4WCFC

Trypanosoma brucei ptr1 in complex with inhibitor 9
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
267
structure length
244
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVKTVETQVAELIGTNAIAPFLLTMSFAQRQNLSIVNLCDAMVDQPMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pteridine reductase
publication title Exploiting the 2-Amino-1,3,4-thiadiazole Scaffold To Inhibit Trypanosoma brucei Pteridine Reductase in Support of Early-Stage Drug Discovery.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
total genus 89
structure length 244
sequence length 267
ec nomenclature
pdb deposition date 2014-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4wcfC00
2EV9A 1J5PA 4AJKA 1YVEI 3TNLA 4MIOA 3V2GA 3UOGA 2TMGA 1UP7A 4IIUA 1VPDA 4HY3A 4QTZA 1M6HA 2X9VA 5JAIA 4LVUA 1EVZA 5JDIC 1LC0A 3ZHXA 1P0CA 1E5LA 3UXYA 1SC6A 3I9JA 5DULA 3VZRA 4BNVA 4XEHA 1PIWA 3WSVA 5JMPA 4UUPA 1AE1A 9LDTA 3OICA 2Y0DA 4ID9A 2NQ8A 1O94A 1FDTA 2ZQZA 4FS3A 4CM3A 1FDUA 1LLDA 3ROPA 1A4UA 3KTDA 3D5QA 4PLHA 4CM8A 1PR9A 2Q1WA 4NJOA 4BNLA 4JNKA 4ND5A 2DTXA 5JY6A 4XQ9A 5ER6A 3ONFA 3UKOA 1PL6A 3DHNA 1E3EA 3WB9A 1NVGA 2I66A 1E6EA 2QYTA 2B0JA 1C0LA 4IIVA 2GN8A 5EJ2A 4KQWA 3KZVA 3E18A 4CR7A 4E12A 4BNWA 3G0OA 3DDNA 1XU7A 1H9BA 5TLSA 2VT2A 3RIHA 1B8UA 2PZJA 2FPGA 3UF0A 2BFAA 3WYEA 5T8KA 1NWCA 4MO2A 5TRTA 4B8ZA 2Q4EA 1UP4A 2O3QA 2UDPA 4NFSA 3TPCA 4XX0A 3LQFA 5H81A 2IEBA 5KKCA 4JROA 3LZ6A 5BNTA 1XA0A 3Q0EA 2O50A 3DBHA 2EGHA 5JE8A 1R15A 4OGWA 1SBYA 3CZMA 2B83A 4I1IA 1YDEA 1ONOA 3EMKA 1PZGA 3TL3A 1QXSA 1LNQA 4AG3A 3V1UA 5F1PA 4L4XA 3CEAA 3UVEA 5L9AA 3WGTA 1IY8A 1E1NA 4L0QA 4MVJE 3AOGA 3HN2A 3PK0A 3U4IA 3F9IA 1EE9A 4XYBA 3RC1A 4OO3A 4PG8A 5MGBA 2BLLA 1BXGA 4L73A 3PGJA 1ZO8A 4DLBA 2O4CA 1KY5A 2Y93A 2DPGA 3VPFA 3LC7O 4KMSA 1DJNA 1GTMA 2HK8A 4TWRA 3FCOA 1G1AA 2CSUA 3JV7A 4W9NC 1P1IA 5COAA 3TZKA 4DRYA 5JDIA 1A7AA 1HDRA 2ZYDA 1R0KA 1DSSG 1H6CA 4W7HA 4GX1A 2PD6A 1O0SA 2ZTMA 3WGOA 4YT2A 1OC2A 3ASUA 2XXBA 4LCEA 2EEZA 1E1MA 2YY7A 3D64A 3G49A 4DBVO 5I7VA 1F8FA 1MA0A 2NU9A 4BMSA 3FN4A 3ITDA 3C7AA 2Y0CA 1SOVA 5HA5A 3P2OA 3W8DA 1HKUA 1WWKA 2QRLA 4QXMA 2YV1A 4AJLA 4FR5A 2GPTA 1T2DA 5A02A 3OP4A 3DHEA 3JQGA 3C24A 4NI5A 2FSSA 1Z45A 1R6DA 4R69A 1EUDA 1W4ZA 1T26A 2FP4A 2YHIB 2J6IA 2HKIA 2RBEA 1T4DA 5L7YA 3JD1A 1I3LA 4AVYA 1LQTA 1C1DA 2ZYGA 1PJCA 4DBZA 4Z9YA 5FYDA 4RVHA 1HLPA 2HMTA 1DLJA 4J6FA 2X0NA 2X9GA 3PJEA 3X2FA 4TRMA 5EQFA 1LX6A 2FR0A 2Q2WA 3IP1A 4GWKA 4WASA 4CM1A 2PTGA 4LCJA 3C8MA 1ARZA 3BTUA 2W2LD 1R0LA 1R4NB 5F1OA 3IL2A 3E1KA 3BMOB 1T2AA 1P74A 3JD0A 3BXXA 4C4OA 3C7CB 4XYLA 4PVCA 1T24A 3BMQA 4PIVA 1HYEA 3GVXA 4PFJA 3ROQA 3GY0A 1V9LA 1CQIA 2DAPA 2GSDA 2DKNA 3R1IA 1H6BA 3C1OA 3GK3A 3GRKA 1NVMB 3NGLA 4PLTA 5GZ6A 5L7TA 2FWMX 2CFCA 1N7HA 2ZIZA 4GGPA 4PLFA 2EW8A 1IYZA 3K8ZA 5THQA 3H5AA 1AHIA 1KVTA 2ET6A 1Q7CA 4XYMA 1BG6A 1KOLA 5CDSA 1KS9A 4W9NA 3GLQA 3EW7A 1V0JA 3QQPA 1ENYA 4E21A 1D4FA 3LDHA 1ZBQA 5B1YA 4BKOA 4J1NA 1P0FA 3QWAA 3RUFA 1V8BA 2E6UX 4B7CA 4G2NA 1A72A 2DFDA 4NBTA 4ZN6A 1DO8A 1NFQA 3ON5A 3PJDA 1HDZA 4HNGA 1WDLA 4IXTA 5U4QA 3RC9A 4OXNA 3CTMA 3ZV5A 4A73A 2CDAA 4RZIA 2V7PA 3WSWA 4PLVA 2CVZA 2PY6A 3D0OA 1ADBA 5DBFA 4DYVA 1YH3A 4R1NA 1OAAA 2BI8A 5DDIP 4J43A 5HWSA 3GPDG 2C2XA 5KJEA 1NFFA 3JQAB 4CMIB 3HB5X 5FI5A 4O5OA 4OM8A 5CHEA 3UICA 1VSVA 1U3WA 3IP3A 3GZNB 5H82A 2BHLA 4RVDA 3STHA 4EBFA 3AUUA 4R16A 2B37A 1PS0A 2XAAA 3HWRA 3B1FA 2QZZA 1LSSA 4HX5A 5JYEA 2CDCA 4GMFA 4OKNA 1QRRA 2IRWA 2FY8A 3OJFA 2HRZA 3ADPA 2HJSA 4XA8A 4B3JA 5IN5A 1RM0A 2JAHA 1YONA 3ASVA 3RUDA 3LVFO 1P31A 2RH8A 4AJ4A 4NDNE 4DQVA 1Y8QB 1MXFA 2OL4A 5EL0A 3BA1A 1EEHA 1ISHA 4YACA 2OXIA 3PWZA 3ZCXA 4ND4A 1ZIDA 3W4JA 2I5PO 3BTOA 3D4NA 4CLOA 4RLSA 3NX4A 3BAZA 4DVJA 4WECA 1IPFA 1ISIA 4J0EA 4DPMA 4FGSA 4YWJA 2C2YA 3PTZA 5KJ1A 3JYOA 1F8GA 5L4LA 4A03A 4YAEA 3OQBA 3ICPA 3L07A 1PJ3A 3TWOA 3E9QA 5L45A 3PEFA 4DGSA 4CM9D 5AXDA 2NQTA 4Q3AA 1ZZEA 4YAKA 1GYRA 3EDMA 3IUPA 2X5JO 4D3DA 3EZYA 2EF1A 3KSUA 1XELA 4I9HA 3VPXA 3GHHA 5IDXA 3UHAA 3MJ4A 3NAQA 5DBGA 1QORA 1EQUA 1WDMA 5I7EA 2WWRA 4NBRA 5DNAA 1LLQA 2JD2A 4HXYA 2JCVA 1RYDA 4XIYA 4IQ0A 4GBJA 4W6ZA 2BMAA 2QG4A 3F47A 5JO9A 1BGVA 4M89A 4E0BA 1K89A 2Q50A 4PRLA 4UEOA 2VWHA 1U5AA 2B5WA 2HMUA 1DPGA 3MCVA 1X14A 2IYOA 4GLLA 4J91A 5ITVA 4ZU3A 4HWKA 1TT5B 1YL7A 1HZZA 2CDBA 4OMUA 3ZWAA 1B8PA 2BF7A 4N18A 4UUMA 3QWIA 3HUDA 1QV6A 2CF6A 2IEDA 3NJ8A 4FBGA 3H2ZA 2NVUB 2EP7A 4CQMB 4I5GA 1FK8A 4BNIA 1PJ4A 4EI2A 1DAPA 3ETDA 3HJAA 2I76A 1U28A 1YB5A 4CV3A 1H94A 4BO2A 4G81A 1C1XB 4L74A 3RAJA 1T2CA 3NUGA 5CDYA 2QRJA 1X1TA 4L4SA 2JFGA 4XD2A 2X5OA 4J90A 4XZ3A 5GZ1A 1FXSA 3F3SA 4UUOA 1PS8A 4D43A 3I9MA 3JQBC 4IY1A 4YJHA 2PR2A 2NNLD 3WLFA 1HYHA 3DMYA 3MJSA 1D8AA 4WEOA 5KVSA 4PG6A 1Y9AA 4Z3KA 3CXRA 3VZPA 2A9FA 3OJ0A 3I52A 3L0DA 5EMHA 3WX0A 3H7AA 3I4CA 2BI7A 2DBRA 3E9MA 2OFPA 5GY7A 2PZKA 3AUTA 1UP6A 4DYDA 4U0KA 1WDKA 2J5RA 4LSWA 2FSVA 4PLGA 3PJGA 2AE2A 1FDSA 1DIGA 4YRDA 3SLKA 3U4DA 1GYPA 2ZK7A 2JAPA 3HZZA 4GPD1 2O23A 5JO0A 3WNQA 1DIAA 1ULSA 4CM7A 4OQZA 1B16A 3VVCA 3C1AA 2Y68A 3GFBA 4WGGA 3PYXA 1BWSA 4PCVA 4O59O 3OETA 4KUEA 2H1SA 1B3RA 