 4TQAA 1YZGA 1LNZA 3C5CA 5JBQA 2GAOA 4EIWA 4B34A 1J70A 4D6PA 3FKSD 3NIBA 3AVQA 4BZPA 1W36B 5JCZA 3IQXA 1SULA 2Y8EA 4BWYA 4U02A 4MA4A 4B33A 2UKDA 2YC2C 1Z0FA 2A5DA 3X1ZA 3I62A 4CEHB 1E6CA 2DWPA 1AKEA 3BGWA 2VSOA 3TNFA 4AG5A 2QP3A 1W4CA 1NN0A 1ZMXA 3B60A 3QG1A 1EFUA 3U6BA 1LFDB 3THXA 1EESA 1KK3A 1NIPA 3WYGA 4D4LA 3QXXA 4C2UA 2WWXA 3WRXC 4Q9IA 4GMXA 4DEYA 2J3EA 4YC7A 1ZC3A 3GFOA 1T9HA 3DMNA 4HZUA 3FWYA 5G40A 4NBSA 5CM9C 2VSFA 2G9NA 4TSFD 3IBGA 4DDUA 1AM4D 1SQ5A 5AR1A 2IS4A 1EWQA 3AKCA 2Z5FA 1QHIA 5JFGA 5KTYA 5L3SB 4K8OA 2MSCB 4PPNA 2QQEA 4HATA 2QEQA 3QXCA 4C0HA 1E2MA 3QF4B 1OH6A 1JQLB 1N5KA 5G3YA 3NEYA 4LBVA 2QAGB 3DO6A 2QORA 2ZRHA 3NG1A 3M1IA 5BQ5A 1R10A 3TKLA 5KPJA 4QJ4A 1FNMA 4A1FA 2YWEA 2J7PD 3D7MA 3PEYA 2BMDA 3KJIA 2ZQ5A 2X1VA 3U6KA 2BWJA 4URWR 3BJIC 3KQUA 4MRVA 4UXIA 1G17A 2FZLA 4A4DA 2AKAB 1EGAA 1BS1A 2GVZC 3CX7A 1PLKA 2BCGY 3UMSA 2AD5A 4Q7MB 4TTQA 2FDCA 3FDIA 3IO5A 4V0LA 4EJSB 4I1SA 2HT6A 4URVR 3C16C 2J0SA 5CDFE 2ZVQX 1TQ4A 5CIWA 1XJCA 3GJ4A 5FOTA 1JPNA 2D06A 2A7QA 4HYYA 2CDNA 5EXPA 3EZ6A 1I4LD 4TLBA 2Q3MA 1NLFA 3RS4A 4IVQA 1CLUA 4IDNA 8OHMA 3RNLA 2A78A 4ABYA 1CR2A 2QAJA 4PAOA 1RIFA 2W6JD 5FBWB 4B6FA 2J45A 4M53A 2J59A 2QRNA 1MV5A 2D2EA 1NVUQ 3NWJA 3SZRA 1COWA 1EFRA 2O8EA 5AUPB 2IUTA 3TAHA 1GNQA 3MUFA 1VYTA 2WKQA 3NBFA 5GJVC 1VHTA 1M1YE 2ZS9A 2KB0A 1H8EA 2QTVB 1RVDA 1SXJE 4TZ0A 2OBNA 4IEIA 1N3BA 1WA5A 4EQ6B 4XWKA 3GLFE 1IJEA 1N6IA 1NMYA 3T34A 5EXXA 4ON9A 3WP1B 3OF5A 4FN5A 4TN1A 1E1RA 2VHQA 2NTYC 3CBQA 4ZCMA 5GADl 3GP8A 2J87A 4B2IA 2ZS8A 2G83A 2GWHA 2WAYA 4B71A 4LJYA 3ONWA 4D82A 4DEXA 3PEWA 2GJAA 4GOJA 2LKDA 2AD1A 4JKYA 3UATA 4KCGA 3N2EA 1TTTA 2ZUBA 1ZM2A 4GPTA 4TT3D 2BEKA 1ESNA 2DY1A 1DAEA 2WIBA 1IONA 2K5UA 4LHVA 3SN6A 2ZTSA 2CNWA 4G1UC 1VECA 4D4KA 1T4GA 2AL7A 1NL3A 3TW4A 3QKSB 4EPWA 1RZ3A 4BFSA 3MRSA 3VR5A 2BBSA 2D4HA 2EFGA 4FCTA 1SXJB 3GLFB 3ADKA 4EUNA 3I5YA 1E9RA 4PC2A 2QI9C 3KKNA 4M4SA 3K0CC 3GLHE 4NTZA 3PUZA 1F3OA 3U3JA 4DJTA 3LW7A 2CCGA 2V1UA 5GJCA 3DEFA 4MGYR 4HAYA 3CNOA 4Q4JA 1XBTA 2XB4A 2IHYA 2YOFA 1FMJA 4IOLA 1VCIA 5AJVB 3RYTC 2D3WA 1GDDA 221PA 5CYOA 1XF9A 2XNDA 2Q21A 5KOYA 3VKHA 2RGAA 2WJIA 2WSSD 3CKLA 4DUGD 1FNNA 3A1VA 3PR1A 4A0GA 1GITA 3UXMA 4YXWD 2GXQA 3PUYA 2OHFA 5KNBA 2OE2A 2EYUA 2C96A 3A36A 3PITA 4XJXA 5FBLB 4BASA 4XSGA 4UNQA 1OXTA 5JRZA 1W7AA 1YZLA 1TADA 4QBFA 1EG7A 1FOEB 4B6EA 3I8SA 4JT4A 3QVVA 4TYYA 1G21E 2BC9A 1F2TA 1UBFA 3FHOA 5SZKB 3AVYA 2IA5A 4PC6A 1KDRA 1OT3A 4HZUB 5CK4A 4EPTA 2E87A 1OV4A 4NH0A 1YZTA 5FPYA 1N6KA 3QXSA 5CYPA 3LDAA 4CGZA 2P65A 5FPKA 1HQYE 4H1VA 1Q57A 4Q66C 3EG5A 2GZHA 1W1WA 1MO6A 3GJ8A 4MRRA 1KSHA 2P5TB 2FFAA 3WBKA 4A15A 1CJUC 4MYHA 1OFTA 3CPHA 3IKJA 3SJCA 2W6ID 1G19A 3PEVA 4BECA 1XPUA 1XEWY 3QPWA 1YZNA 1US8A 3A1UA 2GBLA 1YRAA 2OCPA 2JJ1D 