4UTOA

Crystal structure of pneumococcal surface antigen psaa d280n in the cd-bound, open state
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
278
structure length
278
Chain Sequence
KLKVVATNSIIADITKNIAGDKIDLHSIVPIGQDPHEYEPLPEDVKKTSEADLIFYNGINLETGGNAWFTKLVENAKKTENKDYFAVSDGVDVIYLEGQNEKGKEDPHAWLNLENGIIFAKNIAKQLSAKDPNNKEFYEKNLKEYTDKLDKLDKESKDKFNKIPAEKKLIVTSEGAFKYFSKAYGVPSAYIWEINTEEEGTPEQIKTLVEKLRQTKVPSLFVESSVDDRPMKTVSQDTNIPIYAQIFTNSIAEQGKEGDSYYSMMKYNLDKIAEGLAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dysregulation of transition metal ion homeostasis is the molecular basis for cadmium toxicity in Streptococcus pneumoniae.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Metal binding protein
molecule keywords MANGANESE ABC TRANSPORTER SUBSTRATE-BINDING LIPOPROTEIN
total genus 100
structure length 278
sequence length 278
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01297 ZnuA Zinc-uptake complex component A periplasmic
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 4utoA02
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 4utoA01
2O1EA 5GGYA 1TOAA 3BE5A 5FLYA 1KAEA 4XPIB 1PQ4A 3R5SA 4WESA 4DBLE 3MINB 2XDQB 4WESB 1FP4A 4TKUA 1N2CA 4LS3A 4PAGA 4WN9A 3TLKA 4OVKA 5BVGB 3GI1A 4G09A 4UDNA 1ESZA 1KARA 1N2ZA 4OXRA 4H59A 1MIOB 1FP4B 4HMQA 3AEUA 5I4KA 1KAHA 1QGUB 3AERA 1M34B 3AEKA 1PSZA 1M1NA 3MWFA 5CR9A 1G20A 1M1NB 1K2VN 4TKVA 5JPDA 3LI2A 1L5HA 3MINA 4UTOA 5HDQA 2Q8PA 4FKMA 4G07A 4K3VA 4HMOA 4TKUB 4WN9B 4INOA 2YNMC 1M34A 4BBPA 3AEKB 3ZK9A 3AEQB 1QH8B 4NNOA 1G20B 4CL2A 5M3BA 4INPA 1H1LA 4XPIA 1H1LB 4FNAA 4MDYA 1QH1A 1K75A 2MINB 3AETA 1K7SN 5BVGA 2MINA 4M7OA 3HH8A 4TKVB 1K0FA 1QH1B 3BE6A 3AESA 1XVLA 2OV3A 5KOHB 4FILA 2XH8A 3AETB 5GGXA 2ETVA 5KOJA 3AERB 2WHYA 3AEQA 1QH8A 4WNAB 4IRMA 2OV1A 3TEFA 3CX3A 2XQVA 5KOJB 4H0FA 4HMPA 3ZKAA 3R5TA 3HXPA 2OSVA 5BVHB 3MWGA 3PDIB 5BVHA 5M2QA 4ND8B 3AESB 5KOHA 2PHZA 5CX1A 3ZK8A 4OXQA 3NU1A 4UDOA 1N4AA 3PDIA 2OGWA 1M1YB 4WNAA 5JOQA 2AFIB 2PS9A 3LHSA 5JG7A 5M29A 2AFHA 5HX7A 1EFDN 3U7QB 2QI9F 3TNYA 4MX8A 3EIXA 4PM4A 4FI3F 4ND8A 5CX1B 4HN9A 2AFHB 4MO9A 3MFQA 3G9QA 4GICA 4N01A 2XY4A 2PS3A 3ZK7A 5KHLB 1M1YA 2R79A 3HJTA 3K1AA 4WZBB 4WZAB 3UJPA 3EIWA 4WZAA 4MLZA 5B58T 3U7QA 2YNMD 1G21A 3MD9A 2M6LA 2XDQA 2XUZA 3AEUB 3PSHA 2M6KA 3K1AB 4WZBA 1N2CB 2AFIA 2X4LA 5JJ5A 2PRSA 2R7AA 2RG7A 3PSAA 1G21B 2WI8A 1L5HB 2PS0A 5M34A 4UTPA 1MIOA 1N4DA 4LJSA 2XV1A 3ZTTA 4B8YA 5AFSA 2Q8QA 4NNPA 1QGUA
chains in the Genus database with same CATH superfamily
4TLLB 4HPJB 1ATIA 1I4OA 1TQDA 2I67A 4IICA 3S5JA 2CB0A 1QO9A 4ZO8A 3ZWVA 3UYKA 4RPKA 4DY6A 1USVA 2DVMA 2HA2A 3OT1A 2YN2A 2F3RA 4E3ZA 3GRUA 2FUG6 4RGBA 5FD8A 1TEZA 1MO3A 3KVRA 2A4MA 2PFKA 4HAUA 1ADJA 1PW5A 5T3UA 4KP7A 2G5CA 1SUDA 1KE2A 1VIAA 4YGYA 1JN0A 1SHLA 4AKHA 3R7WA 2QG4A 1J0EA 4TS3A 4F0JA 1QQBA 1XLVA 2AFHE 4YJ3B 4G4SO 5CR9A 3TWOA 3VNUA 3M3PA 1FLAA 4G25A 4Z9BA 4BC0A 3LI2A 4G0NA 4XIGS 4MJ3A 4C5BA 2YRXA 3JTMA 1BD4A 5HXAA 4KWEA 1M34A 3N2KA 2Z6AA 1YA4A 2BELA 3RJZA 3VZDA 1O0BA 1HQDA 4IY1A 5A06A 2BMJA 1T9GS 2AFVA 3T5TA 2GOYA 1NVDA 3F6CA 4O2AF 5FHRA 3UHFA 5IK2D 4DNPA 5KNDA 3R3SA 4RTNA 5BWCA 2VT2A 4PLPA 3W5JA 2ZIVB 3D5QA 3WRYA 1UC4B 3T8YA 1HX7A 1E2MA 3KKPA 3DVRX 1J0BA 5KMGB 2W6JA 1ODCA 2JLVA 2OGUA 3REOA 3FHCB 1LLCA 4GOOD 4RY9A 3TZEA 6REQB 4P81A 1PWZA 4BVLA 1LF0A 3EFEA 3IP1A 1LW7A 2XCIA 2R7NA 4NECA 1IIBA 1GAJA 2AE2A 3BXHA 4C0HA 2XVXA 1H6CA 1KRHA 1P19A 2HOQA 3GT0A 1JZTA 2OV8A 3H84A 4Q1EA 3T52A 2BZ1A 4ID9A 3D5TA 4X8MA 2C82A 3UWDA 1JAIA 1LBTA 3VAZA 3EZ6A 3W5AA 3KVNA 4G0YA 1T2DA 1CETA 3GMSA 4GMGA 1P1RA 3BIFA 2RIPA 4KYVA 4PAOA 3GHYA 1G5TA 1H85A 2XVYA 4BLTA 4EX7A 5J5VA 1TJPB 1WUKS 3UHJA 1Q84A 1XP8A 1LQUA 3EGDA 3NTLA 1GYPA 2GFQA 5KYGA 2GEDA 5EWJA 4C4YA 3WKCA 4OI2A 2ZBVA 3NUGA 1ZONA 2AH5A 2CUKA 3D4IA 3W5SA 8GPBA 1TNDA 3T9CA 2HWUA 2X41A 2YY7A 2XQGA 4WLEA 1JFSA 9ATCA 4N7MA 2WQ6A 3BHJA 4BO3A 2II6A 5CVVA 3MHTA 2BM9A 4FOOA 4LWPA 1JEYA 1VC2A 2O2YA 3V80A 2R8PA 3ZXUB 4F3CA 1Y9DA 4URUR 3IDAA 1JDZA 2EJTA 1SUPA 1DKUA 4IUBS 3QIAA 4MAMA 3VRHA 4ZYZA 5JXGA 4BVEA 3FVVA 1AK1A 5DIFA 1N6IA 2Z5FA 1KOJA 3FRIA 3HCFA 1P6XA 2WINI 3KYJB 3NWJA 4UTZA 4TN5A 5DV9A 1Q0RA 4NSNA 1H2FA 5J40A 3GLFB 1NUUA 3WJAA 2O3UA 5JAMA 4NF2A 2PY6A 4EPVA 4U7HA 2PRZA 2QAJA 2R4QA 4XGNA 3B3GA 4W8OA 3NX4A 4PXSA 2CL0X 3D4PA 3HUUA 5BQPA 4HEHA 4YNBA 4BZXA 4F60A 2O2ZA 1ORIA 3PC3A 4PSAA 1AK2A 1TF2A 1QRUA 1JJVA 2HAEA 2WAMA 3DDUA 2X5OA 3MTIA 3L0DA 4DCJA 4RJTA 1EINA 2ASVA 3W8FA 4FX5A 1RZUA 2OBXA 2XT9A 3ZJTA 5K20A 1E6LA 4CMGA 3ODGA 2P6NA 4CEHA 4Y2TA 1V16A 5LYJA 2H07A 2HI0A 3NFRA 4FJ1A 1V5GA 1NM5C 2ECQA 5COQA 3J7TA 4UEWA 3CZPA 3SSMA 3C3WA 1N6HA 2QM7A 3HGMA 1NRXA 3GLFA 1RSZA 3L8YA 4AQYB 1MOSA 4L9SA 5K5EA 1BCRB 1Z12A 4D81A 3EEBA 5JH7A 2NP6A 1FPMA 1P5RA 1I4EB 3H83A 3OLZA 4TM7A 3FSRA 1OWLA 1POWA 2GD6A 4V1CA 1NXSA 3QMVA 1WZNA 3UF0A 5EHZA 1WXDA 2EHDA 2XB6A 1QNFA 1KXZA 4K1XA 1EVQA 4Q3OA 4QEDA 4RVGA 1QVVA 1WPRA 2ZRAA 3P9KA 2JI9A 1SVOA 1HDEA 3IVXA 4HGRA 5HKAA 4D9NA 5IKXA 5A3SA 3S7TA 1MB2A 1X9HA 4MYRA 5KX5A 1HDYA 2OC9A 1E9SA 2PD3A 1NN1A 3C85A 3IVGA 2G71A 3KQLA 2RK6A 2XMZA 2PO5A 2B20A 4AKIA 4QGGA 