2CZQA

A novel cutinase-like protein from cryptococcus sp.
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
205
structure length
205
Chain Sequence
ATSSACPQYVLINTRGTGEPQGQSAGFRTMNSQITAALSGGTIYNTVYTADFSQNSAAGTADIIRRINSGLAANPNVCYILQGYSQGAAATVVALQQLGTSGAAFNAVKGVFLIGNPDHKSGLTCNVDSNGGTTTRNVNGLSVAYQGSVPSGWVSKTLDVCAYGDGVCDTAHGFGINAQHLSYPSDQGVQTMGYKFAVNKLGGSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure and enhanced activity of a cutinase-like enzyme from Cryptococcus sp. strain S-2
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords cutinase-like protein
total genus 83
structure length 205
sequence length 205
chains with identical sequence B
ec nomenclature ec 3.1.1.-:
pdb deposition date 2005-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01083 Cutinase Cutinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2czqA00
4EUSA 1M33A 3MUOA 4V2IA 3LLCA 4ZWNA 1C7JA 2BGNA 1ACJA 4BVLA 4B84A 3EBLA 3HEAA 5AI5A 3D2BA 3ESDA 4BP8A 3BF7A 2CUTA 5K3EA 2GYUA 4EY7A 1XROA 1ZI6A 3HSSA 4A23A 4CG3A 2HM7A 2IIVA 5ALZA 1SOMA 5BV7A 1DQYA 4BVKA 2WIFA 6YASA 4AO6A 1HDEA 2X5XA 4FHZA 3R3VA 3IB3A 5K3CA 1W52X 4QWWA 3WK7A 4BTVA 5JADA 3R40A 3G0IA 3CCBA 1EI9A 4OCZA 5ALOA 1ZJ5A 1NU8A 3M82A 4Y2PA 2PUHA 3DJYA 5A2GA 2OG1A 1XZJA 1C4XA 1MNAA 4YPVA 1I6WA 3AILA 4PSCA 2O7RA 3DS8A 3ZLUA 5CMLA 3VVLA 4YK7A 5AK4A 3EQ8A 3WKCA 3SWWA 3AJAA 3IUNA 1H2YA 1XRRA 5ALXA 3F96A 3GZJA 4BP9A 2RONA 1CUZA 2WG0A 3IUMA 4BZWA 1JU4A 4BZZA 4BC0A 4AN0A 2WLSA 2E3JA 1LZLA 4G1FA 2NW6A 1AURA 1LPAB 4X90A 1SCIA 4AZ0A 3R0VA 3HRHA 1HBJA 4L3WA 1VJ5A 1EDEA 4JH0A 2ROQA 5AKYA 1J1IA 1QTIA 4UBOA 1UK9A 4QDZA 4AX4A 4OYYA 4I3FA 3V1NA 4W63A 4HRYA 3D7RA 2PPLA 1AGYA 1K8QA 3WKBA 2XMSA 2GZSA 1XRMA 4Y2TA 4NVRA 4U2BA 4K2AA 3JWEA 3O4IA 4S0XA 1BEEA 1XKLA 1F8UA 2HDWA 5CT9A 2OPHA 1EXWA 1Y37A 3FOBA 3QBJA 4W1SA 3WK9A 3QVMA 2OGSA 1UOOA 3G8YA 4AQDA 1EINA 1UXOA 3M3DA 4ETWA 1G5FA 2JGKA 3KOOA 3WWOA 5KREA 3OC0A 2GYVA 5AHXA 5DWDA 5HFNA 5EHQA 4XVCA 4Q3KA 1N8SA 1FFCA 3WWPA 1XZMA 4AO8A 2GBFA 4NMWA 1TK3A 2WFLA 5JD5A 4BRZA 2XMQA 1BN7A 1W6RA 3VVMA 2ONCA 5D7BA 2XQGA 2ZVDA 1ZI9A 3C70A 5AKJA 1WB6A 5AKZA 3EQ9A 1QIJA 2XUAA 2VJCA 3HC7A 3LIPA 1QIMA 4BCBA 4C01A 3I2KA 5DYWA 1CUJA 3FSGD 2ZYIA 2XLBA 4U2CA 3IVMA 4YASA 3LS2A 1CFJA 1WPRA 3VJKA 5IH7A 1YS1X 2I3DA 4GXNA 2WHPB 2P8SA 2DHCA 5JARA 1Q0RA 1E5TA 1ZIXA 2OGZA 3F98A 3WQHA 4FTWA 1DQZA 1XZLA 2BUBA 3STUA 3R3ZA 2HRRA 5ALIA 3I2FA 4OB8A 4AXBA 3WK8A 2LIPA 5CURA 4N8DA 1SCQA 1EB9A 2RIPA 4MYSA 2YYSA 3FVTA 3QPAA 1K4YA 4W9RA 1FFBA 4C4ZA 2WFMA 4IO0A 1EVEA 1BCRA 1CV2A 1DU4A 4BAGA 3FLBA 1N1MA 4G5XA 4HXFB 1ZICA 4QWMA 3YASA 4C87A 3OM8A 4Y2UA 2EDCA 1XRLA 2VJDA 1LGYA 2JF0A 2O2HA 2QOEA 2Z3WA 1R1DA 3FWHA 4OB6A 4ZRDA 1A7UA 3JYHA 5CT4A 1XZIA 2XE4A 2XMDA 1VXRA 5YASA 5JATA 2JGMA 5ALQA 2WUEA 1QIGA 4UFPA 5ALPA 1ZOIA 1LPPA 4PW0A 1TIBA 2XQIA 2WSLA 2BFNA 1AKNA 5LZ8A 4LKOA 5JYCA 4TVKA 4KJXA 5CRIA 3ESCA 1XZEA 4GW3A 2CBGA 4Y9SA 4H0CA 4MXDA 2QXTA 1VZ2A 1VE7A 5LZ9A 1QO7A 4KRYA 2OCKA 2WHRA 4DNQA 2HIHA 1VA5A 5LIPA 3WKAA 4CCYB 2Z5GA 4QZVA 1GZ7A 3B5EA 5AKHA 4X6UA 3DL4A 3AIMA 2HA6A 3HLKA 4DLNA 5AI0A 5EHXA 2HU5A 1A8QA 3EQ7A 3KXPA 2WHQA 4J0CA 4J3JA 1HPLA 3RKSA 3BXPA 1QFSA 1EDBA 4LXIA 3QH4A 3GUUA 1E3QA 5LZ2A 3WZMA 4JYMA 2FJ0A 1GXSA 3BDVA 2R8BA 3EIOA 3G9ZA 4IH9A 4DGQA 1SC9A 1BEZA 1HKHA 1WPXA 4H7FA 1P0PA 3N0TA 3I2HA 4KEAA 4N5IX 4X93A 4K5QA 4Y2QA 4FLMA 1CUIA 5ALGA 3STXA 5I8PA 1XZBA 4B7ZA 1UOPA 1GT6A 3C6ZA 3ILSA 1LPSA 4FKBA 2WUFA 5HKAA 4UBNA 2WIKA 3GA7A 1RWQA 5HF6A 3D4LA 4Y2SA 2HHAA 1UOQA 1WB4A 2WM2A 1USWA 3ED1A 1AZWA 1TCCA 2XMCA 3R3YA 4B82A 1GKLA 2GBCA 4KYVA 2ZSHA 3O4HA 4N8SA 4BE9A 3TRDA 4EBBA 3A2MA 2WKWA 4BDSA 1BN6A 2OCLA 5IKXA 1CQZA 3I2IA 4HTAA 1UK8A 1CIJA 4EHBA 2HU7A 2Z8ZA 4OYLA 4BBZA 2JBWA 2OCGA 1GPNA 3PFCA 3DLTA 2HA5A 4FFVA 4Y2RA 1ZD4A 4UHDA 2CEKA 3S2ZA 4HXEB 2J4CA 4E14A 1CLEA 2H9YA 3A70A 1GQRA 4HRXA 3KWFA 3O4JA 2VQ6A 4KAJA 3MGAA 2JEZA 4DIUA 3GBSA 1MT3A 1GPLA 4OPMA 1MTZA 5IVDA 1MX1A 1THGA 3FCYA 3PFBA 2HFKA 1XKTA 5IVIA 1CUXA 4B0PA 1C7IA 2PSHA 4RPCA 4Q1VA 4L9AA 5I9IA 3NGMA 4WDRA 4N5HX 3GROA 4BE4A 2AXEA 4M0FA 4BYMA 3SC2A 1SFRA 3ZI7A 1XFDA 1E8MA 4XIIA 4Y2XA 3RK4A 4MWSA 2XUKA 1TQHA 1ZGCA 4FLFA 4HXGA 3FYUA 4TPKA 2AJCA 1FFDA 3GELA 1NX9A 1CRLA 5AOAA 1UK7A 1CUCA 2BJHA 2YXPX 4HVTA 1KU6A 3DKKA 5DTIA 3W2TA 4Q3OA 3WIOA 4ZI5A 5LZ4A 4UBMA 1MN6A 2AJ8A 4KAAA 2QUBA 2ZSIA 2QS9A 1DT5A 3IURA 2PSEA 1IUNA 4KE6A 4MEAA 4ROTA 1KU0A 4DMKA 1ORWA 3ZWQA 5HK9A 3DOHA 4WY8A 4DYHA 2X8BA 2WTMA 4KE9A 4IQ4A 3BJMA 1N5MA 3K2IA 2D5LA 2XUQA 1CUUA 2K2QB 1LBSA 4A16A 2J4FA 4Y2YA 1TAHA 3I1IA 4RE5A 2WHPA 3W05A 1MX5A 1TKRA 1Q83A 1MNQA 5A7HA 3AZQA 4WJLA 1YB7A 5JAHA 1EA5A 3DD5A 3AFIA 4H7EA 3WZLA 4MJ3A 4CG1A 5AM3A 1XRNA 1BCSA 1ODCA 3VXKA 4H35A 3ZLVA 2B4KA 1ZI8A 1DX6A 5AKKA 2OCIA 1QLWA 3H18A 2WG2A 5F4ZA 2JGLA 1BE0A 1QONA 1XZGA 3WJ1A 5CW2A 1RYYA 3Q8WA 4B9EA 3H2JA 1CR6A 5LLSA 3F97A 3PDCA 1DINA 5I7UA 3E3AA 4CCYA 2VT7A 1WB5A 1DT3A 2XUIA 4IH1A 1GPKA 3HABA 5FOQA 5LKAA 3I1YA 5JAPA 4UHCA 2HL6A 1LPMA 2VAVA 4JEIA 5ALEA 2QM0A 1BRTA 1WM1A 1VLQA 5AO9A 2DHDA 2PU5A 2PKYX 1VKHA 3FLEA 1DWQA 5AI8A 2OLEA 1E8DA 5IVHA 3ZPXA 1F6WA 