4WCFC

Trypanosoma brucei ptr1 in complex with inhibitor 9
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
267
structure length
244
Chain Sequence
b'EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVKTVETQVAELIGTNAIAPFLLTMSFAQRQNLSIVNLCDAMVDQPMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pteridine reductase
publication title Exploiting the 2-Amino-1,3,4-thiadiazole Scaffold To Inhibit Trypanosoma brucei Pteridine Reductase in Support of Early-Stage Drug Discovery.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
total genus 89
structure length 244
sequence length 267
ec nomenclature
pdb deposition date 2014-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4wcfC00
1WW8A 5MDHA 2O4UX 2FMUA 5U4QA 4UULA 3BMQA 2DVMA 3H5NA 3UCFA 4XD2A 4B3IA 1LRLA 3NT5A 4OXYA 3WIEA 4EJ0A 1OI7A 4UEOA 1DHTA 4QXMA 3JD0A 4CUZA 3A4VA 4IQ0A 3H9GA 4R54A 1LDEA 2F00A 3QWFA 1P74A 3ZHYA 3WXBA 5KJFA 2C82A 5ES3A 1UR5A 2YV1A 4JQCA 1Y5MA 4INAA 3QQPA 4LRTB 5K6AC 3GGGA 4BNJA 1C1XB 1ISGA 1KVTA 2O2YA 4J7CA 3ZV6A 1B8UA 3CKYA 3E5MA 2H1SA 4BO8A 4AJ1A 3C7CB 3MZ0A 1GPDG 3GFGA 1G0OA 3WMWA 5L7YA 3CMCO 1LEHA 3WFIA 2J5QA 4IS2A 4MVJI 1I10A 2A94A 4Z9YA 4WOJA 5DNAA 3K8ZA 3QVWA 3H5AA 5HRUA 1Q7BA 1P9LA 2EKPA 1E3JA 4JX8A 5THQA 3V2UA 4CMBA 2EEZA 2D59A 1ADBA 3P2YA 5KVCA 1L1FA 2PGJA 1NP3A 3OIFA 1PU2A 3I23A 4CR8A 3MOIA 4YQYA 1XELA 2EF1A 2GD1O 1PJ2A 2YDYA 1F0YA 3PVZA 4O1MA 1YH3A 3L77A 2PR2A 3DZBA 3PLRA 3ZWVA 5IN5A 2VHXA 4P38A 1O9BA 3ORFA 1EMDA 1E3EA 1SOWA 2CF6A 1U3VA 3HQ4O 5IDYA 1HLPA 4BMNA 1YJQA 2QYTA 3KV3O 4NBWA 4E6PA 2NM0A 1NVMB 1QP8A 3E18A 4KQXA 1EE2A 2Q99A 4CJXA 3ANNA 3GHHA 4YT2A 2GZ3A 4LVCA 5HS6A 4CODB 1VKOA 4IGFA 2V65A 3JQGA 4PIVA 4MP6A 3KB6A 4K26A 1FMCA 3V1UA 2WEKA 2E48A 1R6DA 4BNHA 3W6ZA 4CLOA 4Z9FA 3X2EA 3BIOA 3JQ7A 1Q2XA 2PA3A 3QJ5A 2E49A 5KKCA 3GEGA 2X1HA 3JQEA 4J91A 4CMEA 3AFNA 2VYND 5C37A 4NU5A 1DJQA 4QUKA 1QSGA 1G0NA 4HBGA 1XQ6A 2O48X 4PZDA 2O3QA 4CQLB 4ZHSA 3W4IA 1EUZA 4YVFA 2ZB8A 3H9JA 5TT0A 3QV1A 1K2WA 2GERA 1DC5A 2C29D 4DC0A 4HNHA 4DGSA 1Q0QA 4TVBA 1QORA 4U0KA 2W2KA 3EHEA 1DDOA 5IDXA 1ZXBA 2GLXA 3ST7A 3VAZA 5JC8A 1NR1A 1LBEA 3ON5A 3MJEA 1XDWA 5BSHA 1VE9A 4RVUA 1I2BA 3GR6A 4FDAA 4CLHA 1ZK1A 3NTRA 4WLVA 1GV0A 1ML3A 3TQHA 5JAZA 2OL4A 1F12A 3FTPA 4FB5A 4TMFA 3WJ7A 4C7KA 4EUHA 4OL9A 3WLEA 1MLDA 4M1QA 4WGGA 3U4CA 1U5CA 5JNLA 1YO6A 1LRJA 4I5DA 4PCVA 1BW9B 3F4LA 1E6EA 3PIIA 2GN6A 2QZ9A 3PP8A 3LC7O 1MXFA 4Z0HO 1NFQA 3PHHA 3HUDA 1T1RA 2AG5A 4XDYA 4ZRNA 2NLOA 4OIMA 4DLLA 1Y8QB 1O8CA 2F1KA 2CNBA 2DTXA 1YXMA 4NNJA 2CVZA 2BHLA 5A03A 4ALJA 1DFHA 4KOAA 3TNLA 5J23A 4R5HA 3Q0EA 1P1IA 3F1KA 5IG2A 1ONNA 2YFHA 2XAAA 5L4SA 4E31A 2JFGA 1HT0A 4BNMA 5BSFA 4FC6A 2UAGA 3OP4A 4GKVA 2IZZA 2FZEA 3PRJA 4O59O 1P0CA 2Q1SA 4PLVA 3V1TC 1TLTA 3CMMA 4CMAA 2EWMA 5G2OA 4R4JA 1MX3A 1KVRA 3HZZA 3ZHXA 2Q1WA 2ZB4A 3DBLB 2JFHA 3ABIA 4MVJH 1NPYA 3U3XA 4M54A 5L51A 2QIOA 1LDYA 3C85A 1I32A 1UP4A 3BMNB 5L40A 5JMPA 4LSMA 2FN7A 3PFFA 1F8FA 3VOSA 4GGPA 1RYDA 4BKQA 3IDSA 2NU8A 1ZJYA 2YY7A 1JWBB 2YHIA 3ADOA 3WGGA 3C1OA 3ITKA 1U8FO 2ZQYA 4IMPA 4B8ZA 4DIOA 1BMDA 1JWAB 3PZRA 3FN4A 4RLSA 4CLXA 2D3TA 3DL2A 1SO8A 4J2OA 4OXNA 4B4VA 2HKIA 4K28A 2DKNA 5F1PA 1YL7A 4XR4A 3HB5X 3JQ9C 4EBFA 4F46A 4J43A 3IL2A 3KTDA 4B7XA 2B83A 2RH8A 4Q3NA 2ZK7A 4ONEA 3SXPA 4PLPA 4MKRA 4PLFA 4ZQEA 3EZYA 2O3JA 4Y67A 1HDZA 4Y98A 5GMOA 5FWNA 4WLUA 3GEMA 3O26A 3B6ZA 3BMQB 3SLGA 2OOSA 5C7IO 2PFGA 4BGEA 4IQGA 5JYDA 1H6DA 3JD1A 5AYVA 3IIEA 4U5QA 1R4MA 4UVIA 3ULKA 4OGWA 1LDMA 2I9PA 1QYCA 3NRCA 3G1UA 3FRJA 3IOYA 1F17A 2QHXA 3KYCB 1N5DA 4YDRA 1X7GA 1E3LA 3LT4A 1H9AA 1YBMA 5TF4A 3VVBA 2B5VA 3GG9A 3WB9A 1FXSA 4FC7A 4IPTA 1YS4A 2O4CA 3ROKA 1YONA 3V5NA 4R9RA 2EG9A 2HK7A 3UUWA 5KNLA 3OMLA 3RU7A 5T8KC 4IGEA 4BNGA 3NDRA 3PGJA 2HDHA 4YA6A 2JFFA 1B2LA 1ORRA 2YQ4A 1WP4A 4YTEA 4ZVVA 4RF2A 4YCAA 5I8ZA 2GNAA 2C5EA 4OOFA 1HE4A 1PEDA 4P8RA 1O6ZA 3VC7A 1GQYA 3GZ4A 3QP9A 3E1KA 3WTBA 1MFPA 4GWKA 3K9QO 5FYDA 3T4EA 3UW3A 4A5OA 4JJIA 2B4TO 2DU8A 1CEQA 3ZWOA 1IUKA 3HDHA 3FI9A 1I8TA 3RUCA 4YRBA 2PZJA 4A7PA 1U8XX 3JD2A 3I5MA 4BO3A 5L9AA 4XYEA 4XYBA 1PJ3A 4BB6A 3I1JA 3WLFA 2YV3A 3HNPA 4CM1A 1SB8A 4JNKA 2BI8A 4TZTA 2NQTA 3H6KA 2Q4BA 4E2YA 1HYGA 4RPKA 3WSWA 1LRKA 2X9GA 4I9NA 2X0RA 1T25A 5DCUA 5CAEA 2AEFA 4JGBA 4J4BA 4LVUA 3LC2O 5EQDA 2DFVA 4P4GA 4D0RA 1AE1A 4KTTE 3HG7A 1RWBA 5AXCA 5G0UA 1B15A 3NUGA 1BTOA 3ZWYA 5JSFA 3F46A 2A92A 4G2NA 1EK6A 2O3RA 3ETDA 3OEYA 5G0SA 3D4PA 2P91A 3KETA 1N1GA 3QRWA 4Z0TA 1IZ9A 2B4RO 2VWGA 2W98A 4X54A 2VHVA 4G81A 3U62A 4LRSB 8ADHA 3BXXA 1KVQA 4XGKA 1HKUA 1RM5A 2IYPA 3K6JA 3UCXA 5JMWA 4I9UA 2QRLA 1XU9A 4J9UE 4DPMA 2BFPA 3RUDA 1YGYA 4WNIA 4NBRA 3E5RA 4J6FA 2D5CA 4CMKA 2IE0A 4PZCA 1V9LA 2NVUB 1E1KA 2CDAA 3WYCA 3D3WB 2ZTUA 3IP3A 2FHSA 4EJMA 5T5QA 2B4QA 3VHRA 2WWRA 2CSUA 3GDFA 1C0IA 2EP7A 3UXYA 1ISMA 1PJCA 2P68A 1Z7BA 4ND4A 1HE5A 5TS3A 2NVBA 3TWOA 4EYEA 3DAGA 1I36A 5B4VA 3JYPA 4FJ2A 3AW9A 1H6CA 3EGOA 3RJ5A 4MPDA 4L74A 2PY6A 1AUPA 2Y1OA 5IZCA 4BIIA 5CDGA 4DMMA 1SEVA 4N5NA 3R1IA 4MOWA 4EUEA 3O4RA 8LDHA 5LDHA 3NGLA 1HETA 3KEOA 4R1UA 1I5RA 1GDHA 5I7FA 2WJPA 3GG2A 1YQDA 