4UTOA

Crystal structure of pneumococcal surface antigen psaa d280n in the cd-bound, open state
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
278
structure length
278
Chain Sequence
KLKVVATNSIIADITKNIAGDKIDLHSIVPIGQDPHEYEPLPEDVKKTSEADLIFYNGINLETGGNAWFTKLVENAKKTENKDYFAVSDGVDVIYLEGQNEKGKEDPHAWLNLENGIIFAKNIAKQLSAKDPNNKEFYEKNLKEYTDKLDKLDKESKDKFNKIPAEKKLIVTSEGAFKYFSKAYGVPSAYIWEINTEEEGTPEQIKTLVEKLRQTKVPSLFVESSVDDRPMKTVSQDTNIPIYAQIFTNSIAEQGKEGDSYYSMMKYNLDKIAEGLAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords MANGANESE ABC TRANSPORTER SUBSTRATE-BINDING LIPOPROTEIN
publication title Dysregulation of transition metal ion homeostasis is the molecular basis for cadmium toxicity in Streptococcus pneumoniae.
pubmed doi rcsb
source organism Streptococcus pneumoniae
total genus 100
structure length 278
sequence length 278
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01297 ZnuA Zinc-uptake complex component A periplasmic
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 4utoA02
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 4utoA01
2XUZA 3G9QA 1H1LB 4OXRA 4WZBA 5CR9A 2M6KA 3U7QA 5BVHA 5M2QA 5KOHA 3HXPA 5GGYA 3AEKA 5I4KA 3AEUB 5KOJB 4FI3F 4K3VA 1M1NB 4XPIA 4TKVA 4WZAA 3ZK9A 3MD9A 3TEFA 1N2CB 3R5TA 4ND8B 4G07A 3AERB 3MWFA 3BE5A 4GICA 2AFHA 3GI1A 3MFQA 4PAGA 5M29A 1QH1B 1M1YA 4WNAB 4MX8A 5B58T 2OV3A 4M7OA 4HMQA 4UDOA 1M34A 4HN9A 3U7QB 1PQ4A 3MINA 3PDIB 3AESA 2OV1A 4TKUB 4UTPA 5BVHB 5KHLB 3LI2A 5KOHB 2ETVA 3AEKB 2O1EA 4OXQA 2Q8QA 5JG7A 1KAHA 4TKVB 4WZAB 4N01A 5JJ5A 1L5HA 4NNPA 1QGUA 4WESB 2MINA 1KAEA 1FP4A 2X4LA 3MWGA 4MLZA 1MIOA 2PS9A 2XQVA 3AEQA 1G20A 5JPDA 1M1YB 3AETA 1QH8A 4LJSA 5CX1A 3ZK8A 3ZTTA 4BBPA 1ESZA 3LHSA 3R5SA 4UDNA 4UTOA 3BE6A 5GGXA 3TNYA 3EIWA 2RG7A 4INOA 3MINB 3AESB 4PM4A 3UJPA 4WZBB 2R79A 2R7AA 2XDQA 1PSZA 2QI9F 3PSHA 4DBLE 5M34A 4XPIB 1QGUB 1M1NA 4WN9A 4B8YA 2MINB 2Q8PA 4ND8A 1MIOB 4H0FA 4INPA 3AEQB 2XY4A 4CL2A 1G20B 2AFHB 3AETB 2XV1A 1QH8B 1K2VN 5FLYA 4HMPA 5M3BA 5BVGA 2AFIA 5CX1B 1KARA 1G21A 4IRMA 1XVLA 4G09A 4HMOA 3NU1A 3K1AA 2WHYA 3ZK7A 4MDYA 3HJTA 3TLKA 1H1LA 1M34B 3ZKAA 4MO9A 4LS3A 1TOAA 3PDIA 1K75A 2PS0A 2XDQB 4TKUA 5HDQA 2M6LA 3HH8A 4H59A 4WN9B 1K7SN 2XH8A 5KOJA 2WI8A 4FNAA 3AEUA 1L5HB 4WESA 3CX3A 2OSVA 1N2CA 2PHZA 1FP4B 4FKMA 1N2ZA 3AERA 4NNOA 5BVGB 2AFIB 3PSAA 1EFDN 1G21B 2OGWA 1N4AA 5JOQA 5AFSA 3K1AB 1N4DA 1QH1A 4WNAA 2PRSA 3EIXA 5HX7A 2PS3A 1K0FA 4FILA 2YNMC 2YNMD 4OVKA
chains in the Genus database with same CATH superfamily
1F0YA 2LDBA 4C5BA 1EK0A 5K8UA 4W5OA 4WASA 2VK1A 4FSXA 4LOKA 4G65A 2HHJA 4J0DA 1ULZA 3T35A 5K8LA 3SVTA 1YE3A 1GM5A 2XVZA 1F8FA 2FEKA 1Z0FA 2XNSA 3G5TA 4CTNA 3N6RA 2DX7A 3HY4A 3RVBA 4CNBA 4BE4A 1OB2A 2VJMA 4IX1A 1M1NB 4XDGA 5IS2A 1HFWA 2YWRA 2XODA 3PTZA 4ZOLB 3A27A 1Q7RA 2PUAA 4QJIA 3MS2A 3CRW1 3DV2A 3WRVA 3V7YA 3PUXA 3RKRA 2QSJA 3GMTA 2ZJ3A 4Z99A 2FPPB 3KRTA 4ZC8A 4M1ZA 1D4ZA 3ZXYA 1DB3A 2BRUC 5HS6A 4LSZA 2WJHA 2FEWB 1G8JA 1XZHA 4YUYA 5LP1A 2ACVA 3I6ZA 1YOVB 4JLJA 1H2BA 1S0UA 1SVSA 3DB1A 5ISMA 2ZVJA 1LJLA 3MOGA 5TT1A 1IHPA 3JATB 2E4XA 1KOLA 1P60A 3COYA 4Z6KA 4JI8B 2Q49A 3TK1A 5FLEX 3GRYA 2V0GA 2AMVA 4K3UA 2QV0A 3LIPA 2O1EA 3HJAA 1BEUB 3TJMA 3TUJC 1NKVA 4I1IA 4IS3A 4RTKA 1IN6A 5AR1A 1X77A 4O5AA 3O2NA 1XQWA 4XARA 4BEWA 3QEAZ 1IBLB 2DYKA 3CRVA 1T2EA 3BB3A 1KL7A 1JJ7A 1I3LA 4XIGS 5K0TA 1DQSA 2JFXA 2ZUVA 3ABOB 1PR5A 3B6MA 4EM6A 3ZZ1A 2POCA 3IB6A 3TNJA 1YJBA 3R40A 4L9WA 3VBEA 3C5CA 2UZ1A 5I8PA 3GFFA 3ONNA 3JQ6A 5ELMA 2WWYA 1AHIA 5FWNA 5C7OO 1S4MA 1MJHA 4G1VA 3BSYA 2OD2A 1FUYB 2A5DA 3VU9A 1KPHA 2H2DA 3IR5A 4J07A 4X6LA 1LB1B 2XADA 2B8TA 5JJKA 1JA9A 2I33A 1P1KA 2R7AA 1LPNA 3MCUA 3S2UA 3AOEA 1SOVA 4YMHA 2BE7A 2DTXA 2P78A 2CB0A 1OX6A 1QRRA 2YHUA 2D1YA 3BIFA 1SVWA 3NIDB 3AYXB 4M1OA 3ZCPA 5E6RA 4WDQA 1TEXA 5C3UA 5A6SB 1T91A 1BXGA 4OD0A 2J1LA 4KQGA 2QAJA 4EYOA 5ALUA 4L74A 4R51A 5BRNA 1FS6A 2XCTB 3PNSA 3GDFA 3HC7A 4PO8A 3FJYA 2ZI9A 3KJQA 3X43A 3LSTA 4CKCA 2BI8A 2E82A 4EPWA 1UQTA 2BBOA 1NDQA 1RBZA 3L8YA 2O2IA 4CMHA 5JO0A 1F17A 3V8NA 2GYYA 1BJKA 2F59A 2RGNC 3LG2A 1UBFA 3NETA 4IIJB 2I1QA 4U2FA 2NYRA 2WVJA 3QY9A 5LBIA 4PFSA 2UV8A 1ZJ6A 2JBAA 4B31A 4CIDA 2JI4A 3BMNB 4OK5A 1O87A 4FNAA 2OFXA 4JAVC 4J91A 1B2LA 1YR2A 2GN0A 2PMKA 3OZWA 4GQAA 1S01A 5AVKA 3SMVA 1QF7A 1E5LA 5LYYA 2HDNB 1JA0A 4GD3Q 5I7WA 4CEHA 3EPJA 4HK4A 3AL3A 3NTRA 5GAJA 4XSHA 1DAHA 4NESA 1D4AA 2G0TA 4HUQA 4XQ0A 3QBVA 3VTFA 1NLMA 3GA0A 4I7EA 3OA2A 6YASA 4I1PA 3GEGA 2Y6VA 5JY6A 4RFSB 3G8CA 5LU8A 1UWLA 2CVFA 5CFMA 2COEA 5KSYA 4M98A 2F8SA 3R44A 1GAXA 2LP4Y 1C0IA 1I7LA 4YAJA 3L7NA 1ZS9A 5GINE 1ZGHA 1GQ2A 1OD6A 2GVDC 2X8WA 4M8LA 1PT9A 1L7PA 1SH7A 5DLQC 