4UTOA

Crystal structure of pneumococcal surface antigen psaa d280n in the cd-bound, open state
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
278
structure length
278
Chain Sequence
b'KLKVVATNSIIADITKNIAGDKIDLHSIVPIGQDPHEYEPLPEDVKKTSEADLIFYNGINLETGGNAWFTKLVENAKKTENKDYFAVSDGVDVIYLEGQNEKGKEDPHAWLNLENGIIFAKNIAKQLSAKDPNNKEFYEKNLKEYTDKLDKLDKESKDKFNKIPAEKKLIVTSEGAFKYFSKAYGVPSAYIWEINTEEEGTPEQIKTLVEKLRQTKVPSLFVESSVDDRPMKTVSQDTNIPIYAQIFTNSIAEQGKEGDSYYSMMKYNLDKIAEGLAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MANGANESE ABC TRANSPORTER SUBSTRATE-BINDING LIPOPROTEIN
publication title Dysregulation of transition metal ion homeostasis is the molecular basis for cadmium toxicity in Streptococcus pneumoniae.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Metal binding protein
total genus 100
structure length 278
sequence length 278
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01297 ZnuA Zinc-uptake complex component A periplasmic
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 4utoA02
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 4utoA01
4UDOA 1MIOB 2MINA 1ESZA 1M1YA 4HN9A 2PRSA 5KOJA 2M6LA 1G20A 3LI2A 1N2CB 2AFIA 4ND8A 3U7QB 5JPDA 3PDIB 4MO9A 4UTPA 3EIXA 5CR9A 3TLKA 1QH8A 2XH8A 1G21B 3LHSA 4UTOA 4TKVA 3PSHA 4OXRA 1N2ZA 3AEKB 1K75A 5KHLB 2XY4A 1M1NA 5BVGB 1QGUB 3NU1A 4WESB 5M3BA 1M1YB 3AESB 3BE6A 1K2VN 3MFQA 5KOJB 1G20B 1KAHA 3BE5A 2AFIB 4INOA 4ND8B 1PSZA 3AEQB 2XUZA 3TEFA 3ZTTA 2OV3A 4TKVB 3ZK7A 4N01A 1PQ4A 4PAGA 1K0FA 5AFSA 5CX1B 1M34B 4OXQA 4TKUA 1QGUA 3MD9A 4WZBA 4WESA 4HMQA 2R79A 3AESA 5BVHB 2WI8A 4MLZA 3AEQA 2YNMD 1N4DA 5JG7A 5I4KA 3HH8A 5GGXA 4WZAB 3AETB 5HX7A 3MWGA 1N4AA 4WN9B 3HJTA 5CX1A 1M34A 4TKUB 5M29A 2QI9F 3CX3A 4NNPA 3ZK9A 4WZBB 4H0FA 1TOAA 3UJPA 4HMOA 4INPA 2Q8QA 3ZKAA 5B58T 1H1LA 4PM4A 4IRMA 4WZAA 1K7SN 3PSAA 3AETA 2XQVA 5M34A 2AFHA 4WN9A 3EIWA 3K1AB 1KAEA 1QH1B 3GI1A 1L5HB 2OV1A 3ZK8A 2PS9A 4MDYA 4K3VA 4HMPA 1EFDN 5JJ5A 5FLYA 3AEUA 3AERB 1H1LB 2YNMC 4FI3F 3R5TA 4LJSA 2AFHB 2WHYA 4OVKA 3K1AA 2PS3A 2O1EA 1QH1A 1L5HA 5M2QA 4FKMA 4H59A 5JOQA 2M6KA 2PS0A 4UDNA 1XVLA 2OGWA 3MINA 3AEUB 4FILA 3AERA 2R7AA 1FP4A 4G07A 4XPIA 5HDQA 2OSVA 4NNOA 4WNAA 4BBPA 2XV1A 4CL2A 3HXPA 2XDQA 4LS3A 4FNAA 5KOHA 4B8YA 3MINB 2PHZA 5BVHA 2X4LA 1FP4B 2MINB 1MIOA 2RG7A 3G9QA 4XPIB 4G09A 3TNYA 2ETVA 1KARA 4WNAB 1N2CA 3U7QA 3PDIA 4M7OA 4DBLE 4GICA 5GGYA 1QH8B 2Q8PA 1G21A 2XDQB 5KOHB 3AEKA 3R5SA 4MX8A 1M1NB 5BVGA 3MWFA
chains in the Genus database with same CATH superfamily
4EGSA 3S99A 3GJRA 3I9V1 3EXG1 2HA0A 4I7EA 1OBCA 3CO5A 3F49S 4C0SA 3B6ZA 2QEQA 2Y77A 3OLQA 1VHTA 2V96A 1W1WA 2C31A 4FYXA 5CLIA 5EMMA 3OZTA 1XZBA 5LQJA 2WM9B 4S1PA 3AVWA 5B12A 2E37A 1WS6A 4PXAA 1AUPA 3GAAA 2WWWA 1XTZA 4DQXA 4MR9B 2VPPA 1E2GA 4FNMA 3D0RA 3IP6A 3JXEA 1DV2A 1QR2A 2B6NA 4JLKA 3TPZA 4CV1A 1JMYA 1D7OA 2HHJA 2NT4A 2WVAA 1FYEA 3I2GA 3KE8A 4R1UA 3CPJB 4HFJA 1UMDB 4RDHA 5D51S 1VIVA 1RJFA 1IK6A 2FHPA 2GNPA 4BE7B 1HE4A 4KEAA 2CHEA 2NM0A 4M7RA 3K8ZA 4F3YA 3STXA 2I1VB 1XDWA 3D1JA 3IV6A 4GLFA 1QIKA 4UMVA 3V7YA 1G7RA 2PGXA 4G97A 3ZR4B 4MW4A 3B1VA 3WLRA 1ZSNA 4X54A 2VTDA 4KTVE 1TAQA 2P6OA 3ZZTA 4CQNA 4JZYA 1RKVA 4L8GA 4B6SA 2RHHA 1V6SA 1G8AA 1ZK3A 2P4QA 1VLZA 4LEIA 3O8OB 1XPJA 1FQJA 4P3NA 2P41A 3LDGA 4WFQA 2YUIA 1ST3A 1W30A 5EWMA 5JU6A 3VPSA 2EC5A 4ENRA 3T9DA 5BXQC 4KDCA 1JH9A 3L7AA 1TMOA 3ZKAA 3MB8A 3UT0A 3MLAA 1M1UA 4AKIA 1MDFA 4Z4IA 1T4GA 2VBGA 3PC2A 4LYHA 1CRLA 3HGTA 2NN3C 4JOCA 3RARA 4LTNA 4I19A 4WN9A 1I13A 2OVBA 5IKXA 1S6YA 2VJDA 3EXFB 3LBHA 1V5FA 3WSTA 5CLJA 3ESBA 4PYRA 3HY6A 2IY9A 1BN7A 1ZH4A 3MS2A 3HDHA 4LDQA 4NULA 5AJUA 4ICIA 1Q1EA 2D1YA 2MR5A 2PFKA 4HLDA 3WLOA 3I9MA 1NLFA 5B4VA 4MO2A 4R2JA 3WHKA 1VIAA 3S2UA 5AHRA 4Z53A 3LWDA 3KD3A 4YJFA 1Z6PA 2B9EA 2QENA 3BXGA 5AI9A 2GM5A 2VHUA 5HQ3B 5KEIA 1ILEA 3W77A 1G4AE 1CIJA 2QVLA 1EZ1A 2GBLC 3K53A 3FVVA 2MMCA 2QGNA 2FEWB 2WSSD 3PJFA 5DEIA 3QVJA 1NP3A 2HBYA 2P0YA 1A76A 4O02B 3AB7A 1XN4A 2GA8A 1KEPA 4H6PA 1L7PA 4KWIA 3SY8A 2GLXA 3PUVA 3QG5A 4URUR 2ZYGA 4WQMA 3PHJA 3CRMA 5DBOA 1JI3A 4N8DA 3SSNA 3ZHCA 4LJ9A 4P7FA 1OAAA 2X7XA 1U8EA 3D4PA 1E79A 3C70A 1XWFA 5KYXB 2G67A 3KK0A 3AP3A 2O59A 2FN9A 1L7EA 2AX4A 2OKGA 4BVAA 3A6GA 3NANA 3ZX5A 1M2KA 1Y5MA 5D7BA 2GZRA 5SZIA 4UQLA 2JAXA 2IRWA 2ACKA 4HYYA 1XMXA 1LRKA 3GUCA 3VTAA 1VJ1A 2TS1A 1WKVA 1S7CA 2XVAA 3L7YA 3DMHA 2GHQA 2DQ4A 2PKCA 5JMTA 3JAKB 2QBYB 4KRGA 1P0CA 2VF8A 2AG1A 2NPOA 2WLTA 2ZDHA 2IIBA 2PH1A 4I9NA 1CF2O 5AKIA 1UL1X 4R1PA 3U4AA 4BTEA 1WCIB 1N2GA 3IPAA 5DKFA 3M34A 2RK4A 3V9AA 4ZYZA 1QHNA 4EW6A 3TXAA 1IJEA 5FWDA 1OFUX 5A3SA 2IYAA 2QMEA 5K99A 3PT5A 4GOLD 1T5DX 4JP2A 2P7HA 2RHBA 3N0RA 4ND1A 3E70C 1CT9A 1WDLA 2BMFA 2P2YA 3OLCX 1H0KA 1L5OA 1CUEA 1S0UA 1S2LA 1K5GA 2VAPA 1JHMA 3AFNA 3D02A 1DDOA 3T7KA 1NSFA 2XCSB 3AFMA 4W8OA 3ZLUA 4HCJA 2D5LA 3R6GA 4R51A 1TT5B 3W3AD 5CDYA 3U1BA 1R6XA 1UJ4A 2AXNA 1H4QA 1KOGA 3UPDA 5JBNA 3FIJA 3RH0A 3LT1A 2FXVA 3IXLA 3KUKA 3F3KA 5ICEA 1WAMA 4FXOA 2AZTA 4YN3A 5T4HA 4TRMA 2CV0A 3UW3A 4A03A 1I7QB 1YZQA 3KXKA 1DC7A 4ILEA 3NAQA 1PW7A 3IUBA 3AI2A 2R00A 3HH8A 1U1EA 4PC6A 5BOSA 1EXWA 3C7AA 3HDTA 4L9SA 