3CO5A

Crystal structure of sigma-54 interaction domain of putative transcriptional response regulator from neisseria gonorrhoeae
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
136
structure length
134
Chain Sequence
GNSAAIQEMNREVEAAAKRTSPVFLTGEAGSPFETVARYFHKNGTPWVSPARVEYLIDMPMELLQKAEGGVLYVGDIAQYSRNIQTGITFIIGKAERCRVRVIASCSYAAGSDSCEEKLAGLFSESVVRIPPLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription regulator
molecule keywords Putative two-component system transcriptional response regul
publication title X-ray crystal structure of Sigma-54 interaction domain of putative transcriptional response regulator from Neisseria gonorrhoeae.
rcsb
source organism Neisseria gonorrhoeae
total genus 33
structure length 134
sequence length 136
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14532 Sigma54_activ_2 Sigma-54 interaction domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3co5A00
4RSGA 1PZNA 3TKLA 3U6BA 3Q7QA 2A7QA 4XD7A 3HU2A 1RPZA 5CK5A 2CHGA 3SJZA 3FMFA 1P3JA 2QGNA 2V6IA 1XMSA 2JGNA 2FSIA 2IUSA 5EE1A 2YOFA 5CITA 1XD8A 4F93B 2QPOA 4HAUA 4L4UA 5F3WB 1Z6XA 3QG5A 2FE4A 4O3MA 4CEJB 4Q7MB 3L0PA 3I8XA 2R6AA 2J0UB 3M0EA 1ODFA 4KBFA 3BB3A 1IN7A 1KOFA 2FZLA 3K0FA 1CF4A 2QE7D 4QOSA 1ZM9A 3AGQA 1W0JA 2OFOA 2OO7A 2IYRA 4MGKR 3IEVA 1VHLA 2PZFA 2XNSA 5E7JA 3CRRA 2O8DA 4YMSA 4DB2A 4V0KA 3GLIE 5BQ5A 4A0RA 1E9RA 2BDTA 2H16A 2KBFA 2WWHA 1G21E 1LB1B 2QSZA 5FTKA 4ACBA 4BUJA 3EWAA 5HE9A 1AS3A 3SC3A 5FUXA 1FNMA 2Q3HA 4WA7A 3GFPA 2R9VA 5D3MA 2Z6VA 4LYHA 1E2HA 1ZD8A 3SHFA 2CNWA 2WTUA 4D0NA 3A4LA 4BWYA 1E0SA 1P9RA 2NO6A 1G7SA 4H1UA 4TL6A 3SQWA 1KI7A 1O3YA 2IEZA 1XTKA 3PEVA 5FTLA 2G1JA 4YC7A 1LW7A 3PV0A 4JL5A 4ASUD 1Z5ZA 1N6HA 3R7WA 2WIAA 2OCAA 1I2MA 2QTFA 5HCNA 3TNFA 2FPLA 3GJ3A 1ZU4A 5HZKA 4K46A 4A92A 3U7FB 2AR7A 3LY5A 1CRPA 2B92A 2O8EB 2B21A 2VL7A 3AP1A 4JLVA 3NG1A 1M74A 1G19A 3ZGXA 1E9FA 1WRBA 3B82A 1UEJA 2C96A 2HXYA 3GJ7A 3L82B 1IM2A 1GTVA 1KI4A 2WKRA 4URZR 2ZI7A 4MRRA 1S3SA 1MRNA 1MABA 4NU0A 3HU3A 1D9XA 4RD3A 4LJ9A 2GJSA 2ZAOA 2FSGA 1VKJA 1F2TB 2ZJZA 5JI2E 2XAUA 3QXJA 2IS2A 3AV0B 4I1SA 1II8A 2ZRLA 2ASEA 3TQFA 4DBLC 2H7VA 1XDBA 1GSIA 1RRFA 1TQ2A 2QP4A 3QQ5A 2IXFA 3IIMA 6Q21A 2IYTA 3NVAA 3KKPA 5JWRA 4EPWA 4LBZA 1P73A 3U7EB 5FI0B 1XBTA 3MCAA 1XP8A 3TE6A 2ZE7A 4LJAA 3GLGA 3E2IA 2WMOB 5KNDA 1QG4A 1KTVA 1IQPA 3T1OA 3C5CA 1FOEB 4URWR 4DUGA 4DIDA 1RKBA 1N6NA 2OCYC 4HI0E 2QAGB 3B9QA 4DC9A 1AM4D 5G53C 4AYXA 4OQNA 3GFTA 1NY5A 1X86B 3K0AA 3LRPA 3MUFA 4Q1CA 2W2TA 1JEEA 2WKQA 2GXAA 1E96A 2HLDA 1KY3A 1FFHA 2P3SA 4OQFA 2XTNA 3Q85A 3UK6A 4QJ4A 2J0VA 1UBCA 2QENA 3CKLA 2IXEA 3B78A 4PC6A 1DAFA 3OE7D 2KSQA 4EFMA 1T0JB 1VMAA 1PLKA 3TAUA 3WHLA 3U4QB 5B64A 2C9OA 4I1UA 3A1TA 3AVTA 5FPYA 4LHVA 4DT1B 2QM8A 1F2UB 1G5RA 1E9CA 4HDQB 1OJLA 3PUZA 4RD2A 4DDUA 2P65A 1OW3B 4LZZA 4V0MA 5CDFA 3NXSA 5FL7A 1R5NA 1HE8B 2QMHA 3TIFA 5FR2A 4LRWA 1ESMA 3AP2A 5SZHB 4DSOA 5JBQA 1GZSA 2GAOA 3LW8A 4QBGB 2NO0A 1RJ9B 1R6BX 3CWZA 3FKSD 3K0EA 4PSAA 5K8TA 3UWOA 4URVR 1DO0A 4XVRA 3ADKA 2OBLA 5A0FA 2FGKA 4E09A 5J4YA 3B1VA 4MITA 3IIJA 1RRCA 5DE3A 2VSFA 4BGDA 3RS0A 2ZRAA 2FDCA 2DWQA 4A1FA 3NHBA 1OXSC 4OHWA 3CR7A 4HAWA 1GAJA 2NZ8A 1Q21A 2H8KA 1XU4A 4K8OA 2FFHA 1VG8A 1YRBA 2C5LA 1YR6A 4CVNA 3QPVA 4HAZA 4HLUC 1I4LD 8OHMA 4MA4A 3J81k 2NG1A 2YWHA 5DI3A 1RRPA 4F4CA 3EC2A 2NQ2C 4ZDWA 2HUPA 3VR3A 3N2EA 1BMFD 4C2UA 2ZU0C 4D81A 4Q9HA 3W3AA 3QKRA 1SXJD 4WVFA 5F2EA 5FI1B 1DAHA 2GZHA 2DPXA 3CX7A 1A2BA 4M8NE 1BS1A 1O87A 4Q9LA 3NH9A 4DLXA 3R8CA 1S0UA 1YZQA 1FZQA 5BN3A 4XD7D 2ZRGA 3A1VA 3NBYC 5FPSA 3Q8XB 1ZIPA 2PCJA 2ZJ2A 4FMDB 1RYHA 3VX3A 5L3SB 1G3RA 1MO4A 2BM0A 2WKPA 3P4YA 1AGPA 5J40A 1XJQA 2B7BA 3T5DA 3SBEA 4JLPA 2FU5C 2XZPA 1AIPA 3MLEA 4Q7KA 2ZJ5A 2O8CB 1FP7A 2C03A 3ZJYA 1JXOA 2J41A 3ZS8A 1W5SA 3T12A 3PIRA 3C41J 1W0JD 4UKDA 1KSFX 1XJ0A 4JVMA 4QNMA 4MRSA 1LNZA 4DLSA 3VAAA 5JJKA 1XX6A 3ND9A 1W36D 3HWSA 2RGXA 5E7MA 4LJ8A 4C0KA 2OCPA 1IY0A 4Z54A 5JCZA 4NE2A 3GLHE 3RNLA 1KJWA 1TMKA 2YV5A 1KY2A 4W5JA 2IWRA 1L8QA 3T15A 3VR1A 4B44A 1PV4A 3BFXA 4GFDA 4TYPA 4XSHA 3SYKA 1Z0AA 3K53A 4Q00A 3GLFA 3CO5A 2ZSDA 1ZC3A 2IHBA 4Q1EA 3VKGA 2C98A 2CNWD 2AHOA 5AUQA 4N1AA 1KI1A 2CL0X 3K8YA 5K8LA 121PA 2R8RA 2JIZA 1Q1EA 3GMTA 2CJWA 3H0KA 4MRNA 1OH8A 3V00A 3VR6A 4QL3A 3B85A 4I1OA 1WCV1 3RS4A 1JNYA 3G0HA 4QBHA 3RRMA 5H8WA 3P20A 1XNJA 1U8AA 1NJGA 4S35A 2E9SA 4AWXA 4TLBA 1Z6AA 3GJ5A 2ZYWX 4IJMA 4TLDA 2ZVPX 5KNCA 5AWFC 3LXXA 2FPKA 1T0HB 3EIHA 4BFWA 4A8JA 1A5TA 3KZ1E 2EFGA 4Q4HB 1P4SA 3W90A 2FH5B 4UXJA 3EZ2A 5CJ2A 1FMLA 2IYSA 2FG5A 1GL7A 1ZVQA 1GNPA 1KJYA 2CCJA 2DFKB 2FEOA 4MKHA 4JLKA 4Q1FA 1YZUA 4GT1A 3AVVA 4RD0A 1TEVA 1OYYA 2JASA 1E4VA 4ESHA 1TX4B 3F5FA 3AP3A 2CMKA 2GXQA 1QZXA 5C46F 4TSFA 1W2HA 3RS3A 3ZQ6A 2R6GA 1KAGA 2K5UA 4G5QA 4EJSA 2ZIAA 4DLVA 1N2CE 4JBYA 4IDPA 3H84A 1ZM2A 4M1SA 5KO2A 4Q1BA 2OILA 2BVNA 2OZEA 3Q7PA 1E1RD 3EZFA 4RFSB 2YYZA 3BH7A 4N0DA 3X1DA 5KYKA 4HUTA 3K70D 3U3MA 3VNUA 1SVSA 2OSBA 3B1XA 3UATA 3I5XA 4NZYA 1XD2A 2HLDD 3AUYA 1P60A 1D5CA 1KKLA 2QMEA 4GOKA 1S96A 2W58A 3MFYA 2WV9A 3TMKA 5DI9A 5HKKD 1CR4A 3ZD7A 2GBLC 3MWKA 2HJVA 5C4MA 4OQLA 2J59A 2PX3A 2QAGC 4Q1AA 