4WCFC

Trypanosoma brucei ptr1 in complex with inhibitor 9
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
267
structure length
244
Chain Sequence
b'EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVKTVETQVAELIGTNAIAPFLLTMSFAQRQNLSIVNLCDAMVDQPMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pteridine reductase
molecule tags Oxidoreductase
source organism Trypanosoma brucei brucei
publication title Exploiting the 2-Amino-1,3,4-thiadiazole Scaffold To Inhibit Trypanosoma brucei Pteridine Reductase in Support of Early-Stage Drug Discovery.
pubmed doi rcsb
total genus 89
structure length 244
sequence length 267
ec nomenclature
pdb deposition date 2014-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4wcfC00
1P1IA 5J23A 2VHZA 4BO4A 4HKTA 1RYDA 4PN3A 1OFGA 3DAPA 3ETGA 3SC6A 1YL5A 3RJ5A 5JNLA 3D5QA 4HUJA 4W99A 2AE2A 4R4JA 4YJFB 3GH3A 2FY8A 1GR0A 2VOEA 4P4NA 5TF4A 1PZFA 1ZXBA 2BFPA 3RKRA 4BV8A 3EMKA 3A28A 1U7HA 3MJSA 5ER6A 2JD1A 4I1IA 5T6BA 5DP1A 2FOIA 2CFCA 2QRLA 5DF1A 1R0LA 3VH4A 1NXQA 1GADO 1TVEA 3E1KA 4IM7A 4IZIA 3GN1A 3SXPA 4PCVA 5L7WA 3WJ7A 2Z5LA 3RWBA 3NKLA 4I5DA 3VZSA 1BXKA 4FFNA 5AXAA 3IJRA 1KC3A 5ES3A 2O4CA 3LT0A 3LDHA 3TFQA 1RWBA 4QECA 1LDMA 2Q45A 1WNTA 4WOKA 4FJ0A 2FSVA 4K26A 5AXBA 5FEUA 2X5OA 4WEOA 4EGFA 2C5EA 3UF0A 2YFQA 4WKGA 4D46A 3PI7A 2PNFA 1MV8A 2IZZA 1T24A 1NWCA 5TRTA 1N8KA 2C54A 4RORA 3RUCA 1PL7A 1EDZA 3VZQA 3BTOA 3NTRA 4NI5A 4ALJA 3RFVA 4JP2A 1PJTA 3D4PA 4BB5A 2OHXA 2OO5A 3IJPA 3PQEA 3RUEA 3P2YA 4E0BA 1GUFA 5K9ZA 4DUPA 4LVCA 4HNHA 2HK9A 3WXBA 2EG9A 3GNQA 1MFPA 4RZIA 2NQTA 4CLDA 3FNFA 3ZNPA 4GX1A 4BNKA 4KUEA 5CP8A 1TT5B 3RU9A 1YVEI 4BNFA 2Q2QA 4Z6KA 1Y9EA 3JQFC 1S7CA 1GUYA 3L6DA 2O3RA 5DCUA 2RHRA 3CE6A 9LDTA 2X1HA 2GZ1A 4II3A 1XLTA 1X1TA 3CSDA 5ENDA 1PJBA 1L1FA 3W8DA 3NV9A 2YHIB 1HF3A 1PWXA 4J0EA 2AQ8A 4MVJP 5L40A 3IIEA 3GY0A 1BDMA 1EUDA 1OAAA 3HFSA 1SNYA 2BFMA 3MEQA 3OJLA 3Q9UA 2GR9A 3DBHB 3U49A 1C1DB 1J4AA 2Q1WA 4FC6A 4IPTA 4U0JA 3RI3A 4FJ2A 2VT2A 4AJHA 1Z73A 2GZ2A 5DN9A 2VHYA 3TWOA 4A10A 1IULA 4II2A 3X2FA 4RZHA 1JTVA 4IDAA 3WYBA 5TIIA 1SEPA 2OMEA 3A4VA 5BSGA 2Z1NA 1ENOA 3JQ7A 4FBGA 4Q3CA 3UKOA 3GRPA 1P0FA 3MTJA 5KCZA 2Q1UA 4OO3A 4CM4A 1PL8A 1UXIA 2QZ9A 5L53A 3I4FA 1UZLA 3L9WA 4R5HA 2ZKLA 2O3TA 1RKXA 2HAEA 4U6QA 3L9XA 3JQBC 4XD2A 1V8BA 4ZU3A 3CKYA 4R01A 3PGJA 1HL3A 3EZYA 3KEQA 3VPFA 2DC1A 5CEEA 5U9CA 3KV3O 4E5NA 5HBRA 2EKPA 3DZIA 4L74A 2I66A 5JAQA 2YV1A 3JQ7B 3Q1LA 5CFZA 3UVEA 2JCXA 4DLLA 2DLDA 4NK4A 1I2CA 4DLBA 3T7CA 3DQPA 1P74A 1V6AA 2NLOA 3KBOA 3F1LA 3HFGA 3EVNA 1OOEA 1LA2A 1IB6A 4RGBA 3MZ0A 4YAEA 3WSVA 2ZB8A 5A1TA 4URFA 4GGPA 5IZCA 5TC4A 3H9UA 2B0JA 3UFXA 4HWKA 1H93A 1U7TA 3UW3A 5G0UA 3HB4X 4J1QA 1C1XA 1IOLA 4JJFA 1DIHA 3T7EA 5CG1A 5L7TA 3DHYA 3DOCA 2Q1TA 4PLVA 2CVZA 1J49A 3GFGA 2HSDA 5B1YA 3ZV6A 5HM8A 1PGOA 2VTDA 1P77A 1DC4A 1TA4A 2RH8A 3C8MA 1C0IA 1QR6A 3PYLA 3K6JA 3KLPX 4NJMB 3JQ9C 3H65A 4E5YA 3C7DB 1OC2A 4ZN6A 2EEZA 2X0JA 2FPGA 4FFPA 1NPYA 3CUKA 5COBA 4LW8A 2HK7A 3JQEA 4CUKA 4Q3BA 2P4HX 4WK6A 1MG5A 5JCXA 1OZAA 3NAQA 3OF2A 3QJ5A 4I9UA 4GX2A 4MKZA 1N7GA 1FDWA 3V2GA 3WGOA 4GAEA 2GLXA 1I3KA 1CETA 3RROA 3E5RA 4NBRA 4CLEA 5KWEA 2I6TA 3N58A 3MCVA 3PJEA 3DZHA 4PG8A 5JAIA 1PGJA 2O3UA 5ITVA 2FN7A 5MDHA 2WYUA 2NNLD 2ZYAA 3ST7A 1ID1A 4FS3A 4A26A 3DBLA 3RC9A 1R12A 5C3MA 4BO1A 5THKA 2ZB7A 2JCVA 1E3IA 3P5SA 1GD1O 2CVQA 1BXZA 4YRDA 2EW8A 4ZQBA 3G49A 3TJRA 5KKCA 3GMSA 5FI3A 4R9RA 1X0VA 3M2PA 4AJ2A 4J9VA 4ZHSA 5ADHA 1WDLA 2YFHA 1ZUD1 2JJYA 1LXCA 3U4CA 3H5RA 2PKQP 1OMOA 4AJIA 1PZHA 1MGOA 4BO5A 2WD7B 1P45A 1YB1A 3L0DA 1WVGA 4MDHA 1GYQA 1UP7A 1H2HA 2FPIA 2NU7A 2H5LA 1U3UA 1GEEA 2PTGA 1E6UA 3AU8A 3K92A 1HDZA 2Y1EA 3FBTA 4K1LA 1H6DA 5GZ3A 5T57A 3UN1A 1EDOA 1IHXA 2FPPA 1NASA 1DIGA 3EK2A 3K5PA 4KUGA 4OXNA 4RDHA 4PG4A 5BNTA 4CMGA 2GN8A 1PX0A 4DC1A 3OHSX 3D3WB 1HWYA 3F47A 4YJFA 4FOSA 1FDTA 4Q39A 1O95A 3WTBA 1E1MA 2X86A 1PZEA 1W8DA 3JQAD 2POQX 4JLWA 1E7YA 3BMQA 1ZK0A 4R41A 2EWMA 3IC5A 5GMOA 3AM5A 1E92A 1K6IA 4LN1A 3KSZO 3F5QA 2R00A 4TRNA 3FBGA 2BGKA 4M8SA 4DQXA 4NJOA 3WGQA 3NT5A 1Z75A 1K89A 1R16A 1I3LA 2C7GA 5C7IO 2YHIA 1PEDA 3ICPA 5U4QA 3BHJA 4XDZA 2OFPA 3B1KA 4CM7A 3PFFA 4JJIA 4IMPA 3D5TA 3P7MA 3RBXA 4ND5A 4O5OA 2D5AA 3ZU4A 2O3QA 2TMGA 4CLOB 4W9NA 3KYCB 5F3RA 1A7AA 2O3JA 2FWMX 2D59A 3U5TA 2D1YA 1CRWG 2VZ8A 1GAEO 4DL9A 3IS3A 4A03A 3KHUA 4PGFA 2O7SA 4B7CA 1Z82A 4XYLA 2QQ5A 4WCFA 2B35A 4J7CA 1FK8A 3F9IA 4DRYA 4J49A 1UAYA 4DIOA 2HJRA 5ICSA 2X4GA 2ZJ1A 1AHIA 4G2NA 1PJ2A 2HMSA 2WD7A 4MP6A 1XHLA 4GX5A 1NQOA 4YACA 2DTXA 3P19A 3RSHA 4E13A 1GQQA 2IYOA 2OZPA 5BSFA 1GFSA 5CDYA 1DRVA 1OC4A 2AE1A 4D3SA 3GHHA 1V0JA 4OYRA 2W2KB 3WGZA 1Y8RA 1U5AA 4J9UE 2X22A 1DOHA 3B70A 1UXHA 1NFFA 2H6EA 4CQLB 5JDIA 1U28A 4KMSA 1J5PA 3WQRA 4GBJA 2VNAA 1ULUA 1JW9B 3GGPA 4LVUA 3PZRA 4C7KA 2PV7A 2VN8A 4YXFA 3SLGA 3AU9A 4N7RA 2ZTUA 2FZEA 3HWRA 3OA0A 4YEDA 1B16A 3ZHBA 3UOGA 4LMRA 4UUMA 2RAFA 2C2XA 3TZHA 5DOVA 1E7WA 1WDMA 2EERA 2EHDA 3JQAB 1C0PA 4ILKA 4BGUA 4QSMA 3H9EO 3H9QA 5BNIA 2JFGA 1PJSA 4K6CA 2EW2A 7MDHA 3EDMA 3VVBA 3ZWWA 1HLDA 4YCAA 3JQ6A 4L8VA 2CUKA 3DONA 3V1YA 3TZCA 