1VCNA 4LGMA 2A2ZA 3AVVA 2ZR7A 3KUCA 1YJ5A 4D4JA 1EFCA 1WQ1R 3P26A 3GPLA 2OCYC 3CM0A 3CF2A 4C0LA 2F1IA 3NTUA 4W7SA 3REGA 2CHGA 5B57C 5DYGA 2RGDA 5DHFA 1NF3A 4Q47A 1HTWA 4JBXA 5DLQC 3RHFA 1FW6A 2UZIR 2REXB 1AGRA 3QBTA 4I81A 1OSNA 1CP2A 1W2GA 2V6IA 1XFAA 4JLMA 2H8KA 3DOFA 3GLIA 5L8VA 2A3RA 4DCVA 4MGZR 5A0FA 5DE3A 4Q19A 4BGDA 1Z06A 5BYJA 1CJTC 1MRNA 2G1KA 3WP0A 4ASUD 2QBYA 1TUIA 1S4QA 4DRZA 1G5RA 1WB9A 1VHLA 1CIPA 2AK3A 3CR8A 3VFDA 4PXAA 1NMXA 1MR3F 2NO7A 1YKSA 1S8FA 1Z8FA 4JSYA 1NSFA 5FTNA 3RWOA 3GJ6A 2ZRMA 4JLJA 4NU0A 4NCJA 1ELOA 1P9RA 2JAQA 1UKVY 2VTKA 1UM8A 3W90A 3KB2A 5C18A 2NPFA 2RCNA 5FTKA 5BWMA 4W5WA 4HLUC 3JZMA 1GAJA 4BQSA 2IYTA 2O8EB 1SXJC 3LD9A 5JWOA 1WMSA 2OM2A 1E32A 2IW3A 3CPEA 1KI9A 3QXJA 2KWIA 5AJYA 5FFMA 3F0TA 3ZYCA 5DNYB 1VCMA 1IN4A 3WMEA 4FMDB 2J41A 4IDHA 2IYWA 4WVFA 2N42A 4TLAA 1IXSB 1SHZA 2R2AA 2ZRLA 2QMOA 4JLNA 4C0KA 1XTQA 2ANCA 3AF1A 3VR1A 2WVJA 4Q21A 3CH4B 5CK5A 3L0IB 5EJEA 1G291 2DWOA 3EA5A 2WKRA 4W5JA 1EWRA 1IOZA 5J4KA 1OKKA 1ZD1A 4B73A 2HLDD 4K46A 1JR3D 1ZP6A 2NO9A 3KJHA 1P73A 1VIYA 4MH0R 3IDQA 2WPDA 1GVNB 2XITA 4V0NA 4JL5A 3AF2A 1CKEA 3VX3A 3C41J 4D0LB 1G3UA 4L4UA 2HT1A 5FI1B 3RS3A 4DZZA 2VA8A 1D2MA 1UKZA 2JJ2A 1OF1A 3F5FA 1IN6A 1KJZA 2O8DB 2PH1A 4IKEA 1N0UA 4TTPA 2XZPA 4URUR 1E2LA 3AKEA 1Q12A 2ZS7A 2R6FA 2P5SA 4L9WA 3U44A 3TAUA 1TL7C 4OJQA 4TLDA 2WKPA 4Q4JB 4WAUA 3KL4A 3LLUA 1Q22A 3A1TA 4BLQA 1DAFA 3WBJA 3KQHA 1O3YA 3I5XA 3BOSA 2RGXA 3NC0C 4WZAE 4UQOA
chains in the Genus database with same CATH superfamily
4A16A 2OZKA 2ZI4A 3C8MA 1XTBA 1ECPA 4QXMA 2FEMA 4FHZA 1CDOA 1DCMA 4DLSA 4E0BA 2P9ZA 4XIIA 1M8PA 1CT9A 2IYSA 3RM3A 1A8HA 1JALA 3K0EA 3T52A 2CVPA 3FAKA 3GFRA 1QTQA 1NUSA 2AKEA 4BBPA 3F78A 1I1OA 3M81A 2EG5A 3G0CA 2A86A 3FD8A 3NWPA 3OEED 2XEDA 1BH2A 3OKPA 4QICA 4RF5A 1P8AA 4G89A 3IHTA 4LZPA 5FPSA 5LQCA 5CCBA 5H59A 2YWFA 1ORRA 3LUJA 4TM8A 3AHHA 5CR9A 2YHSA 2XVAA 3MOGA 3C5HA 1Y9ZA 2P3SA 4MPTA 3A4LA 1R12A 1F2TB 4LVNA 3GNQA 2ZSAA 3P5SA 1BDBA 3H4IA 5AKYA 2XCOA 1JHMA 3AFHA 2B8EA 3JZAA 3ZU5A 5B7NA 5MFPA 4Z9BA 2X7XA 1FJ2A 4IEFB 1E92A 5K03A 2CW5A 3G68A 1G59A 1IPFA 3JZFA 1CHNA 1JPVA 1T5LA 4IO1A 2PLAA 1RFGE 2R7AA 3LW8A 4LDPA 4LSWA 4BLUA 1RBYA 3E1SA 3UKOA 4QGAA 3CRQA 4BUJA 1Y4DE 1DU4A 1RAFA 3PC3A 3UK7A 3O4FA 3KOUA 1GUDA 2CJPA 2IFTA 3WWEA 5G02A 4Z53A 3BDIA 4NK4A 4GO1A 1OFUA 1N34B 2ZIZA 2DFLA 4Z0NA 4M1MA 4MWSA 2IOQA 2HXGA 2C5SA 1YMQA 4BLVA 4JBIA 3ZN2A 5F9FA 4WXEA 5TS3A 1BXKA 3DKIA 1OLUB 3FIUA 1JAYA 1E0DA 4B81A 3LCVB 5EXTA 1CJVC 2IIBA 2X8BA 3IIKA 4FR0A 1CR4A 1TRKA 3QYPA 3KZ1E 3ZDFA 4TWRA 1DRWA 1XCMA 1DG3A 3DHNA 5LQRA 4P58A 4CR7A 2AJBA 3PT9A 3AL2A 1FLVA 1OROA 1UDWA 3I1IA 1AGPA 4PZ9A 4ZO9A 1X7DA 3LKDA 5CPBA 5D00A 1CLEA 2UVQA 2IELA 4LYHA 2G88A 2ZYHA 5SICE 4HEJA 4WXPA 3RGGA 