4WCFC

Trypanosoma brucei ptr1 in complex with inhibitor 9
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
267
structure length
244
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVKTVETQVAELIGTNAIAPFLLTMSFAQRQNLSIVNLCDAMVDQPMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Pteridine reductase
publication title Exploiting the 2-Amino-1,3,4-thiadiazole Scaffold To Inhibit Trypanosoma brucei Pteridine Reductase in Support of Early-Stage Drug Discovery.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
total genus 89
structure length 244
sequence length 267
ec nomenclature
pdb deposition date 2014-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4wcfC00
3DB2A 4J1QA 4JJGA 2HSDA 3O9ZA 1LSJA 3I9OA 4GX0A 3GMDA 5BSHA 1JDJA 5KTKA 2O48X 2ET6A 3WMWA 3A14A 1KVUA 1WPQA 3JQ9C 4BNTA 1T2DA 4HUJA 1B2LA 1O89A 3JQCA 2BLLA 5JDIA 5IN4A 5F5NA 2P9GA 1B8VA 3DZIA 1BHSA 4CR6A 5DULA 4ZJUA 2AMFA 4A2CA 4OOFA 4NBUA 1IUKA 2YW9A 4CLDA 5IDXA 3DWFA 4QECA 2VUSA 1LDBA 3R3JA 4ZQEA 5AVOA 2WYVA 4LMPA 3H2ZA 3GUCA 4MVJM 1KEVA 1H6CA 3OA2A 3PGJA 1BW9B 1Z82A 1B0AA 2B37A 3OJLA 4BKPA 1DDOA 3ZW8A 5ER6A 2IZZA 2BFPA 3CSDA 3FPCA 4I9HA 1J0XO 1EFLA 2YQ4A 3AWDA 3VH1A 3LC1O 4AICA 5H83A 3A06A 3JD3A 1S7CA 2GUGA 3QWFA 2GF2A 4J9UE 2B0JA 1Z45A 3RJ9A 4HKTA 2CF5A 5EINA 4UVGA 2HKIA 2OP1A 4AJ1A 1Y7TA 4BQRA 1KERA 4U0JA 3U4DA 1Q0HA 5T64A 1ZSYA 3UHAA 1HDGO 2D59A 2DM6A 3JQ8B 1E3JA 1D1SA 1DPGA 4BGVA 4BNIA 2CVOA 2D5CA 1DO8A 1F8FA 4BNMA 2DFDA 2Y1GA 4BNKA 2BFMA 4J2OA 4JNKA 1A7KA 2X5OA 5AXBA 5IF3A 3FF4A 1E1KA 1HLPA 3NT5A 1F06A 3DMTA 5F3RA 3AW9A 4YBZA 4E32A 1I2ZA 1GYQA 3RBXA 1R37A 1I24A 1Z74A 1CETA 1OC4A 3DZHA 3K9QO 4IDDA 3ULKA 3S55A 2PY6A 2DTXA 3P19A 3BTSA 2JAPA 1TT5B 4HP8A 1I3LA 1N9GA 4XDZA 3JQFA 5L4LA 1I2CA 4PG5A 3TSCA 3K6JA 3VHRA 5L4SA 1JA9A 3NT2A 5TLSA 2Q1UA 3EZLA 2D3TA 3PLRA 2VHZA 4E2WA 4INAA 5G4LA 4F6CA 1Z75A 2GASA 1ZXBA 4MKRA 1RYEA 4GL4A 2X0RA 4ESOA 1ZMOA 2DBZA 1O5IA 1JTVA 5GMOA 5TNXA 2Q99A 2VHXA 4WPGA 1UXGA 1ID1A 5DP2A 4DA9A 1L7EA 1A4IA 4BO4A 2IODA 2HK7A 2RIRA 1EBFA 3G79A 1U2DA 3KYDB 3JQAA 1P74A 3GGOA 4R16A 4CLRA 5C7LO 1PJQA 1YDWA 2GZ1A 3GG2A 5HM8A 4IIUA 4JP2A 3RC1A 4JXKA 1VE9A 4Z9YA 4D0RA 3UW3A 4M54A 3MOIA 1MGOA 3BXXA 3RBVA 1C1DA 4D0SA 2VZ9A 5MDHA 1DFGA 4GBJA 5IDYA 4QQRA 4CM6A 2DTDA 4I08A 1EK6A 2C29D 1NQAO 4Z0TA 2J3IA 4GMGA 4Z9FA 4ZRMA 3PIIA 1IY8A 4GSLA 4TZTA 5AXAA 1LDNA 4FBGA 4II2A 3JQBA 3U49A 1E3WA 4A73A 2QG4A 2IEBA 4GWKA 5DCWA 1Z6ZA 4EGFA 3FNFA 2D2IA 3VPFA 4ALIA 4EBFA 4FOSA 1H6AA 3K2EA 1GYRA 1SZJG 1QG6A 3HQ4O 3L07A 4YJFA 4UREA 3C7AA 4E5MA 2XPCA 4URFA 4XYGA 3I4CA 4CL3A 2BGLA 1LA2A 5HRUA 1O95A 3R6DA 1T2CA 4HWKA 3RUCA 5A02A 1HSOA 3OIFA 2FR8A 4MIOA 3JQ7B 1T2FA 1WMAA 1FDWA 1PJLA 5ICSA 2O3SA 3BTUA 4E3ZA 1JWBB 5L7WA 1H0KA 3H5AA 3S2GA 4XGKA 5DNAA 3FRJA 5KVSA 2HAEA 3TZCA 1KOLA 1DJNA 2HU2A 2UVDA 5KJ6A 3OSUA 3BMQB 1TA4A 3D5TA 4NNJA 1VC2A 4PGFA 4BNUA 3ZU5A 1P0FA 3E9NA 3IKVA 1Y8RA 2QRJA 2G76A 2PNFA 4WK6A 3MJTA 4DBZA 2NTNA 4RDIA 5C3MA 5ICMA 3HJAA 4BUCA 3PQDA 2EKPA 2LDBA 4BNLA 3U4IA 2IZ1A 4K28A 1BRMA 1Y81A 5A3VA 2NU8A 4CM1A 3PDJA 5L95A 3Q9NA 4PZEA 1PR9A 2O3RA 3OJ0A 2Y0CA 4DGSA 3EMKA 1ISFA 3D0OA 5JCJD 1M66A 4QO7A 3ZV3A 3H5RA 3E82A 4Y6RA 1J5PA 1VJ1A 4CMCA 5B4TA 3ON5A 1BXZA 4EUEA 3WLFA 2VWGA 1N1EA 3DR3A 2FPGA 4NBTA 4IDGA 2Q3EA 2JCYA 3WSWA 3GAFA 3E9QA 1HSZA 2J5KA 4CMIA 1X14A 5TC4A 4LRSB 4CM9A 1PEDA 4RF4A 1T4DA 4IDCA 5JE8A 4ZGWA 5JW6A 1K6IA 1WVGA 4Y6SA 1ZVMA 1PQWA 2D5AA 2P4HX 4H3VA 4YA6A 1LLUA 1LNQA 1U28A 2Q49A 1DJQA 2ZTLA 3ZV6A 1DRWA 1O94A 2HMWA 4F45A 2POQX 2PGDA 3DZGA 1UXJA 1H9AA 4P4LA 4WLUA 3N74A 3UXYA 3WJAA 3C7CB 1WZIA 4FB5A 2V6MA 3Q6IA 3ROMA 3SJ7A 4OXKA 1YONA 4J43A 4CM4A 5L9AA 3H4VA 5IXYA 1B7GO 1PL8A 2PWZA 2JKVA 1WLYA 1VL0A 3AUAA 2IEDA 4D7AA 3N7UA 4OQZA 5KJ1A 1X13A 1CIVA 2FR0A 4IMPA 4CLEA 1LDYA 3L6DA 2JHGA 1SBYA 3GAZA 1N1GA 5B4UA 2DVMA 4L4XA 4XD2A 2VYNA 1JLLA 3RUFA 2GN6A 1M75A 4ND5A 3OEWA 1S6YA 5G4KA 3GZNB 3C1OA 4RVHA 3RU9A 3D4NA 4WASA 3B6ZA 4MVJA 3OHSX 5L53A 4NU6A 5F1OA 5ILGA 1ZJZA 1YQXA 1P9LA 3O8QA 4YJHA 2C07A 1PX0A 2Y99A 4BO3A 3DO5A 3L77A 3AM3A 4G81A 1HWYA 1MFZA 2HRBA 2SCUA 4NBRA 2WYWA 4IM7A 3TZKA 3V1UA 4W7HA 2OUIA 2EHDA 4IJVA 3BZUA 4MIEA 4PLTA 3LQFA 3WICA 3MWDB 4MVJH 3HZZA 2E82A 2HDHA 3M2PA 4JP3A 4W6ZA 2H1SA 4MVJE 4CR8A 5CEEA 3HDQA 4U7WA 4L0QA 3ZHZA 4AL4A 4CV2A 1X1TA 2CY0A 2JFFA 4KTVE 1KC1A 2BHLA 4AJPA 5L4NA 1D4FA 1PS9A 3DTYA 3ZWBA 1R4NB 1XG5A 2HQ1A 3JQGA 3S2FA 1XKQA 4BNFA 1PJCA 5K6AA 1YQGA 5IDWA 4E5NA 4BNWA 1W0CA 4HXYA 3TJRA 4BNJA 4XQEA 3U62A 4E5PA 3QWHA 1BVUA 2EJWA 1P1JA 4R41A 1D3AA 1LRJA 4YB8A 4R1SA 3ZU2A 4NJMA 4AJIA 3INTA 4RPHA 4HFNA 4DC1A 3WQRA 2EW8A 3GFBA 5TIIA 2C2YA 2DU8A 3C8MA 3OIGA 1MV8A 4ONEA 4G2NA 1HTBA 3AFMA 1GV1A 1O6ZA 2H6EA 5CAEA 1K89A 4GGPA 4IIVA 1ZK4A 1SOVA 3JQAD 4TRNA 4CLOA 3DBLA 3OQBA 1XA0A 5JLAA 2AEFA 1U3UA 4R9RA 4J7CA 1H2HA 4PLCA 3ORFA 5EQDA 3U4CA 2PH5A 1XELA 4WEOA 3VKVA 1I3MA 1KS9A 2Z95A 3RC7A 2HUNA 1VPDA 4WE3A 3TL3A 3U3XA 4CJXA 4DREA 3WTCA 1PSDA 1JKJA 4JBHA 3U9LA 2O50A 2X0IA 4RPLA 3PP8A 1E6UA 1HE3A 4DBVO 2OXIA 1QKIA 3ITKA 1E7MA 4UVIA 3E5MA 2DUWA 4BO2A 4B4WA 5EIOA 1YDEA 2BGMA 