3T9BA 3TF5A 1NG9A 4UEKA 3T5MA 2B20A 4JI1B 5DMHA 3WRYC 1KKUA 1YI1A 2FTKE 4HZIA 4AIIA 1IM5A 1S2IA 2Q2NA 2NP7A 2QORA 5L3VA 4BEJA 4L6CA 1QK5A 4RMHA 3G2PA 3MFQA 1K7YA 2DSTA 2QAGA 2X0DA 5GZ6A 4NDNE 4F72A 2WAYA 3IAXA 4PTZA 4JBNA 2RGCA 2VA8A 1T6ZA 1G9SA 4KJZA 5JANA 4GQBA 1J42A 4TYYA 4IV5A 5CW2A 4AECA 2J9GA 1OCEA 3DLBA 3DMTC 4MKXA 4WUVA 1ENYA 4BQNA 3AESA 1QG2A 1TQHA 3RC2A 5CXSA 1YBAA 3EBPA 3OE7A 1X14A 3BFPA 3BH7A 3GVIA 3ZCQA 4QYXA 3ZWNA 4KDCA 3JQEA 5JALA 1D6SA 1S3SA 3WDKA 5I5GA 4ZDIA 1EB8A 3L4KA 1WNFA 5IWCA 2XQIA 3AGQA 4K7JA 4PYQA 4WI1A 4HCJA 2D5BA 4UCWA 1Z2CA 2O2JA 3NJ4A 1PWYE 2JIDA 3S8MA 4ZI7F 3ELWA 3HLYA 4IGIA 5JARA 3S8YA 1SXJA 2I62A 4EHLA 3IBFA 5TV2A 3MLEA 3FNQA 4UOZA 3QU2A 3OETA 3ZY3A 4CTMA 5DK4A 3OEWA 3W2EA 1L5FA 3MT0A 4OCZA 3ASUA 5K3OA 2E1PA 3DTTA 3H2KA 2FPSA 2VHEA 1GL7A 4O4LB 3BAFA 1U1DA 2HIMA 3ZVLA 4QU9A 1SUAA 3QXSA 3ZDFA 5LFAA 2O2YA 5BR8B 4ZN6A 3UK6A 1XQ6A 3I1YA 3BA6A 1B14A 3QEMA 1T1GA 1AIPA 1Q22A 5D3ZA 3DMGA 3GJ3A 4MWEA 1AS3A 5TLSA 2Q8PA 1ZINA 1W88A 4RWZA 2V74B 3MTQA 3M6VA 3RYCA 3WGUA 1MB9A 4QGBA 3H1BA 4ENVA 2QPTA 5JAMA 3NDBB 4KK3A 1MN6A 1JHDA 4G09A 4GLJA 2B99A 1FP7A 5JSQA 4QGSA 4FC7A 1SHLA 4MEBA 5CLHA 1X7WA 3DE7X 4HPWA 4NLLA 4QOIA 2BHRA 3B2QA 3RVPA 4AX4A 4L73A 3RF6A 2ZJ7A 4IQFA 1XHLA 4LE2A 4BQPA 1LLDA 2QX9A 3EXEB 3KSDO 4H4DA 4MARA 4CMBA 2J3KA 4KQJA 4KWIA 4RM3A 1H1DA 2VZEA 4KDRA 4L3WA 2FETA 1I6LA 4K88A 5FPYA 1XHFA 3GGCA 4UJ5A 4CR8A 3MUFA 2I54A 2JAHA 3FHCB 4AZTA 2VBGA 2VKTA 1SWWA 1U0SY 3HZHA 1S8AA 1A88A 2C8VA 2CUNA 3MMXA 4NATA 4PWYA 3ZZUA 5AVSA 1AH2A 3DNPA 4QEKA 4BVHA 3DVQX 4QVGA 1NRJB 4JHLA 2PXXA 4II2A 4HXEB 4DN6A 5EJ6A 1BXZA 2YINC 4XYMA 3P2KA 5EZ6B 1PYOA 4WHMA 2O06A 4DMLA 4RPHA 3P7MA 1SQGA 2ZI7A 4RA9B 4LV8B 1ZO8A 2YIVX 4FFBB 4YONB 3B3GA 3L40A 4PO3X 1PS8A 2Y0DA 1LDBA 5BV7A 3QITA 3QENA 2CBGA 2GLUA 3AVQA 3F74A 1UJ4A 4AJNA 1IJBA 3A9RA 3D02A 3H7IA 3N2YA 3PG5A 1TUGA 3BRCA 4XPIA 4X5OA 5I9BA 4DEVA 5BV0A 1NU6A 3V2IA 4QRDA 1V8DA 1E69A 3O7MA 4QUJA 2VJBA 1YL6A 3N7TA 3T7TA 4S35A 3ZY5A 3FYUA 2UUBB 2HLDA 1H65A 1E5XA 4EGJA 1UKBA 4MA5A 2Q5QA 1Q0SA 3EG9A 4V2UA 4R68A 1LCIA 3A11A 1A9ZA 6NULA 3LKBA 2AN1A 1ZCBA 4XQCA 3IP8A 1ZD1A 1BZYA 4WCVA 3WISA 1NV8A 5L9AA 2F8TA 1PU2A 1Z45A 3ZNNA 4DXAA 3PYMA 5C81A 3A3NA 5IK2A 4RDXA 1LI7A 3RSCA 1VCNA 4MQ6A 2F6RA 1QHFA 1CE8B 2GXAA 3D3KA 3MGCA 1CDOA 4RDHA 4AUEA 4MWBA 2H17A 1MPXA 1P39A 3NP9A 3OT1B 4G67A 4F38A 4DUYB 4UMFA 1JEQA 2BM9A 1CVLA 2GDJA 3TQQA 3VH1A 1QRTA 3HKCA 4FX5A 3W8EA 2XBLA 1VBFA 4BS9A 2L2QA 3ZYZA 2X4LA 1EJ6A 1N2OA 3QY0A 4PZLA 3SQWA 4LZJA 2X4DA 1JMVA 4J8PA 5EXEA 3DDHA 3T3MB 4DWVA 3GEBA 4KOAA 1E6WA 3JWPA 2X0JA 2BZGA 4GUAA 4LJSA 5C7YA 2FWBA 1HEYA 5KQGA 3NYWA 2G8LA 5ADHA 2PX4A 2C1XA 1SBTA 4GR5A 1JX6A 2CXHA 3TE7A 3OQIA 2BL4A 4TTTS 2QR3A 1KQPA 4QGFA 2D06A 4I3HA 3T41A 5IDWA 2XW6A 1GEGA 4L16A 4DA0A 1PJZA 1M2OA 4AZ0B 3DEFA 4K9NA 5TARA 1C7QA 1RAAA 1MORA 4DLKA 1P2FA 1WMBA 4XRGA 5LXTB 3RU9A 4ZCQA 3T3NA 5TJ9A 2X5KO 5IZ4A 2AKYA 4LF4B 4KB5A 2VJPA 4FQ8A 2V6MA 1Z7GA 3GFQA 1R1DA 4HGRA 1G5PA 4L4SA 3STUA 1G21A 4B9EA 2ZPUA 4L8YA 5JJLA 4WL0A 1WSAA 2FK8A 4PQGA 1TC1A 1O9GA 1TPZA 3GJ5A 1VL8A 1ORDA 3QJGA 4BLSA 2YWDA 4R9UC 4CM4B 1AO3A 4ACAA 1MUUA 1JHUA 2LTAA 1A8UA 3M4YA 4LYHA 4M0FA 3BORA 4KR3A 1N8KA 4S1TA 1IEVA 3USES 1VLMA 2ZKIA 4R3WA 1RM0A 2A5JA 1NXWA 1G8HA 1JEJA 1W94A 2G83A 3OT5A 3E53A 1NKTA 2C94A 5KINB 1D2HA 3L1KA 4R6WA 4WESA 3LAWA 2WZBA 2HPHA 3GEEA 3R7FA 2DWOA 3CE9A 1FFEA 4RVOA 4FR2A 3SVZA 1XRJA 2GWHA 4D26A 3Q0IA 2YIDA 1L4FA 1CY1A 2BFFA 3KEOA 2MOKA 4K9LA 3DHVA 3UV7A 3H3XA 4F84A 3VSAA 3X1WA 4I4TB 5ALVA 1BCSB 4O63O 5L53A 4ECAA 2J9ZB 2QRVA 4S0ZA 5B6PA 2J5KA 3B89A 4F3TA 2QP9X 1DUVG 2XZDA 3KKKA 4HB3A 4C21A 3QLVA 1BE0A 2ZYSA 2K6GA 4K9RA 4WY8A 4N6NA 4EKGA 2X0EA 4IFBA 1NUHA 4B7ZA 3RAJA 4BB6A 1I51A 4O08A 5TPZA 5EIOA 5IAAA 3G8DA 1YS6A 1H8HA 3HJRA 3I58A 5ANRB 4YP7A 4P4UA 5SICE 1TZBA 5D3KA 4FLMA 5CB8A 1X7XA 3QFSA 4A36A 1Q7GA 1VFPA 2OPBA 3OX4A 5M29A 1KSFX 3DAFA 2V97A 3IUJA 3PPXA 3C87A 3E7PA 5ITZB 8GPBA 3BJMA 4L7VA 4EO9A 1XA4A 4FGKA 4Q3EA 1NW6A 1GIAA 1QAQA 2BEVB 2CNNA 2RONA 2VHVA 3KTAB 3AJ9A 3R3WA 4LXYA 5AHKA 3SNKA 2HHAA 1Z7BA 4XCQA 2OV1A 5ENDA 1KAGA 4EDHA 1JSLA 1E61A 4KQXA 3PWKA 4HDSB 4Q0MA 4RESA 5K6AC 1JAIA 5TEWA 1DARA 4QT0A 4REMA 2BMWA 2FZKA 4ZO7A 3ZD6A 4KXMA 1THTA 1GN8A 4L8LA 1SIUA 2CBZA 5F7XA 1DAIA 3AU8A 5GOZA 1ZZEA 3WO1A 4BO6A 4L4XA 3ILYA 3K16A 4JQZA 2ZSAA 5I8ZA 5I7SA 4DCCA 2GYVA 4WLVA 3ASYA 3QPCA 3QTLA 1EFUA 3GJRA 1K66A 3K0FB 5THQA 3IKVA 4DCUA 3U7GA 2Y1XA 2CKMA 1IN1A 2H7YA 3QXJA 4INOA 1E9SA 1AE1A 3I3OA 4GXNA 3SHWA 1VG9B 3X1MA 3I6MA 1OR8A 1KI3A 4XIIA 4H0CA 3A9UA 1I3CA 3T3OA 4C14A 2AYXA 1NXQA 2IYYA 2REBA 4I5DA 1H66A 1IUOA 5EHZA 1QRAA 4UHHA 3CEMA 1PGOA 2P1RA 