4R2IA 3SJBA 1IBRA 4IFEA 1E79D 2ZRCA 3LQQA 4BFTA 5FBRB 3X1WA 1XTIA 4EPXA 1KO5A 1NJFA 4TT3A 2GVZC 4PR0A 1US8B 3ZIAA 1E1QA 2VO1A 1J8YF 3BC1A 3ZVRA 2GF0A 4DIEA 1UADA 2AXPA 4D0GA 1E2PA 2QPAA 3RS7A 2H18A 2V54A 1AN0A 2GXSA 3QF4B 1NL3A 1CJVC 1Z6GA 1JR3A 3NHAA 4ACAA 4GP6A 2ZRIA 3VFDA 5TVKA 2P67A 3B5JA 2F1IA 2EW1A 1ZP6A 4PSKA 3EAQA 4DLUA 1ZM4A 2D2EA 3EZ6A 2FOLA 3KXLA 1UKYA 2OAQ1 1W46A 1D6JA 4HLQB 3KTAA 2JLZA 4XWKA 3G5UA 4LV6A 3SYLA 4HB3A 3REGA 4Q48A 1NVVQ 2GK6A 3LVQE 4BASA 4B43A 1YU9A 1GKIA 1AZTA 4MUAA 4UJ3A 4LBWA 4LV5B 4RVCA 5DHFA 4AYTA 2QSYA 2QI9C 521PA 3DMNA 4MYCA 3FB4A 1NN3A 1GITA 2CE7A 2ZUCA 3C5HA 4L9SA 2GK7A 4KSCA 1KI8A 1XZPA 2HCBA 2RHDA 4Q19A 3QJYA 3NEJA 1WA5A 4LYAA 2CEAA 2F9LA 1NLYA 2XSZA 4QM7A 2J45A 3Q5DA 5EZ6B 4IVRA 4DZZA 3AQ4A 3VKHA 5J47A 4PFSA 3DEFA 2ZPTX 1GOTA 3N70A 3PEWA 4NPHA 1XD9A 1S2MA 2GZAA 2JLRA 5JWOA 2IYVA 3GFOA 4GOXA 3KQHA 2D74A 5L3QB 4D4MA 1YR8A 3K0CA 3BIFA 3LW7A 4AYWA 2C9YA 2FFAA 2RGGA 4IOJA 1Z22A 2V7QD 3OEHA 3WYGA 4IXNA 4AI6A 4Q01A 3VU9B 3U2QA 2B8TA 4TL7A 2CBZA 5FBLB 1OHHD 5FUWA 3FFAA 221PA 3THWB 3UXMA 1JJ7A 3A6PC 3F0TA 5CLQA 4ARZA 4TZ6A 1U8YA 2ORIA 4A82A 2KI5A 4A2QA 2IF2A 2PX0A 2PT7A 3ASZA 4LY6A 4KAXA 2IEYA 4JSYA 4TTRA 3IIKA 2XB4A 2IS4A 3TSOA 5BYKA 1U81A 4MYUA 1J7KA 3CNLA 4PHGA 4Q9KA 2QZ4A 3C14C 3ZZUA 5GADl 4PPGA 1P62B 3LBNA 2HCJB 1UAAA 3E70C 1Z0DA 2WWWA 4X8MA 5FBVB 1X1SA 2BKUA 3DL0A 1D2EA 3MRSA 4LOAA 1OB5A 4UNRA 3K0FB 3RAPR 3BFKA 4ZDJA 2WWGA 2G83A 2VP0A 2ZE5A 1DAIA 2ZREA 4L9WA 2IYYA 2O0HA 1P2SA 4C4PA 4JZKA 5TARA 3QXCA 4QC2A 2O8DB 3NKVA 1Q3HA 3E1SA 2ZRDA 2V9PA 1JAHA 5DIFA 3OFNA 4I99A 1MRSA 2FFBA 1HURA 2W0MA 5CM8B 2F9MA 1FUUA 3PCRB 1XZQA 4NONA 1XCMA 3RABA 4DVGA 2IA5A 4AG6A 1E9DA 3CZQA 2HF9A 2QTVB 5D3MB 3QF7A 1EFRD 3PG5A 2ZR9A 1H65A 1CS4C 3M1IA 5JHHB 4CW7A 5FBWB 2GNOA 1D8TA 2OG2A 4YLGA 1MOZA 1DAEA 3KKNA 4DB4A 1VCNA 1XF9A 4FD2A 4Q21A 3I72A 1NIJA 1N5KA 1X8JA 1GIAA 1CIPA 1Z0IA 3JZMA 1ZAKA 2QRNA 1US8A 4TSFD 2J1LA 1BKDR 3TUZC 4JYCA 3QVVA 3R7WB 2A2ZA 2ZI4A 4B3DA 1N5IA 1R0XA 4NTZA 3ONWA 1DBSA 4A9AA 4HB2A 5HTKA 1IY2A 1KI9A 4C0AC 4GMXA 3B1WA 1JQLB 3IO3A 3SR0A 4JL6A 1VYTA 2Z4RA 3CW2A 2JATA 2HEIA 1G4UR 1OH5A 2F1RA 4EPVA 4CEIA 4NKRA 1OYWA 5KHOC 3WMFA 1N3BA 2ZUBA 4U02A 1NMYA 2IS6A 4H9GA 3R9WA 1YVDA 2X1VA 1MABB 1GKYA 2QEQA 2I1QA 1GNQA 2FFQA 3EA0A 3IUYA 1YE8A 2GESA 3D31A 4HYYA 3NTUA 2N1BA 2ZJAA 3CBQA 3HP1A 1II8B 2UKDA 2YC2C 3WNBA 3A4NA 4IFBA 1G8PA 4ZPXA 2JCSA 2GCOA 4OJQA 1YZLA 5DYIA 1SVIA 4TYNA 2C95A 1JXMA 3B7GA 1CR1A 4M1OA 2QUZA 4DLZA 4HZUA 2G1KA 3K9GA 2WAYA 1HYQA 1OXVA 3NIBA 4PHFA 3GLGB 3IBYA 1ZCAA 3BS4A 2B6HA 3WRXC 4ZI2A 4KO8A 1SKQA 3KB2A 3K0AB 1JR3D 4JVLA 4LJYA 3CRVA 4AC9A 1G8FA 1LTQA 2ZI9A 1JECA 4MRVA 2MSCB 1N6OA 2ZRPA 5F9FA 1VDZA 4ILEA 3TW8B 4KXFB 4C30A 1G41A 1NBMD 3L0IB 1Q57A 2EVWX 1E9BA 4FMCF 4LC0A 5B2ZA 1Q1ZA 4B2LA 3VNVA 4DXAA 1J70A 2ODEA 5LBIA 1A2KC 1W0KD 4UXHA 2BOVA 1ZMXA 1DAMA 2IHYA 3L0SA 2OM2A 1A1VA 2Q0HA 2BV3A 2DR3A 4ZIRA 1CJKC 4JLMA 2DFNA 1W5TA 2ZANA 2GCPA 4DWJA 2WJYA 4QJ3A 3NDPA 5FPHA 1YQTA 1B23P 4V0OA 2XSZD 2WICA 4M1YA 3N5CA 4A8JC 1U0JA 5SZIA 3TLXA 1E6CA 1II0A 1AK2A 4QBIA 4HAXA 2P6RA 3QPUA 4AD8A 1N6RA 3A1UA 4GI7A 2V4ZA 2WVJA 4DSUA 1F6BA 4QKQA 1FX0A 2NO1A 1RVDA 3MAAC 4OL0A 3FE2A 1PVOA 2W6IA 3RSLA 3GQBA 1KMHA 1D9ZA 2NMVA 1H8ED 2NPIA 1U2RA 2BCGY 4BECA 2IYXA 4KBGA 4A36A 4KCGA 1LY1A 2OBNA 2Z83A 4Q18A 4LPSA 1RIFA 4U5XA 5JRZA 1RE0A 3FFBA 4NYMQ 1T5LA 4RJLA 3BB1A 3QEOA 4KLNA 2IF0A 3SQXA 4HB0A 3MJRA 2ORVA 5JECA 4MRPA 3NDBB 5DI3B 3GP8A 5JJIA 1NLFA 1A82A 4OKSA 4OHXA 5FOVA 1XTJA 5DISB 3BWDD 3QKRB 5H70A 1E99A 5EP3A 5KU1A 4FW9A 1KDRA 3SOPA 5GVRA 1M8PA 2JLVA 4PPFA 4YMTA 1G7TA 3PEYA 4KI0A 4JIMA 4HB4A 3K9NA 2A5FA 1OT3A 2N42A 3GEEA 5TMPA 1U94A 1P5ZB 3H4MA 2TMKA 4Z1MA 1FL9A 2ODNA 5FTNA 5DNYB 2D3WA 3OEEA 3JZAA 2ZSAA 5TV2A 2DFLA 4CDGA 3SE0A 3VTKA 4CYMA 3QG1A 3AVQA 4R71A 1NSFA 5AUPB 2EQBA 4B2PA 3OFND 5B57C 2UVQA 5EE5B 4JJZA 1QRAA 2OXCA 1ZD9A 5IRCD 4PC7A 2WIBA 4ITRC 4QBFA 4JT2A 3S1AA 2ZJBA 3GLFB 4A2PA 1GNRA 3K9HA 2CL6X 421PA 4A2WA 2B7CA 4P3YA 1OF1A 1UKEA 1YZTA 4ZCLA 3ZVMA 2A3RA 1JPJA 3KUDA 4Q7JB 4HDCA 1Z0FA 2A5GA 1E2LA 2C04A 1C9KA 1OKKA 2CJWB 1BOFA 4P32A 3WNCA 1WB9A 3O8BA 4GRAA 5D3QA 4LJ6A 5GJBA 4Y0VA 1W4BA 3WXMA 1TL7C 4B3FX 3IPYA 5CLLA 4MDFA 4DDVA 4AKHA 2D7CA 2J7PA 3FGNA 1U9IA 3FKQA 4B3GA 1SXJE 3KQKA 3RSOA 4A8JB 4DRZA 1N0UA 1R8SA 2AFIE 3CPHA 5DO9A 3DOFA 2BMFA 4IDHA 4US0R 3DO6A 1G8YA 4LUCA 1ZM3A 2ATXA 2WWXA 5E3HA 4LYJA 4B6FA 1A4RA 4U7DA 2YJTD 2WOOA 2X2EA 5IF9A 3T06B 2ATVA 3ZVLA 1OE0A 2QAJA 3IQXA 3OF5A 1EGAA 3ZZTA 5EXPA 3X1YA 2X77A 3AF4A 3QY0A 1FPMA 1CLUA 4B71A 2FF7A 2AL7A 2IC5A 3GJ0A 2ZYUX 2AWOA 3B2EA 4LSGA 1M7GA 3LX5A 1N5LA 3GLHA 2IYUA 3A36A 1PUIA 2YZ2A 1VCMA 4CT4B 2VP2A 2VSXA 4DLTA 4F4IA 3UPUA 4G0NA 4WZBE 4EJSB 4D26A 1AA9A 3EPHA 1HH4A 1YR7A 3QUSA 3K0CC 1N6LA 1ZCBA 4RCYA 4JKYA 2H17A 1KJZA 1WDTA 1TQDA 4PO8A 2GKSA 4B35A 4NH0A 1H8HA 2C2HA 3B9PA 5K8UA 2YKGA 2H1LA 1NVVR 4RY2A 4LJ4A 3SEAA 1XD2B 1XTSA 1TNDA 1GM5A 1G3QA 4Q4AA 4BLPA 5FUYA 2WSSA 2IK8A 4ZDIA 3CB4A 1NN1A 1S1MA 4D0LB 2NGRA 5FTMA 3VKWA 4KVGA 1DTSA 5FOUA 4F91B 4IVPA 4CIDA 1KHTA 5DHAA 1X1RA 1ETUA 3DKPA 4C0QC 4TQUS 4UNNA 1FUKA 3AVPA 5KUTA 1DO2A 