4YT5A 4PCVA 1E6WA 1H6DA 1YL6A 3AOEC 1BXKA 4RDHA 3NT4A 4MVJI 4NBVA 3JTMA 4NFHA 1LI4A 1SO8A 4J0EA 4N5NA 3PYMA 4UVDA 3AY7A 5L3ZA 2EWMA 5TF4A 5IXSA 4O0LA 3VZQA 3T4XA 1I5RA 4FDAA 5JMPA 4BGUA 1CQJA 1ARZA 2O3QA 2XAAA 5DBFA 5TQVA 5A5FA 5LC1A 4BGIA 4E21A 1VSVA 3HG7A 4MPDA 3NDIA 4BB5A 1H9BA 2GSDA 4WKGA 4PLHA 3ENNA 4NI5A 2VHVA 3MJSA 1EQUA 4Y98A 5CPBA 2I67A 3T7EA 2F00A 3WIDA 3UH1A 3CMMA 4C4OA 2CSUA 4DPMA 1VJTA 4O6VA 3SXPA 4O59O 2PTGA 1A9YA 4BNXA 2FN7A 1XIVA 1YOVB 3ZH2A 1ZO8A 3SX2A 3M1AA 4A27A 1T1RA 1C0PA 3TRIA 5ER9A 5ENDA 2QZZA 3BMNA 1RYDA 4IQ8A 1NWHA 1OC2A 3K30A 4BGEA 2NTVA 2PZMA 1R15A 3E8XA 3V1YA 2VNSA 4O1MA 3KXDA 3ZWVA 2EGHA 2OP0A 5JAQA 1A5ZA 2HRZA 1QLHA 5CG1A 2FRDA 4Q3NA 2P4QA 3KO8A 1V3VA 3FBTA 5JYDA 1B8PA 4IS2A 4PLYA 5L45A 3UCFA 3I1JA 4Z0PA 1KY4A 3AUUA 2E48A 2G82A 4KZPA 1RM4A 3FHLA 1JAXA 1LLCA 2O3UA 2FPPA 5LDHA 3MEQA 4CQMB 3GC6A 2D4AA 3PXXA 5CDGA 2OBYA 2VHYA 2W4QA 3SBOA 4AJNA 4GLLA 1BDBA 2BKAA 1OFGA 5COQA 4EJ0A 2GZ2A 2NLOA 4UUNA 3RJ5A 1AHHA 1EUCA 4CM9D 3NDJA 4E13A 2O2YA 2NUAA 4EJ6A 2PK3A 1HE4A 4PFJA 1R0SA 1R4MB 1KVSA 2NU6A 3KSZO 4WLEA 5HTOA 5C7OO 4FJ0A 2HMUA 2EP5A 2QX7A 3V8BA 3UOGA 3D3WA 4U5QA 4W82A 5A5EA 2FMUA 2FWMX 2ZYAA 3Q2IA 2GNAA 2J6IA 1GUFA 1DC3A 1Y9AA 3WGQA 1M6WA 3WNVA 3JYOA 3DHNA 3ROQA 1DBVO 5DOVA 3ZNQA 3B70A 2Y68A 3Q11A 2AQHA 4LCEA 4DQUA 5KJFA 5I7SA 1H6BA 5G2OA 1Q1NA 3E9MA 1GADO 1NP3A 3C3XA 4B8WA 1AN9A 1U3WA 4NBWA 2P9CA 3E6AA 1BWSA 4R5MA 1PGQA 2VTEA 3UGKA 1NX6A 2PKRA 3DOOA 1HE2A 3ZV4A 2HO5A 3LF2A 5L7TA 1YL7A 2EKLA 4BIIA 4FFRA 3DAPA 5EESA 4ALMA 2AG8A 1Q0LA 3NGLA 2IYOA 4PLFA 2VYND 5KVCA 1ISGA 4CLHA 4ALKA 3MJ4A 2R2GA 1MB4A 1E5QA 4XR9A 1NFFA 4GWGA 4R3WA 1ZEMA 1PZGA 3QRWA 2HK8A 4LSWA 1R6DA 1U3TA 2C5AA 3ROKA 2I3GA 4FGWA 4MVJD 2X9NA 3VPGA 3VVCA 4NPCA 2VQ3A 2CNBA 1BXGB 4FR5A 4OM8A 5T8KC 4NHEA 5JO0A 2IYPA 2X6TA 1XLTA 2PFGA 1E1NA 1ZJYA 1AXEA 3LSYA 4RLHA 3DMTC 2Q2VA 4HY3A 2Q4BA 3AK4A 1PU2A 1Y5RA 2NV6A 5I7FA 1QYVA 4QX6A 3SVTA 3PIDA 2WE8A 3ZWXA 5G0VA 4BOYA 5DCYA 4H15A 3FSRA 5AQ1A 1RKXA 2ZYGA 3FWZA 4CLRB 1NVGA 2J3JA 2WYUA 3JQFC 1I36A 4PIVA 2DBVO 4IBOA 1EDZA 3VTZA 4EUHA 4UUOA 3P2OA 3BTOA 4M55A 1C14A 3IQDB 1I3NA 1EEHA 1ULUA 2HMSA 2J3HA 4OO3A 5JMWA 2VCYA 3CH6A 1NNUA 3P5SA 3DFZA 3NV9A 1JW9B 4RJTA 3QV1A 2EXXA 2Z5LA 4II3A 2O23A 4YVFA 2EW2A 3NX4A 1C0LA 1VKNA 2JHFA 3GT0A 2Y93A 1E3WB 1DAPA 5F21A 3GMSA 3MJVA 3NUGA 4AJEA 3H65A 4D3DA 3GF4A 4MP3A 1H5QA 2I76A 4JCOA 2NQ8A 4TKMA 1LEHA 3IP1A 1P33A 1SPXA 4OL9A 1QSGA 1IL0A 2DPGA 2QHXA 1HT0A 3EZYA 3W4IA 1Z7EA 4UVHA 3WGGA 5COAA 4ZQFA 1XR3A 2Y1CA 3AJRA 4CLXA 1FK8A 2DQ4A 1NR7A 2ZIZA 3FWNA 4CL8A 1E3SA 2QYSA 4Y67A 3D1LA 2B83A 1VRWA 5A05A 4B4OA 3NYWA 3U4HA 2BRUA 1Y9EA 1NR1A 3DZFA 2CVZA 4RQUA 4KUGA 4BVAA 1NQTA 1Q7BA 3R0IA 3HN2A 2VUUA 3OQ6A 4WLNA 1R16A 2Y1FA 4I5FA 5CDYA 3WTBA 1D7OA 1SB9A 5BNIA 4MIYA 3R3SA 2J5RA 4QUKA 4RL6A 5FFFA 2ZQYA 2DC1A 1HYGA 3KRTA 1B3RA 2BGKA 4F3YA 2NVUA 3I52A 2ZB8A 4JN6B 1GTMA 1GUZA 4W9NA 2UV8A 1HE5A 2AQ8A 3E1KA 4M1QA 4PRLA 2Q2QA 3HWRA 3VC7A 3KVOA 4CV1A 3A1NA 2HLPA 4TRMA 2V7PA 1PQPA 1P3DA 1HDRA 3BHMA 3O4RA 2W2KA 3QLJA 3BMCA 5TS3A 3BHJA 1PJ4A 4YRBA 1JU9A 1BG6A 2GRAA 3TN7A 4XR4A 3GEMA 4ZQBA 4XGIA 2PR2A 4Q3EA 1CEQA 3TFQA 4LW8A 3WX0A 3LC7O 2YHIB 1YH3A 2GO1A 3JYPA 1NPDA 3VPHA 4XIJA 3HNPA 3GVHA 1K6JA 4WUVA 2Q2WA 3CZMA 4U6SA 4IXWA 4HNHA 5FEUA 1N2SA 1Y8QA 3PTZA 1GQ2A 2QZ9A 2E4AA 5I9MA 1UR5A 4I5GA 2Q4EA 4QFCA 1GEEA 3L4BC 2BFOA 5H81A 2DT5A 4NK4A 4PLVA 2R00A 3ETDA 2A4KA 3RUDA 1D1TA 3B1JA 4IPTA 4PLWA 3DAFA 4R54A 4OIMA 1V35A 1UXHA 3KUXA 4XQCA 3K2BA 1FJHA 3WQQA 2CD9A 4UULA 3MTGA 3JSAA 3ANMA 2OO5A 1LDEA 2QRKA 3CUKA 2C0CA 3DBHB 3I9JA 1QXSA 2NU7A 4FJ2A 2RAFA 2J3KA 1QV7A 1ZIDA 3H2SA 3ITDA 3JQEA 4ALNA 3ZNNA 4XYLA 4N7RA 1P1KA 2YV1A 2Y0EA 4CUJA 4NG5A 5DBIA 1J4AA 3Q1LA 4YR9A 2P5YA 3WGZA 5JCXA 1QR6A 1XU9A 3EK2A 2X23A 1W73A 1T2EA 2ZTVA 4DIFA 1X0VA 3KOUA 2UYYA 3H9QA 1C0IA 1HDXA 1UUFA 5TJHA 4BKRA 4N18A 3QJ5A 1TVEA 4JBIA 1PZFA 3I9KA 3OJEA 3QWIA 4WCFB 3FTNA 3INRA 3PPIA 4W4TA 4CM8B 1U5AA 1MP0A 4JJFA 1F12A 1DEHA 3GEGA 3H8VA 2XOXA 4L9RA 1CERA 1NQOA 1KETA 3ICPA 1MFPA 4M8SA 4QSMA 4TVOA 4BMSA 1P31A 4L4SA 3RI3A 5TX7A 4CMGA 1EBUA 1NM5A 5BT9A 3ZWPA 1KEWA 5A3JA 3LT1A 5F1PA 3GNTA 5I9NA 1MXHA 2QYTA 1ENPA 1U9JA 1E6EA 3HADA 1TEHA 1BGVA 2WMDA 4FFLA 4TVBA 4MDHA 4XX0A 4OYRA 1KIFA 2WTBA 3RFTA 2DBRA 3V5NA 4OOEA 5JY6A 3ZHYA 4WCFC 3Q2KA 5JO9A 3I3OA 3V1TC 3M6IA 5F1KA 2RHRA 4DMMA 4B3JA 1LC0A 4OKNA 4LMRA 4B79A 1PWZA 4LGVA 3QVOA 4IGFA 3WQSB 2CDAA 1E7SA 4KOAA 3VZSA 3PFWO 3PWZA 4BKUA 3OJFA 4NIMA 3IKTA 3HFGA 4G5HA 4R1TA 3RC9A 1XSEA 3LYLA 1IYZA 3WSVA 5G0WA 3AY6A 3KSDO 3IOYA 2DFVA 3NTOA 3QIVA 4R9SA 5TT1A 3QP9A 2EG9A 3COSA 2WD7B 5KJCA 1WZEA 4J4HA 4BMNA 2G0TA 2X9VA 5A9SB 1HL3A 1G0NA 4RGBA 4UEOA 3TZHA 3TL2A 1YXMA 3H9EO 4W7IA 5DN9A 4BO6A 1DLIA 4K26A 3G1TA 4TZKA 1LDMA 4HFMA 4PLGA 1UP4A 3EVNA 1A72A 4KDFA 3OEYA 1UDCA 4DLAA 2B4TO 4BMVA 4BNYA 2W8ZA 1C1XB 1AUPA 2V6GA 4RZHA 1SC6A 1BW9A 1AE1A 2VRCA 3T7CA 3CTMA 3ETEA 2NU9A 1UXKA 4EEZA 4B7CA 4EDFA 2Q1SA 3AI1A 3PYLA 4FGSA 2Q1TA 1QRRA 1GPDG 1U8XX 2C5EA 1WDMA 4PZCA 3ZHXA 2RHCA 3JD2A 1R12A 2X7HA 3ZN2A 3GGPA 4TSKA 2EV9A 2JD1A 4EITA 4B7UA 