2CZQA

A novel cutinase-like protein from cryptococcus sp.
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
205
structure length
205
Chain Sequence
ATSSACPQYVLINTRGTGEPQGQSAGFRTMNSQITAALSGGTIYNTVYTADFSQNSAAGTADIIRRINSGLAANPNVCYILQGYSQGAAATVVALQQLGTSGAAFNAVKGVFLIGNPDHKSGLTCNVDSNGGTTTRNVNGLSVAYQGSVPSGWVSKTLDVCAYGDGVCDTAHGFGINAQHLSYPSDQGVQTMGYKFAVNKLGGSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cutinase-like protein
publication title Crystal structure and enhanced activity of a cutinase-like enzyme from Cryptococcus sp. strain S-2
pubmed doi rcsb
molecule tags Hydrolase
total genus 83
structure length 205
sequence length 205
chains with identical sequence B
ec nomenclature ec 3.1.1.-:
pdb deposition date 2005-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01083 Cutinase Cutinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2czqA00
4K6KA 2QXTA 2CZQA 2XUFA 1ZIYA 5AIAA 2ZJ6A 4LYDA 2XUQA 1I6WA 5JIBA 4BATA 2J4CA 3BJMA 1VE6A 5AKJA 4Q82A 3C6BA 3FAKA 5YASA 3WL8A 4BDTA 4MEAA 3FYUC 4Y2JA 1BRTA 2CMFA 3H2JA 3I2HA 3DCNA 2XUIA 3W9BA 2DQZA 2Q0XA 2WJ6A 1YB7A 5CT9A 1DTEA 2VEOA 1F6WA 1ZI6A 5FP0A 5KREA 3R40A 1CUIA 4Y2SA 2XT0A 1UFOA 3QPAA 2FX5A 5A2GA 3ZLTA 1H2XA 2ZJ7A 2RGUA 5JAUA 1ODSA 2QVBA 4Z49A 4X90A 3KDAA 1O6GA 2WLSA 4P9NA 5FUMA 4KACA 4NMWA 5AK5A 4FFWA 4BDSA 2OGZA 3UUEA 2BFNA 1ZJ5A 5BWCA 4AXBA 5LIPA 5E2IA 3ZLVA 2HHAA 4W1SA 3ILSA 3DDUA 2WUDA 1N8SA 5BWBA 5AI8A 3S8YA 2I3DA 5JASA 4E14A 5CT6A 5DTJA 5HQ3A 2VT7A 2DHEA 1LZLA 3RM3A 1XZMA 4QZVA 3HRHA 5CXUA 2YXPX 4M0EA 3O4HA 1AX9A 1CUJA 3K6KA 2ACEA 3X3HA 2Y6VA 2RHTA 3T4UA 4UFOA 1LBSA 5ALHA 2W22A 1XRNA 5AK3A 1Q0RA 2AJBA 2QMQA 3CXUA 5T4HA 1JJFA 1ZIXA 5A71A 3RARA 1XZFA 3QMVA 5EIAA 5EIHA 4BB0A 2XQFA 4CIAA 5C8VA 1CUDA 1QLWA 4KAJA 4LXHA 2HA0A 3MVEA 1XKLA 2JGMA 1ORWA 3M3DA 1UOOA 5HFNA 1SCKA 1GPNA 3DS8A 4X93A 1DWQA 1T4MA 3WWCA 1TCCA 1RWQA 3HSSA 2W6CX 3RKSA 5FKJA 1BEZA 1KEZA 3PUIA 5HCUA 4E15A 2PSHA 1A8SA 1J1IA 3H2IA 1Q83A 2WIFA 4FKBA 1ACLA 1LZKA 1DT5A 2Z5GA 1ORVA 5K3AA 5IVKA 4OYLA 4BBZA 2XMRA 2XUAA 2X8BA 3BF8A 1CUSA 5AI5A 1H2WA 2QM0A 4ZV7A 1CUYA 2ORYA 4FHZA 2OAEA 4A5SA 2Y1KA 2RI6A 4ROTA 3H19A 3R3XA 2JGFA 4QDTA 5LP1A 5EIEA 3C6YA 3N0TA 3WI7A 2WTMA 4EZIA 5DYYA 2XUHA 4UPDA 3FSGD 4BP8A 3DYIA 3NOXA 1AUOA 3SWWA 4F5ZA 2XUPA 3WYDA 3O9MA 3ZV7A 5CH3A 1Q84A 4HAIA 4B0PA 2VTVA 1KU6A 3IB3A 2XQIA 2WFLB 3D2CA 5ALNA 4J0HA 1B6GA 4GEGA 3GUUA 2QOEA 1XZIA 3C8HA 4DMCA 5F4ZA 4Y2RA 4JUIA 5EHZA 1AKNA 5CXXA 1W6RA 1R50A 4BAGA 4J3JA 5LZ5A 2HA5A 2ZYIA 4X6UA 3V1NA 4ETWA 1HBJA 3AIOA 1TRHA 3F67A 4JEIA 3C45A 1QFMA 1FFDA 1XLWA 1Y7IA 1DWPA 3STXA 2DSNA 1GKKA 4BE4A 4C6HA 5CH8A 5IVHA 3OPMA 1L7QA 3O4GA 2JGLA 2QTBA 1C4XA 4AZ0A 1X2EA 1BCSA 3PF8A 4BCDA 2PUJA 2B9VA 4GHWA 2WU4A 4H18A 1VKHA 2Z8ZA 4B80A 5E4JA 3WWEA 5AM5A 3RK4A 3ESCA 4PW0A 1MX5A 1PJAA 1IUPA 5CW2A 1AQLA 2PPLA 3G9TA 3AZPA 1P0MA 4ZREA 3VJLA 2HRRA 1YCDA 4PSDA 4UBOA 2VQ6A 4UHDA 1QO7A 3I2JA 5CH5A 5AM3A 4UFNA 3C43A 5FRDA 2G5TA 1F0PA 1H23A 4MYSA 1CUWA 2HU7A 2HM7A 4EY5A 1YAHA 3P2MA 5HFAA 4BC1A 3LS2A 2CBGA 3STYA 1XZBA 2ES4A 1G66A 3FYTA 4FNMA 3QVMA 4AZ3A 1EHYA 3QMMA 1JMYA 1QIFA 4HTAA 5A62A 2PKYX 4UBMA 1DT3A 1X70A 4J0DA 3L1IA 1N5MA 4KRXA 3CN7A 3D0KA 2HRQA 2BJHA 5JATA 3IUQA 4X91A 2WIGA 3WA6A 2Z8XA 3ZPXA 5AM2A 2C5GA 1E5TA 2WG1A 3JWEA 5FLKA 2LIPA 1VA5A 2WJ4A 5EHQA 1XFDA 4DLNA 3I2FA 3DL7A 3M81A 4ZRDA 2HA6A 2XLCA 4K6HA 5AJHA 1XQYA 1QIIA 3EBLA 2H7XA 4B6GA 1BN6A 1QIDA 1CUCA 3ED1A 1CUHA 3WKCA 3PUHA 3F98A 1E89A 5LKRA 5HKBA 1EI9A 1K6EA 1UOPA 4QA9A 3E3AA 5AKYA 1JFRA 4KR0A 4Y2PA 2Y6UA 3PF9A 2ONCA 2RAUA 2WG2A 4Q3LA 2GBCA 1EA5A 3G0GA 5JYCA 3FBWA 2XMQA 3WK6A 3ESAA 2JF0A 2VAXA 5AP9A 5ALDA 5ALKA 4B9EA 3AJAA 3I6YA 2D0DA 3G02A 1LPPA 1YS2X 1YA4A 1XZKA 4L9AA 2ZYRA 3I28A 3FVRA 3QMWA 2JIDA 1GT6A 2EEPA 2NW6A 3VISA 1E3QA 2AXEA 5JD4A 3IURA 3MUNA 1QIEA 4KRYA 1WM1A 3H17A 3DEAA 3R3UA 4CFSA 2GYUA 2YH2A 1JKMA 5ALXA 3IVMA 2V96A 2XUGA 2H1IA 4FMPA 4QWMA 3E0XA 4DMFA 1TQHA 1IUOA 4QDUA 3F96A 4HVTA 2JGKA 1QFSA 2ZSIA 2V98A 3F8SA 1YAJA 4TPKA 4Q3KA 3JYHA 1NX9A 4V2IA 5K3FB 2HA7A 2AJ8A 1QIHA 2I78A 3FCYA 5ALRA 5LLSA 3AFIA 4GECA 4ZI5A 1TAHA 2OAGA 1WCYA 5JD5A 3FOBA 5FDFA 3IULA 4DIUA 5CT5A 5T4BA 3BF7A 3K9BA 5CURA 5ALEA 4X00A 1R1DA 2VF2A 2RONA 5K3BA 5ALQA 3KWJA 2C5FA 3A2LA 3AIKA 3G0CA 5E4YA 1CUZA 3KOOA 5HZGA 2ROQA 1EDEA 1UK6A 1VE7A 3F97A 3FLBA 2XMGA 4N8DA 4G4JA 4J0CA 1SOMA 1TCAA 3NGMA 4B84A 4XVCA 4F60A 5ALJA 4OU4A 2GBIA 4EUSA 1VZ3A 1QJ4A 1NU8A 1VZ2A 4GLBA 4BTLA 5AO9A 4BTVA 5ALZA 5AKKA 1GXSA 5FOQA 2WUEA 1QO9A 1LPSA 1ZICA 2GZSA 2IIVA 4BVKA 1ZD4A 3SK0A 5T4FA 5AM1A 1MPXA 3G0IA 4XIIA 3I2GA 5HF8A 2PSJA 3CCCA 5DJ5A 3WZMA 1SCQA 4DNPA 1PV1A 2XUDA 2GYVA 4OPMA 1W76A 3TEJA 1XZHA 1CPYA 3V48A 3E4DA 3OC0A 5DNVA 4PNZA 4IQ4A 4I4CA 2X5XA 2WIKA 4TGLA 4BCBA 3M83A 1WPRA 1CUXA 4BAZA 3QITA 4PO3X 3WWPA 4UBIA 4DM7A 4I3FA 4GXNA 2ZYHA 1HKHA 4YK7A 3H04A 4G8CA 4D9JA 1VOTA 4X97A 1IUNA 5JZBA 4C89A 4Q3OA 2C4HA 4OB6A 4G1FA 3ICVA 1TCBA 3AILA 5HF5A 1O6FA 1K4YA 4X92A 1BS9A 5AI0A 1CLEA 3GFFA 1H2YA 3A70A 5CRIA 4N8SA 2O2GA 2FJ0A 5AOBA 3HEAA 1XZCA 3OTQA 1DWOA 1F8UA 2WQZA 3D2AA 1MAHA 3FYUB 4BRSA 2QUBA 3G8YA 1U2EA 