2CZQA

A novel cutinase-like protein from cryptococcus sp.
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
205
structure length
205
Chain Sequence
b'ATSSACPQYVLINTRGTGEPQGQSAGFRTMNSQITAALSGGTIYNTVYTADFSQNSAAGTADIIRRINSGLAANPNVCYILQGYSQGAAATVVALQQLGTSGAAFNAVKGVFLIGNPDHKSGLTCNVDSNGGTTTRNVNGLSVAYQGSVPSGWVSKTLDVCAYGDGVCDTAHGFGINAQHLSYPSDQGVQTMGYKFAVNKLGGSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cutinase-like protein
publication title Crystal structure and enhanced activity of a cutinase-like enzyme from Cryptococcus sp. strain S-2
pubmed doi rcsb
molecule tags Hydrolase
total genus 83
structure length 205
sequence length 205
chains with identical sequence B
ec nomenclature ec 3.1.1.-:
pdb deposition date 2005-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01083 Cutinase Cutinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2czqA00
5HCUA 3P2MA 4UHDA 1DT3A 1YA8A 4H7FA 4X6YA 3GUUA 2RHTA 2WHPA 1XRMA 3ZLUA 1GPLA 2O2HA 3WK8A 1TCCA 1WM1A 3PDCA 5EHNA 1CR6A 3QMMA 1CV2A 5ALHA 1IZ7A 4IH1A 4FKBA 4BVLA 1QTIA 5ALIA 3YASA 3U0VA 4QWWA 5EIEA 3HEAA 5JIBA 1TKRA 5CW2A 4DSZA 1LZLA 3IA2A 2PKYX 4X71A 1X70A 3WL7A 4PQEA 1UWCA 5AIBA 4MYSA 3FYUA 4FHZA 5EFZA 2JGJA 2XQJA 4J0JA 3WK6A 2HADA 2PSFA 4L3WA 5T4EA 5JAHA 5DLPA 3HACA 4QE3A 4DLNA 1YS1X 2ZJFA 4UHBA 1X2EA 1VE7A 3RM3A 2OGSA 4HXGA 3ESDA 3W04A 4MQMA 1SCIA 1L7QA 2AJDA 5JZBA 2GBGA 2RAUA 3MGAA 1UT6A 3AIMA 1U2EA 5ALVA 2HA3A 3HABA 4H7HA 4MQLA 1MNQA 3Q0TA 3V1MA 1AQLA 3AUKA 4QDUA 5FPQA 3I2FA 5HK9A 5AKHA 4B85A 2WIJA 5AM0A 4BE9A 5BWCA 1GQSA 4GEGA 3RKSA 2C5FA 5A7FA 4B80A 2HA6A 5J3JA 3D4LA 1CUGA 1ZD2P 1XRLA 4D9JA 3NOXA 4U2GA 1BRTA 1ODCA 4UFNA 1DQYA 4G9GA 2QOEA 4IH4A 1ZIXA 5AI8A 1AC5A 4AMZA 1W4LA 1KEZA 4FWBA 2XUOA 1LBTA 5AM3A 3QZUA 2PU7A 3FNBA 1EX9A 4GI1A 1GPNA 2JEZA 4OD0A 3O4JA 1HL7A 1P0QA 4EUSA 1CVLA 4IH9A 2UZ0A 4KE9A 1CUDA 4DGQA 1XLUA 5IVKA 2OGZA 3WKDA 5FOQA 2C58A 2QUBA 3D2BA 4EY7A 5JATA 1XQWA 1VJ5A 4PV7A 3WKEA 3QPCA 1VOTA 4KE7A 5HKBA 2BUCA 5AOAA 5JZSA 1SC9A 2XUKA 2XUAA 4X92A 3DNMA 2GBFA 2BUBA 4TPKA 1VA5A 2XUFA 1KU6A 3NWOA 3IUQA 1IUPA 2I03A 4Y2YA 4A16A 2WSLA 2XT0A 1DWQA 4B0PA 3ED1A 3HC7A 1R50A 3R41A 4P9NA 4UBOA 4N8SA 4L0CA 1TCBA 1XLWA 1GT6A 3VDXA 3I28A 4CCYB 2QT9A 3U1TA 1R1DA 2XMQA 4AB1A 4FBMA 3E0XA 5AKXA 4BRSA 3PF8A 3IVMA 3L1JA 3CCCA 4UPDA 2AJCA 2GYWA 4WFJA 3C6XA 4UHHA 5AK4A 3VKFA 2RIPA 1FFAA 4FFWA 4J0KA 4X94A 1XZKA 1THGA 1LZKA 3VJKA 1SFRA 4PF1A 2O7RA 4FOLA 3KWFA 2ZSHA 2PX6A 1XZJA 5HF9A 3ZV7A 1R9NA 4DMFA 4NZZA 2ROQA 1CUYA 1EH5A 1CUVA 3G7NA 4INZA 3T4UA 3V1NA 3UUEA 3G9UA 2Y6VA 5FLKA 1EHYA 4KRXA 3AIOA 5KREA 3H2JA 4OB7A 1FSSA 1UOOA 4BVJA 1CIJA 1THTA 3IULA 4BTLA 5E2IA 2PSJA 5CT5A 2VTVA 3C6BA 1FFDA 4BAGA 4NMWA 3BL8A 3EQ8A 1R9MA 2AJLI 4OUKX 2Y1KA 1XZIA 3IDAA 2B9VA 3KD2A 4QDXA 1J1IA 5AK6A 4Y2SA 2RGUA 1SOMA 4DNQA 2ONCA 3OC0A 4G4IA 5AOBA 3WYDA 2QJRA 1N5MA 3BWXA 5CT4A 1CEXA 3H1BA 1WCYA 4WCVA 4X00A 4MWTA 4AO6A 5T4HA 2EDCA 2Q0XA 3R40A 2CBGA 1OILA 4OU4A 2ECFA 2DQZA 1QGED 3O0DA 2HDWA 3R3ZA 4H7EA 1AZWA 3G0BA 3C70A 3OM8A 1WHSA 4KE8A 2HM7A 1LPSA 2IIVA 1E8NA 5CH8A 3A2NA 5AM1A 4Y2QA 4GWLA 1QIJA 2NW6A 5CH5A 1QLWA 4FLMA 2QRUA 5IH7A 2HA5A 3HLKA 5FDFA 4PNZA 4X6XA 1CQWA 3H2GA 2XUJA 3FCYA 4MEAA 3C6ZA 5CBKA 1QJ4A 4M0FA 3WLAA 4YK7A 1EA5A 2G4LA 3WKAA 4N5HX 3EIOA 2C5GA 2WTNA 4Z49A 5JAOA 3WWOA 1XRQA 2DFPA 4E11A 2PSEA 4B0OA 4UBKA 1UK7A 2VJBA 4BTVA 3ESCA 4GHWA 2XB6A 3L1HA 4FNGA 1G66A 3EF3A 3H2KA 1LNSA 1C7JA 5AI4A 4BAUA 2OAEA 1WB6A 1EDDA 2XMGA 4DMCA 5AP9A 5ALZA 3C45A 3C8HA 5CMLA 3AINA 4KJXA 3I6MA 4UBMA 4KEAA 4PSUA 5LLSA 1EB9A 2BJHA 5DTJA 3O95A 4Y7DA 4ZXFA 1XZEA 2Z3WA 3D2AA 1CQZA 4ROTA 1CUXA 5DTIA 4XIIA 3G02A 4OCZA 3TEJA 2VA9A 1E3QA 5A7GA 2HA0A 2JGLA 1UKAA 1XKLA 3FLEA 3AJAA 1BEEA 1U4NA 2FJ0A 3I2KA 3VISA 5K3AA 5LP1A 4F0JA 2CZQA 3B3QA 2FJPA 4BDSA 4AN0A 5EHZA 1QO7A 3VJMA 2RI6A 1ZOIA 2PBLA 3WA7A 1HQDA 4QDTA 1PV1A 2XMZA 3GELA 2Y2UA 4ZGBA 5IKXA 5AHXA 4J0CA 3QMWA 1U65A 1XZGA 5ALRA 3F98A 4H7IA 5AOCA 1CUAA 4B83A 4L72A 5IVDA 2OQIA 1YS2X 3RK4A 3DL4A 1EXWA 1A7UA 3C8DA 5ALYA 4X95A 4HRXA 4HS9A 1CFJA 3MUOA 4Y2PA 4ZV7A 2XMBA 2JGEA 3CCBA 5HFNA 4DM7A 5C7YA 5HFAA 1R4ZA 3BIXA 4EY8A 5AKLA 3WL8A 3W9BA 1ODTC 2BUAA 4U2DA 1W6RA 2I3DA 4XX1A 4ZREA 5DYYA 4U2FA 4J3JA 4XJVA 2BGRA 1IZ8A 1GGVA 2JIDA 1EK1A 4KYVA 2PVSA 5JALA 4FLFA 2HL6A 3OPMA 2VAVA 3GA7A 3M81A 2W6CX 4X90A 5ALFA 4P93A 4HAIA 5LZ9A 2QUAA 4GDMA 2YXPX 4CI9A 3WL6A 2XUDA 5AIAA 4X6UA 3QPAA 5EIAA 4H7KA 1EINA 3W05A 3OURA 3H18A 1J2EA 4F60A 3IB3A 2PUJA 4BYMA 2CJPA 5BV7A 3LS2A 3PFBA 4Q34A 1F6WA 2ZJ6A 5AKEA 5FRDA 5K3EA 3K9BA 4GBGA 3WQHA 1Y7IA 4AN1A 1MX5A 1XQXA 3D3NA 1QIGA 1WOMA 4Y2TA 2ES4A 5DJ5A 1EI9A 3STVA 3EQ9A 2JGIA 1Q84A 3E4DA 5YASA 2OCKA 4W1SA 3KXPA 2EDAA 2VSQA 1DX4A 4CG1A 1Z68A 2BCEA 4UBNA 4N8DA 1MX1A 4MXDA 5HF5A 3STWA 1JFRA 4Y2UA 4DTCA 1QONA 2WTMA 4TGLA 1YCDA 4DNPA 4BRZA 3LIIA 2HA7A 3KSRA 5C8XA 5DWDA 2DHDA 2JF0A 2V98A 5K3FA 4BATA 1VZ3A 1VKHA 1H2XA 5AJHA 2C0QA 4C4YA 1N8SA 1OCEA 2V96A 1I6WA 1KU0A 5HZGA 4C6HA 3IUNA 3F97A 5AKGA 1XQVA 5JD4A 1X2BA 5IVHA 4W63A 4NS4A 1XZDA 1H2WA 1ORWA 2WJ3A 2H1IA 4H7JA 1QOZA 1ISPA 5JD5A 3WJ1A 5IVIA 4HVTA 5ALKA 