3FNEA 3TL3A 2A35A 1V3VA 3DZKA 5K6AA 2WTBA 3QRWA 1H6CA 3D3WA 1JAYA 4MO2A 1RM3A 3ONEA 3S2FA 1O9BA 1XYGA 3PDUA 1DB3A 1ADBA 1JWBB 3RU7A 1PGPA 2WE8A 1QLHA 4CMHA 4YRBA 3FNGA 2EJVA 1GV1A 1W73A 2PWZA 1NM5A 1PJ3A 1DO8A 3GAZA 4INAA 3GZNA 2FP4A 4OKNA 5BSHA 1Z6ZA 3AOEA 4LMPA 3SC4A 5JSFA 2BD0A 3LC7O 1KERA 1QMGA 2X0IA 4U5QA 1LSOA 2W8ZA 2W2LD 1X0XA 1T4BA 1XSEA 1BMDA 1PR9A 1Q7BA 3T4EA 3KSDO 2ZB3A 4XCVA 1FDVA 4QFDA 5JYDA 1Z7EA 2DTDA 3X2EA 1JDJA 4JBHA 1YQDA 1GYRA 4DVJA 4CMJA 1UXJA 5IDQA 3PGXA 4MKRA 4GKVA 1E3WA 3ZWNA 3GVHA 3HE3A 1QV7A 1O89A 1IE3A 1DLJA 1NHGA 3W1VA 4R1TA 1QRRA 2O3SA 2EP5A 4IZHA 3SEFA 3TOXA 3FN4A 5JDIC 1YQGA 3FWZA 4Z9FA 3KM0A 5JY1A 1ORRA 1LTHR 1UJMA 4HFNA 1DAOA 2C20A 1GQYA 4HADA 4Y6PA 1NR7A 2P5YA 3JCZA 4MVJA 4BIIA 1B8VA 1LRJA 5CDUA 4AJOA 3JQDA 3OJEA 5H81A 1U8FO 3VTZA 2C07A 4IUYA 1XU9A 3MJTA 4E31A 3CINA 2GGSA 2O2YA 3ENKA 1NYTA 3EW7A 2ZQYA 4Y98A 4B4OA 2HKIA 4JX8A 4ZD6A 3WGYA 2CDAA 1T2DA 1LDEA 3VPGA 3DHEA 2X23A 3KEOA 4L9RA 3AFMA 3HDQA 1B3RA 1CJCA 4OXKA 4QT0A 1GZ4A 3OSUA 4NBTA 3GPIA 3N74A 1O8CA 4AJPA 1UH5A 4YT8A 3OQ6A 5BT9A 1K6XA 1YQXA 3U62A 3MWEB 3NX4A 2BKAA 2DKNA 3EUWA 1BSVA 6LDHA 1F0YA 5IDXA 2BF7A 4IGFA 3ZHXA 1TT5A 3HB5X 2V7PA 3AY6A 4NK5A 4P4GA 2ZK7A 1P3DA 2BGLA 3TQHA 3SJ7A 3UGKA 3TZ6A 4BNMA 1B14A 1PJLA 2HRZA 3S8MA 4BNWA 4FD3A 4E12A 2VYVA 2WMDA 2CF5A 4TRJA 2B4QA 3JYQA 5IAAA 5EPOA 2D2IA 4GI2A 2DAPA 4YQZA 4O63O 3QE3A 3PWKA 3BMOB 1NFRA 1CDOA 4NFYA 3RBZA 5L9AA 1EVZA 2VZ0A 3ZWYA 3DAGA 3ZNNA 2GNAA 3HN2A 1E3WB 1YJQA 4FW8A 5KJEA 3NEPX 4ZQHA 1K3TA 1KS9A 1EQ2A 1X7GA 2FHSA 2B4TO 3GT0A 4KUHA 3M1AA 4RPGA 4L75A 3WICA 4IQGA 4U8GA 1E6EA 3TN7A 1EVIA 4E5KA 5CG2A 3AJRA 3AY3A 1C1DA 1U8XX 3AFNA 1H2BA 1HE4A 1UDAA 3I23A 4EJ6A 1DC6A 1XA0A 1E6WA 3FF4A 2ZYDA 3GZNB 3TZKA 2JD0A 1NVGA 1SAYA 4FB5A 1NX6A 3O4RA 2ILTA 2O4UX 3OJOA 5A3JA 3OICA 2QX7A 3OIGA 2PKRA 3JD0A 4OOEA 1DHRA 2EP7A 4NBUA 3BYZA 1R4MA 2DBRA 3CMMA 1JAXA 2EF1A 2Y0CA 3ZCXA 4BVAA 1DAPA 1ZSYA 4J6FA 4IIUA 3PFWO 2G82A 4I5EA 3V5NA 3OMLA 2VRCD 4I9HA 4CM8B 4D43A 3DR3A 4CM3A 4XR9A 4LCEA 3PK0A 4YBZA 4DMMA 2OBNA 2XXJA 2GCGA 2YUTA 3K2BA 3V2UA 3JQAA 1SC6A 3VH2A 3RFTA 3ASUA 5DCWA 5DULA 1YBVA 5ICMA 4KP7A 3ZV4A 2Y0EA 3OP4A 1LRKA 3GEGA 3Q2KA 1JKIA 1J6UA 1V35A 4PZEA 4WLNA 5LDGA 4J3FA 5TX7A 3INGA 5BNFA 1RM4A 3JTMA 5CDSA 4D3DA 1TXGA 4XYGA 2Y1OA 5I7SA 3O8QB 3V2HA 4KDEA 4L4RA 1R37A 2NVUA 1N92A 3W6ZA 4R1SA 4ALMA 2J3JA 3NDJA 2P9GA 1HDGO 1MA0A 1UXGA 3BMOA 1X14A 3H5NA 3U4IA 5IZCC 4IDEA 1KY5A 2XF8A 5A05A 2O23A 4W6ZA 1G0OA 2BFOA 1IYZA 4B7UA 1KEUA 5GZ6A 4MOWA 4L73A 5I7VA 4Q3AA 3ABIA 5I7FA 5TNXA 1NBOA 3WGHA 4J90A 3VTFA 1UR5A 4DIFA 4J16A 1RM5A 3RC2A 2AMFA 3ONDA 2LDBA 2X5KO 3RC7A 2DFVA 3W4JA 3MOGA 4B3IA 4M89A 2CD9A 3RVDA 2QYSA 5JO9A 2B69A 2PY6A 4R1NA 1B15A 2CY0A 3KUXA 4IS3A 3ZDFA 5JS6A 3IMFA 2JL1A 3NRCA 4IS2A 5CDGA 1KVUA 3K96A 2PKQO 4WCFC 3ZWVA 4YDRA 4CMAA 3I9NA 2JHGA 3K9QO 2Q3EA 5A03A 3IUPA 2VHXA 4ZQGA 3GAFA 1D3AA 1Y5RA 2DTEA 3E82A 4MJLA 4YYZA 1AN9A 3VPXA 5DBIA 4DLAA 4OOFA 5KIAA 3IKTA 1EUCA 3DZGA 1C1XB 2A94A 1R66A 4OJNA 2QIOA 3CMCO 4BO9A 1UP6A 4AJKA 3JD1A 3I3OA 4A5OA 3C7CB 1WAMA 5CEJA 3GNTA 3K8ZA 3ETDA 4M49A 4PG6A 2VZ9A 4BB6A 3EC7A 3RUFA 2UYYA 2VYND 4DQUA 4EEXA 2ZJ0A 1HLPA 3CTMA 5CHEA 3HZZA 2WWRA 1B8UA 4J4HA 4MVJH 5JMPA 4FSHA 4JQCA 5F21A 1DFIA 2B4RO 2VWHA 4RVSA 3JQ8A 4XB1A 2PGDA 2BGMA 4GLOA 4MIOA 4UVEA 3BMCB 3BIOA 2I9PA 4BKRA 2HJSA 3H2SA 1NTOA 5T67A 3WQQA 4XWYA 3QSGA 4FFOA 2V6MA 4JBGA 4XQCA 2GDZA 3WFIA 8LDHA 1LJ8A 2PLAA 1QV6A 2UVDA 5FFFA 4EI2A 5IXSA 2VCYA 4D44A 3OJ0A 4CM4B 5C37A 3V1UA 3D4NA 2DT5A 3N7UA 4GMFA 4CR7A 3I5MA 1HXHA 1YDWA 1ZXLA 5I9LA 7ADHA 1XWFA 1ZJZA 2R6JA 2V6GA 3MWDB 1T1RA 1YO6A 1E7MA 3DBRA 3PDJA 4RQUA 5K0ZA 1P1FA 1FDUA 4PLZA 3QLJA 2W90A 1ZW1A 4FGSA 4GQAA 5L45A 5TJ9A 1YJ8A 4Z9YA 2VWPA 4CMIA 1HDCA 2HDHA 3DC2A 1O0SA 3H8VA 3E8XA 4UEOA 2G0TA 3GPDG 4EJMA 4R51A 2DBQA 3F3SA 1HTBA 3ZW9A 2OBYA 3OQ1A 3BMNB 1GTMA 3G3EA 3C1AA 3KYBA 3GFBA 3BA1A 2I65A 4B79A 1EBUA 1PIWA 3G0OA 3LF1A 2ZYGA 5L7YA 1U1IA 2HUNA 1R4NB 3ADPA 4AJJA 4EEZA 5IDYA 1D8AA 2C29D 3ZI0A 3QWAA 3TOZA 1LEHA 1ISHA 3EZLA 4YJHB 1DIRA 3FNHA 1G1AA 4MVJE 3VAZA 4BNIA 3TNLA 1GCOA 1G6KA 3EGOA 3L77A 3I6IA 3WG9A 3Q2IA 4ALLA 3DAFA 3VZRA 4YA6A 4CM9D 4D42A 3E18A 4ITUA 1HSOA 2J3IA 2HCTA 2UV8A 3IP1A 4DREA 2IXAA 4HY3A 1OBFO 4JROA 3OETA 5DP2A 3VPHA 2Q46A 3D0OA 1NHWA 1GEGA 1L7EA 2NTVA 3PIIA 5DBGA 3UH1A 1PU2A 3A9WA 1VJTA 2OGUA 1Y5MA 2RIRA 2ZTVA 2ZCUA 4IXWA 4NPCA 4E5MA 2HMVA 3U4HA 4J4TA 4WNCA 1I2BA 1HDXA 4D41A 4YT2A 3PEFA 3WYCA 2CZCA 2DUWA 3MJ4A 2VUUA 5GY7A 5TSDA 3R0IA 2GF2A 3UCFA 1DDOA 2ZTLA 3WTCA 2YYYA 1NNUA 4Z3DA 5HRUA 3FSRA 3ZWMA 1I8TA 4MINA 3G1UA 3WFJA 4FFLA 1E7RA 4BNNA 1EE9A 3FPLA 3B6ZA 3PYMA 3JYOA 1L7DA 2Q50A 5FI5A 2Y68A 4G65A 3GEDA 4TWRA 1VSUA 3C1OA 2X8LA 4BNYA 3PTZA 4MVJD 2Y67A 4BO0A 3HSKA 3KYDA 1Q7CA 1U4OA 3PWSA 1MC5A 5U1PA 4PLPA 1KVSA 3FWNA 4IDBA 3AUSA 4CMKA 5IXYA 3OIDA 1BW9A 1IPFA 4QFCA 4QEDA 3D1LA 1E1KA 5JXWA 3WLEA 3F6YA 2A4KA 4ROSA 3LU1A 3BMQB 4MP8A 4ZGWA 2HO5A 1K5HA 2BI8A 3H5AA 1A4UA 2JHFA 4AL4A 3V1TC 2P9CA 4O6VA 1I24A 3BZUA 1HE3A 1SOWA 4FFRA 3I4CA 4RLSA 1VKNA 1A9YA 6ADHA 1LDNA 3I9LA 4CQMB 4BGIA 3DTYA 