5D3KA 2XQGA 1IZ7A 5AI9A 3WQHA 3STUA 3H0CA 2BGRA 5K5EA 1EK2A 4X6XA 4PF1A 3OURA 4J0IA 3C6ZA 4QDZA 4UBJA 2JEZA 3STVA 2G63A 1VXOA 5EHXA 4FTWA 2WUFA 4QDOA 4MJ3A 1GQRA 4GI1A 2H7CA 2HA3A 2RHWA 3IA2A 2GBGA 3W04A 4CI9A 2Z3WA 4CG2A 5A6VA 1DX4A 4C88A 2XMSA 1ZJ4A 4B82A 1CR6A 3W2TA 3G9XA 6YASA 3NWOA 1FFCA 2VJBA 1CRLA 4EBBA 1QE3A 1U8EA 3IIIA 4ITVA 1GZ7A 1PFQA 1CFJA 4G4GA 3V1LA 5IVDA 1LNSA 4GWLA 4YPVA 4J0GA 5ALYA 1ZGBA 1WHSA 2CJPA 4MQMA 4U2EA 2XUOA 1QGED 3PICA 3DKKA 3QZUA 4G4IA 1UKCA 1HQDA 3VXKA 4P93A 1A8QA 3DL4A 4FOLA 3B12A 2V97A 4NVRA 4WJLA 2PSFA 1OILA 2PBLA 2G5PA 1VJ5A 3WWOA 4RPCA 5AIBA 1A7UA 2C0QA 2GZRA 2DHCA 1BEEA 1W52X 1DQZA 5FV4A 3TGLA 4U2GA 2OXEA 4NS4A 5I7UA 5ALGA 4W1PA 2VATA 5K3CA 2OCIA 1R9NA 2VJCA 5ALUA 2VJAA 4WDQA 1LLFA 2WFLA 3W9UA 1XQVA 2RIPA 4H7IA 1IZ8A 4DSAA 4UBLA 1F0NA 1MN6A 4WDRA 1ISPA 3KD2A 4MYDA 4UHCA 1VA4A 1BN7A 4G5XA 4U2BA 5D6OA 1UK9A 2PUHA 5I9IA 1TK3A 1W1IA 3CCBA 4Y2TA 3G0BA 1C7IA 2Y2VA 3DYVA 1XLUA 1JJBA 4H77A 5DNUA 2PSEA 1MU0A 5JZ9A 1QONA 3IUMA 3GZJA 1J07A 1A8UA 1CUGA 3ICWA 4Q05A 4HS9A 1MT3A 2WM2A 4CCYB 2HL6A 5HF9A 4P92A 1YA8A 5HKAA 5IVIA 2DFPA 2I3ZA 3BE8A 1K5PA 4FDMA 3VDXA 2JGEA 5ALMA 2ZSHA 2XLBA 4WFJA 3STTA 3FWHA 4B85A 2B20A 3G9UA 4H7HA 2FJPA 4G8DA 4JYMA 1MNQA 4JYPA 4FLMA 2WSLA 1J06A 5JALA 4QWWA 4WY8A 2O7VA 1IVYA 4BYMA 1EX9A 1YSCA 4UHFA 3WMRA 2WUGA 1X2BA 4EHBA 1G42A 2PM8A 1T2NA 5KWIA 2XDWA 4KAAA 5DLPA 5A7FA 3V1KA 3GBSA 2JBWA 5LYYA 2QS9A 1XZJA 3VVMA 3QH4A 2WILA 1LPNA 2DR0A 4IH1A 3WIOA 2ZJFA 3QYJA 1EVQA 1W75A 1CEXA 1AZWA 1CUFA 3VVLA 4KJXA 1Y7HA 3ANTA 1ZD2P 2WU3A 3WKDA 2C58A 1EK1A 1W4LA 4TVKA 4AO6A 4KE7A 2OCGA 4BAUA 3UMJA 5IKXA 4XWGA 5FPPA 5JZSA 1CUUA 1ODTC 1BU8A 3U0VA 2VAVA 5H3HA 4AMZA 3C87A 1S8OA 3EIOA 1K8QA 3JW8A 3LCRA 1LPBB 3W06A 1CV2A 4UHHA 1ZOIA 5CT4A 4G9EA 1FFAA 3GA7A 2QJWA 5E4TA 2GBFA 4GDMA 3HABA 1R3DA 3L1HA 3DLTA 1L7RA 3N2ZB 5ALIA 3QPDA 1USWA 2CEKA 4LXGA 3LIIA 2D5LA 4MQLA 4AQDA 1WB5A 4PV7A 4BRZA 4LHEA 2ZYSA 3IUJA 1SC9A 1ZI8A 2AJLI 1E8MA 4OUKX 5AI4A 4LXIA 5AM0A 5AKLA 2IITA 3QBJA 3WL6A 2XE4A 3EQ9A 2K2QB 1P0QA 4ZGBA 2FUKA 3Q0TA 3I1IA 2EDCA 1TKRA 4OD0A 2EDAA 1EB8A 1UWCA 4Y2UA 4JNCA 5HK9A 4AB1A 1EDBA 1SFRA 1ZI9A 4XX1A 4IH9A 4YASA 4QLOA 4B9AA 1UKBA 4S0XA 3H1BA 4MEBA 4MWSA 1CUBA 4W1RA 1CUEA 3BDVA 4DSZA 3ZLUA 4Y2YA 4A16A 1LPMA 1E8DA 4H7EA 3VKFA 3RLIA 4CG1A 7YASA 1XROA 1MAAA 1J2EA 3IBTA 2JGIA 5I8PA 3D59A 4H7KA 2HFJA 3HI4A 3ESDA 2XMBA 5JANA 5ALOA 3I6ZA 1Z68A 4YX9A 2XUJA 4AO7A 5DTIA 1ZD3A 4U2CA 2WG0A 1UKAA 2OPHA 4C4YA 1K63A 2WIJA 3BIXA 2WHQA 2WHRA 5K3DA 1QIJA 4HXGA 5AKGA 3LIPA 2HIHA 3BWXA 5LZ4A 3OG9A 3AIMA 1THTA 2VT6A 3LP5A 4MWTA 1E8NA 3W05A 1QZ3A 2CB9A 1XZEA 3R3WA 5K3FA 2HADA 2WHPB 1JU4A 5ESRA 1XQXA 2QXUA 1DINA 4Y9SA 4BVLA 2H9YA 4DMKA 3AZQA 4Y2VA 3PFBA 2I03A 1GPKA 2JGJA 1MX1A 4J7AA 4LKOA 1XRMA 3WK4A 3G7NA 2XQKA 3CN9A 5DNWA 5KWJA 2J3QA 4HRYA 1UK7A 4RE5A 5IH7A 1UZAA 4BP9A 4OB7A 4WY5A 1AMNA 4X7BA 4DYHA 4DGQA 1JU3A 2XUKA 1Y37A 4FLEA 4H0CA 1QIGA 5ALFA 2QRUA 5J3JA 1THGA 4K5QA 1EXWA 4QLAA 5LKAA 1C7JA 2J3DA 3WL5A 1WB6A 3L1JA 3WK7A 2XMDA 5EHNA 4DTCA 2OQIA 2DQYA 1E66A 2YASA 1YS1X 2Y2UA 3GROA 4X85A 3R3ZA 1JMKC 2YYSA 3G9ZA 4ARBA 4UBKA 2BAGA 3WYNA 4J0KA 1EINA 1LGYA 1IMJA 2ECFA 4W1QA 1LBTA 4C01A 2B61A 3BIWA 5AK4A 1XRLA 5AOAA 4P08A 4KE8A 3C8DA 4RE6A 4M0FA 2QUAA 5AM4A 3FVTA 3DKRA 2HDWA 1KU0A 1TIBA 1LPAB 1M33A 1SCIA 3O4JA 3R0VA 1RP1A 4WFKA 2HA4A 5C8ZA 4L0CA 4Q1VA 1QTIA 1YB6A 4FLFA 4OCZA 1WB4A 1LPOA 3PFCA 3WKEA 4DNFA 3AZOA 2P8SA 4EA6A 5HQ3B 5KBYA 2R8BA 3KSRA 4ZWNA 2QT9A 4Y7DA 2GYWA 5C8XA 3ZI7A 2PX6A 3PI6A 2C0PA 3STWA 5SYNA 3FYUA 5ALWA 4F21A 2QZPA 3I1YA 3SX4A 5JADA 5EFZA 5C81A 2PU5A 4J03A 4OSEA 3C5WP 5ALTA 1AC5A 4CIBA 4U2DA 2OGSA 1XRPA 5EGNA 2WKWA 4W63A 4EY4A 4WFIA 1FSSA 4BE9A 1VLQA 1H2ZA 1UT6A 1GKLA 4FWBA 5JAHA 1DU4A 3H2KA 1XKTA 2VJDA 3SC2A 1BROA 5CT8A 1ACJA 1ZGCA 3TJMA 4PQEA 3C6XA 3EQ8A 1QTRA 3MGAA 4X94A 4ARAA 1N1MA 4JH0A 5AICA 4CG3A 5T4EA 1GPLA 5AKZA 1DQYA 2C7BA 2BGNA 5LZ8A 4KE9A 3PDCA 5A7HA 4Q34A 4B83A 4IO0A 5AKXA 1CQWA 4X95A 3EF3A 4AN1A 1JI3A 3OOSA 4C87A 1YR2A 5JARA 1D07A 3ZWQA 1L7AA 1UOQA 2HA2A 2PL5A 4QNNA 2CUTA 4KEAA 4AX4A 5AH0A 4OB8A 3ANSA 1P0PA 5BOVA 3WZLA 3WK9A 4UUQA 1EVEA 4X6YA 1Q0ZA 4OU5A 1H22A 1MJ5A 2DHDA 1R9MA 2WTNA 3DOIA 1HDEA 4QE3A 3FNBA 3MUOA 1UXOA 4QEKA 4AN0A 2BKLA 1HL7A 1MX9A 1CUVA 4E11A 4WCVA 3I6MA 4RNCA 5CBKA 5CTAA 1QIMA 3DNMA 1HLGA 5LZ7A 3F9CA 2OG1A 1JT2A 3VJKA 5JD6A 4W9RA 4XJVA 3YASA 3HXKA 3HYSA 1XRQA 3R3VA 1U4NA 2QJRA 4KYVA 4NZZA 1GGVA 3WL7A 2BUAA 4CCYA 4MXDA 3I2KA 4G9GA 1DX6A 5AHXA 4C4ZA 3O9VA 4X3CA 4KE6A 4KAFA 3PE6A 3WKBA 3A2MA 2JEYA 3A2NA 1A88A 2CKMA 2VA9A 1FFBA 4AMYA 2OQVA 3V9AA 4BZZA 1QOZA 3C5VA 4G8BA 4H35A 4GW3A 5AKHA 3HZOA 1GQSA 1EB9A 1ODCA 2OLEA 2G4LA 5LZ9A 5LZ2A 4DNQA 3E1GA 5BV7A 3V1MA 2HU8A 2OGTA 3FLEA 3I2IA 3HC7A 2ACKA 1RYYA 4E46A 4BZWA 4CCWA 5EI5A 1AURA 3DJYA 1MNAA 4O08A 5FPQA 4DMHA 2O2IA 1XQWA 3NUZA 4LYEA 2PVSA 4Y2QA 3D4LA 4LIPD 5AK6A 5A7GA 3WKAA 1VXRA 1HPLA 3O4IA 2WFZA 3DD5A 4N5IX 1B41A 2XQJA 1FJ2A 4PSCA 3UUFA 3WWDA 3BJRA 3D3NA 3C70A 2WFMA 2E3JA 3H1AA 4M0MA 2QKYA 5ALPA 3WA7A 4BCCA 1XZAA 5DYTA 3HLKA 3G0DA 4H7DA 5AOCA 3S2ZA 4ZV9A 1OCEA 3M82A 