4B9AA 1XZAA 5AI5A 1XZLA 2OQVA 1K63A 3E3AA 2K2QB 1DX6A 3ESBA 1BE0A 3FLAA 3SK0A 2XQIA 1G5FA 5C8VA 2WIGA 3BF7A 4OYYA 2BAGA 3I6ZA 4KAFA 2PU5A 1BU8A 1H2ZA 3I2GA 1TK3A 4BE4A 1BS9A 4LYEA 1O6FA 5CRIA 1UOPA 4ETWA 3QYJA 3PUHA 4HXEB 5K3CA 5ISMA 2ZYRA 3ZWQA 2YYSA 4BDTA 1JJBA 3C87A 5E4JA 2PPLA 5E4YA 2B61A 4U2BA 3KDAA 4JEIA 1QIIA 2I78A 2ZVDA 3DOHA 3STTA 3WZLA 2WJ4A 4X97A 1B6GA 3STYA 3CXUA 1E89A 4PSCA 3O4GA 1XKTA 5AICA 2H7CA 4CG3A 3HXKA 3FWHA 2XDWA 4BP8A 2XUPA 1LPOA 1MN6A 1UXOA 5CXUA 2QKYA 1C4XA 5ALSA 3DYVA 3V1LA 3WWEA 4F21A 5F4ZA 5DNUA 4H0CA 4EY4A 1YA4A 1NX9A 1CUHA 2WKWA 5ALUA 1T2NA 3PUIA 4Q05A 4OSEA 2ACKA 2HA2A 4KR0A 4BC1A 4AZ3A 4K6KA 3WI7A 4QLOA 2OPHA 5KBYA 3I6YA 3ICWA 2CUTA 1K4YA 3DJYA 5T4FA 2VJDA 4NVRA 1ODSA 3O9MA 1ZD4A 5ALNA 3DEAA 2P8SA 1FJ2A 4X7BA 4LXGA 5AI6A 2WHQA 1Q83A 3EQ7A 2OCGA 2VT6A 4H7DA 1L7RA 4MWSA 1W75A 1ZI9A 3DQZA 3G0IA 3ESAA 4GXNA 2DCMA 5A7HA 3FVRA 2HU5A 5LZ5A 3DKKA 1DINA 3F96A 1DTEA 4TVKA 2Y6UA 5DYWA 5D3ZA 3BF8A 4GECA 3RLIA 1K6EA 2QZPA 3ZLVA 2HHAA 4Y2VA 3LCRA 4M0MA 4B7ZA 2BFNA 1BN7A 4WDQA 1FFBA 2HFJA 1JU3A 3SC2A 2G5PA 1BCSA 1GXSA 4FNMA 5AK3A 5HK8A 1UFOA 4BB0A 4O08A 1R88A 2B4KA 2IITA 4G8CA 2WG1A 4ZV9A 1ZGCA 1B41A 2PSHA 3WIOA 4J03A 3DCNA 1JMKC 2D5LA 4V2IA 3JW8A 4A5SA 4W1PA 1GZ7A 4FFVA 4FLEA 1LPNA 2QXTA 4X85A 2J4FA 3N2ZB 2HU8A 1QIEA 2XMDA 3ILSA 1WHTA 3M82A 3AIKA 1GPKA 1C7IA 4K5QA 3R0VA 2AJBA 3D59A 2OCIA 1MU0A 3FSGD 2VJAA 2R8BA 4E14A 2CEKA 3T52A 4UFOA 2LIPA 3R3VA 4IQ4A 3AILA 4MYDA 3D2CA 3V1KA 5AM2A 4QNNA 3AZQA 1A8QA 1MJ5A 4UUQA 1W1IA 4EB0A 3WA6A 1MO2A 4WJLA 5JAUA 5CXXA 3ZPXA 6YASA 3IUJA 5H3HA 4B84A 4QWMA 2QTBA 4JH0A 4FMPA 4RE5A 5K3BA 3E1GA 3ANSA 2DHCA 4KRYA 4N5IX 2JEYA 1D07A 4I3FA 5K3FB 1AURA 2Z8XA 4BCDA 1QIHA 3WIBA 4Y2RA 1DU4A 2JGFA 5C8ZA 1XZBA 4K2AA 3JWEA 5A71A 4G8BA 1WB5A 1WPXA 1LPAB 1AUOA 4C89A 1JKMA 3H04A 5HF6A 2WFLA 5LIPA 1BEZA 2WG0A 4H35A 3IIIA 2JGKA 2WUEA 2VF2A 2WFMA 2XQKA 5BWBA 4DSAA 3ANTA 2CMFA 1IMJA 3V48A 4G4JA 1MAAA 4ZRDA 1A8SA 3CN9A 1J07A 4LYDA 1ZI8A 1XZHA 2HRQA 1XRNA 3GFFA 4B81A 4E46A 5AK5A 5ALGA 1GQRA 2BGNA 5EHXA 1CUUA 4UFPA 1HBJA 2OG1A 1G42A 1HLGA 1ORVA 5FPPA 2EEPA 1JJIA 5AI9A 1CUCA 3FBWA 5AI0A 2H7YA 1A8UA 5AKIA 5LZ7A 3O4HA 1QIKA 3FVTA 4RGYA 2HIHA 4EBBA 1YAJA 1QZ3A 5AKZA 3G8YA 1UOQA 4H18A 1N1MA 1MPXA 2XUHA 3G0DA 4J0DA 1JI3A 3A70A 5HQ3A 1PJAA 3MUNA 1AKNA 4BC0A 4DNFA 4FBLA 3TRDA 4B82A 4GW3A 2GBCA 3TGLA 4AO7A 1LPMA 1LPBB 4BCBA 5LZ4A 2ZJ7A 3QM1A 4KAAA 1ZJ4A 1XROA 1BN6A 1EVEA 1CUFA 5EIHA 3BJRA 5HF8A 3OOSA 4ZWNA 2ZYHA 4KAJA 1J06A 2O2GA 3H1AA 1QIDA 3A6ZA 4UBJA 2HA4A 1TAHA 2WU3A 2ZSIA 1H23A 4S0XA 5LZ8A 3O9VA 5AKYA 4G5XA 2WIFA 4G9EA 3V9AA 4BVKA 5CTAA 3R3UA 2J3DA 3W06A 3I1YA 4QDZA 4C01A 5A62A 1YR2A 1ZI6A 5JAPA 3RARA 5BOVA 3LLCA 2BKLA 5FP0A 1DT5A 1O6GA 4CIAA 4CG2A 1VA4A 2AXEA 1VXRA 2PM8A 3H17A 2WUGA 5LKAA 1M33A 2RONA 2PUHA 1XQYA 3D0KA 1LLFA 5SYMA 4B6GA 2V9ZA 1NU6A 1W52X 3A2LA 1CRLA 1XRPA 4LXHA 1WB4A 3MVEA 2CB9A 2GYVA 4P08A 3PFCA 2XUIA 2Z3ZA 3VVLA 4OU5A 3UMJA 3G0GA 5CT9A 1UK9A 5I7UA 3C43A 2XQFA 5KWIA 2Z8ZA 1H2YA 3R3XA 3L1IA 2GZRA 1CUZA 2WFZA 1A88A 4IHAA 1CUBA 4LXIA 5LKRA 4Q82A 5LZ2A 3SX4A 5ALEA 4LHEA 5A6VA 4OB8A 3FLBA 5AM5A 3C6YA 2DQYA 5JANA 1Y7HA 1YASA 2DR0A 2G63A 5ALDA 4BBZA 1CLEA 1P0PA 1YB7A 5ALMA 1TCAA 4U2CA 5AKJA 5JARA 4K6HA 4C4ZA 3QBJA 2WM2A 4N8EA 3G9TA 1K5PA 5CT8A 2DSNA 4YX9A 4YASA 4X91A 3WKBA 1QE3A 4BAZA 4J7AA 1OXMA 4IO0A 3PE6A 4AX4A 5CURA 5ESRA 4I4CA 3AFIA 1QFSA 5ALXA 1Q0ZA 1G4HA 5I9IA 3F8SA 2PL5A 1E5TA 3K6KA 3QVMA 4WY5A 2AJ8A 5ALWA 3A2MA 3WJ2A 2ACEA 3WK9A 1LBSA 3DDUA 4L9AA 4J0GA 1W76A 2ZYSA 4UHFA 4X93A 3UUFA 2OXEA 3H2IA 3KWJA 4Q1VA 2CKMA 1CUIA 1ZD3A 3OG9A 2FUKA 3I2JA 4BZZA 2ZYIA 4ZI5A 1NU8A 5KWJA 1QIMA 2XI4A 1BROA 1ZGBA 2JGMA 4X3CA 3WYNA 3BE8A 1P0MA 2XLBA 3GROA 2WFLB 2J4CA 5JASA 1T4MA 2G5TA 3H19A 1SCKA 2ORYA 3DYIA 5CT6A 4K6GA 2WU4A 3DOIA 2FX5A 4HZGA 4JUIA 5D3KA 3HJUA 5CH3A 4Y2JA 4OYLA 1CUEA 1EVQA 5JYCA 3LP5A 2OAGA 4DMHA 1ACLA 4XVCA 4I19A 1GKLA 4PW0A 1XRRA 1XZFA 1P0IA 3WWDA 2YASA 3GZJA 1RYYA 1YAHA 5ALQA 3WWCA 3IUMA 3I2HA 2QVBA 1BCRA 4LIPD 3AZOA 1YSCA 3NGMA 4JNCA 3H2HA 3C5VA 4P92A 4Y2XA 4W9RA 3VXKA 1L7AA 3SWWA 4QA9A 4PO3X 1IUOA 2O7VA 1CPYA 1Q0RA 2X8BA 3C5WP 4AMYA 3M3DA 1YB6A 1EB8A 1QTRA 3BJMA 3KOOA 1LPPA 5D6OA 3R3YA 3FCXA 5AM4A 1UK8A 5HQ3B 3JYHA 3BXPA 3K2IA 1E8DA 3VJLA 4CIBA 2W22A 3OTQA 4UBIA 2GBIA 3DKRA 2VQ6A 4AO8A 2E3JA 3DL7A 5LYYA 5ALTA 1ACJA 1HDEA 4UBLA 2VJCA 2RHWA 5ALPA 1JU4A 4F5ZA 3PI6A 3GBSA 2V97A 4M0EA 2WHRA 1ZIYA 4W1QA 2WG2A 5T4BA 2IX9A 3CN7A 1AGYA 3WKCA 3H0CA 4B9EA 4HXFB 5DNVA 1UZAA 3G9ZA 1ZJ5A 1ETHA 4CCWA 3DLTA 3HZOA 2WQZA 4WDRA 4FTWA 2VATA 1DWPA 5EHQA 1VZ2A 4G1FA 2WHPB 2XMRA 2WJ6A 5FUMA 1FFEA 3TJMA 4XWGA 1TQHA 7YASA 2J3QA 4BZWA 2R11A 2QM0A 1MTZA 1ZICA 2XLCA 3FYUC 1F8UA 4FDMA 4WFKA 1FFCA 2H9YA 5JZ9A 2I3ZA 3B12A 5EGNA 2XUGA 4PSDA 4U2EA 4QZVA 2QJWA 1XZCA 1AX9A 2D0DA 3D5EA 4QLAA 4UHEA 2JBWA 5I8PA 3G0CA 3STUA 1CUWA 3AZPA 3HYSA 4ARBA 4C88A 4DIUA 2Y2VA 4J0HA 1F0NA 2GZSA 4BP9A 1F0PA 3FYUB 3QH4A 4BCCA 3Q8WA 3PICA 2QMQA 2QS9A 3WK4A 4YPVA 2XMSA 2OLEA 1WPRA 1TRHA 3F9CA 5HKAA 3VVMA 1USWA 2XMCA 4KE6A 2OCLA 5FV4A 1CUJA 4ITVA 3ZLTA 3HRHA 5DYTA 1QO9A 2YH2A 2VEOA 