3RNLA 3MIZA 2BHSA 5FHRA 3S3TA 4ZYLA 1WPXA 2P2GA 4TKUB 1A4XA 1OXTA 2IYEA 2B8JA 3SQMA 3ZKWA 4BX9A 2NU7B 3FUUA 1KFJB 2A1UB 3PL1A 4YMWA 5GOZA 1L5NA 2YS6A 1UKAA 1PZMA 3DHWC 3F5DA 1HL3A 5T4BA 4E03A 3UFBA 2Q1SA 2ZETA 1ZIOA 5JD5A 2Q4OA 3GEGA 3LL4A 4V0ME 3IPXA 1C7RA 2VBIA 4J6FA 1T8SA 2IA5A 3WL3A 1CQIA 1KAEA 2WAXA 2GASA 2XYPA 3CRRA 4PX3A 3EASA 5EHQA 2KQUA 3KHSA 4C2TA 3L0SA 1NBWB 1ODLA 2YJ3A 3CLTC 5EUCA 4MYDA 4I2VA 3U4HA 5K0JA 3DL4A 4BAUA 1WXIA 2O8EA 4N65A 1MAUA 2NUTA 5JNWA 1V2HE 4HAXA 5DP1A 2GZ3A 4GR4A 3GLIA 1TM7E 2BF4A 2XWBF 1UZUA 1NRJB 4O8CA 5IC6A 3QBVA 1EH5A 1QVZA 4BATA 4O4HF 1PV4A 4ZIRB 3G82C 3PQ7A 2ZDGA 1NUSA 4UASA 5JCOC 3ZWNA 4RK7A 4ZQBA 3UC5A 4ZAXA 4LMBA 3UXEA 1ZA1A 1G6KA 2FY8A 2WU4A 4Q1DA 4EM6A 4JBHA 4CODB 4INZA 1YDFA 3NASA 3CRW1 5F9MA 3G79A 3D1VA 3DD5A 5HDQA 3I30X 3UJ8A 3O1HB 3FOWA 1ZGGA 1NTOA 3OLXA 3ZEIA 4YJGB 1SEPA 4NICA 1G38A 2H1SA 5FLEX 4GU5A 4PSDA 5KHAA 1A9SA 3P4YA 3VSBA 1KU0A 4BECA 4IZ6A 1JG1A 3SHVA 4JQZA 4DLNA 1E9FA 3CPHA 1TX4B 2VLIA 1IM8A 4Q3LA 1EDEA 3L84A 2AKAB 4FCVA 1X7ZA 4NFHA 2RH5A 3WLNA 1OH8A 3QVGA 5E9WA 3UENA 5GPBA 3X1DA 3INTA 4G1VA 3F4LA 3QHQA 2MYUA 3QFTA 4KMMA 2OMKA 3I9V6 1PW5A 3E23A 1P18A 1RADA 2JGIA 4TS1A 4U6QA 4DJ5X 3OZGA 2XNDA 3MWFA 5DULA 2F43A 1Q0PA 2JCXA 2VO1A 4B4VA 1QHXA 3GNQA 1C1YA 3C7KA 1O95C 2V8OA 3W6ZA 5FJIA 1N2CB 2ZVQX 3CZAA 4OYLA 4LWPA 5I9LA 5LUAA 1I8TA 2QRVB 2FP3A 3SHOA 3CKKA 3L7LA 2PFGA 2PBFA 3OX2A 3AIIA 4N0QA 2ZJ8A 4WW0A 4C08A 3L9WA 5A7FA 1EM8A 1L0BA 1FNMA 1KYZA 3AVPA 4EGFA 1R5JA 4JD5A 5EJ4A 1HO3A 3MCUA 3T9CA 3E35A 5KSWB 1R74A 4WD3A 4HI0E 1T9AA 3RFFA 2BT4A 4QGSA 2AG6A 2VT3A 3DUWA 3Q15C 3NNNA 4PZPA 4X8OA 5E6RB 1YB1A 1ENZA 4YCCA 4A36A 1M8GA 1QO9A 3M82A 4H0CA 4WCFC 3JWEA 3GCZA 4LRWA 4Q3EA 3ZQJA 4EJFA 4N18A 4EY8A 3GJ8A 3E3NA 4MLZA 4UVDA 4D9HA 5KJ6A 3FTQA 3HRIA 4B7XA 4GR5A 2ODTX 3SHTA 4ZICA 1T24A 4LECA 4UTXA 1NW8A 1O03A 3RRXA 1M6VA 1GOTA 5M29A 3AINA 3R3XA 2RARA 4LI3X 4CKBB 3GCWA 5J40A 4MI3A 1AB6A 1S2DA 1JDZA 2PZGA 3JR7A 1FFEA 3FTDA 5HYVA 1MC4A 2N3ZA 3LHFA 2C96A 4XSHA 4JEUA 4ZD6A 1YI1A 5LSAA 1CY1A 2XMPA 4YMIA 4PTLA 1IHXA 4Q18A 2E6UX 3NHFA 1RI4A 2XB6A 3P9IA 5IHXA 2ATEA 3FUCA 1Z36A 3V34A 1E77A 2DKFA 4XRGA 3JWIA 1XD2A 2LV8A 4UNQA 3LA8A 4KG7A 2NNWB 1JJBA 2Z6VA 3D1LA 4U2CA 5DHPA 1JEYA 2O2DA 3AUXA 3JQPA 1E1CB 1GNQA 4LG1A 2AFHB 4QJ4A 3WISA 2C94A 2YCBA 1X8JA 1DBPA 1ZGZA 4NESA 1WDWB 1IXKA 2OM6A 3G1WA 4CLOB 4C7VA 4XVUA 3VNUA 1PWEA 1EPUA 1AZWA 1PZFA 3KBOA 4H59A 5AUQA 5K51A 2OFPA 1P5FA 3GLGB 3KEMA 4RS3A 3B51X 2OGWA 3NFRA 4TYWA 3BSFA 4RENA 3W4KA 5G41A 5DHRA 1LV7A 1PJQA 2YZMA 1Z26A 4B32A 4UQPA 3JARB 2Q3HA 1COWD 3VSDA 2WB2A 1GPNA 4RWEA 1Z5OA 2FW8A 3ZVNA 2C29D 1QZTA 4OI4A 5KYVA 1IN1A 2FPGB 3KT3A 3T3DA 4IS2A 1K97A 4ALKA 3ITEA 2WF6A 2PJDA 1YQGA 2DUNA 4PNPA 5JAPA 5L4SA 4JITA 1RP7A 3WRXA 4K46A 3QWFA 1YQXA 2B30A 4PNHA 2X5JO 3LNTA 1RDFA 3SZLA 3PFKA 4V2UA 4MNTA 5I6DA 1MP0A 2NX2A 3EPJA 5C7OO 1P91A 1MFPA 3M6UA 3TOSA 1IDN1 2WFZA 4QODA 1OIWA 1KZ1A 1F2TB 1W0JD 1QLJA 2X0RA 1T2VA 2OKCA 1CEQA 1X94A 3KL4A 4MLDA 4OATA 3VOAA 3VJLA 3X2FA 1AT1A 3ZCXA 3VU9B 1XTKA 3KEGA 4MO9A 4IIHA 3CVUA 1T8PA 3UATA 1CRQA 4OXRA 4NPAA 1SHKA 1RQNA 4JB8A 2YBEA 5CCBA 2ZPAA 1JR2A 3O8LA 3PIRA 4FSXA 4L16A 3II6X 3IQGX 1M1NA 3E1SA 2WU0A 3Q10A 4ID9A 4TZKA 5KDOA 1HFEL 1KJZA 4S0XA 2M2IA 4E08A 2E7ZA 5K6RA 1AMNA 2DT8A 2ZSKA 1VHDA 3QI2A 4NLLA 3WMGA 1T6ZA 5IF3A 1E63A 1WY5A 2GETA 2R87A 3L4EA 4GXNA 3O9ZA 4HQ6A 1U7WA 4LNUB 4UUMA 3H2BA 4C0KA 5DNEA 4F60A 4GKVA 5DGIA 2H1FA 2VJAA 3AOEA 4LYJA 3VNSA 2A5DA 3QFSA 5CHEA 4KLRA 1Y34E 3O8CA 5D85A 2N1BA 3M5CA 2WI8A 3GBPA 2PMDA 1M3SA 3GXOA 1WG8A 1PFKA 2G28A 3AT1A 4OMUA 3PFBA 4ALIA 3QE3A 2QUKA 2WIBA 3RYHA 3MWGA 9GPBA 2OGZA 5EHIA 2VQFB 2YH2A 4OLJA 3TRDA 3NW9A 1I24A 2AOVA 1HLGA 1WPQA 2Q5FA 1JQ5A 3E9EA 3LHIA 2PZBA 4MMZB 4OL0A 2WPDA 3D7NA 3OJ0A 3SHQA 2QG9A 3L0IB 4FC7A 1P7PA 1IEWA 3KP1A 1CERA 3LUBA 3NI2A 4G5QA 4LNHA 5D84A 3WADA 4I08A 5LN1A 1JZSA 4RIGA 3AV0B 2CMFA 4QHYA 4AO7A 4MR7B 1YJ5A 4KMRA 4W7SA 5EQDA 3S8MA 4BNWA 1A8PA 4PE5B 1UK7A 4HWTA 4B81A 4RUKA 1MO4A 1B6RA 3EDOA 1QRRA 1UUFA 4LHSA 4CHTA 2OESA 3BMNB 5DLDA 4ZOAA 2OXRA 3LCJA 4ZAGA 4ND4A 4NTZA 2O0MA 2FWNA 3GH1A 2DP4E 1EUYA 1XJ0A 3O9VA 2Q29A 3VM6A 4BAGA 1CUXA 2JFQA 3OM8A 4WGGA 4ZQGA 1JAXA 4L5IA 4IDGA 5JLAA 4HEJA 2A9VA 3BWCA 3O4JA 2GNAA 4G3XA 5TQ0A 1MB2A 3SGLA 1T2DA 1GGEA 3LP8A 5I48A 2H0RA 2V3WA 3B3AA 3FHLA 5COAA 5ALUA 4LFCB 5KNLA 4ZALA 5HIMA 1IHYA 1RYNA 1YZTA 3HRHA 4HH4A 3A58B 2XAAA 1II0A 4IIJB 4LGYA 4M0PA 3EDQA 3WL6A 4P5EA 3OM1A 4PRLA 1I2ZA 4DJJA 2X3FA 2O4CA 1G6OA 1XZEA 4KH1A 1QX3A 2PYZA 1BMFD 5DTEA 3RWOA 3P9QA 5ERYA 2HT1A 1K3TA 3PYXA 4BS9A 1VG1A 2VDUE 3CXUA 2JZNA 5EIBD 4KNWA 1VSBA 4OKSA 4H3HB 5A6SA 2QU7A 2RG7A 1L1QA 3NHKA 1G8FA 4MK4A 4ARVA 2AZMA 2QPOA 3WV4A 3J81A 2G8NA 2YWHA 1ULHA 3EFOB 3RC1A 2RCYA 1J8QA 2Q45A 5FCDA 4CPDA 1AM4D 2GGSA 2X42A 3QXJA 1YA6A 2ZKIA 2R6CA 4WCVA 1DFIA 3EZ7A 4G86A 2C42A 5BN4A 1Z8FA 4C2UA 3G2LA 5ICMA 4EGAA 4Z0HO 5AVSA 1DS6A 5EMJA 4YP7A 1L6RA 2W2LA 3ILSA 1XPRA 3KQQA 1IQRA 1JWBB 2X6RA 3DAYA 3DWFA 4UHCA 4KJZA 1OR8A 1SUBA 3NUZA 1BA2A 1S8AA 2ABWA 1KVRA 1CZRA 2EWVA 2G4CA 4GI1A 3TE6A 4ZK2A 2PSDA 2ZXFA 1X42A 2YWFA 4M0KA 1Y3CE 3K09A 5TIIA 