3F1KA 3I4FA 5AYVA 3ROPA 4MVJP 3KTDA 4D45A 3WG9A 4XRGA 1AHIA 5CHEA 1A7AA 1Z7BA 5ADHA 2AEMA 3BIOA 1ISMA 2GCGA 3M2TA 3EGOA 4TWRA 1KVTA 4F6LA 4ALJA 1SOWA 1RM0A 2VWQA 3GY0A 3FD8A 3I9NA 3W8EA 3JQ8A 3GDOA 3DQPA 4W99A 4PG7A 3VTFA 1YBMA 3PHHA 3GHYA 4LK3A 4XEHA 3IUSA 5U4QA 3PJEA 1XQ6A 1ZEJA 4BKQA 3S2EA 1M2WA 5GY7A 4RF2A 1MXFA 4OH1A 2B4QA 4CV3A 1F14A 4E5YA 1LXCA 4J90A 4K9DA 2EEZA 1NBOA 3GR6A 4IZIA 3WYEA 1E7QA 3SLKA 3O03A 1PL6A 4CQLB 4XGNA 2WM3A 3VAZA 2OMEA 3VKUA 3VOSA 3OMLA 4YXFA 1HF3A 1ISIA 1N5DA 3KYCB 3PJFA 4XIYA 2YZ7A 1E92A 3UF0A 4CR7A 3JD1A 2OL4A 5B4VA 3UFXA 1T25A 4BHTA 5IAAA 1QLJA 5HS6A 4P8RA 1CRWG 1A71A 3V2UA 1GFSA 4KQWA 2PD3A 4A0SA 4IGEA 5JAMA 3BMOB 1UH5A 4UVEA 1UJMA 4CMJA 1MUUA 4CM5A 3RROA 1Q2XA 5CDUA 2UUOA 3IS3A 2YFHA 3CKYA 1GZ3A 1PGOA 3V2HA 3GGGA 2E6UX 1KEUA 3OECA 2O3TA 3GK3A 3B20A 1ZMTA 3UCXA 4AJOA 4ND4A 1HEUA 3A9WA 1NAIA 3GDFA 5TT0A 1CJCA 4M49A 3TZQA 3WGIA 4Q9NA 4I9UA 1PTJA 2BH9A 1WW8A 5A03A 2FPIA 4E0BA 2VHWA 1ZK2A 3GRKA 1FMCA 4RV9A 1K5HA 3JYQA 4GX2A 4HBGA 1E77A 3AU9A 4MKZA 4ZQHA 5TRTA 3IIEA 4YJGB 4EEXA 2JCVA 5CEFA 2XXJA 3WS7A 4YRAA 1LU9A 2IRWA 3EVTA 5DF1A 1XDWA 5EJ2A 1X7GA 1YB1A 3DZJA 3KLPX 1KY5A 3DAGA 1UAGA 1YBVA 1LBEA 1ONOA 1G6KA 2Q45A 2ZQZA 2X22A 1R0LA 1RM3A 3HN7A 3WDSA 2NWQA 4R1NA 1PS0A 3K31A 4FFOA 4NU5A 1LQTA 4WOJA 4BV8A 1JQBA 3EHEA 3CMCO 3JQ7A 3WFJA 5CG2A 1G0OA 3C7DB 4XZ3A 4BNZA 5IJZA 3VPSA 1RWBA 4DLBA 2OHXA 2BFAA 2NACA 3RUEA 1GU7A 3Q9UA 4AJKA 4DLLA 3F47A 5BNTA 2ZTUA 4NDNE 3BMQA 4O5OA 4TRJA 1I3KA 2PD4A 4WJZA 5KJEA 3ETGA 3ZCXA 1E3IA 2X0NA 3DBRB 3OP4A 1EVYA 3KV3O 4BNHA 1KBZA 3UKOA 2QQ5A 3VDQA 1DC4A 3S1LA 5I7VA 3X2EA 3GA0A 3I6QA 3ZWAA 3OETA 1U8FO 5BQFA 2YY7A 3VH3A 2P68A 3AM4A 4WEQA 3JQDA 4D79A 3ADPA 4I1IA 5A9TA 1BVRA 2WDZA 4PG8A 3OQ1A 1W4ZA 1TI7A 2NTJA 3TFOA 3OA0A 5KWEA 5A04A 3WMXA 2TMDA 4MVJF 1EK5A 4E30A 4J6FA 3GQVA 5DDIP 3K5PA 4LSMA 5I9LA 1GYPA 4GVXA 1T24A 4YAGA 2ZK7A 3G0OA 3QY9A 4D44A 4M86A 1XYGA 4FFNA 2X8LA 3RBZA 4XWYA 3IL2A 3GVPA 3NDRA 4TRRA 3S8MA 1ZNQO 4QFDA 1HDCA 1B26A 4LISA 5EL0A 3WXBA 3QW2A 5CDTA 4NMHA 5JBIA 5JSFA 4RORA 3L6OO 1EFKA 5L7YA 3W6ZA 2H63A 3K73O 4JROA 4NFSA 3C1AA 4RO0A 1YL5A 3PHGA 4J1TA 2ZCUA 5JDCA 3I83A 3PWSA 1WAMA 1JAYA 3WBBA 3L0DA 8ADHA 1R66A 1YE3A 1BDMA 4ID9A 4OAQA 3QQPA 3PHIA 4GH5A 1P1FA 3RSHA 4D42A 1T2AA 4OGWA 1GAEO 1GUYA 2A94A 4DRYA 5LCXA 1NHGA 4EZBA 5IZCC 3HDYA 3IAHA 4RLSA 4EUFA 4NH4A 2VRCD 3AM5A 1HETA 2Z1NA 4N5LA 2LDXA 1T26A 4R5HA 2OBNA 4XRRA 2NSDA 3F4BA 3ZWMA 2X4GA 4GAEA 4LRTB 5K9ZA 2D0IA 5A9RA 1IOLA 3WWYA 3Q3CA 4KMSA 2J5QA 4Y6PA 5IDQA 3GZNA 5MGBA 5ENVA 4D41A 2CF6A 2HMVA 3QVSA 2Y1EA 3F5QA 1PWXA 3IDSA 3LC2O 3I9MA 5JDIC 4AJHA 3ZGYA 4CMEA 3BTVA 3AY3A 4EJMA 2PKQO 1GPJA 4Z3KA 3U5TA 1PIWA 2GR9A 1AXGA 3L4SO 4J16A 3S2IA 3L9WA 4J7UA 4XQGA 1DC6A 3VH2A 1Z73A 4DPKA 3BAZA 5BNFA 4PVDA 2A92A 4YT2A 1YB4A 1E1MA 4WNIA 2W2LA 3DFUA 3HB5X 4BS9A 3G17A 1ZW1A 4HADA 1NPYA 2VYVA 3W4KA 1FF9A 3DXFA 1IULA 1LTHR 1YVEI 2B69A 2JD2A 4UUMA 2BI7A 2D8AA 3G3EA 4RCVA 4IS3A 2OOSA 3DZKA 3D64A 3GDGA 3PI7A 2OGUA 4GI2A 3MWEB 4HFRA 4J4TA 1QP8A 4DQVA 1OZAA 3JQ6A 3E5RA 4YT8A 4DVJA 4PN3A 4YEDA 3PHLA 1I01A 4U8GA 3EDMA 3KZVA 1N9GB 1R4NA 3FPLA 4XJTA 3RWBA 4XYMA 2I3AA 5DBGA 5FYDA 3IP3A 2NQTA 3C24A 3HB4X 2EERA 3NTRA 4QO8A 1WDLA 4TROA 4B7XA 4ZHSA 5IZ4A 1YB5A 1W6UA 3DL2A 4FS3A 1I33A 2CFCA 1U2GA 2EF1A 3ST7A 3ABIA 4ZU3A 2VOJA 3IUPA 4UAGA 2X1HA 3VH4A 1DIAA 1QV6A 5ES3A 5FF9A 3WYBA 1EDOA 2FHSA 4MO2A 3KLMX 2P5UA 3W6UA 4I9NA 4IQGA 1EVJA 1LRKA 4GSKA 3AOEA 5I8ZA 3RIHA 2O3JA 1OI7A 3B1FA 4KUEA 4RPKA 1P1IA 3OJOA 1K6XA 4K6CA 3PJGA 1NFQA 4L76A 7MDHA 1XCBA 2P9EA 1QYCA 3JQAB 2GZ3A 4H7PA 3SC6A 1WP4A 4DUPA 1SMKA 1YJ8A 3WFIA 1OMOA 3DBVO 4YQYA 2G1UA 1RM5A 2EIHA 3WR5A 1XWFA 3DDNA 4RPJA 4Q3AA 3K96A 1F8GA 2FY8A 1EUZA 4IDFA 4QT0A 1CDOA 4C7JA 1C1DB 4DPLA 3GLQA 3LLVA 3PZRA 4KP7A 6ADHA 5TGDA 1XU7A 3P7MA 4QEDA 1NXQA 5CDSA 4OXNA 5ITWA 1LRLA 3ZU4A 1E0DA 3FTPA 4E2XA 1KVQA 3IJPA 1EVIA 1N8KA 3RFXA 1PZHA 4A5OA 4X54A 5AOVA 2JFGA 2I66A 4DWVA 2VTDA 3OH8A 3ZWYA 4S3MA 5DZSA 6LDHA 2CDCA 1CWUA 4CV0A 4XJSA 4KWIA 4RVSA 4BNNA 3A4VA 1EQ2A 2JAHA 1XEAA 2EJVA 4HV4A 1L1FA 4JQCA 4YJFB 1MLDA 5T5QA 3STHA 4C7KA 3AI2A 4QXMA 1B8UA 1O8CA 1GV0A 1DXYA 1OOEA 1YQDA 4AVYA 1NVMB 4YRDA 1I10A 1ZBQA 1IPEA 3KB6A 2DPHA 1PS8A 1ZKMA 3F4LA 4M89A 4D3SA 5BSFA 2E49A 1FDUA 4FFMA 1G1AA 1UZMA 3ZWOA 5IFLA 1SB8A 1JKIA 3FBGA 3DMYA 1DFIA 1QMGA 1N7HA 1ZUD1 4RZIA 5U9CA 4ND1A 2PGLA 3RUHA 4TKLA 2IE0A 3QSGA 1X7HA 1NASA 1HRDA 3JQBC 4FOOA 5EPOA 1ZCJA 2YV2A 3QVWA 1GR0A 4DL9A 1YOVA 1HKUA 1PJ3A 4OKIA 5CFZA 5TSDA 1NYTA 5KIAA 4AJ2A 1Y8RB 1M6HA 3ENKA 4K1LA 3LF1A 3CEAA 4FC6A 1HDOA 3TZ6A 1XHLA 3RQSA 4WLOA 3NJ4A 4XYEA 1GCOA 4ZQGA 2F1KA 2HCTA 2AE1A 2B5WA 4Y9DA 1DFHA 1HYHA 1E1LA 1V6AA 2R6JA 2AW5A 4Q3CA 5JAIA 3TDKA 1HYEA 3LT4A 2ZYDA 1GD1O 4PRKA 2DUUA 4CODB 4CUZA 1YS4A 1DIHA 5IG2A 4ZD6A 3VPXA 3GEDA 2QIOA 4IJUA 3E48A 3MOGA 4JJIA 3PLNA 4JIGA 3M1LA 1I2BA 2X5JO 4AG3A 3GNSA 4P4GA 4Z9XA 4KUHA 4CQMA 3GZ4A 3UICA 3WJ7A 1LC3A 2PZLA 4J3FA 2PLAA 4PG4A 3BHIA 1RPNA 3HE3A 5HS4A 4E5KA 3DTTA 3EUWA 1U4SA 4CMIB 4B4UA 5JYEA 2FSVA 2Q50A 4XA8A 5A06A 3W8FA 4NJOA 4Z0HO 5ILOA 1A27A 5JC8A 