3WZMA 1K8QA 4WFIA 4W1RA 4QDOA 2WUDA 1IVYA 3QMVA 3S8YA 4OB6A 2VAXA 1QIFA 1SCQA 5K3DA 1AMNA 4DMKA 1H22A 1MNAA 1S8OA 4GLBA 1MAHA 3LIPA 3M83A 3WWPA 5ALLA 5ALOA 2WLSA 1UKBA 4C87A 2HRRA 1IUNA 3D7RA 1HKHA 3QPDA 2GYUA 4UHCA 1PFQA 1DQZA 3FYTA 5EI5A 4Q3OA 1RP1A 4G4GA 2H7XA 4QEKA 2X76A 2C0PA 3STXA 4H77A 3W2TA 4EY6A 3B5EA 1VLQA 1DWOA 3BDIA 1XFDA 1EDBA 5JADA 3NUZA 3ZI7A 2B20A 2QXUA 4Y9SA 4ARAA 1VE6A 1LGYA 4JYPA 1R3DA 3DS8A 1JT2A 2O2IA 5FKJA 4EZIA 4J0IA 4EHBA 1TIBA 1JJFA 2VT7A 4MJ3A 2DHEA 4DNOA 4G8DA 4JYMA 1MX9A 2HU7A 1HPLA 3HI4A 3FSGA 4KACA 2WILA 3N0TA 2XE4A 5D7BA 5FXMA 4HTAA 1UK6A 5SYNA 4E15A 1E66A 4Q3LA 3DD5A 3F67A 3PF9A 3S2ZA 4AXBA 3O4IA 1N5RA 4OPMA 3W9UA 1XLVA 4AZ0A 2C4HA 4CCYA 2WIDA 4LKOA 1GKKA 2PSDA 5K5EA 2OGTA 2QR5A 2Z5GA 5AH0A 1MT3A 1CUSA 1XZMA 4RNCA 4AQDA 2XUQA 3I1IA 3I2IA 5AO9A 5JD6A 1UKCA 3WMRA 4RE6A 2C7BA 3G9XA 2HFKA 3WK5A 4A23A 1Y37A 3FOBA 3WL5A 2XQGA 3ICVA 4WY8A 1ZD5A 3X3HA 4HRYA 5E4TA 3R3WA 5AKKA 3EBLA 4CFSA 4MEBA 1EK2A 3BDVA 3QITA 3WK7A 4EY5A 3IBTA 3IURA 3FAKA 1QFMA 4Q3KA 2WIKA 1RWQA 4DYHA 1E8MA 4C4XA 5C81A 2X5XA 1VXOA 1JMYA 5DNWA 2WUFA 3HSSA 3BIWA 5ALJA 4EA6A 1U8EA 1EDEA 5A2GA 4RPCA
chains in the Genus database with same CATH superfamily
2AFVA 3OAAD 4ZT7A 1N9GB 1CC1S 4EMTA 1JHXA 4AUNA 1XK6A 2AXNA 3G2MA 2DWUA 3DE5X 2QB5A 3NM4A 4II2A 4JZYA 2NU8B 1OXXK 3QEKA 1ODFA 3GFGA 2Y9MB 3TK1A 3U60B 1QYVA 2IBTA 3SHVA 5EVJA 1GPLA 4BUCA 5E6RB 2O2HA 2X1HA 4W5RA 3C8MA 2J0VA 3OX1A 5TV2A 5ICEA 4XQEA 3LBYA 1Z2AA 2XVZA 2QQ5A 3DV9A 5EHNA 1TZCA 2GN2A 3QI7A 5AXDA 2QBYA 1GZUA 1GL9B 2W2XA 4FQ7A 4B17A 4HNUA 4CT0A 1KXZA 4BEJA 4QTUB 2XZPA 3ETNA 2G36A 3C7CB 2B6NA 1IZ7A 2HYDA 3KTOA 4FKBA 4IH1A 4BVBA 4BVLA 3NPAA 1QTIA 1X92A 1PGPA 2H5EA 2MJLA 1WTCA 5ALIA 3KQHA 2WB2A 1C1XA 4C4OA 5LQKA 3E5HA 3UEOA 4ITUA 2G6TA 1KJIA 2F9MA 3EAFA 5H80A 3FKSD 5JIBA 2L2QA 1E4VA 1KEEA 3NATA 4DSZA 1JU9A 1WDMA 1Y8AA 2PO7A 4LDRA 2IXGA 1YL7A 4WVLA 2GJAA 3L40A 2DBZA 1R6DA 2PKYX 1F8XA 1U11A 5K09A 3OWOA 4K8OA 2QU8A 3T35A 3IHWA 4JGIA 3WL7A 1J8FA 1EE2A 3AEQA 2FZCA 2JCBA 3JU3A 3QYAA 1QQBA 3ZK8A 1XYGA 3GFVA 1OLOA 2R47A 3BH7A 3BK7A 3IUBA 4U7WA 4DMGA 5L51A 1W35A 4HO1X 2GO7A 3TBHA 1SG0A 5JSFA 4YP0A 3KSZO 1BD4A 1HC7A 5LD2B 1PNOA 1UQUA 5JXJA 3FSRA 3NNSA 1AN9A 5AR1A 2JGJA 5HA5A 1T15A 5BORA 4AZSA 1UP7A 4IJ5A 3WK6A 4X1OA 3AI7A 5FUQA 1KY3A 4NF2A 2H4ZA 3IQGX 1JSZA 5JAHA 2D2FA 1I7LA 1NJ2A 5DLPA 3KOMA 4Z7NB 1M34E 1M1UA 1TVEA 1XPJA 3GEBA 3OJEA 4LPKA 2ZU0C 1I80A 1MJGA 1ZN8A 2QGNA 2ZJFA 3I37X 4GXQA 3B48A 4K6MA 3ZHXA 1UBSB 2UUOA 3M49A 3KB1A 3G0OA 3C0KA 4G2NA 2UZIR 3RR2A 1VE7A 4DWOA 3AP3A 3RTCA 2OGSA 3OY7A 5DV9A 2NADA 1AUVA 2HIAA 3EASA 4QGGA 4MQMA 1P4RA 1L7QA 2K87A 3JSAA 5TRTA 3GMDA 3M9XA 5I47A 1FA9A 4UQLA 4JIMA 1U8ZA 4LXXA 3DL0A 3N8DA 4HV4A 1Q2UA 4ARZA 2FMFA 3FNEA 5AW4A 4ZI7B 3C8UA 1IN5A 1TO2E 4RM3A 4DV7B 5GJBA 1BIFA 5TGTA 5B2FA 2VRWA 3X1DA 2N0SA 5J2UB 2AB0A 4LN1A 1UT6A 2VSNA 2XDQB 3GFPA 1U2EA 5AW2A 1KC3A 3DW3X 1TZKA 2CDRA 4LWZA 2FWAA 4Q1FA 3HA2A 4RLHA 1QQ6A 4B87A 3P9NA 1QWOA 1XN1A 4NOJA 5JJLA 4NABA 2PZJA 2V7GA 2MINA 4ZQHA 4ALLA 4YAUA 3Q0TA 4I5EA 4V0SA 3O47A 4ZYLA 4Q7KA 1A97A 1MOPA 4JOSA 3WDKA 4EHIA 1UM9A 2XVMA 1V4BA 3BSWA 3LO5A 1FP1D 4NQRA 4KX3A 4QOSA 3T1OA 4TV8B 1IZ9A 1ISIA 5AKHA 1PKXA 4YJHB 2QVGA 1IY0A 2YY5A 2ZI3A 4DPKA 4S05A 5EP4A 1E6MA 4HRVA 4B09A 5BWCA 1E7YA 3GA5A 5G4LA 3TNLA 2D8AA 2QJTA 4ANFA 1VJRA 1WXXA 2CXNA 1QZUA 2PX5A 2XB4A 3K4HA 5G0TA 3EGEA 3RKSA 2C5FA 3HO6A 3MNFA 4EKDA 4XB6B 3MJCA 3QY0A 5DGCA 5G0WA 1OBOA 3MMZA 1Q22A 3U4AA 3WO0A 3U4IA 1KA9H 2WABA 1TMGE 4ML3A 4MIEA 1A5BB 1QF6A 1NC1A 2BKXA 3NT4A 4YUWA 5DRYA 3WL3A 1QB8A 1ZD2P 2WJIA 3RB8A 4RH1A 4IF4A 2ZROA 3BFVA 2WSYB 2PRSA 2VP9A 1EFTA 1BRTA 3T7JA 3AUJB 1RI1A 1D3AA 4QQFA 5G4KA 4MJLA 5G40A 3ZIAD 4BNDB 1CERA 1RZUA 3KT6A 1HRDA 1ZIXA 4BQRA 4G0MA 3ZDFA 2GS9A 1JQDA 4ZCTA 3L0SA 3FR7A 4A0HA 1WRBA 1FMJA 2EGUA 3QEMB 1T1JA 5CJJA 1W4ZA 2R62A 2H5LA 1ID1A 1OFVA 3C3CA 2VDOB 4MW0A 2CV0A 4FWBA 5MFPA 1WDLA 2ACWA 3DG9A 3RFXA 2C3YA 1Q0QA 4LISA 5B4UA 3UC5A 2L69A 3AG6A 4AJ2A 4ED9A 2VPYA 1XTIA 4ZO6A 3UKOA 3HG7A 5EP1A 3E9CA 4V38A 4AURA 1BX3A 1JXMA 3EIUA 4ARIA 1GPNA 2JEZA 1P7YA 4OD0A 5HM6A 5E7QA 5FQOA 3WGZA 3LNTA 2O3TA 5HM8A 3PUXA 4N39A 2BI7A 4EUSA 1CVLA 1WNTA 5DULA 4IH9A 3X1MA 1NMZA 1OU4A 4WKGA 1HR0B 1O94C 2EGGA 2D0IA 4ZZ2A 3IIMA 1NVAA 2QW8A 5CIQA 3SP1A 4C0BA 4J7CA 1MB0A 3H99A 3IEKA 2HV9A 1SBYA 3WKDA 4ZOLA 5EQTA 1OC4A 1SVOA 1L3IA 2O6LA 4ZO7A 1BFDA 3LG2A 2C58A 4Z2YA 4D74A 3OZCA 1JKXA 2ZAGA 1U8YA 3MAJA 3BEOA 5JATA 2BP7B 1JN0A 1J2RA 2BMWA 3WKEA 4V24A 2G9QA 4MR8A 2JI8A 5IN5A 4ZAFA 4ZVLA 4ZCMA 5JHGB 3ETDA 1K2WA 4WBNB 3L49A 1KQFA 4D25A 3SLRA 2BUCA 3DBRA 2BTQA 4ODIA 4FVTA 1A71A 2KS6A 4XASA 1XHFA 1F8FA 2FPWA 2OC4A 4S1WA 3U5TA 5TQVA 4KQMA 1R8JA 4BLWA 1A9SA 3IR5A 4RDHA 1Z29A 4TPKA 1Q7GA 3HS3A 2ZB8A 2PGOA 3C7AA 4GGPA 3DE7X 1EXDA 1ZRMA 3OIVA 3VH2A 2IYXA 1G5IA 3LC7O 3GRKA 3HRIA 5E95A 2H3HA 5F35A 1TPYA 1CD5A 2VTKA 1VCOA 1IUPA 3LVBA 1AHNA 4RZXA 1EESA 2BEWA 5IJ0A 3QVGB 3BXGA 1XKXA 3BGSA 3ANNA 5CVVA 2RGNA 3ZDRA 3GUVA 2Q1XA 4JB0A 3LX8A 2WYVA 1Q21A 5EWJA 2NO7A 5CCBA 4DY4A 2N47A 5E1DA 3EVGA 3RVPA 4EVRA 4E3ZA 2YRFA 4Y9DA 1NPDA 2JLVA 1DFGA 