2OAGA 2ZJ7A 2WUGA 2J3QA 1E66A 4WCVA 5EHZA 1YB6A 3TJMA 1QJ4A 4GHWA 3HJUA 5HK8A 4ZGBA 4FWBA 5CH5A 2QTBA 1G42A 1ODSA 2WQZA 2PVSA 1P0QA 3W06A 2DFPA 4DNPA 2XMBA 4QDOA 2H1IA 1GKKA 3G0GA 5CH8A 3DYVA 4B83A 5HCUA 2FUKA 1OILA 5LZ5A 3VISA 4C6HA 5AOCA 5DYYA 2BAGA 1ZD3A 2C5GA 2WJ6A 3B12A 1W1IA 2ECFA 1LBTA 4E11A 3FSGA 3I6YA 3UUEA 5JIBA 3WL8A 1CVLA 3C6BA 3QITA 3STWA 4X92A 4QE3A 3H2GA 2BKLA 1XRPA 1H23A 2PL5A 1EK2A 4U2EA 2ZJ6A 4EZIA 3HZOA 5ALYA 1VA4A 1YAHA 2PSJA 4Q05A 2PX6A 4G8DA 4GI1A 1UT6A 4CIAA 3WK5A 5ALRA 3WKEA 1J07A 3QMWA 1BROA 2Y2UA 4NZZA 1JJIA 2Y6VA 4H18A 3KDAA 3QZUA 5AKGA 4B81A 1QFMA 4CIBA 4I19A 5ALNA 2I78A 2DR0A 1WHTA 5JALA 1ORVA 4OD0A 4RGYA 1YR2A 3DCNA 2XMGA 1AC5A 4GECA 4OU5A 1S8OA 2WU4A 3G7NA 1TCAA 4E46A 4WY5A 4X95A 2H7YA 4FBLA 1VXOA 4DMFA 5T4FA 4P92A 1VOTA 1A88A 2JEYA 2PBLA 3D0KA 4B6GA 1XQYA 2RAUA 3O95A 1XZCA 2QKYA 3JW8A 5AIAA 5A6VA 1GGVA 2QRUA 2CJPA 1EDDA 2QMQA 1THTA 1QOZA 5JAUA 4H7HA 1W4LA 2XUJA 2HA0A 2V97A 4C88A 2VATA 3QPDA 1Y7HA 1H2WA 4EB0A 4J0HA 2XI4A 5C7YA 3A6ZA 4ZXFA 4QLAA 1X2BA 4LYDA 2RHTA 4DSZA 1IUPA 3WL6A 2VJBA 3BDIA 3EF3A 4RNCA 2B9VA 3DYIA 4DSAA 3FCXA 2D0DA 2H7CA 3O9VA 3OG9A 1NU6A 3WKDA 5AKEA 2QXUA 4FNGA 5K5EA 4BDTA 1W76A 2C0QA 1ZD2P 3WIBA 4MWTA 3WI7A 1K5PA 3N2ZB 1K63A 3AZPA 2EDAA 1B41A 5T4EA 3WL7A 3G9UA 1VE6A 4KRXA 5AM2A 5EIAA 1QIKA 4BRSA 5LZ7A 1GQSA 2R11A 1JU3A 4CFSA 5AKLA 5ALSA 1R4ZA 3L1JA 3UUFA 5C81A 5FPPA 4UFOA 2VA9A 4LXGA 4BAZA 5DYTA 4PNZA 3BIWA 1R50A 5AOBA 3F67A 4BVJA 5JD6A 3DL7A 2V98A 5HQ3A 2QVBA 1H2ZA 5JZSA 4UHEA 4D9JA 3ICWA 3STVA 7YASA 5EIEA 4H7JA 3H2KA 1R3DA 1KEZA 2DQZA 4NS4A 4Q34A 5BOVA 4J0GA 3L1IA 1D07A 4O08A 2OGTA 3RARA 4W1RA 4L72A 1FFEA 4UPDA 3C45A 4WDQA 4UFNA 2XMZA 4PSDA 3G0CA 4UBKA 2PSFA 4K6GA 3NOXA 3RM3A 4BCDA 4GEGA 4UHHA 4X6YA 1CUFA 4U2GA 3V1LA 1FJ2A 4J0IA 1CUBA 1J2EA 5CT8A 1QZ3A 3I6MA 2Q0XA 1X70A 4ARAA 3VJLA 2VSQA 2Z8XA 4G4GA 2VEOA 4KAFA 2B20A 5LKRA 3F9CA 3ESBA 2CKMA 2GZRA 5C8ZA 3BE8A 3IA2A 3SK0A 1QE3A 3D5EA 5AJHA 5CT6A 5DLPA 5KBYA 4QNNA 5KWIA 1EB8A 3DEAA 4F0JA 5ALVA 3C43A 5BWBA 5T4BA 3ZV7A 3R3XA 2HA7A 1B6GA 1QIHA 1WCYA 3H17A 4X6XA 2W22A 1YCDA 3P2MA 1HLGA 5LYYA 3WWEA 1U65A 3A2NA 5LP1A 2XUOA 4X97A 1ETHA 3IULA 4AN1A 1PFQA 4UHBA 4GLBA 3NWOA 5DTJA 2J3DA 1T4MA 3G9XA 5E4YA 1UWCA 3FYUC 3WLAA 5JZ9A 4UBJA 2FJPA 5ALUA 1CUAA 3MUNA 1DWOA 1J06A 2BUCA 4GWLA 1RP1A 3X3HA 2YH2A 1Q84A 4QA9A 2C7BA 3CN9A 1MJ5A 1H2XA 1R88A 3I6ZA 3V9AA 1QTRA 3FYUB 1U8EA 3Q0TA 1K6EA 1XLVA 1YAJA 1F0NA 3TGLA 2YASA 3VDXA 2RHWA 5CT5A 1PV1A 1Y7IA 1IZ8A 5SYMA 3U0VA 3CXUA 2H7XA 4Y7DA 5HF9A 4U2DA 4GBGA 1UKCA 1UKBA 1XLWA 2ORYA 5ALDA 2VF2A 1LPOA 5ALLA 2JGJA 5K3FB 5CXUA 2G4LA 1JI3A 5EGNA 1BS9A 1O6GA 1JT2A 2V96A 3PUIA 4KR0A 4LHEA 4UUQA 2CMFA 3HXKA 3WJ2A 4QEKA 4G8BA 1LPBB 2GBIA 1QIIA 2XUGA 4KE7A 4DMHA 3WL5A 4DM7A 1LZKA 1XZFA 1ACLA 4DTCA 4AMZA 3H1BA 2Y1KA 2WTNA 3BIXA 2ZYSA 5HZGA 4J7AA 4X94A 3T4UA 5JASA 3IBTA 3PF8A 2BGRA 1UK6A 5HF5A 2C0PA 3U1TA 3WYNA 5AK3A 1CUYA 1XZHA 4QDTA 1N5RA 3AUKA 1H22A 2G5TA 5ALJA 3PUHA 4PSUA 2OQVA 3H2IA 1EHYA 2QT9A 5K3AA 2O7VA 2ACKA 4QDXA 3I2JA 3C87A 5A71A 3AIKA 5ALWA 4X7BA 3LCRA 5K3DA 5EI5A 3UMJA 2XUPA 3SX4A 4GDMA 5FKJA 1OXMA 2DHEA 4EY5A 1CEXA 1U2EA 2XMRA 2XLCA 5DNWA 4CI9A 3PE6A 2QR5A 3R3UA 2JGFA 5CTAA 1A8SA 3C5VA 1DTEA 2ZYHA 5ALHA 4FFWA 1MU0A 4Y2VA 4G9EA 1P0IA 3FLAA 3VJMA 3A2LA 4OUKX 3DQZA 3D2AA 4U2FA 3WK6A 1TRHA 2BCEA 1P0MA 4BTLA 1R9NA 2EEPA 3O9MA 3I28A 2QJRA 1YA8A 4CCWA 1CUDA 1EX9A 4PO3X 1W75A 4B80A 3V48A 1QIEA 1CUGA 3BJRA 3IUJA 4J0DA 4Z49A 5IVKA 2VT6A 3KD2A 1EK1A 4K6KA 2X76A 4RE6A 1L7QA 1CUWA 3D3NA 3WMRA 1XZAA 1XQXA 2XQKA 3BL8A 1IVYA 1WOMA 2Y2VA 5AM5A 3ANTA 1XZKA 3T52A 1QIFA 2ZJFA 5AI6A 4AMYA 2UZ0A 1ZJ4A 2WJ4A 4BATA 4J0KA 5K3BA 4DNOA 5FV4A 2XB6A 2O2IA 4W1QA 2DQYA 2G63A 1AQLA 3PF9A 3C8DA 1AUOA 3NUZA 1EH5A 2GYWA 3G9TA 1CUEA 4E15A 3IUQA 4KACA 5T4HA 4J0JA 4AZ3A 3H1AA 2JGEA 3WA7A 5EIHA 1MO2A 3DKRA 1ZIYA 3HI4A 2WILA 5ALTA 4EA6A 4OU4A 2DCMA 5AI9A 1QGED 4M0EA 3C6YA 4BCCA 2AJDA 4F60A 2HRQA 4OSEA 3QM1A 3C6XA 3C5WP 1IZ7A 3DOIA 3IIIA 3E0XA 2BUAA 5JZBA 1A8UA 3RLIA 3FBWA 2FX5A 3B3QA 4J03A 4P9NA 3D59A 3KSRA 5AKXA 3W04A 5FP0A 2RI6A 3V1MA 2WG1A 5D3ZA 5FLKA 4W1PA 1MPXA 4PV7A 4MYDA 5HFAA 3HYSA 1QIDA 4FBMA 4XX1A 4P08A 2XQFA 3KWJA 4HS9A 4N8EA 1QO9A 4H7KA 3M83A 2WUDA 3DDUA 2WFZA 2WJ3A 5C8XA 1ISPA 1YA4A 3E4DA 3PI6A 2OQIA 1XZDA 4M0MA 5CH3A 4IHAA 1ZD5A 3R41A 5HF8A 2IITA 1ZGBA 4CG2A 3IDAA 4INZA 2C4HA 4H7IA 4X85A 1EVQA 4Q82A 3QMVA 2OXEA 1F0PA 4K6HA 5A7GA 5FXMA 4C4XA 3G0BA 5D3KA 1Z68A 3AZOA 2GBGA 4IH4A 3QMMA 1PJAA 4PF1A 2CB9A 4P93A 3QPCA 4DMCA 4KE8A 3PICA 5ISMA 3D2CA 3WK4A 1HL7A 2W6CX 4EY4A 2QUAA 4UBIA 4AB1A 5DJ5A 5ESRA 1IMJA 1HQDA 1YSCA 4WFKA 1LPNA 3H19A 1UKAA 2CZQA 5ALKA 2XUDA 1L7RA 2Y6UA 4X91A 3FNBA 4WFJA 2VAXA 1G4HA 5AM4A 2VTVA 4YX9A 1XQVA 2ZYRA 5J3JA 2PUJA 4PQEA 2HA3A 5A7FA 2VJAA 4AO7A 5H3HA 3R3WA 4EY8A 3W9BA 5AP9A 5EHNA 1JFRA 3W9UA 4LXHA 5AK6A 2V9ZA 3L1HA 3LIIA 1WHSA 2JIDA 3G02A 2ES4A 5AM0A 2HADA 1UFOA 5FRDA 3O4GA 4ITVA 4BC1A 5BWCA 4FLEA 2WFLB 4I4CA 4X00A 5AH0A 2Z3ZA 4JUIA 3ANSA 4JYPA 5A62A 4B0OA 5HKBA 3AIOA 1AMNA 5C8VA 3H04A 4ARBA 5FDFA 1U4NA 4H77A 5SYNA 4F21A 1CQWA 4DNFA 2QZPA 2I03A 