5HF6A 1XZLA 3GELA 3WJ1A 3WK5A 5JAPA 2B4KA 1P0IA 5AKIA 4K6GA 1CIJA 3WLAA 1BCRA 5SYMA 3H2GA 3U1TA 2AJDA 4UBNA 1YASA 3O95A 4EY7A 3O0DA 3R41A 2IX9A 4X71A 4BC0A 2HU5A 1FFEA 5DWDA 2XMZA 4HXFB 1MO2A 1OXMA 1WPXA 4H7JA 4IHAA 2HFKA 3QPCA 3FCXA 2AJCA 2WIDA 4B81A 4PSUA 1XZGA 3VJMA 1WOMA 3AINA 2X76A 1UK8A 3B3QA 1EDDA 5ALSA 1QIKA 4B7ZA 4RGYA 3IUNA 2XI4A 4Y2XA 3DQZA 4I19A 3B5EA 2O2HA 2ZVDA 3T52A 1AGYA 1XZDA 3KWFA 4OYYA 3HJUA 3BL8A 5K3EA 3H18A 4HRXA 3ESBA 4UHEA 4QDXA 2O7RA 1XLVA 4HZGA 2BCEA 4FNGA 1NU6A 5FXMA 1R4ZA 4DNOA 2PSDA 1R88A 1ZD5A 1N5RA 1JJIA 2UZ0A 1WHTA 3WK8A 4FFVA 4A23A 1ETHA 3K2IA 3D7RA 1CUAA 2OCKA 4BVJA 4L72A 3WIBA 5ISMA 2XB6A 5HK8A 1G5FA 4UHBA 3FLAA 4EB0A 3DOHA 3Q8WA 2QR5A 3BXPA 3OM8A 3HACA 4EY8A 3AUKA 4GBGA 3FSGA 3D5EA 1U65A 5ALLA 4L3WA 4N5HX 1MTZA 5C7YA 2BUBA 3IDAA 3KXPA 1EH5A 5CMLA 3WJ2A 4C4XA 4N8EA 3H2HA 2OCLA 4INZA 5D7BA 5JAOA 2VSQA 5AKEA 2DCMA 2R11A 4B0OA 2WHPA 3BDIA 4AO8A 2BUCA 4K2AA 3TRDA 1CQZA 3EQ7A 4HXEB 4FBLA 1CVLA 2V9ZA 2XMCA 4H7FA 2Z3ZA 4J0JA 5AI6A 3D2BA 4IH4A 2WJ3A 4UFPA 4FBMA 5ALVA 4U2FA 3LLCA 4F0JA 4EY6A 1G4HA 1BE0A 3QM1A 4ZXFA 2H7YA 1XRRA 2PU7A 5DYWA 2J4FA 5D3ZA 3R3YA 3A6ZA
chains in the Genus database with same CATH superfamily
3TTVA 2OLKA 4MIOA 2APJA 2CZQA 2VYCA 1N3YA 4MR7B 4TMZA 5FLYA 2CB0A 5EWJA 1U80A 1IN5A 5BN4A 1ZR4A 1DEKA 3W2IA 1J5EB 3GEEA 1MO6A 4IDBA 1RRGA 4DR1B 1VI5A 2PWBA 2XUQA 3CGGA 2I67A 1P1BA 3D6JA 3JQ7B 1YS7A 1YU6A 2WWRA 3OEWA 4DSNA 4NJEB 4IGKA 2PXCA 3WOVA 4R2HA 1IBCA 2JGAA 4FNAA 2A7QA 4QBKA 4JEUA 2WWIA 2HMUA 3OA2A 4FR0A 1F06A 1JHUA 1KYWA 1M2GA 2HX1A 3G9QA 2JB9A 3PV0A 7AT1A 3FAKA 3JD3A 1YOVA 1E6KA 2V7QA 2AS0A 1N6KA 1YBMA 3L6OO 3WL8A 3BZBA 2NXWA 3CLRC 1MIOA 5BN5B 4BDTA 4CQMD 2QD3A 5D00A 1PO7A 2P2DA 4MB6A 5GMOA 1GPJA 2N46A 3QTBA 2JAHA 1FY2A 3AETB 2Q2OA 2VLIA 1FRNA 2ZP1A 3EXAA 2FZWA 1VE9A 2O7QA 3BRQA 4U02A 2BMEA 1KK0A 2COUA 5KO2A 2DQZA 1BVYF 4TROA 3TKLA 5BUSA 1T5SA 5CT9A 1FQWA 1I1QB 1KJQA 1GGHA 4CEHB 4LZNA 3VH3A 4CFZA 1ADGA 3O8DA 4LDNA 4BMOB 4LFBB 1HDOA 2J32A 3N8KA 5FP0A 1LJ8A 1RAGA 1AH2A 3UBTA 3R40A 1WXEA 1CUIA 3HFRA 4BLUA 1DUIA 5LXTA 4F84A 4PHFA 2C5EA 5E7MA 5DX1A 3AXSA 1ZHFA 4M1YA 1UAAA 3GBVA 1S8NA 4KO4S 4EJSA 2PANA 1L1RA 4JYBA 1I3NA 3WHKA 5A2GA 5EE5B 2WWFA 3OLYA 1H2XA 4ZD6A 1LVUA 2DPXA 2IPLA 3IAEA 4N5DA 2C4KA 4M0CA 4BX3A 2CFTA 1PZEA 2UZIR 4A7PA 1CEEA 2ZLBA 5G2OA 1O3YA 4ZAZA 2Q7DA 2UUCB 1UMDA 1H94A 3HWRA 3ME5A 4PZEA 4YXWD 5AXBA 2H07A 2VEDA 3GMIA 2G4VA 2WLSA 1I2DA 2B99A 1WQ4A 3DFIA 1TKAA 3HA5A 4Q47A 1TVKB 4P83A 3AL0C 5FUMA 5BR1A 1DJOA 1YR8A 2PGXA 1NYQA 4M8SA 1I32A 3U39A 5IT0A 3QG5A 2BEVA 1QQ5A 5HOEA 1WXWA 2GN2A 5K4AA 1G4UR 1V16B 2AI3A 1N9ZA 3AJ8A 4A26A 1U7UA 4O2BB 1U7ZA 1PK8A 2JANA 1UQRA 4CTMA 1O96A 2VH1A 1Q2UA 3L43A 1HG1A 4AKSA 2YJZA 2B35A 3OOEA 4JWTA 5JDIA 4YCDA 1NF3A 2HHAA 1I13A 5E7QA 1U8ZA 1PTKA 5BV2P 3GLHE 1H8EA 4XYGA 1LVHA 3U61B 2QTLA 4RMIA 4ZMBA 5JHGB 1QQBA 1BH2A 1SUEA 4ZAXA 4BGUA 1L8LA 2IPMA 4RM2A 5JSZB 1E1CB 3CW8X 5DHSA 1H2HA 5H3CA 3U7FB 1FDVA 5DTJA 2ZJOA 3MPUA 5DE3A 5HQ3A 5K0ZA 5EUBA 4AVYA 2ZSJA 1KOJA 3IAXA 4NBVA 3ZUPA 4BO7A 4OQPA 1IH8A 3C7AA 4LHSA 4QZVA 1DNPA 5HS4A 1UJBA 1RJDA 2AN1A 2PD6A 1ZNQO 4MSUA 4B3GA 3GAMA 3HRHA 3DW1X 2BBWA 5K0BA 1DDOA 1AX9A 2JFNA 3CX3A 3EG9B 3BCHA 3T7SA 2NV0A 2BEJA 2CV1A 3HO1A 2ACEA 3ZDAA 4GX2A 1JDNA 3HJBA 3FNIA 5AK0A 1NVEA 5JYEA 3COJA 5FH9A 4MVJE 2I2AA 3SGLA 2P9YA 5ALHA 3CY6A 2W22A 5ILQA 3ZDQA 1BS2A 1MG5A 4S1WA 1RRVA 4XGQA 1Q0RA 2FQQA 4TMKA 4K9DA 4ARUA 3CKKA 4ROSA 2A3RA 2F3SA 3NOVA 5HJ7A 1Z6ZA 5E1MA 5JZVA 1MTOA 3RARA 1UBFA 4F3RA 4KLAA 4RZUA 2CLFB 2O3JA 1OWPA 2C8LA 4U3JB 3PQ4A 4FHCA 2ZATA 2YZ2A 2GF9A 1JHVA 3QRWA 3UC5A 5CGQB 4S1VA 3WGMA 5A9TA 1QRTA 4TLMB 1MVOA 1YB4A 2CHVA 4CIAA 1NKTA 4J07A 1KH3A 1KO7A 1IHXA 3BSYA 3CTMA 4NWIA 4QBTA 1LQ2A 2VDKB 1Z4QA 3I61A 3KE8A 1U8UA 4Y9RA 2IBTA 3SS8A 1XO1A 3MSXA 1ORWA 1V3UA 2OCAA 5EIBD 2XCSB 3M3DA 3DKPA 3S8EA 4QXQA 1P7WA 3Q8MA 3D8HA 3R8XA 5G3ZA 2XF2A 1A71A 3DS8A 1XMIA 1NC1A 4F3KA 3D4PA 3W5BA 3R75A 1T4MA 1GHTA 3FWPA 1QHXA 2VBCA 1COWD 4RZ3A 5LOVF 5CM9C 4UCXA 3BMQB 3IVGA 1SB8A 3QLTA 4G0QA 4Q3NA 1TCCA 3T3DA 3WBFA 3A4MA 3KNZA 1OQAA 3T41A 1CYDA 4G0MA 4HGZA 1X1RA 4IQFA 4BNYA 1MGOA 1EA7A 3E3LA 3NP9A 2LXNA 3QIAA 1NYRA 1KEZA 3DTVD 2TRSB 4L28A 4P38A 4E5YA 1J25A 1NUUA 2H1RA 2V55B 3FZQA 3K9CA 4GS5A 4S2UA 4E4RA 2CV2A 1SZCA 3QWBA 5B3JC 4D0GA 5T41A 1K75A 3U80A 5JH7F 4TN5A 3FE2A 4CQLB 3GRAA 2YWEA 4EJMA 4RD4A 3PQ2A 1V6SA 3H2IA 1Z4OA 2WJJA 1U5BA 1Q83A 3GQBB 3QNWA 2GRAA 3N8IA 1M1NA 4KSYA 1LZKA 4ZPJA 3GRVA 2YJNA 3HSKA 1ORVA 5JS8A 1T9DA 5K3AA 1KQPA 3FCCA 1KYQA 2QP3A 2VHUA 5BR4A 5GOTA 4LJSA 4G5QA 4OYLA 2HD4A 5CNJA 3FGPA 1IWBB 5L4NA 1W59A 3DLHA 3RFFA 1LI5A 4PPQA 2ZIUB 1M1YA 5EZ6B 2F48A 3LFTA 4ITRC 1WEKA 3IOMA 1H2WA 3HMQA 2PLWA 3A25A 2QM0A 5FQNA 1G3UA 1P6XA 1S0UA 1E2IA 2ZAGA 3FB4A 1A77A 4H6PA 5HPYB 5HDQA 4LYJA 1PLLA 1CETA 2H0AA 2Z30A 5SZIA 4CBVA 3ANLA 2FMUA 2WWVD 2B1RA 4E2XA 3NMUF 2AVNA 1SCUB 1XTUA 1P91A 1SGWA 4WVFA 2OAEA 3DEYX 4EVIA 4FM9A 1UDBA 2RI6A 5ECYA 4EL0A 4CJXA 1HZJA 4RPGA 1K68A 4EELA 1BTOA 1Z2NX 2H0RA 3UGTA 3R3XA 1HFEL 3HKDA 4DR4B 3RVNA 2B36A 2QTHA 1Z18A 4FE7A 3FKQA 3F4LA 2XCOA 3JVDA 4GI3A 4IKOA 