2XOKA 2H92A 4RD6A 4UXIA 1Z63A 1T6NA 1CR0A 2CE2X 2MMCA 2VHQA 1X6VA 3BORA 1K5DA 2LWIA 2GJKA 3QVUA 1M1YE 4C0SA 3I1FA 1SVKA 4HEJA 3X2SA 4P4SA 4RFVA 2Q21A 3A8TA 1GG2A 3SZRA 1K8RA 1T5IA 3B6EA 4FIDA 1RC8A 3SYNA 2ZR7A 2W00A 1KZ7B 1CR2A 1DG3A 1E2DA 2RGNA 3BGWA 3F8TA 3FMPB 4NYJQ 4PTLA 1CBUA 4HUQA 4QFMA 5EUMA 4PSVA 3IQWA 4II7A 2I4IA 3KKOA 2C77A 3OIWA 1UJ2A 2W6ID 1Q12A 3KTAB 5ELXA 3BXZA 2ERYA 1BYUA 3BOSA 2VP4A 2GEVA 2QORA 3W34A 2WWYA 2BHRA 1YHNA 5JJLA 4AKGA 3LWNA 2J0SA 4KFSA 1R0WA 2R2AA 2ZROA 4NCHA 2J7KA 4PPQA 2IBMA 1WBDA 3WP0A 2V1UA 1IONA 4G5OA 4WXPA 3W9YA 5BXQC 4GP7A 4TYWA 1QHSA 2G3YA 3X1ZA 1I2DA 3RVBA 3D6TB 3UKDA 4QGFA 1W4CA 4BFUA 3R9XA 2AD5A 1VTKA 4JBXA 1E4YA 1M34E 2AWNA 4ESVA 2QTHA 4MUBA 2ZRFA 1T91A 2GILA 2J87A 1Q3TA 1KI6A 2WOJA 1EFHA 3N2IA 5KDOA 5A4JA 3R8FA 2BBWA 2NIPA 3SHWA 4UQOA 3FOZA 2XJ9A 1XEXA 2VSOA 2X19A 1UKVY 2EYQA 1ZM7A 4FMDF 4GOJA 5EE9A 4Z1MD 1MR3F 4V0ME 5CDFE 1F48A 1OB2A 1U0LA 1U0HC 1U98A 4CT5A 5J5CA 3BRWD 3NBZC 1FTNA 3DKVA 1E0JA 2VBCA 4D2IA 2BBSA 3OEED 1OFTA 2CHVA 1KO4A 4M1MA 4TMKA 2GZDA 4TLCA 5BN5A 3FWYA 4LCBA 3F3YA 4ZDKA 2AKYA 4TMVA 2CK3A 1NKTA 1JBKA 3U44A 4JMPA 4EPYA 3V4RA 4OHYA 2JDIA 1QHNA 3KFVA 4TN1A 1G3UA 2V55B 1VECA 2WWFA 4ARZB 3K09A 3LO5A 4PAMA 2DY1A 2ZS8A 3VR5A 4BFYA 2IYLD 1G20E 4B3BA 3DPUA 4W5WA 2ZM5A 1YR9A 3QPWA 5HE8A 3ZLJA 4DSNA 1N6KA 3NC0C 1C1YA 2C8VA 4GZLA 4EFNA 2VYFA 4X8HA 1ELOA 1SVLA 2NO9A 1BH2A 1OKKD 1T8TA 3KKQA 1EX6A 2WM9B 2CLCX 5C2JB 4XJXA 3CWQA 3CH5A 3EPJA 2GA8A 4M9QA 4KYIB 1UPTA 2AFHE 2PT5A 2RH5A 1E9EA 2QNRA 4W5HA 1OPXA 4RZXA 4DUGD 1W2GA 2BM1A 4PO1A 2J7PD 2GEUA 5FR1A 1MO6A 3PQCA 3CF6R 5KPDA 3OAAA 3QXXA 1G64A 2D06A 3RRZA 1NSTA 4KFTA 1RYFA 1GVNB 3IILA 3UIEA 2V3CC 2GVDC 2ODWA 2OESA 2BJVA 3QNUA 5C4GB 4DCNA 4IDQA 5FTJA 3I8SA 4R9UC 2Z5FA 2XTMA 5KOYA 5EZ5A 1X8LA 4B3XA 4YDHB 4PO9A 3BERA 1OSNA 3PUXA 1XEFA 4GNKA 1DEKA 1UDXA 1QVRA 1I4TD 1ZNZA 1QVAA 2FN4A 1N25A 3UMFA 4F38A 3OIYA 3ZDQA 3THXA 2JLQA 5TXGA 2OLJA 3CX6A 2IUUA 1ZINA 3TJZA 5E7IA 5FL7D 5DN6D 4Q4LA 2ONJA 1T3LA 4YXWA 4MH0R 4LHZA 1XXHA 5BW8A 2G6BA 3AF2A 1TPZA 4JKIA 4NYIQ 1G291 1IY1A 3WP1B 3LLMA 5KNBA 1VCOA 2EU8A 1WQ1R 4FCVA 5FH9A 4BFSA 4CEIB 4RZ2A 3ADBA 5CYPA 3RRYA 1WXQA 4R2HA 3L0OA 1W4AA 2CXXA 1HT1E 3HYTA 1YRAA 2P6NA 2D7DA 2XGJA 1DVRA 3ETLA 5HCIA 2VRWA 1GDDA 3EA5A 3THOA 2R6CA 2WSSD 3WYFA 4B2IA 1TTTA 2GJAA 4QGHA 1G8HA 2P2LA 2V8OA 1C4OA 2BMJA 2IUTA 3LLUA 4O2RA 2QA5A 2XXAA 5BWMA 1AZSC 4F4JA 1QHHA 3ZZ0A 3OZXA 1K5GA 5AUOB 1MO5A 2ZXUA 2GCOB 2XNDA 2Q9BA 2QQ0A 4DLRA 1T4GA 2OCBA 2ONKA 2XEXA 2YOHA 1IXRC 3QKSA 1OFUX 1UM8A 3LAWA 3AKEA 2DHRA 1YJ5A 1DPFA 2QMUA 4IRUB 4KVAA 1UEIA 1VG0B 4TMXA 1NMXA 2YWEA 4A0GA 3THYA 1NRJB 3QKTA 4HZUB 5G3YA 2VPPA 1EXMA 1U90A 4QG7A 4EKDA 2JLSA 4NBSA 3W6PA 3X1XA 5JI3E 4P33A 1HUQA 3UG7A 3SFZA 2ZS9A 4TLEA 2Y8EA 4XWAA 1TUIA 3K9LA 4OK6A 4C0BA 3NBFA 4NMMA 721PA 2B8WA 1IN4A 4C0LA 3VX4A 3SBDA 3FMIA 5C18A 4BLQA 2IT1A 1J99A 1ESNA 2FSFA 3BK7A 2Q6TA 4FN5A 2VEDA 4NYMR 2YWGA 4AKEA 1Z08A 4DLWA 4L16A 1P2VA 3T34A 3SI7A 4P31A 1W44A 1R8QA 1HE1C 3QXHA 2WBLC 3EARA 4NP6A 4OQXA 3PFIA 2FNAA 5JS7A 1WE2A 1F5NA 2ZS7A 3TSZA 3AKDA 1EFUA 4O25A 1X8KA 5EUQB 1VYVA 1PUJA 4ON9A 2ZRBA 2YC4C 4ZIRB 4EQ6A 4A15A 2F1JA 3A4MA 2CCKA 3ZYCA 2F43A 3TK1A 3LX8A 4L5BA 3I32A 1E0KA 4NCIA 3AH8A 2QE7A 1RRGA 1U8ZA 4FWTA 1U9IC 3HJNA 4XVQA 4IEEA 5CJPA 1W7AA 2A9KA 2IL1A 5AJZA 2RB4A 1EG7A 1MKYA 4IXMA 1KK3A 2JIZD 1W1WA 4N3NA 2EFDB 1FX0B 1KO8A 3CRW1 4B34A 2UZ3A 2QY9A 4QXAA 1HV8A 2FMXA 2JLUA 2F7SA 2EWVA 2XJ4A 2JEOA 4B33A 2O8BA 1KMHB 1LFDB 1TU3A 1KDOA 1E9AA 3I61A 1KIMA 4D25A 4ZKEA 4F92B 1Z47A 1T9HA 3TUJC 1E98A 2AN9A 3GJ4A 3JVVA 2BKEA 5FOSA 1IXSB 1KZGB 4Y0AA 1P9NA 1U99A 5BYJA 1E2QA 1JR3E 5FPKA 4JL8A 2XZOA 4PXAA 5G3ZA 1ONBA 1NF3A 4ASUA 4EUNA 2PMKA 3KKMA 1MO3A 4DJTA 3KJGA 1DAGA 1NVUQ 5TB5A 1XWIA 4HAVA 2Z0MA 4FCTA 3W5JA 1TUEA 2R44A 1NBME 1FQJA 2ZJYA 1Z3IX 2BBOA 2LKCA 1AKEA 3MWJA 3PJRA 5EXXA 4ZV4A 5C1BA 5DN6A 3P27A 1E2IA 5AJWA 5KSZA 4B74A 1I4DD 1NVXQ 1G5TA 3D3QA 1GWNA 2QP9X 4D4JA 2JJ2A 2FGJA 2H57A 2GRJA 3L43A 1XPOA 2NZJA 2VA8A 2MSEB 3SJAA 2GJ8A 2E87A 2JLYA 2GCNA 3LD9A 4JJKA 3PITA 4RKEA 3HYRA 3O8DA 3BB4A 3U60B 1Q22A 4D4KA 4JLAA 2ZUDA 5IK2A 3IO5A 2PZGA 4JVSB 3OAAD 2XTZA 1YZKA 2JAQA 3MGCA 4IHQA 3EG5A 3B13B 2PZEA 3BJIC 4A6XA 1Z0KA 2CHQA 2HV8A 2VTKA 3IEUA 3S1AB 1DE0A 2P5TB 2OLKA 3EW9A 4M4SA 4TL9A 2DYKA 3B8HA 5CIQA 3VMFA 4PQYA 4BEJA 3GLIA 3P26A 1KSHA 4DEYA 4MGIR 3DM5A 1PLLA 1NMZA 1JEDA 2DWPA 2FX3A 2RGNC 4BLSA 1II9A 4C2TA 1NY6A 4TT3D 4M2LA 2DCUA 3ZIAD 1E1QD 3MG9A 4TLAA 2D2FA 4WXRA 4QNRA 5G40A 3VR4A 5IHPA 2GXUA 1T8UA 2QU8A 1SGWA 4XOIA 2BCJQ 4YXWD 1E9SA 3QBVA 4AY2A 2VP5A 3W5IA 1S9DA 1XTRA 3EIQA 1OLOA 2FA9A 4LHWA 3SFVA 1KKMA 2F3RA 2QBYA 3I62A 1EFCA 1RFLA 1YZNA 2FWRA 4EPTA 4D80A 4Z8YA 4OK3A 3W8RA 3A1SA 2WAXA 3CRQA 2NPFA 3R20A 2ZSEA 2ZRJA 1TF5A 3GEIA 3LH5A 3I92A 3AKYA 4ABYA 5JEEA 4PZLA 1G8GA 2ZETA 3DZDA 3QIAA 2NTYC 2BJWA 1N0WA 3TSWA 2PH1A 4V03A 3HPRA 4JT4A 4RZ3A 5JS8A 4OI0A 4S2EA 4TYYA 5F9HA 1ZIOA 3Q9LA 4MGYR 3GLHB 1XCPA 1ZBDA 2ZJ8A 3QEJA 1EESA 1ZRHA 2PLRA 5FOTA 2YINC 3CNOA 4BQSA 4PAOA 4JLOA 1G18A 1TQ4A 4C7OA 5EP4A 1ZNWA 1JPNA 3WRYC 2ZITA 2DWOA 1Q44A 2HYIC 5CYOA 2XB2A 2R65A 