1KVRA 4M87A 3G2JA 4LWQA 4B9EA 4ZCLA 2RK4A 2X9NA 3HL0A 4LV8B 1KVQA 3RYHB 2FNAA 3EE6A 1YCDA 2A8YA 1CULC 2P9TA 1H3FA 1GLNA 2UU9B 2NP6A 4K87A 2F3TA 1B6SA 2W2KB 3CUTA 2G6TA 4WOBA 1ZUWA 4YDRA 1DMRA 5EZSA 1XNRB 2RIPA 4KDEA 1OFIA 5FBVB 4MULA 3SYMA 5M34A 3JD1A 1I2CA 3IP5A 2NYVA 4S0ZA 4AJLA 3VZCA 2OUIA 5FUVA 4UNSA 1INLA 4NMHA 2VDVE 3ZCQA 4JI5B 4C0BA 4YQFA 2AOUA 1LX7A 4S2UA 4B4DA 4N8SA 1SG0A 3VM6A 3WGVA 1TIPA 2NV0A 4MAMA 3ZQUA 5LOVA 4MIEA 2P2CA 4D9MA 4IZ6A 4B3DA 2IZ1A 3A1WA 3GH3A 3NHPA 1NRWA 1XHFA 4FYKA 3CNNA 4L3OA 1OOEA 5AQ1A 1BZYA 2OC9A 4TX1A 3B6EA 4H1UA 4PPGA 1Z0JA 3HKDB 3OJFA 1OV6A 4OUKX 4YAWA 2YL2A 4M88A 2F1JA 3RFXA 3W77A 1BEEA 4YJGB 1Q1AA 1LLFA 3T7RA 4Z7NB 1RWPA 2GK6A 1T9BA 1T0UA 4GE3A 4J7AA 2CMFA 5AI4A 5IJ0A 3H16A 1DCKA 2GB4A 3HVIA 3OUZA 4RYDA 3DPSA 4TMKA 3CV3A 1B8UA 1EJ0A 4F11A 2C5EA 4NPHA 5F5NA 4IHJF 2DFPA 5M04A 3ROFA 3LTEA 5AOAA 3HN2A 1NPYA 4K81B 1N9GA 4J0QA 1QHYA 3LQYA 3HMKA 3TB4A 3H6HA 3IPXA 1O4VA 3BE6A 4H3SA 4J16A 4BU0A 4YIHA 4U5XA 9MHTA 1FBNA 3NYQA 2VSXA 1BCRB 3K9QO 3TIIA 2XA1A 1NW8A 1PBTA 2O06A 2WLSA 1A2BA 4IH1A 3Q7PA 1Z34A 3SGLA 3THOA 3HVKA 1NAIA 2C1EA 5GIPE 3EZFA 3LDHA 2OBFA 4OOFA 5CAEB 1GZ3A 1U9ZA 5G0SA 4TKUB 4RORA 4BRZA 3RSGA 3CB2A 4R9UC 2O05A 2EWVA 2R6DA 4L8VA 4PN3A 4UDYX 3FYCA 2GD0A 1ZO8A 2GBFA 3M9LA 2XMRA 3KLBA 4BGUA 2VLIA 2KLBA 2J5BA 1CQIA 2Q41A 5CT9A 1B23P 2P0YA 1Z0ZA 5BNWA 1RI5A 2VH1A 4FOTA 4NE7A 4Q4CA 1POXA 3EVBA 4HDNA 4INAA 1E3LA 1GPBA 1ZICA 4HOYA 4UJ5A 4BRUA 4UHFA 5EQTA 4HQ0A 4UBNA 1RKXA 2WNHA 2JJ8A 3FZYA 3OM1A 3R5KA 4HFNA 4IXTA 4CG3A 5JVDA 3GJ0A 5DTRA 3BULA 1RJ9A 1VJGA 2PR7A 3X2EA 2ZUUA 3HN6A 4LJ9A 4MYTA 3EFOB 5H3LA 3CW8X 1EH5A 3QEKA 1KAHA 3UMJA 1PJ8A 2IUSA 2UZ0A 4LXUA 4C4RA 4DAOA 4E09A 4QKQA 2EBUA 2XTJA 3W5JA 1VJCA 5JXGA 3T4UA 3M7IA 3HYRA 3DP9A 3OLQA 3K5HA 3KSDO 4LJ4A 4RDHA 2I34A 1T2NA 3G8AA 2Z4RA 2GM3A 3FYUB 3A70A 3I04A 4H7HA 4BNDA 4BV9A 1R1DA 1TMGE 3DL0A 1Y63A 1NX6A 4MUYA 4XD7D 4C6SA 1FUUA 5BPFA 3TGLA 1KNXA 3PYLA 2VT3A 4YXWA 1XK7A 2X8WA 5JJCA 5E9WA 4NAVA 4BO7A 1CY0A 4JC4A 1ZBDA 5AM5A 5BRNA 3LKZA 3MHTA 3KZXA 1S8OA 3PDJA 1OVGA 1Y6GA 1JFSA 2BLNA 5JD5A 1KOGA 1EXWA 1N36B 4E5YA 3TOCA 2A1TS 2PD6A 1U8AA 1D2EA 1Q77A 2HOQA 1KFKB 2R6ZA 3CZ5A 4H4DA 3WSWA 4DA6A 2YWGA 3MK31 4CN8A 2GK7A 2WFZA 3MYYA 1H3NA 4PLVA 4FHGA 4R1QA 2BKUA 4WN9A 2X41A 2A59A 1FDRA 5AW4A 4MARA 4HLCA 4F1JA 5IJWA 2IEGA 2RC5A 3WLOA 4R2MA 3BFVA 1UKYA 3O73A 4ENPA 5AW8A 4ENSA 3MBIA 2C5LA 1RKUA 2CVZA 4BVLA 4F45A 4CIAA 1CUXA 4E13A 2B35A 4F91B 4H16A 5FAKA 5HF8A 3J81k 5BT8A 4KBFA 4ZAGA 4DMGA 3HBMA 1RJEA 1CYDA 1M7HA 1DO2A 3D02A 1MF7A 2BR4A 4FC7A 4GXNA 1KYXA 3PTZA 4GYYA 4KN8A 5JMTA 3HEBA 5BVHB 1BWQA 3IEUA 1WHSA 1KI2A 4CIVA 4IDEA 1PYGA 2AUTA 2NNWB 1FPMA 3V8MA 1TJ5A 3HJGA 4XIFA 4G36A 4LEIA 2B4YA 4DLUA 5FR2A 4Q1AA 3G2LA 