3CO5A

Crystal structure of sigma-54 interaction domain of putative transcriptional response regulator from neisseria gonorrhoeae
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
136
structure length
134
Chain Sequence
b'GNSAAIQEMNREVEAAAKRTSPVFLTGEAGSPFETVARYFHKNGTPWVSPARVEYLIDMPMELLQKAEGGVLYVGDIAQYSRNIQTGITFIIGKAERCRVRVIASCSYAAGSDSCEEKLAGLFSESVVRIPPLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Putative two-component system transcriptional response regul
publication title X-ray crystal structure of Sigma-54 interaction domain of putative transcriptional response regulator from Neisseria gonorrhoeae.
rcsb
source organism Neisseria gonorrhoeae
molecule tags Transcription regulator
total genus 33
structure length 134
sequence length 136
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14532 Sigma54_activ_2 Sigma-54 interaction domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3co5A00
5AJXA 3AKYA 3M4YA 3UANA 1AK2A 4P31A 1PV4A 1U0LA 2O0KA 5JI2E 1GL9B 1K5GA 1JR6A 2NTYC 2XITA 2IS6A 1H8HD 1CRQA 3IQXA 1XPUA 1Q21A 2ZXUA 2QEQA 1GWNA 4GOXA 1BYIA 4F4IA 1G291 4O3MA 3KKOA 1K6MA 1CU1A 1GITA 1OYWA 4IOLA 4BE7B 2IWHA 3EXAA 1N6NA 2VH5R 5HE9A 1E2DA 1HA3A 5FPTA 3TIFA 1XTSA 4PTLA 3R9XA 1G7TA 4D80A 4DVGA 2GXSA 2H8KA 1DAEA 3U7GA 3LNCA 1OFIA 5AJVB 2BHRA 4BUJA 4QJ5A 2FX3A 5L3RA 1SXJC 1ZC4A 1U8AA 4ILEA 1ZD9A 3F5FA 5C4MA 2CHVA 3FTQA 3R8FA 5H70A 2JIZA 4Q1BA 3TW8B 3TSOA 5HCNA 2IUTA 4TQUS 2FPKA 3SS8A 3AKDA 1CR4A 1YR8A 2V7QD 2ZYUX 5JZVA 4AI6A 3LA6A 3BD9A 2AFHE 3WHLA 3TK1A 1RJ9B 2GZDA 3Q72A 2GVZC 4LWZA 1UADA 3WNBA 5C2JB 3EPLA 1YHNA 3GLFE 4PR0A 2FSFA 2VO1A 3EIHA 3K09C 5CLLA 2KE5A 4S2EA 3ONWA 1RRFA 2O0JA 2Q3HA 4OI2A 3MRSA 4M9XA 3L8YA 3HU1A 3QJYA 1ETUA 4QHYA 1FZQA 1SHZA 1QHGA 1SKYE 3C5CA 5AWFC 2AKYA 1G17A 3DPUA 3WBJA 4CEJB 1M6NA 5KSPA 1KK2A 5KU1A 3ZQ6A 1ZNYA 4D6PA 4KV9A 1TQDA 2BM0A 2W58A 4LJ8A 1TF5A 3BH7A 2ONKA 2OUKA 2ZJZA 1D2EA 2ZRGA 3LLMA 4I1VA 4QHSA 2JLXA 1LB1B 4B3XA 1J2JA 2QRNA 1CS4C 1Z5ZA 3MJRA 5UKDA 2AXPA 3U3KA 3WHKA 1ZUIA 4N3NA 4F4CA 2X2EA 4Q1CA 2GAOA 5JJKA 1DG3A 4OL0A 4BASA 2OT3B 2VHQA 4A2QA 1Q1ZA 3CH5A 2G88A 3CONA 4LHZA 1KJZA 1E2NA 2R44A 1XWIA 5LB4A 3U7EB 1EFTA 2GJSA 1JI0A 4LJ5A 4YMVA 2MMGA 4F91B 3SYKA 2GZAA 1ZM2A 2A5FA 1KO8A 2JLQA 1ZNWA 2WWIA 1KKMA 3WYAA 1T6NA 3U7HB 3TJZA 2QM7A 3TAHA 3GEIA 4BFYA 1OXVA 3RDPA 2B92A 4QKQA 1KK3A 1XB2A 1N3BA 3B1XA 5CJ2A 5J47A 5E7IA 5IDVA 2FU5C 3HPRA 3K53A 4PQYA 1CKEA 4QXAA 4KFSA 3AGQA 2IXEA 3JVUA 4MKHA 1NLZA 4TMKA 4CEIA 5DHAA 1AJEA 5LB2A 3ZVRA 1Z6XA 2BWJA 1XD8A 4LJYA 4Q02A 3EZ2A 2KSQA 2GWHA 1TPZA 4TYPA 1W4CA 4JSYA 3E1SA 3THYA 2AHOA 4ARZA 3K70B 2VA8A 1KI6B 3I8XA 2DPXA 4PQRA 5BWMA 1CTQA 2UVQA 2CE2X 2J0UB 1UKZA 2QN6A 5EXXA 1NI3A 5BW8A 3QPUA 4Q18A 2V6JA 2DWQA 3FYHA 3K9GA 3KZ1E 2ANCA 4P4UA 2XZOA 1NN5A 3R9IA 5FR1A 1QF9A 4GFDA 2CCJA 1H8HA 2J7KA 3PUXA 4OI0A 3T06B 5DGXA 1N0VC 2H5EA 1ZJ6A 3QXSA 4U00A 2AFIE 3U5ZB 2ODWA 2OCPA 1P9RA 2W6JD 1Q20A 3ZGXA 4E03A 1T5LA 1TX4B 2O5VA 4Q47A 5A0FA 4EFMA 1NVVR 1D2NA 5DI3B 1M2OB 3GLFA 2YWFA 1TUIA 3TR5A 2GCNA 3TH5A 1W2HA 2HDNB 4OQFA 2ZYWX 2AWOA 5H1YA 4D25A 4CF7A 4Q00A 3NG1A 3FKSD 1BO6A 4LC1A 1T0HB 3I61A 2HYDA 3IIKA 3GQBA 2JLWA 3GJ5A 1E2IA 4DCSA 2BOVA 5EXPA 3SFZA 4GSYA 3OIUA 4C0SA 1ESMA 1NJGA 1TU4A 3QG1A 2IA5A 1JNYA 2V7QA 2WTUA 1EWQA 1NG1A 4B32A 4E5UA 2W0MA 4KO8A 1MOZA 1XTKA 2HF9A 3ADKA 3F0TA 3C5HA 4NMMA 3THWA 1YZLA 2LKDA 2JEOA 5IHPA 3AM1A 2GBLA 1BH2A 5BYKA 3VKHA 1FOEB 2PL3A 2O8CA 3AVYA 2P5TB 3L0SA 1U0HC 2WWYA 4AURA 1PLJA 2ZM5A 4B47A 121PA 1RFLA 2C99A 3AVUA 3V00A 1K8RA 2WJJA 3EW9A 1UF9A 3VR4A 4A82A 2RHDA 3Q8XB 1AZSC 2Q21A 1HE1C 3KTAB 3EX7C 4B2IA 3LVQE 5FUXA 3R9WA 2A78A 4JIMA 4D4LA 3UK6A 1YRBA 2PT7A 4F7WA 821PA 2ZE7A 1M7GA 4MDEA 4IOMA 2YVUA 4I81A 5DI9A 1DAHA 1MR3F 5DO9A 3W6OA 4IDQA 1KSJA 3OFND 4HI0E 3PENA 2R6FA 2ZE6A 1N5IA 3W9YA 3TE6A 1I4LD 1U99A 2ZQ5A 2QMOA 1X8KA 2CL0X 2ZYVX 3B13B 5D3MA 2YHSA 3QG5A 4B71A 2DFNA 2VP5A 2ATXA 2PEYA 3N2IA 3THOA 5TXGA 4DBLC 3ZH9B 1G4UR 2VP0A 2ZSAA 1SVSA 4C2TA 1R10A 1Z63A 3EG5A 4IVRA 1QDEA 3E2IA 2F3RA 1HUQA 1GL7A 4ZI2A 1D9ZA 2BMDA 4HB4A 3T1QA 3O8DA 4CGZA 2HT6A 1S96A 2AK2A 1Q12A 2WHXA 3FFBA 3DDCA 4KFUA 1MKYA 1KGDA 4IOJA 2X19A 1KI1A 2J0VA 4HB2A 3EZ7A 3P20A 4Q9KA 5EP3A 5JSZA 3PG5A 1JEDA 5EXSA 1IY1A 2ZI3A 1CR0A 5DYGA 1ZMXA 2BC9A 4C0BA 2ZYTX 2XZLA 1B23P 4C0QC 4FI3C 2W83A 2JAQA 1GRQA 1ODFA 1VKJA 2PCLA 3PEUA 4UJ3A 3CW2A 2ODBA 3UXMA 4A8JA 4NP6A 1VG9B 3MD0A 1R0YA 4FMCB 1DADA 4O2LA 3GLGE 1T4GA 1G8HA 4HLUC 2GTPA 1OIWA 4NCHA 1MO4A 5FBRB 5HE8A 3ZS9A 1D9XA 2ZI5A 2VF7A 4LRWA 4EIWA 1VCMA 2CVHA 4RD0A 4B48A 4D82A 1LW7A 4FMDB 3LXRA 1IN4A 4PO9A 1R0WA 1NSTA 1ONBA 4GI7A 5JFGA 1N6PA 1LF5A 3IUYA 4Q19A 4H1UA 5B58C 4B34A 3SJBA 2ANBA 2BBWA 4TQ9A 1F48A 1KK0A 4KAXA 2KB0A 2WJIA 4NYJQ 1NIJA 1IJEA 2I1QA 5DISB 4OK3A 4K46A 2EFHB 2XXAA 1EFRD 1IN7A 4JKYA 3WBKA 1Z29A 3BGWA 3QSYA 1TQ6A 1TEVA 1R7RA 4II7A 3LQQA 1XEWX 2JJ8A 3UWOA 3W6NA 3RS3A 1E4VA 4BFTA 2JLZA 2W6JA 3TVDA 5JEEA 1G8FA 2IYVA 2PZGA 4ZDIA 3U3RA 2V54A 4KFTA 4NTZA 5KNDA 2XNDD 1S9HA 4FWTA 4TWZA 2L0XA 1U9IC 4WOPA 1W0JD 3VU9B 1DOAA 3G82C 3KXKA 2C78A 3RANA 3M0EA 3FKSA 4TLDA 1XCGB 4WZAE 3E70C 4ZDJA 