3DTVD 5DH9A 4ITRC 2LR0A 3PVCA 3JQAD 1KNXA 4XWYA 2HT6A 4PO8A 5I7EA 4B44A 2J5QA 3K30A 4WN9B 3UFBA 3QU5A 3ZY2A 4D9GA 4DFDA 1XX6A 2FPIA 1W0JD 3S4YA 1DLJA 4DA7A 1XZ8A 1TCBA 4GZ5A 5K0LA 2X8AA 4RGBA 3EEQA 3P7MA 1PR0A 3MT9A 1CF2O 1XU9A 4QBFA 3SKXA 2OP0A 1OH7A 4OP3A 3IDQA 3GFRA 1GT6A 1M2KA 1P2TA 3KFXA 1ZQ1A 3PB3A 4HWGA 4W6QA 5FIUA 4DBLC 2I71A 4AP5A 3QV2A 5ES3A 4OLHA 5EMJA 3TSAA 3V80A 4OXIA 3UMVA 4PVDA 1MABA 3R44A 1S9DA 3F5QA 4CLOA 5TVKA 3CLUD 5CLIA 4KOAA 4ZJUA 3PSHA 5CLQA 2H85A 4D4GA 3CX4A 3I72A 5CG2A 1R1DA 3Q9LA 4GLJA 4KHPB 2IZOA 4Q7LA 4ROSA 3GQVA 2XMQA 3D8RA 2PKRA 4INPA 3WTBA 1X7YB 1FBNA 3E15A 2COUA 2JLXA 2Q5QA 3PF8A 2EERA 3PFHA 4R8RA 2KX7A 3IVMA 3FWKA 1KRXA 1KGDA 1OY1A 1JQKA 1IXRC 4YROA 1YOVB 2AJCA 2G4VA 1G8HA 1LW6E 2HGZA 1M2FA 3GJSA 3SE7A 3C6XA 2QLTA 3O91A 5HS4A 3I39X 3U1BA 2BCJQ 1FFAA 4I55B 3ZIAA 3BK2A 1L1RA 2QP9X 5BMOA 1ZJ6A 2NU9A 2G83A 3HVUA 4EUHA 3UXMA 4DEVA 4JUFA 5FO1A 2JAPA 4ND3A 3Q3HA 2O7RA 2PBFA 1DIHA 3IPCA 3C4QA 1O0CA 3EXEA 4DUPA 4DYDA 1RPAA 5K01A 3EZ6A 3CJQA 1DQSA 3OJFA 2XOXA 3KWFA 3UOGA 4CT4B 4V3BA 2ZSHA 4EMSA 4MGIR 1XZJA 5J5AA 2QAJA 4BLOA 1C0KA 4EPTA 2DVMA 3LVQE 5M7EA 3QSYA 2OUIA 2ROQA 3QVVA 3E7XA 2F1IA 1N2CB 1BZYA 2PK3A 4YCLA 2YJ5A 1ZAYA 2ZB7A 2ZJOA 5DP1A 4DLZA 4GPBA 1WUYA 3BB4A 3WHKA 2RI0A 4OQYA 2Z1DA 1FDOA 3F6EX 1Q0PA 5JRZA 1VYHA 2ZSAA 2RCNA 1I3LA 1V6AA 4INZA 4I50A 3I9LA 2J46A 2R48A 4IHJB 1GSHA 1SRRA 2APJA 2R85A 3IOCA 4IXNA 4R7ZA 4UU8A 1NW4A 1XOIA 1P1JA 4CL3A 5A5FA 3K3PA 1EHYA 4ND6A 4KRXA 4JLAA 5J5VA 5JO9A 5TMDA 5FTLA 3KVVA 2ZJBA 4XUEA 3MWKA 3P0FA 5ENZA 2HMVA 2PMWB 5KREA 1CS4C 1RXSA 3MELA 1R2QA 1G7SA 1JB1A 1ZBQA 4LNUA 4XGNA 3FPEA 3WGNA 4A8JB 4BVJA 2GX6A 5BSGA 2ZRMA 3T7AA 1ZGAA 3BWCA 3W34A 2KE5A 2ZAIA 1YQWA 3ACDA 3FFXA 5JNRA 3R9XA 3VSCA 3QV1A 1U2TA 1GDHA 3HBMA 1ZONA 5EMKA 2F9FA 4P3NA 3S2EA 2XKKA 1Z63A 1GCGA 2PX0A 4IIGA 4Q4HB 1NF9A 1Z4PX 5U9CA 1VYUA 4M53A 1AMUA 4FSDA 4BEBA 1ZCFA 2XNSA 2J32A 2G0TA 2GVZC 2HUPA 3G5LA 1S8NA 3SF0A 8OHMA 2WF6A 3GRZA 5KTYA 2F1JA 3BH6A 5BVGB 4M9ZA 5K0SA 5K05A 4YUYA 5CVUA 3WWYA 1KRHA 3UNXA 4ZKDA 4BAGA 4M6WA 1UJ6A 5I9SA 2NZYA 4DV0B 3SYLA 1WXWA 2ID8A 5GMOA 4YRJA 4JA2A 1XJ5A 2OWDA 2YV5A 5IARA 3AKDA 3OCVA 2TECE 1KY5A 3UICA 4DJTA 1QYXA 4UTZA 5KSOA 5CPFA 2J0UA 2Z09A 3WLHA 2B9VA 2C2BA 2VWQA 4QDXA 1GGNA 2B0CA 1A4XA 1HYQA 1KMNA 5H02A 3DTVA 2D7DA 3GPDG 2R7AA 3X1ZA 4BV3A 2Z1MA 1RS0A 3VR2A 2V4MA 4J4TA 4FYMA 1R18A 4CKCA 1ENYA 2Y1LA 5KYXA 3II6X 1KY4A 1DSSG 3SICE 3MT0A 1UJ5A 3IEVA 4D4MA 2QJRA 5KKNB 3CZQA 4GZ6A 3JR7A 4F92B 2ZM5A 2PZ8A 2AMLA 4WCVA 1FSZA 1SXJB 4E7OA 4KUHA 3USES 4DS3A 4MWTA 5EUMA 4LGVA 4P31A 2D2EA 5EKSA 4XEHA 2X8WA 2EDCA 1DPFA 1AKWA 2XYGA 1PGJA 2ZRNA 3IIJA 4TQUS 4F4DA 5BN1A 1FF9A 3AB3A 3AF6A 2CBGA 3M6FA 1L4YA 2X0FA 2ECFA 4MDHA 1LK7A 4LMPA 3O0DA 5C5DA 5IPFA 1PS9A 2CXHA 4ICIA 4GU5A 3MYYA 1MH1A 3CB2A 3EGXB 1QV9A 2M6KA 3OM8A 3UOWA 4OL9A 2EP5A 3A3YA 3HLTA 4RY8A 2IV3A 2XRFA 4IIYA 5ICMA 4L07A 2YX1A 1HT3A 1N0WA 1GAJA 4I2VA 4B3MB 1LPSA 4R3UC 2GWHA 4C0WA 1NV9A 5CH8A 4I8DA 4M1QA 5AM1A 1WSWA 4GWLA 5D3MA 5CH5A 1M1NB 1E2PA 1WWKA 1DUVG 2OLJA 3SE0A 3INTA 4G65A 1KZ4A 3UJ8A 3DB1A 1RLMA 1VSTA 2GETA 1IM2A 1PAUA 4FYPA 4LY9A 2HA5A 4MRAA 1O8CA 4CQLA 3MCTA 2FG6C 3BK1A 5BUZA 2P9JA 3OJWA 5FORA 3H5IA 1UBCA 3JQDA 4LHXA 5DOVA 4EZBA 4IXWA 3FMFA 4IZ6A 4ASUD 1PZMA 3WAKA 2CK3D 4KOEC 1QDLB 4NU0A 4ZMRA 4CUZA 3PRKE 2A1TS 2GK7A 2DLCX 1K92A 3GCXA 1V39A 4GKJB 2CE7A 3G6KA 2JK1A 3JAKB 3KJGA 2FSVA 4M8NE 3JQBA 3W2FA 1I7PA 1B3BA 1QFZA 1XEXB 3D3JA 3E3LA 3P8ZA 4RY2A 3V55A 1SUPA 3KL2A 4IQFA 5JCZA 4NCAA 3LSYA 5EHIA 2WTNA 5AUQA 4Z49A 3JWIA 4B79A 4BNIA 4AKEA 2DFPA 1QHFA 4IV5A 2FV8A 2GERA 1TFUA 2G3YA 2J7PD 1E5QA 4MI1A 3LCUA 5HRUA 3ICQB 1W44A 3NQ41 1KZHA 2R96A 4IUBS 4OI1A 3VRHA 4NIMA 4RVDA 3VR5D 1RBMA 3LPNA 4GHWA 3NI2A 2XB6A 3L7AA 4RCVA 3EF3A 3OQMA 1QP7A 4YHHB 3P32A 3RU3A 5AI4A 4BAUA 2XWPA 3PIRA 3TRKA 3CJTA 2P5UA 2XMGA 4MCJA 4R9VA 2DPLA 5AP9A 2YZ2A 1JBEA 4PQGA 2GHRA 4B3CA 3C45A 2P40A 3P52A 2RSLA 3AKZA 3IEMA 1Z07A 1Z39A 3KQVA 1ZRNA 4G2TA 5CMLA 4TYPA 4TOIA 1Z4NA 4KMRA 3DPIA 4KEAA 4CM1A 1TQ2A 1C0EA 3R0IA 3KKEA 2YJ6A 3NVDA 5IKEA 5JXWA 1J8QA 1VJ1A 3IQDB 1O6CA 3PVZA 5LLSA 1YJQA 3GLGE 1RM0A 1OAAA 3CUYA 4Y7DA 1WZUA 3IVGA 1BA3A 4PZUA 3V6LA 4HWRA 1SD5A 3EIHA 3NVMB 1KIAA 5FBHA 4CGYA 5BNIA 1LC3A 2JHFA 5DTIA 1SIUA 2M2IA 4MS3A 2VNKA 3HJRA 4UDXX 4WNIA 4C7VA 4DQUA 3O8OA 3T34A 1G2IA 2CKDA 4EA7A 2ZETA 5GM1A 4DG5A 3AKCA 1U0BB 5P21A 5KJFA 5JAIA 1CG6A 4K88A 1E3QA 2HA0A 2GEBA 4KNWA 2H17A 3PPWA 3WL4A 3FDXA 3LWBA 4TRMA 1BVHA 1EUCB 1UKAA 2QMUA 3KLMX 1WVIA 2UUAB 1IHPA 2D7CA 4RTKA 3N2KB 3P20A 5BT8A 3FLEA 2WWYA 4D8YA 3ZDEA 4WKCA 3KQSA 4ZANA 1PEKE 2YIDA 4QYIB 4BNLA 4N7JA 1SVWA 4XWTA 3OIDA 2WPDA 3VDQA 5K3AA 3HXMA 1A7AA 4TL9A 1VE1A 1XC7A 4F0JA 3B3QA 3QYFA 3TX6A 3MJHA 2D4AA 1RRVA 4U7HA 3GCGA 3U3JA 3LV8A 2A35A 4CJXA 4D3XA 1DRJA 1SHKA 1T24A 3RS9A 3SYNA 3VYRB 2NP6A 2WWHA 3N0XA 2PRIA 1QO7A 3A27A 4K8RB 2P30A 2QNIA 2GWRA 1Z47A 4JBXA 2C20A 3SNKA 1XD2A 4RIEA 5HFJA 4L8GA 2RI6A 1W36D 4HAZA 3EPPA 1O2DA 2PBLA 2VJNA 1KWGA 1R16A 5IT5A 3WA7A 1GU0A 1HQDA 2IE8A 4YMSA 2QT0A 1CJTC 4L95C 5ITWA 1FZTA 4LFAB 4RS4A 3INRA 3R3JA 1E2JA 2Y9PB 