4CGZA 4FMBB 3GJ8A 1KI3A 1OH6A 2ERXA 4TMWA 2ORWA 3KL4A 3NWJA 4UJ5A 5FBQB 3D8BA 3HR8A 4JLJA 1UDWA 1ZC4A 2YOGA 3IGFA 3U3RA 2I3BA 3E5HA 4NDZA 4Q4AB 3AVUA 5EXTA 1R5OA 1IOZA 2N46A 3JVUA 3CRMA 1D2NA 1QF9A 2O8FA 3K09C 1SXJA 2GF9A 1Z07A 1SKYB 2XITA 2Z43A 3R9IA 4CF7A 2OT3B 4NCNA 4HLDA 4X8OA 4BLTA 1L7VC 1IJFA 3EZ9A 4B47A 3OEHD 3CUEF 2FSHA 1R7RA 2G0TA 3ASYA 2DFTA 2G88A 4EJSC 3TBKA 1FMJA 1SQ5A 4DDWA 5J4LA 3TGPA 3EXAA 3D7MA 3EIEA 4MKGA 1HQYE 1Z8FA 5FFMA 4C0JA 4B3CA 1XMJA 4LI0A 2AX4A 4RKFA 2QRZA 3RC8A 4P4SB 4UNQA 2J9RA 1AQUA 4O2LA 2P0EA 4QGGA 2YWFA 3ZH9B 1P61B 1QHGA 3OIVA 4HUQB 4O0MA 2BMDA 3EPKA 4BEBA 1YZGA 2PBRA 4FCWA 5AJXA 2REBA 3L8ZA 3MJHA 1KO7A 3GEHA 1M7HA 3Q5EA 5B30A 3LVRE 1JR6A 5JWHA 2JLWA 4JLBA 3AB3A 2ZVQX 5DYGA 3CNNA 1VHTA 3C4JA 4M21A 3AGPA 3EWSA 3CF2A 1COWA 4KV9A 4OHZA 5DGXA 4TMZA 5CB8A 4JSTA 5KDDA 5JSZA 1E2GA 4RZUA 4Q9IA 3AF0A 2ANBA 5JZVA 4FWIB 4TL8A 4PC2A 2J46A 1LF0A 1TU4A 5AJVB 3CPEA 3K1JA 3NBXX 5E4FA 2PCLA 3AVOA 4GZMA 2A5YB 1Z6YA 3EASA 5JMTA 4IDNA 4PZYA 4ERNA 3OESA 1HT2E 4LC1A 1E32A 1VG9B 2F6RA 4BZQA 2YHSA 2GAAA 2VF8A 4KFRA 4W7SA 2D62A 4M9XA 1KI6B 1MT0A 2GEDA 2FV8A 4Q7LA 5E95A 1SHZA 2RAPA 5IDVA 3AF1A 1G9XA 1SULA 2Q9CA 2R6FA 2ZRHA 1LVGA 2CLSA 4LBYA 3WYAA 2CL7X 5IT5A 2JJ8A 1R2QA 1XEXB 1D2MA 4Q4JA 2W83A 1ANKA 3ADDA 2CVFA 2REXB 2JJ2D 3DHWC 4MKFA 2KJQA 3K0SA 1S1CA 3T1QA 3VHXA 3LBIA 5AK0A 2VH5R 3DVLA 1RZ3A 2X2FA 4DEXA 2Q3MA 2ANCA 2ECKA 2KWIA 3RDPA 1TAGA 4EAQA 3AKCA 3KXIA 4D6PA 1P2UA 4GDFA 3BD9A 4JVNA 5TDHA 2FJUA 4TMTA 4Q9JA 1E3MA 4E07A 3KUCA 3QKUA 4XSGA 2VQSA 2IS1A 5IK2D 5EE3A 3TVDA 1Y63A 2QMOA 2ZU6A 4KYUA 4QHSA 3U3JA 3U44B 1QHIA 3U7HB 4MDEA 4BRUA 1E94E 3U7GA 4DCUA 4NCKA 2AK3A 4GSYA 3DZ8A 4KSBA 3V4FA 1NN0A 4UNPA 4Q66C 3UMRA 2QPTA 4ZCIA 1NKSA 1E1RA 2WJJA 1R0ZA 3NH6A 4IW3B 5FOWA 3WMEA 1NVWQ 4AKIA 4A0HA 5H1YA 3MWLA 4OQMA 3RYTC 2A30A 2BWJA 4NHOA 1E2FA 1Z83A 4HZIA 3I73A 3IPXA 5JCPA 4NYIR 3EX7C 2RGDA 2OV2A 1NG9A 5JEDA 1S3GA 5HKKA 4NL4H 5SZJA 1G16A 1KDTA 4MGZR 2JJ1A 4NCJA 3KJIA 3M6AA 2A5JA 3RANA 2ZSFA 1E79A 5DH9A 3H2YA 5JRJA 3SJCA 3Q72A 1KK1A 2WSMA 3EPLA 1Z0JA 2R6DA 1IAQA 3RS2A 2G77B 3BH0A 3KXKA 2O0JA 2GWHA 4V0LA 1TADA 5CIWA 4G5GA 4G5SA 4CEHA 1CP2A 2YVUA 2OUKA 4ZCMA 4XWOA 2VHJA 3AVXA 3BFVA 4X8LA 4TZ0A 2EWWA 4MKIA 1KGDA 1P9WA 1R4AA 1OXTA 3T1VA 4EFLA 3KQUA 2P6UA 2HJGA 2VLIA 3TUIC 4LWZA 4B6EA 2QG6A 5AUNB 1KNXA 3TW4A 2OFWA 2MSDB 4LHXA 2P5SA 1G4AE 2WWIA 3BBPA 1IN6A 5L3RA 1P72A 1N6IA 3TAHA 3THXB 1R0YA 4OJKA 4CEJA 2I1VB 2J0UA 3NC1C 1G7RA 3KDSE 1XXHB 4POAA 4URXR 1ZYUA 3HU1A 1N5JA 3C8UA 3KJHA 5G41A 3TVTA 2ZSBA 3QE0A 1AQYA 1QG2A 4YONB 4BRWA 5KDLA 1QDEA 3LXRA 4MYHA 4E22A 4IDOA 1DELA 5GJVC 4HDOB 3T61A 5CB6A 5P21A 2AXNA 1FTSA 2WJIA 4Z51A 5AR1A 1A7JA 4KODA 4YDSA 1SVMA 1UBEA 4DCSA 5LPNA 1L4YA 5GVSA 1WP9A 1VIAA 1JALA 2XXAB 4M9ZA 3UWKA 1EK0A 4ZO4A 1QHHB 3SU8A 3O47A 3WHKA 3GLGE 4B73A 3UG6A 5JFGA 3GCGA 2JA1A 2IW3A 4BFVA 3FPAA 2G9NA 3VQTA 2RMKA 1KAOA 1NI3A 3QKSB 4IOKA 2BMEA 2OFXA 2V1XA 1TQ6A 3THYB 2OE2A 3UMSA 5FPTA 5M04A 1K6MA 1NP6A 3CF0A 2ZI5A 3P1JA 1BO6A 1LS1A 4P4UA 2ZYTX 4TQ9A 1OFHA 1Z28A 3RWMB 2V7QA 3I3SR 4U00A 1XPRA 2O8EA 1Z29A 4B75A 1QHYA 4PHHA 5EXSA 5J4VA 5J4KA 1OHHA 4PHTA 3LNCA 3MSXA 3CLVA 5LD2C 3PEUA 3GPLA 4I1VA 4M1WA 3LV8A 3B1YA 4V0NA 1Y3AA 3RC3A 1DOAA 4BPBA 1F2TA 1GUAA 4KFUA 4A0FA 1KO1A 2VHUA 5CM9C 4J0QA 5LB2A 3ZVNA 4KU4A 2ZRNA 1ZNXA 1G6HA 3WBKA 1R10A 2VP9A 4I81A 4JS0A 1Q1BA 3PR1A 3SDZA 1COWD 1EX7A 3C15C 3U3OA 4PPNA 4QHYA 4EQ6B 2BBTA 4CRWB 3KQNA 1AS2A 5AJYA 1DAKA 5L8VA 2F43B 3LDAA 2IX3A 1E2JA 2QN6A 2F55A 3QOFA 3T1TA 4Q03A 2YNMA 2WJVA 2W6JA 3IHWA 2RKOA 2QAGA 4GPTA 2OAP1 4IEIA 2CCGA 1SKYE 3AEZA 3EZ7A 1LF5A 5EP1A 2QQEA 1W48A 2J3EA 2ZJOA 4G3XA 1WMSA 4IOMA 1ZU5A 2ZI3A 3FDIA 2QP3A 1V43A 1XPUA 1HTWA 4OI1A 2GJ9A 3H1TA 2O8BB 1KK0A 4B48A 4MQBA 4DCTA 1EFRA 3TH5A 1MH1A 2ZE8A 5KSOA 3ECCA 4JLDA 1IN8A 1CXZA 4L8GA 3UANA 3O8CA 3KX2A 3U5ZB 4KLZA 3U3KA 3U4QA 2C9CA 1OV4A 4DLYA 3I4LA 5TY0A 4AURA 3U6KA 2BEJA 5KSPA 4DT1A 1CEEA 1CJMA 4JYBA 1F2UA 2VHCA 2EFEB 1GRQA 2NO7A 1EWRA 5KTYA 1J8MF 2Q3FA 2FEMA 2V6JA 1Z06A 1OFIA 4BFZA 5EP2A 1E69A 1CU1A 2WPDA 4HATA 1OIWA 1G3MA 2RGAA 3IBGA 1S8FA 3FHOA 1SHKA 2PEYA 4LHYA 3QENA 1S4QA 1HQCA 1RJ9A 1MV5A 4TYQA 1TEXA 4EPRA 3CH4B 821PA 1G3IA 3AM1A 1J2JA 1N0VC 1E0AA 1P2TA 3ICEA 1T3HA 4URUR 5HR5A 2AK2A 4PQFA 1SXJC 4B32A 1GL9B 1PJRA 3FMOB 4Z8XA 1KSGA 4E03A 2IWHA 2JJ1D 1Z2AA 1T3SA 3LFUA 2X8AA 1Q0UA 3TR5A 5L3VA 2O5VA 4DCVA 2ZQ5A 2G0NA 4BZPA 2SHKA 3GD7A 2XX3A 5B58C 3GLFE 1IXZA 5LB4A 4LYFA 4Q47A 2CLDX 4OK5A 1H8HD 4KITB 3VHLB 2HYDA 1NG1A 1OXXK 4XIGS 2QL6A 4FINA 4PC1A 5LD2B 3KQLA 5LDDC 1OIVA 4N0EA 4XH9B 2IXGA 2ZRMA 4KHZA 1V5WA 2AD1A 2RGEA 5ANRB 3L2OB 3ZD6A 621PA 1NNEA 3HR7A 2D4HA 1VCIA 1NN5A 2QROA 2AKAB 3GLIB 3CM0A 1KI2A 2W0SA 3VR2A 2DB3A 5HPYB 1ZUNB 1W36C 1GRNA 3KFXA 5SZKB 4H1VA 5GJWC 3I5YA 1TF7A 3QI2A 1SZPA 5L3SA 2XOKD 3QXSA 4GBMA 1BIFA 3W3ZB 1Q1QA 3ND8A 2IYQA 3PVSA 3IHLA 1NBMA 3P4XA 3AVYA 1UBFA 3A37A 4DDTA 1E2NA 4ZKDA 3WMGA 4QM6A 1IHUA 4R98A 4WBSA 2O8CA 1HA3A 4HAYA 3EC1A 1XEWY 3TR0A 4OYHA 1W0KA 3MMPA 4US2R 4JLNA 1CRQA 2QBYB 1DARA 2UZIR 1XCGB 4C3ZA 5DSZA 2IYWA 2KB0A 2VIIA 5FOXA 5J4HA 3ICQB 1AS0A 2LCFA 4PANA 1KYIA 