1UUFA 3TJRA 4QO7A 1ZSYA 5K6AC 1PZEA 4E2ZA 1EK5A 1K6XA 1U4SA 4MKRA 3SLGA 4LISA 3DQPA 4BO9A 2CF5A 4WLOA 1I01A 7MDHA 1V3TA 3KM0A 2QW8A 4HP8A 4YTEA 3WQSB 2XXJA 2EP5A 4ILKA 4E5NA 1TB4A 3QVSA 4MJLA 1HDOA 2NTVA 1ZSVA 1T2FA 1TT7A 3QRWA 4HNHA 1BVRA 3ANNA 4OJNA 3RUCA 4ZQFA 2X23A 1DIHA 2E82A 1UZMA 1LLUA 2E4AA 1QR6A 1DB3A 4FC7A 1ZUD1 4D44A 1LBEA 2NU6A 3PQFA 4BNGA 4MKZA 3VTZA 1YOVA 2OP1A 5JCJA 1ZK4A 2VHZA 1DFHA 4AL4A 5KVCA 1IOLA 5TJ9A 4EDFA 4K28A 1KC1A 3VPHA 2A4KA 3BMOA 4CPDA 3PDJA 1O6ZA 1JKFA 4XR4A 2VN8A 3B20A 3ZU3A 4CLRB 1X7HA 2GLXA 3O26A 1JDJA 2NVBA 4QFCA 1LSJA 3MJVA 4MIEA 1HYGA 2WM3A 3DONA 1GD1O 3FR8A 3JYLA 5JNLA 3KEQA 1DHRA 4IDBA 1PJSA 4I9UA 4BS9A 4M49A 4NFHA 4O1MA 5TGDA 4YDRA 4BO1A 1K6IA 1PJTA 3RI3A 1Y7TA 4M55A 4F6LA 3GPIA 3GA0A 2GR9A 1HDYA 3DZKA 3U5TA 3PHIA 2DTEA 2PA3A 4CMGA 1MC5A 4P22A 1E7YA 4E5KA 2AMFA 1SAYA 1QYWA 2PGJA 1RKXA 2EGGA 3OJOA 1XDWA 4M8SA 3RFXA 5COQA 1H2HA 3KSZO 4IZIA 4Y6RA 1BMDA 1LDYA 1KYQA 1F17A 2C7GA 2HLPA 5ILGA 1EVIA 2QZ9A 1GPDG 4LW8A 1D7OA 4EYEA 1ULUA 1EDZA 1CEQA 4QO8A 1YQDA 4UREA 2RCYA 3LU1A 2ZCVA 4DREA 4B7UA 3ZWNA 2XF8A 4ZICA 4MP6A 2B36A 4RVGA 1TEHA 2VZ8A 5TNXA 4EUHA 1O9BA 5LC1A 4TQGA 5L4SA 3JQ9A 1RM3A 3PVZA 4HFJA 3ZWMA 2X4GA 1QYVA 1HDGO 3BYZA 3GH3A 1IZ9A 2JKVA 3GZNA 1B15A 1Y81A 3WGYA 1AHHA 4QUKA 1E3SA 4I8XA 3MTJA 1QYDA 3FF4A 3OBBA 4D3FA 5JC8A 4N5NA 4O6VA 1YGYA 3SJUA 4F6CA 1P1FA 1I32A 2AQ8A 4CV1A 1YB4A 1LRKA 4BV8A 3H9GA 1Z75A 4XRRA 3COSA 4Z6KA 2H6EA 2VYND 3CMCO 3KYBA 5B12A 3LLVA 2QX7A 5A04A 4B7XA 1Y8QA 3ITKA 2YUTA 3FTNA 3IS3A 1YRLA 1CERA 3AFMA 4OSPA 4A5OA 2YQ5A 4RPJA 4K9DA 4ESOA 2Y1DA 3AM5A 3F1LA 4XGKA 4XB2A 1KETA 3WOHA 2PFGA 4JLWA 1V35A 1NHGA 3NV9A 1Z6ZA 4Z0PA 5CDUA 3RKRA 4IJUA 3NT2A 1OC4A 4AJJA 1ADFA 3TZCA 4YCAA 3KOUA 4JX8A 4FQ8A 5I9LA 4EITA 1AN9A 3R3JA 4ZRNA 4O63O 4GWGA 3F46A 4PG5A 3RVDA 3TSCA 3ZWOA 3DOCA 4TVOA 5JAZA 5BR7A 1KEWA 4UUNA 3NTOA 1PGPA 1GUFA 2NSDA 4HFMA 2O2SA 3DZGA 4Q3NA 3HFSA 1Y9EA 1X0XA 3BHJA 3RFVA 5JMWA 2IZ1A 1G0NA 3I4FA 3MZ0A 5FEUA 4AJPA 2NV6A 1U3TA 2DBVO 1PEDA 1SOWA 4R1UA 3PYLA 3QJ5A 4NMHA 2P5UA 3MOIA 4PZEA 5K0ZA 4KP7A 3BZUA 1LC3A 1T1RA 4GLOA 1TT5A 1ZMTA 1B14A 2P4HX 1T2EA 4R9SA 4EUEA 1BXKA 4U5QA 5TJHA 2NVUA 4CQMA 1XHLA 3RROA 2D0IA 5DP1A 2VWQA 3WLEA 4KDFA 4YYZA 6LDHA 1GEGA 3WIEA 5JCJD 3TOXA 1C1XA 1PS9A 1ZXLA 2VUUA 4U8GA 5JC1A 1MFZA 2XPCA 5FI3A 1CQJA 1ZMOA 1M67A 4DWVA 5KKAA 2SCUA 1JW9B 1FDWA 4R01A 2AE1A 4CR8A 4RPGA 2P9CA 1ISMA 1ZK1A 3K96A 4IZHA 1VM6A 2JD0A 3R0IA 4FFOA 1GUZA 4BNUA 4G5HA 4CLOB 4B3HA 1GADO 4TZKA 3MJEA 1TLTA 1KEUA 2UUOA 3AU9A 2AEJA 1ZKMA 3Q1LA 1A7KA 2EHDA 5L7WA 1B2LA 1P1RA 2NVWA 3ZU2A 2Q1SA 1W6UA 1PWZA 5TSDA 4S3MA 4J3FA 1X7GA 4YRBA 4S1VA 1K0UA 2VOJA 4R3WA 4AJIA 2VT3A 3GFGA 3HDQA 3IDSA 3OFSA 4IDCA 2IXBA 4P4GA 5CG1A 3O38A 1H9AA 4B4OA 2B35A 3M1AA 5LDGA 1NQTA 2ZTUA 3DZFA 2WD7A 4BGEA 4IDFA 4XYEA 3DZHA 3IAHA 3Q2IA 2WDZA 5DBIA 1HSOA 1I2ZA 2BRUA 4Q3EA 3V2HA 1FJHA 3RSHA 4ND1A 1OMOA 1VL8A 1BXZA 2EERA 1N9GB 3WGZA 2GF2A 3DB2A 3G1TA 5BNFA 3D1LA 2I3AA 3C3XA 5A9RA 1S6YA 4Z0TA 4BOYA 1XGKA 1NM5A 3JQAD 3FD8A 2GO1A 3RFTA 1DC5A 1E1KA 5ILOA 2EW2A 4W82A 3DBLB 4A27A 4ZGWA 2CY0A 4TSKA 4OAQA 1E7WA 4P4LA 3ZHBA 1QYXA 3AJRA 4D79A 4CL3A 2POQX 3ZWPA 2JHGA 3ZV4A 3GDFA 4GAEA 1MB4A 3GMSA 4CLHA 1GZ6A 1MUUA 4LGVA 1ZW1A 4BNJA 2P9EA 4YB8A 1J0XO 4YJHB 1WAMA 3QWBA 4NNJA 5JFOA 1E5QA 1VSUA 1I10A 3ZGYA 2Z1MA 1VJTA 3S2FA 2PD3A 3I3OA 1XWFA 1IHYA 5F3RA 4BIIA 4CLRA 1P3DA 1D3AA 5TF4A 3SEFA 1FDVA 1BSVA 2GZ3A 4Q3DA 2YW9A 2YV3A 2GD1O 4AJEA 3FWNA 5BSEA 3NTRA 4GSLA 4YPOA 4EUFA 3KYCA 3GGPA 4IINA 5CPFA 5AVOA 4HBGA 1PQUA 4GL4A 3NT5A 2E48A 4HKTA 1E0DA 3AM4A 1EUCA 1ENOA 4AICA 4CODB 2B4QA 2YQ4A 4FJ1A 3SC6A 1ZK0A 2DTDA 3A28A 3QHAA 1YJ8A 5AXCA 4DMMA 3QIVA 3ZHZA 2CNBA 4MVJF 4TKMA 5AYVA 3CUKA 3ZWVA 5AOVA 4WOJA 2D4AA 4R54A 2W8ZA 4RV9A 3GAZA 3V2UA 3PZRA 2G17A 4MP3A 4GQAA 4FOOA 3M1LA 1VKOA 3RBZA 2D59A 1QYCA 2C29D 3GR6A 2ZB7A 2DT5A 4RF5A 3CKYA 3D5TA 4IMRA 4NH4A 2HU2A 5HS6A 3WYBA 3TFQA 4XJSA 2GNAA 4BNTA 4R1TA 3D3EA 1Z73A 1QLHA 2Z5LA 1C14A 4OSOA 3VPSA 1YQXA 3OIGA 1Q1NA 3RUIA 3N58A 3JQFC 1I33A 5JSFA 4CL8A 1UJMA 2Q45A 1DXYA 4J4HA 1J6UA 5TC4A 4E2WA 5ICSA 1C0PA 2VRCA 3CPSA 4J1QA 4TMFA 2Q99A 2O7SA 2E37A 2PKQP 2X0IA 1X13A 1ZSNA 1UDCA 3L6DA 1YOVB 4OL9A 3W6UA 2OZPA 6ADHA 2VTDA 4CQMD 3G1UA 4UVGA 4J7XA 1RJWA 2DBQA 3FPLA 2Y0EA 3QA9A 3U0BA 2PGDA 1F0YA 2PV7A 1ZJYA 3PFFA 3DWFA 3IMFA 4RVUA 1GQYA 1HT0A 4CMCA 4GKBA 2LDBA 1BW9B 1GCUA 1LSUA 1YBAA 1V3UA 1YO6A 2ZB3A 3D3WA 1O8CA 4HV4A 4FFLA 4IM7A 1I5RA 2G76A 1U8XX 2PK3A 5JAQA 1XEAA 1JWAB 3L4BC 5T64A 1FF9A 2J5QA 3C7DB 5IDWA 2A92A 1GR0A 5BNIA 2GGSA 2RAFA 3RD5A 4YBZA 3WG9A 4A0SA 2X1HA 4BV9A 3A06A 4QQRA 1I2CA 1WNTA 3RU9A 5AQ1A 5H83A 2FN7A 3WJAA 4B4UA 1QKIA 2GUGA 3DFUA 4Z0HO 1PR3A 4YJGB 3MTGA 1O89A 2J8ZA 4WLNA 4NJMB 5DCYA 1N8KA 1HE5A 2ZTVA 4CMEC 4IXWA 3KV3O 4U0JA 5BT9A 3VHRA 3L9WA 3W4KA 1M66A 2FR8A 3I9KA 4EJ0A 3OSUA 1HXHA 1RWBA 3JD2A 4E2XA 3KVOA 2GASA 3DC2A 1B26A 4E5YA 3M2PA 5T5QA 3RUHA 1OZAA 2UV8A 4IUYA 3QVXA 4P8RA 3CIFA 5B37A 3GEMA 3JSAA 3ZI0A 3JQFA 3PXXA 3VDRA 1AXGA 3OF2A 2JCXA 1EMDA 2Q2VA 5DF1A 3NJ4A 1QV7A 4BO4A 4YT4A 4BO6A 3F4LA 1RM5A 1YS4A 