2CZQA

A novel cutinase-like protein from cryptococcus sp.
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
205
structure length
205
Chain Sequence
ATSSACPQYVLINTRGTGEPQGQSAGFRTMNSQITAALSGGTIYNTVYTADFSQNSAAGTADIIRRINSGLAANPNVCYILQGYSQGAAATVVALQQLGTSGAAFNAVKGVFLIGNPDHKSGLTCNVDSNGGTTTRNVNGLSVAYQGSVPSGWVSKTLDVCAYGDGVCDTAHGFGINAQHLSYPSDQGVQTMGYKFAVNKLGGSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords cutinase-like protein
publication title Crystal structure and enhanced activity of a cutinase-like enzyme from Cryptococcus sp. strain S-2
pubmed doi rcsb
total genus 83
structure length 205
sequence length 205
chains with identical sequence B
ec nomenclature ec 3.1.1.-:
pdb deposition date 2005-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01083 Cutinase Cutinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2czqA00
1ZD4A 5HKAA 3C45A 5AI5A 3WWPA 5T4EA 4TGLA 1MTZA 1KU6A 1N5RA 4G4JA 4Q3OA 5ALLA 4J0GA 1XZCA 1IUNA 1XZFA 4CIAA 4MEAA 2Y6VA 3MUNA 2XQIA 1FFCA 1CUGA 3S8YA 1EX9A 2PSFA 3FLAA 2OGZA 3V9AA 1WPXA 3DKKA 5LLSA 1QTRA 2WG0A 4HZGA 1JMKC 1VXOA 4J0JA 4ZWNA 3L1JA 1O6GA 2PPLA 3CXUA 3WKDA 1LPOA 3IUJA 4X97A 1WM1A 4L0CA 1VA4A 2JGIA 2C58A 3FLBA 4H7FA 3RK4A 1S8OA 3WL7A 5CH5A 4EY8A 3QYJA 3E1GA 3E4DA 3ZPXA 1ZGBA 3I6ZA 4RE5A 5ALKA 4QA9A 1EXWA 2XUQA 4I3FA 4IH4A 5CH3A 4Q3LA 1K4YA 3PUHA 4J0CA 4MYDA 4FBMA 5IH7A 1ODSA 1BEEA 4GBGA 1BCRA 4FNGA 2IITA 1AURA 3D3NA 5AOBA 2QVBA 5HQ3B 4JUIA 5BV7A 4L72A 4BATA 1EHYA 2XUGA 4X92A 1P0MA 3G0BA 3C8DA 1FFBA 2XQGA 4PNZA 4FTWA 4BAUA 2JGMA 5HK8A 1GXSA 2QJWA 5K3EA 1P0PA 1UFOA 2XT0A 2J4FA 4UFPA 1VE6A 4DYHA 2WSLA 1J1IA 2Z5GA 3I28A 1EK2A 4IH1A 4DGQA 2Z8ZA 2XMSA 5SYNA 3FWHA 4LHEA 3D5EA 3DYVA 4BP8A 1C4XA 2BJHA 5E4YA 5EIHA 5LZ9A 2BAGA 3GROA 2AJCA 3U0VA 4OSEA 1WB6A 4YK7A 1W4LA 2O7VA 3R40A 5CH8A 2JGFA 2GZRA 2R11A 1MX9A 5JADA 4DLNA 2DHEA 1EK1A 1UOQA 3WWOA 1VKHA 1PV1A 3FOBA 3ED1A 4RGYA 4BCBA 1WPRA 1GKLA 3MGAA 5JD6A 5FPQA 1N1MA 1QIIA 3WWDA 4W63A 4C6HA 4AMZA 2PVSA 3VXKA 3FYUB 3KSRA 4UHCA 4C4ZA 4KE9A 1HBJA 4AO6A 4FMPA 4U2CA 3IULA 1MNQA 4HXFB 3IB3A 2VA9A 1Q0ZA 4Q1VA 1DX6A 1FSSA 1Q84A 1QOZA 2G5PA 3VVMA 2PBLA 2C5FA 1MT3A 4IHAA 2WIJA 2HFJA 2BKLA 4DTCA 1BE0A 4BAZA 5BWBA 1IUOA 1GGVA 3AINA 4FDMA 1MAHA 5D3ZA 5ALXA 2WU3A 2J4CA 1A88A 4Y2VA 3O4JA 6YASA 1WOMA 5CXXA 2RHTA 2I3ZA 3AUKA 3C6ZA 4B0OA 3W06A 1MX5A 3K6KA 4QDOA 5EFZA 4GWLA 1SOMA 2WTNA 1TIBA 2QRUA 1CUUA 1USWA 1XZLA 5JANA 1VLQA 1P0IA 5AKIA 4JH0A 3STYA 5AKLA 3VJMA 2P8SA 3WK5A 3BJRA 5LZ8A 2XLBA 4OYLA 5EHZA 4DNQA 4H18A 4UBLA 3V1KA 4X91A 3U1TA 1ETHA 5FOQA 3BDVA 5AJHA 5LKRA 1EH5A 4B0PA 1CQZA 5DNVA 1XRLA 1CUCA 4E11A 3JW8A 1A8QA 3HI4A 3H19A 3MUOA 4WJLA 4U2FA 3QMWA 1JU4A 1XZMA 2HRRA 2UZ0A 3RKSA 1VXRA 1FFEA 3G7NA 5D7BA 2OAGA 2WHQA 1UK8A 4WDQA 3WJ1A 2YH2A 5J3JA 5A62A 1CUYA 4Y2PA 4B84A 2LIPA 5DWDA 4WY8A 3SX4A 3WIBA 1W1IA 5CT5A 4Y2XA 2Y6UA 1HL7A 4X3CA 1GPLA 2WJ3A 1R88A 2XMQA 1F8UA 2JGEA 4IH9A 5JATA 2DR0A 4K6KA 2VJCA 1DWQA 5ESRA 3W9BA 3KDAA 4P9NA 2QUAA 2XUFA 1MO2A 1QGED 5JD4A 5KREA 1QZ3A 3M3DA 1BS9A 1GT6A 2EDCA 2G5TA 4P08A 2QS9A 1CUDA 3OURA 4EY6A 2YYSA 4NMWA 5C7YA 1NX9A 3E0XA 2PSJA 3WKEA 3LS2A 4HRXA 1MAAA 4UHHA 1F6WA 3NOXA 1Q0RA 5T4HA 4RE6A 2WG2A 1NU6A 5K3FA 2DHCA 4GDMA 1CUHA 5AI9A 1EA5A 1UKAA 2Q0XA 2NW6A 1QFSA 5EI5A 1SC9A 1YAHA 1AX9A 1QIHA 3C6BA 3UUFA 4LYDA 4X6YA 1VOTA 1E66A 5AIBA 4J0KA 4KJXA 3DOHA 4YPVA 3HJUA 1H22A 2PX6A 3R41A 2HFKA 5AK4A 3D2CA 1DWOA 1AQLA 3FAKA 2XMBA 5IVKA 3GBSA 4F60A 5EIAA 1BEZA 3DNMA 2XLCA 4B82A 5ALUA 1G42A 1CUXA 4QLOA 4AN0A 1C7IA 1YAJA 4W1SA 1XQVA 2CZQA 2WHRA 4F21A 4S0XA 5HFAA 1CUIA 4UHDA 1CEXA 1CV2A 2PUHA 5ALMA 3WK4A 1IVYA 4FKBA 1ZD3A 3FSGA 2FX5A 2H7XA 1KEZA 4XWGA 3L1IA 1AKNA 4PQEA 3D59A 3FNBA 4I19A 1ZICA 4AO8A 3O4HA 4KRXA 3A70A 4DMFA 4KAJA 4B9EA 2Y2VA 3OOSA 4CIBA 4GLBA 1QIGA 4UHBA 4DSZA 3FVRA 2VATA 2AXEA 5DTIA 1XRPA 4KRYA 5JAPA 1J06A 4GECA 3SC2A 4OB8A 1AC5A 3PUIA 1LPPA 3BWXA 1RP1A 4A5SA 1K5PA 5ALWA 2OCKA 2PSDA 1UXOA 3WZLA 1LPSA 2XQKA 1W75A 3M81A 4B6GA 2QM0A 1I6WA 2QTBA 1EVEA 4H7DA 4GHWA 3ZLVA 5JAHA 5C8ZA 1JT2A 1H2XA 5AI6A 5AM5A 4DMKA 1EVQA 3WKCA 4QDTA 3WI7A 2H1IA 2WUDA 4KEAA 5AHXA 4HXGA 5DJ5A 3DS8A 1Y7IA 3IBTA 3CN9A 2WIKA 2EDAA 1YB6A 1TAHA 1SFRA 2JIDA 3BF7A 3V48A 1HKHA 4CCYB 2ZJ7A 1OCEA 3BL8A 5LIPA 1IZ8A 3A2NA 4BCCA 4QEKA 1JMYA 3FYTA 1BN6A 2ZYSA 5JAOA 1Y7HA 3AIOA 3HZOA 4YX9A 1MU0A 2BGRA 4BTVA 3IUMA 2XUHA 5KBYA 4HS9A 4X6XA 4Y9SA 1XQXA 1CQWA 2HIHA 4YASA 1A8SA 1G66A 4ZV7A 4C89A 4Q82A 1UWCA 5AI8A 5CXUA 4HRYA 1T4MA 1G4HA 5CT6A 5JARA 3DCNA 3W9UA 1JI3A 1XRQA 5A71A 2WU4A 3DYIA 5AI0A 2B61A 3HEAA 4X6UA 2CUTA 2GYUA 2XE4A 5EIEA 2QXTA 5AICA 1QIFA 4QDXA 5FLKA 5ALDA 4BVKA 2WFLB 2V97A 3H1BA 1UK6A 2IX9A 5K3BA 4I4CA 4OB6A 1QONA 3AZQA 2O2HA 5AK5A 5T4FA 3A2LA 1JU3A 5LYYA 1ZIYA 3HC7A 4EY5A 2B4KA 3YASA 1DTEA 1CUJA 5CRIA 4BVJA 4EBBA 5IVHA 5DNUA 2K2QB 3WL5A 5ALFA 1UOOA 1E5TA 2H7YA 2OG1A 2VF2A 2HADA 3KWFA 4K2AA 4DSAA 1WHTA 1LBTA 5E4TA 1L7QA 5CTAA 1EI9A 1SCKA 4BB0A 4NVRA 3EQ9A 1H2YA 5FKJA 2WIGA 4OPMA 4LXIA 5FRDA 1LPMA 1QO7A 2XMRA 3DLTA 4AO7A 3I2GA 1E8NA 5ALOA 4G8BA 4ZREA 3GA7A 2ZVDA 2DQYA 3O4IA 3LLCA 4OYYA 3AFIA 4G1FA 