3UW1A 4JR1A 3L0CA 3T5DA 2ECFA 3C39A 2CVOA 5LYYA 3RU9A 4YQZA 2A78A 3E9RA 3ZTWA 3LPNA 5IBRA 2FRVA 3RIMA 1T1JA 3A4LA 3ZJ5A 3NUQA 1NVTA 3Q3CA 2XTMA 2GZDA 3AR3A 1L4UA 2GAFA 4FWTA 2JH9A 1YT5A 3RS2A 5E4FA 1JDJA 2H6EA 1PR4A 1UKYA 3P7MA 4KPYA 4WW0A 4I46A 3I0ZA 5FOVA 2G70A 1UDCA 2JI6A 3ZZMA 1VJTA 4KPUB 4BFCA 1ZIPA 4GECA 3PHIA 5DRTA 1CV2A 3B2QA 4D3FA 2DYKA 2GWHA 5J4HA 2C31A 4F3RA 5MN5A 2LCIA 4HK4A 1OE0A 2OD2A 4YROA 2R4TA 3W4KA 2C7OA 4DS3A 5TPZD 2XMCA 6ABPA 3CHYA 1TMOA 2R6DA 4BO0A 3NRCA 1OIVA 1O5TA 2Y0PA 1QH9A 2Y71A 4GI1A 1C1DA 2EEZA 4HTFA 2QY6A 3S27A 4QTXA 1GPNA 2NU8B 1YS2X 4RDIA 5HP4A 1JIKA 2W6QA 1IM2A 1JILA 1WDMA 4P7GA 3HCCA 1XKQA 3MBOA 4R51A 1IEXA 5EP4A 4L5BA 3UJ7A 3HGTA 3PCRB 2NSHA 1YZ3A 5SY9A 5KQSA 3SVZA 3SYNA 2A84A 2XWPA 3D02A 1DWPA 5JD5A 4FZRA 4F8YA 3IUMA 4A73A 2QD5A 2XE4A 1WETA 2QI9F 4Y7CA 1ACJA 5CDHA 3NVKI 3HN7A 1RKQA 4K0RA 2C9ZA 1B3RA 2F8MA 2NV6A 2QP4A 3CE6A 3F2IA 3PFGA 4PM4A 5C31A 3R7BA 3OKPA 2O8EA 1E0SA 1XLTA 2OFOA 4KAFA 1EDBA 2H4XA 5FUQA 4MVJA 1TAGA 1I2AA 4HEA1 1P6QA 3G8CA 2A5JA 3SDSA 4BMVA 3KQOA 4LSMA 5CVTA 3EARA 5BWNA 3IOMA 1TQ2A 1FQKA 4PBRA 4QJ3A 3O83A 4EJ6A 1QYIA 1CJSA 4MUJA 1JFVA 1PV1A 2XLCA 4NK5A 3MJVA 4GBMA 1CS0B 4JWKA 3UGKA 2XYHA 3VVCA 1N5RA 4RTRA 1L4HA 3RK1A 3CY6A 4DN6A 1TLTA 2PX3A 2Q3MA 1L5FA 3JCZA 2WUVA 3O8QA 4GX5A 3WDMA 2G9UA 3GGSA 3P9NA 5CD1A 1CCWA 1G4HA 1GPYA 3H4TA 4MCJA 1CQJA 1G9TA 1HMYA 3M6XA 4H31A 4RYDA 4X6YA 4EFMA 1SVUA 4RCVA 1U80A 2IPAB 1AUOA 4DBLE 5ICFA 4BFXA 2Y9PB 3LGSA 3WGKA 2YL2A 2GN0A 2PGNA 3NDRA 2Y1KA 2EF0A 1VFPA 3WMWA 3D6JA 3RVPA 3CZMA 1U4OA 3NHJA 4KWIA 1SBZA 2C96A 1UM9B 1LI5A 3WIVA 2VO1A 2NTEA 4RNCA 1NG1A 5IN5A 2Q7OE 4ZYVA 4ETMA 4BKPA 5HUQA 1NFQA 1NVXQ 4ZREA 3T4EA 1ID8A 2O6HA 3ZU5A 5BSFA 5IJ9B 5D01A 5ANRB 4NAVA 1IBKB 5AOBA 1I7LA 1XAIA 2GF0A 2H18A 4J1QA 4ZIRA 4UBIA 1RWQA 1KI3A 5HGXA 1V1MA 3D8TA 3EXHC 5EQFA 3WL3A 5JPCA 4BO1A 5CGZA 4RUKA 4DEXA 1WA5A 3UV6A 2NZJA 3LC7O 1U6JA 1ONNA 4WK2B 1EKXA 1VBFA 3RGWS 3E9DA 3T38A 5IC4A 2NVWA 2PMBA 2X9NA 4M9XA 4YP5A 1VYVA 4EB8A 1MVOA 3C8HA 4YY3B 3Q0TA 1MQSA 1TKBA 3HH8A 4GP6A 2PH3A 1U5AA 2FR0A 4HXFB 2J32A 1FS4A 1JPNA 1KK3A 2X9GA 1B2LA 2XX3A 4WFIA 2JHAA 2GPWA 4GKBA 4YRRA 1BXGA 1OLSA 1RVV1 1L1FA 3RTBA 1UXOA 2E2WA 3ESZA 5B1EA 1RWMA 5AR1A 2P4SA 3ZJVA 2XA2A 4PLTA 1IXSB 4FDLA 3UAWA 4P3OA 5K8CA 4BNNA 4D4JA 2RAVA 1NVUQ 1TAQA 2Y1CA 1R5OA 4WLUA 5D87A 1EA5A 4WOJA 2JCSA 4C4RA 2OPHA 2JJ8A 2C5AA 2NSLA 1SUEA 3G2PA 2NSJA 5A4DA 1XTUA 5E6SA 2XQKA 1Z6GA 1A4XA 1PL0A 3L0PA 5ITZA 1XMJA 2FPPB 2AN5A 2I8CA 3O26A 4KXNA 4WVLA 3KTAA 1GY8A 1U3VA 2XF2A 2HPAA 1G18A 2OWEA 4B74A 4AG5A 2PMFA 1O9GA 1TUIA 3IOEA 3B1JA 2BDEA 1EAYA 2VXOA 2H9AA 3PRJA 4GX1A 2IZ5A 2ONKA 4LJ4A 2DOKA 1LCIA 1Y9JA 2QY9A 3KYCB 2R60A 1MEEA 3KNZA 4LOHA 2A7QA 4Q16A 3P2YA 4UHEA 3RYTC 4EW2A 2W2XA 1ZD1A 2Q1UA 1ICIA 1IJEA 2V7GA 4YAEA 5MDHA 2ZAMA 4G63A 3MIZA 2QDKA 3FFXA 2GO7A 3FNIA 3W4IA 3GLGA 1B1AA 5K4HA 3LYLA 4IHJF 1L4BA 3MYRA 2GO1A 5CNJA 3Q8KA 3NHSA 3UKOA 4TOIA 1CHDA 1DBRA 3LW7A 4MV5A 4ZJYA 2UVDA 4MKGA 2ACVA 5SICE 4MLZA 4CUKA 5CJ2A 4E22A 3HR8A 5DCLA 2Q0XA 1AZWA 4YT2A 3C87A 1PJCA 1ZMOA 2X4DA 3TLMA 4J0FA 4OQDA 2P4UA 5I8WA 5ALTA 4C4PA 5DJ5A 1O6CA 2XA9A 1XCBA 4AN1A 1EM8B 4UTPA 1OXVA 4LJSA 1NF2A 5CA0A 1MHTA 3VZPA 3PNPA 4IFBA 3NHKA 3Q98A 2DWPA 5LMNB 4ZQEA 4QHSA 4N0PA 5JVDB 1T1EA 3DLPX 2O8CA 4YJ3A 2AEEA 1MUUA 4Q9AA 1UIMA 5JC8A 1AB5A 1FE8A 4XOUA 1ONPA 1Y5LA 4IG4A 5E6UA 2MSCB 2O9JA 3NHZA 3OFVA 3RSCA 3D2CA 3UJ9A 4HVCA 4K0KB 4AKGA 3WMEA 4FOTA 4J29A 4CDNA 1WY7A 2VDOB 4CKCA 3OQNA 4AUEA 2ECPA 3H5RA 1KAMA 4JLNA 2J85A 5LA6F 1Z5WA 3F74A 1CULC 1OZGA 1ZUWA 3HNOA 1JDSA 1NONA 1UK7A 1SRRA 1P61B 1UP7A 4Y2YA 2ZJ7A 3JV7A 3JVVA 3PPYA 1YOVB 4UUOA 4BXOB 5MHTA 3LGAA 1MX9A 2PLFA 5BNZA 2EEPA 1UZUA 3EISA 1OXTA 3M89A 3P9SA 1WO8A 4O6VA 1T3HA 4INOA 4ZARA 4ZJPA 1LLQA 2X2FA 4XARA 4EHIA 3CUWA 2DFVA 4KTTE 1T5BA 2OKCA 1U2QA 4XFJA 4OJKA 3PQDA 5FBQB 1IDN1 4CLXA 1T6NA 3VYSB 2ZZKA 1ZVQA 1KAQA 2DWUA 4LGVA 1ISJA 5KS2A 3I42A 3MUNA 3CH7A 4F71A 2J6CA 3SS8A 4KNWA 3NVMB 1P0PA 3PIRA 3OP1A 4W1PA 3URMA 1CUUA 4CR8A 4D0RA 1KYQA 2CYBA 3E48A 4IG9A 1W4RA 3A0RB 4WZAE 1WOYA 3ZS9A 3FSEA 5IAJA 1LK0A 5SY6A 3TIFA 2KHZA 4RHXA 3BGOS 3JR3A 1XXLA 4R1NA 2HT6A 2D8AA 3A9VA 5TR9A 1AO3A 2Q3DA 4X85A 1ZLXA 3OQPA 1IBSA 1L1RA 2YJTD 2DFTA 2H2WA 4U7PB 3TSZA 1QS0A 3M70A 3F5MA 4AG6A 2QAGA 4ESOA 4OLJA 4DV1B 4JI0B 4J43A 4URZR 3ZVRA 3D6NB 3DE7X 3VHXB 5AI4A 3UWOA 3I73A 1HZJA 3LD9A 2C5LA 4M37A 4P7JA 1HG1A 2KB0A 4LAFA 3A9WA 3AKZA 3O8OA 2QTGA 4IBOA 1TYBE 3ZIUA 4XYMA 2QN1A 2ZVQX 3RS9A 4G9BA 2ZTVA 4U3JB 3DC7A 4E7PA 4N41A 1C8KA 1F60A 4WLNA 2DAPA 4M38A 3GPCA 4XD7A 5BSVA 3F6YA 5TJ9A 3A9SA 3IRVA 5JY6A 2VSYA 1M1YE 1NXQA 4H6VA 4KUGA 3BAZA 4GMXA 4RMHA 1Z5UA 3KYCA 2H1LA 4YPOA 3WSTA 3GUUA 4ZMRA 3MLBA 4JLVA 4MO9A 4AZ0A 1HE3A 2F90A 3B9QA 2VUTA 4FK8A 1EFLA 3V2UA 4MINA 2B61A 3D2AA 3EDCA 1I3MA 1L6IA 4I5FA 4MW5A 3V55A 2AC7A 1QV6A 1S8FA 2EFJA 2IYFA 1AUPA 1MO5A 3FGZA 4IP0A 4TM8A 1MN6A 2D5BA 1IZ0A 4BRZA 1G8HA 3SIRA 3M6IA 4JWTA 3L0SA 3CH5A 1VA5A 1UWKA 2IYQA 5B1IA 1EVIA 5EXSA 2BEVB 4KIUA 3ZS8A 1E9AA 2AFIA 2W7TA 4UCQA 1NUHA 3CNQS 3E7DA 1U0NA 2QL6A 4MPJA 1FJ2A 3GN1A 4ZCRA 4ESHA 1WQ3A 2GCIA 3OURA 4WCFB 5DLQC 5JH7B 