3GQVA 1KVUA 4PVDA 3VPFA 5AVOA 3I9JA 2D0IA 1VI2A 2X5OA 3DOOA 2EGGA 1OBFO 4RPGA 1IB6A 1U5AA 4NQZA 1EE9A 4RVDA 3ICCA 3O38A 2HK8A 2X5JO 4CM5A 3P7MA 4ITUA 4U6QA 4RQTA 5CG1A 4TKMA 2VWPA 2YDXA 5JE8A 3ZW8A 4YACA 3U4DA 3N7UA 3V8BA 3HFSA 3KXDA 3GVCA 1KEUA 1A5ZA 1DIAA 3OJ0A 1B8PA 3HN7A 1L7EA 4N5LA 3WG9A 3UHAA 3WJAA 2FR8A 1U3UA 4JIGA 1HYHA 3V1YA 1UDCA 4URFA 5ILGA 1UP7A 3BYZA 2Z95A 2JJYA 1K6IA 1A9ZA 3UGKA 5TQVA 4ZJUA 3INTA 1SNYA 2WTBA 1PX0A 3R3SA 3NYWA 4S3MA 4F6CA 3FWNA 2YHIB 4JK3A 1UZMA 3GRKA 1O94A 1P3DA 1ENPA 4QFDA 2R2GA 3KYDB 1YJ8A 4YYZA 4PZEA 4MVJF 1LSSA 3TZKA 4K1LA 1RM3A 4J0EA 4RDIA 3VTFA 1I33A 3NAQA 1HZZA 1QRRA 4RV9A 2YW9A 1K6JA 3MTGA 3WYBA 1DOHA 5JCJD 1A7KA 4UEKA 1PR3A 3RC9A 4E32A 3ROQA 2J8ZA 1Y5RA 3L4BC 1XR3A 3DOCA 2VUSA 5H81A 4U0JA 1BSVA 4AJ2A 1D8AA 3DZKA 5IXYA 3MJVA 3LLSA 3DQPA 4GI2A 4TRNA 1E7WA 5G4KA 1X0XA 2C59A 1H2HA 4CQLA 3CPSA 4II2A 3JQDA 1PQUA 1I30A 2C7GA 3IUPA 1Z45A 4U6SA 3DR3A 1PS8A 2PD4A 2PNFA 4XZ3A 1IZ0A 5KVQA 4Z0PA 3DTYA 4GMFA 3TSCA 4NPCA 4FGSA 2ZTVA 3CZRA 4P22A 5BT9A 1WMAA 4RF3A 1E6WA 1PL7A 3OJEA 4LSWA 1R16A 3OM9A 1NFRA 3N58A 4OKNA 3ZHZA 3PJDA 1UUFA 3FCOA 2BRUA 2O7QA 3QWBA 3EK2A 3LT1A 3O9ZA 1RM4A 1BDBA 1HDRA 4RO0A 4XB1A 4UVEA 2BLLA 2VHWA 1DO8A 4BNLA 2JHGA 1AGNA 3TF5A 5A9RA 3QIVA 1A9YA 1UJMA 3JQFC 4I1IA 3RUIA 4D46A 3INGA 1BW9A 5T64A 4DXHA 1ZFNA 3AFMA 3Q2KA 3Q9UA 2DTEA 2Q2QA 4NIMA 3KEQA 1KIFA 1Y8QA 3QA9A 3MTJA 1O0SA 1DRVA 3MWDB 5CP8A 3UFXA 5KVSA 3F3SA 3GC6A 2UVDA 4WE3A 1XEAA 4BNTA 1KY5A 4CR7A 3GK3A 3ANLA 2PKRA 2ZKLA 2HU2A 2CY0A 1CIVA 2EW2A 3FBGA 3S2IA 3GVPA 3SX2A 4DMLA 4YXFA 1LLUA 4FQ8A 3L0DA 3TFQA 5EINA 1ISFA 1JKIA 4CV2A 3PJFA 1XLTA 2AQIA 3WFJA 3L6DA 1GZ4A 1GTMA 1E7MA 3ZU3A 1UXKA 2AHRA 3HJAA 5JAQA 3PWZA 2GN8A 3CZMA 4YAEA 2E82A 1ZVMA 3TRIA 4AJOA 3DZFA 3ZW9A 5KIAA 1JU9A 3KOUA 4QX6A 4M49A 3DHEA 1YL6A 3INRA 3OIDA 4CUJA 3OJOA 3LK7A 3ZWWA 3DBLA 2BFAA 3K2EA 3A14A 3EUWA 6LDHA 4BOYA 1V6AA 2J3JA 5A5FA 4JJGA 5KJ1A 4H3VA 4XJSA 4W4TA 2DBQA 4W99A 1U7TA 4E21A 3IUSA 5BQFA 1TA4A 5JAMA 5AXAA 3PHIA 4W9NC 3LVFO 2DTDA 2Q4EA 2WD7B 1GPJA 1C0LA 2VQ3A 4BNZA 2HMSA 5I7VA 1DFGA 3AY3A 3OSUA 4BO4A 1XWFA 3V2GA 4A10A 2P4QA 5JDCC 3H2SA 2VYNA 3HDYA 3L07A 2VT3A 4ALKA 1JN0A 1HTBA 2BGKA 2VRCA 5KVVA 1E3WA 4NDNE 1ZO8A 4ID9A 4WJZA 1DIHA 1DC4A 2NTJA 2AE1A 1M6HA 1MGOA 1P1HA 1YBVA 2ZJ1A 3IMFA 4BKPA 4PG6A 4CM8B 5JDIC 3E82A 3H9UA 4OJNA 2HSDA 1LLDA 4YJDA 1U3TA 2RH4A 1JKJA 4CLDA 3NV9A 3TZHA 3BZUA 4K6FA 4J1SA 5EMHA 3GDOA 2W2LA 5IZ4A 4ZQFA 5EN4A 2IRWA 1PGJA 4L0QA 4RCVA 4XWYA 5F1KA 4XQ9A 4UEJA 3RBZA 2W90A 2ZYAA 4Y6RA 3KYCA 1E7SA 3D1LA 3U49A 4CUKA 3PTZA 4L73A 3E03A 2NTNA 2AXQA 4WECA 1UZLA 2DC1A 1ZKMA 2XF8A 1DPGA 1R12A 3JCZA 4CMJA 1UP6A 4MINA 1Y6JA 3PHJA 1FDTA 4WKGA 3E9QA 1QXSA 2X0JA 3RFVA 1PQPA 1MC5A 1MC4A 1RKXA 4BNKA 4TWRA 1EBFA 4BKUA 5IN4A 5JY1A 1FDSA 2FR1A 2PK3A 1DB3A 5TX7A 2P2SA 1T1SA 2QQ5A 2YFQA 4XQGA 4CMHA 1YDWA 3G79A 4K9DA 1JQBA 1FF9A 5ADHA 1N2SA 4CM3A 1MXHA 1V0JA 1PJBA 3BMOB 1WDKA 2Y68A 2BGLA 4UUNA 4OM8A 3UAGA 4W6ZA 1O89A 1MP0A 3JQBC 3K73O 4ILKA 3WICA 1PIWA 5JY6A 1SB9A 5ICSA 3PIDA 2PD3A 3WS7A 4CV0A 1PS9A 1ULSA 3W6UA 3L9WA 2E37A 3KHUA 3AY7A 2CFCA 2D1YA 4FN4A 4ZRMA 3ZNQA 5COQA 4DIBA 1ZEMA 5HWSA 3ADPA 4JBIA 3KRTA 3FNEA 4Y9DA 3I9LA 3WGOA 5CEEA 2GN4A 2PKQP 1XHLA 1HDCA 1QKIA 2GRAA 2EW8A 2X23A 1LNQA 1NAIA 3BTSA 1LDNA 2Y66A 3Q11A 3VZSA 1J49A 3ZWNA 1Q7CA 1IL0A 3BHMA 4CV3A 3RI3A 3PWKA 2VRCD 4BNYA 5G4KB 4CQMB 3RFXA 1IOLA 2RCYA 5JAIA 4DA9A 1WMBA 3BTVA 3Q2IA 4WUVA 3DO5A 3DOJA 4WPGA 2DUUA 4R1TA 1QLJA 3Q3CA 5FI3A 1RYEA 1DEHA 1B3BA 2Q49A 3E9MA 1HSOA 3W4JA 4OYRA 2NVUA 3FR7A 4FSHA 2I5PO 3QWIA 2Q3EA 5IFLA 3D3WA 3JD4A 4PRKA 5B12A 4YBZA 4BVAA 4BO5A 2W2LD 1XKQA 3MJ4A 1HE3A 1FJHA 2ZB7A 3ZN2A 2HMVA 3ZHBA 2VTDA 1WWKA 2DLDA 1JDJA 3TZ6A 4IDGA 2WE8A 2G17A 3QE3A 4BMSA 2VWQA 4FCCA 1YVEI 1A27A 4LK3A 3VKUA 3WOHA 4DUPA 2V6MA 2VNSA 3C7DB 2BD0A 2VOEA 4YB8A 1Y7TA 3TPCA 2E4AA 4L8VA 2DM6A 3BMCA 1BXZA 2H5LA 2D4AA 4YJFA 4YPOA 4DLBA 4H7PA 4M86A 4CM9A 1NPDA 2VTEA 4WEQA 1DHRA 2I3AA 3GOHA 2Y0CA 4M89A 4NFHA 1RJWA 4PLYA 3VPHA 4CV1A 4NMHA 4FFPA 4NK4A 5DP2A 2DBVO 4IINA 4E5YA 3TL3A 2OBNA 5DOZA 4CPDA 2IEDA 3W8DA 4KP7A 1NQTA 5L45A 3R6DA 4NU6A 3ENKA 3MCVA 4J49A 4TRMA 4W7IA 1MUUA 3RBVA 3EW7A 4DRYA 4QQRA 4Z3DA 4FJ0A 5KKAA 5IDQA 1DLIA 1N9GB 3ZNNA 2OORA 5TIIA 4KWIA 5T6BA 3FPCA 4RGBA 4D42A 3L6EA 1X7DA 4Z6KA 5HS4A 1GFSA 3JTMA 5KOIA 3AUTA 3H3FA 2Y1FA 2BFMA 1BGVA 1KS9A 2H9IA 2PV7A 3EC7A 1MA0A 1EFLA 1QV7A 3F5SA 2GPTA 4AJKA 3D4NA 4DYVA 1EQ2A 4KDEA 4EDFA 3DONA 2C2XA 2C0CA 3HHPA 3QSGA 4ROSA 3ZU4A 4CL3A 5HBRA 5GY7A 4L4RA 2FP4A 2Q46A 1H9BA 5BSGA 3GT0A 1ENYA 3IJPA 1SAYA 1GY8A 1WZIA 1HYEA 4GLLA 3FNFA 4IZHA 3AOGA 3VKVA 4F6LA 2QG4A 2EGHA 3IC5A 1TT7A 4M55A 4DC1A 1LJ8A 4OO3A 4CMEC 1ONOA 3RIHA 3KYDA 2NADA 1OOEA 5GZ3A 2X5KO 4L75A 1T2EA 1EUCA 2JD2A 3OA0A 4J3FA 4RJTA 2EIHA 2X6TA 1SC6A 4NI5A 3AUAA 1E3WB 4IDEA 3OHSX 1NYTA 1ADGA 3LSYA 1GR0A 3UVEA 2FOIA 2B35A 3GPDG 2ZIZA 1ZK2A 2BMAA 2OXIA 2BKAA 4QFCA 1W0CA 4Y6SA 1BRMA 3RC2A 1ZK3A 4BQPA 2V6BA 2C2YA 1IHYA 3KSUA 2VNAA 4PRLA 1XGKA 5G0VA 4MP3A 3HB4X 3BHIA 1A7AA 3F4BA 3GN1A 4R51A 4XQCA 4DYDA 4PG8A 5FEUA 1ZMTA 1FDUA 