4L8FA 4ENUA 1CR2A 1NVVQ 1UKZA 2HF9A 1JIIA 1MJFA 4RHEA 3D81A 1ZR2A 2FWMX 4CF4A 5G2OA 2Y2UA 4HSGA 1TVKB 1O6BA 4OMFG 3SKYA 4R71A 2G70A 4ZGBA 1F4LA 2XRMA 3TTWA 3U61B 1U6KA 4EA8A 1SBTA 1NNI1 2RC6A 5DXAA 1NNUA 5C1OA 4FE7A 4N7RA 3RJZA 3T0FA 1Z8DA 2IGTA 3F98A 1ECLA 3D6TB 4XCVA 2ZT8A 5FPYA 4H7IA 1FC0A 4H6WA 1D5WA 1CUAA 5HF6A 2P41A 1E3EA 2O07A 4YAWA 4JYZA 4B83A 4L72A 3ZH9B 6LDHA 5CM2Z 3PX7A 3GA0A 3E1KA 4KWTA 5CP8A 4IQ0A 1SCBA 4N47A 4CM7A 4C7OA 3RK4A 3JVDA 4A8HA 4PX9A 1YUBA 1EXWA 2PH1A 3LDFA 1LVUA 1EGAA 3R7FA 3WY9A 5F5NA 5JI3E 1KS2A 5JPCA 4TQAA 4I4IA 2H3EA 2CHUA 5FUVA 3F74A 3OHMA 3QKUA 5HR5A 1C0PA 5LYJF 1NHGA 3GWZA 1FX0A 4E5MA 4BY9E 4LWOA 4Y2PA 3RYIA 2VLBA 3KQLA 3I61A 3H8VA 1YU9A 3M6LA 1PJZA 4Y6LA 5HFNA 2XDYA 4DM7A 4DUGA 1NQTA 5KUTA 2P6MA 1IRXA 5SYAA 3VYSB 5JOQA 5LM3A 5HFAA 1FS4A 1CR0A 5FPKA 3VR5A 3IOEA 3Q9SA 4QXMA 5F2EA 4DQKA 3BIXA 3UK7A 4PTYA 5HIIA 3TZHA 1GV0A 1REQA 4FC6A 3P2IA 4WY2A 3RC1A 5LMUB 1L8XA 4ZGWA 2YXEA 5DHUA 3OCXA 1WEKA 4DDKA 2V0GA 4BFVA 3W9BA 4J6EA 3IQHX 3NJ4A 3TLXA 3F5DA 4U2DA 3PPYA 3AHCA 1RD4A 5DEOA 1W6RA 2D0OB 2I3DA 4Q6BA 2YYAA 3C97A 2XE6A 4WHMA 3IXLA 1ABBA 2FR8A 4EEKA 2JD2A 1LW7A 3WGQA 1R8QA 3SYMA 4M4SA 5J1SB 2QYHA 4ZODA 2BGRA 3RPEA 2X41A 2EYQA 3TL6A 3V9PA 1IZ8A 3UGQA 2H48A 4AM8A 1TVMA 3LGAA 2P3LA 1XXHB 4O63O 2O7NA 1EK1A 2XWSA 4KYVA 1IWOA 4YDQA 3MRSA 2PVSA 1LDYA 4LDNA 3V46A 5MF6A 2W2LD 1V16A 4MW5A 1YR1A 1GN9A 1TLFA 1Z37A 4J29A 1SQ0A 1AXGA 3DVQX 2OB2A 2HL6A 4CZ2A 3OPMA 3QEOA 2HSZA 2VAVA 2F62A 3BCSA 1L5MA 2AXPA 3MWFA 5HKOA 3HB5X 1P0FA 4HVLA 5LZ9A 2JLZA 1F7VA 4GDMA 3THSA 3FX2A 4L57A 4YJFA 2GESA 3FYHA 3OETA 4RWZA 1VPTA 3QWFA 3QPAA 4DV5B 1F7UA 4ZQBA 2XCQA 4YECA 3WB9A 1NXXA 2IU6A 1BMDA 1O4VA 3W05A 4L7VA 1O1YA 2Q8NA 2VG8A 1DC6A 4V0LA 4F60A 3BMOB 3WFJA 1CP3A 1Y80A 3W8FA 1XHLA 3N3AC 1OLSA 4IJQA 3TZKA 2IK8A 1DIBA 4Y0AA 4BYMA 4LQCA 5T5QA 3MFYA 2C61A 4PRYA 2BGKA 3DBOB 3LS2A 4QXQA 4ZOQI 1RU3A 2H0RA 3QQPA 1I32A 5JEEA 5AKEA 5FRDA 3ULKA 4HBZA 1PT7A 2YYZA 2O8CB 1E5VA 3HYCA 4C21A 1A9RA 5C1PA 2A0WA 1G55A 4TXJA 1R4NA 2YHIA 4FE3A 1QGUB 4P4TA 3IDSA 4NV3A 4XXHA 2H1WA 4J9VA 5K3EA 1PRYA 4GBGA 1O0SA 1GXSB 2WPNA 1ZJZA 3O2NA 3OQVA 5DIFA 4CQMA 3SC2B 1ZK2A 5JCPA 1DPGA 1IWPB 1O5IA 2OK8A 4AECA 4AN1A 1SWVA 1UR5A 4FZVA 1XQXA 4HP8A 4INAA 1K7CA 1T36A 1LRLA 2OG2A 1QIGA 4ZT3A 4DR2B 1JIQA 3IAHA 1QSGA 5GJVC 4DIEA 5DJ5A 4PVCA 1PNQA 1EI9A 1RZ3A 3CA8A 3CLUC 5FTNA 1D2GA 2JGIA 2ZYTX 3LPCA 2J9RA 1CRZA 1G7RA 1HA3A 3K6JA 4G81A 3TL3A 3K71B 1I33A 1V11A 2EJCA 4KZPA 1Z4OA 3W7AA 3G8AA 2PMDA 5AJYA 4OHYA 3LOPA 1EGHA 2Y93A 3OCWA 2WD9A 2SICE 4JLKA 521PA 2QENA 2BFBB 1MW8X 2PPVA 4UOZA 1M67A 4CG1A 2VK2A 3EN0A 1ECGA 1WR8A 2VXCA 1MX1A 2JFZA 4GI7A 4R1LA 2WW8A 3KUCA 4POOA 3PTAA 3ADDA 1KJ9A 1XG5A 2C9BA 1VGVA 2PZKA 5IC4A 4QATA 1F8YA 2C29D 1FYFA 4HVCA 4I8XA 4RQAA 4D9FA 4F56A 3I6QA 3STWA 3RVJA 2CXOA 3AJRA 1WZEA 4N12A 3OF3A 1YS7A 2FKNA 1QONA 2PO5A 4FEAA 2YICA 2E49A 3AR8A 4BRZA 4E09A 2NOAA 3TNJA 4PR3A 3H5AA 5DWDA 2JD0A 4EZEA 1YF3A 4LY3A 4Q1CA 3U31A 4GF5A 3ZE8A 1RTTA 1W88B 3AYXB 2I4NA 2VRCD 3A6DA 1YRHA 3FLMA 2FN7A 4O2BF 5BPHA 3A1CA 4V02A 1TZMA 2IPNA 2ZZMA 4NZPA 2H08A 2ZS7A 3BOSA 1QH8A 1ADFA 1AUQA 4MV9A 3ZWVA 4NYJQ 3NONA 4BO3A 2EFCB 4C6SA 2ZAOA 2C0QA 3B9QA 3EXG1 4HPXB 4YR9A 1COZA 3IP3A 4PAMA 3IBCA 1NMYA 1TD1A 4GZ3A 1GDDA 1KU0A 5J2TF 1N36B 3KELA 1EG7A 5HZGA 2JZCA 1X94A 2P4QA 1YL6A 2IDZA 4HNHA 4P33A 4LGCA 1IN8A 5E9WA 2XCRB 3M4JA 4NBWA 4N7MA 1NUSA 5I48A 3CS3A 4IKPA 3B3AA 4GUAA 3F97A 3HBAA 2BH2A 1IXZA 4QOEA 1M1ZA 1OXBB 5JD4A 2RHHA 1DMSA 5FTWA 3LUBA 2C4NA 1W25A 4RVSA 1OPXA 4W63A 1PVDA 1QX4A 5CNKA 4WOJA 3WYGA 4ZYWA 4O3MA 3AF5A 3LX4A 3EC2A 1FSFA 1KARA 1I5RA 1ZW1A 3VR4D 1ITZA 1QZXA 3DKVA 1JH8A 3TMAA 2PUTA 2FSHA 1WXEA 2W8ZA 2G04A 3ZJ5A 4EVQA 3IODA 3SHOA 1HTWA 3REQA 1TD9A 4B5KA 2JBAA 3K09C 4WNAB 1GYQA 3F7NA 4FE4A 2OECA 2GPTA 2QL6A 3TW8A 3ZBUA 1GCUA 2G17A 4RZHA 3T9EA 4EK9A 4PLGA 1F2TA 1XZAA 1Z9BA 3LT4A 3N6XA 2PH7A 2OQVA 2GILA 4PSKA 4E7PA 2J5BA 2DC1A 4KG7A 2K2QB 4R2KA 1RXCA 3ESBA 3CH5A 4X41A 4X60A 4ZOAA 5BN3B 4QVIA 3Q7QA 3ZGNA 3FYDA 1Z6XA 3SK0A 1Y9AA 2XQIA 3A2KA 4WWHA 2WP0A 2QLNA 1ELOA 3HCEA 4LF5B 4RWEA 2XBUA 3ONNA 3DTNA 2WNIA 1H4SA 1IJFA 2Q9UA 1JQ5A 4QNRA 1MZPA 2DKOA 2H9AA 3I6ZA 4Z8YA 2I2AA 3LBAA 2ZZNA 3RRNA 4EG3A 4PIPA 1BS9A 5IN4A 1O6FA 1U2ZA 2ZRHA 4FFMA 4XSGA 5CRIA 2EC5A 4HGRA 1VI2A 1TZ2A 2BZGA 4NEHB 3AO0B 1TMOA 4ETWA 4R9SA 4OIMA 2ZTMA 2MHCA 1SD1A 4YLEA 3IX7A 1OWMA 3SHQA 3VI3B 1EFPA 2X2FA 3QVLA 3S99A 3LPAA 3CNOA 3CPJB 1N7IA 2P27A 1B8PA 2ZKIA 3PQEA 4MW7A 4AWXA 5JQGF 4K03A 3BAFA 3C87A 1FYVA 2ONYA 2LKDA 3UWPA 1Q11A 2GOYA 5IC5A 1X1DA 2XD9A 3PNQA 4U2BA 4R98A 5EJ5A 1LVGA 1MQAA 1QIIA 3UO8B 1VHJA 3OT5A 2I78A 4C3ZA 3LZDA 3WWZA 4X97A 3SX2A 3OI7A 3F2IA 1PG2A 3STYA 1U8AA 1YR3A 3CXUA 1KOGA 1JHUA 1C7ZA 2XGJA 1DBPA 2CBZA 2GJ8A 2O7QA 4Y1EA 4CG3A 5BNFA 3L9XA 2H4WA 2VPPA 1U81A 3E5NA 2RMKA 1K7YA 1V8PA 4YRQA 3EAQA 5F9FA 4GBED 2DECA 1NUUA 4JGGA 1A3CA 2H1FA 1C4XA 4NYJR 3NHWA 5BSUA 5CXUA 4FUQA 3DYVA 2GJ9A 1BDBA 4MMZB 3L93A 2Z5FA 2FMXA 3V1LA 3RRFA 3WWEA 2P9GA 4N9WA 2NZUG 3D43A 1D8AA 1WO8A 2L0XA 2ID4A 1SCNE 2YV1A 3ECCA 4IM7A 2OYRA 4BASA 3MPUA 3SLGA 2VRCA 4FBGA 1W581 