3PZBA 1R4MA 2FOIA 3DHYA 3HFSA 1P1RA 4E4YA 1ZXLA 1GZ4A 2EGGA 3MJCA 1V8BA 4J4BA 2Y0DA 4M87A 4WLVA 3SJUA 2FZWA 4YJDA 1GQQA 3R1IA 4EYEA 1SAYA 2GN9A 4N5MA 5IN5A 3W8DA 5EQFA 1ADFA 2VWHA 1LSSA 3SC4A 1Y6JA 5T8KA 4FD3A 1GZ6A 3GNQA 4CM4B 4BO7A 1E7YA 3KEQA 3MCVA 1PGPA 2FZEA 1WWKA 1UZNA 2FSSA 1HLDA 2AG5A 3ZW9A 1ONPA 3ANNA 4LN1A 2BMAA 1LLQA 2Y05A 4P38A 4GQAA 2VT3A 4AJJA 5COBA 1JVSA 3GVXA 1A9ZA 2JJYA 3ZNOA 2YQ5A 5G4KB 1PGNA 2UUPA 2PZJA 3F9IA 4JGBA 3QVTA 4TMFA 4PLZA 4GLOA 1VLLA 3GRPA 1W8DA 5F5LA 4J91A 1BXGA 1U7HA 2DKNA 1EUDA 3IJRA 5B12A 3O8QB 4YJHB 1NAHA 4IDAA 2ZB7A 2ILTA 1K3TA 5JY1A 3OFSA 1B16A 3HDHA 4YAIA 1NPTO 1ZK0A 2JL1A 2ZB3A 3DZBA 3ZNPA 3PWKA 1J49A 1PL7A 2C7VA 2WEKA 3RD5A 4B3IA 1T4BA 1U5CA 4PZDA 4GVLA 1U1IA 3H6KA 1KYQA 2W2LD 3ZWNA 2DBQA 1EE2A 1SEPA 2WSBA 3UN1A 5THKA 2VYVD 4IDBA 3N58A 2NVWA 9LDTA 4BB6A 3JD4A 1UAYA 2YHUA 9LDBA 4IINA 2HK9A 3WB9A 4E12A 4AJ4A 3TOZA 3EW7A 1ZFNA 4K6FA 2GGSA 2AXQA 4J1NA 3UUWA 3GUYA 1NWCA 2RH4A 1MA0A 4GX5A 3AU8A 2YJZA 5BSEA 2Q1WA 4IJKA 4BO8A 3ONFA 4ND3A 3JQGB 3PFFA 4S1VA 1OBFO 3JQ9A 2PGJA 3VZRA 4KDEA 3SLGA 3HSKA 3O38A 5HA5A 1H93A 4MP6A 4E31A 5KOIA 4NJMB 1WXDA 4RVGA 5T57A 5CPFA 3TPCA 1MX3A 1E7RA 1YO6A 4FQ8A 3EYWA 3NRCA 4F46A 4TQGA 3D3EA 4R51A 4CM3A 4Q3BA 3MZ0A 4GKVA 1ADGA 1V3TA 4KQXA 5KVVA 1ML3A 2W90A 4DIOA 2E37A 3WIEA 4CLOB 3DBLB 4L4RA 2ZJ1A 1D8AA 4IY1A 2W98A 5K6AC 4ILKA 4JK3A 4JLWA 1C0KA 3INGA 2GN8A 3G49A 1Y1PA 2C82A 4U0KA 4YQZA 1HDZA 4RF3A 4I8XA 3VZPA 4XB1A 1LDGA 1P77A 2VZ0A 3FNHA 5TJ9A 4NR0A 4CMKA 3JV7A 1CQIA 4XKJA 1UDAA 2OFPA 4BV9A 1IZ9A 2ZTMA 1ORRA 4LCJA 3K92A 1YBAA 3L9XA 3GVCA 1E3EA 3TF5A 2VOEA 1PR3A 3EAGA 4ZICA 1PQUA 3X2FA 5A4DA 4YACA 4GGOA 5JS6A 2G5CA 1ZH8A 1DB3A 4A10A 4NQZA 1UP6A 4J2HA 3RC2A 3HUDA 2YUTA 3D4OA 4Y8VA 4MKXA 1BTOA 4BQPA 3KYBA 3ADOA 2GD1O 1QYDA 5DCUA 2VZ8A 3VVBA 3H9UA 3L4BA 3LVFO 1IPFA 2PV7A 4IZHA 4YPOA 1FDVA 3RAJA 2NM0A 4WNCA 5FI5A 1GY8A 5JAZA 3BYZA 4J9VA 5AXDA 1SCUA 1V3UA 5THQA 3GH3A 4D3FA 2IXAA 5L40A 1VM6A 2O4CA 1ZSVA 2A35A 1HZJA 1GEGA 4CUKA 2DLDA 2UAGA 2YHIA 1LLDA 2PZKA 1FDSA 5FWNA 1TB4A 4J7XA 3TWOA 3NJ8A 1YKFA 2V6BA 2BD0A 3BMNB 2QW8A 3OICA 2X86A 4IMRA 4RVUA 1B3BA 4GKBA 4WLFA 1YWGO 2YV3A 1DIGA 4RVFA 1MG5A 1E3LA 2Z1MA 3QVXA 4FW8A 1TT5A 4BL5A 4BO9A 1J6UA 1SEVA 3QWAA 4PG6A 3ASUA 4OSPA 5A1TA 1YJQA 3E18A 1P45A 2Y66A 3RKRA 3ICCA 2CZCA 3NTQA 2V65A 4FSHA 4IDEA 2IDZA 4KTTE 5AXCA 3UVEA 4AJLA 2J8ZA 1BMDA 2YDXA 4R3NA 4CQMD 2IXBA 1Q7GA 3A28A 5G0UA 3F6YA 1M76A 2FP4A 2UDPA 4R4JA 3PDUA 3ZDFA 3DBHA 2V6FA 1VKOA 3KHUA 2O4UX 4D46A 4ZRNA 1RJWA 1XGKA 3ZWCA 1BSVA 3BA1A 1V9LA 1IZ0A 2P2SA 5JDCC 4BKOA 3KYDA 4Z3DA 2JFHA 2QRLA 3CE6A 4ZA2A 3RUAA 4O63O 5JNLA 3RKUA 3KM0A 4Z6KA 7ADHA 3G1UA 2HMTA 1X7DA 3D3WB 4B8ZA 5G0SA 4BNGA 1U7TA 4MINA 4N54A 5ITVA 4IUYA 3CIFA 4CPDA 3GG9A 2EKQA 4WCFA 3ZU3A 3T4EA 3FR8A 4CM8A 4WOKA 2WJPA 3E03A 3PEFA 4ITUA 4GX1A 8LDHA 1CYDA 3TOXA 5DT9A 3AI3A 3DONA 4EW6A 1TLTA 4YDRA 4OQYA 3DHEA 3RCBA 5C37A 1IE3A 1MC4A 3F46A 2GN4A 4RVDA 1Q7CA 2YFQA 4MP8A 4DYDA 2O7QA 3CPSA 4CMEC 5EN4A 4FJ1A 1GDHA 4P4NA 3PGXA 5KKAA 2RH8A 4A03A 1HZZA 5DP1A 4EI2A 4ND2A 4WECA 4GMFA 4R1UA 1R0KA 2GDZA 1DHTA 1DAOA 1LSOA 4A26A 2JCXA 2PH3A 2X5KO 2B36A 5I7EA 1PJTA 1ULSA 2VN8A 2IZ0A 2PKQP 5JPIA 4IQ0A 3AUTA 1GL3A 3C85A 4RPGA 4LVUA 2I5PO 3JD0A 3GFGA 1X0XA 4PVCA 1ENZA 3KSUA 4R68A 1DHRA 3LT0A 4E2YA 1UDBA 2C54A 3DOCA 5GZ1A 5KKCA 2TMGA 2FR1A 2I65A 2O7SA 4DC0A 1PJSA 2X58A 2GLXA 4UEKA 2A9FA 2WD7A 4ALLA 1ZSNA 1P44A 2AQKA 1WDKA 4BNVA 1ZK1A 2HJRA 2BF7A 5A9SA 3QHAA 4XQ9A 1AGNA 5LDGA 2GERA 1LX6A 1IHXA 1K0UA 4J1SA 1DOHA 3OIDA 1JKFA 1H94A 2Y1DA 4YWJA 3D7LA 5CP8A 4GPD1 1KVRA 5GZ3A 1SNYA 3AFNA 1PZEA 1PJBA 3I23A 3MJEA 1DLJA 3Q0EA 3CZRA 3I6IA 4LVCA 1M67A 1LQUA 4DXHA 1VL6A 3LDHA 4DQXA 1NFRA 1QYXA 3F5SA 4NFYA 1C1XA 2H5LA 2WD8A 4OSOA 3GHHA 3TQHA 3QE3A 3FNGA 1V0JA 1PGJA 2B35A 5I8WA 1B15A 4XDYA 4I5DA 1N92A 3PHJA 4ZVVA 3QA9A 3MTJA 1Y5MA 2WE7A 3H3FA 5KVQA 3OM9A 2C2XA 4PLPA 3W1VA 4B4VA 5JC1A 1P1HA 1DRVA 2G17A 3D4PA 3K8ZA 3PQFA 1T1SA 1ADCA 3PJDA 3WBFA 4A7PA 3ANLA 5JXWA 5J23A 1Q0QA 1YRLA 2PA3A 3FI9A 1FDTA 1WNTA 2JD0A 3JCZA 1EE9A 1QYWA 3GVIA 3NGXA 3B1KA 3OF2A 2XXBA 3P2YA 5GZ6A 4JX8A 1DIBA 1JWAB 2RBEA 3LZ6A 2DAPA 4DYVA 3TNLA 2C7GA 3WLEA 3WGTA 3WOHA 3ZV5A 3DOJA 4CMBA 1F17A 4YAJA 2BELA 3FN4A 3JYLA 1NQ5A 3WYCA 5BR7A 1UXIA 2Y1OA 5C5IA 3RU7A 3L6EA 2I9PA 1OAAA 3IC5A 1U3VA 2PD6A 4CMAA 5KCZA 1KC3A 1YGYA 1CF2O 4OJNA 1F0YA 1NHWA 3NEPX 4R01A 4YAEA 4FFPA 2EP7A 5H82A 4CQLA 4J0FA 3RUIA 3H9GA 1I8TA 3GPIA 1VI2A 4UEJA 5T67A 2CUKA 1ENOA 1GQYA 3QWBA 3RASA 3KYCA 3ONDA 3ZWWA 4D43A 3UCEA 2C59A 4P22A 5JFOA 3O26A 2I6TA 5KNLA 1TT7A 5HBRA 2NVUB 1H2BA 1UZLA 2ZCVA 5CEJA 4YCAA 1IB6A 3LU1A 5DOZA 4WCDA 2OORA 1FXSA 2VUTA 2ZKLA 1EVZA 3UAGA 4ZN6A 5C7IO 5U1PA 1ZZEA 2W2KB 4L74A 3BMCB 4HX5A 3WNQA 2P91A 1K2WA 1ZK3A 3BMOA 1GCUA 4E6PA 3EY4A 1LSUA 3ZZNA 4FPXA 2D1YA 3GOHA 4FCCA 4JBGA 3AUSA 5FI3A 3LLSA 3F1LA 3WWZA 1EMDA 3GN1A 3LT2A 2WWRA 1KEPA 2HJSA 1Y8QB 1X1EA 2ZB4A 4HNGA 4OXYA 2C20A 4W9NC 3D5QA 3U0BA 1P0CA 1VSUA 4BO1A 2I99A 3C1TA 4RF5A 2VRBA 2BI8A 1L7DA 4HFJA 3ASVA 1NTOA 1PJ2A 3FNEA 4I5EA 3V2GA 2NADA 3IMFA 2CVQA 3WGHA 4B3HA 