2Z83A 5BRJA 4IAOA 3NBQA 3VMFA 1E18A 2X19A 3MHTA 5EJ4A 2V54A 5JJCA 5B55A 3EGIA 1IHUA 1P1HA 3LNTA 3R7DA 1N2IA 3NP7A 1W4AA 1DADA 4V0RA 3OM1A 1IBRA 3JWHA 3QZUA 4DLSA 2KE5A 4OQNA 1Z6YA 2YMLA 1ZJYA 2QNRA 3ICWA 4FBGA 3GJ8A 2FYTA 4L78A 4R2MA 2NO1A 3VNBA 3H2HA 1W48A 3NRBA 3WJ1A 4RH1A 2GD0A 1JFVA 2BCEA 1P19A 2P9EA 2OYCA 1TMKA 2HU2A 3ZU6A 1NSTA 2VQSA 2FPMA 5LR6A 4NDAA 1JJIA 1RACA 3O8LA 4YWHA 1W49A 4BLUA 1DGQA 1Z39A 1EK6A 2QPLA 1YZYA 3NM4A 3P52A 1P77A 5J2UB 4GZ5A 2PLRA 2YOGA 4JLDA 5KNCH 3PNBA 4MTCA 2XUJA 1Y9DA 3DBVO 1T0JB 3UGJA 2F7SA 2FY8A 2ZTLA 2HFJA 4OA8A 3AL0C 2YBEA 1R4ZA 4PHCA 1Q77A 2VP6A 1K63A 4JI5B 4ZOQI 2JATA 4ARUA 3G68A 1PQUA 5HA5A 5HMMA 4OXRA 1W59A 2AF4C 2PCLA 2Z8ZA 3EZYA 1JJAA 1DXQA 3F5MA 3HJGA 5KOHA 2QYSA 3WLFA 2BDUA 1ZJWA 3II6X 1LNQA 3AVXA 3AEUB 4V0NA 1QRUA 1KYVA 1PGQA 4Y6PA 3AF1A 4OQFA 2C5BA 2BCJQ 3MF4A 1AUPA 5DBFA 1SUWA 3TL6A 1TYBE 1SC9A 5B3JC 4TGLA 5CAEB 3UAXA 1QH1B 2Q50A 3LKDA 4DIFA 1T15A 4N18A 1RJGA 1Z3IX 2XTJA 1N5OX 4IJ6A 5B58T 2EP8A 3TOZA 2BFNA 2J07A 4HXGA 1E5TA 1PDVA 1SKBA 3F67A 5HIKA 4TYWA 3Q7SA 1NVUQ 3IPXA 1KDTA 4X6XA 1Q44A 4I50A 5BVHB 2I0FA 1ZITA 1CJUC 3AH8A 2P91A 1QPGA 5A7FA 1Z0DA 2XUOA 1LLQA 2H4WA 4QL3A 3ZHUA 1DRWA 4WKPA 4BP1A 3NHZA 4LWZA 3BDVA 5CHYA 1WEKA 4QLAA 5A7HA 5KYVA 5HM6A 1RQLA 3O8OA 4GW3A 1EG7A 2JCXA 2NYUA 3NR2A 1TQ4A 2R6FA 3M4NA 1CT9A 5T6BA 3B1FA 5ECGC 1D6JA 2JJ8A 3CUUA 5DM1A 3T9DA 3CURA 5IJXA 4JWKA 5LZ7A 3PLRA 1H23A 2SNIE 3VR2D 1T26A 1Y34E 3LUAA 1MOQA 2PD3A 3RYIA 1C3LA 4ZOLA 1NN5A 3R3HA 4CM8A 5HUQA 1VMEA 2G04A 4I99A 4MWDA 4GI2A 3PRHA 4YJ3F 1IULA 1P2BA 1AQYA 1BRMA 2QJWA 1AS0A 1L4HA 4IOJA 3RUAA 5JI2E 2C7QA 4U9IS 4U2KA 4U2GA 4YRIA 5BWLA 1RHRA 5E6SA 3OE7D 3EARA 1WR8A 3KYJB 2ZJ6A 3ILSA 1K3FA 3J7TA 3WOVA 3QVGA 1DP4A 5A1JA 1DDIA 5IABA 2FQWA 4LYEA 5F3WB 5CYFA 3USZA 1N6HA 1H9CA 4Z9YA 3EASA 4DV3B 4FT4A 2E5FA 4C7VA 2DUNA 1MIOB 4CHGA 1FTGA 2H5EA 5K03A 1R9NA 3L6UA 1Z28A 1DWOA 1SXJD 3D8NA 3AB7A 2GTHA 1PZXA 4J7AA 1BOOA 3M4XA 4LDJA 2E18A 2IYWA 4MI9A 4TWIA 5LB2A 4A8HA 3OECA 3GA7A 3LFUA 4JU8A 3ZU5A 4WJZA 2CXOA 2OGZA 1ZKDA 5AW1A 5I7VA 3GVCA 4MAMA 4WTOA 5T4HA 3PDIA 3BILA 3UOWA 2O5VA 2I8LA 2NAFA 3IEVA 4I2NA 3RO7A 2EC5A 4PZ9A 1I3KA 1DEAA 1T1RA 2AD5A 4OAQA 4YJ2B 5CT9A 2JVJA 2OZVA 3C97A 3TLCA 4ZMBA 3EZ2A 4EJSA 1WU8A 2XMBA 3AM3A 3WQSB 1VIAA 2MWMA 2VRCD 3RGGA 4EKNB 4DDTA 4JI7B 4WDRA 2I80A 2NU7A 2OGWA 2ZJFA 3BMQA 3CZ9A 3QX9A 2WY2D 3R7LA 4AJKA 2ZBEA 1GRNA 3EN0A 3JQCA 4L85A 3R76A 3T5GA 4YV1A 1ZM7A 4O2AA 3WDLA 5GZ3A 3I73A 3HCBA 3TR6A 1R0ZA 4EFMA 3GO4A 5JAZA 5AJTA 1VM6A 3AR4A 3SSAA 4F5WA 4DUGA 1QNLA 6GPBA 3RHSA 3AFIA 5EQTA 3KAJA 3TVDA 3AUXA 1Y63A 3HXQA 2WAOA 3I39X 3WYFA 4AN4A 4IOMA 2PX0A 5TY0A 3V34A 4IP0A 1ZONA 3VGPA 1DV1A 2QTMA 4ATNA 1X3LA 2FPXA 3JVDA 1QQ5A 3AQ4A 4LISA 4PYIA 2AHOA 3BK2A 3TQIA 1T9ZA 3UXHA 2YKGA 1N0UA 1Q1BA 3SSOA 5BQXA 1G4HA 3L07A 1AGNA 3E4CA 2UZIR 2OAQ1 3C14C 3AT1A 1ZD3A 2X0NA 1Z6ZA 4IF6A 5CVTA 2XYQA 3IV6A 2H7VA 4YK7A 2WJPA 1AKWA 5AJVB 4B33A 4CKWB 4UFPA 1J07A 4LXGA 1H6DA 4WH0A 1CUVA 1GNSA 1T3ZA 3B20A 2O57A 3C5EA 1JLLB 3GOHA 3AIKA 3IMKA 2A9FA 5B53A 2XI4A 4EMTA 2XD4A 1JBEA 3ZQ6A 2X42A 5JG7A 3PQ6A 2WWHA 4H4CA 4OPMA 1R0KA 3KSAC 5CCDA 1KEEA 5FEUA 2P9QA 3I9KA 2A1TR 4N40A 3QLEA 1J97A 3GLGE 2O2DA 4DUPA 3DDOA 4PRYA 5IBPA 2Q2OA 4XWOA 5KTKA 2HLDD 4J0EA 5HDBB 4ZEMA 4C20A 4FNOA 1E4OA 1O08A 2O2SA 3LUDA 4UVIA 3FWPA 1LSUA 4ID9A 2ZBGA 4QQRA 1PW7A 1DXYA 2Q0SA 1UKEA 2WSIA 3H2ZA 1Z0SA 1X19A 2XE7A 3IERA 4D7AA 2XSZA 7REQB 2YWEA 4EW6A 3PFWO 2PX2A 1PS0A 5IK2D 3OZEA 3T34A 4PTLA 3VC1A 3VC3A 3HNPA 3QFHA 3RKUA 1EHYA 1GTZA 1FDIA 2DCUA 2VYQA 5BN5A 1J1UA 5CM8B 3KTOA 2C04A 2PKQP 5CA1F 1CY0A 4UBMA 2A58A 1BRTA 2IU6A 1I32A 1Q95A 2HADA 4FZRA 1FFGA 3ZTYA 4B3XA 4NKRA 5D5QA 2BELA 1OBHA 4RMGA 4EBFA 2D59A 4WGFA 1C81A 3IUMA 5B1IA 1W87A 1U0BB 4OHZA 7GPBA 3IQHX 4ALNA 3ETJA 3BYZA 2W2PA 3JAKA 4O0MA 2YH2A 3QNMA 4A1OA 5IJ9A 2IYSA 4JYAB 3UWMA 2FW0A 4NMMA 2XIQA 4DRXA 4URUR 1KEPA 2JIMA 3KEFA 3AR6A 1GPNA 3BCSA 4Z0NA 4ONEA 1OPXA 1PT8A 4W7IA 3NBUA 5A4FS 1E2LA 4XQGA 3JALA 4U7PB 2RKWA 4RCVA 2X7XA 3HCOA 4EYKA 3ZS8A 4RDIA 2RKOA 4E15A 4U4AA 2AQ8A 2J0UB 1ORWA 2PGNA 4Q4AB 2QUJA 3NHLA 2ASVA 5TF4A 4QICA 9MHTA 1N2CA 1AA9A 1EE2A 1OKKA 3EPRA 4ZVQA 4KWHA 4NV0A 5HPYB 1QGAA 1SBQA 2PL9A 3LXRA 1ISHA 3UICA 5B7QA 2SECE 2DJIA 5IC4A 2IW1A 3MVEA 4NR0A 4JJ7A 1OFVA 1W581 3SS8A 2BJHA 3O3NB 4RY2A 4U3JB 3KVYA 5IJ0B 4RL4A 3ZCTA 5KAMA 2IOHA 1X0XA 2HK8A 3HCWA 1T36A 4FGSA 3URKA 3ZV5A 3H2IA 4DLWA 3WGHA 1SXJE 4IHQA 2BEWB 1OV4A 2A5LA 3K53A 4EBBA 3G9UA 4ZZ2A 2II6A 4RKYA 1MH1A 2QG9A 1HURA 1NONA 5FXMA 3VSDA 5JQGB 4KREA 1Z36A 3DA8A 1SRQA 4S1PA 5HRAA 4GXTA 2E4ZA 3HVHA 1P5JA 2R1VA 3W7BA 2FPRA 4IQ0A 4BWVA 5JJBA 1BKDR 2VC2B 2IEDA 2G7ZA 