1X3SA 3OIUA 3Q3JB 4IOLA 2J0QA 1AKYA 1AGRA 3SN6A 1SVOA 2HF8A 1Z2CA 1VIYA 1S9HA 2GHIA 2KE5A 4YQFA 3RRNA 2O0KA 1VG1A 5CK4A 4DKXA 1FP6A 2QT0A 1KDPA 2WZQA 2QM7A 1BYIA 3KJEA 1UKZA 1W47A 2CVHA 3O8RA 3QBTA 2RCNA 3M4YA 3IDQA 3RLFA 3W6OA 2EFHB 3BAFA 1KK2A 2GDJA 3PXGA 1XMVA 4W9MC 4ZI3A 1RW4A 3ADCA 3B60A 4YMUA 4YMVA 1XEWX 4TTPA 5K8IA 3BE4A 4KJZA 1H8EA 1GKUB 3U61B 4M53A 4C7OB 4G5RA 3FHCB 3SNHA 1KMQA 2A5DA 2ZEJA 3LA6A 4CZ2A 2VP6A 3CX8A 3PUVA 2MMGA 4LK2A 1GP2A 1QBKC 1F60A 3B1ZA 4Q4HA 2BC9A 4R7ZA 4PC3A 4Q5IA 4BFXA 4OI4A 4WZAE 4XTCS 1JAIA 2HT1A 1G1MA 3FTQA 3TRFA 4Q02A 4DHEA 3SS8A 1XJCA 3DDCA 2WJHA 4IVQA 2O8FB 4M9SA 1J90A 2OXRA 1SXJB 3IKJA 4JBWA 4OHVA 4BLRA 1JQJC 2OBMA 4D4LA 2O52A 4WZ6A 4TWZA 3K70C 1P7CA 3WNDA 1XXHE 1G6OA 2GETA 1KSJA 2WHXA 1IN5A 1NLZA 3FHTA 1ZNYA 5H68A 3KB1A 4US1R 1B0UA 2CK3D 3W8NA 4WOPA 4HLUA 2PJZA 1VPLA 2RHMA 1OH7A 2WMNB 1DS6A 4G01B 2JLXA 1P6XA 2ZR0A 1FNNA 2ZRKA 5EE0A 2JDID 4IKEA 5FUVA 3ZS9A 4HLCA 2HDNB 4TQAA 3DMDA 4P4TA 2PMDA 1GRRA 4LDJA 4URYR 3CONA 4RFSA 4M0LA 2W6JD 4UNSA 3FVQA 4PQRA 2FPMA 4M1KA 4D82A 1HY3A 2H5EA 1W36B 3G82C 3FYHA 1JB1A 3LQRA 4FXPA 1ZW6A 3P32A 3RS5A 1GL6A 2ZI6A 4DSTA 1OXUA 1XRJA 1VYUA 4HSEA 1CTQA 4RCZA 4BLOA 4GL2A 4E5UA 1TF2A 2KBEA 2FZ4A 4K81B 4QJ5A 3WY9A 3H86A 1P75A 4XVUA 2F1HA 3A58B 1HEIA 2R62A 4EIWA 2RGCA 2EFCB 4I4LA 1M6NA 4LJ5A 1CKEA 2GTPA 2QGZA 3DOEA 3MWYW 4L15A 4PX9A 4QGAA 4QRHA 4AG5A 1L4UA 1W49A 4A4DA 5JSZB 1CJUC 3NEYA 5JLJA 1SVWA 4A6PA 3AVWA 4BZXA 1AJEA 3AF3A 2XZLA 1CJTC 2Z4SA 5JHGB 1UBGA 1JI0A 1F3OA 2NOAA 3HPQA 4TTQA 1YKSA 2E1RA 2ZYVX 4QHTA 4WIAA 3CR8A 3T35A 1OIXA 4BE7B 2CDNA 2WPDD 2OHFA 4LGMA 4AK9A 1L2TA 4OBEA 1WBBA 3QF4A 1XFAA 2HT6A 2PLFA 3PUYA 5DLQC 5A5GA 2C78A 1G17A 2OEPA 3C16C 5UKDA 5BN4A 3WBJA 2W2XA 3RWOA 2HXSA 4FMCB 4FI3C 2J5XA 3BH6A 4EDHA 4Q4JB 1Z6TA 1G5PA 1ZUIA 3OE7A 2A78A 1ZUHA 5KPJA 3PUWA 1E2EA 1UF9A 1EFTA 3GJ6A 1DADA 2VF7A 1G7CA 1XB2A 1XMIA 1KNQA 3HDTA 3LBHA 3MD0A 4M1TA 4WAUA 4RD4A 2QT1A 4OI2A 1FW6A 4P0TA 5HZHA 4WW0A 4AIIA 3QSYA 4G1UC 3CPJB 3GJXC 1UFQA 1GFIA 4LJ7A 2F3TA 5GJCA 2Q9AA 5FL3A 1R5BA 2VHTA 1EWQA 2DBYA 5KSYA 4LV8B 2PL3A 4Q1DA 1DG1G 1PLJA 2L0XA 3TQCA 2PEZA 1FQKA 4V02A 2W2VA 1CULC 3K70B 4LX0A 3FKSA 3W6NA 2XNDD 2REOA 1E2KA 2C99A 3PENA 1LV7A 3V9PA 5EJEA 1M2OB 3CZPA 2EYUA 3A1WA 2LKDA 4F7WA 2ZE6A 4GMDA 1W4RA 5L3QA 3OHMA 2WJGA 2BIFA 4NYJR 4PAQA 2RGBA 2ZAMA 1QHXA 3L8YA 1ZJ6A 4MYTA 4LBVA 2PJRA 3ZQJA 3RHFA 3C7KA 3CIOA 3REFA 3DM9B 4B76A 3VU9A 1NIPA 2ZTSA 1Q20A 2ODBA 1IJEA 2BEKA 4YMWA 5EQTA 2IYZA 4XTRA 1LS6A 1M7BA 4M22A 1N6PA 1WF3A 4RD1A 1ZD1A 4CEHB 1BMFA 1XTQA 3THWA 1JJVA 1GILA 4C9BA 4PZZA 4C0HA 3AUXA 1E2MA 4LPKA 2GBLA 5F98A 3T5GA
chains in the Genus database with same CATH superfamily
1PZNA 4WCFA 3TKLA 3U6BA 1UR5A 2FK8A 1IU9A 1GXSB 3QEMB 1XTZA 4PZCA 4LQ4A 2CHGA 5CK5A 1UT8A 2BSAA 1QU2A 2Z6AA 2QGNA 3NP7A 2EIXA 3FPHA 2IUSA 4GLLA 3FUXA 4ZVMA 3SMVA 4F93B 1RWBA 1CJSA 3QSGA 1Z13A 2QR2A 1NVDA 3IJEB 3NVDA 3L0PA 2R6AA 3M0EA 1ODFA 1QDUA 1KQPA 4BS9A 1RLJA 1Q1AA 1A88A 3E53A 1KOFA 1Z4NA 1JB9A 4N3AA 4XW2A 2L19A 4NFLA 2OFOA 1LLFA 1QQ7A 1K5HA 2ZWAA 3NM5A 3EDYA 2I2XB 2IYRA 1CJCA 4QEKA 3NJRA 4KPGA 5L95A 5BY2A 2PJUA 2D8AA 4H35A 1KBQA 2G9VA 1PTKA 5B53A 2ZQYA 3GLIE 1FUIA 2CFIA 5BQ5A 3G2PA 1VFNA 1E9RA 2WWHA 3W3AH 4A0RA 4BUJA 1LB1B 4NDAA 5FTKA 3W8FA 3O2QB 4ZYXA 5LYJB 1AS3A 4BIMA 1XVLA 5FUXA 2VHXA 1VPWA 4OP3A 2Q3HA 1BG6A 4YPOA 1N2BA 3K73O 2B0JA 4ZOEA 1NW8A 5D3MA 2AE2A 2Z6VA 3T5AA 1UBHS 3F71A 3CZ5A 2W2NA 1R8XA 2KQUA 3HVIA 3IJRA 4LYHA 5AXAA 2GKOA 1ONSA 5AW5A 1EEXB 3D1LA 2H7YA 2IFTA 5DGCA 4J03A 5T8KA 5DOVA 1ZL2A 4B7UA 3SQWA 3ESRA 4TL6A 3V42A 1O3YA 4F8EA 2CW5A 4UVGA 2D0PB 4F5ZA 3PEVA 1YQUA 3EMBA 2IIPA 3AFNA 5ILQA 1PR6A 3ZWKA 3VU1A 2VDKB 3KOOA 1EPUA 5IYZA 4ASUD 5GOTA 4D9GA 1N6HA 1ORRA 4F6RB 1I2MA 1T1JA 5TV2A 2QSUA 2QTFA 1VLVA 4GBJA 2AUNA 3TNFA 3ZKAA 1BRTA 4EY3A 4IQFA 4QDZA 5HZKA 3NCTA 1GUFA 1SN7A 4A92A 2AR7A 4R1NA 2B92A 1L4NA 3NG1A 3ZGXA 4BN4A 3LHKA 3QKWA 4WTOA 1FLNA 1K2WA 1A5AB 3PGLA 1WRBA 3KVRA 5EYPA 4ZAWA 1LK0A 3GJ7A 1C80A 2VR1A 3FDZA 4PYKA 1KAHA 1IM2A 1SCQA 1H0SA 1KI4A 1M1YA 1RKUA 1BXKA 2WKRA 2ZI7A 3H1GA 1S3SA 1JZTA 3ITNA 4MRRA 5HFAA 5LIRA 1RYZA 4RD3A 1NVTA 1D9XA 1VKHA 3EUEA 1J2UA 2ZAOA 3I1YA 4LJ9A 3SNKA 3SXJA 2PT6A 3ZNNA 1B7GO 1F2TB 2P9QA 2ZJZA 4E3WA 5JI2E 1FXSA 1VB5A 3QXJA 5I45A 2IS2A 4GIBA 1JKIA 4PO3X 5C8DA 3AV0B 4I1SA 3VR6H 9LDTA 2ZRLA 2BFDA 4GE3A 5CFZA 2VXYA 3ABOB 4BKUA 1Z8HA 1XDBA 3Q6IA 2PUJA 1ILEA 4FFBB 4LRQA 3QQ5A 3NVAA 3HBJA 2B36A 1U3FA 2AW5A 3KKPA 4DXDA 5REQA 4OFWA 4X7RA 2OD9A 1P73A 1KWGA 3VVMA 1JU9A 3I05A 2WC1A 1XP8A 4D4HA 4LJAA 5KNDA 2WMOB 1QZ3A 3C5CA 1JEJA 1FOEB 1IHPA 2JHAA 3A9TA 5EJFA 1N6NA 2RHHA 3VV3A 4RY9A 3ZU4A 4DUGA 2VSYA 3H9EO 3J7TA 3HA7A 1M5TA 4NE7A 3P9CA 4Q3KA 4OQNA 3MUFA 4JJ8A 2XF2A 1I33A 3ZUPA 1XVUA 1JEEA 2WKQA 1PQ4A 2WTNA 2GXAA 3HP7A 1TC1A 4NLLA 1KY3A 2GYWA 3GCWA 4UHFA 4F5EA 2P3SA 3UK6A 1WY5A 1T5HX 3DOHA 4FX5A 1UBCA 3PJGA 3CKLA 5BV0A 3HYNA 1E59A 2HMWA 4PNEA 1DAFA 3H8WA 3A3OA 1O9BA 2ID8A 3OE7D 1OZHA 1CG6A 3B3AA 3N86A 4LVUA 1NGSA 2CNKA 3LUBA 1ESEA 4P38A 3EQ7A 1T0JB 1VMAA 4HKTA 1PLKA 2IEGA 5LBTA 3SZ3A 3WHLA 4BFCA 3U4QB 3WGKA 4GKVA 1HO3A 2ST1A 4HDMB 