2YIJA 1NY5A 3QEMB 1T0PA 3OI7A 2GZ3A 2Q4BA 1N2EA 2E5WA 1W5SA 2Q5IA 2QRJA 3R8XA 3W2FA 1JR3A 1W6RA 2GLUA 3W6UA 3KKKA 2CWDA 4NAHA 3BJMA 4CW7A 4D8YA 4MQ4A 5YASA 4JYZA 4HJXA 4KREA 1I2MA 2HX1A 1K9VF 5KX5B 5E8JA 3ZJUA 4JQOA 4DJ5X 2J3JA 1AXGA 3FPJA 4DMGA 5DNCA 1L1EA 2QPAA 4O2BA 1IUPA 1HE5A 3QVJA 4H7EA 4L27A 4HLDA 1M73E 2E9SA 5TDHA 3GJTA 3C6QA 5KKCA 2ERYA 1DC3A 1Y3DE 3F9IA 3WOVA 4MW2A 4IWNA 4K9SA 3X1WA 4F1WA 5IT0A 2IEZA 1CUJA 4A23A 3Q7PA 3IIIA 3L9WA 3IBFA 1E98A 4CF4A 3LVQE 1L5HA 1XHFA 2R5FA 4UMVA 1MG5A 1J25A 5L3SA 1X19A 2WWIA 1HGXA 4JMPA 4JODA 3TTYA 1NF9A 2IC5A 2YKGA 3OJCA 3KQPA 4H9GA 1CIJA 4INPA 1C14A 1F9EA 3U4QA 2CE2X 4F38A 3T5PA 1IJBA 3CZ9A 1MCZA 1Z7YA 1TEXA 2ZI5A 2JAWA 4WQMA 1KK2A 2BHRA 1KJ9A 3ICCA 4L4YA 4NDZA 1DDOA 1QH1B 5EUCA 4J16A 4UHBA 4JI1B 3REQB 1WSDA 2CNNA 2QGZA 4Z53A 5HHTA 4ZA2A 3HSKA 3V48A 4KE9A 5EJFA 3P9YA 5DNWA 1SZJG 1YVPA 3EYWA 2ZI3A 2H2IA 3L06A 2CBGA 1WVGA 2BGJA 3EVCA 4IRMA 1SC4A 1ENYA 2BN4A 4QJ5A 4W9NC 1PR3A 3TEFA 4YAJA 2YBEA 1IB0A 1L5ZA 1Q1EA 2P3OA 3HVIA 4B3HA 4CKXA 5DYWA 2A14A 3D0RA 5ALEA 4EP1A 3KQSA 1WSWA 4MRAA 3ZY5A 4B6SA 3K94A 4L4UA 1QZXA 1WHTB 1USIA 2DFNA 1OBFO 2W6IA 3DHEA 4BV3A 4D92A 1K7FB 2FZKA 5M2QA 1BJRE 4WXPA 2IXFA 5EQTA 1MFPA 3HP7A 1R0KA 4FHEA 1YIOA 2AJBA 3HV0A 4Y6SA 1XTVA 4YCDA 3HWWA 2ZLBA 2X9QA 3QLUA 2G8NA 1DP4A 3CXUA 4L8VA 3WRXA 2VPTA 4HI0E 3RU3A 2DB3A 1CY8A 1T10A 3BMNA 3GEIA 3OMLA 3RWBA 5DGCA 5DTEA 5HX7A 1JNXX 3GAFA 4WLOA 3TRFA 1EHIA 1QF7A 2JHCA 2IXEA 2ZT7A 3QLEA 1KPGA 2X1LA 3BIOA 2XVZA 3B13B 3GRKA 3IDSA 3HJNA 2RJ3A 3CF0A 3CZAA 3ENNA 3HU5A 5EMJA 1D04A 2N9UA 2E4WA 3N6XA 3VNSA 4MMZB 5JRDS 3QOWA 4O4IB 3B60A 5H02A 4DC1A 2PQMA 2HBYA 4UM9B 3U4IA 4ZO9A 4MUHA 4AKEA 1VCMA 3TLGA 3A6FA 2CNBA 1QQ5A 2CVZA 2XB4A 4JHLA 4I1RA 3B6EA 3SC2B 4KXMA 4EPYA 1YC2A 2YNMD 2H00A 3S44A 2FMKA 4BFWA 2OB1A 4C88A 2QRQA 4EIWA 2HR1A 2E4YA 2BEKA 3NYIA 1KOLA 3F6RA 3DEZA 2TMKA 5FOTA 5BRNA 1JTEA 4M6WA 5FWXB 4PHCA 5K3DA 3GN2A 3ADCA 3AIKA 3SXUB 4YT5A 4UAVA 2QPOA 3ZI0A 2ZSHA 1KVUA 4KR9A 3BA1A 4B4WA 3BDAA 3VGPA 3TVTA 3MCTA 2DLCX 2WA2A 3O91A 2G9QA 4AB1A 5BRAA 3ZCUA 1ZD5A 1F12A 1MW9X 1GKIA 3DMGA 1LVUA 1L5MA 1V5FA 1J0CA 1IAQA 2JZOA 4OF4A 4H4CA 2LCQA 1HSZA 3CEAA 2WJGA 3PNMA 3UMCA 3UTDA 2I4OA 1GRCA 4BUJA 1FBTA 1JU4A 1E3LA 1VP3A 2P40A 4R2IA 1EDZA 4BMSA 5K0FA 3AR9A 3CWZA 3HCRA 1CDZA 2O1WA 3TUZC 5JNLA 4IX1A 5C7YA 2NU7A 1U63A 3VFDA 2HW8A 4L73A 3V8RA 4DCOA 1YKFA 3E5HA 5ETJA 2AI3A 3G0IA 1GPJA 1AH2A 1K6IA 4IH9A 4KQHA 5T4FA 4BAUA 3M4YA 3OEWA 1IUNA 4ASUD 2B9EA 2DFDA 2H65A 1DHRA 4X61A 4B3MB 2JKZA 4G23A 2EKBA 1IB6A 1R10A 3DHVA 1UAGA 2ATXA 3NOOA 3PLNA 4HLUA 4I1YA 3KQNA 4KXXA 1NE2A 1QGOA 4HX5A 4IW3B 5B2ZA 4LZNA 2AW3A 3AOEA 1GO2A 3PFWO 4WK0B 3E1SA 2P6PA 4NOMA 2ZYHA 2YV2A 5BQXA 2YWXA 3L7YA 3U3JA 3TRJA 6AT1A 1ZEMA 5KVVA 2OMKA 2QRHA 3NNDA 1ZH8A 3EVAA 1C4OA 2DHEA 2DT5A 1EXWA 1SVKA 4FNMA 4XWTA 2D2FA 3RS7A 2IOHA 3FOEC 3ESRA 4I19A 4QDTA 5FP0A 4Z3KA 4ZVUA 1HEUA 1YR7A 2WIGA 3AEQA 3O9ZA 4OSEA 5EYPB 1CUWA 2JH8A 2W2OA 1FNCA 4B6JA 4D8WA 4WNAB 3QU9A 3M4ZA 1SUFA 4N5MA 5BWBA 1ZO8A 3KAKA 5JEEA 1EYZA 2XGMA 5CG2A 5F64A 5HF9A 3AF4A 2B78A 3KL2A 4D4LA 4YV1A 3QXCA 4EW6A 3EIQA 1Y8CA 4C5AA 1D2HA 3X1MA 2VZ9A 5BPFA 4L51A 4HOYA 1T36A 2DRIA 2QM8A 2WT8A 4BVHA 3ND8A 3IUQA 4BQQA 3L6RA 1C3JA 4IUYA 4MICA 2PMEA 4BMYA 2IY9A 5FLKA 2EFDB 4BMZA 1B74A 1J0AA 2X23A 2JAOA 2Z08A 2IDZA 3PQ3A 3WYNA 4JB8A 1FDUA 4P33A 5EP3A 4GZ6A 3BCUA 4QU0A 3VU9B 5B4UA 3RS0A 3TPZA 1ZOLA 1C9DB 2CJFA 2VYFA 4YJFB 1GDHA 1K4YA 2PK3A 1UXGA 4YASA 5DHQA 3ZHTA 4CIXA 1FTQA 2QBYB 3V2HA 1GRRA 3EJ6A 4XJTA 1H94A 5DHUA 4GOXA 4OM8A 2WEKA 1OLUA 4N82A 5IYZA 3OJOA 3OX4A 1KEZA 3RGGA 8ABPA 2CF5A 4PGMA 3QE9Y 4GICA 4XJXA 4YRZA 3N75A 3JATA 1E8MA 2PS3A 2JIDA 3L43A 3AONB 4Q6BA 1U5BA 2GXQA 2FY8A 2WHPB 1I4WA 3EG9B 2F2TA 3MHPA 1ULUA 4RLQA 4Z9FA 2OYRA 3E9MA 1NFFA 5DRYA 4CF7A 4KH1A 4I1PA 4QX6A 4AO6A 5BOSB 3ROEA 2Y0DA 4R05A 2CDAA 3DE4X 1NMYA 1NC1A 2XB9A 3BKXA 4U9IS 3T9DA 1YU6A 2HIAA 1W8DA 2Q3EA 3PR3A 1M2WA 5AJZA 1YC5A 4C08A 2XYPA 5TGDA 3UWPA 1OYOA 3ZY6A 4BC1A 1ISMA 4YMLA 5LXTB 2G0TA 5L8VA 1JKJB 1ILWA 1SELA 2Z2XA 2IY8A 2E0IA 2XUPA 3FMOB 4JBGA 5CT6A 5TSDA 5HZGA 3B7GA 1I24A 4LJYA 3BJEA 5IJAA 1UCFA 3MTAA 1FJGB 3U37A 5IYZF 3PE6A 4K7JA 1FP4A 1Z8FA 4C0JA 1CK4A 3EK2A 3JVDA 4DARA 1ZJJA 3BMCA 3THXB 3GJ3A 3LOQA 3QKSB 3ABRB 5JLAA 1EWTA 5B58C 5IDXA 4BO7A 1RCTE 3Q5DA 1IHOA 2PXHA 3A26A 3AVYA 2WFMA 4F04A 1BS1A 3OTGA 1IPHA 4LFAB 1HYBA 4RD6A 3JZDA 3I6YA 1BDHA 2A8YA 3EGEA 1F06A 4GI2A 1QGED 3CLUD 3HYNA 4W9RA 2CYAA 4QHYA 1YUNA 3SE7A 2YJ3A 1QE3A 2PKEA 3H8SA 4HTAA 1TYZA 4JVNA 1QHHB 2C4WA 4H4DA 2XUFA 3DCYA 1LEHA 1AN0A 1WX1A 4WUTA 1WJGA 5C4IA 5L3SB 4IVRA 5JXWA 2AKYA 1YBMA 3GLQA 3GARA 3GJ5A 3IP6A 2OZLB 1KSHA 4JNKA 3V4SA 3THXA 1UAAA 4F5WA 5AKXA 2K4MA 2PJUA 4HEA6 1O9BA 5C0OE 2IIVA 3DOFA 4OHKA 3I1JA 2VQ6A 3FAKA 5IHPA 4RY0A 6LDHA 2P2LA 3ROPA 1N6PA 3MJFA 4D8VA 5KOJA 4I9NA 1I7PA 1YZLA 3H5LA 3H11B 1T0UA 2FMXA 1KI9A 2P90A 2IWHA 4Y1EA 2OAGA 2VCHA 3UAXA 2H11A 1H2YA 2BCEA 3C1AA 3LBNA 3R0IA 4IGIA 2PWAA 1ENZA 3KU4A 2OXEA 3LH5A 2H0QA 4PO9A 2A33A 5DN6A 4CV1A 4E5KA 4F4IA 3R5TA 2HF2A 5LNK1 3FZYA 1ZRHA 3M6VA 4NZMA 1HE4A 2PSSA 4GDMA 4IOJA 1KI6A 2JA1A 2QX6A 2ZB7A 4KYIB 