1GZ4A 3ENKA 4Y6PA 5G0WA 3VKVA 1XQ6A 1PWXA 4DLLA 1PSDA 3WMXA 3I6QA 4BQPA 5U9CA 3GN1A 3IC5A 3ZDFA 1R0SA 5JAMA 1Z7BA 3JQEA 1SEPA 3GZ4A 3UUWA 4JJGA 4ALNA 4E2YA 4RQTA 2V6BA 1BVUA 3QV1A 5DZSA 1DC6A 4HFRA 4N7RA 4J49A 4ONEA 3KLMX 1E3LA 4YAJA 1NWHA 2RIRA 3GGOA 3ONDA 2Q4BA 3VTFA 4II3A 1JU9A 3GGGA 2ZATA 1MG0A 4PG7A 4J9UE 1GFSA 3QWFA 4J16A 3AI3A 3NDJA 1PJ2A 1ML3A 3EYWA 3HHPA 1HEUA 3ZNPA 2R00C 3NKLA 2QHXA 3WDSA 2VHYA 2FZWA 1XKQA 1JKIA 2G5CA 4IJWA 3IKVA 1NPYA 1ISFA 1GCOA 1SCUA 5BQFA 3AM3A 5JBIA 4NU5A 2BFMA 1IUKA 3WNVA 4X54A 1NYTA 4GX5A 8ADHA 2HAEA 4IDGA 2P5YA 2VZ9A 3AI1A 4MIYA 1QP8A 3INRA 3IOYA 3HDYA 3S8MA 1PJLA 1T25A 1XG5A 4II2A 2G0TA 4IBOA 4PN3A 4CUZA 1DLIA 4YR9A 3FTPA 4WE3A 1M76A 5JPIA 3VVBA 3KEOA 3JQDA 1GY8A 2C5AA 4FW8A 1Y8RB 3PHJA 3ROKA 3HNPA 3ZNOA 3Q3CA 5T57A 3LT4A 5B4VA 1RYEA 3DBRA 1JKJA 3OJLA 1N9GA 4I5DA 1DC3A 3DZJA 4OXKA 3MWDB 1YQGA 4FD3A 3BHMA 3IJPA 3G3EA 3HG7A 3NRCA 4JBGA 3KUXA 1P44A 1NAHA 4HFNA 5TX7A 2VRCD 2H5LA 4WCDA 4BNZA 4DIOA 4DA9A 3DBLA 4KWIA 2DBZA 1PU2A 2F00A 3JQCA 2BH9A 3PYMA 2B4TO 4XJTA 1DEHA 4XGNA 4MP8A 5IDYA 4TRRA 4URFA 1ZFNA 2JFFA 1KVSA 4J7CA 4BGIA 1H6DA 1LDGA 1R66A 2OORA 3MOGA 3K6JA 3QW2A 5I8WA 5CG2A 3H9UA 3SJ7A 3GVIA 2RH4A 3NGXA 3H65A 1NP3A 4MVJM 1DRUA 4E5PA 2Z1NA 2ILTA 3VZSA 2NTJA 3UW3A 4A7PA 1P1HA 3QE3A 4HADA 2PLAA 2GN6A 3Q9UA 1BDMA 5MDHA 4FB5A 1VJ1A 3QLJA 1B7GO 4ND2A 3A1NA 3FNHA 4UAGA 4BNKA 3W4IA 3PHLA 4TZTA 3T7CA 3C1TA 3RBXA 3EHEA 3WBBA 4J1TA 1MFPA 4G65A 2HRBA 2NUAA 3H9JA 4FJ0A 3S2EA 4CQLA 1DFIA 5JDCC 1VL0A 4MKXA 4WK6A 2WYUA 1ISJA 3OHSX 3BIOA 4P4NA 1NBOA 3V1YA 3FHLA 4ND3A 3R3SA 1Y5RA 3H3JA 4R41A 4Z3DA 5KOIA 3TZHA 2WD7B 4R68A 5L4NA 3C85A 1IULA 3W6ZA 1HLDA 3FBTA 1WLYA 2AA3A 2HMVA 4BMNA 1EVJA 3E5RA 3O03A 4NBVA 5ER9A 3Q9NA 2Y1GA 3S2GA 1GQ2A 5JLAA 4D41A 2BFPA 1ZEJA 2NLOA 3KBOA 1I3KA 2Y99A 4RF2A 4RF4A 1CJCA 4QEDA 3S2IA 4I5EA 1KC3A 2IODA 4CM5A 4HUJA 4BB6A 1EFKA 3ZWXA 4IDDA 2ZYAA 1NR1A 4DMLA 4E30A 1NQ5A 4M1QA 1U3VA 2ZCUA 1LTHR 1I0ZA 2NU7A 3CZRA 4PLPA 1ZVMA 4NZ9A 4IQ8A 5BSFA 3FWZA 3U62A 3N74A 5C3MA 3F1KA 2ZQYA 2O3RA 2DUUA 3VC7A 3KETA 5KJCA 5A5FA 1DIRA 5L3ZA 3UCFA 3ETEA 4YJFB 3UCEA 5HBRA 4AJOA 3U4CA 1XLTA 1F06A 1LDMA 2VHXA 3ZWCA 3OH8A 1EQ2A 3JYPA 3JQBA 3I9NA 5LCXA 4ZQGA 1LRLA 2OBNA 1ZK2A 4LMRA 1BW9A 3OJEA 3LLSA 1LDNA 3BTVA 1H6AA 1XU9A 2FPPA 3L77A 3OIFA 4C7JA 3KYCB 3OA0A 3PLNA 5I9MA 3WTCA 4LSMA 4MVJA 4FFNA 4NHEA 3WGQA 4CMJA 3LF2A 1UZNA 2AHRA 1U5CA 3IUSA 2PGLA 1SNYA 4OKIA 4B4WA 5BSHA 3TZ6A 4RCVA 4B79A 3P5SA 4F46A 2HUNA 3X2EA 5KJ6A 2WE8A 3DBVO 3K92A 1KEVA 3CSDA 3VKUA 4BO7A 5JDCA 1JLLA 5CEFA 1N1EA 4MVJH 5F5LA 3ULKA 2GN9A 2YFQA 4YJGA 3HDJA 4NPCA 4NJMA 4JGBA 2J3JA 2C20A 5K6AA 3KO8A 4FGWA 5IXYA 1KVQA 1YL6A 2YZ7A 4CM6A 3H8VA 4JP3A 1I3MA 2DM6A 1Y6JA 3JYNA 1PGNA 4N5MA 1W0CA 4GH5A 5AXAA 5DT9A 1B0AA 2C59A 3NYWA 1ZCJA 1C3VA 2GERA 3ZZNA 5A06A 1F12A 1UXKA 4GGOA 5F1KA 4NG5A 3Q11A 3ANMA 4AJHA 3DOOA 2OOSA 1X0VA 3I23A 4JJIA 1VRWA 3PPIA 3DAGA 3W8FA 1X1EA 4RVFA 3VH3A 2D5CA 1JA9A 1EUZA 4AJNA 3B1JA 2PZMA 3H6KA 1R4MB 3AI2A 3EC7A 4QT0A 1HZJA 2AQIA 4RO0A 1VJ0A 2CZCA 2Q46A 4XCVA 5G0SA 3WMWA 3ZW8A 1RM4A 1LQUA 3GNSA 3AUAA 1CF2O 1ADCA 1KY4A 2IDZA 1YE3A 4ZRMA 3BTSA 4WCFC 3H2SA 2GZ2A 2BGLA 3EAGA 1YJQA 2IYPA 3ZU5A 1L1FA 2GCGA 3WIDA 4BNNA 4YAIA 1JWBB 3RUAA 2QIOA 3LK7A 1ZJZA 2O3SA 3LF1A 1N5DA 1NVTA 3D3WB 3GMDA 4WNIA 4D45A 5A03A 2R6JA 5CDTA 4W4TA 4Z9XA 3ZNNA 3ETGA 4L8VA 4E4YA 1E6UA 2QRKA 2OGUA 4GX0A 1XSEA 2BELA 4IJKA 3V5NA 2X58A 2VNSA 3I9OA 4H16A 1T4BA 5COBA 4NK5A 1EFLA 4W7IA 1W73A 5EESA 3GVCA 1R16A 3F5QA 3JD3A 1HF3A 1GL3A 3S55A 1XYGA 3DAPA 3JD4A 2G1UA 4ALIA 3KYDB 1R37A 5IXSA 1KVUA 1ID1A 2J3IA 3UAGA 1DJQA 3JTMA 4PZCA 4ALMA 4BGVA 2VOEA 2V6GA 2YHUA 3QSGA 5DCWA 3OMLA 4YT5A 3WGGA 5I7SA 3F5SA 4CUKA 4WUVA 2HSDA 4OYRA 3OEYA 3OQ1A 5TS3A 1C0IA 1PQPA 2X8LA 2O48X 5CEJA 1MXHA 1Q0QA 1G0OA 4RLHA 1Y8RA 4LRTB 5HRUA 3L6EA 4IMPA 1O5IA 2DUWA 1NNUA 2VQ3A 5A3JA 2VCYA 3GHYA 4MVJP 4PLCA 1NQOA 4NFYA 4U6SA 4BNXA 2BKAA 4WLVA 4R1SA 1D1TA 3SXPA 1ONNA 4WPGA 3DZBA 4B8WA 2VNAA 2X0JA 2X6TA 3PZBA 4FDAA 4PG4A 4R3NA 1ZEMA 4Z9FA 4JN6B 3SC4A 5DP2A 2ZKLA 3EGOA 3RKUA 3U4HA 5C5IA 5F5NA 3HN7A 1YB1A 1V6AA 4A26A 3D4PA 3GF4A 2A94A 4BVAA 3DAFA 5THKA 3AUSA 5FF9A 4O0LA 5G0VA 3T4EA 5T8KC 4F3YA 4PRKA 3WR5A 1JAXA 2Q49A 3L6OO 3PRJA 2WTBA 3WQRA 1AUPA 1EBFA 1KEPA 1TI7A 2VTEA 3WQQA 5IZCC 1XR3A 3KXDA 1DFGA 1HE2A 4J2HA 1NASA 1CETA 3SVTA 1IL0A 1E7RA 4CV0A 2IXAA 1PL7A 3DEYX 2D5AA 4L76A 5GZ3A 1XCBA 4ROSA 4GSKA 3DMTC 2VHVA 4UULA 2ZJ0A 4R5HA 2VUSA 1DHTA 4MVJI 4OOFA 4Y98A 2F1KA 4CV2A 2BGKA 3PWSA 9LDBA 3FPCA 3FRJA 4WLEA 4BO0A 5CDGA 4NBWA 2A35A 2HQ1A 1MX3A 4IGEA 1EDOA 1AXEA 1GEEA 4FFRA 1GZ3A 1U2GA 1HL3A 3DHYA 4FSHA 1NXQA 4CMBA 4BUCA 2O3JA 4BO5A 3I5MA 4UVEA 4CMAA 1JTVA 3P19A 1UAYA 4WNCA 5K9ZA 2FRDA 4FFMA 2BD0A 4UEJA 3K73O 1WW8A 4MOWA 3SBOA 3DBRB 2H63A 4CMKA 4BL5A 1K5HA 1LEHA 1ZH8A 2B5VA 3OM9A 3ICCA 3EY4A 2IZZA 4BNFA 1SZJG 2VWGA 1IB6A 4KTTE 5JW6A 4FOSA 4TROA 5G4LA 4WLUA 4BKPA 2NACA 3CE6A 1UXIA 3RASA 4TKLA 5JYDA 4JBIA 1DC4A 3K31A 3LT1A 4BNMA 1DIBA 2EXXA 2NADA 5L51A 3AY7A 3DL2A 4YQZA 3PHGA 5IDQA 3AW9A 4ZQEA 1K3TA 3WYCA 5CAEA 1NTOA 4NU6A 2V6FA 