5KWJA 3M82A 3WL6A 1JJBA 1UZAA 1UOPA 2WTMA 2VSQA 5HK9A 3QPCA 5K3AA 4UHEA 5AK6A 4QZVA 4UBKA 3D4LA 3DQZA 3PDCA 3GFFA 3WLAA 5AH0A 5ALZA 4U2EA 5ALSA 4X7BA 3WIOA 1CUWA 3A2MA 5AOCA 2X5XA 1MJ5A 4LXGA 1ZI8A 3C70A 1HDEA 2CEKA 3PICA 1YA8A 3K9BA 1VA5A 5AK3A 3T4UA 2HL6A 1YB7A 4AB1A 4QWWA 5AKKA 4M0MA 3IURA 1ISPA 2Z8XA 3QBJA 4CG1A 5AM3A 2O2GA 3R3UA 1PFQA 4J03A 4ZXFA 5C81A 1AMNA 1U4NA 1XZKA 5AKHA 4KYVA 1CUSA 1M33A 4X94A 5H3HA 1LNSA 3QITA 1ZOIA 3B3QA 3DKRA 1VJ5A 3H2KA 4Y2UA 2IIVA 1CPYA 4EHBA 1ODTC 3KD2A 3KWJA 3C5VA 3C8HA 2HA5A 4Y7DA 3W2TA 2ZJ6A 4H7JA 3ZLTA 2VJDA 3BIWA 4MQMA 4AMYA 3H2HA 4N8EA 2XDWA 4TPKA 3I6YA 4UBMA 5AI4A 1TCCA 3E3AA 4Q34A 3QMMA 4WY5A 4ZGBA 2AJDA 5ALYA 5A7HA 4WFKA 4AZ3A 2AJ8A 3WWEA 4C4XA 5FUMA 2JGKA 3I1IA 3H2GA 5IKXA 3RLIA 1BRTA 3PF8A 3FYUC 2JBWA 5IVDA 3OG9A 1L7AA 1U8EA 1XZJA 4FLEA 5DNWA 5AO9A 4GXNA 3VDXA 3NGMA 1GPKA 5DYTA 4MWSA 5ALHA 1X2EA 1YS1X 1JJFA 4H7EA 3FLEA 5LZ7A 1XZGA 4H7KA 4PF1A 3ESCA 4OU5A 1QLWA 4CCWA 3DDUA 4EY4A 1EB8A 1K63A 4QE3A 3VVLA 2OGTA 1YSCA 2PSHA 2OAEA 5JIBA 1R9NA 1XZAA 1ZI6A 5AP9A 4BC1A 1Q83A 5A7FA 3WK9A 3F98A 5T4BA 1E89A 3HACA 2BCEA 2WILA 3QMVA 2VT6A 3G0CA 4BZWA 1CUZA 4O08A 3EQ8A 2JGJA 5FDFA 3PFBA 2VT7A 5LZ2A 1R4ZA 3FBWA 4JNCA 4M0EA 3BXPA 5DTJA 3DL7A 2PM8A 3AIMA 5BOVA 1ORVA 2AJLI 5DLPA 2WFZA 4BBZA 2RAUA 2VJBA 4X00A 3FCXA 3DEAA 2I3DA 3DD5A 2WQZA 2FJ0A 1RWQA 4BTLA 1LBSA 4FHZA 5A2GA 3B12A 4MYSA 1ZD2P 1ZJ4A 3H2IA 1A7UA 3IA2A 3QVMA 5HF6A 3HSSA 4G5XA 5E2IA 2HDWA 3H18A 2HRQA 1XROA 4K6HA 4G8DA 5ALTA 3H1AA 5ALRA 3V1NA 2XB6A 1WHSA 2WKWA 3O4GA 3I2HA 1J07A 4NZZA 5JZ9A 4MWTA 1EDDA 3A6ZA 4J0HA 3C6YA 4BE4A 2XUOA 2PU5A 4M0FA 3STXA 2E3JA 2OXEA 1WB5A 2CKMA 2WIFA 5EHXA 1DWPA 2J3DA 2WHPA 1XKLA 3I2FA 1TKRA 5K3FB 4BDSA 1CUEA 3KXPA 5FP0A 4B85A 4XIIA 2VQ6A 3H17A 4KE6A 1BROA 3H04A 4X93A 1ORWA 1QIEA 3D2AA 4RNCA 5ALIA 3TRDA 2O7RA 1O6FA 2HU5A 4UBJA 4X85A 3G02A 2JEZA 5EHNA 1MPXA 1ODCA 5KWIA 3I6MA 4DNOA 4WDRA 2QKYA 3N2ZB 1XZBA 4H35A 2C0QA 5CT8A 2RONA 3BIXA 2QXUA 5DYWA 1NU8A 2QMQA 3UMJA 3WMRA 3FCYA 1VZ2A 3V1LA 4FNMA 2V96A 2ONCA 4X95A 4C4YA 2QOEA 3BDIA 4OU4A 4MJ3A 5CURA 5EHQA 2JGLA 2ECFA 2BUCA 3ICWA 1LPAB 1J2EA 4JYMA 5CBKA 4ARAA 4B81A 3IVMA 5LP1A 3ZI7A 2WUFA 1OXMA 1A8UA 4FFWA 4UBNA 4B7ZA 2GYVA 5CMLA 3VJLA 2RIPA 5HF9A 2XUJA 2ORYA 2HHAA 2PU7A 1ACJA 2WM2A 2RGUA 2D0DA 4MEBA 5YASA 3G9ZA 2GBCA 3R3ZA 2WIDA 4J3JA 1TK3A 1CVLA 1CR6A 5DYYA 4BP9A 1THTA 4NS4A 5K5EA 4GI1A 5JYCA 1QIDA 2GBFA 2XQJA 3BF8A 3D2BA 3JWEA 1OILA 1CUVA 3V1MA 3C87A 4PW0A 2G63A 1UK7A 2FJPA 3AIKA 1QE3A 1ZIXA 2BFNA 3Q0TA 2XMGA 5LZ4A 1E8MA 4WFJA 4GW3A 1CRLA 3IDAA 1XZEA 5AIAA 2HU7A 4H7HA 4EA6A 2HA3A 1EB9A 1X70A 3WQHA 3IUNA 1X2BA 3DOIA 1BCSA 1YA4A 4WCVA 2DQZA 1N5MA 2ZYRA 3RM3A 2O2IA 4KAAA 4PSDA 4E46A 2W6CX 3UUEA 3H0CA 1GPNA 3VJKA 4W9RA 3CCCA 4X90A 3O9MA 4JEIA 1K6EA 3G9XA 4Y2JA 4BCDA 1GQSA 2ZYIA 3O0DA 3F97A 1XLUA 3OC0A 1LZKA 4ROTA 4FFVA 4KE7A 2R8BA 5JZBA 2VAXA 2OQIA 1XKTA 1E3QA 4DNFA 2RHWA 1F0NA 5K3DA 5ALNA 1H2WA 2EEPA 1EDBA 3C5WP 3AILA 4KACA 1R1DA 3PFCA 5ALEA 1CUFA 3ESAA 4UBIA 3RARA 5HCUA 2Z3ZA 1UK9A 5AKEA 2BUAA 2DSNA 3SWWA 3LP5A 5IVIA 4FWBA 2PL5A 5FV4A 3ZLUA 3R3YA 5AKJA 3WJ2A 1GZ7A 2GBGA 3IIIA 3LIIA 4Y2SA 2XMCA 3OTQA 3CN7A 4D9JA 4IO0A 2AJBA 1XZDA 1WCYA 1TQHA 3O9VA 4X71A 1Y37A 2WFLA 4K5QA 3HABA 1W52X 1JFRA 3H2JA 1DX4A 3TJMA 5JASA 5I9IA 2WG1A 4MXDA 2VAVA 4L9AA 4EZIA 3OPMA 4FLMA 1T2NA 2H7CA 4AN1A 3HXKA 2JF0A 2XUPA 3I2KA 1FJ2A 1MX1A 2OQVA 4BZZA 2WJ6A 4ZRDA 3WZMA 3G0GA 3ZWQA 3HYSA 1SCIA 2JEYA 5AM2A 3STTA 3SK0A 2DFPA 2V98A 5HQ3A 4F5ZA 3F9CA 2OGSA 2WUGA 2CJPA 4FLFA 3LCRA 3WYNA 4BRSA 1RYYA 4QDZA 1LZLA 3OM8A 1CLEA 3STUA 4XX1A 4Y2YA 4ITVA 2HM7A 3VKFA 2ZJFA 1R50A 2GYWA 1QJ4A 3JYHA 4LKOA 2PSEA 3WKAA 3Q8WA 1PJAA 3P2MA 1YS2X 2HA7A 1F0PA 3WA6A 4N5IX 4Q05A 4G9EA 1UT6A 4EB0A 5I7UA 1VZ3A 3G9UA 2I03A 3W04A 4BVLA 3ICVA 1W76A 3WWCA 4ARBA 2Y2UA 3GZJA 2RI6A 3LIPA 3EQ7A 2B20A 2G4LA 3AZOA 2B9VA 4OUKX 1DQYA 3R3XA 1XRNA 1IUPA 3STVA 2BGNA 1XQWA 2WJ4A 5JD5A 4J0IA 4F0JA 2ROQA 1CUBA 1XQYA 5HFNA 4QDUA 4C88A 2XMZA 1LGYA 5LKAA 3ANTA 3D7RA 1DU4A 4BAGA 1CUAA 2CB9A 3FYUA 4XJVA 4PO3X 1AZWA 4XVCA 2PKYX 4MQLA 3O95A 1R3DA 5BWCA 2ACKA 4DNPA 3S2ZA 4C87A 1G5FA 4AXBA 1ZJ5A 4DM7A 4LIPD 2BUBA 4CI9A 4DIUA 4BE9A 2QR5A 1DQZA 4PSUA 4B9AA 3FVTA 2HA2A 2ACEA 5AM1A 2XUKA 1THGA 4P93A 1AGYA 5A6VA 5JAUA 4U2BA 5K3CA 1QTIA 2OCLA 3M83A 2OCGA 1QIMA 1TCBA 4E15A 5CT9A 2XQFA 7YASA 1ZGCA 3VISA 2XI4A 3QM1A 4W1PA 3ILSA 5CW2A 1H2ZA 2ZSHA 1GKKA 3L1HA 4H7IA 1P0QA 3C6XA 5FPPA 1QIJA 1IZ7A 3HRHA 4QWMA 3EIOA 1XLWA 2J3QA 1BU8A 4L3WA 5AKGA 4ETWA 3WL8A 1Z68A 4Y2RA 1LLFA 4BC0A 5AM4A 4G9GA 4W1RA 5ALPA 2C5GA 1W6RA 5JZSA 4UBOA 4QNNA 1U65A 4BRZA 4EUSA 3R3VA 3AZPA 5LZ5A 2CBGA 1XFDA 2C7BA 2XUIA 5AOAA 1EINA 3C43A 5E4JA 3N0TA 3AJAA 3F8SA 4FOLA 4INZA 5I8PA 1KU0A 3HLKA 3D0KA 1E8DA 2DHDA 4UHFA 3WKBA 2ZYHA 4WFIA 4OD0A 3DJYA 1ACLA 3TEJA 1DT3A 5FXMA 5F4ZA 1CIJA 3EBLA 1CFJA 4N8DA 3G9TA 2OPHA 2GZSA 2HA4A 1UKCA 2DCMA 2D5LA 3WA7A 1ZI9A 4P92A 4ZI5A 3B5EA 4AX4A 5AKXA 4KR0A 3K2IA 4G4GA 1LPBB 1B41A 2PUJA 4EY7A 3QH4A 1MN6A 4A16A 1H23A 5ALVA 4C01A 4BDTA 3QPDA 3I2IA 5JALA 4IQ4A 5AKYA 4Y2TA 3WK7A 4AZ0A 3DL4A 5HF8A 3ANSA 2WHPB 5ALGA 