3OURA 4WFIA 5AK5A 2B61A 3ESAA 1IUOA 1MAHA 5KWJA 3OTQA 2XUHA 5E4TA 1BU8A 2JGIA 5FPQA 4FDMA 1FSSA 2XDWA 1FFAA 1JKMA 3OPMA 1MAAA 1LLFA 2AJBA 2PM8A 4MQMA 3DNMA 2XT0A 4Q3LA 3VKFA 3G0DA 3STYA 3BF8A 4TGLA 4XWGA 3K6KA 1CUHA 5DNVA 1DWPA 4B9AA 2PU7A 3F8SA 3V1KA 3S8YA 4L0CA 4MQLA 4G9GA 3C8HA 3HACA 5HQ3B 2C58A 4QLOA 2G5PA 4MEBA 4BB0A 2HA2A 5K3FA 4G4IA 1DX4A 1YS2X 4ZV7A 4BAUA 3CN7A 1O6FA 2HA4A 1VZ3A 1JJBA 3M81A 5AKIA 4HAIA 5JANA 3QYJA 3LP5A 3OOSA 4C4YA 4JNCA 1LNSA 1JMKC 1E8NA 4HZGA 3ICVA 4XJVA 4Y2JA 1YASA 1Q0ZA 3K9BA 3FVRA 5AI4A 2DSNA 5JAOA 4B85A 3I2GA 5EFZA 4FMPA 2WIGA 3WYDA 2IX9A 4G4JA 2RGUA 3WWDA 5AICA 2HFJA 1TCBA 4LYEA 2HU8A 3MVEA 1CPYA 3H2HA 2XQJA 2QJWA 4FNMA 1SCKA 2WU3A 2ACEA 3STTA 2OAEA 4C89A 4OB7A 3BWXA 4X71A 3TEJA 1JMYA 2XUFA 4UBLA 4UHFA 4A5SA 4ZREA 4H7DA 3CCCA 4LIPD 5E4JA 1XRQA 5CBKA 1OCEA 5AIBA 1AX9A 3ZLTA 3E1GA 3AINA 1XQWA 1XLUA 3FAKA 1T2NA 1X2EA 1MX9A 1ODTC 1JJFA 3WA6A 5AM1A 2O2GA 1UZAA 4EY6A 3WWCA 5FUMA 5CXXA 3FYTA 5D6OA 4QDUA 1G66A 3GFFA 2WIDA 2AJLI 1R9MA 2PSDA 4G8CA 3H0CA 4ZV9A 4F5ZA 1E89A 1L7AA 2I3ZA 5ALMA 2WIJA 5ALFA 1CUVA 1CUSA 5JD4A 3O0DA 4FOLA 5DNUA 4X3CA 5E2IA 2C5FA
chains in the Genus database with same CATH superfamily
4C0WA 1DVRA 1NLFA 3AFNA 2FLWA 1NXVA 1TUBB 4DMRA 4EUSA 4QL3A 4R5MA 3VRHA 5A06A 1Q7RA 3TLGA 5JC8A 4QUJA 2OQ2A 1QP8A 4ZWNA 4ID3A 1C7JA 1P72A 2TYSB 3FRIA 2BGNA 3TUIC 3UUWA 4MRPA 3DV2A 4MRAA 1SOAA 3MNFA 3KKPA 1WXFA 3DCYA 4K0RA 2WW8A 3ESDA 1VPDA 1X1CA 1QORA 3OLCX 4FMBB 5A9SA 4AUKA 2CUTA 3AESA 4NATA 1WKVA 4PICA 1OWNA 5K3EA 1EK5A 3AY3A 2Z57A 3U37A 2IBTA 2VRCA 1NUHA 1ZVJA 2WTXA 5DO9A 4AUEA 2AFIA 2XGMA 3L7IA 3AR3A 1NC3A 1TL7C 4A23A 1PYGA 3SSOA 1Q44A 4BIIA 2VZEA 3HCRA 4ZHQA 5T8KA 2B1IA 2H57A 3IELA 1OXXK 4NMLA 4B71A 5DZSA 2AYYA 1C14A 1DCMA 2ZTLA 3K53A 4PIPA 4BVKA 2X7XA 2FUEA 2UYOA 1E0JA 4CL8A 3IVAA 1MO4A 3ZYZA 6YASA 1Q22A 5LYJF 3E22A 3MSXA 4GICA 1KIFA 2P9FA 1HDEA 2X0IA 3AFGA 1E9RA 1VIDA 3RI3A 3UWKA 1XCGB 2DXIA 3V4FA 3L41A 5IK2A 4DWOA 4XDYA 2YMLA 3EGVA 1NI3A 3N0RA 3KXIA 2P6PA 4I5FA 2NMVA 3CCBA 4C6RA 1EI9A 1KL7A 5AUPB 3QW2A 4X62B 2WSYB 3N05A 2H5JA 4LJ7A 2QX8A 4OCZA 3MS7A 1VE1A 5K8IA 3T38A 4YO8A 3HDTA 1JFLA 1UT8A 4MVJG 4EAAA 2QGNA 1ZJ5A 5ALOA 1EGMB 3AF5A 1A9PA 3FPHA 4TROA 3WLTA 5KMGB 1IBKB 3O2SB 3E3OA 1NU8A 3QYPA 3I6IA 3G6WA 4JA0A 3EDCA 4UNSA 2AW5A 2R87A 3SJAA 2BWJA 1FJXA 1MB2A 1WBJB 1Y81A 2FSVC 2W2KA 1J97A 1V4NA 4NNJA 4RKYA 4DBLC 4ESHA 2OHVA 2NZ8A 1ZWLA 5TT1A 3OEHD 5KQGA 4MDFA 1YDGA 2OG1A 3D02A 2QVXX 3FHLA 3OZTA 4NAUA 1T25A 3UUGA 4XQCA 3U60B 1CNMA 2HIMA 2V65A 3AQIA 3DOEA 3HHPA 4MUBA 1MNAA 4CETA 4C0AC 5TQ2B 2HQBA 1G3RA 4JBNA 2ZIXB 5EYPB 2QE7A 2GTHA 3IDSA 4F9GA 1KP3A 3VVLA 4TYMA 5FT9A 3PYXA 3GY0A 1G5RA 1Z5PA 2RBEA 3WKCA 1QFXA 1PG2A 1V3TA 3MXTA 5B7NA 1TM5E 5CDGA 5I7HA 1K8YB 4OXYA 5ALXA 4ACBA 4BVBA 1JHMA 4MQ5A 4OM7A 4QXMA 2QXYA 4G5FA 2NT4A 1D2AA 3GZJA 4NHEA 3DZGA 3DT9A 2QLTA 3W5JA 5LOVF 3OO0A 3FNEA 3ZD7A 4JEHA 5ERGB 1UZLA 1QDEA 4CV1A 3ISTA 2ZKLA 2QVYX 1EMDA 5KNBA 3QU9A 2P9TA 4UMFA 1IN1A 2E3JA 1RQRA 1H1TA 2XF2A 4OHBA 1OBFO 4Q00A 1AURA 1LPAB 3D43A 4C08A 1SXJA 3MWYW 2V3CC 2H08A 1ZHFA 2ODNA 3GRPA 4MUXA 4KPEC 4L5JA 3HYTA 3R0VA 4P7KA 5IFKA 4OGKA 2J9FA 2ZB4A 1HKUA 1EUCB 2IZ5A 2ZQYA 2MOKA 2QSYA 2ZS8A 3V8NA 3DZFA 3EZ7A 5L8VA 3OVMA 2F8LA 4KXVA 1KI6B 5ENZA 2MDTA 4LDRA 2ROQA 5JCJD 4FXPA 3LO8A 3Q9SA 2XVMA 4DV5B 1J1IA 2ECOA 5HILA 4XA8A 4UBOA 1NNLA 1UK9A 2IH5A 3DE5X 1JJ7A 4HLDA 3RC7A 3U7QA 3V1NA 1KY3A 5KTNA 1X1QA 3T35A 3GUVA 1QHGA 3D7RA 5DI9A 2PPLA 4NHOA 3FOFC 2CLEB 3LKVA 3ZHTA 2AE1A 2A9VA 1K8QA 1RC8A 3RFVA 3EMDA 2GN6A 1B26A 2AF4C 4TSFD 5G0SA 1F3LA 3DTYA 2RAFA 2Q7DA 3M2PA 3INNA 1JN0A 3MM4A 2OHXA 1B1AA 3W4KA 4JL8A 3SM9A 2CV2A 4F84A 4U7PB 1SXHA 3F7TA 1U7UA 2P67A 4UVDA 2IHZA 3AC0A 3JARA 3IT2A 4S0XA 3K0EA 1V7QA 3G2PA 2CFRA 1K9VF 3U26A 1TZ2A 2HDWA 3JQCA 3EVNA 3LBFA 4LMRA 3T9AA 4H6VA 3UIEA 1EXWA 3QBJA 4YAUA 1RWXA 2CE2X 3ZIAD 2QP9X 3LWBA 3QJYA 2P4HX 3QVMA 3QKIA 4GC9A 4CQJA 3LP8A 4M3NA 5C1BA 4WFQA 4HNAA 1TMKA 3Q3JB 4N5LA 7REQB 3T06B 3V7UA 1JALA 1UXOA 3EE6A 5HQJA 5FEUA 3NDBB 4INJA 3CQ9A 1VHLA 3LUPA 3S55A 2GO7A 5HE9A 4B6PA 5A4DA 1QQTA 1B6RA 3EZFA 2XWBF 1VMEA 4EB3A 2Q49A 2IXDA 2G06A 3ZWMA 3P9ZA 5JYBA 2GM5A 4CLOA 1PX2A 1S8AA 2NYAA 3CPJB 3PEVA 4FFLA 5HFNA 1B1CA 4L07A 4CF5A 2Z1MA 3GEIA 4CT0A 5GZ1A 2HQ1A 4QHTA 4XVCA 5LQNA 2V5VA 5JAMA 4MRRA 2K4MA 2QVCA 1L7XA 1SOVA 2P79A 3NB0A 4K88A 4QULA 1UPAA 2QORA 4QJIA 1N8SA 4CMCA 3VOTA 1DKNA 1H69A 4PHGA 1VLJA 4J4BA 1EJ0A 1GU1A 3C97A 4NMWA 1KO5A 2AFIB 2EFCB 4PC6A 1KMIY 3VU8A 4ZAWA 4MV1A 3DPUA 4GZLA 5BW8A 5LMUB 1N1GA 3MJFA 4KIWA 1ZOPA 3HUTA 2WFLA 5JD5A 1T15A 2M2IA 4B8WA 3OE7A 4BRZA 4R2JA 1QGUA 5REQB 1ATIA 1PTJA 1ZH2A 1QZTA 2DPGA 2HLPA 3L0CA 4J2HA 2ZIZA 5LMZA 5IUJC 1KJYA 2OZEA 2ZPAA 1Z63A 2AVDA 3JALB 3PSAA 4OK5A 1Y4AE 5LBTA 3KCQA 3RTEA 1XRJA 3TW8B 2R7AA 5LQAA 2YKGA 5KYUB 5KU1A 1J9EA 2NUTA 2RHMA 1U1EA 3KAJA 2AG6A 4ZYVA 5JAZA 3AO0B 3B9BA 2FF7A 3E9CA 1ZD8A 3C85A 1KOFA 2P2DA 3KTAA 5EWLA 4ZEWA 1EXDA 3D7LA 4YXWA 3E4CA 1UOEA 3VR6H 5F3WB 3PIIA 3EQ9A 1N2GA 4A82A 4LI3X 1KZ9A 2AG8A 5B2ZA 1NMQA 2IY9A 1Z8NA 4MGKR 4NPAA 4TM8A 5F52A 1YB5A 3SOZA 4PFJA 4TSRA 3KAKA 4BCBA 