3AUUA 4GM1A 5M5BA 4LDZA 1REQA 3PKZA 3LBNA 4KW7A 1UC9A 1KGDA 2UAGA 2VH5R 3GJZA 1KJIA 1AGXA 1EBBA 1UADA 3AY0A 4XWKA 4B7ZA 1NASA 2CCGA 3PC6A 5ERGB 3STYA 2YQZA 1FDSA 5KTNA 2GF9A 4U00A 4C14A 2YHIB 1XL0A 4MQLA 3AVQA 1SUEA 1EG2A 5LB4A 1T9DA 3L8FA 3QFRA 1Q21A 5DLPA 1P6XA 3GLKA 4KZKA 1HSOA 1D2AA 3T3OA 2FQYA 2HNBA 3ZZ0A 1W8IA 2D6FA 1MX9A 4U7FA 1PCXA 2B35A 2F64A 2E4VA 1Z13A 2JEOA 3QUBA 4PFQA 2OO5C 3OJLA 1M34A 4HADA 4OV6B 4HVTA 2O6HA 3P20A 4R3WA 4K9DA 2PUTA 1P2FA 4E07A 3QBJA 4ZGBA 1JS1X 4CEHA 2C84A 4U9UA 1KVSA 4GHWA 3UWSA 1F48A 3IYLW 4GQIA 3ZN2A 4BQPA 4AKEA 1JLHA 1Q7BA 5C46F 1DCMA 1ZJJA 2X15A 3TRFA 1SOWA 1LLDA 1C7JA 4L5CA 4IIGA 5BORA 3FMIA 3TCNA 4WEOA 3WNCA 5TJ9A 2CW5A 3TUJC 3DZBA 1GQFA 3ORSA 4N0PA 3D7SA 4IDFA 4BUZA 4LZJA 2YFHA 2ZJOA 2PKRA 4TLLB 3DVQX 3KB6A 4G1EB 3VH4A 4NENB 1H3NA 1XU7A 1USGA 2ZT8A 1K6JA 1W36C 5ALGA 3ADPA 1U1DA 1OGYA 5DX1A 3HA2A 4UEOA 3UUGA 2FTKE 1R5BA 3SLKA 1C30A 5J23A 2IBMA 4G4GA 3V1KA 1ECPA 2QGFA 2X77A 3OURA 4G65A 3RSLA 1WMEA 2QVCA 2VJYA 4AKSA 5D1NA 4MWGA 3HVKA 3MSCA 1DIOB 3A1TA 3C1UA 3CW9A 3T41A 4RVDA 2AOUB 3R7SA 2QX6A 3GDOA 2VQEB 3TAHA 2O06A 2H2WA 3FMPB 4DLUA 2Q07A 4DIUA 1KIFA 1KXJA 5KTRA 3H11A 2ZJAA 3I9NA 3SICE 5TARA 3MT7A 4V0KA 5BQPA 5D6OA 1LBEA 1X7WA 3IP5A 2Q6TA 1KRHA 4TN5A 1VHWA 3I2KA 3F97A 1P44A 2FWBA 3CUUA 4MB0A 4YAFA 3FOEC 1E2EA 5KAMA 5TMBA 3C1AA 2VHTA 3DONA 3N39C 4RF2A 4GT1A 4J3FA 4YBZA 2HMVA 1OXBB 5TMEA 1GO2A 1XNRB 1KAOA 4MYUA 4X20A 3KJGA 2OA0A 3EEQA 1EWYA 1GHTA 3I52A 4HGZA 1JG6A 2YIDA 3N3AC 4G4JA 4N3NA 1AS2A 3VTKA 1CUSA 1E5XA 5CFNA 3UK2A 3AEKA 1AU9A 1GNTA 1ODTC 4NCXA 4Z9YA 3WGKA 5JWRA 2XBLA 4ID3A 4R6WA 3ZHVA 5BSRA 4RZIA 5IN5A 4IRXA 4V1CI 4OQFA 2XB4A 4CM5A 4JH0A 2DX7A 1ZH0A 2CKDA 3KKOA 4ESHA 3DEHA 5J5AA 3H04A 4G26A 3NWEA 1Z2DA 3B1YA 3UBTA 2FEPA 1ZJ4A 2H48A 5JPIA 1P8AA 5AWFC 4AYXA 5U4QA 4OHRA 2XTZA 5EFZA 5BVGB 1GKKA 1NAHA 4C4YA 3IEMA 3V48A 1V1MA 4RMGA 3QHPA 4KBGA 3IE2A 2ZRMA 5A7HA 3NYQA 3T38A 3MCZA 2UYQA 1P0MA 2OY0A 3VZDA 3M33A 4E1VA 3K73O 4P7GA 1CJSA 3CW2A 4NZ9A 3CZ9A 3O1IC 4XE5A 1A27A 3EH2A 2B69A 4P4GA 4ZTZB 1AK1A 1E8NA 1JJIA 1DO2A 2E2WA 3BEDA 4TQ9A 4EG0A 1EWRA 4WESA 3AUAA 3MMSA 2XUQA 5LYYA 1JG4A 1QHIA 3JD2A 5E4JA 3VPFA 1AMOA 1J8MF 4DUZB 4YJHB 1QHYA 2WU8A 2XCLA 4F4HA 2M1ZA 1LBTA 3HZRA 3RHSA 3DQPA 1E2QA 1OIVA 3E7WA 4HH1A 4ZGWA 2X0IA 3GWZA 3W1WA 4D8YA 5B53A 4U2KA 5E1DA 1SIUA 2EZ9A 2J3IA 3IV7A 2JATA 2R6R1 3DBHB 3OICA 1B00A 1U8UA 1YBVA 4HMOA 1H4VB 1KZ6A 1XHFA 2D2EA 4LX8A 4ZQIA 1BXRB 3TCXB 5J47A 1KRWA 3SVLA 3SKXA 2XA1A 1E3EA 2GZAA 4GOND 1P2TA 1XMSA 1S2NA 1XBTA 1XROA 4UFNA 3BSSA 1THMA 5DYNA 5THKA 1Z2CA 4L2IB 1UOQA 3K1AB 1NATA 2A0XA 1JJVA 3M3DA 1G6Q1 3WQQA 3TQFA 1V4NA 2FDRA 3K2BA 5AVTA 3CSDA 1XTUA 2WLSA 2QR3A 1U2GA 1UZNA 5I7OA 4NCKA 3FXAA 3CRZA 3NNSA 3R6TA 4N40A 2RE8A 2A9FA 1E9RA 2CB9A 3KVVA 1ZINA 2GK7A 4CTNA 5JJKA 2J9ZB 2OCXA 1C7EA 4FGKA 4OVKA 2PX3A 4ABYA 2I2DA 2Q9UA 2PEZA 3WYFA 1D4AA 4F91B 3ZIAD 1HOTA 2Q6OA 1R4AA 3DEAA 1ZK1A 3IO5A 4KQIA 1E3WB 4PRZA 4TVKA 4PYQA 2FWMX 4BEVA 4KQ2A 2VZ9A 5AXBA 4CIVA 1LPNA 1B3BA 1J8DA 1KKLA 4K6MA 1U8XX 5A1JA 4CF7A 4GOJA 3M81A 2RHCA 1ESNA 3T7RA 1QIEA 4HDRB 1SU8A 5HDBB 1VGQA 1GFZA 3U62A 1B43A 1NY6A 2I6QA 2JFPA 1WHTA 3HXPA 2N0SA 1F17A 5CD1A 1QFJA 1XRMA 4B83A 4PBRA 1XC7A 1WNTA 4GS5A 3CPSA 4B4KA 2WR8A 1ZCZA 1SCKA 3G3EA 1CR6A 2P9QA 4UCWA 4YCAA 4JKYA 3ZHZA 1UXKA 1T4CB 4DNPA 2VTBA 1GTZA 1QUFA 5G0TA 2VHEA 4PBSA 5F77A 2PZ8A 2JHPA 3B1JA 2ZQ5A 1VJCA 3B82A 3ZU5A 4BWVA 5H70A 5SYMA 3HKCB 1XK7A 1TA4A 2E6KA 2A4KA 5JYEA 3AZQA 1ZI6A 2VJBA 3IVAA 1CULC 3A11A 4TV9B 3ED1A 4EATA 1L7AA 1EA5A 2R4UA 4LZPA 4MB6A 5C53B 2B1GA 3RASA 1IU9A 4CDNA 1T34A 4JUIA 3HP1A 2HMSA 1UQRA 5TPWB 1SIOA 3KS9A 3R24A 3VPCA 3FZQA 2HADA 5FYDA 3SFVA 2XLCA 4WZBE 1PJZA 3JQGB 4BYMA 4V1CA 1DBRA 3IAAA 1XPUA 4MYRA 7AT1A 1RZRD 3V42A 4B2YA 5JY6A 1I4TD 2A3RA 4D8WA 4OJKA 4GE0A 2JFBA 2FZLA 2HSDA 5DGCA 4CR6A 1JFRA 1UJNA 3ABQB 4AG3A 2DXIA 1UFOA 3EGVA 2Z04A 1R88A 2JS7A 3PVSA 4FC6A 2ZTUA 4MDHA 4WBSA 4YGYA 2I2XB 1B74A 4E1BA 2XBMA 4CQMA 4HVLA 4KO4S 2Z3ZA 1GGJA 4BCDA 1LNQA 3K5IA 3BAZA 2CLSA 3SM9A 4EBFA 2J3HA 3E8MA 4C89A 1N6NA 4I99A 4RZ3A 1JX6A 5B1HA 2GD6A 2J9FA 5D8DA 4B3IA 4IXMA 3T3MB 4B2PA 2HBZA 3TXXA 3WGNA 4UUQA 3NTUA 4GDFA 1A2KC 4DQ0A 2ZXUA 3FR7A 4LJKA 5AKYA 3I61A 1T29A 1K92A 2JG3A 3TN7A 1U7DA 3AFIA 1YI8A 1VQ1A 1Q7RA 3R4CA 2XA2A 1HYHA 2P9YA 1NIPA 2JBAB 4RK4A 4K6HA 1ZA2A 4KO8A 5AESA 3DLCA 3FCOA 5JQGF 4D41A 5CM9C 1M6YA 4DNOA 3VI4B 1EP9A 1BU5A 4KR0A 4U0JA 4GMXA 1YTLA 2A0FA 2QX8A 2FLVA 2HIAA 2I7XA 2QY9A 4W99A 5LMNB 3PNOA 1N5RA 3M49A 3OQNA 4TKMA 3DOOA 4PSAA 2GAOA 1ZP6A 5EZSA 5G1PA 1JDPA 3VZBA 4G5YA 4BMCA 1KZ9A 1ZL2A 2BFEA 5AVYA 5IK2D 1EAYA 4O2BF 2FG6C 4H7DA 4ML3A 2O8CA 3O26A 3L04A 4J16A 4LC9A 3DMDA 3CVXA 4MVJD 3SVZA 1PEKE 2VAMA 4CCSA 3PGJA 4P3XA 3BZWA 3OD1A 3VC1A 2W42A 1H66A 2FX3A 4RQTA 4M1YA 1TO2E 2IOQA 1XK6A 4UNIA 4BNLA 2BRUA 1SZJG 1NQWA 3HPQA 3F71A 1P1FA 3UAVA 1RBYA 4AYTA 4DZTA 1J56A 4CMGA 1W1IA 3IMKA 1T2AA 4EI2A 3L1JA 1P81A 2NYUA 3W4JA 1L8LA 2GZHA 4HWGA 1SCDA 1P74A 2BZ1A 1MR3F 1MW9X 2ZS9A 3ZTWA 1T5LA 4GPTA 4JLNA 1HFWA 1DWUA 1JR4A 1LDGA 2GCIA 3P5BA 4TQUS 4BEBA 4RF5A 5B64A 2YXLA 1B8OA 2HWUA 3K5PA 5ER6A 4NC9A 1T9BA 2QTVA 