4FN4A 4YT4A 4XR4A 2AEFA 3LYLA 3W6UA 1E1NA 3MTGA 4E5PA 4NDNE 4CV1A 4NBVA 1JN0A 3OJFA 3AI3A 1GZ3A 4D79A 5L4NA 4KZPA 1R4NA 3ROKA 3ZWAA 5A5EA 4E32A 4D0RA 4IDFA 3W4IA 4CM6A 4FFMA 3HQ4O 3HUDA 4J91A 4E6PA 3ONFA 2QRKA 3ENNA 4K28A 3JQFA 1FDSA 2I76A 5JAZA 2JAHA 1W6UA 3LT2A 5C5IA 2PH5A 3PHHA 1O5IA 4EUEA 3ZU3A 4J43A 5BSEA 2W4QA 1AUPA 3RC1A 4CV2A 3S1LA 4BKUA 3AUUA 2W2LA 3GLQA 5G0SA 2AW5A 1AHHA 4RCVA 2PZLA 4E33A 4WNIA 4YWJA 4N5MA 2FRDA 2XPCA 3V8BA 4BMSA 1LDBA 1DJQA 1ONNA 4IQ8A 2TMDA 4BNJA 2PZMA 2PD3A 1EVYA 2J5RA 5DCYA 4DIBA 1NQAO 4D45A 2IE0A 3PLRA 3ZWBA 3WYEA 2I3AA 3GOHA 3MOIA 4QQRA 4BNHA 1U3TA 4WJZA 4GKBA 4CLXA 2YW9A 5L3ZA 2NU8A 3RCBA 3ROPA 2C5AA 1NVMB 3CZMA 3DEYX 1IUKA 1MFZA 3VPSA 1ZBQA 4D3FA 4M86A 3DOOA 1I2ZA 5FF9A 4A2CA 3Q9NA 4ZQFA 1TT7A 3GZ4A 1QP8A 3LVFO 1Q2XA 1KEVA 4DA9A 4WLOA 3AI2A 1YOVB 5TLSA 4RVFA 1KY4A 4EUHA 3FI9A 1CWUA 4HX5A 4K9DA 4WLVA 5TS3A 3FR7A 5IFLA 1I36A 2IEDA 4FCCA 4XZ3A 2F00A 1SBYA 2V65A 2Y66A 1Y6JA 4XQEA 1KVQA 1ZKMA 4OGWA 1DRUA 3E9NA 2X58A 1KIFA 3W8EA 2C7VA 1E3LA 3LLSA 1G0NA 4CLRB 2Q4BA 1DSSG 3G1TA 3RIHA 1JA9A 4YAGA 5A9RA 3PHIA 2A92A 3VH1A 2J8ZA 1WDKA 4N54A 2H63A 2QYTA 4YQYA 5F5LA 5I8WA 3WX0A 5CPBA 5I7EA 4YJHA 4WGGA 4UAGA 4N18A 4IJUA 3RUIA 1ZO8A 4QXMA 4QUKA 3PJDA 3UICA 1KOLA 3GUYA 1XCBA 1PTJA 4NBWA 3WB9A 3QIVA 1IHYA 4J7XA 1LUAA 3D64A 4EJ0A 4LK3A 1ZVMA 1U3VA 2J3HA 4GGOA 4WASA 4R68A 3UUWA 3WS7A 4AJEA 2P2SA 2HU2A 1SOVA 1SB9A 1NQ5A 3S2GA 1YH3A 4DPMA 2Y1FA 5JC8A 1T25A 2XAAA 4ND3A 1MP0A 3QWHA 4FIZA 1WWKA 3I52A 1QXSA 1B26A 2PZKA 2DUUA 1DRWA 1MLDA 1ZMTA 5B4UA 1VPDA 2FR8A 1WW8A 2DM6A 4IQ0A 2P5UA 1CQIA 4WEQA 1W0CA 1KETA 1LC0A 4QTZA 1QYVA 2UDPA 1EMDA 1HYHA 1N9GA 5JPIA 4DPKA 2B36A 4TZTA 4E3ZA 4L4SA 1EQUA 3INTA 1E3EA 3ITDA 2OOSA 4J0FA 1ISGA 2C59A 2YQ4A 1MXHA 1FMCA 2F1KA 4R3NA 1X1EA 4M54A 3DMYA 3EY4A 1UZMA 3DZFA 4OMUA 2BFAA 4O0LA 2CSUA 2WSBA 4M55A 1QYDA 1KYQA 5HWSA 2OL4A 2VHWA 3WWYA 1F8GA 4BV9A 2GERA 1KEPA 4CJXA 4YR9A 4G81A 1U2GA 3LF2A 5G4LA 5B4TA 3JQGA 1LDGA 2Y93A 3Q11A 4IY1A 4P8RA 4CV3A 4BS9A 1GL3A 1RJWA 4RJTA 5EQFA 1QG6A 3FCOA 3HJAA 1VJ0A 1DBVO 4E2YA 3M2TA 4RVHA 3IAHA 1HDYA 4OSOA 3HDJA 1ZK4A 2QG4A 1ARZA 3WOHA 1KVTA 3CPSA 3S55A 3VOSA 3LC2O 1Q0QA 2VYNA 4ZRMA 4F6CA 3ADOA 4H15A 1XR3A 2A9FA 2D4AA 3F1KA 3GRKA 2I5PO 4TKLA 1KVRA 4BHTA 5JY6A 3TPCA 4RLHA 3ZV5A 1ENYA 1HKUA 1LSUA 3WBBA 2BHLA 1ZEMA 5IG2A 4XYBA 2X9NA 4B4WA 1ZK1A 1JWAB 2VNSA 3ZNQA 2DVMA 1VL6A 5L4SA 4GSLA 4ZVVA 1BWSA 2NTJA 3OA2A 4XIJA 3WBFA 4B8ZA 3ZN2A 1M6HA 1K2WA 4IINA 4KQXA 5GZ1A 3U09A 1GPDG 3OQBA 2HLPA 2BLLA 4GWGA 4TZKA 3TSCA 3TDKA 3DWFA 3PRJA 4UEJA 4GWKA 1H6BA 1HZJA 5JE8A 3UXYA 2X7HA 2GRAA 3DBVO 4BQRA 5COAA 1ISMA 1EFLA 4R69A 1SCUA 1VLLA 2OORA 4UVDA 1C0LA 2GASA 1ZCJA 3JQGB 5A9TA 3VVCA 1E1LA 4ESOA 2WYWA 4BNTA 1O6ZA 1BG6A 3JD2A 2HMWA 3PWZA 4UVHA 5JO0A 2P9EA 3PQFA 5JAMA 2BMAA 3EVTA 1M76A 1MC4A 3PVZA 4PRKA 4A73A 3PPIA 3E9MA 4EZBA 1YWGO 1ZK2A 1LC3A 1IL0A 4MIYA 1PJCA 5AXCA 1CYDA 2IYPA 2Q2VA 4AJ4A 5JDCA 1P1JA 2C2YA 3IUSA 4ND2A 1UUFA 3F5SA 5G4KA 3E03A 1AE1A 3NT4A 4EUFA 1PGNA 3RKUA 2EKLA 1ZIDA 3GR6A 4E2XA 1D1TA 2HMTA 4XQ9A 4J1SA 3A1NA 1HDOA 3GHYA 4HNGA 1UP4A 3CXRA 4J2OA 4PRLA 3K30A 3KYDB 3GF4A 3NT2A 2FSSA 1GU7A 4KTTE 2JD2A 1KBZA 1E7QA 2IDZA 4P22A 3W8FA 4IJWA 2P91A 4EBFA 4DYVA 3JYPA 4IXTA 4YAJA 4BGVA 1JQBA 2AXQA 2E6UX 2GN6A 3LSYA 4AG3A 3H9GA 1BXGB 4FPXA 1ONPA 1ZSVA 3BTSA 3QHAA 2PFGA 3I1JA 3IP3A 5JW6A 1I33A 2B37A 2AA3A 1LQUA 1IY8A 3INRA 4PG7A 2EKQA 1ISIA 2AG5A 3BXXA 4XQGA 1GV0A 1N9GB 3DB2A 3UCEA 4AJ1A 4IDGA 1QSGA 5H83A 4WE3A 1LLUA 3RASA 1VJ1A 3KB6A 3ZZNA 1BTOA 2Y0DA 2EXXA 4Q9NA 4YT5A 2Y05A 2X0RA 4NNJA 3L6OO 3KXDA 1R0KA 4WLUA 3CEAA 1DXYA 1T4DA 5AXDA 4YPOA 1WLYA 2V6BA 1B2LA 2X5JO 4NZ9A 2X9GA 3VC7A 1SZJG 1QYCA 5IJZA 5K6AC 3RUAA 3F4BA 2IZ1A 4LSMA 2NACA 4BO7A 1PJQA 5KNLA 1BGVA 1PZGA 4YJGA 3FR8A 4I9NA 1U4SA 3ZH2A 4OQYA 1WPQA 4B4VA 1K0UA 4BKQA 2VUTA 1HETA 4OHUA 5LCXA 1EEHA 5DOZA 1ZNQO 2WE7A 4DWVA 3OECA 1UAGA 4DYDA 3KO8A 1U9JA 1N1GA 2BI7A 2YQ5A 3QP9A 3PYXA 5THQA 4E30A 1YDEA 2AEJA 4YVFA 2AQIA 3H3JA 3DZJA 4Z0HO 5G0VA 4MP3A 4ALKA 4RVDA 3KZVA 1UXKA 2E37A 3DXFA 4B3HA 1D7OA 2CDBA 2NU6A 1PS0A 1U5CA 1DFHA 3UCXA 3PHJA 4BO2A 4XX0A 4I5GA 1O94A 3NYWA 5ILOA 4YTEA 4NQZA 3QY9A 1DHTA 2ZB4A 4NIMA 1LLDA 3C3XA 4FJ1A 2X6TA 5TT0A 4XEHA 2NWQA 3B20A 1LU9A 3WGGA 3NTQA 3WNQA 2IZ0A 3OH8A 4DQVA 1ADFA 3DBRB 5ITWA 3GG2A 3K31A 2O7QA 1H94A 1HZZA 1MG0A 4R9SA 2VTEA 4YJGB 4UUNA 2JAPA 4OIMA 4NG5A 1OI7A 4XJTA 1PQUA 4OQZA 4YAKA 1M67A 1V9LA 1VKOA 5T8KA 1IZ0A 4CMBA 2WD8A 4Z0PA 1NVTA 4LCJA 1I3NA 1FXSA 3OIFA 4S3MA 2NUAA 4C4OA 1LRLA 4JXKA 3IDSA 1F8FA 4R5MA 1YKFA 4CMEC 1E3JA 1P1KA 5KKAA 3D7LA 2GUGA 3FPCA 4NH4A 4KTVE 2D5CA 4LSWA 1Q7GA 1GCUA 3CIFA 2QRJA 2ZIZA 3K73O 3WQSB 4ALNA 2Q1SA 2Y1DA 3Q3CA 5IDWA 2HRBA 4ZA2A 4B3JA 1PS9A 1X7DA 5F1OA 5AOVA 1W4ZA 3NDRA 4LRSB 4CQMA 3MJCA 2B83A 1QYWA 4KDFA 2IODA 2PH3A 4E2ZA 2I3GA 4J1NA 5IZ4A 3WJAA 3IQDB 1QORA 3AUTA 1BXGA 1M66A 1I32A 3AI1A 3PHGA 3H9JA 4UREA 3AOGA 3WMWA 4CPDA 3U0BA 1N7HA 4KOAA 1ADGA 1VM6A 5COQA 4JIGA 3MJEA 3C24A 4CMCA 2BELA 1JU9A 2YV3A 2Z95A 1DIBA 5LC1A 2ZATA 1A9ZA 1F12A 1BVUA 2PD4A 5JCJA 4BMVA 4I5FA 4G5HA 4Z0TA 4KQWA 