4QDTA 5LP1A 4GKJB 2ODTX 1BXGB 1G1AA 1XYYA 3G2MA 3QF4A 3UICA 3I9NA 3AUYA 3ZH9B 3EEIA 1KEEB 3N0TA 1K3UB 4UOZA 1YS9A 2Q4RA 1DAIA 3VX4A 1O97C 3OEHA 2RK4A 2ZANA 5E0OA 1YL6A 1XVLA 2X7XA 5E9AA 5MHTA 10MHA 2CVZA 4Q3EA 821PA 3TAUA 2FG7C 2R0QC 4BP8A 3NRCA 3ZWXA 1ZVMA 3E2IA 3OKCA 2WE8A 5FNVB 2CLIB 1AS3A 1M0WA 2LRHA 4C5CA 4YRIA 4MWZA 5L4LA 1ZEMA 2XUPA 1TZMA 4WV3A 4DCVA 1M2EA 2D0PB 1PEKE 1S7GA 4F2WA 5J23A 4RTOA 2ZSEA 1L3CA 3AQIA 1KMNA 5FTJA 2SECE 1U0OC 2XVAA 4IV0A 2RHGB 4KO3S 4QOHA 4QTZA 1KHHA 4NOLA 4OQFA 1SKYB 5BNFA 3SOZA 2OFPA 3NUQA 3U1VA 2D5BA 3JQQA 1D4ZA 1JQEA 1Y8AA 2P3SA 2AXPA 3D2CA 5IT4A 2MU1A 4Z0NA 4Z4EA 1N3IA 4FCWA 5KNDH 3ZCUA 5B7GA 4DMCA 3UMVA 2VXYA 1E1QA 2KW5A 1ADFA 3SEAA 5F4ZA 3IPAA 4Y2RA 3QK7A 1H2BA 1AKNA 4I3GA 5DX8A 3PNBA 5B3JA 1G21E 1R50A 1ZXLA 2PMBA 2FF7A 3V9PA 2V7PA 4K9QA 4XSHA 4BAGA 3IQGX 4XJTA 2BT4A 1X9GA 5KNCA 2ATCA 1ENZA 5J40A 3RC7A 3KV3O 5FA6A 5CDTA 1B73A 3IIEA 4OL9A 1DE0A 4Q01A 1M3SA 4ZVKA 6NULA 3QVKA 5KX5B 4RJ2A 3WRXC 3VYVA 2J67A 1BOOA 2WA2A 2WT4A 1E5VA 3QXJA 4IVNA 3OTOB 2VQEB 1RWKA 1A9RA 4JEIA 4JIGA 1EM8A 4UEJA 5AXDA 1KJ8A 1RFGE 3BA1A 4GE0A 4TS4A 4XQGA 2XECA 3ZGXA 1OB5A 4I1VA 1Y7IA 4O3MA 3HCPA 2J9FA 1J2YA 4UMEA 4JR1A 3PRKE 2BBOA 3PCXA 3KB2A 1V8DA 4EO4A 1IWPB 1G7TA 1L5HB 5CH8A 1OJLA 1QVWA 2BE7A 3ID6C 4I81A 1GVHA 4LRUA 4RDXA 2FN3A 2YZMA 1E0JA 4MVJG 1MOQA 1AKVA 3LWNA 1Y1SA 2I2CA 4LNHA 5FBKA 3RIYA 3RSFA 2FZVA 1THMA 2GR9A 2BGJA 3WQSB 4CM8A 4DUPA 1OBVA 1RP7A 4RCVA 3DT6A 1JA1A 1K7XB 1ARZA 1NUSA 4C1NA 2WU4A 3MJ4A 4D45A 5ABPA 2I66A 4H18A 4OX9Y 3ULKA 2PNFA 3G1WA 3DBRA 3KEFA 4W7IA 1YDMA 5AW5A 1DFIA 1W0KD 1R5BA 2GK4A 3DFZA 1NWHA 1BX0A 2Z8ZA 3VH1A 3VPAA 4B80A 1JEQB 2X42A 4TLBA 4WUTA 4DC0A 3P5BA 4NXNB 4BNIA 5JJBA 1OFUA 2FPGA 3O93A 3K2BA 2GUWA 4HADA 3ESCA 5LU9A 2AC7A 1R18A 2GN0A 1PJAA 4EA8A 2CY0A 2CMDA 1KYZA 2GESA 3BBPA 1V1MA 4DLZA 3T3NA 1BDMA 1P0MA 5CM2Z 3VJLA 2CLCX 3GDOA 2FDRA 3FF1A 3NYIA 1KWKA 3LYUA 1NBMD 1NTRA 1LC3A 2F43A 3IESA 2BFOA 2JAWA 1QO7A 2F17A 4MICA 1ES9A 3AB7A 4TYQA 1C9KA 1K9SA 3P45A 1JAXA 3EGDA 3HKEB 1GTG1 3U7GA 3K9GA 4HEQA 4G9BA 4ER0A 1AV7A 2VJOA 1Q6YA 3UFXA 3MOGA 2JLRA 1KRXA 2FRDC 3PFHA 3UJ8A 3UUWA 3L07A 1SVKA 1GL3A 3K73O 1KY3A 2BJVA 1N7JA 2X3FA 4KODA 3VOAA 1EWRA 3CLHA 1DZIA 4EUEA 1PFVA 4IIGA 2Y77A 4Q37A 4PC3A 1FNSA 3I30X 4QLBA 3M2TA 5DLQC 4D96A 2BKXA 1SURA 1VDMA 2JVJA 4I4TB 4DANA 3OIVA 3KOWA 4MYSA 4RVUA 1CUWA 2JAUA 2HU7A 2VPXA 3V3KA 2QX8A 1RHRA 3KAKA 4EY5A 1IQPA 5ILOA 2JFQA 3HBLA 1JQJC 3FVVA 3HJGA 2QR3A 3IODA 1TAQA 2EX0A 2OK8A 4O6VA 4RIGA 2P3OA 4IDFA 4XVUA 4MIKA 4UZSA 3FDFA 1OVMA 1RYMA 4W9NC 1E20A 1K08A 3JYLA 3FYTA 4JI6B 2A84A 2YICA 4FNMA 4Q48A 3RYFA 3K53A 2AFIA 2QTRA 4N7RA 1OLUB 1SRQA 1K7SN 1OKKA 2RGNC 1NXQA 2DP4E 1YUBA 2R8XA 4O2RA 3MQ4A 1RNLA 4V0RA 4Z8YA 1JPJA 1P7PA 3HCOA 1WKCA 2B0JA 5AW6A 1U9IC 1X70A 4LYGA 3JR3A 3QKSA 4MX8A 3FFAA 3LFHA 4DYDA 2VZLA 1SOVA 2G0NA 2C8JA 2C1ZA 2KMLA 1ZBDA 2PO7A 3M33A 5L53A 4KCGA 2JATA 5CLHA 2BJHA 4AJ9A 4FR5A 4DV2B 4JITA 3M4YA 5JPDA 3DP9A 4CL2A 1UBNA 2ZCUA 3MJTA 4JJ6A 5EPOA 5AR1A 3SC6A 1XJQA 2VDMB 3KXLA 4JBWA 3ZDXB 1SKYE 2R1TB 1PT9A 2WIGA 2L19A 3AHDA 3A3NA 2FW8A 5DCYA 4JJFA 4WBNB 4F85A 1ELOA 4LOAA 2IYPA 2OKCA 2BMDA 2C4MA 3WLFA 3E9YA 3KZKA 1EQUA 1C81A 5SZKB 4EX7A 2VDNB 1ODJA 3CE6A 3UJCA 4P4TA 3ZD9A 1E1RD 4OQYA 3ZJVA 3SOPA 1T5OA 2VYVA 4REOA 4XUDA 5CCBA 2LIPA 2Y4NA 4UTXA 4WBSA 1X92A 4B43A 1C3OB 1UDXA 2OHXA 4BKQA 2CKDA 5EHQA 2CXTA 1GJRA 3I2FA 1GKIA 3CX8A 2GZ3A 1JG1A 1C3LA 3L1VA 4ZRDA 3I39X 1W19A 1FUUA 3O8NA 2G72A 1GARA 2XLCA 3SEQA 5KTRA 3KWLA 3QY9A 1ZC4A 2RH4A 3EXEB 3KQPA 4KQGA 4IGFA 1HMPA 1QVZA 2REQB 3JZMA 5ICGA 4JD5A 1BXRA 1RWVA 3TAHA 3AHIA 2V65A 1MC8A 3JZIA 4GVPA 2RBGA 1UKVY 1V7PC 4JXKA 5FBWB 4C0JA 4YCNA 1BFKA 3A4LA 5CDFA 3VYUB 3T9CA 5D5HA 2IOQA 4O29A 1CUHA 1WBJB 3GJZA 4UQLA 3VH4A 5LKRA 2IH2A 4NEQA 2EF1A 1EI9A 1YV9A 1O6BA 1WG8A 3PC3A 1K6EA 3MRSA 5C4GB 3UF0A 4QA9A 4TTJA 4CFYA 3D0OA 2VBFA 1QTQA 2Q0SA 3SICE 4G5SA 2XEXA 2AQIA 1JFRA 1VP9A 2WHEA 2FRDA 1RTTA 2AG8A 1VB3A 2HK9A 2YUTA 2WZDA 3ABIA 3OE1A 3TW4A 3VR6D 1VPWA 2FMXA 3JWGA 3PF9A 1G16A 2ONCA 3LPLA 4ARSA 1BGXT 3IUSA 4X1YA 2RAUA 5D2CA 5LIRA 2CF6A 3FTCA 4PAQA 4CF7A 3DE6X 1ILEA 2Y9PB 2GBCA 3L06A 3O5AA 1T25A 1BKYA 4IFBA 3TB6A 3EH1A 3PNMA 4EVSA 5BVGB 1MIHA 1UT8A 1OBOA 2RHDA 4CMAA 5C1PA 4UD6A 3G0GA 4XE5A 4QQNA 2AHRA 5LLTA 2Y4OA 1R16A 5IF9A 1WSAA 5CYPA 2AFHA 4H31A 4ND7A 2XB8A 4HNAB 5ADHA 2RGNA 4WERA 3E3OA 4AI6A 2NVUA 1PP4A 1Z5NA 2FKAA 5AP9A 3AX6A 1P39A 3GN2A 1FMFA 3BD8A 2PKQO 1KMHA 4EG8A 5ALKA 1O03A 3AP3A 1N2ZA 1A9PA 1REQA 3LHDA 5REQA 4JB8A 4B9EA 4YJDA 5IFKA 4MA0A 3P96A 1Y1TA 4YRDA 2D0DA 3HKBA 5SV2A 3G02A 1I2CA 1LPPA 1H9CA 1NOIA 1YXMA 4OFZA 1OA0A 3OLVA 4XYEA 4YMGA 3RR2A 3SC3A 4OHMA 4U6QA 4CUKA 1M66A 3EQ2A 4XVHA 4C30A 1XZKA 2HI0A 1TADA 2BDEA 2RB5A 5GOZA 2Z1DA 2PGDA 4AMBA 5AW3A 4CGZA 3O74A 1PLKA 1C1DB 1SA0B 2P6PA 3I28A 2JIZA 2AL7A 3FVRA 3RBZA 4MUJA 5AW8A 4AYWA 5C51B 2CD9A 4FEEA 1EE9A 3JTEA 2FSFA 1U8TA 2NW6A 3N2LA 5DGXA 2R751 4R68A 4TTQA 5LDDC 1U99A 3I6QA 1ZL0A 2LBPA 1FP4B 4O4IB 3EMDA 1RKUA 1E3QA 3GVXA 1W5AA 3JD0A 3VR4H 1YBVA 3CU5A 3IHWA 2X6TA 3BEDA 3IBFA 3DCYA 3Q7SA 5KNDD 2HJHA 5GJVC 3MD9A 