3C2QA 4UU0A 3IUJA 4LJ8A 4WI1A 2XQKA 3WBBA 1AUQA 2CGEA 3AHDA 3Q11A 4IKEA 4MJXA 1TZBA 4DSOA 2HJVA 3HLKA 1JEEA 1PJTA 2FV8A 1MAHA 2YIMA 4O3FA 2O1SA 4NH0A 4BNTA 2NSHA 3TNDA 2B8TA 2QDKA 1ESMA 1UKVY 2EERA 3WC4A 4RHTA 4AQDA 5CCEA 4EY5A 4F1WA 5JXJA 1MB3A 4LHXA 3JVVA 4DBLE 1CK4A 1SZDA 4XAQA 1G63A 2OO3A 4M38A 3D64A 5IULC 1OZ0A 4K7JA 4AF6A 3UCXA 4B40A 3Q8XB 3JV7A 1UBMS 3ZY3A 3KB2A 3HZHA 3W04A 1W9MA 2G0TA 1NBHA 5AOBA 3A6LA 5KMGB 3G5TA 3DHVA 1QZXA 3CBGA 1RIFA 3GLQA 4P53A 3TQTA 1BDBA 3M5PA 1P77A 3FYUA 2NP7A 1CFZA 3WQRA 1IC6A 5I47A 3IH5A 3WLLA 2IYYA 3PUXA 3KELA 1WUTA 1P2VA 4R98A 5AOCA 1QCYA 3NTLA 5HMLA 4KC0A 3K16A 3ZDRA 2ZAIA 5H80A 2VYVA 3CZ4A 1ESCA 4RHXA 4ACBA 2JLCA 1U0NA 3BL6A 4F46A 5BSVA 3PZRA 1V95A 1DKLA 4RD4A 2X0NA 4OHCA 1T8YA 1HDCA 1QCDA 1O1YA 3A6JA 4ZU1X 4JT9A 1ZK2A 2ZJFA 2H18A 3A36A 4BKUA 1VLHA 3FWYA 4BAZA 1RI5A 1YR3A 2AC2A 1N4DA 3L7CA 3NGXA 4OGKA 2GEFA 2C8LA 1E4OA 2R6ZA 5HJ5A 3T0GA 2WFLB 4Y0VA 3KDSE 4XA8A 1N5DA 1WQ3A 4UZFA 3K4HA 3ROEA 1T0IA 1W0CA 5DHTA 4AO8A 1VCHA 2XXAA 4Q4JA 2REOA 2EFGA 3NR2A 1Z6ZA 1KSGA 3A3PA 2Q4BA 3KOYA 1L2TA 1NN3A 4A8JA 3IT3A 1BQEA 4MMYB 2B5VA 1TECE 2VUHB 4KXFB 1JVSA 1CRZA 4XQ9A 3W1VA 2F3UA 2BKLA 4X60A 3OHMA 3RSCA 1R2QA 3ZU4A 5EJMA 1XQ6A 4O1HA 4GNKA 3KZKA 4FW9A 1CQXA 1AGRA 3BBLA 4JVNA 4P6VF 4RIHA 1LH0A 3WGTA 1C0PA 2XMRA 2D1TA 3RGWS 3J80A 3GLGE 1N1DA 4FFDA 5JMWA 1DNPA 1DQPA 2BFDB 3BMCB 4O63O 5TT1A 4A5OA 4UMFA 1QYRA 1RBQA 1UAGA 2GF2A 1U8CB 2HX1A 2H07A 5EJIA 3WIDA 2W8BA 3ZS8A 4BKQA 3ITNA 3S70A 2ATIA 3DTTA 5KNCH 4E3ZA 5C18A 3MMXA 1ZNWA 4DSZA 5GZ3A 3P96A 4EH1A 2J32A 4AO6A 4H7PA 1XEWY 3X1YA 3ICCA 2H7XA 1JE1A 4FQ7A 5CPBA 4MV4A 1VKZA 3TRKA 5HE8A 5IJ0B 1M1YE 2AMJA 5LQNA 3KRTA 1AO0A 1MFZA 1YMUA 3A1FA 4E4RA 2FG5A 1XELA 2D1QA 2WKWA 4JI0B 3T4PA 4UUBA 3UAOA 4GKJB 4PO1A 3OVMA 3NTVA 1DL5A 1ZHHA 2RHTA 3TOZA 4CM8A 2P5UA 1ZH6A 3UT6A 2ZBPA 4GLOA 2CSXA 5ENDA 2R6HA 1DKMA 2HU5A 1C3JA 4JB2A 4TLAA 4C1NA 4OHFA 4REQA 1RZVA 2ZYTX 3FUTA 3KYDA 4R9SA 1XXLA 2J67A 1A8IA 2ZWPA 1SKUA 4F5EA 5K0TA 4EABA 3L0DA 2QTGA 2V7BA 1LTKA 3F8TA 1XIVA 1SC1A 1EWTA 1QNFA 2EEZA 4N01A 1RAFA 2WHPA 1PEYA 2WKSA 2BOVA 5BMVA 3QEMB 1XU9A 4HZUB 3ZJ4A 2WZBA 2P9EA 5KVAA 4QZVA 2VP6A 2E4YA 4M86A 1F0PA 3L6EA 1N5IA 4IXDA 5AM4A 2VDMB 1GPWB 4GI3A 2AYZA 2BKUA 5I9BA 4W5OA 4OSOA 4IEIA 4WZZA 3GLFA 5A5FA 3H65A 1ZC3A 1Z6QA 2OV4A 4F56A 4YYEA 4TUYB 4BNMA 2QVBA 2A4MA 2D5IA 2H4JA 5JEDA 5IRCD 1SBNE 2DH6A 3WX0A 4F8EA 1P9OA 2NUPA 2X5XA 2ZGVA 3AKCA 3PENA 3BFKA 3C4QA 4YHHB 2GBLA 1Y1KE 2GOYA 1AHNA 1NQTA 4X63A 1GNVA 2XB9A 1LCIA 2QYOA 1S9DA 2VN8A 3V33A 3ELYA 1U31A 5C1PA 2IVFA 1WJGA 3VOTA 1Q74A 4DPKA 3CKYA 3LVFO 3AEQA 1HQDA 1XZ8A 3E0QA 1B7GO 2VF4X 4XGNA 4OQPA 2DSTA 1GCAA 2QPTA 3N7UA 4WZAB 4CXMA 1OT3A 1W52X 4D0NA 4D9EA 5IKMA 5EJ5A 3ICPA 3K6KA 5K8UA 2C2MA 3CX3A 3IAXA 2JNWA 4YRMA 3G8DA 3SWWA 3Q7SA 3DYVA 1ECFA 1IN6A 3KUDA 2V8BA 4FGLA 4KYIB 4YRAA 1D8TA 4NAVA 4R81A 2ZIUB 1LPBB 3SMQA 3IDQA 1J0DA 1BXZA 1ADBA 2RH9B 4JWTA 4DCVA 4K40A 3B6MA 1FK8A 2HUNA 3BD8A 4X7BA 1FU7A 3U7RA 2GN4A 5BQ3A 3C5HA 2D8AA 4XQEA 1E5LA 2H4XA 4BFLA 4FFOA 3FWZA 2QMUA 1R8JA 2P8SA 5AO9A 5IPFA 2ARKA 5JNSA 1PWZA 1I7LA 1RS0A 3IB6A 2QNIA 2OCBA 3L5KA 3LPAA 5GJVC 3VPBA 3KLNA 3RYCA 2R60A 2R96A 4FZRA 1G17A 2ZWMA 1V96A 4MKIA 4LJSA 3M1IA 2PAAA 3QVUA 2X2OA 4YUZA 2GVZC 1QK5A 3BE8A 2YZ7A 4L5JA 1IBKB 4AUKA 1O87A 3UAWA 2JCGA 3HCAA 1QVVA 5C31A 3OWXA 1G66A 4QPDA 3CH4B 2PGLA 3H1GA 2WB4A 5EYPA 1C8VB 1NDQA 4ZAWA 2OSVA 3ANSA 4UATA 2WG2A 4RY0A 1ZOLA 4HATA 3IUSA 1HOXA 4I8DA 4GZ5A 2B4TO 1VLQA 3CPEA 4MPJA 3C3DA 3L82B 1KS2A 5GONF 3VX3A 2ZAMA 1MB4A 2HU7A 4DWVA 4J9UE 2BI7A 3DQZA 4RQBA 5KOHA 2B1JA 3GG2A 4NU6A 4Q19A 1LI4A 3H4IA 1DIRA 3BMXA 3S2YA 5C1OA 4P4LA 2EG9A 5KVSA 4M0DA 3M5WA 1ORVA 2MHCA 4IIEA 5DBGA 2W70A 5JSFA 3IBTA 4QULA 4M0UA 3IUEA 1D4ZA 4P08A 1F7VA 1AVTA 3E2MA 3KU1A 1OROA 4N8SA 5C8ZA 4ND3A 2WJWA 4DLVA 4X97A 1KI2A 1WDMA 3MHPA 4PGMA 3TTUA 4BFSA 5CIQA 1PFQA 4BO5A 3ZWAA 5CT6A 4UXJA 2JJ1D 4PAQA 2NO7A 4Y2PA 3QUQA 3U4IA 2QRJA 1AS0A 1C0KA 3BHMA 2ZB2A 3JYNA 4WKBA 3LI2A 3BEOA 5ECWA 3TZHA 4ER0A 3I32A 3DOUA 1G2QA 3NRCA 3B2NA 4K8RB 1KI3A 2R6FA 3B3GA 4IIFA 4RDXA 1NHWA 3FNHA 2ECQA 2QW0X 5FL7A 1GAQA 5IAJA 4ENPA 1WKBA 1YCGA 4GC5A 4H7JA 2AFRA 4RTNA 1QGUB 3ZE7A 4V0NA 1JVNA 2GAJA 3HN2A 4URWR 1JQBA 4REMA 1XU4A 2JFYA 2PLWA 3VYWA 1K7FB 3DVAA 3FSEA 3KWFA 4HLCA 4OXKA 3PC8A 3ZVLA 2QI9C 2AJDA 4GPZA 5F3RA 3BGOS 3ZWMA 4E51A 4ZIRA 4ND6A 1TEXA 4KJXA 4NBKA 3ZI4A 3QLJA 1MG0A 4GGMX 3DE4X 3VH2A 3D6NB 1FSZA 2SCUB 2XT0A 3EFBA 3RTAA 4CKXA 2JAQA 2P11A 2H00A 1EEHA 1DIHA 2C77A 4P34A 1HDYA 4DGQA 4WBNA 2RGBA 3EZ9A 1B0PA 2Q5QA 5H5JA 4W5TA 4FK8A 2XTNA 3WL4A 1E2BA 3MTGA 4LKRA 3RW9A 3TFQA 2CKMA 4RHCA 2IZZA 1UDAA 2C2GA 3DV9A 4EP1A 1E4EA 4HUJA 2R0QC 1I5OA 5BV7A 3U26A 3CKLA 1F4LA 3HB9A 5HG0A 4V02A 4PG7A 1OH6A 3K8QA 4U8GA 521PA 4DV4B 3I83A 2ZVJA 4CU2A 1ZM7A 1SVSA 5A4MS 1HX7A 1JLKA 1ZKMA 3LO5A 3MBIA 4FMCB 4CL8A 5CK4A 4K6KA 2TMKA 3P4XA 4BO8A 3BXPA 3D3EA 1YR8A 4J76A 3GA0A 3GLVA 4LKOA 2Z3VA 4UPDA 4WCDA 5C0OE 4D42A 4D56A 3B1FA 1INLA 3I5XA 3P9YA 1PT5A 1IJFA 3ZJYA 2QMZA 4TMVA 2RBKA 1JECA 3E22B 4NQZA 3HFGA 4AXBA 1Q19A 2D2XA 2VCHA 2ZVPX 3DZHA 5REQA 2BTQA 3ROTA 4RACA 3IPCA 5KYYA 1OLOA 