1E2MA 1XEWY 3OESA 4M1WA 1OXSC 2VQSA 1CJKC 5C1BA 3I73A 3CWZA 4KCGA 3IO3A 4JLBA 4ARZB 1LF0A 2NZ8A 3Q5DA 4KHZA 5TV2A 3UG7A 5SZHB 3U7FB 1WE2A 3K0EA 1E32A 2VHJA 1NSFA 3FHTA 1NKSA 1AA9A 1YR9A 5AJYA 2GETA 2Q3MA 3DEFA 3QKUA 2Q9CA 2WWFA 4PAQA 3W8NA 4IHQA 1IY0A 1HQCA 4L8GA 3HR7A 3NBFA 4OI4A 3BORA 3RSOA 3QQ5A 4C0HA 3VR3A 4KXFB 4PZLA 1U0JA 3RWOA 1IY2A 1EFCA 2HJGA 3A58B 4FWIB 1MV5A 1KO4A 1DAKA 2GKSA 5BN5A 2NO1A 1T8UA 2AL7A 1YRAA 3CH4B 3AVOA 5FBQB 1II0A 1IJFA 3C14C 4M53A 4HAXA 3LXXA 2XX3A 1G21E 1XMSA 2F9LA 2R9VA 2IUUA 5KUTA 4BLTA 1W48A 2CLDX 4V0OA 5GADl 2MSEB 3LO5A 1CF4A 1I2DA 2XTMA 3DVLA 2IUSA 2D7DA 3LBNA 2ZJOA 3GLFB 2QAJA 2ZRKA 3W34A 3ZIAA 1SXJD 3U2QA 3TQFA 2AK3A 2R6CA 3PEWA 3BAFA 3CX7A 4Q1DA 2P0EA 5J5CA 3OFNA 3TUIC 3PUZA 3LY5A 1SKYB 1YR6A 3Q9LA 4EPRA 2YOHA 3P4XA 3SEAA 4BFWA 2QAGC 4M21A 1P3JA 4HEJA 4RFSA 4D2IA 1Z22A 2V55B 1P6XA 5GVRA 1UDXA 1GKUB 1N0WA 2J5XA 3HYRA 4AYTA 1Y63A 4IOKA 1MO3A 5E7JA 3SJCA 3GLGA 1FQKA 3ICQB 3Q85A 3WYGA 1ZNXA 2A5DA 1KDOA 4TYYA 3IEUA 3KJIA 4NONA 3TUJC 2O8CB 4QBGB 1SXJE 4JLAA 4XJXA 5JI3E 2QTFA 1SVLA 4Q4JA 4DRZA 4IDNA 4EUNA 1ANKA 2WOJA 2XB2A 3TVTA 1XJCA 2IYYA 2OBLA 4A9AA 5L3QA 4HLDA 5KPDA 4JYCA 1JR3D 4V0KA 1KIMA 1K5DA 5FFMA 3AV0B 4Q66C 3RWMB 1E2LA 4GPTA 4KBGA 5EUQB 5H8WA 3BRWD 4POAA 4UNRA 3VX3A 1SVKA 2BCJQ 4XD7A 1KI7A 1XZQA 4DB4A 4NL4H 2R8RA 1VIAA 1RRGA 4QM7A 2NIPA 4LGMA 5E3HA 3NEJA 3TNFA 5GVSA 1E9CA 3H1TA 1FP7A 3BK7A 2WJHA 4YC7A 5JWOA 5FI1B 4QFMA 5D3MB 4G5OA 5HCIA 1JQJC 4Q7KA 2FNAA 1XPOA 1EFRA 4KJZA 3TBKA 2JDID 3JZMA 3CZQA 3ZS8A 1NBMD 2HYIC 1HH4A 2EW1A 2ZEJA 4TMXA 4BQSA 4CW7A 2ZRAA 1UFQA 1JR3E 2Z5FA 2WOOA 4LK2A 4CYMA 4QBFA 1GUAA 3ECCA 3T15A 1FTNA 4ZI3A 1XMJA 4JBXA 1KMQA 1PUJA 3LX8A 5C46F 2XNDA 3P4YA 4JBYA 3GLIB 4I1UA 2QT0A 2PBRA 3FMFA 3OIWA 3T35A 3UMRA 3QE0A 2D74A 2P6NA 1OFUX 4MYCA 1W0JA 2GRJA 4CEHB 1Y3AA 4MYTA 1YJ5A 1XJQA 1ZCBA 3CWQA 4OQLA 4R2IA 3D3QA 1M8PA 2R6GA 1NVWQ 4D81A 1NIPA 4NZYA 3KQUA 3LD9A 3OAAD 1GILA 4YMTA 1KMHA 1II8A 1R8QA 4JLOA 3GJ8A 4UXJA 1NBME 1COWD 4NYJR 3U6KA 1DAIA 4Q1EA 1DAMA 2IHBA 2H16A 1G3MA 4HLCA 4MRNA 4OHWA 3B2EA 2A30A 4L5BA 3CPEA 3GJ0A 3FMIA 2F9MA 2IYTA 4BRWA 3CR7A 2OCAA 1LVGA 1DARA 1DAGA 3OIVA 1XD2A 3VR1A 2XOKD 1RZ3A 1VMAA 3ND8A 1NL3A 5CK4A 3NBZC 2XXAB 1QHHA 2QSZA 5JLJA 1EGAA 4L16A 3T5DA 3IDQA 2WV9A 1TADA 4QOSA 4JJKA 4RKEA 2ORVA 1F2TA 4JSTA 4DJTA 2WJVA 3B60A 3GFPA 1EFUA 4BWYA 3X1DA 2ZRFA 1WXQA 2KBEA 2BBSA 3A4MA 3EA5A 521PA 1GNQA 3AP2A 1GFIA 1O87A 1A5TA 4W5JA 2N1BA 4O2RA 1KYIA 4Q9IA 1SXJA 3C15C 4TYWA 2FEMA 4AY2A 1W49A 4ESHA 1TF7A 5BN4A 1FFHA 2WKRA 4HAZA 4LBYA 1G16A 1FTSA 4LSGA 1IHUA 3GLHE 3SU8A 2P6RA 1OLOA 2KI5A 4OK5A 2IEYA 4U5XA 2F7SA 5JWHA 2WSMA 4HAVA 3MLEA 4WBSA 2F43B 5CIQA 3CRRA 1P9WA 2VBCA 3RC8A 4PFSA 2EFEB 2NO7A 3QXXA 3K09A 2WZQA 3VR5A 3THXA 4EJSC 1OB2A 2IHYA 3BXZA 4HAWA 1Q1QA 1N5KA 2FGKA 1CP2A 4PSVA 4JL5A 1XCMA 1F3OA 4Q7MB 4LX0A 4P0TA 3T61A 2VHCA 1X1RA 4B3FX 3U44A 4BECA 2O8DA 3NH6A 3HR8A 2IWRA 2N46A 4R98A 1CR2A 1E9AA 5JECA 3H0KA 2C03A 1KO1A 2XB4A 2ZRBA 1GKIA 5DIFA 4DEXA 1X8LA 1XBTA 1BOFA 3OEED 4OKSA 3HYTA 4LYJA 2ERYA 4PAOA 2V8OA 5CJPA 1E9EA 2JA1A 4IXMA 4M2LA 3VTKA 1NP6A 3K9HA 3B5JA 4URVR 4UQOA 3DL0A 1V43A 2HUPA 2JLRA 3FMOB 5EZ5A 4E22A 4JL6A 5KSOA 4RD4A 4ZPXA 3WMEA 5LPNA 2YKGA 1XEXA 1C4OA 3CLVA 5FBLB 2JCSA 1BKDR 3DO6A 4WVFA 1OH5A 3W6PA 1W1WA 5KSZA 2REOA 3BFVA 5AR1A 4B6EA 4XSGA 4ERNA 4RFSB 2FJUA 2X1VA 5CIWA 2IYWA 5KHOC 4M1YA 3PEYA 4AKIA 1KI2A 4RZXA 3CB4A 3A1VA 2JDIA 3CNLA 4RZUA 1NBMA 2IEZA 3VQTA 1AGPA 1M7BA 4OHZA 4HUTA 3GLGB 2QGNA 4PC3A 4Q7JB 4A6PA 1M34E 3SBDA 4V02A 3JZAA 5G40A 2B21A 4DDVA 4HUQA 4XOIA 5HR5A 1AQUA 3QY0A 1SULA 4AKGA 1RRPA 3RS7A 4XIGS 3GJ6A 4P4TA 1A82A 1QG4A 4IJMA 4PHFA 4DDWA 1JXOA 3FMPB 4XWKA 1ZP6A 4N0DA 2ZROA 4C0LA 2CBZA 1NNEA 1N6IA 2J59A 1E79A 4TMVA 1X86B 2C9OA 4PQFA 5L3QB 5FUYA 3QKSB 4X8OA 2AXNA 3JVVA 3OAAA 3A6PC 1V5WA 2WKQA 1A1VA 4MKGA 5L3SA 1AS3A 1COWA 2QBYA 4Z54A 2X2FA 2WKPA 1E69A 1W47A 3DHWC 1WDTA 2QRZA 1KHTA 3AUYA 1FL9A 4I99A 1MABB 3T12A 1Z3IX 2V1UA 1ZYUA 4TTRA 5DN6A 3NWJA 2KBFA 4ABYA 1QBKC 1A2BA 4EPWA 2GHIA 3WP1B 2ZSDA 3AKCA 2FFBA 4DSUA 3GEHA 2LKCA 1A4RA 3AVQA 1N6OA 4D4MA 2XOKA 3U4QA 5J4YA 1M1YE 1TQ4A 3QF4A 3KXIA 4C0KA 1LNZA 1TMKA 4AG5A 5IT5A 4QJ4A 3U6BA 4F93B 3GLHA 3LBHA 2ZJBA 1KI4A 4PHHA 1KNXA 2ORWA 4MRPA 3CPJB 3EARA 4PC2A 4TLEA 4JMPA 3LDAA 3NDPA 1VYVA 1QZXA 2OFWA 3DM5A 3KQLA 4KODA 1R2QA 2DR3A 3WMFA 2XEXA 4Q1AA 1GVNB 1VIYA 5FOXA 4MGIR 2X8AA 3TLXA 2G6BA 4IDPA 2W6IA 1TU3A 1IXSB 4Q9LA 2BKUA 4UNQA 3PCRB 1YKSA 4UNSA 4QC2A 1P4SA 2EU8A 5TY0A 1YZTA 2ZS8A 1KMHB 1II8B 4MITA 2ZREA 1LTQA 2VYFA 3D8BA 2BBOA 1N5JA 2VEDA 3KB1A 5CB8A 2YOGA 1CJVC 4DIDA 4LV5B 2CE7A 4M4SA 1D5CA 5AK0A 2FF7A 3EIEA 5B57C 2DCUA 4V0ME 2CLSA 1MRSA 3Q7PA 1T8TA 1KZGB 3RRNA 1P75A 1FW6A 2DY1A 1KTVA 1E9DA 2DBYA 2FA9A 4RD6A 5FBVB 1QHHB 1T3HA 1FNMA 3A37A 3VHLB 4EQ6B 1JAIA 4G5RA 3K9LA 1OIVA 1YZKA 2CCKA 3NH9A 4ITRC 4NYIQ 1XX6A 3DMDA 1DEKA 4QGHA 1F2TB 2K5UA 1DELA 3U60B 1S2MA 3OEEA 1NF3A 4I1OA 4PO8A 2PEZA 4JYBA 3IIMA 4PC6A 1CJTC 3OEHD 4JBWA 2MMCA 2CJWA 5EZ6B 4JLKA 3SOPA 1Q3TA 2D2FA 4KLNA 2GEVA 3QKRA 2ZRMA 4TMWA 5FTNA 4A6XA 1JJ7A 2OFXA 2O8BA 1G9XA 1GOTA 2QQEA 4DCUA 4EFLA 