2WMDA 4GBJA 3GHYA 4YJGB 4GMGA 4IBOA 1LTHR 1T2DA 2P9GA 1M76A 1YB4A 2OUIA 1SZJG 3F6YA 3CEAA 4D79A 1IY8A 3WSVA 5JS6A 1K0UA 1LX6A 4ZQGA 4Z3KA 2GN9A 3RC7A 3KLPX 2O3TA 1BWSA 3E6AA 4XRRA 4D3DA 1PWXA 3ANMA 5A3VA 2DUWA 2V6FA 3GVXA 2OO5A 1DIGA 3HADA 3ICPA 4ALLA 1I3NA 1NTOA 2ZCVA 4CM9D 4UVHA 1U1IA 1PL8A 3CSDA 5JPIA 4I8XA 1N7GA 3JQ8B 1NXQA 4WCDA 4BNVA 4E3ZA 3T7EA 1PL6A 1EVIA 4YT8A 2VRBA 1NBOA 1ZIDA 1HDYA 4BV8A 4FOOA 4R1NA 2BELA 1HDOA 2GUGA 2I99A 5DT9A 1ZSYA 3PPIA 2DBRA 4H16A 5CPFA 5TJ9A 3IKVA 4YQZA 1NR7A 2G0TA 3AWDA 1YL5A 3GAFA 4C7JA 1E77A 2RHRA 4MIEA 2C7VA 5LCXA 1VSVA 1ZNQO 1V35A 2VOJA 5DDIP 4AJ4A 4F3YA 1P1RA 3R0IA 4WLOA 1MG5A 2VCYA 1PZFA 2X0NA 3B1FA 4ZQHA 3S8MA 2HJRA 1PGNA 5A3JA 1B14A 2V7PA 1JW9B 1MB4A 1EQUA 3DHYA 3U5TA 3QW2A 4WLNA 4HNGA 3OJFA 2QYSA 3K30A 3W4KA 1CETA 2FSVA 3D5TA 1GUZA 4OMUA 4RF4A 4PLGA 3GVHA 4Q3EA 4AJLA 1GZ6A 4AJIA 5C7LO 3AY6A 2R00A 1O5IA 3NDJA 2H6EA 3I6IA 1ZJZA 4J4HA 3RQSA 3TOZA 5BNTA 1B7GO 1E1NA 2EHDA 2QX7A 4GL4A 3TN7A 3LT0A 2VN8A 3C24A 4E30A 4IIUA 5AXBA 3AI1A 5EIOA 1PJSA 2X4GA 3ROPA 2JCYA 3HDJA 4NR0A 1PGPA 4JJFA 4BV9A 3D64A 1H6AA 1J5PA 4Q3DA 4D43A 3GNSA 3AUUA 4Q3BA 3WGHA 1LSOA 1U2GA 4MVJP 4NFSA 4R3WA 4XYMA 2X9VA 4J7UA 2ZYDA 3PXXA 1H2BA 1SBYA 1GUYA 2ZCUA 4LCJA 3A1NA 4IDCA 4MO2A 3W8EA 1JVSA 5JCJA 2WD7A 1ZSVA 7MDHA 3NJ4A 3PQFA 4EJ6A 3H7AA 1UDBA 5CFZA 3S2GA 3WGTA 5A1TA 3C3XA 2Y05A 3IJRA 4PGFA 4IJUA 4MVJM 5EESA 3P2OA 4MVJA 2Q1UA 1R0KA 3L4SO 4TRRA 5JXWA 4C4OA 1UXGA 5JCXA 4XDZA 1C3VA 1ADFA 4BO1A 3H2ZA 1LUAA 2FR0A 3PJGA 4L9RA 1WNTA 3RUFA 1I2ZA 3BTOA 4WCFA 4CM8A 1I3KA 4XYLA 1KEPA 1P44A 2J5KA 3ZH2A 1HEUA 4JP2A 4XKJA 5MGBA 4Q39A 3QVSA 4L76A 4DIFA 1NWHA 3G3EA 3HSKA 2DFDA 2J3IA 3I3OA 3V2HA 3L9XA 3BMCB 3WBBA 2NVWA 4IM7A 4CM6A 1BXGB 3QWAA 4YJFB 1P1FA 5COAA 4FS3A 3BAZA 4PG4A 1H5QA 4UUOA 4R69A 2JL1A 3EMKA 1Y8RB 3G49A 3K92A 1CF2O 3PLNA 1PGQA 4I5GA 4R9SA 3OJLA 4W7HA 1JAXA 1T4DA 4YRAA 1YE3A 5K9ZA 3ONFA 2FZWA 4TQGA 1C1DA 1I3MA 1U7HA 3I52A 2ZTLA 1R37A 2WM3A 2LDBA 1CERA 3GA0A 1N92A 3RBXA 1WDLA 1M67A 3VH3A 3WNVA 3JYQA 1KOLA 3PK0A 3PEFA 1B0AA 3WTCA 2H63A 4E2ZA 3HDQA 3O03A 3RVDA 2WE7A 4R5MA 1PQWA 2AMFA 3VDRA 1JTVA 3ZNPA 1HZJA 1P33A 3DMYA 1YKFA 4J0FA 1U28A 4TSKA 5U1PA 4AJJA 2DBZA 4FGWA 4JP3A 1F8GA 5JBIA 4MVJG 2GASA 4Z9XA 2P9CA 1PZHA 2EJWA 3BMOA 3GZNA 5LDGA 3WGQA 2B0JA 2NV6A 3D7LA 3SC6A 3W8FA 1ZCJA 3JQCA 2UUOA 1U2DA 3LU1A 1DXYA 2CDCA 3DZJA 3HE3A 4LW8A 1GQ2A 2X58A 1W6UA 4E13A 5L7WA 4CLRA 2GF2A 2PWZA 4OOEA 5A9SB 2QZZA 4EI2A 4DQUA 3VH1A 3ETEA 3GVIA 1BDMA 2Y67A 4RLHA 4QO7A 2I76A 3H65A 4FW8A 1DAPA 4N54A 4PLZA 3VZQA 3RJ9A 3ZCXA 3ZV5A 4ZICA 4MDHA 1Q0HA 2FRDA 5JLAA 4KUHA 2AG8A 2YYYA 4QECA 3ZWXA 3GGPA 4BO6A 3OECA 2VUTA 4XR9A 1B16A 1PJTA 5EPOA 1C0PA 1BHSA 2R6JA 1O95A 4J90A 1BG6A 2PGLA 3U09A 4MVJD 4ZN6A 4KMSA 3GMDA 1L7DA 1DRWA 1I2CA 4PLTA 4ND2A 3VH4A 2GDZA 4AJEA 4CQMA 3E8XA 4HUJA 4RZIA 1AHHA 2C07A 2SCUA 1KY4A 3KM0A 4J2HA 5A06A 3UN1A 2JCXA 3FF4A 2P5UA 2OBYA 1M6WA 4DREA 3LQFA 3GN2A 3DMTA 3R3JA 4XGNA 5C5IA 4E0BA 3H8VA 3VPXA 1YOVB 3FNHA 3CINA 5IZCC 3C1AA 1JVBA 1EVJA 3OQ1A 3EVNA 4B7UA 2QW8A 3OIGA 3Q1LA 2AQ8A 3HN2A 3OF2A 5DBIA 3LF1A 2LDXA 5C3MA 4FJ1A 3S1LA 3ZNOA 3K31A 1H93A 2GZ1A 1G6KA 4DPKA 2FPPA 3PFWO 1JA9A 2UUPA 2NQ8A 3PHLA 4WLEA 2HMUA 3AOEA 3M2TA 5A4DA 2DQ4A 3AI3A 3B20A 1PR9A 3DBRB 5EL0A 4PLWA 3PQDA 2Z1MA 4FBGA 1ZEJA 3D3EA 4U7WA 4PLHA 4MKXA 4ZD6A 3DHNA 4B4OA 1NQOA 1Z74A 5GZ1A 1EZ4A 5FI5A 2WD8A 2RAFA 2QRJA 4RDHA 3TDKA 4IIVA 1OZAA 1M66A 4OQYA 1LDGA 2Q45A 5HTOA 3DFZA 2YV2A 1D4FA 2JD1A 5ENDA 3DBHB 5JYEA 1XYGA 3X2FA 5DULA 2PGDA 3UCEA 4ZGWA 1ARZA 4BGUA 4A03A 3AJRA 2ZQZA 4FD3A 3RKUA 1ADCA 4G5HA 4I5FA 3STHA 4HKTA 1WAMA 4MIOA 1MFZA 5K6AA 1LLQA 1N9GA 4D0SA 4JBHA 1ENZA 2X86A 3BTUA 4BNUA 1D1TA 4A73A 2AQHA 3ZV4A 3DZGA 4ESOA 3K96A 1W73A 4K6CA 2OGUA 4RORA 3NKLA 4OXKA 4ZU3A 1AXEA 1SCUA 3PZBA 4DTIA 4LISA 5ITWA 2D2IA 1F06A 2DAPA 3CIFA 2E6UX 4J1TA 2I6TA 1E7YA 1LQTA 3T7CA 4E2XA 1C14A 4CR6A 1DFIA 1DIRA 1Z73A 3AM5A 1KETA 1YQGA 1Y81A 4YJHB 2CZCA 2G82A 4YRDA 2EKLA 4P4LA 1LSJA 4BGVA 3UH1A 1TB4A 2I67A 3F1LA 1HL3A 1AXGA 4HY3A 4NBVA 1T2CA 4ND1A 2O7SA 2HJSA 1P1JA 3GNQA 4OSOA 4R01A 4CQMD 5L95A 3DMTC 3PI7A 4TVOA 4WCFB 4AVYA 3AU8A 2X22A 4TROA 1NAHA 1VJ1A 4B8WA 3GGOA 5I8WA 3Q6IA 3W1VA 1ULUA 1ZW1A 1UXJA 5TNXA 4JN6B 4CLEA 5THKA 4B4UA 2HMWA 1HDXA 4LGVA 1PJQA 4UUMA 1Y9AA 3LDHA 4YJGA 3NJ8A 1GEGA 3F47A 3RUAA 5CDSA 3EY4A 4FIZA 3GY0A 1ZH8A 5F3RA 1U4SA 1Q0LA 1ISHA 5EJ2A 3GF4A 2YJZA 4E33A 4S1VA 1C0KA 3HWRA 3CTMA 1EFKA 3H3JA 3NGXA 1TVEA 4DWVA 1GAEO 1ISIA 4R3NA 1C1DB 1E92A 4PN3A 5KJ6A 3FR8A 4L4SA 3PQEA 4NK5A 2OP0A 1P1KA 2AA3A 3ZWAA 2G76A 5FFFA 5TRTA 3IS3A 3JQ8A 2VUUA 3WGIA 1GL3A 5A02A 5TSDA 5ICMA 1GCOA 2X7HA 1LQUA 5T67A 1NHWA 2J6IA 4EEXA 4DVJA 4IDAA 1CYDA 3AM4A 1TT5B 4GVLA 2BGMA 3TFOA 3I83A 5FF9A 5A5EA 4R16A 1VL0A 2CD9A 4B79A 2XXJA 3GZNB 3M1AA 4RPLA 3NT2A 1DBVO 3CXRA 3VPGA 3VPSA 1VKNA 3A9WA 2X0IA 3VDQA 2HRBA 1GYPA 3QWHA 1FDWA 2P5YA 4O6VA 4OHUA 4E2WA 1J4AA 1E7RA 5I7EA 3M6IA 4J16A 1ZXLA 4PFJA 4QO8A 3LF2A 4EZBA 1Y9EA 3DC2A 2NWQA 3OQBA 1CQJA 3RROA 4CLRB 5LC1A 5BNIA 1KEVA 2OHXA 4HFMA 4RVFA 3WX0A 1E3SA 3KLMX 3SEFA 1GV1A 3KO8A 4GGOA 