4LG1A 2PFSA 1MOPA 1KO1A 3L0SA 3UT5B 3EQZA 1NW8A 2REOA 4QUAA 3TRHA 3VOSA 1JJVA 2QP4A 1MVNA 1GZ3A 3LQFA 4Y1RA 3WA6A 4C9BA 3TIGA 2QTVB 3ETEA 3G0OA 4L8GA 5ALNA 4EA6A 3WADA 4E11A 3W1WA 2Y77A 1PQ4A 1UP4A 5EUQB 4X1OA 2VRWA 1KDVA 4CCYB 5AHRA 4JYZA 1G5RA 1YRBA 3TMAA 5CNMA 1TZKA 4YR7A 1IWOA 1JWAB 2CEKA 3A26A 2C9DA 2PE5A 4RZHA 3MYRA 4N01A 2TMYA 3T38A 1X1AA 10MHA 3OCCA 2P3OA 5A62A 2VQ3A 1YZUA 4B6RA 1S9HA 1RHKA 3NALA 1YAHA 3HXOA 4QU0A 2ZB3A 3WRXA 4AUMA 2XZTA 5IBQA 4A26A 4W5NA 4Q6BA 3E9YA 2QR2A 2AF3C 3MJCA 2X0FA 4X6YA 5D3MB 1XAHA 3SQXA 1XMIA 1NC3A 4G1UC 5FNVB 2E6UX 3WJ7A 2ZWAA 3O90A 4RV9A 2C9MA 4KLRA 3ZXXA 4BYMA 1WNTA 4A8JB 2YJ3A 3FM9A 2ACWA 3LLVA 3N05A 3OWHA 5A3VA 4MDEA 2Q6TA 5KX5A 3W7AA 1HQDA 2BW0A 2VTDA 1M7GA 1EWRA 1R15A 4EHHA 1D6NA 5C8VA 5BW8A 5A7GA 2C4WA 3EK2A 2C59A 3M1LA 1WCXA 4D02A 2EV9A 3EWAA 3G0DA 4EGQA 4QDUA 4C43A 4WKBA 1UBSB 1ECJA 5DRYA 1M0SA 4KVFA 4MYCA 1HO3A 3NKFA 4M60A 3AEQB 1Y5MA 3H8VA 1AQ6A 3I61A 4Y2QA 4YRQA 2XITA 3FOAA 4HJRA 5IAJA 3U81A 4KAJA 3V4FA 3K0BA 4ZOAA 3CEAA 2FEPA 4YRLA 3FTDA 4S12A 1BXKA 1V26A 2W42A 3C8DA 3VX3A 2FSHA 1GJRA 4FMPA 2VDMB 3FYDA 3GGSA 2A92A 1YUBA 3O1JC 4XVRA 3V42A 4OV6B 3I0NA 2A5GA 2AVDA 5G3YA 5CM2Z 2D1TA 1YR6A 2GVNA 3ELUA 2IH4A 3CIOA 3GR6A 2IVZA 3VR6A 2IYOA 4YRAA 4Q1EA 4RY8A 5CDGA 2QGFA 1NWCA 2FXVA 3GD7A 3M6MD 1DJOA 2CMKA 3A1UA 4PYKA 3FLMA 4V0KA 3F4LA 3OIYA 2H8GA 3GGPA 4U5XA 5GV7A 3O9MA 5J2TB 3KFLA 5I9MA 3SBDA 1JBKA 1I36A 1U3VA 2C5EA 2JAXA 3H11B 1EG2A 3PC6A 2QJFA 5EUBA 5I9NA 1OH5A 4OSOA 4JP2A 1PTJA 5I7RA 2PAAA 2ZAYA 3VSEA 1RYDA 5JT1A 5LLTA 3ZDQA 2PUBA 4YQYA 4Q4HB 3IKTA 4WXRA 3C5HA 1TT7A 1NTOA 1S2MA 2QTGA 4JI6B 2J3DA 2BKEA 3HPRA 4N5DA 4Q4DA 2P90A 3SXUB 2VZ9A 4AW9A 2J7PD 3ESRA 2Q3EA 3OBBA 3VPCA 2B8JA 2VSNA 4UUOA 5DGDA 2H07A 3ORRA 4J94A 3TRJA 4A10A 3OKCA 2BGKA 3GFSA 5SZKB 2HJSA 2WPDA 1LZLA 2YJ5A 3IKLA 5CVJA 2OCPA 4XM1A 1JR6A 4BMOB 1SKYE 3IIMA 5F1YA 4YPOA 1MG5A 2OLKA 5FT9A 3QVLA 2WJ3A 1WKCA 1DBQA 1FW6A 2J09A 4UNPA 4DADA 2OV4A 3PPWA 1TD1A 2D2EA 3UHOA 3K6JA 4FS8A 2Q9AA 3E2MA 4QGHA 1LBEA 2VXOA 4U8GA 4NXNB 5G41A 1PZGA 3CRNA 4G8CA 5WRFA 4XWKA 3BZWA 3TLGA 4XFKA 3D3NA 1YDMA 5L95A 2NG1A 2V5VA 1FNDA 2VXYA 3K9GA 3TAXA 4ZT6A 1XN1A 2PO7A 4OXKA 4ZVKA 1ONPA 5FOWA 4KWEA 1FTQA 1UK6A 1N5KA 5FA8A 2XNDD 4QULA 4LVCA 5EIXA 3FNRA 2GBLC 2J3MA 1WPXA 1RBQA 2QRGA 2R44A 3DC7A 2BDEA 1P1BA 2ZR7A 1RI1A 3BK1A 3M3HA 4M46A 4O4HA 2HA7A 3N2KB 3QLUA 2CHUA 2WM9B 1Y8RB 4QNNA 3GMIA 4DNQA 1O9HA 2RHWA 3BQ9A 1CB7A 2MINA 2ZJYA 3FRIA 3GJ4A 1GR1A 4AY4A 2Z2ZA 1YF3A 3G2JA 1PZEA 1CBUA 2AUNA 2ZIWB 2IZ0A 4Y6RA 3HR8A 3A9WA 3VDNB 3LS2A 3LC2O 4W8HA 5TF0A 1NMQA 3IVRA 2RCNA 1QDLB 1R27A 5BMVA 1RWXA 4D43A 4DLXA 3Q9LA 3WYAA 2OBYA 3UMVA 1YCHA 1XUOA 3O75A 4CKEB 2CUZA 1GQQA 2H4YA 3HR7A 2YV5A 4E07A 4JITA 4GM1A 3STYA 3ZCXA 5DP2A 1R7RA 2EGGA 2BR4A 2VHTA 2KSQA 4HYYA 4X1IB 2VRBA 5H0IA 3OJXA 3OQMA 4EG5A 2O1WA 2FEXA 4OJKA 2GK3A 2E0IA 3ZWYA 4QECA 2G9VA 3FVWA 1KS2A 3CZMA 2AX3A 3JRNA 4G6ZA 5EN4A 3PUJA 4Q7EA 1QP0A 2O19A 2VDUE 3EEYA 3FI9A 5LP6F 1U5CA 2JFWA 1NXOA 1W0JA 1Y5NA 3SC2B 4WECA 2ONJA 2FX5A 3IGFA 3T7EA 1MTOA 2IC5A 4J29A 3OQHA 4UHKA 3ROPA 3Q40A 2VP5A 5A4MS 4CLHA 3UJBA 2MYPA 4RK4A 1YK1A 3P0RA 5JUWA 3ESBA 4UZSA 4E5DA 5HTOA 1YA6A 3SYLA 3FJ1A 1T13A 2R96A 1L9KA 1UMCA 2BGLA 5FR2A 1EK5A 4Q03A 1EP3B 1TU3A 9GPBA 3A6LA 3T1YB 5AVTA 5DJ5A 3Q87B 3ECCA 2BLNA 1BHO1 3R23A 2EATA 3K5WA 4B6EA 4R69A 1HLGA 1TTPB 3FWNA 2IWRA 5CUQA 3R3SA 3UCFA 2DPHA 3VJRA 4GOOD 4M0CA 1Z7WA 4X63A 3K1ZA 4HL6A 1FNCA 3QELA 1J1ZA 1Q3KA 1G42A 1ZD2P 4XGNA 3UIEA 2Z1MA 3VU1A 5G3ZA 3KSBC 1A97A 1JBQA 1PFUA 2WD8A 2GAIA 2PJUA 1JG3A 3DWGA 2AOTA 2DBVO 2DPXA 3R5JA 3OSUA 3NWJA 3HUTA 3DXXA 1BOFA 3ZW9A 4KQ6A 4MV0A 1YGYA 3GLKA 3ZZTA 3B5JA 1QLHA 1XD2B 1H94A 2NTNA 4QD3A 2JARA 3I2GA 3SQOA 1P6QA 2PX3A 4IUBS 2XA9A 3KSUA 1PBTA 5KZMB 3IHLA 2AD1A 3HFSA 1RXEA 4P53A 3FCUB 4DV6B 1KBQA 4D5GA 4YIHA 1SY7A 3S99A 1HDRA 2V1XA 1BDMA 4HDAA 4HGOA 4L5AA 4D3ZA 4D9FA 4JMPA 3KQNA 4NCIA 5IVIA 3HTXA 4DQXA 3W2IA 4QWWA 5ES4B 4WV3A 5DLYA 3TPZA 2YXEA 1NFQA 3RNOA 4MA0A 5BW5A 1QYDA 1ZH4A 3MINA 4RF2A 1Q1NA 5HQ3A 2PJRA 1XVIA 2MU1A 2OV2A 1ZBQA 3S2GA 3SC2A 4URXR 5ERGB 3R77A 1L7OA 4RF4A 2P11A 4JQSA 2PD4A 2XUPA 4JP8A 5CCXA 4XLTA 5HE8A 4N7JA 4B17A 1D2EA 1R50A 1XTTA 4EI7A 5AI6A 3FJOA 3L4SO 4JLMA 4TX1A 1VE9A 5HGJA 5DYGA 1KVUA 2BSAA 3GWZA 4LWPA 2AXEA 1C4OA 1K06A 4JUDX 4R31A 2G5GX 4DV1B 2ZE5A 3QKIA 2W2VA 1CHNA 5CX1A 4K6OA 4CM5A 1AB6A 1VLHA 4K46A 2C58A 3ZDRA 3IKJA 5DNWA 2C0PA 1CZHA 3I6BA 1EK1A 2FR0A 2IK8A 4KX5A 3TS1A 4Z7JA 4IYJA 2ZT8A 4J1NA 2GI4A 4B2IA 3U19A 1DBPA 2WLTA 1M73E 1RS0A 3L1JA 1BQ3A 3HADA 5BSTA 3FYHA 3VC7A 3KPUA 3QKSA 4RZQA 1E6CA 5ABPA 4MS1B 2Y1FA 3FHJA 2W8BB 3S2YA 2RGEA 1II8B 1GVNB 1DNPA 