1A7JA 2R2AA 4Q4AA 3L82B 3TAUA 3AEZA 1E2JA 4B35A 2IYSA 1EWRA 2ZJAA 2LCFA 5CDFE 3EIQA 4IDOA 4G1UC 5CITA 4G5GA 2IX3A 2FFHA 1NN0A 1NVXQ 2RGAA 2NMVA 3SN6A 5DNYB 4PC1A 1GM5A 2CHQA 2WMNB 3A4LA 3THXB 1E9BA 2AD5A 4MRVA 1HURA 4EPXA 1NY5A 1NVUQ 1CLUA 4GP6A 3BB3A 3CIOA 3BOSA 5CM8B 1ZUNB 3UG6A 3EZ6A 4LI0A 2YV5A 2WJGA 2ZUDA 4NCJA 1KAOA 2GF9A 2OLKA 4WXRA 3U44B 2O8DB 2P6UA 4MUBA 1QVAA 1KSHA 4XVQA 5SZIA 4BZXA 2GXQA 4CRWB 1Q1EA 1W44A 2GJKA 3AGPA 4OI1A 4HZUB 3B8HA 5CLQA 1FPMA 1Z0IA 5J4LA 2B7CA 4HLUA 3ZJYA 4MKFA 5JCPA 2PX0A 2J87A 3BB4A 1S4QA 1Z28A 1E0KA 3AB3A 2FDCA 4TLCA 3UKDA 5B64A 1OFHA 4TYNA 3KXLA 2ZJ5A 1XEXB 2J0QA 2BM1A 3K0SA 3CO5A 4RZ2A 2D7CA 5G53C 1ZW6A 4EKDA 3NC1C 2KJQA 5FTJA 3L0PA 1TL7C 4P4SA 3KFXA 4PPGA 3R7WA 4TZ0A 2DFKB 5JRJA 2VF8A 4XWOA 1QVRA 1G8PA 1XD9A 1XF9A 2ZSEA 3LAWA 3BFKA 1GG2A 2N42A 3B1ZA 3DOFA 4RSGA 4PZZA 2OXCA 3X1YA 1BIFA 1MO5A 1OF1A 3ND9A 1OHHD 4AG6A 3CM0A 1FMJA 2OE2A 3CRW1 2VP2A 2VIIA 4LHWA 1SVWA 2WVJA 3C41J 3HP1A 4JVLA 1U9IA 5CK5A 3ZIAD 1G3UA 4FXPA 4Y0VA 5EP2A 1CEEA 5J40A 3FDIA 5G41A 1F60A 4V0MA 4DXAA 4CVNA 1XTIA 5LD2C 1SQ5A 3FWYA 4UNPA 1UKYA 1VHTA 3O47A 4KVAA 5EXTA 2OLJA 2QENA 3X1ZA 4ZIRA 5FR2A 1BYUA 2ZR9A 2ODNA 5M04A 3UIEA 1YR7A 2V3CC 3RRYA 3MWKA 5L3SB 2C04A 2Z4RA 3NBYC 4ZCIA 2F1RA 4G5QA 1F6BA 2OAQ1 3IQWA 1OXXK 4X8MA 3QENA 2VLIA 4JLVA 2QI9C 4L9SA 4ZO4A 3AQ4A 4D0LB 3KB2A 1RYFA 1Z0DA 2BKEA 4GNKA 1QHYA 3F3YA 4AD8A 3J81k 3CX6A 4PX9A 3RVBA 2ONJA 3U4QB 1G6OA 2XGJA 1KO5A 3QEOA 3ZVNA 1OH7A 2GZHA 1R4AA 3LV8A 2H7VA 2PMKA 1ZIPA 4TYQA 2RKOA 3GLHB 4M22A 1Z6TA 5CDFA 4HB3A 4A0FA 4QBIA 5HKKA 2ERXA 4OQMA 1G64A 1Z6GA 4BLQA 4ZV4A 1XNJA 4B33A 4E09A 1R5NA 2Z43A 5JJLA 1QHXA 3WY9A 4XD7D 5LBIA 1Z0AA 2P67A 2D62A 1EESA 2E87A 3OEHA 4LBZA 1EX6A 2YJTD 4BZPA 2OZEA 2OEPA 2C95A 2NPIA 4GP7A 3RABA 2OM2A 2QAGA 4X8LA 3RLFA 1T3SA 3UATA 4UXIA 4D4JA 1R5BA 1FQJA 2IS4A 1RC8A 5DE3A 2C8VA 4DLXA 1E99A 4KITB 1SVOA 1OYYA 5CYOA 5EE3A 1II9A 4CIDA 4URZR 3LBIA 4PAMA 2W00A 5FOVA 1IAQA 1WQ1R 1EX7A 2VSOA 4K8OA 5FPYA 1NG9A 2A7QA 2Q9BA 4NYIR 4AK9A 1E2FA 1TEXA 3VHXA 4RD3A 4YQFA 1FX0A 4WZBE 2YOFA 2GCPA 1OV4A 1Z06A 1Z6AA 1E1QD 2DFLA 2NO9A 4RJLA 3TRFA 2Z83A 4CEIB 4EAQA 2GXUA 2P65A 2RAPA 2IS1A 3SQXA 5E7MA 1OW3B 5IK2A 1E2KA 1US8A 2W2TA 4QNRA 4C9BA 1JEEA 4MDFA 1J8YF 2VTKA 3THYB 4Q4HA 5AUOB 3PUVA 3S1AA 2YWEA 1ZCAA 5FI0B 1N6LA 2XTNA 3QUSA 3ICEA 1H65A 3M1IA 1VHLA 5F3WB 3OIYA 2DFTA 3H84A 4LJ4A 5AJZA 5EQTA 4LOAA 4DLRA 3WMGA 1ZM7A 2IXFA 2WJYA 3QKRB 2ZRCA 4RD2A 2BMFA 2F3TA 2G0TA 1VDZA 4MRSA 4Z8XA 1KSGA 2VHTA 1E4YA 4LBWA 2XSZD 1CIPA 2G1JA 3ZLJA 2ZRJA 1H8EA 3RRZA 4AIIA 3GJ3A 4GT1A 4BFUA 3BIFA 1XDBA 4FCVA 1Z07A 1KY2A 3N2EA 4IFEA 2RGNC 4OBEA 4Q4LA 4AYWA 4CZ2A 1KSFX 2QMHA 1FNNA 4ACAA 3PEVA 5BXQC 1JPJA 2CL7X 3K1JA 4G5SA 2PT5A 4LBVA 1M74A 2QNRA 1OHHA 4M9SA 2ZRDA 5G3YA 3DMNA 2ZRNA 1NN3A 4Q21A 4BPBA 1EFHA 2RCNA 4DDTA 1NMZA 3ZDQA 1JPNA 1ZUHA 4WAUA 2UKDA 3EPKA 1OFTA 2ZS9A 4OHVA 4R9UC 4E07A 5TB5A 1P5ZB 4W5HA 3TSZA 3F8TA 1ZRHA 4ZKDA 4QG7A 1IQPA 2GAAA 1WP9A 3CF0A 3H86A 1RW4A 1S3SA 2FH5B 3K70D 2O8EA 4NCKA 3CR8A 5EP4A 2A3RA 5B30A 3ZD7A 4ON9A 1UBFA 4V0LA 5JS8A 3DZ8A 3LX5A 2PJRA 1LS1A 2WWHA 5F98A 5FL3A 4C4PA 221PA 4FCWA 1E98A 1L4UA 3UWKA 3THWB 4FCTA 1R5OA 2EWWA 3FB4A 4Q48A 2XTZA 4YONB 2PLRA 1W7AA 3LFUA 5JWRA 1PUIA 5DH9A 4B3CA 1P61B 1A2KC 2ATVA 4P4SB 4OHYA 3R7WB 3HWSA 3U61B 3ZQJA 3OE7D 3KX2A 4GZMA 3MAAC 2RGGA 1TTTA 2HT1A 3CRQA 1AS0A 1FUKA 3KUDA 3VX4A 5LDDC 4KSBA 1D6JA 2QY9A 2HLDD 2VL7A 4FINA 4NPHA 2NG1A 4DLUA 2JJ1D 5FUVA 1E6CA 4JJZA 4KLZA 1E0AA 4GDFA 2GEDA 1W36C 3IO5A 2ZJ2A 4UJ5A 2BIFA 5EE0A 4Z1MD 1WA5A 5KNCA 2QMUA 2AR7A 4JLJA 1AGRA 5KNBA 1Z0JA 1E3MA 1YZNA 3WRXC 3PVSA 3K0FA 1G6HA 2BJWA 2ZAMA 1G19A 1MRNA 1L7VC 2RGCA 4TL6A 4US2R 4ZIRB 1G3QA 4DLSA 4RY2A 5FBWB 4C3ZA 4D4KA 1IM2A 1HE8B 4FD2A 4GOKA 3BBPA 1DS6A 2KWIA 3KJEA 1RJ9A 2ZI7A 5ELXA 1G7RA 3TR0A 3AF3A 4EJSA 4OYHA 2CLCX 5J4KA 1TNDA 4ACBA 3ADCA 1HY3A 2ZANA 2HXYA 2ORIA 4B74A 3UMFA 1W5TA 1AZTA 1E2QA 3EAQA 4Y0AA 3A8TA 3ZYCA 5JHGB 1YU9A 5KDDA 1PZNA 2OO7A 3C8UA 1SGWA 1E9SA 1U81A 3DKPA 4YMUA 5JSZB 2D3WA 2IYRA 1E1QA 4HSEA 4R71A 621PA 2AN9A 2H1LA 1KDRA 1E79D 4TMZA 2QPTA 1BS1A 4A8JB 4DLZA 3KQHA 4LYAA 1C9KA 2P2LA 2BDTA 3FHCB 4HDCA 2WWXA 3W3AA 2D4HA 1ZNZA 2H18A 4IXNA 3SYNA 2BMJA 1NY6A 4KYUA 1VTKA 2LWIA 5DN6D 2JASA 2F1JA 1VG8A 2GVDC 1PJRA 1KKLA 3OHMA 1E0SA 3RS4A 2QPOA 3TSWA 1S9DA 3QXHA 4LPKA 4C0JA 5EE9A 4RFVA 2QAGB 4EDHA 1SHKA 2IYUA 2J46A 1E96A 1QRAA 3QEJA 4BGDA 2O8FA 2BCGY 3MCAA 3SJZA 2XSZA 3A4NA 2IL1A 421PA 4I1SA 3U3JA 2ZPTX 1D2MA 2FPMA 2JGNA 2AWNA 4IVQA 1ESNA 4IVPA 1TAGA 3PJRA 3K9NA 1NLYA 2B7BA 2FZLA 4YMWA 3QPVA 3BJIC 3AF0A 2EFCB 4BFVA 2G83A 5FPSA 3I5XA 2JLYA 1XMIA 1W0KA 3B9PA 2ZITA 2GDJA 1FX0B 3QOFA 2GESA 2ZJYA 4IDHA 4Q03A 2IYLD 3ZZTA 1I4TD 2W6ID 3L43A 1S0UA 3V4RA 4QJ3A 1S8FA 4HYYA 3PXGA 1C1YA 4LJ9A 2ZR0A 4B6FA 3GCGA 1T91A 1US8B 5TARA 3EZ9A 4WW0A 4MQBA 1E0JA 1ELOA 3P1JA 1J99A 4Q4HB 1P62B 2C5LA 3S1AB 2DWOA 4EPTA 1W5SA 4IRUB 1DE0A 2A5YB 3D31A 4DLYA 2QPAA 2TMKA 4MGZR 4KYIB 5F2EA 2ZE5A 1SKQA 4Q9JA 2F1HA 1S3GA 2V6IA 4LV8B 2WMOB 2FSIA 4FMCF 4URWR 3LH5A 4DCNA 4HAUA 2ZRIA 1XEFA 1J8MF 5JMTA 1T5IA 2OHFA 3GFOA 2GJAA 3LW7A 5FTMA 4JVNA 2FN4A 