3KRTA 5F1KA 3JD3A 1GZ6A 1U3WA 2JFHA 1U2DA 3FHLA 3I9KA 4I08A 4B7XA 4QO8A 4R1UA 1RM0A 5JYEA 5EERA 5KVVA 1ISFA 1TI7A 1EBFA 4XDYA 1Y8QA 3QV1A 5G0TA 4BNGA 1VE9A 4IBOA 4WPGA 3QVSA 4OKIA 1D1SA 1WZIA 4MIEA 1JVSA 4JBIA 4UUOA 4Y67A 2YZ7A 4FC7A 2VUSA 4A0SA 4EDFA 3LC1O 1M2WA 3DO5A 4GVXA 4PFJA 5EN4A 3E9QA 4YAIA 2PGLA 3DMTC 4XGNA 5JMWA 3RJ9A 5T5QA 3OEYA 3RUDA 4KWHA 3WMXA 4C7JA 4NR0A 1VI2A 4CR6A 3SVTA 1PR3A 3JYLA 4JGBA 3NGLA 1WZEA 4RPHA 4AVYA 3PXXA 1AXEA 3AOEC 5KTKA 1PL6A 3NGXA 3RD5A 1XQ1A 2W2KA 1DC5A 4DBVO 3OFSA 1MX3A 4JJGA 2NVUB 1I10A 3ETEA 4GVLA 1YS4A 1DEHA 4CUJA 4XB2A 3VDQA 5I8ZA 3HNPA 3DBLB 2JKVA 3L4BA 2C0CA 2IXBA 4ZQEA 3WGIA 4MVJF 1TEHA 5HS6A 5KVQA 4GSKA 4Y6SA 5A04A 1E77A 1TLTA 1CQJA 4F6LA 1HEUA 4IMRA 3JQ9A 4DBZA 5L4LA 1QYXA 4CMEA 3L6EA 4W7HA 4UEKA 1Z45A 4HXYA 3ZWCA 1ISJA 2YV2A 4CM9A 1P31A 5HTOA 1P0CA 4TVBA 1PGQA 4S1VA 4EW6A 4D0SA 4P4LA 4GPD1 2G17A 4KWIA 2NTNA 4CL8A 3TRIA 4BOYA 1ZK3A 3LT4A 5DZSA 3WWZA 4BKOA 3IL2A 3QVTA 1LI4A 4OSPA 1BHSA 4PLWA 3BHMA 5CPFA 1YRLA 3ON5A 4XIYA 1YL6A 3GMDA 4L76A 4R16A 4MKXA 3K2EA 1A71A 4BQPA 1GUZA 4IDCA 2EGHA 3ZU5A 3CZRA 4BNLA 5JCJD 2Y1CA 3PIDA 4BGEA 3PHLA 5ILGA 3HN7A 3S2IA 3L07A 5CAEA 1TB4A 3SBOA 4F46A 1HYEA 3JQBA 4AJNA 4I8XA 1E7SA 3HADA 3FD8A 2CNBA 4CLHA 4HP8A 4XGIA 1V3TA 5A5FA 5C7LO 5IF3A 1PSDA 2B5VA 3A06A 1DC3A 3NJ8A 3RAJA 3GDOA 5DNAA 1I30A 2R2GA 1NAHA 2FZWA 1AGNA 2FMUA 4W9NC 4J1TA 4CM1A 2GN4A 3ORFA 5AQ1A 1F17A 2GO1A 1X15A 3R3SA 1DLIA 4K6FA 5A9SB 2QZZA 2VOJA 1T1SA 4X54A 1NAIA 2EV9A 5F5NA 1BW9B 2YY7A 1XDWA 4TRMA 1NWHA 3L4BC 4IIVA 5T64A 3ZWOA 1ZZEA 1Q0LA 2R00C 2RH4A 4ND4A 1CEQA 1KEWA 5H82A 2CF6A 3O03A 2UAGA 1MXFA 1D4FA 3CH6A 1F06A 3SX2A 3RBVA 3ZWXA 5KJ1A 4AFNA 2EIHA 4JN6B 4AJLA 2J3KA 4WOJA 4RQTA 1H9AA 3T4XA 2WEKA 2G76A 2DFDA 5TT1A 2E4AA 1XKQA 2P68A 3G79A 2AEMA 3ASVA 4NU5A 1T2EA 4PLGA 1LSSA 2C82A 1I0ZA 4PVCA 2YDYA 5A06A 2NSDA 4OXYA 4E2WA 1Y8QB 1IPEA 4AICA 4BNZA 4UVIA 3DMTA 4RF3A 2VT3A 2DBVO 3QVOA 2FR1A 3ZHZA 4CM5A 1Q0HA 3KETA 2VYVD 2CMDA 3Q0EA 4RVGA 5EESA 1J0XO 3TL2A 1A4IA 4M87A 5JFOA 1I5RA 3WLFA 3ZNOA 5I9MA 4RV9A 4W4TA 5TJHA 2RCYA 1N1EA 1EK5A 2EJWA 5G0WA 3AUAA 3WSWA 1CIVA 1P1RA 5F1PA 4Y6RA 4O59O 2VRBA 4B8WA 3ZGYA 3JV7A 2QHXA 3FTPA 4L0QA 1EK6A 2HQ1A 3E6AA 1R0SA 1YXMA 3GEMA 1ULSA 2D8AA 2XOXA 1F14A 2SCUA 3B1FA 4H16A 2PGJA 3DFZA 2DU8A 4A27A 1IZ9A 5FWNA 4RVUA 2HK8A 1H5QA 1GY8A 2WJPA 1P33A 5A9SA 1H6AA 2ZTMA 4PLYA 2O48X 4FQ8A 2G5CA 3ZW8A 5KOIA 4BNUA 3GVIA 1XIVA 2ZQZA 3I9MA 3LZ6A 4PLHA 3G17A 2VWGA 1NR1A 3BMNA 4YRAA 4JK3A 2PA3A 2NV6A 4UULA 3JD4A 3NTOA 4TMFA 5JC1A 2GD1O 4OL9A 4Q3EA 3PLNA 3ROMA 4WCFB 3GQVA 4F3YA 3H2ZA 1PJ4A 1C14A 4QO7A 3BTUA 4NHEA 2NU9A 1BDBA 2WM3A 4O1MA 3U4DA 3VH3A 9LDBA 3HG7A 1BVRA 3C85A 4XYEA 3AWDA 5T8KC 2AHRA 4CLOA 3VHRA 1SB8A 2GZ3A 1R4MB 1C3VA 4GLLA 3O8QA 1DIAA 2IRWA 3TZQA 3SJUA 3QWBA 4PLFA 3PZBA 1MB4A 4XYMA 5KVCA 4HV4A 4FR5A 1RPNA 5CEFA 4MVJM 4EITA 1B7GO 3DBHA 3ANLA 2YJZA 4DC0A 3L4SO 3R6DA 1XELA 3VDRA 4E21A 4PLCA 3TFOA 4BO8A 2CVOA 2VWQA 2NQ8A 1GQ2A 3GVPA 5EINA 1ONOA 1XU7A 4RPJA 3WIDA 1PWZA 1YBMA 2WDZA 5DBFA 5MGBA 5KJCA 3E5MA 1B3BA 2PZJA 3BHIA 3ANMA 1P1HA 1NPTO 1ZSNA 1B8PA 2E49A 4ND1A 4LISA 3KLMX 4RF5A 3RFXA 2D3TA 1YOVA 4L4XA 4PLTA 3AK4A 3W4KA 5B4VA 1AXGA 1P44A 2DBZA 5CDTA 3A14A 4OM8A 1JVBA 1HSZA 3QVWA 4WUVA 1GDHA 5KJ6A 4J4BA 1SEVA 4XA8A 2J5QA 2H1SA 2AQHA 4TVOA 2XXBA 4TKMA 3MJVA 1VL0A 1YGYA 5EL0A 3UAGA 1NP3A 3EHEA 3ULKA 1K6JA 4XGKA 3GDGA 4NFHA 2J6IA 1EUZA 4Z3KA 3R3JA 8ADHA 4IGEA 2DPHA 4MVJG 1MUUA 1X13A 3RQSA 3QWFA 4TSKA 4F45A 4RL6A 1Z7BA 1UDCA 4FOOA 3WR5A 1N2SA 3DDNA 3WDSA 1I3MA 4P38A 5AVOA 3ZHYA 4IDDA 4H3VA 3M6IA 3LK7A 5A4DA 2OXIA 2UUOA 5B37A 3KYCA 1T2CA 4FDAA 5JLAA 4XRGA 4RDIA 3O38A 1S6YA 4NMHA 4M1QA 3GUCA 3HHPA 3NJ4A 3LLVA 3PJGA 1WXDA 5AYVA 5KJFA 5BQFA 2Q2WA 3OM9A 2E48A 2QW8A 3PJFA 3I9OA 4CL3A 3OBBA 3D4OA 3F4LA 2AQKA 3F46A 4DGSA 3LT1A 3U9LA 2Q4EA 2VQ3A 1LDYA 3SLKA 4RF4A 3WGTA 1YBAA 4YB8A 1SMKA 3BAZA 3U3XA 4JCOA 1DPGA 2NVWA 4Q3DA 1H9BA 3ITKA 1M75A 1ENZA 3BTVA 1V3UA 3JYNA 1GPJA 4NFSA 1YB5A 3TF5A 2V6FA 4XJSA 1XG5A 3WIEA 1WMBA 3D3EA 5G4KB 2EGGA 3AM4A 4BUCA 3EAGA 3GNSA 4J7UA 3DZBA 1CERA 4DTIA 3GN2A 5HS4A 1YONA 4GL4A 3VKUA 1NPDA 3H7AA 5DDIP 2VHVA 1HRDA 2I99A 5FYDA 2VRCA 4TRRA 3DTTA 4BMNA 4CR8A 2YHUA 1T26A 4Y8VA 2IEBA 5EJ2A 4BL5A 5A3VA 1PQPA 5JDCC 1KC1A 3KVOA 1SPXA 4A7PA 2P4QA 3KTDA 4U0KA 3I6QA 4OH1A 4CM8A 2Q99A 3PP8A 4B4UA 1DFGA 4UVGA 1ML3A 2PR2A 2Z1MA 1FJHA 3UHAA 4BO6A 3I83A 4TQGA 3GK3A 2GPTA 4ZICA 4CUZA 4D7AA 1LLQA 4DPLA 1PQWA 4FGWA 4ONEA 4XKJA 5BR7A 4XRRA 1JKJA 1NFQA 3H4VA 3ROQA 4ALIA 4BNXA 2Y1GA 5DT9A 2DQ4A 4CV0A 3JQCA 3R1IA 4U6SA 1A7KA 2JCYA 1P9LA 2NM0A 1E5LA 5IN5A 2PD6A 1M6WA 1ZMOA 3VZPA 2NVBA 1YB4A 4WLEA 3QWIA 4GMGA 1CF2O 3GVCA 4BNVA 5B12A 3AW9A 4R3WA 5ER9A 3PQDA 3KOUA 3LQFA 1E3SA 5EIOA 1E0DA 3QA9A 5C7OO 2RHCA 1EVJA 2I67A 4RF2A 1ENPA 5L51A 5L95A 2X0NA 2B5WA 1T2FA 2UUPA 1LLCA 4WLFA 1A27A 1JKFA 3IOYA 4HFRA 4PVDA 5G2OA 3GGGA 1B0AA 4NJMA 3DHNA 4NU6A 2W98A 3IKVA 4PG5A 2Q49A 5EMHA 3AY7A 4CLRA 1GYPA 4MPDA 1X7HA 4Z9XA 1XGKA 4PZCA 4PIVA 4WECA 1R6DA 3COSA 4PZDA 1ZFNA 2BH9A 4HBGA 1YE3A 5LDHA 3B1JA 3O9ZA 5TGDA 1HDRA 2CDCA 1EFKA 