3ANLA 5T6BA 4YJFA 3G79A 3VPGA 2X5KO 5U1PA 4BB5A 1OI7A 3AFNA 1P33A 2OO5A 4A10A 1SMKA 3I1JA 4N5LA 3LC1O 3BMCA 4ZHSA 2I3GA 1P1JA 2AXQA 1H5QA 2PZLA 3PLRA 5DN9A 5F21A 1PJBA 4M87A 5IZCA 4EJMA 5A9TA 1W8DA 3WTBA 4N54A 3ZWWA 1QG6A 3NT4A 1X15A 4H15A 3AOEC 5EN4A 5CEEA 1DOHA 4MPDA 8LDHA 2WYWA 1LSOA 4GVLA 1VE9A 3DMTA 3LT0A 4CQLB 3FNFA 4YXFA 1HE3A 2I6TA 3GQVA 1MC4A 4DXHA 2BGMA 3AY6A 4CUJA 5I7FA 3IQDB 2YFHA 4LN1A 3E03A 2I9PA 3UGKA 3ZWBA 3GT0A 2Q3EA 4J9VA 4E31A 1LA2A 3B70A 1N92A 1PZHA 3TQHA 3ZV3A 4LVCA 2B4RO 2WYVA 1ENPA 3GUYA 2IZ0A 2DFVA 5KVQA 3E48A 1IE3A 4QSMA 4FC6A 4L4RA 4JIGA 4WKGA 3T7EA 2GDZA 1SB9A 4R4JA 3QVWA 4E6PA 1U1IA 5LDHA 4BHTA 1HRDA 3B6ZA 3H4VA 4CM9A 1MG5A 2W98A 4C7KA 2VZ0A 3GDGA 4J0FA 5IJZA 1VLLA 4E32A 1CRWG 2W90A 2ZJ1A 3PP8A 1C0KA 2PH5A 1HDCA 2Q1UA 5EPOA 3B1KA 3GDOA 1PL8A 3GVPA 2VRBA 1CWUA 1E7SA 1M75A 1E1LA 5CPBA 1YL5A 3ZH2A 5CP8A 4Y9DA 1P77A 1R4MA 4D3SA 2IE0A 5BSGA 2D1YA 1N2SA 4NK4A 4YQYA 3G17A 2Z95A 3OIDA 5JS6A 2DPHA 3CMMA 2JCYA 4PVDA 4ALLA 3E82A 2NM0A 3LC2O 1OBFO 3WGHA 1E77A 2UAGA 3AU8A 5GMOA 3A14A 3QVOA 5TIIA 2EKPA 4CLXA 2NTNA 2HMSA 4ZQHA 4IS3A 1YXMA 1H0KA 2DC1A 2FZEA 3DTTA 3QY9A 4QECA 3DR3A 3K5PA 4XYGA 4DQXA 5L95A 3UN1A 4BKRA 1KERA 1FMCA 4K6FA 4XIJA 1BTOA 1Y5MA 1LLCA 1PGOA 1E3JA 1WZIA 3BHIA 3ZU4A 3D7LA 3ZV6A 3O8QB 2P4QA 2VHWA 1NQAO 1YDWA 1PJQA 2LDXA 2VWPA 3IJRA 2E49A 2ZB4A 3AOEA 2EG9A 3F4BA 4NIMA 2RHCA 4TVBA 5G0UA 1ZK3A 3A9WA 3I83A 3HSKA 2WEKA 3GOHA 4UVIA 2X7HA 2O3UA 1WP4A 3K30A 2HJRA 4DPLA 1L7DA 4U6QA 2W4QA 1UDBA 3KYDA 1Q0HA 2CUKA 4BNYA 4QX6A 1JAYA 4MDHA 1U4OA 1LU9A 2Q2QA 4IJVA 1BDBA 1E3WA 5DOVA 1T1SA 3U9LA 1HWYA 1E7QA 2AG8A 5KJFA 2PH3A 2I65A 3EVNA 1DDOA 5A05A 3R6DA 4U7WA 1H2BA 3JQ8A 2JHFA 3Q6IA 4BO8A 5I9NA 3GVHA 1A4IA 2ZB8A 4PLWA 2D2IA 4DQUA 4WLFA 4FPXA 2EJWA 2O4UX 4KQXA 1I24A 3GEGA 5ENDA 2CMDA 4RPKA 1WPQA 3M2TA 1Q7GA 2V6MA 1MV8A 3DTYA 4Q3CA 1QLJA 4JK3A 5AXBA 3WBFA 1N7GA 1Y1PA 2YDXA 3PWKA 4JQCA 1U3UA 3KRTA 4I5FA 4UVDA 4WOKA 1YBMA 5EIOA 4E33A 4ALKA 3T4XA 1A5ZA 4GVXA 4MVJG 5EQDA 1LXCA 2C7VA 3PQEA 5ITWA 1NX6A 3WGIA 3AK4A 5A1TA 2AG5A 1TVEA 3OEWA 2OBYA 3JQ7B 3UFXA 4XR9A 1JQBA 4BO3A 3WXBA 3LYLA 5KTKA 3WJ7A 1HE4A 4JXKA 3L9XA 3H3FA 3CH6A 2DQ4A 3JCZA 2Y1FA 3PDUA 4A2CA 1O95A 3L4BA 3MJTA 2FPIA 4R5MA 1CYDA 1H93A 2OMEA 5JCXA 4CMHA 4CM4B 3BMNB 4FJ2A 4E13A 4TRNA 1ZNQO 3TN7A 3ENNA 5A9SB 3WWZA 3KHUA 3ZNQA 2YDYA 2HK7A 2GZ1A 3H9EO 4P38A 3HQ4O 1GV0A 2DVMA 3VH1A 2AEFA 4JCOA 3OECA 2G82A 3DXFA 3NTQA 3QWHA 5A3VA 2FR1A 2VYVA 1JN0A 4CMEA 4FIZA 4K1LA 3S1LA 5ADHA 5IG2A 1V3VA 3IIEA 4YJDA 1I30A 4FFPA 5HTOA 3U3XA 4IDEA 4GMGA 3V8BA 3K2EA 3UH1A 1JVSA 1WMAA 1UAGA 4Q39A 3CINA 1E3IA 5TT1A 1GQQA 2C07A 3GNQA 1E92A 3TZQA 1U2DA 4RF3A 4M54A 1U9JA 1WMBA 3ST7A 1VL6A 2TMDA 3E5MA 3EZLA 2YV2A 2ZTLA 2J3KA 2HCTA 1I2BA 1OFGA 4EEZA 4RORA 4YEDA 3MEQA 3MWEB 4EZBA 3WWYA 5DCUA 1F14A 3WICA 1E6WA 1K2WA 3TDKA 3GRPA 3U09A 2VUTA 1U8FO 5IAAA 4J7UA 5G4KB 4KZPA 2WJPA 2XOXA 4YAGA 4PLYA 1EK6A 3Q2KA 2X86A 2O7QA 2FHSA 2CD9A 4OH1A 3ZN2A 4WCFB 3EK2A 4E3ZA 3FNGA 2X22A 4DC1A 3HADA 3HB4X 4WJZA 4RZHA 3MJCA 4GKVA 2QQ5A 5KWEA 4J4TA 2BFOA 4RJTA 3ONEA 4K6CA 4YA6A 3PFWO 3PGXA 1AGNA 4IGFA 3RBVA 4L9RA 4RGBA 4I9NA 4GX2A 3O9ZA 3RJ5A 4NR0A 4D0RA 1ORRA 1YBVA 1M2WA 2Q1TA 3L4SO 2R00A 2W2KB 3OQ6A 4QFDA 4F45A 4DTIA 4MINA 4CR6A 1VC2A 2VYNA 2YYYA 3N7UA 4BNHA 3WFIA 4INAA 1S7CA 4JBHA 3GG9A 5IF3A 4UEKA 3RJ9A 3IKTA 4ALJA 2I99A 1WXDA 3OA2A 5L40A 1SPXA 3LSYA 5ICMA 1KVRA 3VZQA 3K2BA 2J5KA 4DPKA 4FN4A 2OHXA 5C7IO 3D4OA 4EW6A 3K9QO 1UDAA 3WS7A 3UCXA 4AJ1A 2OUIA 1YWGO 2D8AA 4FCCA 1A71A 2AQKA 2UVDA 3RC2A 4YVFA 2O2YA 2R2GA 4LMPA 4DUPA 4BKUA 3QP9A 5EINA 1UXGA 3SX2A 1EZ4A 1NFRA 1GDHA 3NDRA 3DOJA 4Y8VA 3RWBA 2FOIA 2P2SA 2NWQA 4JP2A 2O3TA 3ZWYA 4H3VA 4BMVA 4CM8B 4Q3BA 5FWNA 5TQVA 4ZVVA 3ZHYA 4LRSB 4DC0A 3PIDA 5G0TA 1PZFA 5EERA 4K26A 1Q2XA 3JQ9C 5T67A 2Y05A 3EUWA 4AFNA 3GN2A 1TA4A 2JD1A 3FI9A 4OXYA 3HDHA 1NR7A 2YHIA 4OHUA 1GPJA 4D42A 3H5NA 1LRJA 1VI2A 1XQ1A 1ISGA 1I3NA 3LT2A 3BMCB 1J4AA 3DZIA 2P68A 1LJ8A 1PX0A 3PJFA 1KIFA 1DRVA 4KTVE 2B69A 4IPTA 1UXJA 4LK3A 1LDBA 4AJ2A 3DBHB 5L53A 2I67A 5ENVA 5KNLA 1NAIA 1A9YA 2D3TA 3O8QA 1EBUA 4XKJA 3ZW9A 1R4NA 3A4VA 5B4TA 1DAOA 3KSDO 2PKQO 3GAFA 2C54A 3TRIA 4R9RA 3TFOA 1P9LA 5KIAA 4GI2A 3PI7A 4OQYA 4KUGA 2CVOA 3FNEA 4B3IA 2QYSA 3E8XA 2X0RA 3ORFA 3HFGA 4DIFA 1BXGB 1MLDA 3TOZA 4H7PA 1EE2A 2UUPA 3P2YA 2VYVD 5C37A 3FSRA 1EVYA 4OOEA 3JQ6A 4WEQA 1MP0A 5G2OA 4M86A 1UZLA 3P7MA 1UXHA 2HK9A 1M6WA 4CLEA 3PIIA 4BKQA 1XIVA 4DL9A 2EWMA 1IHXA 1IZ0A 2DU8A 2JJYA 4XGIA 1SO8A 3W8EA 1U7HA 2Y1CA 4EGFA 3H9QA 2GN4A 3DFZA 2Y1OA 3RCBA 3M6IA 3VAZA 3F6YA 1HETA 2EIHA 2UYYA 2YJZA 2P9GA 3ADOA 5IZ4A 5HS4A 3I6IA 2GYYA 7ADHA 5B4UA 1Z82A 3FR7A 1P1KA 3KLPX 3KB6A 3PHHA 1SEVA 3JQGB 1LUAA 1GV1A 1L7EA 2PD4A 2AW5A 3VDQA 2OP0A 1PQWA 5A4DA 3AY3A 4CJXA 2JFHA 1GAEO 3JQAA 4CMIA 4BGUA 1C1DB 5IN4A 3GEDA 4ITUA 4J1SA 3ROMA 3RQSA 1A27A 4XRGA 5C7OO 4J4BA 4XDYA 4JJFA 4BQRA 3RC7A 4OIMA 3W1VA 1SB8A 2FMUA 3GNTA 2Y1EA 3E6AA 1UR5A 3JQ7A 3ABIA 3GUCA 3QVTA 2WSBA 2PKRA 1RPNA 1NPTO 4EEXA 5C7LO 2V65A 1I36A 4RQUA 4IQGA 1YKFA 4IS2A 1WZEA 3V1TC 5A5EA 1NHWA 1LI4A 2P91A 4RDIA 