1S1MA 1G5PA 2R65A 4A0RA 2A9KA 1JJVA 2ZR7A 3OE7A 3EWAA 3QVVA 4FMDF 2PJZA 4ZKEA 2WAYA 1VG1A 2BBTA 1DAFA 3D6TB 3QXCA 3WRYC 3EWSA 4QGAA 4M1SA 4ZDWA 2PZFA 1QHNA 2HLDA 1RKBA 4BLPA 1G1MA 4FW9A 3RYTC 3QBTA 3IEVA 2JJ1A 3PQCA 2FGJA 1GP2A 3LW8A 4LJ6A 2CCGA 1OJLA 2ZVPX 2C98A 1UKVY 3KL4A 2X77A 3FFAA 4FMBB 4W5WA 2B8WA 4NYMQ 5FTLA 2JJ2A 1Z0FA 3GFTA 4LJ7A 4R2HA 2BEKA 3T1VA 4L4UA 4Z1MA 1E1RD 2GA8A 2V9PA 4HLQB 4TL8A 3AVTA 1VYTA 4IFBA 3ASYA 4BFZA 3W3ZB 3GD7A 2XZPA 3ASZA 1Z2AA 3K8YA 4PC7A 5EE5B 2QMEA 4DLWA 4S35A 2AD1A 3GEEA 1XU4A 1R6BX 4GL2A 3TW4A 2O8EB 3QNUA 1W2GA 1XFAA 3WP0A 3B82A 4QHTA 5F9FA 2Q6TA 2YWHA 4PZYA 5BQ5A 4ASUD 4LY6A 5JS7A 4JLNA 4OJKA 2WPDD 3O8RA 2J45A 4M0LA 5FPKA 1G18A 2QE7A 2F55A 3VNVA 3FOZA 1UEJA 5J4VA 4LV6A 4JVSB 4HDOB 4M1OA 4TZ6A 3L0OA 3KJGA 3SR0A 2GXAA 4A0GA 2Q3FA 4OHXA 4DC9A 1WF3A 2HJVA 4Q4JB 1IN5A 2GNOA 3GP8A 3ADDA 4OJQA 2ZRPA 5K8IA 2DYKA 1NMYA 2ASEA 3KTAA 5EJEA 2J9RA 1ZVQA 1QHSA 4IW3B 3NKVA 2IT1A 3GJ4A 5EE1A 4UXHA 2ZI6A 3T5GA 4DZZA 3K70C 2H57A 2XNSA 1D8TA 2ZSFA 2ZIAA 1VECA 3W8RA 4DLVA 4G01B 3OZXA 2OXRA 4URXR 1U98A 2Z4SA 1KJYA 1Z47A 3K0FB 4P33A 2UZ3A 1AS2A 4P3YA 3SC3A 4EPYA 721PA 4B2LA 4QM6A 1N6KA 3A1SA 4AKEA 4DSNA 4LHVA 3EPHA 3G0HA 3I8SA 3NVAA 2ZU6A 3WXMA 1RPZA 5FUWA 3BS4A 2J1LA 2HCBA 2O52A 1E2EA 1U2RA 2ZRHA 1SVIA 4EJSB 4TN1A 1E9FA 2SHKA 3KQNA 1ZIOA 2GK7A 1OSNA 2REBA 5HZKA 4IEEA 1AQYA 2W0SA 4LUCA 4XH9B 3TQCA 1EXMA 5BN3A 1G41A 2PH1A 1IN6A 1QG2A 3LRPA 4JKIA 4KSCA 1DTSA 4MRRA 2FFAA 3K0CC 5TDHA 2BJVA 3HU3A 4AKHA 1GL6A 4US1R 3A1TA 2WIAA 2IYXA 3NXSA 1GIAA 1Z8FA 1YZGA 3SQWA 2FWRA 3RC3A 3BE4A 4D0GA 2ZRLA 3PUWA 5L8VA 2RB4A 1P2UA 1DO2A 3O8BA 2F1IA 3K0AA 3PR1A 4M1TA 2CNWD 4XVUA 4I4LA 3AF4A 1DBSA 4W7SA 4DKXA 1OT3A 5GJCA 3ZZ0A 1E94E 1XRJA 1XD2B 4WIAA 4U02A 3U3MA 3I1FA 1M7HA 5H68A 2WBLC 2PMDA 3GJXC 1YVDA 3E5HA 4NU0A 5E4FA 1CJMA 1QHIA 2O8FB 2XJ9A 3FKQA 4ZCLA 4XTCS 1Q44A 1G8YA 2JATA 1KDPA 4MGYR 3EC2A 4JS0A 5HKKD 5KYKA 1LFDB 3W5IA 2OFOA 4MYUA 2FSGA 1PLLA 3P27A 1L8QA 4LYHA 1IXZA 5ANRB 1DG1G 4TLAA 1EK0A 1KK1A 4LZZA 3IHWA 3HU2A 1U8YA 4XSHA 1G7SA 3I3SR 5SZJA 4PSAA 3TUZC 1TF2A 3VU9A 1UDWA 1P60A 4D26A 3QKTA 3W5JA 2VSXA 2V1XA 1KI3A 1SXJB 1F2UA 3GMTA 3LLUA 4A1FA 2R62A 3CRMA 2RGBA 2QTHA 1ZINA 1E1RA 4B44A 4DEYA 1RIFA 1OH8A 3IHLA 3VR2A 3AH8A 2IK8A 1CR1A 2EVWX 1LS6A 2HXSA 2R6DA 1B0UA 2XJ4A 2IYQA 2QP4A 5DLQC 2I3BA 2GF0A 2CDNA 3RS2A 4M9QA 4DLTA 5JBQA 4AWXA 4QBHA 4ASUA 2QT1A 4Q5IA 2YC2C 3U3OA 2WPDA 2CL6X 4NE2A 3T1TA 1T9HA 4TTQA 4DT1A 5JCZA 2WSSD 3GLIE 4TL9A 5DSZA 4Q01A 3AP1A 3L2OB 4CT5A 4PPNA 4C0AC 3CZPA 1N0UA 1ZM3A 1X6VA 4QGFA 3FE2A 1ZAKA 4NYMR 4RKFA 4HATA 5IK2D 4IKEA 4A4DA 1OXTA 3SFVA 3CX8A 1I4DD 3GJ7A 3M6AA 4A2PA 4TLBA 2QL6A 2P3SA 1W4BA 3TKLA 4B2PA 2DHRA 3MGCA 3N5CA 2VSFA 4M1KA 3UPUA 2QG6A 3ZVMA 1N6RA 5J4HA 1W36D 1Q57A 1Z83A 4LHYA 2MSDB 3WNDA 3EZFA 2ODEA 3GPLA 1SVMA 3CBQA 1GSIA 2CK3D 2IYZA 4RVCA 2CMKA 2GCOA 1RRCA 1P7CA 1AIPA 1WBBA 2QROA 3DM9B 3RS5A 3IGFA 4GOJA 1JBKA 1UKEA 1XMVA 8OHMA 3TGPA 1XPRA 4C7OA 1JXMA 3WYFA 1H8ED 4KBFA 2ZUBA 3OF5A 3HDTA 3WNCA 4BLOA 5A5GA 4M9ZA 1IOZA 3UMSA 2G1KA 2IBMA 2P5SA 3A36A 1KO7A 2OG2A 3FGNA 3HJNA 3DKVA 2YZ2A 3NC0C 4PANA 1G3IA 4FN5A 4CT4B 1X1SA 3BWDD 1I2MA 1IBRA 3MG9A 2EFDB 3H2YA 4HUQB 4BRUA 1MO6A 1NN1A 4TSFD 1Q1BA 4JLMA 1YQTA 1KAGA 1AM4D 1XXHE 4FIDA 1R8SA 4DSTA 4L9WA 3R20A 1HT1E 1CRPA 1HV8A 1HTWA 1Q22A 2PCJA 4Z8YA 2IXGA 3TMKA 2IF0A 4RCZA 3REGA 3P26A 2PLFA 3VR6A 2J7PD 2QBYB 1P72A 5A4JA 1SZPA 1L2TA 1X8JA 2YYZA 2C9CA 1G4AE 3B1VA 4WZ6A 4RZ3A 4YDSA 2NOAA 2NPFA 3I72A 4BFSA 2ZE8A 3VMFA 2EYUA 4NH0A 1JECA 2A2ZA 4TL7A 2CNWA 1ZM9A 3A1WA 2FEOA 1OE0A 3SI7A 5FL7D 3FPAA 2AX4A 4TT3D 4A2WA 1JB1A 1ZU4A 1R0ZA 2QM8A 4WA7A 4NHOA 1KZ7B 1XCPA 3QF4B 2C77A 3QXJA 2RGNA 2V4ZA 4N0EA 2ZVQX 2H17A 2WWWA 2RGEA 5D3QA 2BMEA 1E2GA 5DYIA 3T1OA 3QPWA 3SJAA 2G77B 1IXRC 3KQKA 1UBGA 2F6RA 5B2ZA 4A15A 4W9MC 5FH9A 1GDDA 4HZIA 3SE0A 2NGRA 4H1VA 3GLIA 4UNNA 1R0XA 5C18A 1XTRA 2C9YA 4MUAA 4CEHA 2FOLA 2D06A 1KI8A 3RHFA 2W2XA 4NKRA 3QVUA 3MSXA 1KI9A 5AJWA 5HZHA 2FG5A 2ZS7A 1IONA 1NKTA 1P73A 1J7KA 2CHGA 5GJVC 4O25A 1ZD8A 1AKYA 2ECKA 1Z08A 1W4AA 1Q3HA 5JEDA 1JQLB 1LY1A 1ZU5A 4Q1FA 5CB6A 1P2SA 1DO0A 2VP4A 2ZUCA 1W46A 5P21A 3IBYA 3VNUA 3AUXA 3B7GA 3V4FA 2AKAB 4DDUA 2QGZA 1UPTA 3VAAA 3K0AB 1WCV1 1XJ0A 2QP9X 4CDGA 2BVNA 2WSSA 2G9NA 2OV2A 2EFGA 4BFXA 3AVWA 2GBLC 3IPYA 4PPQA 4Q7LA 1EG7A 1YE8A 3BB1A 5KOYA 3MJHA 4LC0A 3P32A 3SYLA 4BLRA 2C96A 4ZDKA 3EASA 1G8GA 4RCYA 1KNQA 3ZVLA 4GMDA 3C4JA 1NJFA 4L15A 5L3VA 2I1VB 4AYXA 4J0QA 2REXB 2NQ2C 2IS2A 2GILA 4LJAA 1Z2CA 2GK6A 3PFIA 4KU4A 5E95A 5K8TA 4DCVA 3ADBA 3LVRE 3PIRA 1VCIA 2FZ4A 1OKKD 4ZCMA 3V9PA 5EUMA 1HQYE 2CJWB 2WAXA 3DZDA 5LD2B 4B3GA 4G3XA 4MA4A 2Q0HA 2CK3A 2J41A 2W2VA 2I4IA 5CM9C 1MH1A 1RE0A 1F2UB 1XXHA 5TVKA 1PVOA 1GZSA 2O8BB 1YZUA 1AKEA 2A5GA 4ESVA 2GJ8A 4Q4AB 1KDTA 1KY3A 4KFRA 1N2CE 3QF7A 3B1WA 1HYQA 4R7ZA 2Y8EA 4IEIA 1G7CA 3MWYW 2F43A 3DOEA 3SDZA 4DWJA 2Q9AA 1OXUA 3A1UA 1JAHA 4JL8A 4P32A 1ZC3A 5KO2A 2RH5A 4DT1B 1HT2E 2DWPA 3SNHA 1W0KD 1MT0A 4KVGA 2IC5A 4XTRA 1W4RA 5IRCD 2QTVB 3AF2A 3ZZUA 4TSFA 3MFYA 3IBGA 3ETLA 3LWNA 2VP6A 4DHEA 4RD1A 3C7KA 4DB2A 1T0JB 1E2PA 1PLKA 3EC1A 4XVRA 1CJUC 2PZEA 