2VJAA 4Y2QA 4W1QA 2W22A 2GBIA 4A23A 2FUKA 4UUQA 3EF3A 1TRHA 3R0VA 5C8XA 2QT9A 1IMJA 1HLGA 2CMFA 3F96A 3ESDA 2HU8A 4V2IA 1QIKA 2OLEA 4DMCA 4PSCA 3I2JA 4Z49A 2YASA 3WK8A 2WUEA 5HF5A 2X76A 1DINA 4BYMA 5HZGA 1QO9A 4FBLA 4J0DA 5EGNA 4ZV9A 1TCAA 4G4IA 2HA6A 3R3WA 4Q3KA 1XZIA 4AQDA 3BE8A 1L7RA 5ALJA 1B6GA 1C7JA 4J7AA 2V9ZA 1MNAA 3I1YA 4U2DA 3KOOA 1FFDA 3F67A 2VTVA 3STWA 5C8VA 4PV7A 4LYEA 1XRMA 2XUAA 1SCQA 4HXEB 1YCDA 2Y1KA 4B83A 4OB7A 4GEGA 2I78A 4HAIA 4G8CA 1HQDA 3X3HA 3ESBA 2VEOA 3GELA 1QFMA 3IUQA 3G8YA 1UKBA 5AKZA 4N8SA 1GQRA 3FSGD 4H0CA 2WLSA 3GUUA 5ALQA 4U2GA 3QPAA 4DMHA 1WB4A 4TVKA 2XMDA 5SYMA 3PE6A 1U2EA 4QLAA 1ZD5A 3MVEA 1XRRA 4UPDA 1HPLA 1N8SA 1EDEA 3QZUA 2XUDA 3TGLA 4LXHA 5HKBA 1D07A 1BN7A 3W05A 2YXPX 4UFNA 2QJRA 2OCIA 2QZPA 2ES4A 2QUBA 4K6GA 4H77A 2Z3WA 1JJIA 5AM0A 2WFMA 3T52A 4JYPA 3ZV7A 4HVTA 5D6OA 3BJMA 4KAFA 4RPCA 4OCZA 3NWOA 4N5HX 5D3KA 2H9YA 4B80A 1K8QA 3NUZA 4E14A 2X8BA 1R9MA 2HA0A 1VE7A 3PF9A 1JKMA 4CCYA 4CG2A 2C4HA 3CCBA 1XLVA 5ISMA 2C0PA 3WYDA 4CG3A 2ZSIA 3WK6A 4CFSA 1DT5A 4HTAA 4UFOA 1AUOA 4KE8A 3PI6A 1YASA 3G0DA 5A7GA 1XZHA 1FFAA 1YR2A 1LPNA 3G0IA 5CT4A
chains in the Genus database with same CATH superfamily
4JC8A 4M1SA 4JLKA 1KI9A 4E31A 4R69A 1T43A 1V39A 3BB4A 1ECLA 4KBFA 5AJWA 3JRXA 5JWHA 2XSZA 1AIPA 1G3UA 5CYFA 3SR3A 5KMGA 1G38A 2ZR8A 1UWVA 3PDIB 3AVOA 2RCNA 3O4FA 4KXMA 4TGLA 4D8VA 5CX1A 1JZTA 2GN9A 3FCUB 1V6SA 2RC6A 5TARA 1H6BA 1H4QA 2PGLA 1CDDA 5IZCC 4BMXA 1HSOA 1YKFA 3RUCA 4YEDA 1A8HA 3NBQA 4Z0NA 1IUNA 2XYRA 1KEWA 2FMUA 5IK2D 3GLFB 4ZU3A 2QRVA 3G85A 4KO1S 4MEAA 2FEKA 1UP4A 5ERYA 5ULLA 5K01A 3TW0A 3ZQ4A 3R9XB 2VDVE 4GS5A 1RI3A 2QPOA 3FPLA 4GP9A 3V8NA 2ZROA 1KR2A 2GKSA 3CUUA 1NN1A 3H75A 2OVBA 4Q3EA 1VIVA 1H2EA 1E2GA 1G1MA 1L5RA 3H65A 4Y0AA 5DEIA 4ASUD 1H2AS 2BFFB 2EZ8A 3ANMA 4O4LA 4MYTA 1EZZA 3SE0A 4J8PA 3FLAA 2H0AA 1U9ZA 4HL6A 4EHNA 4YXFA 1WPXA 1E3EA 5LLSA 3U3KA 5EJ4A 4E6EA 3K4HA 5JQGB 5LOVF 2IXTA 2X77A 3KT8A 4QXAA 1IRXA 1RLUA 2HK6A 1GFIA 2CVQA 3E7XA 1GKUB 1Q7RA 3L1JA 3LGXA 4KN6A 4ZWNA 4W5QA 3ZHOA 1SKMA 1NBHA 3NQ41 4O5OA 4HDKA 2B8WA 3O4RA 3IUJA 4I5IA 1Z74A 4F7DA 3MWGA 4N7JA 4LDJA 4G37A 8ATCA 5KOYA 1E1LA 5CXQA 1N77A 2ZWOA 2W2VA 2O50A 4YCSA 4ODIA 4GC9A 4DPLA 5AK0A 3FLBA 1C3OB 4TKVA 4ZDJA 5ADWA 5K2MA 4MUKA 5JHGB 2OBYA 3G49A 3P8ZA 3WL7A 4DHEA 5AW2A 3MTBA 4KGZA 2ID9A 3F5MA 3REGA 2YC2C 4PG7A 1DP4A 2PNFA 3QF7A 4XWTA 4X24A 1ZDMA 1CG6A 1GSIA 2C2YA 4F3RA 2BDEA 5KU1A 2VFAA 3JRNA 3UH1A 5IT0A 2YS6A 1R0RE 3PDJA 3VPCA 5A6SA 1H5QA 2P5YA 2JLSA 2B4QA 3JQ8B 3FF4A 4QA9A 2GNOA 4Z1MA 1E3LA 1K4MA 4LKRA 2AUNA 5LB2A 3VUFA 5KTTA 2HHLA 3KQNA 3LUAA 5A0TA 2QAJA 1WE2A 4Q3LA 4GE0A 5CH3A 3U9SA 4AL4A 1NFFA 1RHUA 4J0CA 1U6IA 2HQRA 2VHZA 4RCVA 3RRNA 5KJCA 3FNEA 4DMLA 4OUDA 4ZVKA 1MEOA 1ODSA 2B1IA 1BEEA 3T4PA 3THRA 1BCRA 4D3XA 1CULC 2I54A 5B7NA 3FN4A 2AFIE 1FDIA 3W79A 1S4QA 4WLFA 3T7CA 2QVBA 1RZRD 4UC0A 4HBZA 4AWXA 2FKAA 4P5EA 1NZDA 1TD1A 4LHZA 4XWAA 2GWHA 2V55B 3EAFA 4MDEA 5JS2A 1RXCA 4XPIA 4JUIA 4M9UA 1DG3A 1NR7A 4MKGA 5BV7A 3IRUA 3VAZA 2FRVA 2XADA 3DCIA 3IBYA 4O8CA 4D8UA 3IE1A 4TSFD 3CWQA 3RABA 4OLAA 3R8FA 2KWIA 2WLTA 2XUGA 2YQZA 3G0BA 4ZZ1A 4P3KA 1M6WA 2DBYA 3S4YA 1VL1A 3M1IA 4D6XA 3DZJA 1XEWY 3GFSA 4NBLA 2NU8B 4ER3A 4CIXA 4JT4A 4EF4A 2RI0A 3K71B 1ZBQA 1J0BA 4PSVA 1SHKA 1NXTA 1T2DA 2VYND 3DDWA 3DE4X 5BVGA 3NGXA 4BNYA 2EJBA 4UARA 4PNZA 1UBEA 2YOHA 2NVBA 3HN2A 1V43A 2A94A 2HLDD 1NL3A 1NLZA 3E3MA 3HR4A 2GR9A 2PQ6A 5D5HA 5B3KA 3HLTA 1AOXA 3I76A 1GXSA 1C3XA 2HY7A 3KLOA 4FFNA 5F1KA 3R77A 5IT9A 3OKFA 2GZHA 3ABQB 2O8CB 2YXNA 2Q7OE 2H4WA 4LRUA 5DYIA 1E9AA 1GZVA 1VE6A 3AH8A 4DBLE 4UFPA 5HKOA 3GLGE 2HPAA 1JILA 3GWZA 1RC1A 1YCFA 3LU1A 4I2NA 2WSLA 1WTCA 3PYMA 3I28A 2WDPA 4MV3A 4RJ2A 1F0KA 2WWFA 4EMTA 4B6QA 3WOVA 2B9EA 3MCTA 4FSHA 1QRDA 1J7JA 2A9JA 1CS0A 2ZWAA 3IC5A 1DC5A 1MGOA 2ZDQA 1ZISA 2XMSA 5SYNA 2FHPA 3FWHA 3M9WA 4F72A 3S0JA 1GVHA 4KXUA 3DYVA 2VBCA 1BE6A 1P31A 4DV4B 1G7SA 1GA4A 2CFIA 2H51A 4RTLA 3EGEA 1CBUA 2A4MA 2LCFA 1SZDA 5E4YA 1JDTA 3ZNQA 5LZ9A 3GFVA 1U7XA 3ICOA 5H4HA 1R0BA 4TVSA 1I94B 1FTNA 4XB6B 1IWOA 4LHSA 4UTZA 3PPYA 3N0RA 4WV3A 1JI0A 2PLFA 4XEUA 3RUDA 3U0VA 5JCZA 2E5FA 1W2WB 4CV3A 4ZI3A 2OM6A 1YUMA 4B3RB 2O7VA 3HA7A 2JAHA 3TLGB 3H42B 1VGVA 1MX9A 1I6LA 4JKOA 4MOWA 4EG5A 5JADA 1ATZA 4XIJA 1XXLA 1IBRA 3MPOA 4XGNA 2GUGA 3WWOA 1SKQA 2GO7A 4PU0A 4WNAB 3UAYA 1HH4A 1PD1A 3AYXB 4M7WA 2QQGA 4RQTA 4TVBA 3OIDA 1ECGA 4P83A 2VP0A 4AJLA 3J81A 3WRXC 5JCXA 3DE6X 1B8NA 2OCXA 2CLSA 4BCBA 2VZ8A 3LX6A 3PSAA 3UV3A 4B6JA 3W2IA 4I46A 1GKLA 1GTZA 3MGAA 4CEIB 5E2BA 1CQXA 5IC6A 1HQCA 2BISA 4KN5A 3CJQA 1SA0A 1ZR4A 1X1BA 2C8KA 2FN7A 2AXQA 2PN1A 3R6WA 4YN3A 1DKOA 5TDHA 3TNDA 3WWDA 1R5OA 5HIKA 4JELA 3C3BA 1K1EA 2JAOA 2Q9CA 4IDNA 4EK9A 4GMDA 2BONA 3PQEA 1LFAA 3DEKA 3Q4GA 4DCUA 1S2MA 3FYUB 3T0GA 3FMVA 4UHCA 1GT91 4R2MA 2HLHA 3HR8A 1U9IC 2O2YA 2EJVA 4FMPA 2ZE5A 3TI7A 2W2PA 5K09A 3OU6A 3IB3A 2VA9A 1XP8A 2FCRA 4G5SA 1NMSA 1UADA 4XTRA 5HJ7A 2D8AA 4Q1VA 3KJIA 3F49S 4CDMA 5JZOA 1QOZA 4YAJA 2PBLA 2C5FA 3RC7A 4O0LA 2WIJA 3ZCXA 1L4GA 2ST1A 4F3TA 5SY9A 3PQ3A 5HG0A 2Z6AA 1KEEB 3BILA 1O08A 3GDHA 1GGVA 1SPXA 1YGPA 1TCVA 