4C06A 3BOSA 1JV2B 3JTMA 1YZYA 5CNMA 1SG9A 3T3PB 1VL0A 3JAWB 4LSGA 2IYVA 1JKMA 1U6JA 1KMMA 1G8MA 2V96A 2AG5A 3SEZA 2C2BA 2AZTA 2VZEA 4XD2A 4RIHA 3OFND 1FXUA 4QOFA 2XADA 1TAUA 2E55A 1KZ6A 3L7OA 3PQ6A 4I14A 4WJKB 4DMFA 2IS2A 1VMIA 1VMAA 1IHOA 2LR0A 4QDUA 3ZQ6A 2VTDA 4HVTA 4JASB 1SNYA 3IDZA 3OD1A 5B37A 1E9VA 3OEYA 4BNDB 5BYKA 4RA6A 4AQ7A 1ADJA 2QWXA 1QFSA 1RCFA 1MJHA 2V7EA 4KYIB 1DRUA 1VKJA 4PAGA 4RWEA 3F8SA 5LP6F 3C1AA 2VAWA 2QMOA 1IOVA 3FNQA 3KKKA 3SMQA 4RTLA 4Q3KA 2X9VA 5B1YA 5KKNB 4WOKA 1F48A 1KAHA 3KUCA 4EMSA 2O05A 1Y1PA 3EBOA 1YK1A 1AXGA 2FTKE 3RAGA 3RG8A 3C3BA 4FT4A 1F1JA 3NHRA 3OBIA 3C7DB 1SKUA 2BDUA 2HWXA 1Z8HA 2QJTA 3L4BC 3SQLA 1YRLA 1I7LA 1YVUA 2HA7A 2AJ8A 3CC8A 3E82A 4UUBA 1KMIY 1BMTA 2JD1A 4K81B 4PHTA 1FFWA 1MB9A 1EJ6A 3A4NA 3FCYA 3GY0A 2YJ3A 5JE8A 4F1WA 4GECA 4LYYA 4MKZA 1TAHA 4AJJA 1WCYA 2XYVA 3WMEA 3NH6A 4YJ2B 3IULA 4DIUA 1JA0A 4K9KA 3BF7A 4MVJH 5FBHA 1CERA 1GG8A 1KDPA 2DFNA 1XD8A 1DG1G 2YWGA 5CD9A 4X00A 1R1DA 2CJYA 1TA9A 2IZ6A 2O8VA 2RONA 2VF2A 2WD7B 2HBZA 3HEMA 4JY7A 5K3BA 5ALQA 4WXEA 4XVQA 4EHIA 3A2LA 4ILEA 2FF5A 1ZNWA 1U28A 4C2UA 3SM9A 2ATVA 1CUZA 2AN4A 2HMYB 3QWAA 4FK8A 1KY4A 3EXG2 3ZY5A 5K4GA 2ROQA 1OZFA 3E6AA 3IAS1 1GWNA 2WPNA 5DW0A 3A4IA 1GA6A 2NN3C 3NLLA 3GJXC 4RLSA 1PBTA 3D5QA 1VE7A 2IHJA 3FLBA 3GZNA 1JFLA 3LC1O 4E09A 4CDRA 1KBQA 1TCAA 3QXXA 3NGMA 2XSZD 5ESDA 3CUTA 4P0PB 3R74A 4OU4A 3SKYA 4LJ8A 1ZITA 3E35A 1H8HD 1VZ3A 2H48A 3NNSA 4CR8A 3GG2A 4D6XA 5C2JB 3AL3A 1O0BA 2VHTA 1C1YA 4ICIA 2JIMA 3PD0A 4QYIB 3RJZA 2FSSA 3EASA 4LVUA 4QPJC 4E2WA 5IANA 4BTVA 4B7XA 1JYFA 1JA9A 2NO9A 2VCEA 4HQKA 2W8BA 3VFDA 5F7ZA 1H2RS 2ENUA 2QUJA 1CY4A 3IHKA 4WZAB 4MWDA 4PLZA 1C50A 1VSUA 1GGNA 3GWGA 3OMLA 1XJ5A 4JENA 5H7XA 3TDKA 3LH5A 1TVEA 1UEJA 1WLYA 2E6UX 2JIPA 2VSFA 3RS4A 1V39A 1GLVA 2GEJA 3KQYA 4C04A 2BPOA 3E5RA 2EYUA 1Z5OA 2WMYA 3SY8A 2O5CA 3DMTC 1CZKA 2IDZA 5MGBA 1NN5A 1Z28A 1MDBA 1QDEA 4D4LA 5CFLA 1F6DA 1Z4MA 3O7MA 3T5PA 2DMRA 2CNWA 2GZSA 5F7JA 4UMDA 5BSHA 1HYHA 2IIVA 5HM8A 1AMUA 2G7MC 4OQEA 1ZD4A 3NQ41 3X1WA 4BVKA 3SK0A 5T4FA 2C8KA 3S44A 3HVIA 3I76A 1MPXA 1QPGA 3BIFA 3G5LA 4MINA 4G0XA 5DI3B 2UDPA 3I2GA 4URHA 3U7QB 1U2TA 3E3MA 2HK6A 3ZDDA 4P3PA 2QNBA 4DIOA 3KQUA 2VP2A 1UINA 2GJSA 2REXB 4NTZA 5B7NA 2UYHA 2FXVA 2J0EA 1B43A 3LDHA 4WKGA 2P2ZA 1P9OA 2QYSA 4ND3A 3PQEA 4TSKA 1PV1A 2XUDA 3I9FA 5AWFC 2CMHA 1W76A 3TEJA 5CAEA 1EFCA 1R9JA 3BMOA 4WAUA 3LK6A 1XZHA 4MCAA 1IXYA 5IAEA 1MZPA 3BXXA 3TZKA 3V48A 4L7VA 4RPLA 3L4BA 5F78A 4RZHA 3U37A 5EJGA 2WUVA 4BRWA 2QG9A 3DZIA 1P5FA 2L69A 2V5AA 2V59A 2YOHA 4RELA 4O4LF 5FUXA 1R3UA 2EGHA 3HKCA 3K8YA 2A1UA 3GP3A 1CUXA 4FD2A 4R3UC 4X3PA 4BAZA 5SZJA 3R7FA 4AS1A 4WKCA 3K9LA 2XXJA 1VPDA 1P7ZA 4FGZA 3TDMA 2BEUB 4LJ9A 1DIRA 1HKHA 1NT2A 2G9QA 3L8HA 4GLJA 4HFNA 1L5SA 3UMRA 3BXOA 5FWYA 1XVAA 2WB4A 4J1NA 1QH9A 1V47A 3ORSA 1F5SA 3O8OB 4YAWA 3FX2A 4Q9JA 5D3QA 2Q46A 4OJKA 4S1NA 2I6TA 5FIUA 1A9XA 1UXHA 4ME6A 1K3FA 4PQYA 2ERXA 3WX0A 5B1IA 1U7WA 3TXXA 2WKPA 5KOJB 4LZZA 4I1RA 4UU1A 1PGJA 4QFDA 1T15A 3E70C 1EVIA 1T2UA 3SJZA 1F2UA 3D8RA 2IUYA 3N2GB 4PRYA 4P4NA 3T9DA 1BDJA 2Q5LA 4MW5A 5HF5A 5GM1A 1U0EA 1U7XA 1EUDB 3A1DA 1P74A 1W0JA 2PZAA 2QSJA 3KYCA 1K2VN 1CE8A 1OXXK 3B78A 4G97A 1CLEA 2FX3A 2HV9A 2Z9DA 3NVMB 4XGIA 5K1ZA 5KVCA 3EAQA 4FYMA 3ZIAD 1UCFA 3A70A 4KQCA 5CRIA 3D4OA 1N5OX 3WAGA 1V3TA 4U5XA 3GH1A 5BP7A 5AVUA 1PR6A 1DIHA 2HWYA 3IIJA 1UJ4A 2NTVA 5AOBA 2M6LA 3PQ7A 5CIWA 4ZC8A 3HLTA 4QNRA 2JJQA 2OK7A 4IMRA 2WQZA 3F9RA 4CKCB 1JB1A 2P40A 2FR1A 5F23A 4XDYA 1TLFA 3D2AA 4MVJF 1THZA 2VPWA 3OA0A 3N9IA 3ORRA 4RVGA 1LWNA 2FH5B 4FDTA 4BRSA 1W36D 2QUBA 3RS0A 1EZ1A 5CLJA 4YFVA 2ZE6A 4GPD1 3GUCA 1TD9A 3LM8A 3ROZA 3WLHA 1JHXA 5H81A 4YRCA 3AVXA 1EFKA 5KMGB 3OCCA 3HP4A 2D5IA 5M5BA 1CY0A 2CJXA 5CB4B 3DV2A 4BFWA 2NMVA 1H0KA 4X6XA 4TWIA 4YA6A 5TPZA 3TOVA 3QHQA 3C8UA 4UEWA 4QDZA 3VDRA 4A1OA 2SNIE 4GQAA 4EYSA 4LCJA 3Q3VA 2FPPA 5LDHA 1VXOA 2XHZA 4I1UA 5EHXA 4F4HA 5EXDA 1CZUA 1JEAA 3ND6A 4MJ3A 2PV0A 3FXAA 3VOTA 4G01B 1GQRA 1WW3A 3Q8XB 4YN3A 5IARA 4MJLA 3RTCA 4F56A 2GZ1A 3KYBA 1XMXA 4KXXA 4N9QA 4Y1RA 1FYWA 4US0R 4CI9A 2Z3WA 4CG2A 3BFXA 1BYUA 5DBFA 1ZYUA 2YHBA 1DX4A 1ZJ4A 3VO9A 5HIKA 4R6WA 1HLFA 2J3IA 6YASA 3COSA 1ZUHA 2QQGA 3QOFA 1CRLA 1MXFA 2X0NA 2PKEA 3K0CC 1OYYA 5IUKC 4QHSA 4QGSA 4EBBA 2UU9B 4GDFA 3ICQB 3PNPA 1X1CA 1T9ZA 3BMNA 4WZAE 4NRDA 5FR2A 5JMOA 3H5TA 3CNOA 1YUMA 5ULLA 1JHZA 3CF0A 5IM5A 2QMHA 4ITVA 3TZQA 1Q74A 2DETA 1D7AA 2A58A 2C98A 3OIWA 3F1LA 1INLA 3N59A 4K88A 4LC0A 3SSAA 1W85B 1PJ4A 1XK6A 3S70A 4HGNA 2ZS8A 1MB0A 2MMGA 5IVDA 2CFRA 4C22A 4JK3A 4YJ3A 3GPDG 4YPVA 1EUCB 4J0GA 3JWJA 5ALYA 3WYGA 4CV2A 4YDSA 1ZGBA 3JXEA 2IBMA 2NXEA 1NJ2A 3SAJA 4RVDA 3KO8A 4FDUA 1A9QA 2A9OA 2JCXA 2X8AA 4CV3A 1KK1A 1GNVA 4E03A 4JP3A 1EVYA 4G4IA 4QGAA 1A98A 5DXJA 1ZXBA 3A1UA 3FDZB 4ETNA 3RS5A 3BPSA 3TSOA 4ZEWA 3DL4A 2D62A 2YHSA 3KJXA 4J2OA 1NW5A 2FUG1 4WJLA 1OILA 3IOCA 4QTXA 1K89A 2A0WA 2CLLB 3NWBA 4W8GA 1N9GB 1VJ5A 2C95A 4WUVA 2DT8A 2VKTA 2HGZA 1SPBS 3IAHA 4YJHB 3RBXA 1QF9A 2N9UA 4HD8A 4UDNA 3C6KA 2F1IA 3CJQA 1SBCA 4RX1A 1R6VA 1A7UA 2A0KA 4CEIA 5KQGA 2PX3A 3GT0A 2YZKA 5E9JA 4BKPA 1Q1EA 3REQB 