4WPGA 4ZFNA 1KDZA 1Z6XA 1NPDA 1JZSA 1JG2A 2FP4B 3ZZ0A 4E21A 3C3CA 1EVJA 3NTQA 5TSDA 2LGJA 1IJKA 1V8FA 2V7GA 1BDBA 3FOZA 4NJMB 5IDQA 1SUSA 1U63A 1XLTC 3U56A 5IVPA 3D9QX 4DIBA 5KNBA 2F90A 5IDYA 2I34A 3KOZA 1FFCA 1QXSA 4J1TA 3IULA 4MO9A 1L0BA 3IE2A 4FGZA 3TLAA 1VRWA 2QX4A 3IT2A 4Q3BA 4XDYA 2V8OA 3QF7A 3PQDA 3ZHBA 1EEXB 4MUFA 3ZDBA 3VYUB 4CGZA 5JFOA 3WKEA 1ND6A 1KU0A 2PWBA 1JW9B 1LPPA 1JSCA 3FLEA 2A78A 3O73A 2P9YA 2WJVA 2X2FA 4HDCA 3UXYA 3GLFB 4F4DA 1DUIA 3HYSA 4NQZA 1VHQA 2ZZKA 3WYCA 1MFZA 3J81k 2NVUB 4QDZA 2JGLA 3KD2A 2ECOA 1Q84A 1NR1A 2Q07A 3FMGA 4GEKA 1RQXA 1P1CA 1A72A 2JD2A 3NNSA 3T7JA 1E3JA 3D6TB 1SZDA 1E2KA 1DTSA 1GSOA 2Q2WA 4WN3A 5DGHA 2HLNA 1ARZA 1FJ2A 2J9FA 4RTPA 1FRFS 5BN4B 1CZUA 1FDVA 1LPBB 2HMYB 1WZIA 2X23A 3KXKA 1WDMA 4MRPA 3OQBA 4O3FA 3VZBA 1KC3A 3HXTA 5AOAA 1Z4MA 4OHRA 2YMPA 1YIOA 5EZYB 2NUAB 2JS7A 3DS8A 4JI0B 4XWWA 5IN4A 1DCKA 1R10A 4JX8A 1Z4OA 2I3ZA 1EFLA 1RMTA 3NFYA 2AB0A 1KBZA 3NZEA 4ZVNA 3SFTA 5IJZA 1AKQA 1BO6A 1NF9A 3FGNA 4KJXA 4A4DA 4JL5A 4AKEA 2A14A 1NI4B 3E9CA 1NBEA 4N0PA 2G4LA 3CEPB 2QLBA 4G2NA 4N5NA 4WNAB 2F8LA 2RFLA 5IJ9B 1NYQA 2DSNA 1P1RA 3CVJA 2QN8A 3WP0A 1XQ1A 1ORHA 1EX7A 1ZCJA 2HREA 4FDMA 1KIFA 4L5BA 4MIYA 4WK6A 5EMJA 5AKIA 3TZQA 2GFHA 2X8AA 1R4NA 4LZNA 1PR3A 3AI1A 3E4DA 1KKLA 3L5KA 1L4YA 5F2KA 5IN5A 5JDCC 1RYFA 5T8KC 4MGEA 5MHTA 2JDID 3DOEA 1ZNWA 3EZ6A 2I3DA 3C7AA 4CPDA 1V7ZA 5BWOA 5BV8A 2W98A 4B0PA 1I5OA 4K0RA 1NVTA 5DHUA 3H4MA 5FBLB 4FZ3A 7ADHA 3ZWCA 5LOVA 5ADUS 2H29A 1T2CA 4M9QA 1MOZA 3HACA 1BU8A 1NVDA 3DV9A 2OB2A 3IVMA 3PYXA 3CF2A 2R7MA 4NG4A 4W9NA 5ALEA 4GDFA 4QATA 3I45A 1WSBA 2Q5JA 3F6SA 2IYFA 3KKQA 1MGPA 2VHXA 1CR2A 3NCTA 3WWOA 1L5YA 2VUTA 5A5DA 3PC7A 2GK7A 1L3IA 4MV7A 3GUUA 5TQ0A 1AKVA 2IPAB 3G2MA 4RVUA 3GUZA 1RKXA 1LS6A 2ZWIA 1IE3A 1KNXA 3ZQJA 1H3EA 2X8JB 4LSWA 1I2DA 4BMYA 5FUQA 2GESA 4DV2B 1K6MA 4MJ7A 4MYUA 5CTJA 1CQIB 4C0SA 2XB8A 3H1TA 3FVTA 5K2OA 2RB4A 1Z2EA 3GBSA 2OBBA 1NC1A 3A6EA 4LV6A 4Y67A 4E2FA 3WG9A 1CETA 3P71T 1BXRA 3CLKA 3DZIA 4UEWA 1RP7A 3MK31 5ESDA 2PYDA 4DR7B 1F2TA 2HIAA 4UBLA 4E1VA 3WBJA 3V33A 5FLYA 4AB1A 5JEDA 5LM3A 2QMUA 1IJEA 3N2ZB 3OLVA 5C51B 4JHXA 4M49A 4YJGA 4RJJA 1ONSA 4C3ZA 5DM60 1Q91A 3N0VA 4M6WA 2C4NA 3FOFC 3IA2A 1E63A 3DZGA 4FYVA 2W2MA 3M89A 1EVLA 4Q82A 2B7CA 3TGWA 4DCGA 4PBRA 3VTKA 4F0JA 5IF9A 4FHZA 3EWIA 4V0ME 1T6YA 2ZDHA 4K2AA 1J21A 1BVUA 2Q5IA 1N3YA 4BLRA 2ADFA 5TS2A 1GKKA 1ZMXA 3FRHA 1GCOA 4KFUA 3JW8A 3E8SA 4R98A 5JV5A 2JAWA 3SDSA 3F78A 3BWBA 5FPPA 5AW2A 3A0UA 3DONA 5J4YA 2OY0A 4UCQA 3BHNA 5IKEA 1FL9A 1HRKA 1P18A 4ER6A 3O31A 3IIIA 3K32A 3NOOA 2JFZA 4KGXA 1WP9A 3D6FA 3FMFA 3I9MA 4RGVA 5FI0B 1YD7A 3V55A 3NBMA 4RQUA 1N4DA 5EJ5A 1FIUA 3M6WA 2C78A 3C3AA 5DHSA 2V4ZA 3CE6A 4OVKA 3VZCA 1D3AA 1XRNA 4FGUA 2FX3A 3LUJA 1VLLA 1WBBA 4C6RA 5B57C 2ERCA 2XGOA 2YL2A 3ICEA 1JIKA 4FYWA 3IIKA 3L7OA 3DFUA 4BJ3A 4CLRB 2GXQA 1K2WA 3BSFA 4ZHQA 1AGYA 1R18A 1Y89A 4O2BA 1XWIA 4HVCA 3NOQA 1JGTA 1PJRA 2PKWA 3BF8A 3P9QA 1U1CA 1YJ8A 3ZKWA 1MJ5A 4DMFA 4LE0A 1QFXA 1NQOA 2BM8A 4DJAA 1NJ6A 2JW5A 2O0JA 3OWOA 3USCS 3E35A 4G8DA 3MWJA 2Z58A 1NPTO 4PAGA 2VJQA 4PLPA 4IDOA 2A9PA 3COZA 3NC0C 4N41A 1ZN9A 1Z9BA 3K70D 1R8SA 4NE2A 4NJEA 4GWLA 4RMNA 2Z4TA 1W4CA 4JKOA 4LHEA 1J4AA 2ADOA 2F1IA 1OBFO 3H5TA 4D57A 3U9LA 1JQJC 2E1RA 4M3NA 3ZGYA 5AW8A 1DKNA 1XKTA 1K8XB 1XAJA 4PGHA 1QBKC 4YP1A 5KYWB 3L0YA 1DZ3A 2E4YA 2JD0A 2C4MA 1T9BA 4OLJA 3TQFA 2WHRA 3FFTA 4I9UA 5ALSA 5FO1A 4XW2A 4U0KA 1CK4A 1GFIA 5J4VA 5JHHB 1CF2O 3EIUA 3EGDB 4F6RB 3OESA 1GSAA 4NNPA 3U7EB 1UMBB 1L7NA 2IEIA 1ZK4A 2NGRA 4U6SA 3ZDYB 3M6UA 1T8SA 1AS2A 1RJ9A 3FA2A 3MWGA 4N6GA 1Y0BA 1IBSA 1I4EB 1F4PA 1JXOA 2XGGA 1QV9A 1W6RA 2P6UA 3ADDA 4QJ3A 1O95D 1INLA 3UJCA 1PBNA 1RLOA 2P9BA 5DI3A 2EDCA 3SEAA 4ASUA 2BP7B 4D0LB 5ALZA 4G5OA 4PY2A 2IUSA 4HVAA 3L43A 3C7KA 1NW5A 1THMA 2JGAA 1PZHA 5EJAA 3D6AA 1U28C 5LDHA 4AXBA 1LK5A 3MB5A 4NBRA 5C53B 5IVHA 3MUOA 2WHQA 2IS6A 5MGBA 1HZZC 1VXOA 4ROSA 3D3WA 3CUWA 4TQAA 1US8B 3CVYA 2PLAA 1H5NA 4JLWA 4M76B 3C6MA 4N0DA 2PSJA 2OZPA 4RHUA 5KYYB 3ED5A 1QORA 3KKOA 1U04A 3RIHA 4HBZA 4DC0A 2QZSA 3FN4A 3KR9A 2C7BA 3HDTA 4KQ9A 4YXWA 3UEOA 5IMBA 1QR6A 3Q1LA 4ND7A 3H42B 2HLHA 2XV1A 3H99A 1K2VN 4C30A 5MGNA 1AURA 1TQDA 1YMVA 2HMTA 2PGJA 4TMTA 4CDNA 3OJEA 3AP1A 1OX4B 3AKYA 4TWJA 3JQ8A 4L7QA 5SYAA 1ZJJA 2W6ID 2I22A 4EY7A 5JAOA 1QDEA 2NMVA 4BPRA 1J8VA 3D0KA 1TM3E 3R6LA 1JJFA 4JQYA 3P2JA 4KAAA 4A0QA 3PHJA 2V3VA 3PJFA 3AKCA 5K8JB 1Y1TA 2OGUA 4IMRA 3AL2A 1P1IA 2WMDA 3IPAA 2B1JA 5BQOA 2VOEA 1HR0B 1U2ZA 4WADA 1LUAA 5AH0A 1ZY2A 1K7SN 4H1HA 3UMBA 3FVQA 2O2GA 4C1BA 1QH9A 3FSGA 3QPWA 4R01A 5GONB 3WWCA 3QE4A 2IQ5A 2PEYA 3L8ZA 4FI3C 2GETA 1N3IA 2BIFA 2EWWA 3A8TA 4MHSA 4B80A 5BSGA 