3JQ8B 3HDHA 1HYGA 2HMUA 4TROA 4BKPA 4UUPA 1UDBA 2GSDA 1R15A 3QVXA 1LQTA 4CQLA 1Q1NA 3GVXA 4HFMA 1ZEJA 2LDXA 3GG9A 1LSJA 3ZU2A 3FRJA 3GDFA 4E4YA 1VC2A 1Y1PA 2OP0A 3NUGA 3ICCA 4ID9A 1EZ4A 2O2SA 1FF9A 1JLLA 3P2OA 3ZV3A 4JP3A 2X9VA 4LRTB 1VL8A 3VKVA 2O50A 4HFJA 4ZRNA 2AG8A 4RPKA 1WP4A 1RYEA 4YJDA 4OAQA 4J2HA 2OP1A 3C7AA 2WYVA 1A5ZA 5A02A 3QW2A 5EQDA 4MVJI 1QKIA 2ET6A 1EE2A 2G1UA 4N5NA 1I01A 1LBEA 4Y9DA 5JBIA 1WMAA 4CMIB 3FTNA 5HA5A 4WCDA 4DXHA 4QX6A 1Y8RB 1PS8A 4Q3NA 4IJKA 4JNKA 2E82A 4U7WA 3E48A 4RPLA 1C0KA 2H9IA 5KVSA 3EYWA 3ANNA 2DPGA 4EYEA 3WNVA 1QLJA 2OUIA 1XQ6A 4H7PA 3STHA 2FR0A 4CODB 4RO0A 1HT0A 5TQVA 3GGOA 3Q6IA 5ENVA 1VRWA 1SO8A 1BRMA 4DMLA 4CQMD 3H3FA 3HDYA 3O26A 1NQTA 3M1LA 3QQPA 1DJNA 4LGVA 2PK3A 3NDIA 1HE5A 1ZH8A 2BRUA 1ADCA 1H0KA 5IN4A 1HE2A 1LX6A 3BMCA 4GX0A 1Y7TA 1XEAA 3GC6A 3GA0A 1Y81A 1T2AA 2GN9A 4N5LA 3DOJA 4W82A 2YDXA 2GYYA 3DL2A 3AM3A 3S2EA 1Y9AA 4W7IA 2JFFA 3H6KA 3RUHA 3KSUA 1YL7A 2RBEA 4ZJUA 3I9JA 3JSAA 4IJVA 3C1TA 4R54A 3OEWA 4BO3A 2D0IA 4GH5A 2ZCVA 1E5QA 1ZJYA 1VSVA 3ZWPA 1N5DA 1UZNA 1A72A 3DFUA 1LNQA 5I9NA 1Z74A 2J5KA 2NADA 2Y99A
chains in the Genus database with same CATH superfamily
2QRQA 1N78A 3B12A 3T3IA 1EDBA 4L2IB 2FG7C 4HKTA 4NYJR 1RYDA 3TDNA 3CLRC 4QAJA 3RJ5A 4CKZA 1NW9B 1KL7A 3D5QA 4N7BA 3SWWA 2AE2A 3G5AA 1QONA 4YJFB 1M34B 2VOEA 1GR0A 1ZQ1A 1PZFA 1KJQA 1ZXBA 2YJGA 2AMLA 2Z1DA 4BV8A 3KE8A 1E62A 3MJSA 5ER6A 4F5WA 4I1IA 3AG5A 3QMVA 5T6BA 3SM9A 1QHIA 1UMKA 4OEHA 1AQLA 1U81A 2CCGA 3DUWA 1N1DA 1R0LA 3G2HA 3VH4A 3BXPA 2EARA 2AFRA 1SD1A 2FWPA 3F78A 3K2IA 2IE8A 4IM7A 5GJWC 4KQ9A 1FDOA 2GX6A 4QDKA 5B5SA 4AKIA 4G8JA 1BE8A 5JSQA 9MHTA 1V2GA 4ZVTA 2EBWA 1KC3A 5ES3A 4FQ5A 1GKUB 1II8B 3LVRE 4RNDB 1XTIA 3QG5A 4EWLA 2GESA 3A6KA 5TMPA 3OZBA 1QGED 3H84A 2FZKA 4WNAA 1YJ5A 3A4LA 4FFDA 5FUQA 2Q45A 5E8RA 3X1XA 1YDFA 2Y9MB 2QX4A 3I09A 2LCQA 1SZPA 1YVUA 4Q03A 4WEOA 4C43A 1QFMA 1RXIA 2XDYA 1G5FA 4P82A 1KJWA 1EGHA 1XTBA 1ES9A 3DKKA 1BMTA 2HSJA 3LY8A 2XRMA 4V0QA 5A4IS 3EVEA 4MV5A 3U48A 3OM0A 4E1AA 2C54A 1VGRA 2Y1XA 4IHJB 1PL7A 4GNRA 1EDZA 1POWA 1R0CA 1RMQA 1Z2EA 1JS1X 2IT1A 4H1VA 4HN4B 3BTOA 4R6XA 3VZQA 4DCVA 3U4QA 3TJMA 2F59A 4NI5A 3W8RA 4ND8A 1YFLA 3PX7A 1U3DA 1KEKA 3PCTA 4LQDA 3D4PA 2UUCB 3K70B 5A7HA 5IT0A 2OO5A 4HUQA 4E0BA 4DGQA 1OH8A 5AOAA 5LP1A 2MOKA 2ZJZA 4FR0A 2CLFB 1ZIPA 1J2RA 1NJGA 2AOUA 2XOEA 4K6OA 4RZIA 4LK2A 5BQOA 3VV2A 1HG0A 4KQGA 1VPWA 1I6LA 4RE5A 4WGFA 3VFDA 4IZ6A 5KTKA 3L06A 3CA8A 1H2YA 2VXCA 4PM4A 4KR0A 5CP8A 3R4CA 3G59A 1T5OA 2Y77A 3M7IA 3T9FA 1DKOA 4BFYA 4PBRA 3FTEA 4D8XA 5LZ9A 1S7CA 3L6DA 1MNAA 5AI5A 2O3RA 5DCUA 3GJ4A 3NYQA 4J03A 5AK0A 4II3A 3BREA 4GECA 5ALWA 4B71A 2A4MA 5D7BA 4QHTA 2GB4A 5ENDA 2A9QA 3W8DA 4ZHQF 1N6LA 3NV9A 4X00A 2ONCA 2BW0A 3P9ZA 1XEFA 3OG9A 4GE3A 1FJ2A 1YRAA 2JB9A 1B4DA 1K0FA 3PDWA 2HT6A 4TMYA 1C2TA 5EP4A 1D07A 3S27A 3Q9UA 3OJLA 2F3UA 3AEYA 2VT7A 3H5OA 4YP9A 1M5RA 1F2UA 4P4SB 3GEIA 1J4AA 2QMUA 5I7OA 4FC6A 2RHOA 1BHJA 1Z73A 4ZDIA 3M4NA 3WSTA 5JJ5A 5JZ9A 2B7CA 3GBSA 1EH5A 2QAJA 2IX3A 4QZVA 1AJEA 1HQCA 4IDAA 4NOLA 3WYBA 1V7PC 1S2LA 1KU6A 3TDMA 5F7OA 1N6KA 5BSGA 4J1TC 4BXOA 4KDRA 3BE6A 4A6PA 7GPBA 1T35A 2B3TA 5IJ9B 1PL8A 3A6JA 3SJCA 2AG0A 1QX4A 1RZRD 4P7JA 4PR0A 5HIMA 3AR6A 1UZLA 3I4FA 3KE9A 2ZKIA 3BJZA 3L9WA 1IZ7A 5EE5B 1DBPA 1ST2A 2MYNA 3DDOA 3PFGA 1RI5A 4R5HA 3X2SA 2ZKLA 4HEJA 3F6PA 2O3TA 1KJYA 4M1SA 3C6BA 1IXSB 3QFFA 4NPAA 4XD2A 2IV3A 3SHWA 3CKYA 1FRVA 2Z6AA 3MMSA 3E58A 5C4GB 1A9SA 4L22A 5L3SB 2B7BA 2YJTD 3GLIA 5CEEA 2DH6A 1JEQA 3UYKA 4AQ7A 2QRVA 3TSZA 4CN8A 3Q6NA 3DZIA 4R2LA 1BCRB 3USCS 1S8FA 1K97A 5JAQA 1T1JA 2JCXA 4R1QA 3OLQA 3LUBA 4JLMA 4NK4A 1YZUA 2FWRA 2WHQA 1NOIA 3D31A 1EP2B 3DQPA 2MTBA 3AF0A 3KBOA 1JIKA 1RRFA 3D8SA 3KDAA 4PSKA 3UW1A 4QDOA 1RQ7A 3H87A 1OOEA 1GZ7A 2IL1A 4RGBA 4ZT5A 2P4EA 4YCCA 4CG1A 1OXSC 2BKEA 4EJSA 5E1DA 4URFA 5IZCA 1AMOA 2P5TB 4RGYA 1CLUA 2B0JA 3GFVA 2XB6A 4UOQA 4HWKA 3RS3A 4OA8A 4OHOA 3UW3A 5G0UA 4BDSA 1C1XA 2A8YA 3KVYA 1E5XA 5KREA 4BJ3A 3DOCA 4PLVA 5BWOA 5HM8A 1J49A 2GEUA 2WJWA 3DT6A 2CEAA 4RKQA 1PGOA 4YI3A 1U0EA 1NVXQ 2DFPA 4DQ0A 1KJIA 1P77A 1EJBA 2RH8A 4I81A 1JG2A 4E22A 1F8UA 1QR6A 1W2WB 2YYSA 3OZWA 4G63A 4E5YA 5JPDA 3C7DB 5AW8A 3JQEA 3E9CA 3HMKA 4DWWA 4D56A 4ITRC 2EAUA 3PIRA 2R7MA 1XJQA 3LP5A 4I9UA 3RB8A 3MG9A 3G9ZA 4W5RA 4GAEA 2WAYA 2YRWA 2GLXA 2N9UA 4XX1A 4YUVA 3T5CA 3TE6A 4NBRA 3SKVA 5KWEA 4AURA 1XCGB 2ROQA 2CLDX 2COEA 2IDMA 2G5TA 3DZHA 3MCVA 4PFKA 3WKDA 5JAIA 2I9KA 1TOAA 5HE8A 3OLYA 1PBNA 1U7UA 2J0UA 1VL5A 3SX4A 2KI5A 3QKRA 5JRJA 2RARA 3A9SA 3THXB 4M9RA 3BB4A 1GARA 4BO1A 2EL9A 3FSEA 1UBRS 1E59A 1B41A 1ECLA 1L7XA 2JW5A 2XGSA 4UASA 4Z4CA 1XTVA 2I4NA 3BWVA 1W29A 1HNZB 2G72A 2CHFA 3S44A 5AUPB 1FP7A 1AZLA 1I0LA 2X9QA 1SCAA 3EVAA 3E05A 2PA0A 1GXSA 4IO0A 1JIJA 4AJ2A 3Q1KA 5ADHA 2CJXA 4WBNA 3EMVA 2EJTA 2ETXA 1ZUD1 1GFZA 3PE4A 4TM8A 2JJYA 4YJKA 4OI1A 3U4CA 3KR1A 1YS1X 2PKQP 3EE6A 4TQAA 3ZVRA 1ZGBA 3BH7A 4OHFA 3QBDA 2WD7B 3OUZA 3UB2A 3WAKA 2X8JA 2LE0A 3IRVA 4LV8B 1GYQA 1H2HA 5EZYF 5AK6A 1U3UA 1BGWA 3AU8A 4MDEA 3B1WA 1RAHA 1HDZA 5I7RA 2XUAA 1G7TA 5GZ3A 2TMKA 4Q1FA 3T0FA 3QOXA 2A58A 5MN5A 