4BO0A 4E2ZA 4YJGA 1DIRA 1U4OA 5EMHA 3WGYA 3SEFA 2CMDA 4NK5A 4YT4A 2AHRA 2RCYA 1NVTA 2X0JA 4R69A 1B14A 4Q39A 3PYXA 1XQ1A 5G0TA 4U6QA 4OHUA 4MJLA 1ENYA 3LK7A 1DSSG 4IJWA 1ISHA 5EERA 2R00C 2VT2A 5B1YA 3OBBA 1DC5A 3GN2A 2AEJA 2ZJ0A 1VJ0A 3EC7A 3KBOA 2H9IA 4OMUA 2Y67A 1WMBA 2YDYA 4FN4A 3H7AA 3F3SA 3FCOA 4CM7A 2O2SA 3CXRA 4KWHA 4L73A 1O0SA 2X9GA 5B37A 3HHPA 1E5LA 3AOGA 3I5MA 3NAQA 2VWPA 4L8VA 4Q3DA 1I30A 3RFVA 4CMHA 3KEOA 4XB2A 4H16A 4ROSA 1TXGA 3PVZA 4G65A 1LUAA 4BO5A 3DBRA 4RQTA 1EZ4A 3DC2A 1HDYA 1HXHA 3DEYX 1X15A 3ONEA 5HWSA 2YYYA 2VNAA 4AFNA 2XF8A 3JYNA 1DRUA 2AA3A 1VL8A 1I32A 3H3JA 5L51A 5BSGA 2GPTA 1C3VA 1MG0A 1QORA 2GYYA 3NKLA 4DTIA 1IHYA 1MC5A 4YAKA 3CINA 1E7WA 1JVBA 1LJ8A 3GPDG 1ISJA 2CDBA 2OZPA 5JCJA 1O9BA 4FIZA 3ZHBA 2B5VA 4MOWA 1I0ZA 3PQEA 4L75A 4XCVA 4YTEA 4YYZA 1N7GA 2NVBA 5K0ZA 1ONNA 3VDRA 2DTEA 4MVJG 4QTZA 3WGOA 3H5NA 5T6BA 4IXTA 4WGGA 3W4JA 1A4UA 1ADBA 4DMLA 3PRJA 3KETA 4NZ9A 1UP7A 3PK0A 2B4RO 3HDJA 4FC7A 1JN0A 3FR7A 3H9JA 2AQIA 4J49A 4UUPA 2AE2A 3RVDA 4E33A 4XYBA 2Q46A 2ZATA 5IZCA 4DIBA 2NNLD 3I9LA 3U09A 3ZI0A
chains in the Genus database with same CATH superfamily
3KWLA 1SCNE 3DB2A 1JA0A 2N47A 1C9JA 3QKSB 3F90A 4RJJA 4W8OA 4EX7A 2W42A 1M74A 3ZLJA 1JDJA 3EEIA 2FUG1 4XPIB 1JLKA 2MHCA 4NBNA 5EMLA 2EYUA 1GNLA 1R1DA 4JWKA 2GRJA 3JQ9C 3UIEA 1SRRA 1EB8A 3RNOA 2PXAA 3MTBA 3R4CA 1B2LA 1JHQA 5ESDA 5C5EA 2BLLA 3DOIA 4Q47A 2WJHA 3HCAA 3V4LA 1BCRA 3R6LA 4NYMR 4BFCA 3O3MB 1C4OA 4KO2S 1TUGA 4U7HA 1B8VA 2GNPA 5FULA 4ZHQA 1P9NA 1BHSA 4CR6A 4YRMA 3TD6A 2H31A 1UK9A 1A98A 3NCHA 5A6SB 1Z2NX 1LVGA 1V5WA 1IUKA 1GTZA 3A25A 4LG1A 2BZ1A 1DKRA 1Z2AA 2VK2A 2WHRA 3TKLA 4CLDA 1LDBA 5F23A 5A5DA 1P7PA 3DHVA 3H0CA 4K1XA 1RVDA 1PEKE 3GJXC 1YQUA 4LMPA 4RIGA 3R40A 2X4DA 3DEZA 2JK1A 1DADA 2FUEA 1LNZA 3ITEA 2AKEA 3OA2A 3EXG2 1AH2A 1Z82A 2B37A 2XNKA 2XNDA 3O1JC 4R40A 4BKPA 1QP4A 3A11A 2QG6A 3BM5A 3JWJA 3CSDA 3FPCA 4PBSA 2NU9B 3LDFA 1A5BB 2WHQA 1VXOA 4KMMA 1YZ3A 2IK8A 2OFOA 3ABQB 3CJRA 2A3RA 5K0JA 4W5RA 1NN3A 2F3UA 3LD9A 2D7CA 1TKRA 2GF2A 3Q3EA 4C0HA 4J9UE 3HCRA 4RHEA 1Z45A 4HKTA 1E6CA 1U2TA 2CF5A 2YH2A 4LDJA 1NOJA 4GP6A 3VO1A 1KERA 2I55A 4IXDA 3M6XA 4WOBA 2H2IA 2VHQA 3U4DA 1W49A 3W2GA 3FDIA 5T64A 1U4NA 5BVHB 2PUGA 3BBLA 3AUYA 2DM6A 2X40A 1FMTA 1XJ5A 3EE6A 3L8ZA 3LQ1A 3JQ8B 4GXTA 4BBAA 1E3JA 3ML1A 1FQJA 4QWMA 4E15A 4BNMA 4BE9A 2Y1GA 2QORA 4WQMA 1V4BA 2BCGY 4ZI7F 3T94A 3BICA 3AY0A 3DEIA 1HLPA 3IQXA 1JLHA 3PKIA 4CT0A 4D8TA 3NT5A 2WPNA 5F2NA 5I47A 1JEYB 1C1YA 3OTOB 3PEUA 2I7VA 3BREA 4YBZA 3WL5A 3Q1KA 4DKJA 2RG1A 2W2PA 4EA8A 1CETA 1M2OA 2HQSA 3LHSA 4C88A 4YCMA 3MTQA 1W85A 1E2NA 1SD5A 2FW1A 1RBYA 1G98A 1GR1A 3PQ8A 4MLCA 2Q4RA 4N1AA 1OPXA 2FFJA 2NZVG 2QAGB 4MW1A 1VHDA 2EZ4A 2HIAA 2H2FA 3F8WA 3JQFA 4F3TA 3AVQA 3L02A 1TPYA 1Y7HA 1TQ8A 3TSCA 4O4LA 4Q4CA 3K6JA 1T0PA 2JCBA 1U0GA 4JC8A 5L4SA 1CUJA 2Z5GA 2WWYA 1SC3A 1I7NA 2GBLA 1JA9A 3D3NA 3NT2A 5TLSA 2JJQA 2Q1UA 1SXHA 2YWBA 1NL3A 3EZLA 4E2WA 4N8DA 4A23A 1E9CA 1N8SA 2BFFA 4RVNA 5G4LA 3ZW7A 4MKRA 1FVOA 4GL4A 3EWSA 2IYTA 5A1JA 2HNBA 1UKBA 2IXEA 3L4KA 4V1CA 1CT9A 2DBZA 4JASB 5E3JA 3WO0A 1J20A 3QG5A 5JS1A 2VHXA 4O4IA 3O73A 4WPGA 5C1DA 4L2IA 1R5BA 2WJWA 4B3CA 3HXTA 1JMYA 2VP2A 3U7GA 2O0KA 2CEAA 2B1QA 1A4IA 2C9BA 2RIRA 1EBFA 3AFGA 3DVQX 3MD9A 4L8FA 3OHMA 4LX8A 5DXJA 4ZI2A 4ES6A 3SC2B 1S7GA 1UL1X 2FMKA 1G2OA 2GARA 2QSYA 3OT5A 4CLRA 5C7LO 5JU6A 3GFVA 2NO7A 3RODA 2OCLA 5KDOA 3QEKA 4PHGA 2GZ1A 2P2CA 3A37A 4G0YA 4LY9A 4Y30A 5HM8A 3K6SB 4ZIRA 2WVHA 4IIUA 4REQB 1SKUA 4PZLA 2IXDA 3CH4B 3STTA 1R9JA 4Z99A 5FTJA 3NWPA 1T2NA 4D0RA 2CDNA 4MI3A 3MOIA 5KYUA 2JGKA 3RBVA 1C1DA 4YMWA 3E35A 5KSPA 1DFGA 4TV9B 2XE7A 3E22A 4F3CA 2XECA 4QQRA 3AFHA 4CM6A 1SWVA 5FTKA 4IGAA 1T0HB 3MMXA 3HKEA 1K08A 2C29D 3RTEA 5DEIA 4QDKA 1HFKA 2FPIB 1GG5A 3VYRB 2ZDQA 3D4BA 4P4SA 4WL0A 2V98A 1II0A 4TZTA 3FPKA 4BQOA 3IKJA 1SD1A 4L3OA 1MJGM 4C0JA 3IFSA 2Q5QA 3NHAA 3ZGNA 3CN9A 4N01A 5CYOA 5B58T 4EF6A 4LDPA 4EVRA 4MIKA 1FBTA 1WXEA 2LPMA 5FYQA 4EGFA 2O0HA 2H1IA 4EBFA 3LL4A 3IAM1 5CT8A 4EJMA 4UREA 3C7AA 4AMUA 1K9SA 4I55A 3WJ1A 3ZE8A 4URFA 1U6JA 4QEKA 2V7QD 1E8DA 2BGLA 4JSRA 1O8BA 3R6DA 1XDDA 3RUCA 5A02A 1HSOA 2A1UA 2J45A 3Q72A 3RQIA 1IBKB 3JQ7B 4FE4A 1WMAA 3UHFA 1YZUA 3I04A 1UCFA 2EFJA 2P9FA 1XV5A 2CBZA 3OT1A 5L7WA 1H0KA 4U2EA 3S2GA 5DNAA 3TZBA 5BY2A 3DF9A 4DR5B 1PN3A 3TZCA 4ZAFA 5IYZF 2P4UA 4RMGA 3SVLA 1CK4A 3OSUA 2JASA 3GLKA 2QY6A 3D5TA 1QGOA 4G8DA 1MIOB 1OREA 4BNUA 1XQYA 4PSVA 4AO7A 1F8XA 1LI7A 2QRJA 5D7BA 5L3SB 1W34A 4WK6A 1HC7A 4BN4A 4CDRA 4AQYB 1CJMA 4LJLA 3HABA 1Z39A 1G9XA 2EKPA 2LDBA 5EWLB 1RBMA 4BUCA 1Y81A 2QI9F 3FLEA 4Q21A 3PDJA 4WNAB 2XTJA 4YP7A 2BEJA 4JWTA 3WNCA 4RSHA 3T3MB 2FQXA 4EL0A 4KO8A 4OPMA 3TI7A 4QUBA 3TBKA 3WNBA 4HZIA 5EZ5A 4DGSA 1M66A 3NIBA 3FCYA 3R3VA 3W5BA 3QUCA 4IKEA 4HZUB 1W4AA 2IVFA 4JOBA 5TPWA 4KQ9A 2EBHX 4N0EA 1YR2A 4CMCA 1T5LA 4UU0A 1WW3A 2FQQA 2EKDA 3LX4A 2YXDA 3N3BC 3PNBA 1BXZA 2BYTA 2GCIA 3DR3A 4CXMA 1MEJA 1BFDA 1SHZA 2XB9A 3R3HA 4LXIA 2RIPA 5C51B 1IFXA 2JGJA 1LWNA 4G9EA 3EF1A 5AW4A 1X1AA 3BOSA 3FLAA 3LX5A 1XF1A 5LXTF 5CYFA 1XEXB 1HSZA 2FCAA 2J5KA 1PHRA 3MRSA 