2WKWA 5EMMA 4F45A 5LOVA 3K73O 2BRUC 3D5TA 1BXZA 2BEKA 3SD7A 1CZUA 1VSQA 5DCWA 4OAOA 3N7TA 3DXFA 3OEHD 5CXQA 3GJZA 1I7NA 3PFFA 4Q05A 4GOLD 2C9CA 5T41A 1NXPA 4DQ0A 4EW6A 4AKTA 3ZY3A 3OTOB 2X9QA 4NATA 2C5LA 3PWZA 1J0DA 4KR0A 4Q7MB 1DXQA 4BC1A 4GX2A 3R7BA 1IZ0A 1PG0A 1A4IA 3WI7A 1GY8A 4U0KA 4YA6A 4H1TA 1O7JA 2QI9F 1ZUIA 4Z53A 2V58A 4WESB 4QO8A 5C1BA 1TT5A 1IY1A 3UMFA 4UVGA 3D8SA 4LJKA 3U9TA 2QD2A 4UCFA 3SS9X 3A1WA 3DJYA 1N2IA 3RKUA 2ORVA 1I1QB 2VJDA 4A6PA 1SUFA 4ENSA 4GR5A 4B34A 2JH3A 4B2YA 5GWXA 1ZD4A 1DO2A 3B13B 4RPJA 3UFXB 3MFQA 3EZ7A 4FFSA 3U0BA 4NCKA 3KBBA 4XE5A 2WIAA 2CC2A 2F48A 4NJOA 1U0EA 1ZN9A 3NXKA 5KYVA 3VR4A 5AWFC 4A8PA 1DEXA 1GU1A 4GX1A 2OWEA 5TE9A 2YMPA 3EVCA 3EQ7A 2OCGA 5BMVA 2QZSA 4ND5A 4I08A 5A9TA 5H8WA 2VT6A 2NYAA 4H7DA 2FFHA 1FBTA 1L7RA 1U7XA 2D2IA 3JD3A 3T9FA 1FJGB 4QRIA 1W75A 3DQZA 3S68A 3GEIA 3NOQA 3CC8A 4BNHA 3PLRA 1E77A 1B16A 1I6KA 2GAFA 1PFWA 4GXNA 1YQGA 4HQKA 5A7HA 4EENA 4YV1A 4FIZA 4JVSB 2C4TA 3HP4A 4JWKA 1NI4B 2HU5A 4YXFA 4KMOA 2QU7A 4QUHA 3AM4A 4AFNA 4AMUA 4RJJA 1XTBA 3FHCB 1XA3A 3V2GA 3DNFA 2IHUA 2EJBA 1M3SA 2AG1A 2P2GA 3M1IA 4HWPA 5D3ZA 2IYPA 4DEXA 3QP9A 3BF8A 2ZWIA 1PWZA 2ZXEA 3R5JA 1U63A 5B3JC 2HHAA 4OQDA 3RSQA 4B3XA 4ZU3A 3LCRA 1DFIA 4M0MA 5DGDA 1M6HA 3NW9A 3ZWPA 3VFDA 5IAOA 2QR2A 2XOKA 3UB4A 1FFBA 2B8NA 2G7ZA 4KK3A 2AFHE 3CU5A 4A6DA 1YDWA 4YN3A 1HUQA 3VAYA 3LC0A 3QOXA 1T6YA 1HDRA 1LUAA 5DKFA 4Q9HA 3HKBA 5ADVA 5IJZA 5HK8A 2WJVA 1DBWA 1J0BA 1JKJB 3EVTA 3EXHB 3MTAA 2P78A 4HDMA 4MUJA 5EKTA 3QWIA 4BB0A 1MGOA 3MIIA 4CEJA 1P17A 2HGSA 3ZDDA 1QOQB 2D5CA 1LI5A 2B4KA 2IITA 1MXHA 2WG1A 2YIVX 4GKKB 7ADHA 2VYNA 1ZGCA 2V45A 1G7CA 1Z0JA 5C4IA 1AQIA 1M1YB 4TN1A 5CUQA 3QG1A 4IDQA 4OQEA 1JE0A 5A04A 4J03A 4BNVA 2X9VA 1E2DA 2AFHA 4S0ZA 3WB1A 1Z83A 1X80B 2JFVA 5KSYA 4ZT2A 4GOKA 2HWXA 2DFDA 3HGTA 1JG7A 1ZD8A 1IY2A 4DDMA 4EX7A 4EGSA 3G82C 1C80A 4RD3A 1B1AA 1IHXA 2ECPA 2V7EA 3O7MA 3R0ZA 1P31A 4LZJA 3KVOA 4M86A 4FLEA 3RWMB 4FR5A 2QXTA 3FMPB 4XQCA 4E5UA 1R3UA 4Z5XA 1NUHA 4CMKA 3VU9B 1X7WA 1TOAA 3NEPX 3AJ9A 5KYNA 3FPFA 4B73A 3S8EA 3OFND 4QASA 3G5TA 1K7XB 1EZ4A 2HLPA 4Y9UA 3N5CA 4QPCA 4TZKA 5B1EA 3RS4A 1MX3A 4CMIA 3KEOA 3ILSA 1QRAA 3M82A 2B21A 3OZIA 2QRHA 5TQ0B 3B1YA 3AW8A 2ZJ4A 1FNMA 2EIHA 3KSBC 1LSUA 1LFAA 3EZGA 1C7IA 1I3CA 1NBOA 3URMA 3OEHA 2JI6A 3QE0A 3OVMA 3O21A 2HF7A 3R0VA 3WLQA 4BO8A 1MQSA 2PQ0A 3DOFA 3AESB 1O57A 2OCIA 4BYGA 4ZK6A 3RRMA 3VNRA 3FSGD 2C78A 4GMHA 2R68A 4RESA 3F5SA 2WA1A 1CQJB 1KAEA 3VKVA 4ESVA 1SA0B 1R6BX 4MWDA 1V95A 1NN3A 4U7GA 1CJKC 1GEGA 1NR7A 2IYQA 3FXAA 3ZYZA 2ATEA 1RMTA 3VSEA 1X1RA 3R3VA 4XX0A 4IZHA 1YUMA 2Q49A 1PZXA 3MJSA 1JXAA 1P6XA 2KYRA 3GAFA 1NY6A 2VCYA 3I8OA 3RADC 4KLRA 2HRDA 2PJDA 4PZLA 3CZ9A 1EBUA 4JK3A 2QSZA 2PEYA 3UCEA 3PGVA 1C3OA 1OBHA 4NENB 3T5AA 2I67A 1EFUA 2EATA 4R8MA 4G24A 2B99A 3CX3A 3D3WB 3Q7SA 2AD5A 5EKXA 5B37A 5EZQA 4I1YA 4RTMA 5BR4A 2JB9A 1MJ5A 1KAQA 2JFXA 2ORED 2B94A 3OZXA 1B73A 1E7WA 1W1IA 3PEUA 3VOBA 3W8NA 3S2GA 1NHWA 1R7RA 3H2YA 4MVYA 2QTRA 4PNPA 1S2DA 2EGHA 2WMNB 1P81A 4GWGA 5JAUA 3O3CA 3UAXA 3G8BA 4JY7A 1QGAA 3OUZA 4GMFA 6YASA 5KO2A 3S6JA 4HZUB 4DHEA 1QQ5A 1SU7A 3IUJA 1Y33E 2VK8A 4FKZA 2ERXA 4HDKA 1E64A 1KDOA 1T2DA 5AJWA 4B4OA 4D45A 4QWMA 2WSIA 1UDXA 2RGXA 1LWNA 5B7NA 4F4UA 4RFSB 4RU1A 2NO9A 2IXBA 4GX0A 1IVSA 1K0UA 4J49A 3L5OA 5LA6A 2DHCA 4KRYA 3ZE7A 3ROFA 3RWOA 5D7NA 1D07A 2ZB3A 4RIFA 3Q8MA 4LJ4A 3VKHA 4JT2A 5K3FB 1QB7A 4EYEA 1AURA 2PWAA 1VPWA 2XXAB 1B7GO 4Y2RA 3TVYA 4KZKA 3LTNC 1TW2A 2I80A 4LMRA 5C34B 3RRJA 1O96B 1XZBA 2Q5JA 2GZ2A 5HG0A 4AS1A 4K2AA 4G23A 4MV3A 1FTYA 4LW8A 5JU6A 1GSAA 3JWEA 4GVXA 4RVNA 4DBVO 3AEKA 4D0GA 3PYXA 3QNUA 3DZHA 2CLLB 1FCJA 1FMTA 1ZH4A 2HC9A 4PNEA 2E5FA 2YQZA 1TI7A 3SC6A 4AJOA 1LLCA 1K3UB 2WV7A 1YKFA 2IHYA 5DHRA 3H04A 1DEHA 1GPMA 2G1UA 1PSWA 3M9WA 3TEFA 1MEEA 4UM9B 3MLEA 1MA3A 1BVYF 2P2ZA 5DASA 4WMLA 3SM3A 3SSOA 3NBFA 2XQKA 5BWBA 2WJGA 4Z1OA 1ZDMA 3ANTA 4IMPA 3N2EA 1U7TA 2R751 4QTXA 4R83A 1YNOA 2XR1A 1DADA 1B0AA 2CUKA 1VKRA 2YXBA 1Y3CE 1C30B 2RK4A 1P44A 1YBAA 2J4DA 1Y4ZA 3UJHA 4B31A 5CFNA 4I4LA 1ZXLA 3DZGA 1ECJA 3OQJA 4WLOA 3VTZA 3ZU2A 4PBTA 3EMVA 1EX1A 3QBTA 1G17A 1NVMB 1CZHA 1XRNA 2QV7A 4ZZIA 5L7TA 3K1ZA 3EE6A 2WWTA 1KFJB 5DK6A 5EWLA 1CJSA 2YWBA 5LDGA 3TIVA 5AK5A 1PIWA 3OWHA 4TZ0A 4FJ0A 3K0FB 3B3JA 1E0KA 3PFKA 1RQPA 5AW0A 2K6GA 2ZE6A 3CNHA 4A0RA 4BNUA 4KDRA 1SK8A 2ONJA 4YJ2A 1CUUA 1M8FA 2INGX 1HBJA 2OG1A 2WJYA 3IAFA 1G42A 1Z7BA 3CTMA 1ORVA 1OI2A 2E1RA 1S1CA 4F2PA 4R69A 4Y6OA 2HMYB 3S7ZA 5CLGA 1RHMA 3KJZA 2GGSA 3LY5A 3AXTA 1YFLA 3E7FA 4P34A 2X2EA 5KYGA 3SVTA 3D0OA 5K6AA 1I4TD 3M4ZA 3QLTA 2ZDHA 1RE1A 2ZBPA 4HQNA 3TXXA 1Q50A 3GN1A 1JLLA 2J59A 2BFPA 4LYYA 1FVXA 2X7HA 1M0TA 5LU8A 2Z6VA 1T0HB 2Q4OA 4RW0A 2YC4C 4LS3A 3LBIA 3RH0A 2XIJA 2VJLA 1J9EA 4HY3A 4OHWA 4KXLA 4K0RA 4W6ZA 2R86A 2ZUWA 3SXUA 3WRWA 4TWIA 3ZD7A 3C6KA 4D57A 1FDUA 1WD7A 2OKGA 2Q07A 4UTVA 4Q3BA 2HIHA 3PQ6A 2FZ4A 5TVGA 4BNKA 1QZ3A 4OHFA 4US2R 1JB9A 1U0GA 4H18A 1NVXQ 4F86A 2ZIXB 1MPXA 2VHWA 3D6VA 3QA3E 4QOIA 4XWKA 1PJTA 3HBNA 3A70A 3GXBA 1N2EA 1PJAA 1WVGA 2AA3A 3IKVA 3MCZA 3NU1A 3NX4A 5HQ3A 5CGZA 4QPNA 1SO8A 3SOPA 2E4VA 1LLQA 2BBSA 