4RDHA 1QSGA 1NPDA 4XQEA 3BMQB 3E9NA 3TF5A 3FBGA 2AEMA 1PTJA 4ZQBA 5HM8A 2AQHA 4Y6SA 2HMWA 1KBZA 3NEPX 4UVHA 4CM4A 1P45A 3BMNA 4PGFA 1HSZA 3AWDA 4D0SA 4I08A 4R51A 1PGQA 5A9SA 4KUHA 3TL2A 5IFLA 3GG2A 2NU8A 5ES3A 5CFZA 4YRAA 1X7DA 2DLDA 4XWYA 1J49A 1E3WB 3HE3A 5I8ZA 3NDIA 4KWHA 1PGJA 2Y66A 1HDXA 3GC6A 3RUEA 1B3BA 1LDEA 4YT8A 1GYQA 4RL6A 1K6JA 2GRAA 3JQ8B 4DLAA 3H5RA 1Q7BA 2PNFA 4XQGA 4PZDA 4TRJA 4E5MA 2EKQA 4KDEA 4DIBA 2HO5A 4RVSA 1A9ZA 2C82A 2EKLA 3VOSA 1UH5A 4EJ6A 1BHSA 3PQDA 1R12A 1IPEA 2HDHA 2JL1A 1CDOA 3INTA 2WMDA 1D1SA 2EJVA 5TT0A 4B4VA 2RHRA 4ZA2A 1ADGA 1Q0LA 4Y67A 2WE7A 1E7MA 1DBVO 5JXWA 1Z74A 3I9LA 2H9IA 5KVVA 1B8VA 5G4KA 1OOEA 4NBUA 3RU7A 3EVTA 1QMGA 1GU7A 5J23A 2WD8A 3O4RA 4WCFA 3WFJA 1ZXBA 5JY1A 4KOAA 4RPLA 1N1GA 1U7TA 1GUYA 2Y67A 5DOZA 4ZD6A 1TXGA 5FFFA 1ONPA 1WVGA 4XB1A 2C0CA 1BRMA 2CVQA 3VH2A 1MGOA 4D46A 5KCZA 1Z7EA 4L75A 1DRWA 1I8TA 2W2LA 4Q9NA 1JVBA 1CIVA 4PLZA 4J2OA 4W99A 4MVJD 3U49A 4NQZA 3JYQA 4D7AA 2W2KA 4XQCA 2PWZA 2C5EA 4ZJUA 1ENZA 4CLDA 3DO5A 4IDAA 2J3HA 3INGA 1HTBA 3VH4A 1VKNA 1G6KA 4XDZA 4RPHA 2X9NA
chains in the Genus database with same CATH superfamily
1G8JA 1MAHA 1WXGA 4JZKA 3L0SA 3V3KA 1T5OA 2AD5A 1EAMA 1J5PA 1NJ8A 2RI1A 3Q7EA 4JLUA 3U6BA 1YVEI 3TNLA 3V2GA 4YAWA 3TTWA 1K5GA 2VAXA 2CHQA 3EDQA 3UOGA 1UP7A 1E79A 1VPDA 2V55B 3Q3HA 4QTZA 3KWMA 4KO1S 1D2NA 2X9VA 1FUIA 1T9GS 3TMKA 4U3JB 2XKAA 1QR2A 1EVZA 2E21A 2GILA 1POWA 1QGDA 1E5LA 1KQPA 2RJ3A 1SC6A 1FFXB 1DC8A 1ECCA 2FZ4A 4O4JF 1PIWA 3PT9A 1Y3CE 3U7EB 3CS3A 1KU0A 4ETIA 5ULLA 4P7BA 2XKKA 1M2OB 1Q6ZA 2HNAA 3PXEA 2QXTA 3V6MA 2D74A 3GFPA 4MK4A 3PWTA 1JGTA 1TZCA 3ASZA 3BD6A 3QG5A 1Y0BA 3TGWA 4JNKA 5FBHA 2DTXA 3IBFA 2P9HA 2R8OA 1JQ5A 3PC7A 1MA3A 2Q5IA 3WB9A 4ZIRA 2I8CA 1E64A 4A9AA 2QE6A 1NVGA 3V1LA 1E6EA 2CFIA 1QBKC 2B0JA 4IIVA 5EJ2A 3RHTA 4P7GA 4CTNA 1EFVA 4JLOA 3R7FA 4E12A 5BN5A 3WHLA 3DDNA 1JR3D 4MB2A 5I9TA 1AKUA 2BR4A 3QOYA 4ARZA 1WCXA 4H7JA 3VI3B 2CV2A 1FB5A 2VDPB 5JSQA 1NWCA 3AQIA 3KTFA 5B3KA 5K0BA 3M4XA 4IYJA 4NYIR 5TRTA 3T94A 3TR0A 1IIBA 4OQDA 2CMGA 1V3QE 2PRYA 3GCZA 1TEZA 4KREA 1XZJA 1Y3BE 2QPTA 3TNFA 1P2BA 3JPYA 4RK0A 1L6RA 3T7JA 4EG5A 2P7HA 3K9FC 4JROA 3LZ6A 3EEBA 4DV4B 5H9VA 1EFTA 3DL7A 1PFYA 2FMXA 1M7GA 4AY2A 1KL7A 2D4HA 5GGYA 3OPMA 1Z3CA 2FMIA 1QX4A 3AIKA 2VC2B 2B83A 2ES4A 1DJOA 1L7NA 1YUMA 1ONOA 3D8RA 3RG8A 3THSA 1PZGA 1JT9A 1WQ1R 1QXSA 3KQYA 3KKMA 3QVKA 1T5HX 5AK6A 1WD7A 3RJTA 4L4XA 2Z4TA 3N9IA 3TBKA 3UJAA 3UVEA 3V1UA 1FS6A 3WGTA 1J90A 2HA3A 3K3PA 4KR3A 5ALMA 3DE4X 4MVJE 3RVNA 2PSDA 3PK0A 4DUZB 5G40A 3C14C 5AM5A 1JQKA 3F6CA 5HKLA 2VJCA 4OO3A 2BTEA 3BRCA 4F4HA 4O4JB 2Z8YM 4FHEA 4YLEA 3PENA 3FB4A 4MUMA 4M1SA 1PV1A 1BXGA 3C3DA 4UXJA 4L73A 1VYTA 3SZ3A 4G0UA 1ZO8A 3EEYA 3R77A 2ZJOA 1LBIA 1Z28A 2V7EA 4WESA 2XQKA 3LC7O 4KMSA 1DJNA 4QLAA 1TAGA 2HK8A 4ZVPA 2QN7A 3JV7A 1P1IA 3ZS9A 4YN3A 1II8B 4TX1A 4YDHB 3CZPA 2OBMA 4B3XA 5TPZA 1SXHA 1CE8A 1ESNA 2H9AA 3NAGA 4FEYA 4GQBA 1G66A 4PE5B 1NN3A 2PGOA 3U0VA 5KX5A 4YAOA 1Z2CA 4H1WA 3KNZA 2IV2X 3V1NA 4RW0A 1E96A 3TNDA 1M34E 1U9IC 1SIBE 3M9XA 3OPQA 1XD8A 1YS6A 3C7AA 1E32A 3E3MA 5ALQA 1XZQA 2BBTA 2R2AA 1PLJA 2DHEA 1HKUA 1TTHA 3K9WA 5EUQB 1JZSA 1N3IA 5CTAA 1KMNA 2FNAA 2C3YA 2ZSEA 3LL4A 4FR5A 3AESB 1PR6A 1XXHA 1H4TA 1IC6A 3EW9A 5HVNA 5HZKA 3DHEA 1OGIA 3JQGA 2PWAA 3NASA 3ESZA 1HDEA 1QAMA 3EY9A 3NO4A 2CJYA 1JDNA 3AHGA 1FYXA 4BMSA 4LXYA 1W4ZA 4L8YA 3DE3X 4PTZA 5FBWB 3IIIA 5CT9A 3H2BA 4ZVKA 2HKIA 3ROEA 2YYZA 3P71T 2RBEA 1T4DA 1XEWY 2G6BA 3JD1A 1I3LA 4QPJC 4AVYA 3DTVA 2Z6AA 1P80A 3QUTA 1GG2A 4KXMA 1OYWA 3TH5A 1QS0B 1SBTA 3MJDA 1N8SA 3BULA 4WA8A 3L43A 4OGLA 3KJGA 3AVXA 2H2IA 2JFBA 4RKWA 2XEDA 1QC5B 1HLPA 4TQUS 1D04A 1WSWA 1G5HA 2NU6B 2IQIA 1FU7A 2X9GA 5JV5A 3X2FA 4TRMA 1V8PA 4OHVA 4IHQA 3KU4A 4RVOA 3P97A 1XTPA 1KTVA 1GFWA 1S89A 3KWLA 3PXCX 4LZWA 1M6VB 3U1VA 3IL2A 2C83A 4KAXA 3AI7A 4ZI7F 1RSZA 1P74A 1W4BA 1IUPA 1JEQB 1VCNA 2FKNA 2VF2A 3IO5A 3C7CB 4D9EA 5DNWA 3SNKA 4PIVA 3ROQA 4HB2A 3G2HA 4AO6A 3FUWA 4FX2A 4KDRA 4PX2A 2FF5A 3I12A 3SX4A 4NMLA 3CX8A 1F51E 2MHCA 4Q1FA 1U3CA 3LFHA 3DV0A 2DKNA 1ORVA 5HK8A 2J0VA 1JDTA 4I46A 3GK3A 2QTVB 1V8OA 1N2XA 3NGLA 4RKEA 1O97C 2X13A 2ZSBA 4PLTA 2FXIA 3FWYA 3C70A 3EMDA 3K0AA 3KVNA 5EXEA 4BB9A 1GILA 2FWMX 1N7HA 5DGTA 3LDUA 4YALA 1G4UR 1AGPA 2N9UA 3U4QA 1TAUA 2JFOA 1RS0A 4DJAA 2XY4A 4GGPA 4G0WA 2EW8A 2Z57A 3IDAA 1NZFA 3RPEA 4C4RA 1YACA 3W2HA 1G63A 4LF6B 2ZG6A 4N3GA 3QKSA 4D9IA 1KBQA 3OEHA 1UIRA 3C4JA 5CDSA 1KAEA 4HRXA 1KOLA 2RB5A 3QVGB 3LUGA 3TZEA 4FFSA 1HR0B 3KE8A 3WC4A 1ZJWA 2AVNA 4ARSA 3EW7A 3S8EA 4TV9B 2I4RA 3HV0A 2MYNA 1ENYA 5IDVA 2O1SA 3C39A 4P31A 4R0MA 5EJ6A 1NJ6A 5EJ5A 4GMKA 1L7XA 2H5IA 3R0JA 1GTJ1 1DAMA 2J4CA 3FOCA 4G2NA 3AG5A 1V2HE 3FM9A 4UDYX 2XGOA 1J2YA 1QIKA 4NZYA 1PR1A 1HDZA 4HR7A 1WDLA 3MCUA 4XWTA 3K09C 5U4QA 2FDXA 4FR2A 3ZV5A 4BZXA 2CDAA 4RZIA 1PJZA 2GPNA 2V7PA 4UHBA 3BWDD 1U9IA 5IBQA 1TZBA 3HBMA 4D5EA 3D0OA 1C7EA 1KKLA 3D3NA 5PGMA 3TIVA 2YOGA 3QEJA 3GXBA 2WQ7A 2RK4A 1CUHA 4R1NA 5DDIP 5BRJA 1LBHA 1F7VA 1PNTA 1MOPA 2HA2A 2HH9A 1QQ6A 4QGBA 3GPDG 4DABA 2D1RA 2YJNA 3C6XA 3JQAB 4UNQA 4PY2A 5E2AA 1TLFA 5FL7A 