4V38A 1P4JA 2P9CA 4FIDA 2XHEA 2NO5A 1H2FA 2VJMB 5TV2A 1XHLA 3QWHA 1VJDA 5CLIA 2FPKA 2VRNA 2KJQA 2N1MA 1SIUA 2X22A 3DLAA 3QKWA 4ED9A 2IYQA 2V0CA 4BMDA 2GCGA 2GLXA 4D1YA 1T9AA 1EAMA 5B1EA 4YMUA 1X7XB 3ED5A 3NKFA 2XBMA 1S7CA 3M70A 1L5RA 3O6VA 3G8BA 4H7IA 5BMVA 3DZHA 1RWPA 1Z07A 4WDRA 1S2NA 2YBEA 4L73A 3AERA 3RUHA 2IHTA 2PFGA 1O57A 4UHCA 2FFQA 3A9RA 3GK3A 1BN7A 2B94A 2C8VA 2QRJA 3KX2A 4L27A 5T7BA 1BHJA 3E15A 4JS0A 1UK9A 5DHQA 4BKOA 2IH4A 3F2IA 3I2YX 4YP0A 4NCBA 3M6LA 4R81A 3WGKA 3TECE 4KHZA 4ZVTA 1U6IA 2FEWB 2HCTA 2QPLA 3QI7A 4AF7A 1HOXA 1ZW6A 3P5SA 1XLUA 2FSVA 4I1SA 4KXNA 4NOKA 1PFKA 2FWNA 2NV6A 3TPFA 3UQZA 1RJFA 2H1OA 4XTRA 2FPUA 3OECA 2HRDA 1ZIDA 2R68A 2GDZA 4YAOA 1JR2A 4HR7A 5JZ9A 3RT1A 5A04A 1KPHA 3G5MA 3K0CA 3DE7X 4N7JA 3IUMA 3GZJA 4KN9S 4PLYA 4CKWB 5B2FA 1PT5A 1IXZA 1F8YA 3T7JA 3UAOA 4EUNA 1NM5C 4NENB 4DKXA 3KFLA 2RKOA 1CUGA 1EGAA 4JOBA 4RENA 4Q05A 5LBUA 3U7JA 1JQAA 2GM9A 3BILA 1VHJA 4RHYA 4I5FA 2HXGA 2IV3A 3V8RA 1CJSA 3FI9A 1F8GA 3KLBA 4P92A 3THSA 5ITZB 3KIPA 4JX9A 3WV5A 5FHRA 5TF4A 2XXAB 3O47A 2A0YA 3FNGA 5GP1A 3HFSA 2WWTA 4QD3A 3HMKA 2IE0A 3BCSA 5JSQA 1ULTA 1XHFA 2I55A 4MQ4A 5EPEA 4ESEA 3IP5A 4C14A 3S81A 2F4VB 5BYBA 2AT1A 1TKBA 2YOFA 5ALMA 5C7OO 1U8AA 2XLBA 3E03A 4ZCIA 4ZCSA 1A4IA 2FGJA 3QU4A 1VSTA 1DUSA 1FOEB 3LXXA 3OTIA 4GD3Q 4PAWA 3H8VA 4I5DA 3HK2A 4F71A 5J5AA 1HYBA 5IG2A 3G9UA 5IYZF 3OBBA 2E4AA 4NPCA 4DV5B 4K28A 2P2GA 2XNSA 3TCKA 4EHHA 3H5OA 16PKA 1BD4A 4INPA 4BQRA 3MGGA 1PLJA 3EBPA 4F5DA 2VA8A 3ZQKA 2D6FA 4MQBA 4DXDA 5I7VA 3KKMA 1ECFA 5IJ0A 4WA7A 2ZJAA 3BXFA 3B1FA 4I7EA 4J94A 2G1AA 3CZ4A 4WY8A 2ZUSA 5CDGA 5JVDA 3ZD7A 2OVFA 4J7UA 1KQFA 3NC0C 1ORHA 4GR5A 2RGAA 1MMFB 4PN3A 4KWIA 3TOZA 4AZWA 1IVYA 2CCJA 3D7KA 2QK4A 2PBZA 4BYMA 1JFSA 4U39A 4CL8A 2J33A 4HNRA 1YSCA 4YAGA 4UHFA 1GRCA 3EAGA 2WUGA 1GM5A 3MTEA 1T34A 2JD0A 1Z0SA 1D9XA 3EGXB 4KYTA 5FO1A 1X2BA 5G53C 1M6HA 3OT1B 4CHTA 4QAJA 2E21A 2FW9A 2CNKA 2JCGA 4GVXA 1UM9B 1LJLA 1EWVA 4NMXB 3MEQA 4MLZA 4PO1A 1JVSA 2XDWA 4HSEA 4KAAA 2C2KA 4MV8A 5A6SB 4B3MB 4XIYA 1NVAA 1OTXA 5A7FA 3V1KA 3FRJA 3H5NA 2MCFA 3S6JA 3V4FA 2JBWA 3ITNA 3VVMA 1H1DA 2C7GA 4HDOB 4HYTA 3TN7A 3K1AA 2PZBA 3OQJA 4KUGA 4IIYA 4NU0A 2GJ8A 1FPQA 4MPPA 1JSXA 1QC5B 1QK3A 3IC5A 4B1FA 3DR3A 1H42A 3QYJA 3TD6A 3RTBA 4OQNA 2C31A 5KHAA 2UYOA 4I08A 2JK1A 3UHPA 4CM1A 1LLCA 5F1PA 1FX0B 3C1OA 3B51X 3SQXA 3Q1LA 1EWQA 4MI1A 4ZQBA 5E6UB 5EJ5A 2KBFA 2C20A 1WW2A 3FOCA 1T5TA 1WSWA 1Z2CA 4KJXA 5EAIA 3T7IA 2FPOA 5BRAA 1RWMA 3VPCA 5K0JA 1X86B 4BEJA 3ANTA 2JJYA 4R2MA 2Q2NA 1LLDA 1U3UA 3DC2A 1ZD2P 2Q29A 2WHYA 2WU3A 4ZODA 1AUPA 1V4BA 3GA5A 3GEDA 1RBZA 1FTQA 1NMXA 2C58A 1H65A 4KO2S 3TL6A 4XYBA 2VHJA 4CDNA 1NM5A 3DNFA 4JUDX 4RJKA 2EFHB 5KEIA 2TECE 1Y5IA 2VR1A 3C3KA 4PXYA 3RAEC 2PUBA 4IHKA 1JI0A 5F7OA 4F4UA 3SIRA 5FPPA 3THWB 1G5IA 4MI9A 2Z6QA 3AFNA 3MTAA 4K9OA 2G28A 2RC6A 1HA3A 1G3IA 1RQPA 2H5JA 2MYNA 1EXMA 1CY1A 2FQYA 1N1GA 3SU8A 4FHEA 4O2LA 2CN1A 4MW7A 4QBHA 5FOVA 4X20A 3HYLA 1S8OA 1UBEA 1ZGHA 2XF8A 3EIOA 3SLGA 1JG7A 3CX6A 3OM9A 3NC1C 1NQTA 3VNBA 2EKQA 4RH0A 3WC4A 1LPBB 1CS0A 3QUCA 4ZIRA 1OREA 4M1QA 4UHHA 4ZP1A 3MQFA 4M86A 5FWXA 4ENTA 4FSDA 1PFWA 3LSTA 3R3HA 1ZSVA 2Z5LA 3KZCA 3CR8A 1LV8A 1YE3A 5DVZA 4F4CA 3KP1A 5JSHA 2QJWA 3WLRA 1Z4NA 2CC2A 5E4TA 5BW6B 2Z6VA 8MHTA 2IZ0A 4P3YA 1A4UA 1LFAA 3L1HA 1IPEA 3DLTA 4RHEA 5ALIA 3QPDA 5H9VA 2GPNA 1USWA 4Y1GA 2EGGA 2DAPA 2YV2A 4EGAA 4CNQA 3I62A 3LWDA 4I0WB 3D6HA 2QN7A 4K40A 3H16A 4ZGGA 5A4MS 3S3TA 3LA6A 4PYOA 1G2OA 3C24A 5DASA 4BX8A 2C5AA 3C98A 1JDBB 4BVEA 5JSKA 4AQDA 4PV7A 3K1TA 1SQGA 4BRZA 4EB6B 3ZD8A 1B76A 2ZYSA 3DV0B 2HN9A 3ABSB 4IIVA 3U48A 1AMOA 3JQAB 2ZQ5A 4IILA 1F3OA 2FUG6 2I1LA 3WHPA 1GUYA 3AONB 5KCZA 3Q72A 3I5UA 4PGAA 4MARA 3W7AA 4ENRA 1DPGA 1Q7GA 2XE4A 2Y1XA 4JSYA 3EQ9A 1WUHS 2ZWMA 2FFHA 4RQUA 3T0FA 5HRCA 3SIWA 3D3JA 2LDXA 1T1GA 3FPKA 1JJ7A 3MWKA 1DBSA 2DCUA 1AKUA 2PQMA 1H3FA 1GQQA 3K8QA 5JJ5A 2A3NA 3II6X 3UHFA 1TKRA 1YCFA 2GHIA 2PKXA 4OD0A 5DSZA 1IZZA 4HKTA 3FM9A 3LCMA 1Z0DA 3HJRA 2VYQA 2PT5A 1E96A 3PGLA 3LWZA 4JLVA 4LJLA 3IAFA 1QF7A 3JAKB 3P97A 4PCLA 3SFVA 3ZZTA 1ZU5A 3ZDYB 3A7DA 1J2UA 4UAUA 4EYQA 3DG9A 2YNMA 1KORA 2MSKA 4XX1A 3A3KA 3IJPA 4K03A 1M10A 2E4VA 2X40A 5C46F 2NZ8A 2BR5A 1R4NB 3FR8A 4J2TA 1UKBA 1ZK1A 4LI0A 2F1RA 3AEYA 2XY4A 2GD0A 3AJDA 3LRTA 3H1BA 4IX1A 3SXUA 4UNNA 4MWSA 3VAZA 5JZSA 1CNEA 1XELA 2QVLA 2ZYAA 1GYQA 4B6JA 5HE8A 3B36A 1H0HA 1VSBA 3EGIA 1UJ6A 5TPWB 1RI3A 3BK1A 3OCJA 4GNKA 3FMVA 4A8JA 1PQYA 4Y2YA 1LPMA 1G4AE 2WMNB 3GNTA 1NP3A 3RLIA 4CG1A 3QE4A 3MNFA 1CZRA 3L7IA 2XTJA 4DMUB 2D3TA 2GGSA 4HY3A 3P9QA 1N8KA 1V6CA 3DMDA 3NGLA 4O4JB 5AJTA 4Z0HO 2EKDA 1EM6A 1T2DA 1XEFA 4G23A 1PZNA 2C2OA 1H0SA 2W6JD 5L45A 1GTL1 3ESDA 3CWCA 2BFDA 3FUXA 5EFOA 1UPCA 2XWPA 4PHHA 3DHVA 3CLUD 5ALOA 3SBEA 1N0HA 4E4TA 2ONYA 2P2NA 2P4SA 1Z68A 1E62A 2H5IA 2QTVB 1X7WA 2YXNA 3GAZA 3N7UA 4OEHA 4AECA 2ZOSA 5IK2D 3S2SA 3E5HA 3ZK9A 3SJCA 2X7HA 4G86A 2O14A 2FK8A 1SWVA 3IV7A 1ZD3A 2SCUB 3ZU5A 4WK0B 3KT3A 3HA3A 4NJMA 4AIIA 2PWPA 2FVYA 3UKJA 3SZUA 3RANA 4I99A 4M8KA 1T5DX 5BQ3A 3CF4G 3EEOA 5FPYA 3KQHA 2A5GA 3NIFB 2FW6A 5BUCA 1UXIA 3IEMA 4R16A 1BOFA 3THRA 3HCAA 