2ZETA 3D7MA 2QQ0A 2E1RA 2RHMA 2CXXA 5KDOA 3VFDA 4U7DA 3ZD6A 4A8JC 5BYJA 1T3LA 2WICA 1OPXA 5FPHA 5C4GB 2PX3A 4F4JA 2J7PA 1U90A 2HEIA 1ZBDA 1HEIA 4V0NA 4B76A 4DUGD 5K8LA 4AC9A 2OCBA 4PPFA 1TUEA 5GJBA 1GAJA 2FV8A 2XAUA 2R6AA 2GCOB 4MKIA 3L0IB 4LYFA 1BMFD 3SZRA 5DHFA 1NRJB 1O3YA 3PITA 5FL7A 1DPFA 3RAPR 1GNPA 4B3DA 1VG0B 3L8ZA 4TT3A 3O8CA 2OBMA 4C7OB 1N6HA 3RSLA 1OH6A 4JT2A 2OAP1 3NIBA 5IF9A 1JALA 2QORA 4GBMA 2ZAOA 2JLSA 4F92B 3B6EA 4C2UA 4X8HA 3RRMA 2ZSBA 3X1WA 4BEJA 2IW3A 4BEBA 3I5YA 3I92A 4JLPA 2FPLA 1CBUA 2IF2A 2ZJ8A 3SBEA 2QU8A 3R8CA 2JJ2D 2E9SA 3NHAA 3B1YA 4B43A 1ZD1A 3AKEA 4PO1A 3IILA 1G3RA 2B8TA 2EWVA 1WMSA 3KKQA 3IPXA 3N70A 4EPVA 3FHOA 1LV7A 2HF8A 4NCNA 4Z51A 3T34A 3NEYA 5AUNB 3KUCA 4OK6A 2MSCB 3VKGA 3QKSA 2GJ9A 5FTKA 4YXWD 2FFQA 4MGKR 3Q3JB 4LPSA 1NLFA 4NDZA 2VHUA 3PV0A 1OB5A 3NBXX 4HDQB 1XTQA 1X3SA 3KKMA 2FE4A 3B85A 3CUEF 2YWGA 2B6HA 3B9QA 1CULC 5KDLA 1MABA 2QE7D 2D2EA 3CRVA 2QUZA 4LCBA 2QSYA 3AVXA 3MWLA 4TTPA 2QZ4A 1N25A 1TQ2A 1P2TA 4GRAA 3BERA 1CXZA 4URUR 4M1MA 2DB3A 5SZKB 1G5RA 3FVQA 2VP9A 4NCIA 4A36A 4CEJA 3AVVA 1WB9A 2RGXA 1UBEA 3PUYA 1Z0KA 3NTUA 1RYHA 2CVFA 3X2SA 4A0HA 4QRHA 3BH6A 3HPQA 3LQRA 1P9NA 4QL3A 3CF6R 4URYR 4Q9HA 5G3ZA 2NO6A 5KSYA 2CEAA 1GTVA 2VPPA 1G5TA 2OESA 4D0NA 5EP1A 2A5JA 3BFXA 2NZJA 1GNRA 2EYQA 2WM9B 3AF1A 1GRNA 4DCTA 2JLUA 4WXPA 1OKKA 5FOUA 2YNMA 5HPYB 1ZM4A 4NBSA 3QI2A 4EFNA 3X1XA 3MMPA 2BEJA 1AN0A 4LHXA 5TMPA 3Q5EA 2JIZD 4LDJA 4HB0A 1UBCA 3QIAA 2WIBA 2EQBA 1XZPA 4F38A 3CPHA 3KJHA 5JJIA 2RGDA 2QA5A 4B75A 3MUFA 2YC4C 4H9GA 1L4YA 2VRWA 4UKDA 5GJWC 2J3EA 5FOWA 4B73A 1VCOA 4BZQA 3BC1A 4XWAA 3IIJA 1U8ZA 5KTYA 1KOFA 3REFA 4G0NA 1E9RA 4JVMA 1J70A 4O0MA 2UZIR 4MYHA 2G0NA 2OILA 4PHTA 4TQAA 4BLSA 1G20E 1WRBA 1YZQA 1XTJA 3CF2A 3CNOA 3KDSE 3I62A 1XP8A 4MH0R 4EQ6A 3CKLA 3W90A 3EPJA 4OQNA 1VYUA 3C16C 2C2HA 1UM8A 1DVRA 1RVDA 2Z0MA 4K81B 2J0SA 1Z6YA 4JT4A 4PSKA 3SHFA 5JHHB 4A92A 5KPJA 1VCNA 1KI6A 3QBVA 3EA0A 1IN8A 3AVPA 1W36B 5FOTA 2J0UA 1VPLA 4QNMA 2G3YA 4US0R 2Z6VA 1S1CA 1F5NA 4DUGA 3B78A 2ZI9A 4GZLA 2HV8A 1OIXA 2O0HA 2OCYC 3IKJA 4KI0A 3H4MA 1XXHB 1BMFA 3AP3A 1UJ2A 3KKPA 5AUQA 4JZKA 3RNLA 4JLDA 3NDBB 2H92A 3CNNA 4DSOA 5JRZA 3KKNA 2BV3A 4B3BA 3VKWA 2NO0A 2QP3A 1N5LA 4YDHB 3MWJA 2WWGA 1FP6A 2RMKA 4GMXA 1UAAA 2GEUA 1U94A 5CYPA 3I32A 5AUPB 1FMLA 5DI3A 3RS0A 3NHBA 3Q7QA 5F9HA 2YINC 4DIEA 2JLVA 2FSHA 2ZI4A 2ZU0C 1UEIA 4M8NE 1WBDA 3K0CA 5HTKA 6Q21A 1GKYA 4PHGA 4YLGA 4HAYA 5FOSA 2OSBA 1E2HA 4HZUA 4YMSA 1NMXA 4QGGA 3G5UA 4OQXA 2ZTSA 2HCJB 4TMTA 1J90A 1NVVQ 4PXAA 4YXWA 1FUUA 1JR3A 1Q0UA 3I4LA 3KFVA 4N1AA 1KJWA 1P2VA 3SHWA 1GRRA 2FMXA 4C30A 3BH0A 2OBNA 4V03A 5K8UA
chains in the Genus database with same CATH superfamily
5T41A 5AJXA 4IYJA 1QIKA 3WO1A 3UTDA 1AK2A 2I7VA 4P31A 1PV4A 2UDPA 3L92A 3GMIA 4Q9DA 1V9LA 2VAWA 4Z53A 5JI2E 1GL9B 1K5GA 3E4DA 4AKTA 1CE8A 3QP9A 4TWIA 2VRBA 4Y9UA 1PTJC 2YUTA 4X7RA 3TYXA 4KFCA 3LCMA 2ZXUA 2QEQA 5BSTA 5A5VA 1X8XA 2W6PA 2BELA 3C1OA 1VLVA 3KKOA 4IGFA 2BFCB 2W22A 4LHSA 2AFRA 3LECA 3ZQUA 5MN4A 1BXRA 5AKXA 3LZ6A 3IP9A 4INOA 4I19A 2IWHA 4KWCA 5K51A 3OZWA 4P38A 2C7RA 5C4IA 5HE9A 2PUEA 3N87A 3V7NA 4HXGA 1CJCA 4R54A 3K2BA 4Y6LA 4F84A 4G4IA 4DR4B 4IO1A 1HKHA 3R9XA 4KGZA 3PXDA 1G7TA 4D80A 2I5PO 2J5KA 1PQPA 3K3PA 2I3GA 3BEOA 1DAEA 2W9XA 3K92A 3Q2KA 4X9XA 3U7GA 3EZNA 2H52A 2QSJA 1ES9A 1EWTA 4E5KA 4WZBB 2HHJA 2FX3A 1DKOA 5L3RA 5KAMA 5I7HA 3RQSA 1P29A 2DTEA 3D7RA 1ZC4A 2AN5A 3QA9A 4ILEA 3T7SA 3T3HA 2B3DA 4FYKA 1KS9A 3HADA 5C4MA 4AB1A 4K87A 1BVHA 3D4NA 2JIZA 4ZO9A 3OKAA 5IWAB 3TW8B 3T4EA 5HCNA 2Q29A 4WK2B 3SS8A 4D8YA 2FPKA 3F46A 3BTVA 4HGNA 1TVKB 2JKYA 3A26A 2R25B 3KLBA 4AI6A 2XHEA 3F6RA 4AUEA 1GPAA 1Q7EA 5JFGA 3WHLA 3TK1A 2PO5A 2JJQA 5BO5A 1F7UA 3CR3C 2Y4NA 1YHNA 1OLSA 2BZGA 2PGOA 2ZSHA 3V8MA 2FSFA 1YL6A 3EIHA 3K09C 4OGKA 3TZHA 2X5OA 2KE5A 2DHCA 3P52A 4PEVA 3RSHA 3SNKA 5F1PA 1IBKB 1X2BA 4KGDA 1GCOA 3AI2A 1A3CA 3L8YA 4F6LA 5L7YA 3DGEC 2PVPA 3C5CA 1G17A 2AFVA 3QBJA 5LQJA 4F6RB 2G8LA 1WXGA 1DCKA 3KUXA 3CZCA 3ZQ6A 3BT7A 1FDIA 1ML3A 2ID4A 3ODGA 1E7RA 4KV9A 4YRGA 4Z0HO 3UY4A 3H1BA 2G70A 2B1RA 2YS6A 2ZRGA 4I1VA 4PS0A 4QHSA 3W9BA 3MS7A 1LB1B 4NXMB 4IG4A 5UKDA 1U7HA 1LX7A 2BGLA 3NHWA 2Y4OA 1VSBA 1ZUIA 5BY2A 4F4CA 4O4HB 8LDHA 4BX3A 1U1GA 2R8OA 2X2EA 1TZJA 2GAOA 2XZDA 3O9VA 5ENZA 4ZT2A 1A9XA 5BQXA 2JCVA 1H66A 4ZREA 2VHQA 2BKAA 1KYWA 5DGIA 1LVUA 3O1JC 2I62A 3RSCA 3CONA 2CHFA 5HF9A 2ETXA 4BN5A 5M2QA 3TNLA 3U7EB 2YVKA 2VPXA 1HE3A 1WD5A 4CKYA 4LZPA 2VDRB 2MMGA 1F1BA 2FW9A 1U3WA 4G6ZA 5K8CA 1UDCA 2A5FA 1KO8A 1KU0A 1WDKA 1WPXA 2ZZKA 3EXFB 2WWIA 3JRWA 4J0GA 5CPFA 2WQ6A 3ZTYA 4QUAA 1R9MA 4HGOA 1SG6A 1UZNA 3EEBA 2DSNA 3O73A 4IQ8A 3E7WA 3TJZA 4AM8A 4BVKA 5B7GA 2VAXA 5AI0A 2B92A 1WO8A 2C0CA 2OCIA 2P6PA 4J2TA 5T6BA 5J47A 4KI7A 5LWQA 2HQSA 4PYLA 1AGYA 3GC6A 4RNCA 4J3FA 2I29A 3RUEA 2GPWA 4OP1A 5FQNA 1I2CA 3MOIA 4XFDA 2JFQA 3D1JA 3IP7A 3PQ2A 4L4RA 4EJ0A 1Y9JA 4CUJA 4WDQA 4TMKA 3JVUA 4O4IB 3V1NA 2DUUA 4RESA 3FCAA 1M2HA 3PICA 1XD8A 4FSHA 4PX3A 3BL6A 3QU7A 5E7QA 1TJPB 2RIRA 2IHTA 3DE1X 4P5EA 4TYPA 5K7SA 4C3UA 4V1CI 5CEEA 5AI6A 3P45A 4MTLA 4EYEA 3THYA 2AHOA 3NIWA 3Q5GA 2VA8A 4AUKA 1KI6B 3I8XA 