3C7CB 3KB8A 1XALA 3HJFA 1N2BA 1GZ4A 4Y2UA 2REQA 3TTWA 1FPMA 4BN5A 1IFXA 1CUYA 3OIDA 2GDZA 2XGOA 3C4JA 4IZOA 4W8GA 2BMVA 2W37A 5G53C 3NBZC 5TS2A 4AXXA 1FW8A 5ARDA 4Z51A 3TDMA 1BD4A 1UEJA 2QLJA 5DCLA 3A2LA 3GLHA 2F67A 2XT9A 4K9MA 4OP1A 4EG5A 4IJQA 5KTSA 3LFHA 3PTZA 2G5TA 3UMFA 1FSFA 1ODSA 3IR6A 2GPYA 2PUBA 5I5GA 4YH1A 5H9WA 1NJ2A 3D6MA 4E5VA 2P9HA 3D3WA 2ZUFA 2ZI4A 1N34B 4OUKX 3CUYA 4WCFA 5C8DA 1EX7A 3PYMA 3T7TA 4DQUA 3OX4A 3AR6A 4DUYB 1ISMA 4GIBA 3VFDA 1SCQA 1PWHA 4M7PA 3WGHA 5U1PA 3MQ2A 3TQCA 4LWOA 4GOOD 1TLLA 1MO3A 3DAPA 5FPSA 1B8VA 2YV4A 1M2JA 4OU5A 2BGJA 1IZZA 1GUAA 1I1NA 1Q0QA 4H2DA 3H5WA 4TTSA 1HF3A 1QPZA 3U39A 2V9ZA 2VJQA 4HXEB 3F1LA 1KZHA 1VKNA 3OBIA 5FWXB 3OBBA 3QEAZ 1FUKA 1GZDA 4ZANA 2C59A 2PQ0A 1XTQA 2XIJA 4P58A 3J81k 2YJTD 4P0QB 4PGGA 1Q7CA 2PFSA 1HEIA 2OLJA 4KVZA 1K6MA 3VSEA 3GDFA 4ETNA 1NC1A 3SBEA 4ZPXA 1CJKC 1E3MA 4B4WA 1ZY2A 4MQUA 4YX9A 5B2FA 1ZJWA 2XXJA 4EY4A 3TQQA 1TPYA 4GYYA 4E30A 3WSVA 1H22A 4BL5A 1OD6A 1YRWA 2PIDA 5AW4A 4UTNA 2OT3B 2VXYA 2IXDA 2CUNA 4PSUA 3LLSA 4JOQA 1VOTA 4DNXA 2OGSA 1EB9A 2I8LA 4IHJA 3AY7A 5CVJA 4Z8XA 5ELLA 2CNDA 2OXFA 4UVGA 5CPFA 4EJ0A 2WNHA 1CSEE 4I4TA 5EGSA 3ZK7A 5F2EA 2VJPA 3D0KA 4RSHA 4Y2RA 5JD4A 2HB6A 1ENPA 4GOKA 4F5YA 1FP6A 1G18A 2Y1CA 4MWDA 1ORIA 1NR5A 5D2CA 5SZJA 4CG2A 2AZXA 1RLUA 3EY4A 5EKSA 3VDRA 1SCAA 3A25A 5CP8A 1QANA 5ADHA 3DL7A 1BOOA 5GMOA 4XTRA 5ELMA 4ZCPA 4B48A 2MJLA 4K81B 1GPKA 4P31A 1NE7A 3E61A 3B12A 5CX1A 2AJBA 2O2XA 5DF1A 4TTQA 2NXEA 4MGZR 5JAIA 2LVBA 2C2OA 1ZWKA 2IYPA 1FNDA 2WJ3A 2ZBUA 3NBYC 1I7DA 2R8ZA 3LDUA 2GJKA 5JHGB 1K4MA 2UVPA 4UC0A 3LO8A 3NYRA 1CX9B 4OLHA 5CFQA 1QYWA 1XN1A 1ICEA 2OK8A 2C0QA 4TM8A 1GUBA 3JQRA 1ZNZA 5LBIA 4B7AA 4EITA 3DDHA 3JQAD 5DCWA 1P29A 1RWPA 2C2YA 1QNLA 3H9UA 3PRJA 3V6LA 4B09A 2L42A 5FIUA 5AICA 2FGKA 4M3NA 1DDIA 3HZOA 1ARZA 4MMXB 5CA0A 1W88A 4KDRA 2O1WA 4XDYA 3QMVA 4CMEC 1WULS 4X8HA 3SXPA 3TVDA 1JQJC 5L8VA 4PAMA 5EA2A 4CKWA 1T1EA 2PUJA 3C8MA 4XLLA 2GLTA 3EUAA 1M8KA 1NW3A 1PBTA 1BH6A 1TF2A 5ALWA 4NF2A 1DBIA 3V8NA 2JVKA 5IDWA 4GWLA 3DCJA 1ZYUA 4UDNA 3AXSA 1BSVA 5DWVA 4QWMA 5HOQA 4YRRA 4IH4A 1I2BA 1DE0A 2V97A 3NJ4A 5AT1A 2PZKA 1COZA 1FFSA 1WCYA 1X1SA 2R7AA 3WFIA 4LXTA 3PXUA 4EL5A 2QSZA 5IMBA 2NV0A 3B13B 4OHWA 4A2CA 1FMLA 4G0VA 1NXXA 5LKRA 2XGGA 3K31A 3ETNA 2RD2A 1Q7GA 2ECFA 3JQFC 4LQLA 4NOMA 2MSNA 1TW3A 4DM3A 1ZUD1 2QRHA 2IWHA 4O4HB 3V7UA 1UFQA 2CUTA 3PPVA 3I01M 4JBXA 3RFTA 2YVAA 1NJ1A 4EX6A 1RHUA 1A9PA 4RS4A 3LWZA 4A10A 2FZKA 4KO2S 5C80A 1XZCA 1C9JA 4QRHA 3DAOA 1YCDA 3NC0C 4D8TA 2O3JA 3MB5A 5BVHB 3HL4A 4NH4A 5KQLA 4OQEA 1XLVA 1YMQA 5HBGA 4D5GA 3HEBA 5ADVA 1B4DA 3K0FA 1L4KA 1V16B 2XEDA 3NTXA 3Q0IA 1JIQA 4PHTA 2C7GA 2FEOA 4QEDA 5EZYA 5BWOA 4CMBA 3QKUA 3EHEA 3R6DA 3RRJA 1VCNA 4NCJA 4DHWA 2MOKA 1FSPA 4OOFA 1C9DB 4EHBA 2HXGA 4PVCA 3O7WA 3VISA 4DPLA 3SFTA 4RPGA 1BIFA 4PZAA 1PG5A 4IXTA 5DE3A 3O93A 4G6ZA 3SNKA 1KWGA 4Y7DA 3R75A 1XMPA 4F4JA 2FK7A 2AD1A 3PEUA 3Q5GA 3WLFA 4F1JA 2IS1A 3EEIA 3U7IA 4ZJPA 2D06A 2R44A 3PA8A 5K3BA 3L40A 3RS3A 4DQDA 2WJAA 1Q22A 2QRZA 1XGKA 4Z1OA 1SN7A 2C9OA 1OXUA 4Z6KA 2OP0A 3LY5A 1FDUA 1W44A 2PLRA 1BKSB 2Q9AA 4GECA 1Z7GA 4B0OA 4IF6A 4B9AA 1X87A 4HTFA 1KY5A 4F2HA 2ZT5A 4O2LA 5CW1A 4YQFA 1KDOA 4QDZA 1YZNA 4J8PA 4R0MA 4YPOA 3R6LA 5C3UA 1CNMA 4EFLA 5B5SA 3IKTA 2DECA 2ST1A 1TK9A 2B9VA 3EPHA 4LXIA 3GRAA 3H5LA 3FLEA 4JYMA 5CDTA 3THYB 3EQ7A 4ZO6A 5BW6B 2YN2A 3K1JA 4GD3Q 1O96A 4OGLA 1RWBA 2A78A 3PLAE 4QBFA 1SVKA 2GBIA 2JI6A 4QFDA 1GM5A 3ZE1B 4BO1A 3V2HA 4IDNA 1IM5A 4D8UA 4DSAA 4Z1MD 2XQVA 3M4JA 4I4CA 4DMFA 3OQMA 1GAWA 2Q1TA 4UAGA 3SS8A 3EGDA 4QTZA 3THSA 2JLVA 2Z1MA 3VYUB 4KQ6A 3VR6H 3A9CA 3E5HA 1QUEA 5JJLA 4N7BA 3DKRA 3O90A 3I1YA 4KUGA 4WA7A 5LU8A 5IM4A 3OETA 4ZJYA 5EJ7A 2IEYA 3B1ZA 4HXYA 2RKOA 3C15C 4ZCMA 2NSJA 1F2UA 4CLRB 1VL1A 1NRWA 2NU9A 1LLQA 3MGBA 4OEHA 5GIPE 3U9LA 1JPVA 4ENWA 5L6LB 5CEFA 5B55A 1NBIA 4QLAA 3T7AA 3VPDA 3HB7A 3OCXA 1RYZA 3EF0A 1NVVQ 3OF2A 2PO5A 2G9ZA 3IMEA 3IVGA 4E2WA 1A4IA 4GM0A 1X92A 1KK2A 4NU0A 4PAOA 2F48A 2IDZA 3RU7A 5B3LA 1HTBA 1Q1NA 1TUEA 5EHGA 5I7RA 4KE6A 3Q8KA 3O4VA 4C30A 5KX5A 1CZHA 2HLDA 2WYHA 4TROA 4D9BA 5JAQA 2QLFA 3BORA 1ISRA 3KUUA 2Z09A 4KMOA 3LG2A 4KVAA 4TTRA 1OGIA 4IM7A 1KR2A 3CYFA 1QOZA 2VCEA 3H0EA 5HFJA 3SEQA 1Q50A 4M8NE 1J4AA 3WQBA 4XIIA 2I71A 1ZIPA 1N7JA 3RUDA 1DTWB 3D6UA 1SBIA 4IJWA 2B98A 1KJWA 1EJ2A 3BRWD 3G9ZA 1WUJS 2EHDA 3GYGA 5FORA 1HM5A 1OFVA 3QE0A 4MX8A 5ITZA 1NN5A 2AE2A 3KTOA 1T2NA 3I45A 1RXIA 3MXTA 4AMUA 3HVIA 4WNYA 3QENA 2Z8ZA 4KSCA 4HN9A 2DWQA 4O2RA 5KDLA 4POAA 1XCBA 4YHBA 2ZB4A 1G2PA 4DDVA 3O7MA 1IUNA 1P8JA 1X74A 1EUCA 5EWJA 3NIDB 3G2JA 2GN9A 2WF5A 1AY0A 4FHFA 1CUUA 3OPMA 5J2TF 2OQVA 4D99A 1QQ5A 5C1DA 3UWMA 1FFYA 2W6ZA 1T1SA 2XJ9A 4BCCA 2WWIA 3JQ8A 5M3BA 2CL7X 5I3ZA 3W2HA 1ACLA 3ETDA 3AKEA 1PT9A 1YA8A 2N75A 4I5FA 3WMXA 1HDGO 3FBTA 4ATNA 4LY0A 5AW2A 4CMHA 4G89A 1DV1A 3GHYA 3OKAA 5EQTA 1I3NA 4JUBA 2QM3A 1JDBC 5LIRA 2C2BA 2DPXA 2WEKA 5LUBA 4RHUA 1O9GA 4JMPA 1OC4A 5ALJA 3V1YA 2AG8A 3X43A 2VKQA 1M74A 5JALA 2CVQA 1DX6A 3TECE 2CXRA 1KGSA 5E2AA 4DANA 2E87A 3C6ZA 2BR4A 3C8DA 1VP3A 3MC1A 3DF7A 1SKYB 4DJDC 2W8ZA 3GFTA 5FLKA 4Q05A 3CE6A 1A8QA 3LWNA 1EVQA 