3CRW1 4G65A 1JXAA 2DR3A 2J7PD 3LQYA 2ZBVA 4L4RA 1XEAA 1Z37A 4HNTA 2D1RA 1PZFA 2BFBA 3U3XA 5C8DA 4KH1A 4ETMA 4DBZA 5JI3E 2Y1WA 3OG9A 3AIMA 1GPH1 3LE8A 3EXIA 3SDSA 1THTA 4LMAA 3T1OA 4D9HA 5LQDA 4LV8B 1EBBA 2KYRA 1WSBA 3CT4A 3LP5A 1RRFA 3AVUA 1KVUA 3M3PA 121PA 3HXLA 1YNSA 3RC9A 4BFXA 1Y8QA 4EEZA 1RCUA 2CB9A 2IEGA 2K2WA 3MF4A 5DLDA 4LF9B 4U4AA 1J22A 2FR8C 4JV5B 2ZRCA 2AOTA 1SIWA 3TE7A 4X1IA 5K3FA 3SHTA 2VYNA 3GRCA 3DAPA 1R0SA 2PUVA 1DINA 3ONEA 4X7PA 3P2JA 1RXCA 4MW9A 3HB7A 4C4PA 2ZRJA 1GTSA 1LDYA 2WJPA 2H9YA 2VL7A 4DMKA 5B58T 1ZRHA 4Y2VA 4BNLA 2BMVA 1M74A 4KSBA 5HUHA 3N53A 2ORIA 3WFZA 2I03A 3H7AA 2V6FA 2R8YA 3R6LA 3FYHA 1D04A 3ZS8A 1NDQA 3MJSA 4NBTA 3S55A 1CJVC 1NG9A 4P4GA 3UB2A 4JJEA 1D7OA 5IJAA 1VHWA 4LKOA 3E7WA 1FEZA 4GLFA 2I2BA 3EARA 1YACA 1Q7RA 1EFPB 1GG5A 1LS6A 4NESA 1ECGA 2WPDA 1Q11A 3GCWA 1EEXB 1KKLA 2JJ2D 4FZJA 2HPVA 5DNWA 4HRYA 1M6WA 2KI5A 2OVBA 2QPOA 3TTTA 1QU3A 2FEMA 1I4LD 1WL8A 3ZWVA 4EKNB 1S1MA 2AW5A 3DYBA 4NDAA 1W25A 4OMCA 4XB6B 3WO0A 2QLNA 4OLHA 4GWKA 2DUJA 4ZDWA 4DB4A 3MBIA 3KQWA 1OFGA 2QMUA 4DYHA 2ANCA 1CDOA 1G20A 1ZD9A 2XE7A 4FIZA 4ZHQA 5AUOB 2B78A 2W4MA 5TQ2B 3AEKA 3N74A 2VWHA 1SU7A 1NLYA 3P9SA 5KHOC 1TYCA 1Y8CA 3M9XA 3ESRA 1BDBA 4H0CA 5JT1A 5FAKA 5IVPA 2BM0A 2O2SA 1Z6XA 4K9PA 4HWOA 4Q4AB 1Q0HA 5IJXA 4XDZA 1TQ2A 2DXIA 4KIJA 2QGNA 3AXTA 4K5QA 5ARBA 4MI6A 5KYXA 1J6UA 2JKYA 4MWBA 1Z29A 1H4TA 4YT4A 2H1LA 1E18A 3FBTA 1KEUA 3ABZA 1XPJA 4D8XA 2VZ9A 1AKRA 4TL9A 2DUNA 2OORC 3D1LA 2PJDA 2XMDA 1KJ9A 1UAYA 4IDHA 5EHNA 4GQBA 4IIFA 1W96A 3R3SA 3NT2A 2PHZA 1Z4KA 2IHNA 1Q0SA 1I0ZA 2AXNA 4DTCA 1II8A 3B82A 4DHWA 2DQYA 2YASA 1D3AA 2Y2UA 1E64A 3DFUA 3FPCA 3GROA 2ZR7A 1X13A 3LC0A 2DBYA 3NWPA 3W34A 2NYRA 3R3ZA 4PLWA 4V0LA 1EGQA 1ZR2A 1DGQA 3CLSC 3KR2A 4F2DA 3P26A 1T8SA 1TQ8A 3QBDA 2V0NA 4MR9B 3UJHA 2JA1A 3N07A 3Q9LA 2AD5A 3VNQA 1DBQA 4OYRA 3ZW7A 4D25A 2WAMA 1QOPB 1KSFX 2G36A 1ZBQA 4CGYA 4NQZA 3ZHSA 1KPGA 2QM8A 1IMJA 5G0VA 4YRQA 3KZOA 5AW9A 4DNXA 4W1QA 3Q5EA 4NK4A 4RY0A 4C01A 5CCEA 2FZGA 1PZXA 1R8QA 3V4RA 3CR3C 2B61A 3BIWA 5TDHA 2E5LB 3IP7A 5AK4A 1XN1A 3B1ZA 4NFLA 1Y63A 4P08A 4CQLA 1G8PA 2HNBA 4IO1A 3GQVA 4RXMA 3TWOA 1XP5A 3LOUA 1VGRA 3C8DA 2GMWA 3CB2A 3MLEA 2B8JA 2ZYTX 1OXUA 4OSOA 5ADWA 2QBYA 3HYTA 4QFMA 1KJNA 5LJLA 1WAMA 3RHTA 4M0FA 4XJSA 2EGUA 5DO9A 3TOSA 4CDMA 1MVLA 1AV6A 2NU9B 2IYWA 1M8FA 4IWYA 3G8CA 4G41A 1UPFA 2H8KA 4S24A 3GU3A 1EHIA 2GZ2A 2B25A 3BULA 3R0VA 1M33A 1SCIA 3O4JA 2B4YA 3JYNA 1DDGA 2PLRA 2WSBA 2HUPA 1NF9A 2HA4A 3DZKA 4H6XA 3LW7A 3EGVA 2FOXA 1ZGAA 5HUQA 5C8ZA 1Z5VA 1ISJA 3EISA 2QLMA 1TJPB 4FQ5A 4XPIB 5FJJA 1R5JA 1WXXA 2GVZC 3F6SA 3GCGA 1NQWA 2YW2A 4QUBA 3A10A 4Q9AA 4UM8B 2V3VA 3VX3A 3A6DA 1LPOA 1KP3A 4MYRA 2BTQB 1JIKA 1OY1A 3BZWA 1JB9A 3K05A 4OK6A 3AB3A 3WKEA 2AWOA 1AIPA 2NQ2C 1NQOA 2BGKA 4H9GA 2X9NA 4KQIA 3UUGA 3OPVA 3O3NB 2R4QA 1MGPA 3CWQA 4FDVA 5BUQA 2A57A 1U1EA 3JWHA 1GGMA 1U8YA 1KF0A 3O38A 4YJFA 4B5LA 5FNZA 5INTA 2FB9A 1BIFA 1GFWA 2QL7A 4ND5A 2B98A 4XLTA 5JR3A 4LSMA 4HWKA 4I5GA 2WSIA 2ZROA 3JQ6A 4TUYA 1EUQA 2DLCX 1NUTA 2I22A 3DMHA 1FXWA 1PGQA 2JZNA 3GUVA 3EOZA 3E05A 1GGEA 2A88A 4B7UA 4CM8B 2QIOA 5LD2B 2R1UA 5L3QB 1YVRA 4TYMA 4D80A 1G59A 4PFJA 2PH1A 5CEEA 2OWDA 3RVBA 5KIAA 9ABPA 3AQ4A 3M5CA 1S3GA 4GNRA 3A6FA 1UPUA 5DGHA 3VR2D 3DBHA 3OQMA 4KQKA 5EZYF 1ZH6A 1RHUA 2H17A 2PBRA 2O2CA 3A06A 4G56A 1TL7C 4PE5B 4XSGA 3ZHXA 4DGSA 1L5QA 2G76A 2QZPA 2NO4A 4M6WB 3RIMA 3TW8A 5LQMA 3ZCQA 4YR9A 2OORA 3B2EA 3T7AA 1J90A 4RLQA 4XIFA 3JARB 1B26A 2OD2A 4BNKA 3OCVA 1RU3A 3C2QA 4OKNA 5DKFA 5B36A 4J03A 5L7YA 2VNKA 3PLNA 4OSEA 2D13A 1KZGB 2KQUA 2YW9A 2Z3VA 1JH9A 2R6FA 4PLTA 2ILVA 1NNI1 1QHHA 2NZUG 5ALTA 1AC5A 4PLPA 2ZBRA 3CPHA 4YUVA 3V55A 2NTYC 4ABYA 4B46A 3I37X 2HSGA 3F73A 4RHTA 4WESA 4A03A 1M7BA 3U40A 1FSSA 1W4ZA 1D8TA 4MRRA 3E22A 3FKSA 3Q2OA 1BE1A 3UH1A 5BN5A 4YJGA 1X7ZB 1GILA 4BMXA 1GKLA 4FWBA 4QQFA 3MXOA 5KWSA 3A4YA 4YUZA 1OH6A 3PEYA 3NONA 3DE1X 3ZH2A 1DU4A 1M6VB 3WGLA 3CJRA 1B8UA 1WCV1 2QUKA 3KJGA 4BFLA 3EVFA 1GEEA 1S4QA 3HJTA 1JDTA 1R0ZA 4QODA 4RKWA 5JO9A 1E94E 1ZM3A 3ECSA 4EMBA 1SBNE 2COKA 1TA0A 5DBGA 2X13A 1Y3CE 3AR6A 3R2JA 3ER9A 1AGNA 4HLUC 4AD8A 4QELA 2N0SA 1ZGCA 2XQVA 5ECWA 3K9NA 3TJMA 3C6XA 1UDWA 5CX1B 3OSUA 3HPQA 2CBZA 2MSNA 1XE3A 2A1TR 1AVTA 5EXSA 1AM4D 3ASYA 1HLPA 3MGAA 4IJQA 5KWVA 4DILA 2WKRA 4IIJB 4D3SA 4EMUA 4X94A 1U9ZA 2YL2A 2H4ZA 2WV9A 3ZKWA 4FB4A 4YAUA 3KETA 1YQTA 4DM3A 4EPWA 1WE2A 4CG3A 4EZEA 3GHYA 2O07A 1OVGA 1YR9A 3F6EX 3KKOA 4XM2A 3BHJA 3GYBA 5T4EA 4RIFA 4Q1FA 1DQPA 1DQYA 1JL3A 3G2LA 5A3RA 3GDHA 4FXPA 1X14A 1ZMTA 4DLLA 4KJZA 4TV9A 4CLOA 2PTGA 1MORA 3R3JA 5LZ8A 5FEMA 5KYVA 2JFWA 3GUHA 3C5HA 4LNUB 4U6SA 4Q34A 4WZBB 3ZX4A 1QG0A 3L4KA 2GF0A 2GRUA 3VKGA 4WK6A 2NXNA 2WJVA 4GKKB 2GCNA 2YC2C 3UMSA 4S1OA 3WMWA 1K97A 2YWCA 1U3DA 4NX2A 4PYKA 2CK3A 1U3VA 2O1SA 3HCFA 3S8MA 3I8SA 4NV3A 4OV6B 4C7VA 4JVNA 3G1TA 3HDGA 5JFTA 1T1SA 1ORTA 1UFKA 1D2NA 2ZUVA 3CS3A 1PR9A 3HJNA 4D44A 5J2TB 4QNNA 1P1HA 3BQNB 2AKEA 4KEAA 4AX4A 4GGPA 1OV4A 4E5KA 4QOJA 2ZXUA 1JJVA 3DE3X 1NI4A 4KN8A 5F3RA 5B1SA 4OBBA 1SXJC 1H1LA 1P0PA 4UTVA 5BOVA 4DG9A 4RJTA 1VCHA 2O0LA 4F3YA 4NDNE 4CT4B 2OQ2A 1N75A 