1DIGA 3DCNA 3EK2A 3HN6A 2IYRA 3FCUB 4OXNA 1HEYA 1K63A 3FDXA 5BNTA 1FSZA 3PUIA 4JOSA 4BQNA 4CMGA 2OXCA 2JZNA 5FIUA 2RKBA 1AKTA 2GN8A 2QF7A 4PICA 2R7NA 4ZQCB 4OD0A 4Q48A 3OHSX 3KPVA 3NZEA 3OE4A 3FFAA 4JC8A 5JYBA 2BJWA 1HWYA 2ZE7A 2D8MA 3F47A 5BY2A 4XD7A 3U7GA 1FYVA 2RHHA 4AZVA 1FDTA 4Q39A 5CYFA 1NF8A 1D2MA 5E7IA 2LTAA 3BWBA 4WESB 5DTRA 4JVOA 4CEJB 4GYKA 2R6ZA 2PN1A 1OU0A 3E1GA 2OB2A 2X86A 2X42A 4QU8A 3JQAD 1OHHD 5H9VA 2FPWA 3H18A 2A57A 4DV5B 1K4MA 2JDIA 3IC5A 3A31A 4JCCA 3I6ZA 3KSZO 1QPBA 2R00A 4LC9A 1CV2A 3FBGA 4L9WA 3HABA 1HT3A 2GJSA 5KQGA 4DFDA 3WGQA 3SQMA 3NT5A 5BYJA 5FTKA 4Q02A 3C14C 3AV3A 4Q24A 1FP2A 4Q9DA 3R3HA 5C7IO 2C61A 5P21A 3GRYA 3SC2A 5JALA 1V7ZA 5CBPA 4LKRA 2ICAA 4R7ZA 4JJIA 4JLPA 5F5XA 4BLQA 4C05A 2K7FA 3BDIA 3RANA 4ZHQB 4ER6A 3RBXA 5LZ4A 1M54A 1C2YA 4PS0A 4EGJA 3UV7A 4J7AA 2QMHA 2D5AA 3BN3A 2TMGA 4JT2A 4G2TA 5HXAA 4BLTA 2FWMX 4XARA 4HB3A 1KK2A 2D1YA 2KMLA 2P2NA 3OQOA 3F4KA 1GAEO 4BRSA 4A03A 3KHUA 3PE6A 5I4IA 2IS1A 5F2EA 4XYLA 5BUZA 4DAEA 4ZJYA 1BWPA 1FVXA 4JR1A 2XWSA 3TTVA 2WYIA 3KUCA 5K3FA 1OY1A 721PA 1HZZC 1FK8A 3PR2B 3T3EA 3F9IA 4J49A 1FU4A 4E5UA 1F3OA 2F1HA 4DIOA 4BZXA 1NP7A 4OB6A 3QVVA 1X7WB 1W76A 2ZI4A 4KNYA 2PLFA 5LQJA 2X4GA 3VPAA 3VNBA 3BRSA 5KYXA 2HMSA 2ZUWA 3J7TA 3R6WA 2IP4A 3GFPA 2IYZA 2RAPA 1DKMA 4MP6A 1YFJA 1DWQA 3NHSA 2H1VA 2QAIA 3P19A 4G5YA 5B3JC 3GJ3A 5KU7A 4EQ6A 4NE9A 3K0BA 2DQKA 4OI0A 1O94C 3TVDA 1HFKA 1K7EB 4WZZA 3G7SA 4GRDA 5BMOA 2AFHB 2G4LA 5IBRA 3WGZA 5CYOA 5BW5A 4CFYA 4N01A 4TTSA 1DOHA 4DV1B 1XB2A 2LNDA 2H6EA 2AD1A 2FPOA 3MCAA 5K3AA 4ZU6X 1UBFA 5IHPA 1BKDR 1RADA 1R6AA 2ZVPX 3W8NA 3KEGA 1JLSA 4Y1FA 4LVUA 1UPFA 2H9YA 3RABA 3PZRA 4C7KA 2PV7A 4EQZA 3BAFA 3TIFA 4PCUA 2Q21A 1TM1E 4EGAA 4N7RA 3LCMA 1APBA 3V8QA 3HWRA 4D9HA 2Q9BA 2PUFA 2R8XA 5DNEA 1JLMA 1SXQA 2BFCB 4L4UA 4YP7A 1T6NA 1GRQA 2C2XA 2XUZA 5DOVA 4AKGA 4BGUA 1CJKC 1YC5A 2EERA 4DT1A 1CZLA 3T4PA 2JFGA 1PJSA 3LPMA 1P61B 2AZMA 3LXMA 4NOJA 3R09A 7MDHA 2QK4A 1SU8A 3OU2A 1T2NA 3K9NA 3VVBA 3ZJ5A 4X45A 3ZWWA 2AI1A 3V9AA 3CZAA 2IHYA 4OUKX 1ODIA 1X7ZB 3JQ6A 4YCAA 4L8VA 4DV6B 3OIVA 3HGQA 3HM2A 4PYQA 1DPFA 5GADl 2VSFA 1V3VA 2V4ZA 2XR1A 3C3CA 4JUBA 2QY9A 2JBAA 1XRLA 4GDFA 3LV8A 3HB9A 1Z06A 1NM5C 3O2SB 3D3WA 1JAYA 4KXNA 1S3SA 4MO2A 1U0JA 3O2QB 4TPKA 1E2UA 2YRFA 3OQNA 1V4BA 1PGPA 2IPOA 4FW9A 4NECA 2EJVA 1GV1A 1JSXA 4UM5A 3GAZA 4CCAA 4ISBA 2FP4A 4MVXA 4XW2A 2IPMA 1KAOA 5KOHB 3LC7O 1KERA 1Q0ZA 2W2LD 1X0XA 3AKEA 3OBIA 4JU8A 1OPXA 3LWZA 1OFVA 3EXHC 3T4EA 3KSDO 2ZB3A 4XCVA 3R6GA 1TTPB 5JS8A 1C7QA 3KKMA 5SYAA 1BVYF 5E4TA 1ZD4A 2AXNA 1JDJA 2AKYA 2KE5A 4YRJA 4C1NA 4DIEA 1VYTA 1NE7A 2V7UA 1UOQA 3VV3A 4MKRA 2G7MC 3QEKA 2VAPA 1IN7A 2Z04A 1E3WA 1HQKA 3GVHA 3A9RA 3IOCA 3M0EA 5FPKA 1QV7A 4TMWA 3NH9A 5BUSA 4RTJA 1DLJA 5TY0A 3W1VA 3LMKA 4R1TA 2DR0A 1KDOA 4IV5A 4CKWA 2JGJA 2EP5A 4IZHA 4L8WB 3T8YA 5DGTA 3OE7D 1YQGA 4HLCA 4Z9FA 1KI9A 1B1CA 3DLCA 4D99A 1ORRA 1A3CA 2SBTA 3T94A 4FINA 4NYMR 4WZBA 4F11A 3CPEA 1IZYA 1YT5A 4AP5A 4JWKA 3MFQA 4MH0R 1QHSA 4MVJA 1B8VA 5IS2A 2C9BA 1NRJB 2QU7A 5FRDA 4ZCIA 2GA9A 1X94A 2I34A 4C88A 4TUYA 2XGMA 2W2QA 4NWIA 2BYTA 2D7DA 1XU9A 3CG4A 1OYOA 3IELA 4DYHA 4E31A 2O2YA 3F6SA 4URZR 2PH1A 2EX1A 3EW7A 2ZQYA 4KH0A 4ZD6A 2NZUG 3I30X 4NZOA 2WTEA 4ADSG 3V3TA 4DWOA 3DHEA 2L82A 1DV2A 4A8PA 1FC0A 4L9RA 4UCQA 1NBHA 4XSGA 3M6AA 4M9SA 3EZFA 2F9LA 2AOUB 2CXHA 3NM4A 4OXKA 4HEHA 2H0QA 3HB1A 4TWBA 5WRFA 1J5EB 1DBWA 1E0KA 4DJAA 5B1DA 4H27A 1A96A 1P4HA 4OYLA 1PFVA 1VIYA 3OVMA 1YRHA 5KSWB 4DIKA 3TX2A 1ULTA 2FZLA 5BWCA 4YT8A 3OQ6A 2NU6B 4DM4A 5BT9A 2AH5A 5CCBA 5IABA 4IF6A 3EBOA 5KAMA 3NX4A 2BKAA 1C4XA 2DKNA 1BSVA 3COWA 1F0YA 2XGJA 4GOOD 1QHYA 2DKFA 5JD3A 5SICE 3PNSA 4HGOA 3K9HA 3AY6A 1SURA 2XY4A 1Z4OA 2I7TA 1OIWA 1OFHA 2HCBA 1RLJA 1Z36A 1ZQ9A 5SV2A 5C81A 1IVSA 1E98A 1VBKA 4ZI5A 2BGLA 3OIUA 5CLIA 4IQFA 2FEAA 4BBZA 3UGKA 3TZ6A 1CNMA 3K72B 1FXUA 1BQ4A 2X6RA 3S8MA 2Q3FA 1F6WA 1RACA 1T3SA 2V9ZA 4JEMA 3TRHA 4DR1B 1O95C 2VYVA 5T7BA 2DULA 2WMDA 4N76A 1J97A 3NRJA 3GD7A 4EPWA 3ILHA 5IAAA 3MT9A 1N6IA 2D2IA 2QTLA 4AKEA 2DAPA 1JKXA 1RAEA 2OZLA 4O63O 4YQZA 1O4WA 1QRUA 3BMOB 1NFRA 4G4SP 3L7LA 5FOUA 4B8YA 4UTXA 2W7TA 4ZT7A 3ZWYA 5ERYA 2FOXA 3ZNNA 3HV0A 2QJRA 3HN2A 1YUMA 2AKAB 3PT5A 4X41A 2R6HA 4OBEA 1DXQA 1X7GA 2Q7XA 2FHSA 1D6JA 3AJDA 2BCJQ 5C1IA 1E79D 1Y1LA 1F4PA 3L5OA 3M1AA 4KXXA 3T5AA 4P93A 4HDRB 5LR6A 3EIWA 3MJHA 1NBMA 2ORYA 3B1YA 3L0YA 1VECA 4U8GA 3O83A 1XCOA 3AJRA 4WZAB 2IV7A 4FZRA 4EJ6A 5K8IA 2AC4A 2ECFA 2VIIA 1XZAA 4TGLA 4OK6A 1MCZA 4GOMD 2FSHA 3GZNB 1QGUB 2AMJA 3EN0A 3I5AA 3K9GA 2FA9A 4FB5A 2C2HA 1NX6A 1T1IA 4TSFA 3O4RA 2O8VA 4U2KA 1K86A 4WFKA 1ZN8A 1W4BA 3DVLA 5JISA 3U1BA 3DHWC 3KKQA 3OICA 4YJ2B 3SSAA 1CP2A 2QX7A 3WNDA 2V1XA 1Z6TA 3AUXA 2VEDA 4OOEA 1DHRA 3KSMA 4DTCA 4C7OB 3FYUA 4B46A 1WB6A 2WTXA 1P2VA 2DBRA 1V4NA 3ZCXA 2X0KA 3DVAB 3IODA 4J6FA 4ZT3A 2EFHB 4X90A 1KAMA 1WKCA 1A7JA 3ZQKA 2G82A 4IKPA 1JG4A 1KU0A 3M49A 1SVNA 3I1YA 3V5NA 5AI4A 1JHAA 3ZEAA 5EP3A 3ABZA 4IRUB 2BAGA 3RUPA 1GVNB 2HEIA 3LPLA 2XSZA 3QLVC 5IUJC 2NT4A 1ZY2A 4HB4A 3NBQA 2Z9CA 2OBNA 2HL6A 3GLFA 3B9RA 2RI0A 2X1VA 5A71A 3K2BA 3TB4A 3ZGVA 