1YRBA 4JI5B 2EJTA 4FGUA 1PP4A 3CRVA 2OP1A 2EKDA 1P2UA 1XDGA 2QGZA 2WP8J 5FJJA 1H9BA 4FFVA 2IOFK 3HVUA 3KYIB 1AN9A 3WO0A 1QE5A 5P8WA 1VMDA 3ZZNA 1YJCA 5BUSA 3GMDA 4JQSA 2G8LA 4IQFA 5EQJB 3REGA 4COKA 2I6FA 1T5TA 3ZE9A 3LDAA 4E5YA 4DRXB 3N7TA 4KIUA 5IAGA 5KI6A 5JAHA 1WDTA 2NZWA 2NZJA 5EI5A 3WTCA 5K8LA 4QUGA 3NALA 4FYKA 1CRPA 3OOJA 1NF8A 4A1FA 2O8DA 2VZ0A 4OI2A 4AJPA 4YMLA 2O2JA 4R41A 1JPJA 1O0SA 1MQ9A 2QMYA 3GCGA 5KAPA 1G41A 1UPBA 2V45A 4WUTA 3E4CA 3KOOA 4P8RA 2X0DA 5BSKA 2O9JA 2AMFA 5TB5A 3LV8A 3A6KA 1B6SA 3DXXA 3I9KA 4HN4B 1C50A 3A9UA 5DI3A 3O8DA 2QN2A 3GP3A 4FILA 4K6FA 4Z2AA 2W4IA 1FDTA 1FFAA 2NPIA 2HQSA 5JW6A 3HXMA 1WBBA 3TS1A 3DLTA 2UUAB 1H2RS 3OUUA 2TMGA 4IR7A 2ZIZA 5CFPA 1P4HA 3DGEC 3HL0A 4W7HA 1H69A 3CUEF 4P4SA 4ROTA 2WSBA 4HEA1 4CMIA 1A7JA 1B93A 1IDOA 1PX0A 1QGZA 2XWPA 3D59A 5G4KA 3EVGA 3ZWKA 2QTMA 2PU7A 3PDCA 1Y6RA 4DLXA 1LD3A 2B7LA 4YXWA 1FTSA 1VLVA 2D0PB 1MJFA 4MRPA 4P4UA 4OM8A 1SQ0A 1SBYA 2Z0MA 3TM4A 3ACBA 4MRMA 3WBFA 2FJ0A 3GQVA 3ZCPA 3QUTA 5D3MB 4JT8A 1AQJA 2C04A 1Z16A 2ZT6A 5C9ZA 3W5AA 1WXDA 1Y8RA 2XLBA 3UO8B 1Z4OA 4FFWA 3NVAA 3AHIA 2H1VA 4LE0A 4NBVA 3TVYA 1WKCA 3WLAA 1M72A 4C7MA 5KQRA 3D5TA 1YR2A 2VPTA 4QT0A 2PXCA 1SD2A 4WVFA 1UC4B 4F9GA 1T3TA 1LPPA 5CBPB 1LBIA 2Q2QA 3QLEA 2C95A 4ZK6A 4BMOB 5B7PA 2FCRA 4W5QA 5BW5A 4JJIA 5JSKA 2G5CA 4ZRDA 1J21A 4XJXA 1EXVA 4J1TC 1E2HA 3QNWA 4BWFB 4LJ7A 1GY8A 1I3LA 4Y2HA 1KEKA 3G89A 3JZDA 2EG5A 2CHUA 4U2GA 4IHAA 4KNYA 3EXEB 4MKXA 4YAIA 1YT5A 1ND6A 1QKIA 1EDDA 3SG0A 5TLSA 4F3TA 1ONNA 1KU6A 1TYZA 2NYRA 3HP7A 3OU7A 4H4EA 5BURA 5FH9A 3WLSA 3VUFA 1VE7A 4M9RA 4WZAE 5GY7A 1HQYE 2Z8YA 1T26A 3EDCA 4JT2A 4BGDA 3EF1A 3ZVRA 3MMZA 2JIQA 2VXCA 5CB4A 1NVKA 3INYA 2RGGA 2OHJA 3C1OA 1DCTA 4BNDA 1KDVA 1UBKS 3JSAA 1R18A 1JDTA 2HY7A 2YN0A 3IB3A 4DQVA 4DCJA 1JNYA 2JK1A 4OYYA 4R8SA 3CINA 1KI4A 2ZJ7A 3HJRA 2O3QA 3B38A 3PNSA 1KPGA 1SG0A 4KGZA 3VHQA 4PTZA 4CKYA 4D8XA 3U4CA 4DCOA 1IXYA 4FE7A 3NM5A 4DQLA 4UNSA 1QGED 1VHJA 1X1QA 1G7CA 3N2KB 5KOYA 4E2YA 3AF0A 2DFTA 2XWSA 4RD2A 5F51A 4H3SA 3O2NA 2NO5A 1DQZA 4A6PA 4OP3A 3ONFA 3PHLA 1PYDA 2WHEA 3ESQA 3OJEA 4FQ5A 3ZQ6A 3ZDFA 4AZ0A 1N8SA 2XYVA 1FJ2A 121PA 2P68A 1L5QA 3MCTA 2PD3A 4ZQEA 2EJVA 2W2KB 4YPFA 3K15A 2IYFA 1NC3A 2JIRA 3THXB 1E4VA 1BYIA 2XE4A 4GPBA 2J3EA 1NPYA 1QYCA 4Q7MB 1L4HA 3K7EA 3H16A 1P0FA 3F6BX 3QLUC 5FEUA 2AVDA 2F1HA 3FJOA 4Q1FA 5IG2A 1C7IA 3OT1A 4Y6RA 3E3OA 3PJGA 4MH0R 1R0XA 5BR4A 3ND9A 1ADFA 4HDKA 1AF7A 2VSNA 4R1SA 5THXA 3V55A 5C8YF 1W9HA 2E3JA 2WVGA 4RKRA 3ZD6A 4OA8A 4QM6A 2J6BA 1Q92A 3OOWA 4MW5A 4O4JF 4QNNA 3R7WA 1LJLA 3T3PB 1PKXA 3AUSA 1G20E 3LFTA 1UEIA 4ZT3A 1KY3A 4R05A 2Z56A 3IESA 3LOUA 3RQSA 3AOGA 3RS4A 3EFEA 4B8YA 5ICFA 2DG2A 3KJQA 2GH1A 1CW2B 1ZUNB 1ECGA 2J30A 2NOAA 2ON6A 1KARA 1SUIA 1ZS9A 2DMRA 3IRUA 1NF9A 3ONEA 1HL7A 5JS8A 1QG0A 3B85A 4XGKA 4R2IA 2X1HA 5AQ1A 1TPZA 3JD3A 2QRKA 5U9CA 5BW4A 3CT6A 3R5JA 1D2HA 1GTVA 3AI7A 2BMWA 3T5CA 3IAM1 1FEZA 5BR7A 1B8PA 2O7RA 2I9KA 3AUYA 3PWZA 3GRRA 2OL4A 3AVOA 2OG1A 3MS7A 4RIEA 1F3LA 4AJ9A 4UM5A 1TVKB 1JFSA 3PVZA 3U56A 5A3QA 2EX1A 2HPHA 2UZ1A 4HAUA 4LIPD 4TKZA 2R8XA 3TZCA 3UAZA 3WLQA 2OZVA 2EX0A 3CN9A 3OPXA 4BE4A 4CKCB 5CDSA 3ELUA 1SKBA 1PL6A 4KIWA 1IRXA 2PKQP 4TTVA 2QQFA 4N54A 4H7HA 3UA4A 1J9GA 2PTHA 4UBJA 3A8TA 1WHSA 1ULSA 3ZDZB 4CW7A 4R16A 5LB2A 2FN3A 3VSAA 1KPIA 5LXTA 2XT6A 5DH9A 2IX9A 5E95A 4ECEA 3B1XA 1RTKA 3K92A 2GKGA 2JGEA 4G9EA 2OO7A 2X4IA 1JZQA 3LP5A 2AOTA 4ALMA 3O8QA 4BKRA 1Q1BA 1KMHB 1WPRA 4GQBA 3IVMA 4X64B 5C5EA 5IF9A 3NMUF 3EIUA 2F4NA 2G63A 2MR6A 2OCKA 3LLUA 4MDFA 1K89A 1E1KA 1P4GA 2FFAA 4UM9B 1Z0UA 1R15A 3BF7A 5AK4A 5EZ6B 4KVFA 4R2WA 4NMHA 3T5TA 4ANFA 4ITUA 2J5BA 4DDKA 1LDBA 2VWGA 4WOJA 4MQFB 5BNZA 4Y1GA 5FX2A 5AJHA 1IBSA 1QYXA 1WB5A 4OREX 1KC3A 1IB0A 2YICA 5IJWA 1W34A 2ONYA 1Y9AA 3MQFA 5IJAA 3TLMA 5HGXA 1TK3A 1JAZA 2GZSA 2WF8A 3VRHA 4AWXA 4C0LA 1XZLA 4WOCA 3QM1A 1N0UA 4TMZA 1AQUA 4BKPA 1KK3A 4CEIA 2NAPA 1N8KA 1NT2A 4GYWA 3F7NA 3FYCA 1YOVA 1DKNA 1TD9A 2V7GA 3E8SA 2G72A 2XUKA 3FKQA 3GEIA 2PL9A 2QRLA 4X5OA 3U1VA 4BMVA 3L41A 4ZGGA 5AUOB 4TMXA 1NVAA 3HYLA 5EL0A 5FO1A 3UXMA 1F51E 5H82A 5EWMB 1GPH1 4GVPA 4S1NA 4C3OB 2X5OA 4FR2A 2W6MA 3UMJA 3GUZA 4JLBA 3TQIA 1TIPA 1AGNA 3LCMA 3DKIA 1DAMA 2IDKA 3NHLA 2H7CA 3DE2X 4HYTA 4Z9XA 1A5ZA 1TMYA 1BD3A 2Q5LA 2VCYA 4RFVA 4L0QA 1UJMA 2JFFA 1DZIA 4HAVA 4BZWA 3QFHA 3NIWA 1MB0A 1QV7A 2HMTA 1XVUA 4H1TA 3SDSA 4EQZA 3SZUA 2QS9A 3QXCA 2ICAA 4Z7NB 1YVUA 1QJ4A 2M6RA 2B0CA 1PR9A 2CLEB 3FKJA 3IOBA 2WD8A 3GZNA 3IO3A 4HEA6 4YJFB 3E7XA 3L6RA 4HDOB 4JA0A 3GGPA 2FMKA 3OEHA 5KKCA 4QFCA 3RSZA 1NURA 2A5FA 3DDZX 1RHKA 4MA0A 4Q3AA 1GQ2A 4OHXA 2VBCA 4PFJA 2JLAA 3WDMA 4BO2A 2CHQA 2XRYA 1ZW1A 2FR8C 1Q17A 5F1PA 1P0PA 3W5VA 2YWCA 5TVKA 2C99A 1C7FA 4WGFA 4EDFA 3VR4A 4BVLA 3JZAA 1I51A 1DFGA 2P3OA 2QMOA 4K1XA 4QAQA 4UHDA 4DB4A 2WZCA 1QO0A 1IZ7A 2PX0A 2X76A 3RHTA 1UAAA 3EBPA 1T43A 3KOMA 1SKAA 2ADFA 2VAVA 3AHFA 2NXNA 3LW7A 4H17A 2CMGA 4M0CA 2J7PD 1PJSA 2JC3A 3HDGA 4NWIA 5TNXA 1UF9A 3EIOA 1X80B 3T0IA 3WJ7A 5B4UA 3PFIA 4AECA 4CMCA 5D7NA 3I1JA 4DV3B 1YS9A 3JRWA 5BQXA 3EMDA 1JBEA 4WY5A 3HDJA 5J9FA 1CP2A 2NAFA 3PHBE 4TTTS 4RZSA 2H9AA 4YQYA 3P52A 3E7FA 4I55A 4AP5A 