1RRFA 2JFUA 4JV5B 2WUGA 1TD1A 1DPGA 3HBFA 5AXCA 4BKUA 1I3CA 1ZR2A 3O94A 1G8FA 3T4PA 8MHTA 1Z2EA 3AFHA 3C16C 2P6RA 4AJ2A 3ZWBA 5ALKA 2NYAA 1TCUA 1QQ7A 4YFYA 5CFNA 4JYMA 3WVNA 2WJZB 4DLSA 2DKNA 3TDNA 1XNHA 3WHIA 5KQRA 2G88A 1EM6A 1ZX1A 4HWGA 4Q15A 5DWQA 4RF5A 1GVNB 4ISCA 3PPVA 5TEWA 1Z6ZA 2WD7A 4DIUA 2WUEA 3Q6NA 2PTHA 1U9ZA 4TTPA 3OZRA 2AF3C 1V1JA 4PZLA 5DB4A 4O02B 1X2EA 5CEFA 2IP2A 1U2RA 1T5OA 5TE9A 2BLLA 1NV9A 3JATB 2CL7X 5HOEA 3CUUA 1Z6PA 1NI4A 4MDHA 2IYSA 3LVBA 1PJRA 1GGKA 4AULA 1NULA 2MSKA 5E95A 2XMSA 2CLIB 1KPIA 4QIHA 2Q4RA 2XYVA 3PYLA 1XTJA 3NAMA 4ZHSA 2FUG1 3ESBA 4Y6QA 1V48A 1XDDA 3KHUA 4REOA 3F3MA 5CXQA 1HM5A 4P5PA 5A3JA 2EFYA 1GKKA 2GK4A 4D97A 2H4JA 3M0EA 1P60A 4CM7A 5DNUA 3DOCA 3OZTA 1O97D 5IKPA 4JYPA 4C7OA 1XQ9A 5COAA 3OBIA 3V1TC 3FUUA 3ZH9B 2IEDA 3BVPA 3MTGA 4HC4A 2PJZA 4DXDA 5JATA 2A86A 1G4UR 3Q15C 4CTOA 4Q93A 3U09A 5B3AA 3T7CA 4B5LA 4LYFA 1XDWA 2CXHA 3DVAA 1HETA 3IJEB 2DZDA 4RHCA 2H29A 2O5RA 1O3YA 2Q3BA 5EZ5A 4B9EA 5EINA 2B98A 1KQGA 4U2FA 3WJ1A 1NW8A 1AKMA 2VHYA 4YPVA 4DV6B 4DLVA 1KJQA 5KC9A 1IBLB 3MA0A 3E3OA 1XG5A 3HS3A 1N7JA 2ZAYA 3W0LB 2Y1FA 2GZHA 3M3HA 2OFPA 4B71A 4QT0A 3OCYA 2BEWB 3N1UA 4IKOA 5JZ9A 1HNZB 1ZAYA 3WRVA 3WGZA 4FDMA 4DIMA 2Y66A 2J9ZB 3N2YA 1ULBA 3TX6A 3GNLA 3N07A 1IOLA 1J21A 3OT5A 5EJ4A 1MO6A 1H23A 4R9VA 2R7KA 4QDZA 2JB9A 4X1IA 5EMKA 1CDOA 3H1BA 2CLSA 2O14A 5GONF 1GQSA 2B5OA 1MZVA 1T9DA 3DFUA 2GHIA 2O2CA 3ABSB 4Q12A 5ALJA 5GGXA 1U2TA 3ZCRA 3JQ7B 4KQCA 4LKOA 4B4DA 4IDFA 1WAMA 3TSAA 2JLWA 1RAEA 1KQOA 2VNIA 2XF8A 2QTZA 2PR2A 3GD5A 2ZJ8A 3G8BA 4ZOLF 4ZEOA 1O6BA 3DDHA 4M0MA 2R87A 4KKXB 3JTEA 3V1YA 4M98A 3VBEA 1PDWA 1ISGA 1VPEA 1WMSA 5FH9A 1E5TA 3D8NA 4L4ZA 1UMDA 3EULA 4NFLA 4QYWA 1M2KA 3T3MB 2J9YB 4DC0A 1VGVA 3B78A 4DLYA 3G5MA 2NAPA 4Q6WA 4UDOA 3MTDA 4YDRA 3UB2A 4JASB 2FG5A 1X1SA 2I71A 1YDMA 3RSQA 5KQMA 5CT4A 2R6GA 5CCDA 1BE6A 1YL6A 3HO1A 1EVLA 4IMRA 4DDWA 4DB2A 4YA6A 1I80A 3CTPA 4ZT3A 3V9PA 1K08A 1E2NA 1VJDA 3ENKA 5B53A 3PFFA 3EZ7A 4ZQCB 1R9NA 4N1AA 2RBGA 5EQDA 5CEEA 2DQYA 2CXOA 2V03A 1SVNA 5E6SB 1GN8A 1ZVMA 2WRZA 3SJBA 4X92A 3UENA 1OVGA 1V4NA 3WDSA 1NDQA 3ETCA 3C7AA 2WB4A 3GLIB 2WYOA 3ENWA 3STUA 1THGA 4KFSA 3EA0A 3UIEA 4QOFA 3QV1A 1RCUA 3I2HA 1E5VA 1BFUA 4DZTA 4MIEA 5K0BA 3NCHA 3U7QA 1PJBA 1K7CA 1MFZA 2DULA 1XTPA 3ZQKA 4TMVA 4F6LA 3R6TA 1N2CB 4I1SA 3BWDD 2J3EA 5E2IA 3SG0A 5LKRA 1QZUA 2PKWA 1KE1A 4FMDB 3K6SA 1Z3CA 3KJXA 1L3CA 3OA2A 4PLHA 5BOSA 2M1ZA 2OBNA 2DC1A 2W2MA 3C4JA 3ZC3A 5EXDA 5KVAA 1EX6A 4M9CA 4OKNA 3H4MA 4JEHA 1U9IA 1PK8A 3G0DA 3Q8XB 2PT7A 5JSFA 2ZUVA 4JX9A 3FE2A 1GTRA 1Y81A 2HO4A 4E11A 5D6OA 1RYMA 4LC9A 4M54A 4IDEA 1WUYA 1Z9BA 3O1HB 1U8FO 2FPXA 3L8ZA 2GAJA 4GG1A 1W44A 1ELOA 1CP3A 1ODIA 3I9MA 3M4XA 1M74A 3OOJA 4PO8A 4E12A 5B55A 2HBQA 1H8ED 3DMRA 4OXRA 4MYHA 2HGZA 3SFZA 4C6TB 5IJ9A 5H4GA 5KTMA 3I23A 4Q4HB 3C5CA 5EERA 5G1NA 1JHMA 4W9NA 1ISPA 3VR1A 2FZGA 3QKSA 2NZVG 2G36A 3BQMB 3VPDA 1F7UA 4LDPA 3V33A 3HP4A 3UG6A 2Q5JA 2QHXA 4FYHA 5LP6F 4J1TA 5HTOA 4QYSA 2D5AA 2F4VB 2QVZX 2VT6A 4LIPD 5ICGA 3FY4A 4JYAB 2FGKA 2PQ2A 1A4IA 3HWRA 4JIMA 1IG0A 2BR4A 3DNFA 1DO0A 2OVFA 2IYEA 3Q7EA 3QMMA 4CGYA 4EG3A 1LRJA 4MS1B 1UC5B 1RVDA 3JQFC 3Q3JB 4M89A 3Q12A 4O8CA 3LYHA 4YFVA 2AJTA 1S89A 3KELA 5CDFA 4CMBA 2YVAA 5G53C 3C5WP 3GBPA 4CIVA 2AJCA 4KIFA 1AHPA 4AUMA 1GTSA 3V8MA 4EG8A 1YQUA 2QSZA 3NHMA 4OB8A 4JY7A 4PZ9A 2XCSB 3OE4A 4DMUB 2GZRA 1KDPA 3EXFB 3IELA 3N0WA 3VH1A 1I3KA 5E9JA 5DX8A 1EI9A 3I61A 3PUKA 1VE7A 2AX4A 4BVGA 3FPLA 1QFXA 3VC1A 2ZK7A 4WKGA 4DSNA 1SB9A 2BR3A 4A0RA 1AA9A 3U7RA 1IU9A 2X5XA 4B6QA 4BQIA 3DFMA 1XF1A 4FI3C 4WY5A 4DEVA 3CO5A 1ZJZA 2YMMA 1P5ZB 3FDIA 2DP4E 2HSEA 4I6JA 4V0RA 3EPHA 3K92A 2BKEA 2GHTA 4LDNA 1VMAA 3IHTA 4OJNA 4BB5A 1RAIA 4PE5B 1DEAA 1G5RA 2JCBA 3GLTA 1ZBDA 1C3VA 3OUUA 2WM3A 1ABEA 2AR9A 3KFVA 3U1TA 1DCTA 1FSGA 4OJQA 3KJNA 3K1YA 3E15A 1E2QA 1QZ3A 1P73A 2GXAA 4QNRA 3AC0A 1T5DX 3O2NA 2YRWA 2V0GA 2WM9B 3HJBA 4ITUA 5HW0A 2IBTA 2CFRA 2DY0A 4RK1A 4A27A 3L1JA 4BNWA 1YONA 3GEGA 1SEPA 4QXOA 4J0JA 2Y92A 2ISSD 4NESA 3K31A 4ZV4A 4YLYA 2P9HA 4R68A 4D44A 2A3NA 3TECE 2QTHA 5IT9A 4I99A 3EZXA 1WXGA 3L6DA 3LX5A 1P44A 3KWJA 4M1MA 2WWGA 1XWWA 4QQKA 1XVTA 5I9SA 1HTTA 1W47A 3ACBA 4HWPA 5AI6A 4DA9A 5L53A 3LUAA 4H08A 2W83A 2YZGA 1E3WB 4AS2A 5I7VA 4DILA 2QR3A 1IBRA 1RJWA 1S2GA 3CUVA 3EAGA 1NZJA 2CFOA 5IK2A 1F8GA 4BEVA 621PA 2XSZA 2EL7A 1JQDA 4IFIA 5KNDH 3ZLTA 1R66A 1UKZA 1FJHA 3OT1B 3RDPA 1M0EA 1VSVA 4K6GA 4HADA 2R5WA 1M8JA 4CUJA 1N5LA 3W9UA 2G76A 5EWLB 2IS2A 3TQCA 3SEAA 3C74A 4Q02A 5J5CA 2BUAA 4IFTA 3S6JA 1GGHA 2X15A 4TYYA 2X13A 1LDNA 1XVIA 4JJZA 2HCFA 5TMEA 2P91A 3RR2A 1GGEA 2EBUA 4PC6A 4YRQA 3PXGA 5HUHA 1OXBB 3IMCA 4G0XA 4BN0A 1CS4C 2P5YA 3DSRA 4DR2B 1S2NA 3OTHA 5BN5A 4O4LA 1EFCA 4ZMSA 1VXOA 2QN6A 4PONA 4A8HA 4EENA 3KIPA 4EY7A 2HCBA 1UP6A 2BBSA 2HCTA 5HIJA 3ANMA 3U4DA 1P0IA 4X64B 3OAAD 1OT3A 5FB3A 3GLGB 1NF3A 2H8KA 1NWCA 2IHZA 1O1YA 1A2BA 3PKJA 4IUCS 4LX0A 1TZJA 3DHWC 4U7FA 2VKTA 4DJEC 5EIHA 2OESA 2WT9A 1YCHA 1ARZA 5FEUA 3AFGA 4JS0A 1CG6A 1RDFA 1T9HA 3SQXA 1FBNA 3VX3A 1JWLA 4K9OA 2CBXA 4UNQA 1T4CB 4OFZA 4B84A 3FPKA 2WU3A 2A30A 2ZYUX 1R0YA 1QYVA 3CF4G 5DX0A 3ZLJA 4MROA 2QPLA 