2YHSA 3O8DA 4RSHA 3EG9A 2QSJA 1A9YA 3C1UA 4BS9A 1T2DA 3TAXA 4M0KA 2W00A 2XLBA 1XWIA 1XYGA 4KPUB 5BSHA 1TUIA 4LYHA 1FX0B 1K97A 4PG7A 1ZINA 5FAKA 2GHRA 3SJCA 1EFPB 1SH7A 4YASA 2ZP1A 3DV0B 3RREA 4AIIA 3BILA 4WKBA 1MFPA 5FJIA 3VO8A 2MHCA 5FL7A 1FNDA 3JTEA 5EIFA 3RTCA 3VJKA 1MO5A 3L5KA 3SC4A 1Q1AA 5IH7A 3EASA 2ISCA 4NZPA 2Q9BA 1B8PA 3WBFA 1HDGO 4YAKA 2XBMA 1VPTA 3NX4A 3PBKA 5DVZA 2DHCA 5C51B 1QTQA 5FBHA 3AVOA 1IXKA 4FPXA 2DUNA 5AW9A 1ENPA 1X1DA 1BQ3A 2A9RA 4NCNA 3QIVA 3H1EA 1HDXA 1XZLA 2AS0A 1WP9A 1JG4A 1H6CA 1RWNA 4FTWA 4TL8A 1D2MA 5E0KB 4IIJF 3TLXA 4D1YA 1IHOA 1VMKA 1G5IA 4YUVA 3ISJA 4FYYA 2PBFA 4RVSA 1NURA 2C4TA 4V0QA 3MS2A 3AU9A 5KKAA 1A69A 1BKDR 2P3LA 4OB8A 1YZGA 1CE8A 3UKJA 4G5SA 3UO8B 2JJ1D 3DL0A 2P4EA 2V3VA 1L8XA 4N8DA 5EXSA 5G3YA 1IHXA 4UNNA 4MCIA 5CFZA 4PYJA 2WZCA 3IMCA 3GZ4A 2C4KA 3PCXA 4YJ2A 3KOMA 5FOXA 4D4JA 1ADJA 1HQYE 1Y9EA 3EOAI 5B5SA 3GEDA 5D85A 5AJTA 4MWZA 4MYUA 3ZHBA 3NT4A 1H42A 3VPBA 1BW9A 3CURA 1E4EA 4ND8B 5FL3A 4YCDA 3CS3A 5H82A 1Z5OA 2I4IA 4MR9B 3PKZA 4OXRA 3HA2A 3EIEA 1KI1A 4I9NA 2AFHA 1CY6A 4PZDA 3N2GB 1KQGA 5KINB 2P90A 2A58A 5CVEA 1YMUA 2HREA 3AKEA 3QELB 2O07A 5JYEA 5IT9A 2E5WA 4CM8B 4FOOA 4G2NA 1S7CA 2C2YA 3L8YA 3LBAA 3VAAA 3I61A 1OLXA 1QAQA 4XEHA 2SCUB 2O7NA 2RKBA 4L5YA 3PJGA 4JA2A 2GAAA 4G97A 1W73A 4U63A 3W7BA 4MYCA 1YMQA 1ZICA 2J3KA 4NMHA 3A1TA 4QWMA 4ARZB 5GJBA 2P9BA 5EFOA 4IIEA 4QUDA 4C87A 1P17A 3EDQA 2EDCA 2FPIB 1SBQA 4R6WA 1WDMA 2YHIA 3ZCTA 4FI3F 3FCCA 1LGYA 4JITA 3WFIA 2J0SA 4N7BA 2W2VA 2O2HA 4GT1A 1U2RA 1SIWA 2MSLA 2V7VA 2VJKA 3WYBA 5M3BA 3LA8A 2KLBA 1R1DA 2VT3A 4JDPA 1OSNA 4OB6A 1PKEA 1N92A 2OVFA 3EF1A 3KG2A 4TTAA 4XYGA 1NZJA 3NAQA 4JXKA 4FZVA 1MJFA 1Q91A 5IF3A 4DFDA 4FCCA 4Z1OA 4J1TC 5BMVA 1XA4A 3CLSC 1XCJA 4UEOA 3V7YA 3TCKA 4O3FA 3VKUA 4CQLA 2Q4OA 3CYFA 1MJGM 1FJGB 1NNEA 2DBYA 4IIJA 3UJ7A 4OUDA 2DUWA 1XTRA 1Y89A 4YACA 1RWMA 4YBRA 3IJEB 1QP0A 2CHGA 4G23A 1IJKA 5BR4A 4Z7NB 4A2CA 1GPYA 3RT9A 4UFPA 4LW8A 3RFXA 4YV2A 1J0CA 1LPPA 1E6EA 1B8VA 2ECPA 2RCNA 4DCUA 3ENNA 2CMGA 2LZ0A 2XQIA 4KO3S 2E82A 1SC3A 3GHHA 2P0YA 1OA1A 4W5HA 2DWUA 1VHQA 4LKOA 4DM3A 2BF7A 2HPHA 5JYCA 1R5JA 3S68A 3QX3A 1OYWA 1XA0A 4I14A 3DLHA 3PWTA 2CBGA 4S24A 5DBEX 3U7JA 4B40A 2A0UA 1E3WA 2XVZA 1JSRA 1N0VC 1BIFA 1HGXA 1L5RA 1RXUA 2FWJA 3GK3A 5ERXA 2GETA 3OSZA 5COAA 5LPNA 4QU9A 3UJNA 3RYTC 2ZOSA 2IPLA 4Z4GA 4NEHB 3GD5A 2W5UA 1XRSB 2MMGA 4ZKEA 3A4YA 4GYJA 4KRYA 4QKQA 4G0MA 1KDVA 4DNQA 4JLDA 4IVNA 4Q7JB 3TR0A 3QU4A 1VA5A 3PR2B 1ZFNA 4FZ3A 4XQGA 3GNQA 1I7PA 3WKAA 2PL1A 2VAPA 2HIGA 3L77A 4BO9A 2ATIA 4CCYB 5KSWB 4BNUA 1Y1LA 4QZVA 3RTGA 2Q2OA 1R66A 2Q1XA 1C4OA 1KKLA 3GEBA 4GP9A 1TM3E 2N47A 4D74A 2QD3A 1GLNA 1M74A 3CNBA 3EBOA 1FK8A 4XGNA 1U3WA 4DLNA 5AI0A 2Z98A 1J4AA 4JI8B 3AR7A 1G9XA 1A8QA 3H8VA 1MHPA 3EQ7A 3IOCA 3QF4B 4JUBA 1R5NA 4UNQA 2G71A 5MFPA 5EPEA 3ZWYA 2DJIA 4NBVA 2X3FA 1NVFA 2YN2A 1O2DA 4IHJB 4EQ6A 3W79A 2JBAB 1U1DA 4MUJA 4QSHA 2I2XB 3QNWA 1JAYA 4OHPA 5ITZA 2QT0A 5AJUA 1VSVA 1GTJ1 4ND6A 5I7VA 1PVVA 1FL9A 1P45A 1TJNA 2P2YA 1T2AA 3OY2A 4LDPA 5LZ2A 4R8MA 2BYTA 1EVJA 3MQ4A 3N1UA 4JYMA 3B36A 1B2LA 3IYLW 1MOPA 4NYJQ 4RKFA 1SG9A 4PS1A 1OAKA 3BDVA 3DAPA 1FYXA 3E9RA 4FD3A 4PC1A 5JD3A 1XX6A 3G9ZA 3HXQA 3WB0A 3AFHA 4R8SA 1YQGA 3QOXA 1W0JA 3C5CA 1V1JA 5TY0A 3PITA 2WYOA 1JA9A 4DGQA 2WKRA 1WPXA 2P5UA 4HGYA 4H7FA 1V1MB 1E7WA 3N0TA 2VKQA 1HZJA 3AWIA 1G8KA 2YXNA 3WHPA 2VTDA 4KEAA 4HUQB 4X93A 3G8CA 3UK0A 2AG5A 4K7JA 4DA9A 2BEVB 3F5QA 4OO3A 2O3RA 1JF8A 1P18A 2P6OA 5GADl 4R9RA 5F23A 2EG5A 3HKBA 2EJCA 5IT0A 3F1LA 4FGKA 4ZOLB 3SZLA 2DKOA 1P2SA 3KB2A 5A4AA 1GL7A 2ZREA 1E9BA 1UOPA 4US2R 5E6SA 2EKPA 2IZOA 1U0SY 5EMKA 2JFUA 2ZIFA 3ILSA 4YRJA 2HJWA 3OKPA 4DA4A 2WF9A 4B3TB 1RXCA 3DZHA 2WUFA 5HKAA 5FWAA 3NKVA 1FFYA 3IUYA 1QFJA 2JCGA 2FG7C 2QX6A 4CMKA 3GA7A 3O91A 2FEXA 2HWYA 5KYNA 2YHUA 1UBKS 2C1EA 3V6MA 3X0DA 3WSVA 5IWCA 3ESZA 3V4VB 2W98A 1WB4A 3RDPA 3AY6A 1F38A 2ZI5A 3B7WA 1L2TA 2OYSA 1TD9A 1USWA 4IDAA 3AR4A 4CDNA 5IAOA 3CF6R 3OKFA 4MS4A 3AEQA 4UQLA 1TCCA 2WWGA 2GPNA 1XCOA 4NYMQ 4F4DA 1QDUA 3PFKA 5FWYB 5L7YA 3CBQA 3OZGA 5C1DA 1JG6A 2EKLA 1K6XA 1PBNA 4PRLA 2G4VA 4R1TA 3AJDA 2RGBA 4KSYA 3TLYA 4PZEA 1WS6A 1C7ZA 2C4VA 2HGZA 4IXTA 2CLHB 2WKWA 2WJYA 5IN5A 4GX0A 5BSGA 1II8B 4RZXA 1XU9A 1BN6A 4UUOA 1N34B 2FGKA 3H3FA 1QH8B 1KYZA 1MABB 5IM4F 4ZCRA 1CERA 4EG4A 5A5FA 1ZP6A 2JBAA 5DV9A 3V1UA 3W7VA 1DQNA 3TSOA 4JJEA 3ZHRA 4F6RB 1ZMTA 1CIJA 4YWJA 3UW3A 4QHSA 2R5WA 3QVGB 4H1VA 3S28A 4DLYA 4EIWA 3FPGA 3T5TA 4C0KA 4TLLB 2QRLA 1G8JA 2Z8ZA 2ZRMA 3IEXA 3RB8A 4YJ3F 2PDAA 2F6RA 1YR1A 1ZK0A 3R6GA 4ZDWA 3S2IA 4BUJA 5K0CA 3Q3CA 5CDFA 1TYZA 1UL1X 2YY6A 3E7PA 3TKLA 2AXQA 3ZCSA 4TMKA 1OPRA 3REOA 1HYBA 1B0UA 3U7HB 4OX9Y 4WNAA 2HA5A 821PA 1JFFA 1A98A 1BD4A 3K09C 4UHDA 5KJ6A 1PVOA 3AVTA 2WV7A 4KFRA 1BOOA 4PSKA 3CR3C 2QB5A 3CUVA 5F1PA 5IANA 4S04A 2GD6A 4AKSA 3JAWB 1IIBA 2W2LA 2ZIWB 4V1CB 1LUAA 4HXEB 4QPCA 2J4CA 2NQ2C 1ABEA 1TAGA 5BYBA 1L8OA 1X1RA 2OLKA 2OV1A 3HKDA 1YI1A 3TXYA 3VBCA 4CM4A 4NLLA 3SCZA 1K7YA 3M9WA 4D80A 3KWFA 3TNYA 4KAJA 4XJSA 1KMCA 5EE3A 1DKMA 3NKLA 5AOVA 1N5LA 2PLWA 3MGAA 5IBRA 1FSZA 2JEZA 4JSRA 1SB9A 2WJWA 3AI7A 3DFFA 