1MU0A 1SUEA 4HN9A 3SQXA 1E2EA 1ODLA 5J5CA 4Z4FA 3IDAA 4EA8A 1NXPA 3GNSA 3R0ZA 4H6VA 1JDBB 2FAXA 3GD7A 3PQ4A 3ZE2B 4MHTA 4NEQA 3BWCA 2V0GA 5ITWA 3MOIA 1BGWA 2WIJA 4IX1A 3JQEA 2KW5A 1BNCA 4BO2A 1AUQA 4L6CA 2Q0HA 1JZQA 3EWAA 3QPVA 3L92A 2A9PA 1E6EA 3EXFB 4QT0A 1E8MA 1H8HD 3EA0A 2BFPA 2G9UA 2VA9A 1X77A 2GZRA 1LB1B 1S6YA 2ZSDA 1N8TA 4LCBA 1TM3E 2OB1A 2QT1A 2EJCA 1TA9A 2WV9A 3P19A 4IVRA 2XB6A 5HGJA 3MMPA 5CT5A 4TQGA 1YL6A 2X5XA 3RGWS 2QMEA 1E0KA 2ZZKA 3VRHA 1JEQB 5JFTA 1P9OA 3AIOA 1C81A 1Y4AE 3QE4A 4IIDA 4PX2A 2JIPA 4NL4H 3CJQA 4MVXA 1Z0IA 4MLZA 1YBHA 2PWPA 2QZ4A 3GJTA 4P4UA 5DNUA 2EKDA 4HAXA 1NXOA 3RC8A 4JR2A 4GD3Q 4K6MA 4PYJA 3HUFA 3WL8A 3EZGA 1TJYA 5AH0A 5ILQA 3K70B 1GO2A 4AJ2A 5FH9A 1YNSA 3GFVA 2BI8A 1AUVA 2H92A 1E61A 4J76A 5EKDA 2G6BA 3QE0A 1E89A 3W9BA 2CLCX 1SA0A 2I2XB 2C04A 2M1XA 2HA2A 1JHRA 4DLNA 3A2NA 2GR9A 1ODIA 4QQRA 1TIBA 1FS5A 4BVHA 2I6XA 3GRFA 4JJEA 1FVOA 4A5SA 1XTRA 2HRQA 5AHOA 3D6UA 5J40A 3SX4A 3L7IA 2QYOA 1UBTS 3GGSA 3FTPA 4A8JC 2B7LA 4R9RA 4EM6A 3OT1B 5BV1A 3CBGA 4JEHA 4QPNA 3VBEA 3FF4A 4OK3A 4WNYA 2VZ0A 2LW7A 5EVCA 3FYUC 2F8SA 2HLDA 4M7RA 2J6HA 1C30A 1YAJA 2R1VB 2YV5A 1V9CA 1JR3A 2QQ5A 4UATA 2Z2YA 1YMUA 5KYYB 1Z82A 2FA9A 4FSXA 4J1NA 2ZZNA 2DKNA 2AXEA 2YWHA 5CXQA 1CB7A 1G98A 4YRIA 5COQA 5T7BA 1OYYA 1ZC4A 4EI7A 2PO7A 3ZNPA 1OJLA 5KYUA 2R68A 3H4TA 5JWHA 1IY9A 3CLTC 1L7EA 4KIJA 3PPYA 4NJOA 5HFJA 1RXSA 3IB6A 2ZOSA 2C03A 3UICA 2IPAB 4KITB 2HA0A 5JZSA 2C9ZA 1B2LA 1Z2EA 5HFNA 4NE2A 2BH9A 3O74A 3OQ1A 4FBMA 3H8SA 5ANRB 1KO8A 4TL6A 4BNLA 3DMTC 2Y4OA 1JBKA 4HMPA 3HBFA 3HABA 1RPJA 2XXBA 4E32A 1I36A 4EL0A 2LNDA 2XODA 1I24A 2H2WA 3JSXA 2GEDA 3L8HA 3KCNA 4OXRA 2QQGA 3IJEB 1CY8A 4QFDA 4RK4A 2IDMA 2LBPA 5ESXA 2BBWA 3N6RA 2OBYA 3K20A 1R16A 3MLAA 3PPVA 1KBZA 2XXAB 2WTUA 2PA3A 5HYVA 3CGWA 3ELUA 2I6UA 3D2CA 1JV2B 1ZN9A 2VWHA 5K05A 1SUFA 4OQXA 5JATA 2WQ6A 1F0NA 1A9OA 1N3LA 2BZSA 3Q9UA 2VDLB 2Y1OA 3R7LA 4XVQA 3RFTA 3UMMA 1JDBC 3UH1A 1TD9A 4KR0A 2ZUFA 3HP7A 4A3SA 4TMXA 5I51A 4IEEA 1P29A 1T35A 4U7TB 2QX8A 3S2ZA 3FTDA 3IGFA 1NG9A 3AVYA 2J46A 2ZSIA 3I0ZA 2XBUA 1ZWLA 3LYHA 4KLRA 3P96A 3LZ6A 2Q9AA 5F35A 2ETVA 3DQPA 4OHPA 2BGGA 3HC7A 4UCQA 4Y18A 3ZE6A 4CI9A 1Y6FA 3HH8A 1SG9A 2IEZA 4W1RA 2BFCB 2X0FA 4L6IA 3WLEA 1FXUA 3S1SA 4X20B 4GLJA 1XRNA 4C2TA 3PR3A 3T9BA 4IIBA 3BRSA 4JXZA 2P2NA 4B7CA 2V7BA 1H1LB 1CUCA 4FFNA 4CFYA 1T15A 4FE4A 5ICGA 1WBDA 1NNUA 3N8IA 1DJQA 1X7ZA 1GCGA 1LPSA 4DNXA 4ND8B 5BNZA 5EUCA 4KP7A 1AGYA 5CVJA 5LFAA 4C6TA 4H7JA 3DS8A 1BXRB 1H2XA 4MKRA 4OMUA 4PR0A 3QX3A 4OY3A 2LZ0A 1ZOPA 3G1TA 3ESCA 3VPAA 4QHYA 4RULA 1R6BX 2W6MA 1PJLA 4BWGA 5JNVA 3BMOA 1ZD8A 4D0GA 1RQXA 2QAGC 3NVAA 1SM4A 1ADJA 1LC3A 2FCAA 2HDNB 3K70C 4HF7A 1LF5A 3H5RA 4MR7B 4CFZA 1X8LA 4XYGA 4OHBA 3FOAA 3JALB 3T3HA 1CETA 2R84A 