1THZA 1E2GA 5ALMA 3ETGA 3VC3A 3WICA 2N1MA 4WKNA 1G3RA 2QLLA 2AYYA 1I1HA 2YHBA 3OFNA 4O1HA 4S1TA 3NH6A 2CNWD 4L95C 4WX2B 4K9PA 4KBYA 4RH0A 5DCUA 4UFNA 5HZKA 1LW6E 1YQTA 4OBWA 4IIFA 1NNLA 4AJ9A 4C76A 2QLTA 3II6X 3ZNPA 4IZIA 3I01M 5ALXA 1CDEA 2ZB3A 1B00A 1U0BB 3T7KA 4DV4B 4HRAA 4KOEC 4DYVA 4UCFA 1KYYA 3B7WA 3K4HA 3RUEA 3RHSA 3MLEA 1ZI8A 1Z88A 4R6XA 1GSHA 2P0AA 2GUGA 2GM3A 1Z45A 2BF4A 5E2AA 2OILA 3VSBA 2HLDA 4QO7A 1PZXA 3TW4A 1M7BA 4RD0A 5KWVA 3ELBA 4J07A 1H2WA 4PLFA 4M1OA 3K32A 4KYUA 2Q50A 2J3DA 1YI1A 3PE4A 3I32A 3O1LA 2WDPA 2ZW9A 3HFRA 1L8XA 4OL9A 2A59A 4AYTA 2O4CA 5C3UA 3RVQA 5C1PA 1XMPA 4J76A 3R7NA 1W7AA 2FZ4A 1XWFA 4RMGA 1ODSA 2P2CA 2QN9A 3GFSA 3H13A 1TZMA 4NE2A 2RG7A 5DF1A 2YHSA 5FXMA 1N36B 1WXIA 1L8QA 3EJWA 1M6EX 1XPUA 4LRXA 4QDOA 5KVCA 1UZNA 3T4XA 1XZAA 3DFFA 1EBFA 3VKFA 4FONA 4EKNB 3ICVA 1NMSA 3LK7A 1X3SA 1XMXA 4BQSA 1NURA 3MJSA 5HVNA 3C1TA 1L9KA 3OE1A 4PIMA 2PX2A 3H42B 5FFFA 3NAZA 3R5SA 3AEYA 3FCOA 3EZ2A 2FP4B 4F84A 1RAAA 4YWJA 1D6MA 2JS7A 4O2LA 2FVYA 5F78A 2FR8A 4G81A 4R1LA 4JT2A 2PU5A 2WIDA 4JOCA 3TRHA 4BHTA 1E89A 4OX9Y 1V96A 4RVFA 5K3FB 3GI1A 5I9LA 3GG2A 2GYYA 4KIWA 4B0OA 2A1TR 4Z54A 1NQWA 3GT4A 1KRWA 3JWIA 4MR9A 3OM8A 5TPWA 1NE7A 2P8SA 4NXMB 2CJPA 1EK2A 3LNTA 1LLFA 3HABA 2QJTA 5AICA 3TFQA 1NOIA 1PF7E 1L0BA 4B48A 1PFVA 4D3SA 1UEIA 4HH1A 4ROSA 5JE8A 2XXAA 2VK8A 4IF6A 4KRFA 3HJGA 4YYEA 2OK7A 1FSPA 5REQB 1S1CA 3K5WA 4WE3A 1W34A 2DBQA 4WGGA 2Y05A 4KSCA 1DQSA 1L5OA 3JQ7A 4PBTA 3WIBA 5TQ0B 1QVRA 3ESYA 4LZWA 1KP2A 2XGGA 1PQUA 2B0CA 3S2FA 1XRMA 4RLSA 1W49A 1C9MA 5KTSA 1QF9A 1FQOA 5JADA 4IX9A 2YXNA 1UMDB 3KXLA 1MNQA 3CFYA 3HU1A 1XVLA 3I2KA 1Z39A 1ZWLA 2ZXEA 1WY5A 1W85A 3L7AA 3WWZA 4DR3B 3AIIA 1HYQA 1BHJA 4UPEA 4GLJA 3AERB 3N9IA 1RMTA 1N2IA 2EG5A 2C9DA 3R44A 1G5QA 3DYBA 5ERXA 3EF1A 4EG6A 3DT8A 3PGKA 5ADUS 4DB4A 3OKCA 5KTOA 4BJ6A 2AVNA 5IVHA 4JU9A 5J1TB 4M9UA 1JQLB 1Y7IA 3FFBA 1AMOA 3R3WA 3ZDYB 5ALFA 1Y8QB 4BGIA 2AS0A 1S02A 1PFQA 3EXG1 4FZ5A 4DG9A 2R65A 3CIFA 2JFBA 3MJCA 3UMFA 2G9RA 4EG4A 2AJDA 2V98A 3FF4A 3F97A 1KAGA 2VHWA 4KAAA 4R9SA 1E20A 4PC1A 4U3JA 4ZOCA 5F23A 1DUVG 3KWMA 1P9RA 4A5SA 2J5QA 4GDFA 3SKXA 2HQRA 4R41A 2XWQA 3CCFA 2PXAA 1N9ZA 1T1SA 3FZNA 1XHLA 1Q1BA 4CLRB 1A9RA 3DVLA 4N3NA 1RRGA 4LZPA 4PYQA 3VQTA 3HUEA 3MCZA 2H7VA 2BUCA 3MUOA 3WNZA 4BFZA 3PEWA 2O8CB 5GTDA 3DL0A 4CV3A 3VO1A 4LBZA 4KV7A 3MPOA 1IMJA 1QHFA 1PR1A 1KKUA 4MIYA 2BEUB 3IAM6 3IBGA 4Q9HA 4ZVLA 3IP5A 4I4TF 1JR6A 1IN8A 4N6NA 5EKXA 3RS3A 3FI9A 1ECLA 4LKRA 3FNEA 4CKBA 5A4KA 5EE9A 4DMLA 2AKEA 1JDPA 4D46A 3SX0A 4GXTA 3ADPA 4HZUA 3PKZA 1U2DC 4QWMA 5KYYA 3OZCA 2FRXA 2ZYDA 3X2SA 2JAHA 2P9CA 2PFGA 1A9PA 4F97A 1YTLA 3A6LA 1EUCA 4BLWA 2JIRA 4Y9RA 2IOQA 5EIXA 4E94A 4CLRA 1Q16A 1INLA 3QGMA 4B8YA 1YIAA 3TB4A 4Z9XA 3DL7A 2ALJA 2WWXA 4NJOA 3P0HA 1XL0A 1KZHA 3PZRA 3FFAA 2QTWB 4I08A 2XNDA 1GU7A 1LTHR 2E85A 4X1OA 1QQAA 2RGUA 5U1PA 1PTJA 4UTVA 4Z1MD 1FMJA 2XDQB 3IRUA 3WGTA 1X8XA 1SBTA 3U6KA 3A1CA 1ZESA 1EJBA 4ZP1A 3F6BX 3I52A 5M04A 2H17A 1LSSA 1I6LA 3QVWA 2OGZA 4R1MA 2V97A 5K05A 3G82C 1MQAA 1VHQA 2FSIA 1XZIA 3A11A 3I53A 4KQWA 4D57A 1JP7A 1HE1C 3T34A 3HZOA 3AEUA 4NCXA 4CMJA 2XQFA 1S8OA 5JROA 2W6CX 1W1IA 3COPA 4P5DA 1ZH2A 1UMBB 4YT8A 5JPDA 2MIIA 1BDMA 3Q10A 3U1BA 3M5WA 1DZIA 4G07A 3ROFA 4BWYA 2A1UB 3DEKA 3IYLW 2FOLA 1E0AA 3NM5A 3KTFA 2NADA 3SC3A 4B6GA 1WHSB 4GE3A 3NM4A 3DBOB 1ZZGA 2EWVA 1SXJB 2OAP1 3HWX1 2LZ0A 3QX3A 1UH5A 4J3NA 3O8OB 2ZJBA 4XR4A 4P6VF 3DEIA 5KTPA 2B3TA 3MMXA 1E6WA 1X1DA 1IQ0A 1HYGA 2PRKA 4GFDA 4TMKA 3VHLB 4NBKA 1CRPA 5B4TA 3OESA 1QTNA 3BRSA 1GCAA 4X1KA 3LY7A 4XEUA 3BX1A 1A5BB 2J48A 1WMEA 2GAAA 3AUJB 3I3SR 4IO0A 4BZQA 5IANA 3GPBA 1FDSA 2E49A 3THOA 2MCFA 1OV6A 2Q0QA 3OFKA 4HDSA 3FR7A 2I7VA 4A0HA 1GGMA 1JR3E 5MFZA 1T36B 1M1XB 3R6DA 2C84A 1R50A 1TZCA 4L0MA 5KU1A 3WS7A 3M1LA 5KOIA 3KOXA 2NVUB 2LR0A 1T3SA 2OCXA 3DLIA 2UDPA 1UMKA 3FDZB 3NETA 3RUIA 4D5EA 4YRDA 4FHGA 3RSSA 4DNQA 5I01A 2NTJA 5KWIA 2AFIE 2ZPUA 5ADHA 2OHIA 1GZSA 2GFHA 3HEBA 2VQFB 1IATA 5A05A 2QTRA 5SZIA 3NW9A 1J2EA 1E69A 2Z83A 3VU8A 1W48A 2PUTA 3MILA 5GVRA 4EYSA 3THYB 2FEXA 2RK4A 4LRYA 3IH5A 3KKZA 3FRHA 1DAEA 4TMWA 5BWLA 5IJWA 1EIZA 2OHOA 3QFHA 3RC3A 1CUGA 1NAIA 2IUTA 4UEJA 2WNHA 1P7VA 4D4KA 3EDYA 5KWSA 4DCPA 1N1DA 1M2VA 1FW6A 2EU8A 4TMTA 5E3HA 4ZCIA 3K70B 5JCXA 2HEIA 2GETA 2AG6A 2PEZA 4UQPA 2W2QA 1E94E 4NCJA 3MOSA 4ZANA 3GEEA 1B7GO 3FMIA 3UJPA 4AXXA 2YZ2A 3G2LA 3MUEA 1IVSA 2ASEA 4J6FA 3ZV7A 3D7RA 3F73A 1Z4JA 2Q27A 3O3MB 2QLMA 3IXMA 4J0IA 1RHRA 5BRJA 2VNKA 3OPNA 4LDRA 4TTJA 3DS8A 4EL0A 4IEIA 4KFTA 4K1LA 5AOAA 4MR7A 5K01A 5IBQA 3IEIA 1E5XA 3ZN2A 5JZMA 2WF9A 5F5NA 1AQYA 1KERA 2RGXA 1N4DA 4TXMA 5CVDA 5EWLA 1CJVC 4HFJA 2IIBA 1RLTA 1GAQA 3WMRA 3ULKA 3CURA 3SLGA 4RLHA 4TX1A 3UVEA 4YALA 5LKAA 1P2VA 1QGDA 1M33A 3DKKA 3E9QA 4GW3A 2UKDA 1GUBA 4NYMQ 4EJ0A 2CLCX 2FWPA 3WIDA 4CODB 1O97C 1H93A 3HP1A 2QMOA 1SXJE 4Q7MB 1FY2A 1MPXA 1GPBA 5IXJA 1O0SA 4HQ6A 3REQA 1EFPB 1TM4E 1OX4A 1RAFA 2ODTX 2I2CA 1Y5IA 2ZQZA 3AILA 1QGUB 2ODBA 1Q21A 3MJRA 3N53A 4I50B 4LY9A 2ADOA 3UMRA 2DQSA 3H2ZA 3WA6A 3DCNA 4O0LA 1FEZA 4S1PA 3ED5A 1AX9A 1ZM4A 2O3SA 5LDGA 2AL7A 2EZ8A 2YICA 1WW3A 2A92A 2PTGA 1QV7A 1H2AS 1XN1A 