3I64A 4YLYA 1PZMA 3BSYA 4DT1B 5EJFA 5CB4A 2QTVA 3RFTA 3ASUA 5E6SA 1X80A 3R8FA 2GBPA 1FB5A 1UJ5A 3PNKA 1R27A 1VB5A 3KB2A 2XUGA 3U61B 1W59A 3E8MA 1BEZA 2ZT8A 3GEGA 4KRGA 3Q2KA 1EB9A 1J6UA 1QVRA 3FKQA 4IOJA 4PY2A 1CUEA 4WLNA 4ZVKA 5LDGA 1OW3B 3E3MA 1E2PA 3INGA 2HGSA 3LP8A 3PF8A 5TX7A 3AJ9A 4EYOA 4XYGA 4I66A 4C76A 5LDDC 5I7SA 3O8QB 4ZZ1A 3CWZA 4GI5A 1J8DA 4NF2A 1MT3A 4R1SA 3H2JA 4EJFA 1D6MA 3SDSA 4DR4B 2GLUA 4FOPA 3URKA 5BMVF 1PVDA 4MUBA 2B5OA 3X1MA 3PNYA 1DOAA 1MA0A 1UK6A 3F8TA 4ZCTA 4LFBB 4PC2A 1TQDA 5D7NA 2B30A 5A05A 1KJZA 4HLQB 1L8XA 3GAMA 1RHQA 1SOMA 1N33B 2H1IA 4KIWA 3ZDCA 1YMUA 3ZK9A 1NMZA 1R9MA 3Q15C 3H17A 4HWGA 4Q3AA 4BZPA 5JJKA 1CX9B 3ABIA 1XKTA 4YN3A 5TNXA 3UAWA 2EF0A 4LDRA 2JFUA 2RGUA 3WGHA 1AY0A 5DYGA 1QGYA 3WGNA 1NF9A 2D0DA 2VJQA 3G2PA 5H68A 3RC2A 3JZDA 3RRFA 2LDBA 1YFZA 2P3LA 2DFVA 4QNRA 4UCXA 4NNOA 1M7GA 3RC7A 2X8WA 3LY9A 3U7EB 4DNQA 2JLAA 2PX0A 1KWKA 3HJCA 3EH2A 2CD9A 2H52A 1QZXA 2KSQA 3A6LA 5CD9A 1N5LA 2WA2A 2QP9X 4EB3A 4IS3A 3EQ9A 3IMFA 4FZJA 2BP7B 3NRCA 1I4WA 3TOVA 1XMJA 1KVUA 3K96A 2PKQO 3UK7A 3ZWVA 3D81A 3K20A 3OFKA 4I1UA 4M1WA 4G4GA 2OHOA 3K9QO 3KR2A 4P98A 2Q3EA 2ZGVA 2VHXA 2ZWPA 1CT9A 1JIIA 2REOA 3MLEA 3UMYA 3GFFA 2IYLD 1QIFA 2DTEA 4MJLA 1VMIA 1Y80A 4Y2QA 3ZDXB 1WE2A 1KR5A 1T9HA 1VHLA 3QHPA 2VP2A 2MU1A 3PVSA 4I46A 3T3OA 2G5GX 5LNK6 2A94A 2YS6A 3JVEA 3HJNA 3PXEA 4G24A 4OJNA 1P7VA 1XEXA 3I37X 3SHVA 3IP7A 3B52X 4CFSA 1UP6A 1JH9A 4Q16A 3RSLA 1B0PA 1NBME 4HDKA 1ZCZA 1NUHA 1LTQA 4JI5B 4OHXA 5A3RA 4TZ0A 3RUFA 3LO5A 2UYYA 2VYND 1DBSA 2W11A 4TL7A 2BZGA 2BUCA 3AXSA 3EBLA 4E5DA 4NATA 4WOPA 1N5JA 1OI3A 2BT4A 2N3ZA 2AJCA 3DMHA 1LX7A 3KLNA 1G63A 4HH0A 1UBLS 2C2MA 2CNOA 4QYIB 5J2TB 3V8NA 1XXHB 1DFIA 2OXFA 3EOAI 5B2EA 2PGDA 1YNOA 4QYSA 2VDMB 4UVEA 3CNEA 1YR8A 3BIOA 4BKRA 5T67A 2B61A 3WQQA 5AJZA 4B74A 4FYJA 4FFOA 5DBHX 4JBGA 1NI4A 8LDHA 3WFIA 4G5SA 4OSEA 3HU3A 1LJ8A 1G8YA 1PP4A 4JUDX 4CL0A 4EKDA 2M9MA 1ZM9A 1FRFS 2WF9A 4JXJA 4P3XA 3H4TA 4UZSA 5FOVA 3U3DA 4DMCA 5JS7A 4JASB 2UVPA 3D4NA 4LIPD 3N7UA 4ZGGA 1YDWA 4X9XA 3WRXA 2CL7X 5KYVA 3BCHA 1Q1ZA 2I7DA 5LP6F 2R6JA 2FKAA 1RQ2A 2V6GA 3GMTA 2QBYB 3V7NA 1YO6A 1E7MA 1R5NA 1CVLA 3CRRA 1P1FA 1FDUA 4FEAA 3AHEA 1CZOA 1CUAA 4ZT6A 2W90A 2Y9PB 3TECE 3ZHRA 1L5YA 3ZLJA 4TV8B 1QCZA 3M6UA 5CK4A 5TJ9A 4Z9YA 2VWPA 1K8YB 3RVMA 2VG8A 3SOPA 1O0SA 2QTGA 2FOLA 2DFLA 3HL4A 1AGXA 3GPDG 1EHIA 1V5FA 5E38A 3VR4A 2PUHA 2GF0A 1CQXA 1NVEA 1ZN2A 4INPA 4Q7KA 4Z5XA 3L4EA 2FFAA 1DWOA 3G3EA 4HHEA 3C1AA 3GFBA 4HDAA 2I65A 3HA7A 3QFCA 2KBFA 1M1ZA 3KYJB 1UBSB 1WCV1 4EECA 1I5EA 4F96A 1CRZA 4BLOA 1DL5A 1I9CA 4EEZA 1R4NB 4IGIA 1E4VA 1W46A 3PENA 4XM0A 4C2TA 3RREA 1LTKA 2C29D 4JJEA 3D6UA 4KO2S 3D0RA 5FFNA 4YV7A 4YJHB 1JQEA 4JP1A 3UJHA 2PUVA 3F6BX 5FBLB 4F2GA 4CIYA 3OE5A 1G1AA 4MVJE 4HDMB 3BVPA 3TNLA 4RKWA 4BNIA 2EATA 2ZAGA 1E2EA 1SXGA 3L77A 3DBOB 1Z2CA 3I6IA 3N0VA 4HLNA 5REQA 1WXEA 1U0LA 2MSEB 2I4OA 3N0WA 5AJHA 3A6EA 4ALLA 4D42A 5C46F 4OMFG 3AF6A 1YI1A 2JLCA 1VRCA 4TTQA 2FGJA 2J3IA 2XVXA 1QYIA 3LL4A 4DREA 3IULA 5KQLA 2IXAA 2PNJA 1EXNA 2PX5A 3A1SA 3EHDA 1O5TA 2BFFA 3OETA 4HY3A 4ZYTA 3BH0A 4M60A 5FTLA 5E9JA 3VPHA 1ZYUA 1NHWA 3L1JA 3UH1A 3QW4B 4RUKA 5C8ZA 4X97A 3K0FA 4TV9B 1WV0A 3COYA 2C4UA 2OGUA 2FNAA 4G9EA 4LQ4A 3LL7A 1Y5MA 4WK2B 2RIRA 2IU4A 5CT4A 4Q9JA 3IHKA 2ZTVA 5AUOB 3R3ZA 2JA1A 2D1FA 4E5MA 1JILA 4K9QA 4N7JA 1D04A 3EA0A 4J4TA 2XNDA 3GJ0A 2KBEA 3PKZA 1E1DA 2QL6A 2XUJA 3PEFA 4FX5A 4JZYA 3T7SA 3JWJA 1TJYA 3MCTA 2D0PB 3C0KA 1RKVA 1V8FA 1XVIA 5TSDA 4W8GA 4EMTA 3BCUA 4NG4A 3URMA 3ZE6A 2QRVB 1K7XB 4UUAA 3WWCA 1W2HA 1ITZA 4MUYA 4URXR 3G1UA 4QVKA 3WFJA 4FFLA 4GP9A 4B43A 1Y63A 5E7JA 1GUDA 5IARA 4EW3A 3DEHA 1AKVA 4YK7A 4V38A 4UBIA 2TRSB 4P3KA 4PIMA 4ERXA 1OFTA 1Y37A 2E18A 2EJUA 4X8MA 5FHRA 5H7XA 4DKXA 2CYCA 2X3FA 3W5BA 3OWOA 4EUKA 1YZLA 1UADA 2J5BA 2SKDA 3N70A 3FZGA 3PWSA 5K8JB 2C3YA 4L3WA 4KSYA 3T5DA 2WWFA 3ZDEA 5CAEB 3B3FA 2O8DB 1H1LA 3ZCRA 1B93A 1CHNA 2GYVA 2H92A 4R9VA 1WVMA 3D1LA 1NXSA 1R6TA 1VKRA 1EWQA 1BFUA 1SKYE 4ROSA 3CSSA 3EASA 3HKDA 1IEVA 3QE2A 4DLTA 3EDRA 4ZGWA 2V1UA 2VP0A 1K5HA 1Q0TA 3LDFA 3R5XA 2HV9A 2NV2B 2FQYA 3PCRB 4HNRA 2O8CA 4MMZB 4YDQA 4BBJA 2DWQA 3D7NA 1T5SA 4C7XA 1MC1A 1SOWA 1COZA 3I4CA 2YY5A 3AX6A 1ODCA 4PYIA 4RLSA 4ZI3A 2P3QA 1LDNA 4JNCA 2NZJA 1XUOA 1QK4A 3N2ZB 3DTYA 1KZ9A 2E4UA 3GPLA 3H6HA 1RYFA 1M1XB 3KXPA 5J47A 1HEIA 5JEDA 5K2OA 1OAKA 4E5PA 5ALQA 4CV1A 1NUQA 2RG1A 5EGSA 1DZ3A 4BCBA 3NVAA 2Z5GA 4RHXA 3NH6A 1BU5A 7ABPA 3AILA 3FPEA 1UC9A 1B74A 3RTGA 1ISPA 1Y9ZA 2C4WA 2ON6A 2P8JA 4J91A 4JJ6A 3M6WA 2OXTA 2IKQA 3ONFA 4E6PA 2J0EA 2QRKA 3A1EA 3P96A 1XP5A 4H7EA 1FDSA 2C7RA 2XDAA 5FP0A 3HXLA 2O2JA 3LT2A 1GUBA 1QOZA 4RXUA 1CJUC 3ZU3A 5J43A 1C9YA 4RIHA 4U3JA 3IAAA 3L1KA 4DADA 2W4QA 3R5FA 4LFCB 3EPJA 4LF8B 2CLHB 1VMAA 1N5MA 1VLJA 2CYBA 5G0SA 4AP9A 5JXJA 1RWNA 2PZLA 3PXBA 1VIDA 2JIMA 4P3PA 3JS5A 3LBFA 1WA5A 1E4EB 3S70A 4AMZA 1LDBA 4NS4A 3EEBA 5HF6A 4G5GA 1A8IA 1S2IA 2HWYA 3C70A 3EY9A 1ZGCA 3KBBA 4N0EA 3Q7EA 7REQB 4O4IB 1JDBB 3DE3X 4Q7QA 1ILWA 4PQRA 5L3QA 3RRYA 1YI8A 2Y3IA 3HNOA 3CE9A 4WBSA 1ZGZA 4BUJA 3EPPA 2GUWA 3ZWBA 2AMVA 2I3AA 3EAFA 3MOIA 4RA9B 