1T8WA 3PC3A 3DAOA 4UVDA 3PHGA 2ZDQA 4NH4A 3O4GA 1F2UB 4HDQB 4FJ1A 2P65A 4WFKA 3A9RA 2F9FA 4R2MA 1WXFA 2B2NA 3WKEA 4LZZA 4UFOA 4V0MA 4C01A 3MTAA 4INPA 2QMHA 1QCYA 3K2BA 4JNKA 2QM3A 4O1IA 4EGAA 4CKEA 2WU0A 2P75A 1FPQA 4RQUA 1DZ3A 3ISTA 4LNUB 2KLHA 4DLLA 3H1PA 5ILOA 3AP2A 4TLMB 1TM2A 1U2GA 1E7MA 1V26A 4DSOA 1SCIA 1HNZB 1ZICA 3ILHA 3VNRA 1QX4A 5TF0A 3D8NA 4PSAA 4DA8A 3ILSA 5K8TA 5A3JA 5CW1A 5DTQA 4JZYA 3OTQA 4XYBA 2PZMA 5E1DA 3U26A 1TKRA 2AXQA 5JMWA 4DKJA 2FGKA 3B1VA 2A0KA 2NLOA 3IIJA 3IUPA 3O4VA 3OLQA 2VSFA 3VO1A 3R3SA 4TV8F 2NSDA 3WLQA 2Y1KA 3HZRA 3FTCA 1QKIA 2D1TA 1X1CA 2DWQA 4ZQGA 3W7BA 1T29A 1PWHA 1Y8AA 3NHBA 4ZYWA 3LRXA 4LF8B 4BKPA 1IIBA 4DCGA 5JUWA 2PRZA 3UMJA 1GAJA 5IWCA 1XU4A 4K8OA 3KAJA 1UEXC 2YIDA 4KLAA 2WWRA 3BXEA 2FFHA 3NTQA 3ZBPA 2QW8A 4Q7EA 5HM8A 1NJSA 1QDLB 3TL2A 4B4DA 2VRNA 3J81k 2FRDA 5HKOA 1P3DA 3GAMA 5DI3A 2DBZA 3BRCA 2DKFA 4IJQA 4XZ3A 4Z0HO 2NQ2C 4D9EA 2XWPA 4C2UA 2ZU0C 1K0FA 3GHHA 5DWVA 3MAGA 1VI5A 5ADUS 4FKMA 1Q3KA 1R88A 4D98A 1MW8X 4P22A 3T9BA 1O87A 4AJEA 1Q1NA 1J2EA 1YZQA 2Q62A 4OKNA 5BN3A 4XD7D 3A1VA 5FPSA 4QPZA 3ZV7A 1R1DA 1YS1X 4DANA 2W6PA 4O63O 4LVNA 1YL6A 5L3SB 3T8YA 1MO4A 3NTVA 1OD6A 3P4YA 4MDHA 3U4GA 3T5DA 2HO4A 1XJQA 2X0KA 3H2IA 3SBEA 4C4SA 1XQVA 3LF1A 3G2OA 2EL7A 1USVA 2WB2A 3D1JA 4OD0A 3BIXA 3SQMA 1JG7A 4KR3A 4XM1A 1PFUA 5K8VA 2YRXA 1TUBA 3EIWA 3K4HA 5CTAA 2VTEA 2O8CB 1FC0A 2J41A 4AAYA 2X2OA 4NSNA 5CLGA 1Z74A 3SF8A 1W0JD 1DAPA 1M6HA 2W6OA 1V5GA 3TOZA 5TLSA 2L18A 4G23A 5K4HA 4O5AA 3U4MA 4X45A 2HUNA 3C97A 4QNMA 2VKTA 1PG0A 2HSJA 1XQYA 1W36D 3STUA 2RGXA 1CUHA 5E7MA 1R64A 5T3YA 4C0KA 2NT4A 2OCPA 2QMQA 4UDXX 3V2GA 4ER5A 1IY0A 1P8AA 3D2CA 1LWOA 3HJUA 5IT0A 1MJ5A 1GQSA 1WUJS 3FLAA 4QQ8A 4W5JA 1ODIA 5ER9A 2IWRA 3LIPA 4G5FA 2NUBA 1WTAA 3ZGLA 2ID4A 1GDHA 1N7HA 4XSHA 3SYKA 1Z0AA 3NDRA 2ZSDA 3QW4B 1P0FA 4Q1EA 3HVUA 3WGVA 4LGYA 1QCDA 3LBFA 3E23A 3GX1A 5AUQA 2CNWD 3VKGA 1OFUA 1KI1A 121PA 2R8RA 2JIZA 3PPWA 3JTMA 4HO1X 3V00A 1IZ7A 4FEEA 1NRWA 4HFRA 4I1OA 4S24A 1WCV1 1XJ5A 3RS4A 3G0HA 4QBHA 4NZ9A 1DBWA 2XUAA 2P2ZA 2E4UA 2Q1SA 4EYQA 4D9CA 3HDHA 1Z6AA 2ZYWX 4YHHB 3ANXA 1Q0LA 2ZVPX 1Z7WA 1RHRA 3A4IA 4UPDA 1C30B 1PT8A 4KN5A 4XLLA 3KZ1E 4XFDA 3W90A 3C5EA 4QLAA 2WAMA 1U0TA 3OICA 3ABIA 3B6ZA 3V1YA 2I87A 1FMLA 3SF0A 3W5VA 1SZJG 2DETA 1VLHA 4AULA 1ZVQA 1JILA 4FDAA 1KJYA 1BWQA 2CCJA 5B1DA 4A3SA 1JSCA 1MAUA 4IICA 4JLKA 4RAOA 5AI9A 5CUQA 2HA7A 2LTAA 4GT1A 5FYQA 2XGMA 1TEVA 4N18A 3ISJA 1HT0A 3O73A 3PKZA 5A6SA 4CDGA 2XMGA 5E9WA 4AY3A 3V8PA 1DC3A 4ESHA 3U1BA 1KAQA 4O2BB 1U7TA 5A9SA 3P4UA 2PE5A 4JI0B 3DTVA 4OMCA 4TSFA 1DJNA 1W2HA 2PV0A 3QX8A 4K9RA 4RPCA 2R6GA 3N6RA 4UU7A 3RVLA 4X1OA 4BLUA 4YB8A 1C7RA 1KAGA 3JQBA 2H1CA 1DCKA 2PY6A 3UH0A 3D7LA 3UMBA 3PYLA 4DLVA 3TLGB 1M2VB 4LF9B 2FPUA 4G6ZA 4J49A 3ZWYA 1SCBA 4L5CA 1NU8A 3H84A 1UC4B 1ZIDA 4WV3A 5LR6A 4OXKA 1ZM2A 5G0UA 2XR1A 4M38A 1T4BA 4MGEA 3M9LA 3ORFA 3Q7PA 1GNSA 1BW9A 3BH7A 3EYWA 4G0MA 1LD3A 2X23A 3DL2A 4N0DA 5CNIA 3HDYA 3ZTWA 4HUTA 3VNUA 4EJ6A 1L4KA 1SVSA 2OSBA 3B1XA 1TDJA 4U9IS 4UD6A 3UATA 4WN3A 2FUCA 3I30X 3TRHA 5GINE 2B1RA 2QMEA 1C14A 1M72A 3MFYA 4OUDB 1M2WA 2P9FA 3TMKA 1ABEA 5JATA 4DTCA 2Y1GA 1CR4A 3KQSA 5J2UF 4UOEA 1ZHOA 1GGNA 2PGNA 5CFRA 3AESB 2DG2A 1ORTA 4OQLA 5C4MA 5IAKA 3BIOA 4R2IA 1IBRA 4C21A 4BFTA 5B7PA 1RZRA 1XTIA 1NJFA 2NN3C 1TKAA 2YDXA 3DCIA 2GVZC 3QITA 2WP0A 1US8B 1R12A 4Z9YA 3ZIAA 2A33A 3BPSA 1BXRB 2AEFA 4L85A 4ZVLA 2ZJ6A 3ZHYA 3BC1A 3D8TA 3N9IA 1VP3A 2AF3C 1R16A 2AXPA 5DK6A 1QGDA 1RI2A 1NT4A 4D0GA 1E2PA 4IFIA 2H18A 4WRRA 1TJ5A 2A1UB 3DFIA 3HP4A 2P8SA 1U9CA 4HH4A 2JFWA 4NXMB 1IWOA 2Z30A 3QF4B 3B1JA 2IUYA 1JR3A 4ACAA 4GP6A 5E3JA 5K4GA 2P67A 4DV4B 2F1IA 4DWOA 4Z0TA 4REQA 1SVUA 4WEQA 5BN4B 1RKXA 2VK1A 4PSKA 1TO6A 4FC7A 5LP6C 1ZM4A 3D0OA 5E1MA 5E6UB 3TLJA 2FOLA 3KXLA 3G79A 3SCZA 1D6JA 2FN9A 4HLQB 2EX1A 3IAS1 4I55B 4JJIA 4K6CA 4PZ9A 5K8CA 1TXGA 2BEUB 2UYOA 2X41A 3ABQB 4HB3A 2YUTA 2JCBA 2AC7A 3M70A 1ZSYA 4BASA 4O2AF 4B43A 3QUQA 4YO7A 2AA3A 2BW0A 4UU8A 5FI3A 2OYRA 4DDMA 2AFVA 1RJDA 1QNFA 2QI9C 2BGRA 3BWVA 3AY0A 4ZCSA 1VC2A 3DMNA 2OVBA 3I5UA 3HBFA 1B4DA 2NW6A 3MERA 4MYCA 1JQEA 4V2IA 4ATNA 5HW0A 1K7FB 1XSEA 2WDZA 3PDIB 3PPVA 1GITA 2CE7A 2ZUCA 4KSCA 1FSPA 1XZPA 1E3DA 1D6NA 1SZDA 1Y6ZA 2RHDA 4W6ZA 1XJWA 2CEAA 3FPKA 2F9LA 2GLTA 1Z6QA 5DGDA 1HSZA 2IU4A 2J45A 3Q5DA 3RW9A 2O57A 1E6LA 4AX8A 4B6JA 3AQ4A 4DJJA 3WI7A 4PG6A 1RQNA 1URPA 5JSYA 3KUUA 1IUKA 1E3IA 3R3XA 4ZFNA 1FJGB 3LLVA 3MWGA 4LC9A 4C0XA 3N70A 2QX7A 1NP7A 2RSLA 2UUPA 3BREA 4NPHA 1GPWB 5C81A 3BN3A 3HM2A 3L5OA 3RTBA 1QZZA 3BGVA 3U80A 4ZCTA 1M2GA 4FU0A 3UC9A 1BGWA 3NHZA 2GM9A 3FCUB 1YCGA 4GOXA 5B1YA 3F6YA 1RQRA 2D74A 3EZGA 3DAYA 1TK9A 3PRYA 1YR8A 3K0CA 1OZ0A 2MYNA 3BIFA 3DYBA 3ND7A 4IO1A 1LLUA 3V8RA 1DU4A 4AYWA 2C9YA 4JLUA 1DWPA 2I1LA 5JC8A 4WESB 2KW5A 1K6XA 3E22A 4IIFA 4KO4S 3O8QA 2V7QD 3TOVA 4GBED 2I6GA 2WF8A 1O03A 3SLGA 1WPQA 4AI6A 3AMVA 4LY0A 3ZCXA 4QYXA 1C9EA 1HL7A 4MJLA 4TL7A 3K94A 2XUKA 2CBZA 5JTTA 1P17A 1YD7A 2ZSJA 5FBLB 3SHOA 2AE1A 1CHNA 2NYUA 5AKIA 3S28A 5JYDA 4ETMA 3EOAI 4P80A 1REQB 4HYEA 3CVYA 2BFWA 4X1KB 3HS3A 3RFFA 2PQ2A 2VHYA 2XVYA 2ORIA 1A95A 3BL6A 1CUJA 4GSLA 4A82A 