3CLSD 2O2IA 4QLAA 4FFWA 2XUGA 4WEOA 1SZCA 1BE0A 1E7SA 2Y8EA 4FYXA 3A2MA 3DC2A 1X1CA 1OX5A 4UNIA 5G2OA 3ZY2A 5AW7A 3N7TA 2IP1A 2COKA 2OLKA 4R69A 3KQMA 2I3BA 4RA9B 5IFLA 2RGCA 2FPKA 2BMDA 5LDDC 1W5BA 2EZ4A 3G9ZA 1W9MA 3DZFA 3DEAA 4QUGA 1L7OA 4ZZ0A 1MNAA 3WZMA 2I4RA 1X7DA 1QLHA 2WLTA 4KXFB 4M1QA 5IEBA 3TD6A 4HT3B 2Z6UA 4P84A 2W00A 2R8ZA 4OH7A 4ZQGA 3CKYA 3Q87B 4G24A 5ELMA 3M34A 4BU0A 1FB5A 1KXJA 3JQAD 2C29D 1DCMA 3K6RA 2CJWB 5KWJA 1Z0DA 3WV4A 3BYZA 1HEYA 2I6GA 2V7BA 2C98A 4A1OA 2HU2A 2PRIA 3FTPA 5FOWA 1S01A 4TKLA 3IUNA 1GTG1 4MUAA 3PGXA 5AW2A 2G4LA 3T3HA 1ZL0A 2CHQA 1RKBA 3FTNA 3PWZA 3WL4A 5C53B 3H5OA 5A03A 2BJHA 2EG9A 2X77A 2IXBA 4B79A 1NP6A 1I4DD 2H5JA 3A6KA 1V9SA 2C0PA 3DTNA 4MV9A 4RVOA 1OH8A 3CNBA 3LPAA 5IEJA 1TU0A 4D43A 4G65A 2H3HA 4DIBA 2FN9A 1N32B 1W19A 1FYDA 4JUDX 3K9BA 4QQ8A 4X45A 2BFFB 3YASA 1T6YA 5JASA 2JLUA 4DIDA 1Q92A 4NR0A 2PE5A 2L69A 1NG9A 1J1UA 3Q72A 3V1UA 3LYAA 5CW2A 1PHPA 1T43A 3P94A 1JTVA 2YQZA 4ZVRA 2O1XA 4YCSA 1RJFA 4JQZA 4Q4JA 4M22A 4EGSA 4RHYA 1RBYA 1ZMBA 4L5AA 4RCYA 4S1VA 1P0FA 3DKIA 3MB8A 4F4CA 2VYND 4TRRA 5ALWA 1NASA 3BA6A 3QM1A 3V4FA 5FNVA 2QZJA 3SR4A 4G0MA 4LHYA 4P0QB 5AKLA 3WGQA 1CBUA 1SOWA 1X74A 3IC5A 1RWPA 2ACKA 1KMCA 4TV9A 1CLEA 4TXLA 2B5VA 5HM8A 5LQJA 3FCSB 3NHAA 4YJDA 3U9SA 4KZKA 5J63A 4LQ4A 4YDQA 2AJ8A 5AQEA 4MPRA 4E2ZA 3S2UA 4QTUB 4JVMA 1XZGA 1VZ2A 3VDQA 1ZIOA 4UREA 1AZTA 2AMYA 3Q41A 2J4DA 3TAXA 4ZYXA 1CJMA 5CYOA 1DNPA 2M9MA 2WKRA 1S6YA 4KYTA 1OXUA 5U4QA 2RHRA 2XLBA 4OQXA 1D7AA 1SK9A 2B94A 1RNLA 1Z8DA 2Z2KA 4TUYF 1CEQA 2AT1A 3VDNB 3QEOA 2IQ5A 1ANKA 5HIAA 1WP9A 4Q4LA 4QTZA 3EHDA 2J4FA 4OQMA 4PAGA 5HQ3A 1OI2A 3TLKA 1NR1A 1OAAA 1US8A 5IWCA 3WAGA 1Q7RA 4XRRA 3GUVA 4JU8A 3PDCA 4RZQA 4EMBA 1QHEA 4A2QA 2YDXA 4EO9A 3HA2A 2WY2D 2IKSA 2YYZA 5HWSA 4HH4A 4M55A 1COWD 1Z7GA 1N25A 2AF4C 3G0OA 4K81B 5EI5A 2C3MA 3SFVA 4B35A 2BEWA 2PR7A 2XMDA 3IVCA 1QH0A 5LBTA 3RU2A 5JS1A 3TNDA 4ENPA 1HURA 2BC9A 2JRLA 5A0VA 1UL1X 2FX2A 5I4CA 1XTRA 2XZOA 2G7ZA 2J3HA 4HLQB 2GKOA 3QUCA 2ZTSA 4IQ8A 2A88A 3QELB 4PAQA 1E2IA 4Q4AA 3HJFA 1OI7A 2XGJA 2PV7A 1KO1A 3UB4A 1QHHA 1W2HA 1QCDA 4TZKA 4DCTA 2QXTA 4M76B 4BCDA 2FWBA 3BXZA 3DV2A 1TF7A 3IMFA 3R40A 4RZHA 1RM4A 5CT9A 4FT4A 2Q49A 5SZJA 2R6CA 2ODPA 1NJFA 2VOEA 2WV7A 3I01A 4A8JC 4DV3B 1DEOA 1V7QA 2RONA 4TWZA 5FPHA 1U94A 4XSGA 3F8SA 1X8JA 1DSSG 4TTAA 3IAXA 1MC4A 3RARA 1UANA 3PCXA 4RIHA 2Q45A 3HM2A 3KUDA 2EKPA 2V7EA 5DLDA 4HDMB 5HM6A 4Q34A 4EJSA 1RI3A 3WR5A 1MOQA 2E4AA 3ONFA 4MVJP 3AWIA 1N33B 3DBVO 1AHNA 4WIAA 1M8GA 2BR5A 3C48A 4LBWA 4MS1A 5AJWA 4P86A 5HE9A 2FQWA 5CFPA 2V6BA 3DTVA 3P52A 4HB2A 4P35A 4RZSA 4TLCA 2ZJ2A 4XOIA 3UBTA 3GVPA 3PA8A 1C0PA 3AI2A 4HNQA 3QU2A 4R5HA 2IT1A 1O58A 2OENG 1XEXA 1EE1A 3QX9A 4ZEMA 1ZA2A 4IHAA 2G1JA 1E61A 2QXYA 2WJ3A 3JRWA 3T7JA 6REQA 2UUCB 1TX4B 2VUIB 1T4DA 4HYEA 5JQGB 4YCJA 1JRLA 4QNMA 4N39A 3W2IA 5EEGA 1BYIA 2QUBA 4R9UC 2EJVA 1EDOA 2Z56A 4EFLA 2XHZA 3NBYC 4BAGA 1J99A 1X7ZA 2FYTA 1NXWA 2P9FA 1EWVA 3JAMA 1L8LA 5SY4A 3ROKA 1EFTA 1MD9A 2FB9A 4HDMA 3BN3A 1B3BA 1YQQA 5JHHB 2ZWOA 3PHBE 2BRUC 3JW8A 4NENB 1K6XA 1DIAA 3TZ6A 4O4HA 4MV6A 2EFEB 2ICAA 4MIKA 4BFTA 4JP3A 4E5VA 3I72A 4Y1FA 1QP7A 2XOKD 4QUKA 1RM5A 4MWTA 3W6OA 1M1YA 2Y0EA 3IB6A 3LRTA 2C9BA 4KTVE 5A1TA 2Z4TA 2QRKA 4KPGA 2WIFA 3C8MA 1JWAB 4Q3KA 1HDGO 3OM0A 2J7PA 1PEAA 4UDXX 1N6NA 1YFLA 2I3AA 1IEVA 1Q57A 2OHFA 4P36A 4WI1A 2JBAB 5TS3A 3CNLA 4KE6A 5LMZA 4TQUS 4RZIA 1VCHA 2P1DA 5AM0A 1WNFA 1A8QA 4A8JA 2Z43A 3E23A 3PSAA 3RRBA 4ZJUA 4F4UA 1T0HB 4RPJA 1T4BA 4G89A 5LDHA 4H7IA 5FR2A 3WLJA 4O1MA 5JAQA 1Z16A 4G0PA 4ZEXA 5IYZB 2JLRA 4B8WA 2W93A 4G01B 2VDVE 1YUMA 3ASVA 2A9VA 4QTYA 1FUKA 2W2PA 3DGFC 3FOCA 3GP8A 1NBMA 2EGUA 4ODIA 2DU8A 3I76A 3SN6A 3AY7A 4EA6A 4JFAA 3B2NA 4R0MA 1XD8A 4CMEA 2UAGA 3ILHA 1XZJA 1MOZA 3EZLA 5D3MA 5DLPA 3SIXA 1C3XA 3A7DA 1JKMA 4J7CA 3DZGA 1NBIA 3UM9A 4BVFA 3CQ9A 3R5XA 4KQ1A 4PG6A 4C3UA 1V5EA 4MQFA 4ZCSA 2JIPA 2JJQA 3OO1A 3QU4A 4B45A 3OETA 4OHZA 3Q8LA 1N3BA 1XDBA 2ZJ4A 1CZRA 2R1VA 1X9IA 2EIXA 4OXNA 2TMYA 4XAQA 1WZ2A 4LQDA 4HV4A 4FUTA 3TNFA 1RRPA 1V8BA 1KI2A 2VSXA 4FGUA 2J08A 2AQKA 3DWIA 4HDSB 2FN4A 3C14C 3EPPA 5FV4A 3KZXA 1QX4A 2C0CA 2ZETA 4I14A 3BHMA 3CVJA 3CN9A 1XZFA 4NC9A 2A1IA 4GL4A 4GXNA 2ATCA 2YR0A 3RJMA 5JNRA 1U8ZA 1L7MA 1YJQA 4RSRA 2FMHA 5MGNA 4D82A 1JR3D 2X76A 3IP9A 3NUZA 3TJZA 4MHTA 1PFYA 1NKSA 2BZGA 3QTTA 4UNNA 4AJEA 3EOAI 2EQ5A 3STXA 1GFSA 3NV9A 4RA6B 1FS5A 5T41A 4Q4CA 3F6EX 4OAQA 7GPBA 5I4IA 3K8ZA 2CLHB 2IOYA 4Z86A 5H83A 1X7YB 3QYJA 2FW8A 2IU0A 3FB1A 4DCSA 5A2QA 4BRSA 2VSOA 3B12A 1M67A 3FCCA 1BNCA 2HBRA 3PIIA 2V96A 3SOZA 1TGVA 3CUTA 1SQFA 2OHHA 4OLHA 1Y1QA 5CX1A 3A1TA 3DOIA 4IV8A 4ZD6A 4RM3A 3R5KA 3GP5A 3WDLA 2WJAA 4GT1A 1KSGA 4X7BA 5BSHA 4YRCA 3HVHA 3KLNA 1EZZA 3NIFB 2IXAA 5JZBA 4RDHA 2PGJA 2BE9A 2ZITA 3CCCA 4KXWA 1UIRA 3KZOA 2ZRGA 1V1RB 4IHJB 5B57C 1T29A 2X7XA 3CKLA 2OMEA 4HNGA 1OVMA 2D2IA 4RK0A 2I03A 4DRZA 1COZA 4PHFA 1H2HA 1Q0HA 2WWYA 2O19A 4HXGA 2NU8A 2RI6A 3Q0IA 1XFAA 2WWVD 3GLIA 1CY4A 1DRKA 1HRKA 5EVCA 1VL8A 4QUAA 1ZLYA 1PYGA 1ZOOA 3IDOA 1Y3BE 5CDFE 3U44B 1BDBA 4QPCA 3ISJA 2C4UA 4US0R 4WKCA 5I8ZA 1HOTA 4AJIA 4LVUA 3PD7A 3I2YX 4WZAA 3NT5A 1EGMB 1R9MA 