3Q9NA 4KR6A 1M2NA 3FB4A 4WY2A 2ENUA 3VZSA 3LX4A 3TJRA 2HMTA 3VR4A 1D2GA 5GINE 4YDQA 1ZPDA 2VPTA 1VI5A 4GAEA 4LRXA 3EGIA 3B1WA 3K9GA 4L28A 3GFPA 4Z7JA 3O7WA 5K0NA 3KBBA 4HPWA 4PYQA 2LXNA 4BGVA 2ZJ0A 4TMWA 4H3VA 3JTMA 3HY4A 2ZXUA 3NHBA 3PDIB 5DGXA 4JI1B 4IRMA 1DDIA 2DBVO 3FPCA 4LK3A 4X1IA 5FWDA 2IF0A 2R1TB 1CRLA 1KVTA 2WU8A 4PHTA 3WB1A 5FI5A 4EJSC 5JOQA 2XQGA 4RD3A 4ERNA 5FPTA 3PICA 4PSAA 1VE6A 3LY9A 2R8RA 1QH9A 1I30A 4NQZA 4AQDA 4CW7A 4TZ6A 3A26A 3ESXA 3H2GA 4CKZA 1Q17A 4N3BA 3F8WA 5HMMA 1J97A 2A9KA 2B4TO 3QVGB 1HF3A 4HDQB 4MQFB 5D86A 4PLFA 2CMDA 2VEOA 4COOA 4BN4A 3ZWAA 1KVUA 1I3KA 1Z8HA 3LRPA 1P72A 1YGYA 2K4MA 2HJSA 2HRDA 3DBVO 3H87A 1U0JA 2FSVC 2OY0A 1P0QA 3FCEA 3ZU6A 1KEUA 1QH0A 3V32A 3H8VA 4E5UA 3SZMA 4RADA 4AKGA 3LBHA 1V48A 1KSFX 1LJLA 3FCSB 3QPDA 4EHJA 1PJZA 5J58A 4RHCA 1ZI8A 4PANA 2Z0MA 2HPHA 2PMDA 2ZI5A 1WUIS 4EG1A 4KC0A 3JQ9C 4KKVA 4EHLA 4PS0A 2ZFUA 3O03A 1TCUA 2BGUA 1NU6A 4I50A 1IK4A 2A0FA 1JDZA 1KY5A 1ADBA 2NG1A 5C8DA 1VG8A 3RD5A 3W06A 3R5JA 2PH3A 4PE5B 4V0MA 4YGYA 2JIDA 2OAEA 1PN3A 4QEKA 3U3MA 2PUEA 4FLEA 4RZ3A 3TPFA 3W0LB 4DWOA 2JGDB 1YZFA 1G60A 1S1MA 3KJQA 3DFFA 1NXQA 2WIGA 4QREA 3UXEA 2D13A 1Y8QB 1YS7A 3OE1A 1KYZA 4ZVPA 3AWDA 3H2IA 4KBYA 5KNDA 1KKLA 3WYEA 5JTTA 1EUDB 4RK5A 1R0XA 4L02A 1K5PA 4XA8A 1Z0AA 2DHDA 1B8OA 3I30X 2X0EA 2F3SA 3RS8A 3X44A 3ZLJA 3GGPA 4RAQA 1G8SA 2BM8A 1R0ZA 4RK7A 1XUOA 3J7TA 4BBAA 1D04A 5DKFA 5EE3A 4RPJA 5DZSA 4OIMA 1SBNE 1SZDA 4GBED 1FP2A 1R3DA 2A4KA 5KVQA 1QRAA 1YBAA 1T10A 4M9SA 3W8DA 2WOJA 1E2UA 3GDGA 1J20A 3L1IA 5K51A 4OAQA 1V7PC 2C83A 3SE7A 2ZIAA 3EF1A 2X58A 4HWPA 4BMXA 4OXNA 4Q4HA 1UMBA 1YZQA 2PGAA 5C5EA 5L7WA 2YXLA 1FDIA 4G0YA 3NEAA 4OAPA 3DHYA 1U90A 3R4VA 4LUCA 3K96A 1VLLA 4MA0A 3ITNA 4G4SO 5L7TA 5T4HA 5ICEA 3U9SA 3BH6A 1SBTA 5KKAA 3TIVA 3TUZC 2FWAA 1RC8A 4MUXA 4G0PA 4I2VA 3T06B 3TEJA 5AD1A 3H7IA 1RYDA 2C4TA 1X1RA 2O2IA 3G59A 4MVJD 4EUSA 3D6JA 1RMTA 5LD2B 4RD1A 3DXXA 2EFHB 1VQ1A 3RBXA 2PSEA 3NCHA 5TPZA 2CLSA 2EF1A 5BWCA 1Q2XA 1H42A 1XZ8A 2PGOA 5EWJB 4EELA 4HB2A 1YS9A 4FMCF 1IDN1 4XVRA 4Q7KA 2TMKA 4GMHA 1GP2A 4MDYA 1N2CA 1LPPA 1N6OA 2GF9A 1WW3A 1YRWA 4GWGA 4HKTA 5ICFA 2M6KA 1NVVR 1E8NA 2XUJA 4RA9B 4LV6A 2WHPA 1PTJA 5H81A 1PV1A 2AOTA 1UBSB 1JAIA 1RCFA 2Y9PB 4LBYA 4OPMA 4WDRA 3T6KA 2Q2QA 3QEMB 2CLMB 2A3NA 3PV0A 4L8GA 4BQFA 1HNZB 4WKBA 4BVJA 3QBJA 1OH8A 2OQVA 4AURA 1T0JB 1DAHA 1P4SA 1PGNA 2KE5A 2X40A 3AEKA 5H1YA 4DRYA 2G1PA 2XRYA 2R8BA 5E95A 2YVKA 1XZAA 2D00A 1RU3A 2J3QA 2CJXA 3AFMA 3KR0A 1ZJJA 3TRKA 4D99A 3JQGB 1ZEMA 2OUKA 1ZVKA 1JXQA 2PIDA 3FPJA 4YRQA 3ZZMA 5FTMA 1UANA 3JQPA 3WRXA 2JJQA 1R50A 2JS7A 3H9BA 1WF3A 4IHJB 4FDVA 5CB8A 5FYQA 3A6JA 4E22A 3VJKA 4JY7A 1QVZA 1VSTA 1GPKA 3KOXA 3E3OA 4GE0A 1MPTA 2CHVA 3A4VA 4RIHA 4ZI2A 4Q6WA 2P27A 2YNMD 