2FU5C 3LUPA 4IWNA 4XLTA 3UICA 2CHFA 2OQ2A 4EJFA 1WVMA 4D97A 4JB3A 5H82A 1FRQA 4LJYA 2BHLA 4JJ7A 4BTLA 4ZZ0A 4ZI7B 1G2OA 1KI7A 3AUUA 3OUTA 5CH5A 4BX0A 1W0JD 3H1EA 2B21A 1PS0A 2OZLB 5ALPA 2JH9A 4X1IB 4IIJF 3BM5A 5AVKA 3DNMA 2QZZA 5JYEA 3SQOA 2WG0A 2C2ZA 3HYRA 3OOYA 5IJ0A 1IEWA 2FY8A 2HJVA 4LA4A 2HRZA 3IV6A 2OFXA 2HJSA 3ADPA 3QI7A 1CZUA 1XNQB 4WXRA 2FPXA 1FLDA 1DBSA 4QYMA 4ZO6A 5AK3A 3QHPA 4LJKA 2VSNA 1Z12A 3RUDA 1UJNA 3B13B 1KF0A 2H57A 2RH8A 2VVTA 4HQKA 4IRXA 2IITA 5LP6F 3ILVA 5BT8A 1EFCA 1Y37A 2Q21A 2FN9A 2ZRLA 3Q3EA 5ARCA 1C9NA 5IM5A 1M2HA 3PWZA 5JJCA 1MJNA 3AX6A 1PP4A 4AY3A 4ND4A 3VOAA 4BU0A 1ZIDA 3ZOKA 1BCRA 2FQXA 1YI8A 2FQQA 4BCCA 1GNTA 4X5OA 3D6JA 2I6QA 3EVBA 4CLOA 3NX4A 4J0EA 2VQDA 4RTNA 1VHLA 1Z2NX 4FZ5A 2PX8A 3H16A 3OKAA 4YWJA 5JADA 2CNWA 2CXXA 3PTZA 4MWTA 5KJ1A 2FSGA 4LMBA 4AZWA 3DCNA 3KTOA 3N2NA 4Y9RA 1XZPA 4MQEA 1UBEA 4ZTBA 3ICPA 4U3JA 1G5PA 1H42A 4G0OA 2P35A 1B00A 3FGPA 1VCHA 3TWOA 3UG6A 1E2BA 1YB6A 3O91A 3L7CA 1FFXA 1PT6A 5JXGA 2ZRJA 1ZZEA 5ELLA 1FPMA 1PG2A 2FB9A 3ZCTA 5HR5A 1M2GA 4HEA6 3HBNA 4D3DA 3WA7A 1PEAA 4V0QA 2EF1A 1Z2EA 4N3BA 3KSUA 2BKVA 1XELA 3HYLA 4I9HA 3TCXB 1M2OA 3UHAA 3FNRA 4ZGBA 4WFJA 3K09A 3FRHA 4DMHA 1P91A 1I6KA 4KQ6A 4PV7A 5I7EA 2PN1A 4NBRA 1LV7A 5D51S 4YUYA 1E9RA 5B36A 2IYRA 2JD2A 5AKYA 4Q02A 3ZJYA 3I37X 1D2RA 3NAZA 2Q2OA 2QG4A 2QN1A 4D0LB 1DV1A 3F47A 4DQ0A 3AEKB 3BRWD 3OY2A 4V38A 1GO2A 3FI0A 1BEEA 3G89A 3ZU6A 5AW5A 1U5AA 2B5WA 2FWNA 1DPGA 3RYCB 4PSCA 3VR3A 2Q9AA 2GBFA 3VJLA 1OQAA 4ZU3A 1W96A 1YL7A 2CDBA 4EYOA 1NW6A 3RAFC 1B8PA 4LV8B 1RI3A 5KNDH 4JEIA 4QU0A 1VBFA 4UUMA 3HUDA 3NJ8A 3C7TA 2GJ4A 2YXPX 1JA0A 3A11A 2I4MA 3D54D 4Q7MB 4W1RA 5LP6B 4CQMB 1T9ZA 1F38A 1WZNA 3NTLA 1FK8A 4RKRA 2ZVPX 3ETDA 2D7CA 3HCEA 4TTRA 2ZR0A 1K8YB 3NM5A 3Q40A 1K9SA 1IU9A 1XCPA 1XZFA 2BDUA 3HXOA 1C1XB 1MO5A 3T54A 4MUFA 2DMRA 3IAS6 3BD9A 1XZIA 1SBIA 4XD2A 221PA 4QOSA 2E1RA 3N0TA 4J90A 1DDGA 5GZ1A 3NALA 3F3SA 3AP1A 4X84A 2X9QA 2O5EA 2NP7A 3EVCA 2C94A 3OIUA 5EKSA 3OT4A 3LZCA 1JR6A 3QU9A 4F86A 1Y9AA 3OZBA 2WQZA 3CXRA 3VZPA 3JARB 5HDQA 1CF4A 5TVKA 1U0RA 2HCBA 3PPVA 2ICAA 2XMCA 4DR4B 3HUUA 1B1CA 3C3PA 1K4MA 2IPAB 4MULA 4O4JA 3RSZA 3TRHA 1Y6GA 2JATA 1OCEA 2PJDA 3UWKA 4Z51A 2P30A 3P2EA 5ICSA 1XUOA 2XWJI 1HBJA 3PJGA 4PLGA 2XCUA 3SLKA 1GYPA 2ZK7A 3HZZA 4EOGA 4GPD1 1BEUB 1LK5A 5JO0A 2WNSA 1WU7A 1CY7A 1DIAA 3GLUA 1WSBA 3CNEA 4UCFA 3FMFA 3B6KA 1U0JA 5BWBA 1II8A 1QB7A 3WIUA 2OSBA 3HJCA 4O59O 1JFLA 3OETA 4RK7A 5H8WA 2H8GA 3KPVA 4WV3A 4BEWA 1UUFA 4FNGA 4BFYA 3ZYZA 2QK4A 4FT4A 1FFCA 3WRVA 4YMGA 2ZJ2A 1EK5A 2EYUA 2DUJA 2I7TA 4E2ZA 2Z04A 1RBYA 1X1QA 2AHOA 3GIDA 4Y6OA 5GV7A 4BO9A 2J4FA 2IK8A 4WLOA 4B46A 1TKBA 3QJGA 5AKJA 4DV3B 5KNCD 3UMYA 1ZIOA 2XXJA 3W7VA 1LNZA 1XRSB 3AESA 1VSQA 2QG6A 4WINA 4E5NA 1QWOA 1AF7A 2VKTA 1JIXA 2O7NA 3FSGD 4IG4A 2IP2A 2F3UA 3HEBA 3BQMB 3KJNA 1V11A 2VP2A 3OLXA 2Q4RA 4LTMA 4F5EA 4EHHA 5IH7A 1MX5A 3QRWA 1XXHE 3ENVA 2OK7A 4ZQFA 4EJSC 3Q72A 2E2WA 1DIHA 4G25A 4X7PA 2ID9A 1QS0A 2IU4A 2WIFA 3KU1A 1PLLA 4DV1B 2WSLA 4LC0A 3A70A 1DB3A 3FB1A 1X9HA 3GB9A 2QPAA 4FC7A 4REMA 5DGHA 4URUR 1QC5A 3WLSA 6NULA 5AUOB 4F9GA 3UANA 2NU6A 3PQFA 1RQRA 1GT91 3GWZA 2EJUA 3P0IA 2IEYA 3VTZA 2Y1LA 3MTIA 2VHZA 4QFBA 3NHFA 1O08A 4DR5B 1XYVA 4P2BA 2X0DA 1PT7A 1IOLA 3RREA 1CUEA 1GA4A 2PS3A 3PEUA 3AJ9A 1M6VA 1NLYA 1Q0UA 1JEQA 3W77A 1JKFA 3IB3A 2WWXA 4XR4A 5GPBA 1RAHA 1E0SA 4XIYA 1LSJA 1GD1O 3EIUA 3M3DA 5DASA 1AURA 4X6LA 1PJSA 2CCKA 4BQEA 2XNDA 3FYSA 1L5OA 3WLPA 2QTVA 2VJQA 4NFHA 5LZ4A 4EM6A 4Z0NA 3RSSA 2PFKA 1XN1A 4BBJA 4M2LA 4DTCA 4BO1A 1N78A 1K6IA 1MB3A 2ZDQA 3T3GA 1U6JA 1L5GB 1XCJA 1Y7TA 5C1BA 1FSSA 1HDYA 1XTRA 2W83A 2HWXA 2JGLA 3AHEA 1E18A 2FVXA 2DTEA 3RO7A 3NQ41 5K3AA 4EHNA 2PA3A 5EFOA 5C2JB 4CMGA 3B6JA 4E5KA 1QYWA 4TV9A 2CYCA 1ZN7A 1AF4A 1CT9A 1MB9A 4DLKA 2EQ5A 1OPRA 1HDIA 2ODTX 1BX1A 3JYHA 4JXJA 4KCGA 4TOIA 4YQEA 1RWVA 1H2HA 1J56A 4IZIA 4BDSA 4Y6RA 1K86A 1BMDA 4S2EA 4C2AA 4YRIA 5ILGA 3WO0A 2HLPA 2YWJA 1R2QA 2HM7A 3LQRA 4LW8A 4C14A 5M29A 1GQRA 1X1BA 2JZCA 3KSAC 4UD2A 4JV5B 3NYRA 4P2GA 4QO8A 1UJCA 4QTYA 3HM2A 4JJEA 4C6RA 1O0BA 5BXQC 1X80B 3PR3A 1C50A 3A1CA 4PONA 1W46A 3CR7A 4IEIA 4FYYA 4K03A 1RTTA 2VZ8A 5TNXA 4AS2A 2YRXA 1EUDB 1KY2A 4NBLA 3TSWA 5L4SA 4AS3A 4XIIA 4YCLA 3IXLA 4GUDA 4E7PA 2Y9PB 5DXFA 4X00A 4YUVA 1WOYA 1IZZA 4M38A 3AKEA 1ODFA 2P0YA 2QE7A 2WUDA 4DV2B 5SYNA 4DV7B 1DQZA 3CNQS 4XWOA 3O3CA 4GR9A 2C84A 4WW0A 1XD9A 4ZI7A 3WGYA 3S81A 4EJSA 4QG7A 1G59A 1YTUA 5LP6C 4RD3A 2XUHA 1T9GR 1W4AA 3NAMA 2PL1A 3DAYA 3GRRA 3L1VA 3CPJB 4IW3B 4PRYA 4B17A 4TS4A 4O2AB 4BUJA 4D3FA 1NXTA 3WGLA 4FDLA 2HHAA 1L9XA 4V0MA 1PZMA 3O1IC 4JCCA 4FGUA 1U8EA 2A9RA 3SOZA 2ZROA 4FMDF 3H9GA 4BV8A 4DDHA 4XRRA 2GXAA 3COSA 3GJ4A 4Z6KA 2AR9A 1ZGCA 3CMCO 3KYBA 3NC4A 4YH1A 1G2PA 4CIWA 3V4FA 1TVKB 2L69A 4CCWA 5KHOC 2XWPA 4Z5XA 4MA0A 4OHBA 1I14A 2QNBA 2WVHA 5A62A 2W6NA 1YRLA 3DMPA 3TKAA 1U0SY 2X2PA 3PBKA 4GC5A 5HQ3A 3TLGB 2WWHA 5DNUA 4IIHA 1ZM2A 3GT4A 1KETA 4PC6A 4WTOA 3UTDA 3IQFA 2HV8A 3NV9A 4AROA 2A59A 5LWQA 3IHWA 4KRXA 4IJUA 4MV3A 4MUXA 1OC4A 3W2FA 1EK0A 4EKEA 1TLLA 3J81A 1ADFA 4LEIA 3WMRA 4DIKA 1KO8A 