4DIUA 2YWDA 3G23A 4PINA 1DXOA 1E63A 3EIUA 1L9KA 1J99A 2OTCA 5KOJA 1MT3A 1GPLA 3RHFA 3GH1A 4W5TA 2EFYA 4P2GA 1Z4NA 1K27A 1OIXA 1U0GA 3FCYA 5EY5B 1BDBA 4ZALA 4N3AA 4UNRA 1ZGHA 4JJKA 5B7PA 3QE2A 3U7GA 5C8DA 1VCHA 3EG5A 3NHWA 1ZU4A 4IIFA 3BB3A 3VMFA 1A5TA 4GKAA 2GWRA 3AX6A 4YP5A 5EKXA 4A26A 4EI8A 4TYQA 2DH6A 2XTNA 4XD7D 3VU0A 1MG0A 2XWQA 1PT6A 2G36A 2X77A 1RQ2A 2Q9UA 2WWTA 1TFRA 3KDPA 4U6NA 3JWIA 4BWYA 5KEIA 1C0KA 2F43A 2B92A 4F46A 1K5HA 3NUGA 4CKEB 1GFIA 1AK2A 4U9IS 3RUDA 2K7FA 1ISHA 5IMSA 2AXEA 1MPTA 1A9QA 4M0FA 3ZDFA 3IP7A 2ZWOA 3Q40A 4TMYA 3HUDA 3U4AA 4S35A 3KUKA 5TGDA 4AJHA 1G8PA 1PK8A 2XOKD 4YDHB 3RVPA 3SVLA 1F0YA 5C18A 2C9CA 2XNCA 3H9CA 1SFRA 1GUFA 1I36A 1E8MA 2C29D 3BFPA 1GRNA 3DO6A 1PR5A 1IHPA 3FUXA 4ND8A 4MWSA 4PBRA 4W7HA 4Y2XA 1NOKA 4WHMA 2XUKA 2ZWVA 3PG5A 4G26A 2XGJA 2HV9A 2QTAA 3Q72A 2PJUA 5H83A 4I5GA 4TYYA 1EA7A 5JWOA 4M87A 3N6VA 1FFDA 1UAGA 2D4AA 2FGJA 2BMVA 3EGDB 1SVMA 3HXPA 3IIEA 4X54A 1GKIA 1UK7A 2CFIA 2KE5A 2MWMA 2AQIA 4JENA 1XELA 1NKTA 4E0BA 1QFZA 2BJHA 3RNOA 1T8PA 3U3DA 3FCSB 3W5HA 4CNQA 4MI3A 2F00A 2LTAA 1Y3FE 3DMYA 5KOYA 5DTIA 3W2TA 2NP7A 4Q3OA 1G291 1IOWA 1SVNA 2BGUA 1YJBA 2FRDA 4M86A 4M7RA 2E1PA 1BW9B 1H05A 2FVYA 2AJ8A 1RZ3A 3IBGA 1OZFA 1XDGA 1DMRA 1B3RA 4KAAA 5CIWA 1WY5A 5BT9A 4CM5A 3L6RA 4ENSA 1RM3A 4IXMA 4D9IA 1W4BA 1LTHR 3KQYA 1G5HA 1N6RA 3IURA 4P2BA 2E0IA 4FM9A 3LDHA 1WABA 1Y5RA 1YU6A 1DJNA 2DTEA 1KDRA 1QWSA 5ES3A 2ZJ0A 5SYAA 5BV8A 2WLTA 3L6CA 4GFDA 4DLLA 1RI2A 3H65A 4NBUA 4YIKA 3BWBA 3K5IA 4K0KB 4MIOA 1Q74A 3RUCA 4TX1A 2GJKA 3D3EA 1AGXA 4TKLA 5CB4A 3NT5A 4GBMA 1N5MA 2ZRJA 3PQ2A 2ZRCA 3C24A 3MK31 1FDTA 1ZLYA 1OTHA 1Z5NA 2VXBA 4IYJA 1RKXA 4U7HA 5JO0A 1ZN7A 2FZKA 2RG1A 1T10A 2CGEA 3AOEC 1KVUA 4RKEA 5LCXA 1DUIA 2MCFA 1MOQA 2I6SA 3KQUA 1KHTA 1Y9AA 1P0FA 1U98A 2VVTA 3UAZA 1HDIA 4PZZA 1GQOA 4RE5A 2IE0A 1R8XA 3AHEA 2F8MA 4OA5A 4E08A 4IMPA 3K0AB 4IGIA 1V11B 1P1RA 3ANYB 4BVGA 2TSYB 5IG2A 1GAQA 3KHSA 4P0QB 4CL0A 5DN9A 3AZQA 1T8RA 3QWAA 4LSMA 3BEOA 4JS0A 4RSRA 1L5GB 3FIJA 1UINA 1XJ5A 4UEWA 2I4LA 2QSUA 1ODIA 4RIIA 3WZLA 1GFSA 1Q3HA 1TTQB 1ZM2A 2WJJA 4Q4AA 1Z22A 4RFLA 2EYUA 3Q7IA 3P94A 3EG9B 3TSAA 1KVSA 2WZDA 1L5NA 3ZU6A 4JSTA 1NW4A 4JLVA 3ZLVA 5AVUA 4EELA 2WTAA 2B4KA 3ZNNA 3IAS1 2XJ9A 1MB0A 2OESA 4LVOA 1NQUA 5H4HA 1GTG1 3DKPA 1C2YA 3C74A 3H18A 4DA7A 3NV7A 1EGAA 1P2VA 1G1AA 2P0EA 3ZE6A 3D31A 1DADA 2JGLA 1BVUA 4LWQA 4EITA 2DP4E 2WJPA 4KN6A 1ONNA 3HUEA 3EX7C 4RM2A 2B8TA 1U8AA 2GR9A 3WJ1A 5BYAA 2QLJA 2FKNA 3I9LA 3V8MA 5CW2A 5KS2A 5K6RA 3N8IA 3Q8WA 5I8ZA 5SZJA 1XTTA 4B9EA 4Q7QA 5LOVB 5HNKA 1YR6A 3BWMA 4HZUB 4C4AA 3TQFA 1I7QB 1I30A 5LLSA 1QP7A 1G3IA 4N5DA 3PDCA 4ZYWA 2ESRA 5I7UA 1XNRB 3OJCA 4DUGD 3C7CB 1NR7A 4IJ6A 3R7BA 1WB5A 5BRNA 1DT3A 1YS6A 3SN6A 3I9MA 3SLKA 3MD9A 2C9MA 2ZIEA 1A9TA 1ZY2A 1O96A 3BJIC 5H5JA 3VC1A 2V7QA 1AKYA 4CZ2A 2UUPA 2GJ9A 2PAFA 3TOXA 3HABA 2WUVA 3KFXA 5IVPA 3KXDA 1PLLA 4KMMA 2J08A 1M2HA 5CVTA 4Z0TA 3FFXA 3S27A 4N0PA 3KJZA 3EVCA 4ES6A 4NYJR 1LPMA 2E5LB 1HDOA 5ALEA 4AJ1A 4EGFA 2AQHA 1ESNA 1OXTA 2FYTA 1YK0A 1BX0A 1V5WA 1E64A 3QKRB 4HQFA 5LNK1 1BRTA 1O0BA 5AO9A 2YVQA 2DHDA 1YOVA 3TDKA 1VKHA 3B9QA 1DWQA 5TPWB 2VQEB 2OLEA 1E8DA 2QUIA 1JJVA 5IVHA 4E2FA 2R6HA 2AEJA 5HS4A 1WSAA 3ZPXA 2OAGA 1W59A 2ZJ7A 5DGDA 2JLSA 3TD6A 4L0QA 2AN1A 4IIDA 4HB4A 4KNVA 4D0RA 1M7BA 4NU8X 2Y8EA 3ANNA 5E6RB 3KL4A 2AI1A 3I76A 1T3TA 1AU9A 2F59A 1Y5IA 2PVCA 2RBGA 4EL0A 1U2QA 3NHSA 1XJ0A 3UW1A 1HF3A 2QRPA 1LK7A 4G0VA 4AW9A 1NYTA 1JIVA 5FA5A 3TQRA 4Q19A 3TJMA 4DRYA 1DTWA 2RHOA 2UU9B 1QJ4A 3GLGA 2VL7A 1LNZA 2YWFA 4QFCA 5DMXA 1PNVA 3ETLA 4NAHA 4OH7A 2HZ7A 5HK8A 2O5CA 3JQ8A 3RHZA 2PWPA 2IU3A 2PJZA 3SZGA 4LDAA 3SICE 1ORRA 5JZOA 3KFVA 3BRSA 1KKUA 3FPEA 2VLBA 2OEPA 3CZ5A 3L05A 2QTBA 4ZKDA 5ADUS 4D43A 4HMPA 5KQPA 1M5TA 4S3MA 5ADVA 2GA9A 4KO2S 2QE6A 4C0LA 1ODSA 3GBVA 1R0WA 2GM4A 1IBSA 2OPBA 3GUHA 3HCNA 1DC4A 3TTUA 1IHUA 5CG2A 2XMBA 4GE0A 3VPDA 1C4WA 4KK4A 4YRFA 1EHCA 3OECA 4IIYA 4BB6A 4DDKA 4ZI2A 2DKFA 3PNVA 4N39A 2JFQA 1HXHA 3VSCA 1ZCBA 4DXHA 3C8ZA 5GZ6A 3JQEA 2VYNA 2PXCA 4V0KA 1BMFD 5LP6A 3JD0A 1C5KA 1KE1A 1QRUA 2JIZA 1U99A 3ANXA 3B70A 5IZCC 3MJ4A 4DV2B 3HCFA 5A4FS 1YFLA 4PFQA 2P78A 3EIHA 3CG0A 2ZRIA 3ILXA 4MA0A 1OILA 4M98A 4W5WA 4RJ2A 3U17A 3WNZA 2ST1A 1FIUA 5BO5A 1B8UA 2QAIA 2VNHA 2MMCA 2XDAA 1P3JA 3B3JA 1E2QA 3BD6A 3QUBA 4H16A 4JYZA 3VX4A 1D8AA 1JQBA 1XLTA 3CF4A 2FFHA 3F5SA 5JAIA 2W6MA 3DFUA 1U5CA 1N6HA 1WKCA 2X2PA 3KU4A 3ME5A 4PYOA 4MR8B 1NVMB 1XTSA 3EFEA 2MIIA 1L6RA 4A0FA 2NZUG 1GAEO 1ICEA 5CPFA 2QTFA 4HDNA 4MVJE 2BH9A 4XPZA 4ONEA 4AVYA 1UBJS 2JFYA 3I6YA 3OZCA 4A15A 2E4WA 1TMOA 4TKVA 5JIBA 2GPWA 2O6HA 4HYEA 4W5JA 1VL8A 3GVCA 5CFOA 1Z38A 5ITSA 1SZDA 1U04A 4KQ6A 1L4YA 3SOPA 1OFIA 2OV3A 3PE4A 2HDOA 2HJGA 4GYKA 2H5LA 4X92A 3DBRA 3H2GA 2BPOA 3D6VA 5ECDA 1WETA 2IF2A 3KR9A 4MWDA 4DG5A 2BKLA 2Q46A 4IDFA 4IP0A 2IBSA 2BMDA 1W4ZA 4GR9A 4V02A 1H23A 2QIPA 5DEOA 3PU6A 4WASA 2P2ZA 1EK2A 1PTJC 1XL1A 1NATA 4ITUA 5FR2A 1B43A 3HZOA 2QE7D 5ALYA 3DD1A 1N2CE 3FKQA 3PRKE 4RH1A 3A04A 2WPDA 2OFXA 4GXRA 5C0OE 4A9AA 3PQCA 2WU1A 4JVSB 4RJLA 3S4YA 4G8DA 4BMDA 4TVSA 4A4DA 2WTEA 3PFFA 5AR1A 3EWSA 3WK5A 