4Q93A 3MFQA 2Q3FA 1PR6A 1B16A 4C0QC 1STOA 3QWAA 5DPMA 1SK8A 4G24A 5E9JA 5BXYA 2WU3A 4UOQA 1DE0A 1OX5A 1BS2A 4C7KA 4Y2VA 3DVSX 2WFAA 3UCFA 1WOMA 5CXXA 3AUKA 2IYZA 1NW9B 2WWGA 3A4YA 1W2HA 1ODLA 1IN1A 3O21A 4ZOQI 2ZWPA 1MX5A 1NYRA 4EH1A 5D86A 4FM9A 2MSNA 3IODA 1WUTA 3BM5A 3CMCO 3C3WA 3DLAA 1TIBA 1T9GS 2RGCA 4NDZA 3TN7A 1JZSA 1CDEA 4H08A 2JIRA 4LBWA 4M46A 1EMDA 4W7HA 5AVKA 5HRUA 2QRUA 3L18A 3VA7A 1WBJB 2Q6VA 1VLQA 1P74A 2JCXA 3IE0A 4UAJA 1DMSA 2AN4A 3RT7A 3T12A 1T0BA 3STYA 1BWQA 1SIWA 1Z7GA 1RWNA 1UFQA 1XCOA 3LT1A 3OJWA 4PYMA 3E8SA 3D4OA 3MJVA 3GJ6A 1J8YF 4IAOA 4N0DA 2P8SA 2CLDX 2Y76A 2JJ2A 2OY0A 2XLBA 2ZE8A 5EHZA 2QQ5A 3DVQX 3PR2B 5KYXB 4R9SA 4L0MA 4EHIA 1ABEA 3IXMA 1DG9A 4H18A 3V4SA 1ZJWA 4RETA 2O7QA 2DPXA 2BOVA 2CXNA 4BLWA 1PR0A 4DQKA 4AP6A 4N7MA 1P2SA 5EZYF 1U7OA 1ETHA 1OAKA 1ZNZA 2P90A 4MI9A 2IS6A 1EWQA 1I5RA 3NFYA 5LKRA 4WZAE 5GM2A 3OBIA 3KE8A 3N39C 4WK0B 1L4UA 5PGMA 4IIFA 1L6RA 4U5QA 3U0BA 3PS9A 4TKMA 4G86A 2O20A 3JW8A 1SD1A 3M3HA 4LCEA 3ROXA 3AUTA 3HFSA 1JHDA 1MLDA 1XAIA 3H19A 2ZK7A 1DG1G 3HI4A 4IIGA 3O84A 6PFKA 2IH5A 2V54A 1JGTA 1JWBB 2IA5A 2XTZA 3ADOA 3MBKA 3TPZA 5REQB 2UZ0A 2BGTA 1U0TA 1E79D 2SBTA 1QP4A 3W3ZB 3G7NA 1RM5A 1O95D 2O8DB 1T13A 3VFDA 1J2JA 4O1HA 3AF4A 1P4AA 3BWYA 3MAJA 3C3JA 1K6XA 3NHFA 4WDQA 2P35A 5C9ZA 4J2HA 3F74A 4R2KA 2JI8A 3W2EA 3KJEA 2W2LA 1FRQA 3GQVA 4JSYA 2R8OA 4BFVA 4TS3A 4X8LA 3PC3A 4U3JA 4Y2PA 1B8PA 4RVOA 1E9DA 2P75A 1O95C 3GFGA 3WLEA 3JAMA 1ZOOA 1NVAA 3OPNA 4QUEA 3NNNA 3VR3D 3HYTA 4PZZA 4TQGA 4OAPA 3BRSA 3FI0A 3X1XA 5JSHA 1UJ2A 4RH3A 2H5EA 4NBVA 1SN7A 3SX4A 5GVSA 1G63A 2WVHA 3UCEA 3FMFA 2SICE 5DN6A 3DW3X 4NS1A 1TZKA 1L5NA 1PRYA 3RRZA 3WAJA 4CLXA 3M8KA 4J16A 1Z06A 1RRKA 1M1XB 1JHZA 4DZRA 3L6EA 1M1YE 2BEUA 4BV9A 2BEJA 1F8UA 1DFIA 2JGEA 3EXFA 1HZZA 2AXPA 1EEXB 2TS1A 3TSZA 1U2TA 3DLPX 2PZEA 3O8OB 1SKYB 1DWQA 3RW9A 1U2DA 5ESRA 3CHYA 1DX9A 4HAUA 3KDAA 5BV2P 4C2TA 2QUAA 2CF5A 2XUFA 1E1CB 4Z7OB 2AVDA 4G89A 4TYQA 2GASA 2VNHA 3FKJA 2IU6A 5CVUA 2WABA 4WLVA 1D9XA 1QGED 3DLCA 3OIVA 4IZ6A 3AEXA 3SVLA 3RQSA 1VE3A 1QZ3A 1N3IA 3HXPA 3ERCA 2A5LA 3M3DA 5CDTA 1FMLA 4TQAA 4JLVA 2X4IA 4J9UE 1EFHA 2G5TA 5CYOA 1M8JA 221PA 3DOUA 4NDNE 4WACA 4URXR 3L7BA 2PUBA 2HLNA 2Y1LA 3EXEB 5KSYA 3D4PA 3DUFA 3CZPA 1TYZA 2YYSA 3ZHQA 4B43A 4OYHA 1ZGZA 1QAMA 3S70A 2KM1A 4WXYB 3A10A 2I99A 2C78A 1XCJA 4KWTA 2PVCA 3LFTA 4IIYA 3LS2A 1HT3A 5PNTA 5JTTA 3E2PA 4J4HA 1FIUA 2EVWX 3G2QA 2AUTA 2X2FA 1NYTA 2JK0A 2ZBVA 2O23A 2WMDA 2CDCA 2OXCA 4RE6A 2KS6A 4LY6A 1W0KA 4W9NC 1IM5A 3T61A 3S68A 5BYAA 2DHCA 3K8YA 2JFQA 4GDMA 4OBEA 5FJJA 1QYVA 1N3BA 1W29A 5AI9A 2EZ9A 5BSUA 5E2AA 3H7IA 4JOQA 4MROA 2CXXA 4LV5B 3QVOA 2J0SA 4MV4A 4CL3A 1BU5A 2ZYVX 3BEDA 5LMCA 4ZCIA 3R6GA 1YAHA 1P4SA 3VYTB 1KYXA 3CEJA 3A25A 3VO8A 4CR8A 2E5WA 2MSCB 4F56A 1EIWA 1EFAA 3DHNA 2XYQA 1PZHA 1JBKA 4G1CA 2IEZA 1MO4A 2POQX 3N07A 3KFXA 4L7QA 4ZVUA 4DDTA 1VOTA 1KYTA 3UMGA 4L76A 5KTOA 1BMQA 4F2DA 3T7RA 4KH1A 4X1OA 3HJUA 2CCKA 1WO8A 2G6BA 3CISA 4ND2A 3G3EA 3QMPA 1RCUA 1F2TA 1ZAKA 4Q24A 1FFGA 2QTHA 2UZ1B 2OKCA 3CF4A 1XNRB 4TTAA 1FP1D 3NXSA 3L8ZA 1CRZA 3SCZA 1NVBA 4NJMA 5EJGA 4DWOA 1E20A 1JX6A 1H0HA 2OXFA 2RMKA 2Q7DA 5JY6A 2P1RA 2BGGA 2EAUA 4G1EB 1AQLA 4P4TA 1NNUA 2GLXA 2XMBA 5F7ZA 5GZ1A 1P7YA 3M1AA 1U1GA 3PGA1 4D9IA 2R751 1A2KC 4JMPA 1AV7A 3V3KA 1DDIA 3Q7PA 3ZHTA 1BEZA 1PGPA 2XNHA 1RQLA 2DGDA 3BREA 1L5HA 3LLVA 1DQPA 3R9IA 2IKSA 3DAOA 4JP2A 3VOBA 4B82A 3JATB 5L4SA 1GAEO 4E09A 2OMKA 1CVRA 5HW0A 1GCGA 3GEIA 4YHHB 4QLOA 1SMKA 1TJPB 3F78A 3U4QA 1KNXA 2CXUA 1C7IA 3DBHA 1KERA 2GM4A 3TW4A 2D5AA 3WL4A 2ZIUB 4LZOA 2RK3A 2HRBA 2OZLA 3NTRA 4TQUS 1EVZA 1H1DA 1LFDB 3AT1A 1O54A 2XTAA 2HPZA 2EZUA 2R44A 2ZIZA 2F17A 5CA1F 4PTZA 4EJ2A 1ZAYA 3BE5A 3DFFA 3EK2A 1Z3CA 3BQ9A 1AE1A 1IVYA 3C7TA 1P5ZB 2GZ3A 4NR0A 3LT5A 4Q4JB 2P27A 3ZKAA 3VKWA 2FX5A 3QX3A 1ACMA 1P5HA 1ZD8A 1DNPA 4KI7A 2PX8A 4JP1A 4EY3A 5BY2A 4YV0A 4EL5A 2VRCA 1T2UA 3DP9A 3OM1A 2RFLA 4LWPA 2R1TA 3DL0A 2C94A 1RHRA 4HB2A 4NOLA 4BNVA 4GL2A 2VNIA 3R44A 4XWGA 1AKNA 1U3GA 2BGKA 3THYA 3D59A 5FYDA 5KPDA 4AO8A 1H3FA 4C08A 1XD2A 2G72A 5DNDA 4ZFNA 1EDOA 2A30A 3G2LA 3KAPA 2EOAA 1Q0TA 2OHHA 4DMFA 2G6TA 4HEA1 3TUJC 2DUWA 3HO1A 4CIBA 3PU6A 4CMEC 2IHVA 5K8TA 3SN6A 1PVOA 3FYHA 5CDFE 2DFTA 4CMCA 4DV2B 4KC0A 3IEVA 4X64B 4KMOA 2I8CA 2FSVC 3I6BA 3CURA 4FU0A 4LOKA 5FUVA 3K9HA 3T7TA 5JSQA 3A05A 1UPFA 4N5NA 3DM5A 4RANA 5BMVF 2IEBA 2EQBA 4WKPA 5IANA 2G1PA 1TVEA 2R6DA 3WV4A 1L5FA 2KJQA 1T3ZA 3GO4A 4U2KA 3ZDEA 1BX0A 3U7EB 1N0IA 1XTVA 3SG0A 1N9GA 3CV3A 1UBTS 1AC5A 2GEDA 2E4AA 4P7GA 4XLZA 4AJEA 4F04A 4UTVA 4YT4A 3BWXA 2R0QC 1IE3A 4P4UA 1H2BA 1K5PA 1A2BA 2Q1SA 4LN1A 4YLYA 4C0XA 5K8UA 1M8PA 3VKVA 5EEHA 4IF6A 2OCPA 5JS1A 1I7LA 2OCKA 3DZ8A 4EKDA 5I6DA 3WSTA 4LDRA 1NI4B 1GM5A 2QR3A 5H68A 5IHPA 1O94A 4BVGA 4HNUA 1K7EB 3LV8A 1W75A 1S2GA 3ORSA 4B6GA 1Z07A 1NWHA 2X0EA 3KETA 1U6JA 3FHJA 1I6WA 4XGRA 3PHLA 4D9MA 1EVEA 3A1VA 2Q4TA 3LQ2A 2H5LA 4Q02A 4GHWA 3EARA 3GA0A 1US8A 5LBUA 2XBLA 3OLVA 3A1WA 3K0FA 1VRVA 3PWTA 1DXYA 1KI3A 3RUPA 3LP8A 4GBED 1H2XA 4BECA 3L1KA 5JJLA 2A84A 2P65A 3EUEA 3K2EA 3BCSA 3P9CA 1HR0B 5U4QA 3AERA 2GJKA 3H9QA 3RJMA 