1MPXA 4S05A 5UKDA 1J8DA 3I32A 3OZ7A 4EITA 1AN9A 1JG6A 2BFFB 1M0WA 2XUJA 4OLFA 9GPBA 3WA6A 3HBLA 3TSCA 3CTPA 4TVOA 4A8PA 5JAZA 2PZEA 1JBQA 5C1DA 4H18A 2A5YB 4UUNA 3M6AA 1HE8B 1PGPA 3ESDA 2NSDA 3NTOA 4E1BA 2A1UB 5DXAA 4Q3NA 3RRFA 1YULA 4AKHA 1Y9EA 1X0XA 2YJ3A 4CDRA 3BHJA 1X8JA 5JMWA 4BVJA 3NP9A 2OB1A 3B7PA 3N2KB 4PNZA 4E08A 2FLVA 1GGNA 2DBVO 2DX7A 1UPCA 1SOWA 2FXVA 2VSYA 1TKAA 4R1UA 1XX6A 1Y1SA 1J2JA 2VAPA 2P11A 2R65A 1SQ6A 4NMHA 2W2XA 5K0ZA 1T3GA 3QXXA 1Z13A 4MQBA 3RYCA 3MUEA 4PNHA 2A9PA 3M6FA 5CU7A 3EULA 5IUKC 1VGRA 1B14A 2P4HX 5FNZA 1T2EA 2I6SA 4PBSA 2JRLA 4ISCA 4EUEA 1BXKA 5TJHA 4CTOA 5J47A 1SPBS 1G9SA 3DKVA 4LCBA 5LP6A 4IWXA 4CQMA 3C6YA 1XHLA 1FFHA 4OJMX 1J1ZA 1GSOA 1Z6XA 1FBTA 6LDHA 5AVXA 1SXPA 3WIEA 1B8OA 2BE9A 5JCJD 3IIKA 1C1XA 1PS9A 3OTHA 3TOXA 1Q12A 3H8SA 3L06A 1VJ5A 4DWVA 1UQUA 1YC5A 2J67A 3H1TA 1DBIA 3C8ZA 3LUBA 1B76A 1JW9B 5EXDA 1ZN8A 4ESVA 1PW7A 1L5HB 1FSZA 4QUDA 4CL2A 4X6YA 4RPGA 2P9CA 4FDTA 1ZK1A 3NBZC 4WJLA 3CVVA 3P0RA 1BA3A 1SVSA 4R0NA 1W0KD 3JVVA 3IIJA 1VCOA 3DFIA 4ARVA 4YGXB 1XZCA 2G40A 4G5HA 2ZB2A 4JL5A 2G8NA 2OFWA 3JARA 2MR5A 4UFOA 3W4KA 1WVIA 2LIPA 4DMFA 1BROA 2YXEA 1FP1D 4IRUB 1GFIA 2WABA 2R86A 4AMZA 4Z4IA 2UUOA 3OTQA 4AI6A 3QUBA 3K7EA 3R6WA 5TQ2B 1WBBA 2EHDA 2B9VA 2BGWA 1MPTA 3CCFA 3T7IA 3JRNA 5BNZA 1CVIA 1EM8B 2X2OA 4N82A 1LV8A 3BILA 2Q28A 4EI8A 1N0HA 3OC6A 5TSDA 3AR6A 3E9RA 1BXRB 3ED5A 4Q1EA 1GHTA 1X7GA 5GONA 2ACKA 3UWSA 2V7GA 3PDHA 4ENPA 1GDTA 5IEJA 2XLBA 3IPRA 3HDQA 1N9KA 4FE4A 3IIMA 3PR2B 1Q77A 2H4XA 3M1AA 1QZ3A 2ZTUA 3MMPA 2YVQA 1JHXA 1QTRA 3GPCA 3OWOA 2GK6A 2ZT5A 4KLCA 4WNAB 3TCNA 4BCDA 1I6MA 1PFGA 2AVDA 3OZIA 2ODEA 1KQ3A 4YJ3F 1T91A 3UUFA 4DA6A 1CIPA 5DBIA 1FTNA 1JLKA 1ZZGA 4Q3EA 2OSVA 1FJHA 3M7IA 3RSHA 3V2HA 2EFJA 4RNDB 4BJ6A 1VL8A 3AGPA 1SRRA 3ZQUA 2EERA 1VZ2A 2VNKA 3D4LA 1IAQA 1JR4A 1N9GB 4NCIA 4Q82A 3ZK8A 3C8HA 1F4LA 1K7YA 3E53A 3OESA 4DBLC 3QUQA 1K97A 3WMGA 3OLYA 5A9RA 3B1XA 4DSOA 3EBPA 1C9KA 3A3YA 1MC1A 4CNBA 2GO1A 1SUFA 1E1KA 2FP3A 4RTKA 1JHAA 3FWHA 1D9XA 3DBLB 4G6ZA 5TB5A 2W43A 4ZP1A 4R9VA 2J30A 3FY4A 4FI3F 3HYNA 4CL3A 1T1EA 1JHMA 2Z6QA 4LE1A 2SKCA 2QTMA 2GHQA 2POQX 4MRRA 2A5DA 1YI1A 4B33A 1QJ4A 3V97A 3VTAA 2CLKB 1KK0A 3ZV4A 1OFHA 2QRHA 2V4UA 1GZ6A 1C9EA 2I1QA 4D99A 1FLNA 2B8JA 2PHZA 1VLMA 3HFJA 3NDPA 2AB0A 3L1UA 4LGVA 4Y2JA 1E8MA 2P9EA 4D80A 3UK1A 4YJHB 1KE1A 3P94A 4NNJA 5JJIA 2HSJA 4PGAA 5EUMA 1E5QA 2ZJ6A 1FQKA 4D5GA 3SZOA 4F2GA 3ZGYA 4A0GA 4JDPA 4M9XA 4QBIA 4NPAA 1K0FA 1N7JA 1TFRA 4PICA 4F60A 1IHYA 2I6GA 4JI4B 2R8XA 1D3AA 5BXYA 4KFUA 3RW9A 4QQKA 1G5TA 1YNSA 1DCKA 2GZ3A 2RSLA 3ZUPA 4MH0R 1TCBA 1XU4A 3W34A 4AJEA 1G8SA 3N7AA 1D2AA 2J31A 1ZP6A 3W7BA 3R6TA 4CN9A 1XD2A 4YPOA 2O14A 4PIMA 4BRUA 2QZJA 4PPFA 1FL9A 1PQUA 3CVOA 2LV8A 4QXAA 2RGUA 4ZALA 4LY3A 1YA6A 1QQAA 1TKRA 2W6JA 3F7OA 4HKTA 3FYTA 3FCAA 4AICA 4FJ1A 1WQ4A 1ZA2A 2OBXA 3KFLA 2XMGA 2XXAB 1NLUA 1ZK0A 2DTDA 4GMDA 3A28A 4ZEOA 2IIPA 3ZHZA 4JC5A 2J5XA 3ESRA 1DUVG 5AOVA 5MN4A 4FHFA 2D4AA 4OD0A 5HDBB 3UB2A 2WWFA 1SUDA 2FSUA 3LXXA 3GAZA 4RV9A 3QLVA 4NTZA 2FR8C 2G17A 3FZNA 2C2GA 3RDPA 4G07A 3V2UA 4C0KA 3VDMA 1VKOA 1O5TA 1BS9A 2XODA 5K09A 3GR6A 4IV5A 1DAEA 2ZB7A 2DT5A 1IHPA 2QSUA 3ORQA 4RF5A 5E3JA 2IX3A 1MT0A 1Y9DA 2BEJA 4IMRA 3QVMA 4KWTA 4NH4A 3DB1A 3LLCA 5IT0A 3EQ9A 3KPJA 3ESYA 1HL7A 1W25A 2IYUA 3A4MA 4G0PA 5EJ9A 2Z30A 3KBBA 1SY7A 5DMXA 5EE0A 1TNDA 4A0QA 2JJ1D 3O1HB 3STXA 2Z5LA 4LKOA 4F8YA 3ME5A 4XI9A 3VPSA 4ZCIA 5BV8A 5FWDA 4V3CA 1W44A 2IHBA 2GBCA 2HIMA 3NXSA 2G70A 4CL8A 1UJMA 4EA8A 3R20A 4AUMA 3EGIA 1VJGA 1J6UA 1KWGA 3UMBA 2PMCA 1C0PA 4J1QA 3VAYA 4A8JC 5ALLA 1DTSA 2NU7B 5DU2A 3U3RA 3LNCA 1JDZA 3P52A 4CKZA 1ZC4A 2HJ9A 3L6DA 4KX3A 3AQ4A 3WJ1A 3DFFA 4NC9A 2GEUA 2E4VA 1Z35A 2R6ZA 3A6JA 2O8VA 4M9CA 1D5CA 4O2AA 4J7XA 4YUZA 1KSHA 3OO1A 3ZGXA 2DBQA 3DDUA 5CYOA 1KYYA 3T61A 5JSHA 2Y0EA 3QA9A 3G5MA 3U0BA 2C78A 3E5HA 2XVAA 1P6UA 2PV7A 2EX0A 3I92A 5IP5A 4IDNA 4H3SA 1AH2A 1U3GA 4L6AA 4C7OB 3OHMA 5K3SA 3ZD6A 1HT0A 1B0PA 3ZDEA 5E7QA 5L6LB 1GCUA 4RFLA 1YR6A 1LSUA 4G01B 1YO6A 3V8QA 2ZFUA 1P5FA 2QUIA 4HV4A 4FFLA 3Q6NA 2G76A 4HNAB 4RMJA 1P2TA 1G20B 4JLJA 4PZPA 2YUIA 3EF0A 4O8CA 4FN5A 4QHSA 3AKZA 2FPOA 3I6BA 1ZG3A 2GGSA 1V26A 1IMJA 4I3GA 3WG9A 4A0SA 2X1HA 1S2GA 2HWYA 1Y7HA 3N8KA 4QQRA 3S68A 3CVXA 4Q4LA 3BSWA 2PUHA 4BJ5A 2H1FA 1JLLB 3LUHA 2R68A 3UJ3X 3TTSA 2YJGA 1W2HA 2PS9A 2HDOA 3M34A 5HHTA 4Z0HO 2WRZA 3AR2A 2UYOA 1PR3A 3MQFA 3F49S 4YJGB 4ZPJA 2NO1A 1O89A 5D84A 1C8KA 3KV3O 4U0JA 1UC8A 1WZCA 1F0PA 1ZM3A 1M66A 4R98A 1NMYA 1K06A 1XVLA 2FR8A 2R6FA 1MRZA 3DOUA 4GZMA 5FKJA 5IRCD 5E4TA 2J07A 4EJ0A 5CIWA 3OSUA 3TTUA 1HXHA 5LJLA 2CXSA 2JHPA 3JD2A 4DLTA 2I2FA 2RCNA 4B48A 3U39A 1OWOA 3PV0A 3K9GA 5I45A 2X77A 5AKEA 2FN3A 3PNPA 5DLQC 3N2KA 3LFTA 4QDOA 5EXSA 5CA0F 1OZAA 4Y2YA 1JDBB 2C4MA 2CKDA 2Z58A 3G8DA 3H9BA 4RBNA 3R5TA 4FMCF 2GPBA 1H2ZA 3VDRA 3OF2A 1Q14A 4B5LA 1LH0A 5T4HA 1W5TA 4KJXA 1Q1ZA 2MDTA 3AEXA 3DW3X 3NJ4A 4BO4A 3FUVA 3H5OA 1A97A 4C0AC 1RM5A 1YS4A 2DUNA 1U11A 2ZYRA 2JB9A 2FEMA 3VKVA 1BYIA 4D81A 5ERYA 4ZO9A 3VR5D 5U9CA 4G9EA 4ZEXA 1U81A 1MO2A 2QL6A 2QORA 2XTAA 4F8JA 1Z25A 4JQSA 4GIBA 