1DBPA 4TTQA 2GZ1A 3RSFA 4KLZA 3EXG1 2QMOA 3PIDA 4IICA 1TO2E 3NV9A 3CVYA 1U7OA 3K6RA 5KVCA 1BROA 1J23A 2Y2UA 5CDTA 2G6BA 1AS2A 1E92A 3CEPB 3RASA 1KO4A 3B3GA 3NHFA 4TZ0A 1YCHA 1FPMA 4KV7A 4E70A 3KDAA 2AGVA 1E2GA 2QD2A 3EXEB 4B81A 1AO0A 3UTDA 3MLAA 1QFMA 2NQTA 4MI9A 4D5EA 4Q21A 5HM8A 1DG1G 1V47A 1WKBA 2WVGA 3FGOA 2I78A 3QKSA 4FMCF 4I99A 4YQZA 3SSMA 4ZHQB 2VC2B 1SQ0A 3EXIA 3WGIA 4TMTA 2QZJA 2CBZA 1Y6FA 2AVNA 4CLDA 3ORQA 3QOFA 5JALA 1ORVA 1PQUA 4FEGA 3ZTYA 3F4KA 5T3UA 1LV7A 4IOLA 1SOUA 1U1CA 1YR2A 5EIBD 5KX5B 1WB9A 2IODA 2V4UA 3DCNA 3NGXA 3OEED 4BNMA 3C4VA 1IBMB 3ECSA 4GECA 4EABA 3O26A 2XR1A 3M6VA 3KELA 5GY7A 3UOGA 3GMIA 1ZUNA 2ADOA 2QRGA 1A72A 4R7ZA 1T4CB 4O1MA 3HP1A 4JC5A 1RXVA 5L4NA 3L79A 2C8JA 4G63A 4IXWA 1IN6A 2D00A 1M6NA 2H7YA 1XP5A 1NMZA 3VUEA 3OZIA 3OICA 4DMFA 1VDMA 1FTGA 2DB3A 1VOTA 4EJ2A 3RV4A 1CRWG 1JLLB 1RR6A 2DBRA 2JEYA 2QK4A 3AUSA 5CHEA 5KVVA 3F46A 1Y48E 3QWHA 1Z39A 3NBUA 4HH3C 1XC7A 1BC5A 3NAZA 5DH9A 4JV5B 1BWRA 4RAOA 3GWZA 4MJ7A 3UN1A 2J3EA 4C1BA 4ID9A 3T9BA 3VTKA 4DJJA 3KOUA 4O5AA 3JW8A 2QD1A 2C7PA 1TLLA 2OUKA 2CN1A 5JHGB 1GGVA 2QRUA 3C1OA 4BBPA 1Y8AA 3UQZA 1DEXA 1RPNA 3Q5GA 4EB8A 3WX0A 2XOKA 4RXUA 5KYGA 3B52X 3VR5D 5GIPE 2PUEA 2G83A 1AK1A 1QOZA 1A7AA 1MH1A 4JR2A 3CLTC 2WNHA 4M6WA 4Q16A 3OTIA 2WAMA 3B5IA 2VATA 3IDZA 2ODAA 3QPDA 2JA1A 2ZBVA 3OWHA 3OO1A 4QJ5A 3WGKA 1NW8A 4IZHA 1H2WA 1JHQA 1ZQ9A 2ID7A 1E69A 1FSFA 1E0SA 1XF1A 2V7WA 3ITNA 3MJTA 4H2DA 1JU9A 4R0MA 3O8CA 4NH0A 2F3RA 1YVRA 3GZNB 1VKJA 4P4LA 3U81A 3RBAA 4CR8A 3WGQA 4EL5A 4PN3A 5HZKA 1KJNA 2H1VA 2QP4A 2ZUBA 2P9EA 2FZ4A 3KXKA 1FVXA 3Q7TA 3R44A 4B8ZA 3HR8A 2J85A 3ZE0B 4L9RA 4A2PA 1WMAA 4HVLA 1LQUA 1QFYA 4B6EA 5FPTA 1Y4ZA 4PVDA 3BDIA 2DZDA 2QW8A 1DJLA 1VYHA 5LWQA 3HE3A 4ZQEA 3SS7X 2CXNA 3ND5A 4DABA 3DYIA 4L5CA 1XG5A 4OFZA 3TWOA 3E3MA 1EESA 5FUYA 3CVXA 1HFWA 1I1NA 1OR8A 2AK3A 2XTMA 3LDFA 3NTVA 4C1NA 2CV0A 2XJ4A 1EWQA 1HMYA 3HBFA 5DNYB 3KUUA 4JGGA 3GA5A 4OMDA 5LXTA 1EPUA 3SC6A 5FTKA 3GA0A 1BGWA 2ZI7A 1YJ8A 2D0OB 2QXUA 3W1EA 2TMKA 4KREA 4XW2A 4FMCB 4KQJA 5K5EA 1CRPA 2A59A 1PW5A 1VI2A 2IEIA 4LOHA 5EJGA 1W76A 1HEYA 3U61B 1L4UA 2PT5A 3R3JA 5HOEA 3CWCA 3H5IA 4D8YA 3WIBA 1FUUA 3DR3A 1FP4B 1WCV1 1ZBDA 2DFDA 2EGUA 4MUMA 4UXIA 5JMWA 1QGZA 1ESDA 1JA0A 2O1SA 3TFQA 3TTWA 3Q6IA 1A04A 1YI0A 2ZYUX 3A32A 4HNHA 1T3HA 3MGGA 3O8BA 3GO4A 4RWZA 4A6EA 4CCAA 2H18A 4QOGA 4RIGA 4QPJC 2RJNA 4YEDA 4L9WA 4JXJA 3ZHYA 3G9UA 2BE9A 1G2OA 5LFAA 1P9OA 1Y0BA 5AM2A 2BKVA 4X20B 1YBAA 1L3CA 1GLGA 4ZQIA 1HG1A 3W78A 4P0TA 2NU9A 1ORTA 2W2XA 3CKKA 2JK0A 4M9CA 1B8OA 4E1VA 1I6KA 1Z7EA 2ZTHA 4UHKA 4CFSA 3THWB 3NEAA 2RGGA 2ZAMA 5AKLA 2PUGA 3KKMA 5ALSA 3JQ8B 4Q1EA 3UBMA 4EPWA 2KJQA 2PR2A 4QUIA 4Y18A 4LWZA 3UJAA 3QXJA 1LV8A 3V00A 3HMQA 3ZGNA 3T1HB 2P69A 3MW8A 1C9EA 1C1XB 1S2LA 2VUSA 1CY4A 3SMQA 3WDSA 1XV5A 5A9RA 1GWNA 4DR4B 4RLSA 2B8EA 1NDUA 2RH9B 2X9QA 4JVNA 4F7WA 4M4SA 3IR6A 2X8JB 3B13B 3HO8A 3PNKA 3GRUA 4NG5A 4UTOA 3GLTA 5DGCA 3VHLB 2G40A 4A5OA 3LTEA 4C3ZA 1L5LA 4EMUA 3L2OB 1YS4A 1AGPA 3Q1LA 1P1IA 4XGKA 4BFSA 3QF7A 5JVDF 1TDJA 1KK2A 1WUTA 1ZM9A 4ZVNA 1QHHA 5B2FA 1IXRC 2ISSD 2ZCVA 5TPWA 1QNFA 2ZWAA 5AYVA 4BVJA 3HXOA 1SC4A 1M8KA 1N9KA 2X4LA 3AHCA 3OZRA 2RGCA 1K8ZB 2ZRNA 3TKYA 4DLXA 4F4JA 5KYXB 1NJ5A 1QVZA 3DL7A 4M54A 4KQEA 1D2GA 5JZSA 2A33A 3KX2A 4GOMD 1IY1A 4RF3A 4EI2A 2CB0A 5EMNA 2ZE5A 3BIFA 2D2FA 3ICWA 3OFNA 4MVYA 4CEJB 1VSQA 1JQAA 3OFSA 3C3XA 1T4GA 3UAYA 3ZR4B 1CG6A 2CNWA 3ZV5A 1TNDA 4UMVA 2VTBA 4OLHA 3O83A 3THYB 3ZY6A 3UAGA 5DTMA 6ADHA 5HP4A 1IRXA 5BOVA 3EVAA 4HZIA 2M6LA 2EKDA 5C9ZA 3CA8A 1BHSA 2WA2A 4O63O 1JH8A 4CT4B 3B6JA 3L1IA 5HEKA 2RBKA 4N0EA 2PXHA 1D07A 2UVDA 2OGTA 3ML1A 3IVGA 4O08A 1V6SA 3K05A 4M0UA 3DF7A 3HL0A 3H2BA 1UF9A 4LJRA 3TIFA 1X7GA 2CWWA 4IG9A 4E03A 3FDZA 2QPTA 3UMGA 5FORA 3CU5A 4NZMA 5B3AA 1QAOA 4D25A 4UBKA 3R3HA 3PC6A 1C3EA 5JLJA 4E51A 3AF2A 1ULBA 4PANA 1CCWA 1A4IA 2JGRA 2PANA 3WYCA 3TR5A 3ZY5A 1PJTA 1QOPB 1XFAA 2GBLA 1W2WB 4RQAA 5DOVA 4GLFA 5FBLB 4XIJA 3R4CA 4B4UA 1GA1A 3V1LA 4L5IA 4V03A 3VR5H 8ABPA 3Q3EA 4DMUB 1CUBA 3MWDB 1Z0FA 3FHCB 4N9QA 4YB8A 4ZQBA 5CUQA 1QZ3A 4EATA 4WNIA 1SKMA 2N9UA 3I6MA 5AXDA 5DBIA 5LN1A 3I04M 4IBOA 1OC4A 4Q4AB 2ZTSA 2ZR8A 1ZA2A 4CHTA 3RH0A 2YOGA 1X70A 1LX7A 2QRVA 1PLKA 2TECE 3OHPA 1JLSA 5HKLA 1B6SA 2NUAB 2Q7XA 4EG3A 1TTTA 4GQIA 1SQ5A 2Z8XA 5L3ZA 4BU0A 3FAZA 4IRMA 4A91A 4OGGA 2CKMA 4HQOA 5AVJA 5C8ZA 4IJVA 2UYYA 4DNXA 3IA2A 3F3KA 4KB5A 5H1YA 3SK0A 1ULTA 3D5EA 3JRXA 2Z04A 3N8DA 4M1KA 1CEYA 1PVDA 4XB1A 3GC6A 3QKWA 4PIMA 1HE5A 1ZHHA 4RPHA 5D1HA 2F3QA 2CVZA 3DEAA 3DE2X 3GJ0A 1K8XB 1Z9BA 3HCOA 3QEKA 3QVSA 1GG9A 5BRJA 3Q88A 4XRGA 5BSEA 1E3TA 3L8EA 4BFUA 1RPAA 5GONF 2C42A 2PWYA 2ZYGA 5D8DA 1C81A 2Z6VA 1SCUB 1SOWA 3D2LA 3EW7A 1QIHA 1TMGE 2C5AA 1SRRA 4X6XA 1IG0A 2W22A 4NOMA 1IDN1 4PX2A 4AWXA 1F5SA 4ML3A 5A5DA 5FHRA 2F3TA 3M5CA 1PNQA 4MS1A 2L42A 1VLVA 3ZDEA 2BGLA 2HWUA 2J3LA 1U65A 1Z0AA 1NW5A 1HE2A 3H4MA 2ODPA 3LBHA 3EJ6A 1C0EA 1ETHA 1Z6GA 4IGKA 4P7FA 3R2JA 9GPBA 2QLMA 5IUKC 3IXLA 4MV8A 1PFQA 4GLBA 4UZEA 2WICA 3NWOA 5DTJA 3RC8A 3FB4A 3H11A 2PMBA 4FE3A 2REBA 2IUUA 1S3SA 1V1MA 4JUFA 3K31A 1ZBQA 4XIYA 2AMYA 2C5SA 5E4YA 