3ENNA 2XXBA 4IDBA 3FSRA 1PSDA 3GUYA 5G0TA 3EYWA 1ZK0A 4IY1A 3C7AA 4GPD1 4A26A 2GO1A 3NTQA 2ZTMA 4IXWA 1GADO 3RUHA 1E7QA 3ZWBA 4GVXA 2J3KA 2HK9A 5CDUA 3CH6A 1X1EA 4NG5A 1H94A 2Y1GA 4YAIA 4I08A 2NU9A 3JV7A 5DCYA 2W8ZA 1N8KA 2WYUA 4D45A 1F14A 5ER6A 4FR5A 4B3HA 2OZPA 4DQXA 2PZKA 4IJWA 2C20A 3F5QA 3RCBA 1OFGA 1SMKA 2YHUA 1ZSNA 4Y6PA 3KVOA 3T4XA 1GQQA 4IUYA 3AI2A 1H6BA 5I9NA 2IDZA 1DC3A 2XOXA 3SJUA 3U9LA 4BNFA 1GEEA 3JQ9A 1IULA 3RSHA 5A9TA 4A0SA 1RM0A 2UDPA 1EK5A 3G1TA 5CG2A 4HFNA 1J6UA 4GLOA 4E5PA 2IXAA 2NUAA 4DBVO 3I9MA 1IPFA 1BXGA 2WYVA 3JQAA 2GGSA 5ITVA 3LZ6A 3DZIA 2VZ0A 4IQ8A 1Y8RA 1ZBQA 3OH8A 4B7CA 4D3SA 5L53A 4OAQA 3VZPA 1P77A 4HP8A 1NHGA 3GDGA 4XCVA 2WDZA 1Z6ZA 5CDTA 2GYYA 4CM4A 1E1LA 3AU9A 4RVSA 4A27A 1DLJA 1D1SA 4BGIA 2B37A 4MP8A 4CMGA 3PYXA 1B3RA 1PGOA 1S7CA 1IPEA 1XU7A 2VYVA 3GEDA 3NX4A 4WNCA 4ND3A 2HLPA 4YWJA 1DRUA 1HE2A 5L3ZA 4FFNA 4BO9A 1K6XA 5L4LA 2YQ5A 5B4TA 3KSDO 3IKTA 3EVTA 3DEYX 5T8KA 1PWZA 1XIVA 3FTNA 3I9KA 1B8VA 3JSAA 4JBGA 1A72A 3GH3A 3P5SA 3IP1A 5ENVA 1XQ1A 4BO7A 1DJNA 2X9NA 1FK8A 1I3LA 1DC6A 3MEQA 4UVGA 5DBFA 3WR5A 5TLSA 3C8MA 2I3GA 1ZUD1 1G1AA 4G65A 3G17A 2TMDA 5KWEA 4ALIA 4NZ9A 1KC1A 1U4OA 1NVGA 3FNGA 2D8AA 2PLAA 1QYDA 3FWZA 5I9LA 2UV8A 3GNTA 1IE3A 1VSUA 5EERA 1K89A 1UAYA 1LXCA 2B36A 1OMOA 4ALNA 1BVRA 2D5AA 1LC3A 5A9SA 2CVOA 3I9OA 2OFPA 4XX0A 3LT2A 2CMDA 3OEWA 3LYLA 4EGFA 5CEFA 5AOVA 1VJTA 2AEJA 3DTTA 4O63O 3TJRA 3UOGA 2JCVA 4BKOA 2EV9A 5F21A 1V3UA 2ZB3A 4XGIA 4CMIB 2IZ0A 2I66A 3NTOA 4QSMA 1NM5A 1PZGA 2CUKA 3H4VA 5DBGA 2ZJ0A 1P45A 3UF0A 4JLWA 2AE2A 3MWEB 1M2WA 3FHLA 4ZA2A 3PHGA 3DFUA 3WBFA 4E5KA 1A4UA 1VPDA 4Q9NA 5F5LA 1DAOA 4Q3AA 4II3A 2P9EA 1NPTO 3RC1A 2O23A 3AUSA 4NJMB 1P31A 2BFOA 3K2BA 2ET6A 5CEJA 2JKVA 3VZRA 4TRJA 1NVTA 4CMCA 1PJ4A 4XIJA 5L7TA 4AG3A 1Z75A 1MV8A 4WEOA 3WWZA 3U4HA 1YOVA 2A35A 1KVSA 1LC0A 4J7XA 4IDFA 4U8GA 1NASA 3ZWMA 4N18A 3ETGA 4E12A 3D0OA 1XG5A 4AJHA 3JQAD 4IXTA 3NDIA 3VH2A 3ASVA 3IQDB 4XRGA 4IZIA 3CUKA 3SC4A 1LU9A 3GAZA 3PDUA 4HADA 5IJZA 1EVYA 5DZSA 4DL9A 1JAYA 4FFRA 4F45A 2JAPA 1ISJA 1X7HA 4NBTA 1YDEA 3DBRA 2PZLA 5A04A 1UZNA 2PH5A 1WVGA 2BI7A 1CJCA 1VC2A 1V3TA 3DBVO 1K5HA 3SLKA 3DXFA 4BKRA 3B1KA 1HRDA 1R4NA 3I6QA 4LMRA 2VYVD 2B5WA 1R0LA 1DSSG 5BSEA 2Y1DA 1PTJA 4AJPA 5B4UA 2Y99A 4TKLA 3F9IA 4YT5A 3DBHA 3FBTA 1QYWA 4TZKA 3GFBA 5JC1A 4E5NA 1X15A 1K3TA 3MJCA 2DPHA 5BR7A 3WDSA 2Y0EA 1HF3A 4GAEA 2XPCA 1B26A 1NFFA 2Q2WA 4FFMA 1S6YA 3TL2A 1ZK4A 2O3UA 1X13A 4E4YA 4RPHA 1H0KA 1LLCA 2NU6A 5H83A 2VWHA 4AL4A 4D7AA 4XA8A 3EAGA 1X1TA 3OQ6A 3ZV3A 1CWUA 2PH3A 4IJVA 2HMTA 2YZ7A 4KZPA 1YQXA 4GQAA 3AM3A 2NNLD 1WDMA 3S2FA 3ITDA 1CRWG 3D5QA 3ONEA 1U3WA 2O2SA 3PWSA 5B1YA 1J0XO 1XSEA 1E1MA 6ADHA 5KJCA 1OAAA 2FPIA 1JKFA 2J3HA 1PZEA 2X8LA 2Y1CA 3LLVA 3O8QA 3RAJA 3U4IA 1GU7A 3UICA 4YAGA 1NQ5A 3JQGB 4YR9A 3OBBA 4BNXA 3KBOA 1EVZA 3P19A 2Q50A 4KDFA 4YJHA 1RPNA 4B4WA 1UXHA 3N74A 4CLOB 2FSSA 4CL8A 3DZHA 3GMSA 3JQ7B 4IS3A 4GKBA 4Q3CA 3MJSA 4XIYA 5F1OA 1ZMOA 2Z5LA 4FPXA 5AQ1A 3S2EA 2RBEA 2HCTA 1UH5A 4RVHA 1R0SA 4JXKA 4EW6A 3BHJA 5IAAA 3OFSA 9LDTA 3RKRA 2AQKA 3TZQA 3TZCA 1NNUA 1V3VA 3GUCA 3M1LA 3WWYA 3OETA 1UXIA 2W2KB 1SOVA 4W82A 5JFOA 4DPLA 4KQWA 3EZLA 3KZVA 1UAGA 1QG6A 4UAGA 4MIYA 5A05A 3COSA 3ONDA 3L4BA 1EBUA 4GX1A 1VL6A 3JQAB 3PYLA 1I01A 2A4KA 3DWFA 1PJLA 3A06A 3DAFA 2EERA 3S55A 4GX5A 4O0LA 2PKQO 4ND5A 3U0BA 3QHAA 4J9VA 5ER9A 1DIBA 2GSDA 1T26A 5I7SA 1E5QA 1KERA 3C1TA 4MVJE 2HQ1A 5K0ZA 1LDBA 4WLFA 4BHTA 3JD3A 4P4NA 5L4NA 4CM4B 2CF5A 1Z7EA 5DOVA 4QEDA 5TC4A 3RUEA 1Q1NA 4LMPA 4YT4A 2C54A 3M2PA 3DB2A 7ADHA 4RPJA 4KTVE 4O5OA 3Q9NA 4EEZA 2EKQA 4R68A 5TJHA 2JD0A 4AICA 3D4OA 2PZMA 1R66A 2IXBA 3GPIA 2NTVA 1XCBA 3FD8A 3JQFA 4GSLA 3ZU2A 1AHIA 1TT5A 2DPGA 1HDGO 2YUTA 4GSKA 4HFJA 4BNWA 1C1XA 2RHCA 2VHYA 5HA5A 3PJEA 3RWBA 3OICA 5IXSA 1TXGA 4RQUA 2R00C 4M87A 4QT0A 1BVUA 4XEHA 2ILTA 1QYVA 1WZEA 2O3SA 4UREA 2TMGA 3ZGYA 4OKIA 1WLYA 3WMXA 1NX6A 4ALMA 3RASA 3WNQA 1HSZA 4XQEA 3ROMA 4I9HA 4B3JA 1ONPA 3WYEA 1TEHA 2PTGA 4UVDA 4DLAA 1X0VA 3HFGA 5KCZA 2W4QA 4I5EA 1T24A 1KBZA 1QMGA 4NBUA 2FPGA 2OMEA 4NHEA 2PD6A 1P0FA 3JYOA 3E9NA 3PGXA 2HO5A 4BQRA 4BMVA 1KEWA 2C5AA 5JO9A 3WGYA 3WGZA 5JO0A 1Z82A 1YBAA 3CE6A 3PDJA 3AK4A 4OH1A 2FY8A 1HLDA 4RL6A 3L6OO 1A4IA 2IEBA 2UYYA 5G0WA 4H15A 2AEMA 2G1UA 5F5NA 1FDVA 4MKZA 1VM6A 4KWHA 4M8SA 4RZHA 5TT1A 3WQQA 4HX5A 5TGDA 3RU9A 1YB1A 5DP1A 4EITA 3QVTA 4WCFC 3FPLA 1GCUA 2GZ2A 1MG0A 1Y1PA 1WPQA 1ZZEA 1IYZA 1D3AA 4HWKA 5ILOA 4PG5A 4RF5A 1EUDA 1GD1O 3G0OA 4W9NA 2OP1A 1KC3A 1EDZA 4UUPA 1VL8A 1LA2A 1E3IA 1XA0A 4XJTA 4XYGA 1IHXA 1QYXA 4J4TA 5IDWA 1AN9A 4QTZA 2VHZA 1ENOA 3IAHA 4DQVA 5JDCA 2G5CA 1I24A 4RVGA 4DBZA 5B37A 2Z1NA 1R4MB 2BH9A 3ZWCA 1T2AA 1W4ZA 2VZ8A 3WQSB 4HXYA 3E48A 4IDDA 5I9MA 5T57A 3DDNA 3JYLA 2QRKA 2VT2A 1NWCA 1CDOA 1W8DA 2Y0DA 3LC1O 4NJOA 5JDIA 2NU7A 3VVCA 3TOXA 4D44A 5COBA 3H5RA 2VZ9A 2FWMX 5DCWA 1R15A 4CM7A 3WIDA 1R4NB 2POQX 1SPXA 5HM8A 2A9FA 5AXDA 4PG7A 3BA1A 2B69A 4BNNA 2IYOA 3H9QA 1VLLA 5IF3A 5JW6A 4BO0A 5U9CA 2EXXA 4FFOA 1OC2A 2GR9A 2JAHA 4OQZA 3SBOA 3MOGA 1TI7A 1QV6A 2WYWA 5KJEA 3K5PA 3QY9A 1M75A 3ZU5A 1E6UA 1KYQA 