1YK0A 1OWNA 5JS6A 3FDIA 2QTRA 1RXWA 1N6HA 4HDCA 4HWGA 1G21B 3LUKA 1ZVMA 3A4VA 3LJKA 3PJDA 2FSIA 5DJ5A 1Y7IA 2IK8A 1U3VA 1I9GA 4OMUA 1EUCA 2I22A 3TVYA 2NM0A 4D8WA 1WV1A 2VWQA 1F2UA 2ZRDA 3FFWA 2HZBA 4YMIA 1TJ4A 1SB9A 5KQPA 3UJHA 1T2FA 4NL4H 1A4XA 2V9PA 1YB6A 3CLSD 3NC4A 4C22A 2W6NA 3RTGA 1SXHA 3LFUA 1JEOA 2CFOA 4NOKA 3BF7A 1D2AA 5IC5A 4EQ6A 4PXAA 1KWKA 1JIQA 2AOUA 2FU5C 1Y5MA 4W82A 4KIFA 4DCTA 1F12A 4P80A 1E7QA 4B4DA 3HKCA 5CG2A 4TMZA 1OCEA 1WY5A 2GTPA 4KQ9A 4Y1RA 9LDTA 2CK3A 2E4YA 1MEJA 3IQEA 4UNPA 4LWOA 4OM7A 6GPBA 1C9JA 1ZW1A 2CY0A 1Z6AA 1IZ8A 4PO8A 3CLUD 3QUCA 1YHNA 4QEKA 2P9QA 1ZA2A 4W5OA 4M1EA 3N8DA 2BFCB 1JMYA 4MIOA 5HKKD 3DXXA 1PW7A 5KYUA 1U8TA 5K0CA 2QRQA 1UXKA 1K6JA 4R0MA 1OU4A 4YX9A 2EBUA 1MU0A 1LLDA 1JKFA 4RAQA 3FGOA 4JLJA 4H2DA 3CLUC 4IJQA 3S2UA 3A06A 1IZYA 1Z4OA 1B8UA 2NU7A 2XUHA 4L51A 5KBYA 1XTUA 1UJCA 4QATA 1VJRA 4Y9SA 3UJPA 2VTBB 4LMPA 5J59A 1M7GA 1CQWA 1IJBA 2HIHA 1QFJA 3ZHBA 3HCAA 3CZQA 4MA4A 3V9PA 4WJZA 1A8SA 5IK2A 1OA0A 4Q82A 1YZYA 3IP5A 2I2CA 4C6SA 2W90A 1Y1KE 4UPEA 4NE7A 1W5AA 5A3SA 2YMMA 3TOCA 1JEDA 1NIPA 5DHRA 2MR5A 2LDXA 2ZRKA 3UXHA 1MORA 5CEFA 1T24A 1YBFA 1PL7A 1GZ4A 3ZTWA 2WD8A 4QU0A 3ITKA 2ONYA 3T54A 3FZQA 1G4HA 5CT6A 4MS4B 1C9YA 3DCNA 4TMWA 5JARA 3H3FA 4NV3A 1H2FA 4PRLA 3FKSA 3IUBA 4PIPA 1U0EA 4OFBA 4RMNA 3W9UA 1HE5A 2FQQA 1DIOB 1UC4B 3ANXA 1MF7A 4WPGA 4XVHA 3SYLA 4YRBA 3EX7C 1IBMB 3IA7A 2V7XA 5G1NA 4ZYUA 3THXB 2BZSA 2CLMB 4UD6A 2B4YA 4MWCA 5JJ5A 4PX3A 4V1CB 1RD4A 2FMFA 2CVZA 3PUKA 3LWDA 2CUTA 2VZEA 4I55A 4DV3B 3OY7A 5JPDA 5EP3A 3IRVA 1WLYA 5TVKA 2BSQA 5EIEA 1PDWA 5AR1A 2NPFA 4DMMA 3AI7A 2XKBA 3DT6A 2QN7A 2VJMB 1NQOA 2QG9A 2RKBA 2WFLB 1M2VA 2XHZA 4YAFA 2IX9A 4RELA 4RK7A 1FA9A 4TVOA 2FEWB 5K6AA 1T5LA 1AV6A 2A5DA 4MZDA 3W2HA 3PRYA 3KCNA 4JJKA 1MOPA 3TQHA 1ZCAA 4MHSA 1RKUA 2P0YA 5FO0A 4WN3A 1QONA 3N2IA 1RKVA 2X4LA 1H9CA 4PSKA 4UZEA 1R0SA 1JQ3A 3AWDA 5MN6A 4GR5A 1NVEA 1ZL0A 1SVIA 3IQFA 4MVJM 2HXYA 5IU6A 1HYEA 2W93A 1L3CA 3GB9A 2YOFA 3HB1A 1WUIS 3EA4A 3W8NA 4Q01A 1LC0A 5J2TA 4IJKA 1PS9A 4MS3A 5JT1A 3INTA 3HC7A 3HJGA 1E7YA 3VDNB 3YASA 3LQYA 1CUJA 4BN4A 1XMOB 1RHJA 3U4GA 4RLHA 4PRYA 1SCAA 3IAM6 4C1BA 2FSGA 3B9QA 3G6KA 2K2QB 4IIHA 4WKOA 2A2ZA 1F3OA 2ZATA 4KPUB 4EGFA 5ALFA 4EYGA 2ZZNA 1J0DA 2BMVA 1E5TA 1G9XA 3WNVA 2OG1A 1DI0A 2N3ZA 2OECA 2O6LA 1G9TA 3VC3A 3ZUPA 1UQRA 1WHTA 4HX2A 5AW6A 5C35A 4ZI2A 4NCXA 1L7QA 5FBRB 4B8YA 4F4HA 1I7PA 4DCSA 4L0DA 3BCRA 4XVQA 3IV7A 1V5IA 4OP2A 5A9SB 2JBAB 1H2YA 5EJ2A 3E3OA 3KUDA 4IL5A 3L4BA 4QRDA 5JFOA 2WIGA 4OPMA 1SUFA 4QPDA 4RZHA 1FC0A 5DHAA 4CR6A 3M9XA 1D04A 2KLHA 3CO5A 1LPMA 4MP6A 5J58A 1CSEE 2ENWA 3BD8A 3WO1A 4AO7A 1AZSC 4FE3A 3OZXA 2WJGA 3F7NA 4TMYA 5ALOA 3JYQA 2IW3A 5T7BA 4BO9A 2C95A 2PWZA 4HH0A 1J1ZA 5DM2A 2PBFA 1N57A 2GETA 4AJNA 1MD9A 1S3FA 1SCBA 2ZVDA 2DQYA 5E6UA 2HT1A 1Z5ZA 2O4CA 2RH5A 4UTPA 4BFTA 5JROA 1HLPA 3MN1A 1YIOA 2J9FA 3AFIA 4KLZA 3V8MA 4AYWA 4BXOA 1RWMA 3ZKWB 3Q9LA 2ABWA 2Y1DA 3K8OE 5CYGA 1E2EA 1JG7A 1JJBA 1GCUA 1RAGA 1WEKA 5DTMA 5G0VA 2QX8A 2WTMA 1KDVA 2VSQA 2QM3A 3VR5A 4DSNA 5BOSA 2IZ1A 3TLMA 1RXVA 3QU4A 1YRLA 2VDPB 4IKOA 1ORIA 1XMSA 3G59A 5C18A 3OESA 4LPSA 4JVNA 1YF3A 4UHEA 1J20A 1BZYA 3R0QA 3D4LA 2QLBA 3MWEB 3ZJ4A 1XTSA 2CMHA 3MJFA 3FRHA 1ST2A 3O8BA 4CMBA 4DS3A 5D3MB 1CZLA 1D2NA 1RABA 5ALZA 4ZAYA 1MABA 3TZEA 4HWOA 2PH1A 3WIOA 3FWPA 2F55A 4PX5A 2II6A 2QRMA 3A2MA 4X1KB 1NSTA 2YN4A 1ZI8A 3GG2A 3C70A 3HY3A 4YYEA 2ZVQX 1BC5A 3F90A 2EF0A 4JUCA 3EC2A 3PUWA 2CV2A 3WNDA 2A0UA 4OFXA 4RF2A 1R5NA 1XK6A 1ILWA 2RBEA 4ND8A 4ZDWA 4CG0A 4E0BA 3AV3A 3STHA 1N7JA 5I4CA 3HA2A 4HFMA 1U8AA 2PZGA 3SLKA 4QFCA 3ABZA 1A9YA 1E61A 1H6DA 2G1KA 2C5EA 2PZJA 2BKXA 3ZJYA 3IURA 2Q3BA 4P0TA 1F5SA 2NYAA 3FAZA 4EPWA 3U2QA 3IOCA 3MWDA 3QBJA 4CG1A 5AM3A 5AW0A 2H8KA 2O2GA 2ZANA 5FIUA 3R3UA 4JLPA 3ZK7A 2I7CA 4J1NA 1OW3B 2P67A 4X45A 2EL7A 1I3MA 1YQ9A 2N9UA 2Q4RA 5B1HA 4PYNA 1MTOA 2CFRA 3C3AA 1C80A 2VAWA 3ENKA 5CM9C 3O6VA 2WJIA 5EJ9A 2I62A 2W6ZA 2WJZB 2G9VA 4LRSB 2I87A 3P4YA 1AVTA 1UM8A 1OWMA 3FG9A 4JHXA 2HQSA 2IIPA 4X94A 1FLVA 1BHSA 2JIZD 3NDPA 4UU1A 5JS8A 3QITA 1ZM2A 3ZGXA 3DKRA 1R4NB 3Q8MA 4E2ZA 4YJHA 1XVAA 2B82A 1FX0B 2IIVA 2ETXA 3V00A 1HG1A 3OTHA 4EHBA 3Q7IA 2H2DA 4F5DA 3KWJA 4BWVA 5JBQA 1K66A 3M5DA 2E7ZA 5HS4A 5IBCA 1G7RA 3C8HA 2C04A 3D43A 2HA5A 1JS1X 3L1VA 4YCLA 4KB5A 1PR9A 2B35A 3AEYA 4Y9UA 5I3ZA 4DTIA 1V1MB 3QEMB 5LMUB 2J1LA 1SVUA 3OCVA 3NM6B 3WGJA 4MA0A 3SLGA 4CKBB 3JQDA 2H2GA 4Z9YA 1NSFA 4N8EA 3D3WB 5C1PA 3PTAA 1I7NA 3G5LA 2XCLA 2O48X 4YMWA 3RADC 2YVLA 1XK7A 3E3AA 4E88A 1WMBA 4Q34A 1CW2B 3L1UA 4U0KA 3RD5A 1E0AA 2BW0A 1ZXBA 2H17A 4H59A 2R79A 4GM1A 1IPFA 1I9CA 1Q15A 1YRQA 3L05A 3R1IA 2D2IA 1KKUA 2NSJA 4FSXA 1E58A 2GAJA 1PG5A 2A9OA 2GGSA 3NKFA 4LK3A 4RVSA 5FBWB 4BBPA 2IS1A 1XDSA 1Y5IA 4EGSA 2P2GA 3BB1A 3NC0C 5K2OA 4HQOA 2WSYB 5FUMA 4CI0B 2HUPA 3HWX1 2B36A 1VG1A 4A82A 5K51A 3IO3A 2R68A 3VZBA 5B4VA 2C7GA 2R25B 5CAEA 1JL3A 2TMGA 3BXGA 4F9EA 3I1IA 2X8AA 2D5BA 2AFHB 1V16B 3RLIA 1I32A 3Q3EA 1BRTA 3EHEA 4KHZA 2VDWB 1Y8RB 2ZRJA 1JJ7A 1Q2XA 4UM9D 2ZWIA 1EFPB 1YMVA 1PU2A 1Z8FA 3R75A 1JXAA 4FOSA 3I61A 1UBCA 3OG9A 1L7AA 1XZJA 3AKCA 5DNWA 5HM6A 