4ZVUA 3OFND 1DADA 3TQQA 3IR6A 3IQIX 3VO2A 1SEPA 1AMUA 2ZCJA 2RGGA 4JJGA 4ALNA 4IG9A 2V6BA 4RQTA 3KQNA 1BVUA 1FX1A 3AB7A 1DEKA 4M0CA 4MW1A 3KLMX 5D6NA 4ZVOA 1LBSA 1JPVA 2QTTA 5LR6A 1L4GA 1XRNA 5IBPA 5AOBA 3GGOA 3ONDA 1Z0SA 3ZLBA 4Y2UA 3GGGA 1NVVR 1VA4A 2ZR9A 1E1QA 2ZATA 1L5HA 3W5VA 4BFZA 3L41A 5CD9A 2FCRA 1NRJB 2Q6OA 3AI3A 1X6VA 3HRKA 1PJ2A 3NDJA 5EIAA 3HHPA 4B4DA 5FRDA 3W3AA 3TUIC 4CKCB 1UBTS 4BAZA 4L07A 5IKEA 2VHYA 3B2EA 3ZGOA 2EL9A 5CFLA 4LTNA 4JC4A 4X66B 2A14A 5TQ2A 5ADWA 2P1ZA 1NPYA 1G21B 2W6ZA 1ISFA 2WP0A 2ZRGA 4J1TC 2ZJ5A 2ZE6A 1JMKC 1SCUA 3FVQA 3AKCA 3AM3A 5BQFA 2CHEA 2BFMA 1QTIA 2QI9F 3N8GA 4EA6A 4V1CB 4C7VA 4N12A 3VQTA 4EF5A 2CT8A 3SEZA 3UC5A 4RHXA 2CLOB 2ORYA 1KEKA 2CXHA 3FUCA 3IA7A 3IOYA 1OVGA 1PJLA 3UBTA 1UJ5A 2YWRA 1Z2OX 3DLAA 5KNBH 5JD5A 2QT0A 5AM2A 3U3KA 3CUWA 5AJTA 3OFVA 4IBOA 3GAAA 521PA 4CUZA 4JJZA 1DLIA 4OJYA 4PS0A 4WNAA 5HF5A 3V80A 4YR9A 2ZSUA 1R3DA 1M76A 2FLWA 2O0KA 1ZNWA 3V4ZA 1C3EA 3B5EA 2IBSA 2WMOB 1KO5A 3PHJA 1X2EA 3FUXA 4PGHA 2REOA 3WLQA 4FI3C 3Q3CA 5D3KA 1RKVA 1PBTA 2Q5QA 3IVMA 3SYKA 4EY5A 5KOHA 1RXUA 4MS1A 1N9GA 4I5DA 3Q15C 3DZJA 4K9KA 3CR8A 4DY6A 1IXKA 3IJPA 4U5XA 3VR6A 4A1FA 3G3EA 2A0XA 4OMDA 1ML4A 4ISBA 3NRCA 4XVCA 3MB8A 1P44A 2C2MA 1UMDA 4IJ6A 5TX7A 1NE2A 2Z83A 1TF2A 2PRSA 2ERCA 2GMWA 2H8KA 2R66A 3BAFA 1JPJA 2DLNA 3DBLA 4J0JA 4PM4A 2BH9A 1A7UA 1BRTA 3F96A 4P3KA 4XGNA 4XWWA 4MP8A 5IDYA 4YDQA 1W94A 1ZFNA 3WIBA 2ZT8A 5D3QA 5ARBA 4MGZR 5K4HA 2NX2A 2OAP1 2OORA 3ABSB 3WBJA 2N75A 3ZWKA 4ON9A 1OXSC 1U02A 5EZQA 1CP3A 5I8WA 2NSLA 3HWSA 2PMKA 2RC5A 2ZE7A 3M5PA 1MW8X 1H4QA 3OHPA 2WDPA 2IUFA 3K9HA 4E3WA 3NGXA 3H65A 3FVRA 2OECA 4GLBA 4MPJA 4LZZA 1M10A 4FBMA 2NTJA 1CLUA 1OR8A 1I2MA 4IF6A 1XPUA 1L1QA 3ZD7A 2YY5A 3IQHX 1TYBE 2GN6A 3Q9UA 3QMVA 4RD1A 1BDMA 5EKXA 4CFSA 4EO9A 5MDHA 4Z53A 2VPTA 5KYKA 3HCPA 3RGGA 3SQXA 1SK8A 1AKQA 1D4OA 1W1IA 4ERNA 3PHLA 4UHHA 1U9YA 3ZDAA 1AV7A 1T3ZA 4HAIA 2WLSA 4J1TA 5B1DA 5BSWA 1E66A 3K5IA 3K9CA 4KQFA 1BGWA 2WIDA 3W90A 1M2EA 2QR2A 3LPDA 1VL0A 2WYUA 1ISJA 4HEHA 1STOA 1XDZA 1T3LA 2FPMA 3CGWA 3OHSX 4YJ3A 3IILA 4YRSA 2JLQA 3DE7X 5A4AA 5F4ZA 1NBOA 2HF8A 2NOAA 2QLLA 3FHLA 3DZCA 5J5AA 4ECAA 1Z8FA 3L1HA 3RRYA 2AD1A 1R9NA 2J9GA 3ZIUA 5L4NA 3T8YA 4KZKA 3C85A 3L6RA 3LXRA 1LX7A 4XPZA 5DVZA 2HMVA 4BEJA 2QUKA 2F8SA 4YWHA 1HTTA 2IYEA 1CVLA 1Z6GA 2YWDA 4LHWA 4NBVA 3TECE 4P32A 3Q9NA 1DINA 4L16A 4BX2A 4HPWA 1GQ2A 3GJ5A 4LDJA 1UKBA 3EHDA 4JLPA 4PZAA 2R97A 2BFPA 1P4HA 3FDJA 4QYWA 2NLOA 1EVKA 1CULC 4GC9A 3OZWA 4J0DA 1YE5A 1L7MA 3VUFA 1EJBA 1I3KA 2Y99A 5FPSA 1TQHA 2A5JA 3BORA 4PNEA 1A8UA 2R751 5AKKA 3U16A 3RAEC 3E8MA 2IF2A 3MUNA 4FYWA 4HUJA 4BB6A 1FZTA 1V7CA 3GQBB 2RGYA 3NRJA 1OFUX 3DT6A 4PSDA 3AR3A 3WSTA 4B71A 1Z88A 1DKMA 1V7ZA 1FMFA 2QRNA 3ICVA 1U3VA 1XTSA 1I0ZA 2NU7A 4ED9A 4I4TF 1NOIA 1JFRA 1ZVMA 2E89A 2I4IA 3CBGA 2ZUFA 4P4UA 3KB8A 3HDTA 3R8FA 5CXSA 4KKXB 5B64A 2GK3A 1GNRA 4L8WB 1BN6A 4GQIA 3SF0A 3VC7A 1ES9A 2O2ZA 3NRBA 4CBVA 3KETA 1M0EA 4PZYA 1F3OA 5JZ9A 1QE5A 2AUNA 3I2KA 4D82A 4XWKA 3D6NB 3ETEA 3GT3A 4QDJA 3ZW7A 5HBRA 4LWQA 5I4KA 3TW4A 4QUHA 4JD5A 1AQLA 3OH8A 1EQ2A 1NMQA 4I1OA 2I55A 2Y92A 4C7OA 5ALRA 1GZ7A 4ZQGA 1LRLA 1LFAA 1VE1A 1I4WA 3L8GA 5F35A 4X41A 1KR2A 4AU1A 3SM9A 3HU2A 1DCMA 1P2DA 2P5SA 4J07A 4RSMA 4A2QA 4ZOQI 1KDOA 2WG1A 1H6AA 1XU9A 4H2DA 3WNBA 3KVRA 3OA0A 3BCSA 3COWA 3QITA 5E6UB 2YIJA 4BNDB 3VBEA 2JIQA 4HNAA 5D5HA 4FFNA 5TR9A 3WGQA 4DE5A 1IONA 3DT9A 1UZNA 2AHRA 4MUIA 1CY8A 5FUQA 1SNYA 3L18A 1I4OA 2QM7A 3QX9A 3PIRA 2VK2A 4RKQA 3KOYA 4RY2A 5CT8A 4B4WA 3TZ6A 3M3HA 2C31A 3O84A 1PAUA 1WP9A 3P5SA 3STUA 3ZY4A 2X1MA 4B79A 3X2EA 5BUZA 3B8EA 3FPSA 4MHTA 1USVA 3K92A 3CSDA 1N3BA 4EL5A 2QN2A 4Z8YA 1JLLA 1Z0IA 1HLFA 4UMEA 1KJIA 2B3TA 4C30A 5CDHA 4MVJH 2BBOA 1ESDA 5JAUA 3QTBA 1HUQA 1U2SA 3HDJA 4K9PA 4YJGA 1N77A 1PT8A 3WRWA 2J3JA 4MS3B 2P40A 3TSOA 3KO8A 5EVJA 1UEJA 3IODA 2YZ7A 3FF1A 1CR2A 5HW0A 2VF5X 4C3VA 3H8VA 5C8ZA 3TW0A 1I3MA 3HC7A 1JIIA 5EWJA 2ZU6A 1ZHOA 4JA2A 2IGBA 3UMGA 5FBVB 3LTNC 4EL0A 5LU8A 3NYWA 1U8AA 4RFSB 1QKKA 2ZI7A 2X2EA 4P3PA 2O2CA 4ZV7A 3ZE1B 5K8LA 2GERA 1M0SA 3QPCA 5A06A 1AQJA 4KE6A 3SICE 2YMPA 3QLUC 4MKHA 4PO1A 3SZUA 4ZK6A 4JJIA 4URVR 1GGMA 4A6XA 5K3CA 4G4IA 1Z0AA 3N86A 4RS3A 2D5CA 3GJ7A 1RXEA 4LRYA 3LJKA 4AJNA 3GJSA 4EUNA 3U80A 4QXQA 2BLNA 2HU7A 2CZCA 3BSSA 4M46A 4Z1OA 3NNSA 2Q46A 4XCVA 3GNSA 1LQUA 1HPLA 4JIMA 3AUAA 4R8SA 4YAFA 4MAMA 3OOEA 3RNLA 2IDZA 5JBNA 5GV8A 1JHUA 2HHHB 1JR3A 3IE2A 2BGLA 3GRZA 1C4KA 1V1JA 5L3QB 2RGEA 1IBRA 2NXWA 1CJSA 5F64A 4BNNA 4C05A 3RUAA 3MHTA 1Z62A 3LK7A 1R5BA 1ZJZA 5A03A 3EPKA 3WO1A 5KTRA 2HGSA 1R6XA 4JMPA 1QGED 5CDTA 4JEUA 4W4TA 5EP1A 4E4YA 4IJKA 1XSEA 2BELA 3C8UA 1J33A 2VNSA 1DOZA 3I9OA 3OE1A 1T4BA 3L8YA 1EX1A 4H16A 1R1DA 2WF6A 1RKQA 1J09A 1GTL1 3WB1A 4CKCA 1NQXA 2X8WA 3EMBA 1A50B 1PNOA 4FYPA 4NK5A 1QIDA 4W7IA 2J0UB 3A1UA 4BQQA 3Q5EA 2R4QA 4H7HA 2B2XA 3I72A 3GVCA 1R16A 2Z2IA 2IW1A 3ZJ5A 2QJFA 1HF3A 2JFQA 4WZAA 3NYIA 1XYGA 3DAPA 4X94A 3GFVA 3PNMA 5HRCA 2HDNB 3UYLA 3OQPA 1OLUB 1V1MB 4LHXA 4ALIA 4ZREA 4G2TA 2AJTA 5A7GA 4HLDA 4TLEA 4TMZA 1KVUA 1PDWA 2J3IA 4QC2A 1F2TB 1H05A 1M6NA