3ASUA 3I4FA 4OSPA 1GYQA 4HFRA 3KUXA 1UDAA 5G4LA 1E0DA 1GZ3A 4GX2A 1VRWA 3B70A 1BXKA 3B1JA 1D7OA 3KSZO 4PLCA 1YRLA 3QLJA 2EJVA 2CVQA 1T2FA 5KTKA 4XB2A 4FFLA 4AFNA 4BO2A 1WXDA 1QLHA 4KUEA 3ZZNA 2AW5A 1Q7GA 4L4XA 4LN1A 4YAKA 5CPBA 2P4HX 4J1NA 2IZ1A 4AJNA 4D41A 3OA2A 2IODA 9LDBA 1N7HA 1JLLA 3O8QB 2Y93A 1OC4A 4BL5A 1I0ZA 2JHFA 2ZATA 3A28A 4BS9A 4J1QA 3RD5A 4BB5A 4D3FA 3EDMA 1YB5A 3SVTA 3WQRA 3I4CA 2Y1EA 4HV4A 4IJKA 1LSUA 3JQBA 3ZWPA 4EUFA 2EP5A 4GH5A 1LI4A 2Q1TA 4GWGA 4BNIA 1X14A 5DN9A 2CDBA 3GRPA 2HUNA 3H9EO 5DF1A 1E5LA 3RFTA 4R41A 4JROA 3NT4A 4A2CA 1YWGO 2O50A 3UKOA 1CQIA 4FOSA 4YAJA 3ZI0A 1QR6A 3BMNA 1T4BA 1HWYA 2Q2VA 2GCGA 4R1SA 1VJ0A 5CHEA 1GYRA 3ZDFA 3MJTA 4WOKA 4CMIA 3I9NA 4GX0A 2ZYGA 4JCOA 1HXHA 2HAEA 2WSBA 1EDOA 2HRZA 4KUGA 3GLQA 1EEHA 1V8BA 2V6GA 3QVOA 2BF7A 4MJLA 5CDYA 4IMRA 1U9JA 4LCEA 2RIRA 1PS0A 5GZ6A 2I65A 4WK6A 5BNFA 4YEDA 1A71A 1GUFA 3DAPA 3KYBA 3SJ7A 3JQ6A 4N5MA 1NQAO 3QVXA 2DT5A 1N1EA 4NJMA 3VTZA 3NEPX 2J5RA 3JYNA 4ZQBA 4WASA 2NSDA 4NFYA 4BUCA 3AOEC 1SEPA 4N7RA 4Y8VA 2NACA 3PYMA 4E5MA 4PVCA 5H82A 5EQFA 1ID1A 4NH4A 5C7OO
chains in the Genus database with same CATH superfamily
3UA3A 3A4LA 4M83A 3IA2A 2ACEA 2FMUA 1Q6YA 3L8CA 3MWLA 1O5TA 5U4QA 3BMQA 4S1PA 1G5RA 4YV7A 2DVMA 2E5FA 4MRMA 3SNKA 5A7GA 3UCFA 4O2LA 1Z63A 1XFAA 3EGDA 3L92A 1F4VA 4EJ0A 4QM7A 4JASB 4PSCA 2VJNA 1C2YA 1DP4A 1WM1A 4L7QA 1KSGA 2WWFA 4R54A 1ZD9A 5CT4A 1P29A 5K6RA 1XVUA 1ZA2A 1EGAA 4PFQA 2LV8A 2IDKA 3WRYC 2WTXA 1UR5A 3NHRA 5DFAA 2XITA 2Z5VA 2Q5EA 4HXEB 1II8B 3AFOA 1BJKA 1Y5MA 4WZAE 5K6AC 2QRQA 3H83A 4HL6A 1H23A 1MRNA 4FDUA 4HNQA 1XL1A 4J7CA 4OF4A 2D6FA 3Q6NA 2QXTA 5LA6B 3M6FA 1PFGA 5I7RA 3B8HA 3CKYA 2FQXA 3D0RA 3HSYA 3R5XA 4XVHA 2JHPA 3NOVA 4PNHA 4AJ1A 3MZ0A 1DWOA 4DFDA 2BTEA 5HGJA 4P80A 4JJ7A 3WMWA 1KSHA 4O4JB 2Z2YA 5AW2A 2J5QA 3DV9A 4KIGA 2IUTA 1JNXX 3OY2A 4M1EA 5DLYA 4B83A 5FTKA 5KTSA 5CIYA 2G80A 3GP8A 3D2BA 5DWQA 2B25A 2Z83A 1KOFA 4YMWA 5KMGB 5KVCA 1ECJA 1V8OA 1QGAA 1RRVA 1UPFA 2DWQA 3OIFA 1SBTA 2OG1A 3B6EA 4OD0A 2DECA 4QYIB 4K9SA 3V9AA 4B45A 4KL8S 2HLHA 4KVAA 5E8JA 3W8NA 1L5VA 2ZJAA 2D8MA 4C3ZA 1UKBA 2RSLA 1Z34A 3DO8A 2FPGB 5FPPA 4JQOA 1KORA 1AD2A 4QXRA 2P3LA 421PA 4YP6A 3PLRA 4TWZA 1BC5A 3C6MA 3ZQJA 1QTRA 3W3AH 2E0IA 1E6KA 5CM8B 5LXTF 5CX1A 1JHRA 1SOWA 1WG8A 2CF6A 1GPBA 4I55F 3S1AA 5TXGA 1QS0A 2WK1A 1TEZA 3KV3O 2ZROA 1P6UA 4NBWA 1C9MA 1NVMB 3WK4A 5EJ4A 1EE2A 3GJ4A 2YWXA 3LQKA 1FFAA 1YZ3A 1Z3CA 2WT8A 3OIUA 4GQBA 4LVCA 1RXIA 1ZWKA 4C88A 2HRRA 2G4LA 3BEDA 3KD3A 3M3PA 1YVPA 1TAHA 4PV7A 4K26A 2OFWA 2E48A 3N0XA 4U2EA 2DWCA 1RAGA 3X2EA 4PYQA 5IFKA 2WUGA 5BN1A 2ATXA 4GOXA 4N5IX 2PA3A 5LQMA 5KKCA 3BE6A 1MW8X 3GEGA 2F59A 1RMYA 2X1HA 1MAUA 3I5YA 1SXJC 3EDRA 4ABYA 3OSZA 4KBYA 3AFNA 3QKWA 4XOIA 2JC3A 3ME5A 1DL5A 1ZN7A 2JVJA 1J07A 3N2KB 2Y27A 1DJQA 3L06A 1PG0A 1W85B 4HBGA 4LOAA 8ABPA 3PHCA 3T0FA 1EESA 4IUCS 2M32A 4I2VA 1WY5A 1IUPA 2IHTA 1K1EA 2JCBA 2OZKA 3FGPA 2CMHA 4KAJA 4L0CA 2W93A 4B6EA 2BJWA 2ERCA 4ZYLA 3TSYA 3VAYA 1E61A 2J31A 3IURA 2GERA 1DC5A 1J56A 2QP3A 3SHVA 2SBTA 4HNHA 3IULA 1SBCA 2XVXA 2MCFA 4CCYB 2EOAA 2WPDD 3X1JA 3EWSA 1T35A 1IOZA 5JC8A 3S7ZA 4P93A 2GAFA 4M0EA 1KI2A 5EHIA 1TPZA 3HXLA 1MQ9A 1BWRA 1ZGHA 4RFSB 4NQRA 4KI0A 1JT9A 3IAM1 4V0QA 2Q3DA 2YWEA 3NTRA 5JAZA 1LJUA 2XUDA 4GOMD 1BYUA 1XZDA 4OX9Y 1QGUB 2A5JA 2QJOA 4J75A 5E1MA 4CVNA 4TMFA 4FB5A 5KAMA 2NO0A 4TM8A 3HRIA 5EMLA 5BSVA 5JNLA 4RELA 3MCZA 2A1UB 1Z8DA 2P8JA 3AV0B 4RHTA 4HT3B 4EHNA 1GPH1 3TAHA 1BW9B 1VJDA 3F4LA 2AKYA 2J1LA 4KBFA 3OO0A 4NU8X 1JPJA 2IGBA 4NV1A 4OB6A 1MXFA 1KZGB 5BWOA 2XDQA 4I1UA 1AH2A 4YIKA 1WS6A 4MMXB 1W49A 3GJTA 5FPKA 2RHDA 3F7NA 1XMPA 3L05A 2DTXA 3PQ5A 4NNJA 1PBTA 3DTVD 3K0AB 4C6HA 2BHLA 2EBFX 4ALJA 1NBIA 1B2RA 4KOAA 5J23A 5CNKA 1ZIOA 5BVGA 1YR9A 4M6WB 3FPAA 4RWEA 4J16C 1PR5A 1ONNA 1FYXA 3R40A 3S81A 3OHMA 1ZZGA 2YFHA 2OK8A 3FF1A 2PH7A 5L4SA 4E31A 2CK3A 2E4VA 1U7DA 1QQAA 1KFKB 4HWTA 2J3LA 4URUR 3WLTA 3USZA 3W9UA 3PFIA 1KARA 2GNOA 2UAGA 2XIQA 2ZP1A 3IVXA 2VTBB 1U81A 3AHGA 3MOSA 1CF9A 1PP4A 4M9ZA 2FWRA 2DKFA 5LVAA 1JLLB 1GN9A 4PLVA 1JQEA 1X39A 3G9XA 4PZLA 5ARDA 1Q0TA 3CMMA 3W6OA 1XT6A 4MEAA 1GTRA 2EWMA 4U1RA 4HYTA 3FNIA 3QOXA 4R4JA 2ECQA 4PPFA 2AKAB 1T5LA 3QFTA 3U0VA 2A5YB 2B98A 2ZB4A 5K4AA 3DBLB 3KQNA 1G9XA 2IK8A 3CQ9A 1L3IA 1QQ7A 4Y6QA 3ZBTA 3UB4A 4DCUA 1XRPA 4X45A 3VJRA 2JGEA 2C4KA 4M54A 5I51A 3OQMA 1QR2A 2RHLA 4A0GA 3L6BA 1V96A 1N5JA 3CT4A 4OJMX 3BMNB 5DGXA 3UAOA 4LJ6A 2OUKA 2WJJA 4JA2A 4QICA 5B1DA 4DCOA 4GGPA 4BKQA 3IDSA 3L4JA 3MQ2A 1W4RA 3GB9A 2C88A 3C6QA 4MV9A 4DIOA 5BV1A 3CV3A 3GT4A 3K5IA 1B41A 2JF0A 2JI9A 4ASUA 3EPPA 4QIHA 3PZRA 1VKHA 4R40A 4RLSA 1VCMA 3G2OA 3Q9SA 3D5EA 4XLTA 1T2VA 2CYCA 1HT3A 2ZBUA 4J2OA 4M60A 2XQIA 4OXNA 2HQOA 3E22B 4P54A 1A82A 5D2CA 2D5BA 3JQ9C 3G0HA 5BV8A 4J43A 3CY6A 4Z7NB 3IL2A 4AF7A 3ADDA 1QF6A 2FFRA 1PE0A 2B83A 5JROA 3KFLA 1GRVA 2IHJA 4ZQEA 4LY9A 5LQSA 3LDUA 2F8LA 2Q7DA 1JKJB 3ANSA 2CDRA 5LBTA 5TPWB 1GA1A 3NM4A 3BMQB 3I30X 2G9ZA 3TYXA 4U2DA 2Q5QA 2OOSA 2PFGA 3EGDB 4IQGA 2EX4A 4V0LA 3N8IA 2QRGA 3EZXA 5BRAA 4NLLA 3IIEA 1AUQA 2OFFA 3FTQA 4FMDB 3SHTA 3IPYA 4DXAA 2I9PA 