4RF4A 3U56A 3TRJA 1N3BA 2NO1A 1DKPA 1YIOA 4BGDA 4OQLA 2K4MA 3CNEA 1VDZA 1Y1LA 2P4HX 4MAAA 4YA6A 5L53A 4MWGA 1LLUA 5K3CA 1Z2OX 1ZD2P 4BEVA 1AQNA 3O2SB 2B0CA 3EOAI 1I7SB 2UUAB 1DJQA 1T13A 1IN5A 2ZTLA 1WUIS 2V0CA 3ZV6A 1FJGB 2HMWA 4XWOA 2BGTA 1LZKA 1IWPB 1SG0A 2POQX 4WFIA 5DLPA 2QMYA 2HPAA 3D6JA 1SGWA 1HE1C 5DU2A 1YRBA 3W2EA 1SKBA 2HA2A 4P4LA 2WV7A 3RRNA 5C8DA 1IN8A 3Q6IA 4F2GA 2JIOA 3ZJVA 1XTQA 3CKLA 5L9AA 3H4VA 5IXYA 1B7GO 2PWZA 1BAPA 2JKVA 2RJOA 1X7WB 4IHAA 2QTGA 3B7WA 5K4HA 2PJDA 1ABFA 3KKMA 3N7UA 4UQPA 2A88A 2FR0A 2YVLA 3T1OA 2ZIUB 1OFIA 1LDYA 1TFRA 2XNDD 3H5IA 3QKRA 4S2UA 3VR5A 4CLEA 2R6FA 5CXUA 1AV6A 1X7ZA 4B31A 1ZP6A 1J5EB 3E9CA 1PFKA 2DVMA 3CX4A 3HJBA 2C3MA 5JZ9A 1ZJWA 2OGWA 2PSDA 1GRQA 1NIPA 4L4XA 3EG9B 3PCXA 4XD2A 2VYNA 3RVOA 2DFLA 1DBWA 1TVCA 3B3AA 2RGNC 1M75A 2VJPA 1TYDE 4ND5A 3L7AA 4RVHA 2QR5A 3C1OA 2IYVA 4Y1FA 5B5SA 2PUWA 1WSBA 4HT3B 3AF6A 1X70A 4ZJPA 5B3LA 1DZIA 1RWVA 3VR5H 2V0NA 4E08A 4TL8A 3BILA 5F1OA 1ZJZA 1JB1A 1P9LA 3O8QA 4YJHA 3AF0A 1PX0A 1JR2A 1ZCAA 3C3MA 5I51A 2FSPA 3FTDA 4I5IA 4D6YA 5J5AA 1MFZA 4KLNA 1PVDA 2WG1A 2SCUA 4NBRA 2WYWA 3KKNA 4IM7A 3GLIA 4W7HA 2OUIA 2EHDA 4MIEA 3BZUA 3NBQA 3OTQA 5JVDB 3UKDA 3WICA 5FAXA 3BQ9A 3F7TA 2ZUSA 1U7PA 1OGIA 3CVWA 3OZUA 3UATA 3R9XB 3UYKA 1M34A 1Z15A 4BX2A 3M2PA 4PPGA 3M0EA 1J06A 4UC0A 5SZIA 4WESA 2ZW9A 2ZRKA 4ZVNA 1BZYA 3DYBA 4M0MA 2FSFA 1QANA 2AJBA 1KC1A 1Y6QA 5CUQA 4BRZA 5F7OA 1DOZA 1VYVA 3BPSA 4LWOA 4MWEA 5HCNA 4AJPA 1OH7A 5CFPA 4ZCPA 2Q6LA 2FFHA 1N9ZA 2I6XA 2WAYA 3L0BA 3ROXA 3DFIA 3UJAA 5KINB 1RMQA 1XG5A 4C2AA 3GLIE 2YJ5A 1YFLA 3CUEF 1JSXA 3OC6A 3O4GA 4V39A 3GIWA 4GOMD 1NMQA 1PJCA 3SVZA 3UAOA 2PJRA 4POAA 4HXYA 4LTNA 3S7TA 4M99A 3D6MA 1M34E 4EGSA 2SBTA 4E5PA 3TDNA 1MCZA 1YA8A 1BVUA 2HZBA 4XIIA 2HM7A 2RJNA 4OVKA 3C8DA 3JX9A 4R1SA 1X8LA 2H07A 3H99A 4F12A 1BH6A 4NJMA 1SQGA 1J33A 5B6IA 1L8QA 2FK7A 3NCTA 4QC2A 3U3RA 2ZXEA 3TTUA 3WRXA 4DC1A 3W5IA 4HWGA 4JB0A 5EHXA 1USKA 3BAFA 1US8A 4B7AA 2QGNA 4K9MA 1V11B 3C8MA 3ZR4B 2E3JA 4GZLA 1FP1D 1U31A 4TS1A 1HTBA 3WWOA 2QLMA 3ZCQA 5G3ZA 4Y2PA 4LQDA 3AP3A 1NG1A 5F3DA 1WM1A 2E4VA 1K89A 3LPLA 5E38A 3PQ7A 5BQ5A 1MU0A 5JLAA 1N2ZA 1SURA 2AEFA 1F6WA 1I6LA 1U3UA 2B2XA 2ZUCA 3GYGA 3HRKA 3IBFA 1XFDA 2MSWA 4J7CA 2FFAA 3WLTA 1JEEA 2KI5A 3DJYA 3DT9A 3QBDA 2UUBB 4FBLA 4E09A 4MSUA 1XRPA 2JGNA 2Z95A 4A0QA 3EGXA 3IDQA 3DL4A 1WY5A 5B57C 2O7RA 1A2OA 2ZJ5A 1CDDA 1PSDA 3WBJA 1JDSA 2O50A 3CCCA 3FDJA 3L0OA 3PP8A 1E6UA 1HE3A 2EL9A 3OQOA 1E7MA 4UVIA 3E5MA 4BO2A 2IUYA 1E58A 1E6MA 3S3TA 4CM9A 3OPYB 4URXR 1E6WA 3AOEC 2XA2A 2VP0A 1L5NA 2QSZA 2BMWA 1GFIA 2I87A 5BYJA 4DHWA 3RYCB 4PFQA 2ZPTX 3HBAA 4NBVA 1DKUA 1FNDA 1ZRNA 2VNJA 4UVDA 5EY5B 4DQKA 1U5BA 2HU5A 3AY7A 5DB4A 2EWMA 4ZU6X 2IV3A 4R2KA 2P2ZA 3VZQA 3T4XA 5IXSA 1I5RA 1P80A 1UJ5A 3ILHA 3FOEC 1UOOA 5BN5A 4ER3A 1W94A 5FOXA 3RABA 1U0JA 1OXBB 3ZK7A 5AM2A 2P90A 2YV4A 2G08A 5AK3A 3R5SA 1NVWQ 1XNGA 2HYDA 5DTIA 2K2QB 3CEHA 5DNYB 3I3SR 4E21A 4MPDA 3NDIA 1DC8A 1Z38A 2Q2OA 1K4YA 3E70C 2ZSKA 3W6NA 2YNMA 1J00A 3D4LA 1DBIA 4F85A 1H9BA 4NULA 4WKGA 3WDKA 1DTWB 5ITSA 1IZ8A 1E60A 1OLUB 2J85A 2WMYA 4M1KA 2YRWA 4XOIA 1X80A 3CZAA 1W96A 4Y98A 4D8UA 3CMMA 1HMYA 1Z12A 4MI6A 4NCAA 2DBYA 2XQGA 4X60A 1BIFA 4DPMA 2Y2UA 4HVAA 2VJAA 1IXZA 4FMDF 1LB1B 4FCVA 4O6VA 3E58A 1XF9A 4BVGA 4O59O 4YQFA 3KYIB 1A9YA 2I2XB 4L4ZA 3K9FC 3H75A 1XIVA 1FS6A 1XZCA 1E4OA 2XUAA 2JCSA 2GPBA 2JGDB 5DYWA 5BW6B 2RBKA 1QE3A 1YIAA 1K8QA 4F1JA 1V7PC 2QZZA 3E3LA 1RYDA 1O7JA 2IY9A 2O2HA 3DOUA 4BGEA 3E8XA 2WWXA 3UH0A 1SN7A 2P3OA 2VNSA 3V1YA 4P33A 3I9FA 4OK6A 2EGHA 5JAQA 1IXRC 2C0PA 3KJEA 4AQ7A 2HRZA 3I2JA 4I99A 1E5XA 1LBTA 2PKWA 3E9DA 4Q3NA 4TL7A 2R85A 4DT1A 1IN6A 4LF7B 3A9VA 3MG9A 5ALRA 2ZIXB 3VKFA 5CM2Z 3DSRA 3RJTA 1W76A 3ZDZB 1PLKA 1V8FA 4QRIA 4PLYA 4MGYR 4WXPA 2R48A 2K6GA 2P9QA 4BX9A 4EY8A 4ZOCA 3I1JA 4R3UC 1O96A 5MGNA 3UMCA 2DPXA 3E15A 4OGGA 1QDUA 3L7NA 5DW0A 4RTQA 3MWLA 3LBAA 5CA0B 2FPPA 3F8TA 3GUUA 5LDHA 4KJXA 2HT1A 4CQMB 4QTXA 2OLJA 1GAXA 4AJNA 1WS6A 1PWHA 5COQA 1N32B 4FCWA 3CX7A 3CGGA 4TMYA 2ZAIA 3U4QB 4UUNA 3EEOA 3EFBA 3NDJA 1SY7A 1FFXA 2O2YA 2GZAA 4KNYA 3MCAA 3PSHA 4NABA 3UHOA 1TJYA 4KHPB 1KTVA 4RK1A 1HE4A 1R0SA 5CA1B 5CD9A 1KVSA 3TB6A 1PRYA 1U8UA 5C7OO 7GPBA 3VJLA 1ZOOA 2HMUA 4L50A 2QX7A 1TQ4A 3B8EA 3K0FB 4HQOA 4TTVA 4U5QA 2D4HA 5E4YA 2FWMX 5HDQA 3KKZA 1M1ZA 3K1YA 2C5FA 2Q6VA 2P65A 1Q11A 3EN0A 3JYOA 3DHNA 3WNVA 1DBVO 3WK9A 4ZZ0A 5DOVA 2BN4A 2KLHA 3ZNQA 2R1ZA 3B70A 5DNEA 2AQHA 3CRRA 1STOA 5K20A 3W9BA 3BEDA 1LPNA 5I7SA 3HN6A 5K8LA 1ZUNA 3VNUA 2VC2B 5A5VA 2BEVB 1PYGA 2C0QA 1NP3A 3C3XA 3QUAA 2GUWA 4NBWA 2Y9MB 3K5IA 2XMBA 2AYZA 4LQ4A 4RM2A 4H1VA 1E66A 4KQ2A 1VB3A 3W5AA 1SXJB 3UGKA 3WQBA 4PR3A 3VR5D 4A8TA 4F9GA 3AETB 5L7TA 3HYTA 1YL7A 1N2CA 1M1NA 2WUGA 2O5VA 2D2XA 3NOOA 4BIIA 4QG3A 1ULAA 3DAPA 1UJ4A 3A4MA 1DC7A 3LRXA 1Q0LA 2YWJA 2VYND 3ZH9B 1ISGA 3TOCA 4FX5A 2ONCA 3MJ4A 5DBGA 3ROZA 1KNXA 1QKKA 1R18A 1ESCA 2QU8A 1AQ6A 2CL5A 4Z7JA 3LPNA 4R3WA 1U0SY 3AQ4A 1OVMA 1R6DA 2C5AA 3AR8A 1VYUA 4E14A 1XD2B 4FGWA 3H2BA 4X6UA 1Y9DA 3RTCA 1FRZA 3VVCA 4JI8B 4FR5A 1BXGB 2PV0A 1EUDB 2Q5CA 3I1FA 4NHEA 2YN4A 