2Y0EA 4NEQA 1WMFA 3LT0A 1XMQB 1O6BA 3WLQA 4OGKA 3ZTWA 4KWCA 4J0KA 4NAVA 2CHVA 3VU3A 1W30A 4MUXA 2QVCA 4XWAA 1WUIS 5EQDA 1SCIA 1NVGA 3MERA 1HG0A 3LI2A 4WKNA 3SR4A 3VPHA 4YUXA 3TKLA 1Z6PA 1ZKMA 3N86A 3M1IA 5BXYA 5CPFA 4YALA 5LL6P 3M3DA 5I48A 1W9HA 3BERA 3E9DA 3DYIA 2H4ZA 2GAOA 1KMQA 3LBFA 3QPUA 1IAQA 2PZEA 4KPUA 5FA6A 4K81B 1E7QA 3STXA 1FMLA 2IWHA 1Z5NA 2GHIA 2H5IA 4ZYTA 4TMKA 5DGXA 3ISJA 4OYYA 1PQPA 4NBNA 3RU7A 2PS1A 4LJLA 4ZVRA 2CJPA 3WE7A 2J0SA 2X40A 5JR3A 1W36C 3OJWA 4PS0A 4TOIA 5K1ZA 4I46A 3PP8A 4R8RA 4MVJF 3DFIA 2Q7OE 3UWOA 3X2SA 4Q19A 2QUZA 3CCFA 7AT1A 4IH9A 4QAJA 3ER8A 1SHZA 1UZNA 4RMJA 4MCHA 3C6QA 4AQDA 4EHBA 2D2XA 1KDYA 4LHXA 4PLVA 1TM1E 3DYBA 4TVKA 4RLHA 4ZQEA 2GJSA 3SZLA 3T5DA 2JI8A 3EUWA 3TNDA 2ONKA 4G23A 1OLUA 4IMIB 1XXLA 3G1UA 1OTYA 1FS5A 3EVAA 1YJQA 4C6SA 3R5KA 1EJBA 1GLGA 4NYJQ 1DAKA 1KVQA 3LUKA 5E7JA 3TIXB 4ZDJA 2CDNA 1YZVA 1DKUA 1YMUA 5C31A 3PRYA 3IALA 1NJ1A 1G8GA 2J87A 3EJ6A 3RS8A 2J45A 3D4IA 3VGJA 4BWFB 3D7RA 3BAZA 5H4HA 4Z7NB 1XQXA 2JZCA 2QTHA 4Y2PA 4YJFA 4WBNA 2D1QA 1JQAA 3C3BA 4MVJH 4Y3UA 5CB4B 4C2UA 2AMYA 3AWIA 1N7GA 1N36B 1BX3A 2JI6A 1C1XB 3WLJA 2JG3A 2QN1A 3G7UA 3AVPA 3BC1A 2HQSA 4Q3DA 5E3IA 2HNBA 3EHEA 3ZUPA 1QZZA 1Y48E 3W2HA 1DAFA 4RKRA 2OBFA 1QVWA 5ALMA 2V6JA 1UEIA 3SHQA 1K7CA 4FN4A 3QSYA 3TTTA 4Z3OA 1DDOA 1ONBA 4AJLA 3G5UA 2G72A 4KUEA 5FUXA 5JCJD 4MUKA 3NNDA 2IYXA 5L4LA 3Q8XB 3RS7A 4L76A 3ELBA 1L7EA 3LZDA 4BB9A 13PKA 2ONZA 1ORTA 3ET4A 3B6ZA 5B1HA 5HQTA 1LSSA 2UZ1B 1K4YA 3HSYA 4W1RA 4WXPA 3I72A 3WV5A 5AUPB 1R9GA 2H1IA 3ZGZA 1QX3A 1H2YA 1ZEJA 3FLAA 4HMOA 1ZMBA 5AM3A 3IEXA 5BT9A 3B53X 3K1YA 2XECA 2FW8A 2WAAA 3PC3A 5DASA 3H17A 3LQ2A 2B8WA 2IYZA 4NENA 2FUG1 3LVFO 1L5WA 3FPSA 2PPLA 1G55A 3AHDA 1PSDA 1EA5A 5H83A 3VH3A 2G70A 5I4BA 3HY6A 1KRXA 1CUSA 3BWVA 1D1SA 2ASEA 4YRGA 1CR6A 5BSVA 2ERYA 4GOND 3AR9A 1C80A 1BXGB 3TQHA 1EXMA 4X7RA 2VQEB 2OHIA 4M7RA 3C98A 1HX7A 3Q88A 1OF1A 4LEIA 4L0CA 2ZYRA 2HWYA 4Q24A 4CKCB 1UJ5A 3DR3A 3Q5DA 5I3ZA 3AJRA 1IZ0A 1KR2A 2GJKA 2YWBA 4X6UA 3HO8A 4DDUA 5JRJA 1RBMA 2QB5A 5JDIC 1KVSA 2PIDA 3BD8A 5I7AA 1S1CA 3AR8A 4WZBA 2IZOA 1E3LA 2Y66A 5DISB 1RPZA 1ECCA 2VYND 1HFKA 1NNUA 3F7TA 4MA4A 1QTNA 3UHAA 4EATA 1MNQA 4LBVA 2HBRA 2RHBA 3W6PA 2QRPA 5G0UA 1IC6A 1EDZA 1KBOA 1NVXQ 2VAMA 3RSLA 1NE2A 4RD3A 4U7DA 4TRMA 2PH5A 5H7XA 2ERXA 3JZFA 3SS7X 4HUQB 1Q92A 2H2FA 2HJRA 3L4BC 1U8ZA 1PJAA 1WQ4A 3I34X 4ZICA 3KB8A 4PQFA 3RRNA 4P5DA 3C24A 1GRCA 4LJYA 4UEJA 1FX0B 3EXG1 2PRJA 2H00A 1ES9A 3P9PA 1GD1O 3EWSA 2VHCA 3OZRA 4QWMA 4URHA 2WSSA 4BBJA 1UANA 1U9IA 4BFLA 4AQ7A 1VMAA 1FJGB 3WQBA 2PZ8A 3ZGVA 4K9PA 3KKNA 1A0OA 3KSZO 4A0FA 1L1FA 3PX7A 5TPWA 4KQEA 1OLSA 2ZBPA 1QIJA 3RFVA 1FDUA 5T41A 1Q1AA 4EG1A 1PL6A 1KY2A 1MBZA 2J5RA 2OO3A 2GH1A 2QRUA 2Z04A 1X9HA 3B78A 1U9JA 1NXPA 2QMZA 5EUMA 3T12A 3NH6A 3BGSA 4YCMA 2QAGB 4PC7A 3RTGA 1JA1A 3PLNA 3U26A 2WZCA 1RBYA 2ZQ5A 4TSRA 4C05A 1T3HA 3C3EA 5J47A 3DV0A 3SQMA 3GCDA 3O83A 4N12A 1E60A 2O7NA 3L0IB 5JVDA 1ESZA 2R11A 4S1WA 1PUJA 4NPCA 2C57A 1KO4A 3AY7A 5FF9A 3AESB 4W7SA 1TF7A 2FZGA 5HFAA 4RTLA 4JP1A 4IKEA 1FYWA 1E2UA 4AKHA 3Q7EA 4EUFA 2VCEA 4R41A 1W44A 2NU9A 2OO5A 4F3RA 3PSHA 4IDQA 4UVEA 2P7IA 2Z6VA 3JZMA 1UOEA 4S0XA 3FTQA 1X92A 2B7BA 2IIVA 4HAYA 1W0KD 2PYZA 5BWCA 4DCVA 3TH5A 1KP9A 1PG2A 3I6IA 2YY7A 4CRWB 1E1LA 1CUBA 1ZNZA 3DF9A 1WWKA 3TDKA 2B34A 2PKEA 4KQ1A 4LQ4A 1SHJA 3WK5A 4DANA 4BP9A 4M9SA 4AY3A 1IY8A 2P4QA 4BNHA 3B9PA 1RYZA 2VP4A 3L93A 1R0RE 3FG9A 5LNK1 1H4SA 4HAZA 1QV7A 4B2LA 3DGFC 2BZSA 3ENNA 3R0JA 4JOQA 3F8TA 5CVCA 3PDUA 4XJTA 2BAGA 5EAIA 3OVMA 4DC9A 1X13A 1U99A 4QXPA 4O25A 5CBKA 3LXMA 1M5RA 2Q62A 4RK0A 3QEMB 5DWVA 2GAAA 4RJLA 3MC1A 5JS2A 4JELA 4A5SA 4GYWA 1BFDA 5LZ8A 3RYHA 3SBEA 5KMGA 1X39A 2XYGA 3QHPA 4XLLA 1DCFA 1P9OA 1FYXA 4GI3A 2VHQA 2R9VA 4P84A 4COKA 5EKSA 4QM7A 3OIWA 1BWPA 2ZSBA 3D8SA 3VH4A 4CQLB 2H65A 2ZLBA 1X7WB 1V1RB 3LQRA 2QTAA 4TS1A 2CJXA 2YNMC 4AS2A 4RX1A 3G13A 5JYBA 2CV1A 4ZRDA 1SXGA 4XASA 1XNHA 2WSMA 1VRCA 3GEIA 1A77A 1T5LA 2OFOA 3PR3A 1A8QA 3HDQA 4RIGA 3QP9A 1G7TA 2ZYUX 1KVTA 3OKAA 3OTGA 4HGPA 3DEZA 4C5AA 2DETA 2NUPA 4YI3A 1U2DA 4U8HA 4Z4FA 3DMHA 3R3JA 4IGAA 5HKBA 3K6KA 1ZEMA 4AO6A 1XRPA 2H0QA 3H0KA 2YWFA 4FR5A 3PQ7A 4WJLA 1H42A 2ATEA 4FP9A 2CVQA 4RGBA 3J80A 4O3MA 1LNSA 2DM6A 4FE7A 1RQPA 4ZCSA 1C3OB 3X2EA 1U7DA 4UPEA 4QYIA 1OAKA 1W1WA 1NM5A 2HH9A 2DHDA 3C8HA 3JRXA 3LX8A 5I9SA 4CG0A 1Z63A 2FA9A 3QXCA 2VQDA 3PNKA 4GRDA 4XUGB 1X2EA 2I2WA 1M1XB 1EP2B 1A5ZA 4URZR 4FE4A 4IICA 2E5LB 3PXEA 4OI2A 3ILXA 4F96A 2Q8QA 3PVSA 4PGGA 2PSFA 4MTLA 1KQFA 1IRIA 3MTGA 4WUTA 3A6DA 5I9TA 4TMVA 3ZXSA 5CDFA 1XJCA 3V3TA 4B7XA 4GF5A 1V71A 2I76A 3GPIA 1OFUX 5FI5A 3R2JA 4FX2A 3P9RA 3VJLA 3FYUB 2YICA 3FNEA 