3KYDA 4H1VA 4L9WA 4KXWA 4ALMA 4CV0A 5EJIA 1LJLA 4FW8A 2D0PB 3CVWA 3URKA 1WZIA 2WJHA 1MG0A 3ENZA 3ONFA 3Q3JB 4I9GA 3MGGA 3VAAA 1XJWA 5JEDA 2XB8A 3AYZB 4RADA 4MYCA 5SZKB 3T1TA 1K66A 1TL7C 2AMJA 1LPBB 3K32A 1GRNA 5IEBA 4BCBA 2B5VA 4RMHA 1KEVA 1U1CA 4IAOA 4KAAA 1Y5IA 3WJAA 4EH1A 5HHTA 3DEJA 1KQNA 3SVZA 3HJTA 1HNXB 3RSHA 2WAXA 3FGPA 4XJTA 3OA0A 1BN6A 1XMXA 5FUWA 3E5MA 3JRWA 5EIHA 3TJRA 5HW0A 5HJEA 4MZDA 3K15A 3OOSA 2WF8A 1EUYA 4F1WA 4X44A 1L7BA 2JHAA 3R5SA 4DV6B 4JZKA 1Z35A 3GBVA 1T6NA 2OV2A 2O5VA 3A6ZA 3V1UA 1DKQA 4UUBA 2F3UA 1A96A 2YQ5A 3B85A 4MVCA 4B6RA 5JWOA 1T4CA 2QNBA 3PLNA 4LKRA 2ZRDA 4XLLA 1W48A 4PHGA 2A9FA 4YLGA 3EZXA 1ZRSA 3BSYA 3T5MA 2V7PA 3M2PA 3DNPA 3HKEB 4HLCA 1D7AA 4BGVA 1QMPA 3KETA 1W0KD 4ON9A 3O9VA 1TU4A 3HDGA 5AKYA 1TM7E 4URXR 4NC9A 2AHOA 1ML4A 1E7MA 2WIFA 1YZLA 3FH0A 3J80A 1PJ8A 3LUHA 1FOEB 1RBYA 2Q1WA 4JLOA 7ABPA 1VBMA 2XIQA 3HY3A 4W5NA 2PLFA 1QJCA 2Y1DA 5A05A 1GKIA 1D6NA 1Y6FA 1U3GA 3DDCA 2PFKA 2ZUBA 1TYCA 3K2BA 3BA1A 1ENPA 1L8QA 3MCUA 1KI4A 3TWOA 1YMVA 3R3UA 2J3DA 4JQSA 3TZCA 4R0MA 1UP4A 3I1YA 4YRTA 4NFYA 4XUCA 2OHOA 2BI8A 3DUFA 4Q15A 5JAPA 5CDUA 4ZPXA 5BOVA 5LLTA 1LEHA 4QULA 3FIUA 4HQ0A 1HTBA 3E22B 1J4AA 2EYUA 4OBXA 2B1GA 2BKLA 4NMHA 3K0AB 2HEGA 5A0VA 4IJ6A 3IAUA 1DGQA 2IYNA 5M29A 1BO6A 2Z5LA 1PX2A 4CG2A 1TKCA 1CR4A 3QUCA 1ZHOA 3IGFA 4X1KB 7MHTA 3MG9A 1NC3A 1VXRA 4M0LA 1U9JA 1L4LA 1YIOA 5CX1A 4BJ5A 2GCPA 4D9NA 5LKAA 1O58A 2XGGA 4KI7A 1BGWA 1FP7A 1PU2A 1T10A 3ICPA 3NHZA 2PUHA 4ZJYA 2X7JA 2PWPA 3B8EA 4LE2A 4R7TA 2DJ5A 1QQAA 5M3BA 4KK4A 2FA9A 2KQUA 2DYKA 3D0KA 4RLSA 1RI3A 2IFTA 1EVKA 4YEDA 2X5OA 3R6GA 1I1NA 1RQLA 1LQUA 2QVLA 3CCFA 3IDOA 4IWYA 2FZWA 5B1YA 2LW7A 4A82A 2JA1A 2VDRB 3LQ1A 2J85A 2C9ZA 3NYRA 4FCCA 1CBUA 4ZALA 1PEYA 1W94A 1R6XA 5LYJB 4AWAA 2IWHA 1CYDA 3W5IA 1HE4A 3MVEA 1LNZA 2CB9A 4C0QC 1CETA 1HV8A 4L8WB 1A2BA 2IYAA 1FS6A 1H93A 2M9MA 4DPLA 5L4LA 4BE7B 1XDSA 1FSGA 4OREX 4F4IA 2KPOA 3PVSA 3PWTA 2Q2VA 3K9FC 3TD9A 2GXSA 1SC6A 2BSAA 2PVCA 3EG9B 3G0GA 3HDVA 3E81A 1PK9A 2G7MC 4WZBE 1TA0A 1QK5A 1OXSC 3W8EA 1DCKA 4LQ4A 1IXYA 1ORHA 4S24A 3VTAA 3RNOA 5F5LA 2IPMA 4CYMA 4ZN6A 1V1RB 2AD1A 2AOTB 2BMJA 3HCCA 4X8OA 4IHAA 2DFVA 1CUBA 2IWRA 5KHOC 3HM9A 7AT1A 4G1UC 4F3NA 2OMEA 3CRRA 3SX4A 4LHEA 1CRPA 3R9IA 1LI7A 3FLBA 2O3SA 1MUUA 1PJLA 5HKKD 4DIOA 4FEGA 2CLSA 1YASA 2DR0A 3DOJA 5FBLB 3UTDA 1ADJA 1USGA 3IP9A 2WYOA 3TQCA 4IDBA 4EGQA 1DQNA 3EWNA 3KT3A 1YB7A 2PFSA 4QUJA 4TS4A 4YP6A 3SQNA 4KL8S 2ZWVA 3OZDA 4TKVB 621PA 2NXNA 1J7KA 3GJ4A 4IV0A 3UV3A 3KJFA 4C4ZA 1GYPA 2AF4C 4FYIA 3V2UA 1GRCA 3VPCA 3KKNA 1ZK4A 4N8EA 4YYZA 4AY3A 1G6HA 5FR1A 4XM0A 3KTAA 5EERA 1T2AA 2DSNA 4YASA 3WKBA 5IFKA 4BAZA 2BLNA 4XTCS 1HYHA 2H2HA 4YUZA 1U3TA 2J7KA 3HJCA 1EWQA 5DN6A 2OFWA 3FWZA 1GJRA 2R1TA 2YVAA 3NDJA 1N0UA 1RI5A 3NOVA 3S70A 4KXMA 4F5EA 3MLAA 3BJZA 3TAHA 1H8HD 1ZA2A 5KDOA 3K9QO 4O25A 2H31A 5IWAB 3K70B 4RIHA 4DLYA 3D1VA 3BB3A 4ZQCB 5F12A 5I45A 1U28C 2QGZA 4B71A 4ZZ3A 1B0ZA 1P9WA 1ZR4A 3C2QA 1E5TA 1QAOA 2ZI6A 2VNSA 3NIDB 1W9MA 5JG7A 4EUEA 5F7ZA 1ZLYA 4G0UA 1DE0A 3QVMA 1JIKA 2ADOA 4N7BA 2NXEA 4F84A 2HK9A 4GRDA 2WYIA 4B32A 4JJAA 1VIMA 3SBOA 4ZFNA 2B8EA 4HGPA 1DBRA 2O8BA 1J1ZA 3SFZA 1M73E 1JV2B 1PTJA 1WF3A 3PXXA 4YO7A 1ISHA 1RWPA 2W2KB 3WK9A 2Y0EA 1F2UB 1X1QA 4X7MA 4BMYA 5C8YF 1W76A 1MB9A 2ZYSA 1P1IA 1ZAKA 2VIIA 3CY6A 4KKXB 4UHFA 2OXEA 5FF9A 2EZ4A 1UBOS 3FG9A 4P35A 2CKMA 3UKJA 3O8LA 1CUIA 2I87A 3CURA 4HLNA 4KVZA 4O4JA 4DJ5X 4DA4A 2IV2X 4KXNA 3I2JA 1P5JA 3O38A 4BS9A 4TM7A 4YJGA 5DGHA 5DNEA 1RCUA 4DLRA 1IOWA 4ZTUB 4MWEA 3ZLJA 2Y1WA 1ZPDA 4GPTA 3PC8A 4Q7QA 2NSYA 1ZGBA 3FUUA 1M2WA 1NUTA 1RTKA 2JJ8A 4HDRA 2HRBA 3EZNA 3A05A 3QELA 4KODA 1FLNA 1U31A 4XYGA 2H4HA 4BECA 4OMDA 3FVVA 1K97A 4IEEA 2A1UB 1XNRB 3CB4A 1YE3A 4LJLA 3QWAA 3SI7A 1WMAA 1A9YA 5JJIA 3GT3A 2ANCA 2I9PA 1T4MA 3ORSA 4HFRA 2NWQA 4TUYF 3AHDA 3AERB 4DBZA 1SCKA 3OOHA 1L7PA 1Y6ZA 4OFBA 4UAUA 2AN9A 4BV9A 2PUCA 4KO4S 1T4GA 1F4VA 4I0WB 1RE0A 3PNPA 4LSMA 1FUUA 2QQ0A 1ADCA 3H1GA 4B7CA 1H6BA 3ZDAA 4G0WA 1AJEA 2J31A 1P74A 1GL6A 4HGOA 1N6LA 3O8QB 1UWVA 4HZGA 2PV7A 4OLFA 4DIFA 3HJUA 4PG8A 3A4TA 4O3FA 2Q6OA 5CH3A 2PZBA 1UBJS 5JMOA 2VNIA 1QG6A 2IUEA 2O0MA 4IBOA 1U6IA 4PZEA 4B5LA 1NW5A 2F90A 5IM4A 4O2BB 1NLFA 1M2HA 2OAGA 3DMRA 3G2LA 4BJHB 2WM8A 2ZJ3A 3GFQA 4ER7A 4YRGA 1D5CA 3D1LA 4XVCA 3PRYA 4NZ9A 2YVKA 1TYZA 2X8JA 3EPJA 1XRRA 4NS1A 4J4HA 2Q4TA 4BV2A 3AFOA 2EFGA 2QPTA 3WWDA 2Q3HA 2VSXA 1GAWA 1QVVA 3DHWC 3R4CA 5HKKA 5IG2A 3ACBA 5J2TB 1X7ZA 3HCAA 3IS3A 2HJVA 3CHYA 1QC5A 1ZH6A 3LWNA 4LIPD 3SHFA 3HMKA 1RQ7A 1ZFNA 5HE9A 3H2HA 1Q0UA 3OKAA 1O5OA 4CM3A 1SQFA 3HTXA 4FHDA 1O8BA 1LBHA 2GYYA 1YTUA 1QV6A 4CMCA 3KJHA 4EYGA 5DX8A 3C48A 1L7AA 1A1VA 2V1UA 3ICOA 4TMKA 4U7DA 3QFSA 4IRMA 2WYUA 4JYCA 2AMYA 2NU6A 5I3CA 1WY7A 2CFRA 3DCJA 3T3DA 3VHQA 4F04A 5LSAA 2BGMA 1ONSA 2Q99A 3HB0A 4RK1A 4F8YA 3A9UA 3CLTD 2Y0DA 3OZWA 3TSOA 3JRXA 2AXQA 3LK6A 4AMYA 1GLVA 1SOAA 1P1HA 1X8LA 2WR8A 4BLPA 3GJXC 1H8HA 3R5TA 2V6GA 3ZBPA 4LVUA 3CZCA 1KH2A 2GH1A 2PFGA 3FYCA 2GCOB 2GTIA 4KV7A 4WINA 2X4LA 3FCXA 3EYAA 5AW3A 1DJMA 2QPLA 2DBQA 1HG0A 5AM4A 5EZ5A 2O54A 4R0VA 4LOJA 3ROZA 4DRYA 4KLCA 3COVA 4URHA 