1TF2A 5AUOB 2N75A 3DT8A 3HKBB 5A5GA 3AVWA 1JDZA 2QNIA 2LKCA 5J4LA 4EEZA 2PG3A 1AUPA 3BH0A 1YS1X 4U5XA 1JQBA 4M0KA 2JLUA 5K8IA 3RG2A 4H7EA 5A5VA 1ISSA 3F6RA 1OMOA 1X87A 2QGZA 2ZAGA 1E59A 4HGRA 4HWRA 5BMVB 4H7KA 3L01A 3ZGVA 2RK6A 4CKWB 3RODA 3OQIA 1UCFA 2XWQA 1M10A 3CF4G 4HTFA 2Q28A 5E7IA 1QLWA 4FCWA 4HC4A 3WGMA 1JLLA 1HDXA 1EB8A 1K63A 3PNLA 3R3SA 4L3VA 4M0UA 4Q7KA 1WP9A 2FPIB 2KW5A 3NATA 5B7GA 3HP4A 2KE5A 2I9KA 3GMIA 3QUSA 3H9GA 1VCOA 1FEZA 4ZI7B 1R9NA 2O59A 3FR8A 3ESQA 4IUDS 3U7IA 3FNFA 5JAMA 4CE6A 2FPKA 4BIIA 1E2LA 4P2GA 4YLEA 5D8DA 4JXXA 2YVQA 5AVRA 1KBZA 4W8HA 4XPZA 1SH7A 4GKAA 3T7IA 3W6ZA 3HUEA 2J3EA 3NFRA 3KNZA 3F98A 3M1LA 4L4UA 1E89A 2EKZA 3HACA 2BCEA 3NS7A 4WD3A 1U2GC 1YJCA 3R4CA 1HE8B 4UCQA 2VT6A 5TSDA 3LNCA 4P4SB 1T3LA 4OAQA 1XKXA 3H2ZA 1ZD1A 1ECCA 4BZWA 3SOPA 1N8NA 3JAWA 2OOSA 4RORA 1FTWA 1GHTA 4N65A 3SFZA 4DYVA 3C8UA 4MITA 1HE1C 3PFBA 2Z2KA 2J33A 1FYWA 3IAS6 4JYBA 1REQB 4EITA 4M0EA 5FTLA 1O8BA 3BXPA 3LVRE 1NDQA 3E22A 5TS3A 3HPQA 1TZ2A 1UM9A 2PM8A 3AVXA 1V8PA 1HRDA 4P4LA 1P61B 2AJLI 4F85A 3QUTA 5CDUA 1Y4UA 4L5AA 4ZAWA 4A8JB 2WFZA 3KT3A 2DECA 3FUTA 4I5DA 3RE1A 4PQGA 2RAUA 1M0SA 3MSXA 4GLFA 4RJJA 1POXA 1ZM3A 4UU0A 2Y0DA 4X00A 4GUDA 3QUAA 4K9KA 5EJEA 3TBHA 1HZJA 5ITVA 5GJCA 1XZ8A 4NBUA 3VR1A 4FKZA 1QH9A 3L06A 2WT9A 3L8FA 3OWOA 4KXWA 4TXJA 1D4FA 5D6NA 1XAJA 2I3DA 3I4LA 1BQEA 3WDLA 4RJKA 1U3UA 2SCUB 3RC1A 3Q8XB 2D1QA 3EGDA 4FHZA 3AR7A 2WZQA 5A2GA 3VHQA 1G16A 3SC4A 5EHIA 4MYSA 4CDRA 2JH8A 2D6FA 4DUPA 1TUEA 3T4XA 2PV7A 2RH9B 3H2IA 3AFHA 1TM5E 4Z4HA 4ZEVA 2JJ1D 3D2LA 1WMEA 2IYAA 3BA1A 4ARZB 1O9GA 3GVHA 2QTLA 4JB3A 5D00A 1N7GA 2HDWA 3V8EA 2K2WA 2AVNA 1NQAO 2W9XA 2XCOA 2XYGA 4I9HA 4M38A 2XKKA 3PX7A 4D9BA 4QEZA 3K1YA 3AMVA 2FMXA 2B99A 3BIOA 3LOPA 2ZT7A 2OXTA 5AFSA 4G8DA 4LVUA 2O8BA 1PE0A 3ZE9A 3SJAA 5E1DA 3KQLA 4CEHB 1SCDA 5ERXA 1ULUA 5AJUA 2HRDA 2XYHA 1AKUA 2F3RA 3QOFA 3VRHA 1RLIA 3LC2O 1J07A 4CM7A 1OOEA 4MQEB 3S1AA 3OQBA 1EDDA 2BFOA 4TM7A 1EGHA 5CFMA 5JZ9A 2Q5QA 3DQPA 5IS2A 1ESDA 5JDIA 2A6PA 1I0LA 1N2EA 5AJTA 4BE4A 1GGNA 1OASA 2HLPA 3GLSA 1OAAA 3AB8A 3MJCA 2PU5A 3PT5A 2V58A 3IMEA 1PHPA 3K31A 3KR1A 3QXXA 4MB0A 3RH0A 3JQCA 3STXA 2CNOA 2P78A 3SFTA 2WIFA 2CWWA 3OU2A 4MKXA 1XTPA 1H4SA 2J3DA 1RKBA 2R6AA 3LL4A 3RVDA 3S5JA 5CEJA 3QVVA 2J6IA 2I6TA 5IAEA 3E05A 3TAHA 1TW3A 1X0VA 4I5GA 4K2HA 2MWMA 4FEGA 6ADHA 1BS1A 4LXYA 4Y2HA 2CXOA 2UVDA 2VPXA 4MUFA 4GQBA 3KZMA 4M89A 1OFGA 3M6XA 3L79A 3OCJA 1W4RA 4PINA 2BGLA 3WRYA 4B85A 3VZQA 1BROA 3OWHA 3G68A 2IS4A 5JAZA 3ESZA 1HGXA 4PNPA 2UZ3A 1H4VB 1ORWA 1QIEA 2O0MA 1YOVA 3RAEC 2HBZA 1U94A 3KYIB 2FMHA 1YVUA 3PE4A 2FWAA 2FUCA 2HU5A 3N86A 4REQB 4TV9A 3WDKA 4QQNA 1CJSA 1BVRA 1TTPB 1X1QA 3LSTA 4S04A 2NO0A 5KWIA 1JN0A 2VUSA 4DNOA 5B58T 2E0IA 3NPAA 2H1FA 1HDGO 1H85A 1XVTA 1U4OA 3DZGA 4UUPA 1DBIA 4H35A 3W6PA 1BE1A 5TMBA 3IOMA 4PG4A 5CT8A 4B34A 1QB8A 2OZPA 1II0A 1KY4A 1YQUA 1YR3A 5DP2A 2P77A 5F3DA 4JQSA 4EW1A 4ZYZA 3CRW1 3FJOA 2QXUA 1YDEA 2WSMA 2AFRA 2I4OA 2JIMA 2W2XA 2P6UA 3I9NA 4TKUA 5AW1A 4UULA 2L2QA 4D9CA 3L7KA 2BMFA 4DA0A 1E9RA 1B26A 3OPYA 4L6CA 3PQ7A 4HDOB 4MA5A 1RT9A 5JDCC 1VZ2A 4M22A 5JVDB 2V96A 1JWLA 2Q1YA 4R5HA 4X95A 3RVJA 4BVHA 3BSYA 4E1VA 2BGWA 1U9YA 4OU4A 3A0RB 4WNCA 3SXUA 2DETA 3KV1A 1JBEA 2O5RA 2QRPA 1UAAA 2VHCA 1T9CA 2BUCA 2IPAB 1O3YA 3HWRA 4KRFA 1XU7A 1Y9DA 4ND6A 2E55A 4JYMA 5JSFA 2JANA 5DLEA 1VGQA 4Y0VA 4V38A 2IUFA 5C5CA 2XODA 1HFKA 1GTL1 1M76A 3R8XA 3ZI7A 3FPCA 1SUDA 1WVIA 4PGFA 1MJGM 4BNLA 3R7NA 4B7ZA 2H0QA 5BSTA 2NU9B 1GDTA 4NX2A 1KHHA 4V0ME 2Z1MA 3G2JA 2YIDA 2JLWA 4GI2A 1Y5NA 5I4IA 3Q3JB 4KNWA 3DFKA 3OFNA 5CFOA 1CNFA 3QYPA 4IILA 1ACJA 4PZ0A 3G2HA 5ICFA 2IHBA 2YZNA 3D4BA 5BR8B 3WXBA 4AP5A 1PG2A 4K9QA 1NXXA 2BGJA 4CF5A 1NBME 2REXB 2FXIA 4IX9A 3ZD9A 4HI0E 2WIDA 3QKTA 1TK3A 1CS4C 1CVLA 3PJGA 4ISBA 3TTYA 3ZWDA 4NABA 4F9FA 4YCNA 1EFRA 3ICCA 4KR3A 2JLRA 4BP9A 1GZSA 4NS4A 4BX9A 4FWIB 4MQUA 3IDSA 1A7AA 3I04A 4MRRA 4JIMA 4DR2B 1V3TA 1P1IA 4JXZA 2AK3A 2R6GA 1KI4A 1PJQA 1AF4A 4CZ2A 5CK4A 3OCYA 1R6TA 2VUTA 4LX0A 3BF8A 3DFZA 4KXFB 1TE2A 1VPTA 2VAMA 2NO5A 1GTJ1 2JI4A 3DMTA 3IR6A 4BO8A 1NR5A 2X41A 2CMDA 2EFHB 1GYPA 2IYQA 1V5FA 2FQXA 4JMLA 3WGYA 1II8A 1AB5A 1FRNA 3C87A 3GCXA 4KXYA 4UMDA 1DJMA 2HYDA 4LXXA 4YFVA 5FCDA 5LNK1 3FOZA 4UE6A 1UK7A 3OCZA 2W6QA 3A1TA 1KYVA 2PWPA 5TX7A 2FJPA 3MJRA 2QE7D 1ID1A 1JDBC 4MKHA 5CCBA 2GCEA 3CCFA 2O07A 3B1WA 1UPBA 3VZDA 2ZBGA 1QZUA 2PUAA 3CZCA 5DRYA 1EEHA 3WGTA 2RC5A 5KSZA 3U3ZA 4RVDA 3HXOA 2RGGA 3BMNB 1JKIA 3BGSA 2XMGA 3HSKA 5C46F 1MQ8B 4WTOA 4YTEA 4JJ6A 3SX0A 4BB5A 4LMBA 4DCNA 2CVOA 3NXKA 5GONF 1LWNA 1RAIA 2Z2XA 4GW3A 1AS3A 2B0JA 1JPVA 1XHFA 3ETHA 4RK5A 2J32A 3H8SA 4JB0A 3CB2A 4G63A 3R7WA 1E96A 2H1LA 3UT5B 1VRCA 1PNRA 4E4YA 1YI8A 3KZCA 3IOBA 2HA3A 3LUJA 4U7HA 2IODA 4DJ5X 4M9SA 1OAOA 4FB4A 2AG1A 2YCLA 3AY0A 3LQQA 3SBEA 1EBBA 3ORHA 3DOIA 4KRGA 1KDRA 3C6KA 4EIWA 3TIVA 3VSBA 4JBNA 1RQXA 3PCTA 4C5AA 4GI5A 1YA4A 1KL7A 1P29A 1XEXA 4E2YA 4P4GA 5JUWA 1AUVA 2H4JA 1RVDA 1ZN8A 2R87A 2ZYRA 3VNRA 3VU0A 4C3VA 5K0EA 4AP9A 4KAAA 3W3AA 1N33B 1UIRA 10MHA 4KQKA 4QTXA 5SZIA 3QHPA 2GQ0A 3AJEA 1T34A 3GP5A 1KMHB 3DXFA 1E1QA 1FP4B 