5C8YA 4ALNA 4C7OA 2I62A 4C0XA 2NXNA 1XMPA 3CW9A 4YAUA 2OEPA 1PR4A 1DEXA 1ENZA 3DZFA 3TLKA 3UMYA 1H4SA 2ENWA 2H9AA 3KFVA 3OAAA 1QYRA 5DI3B 1KEKA 1XF1A 3CONA 1WQ4A 3FPGA 1T29A 2GAJA 4JROA 2MOKA 4K0RA 4PFQA 1NBOA 3N8HA 4B32A 3DMYA 5ESDA 3NAZA 4M49A 5CCXA 3U1TA 4ZV7A 1BFUA 2A33A 3KPUA 4KQMA 3WMWA 2GM4A 2D1RA 3OD1A 2ZJOA 2QRPA 3G5MA 3CCCA 4TS3A 1EUQA 3PQ7A 4O4LB 4S2EA 4U9IS 3B8HA 1WETA 1JF8A 1JSXA 5FOUA 4R83A 3FNRA 4OJYA 2ONJA 3QU5A 4Y2UA 2ONZA 4ZI7A 1ZH0A 1MN6A 3MXTA 4CM4A 5F4ZA 3KSAC 3VDMA 4BVKA 1E5LA 1UADA 1CUVA 1P5ZB 1A5TA 5ALNA 1CUHA 2CL7X 4RY8A 5EIFA 4ZCPA 3WL4A 3NP7A 3CY6A 2B36A 5DVZA 2ODBA 2QSUA 3OFND 2G04A 5H70A 4CZ2A 1IN1A 5FOQA 5JAQA 2X76A 3SIRA 4RAOA 4UU1A 3W9SA 3W8EA 1TUBA 3KV1A 3SYKA 4DGSA 1ARZA 1Q19A 4K9SA 4Y2TA 1Z5VA 2W00A 3BSYA 3DXYA 4RMGA 4RGBA 4FSHA 3RWMB 1Z6TA 1DL5A 4Z9AA 1I80A 1JU9A 4CLHA 1V26A 1H2WA 4LQCA 1U5CA 1U81A 1UINA 3P9ZA 1E1KA 4D3DA 3MJRA 1T1SA 1NVAA 2VJOA 2FLWA 1D2CA 2C7BA 4S1NA 5TQ0A 3KEGA 4BAZA 4BWFB 7AT1A 5FWXB 2CXHA 4UMEA 3N0WA 2C5FA 3GZNA 3D7LA 3ZE0B 4C21A 1C9MA 4G5RA 1OX4B 3BMCA 2QMUA 4JJZA 2F1RA 3LUCA 4UZEA 3U7JA 1W96A 3WJ7A 2RFLA 5CVVA 1E2PA 3TECE 1O96A 2CEAA 1NQWA 1QCYA 4HJXA 5KDOA 2P9QA 1D2HA 4FFMA 1RWXA 3GLIB 2Q7XA 4ZOAA 3SDSA 4Y0VA 4DDWA 5TMBA 1A2OA 2FEPA 3IILA 4Y6PA 5CNIA 5TT0A 3JD2A 1P5RA 1SBIA 2IW1A 1LZLA 3BB1A 3O2NA 1Q0ZA 4BNFA 1Z68A 3QE3A 5KREA 1XEFA 3T1QA 1P2DA 1TKAA 5C3MA 4IDAA 3BH0A 2PUVA 4M22A 1M7BA 4FDUA 5I3CA 2ERXA 1U3GA 2QRUA 4FZ5A 2WMNB 1GGFA 1MBZA 2Q5IA 4N6OA 3FWHA 3MPOA 4LMAA 5G0WA 3RQSA 4N8DA 5EA2A 4FM9A 5IBQA 4BLOA 3HP1A 2FPPB 1JYSA 1KMNA 5SYNA 2CLLB 5HZMA 3KT8A 1O77A 1NQOA 1YFKA 2AK2A 3BCHA 3DAFA 4JBNA 4K26A 1L4HA 2IEAA 2QYTA 2C94A 4FLMA 4M55A 4L22A 4NCNA 1HH4A 1ODCA 5DYTA 3TAXA 4C88A 2BD0A 3AU8A 4GM1A 4BX3A 3LP8A 3ENNA 3LUHA 1XVLA 3GN1A 3F2IA 2VO1A 10MHA 4CEHA 2QN3A 1NY6A 1T36B 4N0MA 3R6DA 4M1TA 4D25A 2AFHE 3NHLA 5TB5A 2X5KO 4OHYA 2YWCA 4KDFA 4UASA 5GPBA 3WQRA 5BWOA 1HOXA 2B1GA 3JATA 2D8MA 5E0KB 2C7RA 4DYDA 4HDCA 1GNPA 4URZR 3PNYA 3KKLA 1E1QD 2P9CA 2WG0A 1ENYA 4CJXA 2OESA 5LNK6 2DOKA 3TD2A 1UKAA 1J0CA 1KXZA 1UEIA 3F9RA 3HK2A 4TXLA 2FTKE 4FZVA 3DE0X 1R5OA 5AHWA 3TQCA 4B2PA 1G6KA 2B21A 2JDIA 4H7IA 3BE5A 4M1YA 3PLAE 1T1EA 2GF2A 2XX3A 4JSTA 2G0AA 3OCUA 4CNBA 1Y7LA 2A5LA 4YT5A 3HI6A 4OTZA 2GESA 4D26A 4GZMA 1L4FA 4DR6B 1BEUB 1QO0D 2CXXA 4WXRA 4EY7A 1CJCA 5GJBA 3OICA 3CMMA 1SOUA 2OC4A 2P4SA 4FKZA 2XCTB 2XCRB 3QF4A 1NJSA 2C99A 3W3AA 2QF7A 4G65A 5G4KB 2ORWA 2C3OA 2AFIA 4R2LA 1I5OA 3R6LA 4A6PA 1QAOA 4EYKA 2Z6QA 2P35A 2BGMA 1WV0A 3FMIA 1WPQA 2LWIA 2FW1A 2IEIA 1PDVA 2QTNA 1FTWA 2PGJA 2X8LA 3RHSA 1ZS9A 2IH4A 1Y1KE 1OR8A 4MZXA 1TPYA 3LC1O 1RVV1 3KYDA 2WIFA 3PRKE 4HEQA 3T12A 1PUJA 4LOAA 4BLPA 2ZRCA 3QBVA 1P1KA 3OIFA 4BE7B 2C82A 3AHIA 4DMKA 