3F7MA 3H9JA 3LC0A 1FYEA 2IPMA 3AFOA 2L19A 3WLKX 1WXXA 5K8TA 2WI8A 5K03A 5EEGA 2ZZMA 1P9LA 1K75A 3UCEA 1ULSA 1CUAA 1G3QA 3HYNA 3MUNA 3IQZA 4UQPA 1DRJA 1EZZA 2WWFA 5G4LA 1C7FA 4GWLA 2G1PA 2GPTA 3I8OA 3KKKA 2YH2A 2G0TA 2XZLA 2C7BA 5IASA 5KVAA 9MHTA 3E81A 1YZYA 2JFGA 1XU7A 2JS7A 2QJFA 1YHNA 1T8WA 2I29A 3JY6A 4KQKA 3QV2A 4B7AA 4Z2AA 5IDVA 1JHPA 4QTYA 3NO4A 2QBYA 1OZGA 2H1HA 1WNTA 4WACA 3MT0A 4C20A 2M98A 2GN4A 4D26A 5FOWA 3EB9A 2O2CA 3C2QA 2GCGA 1U8EA 4BQRA 1OZHA 2VNJA 3O74A 4O0LA 3IP5A 2GK3A 3RW9A 3IPXA 1U8XX 4I66A 3IO3A 5CA1A 3WZMA 1PT8A 3C5HA 4OHCA 3SF8B 1S9HA 1WU7A 1YQWA 5K8LA 1GUBA 2YASA 3BEDA 4CMIB 1I80A 1T0HB 2RHWA 2EF0A 3ZW8A 3ORSA 3LY5A 3IKTA 2W83A 4RM3A 1IZ8A 4ZOEA 3WLIA 4UVHA 3LZDA 4C3UA 4YRMA 5AVRA 2VNKA 2QQEA 4Y7DA 4CKEA 5CLQA 4YAJA 2QNBA 4F04A 2YX1A 3FVWA 3QBEA 4OGWA 4AF7A 1SBIA 3IUPA 1RYBA 3BZBA 2WSSD 3DCIA 2GUWA 1E9VA 2H8GA 2FSSA 2GN0A 3LLMA 3RS3A 2P91A 3B78A 3MJEA 4NF2A 4WOPA 3HKEA 3IQHX 3K1JA 3H5AA 3L8ZA 3T3PB 4B8YA 2VTBB 3R5HA 2P6UA 4DW8A 1ZM3A 2KS6A 2JGJA 4U6SA 4DQVA 5EE9A 3EZ2A 5AW6A 2VCHA 5JZMA 2I4MA 1V8PA 1JI3A 3V80A 4P98A 4YAIA 1BS9A 1ZJJA 1P33A 1O77A 2CDAA 5SY6A 4ANFA 1JSLA 1RABA 3NEJA 3PUIA 4UM5A 4FDTA 2I6XA 3I5AA 4KO1S 4KR0A 5DRTA 2W6ID 3VZBA 1J2JA 1U2GA 4UUQA 3R5FA 3ZTWA 2CMFA 3CT6A 2XA1A 1KGSA 2W4MA 4QX6A 4NJEA 4FGLA 4K46A 1O7JA 3P9IA 4B4WA 3E7XA 2H4WA 2X8WA 2EZ8A 2DLNA 4BXOB 1GILA 1P6QA 1XKXA 1Z8HA 3EWIA 3GZTB 4MRSA 3R7SA 3SGLA 3ZU4A 4BZQA 4IIJB 3KZXA 4ENQA 4KE7A 4D6XA 1M76A 1WZNA 4LNHA 4DMHA 1QCDA 1H2HA 1M1YE 3WL5A 4D4MA 2C95A 1T5LA 4K6OA 4CQLB 4WBXC 1GPWB 4DR6B 4CKCA 2JLWA 1XZFA 1GPAA 1X8LA 4I50F 4ZANA 5CFMA 3KR0A 1I94B 3ZI4A 3GIWA 2ATXA 3R74A 1ZR4A 1AHPA 1PNRA 5HR5A 2BR5A 1DRKA 2VRCD 1V3VA 2ZRDA 1NY6A 5BSVA 1IM2A 1NRWA 1LDMA 2AEMA 2JIMA 2J3JA 4ME6A 3ND7A 4XKJA 3ILHA 3A1SA 2A0WA 3QY0A 2P5YA 3QEMB 2GJAA 2BSXA 5B3JC 5CB8A 3H86A 2XD9A 3D6AA 4C21A 3R0XA 3BIOA 3P9RA 3WLOA 2VNAA 4TLCA 1UK6A 2XWSA 5DT9A 2C0PA 1J8FA 2Y92A 3ORRA 1JQJC 1H3FA 4E31A 2FPOA 1UQUA 2BFOA 4O2BA 5FBQB 4FSXA 1GN9A 2CNOA 1NF9A 2E5FA 2FP4B 3D81A 4CKBA 2HBQA 2GMWA 3OMWA 4JL5A 4QDTA 1N5RA 5AVVA 1J22A 1COZA 1DKUA 2O8VA 2Q07A 3FSRA 2WRZA 3JD1A 4R2KA 5I51A 3GOQA 4B2IA 3N0WA 3DHNA 4C6TB 2K2WA 1MC1A 3O2QB 5KOIA 1Q1NA 3WO1A 1RLTA 1I14A 4Q7LA 5FI0B 4EW3A 1H8EA 3VPFA 3DE1X 3OFVA 2HMAA 1EHYA 4WKNA 5K3AA 2OUIA 3HZHA 3C87A 4FFMA 3BCHA 1HFJA 3FDXA 4G4SO 3K5PA 4D9NA 5FOSA 4NYIR 4X1IA 2IDJA 3A1VA 3VJRA 4Y30A 4L8LA 4X7BA 2Q6TA 4HKTA 4H3SA 3IAM6 1P2GA 4TWZA 3UVEA 3QY9A 1G6Q1 1Y3DE 4RQUA 4KXUA 1WP4A 2OP1A 4QRDA 2QTTA 1Z2AA 4DZZA 2ZRLA 4I0WB 3FFBA 1PZHA 3OQIB 4KQ9A 3SX4A 3ETNA 1TJ3A 2AI3A 4EF5A 4EI7A 3HR7A 4KX3A 2RSLA 1QYDA 4DN6A 1X6VA 2YINC 2DHEA 3QX9A 1CEXA 4UDOA 4L4YA 5DX1A 3WP1B 2J3HA 2WSSA 4XUGB 2YXDA 4NU5A 3D1LA 4GD3Q 3HKBB 3GUCA 3U49A 1GZSA 5AVQA 3OU2A 3UC5A 1NP7A 3FF4A 4I6GA 4EHJA 5AHRA 2QRHA 3BB1A 3Q15C 4CI9A 4ZI7B 2WKPA 3AVVA 2QR5A 1XWFA 2UVPA 3FUTA 5EE1A 4DRXA 2JGFA 2GUGA 5J4HA 1QZZA 4B48A 3T1NA 1A8SA 2PN1A 1DTEA 5DXFA 4AMGA 1Y6JA 3FZYA 5AJZA 4MUKA 4WKCA 4MROA 5EESA 4EJSA 3G3EA 1NLMA 1U2GC 2Q4BA 3CH5A 2MSKA 3BXXA 2C2BA 1U3TA 2QRVB 3V3KA 3K20A 2BFWA 3QIAA 3AB3A 2PWZA 2PXXA 3A3NA 3OLQA 4B33A 1VLHA 5ICEA 3NEPX 2G7MC 2XRFA 3G59A 5KYYA 2ZSDA 4QYWA 1KS9A 1MEJA 3Q2KA 2QUKA 4KFUA 3RKRA 2IHTA 1OH7A 2ACWA 1HYGA 1WZIA 2IS4A 3DWGA 4URXR 2A1UA 2VH2A 3D2AA 4PZ9A 4U2FA 3TPZA 5EJEA 3QMPA 5CU7A 4M1TA 4F4HA 2LDBA 3ZE8A 4BMNA 4BTLA 2CXQA 5DTQA 3PA6A 2XGOA 1ZAKA 3O9MA 1KFKB 1QC5A 1YA8A 2D8AA 2FMFA 4MTCA 3RJMA 4A6XA 4BJHB 1CDZA 2PL9A 1GA4A 3D8RA 1CQIB 2GJ8A 1US8A 3BJRA 5AUQA 3N0XA 3AU8A 4NCXA 3PNSA 3C6MA 3Q2IA 1FOEB 3C98A 3OPNA 4A92A 4DANA 1EK1A 1EBUA 3NZEA 1YI8A 4Q6BA 3H8JA 5F12A 4QXQA 1CUWA 4DC0A 3F73A 4ZJPA 2G5GX 3PB3A 4LHXA 4DQKA 3KQMA 4NIMA 1RWBA 4IXNA 4GXTA 1YKSA 4GC5A 4JXXA 4LXYA 3BL8A 2V55B 3MD0A 3LMKA 1ZNQO 1IHYA 4QIHA 2BI8A 4TZTA 2WWRA 2N1BA 4UE3S 3UK7A 2P2LA 3VZCA 4AN4A 4CQMA 4DMLA 4NENA 3FYHA 4KQIA 5C1PA 3NHRA 1RW4A 3CZCA 4DUZB 1QIFA 4JWTA 2CLFB 3P9PA 2V58A 4M7WA 4B46A 4CEJA 1U7HA 2ZJFA 4U1RA 1FBNA 1SR8A 2MINB 5DCLA 4ZC1A 4AMYA 5LR6A 3TE6A 2UUAB 1ILWA 1RC1A 1QK3A 1ZJ4A 2ANBA 4GBJA 1G98A 1PR2A 2REQB 3EUAA 2HLDA 5JVDB 5DNCA 4DNOA 1PKXA 2V7QD 1VE9A 3NBXX 5BSUA 3E58A 1M66A 2XNDD 3SYNA 3KQPA 4PPYA 2NO9A 3WVNA 1SHJA 4BFWA 2OO5C 4BNIA 2DQYA 2G63A 4L6IA 2G82A 1G8HA 1QCCA 2OBYA 2Q3JA 1UWKA 5LM3A 4ZQHA 1L5OA 4F91B 1DGQA 3GNSA 4C29A 1YZQA 1JQ3A 1EH5A 1F8XA 4K03A 2QI9F 3RFFA 4CBVA 1RZVA 2PZGA 3K0CC 2FI1A 3BMQA 4BN5A 1UKEA 3IJ5A 4E15A 2Q50A 3IS3A 2OXFA 4CKWA 3CIOA 1HEUA 5TT0A 3V4SA 2JGEA 3WA7A 4HQNA 2QM8A 3GFRA 3QJGA 4ECAA 2I5PO 1GVNB 4LZOA 3WYFA 2IS1A 1ORIA 3L0SA 1MO2A 3DKRA 4PYNA 4JI7B 3THWA 3AYXB 1B15A 1LVUA 4MLPA 4L0DA 2PL3A 3MMXA 2QZSA 1U0TA 1YRLA 3F4LA 4DLBA 4EA6A 1O0SA 2YHIB 3C6YA 2FPUA 4F60A 1WVGA 3CJQA 4OSEA 2E21A 3QM1A 2IJGX 4Q9AA 3I62A 1RMYA 2XCIA 3TW0A 1IZ7A 5C3MA 2SCUA 2QL7A 3N8NA 3E0XA 2RHRA 5E95A 1XTPA 3W5DA 3IPLA 1QHSA 3ZDDA 3B3QA 4ILEA 3LX4A 2W42A 1V9LA 2E4YA 3VR0A 3QGMA 4LZAA 5AKXA 1RWWA 1P9RA 3EYAA 3Q7RA 1ZJZA 2Q2QA 2E4XA 4LQ4A 5K3SA 2BHRA 2EYQA 4KSCA 1EE9A 3CLRC 1G7CA 1KXZA 2PFSA 2QV7A 