4PQRA 1GARA 2G9ZA 4BVBA 2GN9A 2J0UB 2X0KA 1UKZA 3C87A 4REQA 3ABRB 1KVUA 1XE3A 2VJPA 3LF2A 3NDIA 3ZX4A 5BW8A 3OKPA 3QPUA 5F1YA 3NHRA 1LLDA 4AQDA 5DULA 1XRLA 4L27A 1GNVA 1Z12A 2X6TA 2IYNA 5T64A 4DUZB 2ANCA 1FFDA 3A9VA 1NJ6A 4G86A 2PE5A 4J94A 3RG2A 3G0IA 3KOOA 4GMKA 2J7KA 1NI4A 3PX3A 2QTNA 3T06B 4GRDA 5LWHA 1XN1A 2R85A 2QJWA 3KZMA 4CWAA 1I3OA 2VSYA 2NXJA 3LA8A 4RVDA 3U5ZB 2MDTA 4L02A 2PK3A 3D8RA 4F3TA 1JMYA 1YS6A 1P9RA 3KWLA 2W6JD 5DGHA 3VTZA 4X61A 1BVUA 3C70A 5CLHA 1L4BA 4PYNA 1T2CA 3VVLA 3T3GA 4IEFB 2E48A 4L0QA 3RSGA 3ZY4A 5FO1A 2VDVE 1EA7A 3TD6A 1D2NA 4F1JA 2YJNA 1P0MA 1OWOA 1TUIA 3HV0A 2OQIA 2GCNA 4AF8A 3AUSA 4XQCA 4OBWA 1W2HA 1VI2A 3N86A 3AY0A 3SEQA 4MZXA 4OQFA 2ZYWX 3ER6A 1CEQA 3HSSA 4R40A 5BW5A 5KX5F 5MDHA 4HMOA 3U9LA 3UMYA 5A5EA 1RYZA 5J2UA 2DTDA 3NIFB 1EVLA 3DFFA 3QFTA 1IY8A 3IIKA 4P7BA 1A76A 2VTDA 1PEDA 4FHCA 4EI7A 5TB5A 2JLWA 3L7OA 2BOVA 1RAIA 3SFZA 1CJBA 1U2QA 1R6XA 4EJMA 4XGRA 4OMDA 1ESMA 1PS0A 4C0SA 2A0KA 1UMDB 4QOEA 1TAQA 4I9GA 4YROA 3M3PA 2V7QA 4PZ9A 2YHIB 2CV1A 1QX3A 2JCXA 3KQYA 2PZBA 3KYJB 1EFPA 4IIJA 5F4BA 2RIPA 3SF8A 3TD2A 3HXPA 4KO8A 3RK1A 4E3WA 5JQWA 4HNRA 5DRTA 1CY7A 5E2BA 5AM3A 4PLZA 1YZLA 1YOBA 5IHPA 1ICEA 2GBLA 1O58A 2PL3A 4P35A 3CFYA 2O8CA 4ITVA 2QY6A 2X7JA 3AVYA 3WQBA 3HHEA 4EELA 2P5TB 1U0HC 1U9JA 3ODPA 5HGJA 1PLJA 4AURA 4V1CA 2ZM5A 4YRSA 2JFWA 1RFLA 2QNBA 2FEWB 1V9CA 1LA2A 3V00A 1BC5A 2WJJA 5CDTA 1E7QA 2ACVA 2I91A 3W0LB 1XV5A 4CLOB 1U5CA 2FPGB 1VB3A 4IIVA 2YBDA 1RAGA 5G4KB 2Q21A 1N4AA 1BSVA 1VIVA 2O7VA 1ZCJA 2X5JO 3LKVA 3MLBA 5IBPA 3R75A 2DJ5A 2A78A 2FMFA 1JVBA 3E23A 4JIMA 1I9GA 3UK6A 4F7WA 1J9EA 6YASA 4IX1A 4PICA 5DHUA 5JAIA 1ORWA 3DJFA 3KHUA 2YVUA 4G4JA 1DAHA 4P93A 3EFHA 2N47A 2VEOA 3CISA 3HWRA 1RLIA 4TXJA 3TCKA 4KREA 1LJUA 4IDQA 2QU7A 3F1LA 3PENA 4HOYA 4HADA 3UV6A 4UEKA 4ZYXA 4OX9B 1YE3A 4FFNA 1RXWA 2R7AA 5I7RA 2GM3A 3ZTWA 3MUNA 4ND6A 4S12A 3VOBA 5J5VA 4LE0A 2QMOA 1X8KA 3UW3A 4MVJI 1JYFA 3B13B 3QG5A 3WKCA 2J3DA 3ONFA 3QVGB 3HR4A 3CNBA 4F5WA 3UJNA 1G4UR 3F5MA 1SHTX 2ZSAA 2IV7A 4CI0B 4UC0A 4Z9AA 1J22A 1ZN9A 2PAFA 3EG5A 4C7MA 1RS0A 1BFKA 1KP2A 1GL7A 3GIDA 5HMMA 3SY8A 4MI6A 2IZZA 2VPWA 3KALA 2HT6A 1ZL2A 3VDRA 2WHXA 4CGZA 3IUMA 4NPCA 1GDHA 3FFBA 4CTOA 4JJIA 4KFUA 5ADUS 1GPMA 2NUPA 5LXTA 1JEYA 3P20A 2BFEB 3FDJA 4Q9KA 5EP3A 1ZJ4A 2AS0A 5IAJA 5TS3A 3UM9A 4F1KA 5JSZA 3ZE7A 5DYGA 1PZEA 3WB2A 4A26A 1IM8A 4KGVA 5AOCA 3FF1A 4C0BA 4KQKA 2JAQA 1ZRMA 1F0NA 3PEUA 4A8JA 4TV8B 4L6AA 5I9LA 3BWEA 1EG2A 1VG9B 2AFIA 3MD0A 4ED9A 3C5WP 3VH1A 1Q84A 3QV2A 1DJOA 3FJ1A 2NXCA 3GLGE 4B3TB 3A6HA 4HLUC 4EG0A 4I6EA 2JVKA 5HE8A 3KG2A 2ZIUB 1T2NA 1RC1A 1JKIA 1HDGO 1C8KA 4P08A 2QIOA 4PAWA 1JW9B 4IQFA 3TIXB 4PGFA 2CVHA 4RD0A 3VBEA 3BIOA 3DCNA 1XZDA 4ZVMA 5IC6A 1IXYA 4FQ7A 4PO9A 1R0WA 4CHTA 4AZWA 2DLDA 1N6PA 1LF5A 3OM0A 5LDGA 3BYZA 3ORFA 3K9CA 1VMIA 3Q9SA 2NTVA 4HDSA 3PZRA 5HXAA 4WCFB 1ITZA 4HHEA 5DVZA 2OBFA 1IJEA 1NDHA 4QUKA 2EFHB 2HUNA 2XXAA 4YAGA 1EFRD 1F8FA 1IN7A 1YBFA 4JKYA 4R3UC 1OWMA 1L9KA 1Z6ZA 3SOZA 3W5DA 1Z3CA 2C9BA 5PNTA 2PGXA 1R7RA 4II7A 2V7UA 3LQQA 3V55A 1E4VA 2CXHA 4WN9B 1FP2A 3BEDA 4KUEA 3I12A 1EQAA 6REQB 1SD1A 1TI7A 1LFAA 2V54A 4JIGA 1YS9A 2Y66A 3KT0A 4NTZA 3UWPA 5AVTA 4KKXB 1S9HA 4DL9A 3KE8A 4ARAA 4M0FA 5AOBA 3FNEA 2EP8A 4MVJA 5LZ2A 4WOPA 4B3MB 1W0JD 5CTAA 1XTBA 2RD2A 3SSOA 2VYQA 4DCJA 3EDQA 3S8YA 5KJCA 5C3UA 1SK9A 4DPMA 3M0EA 4TLDA 1XCGB 2ZJ1A 3RS9A 1YFJA 4X95A 3KQMA 2NVBA 5JO0A 2NU9B 2WYIA 2ZQYA 3EEYA 1M2VA 4CF5A 3FOWA 1NVFA 3B3AA 2BFFB 1QPBA 2C7VA 4YUVA 1EMDA 2C2XA 4URFA 1NI5A 3CC8A 2NZ8A 3ZD9A 1V5FA 4I4TB 3NCHA 1SAYA 2LXNA 2VHJA 3K0EA 3U40A 4BJ3A 3U4HA 1YMVA 3K6KA 3ZWCA 2DUNA 2XYPA 3QKUA 5D3ZA 1RRMA 3RRXA 4PAQA 3W8NA 4IHQA 1HQCA 3M9LA 5ECWA 3ME5A 4HEQA 4OI4A 2G5CA 3VR3A 2QGFA 2CNLA 1JN0A 1MA3A 1U0JA 1ZOPA 3SC4A 3NHMA 1EFCA 2GN6A 1J9ZA 3G6KA 4MK4A 2XGOA 2P9EA 3L02A 4BNHA 3AVOA 2EL9A 1U2ZA 1TGYA 1II0A 3RR2A 4K9MA 3TI7A 1D0SA 4JUAA 3LXXA 2WAOA 1BROA 2XX3A 4J3NA 4AJ1A 5CYFA 4JI3B 2FW7A 4BLTA 4V0OA 4WX2B 2MSEB 5TIIA 2H1SA 1U9ZA 1Y8AA 3DVLA 1QGDA 2IUSA 3GK3A 5TQ2A 4NABA 3T9DA 3GLFB 1XVLA 2ZRKA 2X22A 4CFSA 3F73A 4IWYA 4KWEA 2JFVA 3I09A 2PGNA 1ORDA 4K28A 3LUBA 3U2QA 2PV7A 3L7AA 3KOUA 3BAFA 1X2EA 3PC6A 4PRZA 3PNBA 3AY3A 3ROTA 2PWAA 4RTKA 1C1HA 5JPIA 16PKA 1P4GA 3Q9LA 4EPRA 2YOHA 3QOXA 1XQWA 2HIMA 4D0SA 5FXMA 1ENZA 1V1RA 2F4NA 4DG8A 1F5SA 4HEJA 2V55B 1XYGA 4FHEA 2WDZA 4IJKA 1UDXA 1PJQA 3DAOA 1MENA 1BJRE 2J5XA 1QF7A 4S1TA 1Y4DE 4AJKA 3FI9A 2H4YA 3AILA 4JB0A 5E3JA 5E7JA 4B8WA 1TCUA 4CUZA 5ALVA 4FB4A 2C9DA 2GOYA 1T2FA 2OZPA 4MV8A 1B8UA 5DJ5A 3EDOA 4KC0A 5IM4F 3ICQB 1D2GA 1ZNXA 5EQDA 1DIRA 4E51A 4JI1B 4GR9A 4ER0A 1XQ1A 1I30A 1ACMA 2VQ6A 2PTHA 4RV4A 3RF7A 5B3LA 1SXJE 4D79A 1XLTC 2C4TA 3SDSA 5C9ZA 4ZT7A 3UV3A 3MJDA 4TM8A 3OLZA 3VSBA 3ZV6A 4RTJA 4Z4CA 3M33A 4Q4JA 2VUIB 5KTNA 1RQNA 1T9BA 5ALTA 3SHVA 4H7FA 1N7GA 4KDEA 1QM5A 4KTTE 1T5TA 1N8KA 2E4ZA 4K3UA 4R1OA 2GYVA 4V0KA 1B42A 2E4WA 2VWHA 4Y6OA 5FFMA 4A91A 3OCZA 2J07A 3RWMB 2YIVX 4C03A 1I5OA 4WGFA 4POAA 3TQTA 1F6WA 3G1UA 1JG6A 1QP4A 1U3VA 4W5RA 1JSLA 1K4KA 1XZQA 2OOKA 1EDBA 3PUJA 5DWDA 2XCRB 3WGQA 4MIOA 1T10A 2HA4A 4RS4A 4LGMA 3SJ7A 3ZK8A 1W1IA 