4IF6A 1UJCA 1Y34E 1GG9A 1BFKA 2R6JA 2DX7A 4IINA 1U3DA 2Q27A 4K05A 3OECA 4UBIA 1P2SA 9LDBA 2O8EA 1GTG1 3WBBA 4MROA 2X9NA 4Q4AB 3DKRA 4Q47A 1PFVA 4ZQIA 4NRDA 1H2HA 5L53A 1ID8A 4N40A 1RI2A 3ETCA 4GG1A 2FUCA 4O6VA 3LL4A 5LYYA 3S55A 2JASA 3TG2A 1V96A 3KWLA 3AP2A 1ACJA 4UBLA 6GPBA 2X13A 4IDNA 3RV4A 4EP1A 3IHLA 2YWJA 5L3SA 1PJSA 5KTNA 2ADFA 3GO4A 4KNYA 2Y71A 3PI6A 1J5XA 3NCHA 3H8JA 1QK4A 1Q3TA 3N05A 4GQBA 3OLZA 4TLDA 2MCFA 4CEHB 4W1QA 5FWDA 2PT5A 3UJ7A 2WG2A 4L9SA 4EFNA 5JQGB 4IDDA 2IX9A 3IMGA 1V8OA 5FBWB 4AU1A 3PGXA 4REOA 4NZYA 3T95A 2RB4A 2LCIA 3FTPA 3L8DA 3ZNNA 1AO0A 3F6PA 4HMQA 3S7TA 3OE7D 5CPBA 5DLEA 1SOVA 1YZTA 5KTMA 2OBYA 5L45A 1R9GA 1QUFA 3VZCA 4KYUA 1LKZA 1TM1E 4G3XA 3SZMA 2NU7B 2XYPA 2SCUA 2ZB2A 4I9NA 4TLEA 4JV5B 2QTVB 9GPBA 4LZLA 1Z5PA 4JKYA 4W5JA 2Q3FA 5INTA 1FRVA 1N78A 1SC4A 2PCJA 3MTEA 4IIJA 2WQZA 1EGMB 3W5CA 3R3SA 2VXBA 4FTWA 2GNOA 2JPDA 4GXTA 4Q7JB 2DLNA 3K0HA 3ZNOA 1YZNA 3ZU5A 1G8GA 1L9XA 3OZBA 2BR3A 5JRDS 3TOCA 4GMGA 5FNVA 3LQ4A 3OPXA 1OGIA 4KQ6A 4M1YA 1FFEA 1NBHA 5AMXA 2ZQYA 1JPVA 1RP7A 1JTFA 1NI5A 1NRXA 5CDYA 4XWGA 1EBFA 3UMRA 4ALNA 4FWIB 3UIEA 3B6EA 2R11A 1MTZA 2ZSDA 5G0VA 2AMVA 3PG5A 2HJSA 3AU9A 4A2WA 3VPAA 1L8AA 3ZHSA 4MGZR 2ZCVA 3IUSA 4JR1A 2CXXA 1JEAA 2IYRA 3FYUC 3ELBA 3NBXX 4E5VA 4WFKA 4XPIB 1VTKA 4IDPA 1CWUA 1FFCA 1UADA 1T9GR 4NYMR 4P3YA 1SD2A 1ZSYA 3HXLA 4EFDA 4EFMA 3OZEA 1VLJA 3B12A 5EGNA 2H29A 1AT1A 4PSVA 2V7UA 4QZVA 3CXRA 5D84A 5KKAA 1XZCA 4UHEA 2Y0CA 5ECGC 5F51A 3ZJUA 1T35A 3ASYA 1FU8A 1TRKA 4XVUA 4RCYA 5JBNA 4YWJA 3DOCA 2OV1A 2BH9A 5DB4A 3IYLW 2IA5A 4L5IA 4KQ1A 2IEDA 4RZSA 2JAXA 3QXSA 2Y8EA 2PIDA 4MQEA 2GZSA 3PGMA 2IHTA 4NARA 4RDIA 1JSLA 4KXXA 3PICA 2QMQA 3DC2A 2N9UA 3ADKA 4NJMA 1RAAA 1SKYB 3DR3A 3STHA 2O3RA 1NOIA 1U7ZA 2BZ0A 3A7DA 3VI4B 3VOAA 3WXMA 1JP7A 3CNNA 2JIRA 5FFNA 2WF5A 4HR7A 3DAHA 1G6Q1 2RBEA 3CF0A 3QVOA 4N0DA 2J9FA 4WK2B 3R7NA 5EWMA 2WVGA 2WP8J 4BGEA 4MUNA 1EP9A 3F9CA 5HKAA 3AP1A 4GP7A 4JJ8A 4ZI3A 1D1QA 4OQXA 1F3LA 3GLHB 4TYWA 5KNBA 1N0HA 3SC3A 1L4BA 2C95A 2JLRA 3DCYA 2OCLA 1J1UA 1ZOOA 3DH0A 5FV4A 3U4QA 5B5SA 3I5YA 2VPZA 1DAPA 3ZLTA 3HRHA 1T8SA 2BFOA 3VPSA 4MMYB 5T3YA 4ENWA 1OR8A 1AN0A 1DB3A 5LXTF 2UKDA 1QO9A 1UPTA 4RV5A 5JI2E 5A3RA 1TK9A 5J59A 4LZAA 3IIEA 4CNBA 2B2NA 2HO5A 3HNOA 1D09A 4BO9A 2UVPB 2YH2A 2PQ2A 4NU5A 1ADGA 3MB8A 3PYMA 2P5TB 2VEOA 2V7WA 3KYCB 3JATA 4M0DA 4YJDA 4JVNA 1WV1A 1G21E 4LMAA 1T8UA 2DB3A 3E9EA 4X3PA 4W1RA 3UAGA 4B46A 3UVEA 1OLXB 3CWQA 2Z4TA 1TLTA 3L7BA 5L3RA 1F2DA 2IL1A 2ZS9A 4AQ7A 3MMPA 3IMCA 2WUDA 1IVYA 5HUHA 5BUQA 5NULA 1YRQA 2G6BA 4RKRA 2B9EA 1MEJA 3BJIC 1YA6A 1WF6A 5KI6A 3FNFA 3U6KA 2Z98A 2ZJ8A 4GFDA 2O3UA 5K3DA 4WL0A 4DMKA 4UULA 4K9SA 2J48A 1AMNA 3PEWA 4NV1A 2W6JD 1V3TA 3UWSA 4C5BA 2Z8YM 4QDKA 3MBIA 3GLFE 3HCOA 3DP9A 1DQRA 2R8PA 1HE3A 2RGRA 1EA7A 3Q8XB 4JHLA 4EATA 3L4BA 5FPSA 3OICA 1U7DA 2SKEA 2IEGA 3M83A 4CXMA 4P7GA 4XSVA 2B3TA 4DA9A 2EQ5A 3KT8A 2R7LA 7GPBA 1RNLA 2Q6TA 5ICGA 1EDOA 4RJKA 3CKLA 3M3HA 4KQHA 3AUAA 2XB2A 1UKBA 4W4TA 1OX6A 2HRRA 3ILHA 4W7SA 3WGYA 1IUNA 3D7RA 3FFTA 4C87A 4C4AA 2RE8A 1C1HA 1A5TA 3V4RA 4UHCA 2G0NA 1TF2A 2I1QA 3PXGA 4OHKA 3T5TA 1EX7A 1SUEA 2H52A 1DQZA 1YQEA 3IO3A 4GLLA 3I01M 4MAMA 2BR5A 3G6WA 3GV0A 1E9RA 1T0JB 2H7XA 4G4GA 4YCBA 3RV3A 3GLFA 4WUTA 5H83A 2WVJA 4A9AA 5JYBA 1SBZA 2FN3A 3U7GA 3STXA 1CF4A 4H77A 3W2TA 2QSUA 3SX0A 2QLFA 4AG5A 3HGMA 2OV4A 2B37A 3IO5A 3QE2A 3TTXA 3PV0A 2VRNA 5G1OA 1G59A 1V1MA 1E7RA 3GUCA 3P2JA 2R2AA 1VJ0A 1NASA 4RMIA 3VZBA 1TJYA 3WADA 2A67A 1RFGE 2E7ZA 4ABTA 3BRWD 3FFAA 4JQCA 2OOKA 5AW5A 2B4TO 4ARAA 4DRXA 2W48A 1V9CA 1E2NA 1LGYA 1R3DA 2XOEA 1XP5A 1VIYA 4JYPA 4PPGA 4DE5A 1ZCAA 5T7BA 1ULAA 2O2IA 3O0TA 5FKJA 5F7OA 3MWLA 1RLJA 1Z0AA 3NDPA 1ISSA 2NACA 3GP5A 4ZYYA 3WV5A 4LE0A 3P9KA 4WE3A 5ER9A 5HKLA 2ZS8A 1WPGA 4EF5A 4OXYA 3ZU6A 1U90A 2RHOA 4G8DA 3AGPA 1KZ1A 3HADA 4HH0A 3ZY5A 3HI4A 4BX3A 4MCIA 4BU1A 5HUQA 5JSZA 2MYUA 1X8XA 2NO1A 2ZCJA 3OM9A 3NWEA 3PR3A 1EXVA 1I3KA 2FQXA 5D7BA 3BHNA 3A3NA 2FP3A 3PT9A 1UK6A 4HTAA 1J2UA 1O4WA 2NUTB 1E66A 2MTBA 3DO6A 2BFFB 3DD5A 3F67A 3PF9A 3LXMA 3RYHA 3VR0A 4AXBA 3D3QA 1J9ZA 1JA1A 1OGYA 4ZHQF 4D4HA 1LTKA 4OAPA 1PQPA 5TS2A 3LKBA 4I50F 5JV5A 5IKMA 3VH3A 1EVJA 2KSQA 1DARA 5EYPA 4PCAA 5FI5A 5H16A 3U80A 2WIDA 3RUAA 4AZ0A 1CTQA 4LKOA 2ZUUA 1GKKA 1HXHA 4X1YB 1IE3A 1PSDA 5EZSA 2XRZA 2QR5A 4EFLA 2AHRA 3AM5A 3ZQ4A 2QRNA 3D0RA 3EOZA 2V4ZA 3HCFA 1RKVA 3QVJA 1E1KA 3LDUA 4ID3A 4PLZA 1BVUA 4AQDA 3ZQJA 4E21A 4LG1A 3VGPA 1M7BA 3I1IA 1OHHD 3I2IA 3I73A 4C7KA 2NUAA 3F4KA 4EJMA 3HZRA 4AF8A 3FBGA 1T8YA 1UMBA 5FWYA 1ZY2A 4AKIA 1GHTA 2X1VA 3HFJA 4RE6A 4KQ9A 1D1PA 4UPVA 2VWGA 3EFOB 2C7BA 2CUZA 1V43A 3HR4A 1KDYA 2Y68A 1KO7A 1K98A 1VDZA 4A23A 3L8MA 3CEHA 3FOBA 1EXNA 3RQIA 2RKBA 2XQGA 4XARA 5GY7A 3WL5A 1HSZA 1WDWB 3NEAA 1ZD5A 4HX5A 1PJCA 2HJWA 2LWIA 5E4TA 1Z5UA 1TEHA 2BKUA 4TTRA 3MTIA 3E1SA 1FB5A 4NBUA 3THRA 5BYJA 4IL5A 5AKKA 3ZJVA 4I1IA 5GM2A 4YRBA 1GT91 1QWSA 4MEBA 4J3NA 5IASA 5T8KA 1GU7A 3QITA 3TLJA 2NPIA 2E9SA 3T3OA 3EDRA 3IBTA 3IURA 2QX8A 2I2FA 3P4YA 4OJKA 4RHYA 3VM6A 3N59A 2GASA 4COOA 4NNPA 4OP2A 1NPYA 4YWHA 4V1CA 3NLLA 5HDQA 4L3OA 1J22A 4N3AA 2DTDA 2YW2A