2ZSKA 3MTDA 3KXPA 2R8XA 4B6QA 4MV4A 1F17A 2IPAB 3HKBA 4CI9A 5KTYA 3AGPA 4OQMA 3IQFA 1YBMA 5KTTA 3Q8LA 3SJAA 1YC2A 2NO4A 2QPLA 4QWMA 5AJTA 2Z3ZA 4GBMA 5D6NA 4J3NA 2Q0XA 4TXJA 2O4CA 2WFZA 3IKLA 4DSTA 3S3TA 2H2WA 4MRPA 1L7NA 3RU7A 2VKTA 3TO5A 3BK1A 4X92A 4A0QA 1XPUA 3R9WA 4D57A 2GX6A 2M6RA 3TG8A 1NZDA 2HMAA 4K3UA 5AHOA 3PGJA 3GJSA 3SQXA 3IVCA 3PENA 3BILA 4EKDA 1DRKA 4U9HS 4ZVVA 4HSEA 1ONBA 2WNSA 3H2YA 3KOYA 4HZUB 1Z47A 1REQB 2GNAA 3TIXB 4AW9A 1JQKA 5FP0A 4JC0A 3EVGA 1PEDA 3KT8A 1O6ZA 2EFDB 2R5NA 3TMYA 1GQYA 3GZ4A 3QP9A 1RQPA 4PYLA 4XWAA 3ZCTA 1AZLA 3N1UA 2KW5A 1Y3AA 1AO3A 2GO7A 4GWKA 4DVGA 3CEMA 3O47A 2P1ZA 3MWYW 1UC4B 2J7KA 2B4TO 4JJIA 5FD8A 3CNNA 3SP1A 1N0UA 4QJBA 4KPEC 2DJIA 4DMFA 1K3UB 4MH0R 1F6BA 4Z4GA 1TO1E 3I2GA 3K1ZA 1BA2A 4RD3A 2J08A 2ATIA 3TZEA 4A7PA 4HGYA 4C07A 1UL1X 5KC8A 5TVGA 5L9AA 3G2KA 4BB6A 2IHUA 2YV3A 4ZT5A 4DV3B 1RRFA 3H5LA 5CX1B 4YN3A 2ONZA 4Y2RA 3ZKWA 4ZO6A 4FE4A 1N25A 2BV3A 4YRKA 2ZUCA 4RPKA 1LRKA 1OWOA 2PXXA 4JT4A 3CS3A 2X0RA 1WV1A 5HOEA 1NT4A 4RTJA 3P0FA 5AHRA 621PA 3MRXA 4ZHQF 4EM6A 3GRVA 4P4GA 1P8AA 4KTTE 6REQA 3RYHB 1RWBA 2I1WA 2EAUA 1B15A 3AJ9A 3TPFA 3ZWYA 5JSFA 3TKYA 1ZLXA 3F46A 3MBIA 1JEEA 4OHOA 1E2FA 2GEFA 1M6NA 3MTEA 2WICA 2ADMA 3CX4A 3KETA 3MPUA 1THGA 3EH1A 3R7AA 3B5IA 1C3EA 2HT6A 1YR8A 1Z0UA 3P9PA 1CIPA 1NW8A 4HNUA 2AOVA 2F43B 5GWXA 4G81A 3ZE9A 3U62A 3EULA 8ADHA 1HQKA 3CUTA 3CWZA 5HXAA 1WF6A 4UHJA 3ZIDA 5JMWA 1CZNA 1W30A 2QRLA 1XU9A 3LG2A 4J9UE 1ORTA 5CCBA 1YGYA 4DARA 1JGTA 2JGJA 1DXHA 3ELWA 3IP9A 4NBRA 4QQKA 2IVFA 1G66A 2D5CA 2FN4A 2IE0A 2ORWA 3ETJA 4A36A 4PZCA 2CXNA 4QATA 4HTAA 1IONA 3ZDCA 2PFKA 3H1FA 2CDAA 2CL5A 2OXRA 4GICA 4BY9E 4NF2A 1JFTA 3AHCA 2N1MA 2ZTUA 3D3WB 4FHEA 2OHOA 4B0OA 4RZSA 4E2FA 2H1RA 1JWLA 4UPVA 1FFCA 4RENA 3T61A 5C8DA 4JLJA 2VSNA 3RU3A 5JSKA 1ABFA 1ISMA 1PJCA 4B33A 2ZYTX 1PFKA 4ZRDA 1Z7BA 4ND4A 1ZICA 2G1JA 2GTPA 2QG6A 2NVBA 2X8JB 2YHSA 4R3UC 3WWOA 3EUFA 1DZIA 1RWWA 1PD1A 1U2TA 3F2VA 3I04M 4FJ2A 4LHYA 4RYDA 3T3EA 3EGOA 3RJ5A 4MPDA 1AC5A 4X66B 4N0EA 5BWBA 2F67A 2PY6A 4X91A 3LUBA 5IZCA 3PS9A 4BIIA 3OY7A 3CLRC 5CDGA 1SEVA 2E4XA 3UK7A 1R6UA 4K9QA 5IUNC 1KYWA 1SC3A 1L8OA 2XYGA 5DEIA 3T9DA 4B5LA 4RKEA 3RRNA 3AX6A 3KEOA 5F12A 4ZOAA 2BM0A 4OFBA 1GDHA 3OWOA 5BVGB 3GQVA 4Q1DA 1EFRD 2FMIA 3GP3A 1R8YA 2GQ0A 1TUGA 2A57A 4F5WA 3QE9Y 2QM7A 1KFCB 5IEJA 1JJAA 1USVA 1IB6A 3WNCA 1KYXA 4IG9A 1M0WA 1EE9A 2I1VB 4Y30A 5EPEA 1W36D 2ES4A 5TE9A 4E70A 4LXHA 3ICCA 1FRFS 3IUEA 3MCWA 3TQFA 5CA0F 2HHHB 4ITUA 1BMTA 1HL7A 4FINA 2Z56A 1D1QA 2O8NA 5F78A 4TKMA 2VWPA 3ZE7A 1MAAA 1JAHA 2WSSD 2Z2KA 1KO8A 3N7UA 1YS1X 4K6KA 3KXDA 2I54A 2YVUA 1U04A 1A5ZA 3GVCA 4QPJC 3SIWA 4H08A 4E15A 1NLZA 3OE5A 2PE5A 3RS0A 1B8PA 1BVHA 2BBOA 3KV1A 4XD7A 5CB4F 2CCKA 4M2LA 2I8CA 2FR8A 1X1CA 4D97A 2PSSA 3FMVA 2JFXA 4UARA 2QUBA 4C20A 2P9YA 1HYHA 3I8OA 1UDCA 2LIPA 3V1YA 4B5KA 3GRZA 2ZU6A 1BYIA 2Z95A 3BYZA 2EGUA 4L4YA 2CJWA 2YL2A 1A9ZA 4WFQA 5ALUA 1RPTA 3QXJA 3UKDA 2C8JA 2NZJA 5B3KA 1CFZA 2M9MA 3ITNA 3OCVA 2QRHA 4GM4A 3C5CA 2QN8A 3KR1A 3BL8A 821PA 5J4LA 1YA6A 4XVQA 4RJJA 3OPYA 5A4FS 3ZZUA 1O94A 1P3DA 4QFDA 2R2GA 1YJ8A 1KMIY 3RWMB 3BB3A 5AOCA 5I7HA 2UU9B 4PZEA 4JR2A 3PVCA 4MVJF 3P9RA 1L3CA 2NZYA 4C0JA 4DR6B 3TM4A 3NHJA 4IIDA 5M5BA 4FEGA 3L0ZA 2HQRA 4J0EA 3VTFA 5L6MB 1I33A 3NAQA 5E9JA 5B2EA 2XMBA 5IKMA 2AR7A 3MLEA 4KXUA 2ZI6A 1U7OA 3ILYA 1GWNA 3BCRA 2XUIA 5C52B 5JALA 1DOHA 1V7ZA 5JH7A 1E0JA 4UEKA 4UBMA 3A9TA 1CEYA 1PR3A 1YCHA 3RC9A 1FYDA 2QLLA 3KQMA 3ROQA 1Q83A 1FPQA 2J8ZA 3IOEA 5AIBA 3W90A 4ENVA 3U39A 1NRWA 1KO4A 3DOCA 2PWYA 3N8GA 4KX5A 2DFNA 4JITA 1Q95A 4JY7A 1X86B 2R1ZA 2H2DA 4IVRA 4KFRA 4AJ2A 4F4JA 1NKVA 3IDQA 3LLSA 3MJVA 4GI2A 3ZW7A 1ESDA 1BEUB 1E7WA 1UMKA 3H1EA 1CVLA 3W1WA 3P9XA 4BASA 4EHKA 3JSXA 3L1KA 1X74A 4U7TB 5AI0A 3T41A 1H2HA 4CQLA 2O5RA 3Q3IA 4TYPA 4MV0A 1X7WB 1PQUA 1IATA 2JFUA 4ZT2A 1T0UA 2V59A 2Y0PA 2JASA 3DR3A 3KAJA 3M81A 4C3UA 1Q14A 2C9ZA 5FL7A 3HKBB 2F9MA 2ODBA 3I6BA 1PQ4A 1YKSA 4KDCA 3OD1A 5HX7A 3TSCA 4OMCA 2ZRJA 1NP6A 2NUBA 4J0GA 1I7PA 2DY0A 3DWIA 4WA8A 1RWVA 2PRSA 1V1MB 1E6WA 4J2TA 1PL7A 1QCCA 3OJEA 2IEZA 1QB7A 3EQ7A 3OM9A 1NFRA 1VGQA 4BEBA 3EQZA 3T99A 3ZHZA 5BNWA 4C6SA 2HA3A 3UG7A 2BYTA 2HLDA 3QWBA 1N2BA 3EK2A 3O9ZA 4RO0A 1MAVA 4XB1A 1NE7A 3ZXYA 2BLLA 4NICA 4CU2A 1QFXA 2B61A 5TQ2A 2JHGA 1AGNA 1TIPA 4BNLA 4I5IA 2WLTA 3DLBA 3JQFC 1EHYA 3RUIA 3OQOA 1WEKA 4L8GA 4F96A 4X7BA 4UATA 3C2QA 2YVLA 3AFMA 3KWLA 1AK2A 4B40A 1XJ5A 2JG3A 2BT4A 1MABB 1XEXA 3HY3A 2R6GA 3HMKA 3KEQA 1SUFA 4AKSA 2B7LA 1R2QA 1QO0A 3EZ2A 3QA9A 1K92A 3MTJA 1BNCA 4M1ZA 2H1VA 2P9QA 1ELOA 4BJ5A 3AEYA 1ZD3A 3F3SA 3LVRE 2B4KA 2RI1A 3WRXC 2OMKA 4L85A 4F8EA 3C98A 2WZQA 2I2BA 3DG9A 1KK0A 4ZOBA 4Q4AA 2PSEA 1TJ4A 5H70A 4OBEA 1ATZA 3K1AA 4DS3A 3OLYA 3FBGA 5BUQA 3S2IA 3SSMA 2QTZA 1PT6A 2Y8EA 2A9RA 3SX2A 3ZKWB 4FQ8A 1V7QA 3L0DA 4IF4A 4CG2A 1ISFA 5CIQA 4C2UA 4N9WA 4HGQA 3WFJA 3WQBA 1XTQA 1BHJA 3F96A 3HJAA 4GMDA 5BV0A 3VYUB 4QOHA 1VSTA 2O8CA 1VHTA 5M3BA 1Y4UA 1TCCA 1C50A 4AJOA 3ZW9A 5KIAA 2QTVA 2OSBA 3VR5D 3F5MA 1JU9A 2LWIA 5CDFE 4QX6A 4HUQB 2C2MA 2CKMA 3T3OA 3DHEA 2FI1A 3LPDA 2Q8QA 3INRA 3QI2A 1L7VC 