1A9RA 2DUWA 5H4HA 3KZOA 4JSRA 5HRUA 4L5AA 1HRDA 1V5EA 4WZZA 1XQWA 2VG8A 1WUJS 1BN6A 4ZEWA 3ZK7A 1NP3A 1C7RA 4WV3A 1X87A 1UBNA 2B8NA 2B8WA 4MKFA 5EAIA 5EQJB 3W5HA 1Z5UA 4D74A 5JS2A 3X2SA 4TWAA 5HWSA 3RJMA 2JFVA 2JH8A 4QGSA 1EVKA 2H0RA 2FDRA 5LZ5A 3NM6B 2VZEA 1G3RA 5AW7A 1H5NA 3KR9A 1NP6A 4MWCA 4OQEA 3C4JA 4UCFA 5TEVA 4RESA 4PAQA 4EB8A 1J56A 1MNAA 4O2RA 1KE2A 2R65A 1KEEB 2J67A 3O8DA 2VUUA 4GOXA 2I4LA 1JA1A 3GRKA 3HCNA 3MGKA 2AV6A 4UTPA 2JLWA 1CJMA 1OZGA 2N0SA 1E4VA 1M2GA 1TLLA 2F3UA 1CEEA 1XXHB 1DT5A 4AXBA 4NZNA 4S24A 3JARA 2YDXA 3B1KA 3PVZA 2BFEA 4UM9B 5T6BA 4L76A 3U4MA 4HYTA 2Y76A 3PXAA 2QGZA 2PKXA 5DYIA 3TXXA 4HNTA 2BYTA 5K4HA 4XYLA 3NKLA 1UXJA 5EFZA 3G0HA 4P22A 3SBDA 2XXJA 3HEAA 1MH9A 3E3LA 3UTCA 1DBSA 1RI2A 1NW6A 4N3CA 1G16A 5IZCA 3R0QA 3UENA 5DLDA 1HYBA 5DHQA 2V9PA 5K3DA 5BWLA 4N5MA 1M66A 4CQMB 2EDCA 1EJ6A 5L3RA 3HCWA 5DYNA 5BQ3A 4OJMX 1QX3A 1L8XA 1WDWB 1GD1O 3RV4A 3S1AB 1FDWA 3RRBA 4LF8B 3LXUX 4QGFA 2O8CA 2HSWA 1DKLA 1E6MA 3CN9A 3K3PA 3IBTA 3FBGA 4UM5A 1Z0KA 3QKRA 3O8OA 1ZHHA 3DBLA 3FAZA 4RK6A 5B4VA 5IU6A 3AETA 4YPVA 1GNVA 4NY1A 4R3WA 3DTVA 4HAVA 2RI6A 1U7WA 1Y82A 2ZUVA 2QL6A 3SFVA 3QPAA 1YTLA 3L8ZA 3F6BX 4B6RA 5B1EA 1Z36A 4EENA 1WBBA 4O4IF 3OIGA 4QOJA 1SXJA 3ETEA 1M5UA 2RHCA 2D0IA 1JXAA 4JUCA 5BR8B 2GBPA 4HH0A 3WDKA 1KP3A 3I37X 1SHLA 3IQZA 2YUTA 2R5WA 4QU0A 2C20A 2HRZA 2NUBA 4JDUA 4WOJA 5GV7A 2IY7A 1A04A 4OHFA 1KI6B 3UXHA 2IYLD 5EWLA 5ITZB 1ORWA 3TEFA 2GPSA 4M3NA 1JWAB 3VVBA 4MVCA 1VKZA 3JU3A 4G5SA 1N9KA 5HPYB 1LWOA 1SB8A 3T5GA 1KHHA 4BE4A 3T5PA 4NYIQ 4J7XA 5JO9A 3X1YA 2F6RA 1ONSA 1XMSA 3A10A 3K92A 4C7JA 4RTOA 4FEYA 3V4LA 5C7YA 1WPXA 4N5LA 4YMIA 3R9WA 2WJYA 3O5AA 2W93A 2PFKA 4YREA 3PDWA 2FRDC 2QW0X 2C3YA 2UYQA 1TD1A 1RHKA 2BJHA 1V3TA 2HK9A 2QOEA 2A0YA 2GRUA 1LI4A 5EUMA 4NG5A 4AD8A 2CFSA 2PKYX 1HLGA 2WJZB 1HFKA 4L50A 4J2TA 4TT8A 3RTDA 1O95C 3R5FA 3VR3A 2YN2A 3WFJA 5GZ1A 2NACA 3CT4A 2Y1LA 1V43A 2W90A 3KR2A 4B0PA 4TYMA 2NU7A 1E4OA 3OY7A 4RFSA 5TS2A 1ZOIA 4IAOA 2I6FA 5LYJA 3RF6A 3U7EB 2BF4A 3H65A 4H77A 3WIDA 2HMWA 3KB1A 3VPHA 2J3IA 2OAQ1 3CR3C 1ZMTA 3L0YA 3WV4A 1JFLA 4ZRDA 3T3EA 1DBIA 1N5MA 1A76A 3OCJA 1MEJA 1NMZA 1NLYA 2BI7A 3AHFA 4YJFB 1QK4A 1C0KA 2Q0SA 5HM6A 1N0WA 4R98A 4ZI3A 2BJVA 3U4CA 3K9LA 1UZNA 4MWZA 1RCUA 3RSCA 1P2BA 3PCRB 2W2XA 3FWNA 3ZD9A 5CW1A 3ZZUA 3FNEA 1G6Q1 3WY9A 3FYDA 4F85A 1U94A 1C7FA 3DBHB 4F4IA 4LJKA 3ZDYB 3EIQA 3ZHSA 4MKZA 3LCCA 3NFRA 2FN9A 2CDRA 1FFSA 4E5DA 5DB4A 2BUCA 3QY0A 4ZU6X 1EPUA 5TV2A 4A92A 3AR9A 3N2NA 1U6IA 3B2NA 3CLUC 4JKOA 5C8VA 4IRXA 1H2ZA 4RE6A 5J4VA 4FHEA 4NIMA 2GJ8A 1Y80A 4H3HB 3ZH9B 3QX9A 1TNDA 2V4MA 1PJQA 4ZQFA 1BE1A 1W36D 2B0CA 2EF0A 3IO3A 2WFAA 4L9RA 4PYLA 3NBUA 5DRTA 3VKWA 1N2EA 4JAVC 4HWKA 4ZT5A 1CR1A 2SHKA 1CF4A 1IBMB 2A94A 3RVSA 3V4ZA 