221PA 2Q7XA 3DMFA 3K9WA 1NKVA 4OL0A 4PS0A 1C7EA 1CNEA 3M1IA 2EZ9A 2AA3A 4IKEA 3ANXA 5AHKA 1I01A 3ZCTA 4OU5A 1AGYA 3D7KA 1HKUA 1EVEA 1PYOA 1QYDA 4CM5A 2XRMA 3W78A 2VRWA 5G0TA 4HUTA 4WXEA 3AM3A 3GCXA 4Q3NA 2IQIA 1LK7A 2J4CA 3IFSA 5G4KB 2LIVA 3HRIA 1UOEA 4MUYA 4F7WA 4HJRA 2FZEA 3AKEA 1QGUA 4U4AA 1JLLB 2FPOA 3X2EA 1NXPA 2J3MA 3NOQA 4GUDA 2PKXA 3R76A 1VL2A 2MSNA 3MQ4A 2HH9A 3SLKA 3UATA 1PO7A 1Q7CA 4QBGB 3ZWPA 2G25A 2WFAA 4KRYA 1XQXA 4R2XA 3SGLA 4DLTA 3R7FA 4IOLA 1P5HA 1PUJA 4UU7A 4JD5A 4MW0A 2WJPA 3RSOA 1HTBA 3CKKA 1EXNA 2ZUFA 5EA2A 4HPXB 2W4QA 4HDNA 2PNJA 4BEWA 4KFCA 5LLDA 2F62A 1KJNA 4LWOA 4ANFA 3ZDCA 2FOIA 4K9KA 1CVRA 4A6EA 1CQJB 4WOPA 4IEFB 5A71A 5A0FA 2ZCJA 3VYTB 1W4BA 2IZ1A 1CUFA 2VJYA 1YRAA 2Z98A 3O4IA 1V26A 2BEJA 3W6ZA 1O4WA 3LQRA 3LQQA 4X7MA 4OH1A 1BTOA 1RT9A 2QMHA 4M0PA 3BWXA 2DHCA 1W581 2ZUCA 1PWXA 1RQ2A 4OYRA 4QGSA 4CL2A 1DGQA 5IDWA 1HL3A 2VRCA 3QPBA 2Q8NA 4L0DA 4UD6A 4Y2QA 1JIVA 3UK7A 3HKCB 5FPSA 1D2EA 1N57A 2YZKA 1EUYA 3NBMA 3P2KA 3LHDA 1R16A 1RWVA 1J06A 4PWYA 3CVWA 3ICQB 4KMSA 1MRSA 3AVWA 3DVAB 4NYIR 1B43A 5JNWA 3K96A 2NU9B 3DBLA 3JD1A 4Q9JA 3ZEIA 2WYHA 3W8DA 3Q6IA 4C2TA 1ATZA 4Q66C 1GWNA 3WNCA 3EDRA 5E8RA 3FUWA 5SYNA 3WLNA 4ALJA 1FA9A 1JFFA 1DU4A 3EXHA 1RPJA 3QG5A 4E0BA 1EFVB 1YZFA 2DKFA 3HV2A 1EEHA 4IJQA 4AMBA 4JAVC 2FVXA 1BO6A 1PD1A 3O1IC 2GSDA 2NT3A 3O2JA 4FFOA 1DELA 4XD2A 1J22A 3C6KA 3W6PA 1CY0A 1S9DA 2G28A 3LTEA 4CDMA 4C7VA 3NIWA 1AQJA 1H4SA 5HJ2A 4I7EA 1IC6A 4DCMA 3IDZA 4FLEA 1QHSA 2XUHA 2WJ4A 3ASZA 4ATNA 4PEVA 2C4NA 4A0GA 3GZNB 5CH5A 2X6RA 4HBGA 3ZIAD 2NU9A 1LWOA 3C45A 3ZWMA 4YAKA 3IQWA 4V0QA 2WG0A 3FYUA 4C0LA 1PR5A 2FZVA 2I87A 2EJCA 2VP5A 2XNCA 1A9TA 3BUSA 3I6IA 2J5XA 3RWOA 3G59A 3AZQA 3C97A 3HADA 4RQTA 4DBZA 4MX8A 4ZTUB 1IPEA 2Q21A 3MT0A 4FB4A 3I3OA 4BVJA 3ZYCA 5LOVB 4B3TB 1T8WA 3FTEA 2AFHB 2YHAA 4TQAA 4TS4A 2QTBA 1R4ZA 2CKDA 4XJVA 4INJA 3JARA 5CAEB 2OCGA 3EEQA 1E63A 4M49A 3IE0A 1BW9B 1A4RA 1NVVQ 2W8BA 5AI5A 5GV7A 3QI2A 4A5OA 1LLDA 2Z30A 3E2IA 5DNDA 4B3DA 2VQEB 1EAMA 3HBMA 1VMIA 4YUZA 3TTVA 2P2NA 3AL0C 4JUIA 1VJCA 5BUSA 1W36B 5ALVA 1EX9A 3RYFB 3DOUA 1CVIA 2P79A 3CR8A 4OB7A 5FADA 3CLTD 2HK7A 4AC9A 4CR7A 2XCOA 2JFOA 1QO0D 4PZ0A 1U8AA 3D0QA 5ECDA 4DA7A 4M46A 4OK5A 4B7XA 3QZUA 4LF5B 2W6NA 1XF9A 3LBYA 1GPWB 4JITA 3LC0A 4ZFNA 3FNRA 4HNVA 1FFXA 1MJGA 3AEXA 4B2LA 1N5JA 1ZFNA 4IXWA 3ORQA 4HZIA 5GJVC 5KTKA 1BCRA 3SR0A 3TK1A 1XN4A 4BNDA 2AE1A 3W9SA 1JHYA 1P62B 1XDUA 1P80A 4F11A 5E7IA 1DQRA 1LGYA 2CNWA 1OWOA 1SQ6A 1XZEA 2VXCA 1BOOA 1VLQA 1WZEA 2C8JA 2P2YA 2WIJA 3EXFA 3FN4A 3NYRA 3OIFA 4I55F 2P2GA 4S2EA 4LCJA 4QFBA 3VZBA 4EHHA 5JNVA 1OB5A 3HTXA 1P9NA 1AURA 4G86A 1PDVA 1XZDA 3PNQA 5KNBH 2ZPAA 5JMTA 5K3EA 1CLUA 3VYWA 3W06A 4RMNA 2H5LA 5DTQA 3CCBA 1KYVA 3SIPA 1GKLA 2VUHB 4DHEA 3PJRA 2AZXA 4KX3A 4D41A 4MQMA 1G8GA 4OLBA 1M6HA 3KQQA 2XTJA 2R751 5TMDA 4JLAA 3UMBA 1XCMA 2WM2A 4EZIA 3LXXA 4ZICA 3BTVA 3COSA 4M1TA 1J8YF 3RKSA 1XCOA 2Q9BA 5L40A 3NGMA 5IHXA 2XDAA 4AU1A 2QROA 3A1NA 1T0JB 4QLOA 4UAJA 5EWJB 3GJRA 4Z5XA 3PENA 2AMVA 3K2IA 4PYMA 4Q4DA 5MF6A 3BD6A 2CWWA 1RC1A 2IU6A 2OLJA 4FILA 3BT7A 1QK5A 2A1UA 1F8XA 2X2PA 3NATA 2O2XA 4UU1A 3LPCA 3PS9A 3DLBA 4MIOA 4L7VA 4BGDA 2ISCA 4R2WA 1Q0ZA 5AUPB 4I4TB 4EHLA 4LOJA 1ESEA 2VH2A 1GA1A 3LQFA 1D7OA 1QDUA 3S99A 1FF9A 4KPFC 3B36A 3WIUA 3WA7A 1VHLA 4QDUA 3VJLA 1MB3A 5LB4A 4CT0A 4MVJM 1Z35A 3B48A 1ZRNA 3UHAA 1G16A 3BM5A 3SHOA 4C7XA 3LLUA 4DLZA 2C00A 1E62A 2VPQA 4LA4A 1E9RA 3QPWA 2V5VA 2G9VA 2IUFA 1FU8A 4FOSA 5T8KC 3AGQA 3RM3A 2YHIA 1ZUD1 4AG3A 1G63A 4O2AA 1BDIA 1Z6QA 1JNYA 3PYMA 5LL6P 5AVSA 4KLAA 4C78A 1D07A 5F2EA 1OV4A 4RF3A 3KP1A 1GQRA 1VFNA 3ORHA 5F33A 3RHTA 2R11A 1YULA 2ZQYA 5B3LA 1N2GA 9ABPA 3EIXA 1AS2A 3BIXA 3QE2A 2G4VA 2NQTA 2BIFA 1DLIA 1PL8A 3DJYA 4PFQA 1RJDA 4RWZA 2FEMA 1WU8A 3NPAA 1H5NA 1K8ZB 4QATA 5JYCA 5TT0A 1BHSA 2YN4A 4Q1CA 4X62B 3WG9A 1JR2A 2WVGA 1QWOA 1RXSA 2IDKA 4DM3A 3H6GA 3BWEA 4NVRA 5EE0A 3WGYA 4C6RA 1LBSA 4X94A 3EUEA 5AW3A 1M6NA 1BRMA 5LQNA 1Z56C 1PHRA 1S8AA 5JJ5A 4LDAA 2Q99A 4MWSA 4RAOA 3T35A 3ZGYA 2P0EA 1Y4SA 1AKTA 2NTVA 5ABPA 3MTEA 4DMCA 4DUPA 3D31A 1HYEA 2JFYA 3IJPA 1FZTA 4NNPA 3HJAA 1A7JA 4AO7A 1G66A 3F3SA 1KWKA 5GJBA 4J7AA 2EWMA 1HLDA 3K9NA 4MK4A 5HF8A 3PC7A 4J91A 5JCOC 4WOKA 3RBZA 5JS7A 4JEUA 3CRVA 3SYKA 1D4OA 4B73A 16PKA 3FZGA 3SYLA 1ODKA 2QMQA 4LZAA 4HNTA 4WBNF 5EJEA 1TK2A 4LY3A 3QHAA 1B6SA 2GPTA 2D06A 1RP7A 2J9RA 3QYAA 3AXTA 5ALZA 1IN1A 4KK3A 1ISHA 6PFKA 3OZGA 5TQ2B 5IRCD 2NNWB 2FDRA 4YUVA 1E4EA 5AOVA 4LMPA 4P7KA 1LZLA 4R8RA 4MAAA 1YQEA 2VF4X 4Y7DA 3AB8A 1XZKA 4XX0B 5EJGA 5EKTA 4Z7OB 1P7CA 2GJKA 1D6NA 4L7QA 3MSCA 1JG7A 1QG4A 2QV7A 4FKMA 2HTFA 3NIGB 1M34E 3OZDA 2YNMC 1S2LA 4ZTBA 4AYWA 1YDWA 1LDMA 2H4HA 3FAZA 3I8SA 3GFOA 4OKIA 3FYHA 2RCNA 2OCPA 4DLUA 4P53A 1UQUA 4TGLA 4V0OA 4UOQA 4P32A 2ZI4A 2ZR9A 4H15A 1FS6A 4Z49A 3PGVA 1Q1QA 1GR0A 1G4AE 3KZMA 2J0UB 2DHDA 5JDCA 4K40A 1VE6A 3IAS1 1ZRMA 2PAFA 3EZGA 4L5JA 2C07A 3WZLA 1JR4A 1S2MA 5MN6A 2HL6A 1N5OX 4EUHA 1RI1A 1ZWKA 3W5IA 2EC5A 4LRWA 4X8OA 4GOJA 1Q1GA 1XVUA 2H1VA 2GAIA 4IOMA 3E5RA 2R1TB 3KWFA 5HUJA 1DBSA 4CKEA 3HB5X 4J3JA 4XVQA 4M1ZA 2G9ZA 4CEJB 5J2TF 1MB9A 1EJ0A 3SZOA 4IHJA 3F67A 