1ES9A 4A2QA 4DIUA 3DE3X 2PT7A 3OZVA 4GICA 1B8NA 3PFWO 3IIKA 4UDNA 1AKUA 3HSYA 5BYKA 1U81A 1J7KA 5G0WA 1B00A 3WL3A 3C14C 3V1TC 1TA9A 3TFOA 3ZZUA 4GX1A 4UUOA 1Q7CA 3MXOA 4L8YA 3FZNA 3HC7A 3V7WA 3QVGA 3RTCA 4MI3A 5KBYA 2GNAA 1BE1A 2X2PA 2D4AA 3SVTA 1UAAA 3DL4A 2BKUA 4O8CA 1CLEA 3DE6X 4LOAA 4BB9A 1A0OA 1H94A 1U2DC 3K0FB 4V0QA 4DUPA 4YS6A 1NI4B 4ZDJA 2WWGA 2F67A 3P2MA 2JI7A 2VP0A 4KAAA 2QUHA 3BHJA 4XB2A 3SYMA 5IAOA 3ZGNA 5LOVF 1FFGA 1P2SA 2IELA 3IBSA 5TARA 1WUHS 4QC2A 5JRDS 3NKVA 2ZRDA 1MUUA 4RV4A 2R6HA 3AO0B 2FFBA 3K1YA 1OVGA 5LP6B 1HBJA 1YBVA 2ROQA 4TT8A 2JVIA 4ZZ3A 1E89A 3HBAA 1J8DA 1LKZA 2EGHA 4IINA 3IAXA 3KR0A 2QTVB 1MB4A 1Q6YA 4J4BA 4UUNA 4PCVA 1SU8A 3WK7A 2ZR9A 1DZIA 2GARA 4NRDA 1F4PA 4JUFA 3M1IA 2HRDA 3WYEA 5IJ0A 5JHHB 3SMQA 2GNOA 1D8TA 2OG2A 4GAEA 3V4LA 4WNIA 3RNOA 1DAEA 4N7BA 5KYNA 3KKNA 3TJMA 1XEAA 5D6OA 4ZAZA 4O0LA 4AO6A 4F9TA 1UQTA 3C8ZA 1Z0IA 1IK4A 4H15A 5B3JA 5AT1A 3TO5A 1XYVA 2ZQZA 1KJ8A 2BGKA 2REQA 1UMBB 3AX6A 1M6VB 4FD3A 2X8WA 3NAGA 4MSUA 4HWKA 4D4IA 3K6SA 2BKLA 1L1QA 2A2ZA 5D3ZA 1ZRSA 2CF6A 3GUHA 3C3XA 1R0XA 2VDMB 4NTZA 4MI9A 2F3UA 2IP1A 1Y1QA 4A9AA 4X94A 1SQFA 2PUAA 3WIBA 1KAEA 4W1PA 3DYVA 4W99A 1JQLB 3P96A 2CDBA 3SR0A 4CETA 4JCOA 5AI8A 4GKBA 3CW2A 4MW2A 3UKJA 2HW8A 1G4UR 4CEIA 3CNEA 2HBRA 2XB6A 2PH3A 1KYZA 2QRHA 3TSCA 3ZDXB 4U02A 1P7YA 2IS6A 1R0KA 1QGZA 5IFLA 2B0CA 3R9WA 1I2CA 2KS6A 3K8OE 2NUPA 3BIJA 4P54A 4MQEA 5KYVA 3ADPA 1DTWB 1H2XA 2D1QA 2FZEA 2FFQA 3EA0A 5F5XA 5B58T 2GESA 4D8TA 4Q4CA 4HYYA 1SCJA 1NULA 2V5UA 1QYDA 5BVGA 2C9BA 1YAJA 2N1BA 3SD7A 3CBQA 3SOZA 3VGPA 1X1TA 1GGKA 1ZESA 2YC2C 3GDGA 1I5RA 4HP8A 4Y9SA 4BQFA 1G8PA 1GAWA 4GECA 2A5LA 3G7SA 2YJZA 3JQAB 3PSHA 4QG3A 1YZLA 1DXHA 2G82A 2VPZA 3E03A 3PDJA 3O9VA 4FTWA 5JO9A 3E5MA 4WBNA 5KYYA 2C95A 2W4IA 2HA3A 4CWAA 2HMSA 4EGSA 4YAUA 1JXMA 2C7OA 1Y1KE 3OU2A 3WGQA 1EFPB 1LBEA 2QUZA 4CMAA 5K8JB 2G1KA 2WUFA 3K9GA 2F3QA 4XR4A 3H5AA 2VK8A 4A8TA 2CXNA 4EHFA 5K2OA 1JEQB 3NB0A 5LQJA 1TT7A 3BS4A 3KD3A 1LGYA 3H1BA 1TU0A 4ENTA 3HKCA 1D7AA 2GTIA 1RADA 4ZI2A 5K0EA 3VR2D 3W7AA 2O1EA 4FE7A 2QM0A 1DJPA 3G6WA 3OM9A 4NS1A 3SC4A 3R3UA 3OZTA 1LTQA 1P18A 2FW1A 4TUYA 4XQ0A 2FKAA 3F4KA 2MSCB 3UAWA 2A14A 4FIZA 3VPAA 4WN9A 2POCA 3EEQA 1T36B 3LSTA 4D56A 1UMDB 2IZZA 2EJVA 3E82A 1NBMD 5AW2A 2QJTA 2CKMA 1Q57A 1DXQA 1FBNA 2BD0A 2EVWX 2ILVA 2ZIXB 3DO5A 3FOWA 4FMCF 4D4GA 4DNOA 4Y7CA 1J70A 2IKQA 2FY8A 3PNVA 5CLJA 1ZITA 1U0EA 1BWPA 3I01M 3T3NA 1HEYA 4AQYB 1W0KD 3QLUA 5DRYA 5CG1A 3QWBA 1DAMA 4DYHA 1EX9A 5KI6A 3BXHA 3DOOA 3I9MA 2DR3A 4FFWA 1JH8A 4IIXA 1R6AA 2VNIA 4X0EA 4JLMA 3RUAA 1VOTA 3WR5A 1RYNA 2R1TA 4YUAA 1C0LA 4OJYA 5JXHA 1T3TA 1CB0A 1A1SA 4BDTA 4AUEA 4JBGA 5E3IA 2DVMA 5ALQA 1AXRA 3ROKA 4G36A 1PZFA 2WICA 5AH0A 1YGPA 2C97A 4BBPA 1XZKA 1E6CA 4I66A 2C2YA 4HAXA 1RLOA 3C4VA 1XLVA 3IT3A 1P0CA 2WNIA 1L1RA 4OM7A 2WVJA 4ZHQB 3OFJA 2VCEA 2ES4A 3WKBA 3KHUA 1YI0A 4N39A 3E15A 3FE2A 2W6IA 3BDAA 3UVEA 3ZI7A 1YJAA 1KFCB 1KMHA 5LBUA 2NMVA 2X0NA 1U2RA 2OQ2A 3UJAA 4EUEA 2IYXA 4KBGA 4EUKA 3AHHA 4B9AA 1LY1A 2JH8A 4U5XA 4Q18A 1RIFA 4JBLA 4UM5A 4G84A 3EC7A 2VQ3A 4PXSA 1T5LA 2H1HA 2O5RA 2I62A 2AH5A 3RIYA 3HEMA 2OMEA 4X3OA 3MJRA 4HDKA 1JP7A 3GP8A 3ERCA 5JJIA 4X5OA 3PICA 4BBAA 3OIGA 5AVKA 2P5UA 3HABA 4RK7A 4ZEXA 2E6KA 1XTJA 2JIMA 6REQA 3UY4A 1Z0ZA 4MX8A 4FZVA 5CVDA 3ROZA 4WOJA 5K0SA 1XQ9A 2WHRA 4PS1A 1E99A 2PM8A 2JEZA 3FNHA 3KTDA 1DQNA 3OOYA 4FW9A 3SOPA 3TL6A 3WL6A 1L7AA 1J07A 3NEPX 5GVRA 3KB6A 4CIXA 3GBSA 4YMTA 5ECDA 4KI0A 4JP3A 1G59A 4HB4A 3K9NA 1BCSA 3EGCA 3KFLA 2WM8A 1X7GA 1U94A 5AKKA 1U4SA 2XMCA 3VBCA 3H4MA 2R8OA 3GDOA 1V9SA 3U81A 4BX8A 4NFSA 2H11A 2TMKA 4PWYA 1QS0A 2B35A 1O6BA 2QRQA 5B2EA 4YRKA 2PZBA 3AL2A 1K27A 2X0RA 1DIOB 5DNYB 2D3WA 3P0IA 4AJNA 1LW6E 4R8LA 3F7MA 4M9UA 4CYMA 4BGEA 3RT7A 3VTKA 6YASA 5C5IA 1PG2A 4O3FA 4RTNA 3JQDA 4EI8A 3SVZA 3AVQA 1BSVA 5JG7A 4FOPA 2WB4A 5A4AA 1JDVA 1EVEA 5F7OA 4DLKA 4ZN6A 2UVQA 2RC5A 3QU9A 5EZYB 5F98A 1YUMA 8MHTA 1JYFA 1OASA 4RK1A 1MQ8B 3PUJA 1I1NA 1CHDA 3COYA 3KU1A 2FQXA 1U1CA 3KP1A 4JY7A 4MUEA 3CH6A 5ESXA 4ITRC 3ZV6A 1MX1A 4E2WA 4ZQFA 3GLFB 2CJFA 4FYIA 5TNXA 3EG9A 4A2PA 4ZYZA 2CL6X 3KZVA 4YCAA 4F2GA 1KFBB 1BX3A 3TOCA 4Z6KA 1QOQB 1K06A 2XA2A 3KUDA 4KIGA 1LLDA 1E2LA 3OQIB 2CJWB 1E3SA 1OKKA 4II2A 1QTNA 1FDTA 1PT5A 4IKOA 3MTIA 3ZGYA 2HM7A 2TMGA 3COWA 5ESWA 3EZYA 4JYZA 3GLKA 3OZRA 3JYQA 3MJCA 4FZRA 1E4EA 1HORA 2OZPA 2EWMA 4HADA 2J5BA 4PCUA 5C0OE 1U28A 4I4TA 4WACA 4DDVA 5LP1A 2D7CA 4R69A 4MDFA 1A97A 3FKQA 4X7MA 3KQKA 1RHUA 3KJZA 4TWBA 5DO9A 3DOFA 3LS2A 4IDHA 5EWJA 4B87A 4US0R 5B5SA 1CY4A 2J0QA 1G8YA 3V8NA 3IH5A 1IUOA 1ZM3A 3EGOA 5T4FA 2GEJA 1JIJA 3ZXYA 1SK9A 3LA8A 4INJA 3WX0A 8ATCA 4ZT3A 4U7DA 2D1YA 3N8GA 4R31A 4X9XA 1XO1A 3ZNQA 2YFYA 3ZVLA 3MTGA 4FNMA 1OE0A 5DIZA 2OHVA 3UMYA 3IQXA 1E6EA 3ESAA 4Z4EA 2C2GA 5BV8A 1EGAA 1O96B 3ZZTA 4KXXA 4BKMA 2JFZA 4CMCA 1FPMA 5CCXA 2YR0A 6LDHA 2D1RA 3RSCA 4DGSA 4K9PA 3SXUA 2HA4A 3DHNA 3EIUA 3PTZA 3UBTA 4LZNA 2R60A 1GTZA 3PX3A 4M0UA 4LSGA 3DD5A 4RHCA 3W5DA 2IYUA 4YJHB 1PUIA 1C8LA 1P80A 4NAHA 3AJEA 3FFXA 2PBLA 2VP2A 2VSXA 4D42A 3LKDA 2B5WA 1A9YA 4FFSA 1J8VA 1P39A 1YR7A 3QQPA 3QUSA 4FLFA 1ZCBA 4ZOLF 2PVCA 