2Q4BA 2VJPA 3MCAA 5ECWA 1TVCA 3W8RA 3ZJTA 1IB6A 3M0EA 1ICIA 2ZTUA 1OBVA 1C41A 2GCNA 2VCYA 3ZC3A 2R00A 1NC1A 2Q27A 4DAOA 3UJ8A 1TZMA 1OZFA 4NU5A 5BT8A 2A0KA 4AUEA 3KQUA 3CCCA 3NM5A 5ITSA 3HBFA 2CHUA 3O83A 4EVSA 3GQBA 1V8BA 4BU0A 4CHTA 1BX3A 4DQVA 5A62A 2ZUBA 3W8EA 5KCMA 4LF8B 2RBKA 2X9VA 4Y2JA 3WX0A 3EVZA 3RS3A 2Y92A 4R8LA 4E03A 3HP1A 1WW3A 2AX3A 3BK1A 4QAJA 3JQFA 3ZD8A 3ND8A 4A1OA 5FNVF 3PUZA 4IFEA 1DEOA 2GVDC 2ZYIA 2W48A 4AD8A 5U4XA 4OGGA 1NURA 1XLUA 4EJ0A 4N3GA 1LZKA 1VP3A 4D6YA 4E3WA 3NUQA 1ZY2A 4JY7A 4ONEA 3VR6A 1KS9A 2W2KB 2R8BA 3EG5A 4KITB 1SKUA 3KKEA 1SBQA 4S1WA 1Y4SA 3CNLA 1H93A 3CY6A 4R3UC 4TOIA 1OZ0A 4MR7A 3HKDB 1RRCA 2FG5A 4HGZA 4LYGA 1LUAA 2C8VA 1D6SA 4IVQA 1W5TA 1E3QA 1K9SA 2RHWA 4DNFA 1ZD9A 2WEKA 1TNDA 1U7HA 1YU6A 2VDLB 3F4BA 4MGIR 4XXHA 5K0LA 2NVOA 2ZQZA 3F3MA 3TZQA 2IHNA 3RS7A 5LC1A 1H2WA 2EEPA 1EDBA 4LRTB 5DXJA 3VBEA 3AILA 4DJJA 5AVUA 4TWBA 2NO1A 5HJEA 3KT6A 1Z2AA 1ZHFA 3PFCA 5ALEA 5FBHA 2NUTA 5EJ7A 3CT4A 3DZHA 4UATA 4NAVA 1Q20A 2QRVB 1O2DA 2PXXA 5L7TA 4NENB 2ZYUX 3DTVA 2LGJA 3QJ5A 4HNHA 4YJGA 5AKEA 5U9CA 4XOIA 4AKHA 1TUBA 5CW1A 3VNUA 2A67A 3I1JA 3IMFA 2DSNA 4IKEA 1NPTO 1R9JA 4QUIA 4WK4B 7AT1A 5D5PA 3JS5A 4MUJA 2IV7A 5FV4A 1ZN2A 4JK3A 3ZVRA 2O14A 2ZU0C 2XNSA 1ZMRA 3JXEA 4DCOA 5ICEA 5KNDA 1S8FA 2XSZD 1WUHS 2H07A 4U8GA 2HQ1A 2VK4A 3BTUA 3D54D 1RYDA 3LIIA 4B79A 1JLSA 3ACCA 2XMCA 4XUEA 4Y2SA 4ESEA 2OBMA 1PJCA 2EHJA 1GZ3A 4GSKA 4C0HA 1B15A 4XD2A 4D56A 3B7PA 3LKZA 5K6RA 4KXQA 1QZTA 3OLCX 4YI3A 3OX4A 4IO0A 1AQUA 4DLSA 1XZDA 4OQQA 5DWVA 2C2ZA 1IEWA 1OYVA 3I3SR 3VX4A 1X39A 2ZB7A 5I7WA 1TQHA 2R62A 3HJCA 4FX2A 1KJNA 2D2FA 5JNUA 4M1TA 4OXIA 3RYIA 2DXIA 1XCBA 3GLKA 3JY6A 3OI7A 3TE7A 4QBFA 4MWEA 1V1RA 3KVVA 3EG9B 1DX4A 1HTTA 1L5OA 3DH0A 5EG5A 2IEIA 2WG1A 1Z29A 3AFNA 3D1LA 2VAVA 1O0SA 4D3SA 3DVLA 3ES9A 4OOEA 1JF8A 2WJYA 2W71A 3INYA 3LBNA 1T2NA 3MXOA 2P79A 4IRXA 2VDRB 1TJ5A 5A6SB 4AN1A 3AV0B 1X7WA 3RWOA 4HADA 4J1QA 1J49A 3K0AA 3DCJA 2X15A 3I2KA 4Z0TA 3URKA 1JQDA 1IVSA 4MRMB 3RHZA 1I1OA 4BZZA 3SC6A 5HPYB 4L9WA 3FHCB 1C30B 1G3MA 2QN2A 3K4QA 3KU1A 4ZJUA 4K40A 5L53A 4YY3B 1I4LD 3Q6MA 1TYDE 3GFQA 4H3VA 3RTEA 1XALA 3DB1A 3G0GA 4AJ4A 3G1WA 4BJ6A 2WZDA 5I9BA 4R0NA 3T1VA 5JRJA 1P33A 3EPJA 3AVQA 2Z4TA 4NZOA 5FF9A 2A57A 4TV8A 1QR2A 1KIAA 1WR8A 1N92A 1OXUA 4LTNA 5EJFA 1Y8QB 1OZHA 4CMIB 1VPWA 1GPMA 3RTDA 5LQAA 2ATIA 3BXHA 3S2IA 5BUQA 5EWMB 1UEXC 4I1SA 4MVJE 1XPUA 2V98A 2VHTA 5HQ3A 2VHVA 1Z25A 1YQXA 4PPNA 3X1ZA 3H5OA 1SULA 1JHMA 4MVJI 4NRDA 4QDZA 3PIIA 1Q6YA 1QX4A 1OYOA 4WEQA 4Z1MD 2JW5A 2ZR9A 1JW9B 3U1VA 3OM8A 1KBQA 4N41A 4DT1B 3K2BA 3BAFA 2OM2A 4DFDA 2W4QA 1M74A 4OFWA 4YECA 2VUUA 4JI7B 4OHWA 1KKLA 3SJUA 1Q6ZA 3C5CA 2QWXA 5H02A 1YR8A 4EKEA 8GPBA 3ZU2A 2FFAA 1QJ4A 3JYHA 3TS1A 3BHMA 5BR7A 3ZU3A 3EY4A 4QO7A 5FQOA 4LKOA 4V39A 3ZH9B 3TVDA 2PSEA 2REQA 2AR0A 1Y7TA 3WKAA 4IMIB 4Y1FA 4ERNA 3SQOA 4WINA 5AVXA 4OOFA 2QD4A 3CWZA 2ZTSA 3KCQA 2ZSJA 4NOJA 4ABTA 2ERCA 3KYCB 3VHXB 4YDQA 5KOHA 4FFLA 1FTSA 1BXRB 2GK6A 4RQUA 5H3LA 3VUEA 1RJWA 3FMIA 4HVAA 1V3QE 3GPDG 5ADUS 3L4KA 1WDWB 2H57A 2PA0A 2WT4A 4N5DA 3G9UA 3S2FA 5FBKA 2BFBA 2H65A 2P2YA 3WE7A 4BVLA 3EPRA 3N6VA 3CX8A 3ICVA 1ZVJA 2H0RA 2IZ6A 3I9JA 3IE2A 3IOEA 2OBNA 1I3KA 1XXHE 5K4GA 3KQWA 1XSEA 1SBNE 2WYVA 1E98A 2GZ1A 2YHUA 4INJA 5JXJA 1Y63A 4LSGA 3PUJA 5A4DA 2JCGA 1HFJA 2ZSAA 2Q9BA 4TLEA 3V5NA 5TQVA 5FWYA 1B1CA 4GOKA 3P0EA 2AHOA 3LC7O 4QASA 4C6RA 3SMVA 3QBTA 5JY1A 5KTMA 2GKOA 4UEQA 5CLGA 2RI6A 4NBKA 4KGDA 2Q6IA 2XDYA 1XIVA 2W8BA 1F0YA 2B20A 3QVXA 2G8NA 2HSZA 1DQYA 3L0PA 3R3XA 2C57A 2PWAA 4EG3A 3BRQA 3MTJA 1IUPA 4Q4AA 4U7TB 3STVA 3TYXA 4R05A 1N6OA 1W2GA 2WJ4A 1M72A 2R5NA 2BPOA 5IJXA 5C37A 1Z6ZA 4QUJA 1C8KA 4RPGA 5EJ8A 2ZBEA 5HFNA 3HK2A 3C0KA 4QDUA 1SA0B 4XAQA 4C88A 3I23A 2E1RA 1NN3A 2XMZA 3LBYA 4LG1A 3TLEA 2IPNA 2HPHA 3IFSA 1A1VA 3ANTA 1JG4A 4M0CA 2P68A 2QW8A 2G7ZA 3CNHA 5DK6A 3D7RA 2JIBA 2ZCVA 4N7RA 4OL0A 3DDZX 2NYRA 4DLRA 3BCHA 1DC3A 3GDFA 2KSQA 4BNDB 2JHPA 4PYRA 4XJVA 1TF5A 1B76A 1MGPA 4PO3X 4UNRA 1U7ZA 2IQ5A 3H6HA 1TPZA 2BR3A 4HDSA 4M98A 4C2BA 3EGCA 3ET5A 5JAQA 1T91A 1RIFA 2D2VA 2QTCA 1P9LA 1EGVB 2VLIA 4L8GA 3IXQA 2H59A 2PKYX 4MQLA 2PAFA 4N48A 1DOZA 3Q8LA 4PFQA 2G36A 1C9KA 1F7UA 1T36A 5K45A 2HDHA 2Y4NA 4GFDA 4AUNA 5BWCA 3C5HA 4YP7A 1HTWA 4AXBA 3IKTA 2NTYC 3D6FA 1E9VA 1JPUA 1IEQA 3L07A 4Q9NA 4CEJA 2VDOB 4P7BA 4BE9A 4B09A 5AUPB 2EFGA 2I4RA 1HDYA 2V45A 4FS3A 5B1DA 1E9SA 3AWIA 1HETA 1WMSA 2HA2A 1SWVA 2ACEA 1WX1A 2PRSA 1THGA 3SKXA 3TLXA 4YROA 2GAIA 4M9ZA 3V2HA 4JVMA 1AGYA 1RHKA 4UEJA 4B4UA 1Z88A 4CYMA 4LYHA 2YJ3A 2GLUA 1KFEB 3E9YA 4IUYA 3M83A 2DPLA 2OCGA 5E0OA 3DE5X 3QVKA 4L7VA 2JZOA 4DR3B 3FCOA 3HBMA 3WHLA 2VJKA 4M1ZA 5CT9A 4FYMA 1DAOA 3L02A 1H5NA 3AJRA 3OOJA 1ENOA 2H1RA 2WB2A 1VPEA 4OHMA 3SYRA 1DKRA 2ZAIA 4HAOA 3CRZA 1FYXA 2R9VA 2AFVA 2G4VA 6CHYA 1TYCA 2AYYA 3QM1A 3TBKA 1PJ4A 2HTFA 3VMMA 4ZJYA 4ZVNA 1F3LA 2O2SA 5CW2A 4I55F 4D3FA 3QKUA 3PKZA 3OIFA 4CW7A 3DDHA 4GP6A 4MQ5A 3OQMA 1V9LA 2ZSHA 3TW6A 2CB0A 2CCJA 2CLOB 2OP1A 5EE9A 1KPHA 1THMA 4BFWA 1E5XA 3KB1A 1WY7A 1P0QA 3W0LB 1OLSA 1G20A 1J33A 4MUMA 3EULA 5FUQA 3VU9A 5ITZA 5IAKA 2J5XA 1VSTA 3NONA 