3RE1A 4CUJA 3EIWA 1W44A 4TSFD 2BFAA 4N8SA 1HORA 2PLFA 2KI5A 3DP7A 4E1VA 4BOYA 2WVJA 3KZNA 2J3JA 2PDAA 3KQYA 4JJGA 2Q4TA 3V1NA 1NC3A 1CU1A 1JR3E 1MIOA 2W71A 3I0NA 4XJSA 5KJ1A 2DBQA 5D1HA 2X2EA 1CUAA 4H35A 1ZH2A 4E21A 1XVTA 5JAMA 4GPAA 5AXAA 2PBLA 2QD5A 3PHIA 1RMTA 3LVFO 4W9NC 2WD7B 2XLCA 4DG8A 3EQ9A 5AI4A 3IV9A 2A5FA 2KWIA 1WXQA 1U0HC 2Y1LA 1Z4JA 2RD2A 2A9JA 3OSUA 1BE6A 1GNRA 4BO4A 1P4GA 1V7CA 2VDMB 2P4QA 3BXFA 3FKJA 4EO4A 1KRXA 4PRZA 5JXIA 3P8ZA 1FU4A 5KVVA 1Y63A 4BZZA 4EB3A 5CLFA 2I6XA 5DBEX 5K2OA 2E2WA 1FNMA 3QYJA 4I9FA 3TIGA 5K7SA 1NU8A 2NTJA 4XFJA 2AE1A 1AX9A 2I4MA 1P1HA 1OPRA 5C1DA 5ALNA 3BM5A 5JDIC 1DRJA 2LGJA 4U00A 4WT7A 4DGQA 3H9UA 1EWRA 3IPCA 1LS6A 2HSDA 4YJDA 1QIKA 3BRQA 5C81A 3HI6A 2Q9AA 2RH4A 2GA8A 5HIIA 4CLDA 4YRNA 1YZGA 1QGOA 3GA7A 3NWPA 1EINA 2PJDA 4ND8A 1IBRA 4OUDA 2QV0A 5EMHA 5TPZD 3ZXSA 4P3XA 5JYCA 5HDBB 4ZQFA 3B1ZA 4RCVA 3GLGE 3C6XA 3CBQA 1EIZA 3NUQA 4QEKA 3PUIA 4XQ9A 1QPZA 3ICEA 1I6MA 2A3RA 2I2DA 2R86A 1U9ZA 4G56A 4IYRA 4L8LA 4LHVA 4N3BA 4MPPA 2WU1A 3KYCA 1WUYA 5ITSA 4JP1A 5EIBD 1AO0A 3CF4A 3RVJA 1CR4A 2FW7A 2V6IA 3G9UA 4NULA 4FVTA 4H18A 4DB2A 1R7RA 2DC1A 2BEJA 3W7VA 4ARZA 4TVSA 4MINA 1EK1A 1Y6JA 2B8JA 4A23A 3WO1A 3W5IA 2FZ5A 1W76A 3PUXA 1PQPA 1U0TA 2CLLB 2FWPA 4KR9A 2FW8A 4OHXA 4TWRA 4FYIA 4BNKA 2H1FA 2QGNA 3L7BA 3OLZA 4AZVA 2FR1A 2WRZA 2PK3A 2ASEA 1NVVQ 2C3PA 1Z2CA 3DAHA 3VR6D 2QQ5A 4TQ9A 4V2UA 4A9AA 5C8VA 5A62A 2WUEA 3IDFA 3IT1A 4XQGA 2YHBA 4RAQA 3I53A 2E4YA 3LFUA 4K9DA 2JKYA 3GMIA 3TVDA 4TL9A 1SVLA 2FHPA 4LXUA 4HRXA 2A67A 3FPBA 1MXHA 1V0JA 2CJWB 2KBFA 4L78A 2Y68A 5D00A 1RXEA 3UK2A 4AWAA 1JSXA 1UKCA 2ZTSA 1WUJS 4OM8A 1NQXA 1NULA 4PYOA 2AX4A 2H17A 2PX4A 2V8BA 1NJGA 3JQBC 3OEHA 4ILKA 2AD5A 5AVUA 4DMKA 2IITA 3HUFA 3G2PA 2Y4NA 3GLHB 2ZQ5A 3B3JA 3KZKA 3PIDA 4G0VA 1Q7EA 1LWOA 4MWTA 1MO2A 1ULSA 3P27A 4C87A 2WB2A 4NVRA 1SKBA 1PW5A 4PR3A 4KOEC 3D54D 3LBYA 4AY5A 2E37A 4ETWA 1QANA 3BWMA 4FN4A 3A6EA 1CS0A 3ZNQA 3NFYA 4NCBA 1G5HA 1E3QA 2IQIA 3CUEF 2B94A 3JAWB 5EMNA 5DW3A 2NYVA 1QOZA 2GN4A 4YQFA 1IQ0A 3AR5A 5JH7B 1Q91A 3C3KA 2O0KA 4BMZA 1K7SN 3ZJYA 5DYWA 3BZBA 3G59A 4CEIA 2QX8A 2PT7A 2EW8A 1UIRA 2JFQA 1BOFA 2X23A 3NS7A 1QBGA 4QPPA 1RLIA 4S24A 3UJ8A 3V48A 3V1LA 3WB0A 4BQFA 1J09A 3D6AA 3F6SA 2YN0A 3NU1A 4KAAA 4KVGA 4DCCA 1YACA 1QVAA 4PONA 3IOBA 5I45A 1CB7A 1GL9B 1C3LA 4UASA 3WNZA 4LY3A 3L4KA 1TW3A 4MDFA 4HGZA 2EQBA 4BNYA 1VJRA 4POAA 2HSGA 4ZMRA 3HKEB 3BTVA 4PZAA 2N3ZA 3DO5A 1ZCZA 5ILQA 1YZTA 4CKBA 2IZ5A 5IF9A 2AN5A 4MVCA 1IPHA 1DEOA 4MRAA 3WLIA 3PFKA 2HW8A 2AG6A 2CW5A 1WB9A 2XMDA 1Y5NA 5BSRA 1B3BA 2Q49A 2BMJA 3E9MA 4OHBA 1EXDA 4NYJQ 1G7SA 1V3QE 4EGAA 4FSHA 3HCPA 5IFLA 2ZRNA 3JD4A 4MW6A 2ID8A 4PRKA 3OLXA 3UK1A 5B12A 1UJ4A 1W2HA 4MZXA 2VXYA 2W2LD 3IEVA 3WZ2A 2H54A 4FYJA 4Z99A 3ZI4A 3ENQA 5CA1F 1EK2A 4HDSA 3KDAA 4IIEA 3GFQA 3ZHBA 1WWKA 1HT1E 1Q0ZA 4YJ3F 3QE3A 1TKCA 3IAXA 1G7TA 3Q5DA 4CNQA 5HGXA 3WY9A 3IXMA 1E18A 2H2GA 4FCCA 1A27A 3Q6MA 3VKUA 1B8OA 4HN2A 3WOHA 4DUPA 2V6MA 2HRCA 5GONA 1SQSA 2IOHA 2BD0A 3HVJA 3TRDA 1H3FA 1QGZA 2A0YA 4XWOA 1XEXB 2VUIB 3AUJB 3VO1A 5T4BA 2D74A 4TMZA 3VZBA 4YPOA 3SVLA 1VQ1A 2DBYA 4LE1A 3G9ZA 3WHLA 4GPZA 4M86A 3NG1A 3G7SA 2VTEA 1C3JA 3MERA 4TQAA 4X84A 1NOIA 1RJWA 3GLRA 2P77A 4X8HA 4Q4AB 2GJSA 2IYTA 2C5SA 2DBVO 3K1AB 4E5YA 3TL3A 2PXAA 3IP8A 4G1FA 3DT6A 5BRNA 2IEDA 2I4TA 2SICE 3LCCA 4K6HA 3W8DA 3R6DA 1OILA 1NKSA 2OCXA 1J39A 4LZZA 3GIWA 3LLCA 4TRMA 5KCMA 4XUEA 1MUUA 4AIIA 4QQRA 4U2GA 4YV0A 1C4KA 1ZD4A 2ZYHA 3MMPA 4F38A 2O8CB 1EX6A 3H11B 5D3MB 1N9GB 4D82A 2OK7A 3FWKA 1ZPDA 2QTVB 3LHDA 5T6BA 3FPCA 1KR2A 3AZQA 2N42A 4B9EA 1O03A 2HU5A 4D42A 2HK6A 1GZUA 1EWVA 4L51A 1O77A 1VCNA 1FFXB 3RWOA 4ZYXA 4GG1A 3DE7X 1E1DA 3ITEA 3MXOA 2CLMB 4TVKA 2C2XA 5C7YA 2C04A 2GPSA 1AGPA 3QSGA 4GD3Q 2HEIA 4CL3A 5LZ2A 5DHQA 4FFDA 2FP4A 7YASA 5BSGA 1MIOB 3IJPA 1Q16A 3HLKA 4QHSA 1WZIA 5IJ9A 1FIUA 1Z8FA 2AL7A 3FNFA 3GROA 2H8KA 1IEVA 3GBVA 1C4OA 1WABA 3RYCA 3UWOA 3IC5A 1Z5PA 3UTCA 1TT7A 1D6NA 2FWBA 3HB0A 5DN6D 1RLUA 1LJ8A 1V4VA 3OZBA 2NSHA 4GYYA 4HWSA 1QUEA 3BE5A 3TQQA 3O92A 4L75A 3HUUA 1Z8NA 3NC0C 4LG1A 4DSAA 4ZMBA 5HM6A 4J3FA 5DLQC 1JPUA 2M6KA 2XRYA 2ALJA 2XH8A 4EG1A 2J4FA 1RLMA 1THTA 1GR0A 3CVOA 4DRXB 2FOIA 3G9QA 1MJGA 2B35A 1HE1C 3RHFA 2ZIZA 3F5DA 2ZYUX 3U19A 2GN1A 5CHYA 4O08A 2OXIA 4QFCA 1T1EA 4BQPA 2P0YA 4FK8A 4ARVA 4CKCA 3PUJA 4URHA 1Z5VA 1WX1A 4ZDIA 5TGTA 3G89A 3WLNA 4BX8A 3VYTB 3GN1A 2HHAA 4XQCA 3TTTA 5FEUA 1LBTA 3PRHA 2O5CA 1GRNA 1VHLA 3K35A 4R05A 3O0TA 4ZOLB 3HWWA 4IOKA 3ZY3A 1V25A 4YJGB 3HBNA 3ONNA 4GMGA 3TLMA 3F6RA 1T2DA 2P9GA 2OUIA 1U8ZA 3PX3A 4TT8A 2ZR9A 3C97A 2Q9CA 4KR2A 3CF0A 4ZI2A 1IY8A 1HG0A 3U7EB 3WSVA 2XNDA 5JS6A 2F1OA 1MIHA 3BMXA 1FNDA 1LX6A 3FFXA 4Q05A 4HCJA 1I2DA 4F60A 1AZSC 3ZDAA 5FXMA 1YRHA 1QHYA 1EXWA 3JZFA 5FNVA 1A9XA 2VDVE 3WYNA 4AI6A 2ZIUB 3ANMA 3TX6A 1OZ0A 2F3UA 2GWHA 2FZVA 4IFEA 5DHTA 1VMDA 4M7OA 3VDXA 3ICPA 3B1WA 5EMMA 4DB4A 1CP3A 2H4XA 3B78A 1WSAA 3MILA 1AQYA 1EAYA 4F5YA 5FTJA 3W79A 3EXEB 3SMQA 4KRFA 3FLEA 2YXNA 3AC0A 1N7GA 2B0CA 3LTEA 4PHFA 4TTJA 4WCDA 5ALKA 1CZUA 2EEPA 1UM9B 3SPXA 3IH5A 1BMFD 1PW7A 1ZIDA 3FSGD 4AZSA 