2WF5A 2Q9AA 3A36A 3ZD7A 1N2CE 2X2FA 1UBSB 3FNBA 3H18A 1T6XA 1C7ZA 1E1NA 1AXEA 2ECOA 3B36A 3JWHA 1ECPA 3K35A 5BMVA 2F9FA 3CN7A 4M1ZA 1VTKA 2Q4BA 3LUCA 2OAGA 3ZHOA 3SYLA 4W5TA 4FHEA 4K6GA 2HRRA 3ZDBA 4KXWA 5K0GA 1K5DA 2Z56A 4JLNA 4WI1A 3ZWXA 1Q1AA 1P2BA 4H15A 5DCYA 3FSRA 1P62B 1RKXA 5AQ1A 1E0AA 2ZYGA 3UMMA 2J0QA 1GUAA 1TZBA 2ZRDA 3MLBA 3AR4A 3JQFC 1CQXA 3OY2A 4LHEA 4PIVA 5AK0A 2XB2A 1EDZA 2EF0A 4TZ0A 3P2OA 2V4ZA 1JBKA 3KXPA 3RPEA 2ECQA 5K05A 1C14A 4L0DA 4ZCTA 4HMQA 1ULUA 2GBLC 4X66B 4X7PA 4KU4A 3NWJA 2FSGA 4B2LA 4HUQA 3HY3A 2VCYA 4QOFA 1NNUA 3IPRA 3SXUA 1PFUA 1SA0A 4UU7A 1RQGA 3L7IA 3EOBI 1I13A 4MQEB 3ME5A 3NATA 2EXXA 4PNPA 4II3A 2KBFA 1IY1A 3FVRA 3GGJA 3IBYA 3R3UA 2EW2A 3U26A 3A1VA 1RI4A 2YVUA 1TFUA 1ZCZA 1QC5A 4KN5A 1UPFA 2FPSA 4RTRA 2Y93A 3OQPA 1L4KA 2XMRA 2XTZA 5IAEA 5F21A 3GMSA 3AHDA 5KTOA 2V3VA 2VQFB 1F8UA 1XX6A 1YI8A 4D3DA 3L46A 1L4HA 1VLMA 2ADFA 3MFYA 2I76A 3IQHX 4NZZA 1NUHA 3B3JA 1FP2A 2NQ8A 3P9IA 4V0KA 4JV5B 2FPUA 2ZGVA 4HEJA 5BOVA 5I7RA 3GJRA 4OL9A 3FCXA 4WZAB 1YFKA 1LW6E 1V43A 4S1NA 1Z7EA 4WBNF 4UATA 2R4UA 3EEBA 1XR3A 3AJRA 1U2RA 1PFWA 3P0RA 4FYPA 2NSJA 2DQ4A 1NR7A 4RKFA 3AEYA 1SCJA 3FWNA 2E4UA 1DAMA 5DHPA 4CL8A 2XCRB 4LFCB 3UB4A 1QGZA 2PUHA 1OTYA 2NSLA 1WB4A 4GZ5A 4B35A 3D8RA 1P1BA 3W2HA 1MA3A 5JANA 1WDWB 3N2GB 3P0FA 2PJZA 3VYTB 1PK9A 2WABA 4OFBA 1SXGA 2RFLA 4I1VA 4KUGA 3DM9B 2BWJA 2K5UA 4BVAA 3W79A 3HN2A 3OQ6A 4P7GA 4ZEWA 3IAXA 1XZQA 4Y0NA 1CQIB 2XMDA 4I5FA 1C81A 3QFRA 1SBIA 2R8XA 2G8NA 4ABTA 2JFBA 3K1AB 5L6LB 5HZMA 3GCWA 4UD2A 3TRKA 4HTFB 5BNIA 2QTMA 4XFDA 4MIYA 2EFCB 2QE6A 4QUKA 4GMDA 3V6MA 2MTBA 3AEQB 3TNJA 1KI6A 1KYTA 3TMKA 3HSYA 3KRTA 1G6HA 5KSZA 3OF5A 3EXEA 1AQIA 4PO3X 5EIHA 4ED9A 1VE6A 3RYHB 2AT1A 3G23A 3NP9A 1GTG1 4JELA 2C04A 1E20A 1VBMA 4L5BA 2YNMD 2CUZA 2AIRA 1GTMA 2QX6A 2I1WA 3D59A 1GZHB 2UV8A 3EVDA 2GM3A 3E1KA 1A9XA 2Q2QA 3HWRA 3JZDA 4JYBA 5F7XA 2DQYA 1QX3A 3FIUA 4TRMA 5EXSA 4OGFA 1HDRA 3B1VA 4LFBB 2W2KA 3QXJA 5TS3A 1VL1A 3BHJA 5EE3A 1G7CA 2GRAA 2VTBA 2E55A 3GEMA 4IZOA 3JQRA 5EJ4A 5AJXA 4CFZA 1CEQA 5CB8A 3A9TA 4V3BA 4NONA 4ZC8A 3NS7A 1G20B 3F9CA 3M5DA 4QOIA 2PL3A 3PI6A 1QHYA 1SU8A 4XIJA 5C52B 1YA4A 3FIJA 2ZUBA 5IAGA 3CZMA 3IBTA 3BWEA 4IILA 5BQ3A 4TUYB 3OQJA 3TOVA 2AN1A 4HGPA 4UUAA 4Q02A 5I9TA 3VSCA 4FP9A 1T2UA 2ABWA 1EINA 3TL6A 3U81A 4ENPA 4XD7A 5FEUA 2OV8A 2RONA 4IIYA 5DE3A 1SHKA 2Q4EA 1XEWY 4QFCA 1HURA 2BFOA 3C7TA 1D2GA 1YQQA 2FOXA 3ETDA 3K15A 3NXSA 4JJ7A 1HKHA 3B1JA 1V25A 3OPNA 2AFIE 3GRRA 1BGWA 3ETCA 4CKEB 2MSCB 4R54A 3V34A 4L5AA 3B5IA 4QU5A 3VU9B 4RV4A 3LGSA 3NRBA 1UT5A 2H92A 2VT6A 3GT4A 3I6YA 3K2BA 4W6QA 3WQQA 2HWYA 1OUMA 1C3EA 4MGKR 1BS1A 3BSYA 1ST3A 4EYSA 4GEGA 4OUKX 4EM6A 2GVNA 3BIFA 1T4CA 3U80A 3SG0A 4MWBA 4BFVA 3C6KA 1QXSA 2NU7A 3HZOA 3HA5A 2GN2A 3IKMB 2IOYA 2FFBA 4JBNA 1N1MA 4NDZA 4YCDA 2BTQB 4DJ5X 1ZISA 1ZIDA 3BK7A 4PG8A 1KS2A 3FHJA 5K3FA 1MPXA 3CO5A 3ZNNA 4ENVA 4N7RA 1V5GA 4WJLA 3C4QA 4XYLA 2Y0EA 1IATA 4Q3KA 4GM4A 2BMVA 2ZKIA 3QELB 4I19A 1BROA 3QOXA 3T0GA 1UJ2A 3V1MA 2P5YA 4CEJA 4YC7A 5BQXA 1XLWA 3L7OA 2H51A 1GA4A 1EQAA 1SC4A 3GP3A 1C9DB 4IRMA 3CW8X 3KB8A 4JBIA 2CUTA 4FYJA 4ZHQF 1U04A 2VHUA 3FGPA 3QWIA 4PNEA 3INRA 1ISRA 2BKEA 3PPIA 3IE0A 4C5BA 4W4TA 4NCIA 1BQ3A 4R8RA 3AKYA 2C00A 3R6TA 5K3OA 4JXZA 3KE9A 4M8SA 1O6BA 5AUNB 3GFQA 3O8LA 2OTCA 4ZTZB 2HLHA 3DE3X 3NDPA 2X8AA 1KO7A 3O8BA 4JT8A 3GGCA 3V4FA 1DAHA 3D02A 1R8JA 4OJMX 3V55A 1KEWA 4MV4A 1BS2A 2VDQB 2L82A 2M1XA 2QG9A 2PZEA 2AZ4A 1FRFS 4RZ2A 5F1PA 5LP6A 3IUEA 3JS5A 4YV7A 1E6EA 1BGVA 4FVTA 4FZ3A 4Q4JA 4K88A 2PO5A 3HLYA 4MDHA 5BSUA 1RI2A 5JATA 3ND6A 2Y0PA 4WN3A 2WJ3A 2ERXA 1KIFA 3LUJA 4C6SA 3CNQS 1Z68A 1THMA 1XPUA 3BD9A 5IDVA 4QUAA 5I6DA 2EFHB 4C87A 4V2UA 2VRWA 4H7HA 3V1TC 1XXLA 4LC0A 5BN4A 1G7RA 2WOOA 3ANTA 2RHRA 4DMMA 2IOHA 3B3FA 3CU5A 3D81A 4OK3A 4DCGA 1ZOSA 2W11A 3SDSA 2PSEA 1Q74A 5BUQA 5EP2A 4KOAA 3M9XA 2JLQA 2WYIA 2Z8ZA 4NIMA 2LBPA 4NU0A 2H1OA 3EIFA 4V0LA 2ZYWX 1XSEA 5LU9A 4J07A 1OIVA 4X9XA 1NJ2A 2ZS7A 3BEOA 3SWWA 2X14A 2FLVA 3AY6A 2CE7A 1MABB 2DFVA 2B3TA 4FSDA 1NW6A 4LXGA 5TT1A 3U4AA 2RJ3A 4AZSA 5KYYB 1RI1A 1Z4JA 2DQSA 2XMCA 4P6VF 4PAWA 4US1R 5IT9A 2WD7B 4OHZA 3OLZA 2G0TA 3B12A 1UK8A 5A9SB 1DZ3A 2CYCA 1G0NA 4RGBA 3UXEA 1DKOA 1M8FA 1VPVA 3A6EA 4NMXB 5ALWA 5HF5A 2VHTA 1A88A 4C01A 5CDGA 2PBZA 5LOVB 2ZZKA 3K6KA 3IO3A 1Y33E 1IBCA 3O21A 1AKTA 1NNI1 1GLGA 2I4RA 4NZPA 2XDAA 4KBGA 5B1IA 1L5WA 2MINA 4O4LF 1CXZA 4OEHA 3TM5A 4RNCA 1GRRA 2QD2A 3BRQA 3WRXC 3L1VA 3OEYA 4LYFA 4D8XA 1MAHA 2QMZA 4G63A 2WTEA 3USCS 1SC6A 3M4NA 4LGYA 1BW9A 1AE1A 4JBXA 5L3VA 3GU3A 2VDUE 1OAOC 4EEZA 4EDFA 1RRGA 1A2QA 2QB5A 4K9LA 1YU9A 3EDYA 2IU6A 2CCGA 2IXTA 4O4IF 4ZT6A 1U8XX 4AWBA 2C5EA 3ZHXA 1JJ7A 4EG7A 4YP9A 1MZPA 2ZJFA 2X7HA 4LTMA 5M34A 5E9QA 1V26A 4POOA 4TSKA 3AF1A 3M1YA 4WZZA 5E6RA 5AM0A 1G9TA 1RZVA 4M0CA 1CW2B 3I4FA 5AYVA 3VZCA 1A0OA 1ATZA 4EFLA 1XE3A 2X8BA 1FSFA 1Z13A 3NAZA 4US2R 4RELA 4GNRA 2PFSA 4LJKA 2W9XA 1A7AA 2ZEJA 5CHEA 4A1OA 5ADHA 1YZQA 3ZLUA 3KG2A 2AEMA 3EZGA 2E5LB 3FPAA 1TM1E 4EO4A 4BUZA 2BKLA 4F6LA 2J3EA 3TLZA 5LM3A 2ALJA 3GY0A 3AEKB 2WQ6A 4BEBA 1XDSA 3GDOA 1BE1A 2YRXA 3VYVA 