5EMNA 4NU8X 5KREA 4JGGA 4HNQA 4YI5A 3W5JA 3EG9B 4PZPA 4TUYF 2NOAA 1KETA 4MUAA 4MVJP 1J2UA 4OJQA 4RK7A 3A1NA 3ZK8A 2WEKA 1OZGA 3BWCA 1GA4A 3IAUA 2OD9A 4JOSA 4M9XA 4O4JA 2I6XA 3E3OA 4R0NA 5DNEA 4MOWA 5INTA 5K7SA 1ZCAA 2RC6A 3GW8A 2GQ0A 4NH4A 3CBGA 1BDJA 4IV0A 3WO0A 2EYQA 3W90A 5C7LO 4ZCIA 1PEAA 4U2EA 1Z4PX 1KK2A 2O07A 2QI9F 2R68A 3K05A 3O84A 5FBWB 4JQCA 4J16C 1T25A 2QRMA 1JEQB 5KJ1A 3VX4A 3HKCB 3JQBA 4NYJR 4NZYA 3JQGB 1U2RA 4J4HA 3A1CA 1HWYA 4WK4B 5F5NA 2BE9A 3RVJA 3VR4H 3GJYA 4DXDA 5K0JA 1CZOA 2M32A 4LMBA 3Q3HA 4B81A 3NXKA 4JBWA 3SEQA 1XVUA 5M3BA 1M8PA 3V80A 1LTHR 2H59A 4LE1A 1D2GA 1C9MA 2C3PA 5E4JA 1UBLS 3HDVA 1FFWA 3OQIB 1R6BX 4MDYA 3TECE 2ZB2A 5KVAA 1IZYA 3TW6A 4L9AA 1JSRA 2E5WA 2YJTD 2BV3A 2B0CA 3CLVA 4IQGA 3RE1A 3AV0B 3ADKA 2CDRA 1M2OB 3RSOA 2ECPA 3SFZA 1SFRA 2HQRA 1IY9A 1UH5A 1DELA 2IHJA 2JGEA 4H59A 5G1PA 4WVLA 1V3TA 3BZBA 3I04M 4W1PA 5B36A 4DQUA 4LBYA 1RT9A 3QFFA 3K9HA 2TECE 4MVXA 4B09A 4F3NA 1TEZA 1UAAA 1YNOA 1ZFNA 4V3CA 1R6XA 4FSDA 1SQFA 2XVYA 1NPYA 1GCIA 4PVCA 3T4XA 3TJZA 3EY9A 2LZ0A 4UHCA 1G21B 4E2WA 2X3FA 3KOXA 4IIUA 1AGXA 2CF5A 1FU4A 4UOQA 3IUQA 2G0NA 2OBMA 2V7QA 4GMKA 4ZQHA 4DSNA 4P4TA 4BNWA 3DJYA 2O48X 2X7HA 1TCAA 2DH5A 5DN6A 2ZYAA 5EHGA 4CMKA 3PKJA 1R5BA 3REFA 1OJLA 4MIEA 4W5HA 5J43A 4ZK2A 5AVJA 5CLLA 3U16A 3G85A 2EJVA 5ILQA 1EJ2A 1I7PA 1M72A 2XB6A 5LDGA 1JDZA 1DPGA 2DZDA 4E08A 3TUIC 2QKYA 5G4LA 5C4IA 5JNWA 3LYUA 3MSXA 3FSGD 3ZY2A 3ANLA 2RGWA 2FN4A 3O4GA 3CFYA 3S2EA 3VI3B 1VLJA 1QPZA 2X77A 1YZTA 3A4YA 3N70A 4DOMA 1SIOA 2FW1A 3QE2A 3HJBA 1JIXA 1YK0A 3LO8A 1A1SA 2QNIA 3O2SB 4DV7B 2DBQA 1YRQA 2VDPB 5F1KA 3CLTD 1I3NA 5AK0A 3KSRA 5LMNB 3KT6A 1T3LA 5DM2A 5DYTA 4RVSA 4L08A 1JDBB 1Q14A 1ZD8A 3KHUA 1NXXA 5J59A 4F1JA 1VC2A 4O59O 2OVFA 2QRVB 3L7DA 3PC4A 1AZWA 2P69A 1JVBA 2LWIA 1DINA 4HAUA 4JGBA 4WXYB 4XAQA 2B83A 1SIWA 1FW8A 3KZOA 5K3AA 2OHXA 2ZB7A 5LQJA 4UJ3A 3CVWA 3I2IA 3ILVA 2WB4A 3RH0A 4OSPA 3LWZA 3C85A 2BH2A 4H3VA 5SY4A 5JSHA 2WVHA 4QC2A 3OJFA 4OHKA 4V1CA 1UXKA 4H1TA 3NUQA 3RVDA 2Q9UA 1JJBA 2Q41A 2Z3VA 5ENVA 1R3UA 1C0PA 3Q7RA 1X7XB 2WUEA 4HDMA 3QI7A 5KWSA 1KJQA 3QHQA 4BN4A 5DYNA 2JLZA 5AI4A 1RMYA 2DC1A 3RVQA 3ZJTA 3DMRA 1WVGA 3VYTB 1BA3A 2WWGA 1V9LA 4U63A 1VG1A 4EEZA 1BIFA 4UDNA 1NULA 1R0SA 1BEEA 1GZDA 1NUSA 3ICOA 3FBTA 3H5OA 1BMQA 1CR0A 5JH7A 2ICAA 1R2QA 1G8AA 1PFQA 3EXHB 3N8DA 1PEKE 2XQGA 5TMBA 2XRZA 1QWSA 2ACEA 4OFBA 3W8NA 5BOVA 3L9XA 5HEKA 4C06A 2B7LA 3OTHA 3A4LA 4A16A 1D7OA 2Q9BA 4P38A 4JT4A 1YDWA 1DRKA 1DC8A 2DT5A 2RSLA 3PK0A 4XD2A 3HO1A 2ZXEA 1ICIA 3RUPA 2WRZA 2C8JA 5FFMA 1GPH1 3IESA 4WNYA 4DYDA 3T7SA 1XZBA 3F9CA 2IYVA 3KOWA 2XYHA 2Q6LA 2KM1A 4XFDA 1GSIA 3ZWQA 2P2YA 1TIPA 1T1IA 3UQZA 1FDWA 4L3OA 1JT9A 4LY0A 5DO9A 2GF0A 2VPQA 4FYPA 4GLLA 4LKOA 2D0OB 2P6OA 4I36A 3GIDA 1ESEA 4AJJA 2P1DA 1XX6A 1LQ2A 2BFEA 3DMPA 4L9RA 3FPLA 4MGKR 1E89A 5AKJA 1JI0A 3GAZA 5EE3A 1JQ3A 4Q4CA 1B0AA 5FWXA 4I6JA 4BX9A 1EFRD 4ZO8A 1E79A 2C2XA 2VZ8A 4GM4A 4CTKA 3VHRA 4EB8A 2QQ5A 3WLMA 3WZ2A 4EWLA 1C9DB 3SYNA 3NYRA 5HZHA 1EP9A 4C4YA 1YFJA 2C20A 1QVVA 2P77A 1N2ZA 3A4VA 3HA2A 5C5DA 2EX1A 2YBDA 2ZIEA 4OEHA 1CUIA 3CW8X 3LA8A 3VDXA 1SZCA 2ZVQX 2HBZA 3AM5A 1P0PA 3B3AA 1QLWA 4KGVA 1VSQA 3O92A 4QBIA 4KFTA 1C7EA 1MKYA 3EZ7A 4EABA 1WPQA 3GPCA 1OIVA 1Q7TA 1T9DA 1VXRA 3RRYA 1XG5A 3KJZA 4PZ0A 521PA 2ABWA 1E96A 4X20A 3M9WA 4PC6A 3JYHA 3O8DA 3C74A 3F5FA 3LA6A 3TEFA 4FCTA 2LDXA 5EKUA 3RFFA 5DV9A 3FYCA 2Q0HA 1MABA 3JAWA 5KYKA 1U8XX 3STVA 4IOKA 1QCCA 4KTTE 1U9YA 1ENPA 3CY6A 2H1RA 3L0DA 5SZJA 5B5SA 4OHUA 5FPHA 2EXXA 2P8JA 4OLFA 1C0EA 4RTMA 4Q9JA 1S7CA 1E1QA 2J3QA 1QGED 3BD6A 4M9UA 4KR6A 4HKTA 1IMOA 5HF5A 4MB2A 4Q21A 1UJMA 2HXSA 3JD4A 2FFHA 3LY7A 3G5LA 3HY3A 3KEGA 3ND8A 4UE2A 3P9NA 2OPHA 1UT8A 2CD9A 3UPDA 4N5HX 2ZFUA 8OHMA 4BN0A 5KOHB 1WA5A 2KLHA 1XCBA 2FZVA 5DFAA 5B1DA 2X9VA 1VRVA 3O7WA 1A2QA 1A5BB 4GL2A 3GNTA 5JSFA 3KJGA 4UHFA 3BXXA 3DB2A 1DBWA 1MX1A 2VUUA 2D0IA 5DNDA 1HT3A 1PS9A 3TUZC 1YS7A 5D7BA 5DLDA 4CFYA 3R7BA 2RBEA 1ZC3A 2FV8A 3HV2A 1YQ9A 3HYRA 2YWHA 3P94A 1QH8A 1H8EA 2Y76A 4QFMA 1S2GA 1FFSA 2Q7DA 2DLNA 3QX3A 5KYTA 2O2HA 4ZAXA 5SZHB 5IT0A 2EJTA 5DPMA 2O7RA 3LC1O 4DGQA 3NJRA 4Z0HO 2CBXA 4RO0A 5CLIA 3NDRA 2OV6A 3N2NA 1CLEA 4I50B 4NV3A 2C99A 3FUCA 1ZG3A 3D0RA 1T5BA 3FOWA 3EULA 4XSGA 2I91A 4V03A 2FDCA 3RWOA 1J2EA 4J6FA 4YLEA 2ZJ1A 5TR9A 1M1NA 1B0ZA 2ANBA 2QQEA 2PT9A 2BKUA 3GARA 2A30A 3O8OB 4NPAA 2P2SA 3KXIA 3KIPA 4FWBA 4QE3A 1G0OA 2WVGA 1HE3A 1EBBA 5K3BA 1DC5A 3COPA 3UMSA 4IGKA 2BFOA 4X0EA 4H7DA 4II7A 3ZW8A 4QDTA 5KKCA 4PLTA 1YL5A 4FDTA 1KARA 2IU3A 4WCFC 3Q2OA 5JWRA 4C0XA 3HGTA 3COSA 4UQOA 3VPAA 4CM1A 3G2HA 4CM8B 5CDUA 3MWEB 3A6PC 3UTCA 1B0PA 3HA3A 4NMHA 1A9OA 1DWUA 4PVDA 2WKPA 3NAQA 