4BV8A 4W5TA 4NZNA 3P4UA 5YASA 1LK7A 2CMGA 5T3YA 4I19A 2VHEA 1JEAA 2BELA 3EWIA 1X8KA 3MMNA 5DT9A 1CCWA 1AKNA 3SR3A 5JZSA 2HHCA 5A4JA 1JG7A 3O7WA 3FHOA 5CBPA 1N1DA 1ZOPA 3H2KA 5TJ9A 4ZCMA 3NHZA 2DH6A 2G0TA 2OCBA 5MN4A 1E79D 3AWDA 1M1UA 1E77A 5M04A 3CJQA 4EQ6A 5DDIP 1L5RA 4GPTA 5TMEA 3VYRB 3SSOA 4QXQA 2AN4A 4DT1B 2J07A 5KVAA 1EUQA 1MG5A 2VPQA 4MLPA 2R6DA 1G8FA 1PZFA 4ZQHA 3S8MA 3DMNA 2ZULA 4HLNA 4XPIA 1Q3TA 3GLTA 3IB6A 1EQUA 2ZUBA 2Q5JA 2B2NA 3NO4A 4WLNA 4TWBA 1O54A 5I8PA 3AF5A 3OJFA 2CXQA 1CS0B 3LY9A 3W4KA 1WR8A 5KINB 1L5YA 1A1SA 1CETA 5A3SA 1GUZA 5H9VA 2B1QA 1T1GA 3GH1A 3MRTA 2REQA 4WNAB 4AJLA 4YQEA 1ZR2A 4F12A 2XCQA 4AECA 2QA5A 4QM6A 5BVHA 2H6EA 3RQSA 4B84A 1B7GO 1RQ7A 3HLYA 1XD9A 1N2XA 1Z36A 3LT0A 3C24A 4Y9RA 2BJVA 3HEBA 4QHYA 3OPNA 1KFBB 4IIUA 4F5EA 1HRKA 1XTTA 1PYGA 1WO8A 3VU9B 4QZVA 3HDJA 4NR0A 1PGPA 1V1JA 5IH7A 4V1CB 1OASA 1FTSA 3HYCA 3FM9A 3B7WA 3D64A 2CNDA 5FORA 4BV9A 3THYA 3AVYA 3WGHA 2WF7A 1Z08A 4GR5A 1Q19A 3NP7A 4XYMA 5EJIA 1AA6A 2IH4A 3CO0S 2PUEA 2C2BA 4Q7MB 3L7YA 3VYWA 1M3SA 13PKA 1MOZA 4IDCA 2PLRA 4I3HA 3W8EA 4D9CA 1HR0B 5JCJA 4CKBB 5CT5A 1ZSVA 7MDHA 1OSNA 2EIXA 2REBA 3NJ4A 1P0MA 4KQ6A 4OJTA 3GYGA 3JR3A 3SQDA 3TB4A 4BBAA 2CLOB 4M7RA 4EJ6A 3FYUC 5J2TB 5HQJA 2NU9B 1UDBA 2FVYA 3D8BA 2GEKA 3OFKA 3F6CA 3WGTA 4LFBB 3C3XA 2ZYSA 1BD3A 1OLSB 1R74A 2J9ZB 3FLAA 1EJBA 1KP2A 2Y0BA 1UQRA 3I2JA 4G8CA 4IJUA 4MVJM 4PGFA 4CIXA 4RA9A 1P2UA 3KHKA 4TLCA 1TM4E 5ALLA 3RIMA 4CE6A 1R0KA 3L4SO 2DUMA 4YXWD 2YYAA 4TRRA 2ZBRA 4OK5A 4EZIA 2VP2A 2UUBB 4IXDA 2FRVA 3EC1A 4HDSB 4XASA 3LX4A 3O74A 1T8RA 2RHOA 4ICIA 3R3HA 4H4DA 4WCFA 1R88A 2PKEA 3HPQA 4EJ2A 1KEPA 2J5KA 3D02A 2HSZA 1DMRA 1TECE 3MJRA 4R0NA 2WB4A 1SQGA 3TW4A 4PICA 1ULZA 5AW6A 2R8OA 4EHBA 5LNK6 5MGBA 4F8YA 3ZOZA 4UTRA 2Q6KA 4XIFA 5GONB 3CR3C 1J23A 4H0CA 4L9SA 5AVJA 1ES9A 3CVJA 3LRTA 2DFDA 3I3OA 3EA5A 4JFAA 3V2HA 4IM7A 5FLYA 1BXGB 5FUXA 1SD5A 3LPLA 4DRZA 4FS3A 1YB7A 3GD5A 4PG4A 2P62A 1H5QA 2BFEB 4TUYA 3LK6A 2GKSA 1Y8RB 2IKSA 4ZYUA 1CF2O 4LDAA 1M2NA 2C9BA 1YJAA 4I5GA 1O8BA 4EGQA 5C46F 4W7HA 4C04A 1J7KA 4LA4A 2AXNA 3P9CA 4MUFA 1U7XA 5ALVA 3CX8A 5KOHA 3QOFA 1JAXA 4XB6B 4N0DA 4HDMA 2R8ZA 2AC2A 1RKQA 1X7YA 4M1OA 5ALJA 4P0QB 4YJ2A 1SWWA 1UBJS 1YE3A 2IDJA 3D2AA 4KCGA 4Y6LA 1R6AA 1YMQA 2AFHB 2FUG1 3ONFA 4MPTA 2FZWA 4O4HA 4S1OA 2VAWA 1NV8A 3BFJA 1C1DA 4ZEVA 1I3MA 4L8YA 1FMFA 5JD5A 1YIAA 1XNHA 3VJKA 2ZTLA 4ZU1X 1R37A 2WM3A 1YHZA 5KUTA 3RBXA 5KNBH 1ZVVA 2HR1A 1D2AA 1RYYA 3WKEA 1DCKA 2GEBA 4OP1A 4B82A 1GNVA 3CLKA 4A4DA 2FZKA 2ZUTA 3O03A 3RVDA 2GXQA 2WE7A 3VDRA 5L3RA 3ZY5A 3LNTA 3DMYA 4V39A 1SG0A 1XA3A 3L43A 4E5DA 5BWMA 1Y1LA 3GCXA 2MSDB 4AJJA 4FGWA 4Y7CA 4JP3A 1E1CA 1F8GA 1PYOA 4JP8A 4C3OB 2LCFA 4WERA 4O5AA 1K5GA 4Z9XA 3C3WA 5LZ9A 4JI2B 3DEAA 1PZHA 2MHCA 1WDTA 3BMOA 3GZNA 3IESA 2PRYA 1I4OA 4R8SA 1XLWA 3RYIA 3WGQA 2NV6A 2VJMA 4F3KA 3W8FA 1ZCJA 5EIEA 16PKA 4L08A 1R0WA 4Y2UA 2KE5A 5ITZB 3RYCB 4I0WB 3MAGA 1LH0A 2CDCA 2I34A 2VDQB 3QKRA 4LW8A 3ESBA 3Q5GA 2C3YA 1A2OA 1VRCA 4TMXA 4E13A 2VZLA 4C4YA 2GF2A 4YP0A 4G9BA 1P6QA 4AO8A 4AZ3A 4KFSA 2QZZA 5F76A 3AVUA 2B8TA 2C1ZA 1Y0BA 2WU4A 2WSLA 3U40A 1SK9A 1NNI1 2E89A 3GPCA 1U9IC 5E4TA 3OEED 3Q41A 3KXIA 3NBZC 4ZICA 1E2JA 3RJTA 3ADCA 2VK8A 4MDHA 4R1QA 1U2PA 4HC4A 1AS3A 3C6BA 2AG8A 3ZE6A 4QECA 5JBQA 2FMKA 4FCWA 5HOQA 1ZJWA 1Z88A 2QIPA 3JW8A 4CKCB 3SI7A 3MBOA 1SIOA 2OAEA 1HBJA 5EPOA 2AXPA 1CZRA 5FJJA 1O95A 2CD7A 2W6IA 4J90A 2BDTA 3RS5A 2A1IA 2Q2OA 1FQJA 1O97C 3U09A 1NVWQ 4MVJD 3WK8A 4ZN6A 4KMSA 2O1SA 2P41A 4KO3S 5GADl 1DRWA 1NOJA 3LW8A 3VH4A 4CQMA 3VR3D 2VRWA 4Z7OB 3PKIA 3CRQA 1MNQA 1MO5A 2CUTA 3BDAA 3Q3GE 5A06A 2Z57A 3Q98A 3LNCA 2P5UA 2JIRA 3VMMA 4AMZA 1PUIA 3T5BA 5K01A 1XMXA 5C5IA 2ZUEA 2BBWA 1LPNA 4E0BA 3GEIA 1T3SA 7REQA 3H8VA 1E5VA 3C39A 1NVKA 4Q48A 3CINA 3WL6A 5IT5A 3DXYA 2ISCA 4FMCF 4GLBA 1TCVA 1N6IA 3LGSA 1KJ8A 1QG2A 3U31A 3A9VA 2ONYA 4XLLA 3ZQ6A 1RRGA 5C3MA 4JODA 1U1FA 3K31A 1H93A 1MEEA 1Z0AA 2JIBA 1G6KA 4DDMA 2FPPA 2Q6VA 1F5NA 4MTLA 3IQWA 4OI1A 3T0GA 4F85A 3QQ5A 1N0HA 1RZRA 1PK7A 2QD4A 3GX1A 5JWOA 2DQ4A 2G07A 4LV8B 4RFLA 3AI3A 1PR9A 2K2QB 4RM3A 4X6LA 5IKPA 5J4VA 1ZEJA 3EJWA 1LVUA 3LUPA 1S2LA 4N6OA 1D0SA 4LYAA 4OCZA 4P33A 4K88A 3DHNA 4NYIQ 5DSXA 4O2AA 4UPDA 4F4FA 5GZ1A 3UMJA 3BF7A 2SHKA 3QKTA 2JBHA 4IIVA 1OZAA 1M66A 4W1RA 4EQ6B 1F38A 3O2SB 2FN9A 1EP2B 2QENA 3HV2A 4LTNA 1UKYA 1VJCA 2JD1A 3DBHB 4G1EB 1XYGA 3LX8A 2F7SA 5JYEA 2ZETA 3BKWA 4WY5A 2QQGA 2WAAA 1JEJA 4EG5A 2PGDA 2V96A 5B5SA 2NGRA 2BKLA 1O6FA 1ARZA 4XPIB 1OB2A 1XZFA 3A6PC 1TZMA 3AJRA 2XT0A 3WL7A 1KL7A 4HVLA 1T8UA 4LNUA 5DT2A 4ZCQA 4FD3A 1Z3IX 2FFAA 2UYOA 4RK0A 1ADCA 2ZTHA 4KQ9A 4G5HA 4LS3A 3FDZA 3PPWA 2R1VA 3KK0A 1MFZA 1SD2A 2CEAA 3CZQA 3GYBA 3HJCA 3JWPA 3TLGA 4MRRA 4D0SA 4BP8A 3GLFA 2NU6B 4BNUA 3BTUA 1VKJA 1D1TA 1GVNB 3IIKA 4ZT4A 5LZ8A 4A73A 1WXWA 1NJ2A 2A0WA 1RACA 5EP1A 5LQNA 1KH2A 4LF4B 4BLUA 2P3QA 5LWHA 4E11A 3QVUA 2AG1A 5J2UB 3GEPA 4LZNA 1DT3A 5LYYA 3A2MA 3GCZA 3EASA 3W8RA 4ZU3A 1V6CA 1L5SA 4M1KA 3MGKA 3DLTA 4TZ0A 5E1OA 3M1IA 4DTIA 4WAUA 1BXRA 5BN5A 2CHVA 5ENZA 1UANA 1NN3A 2CC2A 2L19A 1GKLA 2QRNA 3LDFA 2A86A 4GZMA 1M1YA 5FOSA