4EHLA 4YJ3A 2YXLA 2BSXA 1BU8A 3NANA 4H6XA 2PX4A 1N1EA 1YMUA 4D92A 5DNEA 1DBWA 4I1PA 2F1JA 3AKZA 2Y9MB 4O2BA 1Z68A 3S28A 1KZ1A 3VR2A 3IVRA 4IYJA 5GONB 3VVCA 4GI7A 4RWZA 5E8RA 1E5QA 1D5WA 1E7RA 5J2TF 1N1GA 3ZCPA 3JWHA 2PZLA 2WSBA 4ALJA 5EA2A 5BSKA 1NZFA 2FSHA 2HPVA 1KE2A 3W4KA 1W6RA 3E27A 3KV3O 4L73A 5JZSA 3THWA 4XUGB 2PLRA 3MEQA 5I7RA 1NXWA 1OIVA 1VGRA 3WYCA 5B6JA 1T4GA 5JCJA 3RO7A 1GZ5A 4YBRA 3DE7X 4EUSA 2A0XA 2WT8A 3ORFA 5LXTA 3R3VA 3CXRA 5TY0A 2XCSB 3PEEA 3FYCA 3NETA 5E4JA 1VE1A 3TJMA 1A5ZA 2VZ9A 4FJ1A 2GZDA 4RTNA 3AJAA 3O92A 2F48A 4EHKA 4JWTA 4QL3A 3TAUA 4FOLA 2C29D 5I8PA 5IABA 1COZA 1N9KA 3D8HA 3DF9A 3PDUA 2OV2A 2P6PA 4C03A 1IXRC 4ZAFA 2YJ5A 5FNZA 4U0JA 1HRKA 5DP1A 1LX6A 1E8DA 4OQFA 4ER5A 3SZUA 4MUXA 1NF3A 3SS8A 1LI4A 3LPMA 3BG5A 3R0XA 4WFIA 1DKLA 2MTBA 3AUFA 3ZZUA 2ZCJA 3CX4A 4OD0A 3EXFB 4OI2A 5MDHA 5LWQA 4WQMA 5FR1A 4FDVA 1YT5A 3Q6NA 5FXMA 1L7DA 3UHFA 4KFCA 1H1TA 1ESCA 1XDZA 1M66A 2PQ0A 3G9TA 4N8DA 1UAYA 2NZXA 2B2XA 3B51X 4OFZA 4ZRNA 3FA2A 2G04A 1UKCA 3K9GA 4IIJA 3I09A 3RU7A 2CMKA 5DNAA 5FADA 1LH0A 1U9JA 3ZIUA 3ZY3A 3WISA 4KAXA 1GZUA 1KJIA 1Y34E 4J3FA 4JGGA 4CNQA 5CBPB 3CBGA 3ECAA 1DDGA 3K2IA 3PXBA 1L7XA 2IQIA 5E7QA 4UDNA 3PEWA 3F0TA 2H4HA 5FNVB 1IIBA 3D0RA 4C14A 2FUG1 3G89A 4JJ7A 5DN6D 3RK1A 2PRJA 4GXRA 4ACAA 5B36A 2OILA 1VJ0A 5KYGA 4H6PA 5CIYA 3QH4A 4L6IA 2N42A 2MINB 1HEUA 4ER0A 1J6UA 3LUBA 1ZGJA 4UNNA 4UDYX 3W34A 2AGVA 1QBGA 4QQFA 4X60A 4C01A 2D62A 1BYUA 1NHWA 1Y1TA 2RJ3A 4GG1A 2J0UA 1K8XB 3QPDA 5K8LA 3GJRA 3B82A 3QWHA 4DWWA 2Y1CA 5K0JA 4G36A 4UHJA 3J81k 1GSHA 2XA2A 3CNEA 3OF5A 4OGFA 4Y2TA 3SDSA 1TDJA 4J16C 1PNVA 3O73A 3LBIA 3EIEA 3F5QA 1AO0A 3VC1A 2WHPB 5ALGA 1A5BB 5DXFA 5TXGA 3K73O 3ABOB 4HEJA 1G17A 2MYNA 4GIBA 1HZZC 4ZZ3A 4LF9B 2LXNA 1TA4A 3EIFA 3M4JA 5AW3A 4OK6A 2HBYA 1F7VA 2PCLA 1U2ZA 1U2DC 2GBIA 4A23A 3QHQA 1NP6A 4RA6B 1Z75A 1TRHA 3R0VA 3DMRA 3K70B 4RADA 2PYZA 4JL6A 2QT9A 3IEXA 2TMDA 1MC5A 3ODPA 4WECA 3SAJA 1ODKA 2B30A 2E6UX 4B3DA 1IMJA 1JHOA 2J8ZA 2WAMA 1YE5A 5EGSA 5JRZA 3FCSB 3OOWA 2CVFA 1XA3A 1SQGA 1CRPA 5L3ZA 3KYDB 3UPDA 4OJMX 1TUIA 3MSCA 3QJYA 4PO1A 1GNPA 2F43A 2VZLA 4MINA 2Z1NA 3R2JA 4PSCA 1W0KD 4B3MB 1GRCA 2YASA 2MCFA 2FPPB 4DSUA 5DNCA 4O33A 5K05A 3HDHA 4UU7A 4RXTA 4L5JA 1BG6A 1MVOA 2WUEA 1E1NA 3F4LA 2AMYA 1DKUA 2UYOA 1V3UA 4RU1A 1YBMA 4BO6A 1KZ7B 3UAXA 1NBAA 2VC2B 2X9NA 4G0UA 5CFQA 2J9RA 2X76A 5JBNA 4JLWA 1DL5A 4UOEA 1QRTA 1KC1A 1B1AA 4IDCA 3ONWA 3VU1A 4EG7A 2AFIA 3H1TA 3D0OA 2XWSA 3CINA 1ZHOA 2QP9X 4RPJA 4NPHA 4C0LA 4R6XA 1R64A 3FWZA 4MAAA 4DA4A 1BD3A 4H3SA 4TYYA 1KI8A 2IYLD 4Q3KA 3VOTA 5JC1A 4AQDA 2ZBPA 3BE8A 2OZLB 1CLUA 1L7RA 3PQ5A 2H08A 1LI5A 1TKAA 1YB1A 2HX1A 4PTLA 5ALJA 2W4MA 3QLVA 2WRZA 2G9NA 1NBOA 2AN1A 2ORIA 2AOVA 2YJTD 1NXSA 1TC1A 4WESA 5CB0A 2B8NA 3NTOA 4PPQA 3CRRA 4BNKA 1IBLB 3GRKA 1YHYA 5A0VA 5GJBA 1MNAA 3I83A 3EWSA 3LGAA 2JGNA 1MQAA 3FWYA 2NP7A 3T1OA 2ZT6A 1R0WA 1IATA 2CD7A 3QFTA 2UYHA 1I24A 1NVVR 3F67A 1M6EX 3B6MA 1ONOA 3G88A 4A9AA 4B33A 3FPSA 5EKSA 5LQDA 4HQLA 2DT5A 2WWWA 4TRNA 1FMTA 5DVZA 3BICA 3KBBA 4U00A 3PPXA 3W5BA 2X5OA 3GGOA 4LYEA 1K2VN 4Z99A 5LQSA 4TL7A 1NNSA 2CHGA 2XUAA 4J7XA 4MYUA 1JIXA 4Q9KA 3OJLA 3JU3A 3WWYA 3ZGOA 2Y1KA 2QTAA 3PGMA 1CY4A 1GGJA 1JYSA 5JSZB 4OQEA 4MVWA 5ECDA 3GLGA 4B83A 4OB7A 3NHJA 4GEGA 2I78A 4HAIA 1I1HA 1YDWA 2DSTA 2DWQA 3O90A 3L2OB 1HQDA 1DC8A 1JKJA 5TQ0A 2W2NA 1A9XB 2PT7A 2VK2A 2VVTA 1KI6B 3FDXA 1E2KA 1QOPB 3MQ2A 5KOJB 1KO5A 2VPIA 3QOYA 2V7BA 2Z57A 4JJ8A 4KMMA 4WIAA 1NJ8A 2VEOA 4WY2A 4PG8A 1RMYA 5F98A 2CYBA 3OZAA 1Y6RA 4Q0MA 4QGBA 2GXUA 2O5CA 1OLXB 4C7XA 4RD4A 3PT9A 1NRJB 1C7RA 3BD9A 3H5TA 3LUDA 4N8SA 4K9LA 4C06A 5T3YA 1NXPA 3TSYA 1U4SA 2ZYTX 3BWDD 3PXAA 3V7WA 4MULA 2VRCD 2H4ZA 2WLSA 3AF2A 3D8UA 1NW5A 4AS3A 5K99A 2GBLA 1RAAA 2XVYA 3CX6A 1OI3A 3E18A 1E6MA 1QV6A 1M0WA 1PGOA 1QSGA 2AOTA 1D8TA 1ODIA 2A5YB 2NXCA 1DARA 2FW1A 3N3BC 3PSHA 2X3UA 3ASVA 5EIWA 4HPJB 5BWOA 4IZOA 1ABBA 1G64A 3K6JA 1V45E 2XMDA 3IUPA 2G9UA 5NULA 3RVMA 4F3CA 2IPLA 3RUHA 5DX8A 1KETA 2C8LA 3PE6A 1L8AA 4M8IA 2C9OA 2VBGA 3SGLA 1SVWA 3NHPA 4P36A 5BSGA 2VP9A 1XRRA 2W6OA 1VLJA 1HG0A 4QT0A 3ELUA 2EJCA 1DPFA 5A03A 1OX4B 5BQOA 3RFFA 5BQFA 4BNJA 3O1IC 5FWDA 1EDEA 5COQA 1X80A 5TEVA 3WDSA 3NNDA 1E1DA 2AE1A 1EJBA 1FXWA 1URPA 1YQQA 4RQBA 4UEOA 1EP2B 5HZKA 5TT1A 2ILVA 1WZEA 2AL7A 3W05A 2JI7A 4UFNA 3ENZA 3LCMA 1IU9A 2B37A 4LMRA 2H1OA 1I3CA 3VSCA 2G82A 1YJXA 2QZPA 3MELA 2ES4A 3MBOA 2FZCA 4IICA 1KSGA 4K6GA 5JLAA 1FRVA 4GEKA 4U7PB 3NLLA 4RTOA 1P0CA 3TKAA 4UPVA 9ATCA 2ZXEA 3OUUA 2I4LA 4QELA 1MW9X 4DLLA 1JECA 1RCFA 5E1BA 1NOIA 3DMFA 4GLJA 2I6XA 5DSTA 1Y3HA 2V0GA 1O94D 4M83A 2IDJA 4AMBA 1X74A 3R74A 3BJMA 1F2UB 3GRCA 3MJEA 1E1KA 3AJDA 4KAFA 3SZGA 3IP9A 3F9RA 2R7KA 2CNBA 2IZ5A 1DMRA 1P2DA 2F3QA 3M6VA 4PCUA 4ZQEA 3U4DA 1CQJA 1ZM4A 3U09A 4HDMA 1CVIA 2V8OA 5D3KA 5CDGA 4LGVA 1X8KA 3OEYA 2EXXA 3DP7A 5DKFA 1PL0A 5FHQA 3LOUA 4CN9A 2WQ7A 3NUZA 1O94C 2I8LA 3ZE6A 4E14A 4FGKA 4E1BA 1QUEA 3PXCX 4PAQA 2FOIA 1E6WA 4DJDC 4YP1A 3TM4A 2GHQA 4EX7A 4CCYA 2H8GA 1QCCA 2JFVA 2Q6KA 1Z0FA 4TUYA 2QAIA 1S9DA 2JFWA 3IS3A 4TT3A 1O03A 2ODEA 4ZPXA 2Q9AA 2CJXA 2QAGA 1N78A 4OIMA 3GCDA 2HWYA