4DXHA 4NE7A 2P91A 1CKEA 4S2UA 1S8OA 3TW6A 3TRJA 4J49A 1VIDA 2ZE6A 1DEHA 2CDNA 4OXYA 1KVUA 1X38A 4Q16A 1BHO1 4E21A 4B6RA 3ZWOA 4NS1A 3MD0A 4INOA 2JAHA 3KYJB 5FUMA 1FXWA 4P7KA 2A92A 5EE5B 4ZPJA 9ATCA 1HT1E 2OCAA 4BXOA 3ANYB 1IEQA 3HCEA 2BBSA 1DRWA 1GL9B 2ZZNA 1V5IA 1W4BA 2PQ2A 4BQRA 2RIRA 1JFTA 2Q1WA 1EM6A 3ZJVA 3COPA 2XADA 3QJYA 4FR5A 1YQDA 4YLEA 2ZJ3A 5LWQA 1HY3A 4L27A 2ODBA 1FZQA 1QYDA 3CH7A 1C4WA 3NS7A 2Z9BA 3S2IA 3NVDA 5HX7A 2JFXA 4PG6A 6PFKA 1CQJB 5J3JA 4J03A 2R65A 4DGSA 4JMLA 1OLUA 3L8DA 1VGVA 2C3PA 2IEAA 2C88A 4ZC1A 3F8WA 3T9AA 3I1FA 4RM3A 4INPA 3PFNA 4EEZA 1XA4A 2UVDA 1CS0A 2C5BA 3K35A 1HKUA 4IPTA 5K8JB 4EL0A 1UDRA 5DLQC 5CA0F 3G0BA 5BOSB 1DEKA 2ZIWB 1A95A 3RU3A 4L4YA 1TF7A 3EMVA 1M2HA 3A1EA 3BGSA 3PR1A 3FOBA 2WF7A 3DE3X 4L5BA 1AKUA 1R6TA 3L4BA 4J2HA 4K5QA 3S2ZA 1DXQA 3O82A 1XPOA 1DSSG 3MZ0A 3Q7QA 4HR7A 1V1RB 1EK2A 3QP9A 5IXYA 5K5EA 4ZTUB 5JQGB 2GZDA 2EGUA 3DC7A 4G0OA 4GLLA 5CXXA 2P75A 3SP1A 3RNOA 1CQIB 3GZTB 5D87A 4BIMA 1VYUA 3CF4G 2C83A 3AXTA 2LE0A 3FMGA 3ZY4A 5CNKA 1UM9A 3LCUA 5CT9A 2O8EB 2NUTB 3TL6A 4BX3A 1NG9A 1NXPA 1XQ1A 2R11A 4IKOA 4EGQA 2WTMA 1EWVA 2XITA 721PA 5KTPA 3GLIB 1H9AA 1UWLA 2YZKA 3QYJA 5IANA 1T5SA 1E1QD 4O2BB 1YL7A 2UV8A 1QQTA 1UC8A 1XTTA 3ML1A 3NGMA 1KQOA 2CFCA 3AFGA 3GOQA 4DY6A 5BN1A 1C9KA 1EXNA 2BMAA 5JS1A 4FUQA 4R71A 3BTVA 5BT8A 4ED9A 5C7LO 3ZXYA 5CB6A 4WDQA 1C4XA 3PUHA 3OM0A 1XCGB 3QV1A 1QP7A 3VC2A 2C0PA 4B3TB 2Q0QA 4PCUA 4O4IA 4UJ3A 3ZV4A 1G55A 2CZGA 4DAOA 1AA6A 2ZBRA 2WWRA 3KJXA 1WZUA 5LCXA 3WK6A 3THWA 3FTEA 3U13A 2HMUA 4H7FA 1X7YA 2QAIA 3D6TB 3IAM6 4I8IA 2WIKA 4M7OA 4DMLA 3ZQ4A 3EVDA 5A6VA 3TFOA 5A0VA 4V38A 4RCYA 5EZYF 1TM5E 3LXXA 3VR5H 4B17A 4MJ3A 4EHIA 1ECBA 4UU1A 3L7KA 1PJ2A 2R7LA 3N8KA 3E81A 3OPYA 5CA1F 2V6JA 4OA5A 5L53A 2M6LA 5L7TA 4RPKA 1X7ZB 3SKYA 3NQ41 1TAUA 1DDGA 3QVGB 1VKJA 3HVHA 4YV2A 5KYKA 1Y7PA 4MVJI 3TJRA 1H6BA 1QIGA 1U0LA 4YI3A 3HB5X 3F6RA 1NYLA 1ONPA 2X86A 2OECA 2C57A 2XMGA 1WMDA 2F43B 1Z7BA 2PSEA 3DPUA 3IAHA 5H16A 3U48A 3FUXA 5A0FA 2HQRA 2O7NA 3E58A 3RJMA 1OXSC 4HGNA 3I72A 2V98A 4MWOA 5E38A 3VHXA 1MV5A 2MT9A 1BRTA 4RJJA 4X1IA 3A1NA 1LRJA 3T7SA 3OEEA 4ASUA 1Y63A 1C7QA 4KH0A 1YHYA 4BYGA 4EK9A 2QM7A 1VSTA 4PAGA 4WEQA 4AWBA 4BB6A 2CF5A 5TGTA 3ZI7A 1BX3A 3K05A 2P27A 1KF0A 3JR3A 1DU4A 3QWAA 4FHZA 5D6NA 5JZMA 2HI0A 2R79A 3MNFA 3QKRA 1CQZA 1EM8B 1FUYB 2C4MA 2H1WA 2IODA 3K5WA 5F1YA 3T5BA 3V6MA 1EFAA 1ISIA 1FS4A 5E8JA 1VCIA 4Q4HA 1FF9A 4UM9D 1AA9A 3W5UA 1CVRA 2Q2WA 3HS3A 5MN6A 3ZDXB 1TKRA 4DA8A 2A86A 1CCWA 3U3MA 4UREA 1CBUA 1CQPA 1E96A 4C4TA 2B8EA 3UPUA 4F5ZA 3VTFA 2QMQA 3M6MD 4EB0A 1XCPA 3KCQA 1LX6A 2BZSA 4BQNA 4JL5A 2XTMA 5T3UA 3FRJA 3UYLA 1S7GA 4AS1A 4Z4EA 5FUVA 3G8AA 3UJ9A 3U37A 1BW9A 3CH6A 3QUSA 1GEGA 2G9RA 2JIMA 4ZU6X 3NATA 1GLNA 2BEJA 2B82A 1JXQA 3R0XA 4JOBA 3Q3JB 4PZLA 2P3QA 2ZR7A 3T1VA 4EYOA 4Y2JA 4U7DA 2WG0A 4P3KA 2RI0A 4PY2A 1YBMA 3FZEA 4B45A 1IWOA 2YNMC 4R3UC 1JHAA 3TIIA 1VECA 2PSHA 3ZCVA 1OW3B 1N33B 3HA7A 4IOLA 4P9NA 4QLOA 2A57A 5CBKA 4YMVA 3DL0A 5LR6A 4P54A 3RKSA 2XIQA 4ZOCA 4C76A 1E9CA 2I99A 5IS2A 1PUXA 1M73E 1XD2B 3QRWA 4GP7A 4KBFA 1XD8A 2G08A 2CZQA 1F5SA 4FFMA 5HIJA 5KX5F 2C7RA 4JQYA 4PLCA 5JISA 1JEYB 5DBFA 4DEXA 5KYTA 4KKXB 4N5LA 3AKDA 3UQYS 4DC1A 1SH7A 4UEWA 2DCUA 4G01B 1YR7A 1NM5C 2P1ZA 4EGCB 2IKSA 3ZVKA 4EKDA 5FBHA 3A14A 1P75A 2EP7A 2ZRHA 4OBBA 3UW1A 2PU5A 3WYCA 1BMQA 2V7QA 5DYIA 3K6RA 5JVDA 3ZDBA 2PMFA 2FQ1A 1K5PA 1ODIA 3R1IA 4MXDA 3BVPA 3W78A 2BSQA 2L18A 2Q6VA 1EP2B 3KC2A 4HDNB 4ITRC 4LJYA 3WAGA 5ALYA 2CYCA 1XJ5A 4YJ3A 3PDIA 1XHEA 4G0ZA 2GA9A 1I3OA 4MW6A 1T4DA 4Q24A 3RYFA 4I0WB 1TCUA 4MA5A 3LF1A 1XT6A 5JZSA 3G0GA 2OHXA 4G0NA 1ZIDA 4AD8A 1E79D 1MN6A 4LJAA 1KZ4A 3C7DB 1OFTA 4BKMA 1H2HA 1Z4KA 2WM2A 4PPYA 6REQA 4X45A 3G5UA 3DAGA 1TTPB 3AB8A 5CAEB 3PI7A 3SC6A 4BIIA 4D02A 2GPWA 2FJPA 3FDXA 2X58A 3SZ3A 4HBGA 3P0RA 1XTRA 1WXHA 3DZ8A 2B21A 1IVYA 1VLLA 2I2WA 5DN6A 2W00A 4Z99A 1XDDA 4ZXFA 2WMDA 4JEIA 2AI2A 2XE8A 3KPUA 1GR1A 3R3ZA 4GXQA 2IWRA 1DI0A 4MTLA 4M54A 4TN1A 4IIVA 1IOZA 1GT91 2O50A 1NULA 3ESRA 5EPOA 4B3FX 4ZHQA 1PVOA 1XJCA 5BO5A 5MFZA 3PHCA 5BSGA 2G71A 3PNPA 4IEFB 2OLEA 5IYZA 4P86A 1L5YA 3P9NA 2JFGA 2VNHA 5HF9A 3E05A 2P2ZA 3FDIA 2G9VA 4TMWA 2OYSA 1Z3IX 3LE8A 4B87A 1IEVA 1MCZA 2D13A 4UHFA 2FMTA 4XOUA 2WUWE 1SKYE 2AEJA 3EVBA 3BWXA 3NH9A 3Q2OA 3FWKA 5JMOA 1M0SA 4FDMA 4DIDA 4I3HA 2HQOA 3PF8A 4X3PA 5DBHX 4LPSA 2DQZA 1E5VA 4QXQA 2NUBA 1VIMA 5BUCA 4CEJA 3H8SA 1XCJA 4BASA 2I1QA 1MJGA 5ES4B 3LY7A 4MEAA 2I4NA 2QTHA 2ZTMA 3C6BA 4ZCLA 1K86A 3ZDQA 1WBDA 1C9MA 1KDPA 2C97A 3ZU2A 8ATCA 3CVJA 1I4DD 2WIDA 1XXHE 4NCIA 2H2HA 2O2SA 3CV3A 3FVWA 1NJSA 1M2OA 2BJHA 4NBUA 1JFLA 1N5LA 2EP8A 2EW8A 2IZ1A 4JLWA 3RYHB 3TGWA 1GGVA 2QN8A 3WFZA 4UKDA 1ZCFA 2BEVA 1Q0ZA 5L3ZA 3IAEA 2YKGA 1GKIA 1NMEA 2BP7A 2OV1A 1NSYA 2LTAA 3K0BA 1YFJA 1RPNA 4B6GA 2IPNA 4KMSA 5CDHA 4BNFA 3UTDA 4DBLC 4E2ZA 1DCFA 1DQNA 3QVWA 4N5DA 3OPVA 1D0SA 2WTBA 3WL8A 3LLMA 1CZNA 1E8MA 3AWIA 4OIFA 5ALRA 1NWHA 5F7OA 1K3UB 1I1QB 3DLIA 5JXGA 4JC0A 3PXBA 3PRKE 3JTMA 1GAJA 3UNXA 1M0WA 3JW8A 13PKA 4GX1A 4KFUA 5EHZA 2Y1KA 3CLHA 2XUHA 4WXEA 6YASA 1ZCJA 1HQCA 3O84A 4TLBA 1QONA 3UA3A 1IUKA 4Q5IA 3WLIA 4D98A 