2FPOA 3U3OA 4QD3A 5JCJA 2Z8ZA 4DCOA 4M9XA 3HDTA 4PY2A 1T3SA 1W5TA 1C1DA 3C2QA 3QPBA 5AVRA 3H3XA 4DQUA 4X64B 5JCXA 1P7CA 1KZGB 2A0KA 1QB8A 3RASA 5ITSA 1E1CA 1T9ZA 3KOYA 4BZXA 2D2VA 1SUDA 4Q4AB 3O4VA 1CVLA 4IJWA 4LXHA 3D1JA 5CA1A 2WF9A 4QPDA 4XX0A 1FQOA 1P4AA 2OD7A 3QOFA 2EC5A 3PJRA 1REQB 4HADA 4YMWA 2XSZA 4YMUA 5K0GA 2C4KA 2GEVA 1WUKS 1HE5A 3PA6A 4AKEA 2Q5OA 4B31A 1G7RA 1RI1A 2P2GA 2XQVA 5C7IO 1SXGA 5KPDA 1KI8A 2W70A 5DI9A 1VL2A 1WIWA 3NETA 1YB4A 1ISJA 3BSWA 4FIDA 3RU3A 4DJJA 1RM3A 2D7CA 4LNUA 3WWDA 1TA4A 2FQ1A 3MQ2A 2Y4NA 2DY0A 2QZJA 2VP4A 1X7YA 3PB3A 5IK2A 4K05A 3LCMA 3P4YA 2LUOA 3AEQA 3UC9A 4PQGA 4QDOA 4R51A 2B69A 4K9MA 5C1OA 2PKRA 2QWXA 1ONPA 3DHEA 2OZLA 3MJCA 4YJ2B 1M8JA 4YAEA 2JFXA 3IEVA 2AC2A 2YJTD 2OMEA 1VFNA 3PZBA 1ZNQO 2ZAIA 1Z4KA 2ZPUA 3CUVA 2XB8A 1V25A 3TR6A 3V9PA 2VL7A 5GGYA 3AKZA 3UQZA 3PE3A 2EX4A 3AVWA 2V4ZA 3MB8A 2IHZA 1NRXA 1UDCA 1U3VA 4R1TA 4GG1A 2CE2X 4CTJA 3R9XB 4D3YA 4PG4A 2ZSFA 1WXFA 3TPZA 5DBIA 2Q5LA 3D5TA 3UPTA 2NAPA 2PD4A 4G0VA 3H8WA 3GNLA 4CPDA 3M0EA 1OYWA 4RQUA 2IYVA 3F1KA 5DW0A 2CUNA 3JQCA 4DMMA 4C07A 5GIOE 4HDOB 2RB5A 1QGUB 2O1XA 4AKSA 4J2OA 3V1NA 4BLTA 3AGPA 1G8FA 2RJNA 4F4FA 1U99A 2ILVA 2PX0A 3UEOA 2J1LA 2PYZA 4JA0A 3VHXA 4C87A 2HB6A 3ER9A 2PZEA 1LK0A 4FMCB 3ZWVA 3KTAB 3LDGA 1RI4A 4HYEA 1IQ0A 1H0RA 2EJUA 4O4HA 1QOQB 2H1HA 3GG2A 1G6OA 5M3BA 2NU8B 4TV8A 2YJGA 1HSOA 2H4JA 3E7XA 3F7NA 1WVIA 3OESA 2DJIA 5FBZA 4V39A 3I5UA 1OAKA 2WWHA 3FMOB 3H86A 4N12A 2YHBA 3GJ7A 4MPPA 2O8DA 4ROTA 4DCTA 5JNSA 1YHNA 2P0AA 1DEHA 1OFVA 2XNJA 4UZSA 1E96A 4FILA 3K8YA 3SJZA 1AK1A 3KKOA 2IOFK 2C2YA 5HRCA 4WRRA 4CMHA 4NECA 4F5DA 3HJNA 1CDDA 3L04A 5FLEX 1J8YF 5CLGA 2V5AA 5K8JB 4IIYA 4QXOA 1Z2CA 4ESOA 1NVXQ 1NUQA 1L7OA 3LLVA 1BXGB 4GEGA 4KQ6A 1NKVA 1OXBB 5A4IS 1EI9A 1NASA 3UWSA 4D7AA 5JBNA 5ISMA 3LKVA 3QVMA 5DM60 2ZYWX 1U0GA 3K1AB 4ND6A 5EJ6A 5IKMA 3TZ6A 4MVJE 2R5FA 2QB5A 2QTCA 5AKLA 1SKYB 4PC7A 1QBKC 1V11B 2WFMA 4RQAA 4Z4QA 4IGEA 4RPGA 1JP7A 1WXQA 1AQYA 3BA1A 1RPAA 2G40A 3E5NA 2XLBA 1B4DA 3RSSA 1IBSA 3L9XA 4UEQA 2VBCA 4DV4B 1T0HB 2A6PA 5FKJA 1BDIA 2Q4RA 3GLHB 4H1HA 1K8QA 1AN0A 1K2VN 3BWEA 2WAAA 3DDCA 4MW2A 5DEOA 3TSYA 4UQLA 1K5GA 5UKDA 3OX1A 2ZIVB 1MO4A 2RGBA 1LD3A 1UPAA 3BRWA 3FVQA 4LTNA 4NJMB 3UMCA 3WQSB 3GAFA 3DBIA 3WYDA 4F6LA 1P7PA 4Z1OA 2KYRA 2ZRJA 1DAIA 2HX1A 2GHTA 4Y2PA 3FKQA 4FFLA 4JP3A 4R7TA 4RSGA 3WK8A 1MNQA 2OO7A 4EY5A 5B1YA 3PFIA 4GOOD 1UXGA 4R54A 3TBHA 3TBKA 1NFFA 2LCIA 4ZCTA 2GYWA 3OPMA 4RCVA 3VZDA 4DRXA 1LRLA 4QOHA 2I2DA 4FK8A 4GRDA 4KSBA 1PW7A 3L9WA 4YROA 2P2DA 5LQSA 2GAAA 2QSYA 2QLNA 3BQ9A 4HWRA 5EE5B 3FI0A 1EDOA 1D7OA 3RAPR 3MWDB 1W4BA 1AS2A 1GU7A 2P62A 2ZBQA 3D6MA 4UM7A 3VUFA 3K0FB 5K8IA 1IRIA 2FMFA 1X86B 2CF6A 4FS3A 4KTVE 5K4AA 3BWDD 3HHPA 3Q3VA 3OLVA 4HEHA 3GEH