4WZBA 2Z4RA 1XQ9A 3WWZA 3I6BA 3WL4A 3DVAB 4PCVA 4TYPA 3OZEA 4GGMX 5E1DA 2QRKA 2JLXA 1N25A 1ISJA 3WGMA 1R8JA 1DEAA 3VSAA 1MPXA 1Q77A 4P4SB 4WN3A 3GBPA 1KI3A 4CKZA 1DEHA 2PZMA 4RBNA 5HFAA 4DXDA 3FSEA 1OYVA 2B21A 3AF1A 3MAAC 3HYSA 3RIGA 2XZPA 1IXZA 4YRNA 1WUIS 3ID6C 4DDHA 2VK2A 4OYHA 2DCUA 5BVHB 4FBMA 3GQBA 2J07A 2FH5B 2XQFA 4G84A 3LYHA 3QXCA 3K7EA 1IATA 1QO9A 3MMNA 4H7KA 3NC4A 4UM9D 1P6UA 5IH3A 5C8XA 3E4DA 3H97A 1IG3A 1J8DA 1RC0A 4M0MA 2ZI4A 4MULA 3RLFA 4MHTA 3UB4A 4MA5A 3R41A 3FWPA 5HF8A 2DTDA 1BS2A 4CG2A 4D3YA 1FMJA 1Y1QA 2VH5R 4XCQA 3HPQA 1ZUWA 4BB5A 2HYDA 2NPOA 3DCJA 3BN3A 3LC2O 4PX5A 1XHEA 1B3BA 2CYAA 2HY7A 3I34X 3MJVA 4AMBA 5B30A 2Y0PA 1ZL0A 1QR2A 3OHSX 3SNHA 4KDEA 1KNXA 4XX0A 1Y63A 3P0FA 4YO7A 3MERA 1T4DA 3S7ZA 1Z5WA 4K6HA 2PA0A 3L8HA 5A7GA 3QX7A 2OXTA 3FE2A 3QXSA 2ONZA 2HEIA 3N75A 1CZUA 3I92A 2HDHA 2IHKA 2IV7A 4XDGA 4JP2A 3JWPA 2WZQA 4A73A 2BBSA 2OXCA 4BKMA 1GL3A 4WW0A 1XTIA 4LJAA 3I12A 3QMMA 4OP2A 5KAMA 2WV9A 2WOOA 1PJAA 5KJ1A 2EZUA 3LOUA 5FPHA 1M7GA 2GCNA 3RAFC 2FMHA 4BNGA 1ENOA 2PT9A 1NRXA 2W8BA 1XOIA 1C0LA 4ZI3A 2JFZA 5EWLB 3WK4A 4EUHA 3ZJ5A 3BK2A 3P9SA 2JNWA 2P1RA 3MWEA 5J43A 1I7LA 1KY2A 3U7IA 4UBIA 4NYIQ 2PE5A 3Q9UA 2A9KA 2FOXA 4WGFA 4RACA 1N7HA 4WFKA 1LPNA 5C31A 4X7RA 3BA6A 4BPBA 1QJCA 3CLUC 3H19A 1U63A 2CZQA 4BNDB 1I6LA 2X7JA 1OT5A 2XUDA 3WIDA 2L0XA 3KYIB 3L7DA 2W4IA 1CQJB 2AZDA 3BKWA 3IE0A 3LYLA 4KN9S 4P82A 1N2JA 1AZLA 3BTOA 5KHLB 3K6SA 2GXUA 1N3IA 1TM1E 1C0IA 2LBPA 4HZUA 4OHXA 1G4HA 4MSUA 5AM4A 4AP9A 4AP6A 3H84A 1NPDA 4BNDA 2ZYRA 1JEAA 3FX2A 4E13A 2PUJA 4M49A 5FTNA 4FFDA 4HNGA 4D41A 2HA3A 4QDJA 2M6SA 3T15A 1OA0A 3NYIA 1TLFA 4URYR 5A7FA 5C5IA 2AHOA 1ADBA 3PXUA 4HN2A 4UU8A 5JCZA 2Y1FA 4RTMA 1CJBA 1QB8A 2PX4A 2VJAA 3FY4A 3R0IA 4HCJA 1P1HA 2A67A 3GJ5A 3QPWA 4PXSA 1V96A 4MVJM 1AUQA 3W9BA 2KI5A 4EY8A 1KXJA 3W8RA 1TQ2A 3HJFA 1Y3CE 5FUXA 3JQRA 4XLTA 5TDHA 3PVCA 5CFRA 5AP9A 5TF0A 2B3DA 4KZKA 3S2YA 2WSMA 4M36A 3EZNA 3MB5A 4JJ6A 2ONJA 1NT2A 1ZW6A 3N2EA 3W8FA 1Y8QA 2V9ZA 3COYA 1E1CA 2AUMA 4HPXB 3LCMA 3G02A 3R8FA 1RBQA 2B3TA 3NFRA 4BVHA 1SWVA 1XAHA 3AKDA 2TMYA 4XH9B 3BHJA 1KYQA 1RM0A 3O4GA 3LFTA 2RH4A 4ITVA 4NY1A 5DGIA 1L4EA 4PAQA 1KRXA 3I39X 4XX0B 1Z5UA 2HMUA 4BLWA 1B0ZA 1JXAA 4FLEA 4A2WA 3GLHA 5C5EA 3A6LA 1YHZA 1XCBA 3T7IA 2UYCA 4MYTA 1M6HA 2AEEA 4JUIA 4WXRA 5CJPA 4EMTA 5JBNA 4D9HA 2J67A 1GNPA 3IH5A 3OPYI 2QR2A 5E3JA 1W5AA 3MS4A 3E48A 3LVFO 4RHUA 1E9DA 5C8VA 4S2UA 4QUAA 4TOIA 2FZLA 2PJDA 5K0SA 3HVHA 4ZN6A 1U4NA 5FDFA 3IBFA 2JLQA 3A31A 3B85A 1FQOA 2GEKA 3QVXA 4BV3A 4ZGGA 1OX4B 2QZPA 5G40A 1T29A 1KEUA 1L7MA 1ZM4A 4F92B 4I7EA 2QX9A 4Q02A 3PXXA 3CUTA 5DM0A 3RYFA 3SBXA 1WVMA 3GDWA 1L5FA 1VI5A 2N3ZA 3U4CA 3VPSA 2LIVA 5CITA 5L6MB 2W6IA 1G64A 2VJQA 1TCUA 3PS9A 3ZCXA 2B61A 3ESAA 3CY6A 4G89A 4LZLA 4OI1A 4BLPA 1M34B 3KZCA 5FO0A 2SBTA 1GZ5A 5AUOB 5KWJA 2XXAA 1SVOA 4P4SA 2BGWA 4CLEA 2ETVA 5EZ5A 4JU9A 4X8MA 5E2BA 1BU8A 2GJSA 2R5NA 1YDMA 3FPJA 3HP7A 1G55A 3L4KA 1WTCA 3DVAA 4ICIA 1TQ4A 1W48A 2WTBA 1AHNA 2Z4TA 4RL4A 4LRWA 2PM8A 4ZCPA 4DDMA 1EXMA 5BWCA 1RLOA 3T7CA 4QECA 1PQ4A 3K73O 3DZCA 3IJPA 2DSTA 2XT0A 2PS1A 2D2VA 4Q3LA 2A5GA 3H9BA 1OV4A 3G0DA 3STYA 4BQPA 1X7WB 4IDGA 4MS3A 4YBZA 4K40A 1CUHA 1AE1A 3DFZA 4JT4A 4X7PA 1PL6A 4HN9A 4O2BB 4C5CA 3CVOA 2HQSA 4AROA 3X1ZA 4WK4B 3S8YA 2WR8A 3PPYA 3M4YA 4G9GA 1AKQA 4H3KB 4MQLA 4QLOA 3ZDAA 3KKQA 3SZUA 1WSDA 5EYPA 2HHJA 2KB0A 3BKXA 1IQ0A 1ZU5A 1TX4B 3F49S 4GOXA 3RT1A 4EHFA 1D2HA 1R6AA 2Q0SA 4KN5A 1PQYA 4QUEA 3U3ZA 4ED9A 5MN5A 2R1VA 2VK4A 3HB5X 2WB4A 5DSZA 1XTQA 3TL6A 2Y1DA 3BMOA 5KTMA 1JAIA 5JFOA 2VRWA 3HDYA 1DTWB 1HT0A 1O6FA 2Y68A 4WZAB 1YB4A 4PLCA 5BSRA 4O4LB 3ERCA 1JR3D 2ZWIA 4Y2GA 5L40A 5E9AA 2Q62A 3PQDA 1XD2A 4QSMA 1TJYA 3N53A 1KO8A 4FDLA 1GRVA 5JANA 3LP5A 3U1BA 2OXRA 5KMGA 1QV6A 2JIOA 1NQAO 4JNCA 1XYVA 3FNFA 5K1ZA 4W9MC 1PR3A 1QRSA 1V2HE 3KEFA 2PNFA 4WXMA 5FB3A 1CZLA 1KJWA 3ECCA 3AP3A 4PZAA 1XNHA 3UT5B 5FL7D 5BN5A 5CDUA 5CXSA 3RGWS 4CIWA 1U0JA 1SUSA 3I2GA 4YJDA 3WHIA 2Z2ZA 4BKOA 5A2QA 3HZZA 2WIGA 5HCIA 4FUTA 2HCFA 3GDFA 3MFYA 2FPPB 3B53X 4LDQA 1MIHA 1TF5A 4L9SA 2BFFB 1KA9H 4GMKA 2WP0A 3KQVA 1PR9A 4HQ0A 4MPRA 4EZEA 3IAUA 2IX9A 1YQXA 2X5NA 3DBHB 5CJ2A 4J91A 4UZFA 5JE8A 1TCBA 4LVNA 3TMKA 3ZWWA 3B51X 4LYEA 4XUCA 2HU8A 4CFYA 1XPUA 4ZU1X 5DHPA 3BBLA 3B1VA 4JHLA 5J1TB 3RUPA 4MP6A 1FDIA 3H2HA 1Z0KA 1USGA 1E61A 2HO4A 3I45A 4AF8A 3T3IA 1Y6QA 2QJWA 1ZKMA 2H2GA 4DB4A 5B6JA 4FNMA 1FJHA 1CS0B 1GSOA 2WU3A 4NPHA 4XQEA 1WPQA 2PGJA 3CX4A 1W49A 3PR3A 4QYIA 5A9SB 5BN3A 4OB7A 1VRWA 3WISA 2OECA 2F7SA 4GNRA 4GM4A 4RLHA 3KB1A 3ZE2B 5BV2P 1TYEB 3ASZA 1IQUA 2C2KA 3MTBA 4UHFA 4FEEA 4X0EA 2RE8A 1Q0QA 3SE7A 1PZEA 3A3PA 4Y1RA 3AHGA 3SDZA 1XRQA 3TECE 5CBKA 1U28A 1E6WA 3PTZA 4ZIRB 1BDHA 1NGSA 3E8SA 3ENWA 2HCBA 1ZZGA 4JQSA 1P61B 4AY4A 1R0SA 3JYNA 4G5OA 1UJ2A 1SK8A 4L0MA 3QI2A 4M1YA 4MMXB 2X3UA 4KP7A 4LE2A 1XQWA 1XLUA 2J59A 4DC9A 1X2EA 4L02A 1G20B 1ODTC 1PYDA 1II8A 1E58A 1E9CA 1OKKD 5DI3B 1EJBA 4RD6A 2ZJ5A 2EERA 2BE7A 3L7CA 3W2EA 3ZZ0A 5FUVA 1H8HA 2MYTA 2IV3A 3WWCA 4O2AB 3DEYX 2Y99A 4MH0R 4KMSA 3T7EA 4ZI7F 1N4DA 1GADO 4H08A 3CVWA 1NXQA 4ZVUA 3L4JA 1X8XA 3RSSA 4C22A 3OP1A