4O2BA 3D3KA 1FZQA 4W99A 2PVSA 1DCFA 2J5XA 2HSJA 3PQCA 3KUCA 3HVHA 4R8VA 3PHHA 1YV9A 1P4HA 4H9GA 2OK7A 1ZEJA 4W5HA 4DLXA 1C30B 1TD9A 5HJ2A 1TPZA 4RF2A 1G3MA 1MXFA 3L84A 3UM9A 1HY3A 2B4QA 3VVMA 3W7BA 2HBYA 1UBMS 3N2ZB 3LKZA 2WUEA 1F14A 3EB9A 2OPHA 1CZHA 1RYZA 2RKWA 3UT6A 1L7XA 4E5YA 5CXSA 2CNOA 1NBOA 4IZIA 3UMSA 1UXOA 2QN9A 5F2EA 5KC9A 1E7QA 3O03A 2OM6A 4QKQA 2DP4E 4DMKA 2PX3A 1TO2E 1YR6A 4O2RA 4CIYA 3VKUA 2OMEA 2VI5A 4JVNA 3VOSA 1ZAYA 3H1FA 4I55F 1W75A 3II6X 4LPSA 1N5DA 3GCDA 2GEUA 5IJWA 3NVKI 4TQAA 1DGQA 4GU5A 3DG9A 3N5CA 4K9SA 4ZEXA 5KWIA 4CR7A 1WTCA 5CDFA 2JATA 3VHQA 1OV6A 4RFSA 4AY4A 3LUFA 2ATCA 2CNNA 5B4VA 1CRZA 2ZB2A 2NZ8A 1D0VA 3MQ4A 3P0HA 4BHTA 1QLJA 3BGDA 3DXYA 3CB4A 5HS6A 4B3SB 3KNZA 1CRWG 4D9CA 1OWMA 3MRXA 1Z0IA 2ID7A 4QUEA 2R1UA 3P2MA 1YMVA 2ON6A 4A0SA 2OYRA 4EKIA 3HO1A 4IGEA 2X41A 1G5PA 1QGUB 1U2ZA 1RTTA 2EFGA 4Y2HA 3U3JA 3MMNA 1OFTA 3W0LB 5CDUA 3A1WA 3FZYA 4MUEA 4UARA 2YFHA 3WRWA 5BSVA 1G8MA 4NOLA 4MULA 5CGZA 1VGRA 2B7CA 3ASZA 3K0CC 4KO1S 4H2DA 4MYTA 1PGOA 2FU5C 1CUZA 4PCLA 2OEPA 2PWBA 4QQ8A 2GWHA 4L1KA 5CT9A 2BCJQ 3SZGA 4ZEVA 2Z6UA 2YOHA 1WHTB 1ZH6A 1KEUA 2E6UX 2J9FB 2ANBA 2O3TA 3CLHA 3CLVA 4XD7D 4MB2A 2ZRNA 3GK3A 5B1DA 4Q19A 4B6RA 1GA6A 4ARZB 3JARB 3DO6A 3G02A 3SOPA 2ZWPA 3WL3A 2ZIAA 1SIBE 1SXIA 4M49A 5EZ6B 3TZQA 4KHZA 4C2TA 5F77A 1GL6A 2BJVA 3BDVA 4QEZA 5LKRA 1ECBA 1TECE 1I4TD 2FDXA 2YHBA 1T9CA 2FRXA 1E77A 4MKZA 3IIEA 4QPCA 2XXJA 1QHXA 2EX4A 4QFBA 3EVTA 3A6FA 2C84A 3AHCA 4JKYA 3S68A 3CRZA 2AC4A 4DCOA 1X7GA 4UHKA 1NMZA 3I30X 1E63A 1ONOA 1ZIOA 1XNQB 1L7BA 1QNLA 2W58A 2DX7A 3WWEA 2CGEA 1UBEA 1YULA 3UGJA 4Z7QB 1V96A 3PGLA 4BFSA 1I9GA 1PS0A 3K31A 1OB5A 1UKAA 2BCEA 3HR4A 2C7OA 2GI4A 4MARA 2PPLA 3LQ4A 3R77A 4Y2GA 3V8QA 5KQGA 3ER9A 1PNRA 3EHEA 3CMCO 1ZESA 1JECA 1U8EA 1YZYA 2G9RA 1GHTA 4F9EA 1DX6A 3IP7A 5IJZA 2AF4C 4K9PA 4DLBA 4UTXA 1QHGA 3FPBA 2OHXA 3L8CA 5KQLA 3K1TA 3Q9UA 1E69A 5H0IA 1O87A 3VSAA 1TLLA 421PA 3LLMA 1SVLA 4EUNA 5TQ0A 3ESRA 4BQEA 4YMHA 3R5HA 2WR8A 4JI5B 1YVUA 3ZCXA 4LX0A 2I7DA 1N8NA 1TZ2A 4Z54A 1U99A 1EVYA 3NHSA 1H0RA 3PNOA 2AN9A 1GKUB 1OV4A 4K6OA 1WQ3A 1DC4A 3T5DA 4W1SA 3X2EA 3GA0A 3N0RA 1OBCA 2IZ7A 3KEMA 1IHOA 2W4MA 3DV9A 5I4KA 3I2YX 5ENZA 4E12A 3ICEA 3PR1A 4EA6A 4DLSA 2P68A 3JW8A 1FW8A 2XJ4A 4B76A 3JQDA 3L8HA 2MDTA 3PF8A 2C2GA 1YS2X 5IBQA 1EDBA 1MVLA 3GIDA 5DBOA 4D79A 3BCSA 4PX3A 1MJHA 1ZW6A 2AG6A 2WDZA 4G24A 4MROA 4QHTA 1D2AA 4WADA 4RIHA 3RRFA 4CU5A 3I0MA 4DSUA 3TFOA 1TD1A 3OA0A 2VJKA 2C9DA 4HEA6 5B1SA 3PGKA 4MTCA 4BYGA 4DJDC 2TMDA 2F3QA 2O8VA 3IUJA 1UC5B 3B6EA 4WXHA 3P27A 4E30A 2WM9B 3KR2A 3GQVA 4LSMA 5IS2A 1VE1A 3DGEC 3LOUA 4XTRA 1GZ5A 1TJ4A 4GQBA 3RSCA 1Q20A 3CG0A 1Q3KA 2ZUTA 1XYGA 1ZMBA 1QH8A 2CEKA 2J1LA 3IEIA 5T6MA 2ECPA 2X8LA 4UEWA 2G83A 1VGVA 3RBZA 3KFLA 3LGAA 4F8YA 4PYIA 3NHYA 4M83A 1WR8A 4HJRA 2JDIA 3OO0A 1E2EA 2XZLA 3O6VA 4UD6A 5JBIA 2XYGA 5JSFA 2CLCX 4EB6A 4F8JA 1PAUA 1TGVA 5JS8A 1B4DA 1KKLA 3F6EX 3N75A 3QEMA 3I09A 2IBTA 4JROA 3C1AA 4RO0A 5LVAA 2BFBB 2ST1A 4EW2A 1NC1A 5CLLA 3I39X 4C76A 5KOHA 3QOWA 1NI5A 1Z33A 1RHJA 1IY9A 3PQ5A 3I83A 1E2KA 1KRXA 1ZJJA 2QLLA 5MF6A 4OJQA 3U7QB 3N6XA 2DOKA 2PLWA 5K5EA 1XNHA 2VDVE 4DWOA 1P5ZB 3B52X 2UYQA 1KEZA 2PGOA 3QQPA 2H4XA 1UMCA 4G0NA 4B7ZA 2Z43A 4HNVA 2QV0A 5FX2A 2NP6A 4D42A 1OXUA 1T2AA 5GJWC 5CLHA 1GUYA 2D1RA 4EZBA 5IZCC 4N3NA 1LKZA 3SQNA 3T12A 3UANA 5KS2A 1HETA 1PG0A 1ODIA 3LHKA 3QU2A 2WZBA 2QRVB 4C0AC 2OHJA 5DCLA 3KPWA 1T26A 3VU8A 1AC5A 1AURA 1GG9A 4KL8S 2BE7A 3THXA 3A31A 1GCGA 2JBAB 4YX9A 2VUIB 1IOLA 5EJMA 3COPA 3HU5A 3LCVB 5ENVA 4ZQIA 4D3ZA 3DUFA 3F5QA 3LC2O 4ZTBA 1TQHA 3UT5B 3HYCA 3ZLTA 3SX0A 4AJHA 2GM4A 3ZGYA 2ZYIA 2CXUA 2O2JA 3BTVA 4KDRA 3UHPA 4DDTA 3A26A 3COVA 3X0DA 4GGMX 2O0JA 1U2QA 4KFSA 2GR9A 5TGZA 2I8AA 4I1SA 3L9WA 4LPKA 4XQGA 1DC6A 4MHSA 4TQUS 3C3PA 5DI3B 3VNAA 2XNSA 3G2KA 4ZO9A 3ED1A 4Y0AA 1GGVA 3KOYA 4WGFA 2WIAA 3G0CA 2X4IA 4QHYA 3OLWA 3TIXB 1H42A 1E1MA 3UT0A 3HB5X 5TPZA 1XC7A 3IXLA 4BE4A 3G17A 3HJUA 4PIMA 1ZW1A 3V7YA 1S8NA 1NPYA 2VYVA 5K6TA 2I2DA 4M8IA 3TSOA 3W4KA 1FF9A 2QMHA 4Z4HA 1UBOS 4G0WA 4UUMA 1Y8CA 2D8AA 5KWVA 1NJ6A 1R6AA 4G5YA 4J8PA 1W5SA 1Z4KA 2ODWA 2OOSA 3D64A 3GP5A 4IIJB 4J4TA 3MWEB 2W6OA 4Z4GA 5CCBA 1YKGA 1OZAA 3EDQA 2C57A 2Z04A 1AQLA 3RYIA 1OGJA 1X8KA 5A71A 4CF3A 1NW3A 4HXEB 4BCCA 2P9YA 2FCRA 4YEDA 4I6EA 5IXJA 1Y3HA 3GNLA 4HRYA 5BP7A 1N9GB 3G13A 5I01A 2I3AA 4GP7A 4JLPA 1EGMB 5FYDA 1P4SA 1T6YA 3IP3A 2NQTA 2QVGA 3HB4X 1T35A 3KXKA 2VQDA 4ZK2A 3IOEA 4ZHSA 3A7EA 1EWYA 1YB5A 2YC2C 4FS3A 4HQNA 3ST7A 5JJBA 1BN7A 2O0LA 2VOJA 4OHOA 3SFTA 5A0TA 2COEA 1DIAA 5FF9A 4CWAA 1SFRA 1DKLA 1YGPA 4RTSA 2ZSHA 1DQYA 1M2HA 3UTCA 5KTSA 4MO2A 3KLMX 2P5UA 2BDTA 3W6UA 1F2UA 1RHKA 2ONKA 1LRKA 4Y2SA 1P5HA 4B6JA 1ZD8A 2WIBA 1OI7A 4MPTA 4IVRA 3DDWA 4K6CA 3PJGA 1NFQA 2Z98A 5F9HA 4JUAA 1KPHA 2OBLA 4IOLA 4Q1BA 1JDBC 2NO5A 4MS1B 1IK4A 4KMOA 4N5HX 3U3DA 3VNQA 4CTJA 1C80A 2Q1XA 3BWXA 3A2LA 4QL3A 5ESWA 4CGYA 2IZOA 5LQKA 3CUVA 4KG7A 5M5BA 1YJ8A 2DWCA 2PUAA 2AD1A 1CU1A 4UAVA 1I2DA 3PGVA 2BUAA 3SSOA 4DCPA 3CBQA 1UM9A 4TN5A 1KYYA 2XUZA 5HP4A 2B8EA 4DEVA 2YYAA 3K96A 1QBKC 1EUZA 4IDFA 1GLNA