2ZIAA 3VKWA 4JI0B 2YXEA 2DWPA 2PAFA 4A1FA 3AVVA 4HDKA 1EUYA 1WULS 5FLEX 1FYDA 1RZUA 1VB5A 2I2DA 3IE1A 3QVWA 5TIIA 1V45E 2FPXA 1Q0ZA 3MB8A 2I4MA 3L77A 3NRJA 5DM0A 3LWBA 2DHDA 2IZZA 2ET6A 2E1RA 3CW9A 4MO2A 3UWMA 4BVAA 2VYFA 3ZVKA 1DUVG 3H4TA 5KOHB 3DMNA 1KI3A 3ORQA 5L95A 1ML3A 2YWBA 4Q19A 5FOSA 1SC6A 4XZ3A 1CT9A 1U2DA 4ZYYA 3AI7A 1HL7A 4WCVA 2IPNA 3V7FA 2NSDA 4DLSA 4DV3B 1IIRA 1RADA 1AN0A 1VJCA 3VZSA 5J4YA 2BFFB 3OHMA 3ZGZA 3MJRA 3JALA 4HGOA 4JEMA 5LZ7A 4GI2A 4BE7B 3F9CA 2CEAA 2DFTA 5KC8A 2GN9A 2IIBA 3SQNA 3AFHA 3ZWDA 2R86A 4W9RA 1BMFD 1DKUA 3T94A 4AKIA 1CD5A 4H1TA 3YASA 4NZYA 3VZCA 2FMTA 1RYHA 1TDJA 4MPTA 2JD2A 1U4NA 5BW4A 1Y8RB 4UXJA 3CKMA 3TSCA 2Q3DA 4M21A 1EFRD 5TC4A 2NU8A 4G0UA 4L16A 4KYVA 2Q3LA 3PXBA 4QGFA 2YFQA 3GGJA 2E85A 3KQQA 2BUAA 1GNRA 4CCYA 2XCTB 1KJZA 2MINB 4NULA 4G9GA 2Q2QA 2Q28A 4YJKA 2G4CA 4GO1A 2B8EA 2QRNA 5FUYA 3WP1B 1XTQA 3PE6A 2NU7B 5BSEA 4N0DA 3WKBA 3B7WA 3A2MA 2PXXA 4X6LA 1T6BY 3ZW8A 3BM5A 3HJFA 1DV1A 1F7UA 2OC9A 5D5QA 1AUXA 2ODEA 4BLVA 1EHCA 2P6MA 1E9CA 3AI1A 1Z26A 1UMBB 3A2NA 5LYJB 2HW8A 2O1EA 1XGKA 1US8A 3LT5A 3Q0IA 2O54A 2VA9A 4CCSA 4M3NA 3Q7IA 3EVAA 2O8EB 3U60B 3KLOA 4ZYUA 2OP1A 4PLVA 2Q5HA 1NYTA 3G13A 4JC8A 1N6PA 2KB0A 4WCFC 3A6EA 4EQ6A 4ZYLA 5ICFA 2Q8PA 3KOUA 4PAMA 1FA9A 2NUAB 4A8HA 2QHXA 3QBEA 5A4AA 3RF6A 2XKAA 3W5CA 1JSRA 5L51A 4P0QB 3BT7A 4GUDA 2G1KA 4RSMA 3OZCA 3Q15C 4AZ0B 2XOKA 1ATZA 4FSXA 2QRVB 3PC4A 4GICA 5K20A 1KI6A 4ZHQB 3I9MA 4DXAA 2G4LA 2GK6A 1FS5A 3G6KA 3GOQA 3Q9SA 4HH4A 1L5GB 1KNQA 4RPHA 4Q7QA 2NUPA 4DCJA 1C1XA 1T3ZA 5BV7A 1ZSYA 1A9OA 1L3BA 3RRBA 4XB1A 2HU8A 2V1XA 2XW6A 5EIBC 2EWMA 4CKEA 5AW2A 2YWXA 3IMCA 4Z7QB 5BURA 3I2IA 4KPEC 2JFGA 2PZMA 3JQGA 1JFFB 2HQOA 4PSVA 5IZCC 1XQ9A 3H42B 1LD3A 2VBIA 2EERA 1G8FA 3E1KA 4YGXB 1RQRA 4I6GA 3DMFA 1J8YF 3K5IA 4WZBE 4QICA 4BPRA 2VUHB 2F1OA 4YXWA 4C6RA 4F92B 3FETA 3VNRA 2AR7A 4QYSA 4EFMA 4LOLA 4PLHA 1VG9B 3E2MA 2QT1A 5FPQA 3CPEA 4QUHA 2EFCB 1Y82A 2KSQA 3EUWA 3L0OA 1PKXA 2ZRPA 3HYRA 2DBZA 2ACVA 3VAYA 1LRJA 1XQWA 4YNBA 4FDLA 4WACA 2IC5A 3ADOA 1RIFA 1B3RA 1SUWA 2R48A 3FA2A 1JG4A 3R20A 3DH0A 4KIFA 3OUZA 5EXTA 5B53A 1RM4A 2EXXA 3DQPA 5IAJA 4E33A 3FUWA 4WW0A 1IN7A 3VO8A 5L6LB 1Y4UA 2XZLA 3NAQA 4JI3B 2EQAA 2WFZA 3S29A 5C18A 3IBCA 2C2HA 4N5IX 3T3GA 3U16A 3N8DA 3U9SA 3PKJA 1GTVA 2GILA 1ZNZA 3UN1A 1B41A 2G1PA 1EJ2A 1DTSA 3CH6A 3CVJA 3NR2A 3LGSA 1JXOA 4KGDA 2W70A 1IJEA 5KJCA 1D0VA 4W5HA 3D3NA 2YJGA 1IJKA 2QYTA 2V4ZA 2IIQA 4DIBA 2ZWIA 5IJWA 5TX7A 1SZJG 3F8TA 3B1KA 2ISQA 4M0MA 3EJWA 2BHSA 1Z39A 3BJIC 5DHUA 1OYWA 5ALPA 5L9AA 3BL6A 1DAMA 3UAZA 3RK1A 1TTPB 4X65B 2A0FA 1H8ED 2IS6A 3OY2A 4M98A 4MGKR 1KTIA 3F5FA 1O5TA 4IFTA 4ZK2A 3O1JC 7GPBA 4F93B 3LNTA 1GZ6A 1V26A 3D8NA 2GT1A 5DYTA 3VHXB 1X8LA 3PJRA 2ZUBA 1DCKA 3RYIA 4HRVA 5DNCA 1Z06A 4DV6B 2ODWA 4UE3S 3S2ZA 1OCEA 3M82A 5HF6A 2BTEA 3RS3A 3FNRA 1AA6A 2GEKA 3MINA 4LDPA 3OZDA 3X2EA 5BN1A 2B30A 3WK5A 3WQRA 4WCFA 4PZUA 1U5CA 4BRUA 5JAPA 2CXRA 3HJAA 2ZZKA 3HUTA 5K6RA 1Q17A 4AMGA 3C1UA 1CIJA 1QYVA 2M32A 5SYMA 3WLAA 2FMIA 3CJTA 2GEUA 5JAIA 3FUUA 4P7FA 3QUTA 4CNBA 4MUYA 1WV1A 2PL9A 2ZRMA 3HSYA 2AJDA 1HTBA 3CRVA 1U4SA 2OILA 2C29D 3GJQA 2FQ1A 2A9KA 3O95A 2H2AA 3OPYI 3H5RA 4OHRA 3O0DA 1GQFA 4X8HA 2XAAA 3KQLA 2WC1A 4KRFA 2F6RA 3CLRD 3L8ZA 1W93A 2VP5A 2HU5A 5FR1A 3M4NA 4DDUA 3TPZA 4RHUA 2IXTA 4PCAA 4HXFB 1V8ZA 3MGKA 4JUFA 3DOUA 1R6BX 1RW4A 1WPXA 1QG4A 3JQFC 4B79A 3L0YA 1Z6GA 2ZYGA 4TXLA 4EP1A 1LQTA 2FN4A 3P9YA 2KLBA 3AK4A 3PNSA 3PS9A 2HFKA 3Q9NA 3QPCA 4QECA 5K2OA 3DEHA 3FCXA 4QQKA 1ZLYA 3QSGA 1FSPA 3TNFA 1HURA 1YQ9A 2Q4TA 3ELDA 4FYPA 3CM0A 3MD0A 1WA5A 3VAAA 3VJMA 3A6KA 5M34A 5I48A 2CGEA 2ZJ2A 3DTVA 1NN0A 2X76A 3QQ5A 4HUTA 2I0FA 5DV9A 1WCIA 3SYTA 3MWYW 5GQSA 3TQSA 4B2PA 1YZTA 1Z17A 3LHFA 3EXG1 2QRKA 2NZJA 4ZVMA 3ZC3A 4B7ZA 2BP7B 1O4VA 2H31A 4B8WA 2VDJA 5A5VA 2XGJA 3K7EA 2IT1A 2IPAB 4YQFA 2X77A 3I9V1 1G9XA 4BGIA 1TT7A 1WZEA 3B5EA 1UBSB 2VK4A 4TS3A 3ROTA 2CMGA 1NXVA 1YHZA 3RJ9A 1N0VC 1VSVA 2WK1A 3B1XA 3BL8A 5AHKA 4UDYX 5LA6B 4HDAA 1BMDA 2AN5A 4GOKA 2DBRA 4QIHA 5FFNA 4BX0A 2GEVA 3H18A 4RULA 1G0NA 1OXKB 1Z12A 3LY8A 4R1UA 1NVXQ 4UHEA 4OQXA 5D3MA 3ZXUB 3KPVA 4A3SA 4C6TA 1DIBA 1G64A 4FNGA 4IQ0A 2I7VA 3ABQB 2PGIA 3GFOA 3GIWA 5IJ9B 2M2IA 4DNOA 2C78A 2PZGA 2Q1WA 1STOA 4IJUA 1URPA 4JL8A 4FGWA 4OJQA 3T5CA 4RMNA 5GZ1A 1DXHA 1BHQ1 1EQ2A 1L6IA 1AQIA 2IEBA 2O2ZA 2ZW9A 3AB8A 3KPWA 1L7DA 2OUKA 2XTNA 3CZ5A 3K0HA 3L84A 3PHHA 4LTMA 4OVKA 4FFVA 1PX0A 4UNQA 4OIFA 1B42A 3AY6A 3K2IA 4QUGA 3PITA 3MWEA 3D7RA 4G84A 4DQVA 1EDOA 2C4UA 2I1VB 4I8XA 4K6OA 5CLFA 3AM3A 4QEZA 3O83A 1SMKA 1VCNA 1W5EA 2H2GA 4FMDB 4KLNA 4L72A 4HI0E 4AJLA 5ELXA 1T4BA 1SQSA 4D0LB 3V97A 3GJ3A 1QCDA 4JLKA 4L5YA 4UHBA 2JVKA 4L8FA 4H59A 4OQMA 3F6BX 5E8JA 4EB0A 3OQNA 2ZJ3A 1UXKA 4JBYA 2GPTA 4LZOA 3L7JA 1J2RA 2Q3EA 1GU7A 1CQJB 2HJ9A 1QH8A 5CPFA 2ECOA 4F46A 1SKQA 2AB0A 4GBGA 4R7TA 1NIPA 1NSTA 3NIDB 1ZISA 2ZT8A 1YQUA 3FUCA 4HYYA 3MCZA 4FQ7A 3CRQA 1DCFA 5JNSA 1Y33E 3KCNA 1E1MA 5CVJA 1XKXA 5L6MB 2SKDA 3MAJA 3EMVA 4OA8A 5DP1A 3B1WA 3NYRA 4N76A 1HGXA 3G2KA 3EUEA 4N3AA 4PANA 2G9NA 2OGWA 3WJ2A 4C4XA 1G8KA 3B9PA 1GUZA 3BGOS 1Z5PA 3OM1A 3O91A 1OAOA