3GVIA 4AY3A 3GGPA 5K3OA 1LLUA 1P4JA 5AKGA 4IIJB 4KLCA 4ZVKA 5PGMA 3I04A 2ANBA 3NTOA 2O7VA 1ZIYA 1Y1KE 2Z5VA 3AESB 4KR0A 5K0JA 5SV2A 1ZC4A 5EPEA 3JAWB 3KZVA 4ZRNA 3QHPA 5DNAA 5JAZA 4FGSA 3PDIA 3QKRB 4RGVA 2I80A 1FDTA 2BGLA 1E0KA 2YV1A 3FD8A 5ESDA 1LPPA 2ZE7A 3RTDA 2PIAA 5IULC 2F3TA 1TPYA 4ZQHA 3FLBA 4ECEA 1R74A 2CFCA 2GESA 3MWEB 3JS5A 4G84A 3FHJA 3M2TA 5JV5A 3H0EA 1FYFA 5JYDA 4B47A 3K0HA 2EDAA 4YCAA 2VLIA 2R68A 4FOLA 3OD5A 4IVQA 3BSYA 4CM6A 4ZAGA 4BGUA 3CM0A 1BX1A 2HN9A 4LN1A 2I6TA 1T2FA 2CKMA 2QLJA 4EAAA 2O3JA 5ILQA 1RLJA 2UZ4A 1RWNA 1NBME 1GL7A 2E3JA 3VTKA 4PSCA 2GH1A 1F48A 2CE7A 5CVUA 4XYBA 2P9GA 4YMIA 1IEQA 3M7IA 1SXPA 4TZ6A 1Y1SA 1YHYA 2DBVO 2XZPA 4YAGA 5LP6B 4X63A 1X9GA 1CXZA 1W5AA 2O4UX 2ZOSA 3MD9A 4KACA 5H8WA 3EC1A 4N7BA 2O8DA 1VCOA 3WYAA 3GIDA 1KQPA 4HQNA 1OB2A 1TJ5A 4CEIB 2PRSA 1JG6A 3DQQA 4AS3A 1SC9A 3GRYA 4UVIA 5G3YA 2DT8A 4IJKA 2Z8YA 2QORA 5KNDD 1QSGA 1QRDA 3MWEA 3QWFA 3T3DA 3I5MA 4Q1DA 3VAYA 2XGSA 2JBHA 2DPXA 3NEJA 1ZH6A 3U0VA 4C0XA 4CN8A 4CN9A 2HWKA 4R3UC 2B3DA 3WRWA 3ZUGA 2Q4TA 2QM0A 2H1SA 2BVNA 2QVYX 3WKEA 3E27A 3RVOA 1PEYA 1T8PA 4V39A 3PQ7A 4DM4A 1ADGA 5KYUB 3ZHXA 4JC5A 3Q8MA 4C3ZA 1HQKA 2MSEB 4JB3A 3FR8A 3SXUA 2ZCVA 1QBKC 2W2TA 1SCKA 1YCGA 3HN6A 1PEKE 3EWIA 4F06A 2XOXA 4D8TA 5I5EA 3NGLA 2GA8A 4MVJH 2Q29A 4M87A 3WL5A 4MVWA 4BFYA 1SNYA 3S1AA 3CB2A 5JAOA 1DX4A 4POOA 3MWFA 1QHYA 4U6SA 5AW6A 1MB4A 2AOUA 3RO7A 5ITVA 3H8JA 4C2BA 3ZBQA 2NVBA 1IYZA 1II8A 2D54A 3ZCQA 1LDGA 3R3VA 2XCRB 2V4UA 1JMKC 5B12A 1D1PA 2H2DA 1DOZA 2QX4A 1OTXA 2OZPA 3LC1O 3MWDB 2HQOA 1H1LA 3FWZA 3M8KA 1VDZA 3VSDA 1JZQA 1BKYA 3L5KA 4CM9D 1Y48E 5F7ZA 1OFIA 2V58A 5KTNA 2PM8A 1BVYF 1HT3A 3O8NA 3VH3A 3H87A 3I6BA 3ZNNA 5BWOA 4GBED 4MW6A 2OV3A 2A0FA 1NUSA 2VBGA 4D9EA 1EESA 1TYAE 4H7HA 5LZ7A 3FLAA 3QPDA 2GBIA 4DMRA 3RVJA 3RABA 1NIJA 4RS4A 2OR3A 4WXMA 5FWAA 5E1BA 4JGIA 1B1CA 4YS6A 3MTJA 4C9BA 2D59A 1JKIA 3VYUB 3JWJA 4QOGA 5FFMA 3MMPA 2I54A 3OY7A 3L6CA 5DT9A 3MWDA 2OM6A 4OTZA 5INTA 4MV0A 3BK1A 4RJJA 3OH8A 3RC7A 3V46A 4KDRA 4L50A 1EK1A 1UEXC 3GDWA 3GQVA 3LA8A 2V1XA 1LSOA 2CFSA 3UHPA 1WKVA 4OUKX 4LF8B 3WB0A 3TTXA 2HEGA 5LQDA 2YFYA 4IDBA 4XFKA 4CQJA 5ED4A 1SN7A 1BYUA 1YB2A 3KEOA 2HBZA 2RGBA 3DFZA 3OQHA 3D4NA 3OLXA 4FFBA 4JLBA 1OD6A 2I6UA 3VSAA 5CA0B 3JZMA 5EEHA 4JSTA 2J5BA 4EG5A 1XROA 4QPJC 1XU7A 1GV0A 3V3TA 3ILSA 3QVUA 1N9GB 3MTQA 4MULA 4XUDA 2WJWA 3ZHVA 2VDJA 2X0NA 3TS1A 2A0YA 1BWRA 4NJMA 3KM0A 3SJUA 3SJ7A 4WRRA 4EI9A 4BUZA 1FC0A 2QX9A 2DTEA 4GS5A 4F3NA 2Z1MA 1G38A 1NJ5A 4AUKA 4F9FA 1XO1A 4AO8A 1K5DA 3TTSA 1M2GA 1RR6A 4CM1A 4ZVTA 3GT7A 1U9YA 4CEIA 2QTAA 4B4OA 2AN4A 2K5UA 2F00A 1WULS 5TPZA 1X15A 3VGJA 1N3YA 2LKCA 2XI4A 5ARCA 2YIMA 3WK7A 4UHKA 1DDGA 1HFWA 1YQDA 5GP1A 1JPUA 4YH1A 5BR4A 1OCEA 4YREA 3FMPB 1KZGB 4JFRA 3P32A 1Y4ZA 4J1TC 4JK3A 4XDHA 4PNZA 3VKHA 4E1BA 2D7CA 4MRNA 3ZI7A 5KDDA 2PUJA 4GIBA 3LOPA 1DQYA 1RI2A 5F51A 3KQKA 3SHVA 2I91A 5CYGA 3ZDRA 3HWSA 2XMPA 2B2NA 3PXCX 2MSDB 4JBNA 2Y6UA 4L75A 4U6QA 3T99A 4PR0A 3RTAA 5FWYA 3JAKA 2X8JB 4QTTB 2V74B 2HHHB 3HVJA 2RB4A 3FH0A 4Q4AB 2IZ7A 1PSZA 4I4IA 1QIIA 4C0AC 3Q3GE 3ZWQA 2VZ8A 1IWBB 3A7EA 3CGGA 3JQBC 1WVMA 1ZI6A 1CDDA 1EUCB 1QZTA 1X7WB 2D2VA 3DZDA 3O84A 2E18A 4YMHA 1B73A 1JDBB 1V9LA 2HXGA 2IYWA 1M2NA 2PN1A 3CINA 5DT2A 3WNVA 5IXYA 5B6IA 3ITKA 2Z9DA 3R3UA 4DV0B 1G8KA 5GONB 1YB6A 5CD9A 5EJ2A 4BNHA 1V3TA 5KYXB 1RM0A 2CB9A 4KHZA 1LA2A 3HMKA 4YRJA 1BU8A 3O8BA 1QFSA 3CBQA 3PIDA 4YP9A 3S2GA 5KTRA 3DNPA 3GDOA 1OBOA 3IR6A 4PNHA 4FYVA 4FHCA 4NLLA 4NABA 3N2GA 1R0WA 4TL9A 4U9UA 1Z4KA 1P2FA 4OHYA 1JT2A 2XBUA 5ARDA 4CFSA 5H3CA 2OHVA 5IAGA 2GERA 1BXKA 1PRYA 3M5PA 5IBCA 4ONEA 3DTVB 1KETA 1MXHA 4YRGA 1DV2A 1MX1A 3P9CA 1P2GA 4B6RA 2ZXFA 2POCA 4PNPA 3B53X 2DF8A 3FJOA 3EG5A 3ICPA 1Z4IA 4HAXA 4BP3A 1XJ5A 2JIBA 3VNAA 1YR2A 3VKGA 4WASA 1C2TA 1CNMA 1G64A 2WHQA 5ICEA 4WZ6A 4B31A 2OSVA 5TEVA 1JXAA 3D2LA 1QCZA 1GUYA 1NSYA 4YHBA 5GOZA 1WXHA 3KX2A 4QUHA 3STTA 1YAHA 3WZ2A 4DCCA 3U26A 5IZCA 2WQ7A 2IHVA 1YRHA 4DV5B 2VSQA 3DR5A 4F2HA 4F72A 1NUTA 4MQLA 4BLVA 2IUYA 1GVHA 1JQ5A 2AR0A 3AHEA 1VMEA 4LTDA 2IV2X 3UXMA 4F9TA 3DXYA 5FTJA 3ODPA 5EJ5A 3UPTA 1YK1A 3LHSA 3GD7A 4K87A 4PGGA 3BWCA 5L4NA 1STOA 3TD2A 3ZLVA 4P0PB 3HYRA 4IQ0A 3GJ0A 1KZ7B 3IA2A 3CZQA 1DBWA 3F71A 1NYTA 3IOBA 4FUQA 5AJXA 1X92A 1R4AA 3KPUA 1NW9B 3WGLA 3QTBA 4X1YB 1KBOA 5A0TA 1UT5A 2D0PB 1DT5A 2CVQA 5CDGA 3DMHA 3QOXA 2N46A 4Z9YA 5HJEA 1OQAA 5THKA 4MMXB 2Z2YA 3S81A 5DM60 4QJ4A 1BVHA 3QEKA 3MW8A 4NG4A 1D2CA 1BD3A 5B2EA 1DXYA 4RKRA 4G1EB 1P75A 2YWDA 1P2TA 2B2XA 2HQ1A 3GLVA 5F76A 1PGPA 2QG6A 3NONA 1YRQA 1L5KA 4BV9A 3TW0A 5A6SA 5B5SA 2C3OA 1II0A 1ODJA 1YFZA 1QHXA 1SHJA 2IHYA 3DZHA 3GFTA 4LRTB 2AZ4A 1Z7BA 4IR7A 4EW3A 3K0CC 4WWHA 1GZ4A 2ZRDA 2AFRA 3N8KA 4HDKA 3OQOA 1RFGE 2CMDA 1XRPA 3FHOA 4OIMA 1MDBA 1L5HB 2F43B 1K5HA 1ZISA 5B3JC 3OA0A 2DLDA 2IZOA 4UEOA 2X6QA 3D8RA 5FEMA 2D1FA 2G09A 1E1YA 3JQ9C 2VRBA 3C0KA 1MJFA 2PBLA 3GJQA 4HSGA 4RHFA 5A5EA 1PV4A 3GGDA 4ARBA 1AV6A 3F5FA 3RYCB 4XRGA 1MAVA 1GPDG 3N76A 3C5EA 5EZYA 3RV3A 2RH4A 4RA9A 3WLKX 1CY6A 2PL1A 4MP6A 4Z7QB 1DKMA 1U2DA 4AKSA 1MGOA 2FP4A 1KDRA 4H0NA 4KGDA 2RGNC 1E2DA 4U5XA 3BMOA 3RH0A 4RDXA 3LHFA 2B21A 3MN1A