2BTQB 1BEZA 2RFLA 1FP7A 1E3JA 1I1QB 4DIMA 1H6DA 5T4FA 1GGEA 3CUYA 2EW2A 1D1TA 4YC7A 1EJ0A 5B3AA 2WC1A 1XTUA 1AKTA 3HZZA 1NVKA 2XADA 4ISBA 2PRZA 3ETDA 3NYRA 4FOOA 4BNTA 1QB7A 3CB2A 5FI1B 4DLPA 1EM6A 5LM3A 2PLAA 3PNOA 3HLTA 4L4ZA 3RVMA 2FOXA 1KZ9A 5KYWA 1W8DA 3NJRA 2Y9PB 1A72A 2HYIC 3D8TA 4KO2S 1BXGA 4CW7A 3F6CA 4EB6B 2BLNA 1UFQA 3K5HA 5A3SA 4PO3X 1MGPA 3AC0A 1J0XO 3KR9A 2WHYA 3P2MA 5H02A 3U49A 2DUWA 4PN3A 3UBMA 4LYEA 1FTNA 2C61A 1DT5A 2MIIA 5EZSA 5REQA 4ZI3A 3IKTA 4JI7B 1LW6E 1L8OA 4WACA 3LG2A 3OPVA 4B87A 1V2HE 3ACDA 1PUJA 1R4MB 4JBYA 4BWFB 1XT6A 1X94A 1L3IA 4FE3A 1HDEA 4MYCA 3E2PA 2PMEA 2GRJA 4KB5A 5K0JA 1IC6A 2FUG1 3O2SB 2XNCA 3T7EA 2FWPA 3VISA 3VZQA 1XJQA 1ZIYA 3IVAA 3R1IA 3CWQA 4R2IA 2IELA 5C1DA 3F7MA 1QGED 1M8PA 1V0JA 3QW4B 1Y1KE 4D81A 5KNLA 3IPLA 3W4IA 1GILA 3HXTA 3TTUA 3B6JA 3VOSA 4JOSA 1NBME 1COWD 2Z56A 1Y82A 3C3AA 3COPA 3FTPA 1G21A 3IIEA 4NYJR 3Q6NA 4OXQA 1QIEA 1OPRA 3VV2A 4B40A 4BMZA 2IHBA 1E6KA 3QE3A 4OHWA 1B0ZA 3IMFA 2A30A 4L5BA 4MHOA 4UTPA 2FN7A 1FDVA 2HDWA 1QYRA 3FMIA 4AUNA 3D5TA 4F8JA 2IYTA 3F6YA 4BRWA 4BXOA 4FR2A 4G5YA 5ARCA 2ISCA 1JSRA 1LVGA 4POOA 1SA0B 4RVUA 2EGHA 1KE1A 2XOKD 2PSSA 3IA2A 3TM4A 2V96A 3GEGA 1IFXA 3JQDA 5KNCA 3M2PA 1NL3A 4MCAA 3RBAA 2EDCA 3KLMX 3DXFA 1L4EA 4QO7A 2QX6A 2QSZA 3DOIA 4EA7A 2OGTA 3MZ0A 2HD4A 4C7XA 1GAWA 4MUFA 5JLJA 5F2KA 4FQ8A 3PCXA 5DSTA 1UPAA 1YAJA 4WXMA 2BCEA 2IZ6A 3FTCA 3D6VA 4QOSA 2ORVA 1F2TA 4LK3A 4JSTA 1E77A 2ZUFA 1YUBA 1OZHA 3RROA 4A8TA 2C7OA 3CTPA 2KS6A 2ZRFA 1ACLA 1WXQA 2KBEA 3A4MA 5FBKA 3BXHA 4ZVRA 1GNQA 1W85B 4MJXA 3EIUA 3AP2A 1GFIA 4NQRA 3QU5A 5AI8A 2YQ4A 3VU0A 2AJBA 1ZITA 4AZ3A 3EJ6A 3H65A 4RORA 2R84A 4AY2A 1L4GA 3LLCA 4E4RA 2WKRA 4DV4B 1C4KA 4YLYA 4HAZA 1A2QA 2LD4A 2P6RA 4MWTA 2J3JA 4P98A 3RU3A 2BDUA 1AUOA 1OTHA 3QELB 1ZCZA 2H5LA 4HAVA 2F43B 5HKLA 1BDHA 1JSCA 3SLGA 3EXEA 4PG5A 1P9WA 2VBCA 4LYYA 5TPZA 2P6OA 3ZHYA 2EFEB 3QXXA 4FFOA 5CVCA 3T9FA 3VR5A 1DX6A 2V8BA 4FE7A 3ZI4A 1W59A 4EJSC 3DTYA 3FYUA 2ISQA 3KQVA 4A6DA 3DHEA 1Q0PA 1XK7A 1R5JA 4F86A 2H7YA 4MW0A 1NVMB 2OCXA 2VHEA 2WP0A 3DZHA 4GMFA 1IMJA 4FYXA 2JL1A 1XCMA 4JL5A 1NNLA 3V32A 5JALA 4YRQA 3F49S 5DTIA 4KQFA 4KNYA 5U1PA 4BECA 2O8DA 3L4JA 4R9RA 2IWRA 2FSUA 4S05A 4R98A 4ND4A 1CR2A 2I22A 3TOVA 4YJKA 3UN1A 1YONA 1SIWA 2C03A 4OXXA 1XVVA 1XKLA 1W75A 1Y5IA 4DEXA 1C30A 3OEED 4K3VA 5T67A 5CJPA 1SXHA 3C43A 2X0EA 2QRHA 3K9HA 4MMXB 4NXNB 4URVR 4UQOA 5CLGA 3QEBZ 2HUPA 1QMPA 3BRWA 2G1PA 4PF1A 2YVLA 4GS5A 3RUAA 1DEAA 5JARA 5EJMA 4FLFA 3UA4A 4XAQA 2LTAA 2X1LA 2YV1A 3DV0B 3VGPA 3ZWDA 2NU6A 5I48A 2YKGA 1RLTA 2JRCA 1BKDR 3IT0A 5DCLA 4YJHB 3W6PA 3ISJA 5IC4A 4RF4A 2REOA 3BFVA 4MWGA 4XJSA 4ZI7F 1GGVA 2PYDA 5DOZA 2FJUA 3QZUA 2YXPX 3NDJA 1W6UA 4RKYA 5KHOC 3JD2A 4RZXA 3A1VA 4V0RA 2JDIA 2BT4A 4RZUA 2C7GA 3JD1A 2WHQA 4YDRA 4A6PA 4J0DA 1G6Q1 2XCQA 1M34E 4MV4A 3S27A 3PA6A 2W37A 1LWNA 2E4VA 1UWLA 3BMCA 4HQNA 4Q3KA 4V02A 1V16A 1E89A 1VBMA 4J1NA 1TKRA 2CT8A 2JPDA 5HCIA 4X7MA 1MG0A 1WCWA 3JW8A 4HUQA 2PBLA 5HR5A 2Q4BA 1SULA 1V6CA 2VNIA 1BN7A 2J48A 1USWA 3GGCA 1L5QA 4PLWA 5LCXA 3BD7A 2YWXA 3ZLUA 2CLLB 2D5IA 4G24A 2YZMA 3PR3A 4EKNB 4DDWA 3CZ5A 1ZP6A 1BWQA 4N0DA 1UAYA 3UOWA 4FM9A 1ST3A 2BKXA 4LWPA 2GUWA 1NNEA 5HQJA 4ZEOA 3JXEA 1N36B 1ZOIA 2J59A 5ICGA 2C9OA 2A58A 4L72A 3RC2A 1PTKA 2XNKA 1W94A 1DTWA 3JVVA 1OJ7A 3OQIB 4DNOA 1ZESA 3RUFA 3L79A 4CMIA 3K4HA 1SKMA 4B80A 5L3SA 1A1VA 4MW6A 2XWJI 3KM0A 2X2FA 4MEJA 1E69A 4M37A 1TM1E 3DHWC 1WDTA 4QULA 2H2DA 1SHUX 1PCXA 1KJJA 1WM1A 3QU2A 3D43A 1MABB 3HDHA 5BRNA 2C7QA 3O75A 3AJRA 2QRJA 3VYRB 4TTRA 4MQ6A 5FNVF 3NWJA 3NWOA 2V74B 4DABA 1PR9A 4Y6GB 2E4UA 3I04A 5K2MA 2AOXA 1QQTA 3CNHA 1U7PA 2ZSDA 3AVQA 3H1EA 4D4MA 3U4QA 3DS8A 3FH0A 1M8KA 5TQVA 1DWOA 3Q87B 3HB7A 1Q77A 2BMAA 3RW9A 1QH1B 1O0CA 4C0KA 4B4VA 1EVIA 5CCXA 2YRFA 5DU2A 2O2SA 2ZJBA 1KI4A 4MXDA 1KNXA 2OWDA 3AHEA 3CPJB 4PC2A 1PR5A 4ETNA 2BGKA 1I13A 1RQRA 1K06A 4TLEA 4YAJA 3NTQA 3NLLA 4YRZA 3F78A 5IYZB 1VYVA 1MPTA 3DM5A 2C83A 2XEXA 4HDKB 1KRXA 2DG2A 1YCGA 1RYEA 3E9EA 2P69A 4OQYA 1CZKA 3M9XA 3IR5A 2AJ8A 1BCRA 2BEWA 1POWA 4JUDX 1GLGA 5JG7A 2G6BA 4CF3A 1NDQA 4O2BB 2R5NA 2W6IA 3I2KA 4H1TA 4HO1X 5CTJA 5LC1A 1SUIA 2YXDA 5JS6A 1YIDA 4TS1A 1YKSA 2ZYDA 3GRFA 3CVYA 3EMKA 2D8MA 4LI3X 3AR8A 3HN2A 1II8B 2AEJA 2AW3A 2ZREA 2VT7A 3C2QA 3DEYX 4ZP1A 1IG3A 3BE8A 1YRYE 2JEZA 3KB1A 4M88A 1X80A 1UIMA 4R8LA 5CB8A 1CJVC 1KC1A 1MB9A 1XVIA 2IHKA 4DIDA 1RYMA 4L51A 1N2JA 1PNQA 4AXBA 2CE7A 1NVEA 2QTBA 4KUGA 2E85A 1D5CA 3K35A 2J6CA 2QRVA 5EG5A 3WLSA 3QWAA 2DCUA 1G2PA 1KIAA 1E1DA 2CLSA 2CNBA 3O03A 1GQQA 3ORHA 1EA5A 4P4NA 2C3PA 1SUDA 2J6IA 4UUBA 1QC5A 3VSAA 1FW6A 4NCAA 4LJSA 3WMRA 1B4DA 4RD6A 2VK1A 3E0XA 4BQFA 3GW8A 1MAVA 1WUKS 4EQ6B 2IHNA 2WUVA 3UFBA 3LT5A 5B2FA 3DMDA 2Q6IA 5IT9A 1DEKA 4DQLA 2YUIA 3D5EA 4NIMA 1EVKA 4QGHA 1E7MA 2K5UA 3BICA 1NF3A 4L4XA 1U1EA 2QIPA 2JFXA 4JYBA 5F3DA 1LBTA 2VK8A 4FGUA 4JBNA 3OEHD 3KUKA 1TM7E 5EYPA 5EZ6B 2NU7A 2JFHA 3MWDB 3ONDA 4MV3A 5A62A 1M2JA 3SOPA 1Q3TA 3CLRC 3K1AA 4U4AA 1AB6A 4HGRA 2A9JA 1PR4A 1J0AA 3FJOA 3P96A 5DBEX 4X00A 5EJ9A 1RAHA 3RVOA 1JJ7A 2O8BA 1GOTA 4DCUA 3DZIA 4EFLA 4YRFA 1Z5UA 1ZJYA 3L82B 3ESRA 3AEZA 1MGOA 2JLCA 