3H17A 1AQ6A 4S24A 1XP8A 3T1TA 4YP0A 4LOIA 4D6PA 4AULA 1E2DA 3BMQA 5LMZA 2BR5A 3NV7A 4LGCA 3HSYA 2I3AA 5KNDA 2BH2A 1BFUA 4OHPA 1NONA 1A9ZA 2MU1A 2G25A 3B9RA 1UMCB 4RPHA 3L0PA 5TQ0B 2NZYA 5T7BA 2RK6A 3Q2IA 5K3SA 5C34B 3L8MA 5JMPA 3AHGA 1R6AA 3RV4A 1II8A 4OOEA 1N5JA 1CZLA 2XHEA 4HXGA 2KHZA 3NGLA 1Q0HA 2H63A 3KUXA 2IEGA 3U2QA 2VDKB 1P61B 4LBYA 1HE1C 4U0KA 3VMFA 1Q11A 3KJNA 2HJHA 1NP7A 2OORC 4EG4A 4IHKA 4IWYA 1Y0BA 4Z4HA 2A7XA 3ABRB 1Y6QA 1YO6A 2HF9A 3GHHA 4ZOEA 4B8ZA 1DAIA 3A1WA 5JSHA 1P9RA 2HM7A 1PGJA 2R86A 4URHA 5A6SB 2JLRA 1TYDE 3IC5A 5GJCA 1JKMA 2RC5A 2XODA 4EDHA 3E18A 2HDNB 1ULZA 3R3WA 4WLVA 4AK9A 4Z3KA 1R3UA 2QL6A 3V2GA 2ZSUA 2KE5A 4KXVA 1ONOA 2QZJA 2G1JA 2I6UA 2J9XB 3LT4A 5ALFA 4A26A 4BJ6A 4ZVSA 4EEKA 4MB2A 4YUAA 4Y3UA 4NBWA 3OTHA 2X9QA 1N2ZA 1U3VA 5BN4B 2D2IA 3C5CA 4KE8A 2PBRA 1XZDA 1WV1A 3FCSB 3Q9UA 3QYFA 7REQB 2AD5A 4LRTB 4CMEA 3Q6IA 1DLJA 3GRVA 5I4CA 1TJ4A 1XQVA 2XNDD 4J4BA 2Y0CA 3UB2A 4ETIA 3PU6A 1K88A 2ZR0A 3KFVA 2XD9A 2J4CA 4QQ8A 3QI7A 1QGOA 4Q4LA 3DUFA 2VH2A 2DTXA 2QKYA 3H42B 4O8ZA 2DT5A 4UVHA 5CB4F 1D09A 3RU9A 3N8IA 1GQYA 3LKDA 3PWTA 3C5EA 2ENUA 3N3BC 4YJKA 3RFXA 4KO3S 1REQB 3PP8A 1Z6XA 2I6SA 4CFSA 1V11A 2CV2A 4MKRA 4QBHA 4BO7A 3PGKA 3UJHA 3ROKA 1NYTA 2JZOA 1EVJA 3ANNA 2J4DA 1VE9A 2GSWA 1VPWA 1S3FA 2B2NA 2IC5A 1CDEA 4LVCA 4PLTA 2PZAA 4F06A 2W2VA 3IDSA 2WAYA 2EFYA 5HXAA 1BMDA 1QKJA 2RGNA 4EWLA 4L6CA 4MVJG 2AHOA 2ZRKA 2BEUA 4LYEA 2VSQA 2XSZA 3A4VA 4MS4A 4UD6A 3FOCA 3NNDA 4US1R 4JXZA 2I7DA 4C4ZA 4Q7EA 1K7SN 3RUEA 1GZHB 4FMPA 1Z7YA 5B37A 1E9DA 2QSJA 1M66A 1CPYA 2I33A 3TMYA 5FBVB 2GVNA 4L07A 3RUHA 4CEHB 3W3AH 1J2EA 3RQIA 2KX7A 5BR1A 1K6XA 4C5BA 3VUEA 3KHKA 2ORVA 1M0TA 1L1FA 5FBLB 2UYYA 1G5IA 3O8NA 1P3DA 1JIVA 2COEA 4W1RA 4UFPA 5HW0A 4XM2A 5A9TA 2O54A 4HX9A 5JQWA 1M7BA 10MHA 1I9CA 3W6PA 4EJ2A 2NTYC 1L4GA 4TQGA 1RPJA 1YJQA 2HJGA 4NOLA 2WY2D 2IHTA 1RYHA 4JVLA 2YXDA 4C22A 5AM3A 2OPBA 3I0ZA 2ZSFA 3ZNNA 4F04A 3TZKA 1RHQA 1V26A 2WJVA 1LDNA 1EWKA 1GWNA 2JIOA 3DW1X 1AUXA 4B3JA 3DT9A 3FHTA 1WD7A 3STUA 1HXHA 1C30B 3PQ2A 4QGHA 4DM4A 1RJEA 4D3YA 3WKAA 3DYIA 3QYAA 2KMLA 1ZN8A 4BJHB 3P4UA 4WOBA 2HTFA 1V48A 3NDPA 5LQUA 1E9AA 1CJCA 1F1JA 5B7QA 3PDUA 4LZOA 3LXMA 2XQIA 3TGLA 4IJ6A 4GP6A 2FPSA 1W19A 4D9MA 5AKLA 5JNRA 4I4NA 1MJHA 1PGNA 2HBQA 2C5EA 1TI7A 1J2YA 2Q3MA 2Z8YM 2PWAA 4KQWA 4N12A 1X7WB 2FVYA 2WUVA 4X7PA 3ZE6A 4DMUB 3LMKA 3BL8A 5HTKA 1KYXA 3WS7A 3BA1A 1IULA 3JYHA 2VHXA 3I37X 3GP8A 3TW0A 2ZIXA 3UPTA 3BREA 2GM9A 4DL9A 2NSDA 4YRZA 1J09A 2OAEA 3V4OA 3I42A 4X20B 5KOJA 3DVSX 5FUQA 3WJ1A 2NU6B 4OXIA 2YMMA 2FPMA 4YDRA 3RJ5A 4XWWA 2IH2A 3DDOA 1SG6A 4KPEC 2DUWA 5K3FA 2B4RO 1DARA 1PO7A 2JRCA 2Y6VA 1R0KA 3Q85A 1OKKA 2OXIA 3DW3X 1WO8A 4Q6BA 4NK4A 4L72A 3AEKB 2NTJA 4B8WA 4D4MA 3PPYA 1JAIA 1V8BA 1X8XA 3N28A 1NF2A 2RGYA 4QTTB 3WNZA 5DCYA 1TC1A 4PZUA 4NR0A 5IBQA 3HM9A 1H3FA 4U39A 3FNIA 2VPYA 3QEJA 2YS7A 4RXTA 4UFOA 1AIPA 1EUDB 2Y9MB 4N49A 3AC0A 4WZ6A 1ZVJA 1QE0A 1F8XA 2OCGA 3SEZA 3L7OA 2Q4TA 2VYFA 1V1MB 1EP1B 2JRLA 3RRBA 1HH4A 3KR2A 3L02A 4X90A 3CG0A 3WRYC 1CUZA 1YZFA 2R8BA 2JFHA 1L8AA 3ORRA 4J1NA 4KN6A 4QEKA 1WETA 4KSYA 2OCLA 3WP0A 2W6IA 4TQAA 5K09A 1KH1A 5JCZA 1W87A 1CU1A 1ESDA 3U3OA 3HJUA 1LNZA 3OC0A 3WHIA 4S05A 3TQHA 4Q48A 5JANA 3TPCA 2BCEA 1Q1AA 3W7VA 4E0BA 3KPWA 3UMMA 1SHTX 4KV7A 4DMGA 5IBRA 2ASEA 4JY7A 5AYVA 5BSWA 2HKIA 3LC1O 4QU9A 1UBFA 2VQ6A 1SMKA 3T95A 2XNCA 4R1LA 2XHZA 4YCMA 1Q83A 1WQ4A 3F6YA 3GELA 3R3JA 2AJ8A 3INRA 4G2NA 4V39A 1NRXA 3ETCA 3ZDDA 1E60A 4HNSA 1RC1A 5HJ2A 1OWNA 2XCRB 3B53X 1IRIA 1CE8A 1ZRNA 2WPDD 3VVMA 1TA9A 2D54A 3IR7A 2ZK7A 5A4JA 1D1TA 3IX7A 1E69A 4QPNA 2YWRA 4R69A 2QUIA 1QC5A 2DPYA 3TZQA 3ZJUA 4EHHA 3HYCA 5JDCA 2R7NA 1TEZA 2GEUA 3H5IA 4K0KB 5AK3A 1RP1A 1G8KA 2BKXA 3LHKA 1D3AA 3D2BA 3LW8A 1SUSA 4TWBA 1RT9A 4V0MA 5GV7A 1Z34A 4DR7B 4F86A 3QX8A 4RVUA 1HYQA 2PUWA 5D3QA 1RWVA 3LUGA 4KIJA 2PUGA 5BNIA 4P35A 3TTSA 3OMLA 4YO8A 3HCNA 2XUDA 4FE4A 4B4UA 1QZUA 2YDXA 2CK3A 3JQBA 2KSQA 1CC1S 2PZJA 5FD8A 2AZDA 3PD7A 1NL3A 2C2HA 4JCCA 5AKHA 3TW8A 1DT5A 1R7RA 4PIMA 3QVOA 4ZZ2A 5TY0A 1FMCA 1N1MA 5FI0B 1MO2A 2AWNA 4X6YA 1BN6A 1IIBA 4ZDIA 3CZCA 1P7WA 2IYUA 1ZJ5A 3OESA 4R4JA 4F4CA 3GMSA 3MWDA 1NUHA 2QRGA 5H68A 1V0JA 5DM0A 2OHOA 1NVTA 1GQRA 2GX6A 1RWWA 2GEJA 4HSGA 1L5LA 4ZMBA 4Z3OA 2I3GA 1OJLA 1AKVA 4MAFA 5CH5A 1TYEB 3P1JA 3Q98A 3T3GA 5KJEA 2ZEJA 1OI4A 3M1YA 3P2EA 1B2LA 2QTNA 4LHEA 4NJOA 4F45A 2L17A 5KSPA 5T64A 2XQJA 2VC2B 2VTBB 3EQ9A 4Z9FA 1XLWA 2IXAA 4P81A 1MOSA 4CKZA 2DY1A 2V4UA 1R64A 2RAPA 1T5IA 2W2NA 3H0KA 3JYLA 4X44A 3EQZA 1KDTA 5C52B 3PQFA 3FMVA 2QD5A 3SLGA 1RPZA 2IQIA 2KM1A 2C58A 1V7CA 1SCIA 1KL7A 2WSYB 1YDHA 2CE7A 3I39X 3OP4A 2W2LD 4YUVA 3TE7A 3I9JA 4C7JA 1E1RA 3CIFA 1VL2A 3W5SA 4C6TB 3LHDA 4IMRA 4V1CB 1EJ6A 3D4BA 2Q1XA 3MILA 4COOA 2GHRA 5JIBA 3UGJA 3BXFA 3SXUA 2CLLB 1PQ4A 3AILA 5KKAA 3PA6A 1JLRA 3ZD9A 2R1TB 3AM1A 4QGFA 3F2VA 1ZK4A 2VSXA 2PG3A 4UBMA 3UHAA 4F9TA 4RVOA 4PNEA 2YXPX 1G19A 1YI0A 1U2DC 3PIIA 5AM0A 3UXHA 1PYGA 4K3UA 4CQMB 1YQEA 2BISA 4PSVA 5ECDA 3HJAA 2R8EA 1PBNA 5ESWA 5TEWA 3KKKA 4FUTA 1AB5A 5CDUA 2XVXA 2J9FB 4W5HA 4Y2QA 2ZIGA 3ACCA 3J7AC 1UP7A 5IBCA 1ZL0A 2J46A 1LGYA 4CLXA 5F7XA 1D2GA 4WBXC