5JSUA 2C4NA 2FVYA 2SNIE 3ZW7A 5LBUA 3CXUA 1N6OA 3MIZA 4J3JA 3RHSA 4JEUA 1QB7A 3OCZA 2VFAA 3HY4A 4M9CA 1PR2A 4XPIB 4YECA 3WV5A 3MVEA 1O94D 3EIOA 1THTA 3RCBA 2C5AA 1NVMB 2IHZA 3ANSA 2ZS8A 3CZMA 4PR3A 4RYDA 1CJVC 1SM4A 2PMFA 4M86A 5C8XA 3I0ZA 4K0RA 5DGHA 2WG0A 2J0SA 1O4VA 1BKYA 4EF4A 2GZMA 3LVFO 1Q2XA 3WHIA 4ZYYA 1IOVA 4WLOA 1MX1A 3AI2A 2A1UB 3D0KA 5TLSA 1KY4A 1SOAA 2BHSA 2O1XA 1JEYA 1IQRA 2QN6A 4M6WA 4M76B 1WQ4A 4WADA 2FPLA 5JZMA 4WX2B 5TS3A 3FR7A 2IUYA 1XNGA 2ZRHA 5DHAA 3EX7C 3ZDYB 4Q01A 3ENVA 4MUNA 5THXA 1KVQA 1ZKMA 1DBIA 4NRDA 4X8HA 4ZV7A 2GJKA 2J9FA 4KXUA 3E9NA 1JR3E 2XYGA 1JZSA 3RWMB 3NFRA 4H2DA 1WV1A 4GOND 4RCYA 1QRAA 2EX0A 2F17A 1G3MA 4B7AA 3F5MA 4Q12A 1GG5A 4Q7MB 1A8PA 1JDPA 4M0KA 5FUVA 3CH5A 1NOJA 2G9NA 3W9YA 2H1OA 4P53A 4MV3A 4TUYF 4X85A 4FUTA 2G80A 2P8SA 3EZNA 2ZYUX 5F5LA 3BXOA 1CDDA 3W9UA 1BN6A 4MR7A 3K9LA 4IJUA 3RUIA 1SGWA 4RD2A 3TVTA 4JAVC 2E7ZA 4QXMA 4QUKA 1IBMB 2FMHA 5AKYA 3UJPA 3SMQA 1XCBA 3HFJA 1O97C 4FYHA 5EQTA 2YCLA 4FU0A 4J7XA 3NC1C 3ZOZA 3D64A 1FIUA 4LXIA 2NSJA 2J3HA 1U3VA 1L5QA 3H4IA 2JVJA 4AJEA 4P2BA 1QQ5A 3MS2A 2HU2A 3PUYA 3ELWA 4RENA 4HJXA 1YH3A 3FLMA 2OA0A 3GFTA 3O3MB 1QK5A 1VB3A 3TZLA 2I3DA 4FIZA 2WB2A 1WWKA 2AR0A 3TKLA 5E6RA 2DUUA 1FLVA 1Y1RA 1MLDA 2QU8A 2C4HA 1ZMTA 5B1IA 2B92A 3TQTA 4LNUA 3ZBTA 4YRIA 1PJ8A 2VPIA 4C4ZA 2HXGA 2CDRA 2ZQ5A 4K88A 1G8PA 1WW8A 5FTJA 1LJLA 2P5UA 3SMVA 3SYRA 2V3WA 4CVNA 5AVTA 1CQIA 3G02A 5ICCA 1NVWQ 5A7FA 3JZMA 2XA9A 3BE4A 4Q93A 4NKRA 1QYVA 4G3XA 1J0EA 2FF5A 3PHCA 1EMDA 4V0NA 4B3FX 1FFEA 4DPKA 2ZWMA 3BXGA 5JXWA 2FMXA 3H1AA 4E3ZA 4IVPA 2X2PA 4A2PA 4BN5A 1FMLA 3ELYA 3IP5A 4B3TB 4MRMB 4BJ1A 1G5TA 1LV7A 1NVAA 1XZCA 1QOPB 3ABSB 3WI7A 1QAQA 1OLXA 4WDQA 2DR3A 1KMQA 2YFYA 4BMCA 1M5TA 1KMHB 3TUZC 1ZAKA 2W58A 3PPWA 4B3GA 1XRSB 1XMSA 1GP2A 1X1EA 1HRKA 3EDQA 3JZIA 3DMYA 3EY4A 4ACBA 4PX9A 1A9TA 2BFAA 3FYUC 3I9V1 3IQWA 4O0LA 5JQGF 4DUPA 3NPAA 2CSUA 1ZD3A 2F62A 3FFWA 4TVSA 5HWSA 4C2BA 1U9IA 1HC7A 2VHWA 3AGQA 4BV9A 2GERA 1PBTA 3YASA 1KEPA 1UK7A 3L0PA 3PXGA 2LR0A 1U2GA 4YIKA 2AXPA 5G4LA 2FG6C 3EXG2 3PPYA 2G0AA 1FTYA 4H7HA 1GL3A 3PNVA 3LCUA 4XFDA 1FA9A 4C6SA 2E87A 4BC1A 1XVAA 3IQGX 5IBPA 4RJTA 3P9NA 3TG8A 4LOKA 4LVOA 2YVAA 4ZREA 5H3LA 1U31A 5FXMA 3CRW1 1JIUA 3M2TA 1QS0A 4OU4A 2BI4A 3K3PA 4L9SA 3A1CA 2A5LA 4G5QA 4JYCA 2D54A 2ZRFA 3MD9A 1ZK4A 3K4QA 4FDUA 4Y2HA 4FXPA 2F7SA 3OESA 3DCIA 4OJYA 3TPZA 1OXUA 3S55A 3VOSA 1IHDA 1OILA 1Z26A 1PSZA 2AUNA 2O0JA 2GYUA 2R6CA 5T4FA 1QFXA 2YWXA 4G8CA 2QRUA 4X91A 3DTVB 1V16A 3DOEA 2J0QA 2JJ1A 3WBBA 5FO1A 3BHNA 3B6IA 1ZEMA 2QRNA 5I51A 5IG2A 4XYBA 3DF7A 3C16C 1ZK1A 2VNSA 2B99A 3ZNQA 4BBPA 5L4SA 3DWIA 2C8JA 4JJZA 5FL3A 2NV0A 5ALRA 3U17A 2RB4A 3OA2A 1E9BA 2AYXA 4B8ZA 2WF6A 4LQCA 2OZLB 2YH2A 1W88A 4CDGA 1K2WA 3M70A 5CVVA 3M4YA 4XVHA 1GPDG 2D74A 3IIMA 3KQSA 2HLPA 2PAFA 3TDKA 1Y8AA 1YK0A 3NC0C 4GWKA 4UEJA 1H6BA 2PEYA 5JE8A 1GA6A 2FPMA 3O94A 3SR4A 3H2KA 3ZQ4A 1H2FA 1EFLA 4JJAA 1SCUA 2Q1XA 4RSMA 5TMDA 4D4JA 1CUYA 2GASA 4I36A 1M34A 2C95A 4UDNA 1TM5E 2VDPB 4HGNA 4Q4AA 4YMVA 2JF0A 1FVFA 4KO8A 4ESOA 3KQKA 3AVQA 4B87A 3RAFC 3V42A 4PHTA 1BG6A 3JD2A 1KR2A 2BJVA 2HMWA 3PWZA 4GDMA 2Z5FA 2EOAA 2GBCA 3BWYA 3DG9A 3SNKA 3CLSD 5TGZA 1ESEA 4C4YA 3KX2A 1E3DA 1PFQA 3W1EA 1MRZA 5EXSA 3UJ9A 3HXOA 5I3CA 1YWGO 1ZK2A 3VHXA 4O0MA 3ER6A 1HM5A 1IL0A 1RYMA 2Y0PA 3RWOA 3VPDA 1PJCA 4F84A 3K1AA 3ICWA 1CYDA 2EFYA 2Q2VA 1UJ4A 2VNIA 5AXCA 1UZAA 5JDCA 4ND2A 1AE1A 1AZWA 1VP3A 3NT4A 3TMKA 5AVVA 3I5XA 3V4RA 5JQGA 5EIWA 4HH1A 3RK4A 5INTA 1ZIDA 1L7MA 2V3VA 4TL9A 4GI1A 1SCDA 3SD7A 2XHZA 3A1NA 1AKYA 2CNWA 2QGNA 1QH1A 3L6UA 4NULA 1OKKA 5HCIA 4C4SA 1XPUA 2GFIA 3MMXA 4PRLA 3KYDB 1JBEA 1IRIA 1RAFA 1FZQA 5BSWA 4B40A 2YHAA 2IDZA 2P91A 1Y42X 3NHYA 2GAJA 4IXTA 1L4LA 1M8FA 1XZJA 2DYKA 3QKSB 1SWWA 4YAJA 5DHUA 5A5GA 2HR1A 3TNJA 1SHKA 1VE5A 2XUIA 4DZZA 1T3TA 1BXGB 3UT5A 5IYZA 2RHLA 2O8CB 4FPXA 4PYJA 3D8RA 1ONPA 2CXQA 1PFYA 1RXYA 2A9OA 1HDIA 4RANA 4K6MA 4F21A 2B37A 3H1GA 4CMIA 1IY8A 1QANA 3EB9A 3INRA 2EKQA 2VJOA 1L7QA 4XQGA 3O92A 1GV0A 1ECFA 1TYDE 3DNMA 3KKZA 3QV2A 4AJ1A 1PUJA 1MQAA 4R7TA 5A4MS 1Q6ZA 4MWZA 3VSDA 4WFIA 1FTQA 2ZUTA 3JWPA 2BFEA 4HAIA 4B35A 3E23A 3L04A 1ZKDA 2C03A 3MCZA 2J31A 4L0DA 4OJKA 2X0RA 4N48A 5ULLA 1J9ZA 1LNZA 2QD5A 5HKBA 5ICFA 1LD3A 2ZJAA 1W5FA 2I80A 3EGXA 1R4AA 1XZFA 3GBPA 4M99A 2A5YB 2XUDA 4YPOA 3TQFA 5H59A 1GSHA 2CFIA 5EE0A 4I9GA 5ITZB 1IJFA 4K9LA 3ERCA 4I55A 4BQQA 1RAAA 1B2LA 1JQAA 2BFFB 2V6BA 2OPHA 1ECGA 3HO1A 4MW0A 3VC7A 1SZJG 1U0TA 3AONB 3QE4A 3F4BA 4LZWA 1GGEA 1TRKA 2W83A 2NACA 4JB3A 4FYVA 5CK5A 5EZQA 1PI3A 2F1OA 3D7RA 3TLAA 4BO7A 2LIVA 3KZCA 3MELA 1NP6A 1JHQA 4I9NA 1CUSA 2BDUA 3ZH2A 1JIVA 1XEWX 1RKUA 1T2UA 2Q3BA 4OQYA 4BKQA 1AUVA 3Q5GA 1Z33A 3KKNA 1CRQA 4N40A 4X6YA 4BJ6A 3A3PA 4G41A 3HM9A 1X1DA 1EEHA 3MAJA 3OX3A 4N03A 4MEBA 2ZT7A 1UAGA 2R3SA 1QTRA 3BGWA 2ODEA 2OZKA 2COUA 4QPZA 3L8YA 1FSSA 5D84A 2YVUA 4IRXA 4UBMA 4D8TA 4HQKA 4C6RA 4EG4A 3H3JA 4QARA 3F8WA 1YB6A 1TA9A 2ID9A 5CM8B 4YJ3F 5G0VA 4ALKA 1UQUA 2QUIA 2DPMA 1GTG1 1HOXA 4U00A 2PS0A 1Z9BA 3LX4A 4YCDA 2CMFA 2JGDA 5G1OA 2NU6A 2PRJA 3N3BC 1DFHA 4IEIA 3PHJA 2PVPA 1IXRC