1FU8A 4GOLD 4RCYA 4JKYA 2H3EA 4EZBA 5K0LA 1N33B 4RHYA 3QRWA 1GJRA 1FS4A 4MW7A 3TLZA 4EKGA 1QFSA 3QE9Y 2GKSA 4YQYA 1IQRA 3OHPA 4MVJP 4X20B 1JAZA 2DWCA 2JFVA 5K8UA 1AQ6A 2WKSA 2L69A 2YKGA 3ODGA 5TS2A 2FAXA 1TW3A 1XD2B 1UH5A 3JWHA 3K92A 5CX4A 4Q4AA 4YP9A 4DVJA 2I3ZA 1LTHR 3N5KA 4FDTA 5JDCC 4GOOD 2YS6A 5FF9A 2G70A 3IIEA 3UKOA 1ND5A 1TJPB 4IHKA 4KVGA 4I50F 4MW4A 5FOUA 5FTMA 3SEFA 4BB6A 4G5HA 4OHOA 4CIDA 3FCOA 1GPJA 2QD4A 1T1EA 3L0BA 5KOJB 2G4LA 4GOND 5K51A 4WZAB 1OLUA 3ZC3A 3ZXXA 2OY0A 1I51A 1AUOA 2E5FA 2ZR8A 4KN8A 3JSXA 5KUTA 1QNLA 4RD6A 4UXIA 1Z63A 2MMCA 1MENA 2VHQA 5HUJA 4JFRA 3BMNA 3MOGA 5KNBH 3DE5X 3KJXA 2WD8A 1DDGA 4H7HA 4JP2A 4MQLA 2PUDA 4HEJA 5DNCA 3H2GA 2R87A 1JH9A 3A8TA 1FYVA 2MWMA 4EVSA 4LJRA 2K6GA 4FIDA 3CCFA 2ZIGA 3N87A 1ZIYA 3T3OA 1LDYA 1AKNA 2XWSA 4QU8A 4HXYA 4QUIA 1XROA 5FO1A 1CR2A 2RGNA 2WY2D 3FMPB 1GO2A 3F8TA 1E1YA 3HDQA 3A9WA 3IERA 4HUQA 4JB2A 1OOEA 4M37A 3E2MA 3ZHOA 5JASA 4RHTA 3PI6A 3G8BA 3ZJUA 2NU8A 1NOIA 4TWAA 8LDHA 2I4IA 5AM4A 3MS4A 3IAM6 4FW8A 4A03A 1N7JA 5ELXA 4AG3A 3ES9A 1CUGA 1UZAA 4J1TC 4YCDA 3RRXA 3PQEA 5DYNA 4KREA 2QORA 4ZVQA 4EJFA 3DDUA 1U4NA 2WWYA 2PZ8A 4JGGA 5A3VA 2NSYA 4KQ2A 3KUKA 4MR9B 4U9HS 4AKGA 1YR3A 2OGWA 1ZR2A 3H19A 3R74A 3HBLA 3W7VA 3U9SA 2SKDA 4AJ1A 4PPQA 3JYHA 4Q05A 2IBMA 1SIOA 1PJ2A 3P2YA 1WSDA 5FUBA 5I9IA 2A1TS 4F04A 1VLQA 1KU6A 3GMSA 3UKDA 4QGFA 2NU9B 3OIDA 3QGMA 4D57A 3EXEA 1E4YA 3E4DA 3CX3A 2AWNA 2ZKLA 2PSSA 2MINB 1VE3A 4BYMA 3OJFA 2W2LA 2ZRFA 4MUBA 3RUDA 3LC7O 1Q3TA 4XRGA 3RADC 1N9KA 4LQDA 1EFHA 5KDOA 2CMFA 3D6AA 3OH8A 4DQXA 1CIJA 3R8FA 3P97A 3QPBA 3LPNA 1PNOA 2NIPA 3FTNA 4UQOA 2HL6A 2FZKA 3FOZA 2PKCA 4Q24A 2XJ9A 3B5EA 3M5WA 4UZFA 1EBFA 4G09A 2VSOA 1JBQA 3EDMA 4P7JA 3PHLA 4PIPA 3UHPA 1ODJA 2X19A 2WE7A 4EENA 2PXAA 1ZM7A 2PPVA 4FMDF 2FEAA 4PGHA 5EE9A 1MR3F 4BY9E 4RJIA 4WK2B 1NQOA 2EDAA 1U0LA 3BIWA 4BZWA 1RM3A 5J5CA 3BRWD 3NBZC 5JXWA 4EL5A 2ZTMA 5JFOA 1OFTA 4JJ7A 4M1MA 4TKMA 3DH0A 2GZDA 2YMMA 3CUWA 3EXHC 3O2SB 4TLCA 1HLGA 3JYNA 5AI6A 2XGSA 3LPMA 4QQRA 5FAXA 2FP4B 4UARA 1I4EB 2CK3A 3DVAA 2JFUA 3GLSA 3VYTB 4JMPA 1U5AA 2UVPB 2PX5A 2YJ4A 1YZ3A 1PD0A 3ITKA 3ZJVA 3KFVA 2WTAA 4FHCA 1JYEA 4N5LA 1G3UA 4TN1A 1VECA 1RZVA 4UBKA 4AWAA 1T9GR 1J4AA 4K6KA 3COJA 3K09A 2Q4DA 4TQGA 2VHVA 3B52X 2A84A 2GFHA 1U1IA 1RMTA 1INLA 4MP6A 3CBGA 3FVRA 2HLNA 2K2WA 3DPUA 1RPNA 2FPIB 5CVCA 2NU6B 4QTYA 3ZLJA 3NC0C 2Y0PA 3CN7A 3FJ1A 2WYWA 1Z34A 4XM2A 3OLZA 4KAJA 3VYSB 4EVRA 1SVLA 2NO9A 3OWOA 3R4CA 4EB0A 1XRNA 3KXPA 1L1FA 3GUVA 3KKQA 3WADA 2WM9B 2CLCX 3KS9A 1E1CA 1JDSA 2XQIA 4JYMA 5ECWA 3TTWA 1MT3A 4Z9AA 4P4GA 3BZUA 3CH5A 4LSZA 4FGWA 4IHJB 3K0HA 2QD2A 3M1AA 3HJFA 1IHXA 4PYIA 1AUQA 3V7FA 5JJBA 2QNRA 2UZ0A 4DGQA 1XFDA 4M0EA 4PCAA 2J7PD 5TQJA 3IT1A 4HN4B 1OAKA 1M1UA 1YC5A 2EZ4A 1VFPA 3N8IA 4P98A 5FR1A 1LZKA 2ZIWB 3ZE6A 3CF6R 4NMXB 3QXXA 2C7RA 4KDEA 3RRJA 4D6YA 1GVNB 2M1ZA 1M33A 2QVYX 3DZJA 4L9AA 4D25A 4JVOA 2GVDC 2GBFA 2ODWA 3COZA 2BKVA 3T5MA 5IX8A 2GPWA 3ONFA 4OEHA 4DUYB 3FDFA 3GGOA 2DXIA 1P1BA 4J2OA 1H3EA 3MC1A 1OU0A 1WVMA 3CIFA 1YRQA 3NS7A 4I4IA 1TVEA 3MJDA 3MJVA 1X8LA 4YDHB 4ZOCA 1PR0A 1NDUA 3D7RA 4G24A 3BT7A 5EIOA 1D2RA 1OSNA 1XEFA 4QLBA 1DEKA 2QUJA 3O4RA 2O3UA 3OLCX 1F2VA 4P7GA 2B9VA 3UMFA 2D59A 4F38A 3H0CA 1Y1SA 1B93A 1X9GA 4NWIA 3ZDQA 5TXGA 1O89A 2IUUA 2PUTA 3MUEA 1O4WA 2FB9A 1Z0SA 3RB8A 2H59A 3K1AA 1FP4B 3ML1A 4FDMA 5BORA 4R16A 1RFGE 4I8XA 1QGED 3VZBA 5BW8A 1P45A 1H2ZA 2ZLBA 4JKIA 1A9PA 4J6EA 5CEEA 1SXQA 3FKJA 3JZIA 1VCOA 3DZHA 2VBFA 4E6EA 5AO9A 3IQZA 4BFSA 1AGYA 4NCAA 1PW7A 1KEKA 3RRYA 3KT0A 1ZOLA 5JQWA 2QTWB 1XZLA 4EITA 4MWGA 2P6NA 1I7DA 5F3DA 1DVRA 4HGZA 3ETLA 4Z86A 3ACBA 2Y1CA 5FA5A 3TTSA 3EA5A 2YXEA 2WSSD 3THOA 2IDZA 3WYFA 2B25A 5AJUA 2QYSA 1G8HA 1C4OA 1YDMA 2WYVA 2BONA 3S4YA 1YFKA 1CUWA 4KE9A 4CM1A 1OREA 3KPJA 4ROTA 3U40A 3C74A 5LCXA 4MWCA 4DCCA 3NHWA 4GS5A 1UAYA 2JKYA 2OCGA 1T4GA 1R9JA 2OCBA 2YOHA 3QX9A 3A3PA 2O2CA 4D45A 4FC6A 2ODQA 2WVGA 1Y3HA 4NEGA 3ZTYA 1EP2B 2B4YA 1HDEA 3WSWA 4D6XA 4NAUA 4HZUB 2D1SA 1C1DA 3VYWA 1JHPA 4NBSA 3W6PA 4UEOA 2FPOA 1T2EA 3GDHA 4LDRA 5CDHA 5I7HA 3C6XA 4MRMA 5D5PA 3IT0A 3WZMA 1HUQA 3RYCB 1EMDA 2YV4A 5CXQA 4GX2A 5FHQA 3U17A 2Q0SA 4RWEA 5LLTA 2OGZA 3FPGA 4U9UA 1G60A 721PA 2GM4A 2NAFA 2BHNA 4GKAA 4G07A 4C6RA 2GN9A 2M32A 2XBUA 1LBQA 2IT1A 1J99A 1FTYA 1ESNA 4HN2A 2Q2VA 4X6LA 2VEDA 1SUSA 5KQMA 3EGWA 4AKEA 5LZ4A 3C87A 5DZSA 4L16A 2O54A 2UAGA 1QAMA 4DM3A 4P31A 5AHOA 4XAQA 3KOZA 1QE5A 3ONDA 4I9NA 3VMMA 4AZ3A 2WBLC 1HDYA 1N32B 1RLIA 2AQKA 3CEJA 3PFIA 3JYOA 3LPAA 5D7BA 2G5CA 5EJ8A 5JVDF 1EFUA 4UZSA 3M4NA 3RYHB 1X8KA 1E5DA 3EJ6A 5BSEA 1VYVA 2IKSA 4ZCQA 1O9GA 1ZAYA 1TM7E 1E7YA 2CCKA 3RQSA 3NTLA 3MS7A 4LXQA 3EQ9A 3LX8A 4L5BA 5KWIA 1E0KA 2OTCA 2PNFA 4PS0A 5DLYA 1U8ZA 4FWTA 1VP9A 3RBVA 1QRSA 3HLKA 4MPDA 4XVQA 3CZRA 1ECBA 2HWYA 2G9QA 3QLVC 3KE9A 1W7AA 4JXKA 1ACMA 2RB4A 1QFZA 3N8KA 2Q2NA 2H07A 4LOHA 4BJ5A 4BAUA 1W1WA 2CXQA 3BJZA 5J2UA 2EFDB 5I8ZA 4MW6A 4H3VA 4WDRA 4Y2YA 4FYHA 2CFSA 4CKBB 3DNMA 3F6BX 4XOUA 5IARA 2JLUA 2F7SA 1MEOA 3WKCA 2XJ4A 2HMTA 1MG5A 2JEOA 4MYDA 3RG8A 4WBXC 4A26A 5E7QA 1KDOA 5EHGA 3D4NA 5EAIA 2Q4OA 3I61A 1ZCZA 4NF2A 3TCXB 2YMQA 3AYXB 1QC5A