2ZJAA 1HDYA 2GZSA 3GFBA 1JDNA 3PHIA 1L5HB 3EIQA 4IDOA 3L8FA 4WOKA 2IX3A 2AOVA 4G9GA 3ON5A 1K63A 2FFHA 1JHVA 1CQXA 1NVXQ 4PLGA 3VPAA 4BRZA 2FLKA 2AUNA 1PG0A 1SKBA 5DNYB 4NR0A 1GM5A 2CHQA 4ZCQA 3ZI7A 3THXB 1E9BA 2J67A 4G1FA 4MRVA 1HURA 2GM4A 1NY5A 3AXTA 2VPYA 2CLMB 3HJHA 4I50F 1B00A 3TXAA 5AVXA 3BOSA 2HLNA 3JYQA 1LK7A 3F90A 1ZUNB 2GASA 3IA7A 3KSDO 3UG6A 5L53A 3KKKA 2CNKA 3PNVA 1HI9A 2MINA 2G9UA 2WJGA 2GN1A 2ZUDA 4UDYX 3RGWS 2GF9A 3IMCA 4WXRA 3U44B 1A8SA 1QFSA 2B5OA 2G5PA 1KSHA 3ZZMA 1BNCA 1W44A 1Y9AA 3IULA 3FNIA 3BXXA 3IUBA 1NUHA 3UB3A 1DZ3A 1FPMA 2OD9A 2RBEA 2B7CA 4FGSA 3ZJYA 4ALNA 3NNSA 3U4IA 4ESOA 5LKRA 2J87A 2N3ZA 2YFHA 1GEEA 2NZXA 4O5OA 1C7RA 4AQYB 3PS9A 3AB3A 1EU1A 1P5JA 2FDCA 4FJ0A 1Y7IA 2Q3BA 3UKDA 1JH9A 3F1KA 2NVOA 1Y7LA 3MTIA 1OFHA 1O8BA 2A35A 4WECA 4A5OA 1XMXA 4JR2A 2M98A 1ULBA 2ZB4A 3CGWA 5G53C 4CL0A 2KJQA 2WM3A 4PIPA 1JTEA 4PPGA 4P4SA 3KFXA 5ER6A 5F4ZA 5FTJA 3R7WA 1EYZA 3H2IA 4HGPA 1JSXA 1CZNA 1P77A 3G8YA 2GPAA 2VF8A 3BXFA 2JGDA 1QVRA 2BTEA 4L4SA 3RQIA 1SD5A 4KRFA 4XYEA 1JZQA 2R6JA 4QDZA 2R8BA 3AZPA 3KLNA 5A9RA 2N42A 3B1ZA 4PG7A 2BUCA 1QGZA 3NX4A 1GYQA 5FULA 2DECA 1BXRB 5BN5B 1NC3A 1OF1A 1W76A 3H0EA 3M81A 3ND9A 4LXTA 3CM0A 2DXIA 1U7XA 2OE2A 2VP2A 2VIIA 4DQUA 1SVWA 1TJ4A 3C41J 3HJTA 4JXXA 4AF6A 3Q8MA 1GTMA 2M1ZA 4AS1A 1O9GA 1KPHA 4FXPA 1T36A 4XUCA 4AVYA 3R9XB 2XCTB 1OV6A 3FDIA 3CCCA 1L5SA 1F17A 2P2CA 2XUDA 1MH9A 3WFIA 4N3AA 2A59A 5LD2C 1A88A 2NQ8A 1UKYA 2Y67A 4NBTA 1VHTA 3O47A 2X58A 3UK1A 3K71B 3EE6A 4EI9A 4K6KA 4QO8A 3T1YB 1H94A 1SCUA 2HTEA 2QENA 5DTMA 1Y3CE 4XQ0A 4AP9A 1FFSA 1HTTA 1G60A 5F9MA 4ZIRA 4RY9A 3HGTA 1WUJS 1YR7A 4C1BA 2UYYA 4HNHA 4RK7A 2NAPA 1U8CB 2Y0CA 4AZ0A 3CXRA 3DKRA 3IEPA 2HMVA 1F6BA 3IQWA 3ZWXA 2BI8A 4X8MA 2AG0A 1OLSB 1Y8CA 3QENA 3CVUA 4K1LA 4IV5A 1IWPB 1V8BA 2V7WA 1RYFA 3N8HA 4ZEMA 1MQSA 4YAKA 5C53B 3F3YA 4AD8A 3DTNA 4PX9A 3RPEA 1SQGA 4YRPA 3BMOB 3UC5A 2O7QA 4DGSA 1QLWA 5AP9A 4V0SA 1OH7A 4YR9A 1ZGCA 1PWYE 4TYQA 5I7EA 3GLHB 3B1FA 4QOFA 1RCFA 1M0WA 1Z6TA 1CY0A 3ZH2A 4ZN6A 4O3MA 1L4NA 3KYCA 1V8ZA 3TLBA 4P83A 3G9XA 1GSAA 1Z6GA 1U7DA 3X1JA 3PFGA 4GBED 3FPJA 1AVTA 2Z43A 3UMJA 1AKVA 1L8AA 4ZICA 1O96A 3GEPA 5IBCA 1V41E 2P67A 5TGZA 3SMQA 2H48A 3CWCA 1M76A 1XSEA 2OEPA 1H0RA 2HWUA 2Z2XA 3QE2A 1Z5OA 4HWGA 4K1XA 1MZPA 2REQA 3VAYA 4ER6A 1RAEA 4GP7A 3RABA 5KNBD 3I9V6 3IV6A 3WIDA 1A8HA 3RLFA 1T3SA 5TMDA 1ZZGA 3WGTA 4X1IA 5EOVA 2YJZA 4PNHA 1EJBA 2LCQA 1SVOA 5CYOA 4DLXA 5EIBC 5CFRA 1FVHA 3EZYA 3IUJA 4CIDA 1CUVA 3A6ZA 1PQ4A 4KPUA 3NHYA 4NMWA 3NOVA 4URZR 3GV0A 3LBIA 4INJA 4PAMA 2PSEA 5LUBA 3E7XA 5KX5A 3T0FA 1EX7A 3BXGA 4K8OA 3TDKA 1BGXT 5DNAA 1YI8A 4DSAA 4MVJP 2P6MA 3LP5A 1FLDA 4DANA 3CCBA 3RUPA 3UWDA 4FU0A 4EF5A 2PS1A 3PXBA 1NG9A 2Q9BA 3FCCA 5BXYA 1F51E 3WLTA 5K6RA 1QORA 4AK9A 2QW0X 3A9UA 1NRWA 3DUFA 2GBIA 2VF5X 1M6VA 2CBXA 2ZK7A 5CUQA 3NVMB 1V71A 4TS4A 2GCPA 1Z6AA 3KCQA 3W8EA 5H3LA 2NO9A 2NQTA 4QOGA 1QVWA 1E5LA 1MC5A 4EAQA 2GXUA 1TZMA 4O29A 2IS1A 1N7HA 3NI2A 1GFSA 4OOFA 2GUGA 5IK2A 1RPTA 3OF2A 4JWKA 4C04A 2P35A 3PJEA 5ALFA 2GYYA 4X3OA 2FKNA 3FIJA 4QNRA 1GGHA 3WKDA 1B6RA 2P1RA 3PB3A 3THYB 4S24A 2PQMA 3NIDB 3PUVA 2YWEA 4DFDA 2XAAA 2WJ6A 5EXDA 2WUFA 1H65A 4E88A 3N0XA 4YXFA 3AWDA 4KE6A 4OQDA 3U7QA 2AMJA 4BKQA 4DIBA 1T6BY 2IXFA 2WJYA 3QKRB 4RD2A 1JIVA 2F3TA 2G0TA 1HBJA 1DFGA 4U9UA 5CB4F 3I2YX 3KIPA 4JU9A 2OHOA 4MQ5A 3DFUA 2XSZD 3B3FA 4JGGA 1H8EA 3RRZA 4DC1A 1NT4A 3GJ3A 3TKAA 4D96A 4LOJA 1XNGA 3MW8A 1GTG1 1INLA 1TLTA 4QYWA 4YP9A 3WLNA 4INPA 2QV0A 3UMCA 4AYWA 5BNTA 4ACAA 1G42A 2OOSA 2C94A 2CL7X 3OCXA 3WWEA 1M74A 3M89A 1OHHA 3ZGNA 1ISHA 2ZRDA 5G3YA 3Q3VA 4X91A 2TMGA 5D86A 1M33A 1S5PA 1QGOA 3ROQA 4BKRA 5FUMA 2DLCX 5A4KA 4BP1A 4HQFA 3DDHA 2IP4A 2R87A 2FZWA 1OBFO 3FVTA 3L6EA 3M6UA 4R51A 4XIYA 2X0JA 1WMAA 3PFHA 1DXHA 4BNDB 4MROA 1ZK4A 1O2DA 2WE7A 2ZS9A 3A6LA 4OHVA 4R9UC 1LLQA 3N1UA 5J2UB 1W581 2QVCA 2QJOA 2DBZA 3I2IA 4ZKDA 3F8TA 1ZRHA 3O1LA 1X1BA 2H4FA 3DTVA 1IQPA 1AKQA 4RYDA 3WK5A 5CB0A 2FH5B 3K70D 3FUWA 2O8EA 3JQAD 4CR6A 4QUIA 3DDSA 3WICA 5FBHA 4E6EA 4ON9A 3PWKA 5JS8A 3DZ8A 4PZEA 4YP7A 3R7NA 1LS1A 3VR5D 4IIJB 1PFUA 4C6TA 5F98A 3N2KA 1EP1B 3GPIA 3DE5X 2BISA 2PWYA 4J16A 3RCBA 3N74A 1DKLA 1E98A 3GH1A 1RRVA 4FCWA 4Q34A 4RQAA 4FCTA 1QYDA 2V6FA 4Q48A 3ZXSA 4QXOA 2FP4A 2R6HA 3LFUA 5ITWA 2XKKA 1Q6YA 4ZQHA 2BH2A 5IT0A 4B3CA 1P61B 4FX5A 4EVSA 4LFCB 1HX7A 4LOHA 1FDTA 1CY2A 2MSNA 2NZUG 2HJRA 3BL8A 4QQ8A 2AI3A 4RVFA 5EZYF 5EFOA 1QH0A 4OBXA 4PLTA 3HP7A 1ZD3A 3KX2A 5F5XA 2XBUA 2FDRA 3ZUPA 3BIXA 4WNIA 1XHLA 3VX4A 3HHPA 1PFVA 3B9BA 3GYGA 2HLDD 2I9KA 1KZ4A 2TSYB 3TW0A 2G71A 1G5FA 1K86A 1IBSA 2DH6A 2NG1A 4ZVSA 2ZYHA 4I7EA 4NG5A 3OOWA 3SSNA 5BR8B 1Q7GA 2MT9A 4LRQA 1F2VA 1I5EA 2IUFA 2ZIFA 5J43A 2OHIA 4GPAA 1S2LA 2UXCB 1UMBB 1BU8A 2O7NA 3RBVA 1BQ3A 3G3EA 1OXKB 5EA2A 4K86A 3L0ZA 4UJ5A 1A5AB 5EE0A 2O06A 1PIWA 4Z1MD 1EJ6A 2CYBA 2QMUA 4F2WA 4JA2A 3UAZA 5IBQA 5HRAA 1SOWA 2AR7A 4JLJA 4HMQA 3CCFA 3HKEA 2CDBA 1G6HA 1TAHA 4PV7A 3HSYA 3SQMA 3WDMA 5E1DA 5FBWB 4D4KA 1HZZA 3GCWA 3NUGA 3MCVA 2DOKA 3P97A 4BUZA 2VHWA 4GOKA 3UCFA 5JXWA 4XI9A 1DS6A 3HJGA 4RZSA 1Q7CA 2KWIA 2C84A 3NO4A 1YK0A 4KG7A 4KXMA 3KQTA 2DEUA 2F3PA 1E5TA