4G5RA 4QUDA 2AIRA 3K0CC 5E6SB 1E0AA 3QVGB 1DI0A 4CGYA 5I8WA 2G9NA 1U3WA 1ODFA 3EQ7A 4B3TB 1L5OA 2F3RA 3PWTA 1H22A 2V6BA 3DNFA 1U3CA 2ZPTX 2AMJA 1LZKA 5LA6B 3CF6R 1HORA 4Y6GB 5FI1B 3NC4A 4IS2A 4G63A 3SX4A 4N48A 1PZMA 2Q5EA 3G2QA 4CCSA 3RVMA 5EE0A 4L72A 1RQNA 4Q3AA 1IQ0A 3KR1A 4ZAWA 3VR5D 5J23A 3MJHA 2Y71A 4J9UE 4MQ4A 2IF2A 4MMYB 1P31A 1DJPA 4BRZA 5FOXA 1ZRSA 1QX4A 3WIDA 1DWPA 1O94D 4UEQA 4Q18A 2HL6A 1T3TA 1LVHA 4V0LA 3HBLA 2BUBA 4XCXA 4OM8A 1J8QA 2H5LA 3RT7A 2WV9A 3QH4A 1YFZA 5DHTA 4MWSA 5LB4A 1L7MA 3EX7C 2W48A 4RFLA 5HVNA 3GYGA 3TFWA 1URPA 2XKJE 3AG6A 1V8PA 4F8EA 4P32A 2XGJA 1RLUA 4YRTA 4P2BA 1JHPA 2AZDA 5EMHA 1BA2A 5CNIA 1E2QA 2NU7B 4CDGA 4F56A 4WLUA 1Q0UA 1TJ3A 3DLPX 1DL5A 5L3ZA 1VPVA 3QLTA 4OM7A 4NJOA 4U7WA 3AKZA 4O2AB 2P0AA 5J4LA 1T8UA 2XMPA 2PV0A 2HWUA 3G17A 4O6VA 1FF9A 5AOVA 5TX7A 3W2TA 3D7SA 4FM9A 1LC3A 1G5IA 1Z38A 1AUVA 4B3HA 1KYYA 5HKKD 4ZODA 5HOQA 4IIJA 1YKGA 1L8XA 2F1OA 3DZDA 4MVJG 3G88A 1Z8NA 2NP6A 2EKLA 3L79A 4AJIA 5LD2B 3DCYA 3I12A 5IHXA 1T8TA 4PSDA 4ODIA 4YJKA 3B6KA 1Z0KA 4ZTBA 3W78A 2XLBA 5J9FA 2L0XA 3DT8A 3THXB 1Z22A 2HK6A 3EIOA 1LVUA 3ZHZA 1VLVA 4P4LA 1DT5A 3AHGA 2ODWA 4A82A 4JJAA 4LZPA 2B8EA 3BXEA 4MWGA 4Z3DA 5CA1A 1OE0A 2FE4A 1UQRA 1XLVA 3E8MA 1WG8A 2JRCA 1SCDA 3WK4A 4IDEA 4BBPA 2NNWB 5E9WA 5DYWA 4JC5A 5C1PA 5HOEA 2BR3A 3TQOA 3G6KA 3OE5A 5LUAA 1OOEA 1NTRA 1DTWA 3BN3A 1ZJ5A 1W47A 1ZICA 3OOYA 4GAEA 5EUCA 3EGVA 3ZX4A 1EINA 3GLTA 1OI7A 1W34A 1GKLA 4UFNA 3WGGA 4UUPA 2DT8A 3GZ4A 1KEEB 5ETJA 2ZCUA 4BU1A 5BYKA 5HS4A 2QL5A 1EGHA 1KJIA 3UT0A 1W76A 1TF2A 1ZRHA 2HJ9A 2PAFA 3DL7A 3UHPA 1YVPA 4P9NA 4LGYA 4BXOB 4WZBE 1F6WA 4CV3A 5KYUA 5BUSA 1J00A 4TZKA 1FMJA 3NYQA 4K40A 3B82A 4IZOA 4E2YA 1NLFA 4Z54A 2OXFA 2P65A 3KJXA 3NVAA 5G0SA 5EKDA 4HTFA 3DOUA 3AOGA 1UC5B 4O4LF 2Q7XA 1QVRA 4O02B 4CT0A 3FDXA 1QCZA 4P0TA 1BWSA 4HXFB 1FSZA 1YVDA 1RWOA 1ZHHA 1TO6A 4WGGA 1Z5PA 1XPOA 2XB2A 4IVNA 5CP8A 2AI1A 5C4MA 2PUJA 5BN5B 2FOLA 3WHLA 3I2JA 4L5YA 5H1YA 1KSGA 2ATIA 3GLHE 3AZOA 5KOJA 2HTFA 5LQKA 2RGAA 2VF8A 1GQRA 4MW7A 5B2FA 2GCIA 3C4QA 2NACA 2E21A 2NU6B 3OUUA 3UB2A 2HJVA 1PD1A 1SO8A 5TQ2A 2REQB 3ZC3A 3QOFA 4YCCA 1UMKA 5AW0A 1Z34A 4IJWA 5DIFA 2CE2X 1YUNA 4HB2A 1IPHA 1FFDA 1YRAA 2TMDA 3JAKB 3JASA 3CZRA 1NUQA 5FWDA 5G0VA 1P2DA 1CJMA 1KI8A 3I4CA 2V5UA 4L4YA 3EMKA 2ZYHA 3GCXA 4IDGA 4MUEA 1O97C 3FYTA 3GJ6A 3RAPR 2VLBA 5IZCA 5AICA 2XMRA 3W1EA 5C8YB 3JALB 3O0TA 4BNFA 1Y7TA 2JFGA 3MOIA 3FHLA 1FVHA 2HNAA 3Q4GA 1RYBA 3V8BA 5BP7A 5AW6A 2J6BA 3R0QA 5CT8A 4TSFA 3P0JA 5FWXB 2P0EA 1E9EA 1YBMA 4Z0TA 1N2CB 1GZHB 3SK0A 2BCGY 4UARA 5ALJA 4AY6A 4C6HA 1Q0HA 1FP2A 1B8UA 2GBCA 1Q0ZA 1DEKA 3IQEA 3MWFA 4BMXA 2BZ0A 1C5KA 1OSNA 2AN3A 1XTIA 2PT7A 1PNOA 3P97A 1L6RA 4DJEC 2O3SA 5KQLA 3DBLA 4OMUA 4OQMA 1HLDA 1LRJA 1LI4A 2ZTHA 2PMCA 3DWIA 4JFAA 4HEQA 5DN6D 3GLSA 3R3UA 2W6PA 4BEBA 1ZM4A 4R1LA 4DMRA 1ZR4A 2HRQA 1IUKA 2JJMA 3I2YX 1ZIYA 1GQYA 3TTXA 4RPIA 5IFLA 5U9CA 5B12A 4LX8A 3NIBA 2AEFA 4HGNA 3KZNA 3AUSA 4WZ6A 1EQUA 2V7EA 2DWQA 5LBTA 5I7FA 1TUBA 2VEOA 3IMFA 4YQZA 3BREA 2WFAA 1LLFA 2O0MA 3LP6A 4YRSA 5CBPB 4YT2A 5CITA 3R3YA 2EW2A 3SKVA 4LC9A 1UPXA 3WGOA 4X66B 4RORA 3IP5A 2ZZMA 3IUBA 1AQUA 3CUSA 4Y1RB 3L02A 3ZTTA 1J9ZA 2X2EA 4BUCA 4Z51A 1GU0A 4HLUC 2JAPA 1XNGA 2AC7A 4HX9A 3U49A 5FPTA 3RT9A 1RWKA 3DLIA 4FLEA 2UU9B 5DYYA 2XD9A 3K6RA 3QLVC 1PSZA 1TMGE 4TVOA 4EPYA 4ALIA 1KEWA 4DBLE 4FE3A 2GF9A 1T1SA 1NXTA 2IH2A 2I7VA 2AG5A 2Q99A 3NHKA 4TKMA 5ITSA 1QLJA 2YY5A 4DT1A 3ZHVA 2AV6A 3C41J 5L6MB 2H1WA 3S81A 2YXNA 2IPXA 3JQAB 4D9KA 2VWQA 4BCBA 4F91B 1OBCA 5F51A 1YU9A 2HY7A 4HNHA 4QOFA 4TT8A 5EZ5A 5ITVA 2QRKA 4RTOA 5FBRB 5KX5B 2O20A 1GNPA 3TGPA 3WTCA 5DEIA 1TAUA 3CQ9A 1K5PA 1NR5A 1RTTA 4XR9A 3JQDA 3HRHA 1IWBB 1R9JA 1OTXA 3DM5A 3IAAA 3IO3A 3LUBA 5HDQA 1ZRMA 3P2MA 4DDWA 3HH8A 1SIBE 4KE9A 1LSJA 3GH1A 2GOYA 3L6EA 1HL7A 4LYJA 2I4IA 3P9IA 1H2WA 1RM3A 1XF1A 3P2OA 4DTCA 4D9IA 5AKEA 4MVJI 1NBIA 3UC9A 3HI6A 3H6GA 4HQNA 3ZWPA 1ZAYA 3I92A 3KEMA 3RSZA 4FMDB 5HTKA 1E77A 3DFZA 4RL6A 4FFSA 4EFLA 4YASA 2P2ZA 2ZYDA 1XTQA 1GUZA 2B37A 4H4EA 3OMWA 1EZZA 1HYEA 1N4AA 4MW2A 2Z98A 5L40A 2V7BA 1LSOA 3UUWA 1J0CA 3H1EA 4ITUA 1G3UA 2PVCA 3WYDA 1UK7A 2R66A 3F0TA 1HE2A 5BQ3A 3FNBA 3MCAA 1WMEA 4C4TA 4EHAA 3ESYA 3I5UA 3INYA 3PHCA 4JNCA 1SB9A 1DXHA 2OHJA 5ALIA 5CHEA 2W2TA 2OCXA 1EX1A 3P0HA 2QQGA 4AZ0A 1RKVA 2FZCA 1IM8A 3DMFA 1Q16A 5DHQA 4D8YA 1QKJA 1DBSA 2EAUA 3H9BA 3R5TA 4MKIA 1S8FA 4PFKA 3A58B 3BM5A 3N0WA 4J2OA 1YRYE 4N3BA 5FL7D 3CUYA 2OWEA 5CFNA 3PIDA 1P2TA 4I4TF 5A4AA 3CEHA 4GFDA 5JPCA 3D64A 2WUVA 2ZULA 3DL2A 3DEJA 1T1JA 4WFKA 2PUWA 3RJ5A 1C4WA 2WTAA 3GJQA 3LBNA 3PEFA 4E4TA 2XE6A 3R9XA 2GBPA 4CM4A 2QENA 1E0KA 4TLBA 4E3WA 4OQQA 4R1OA 2PWYA 1KI2A 4HB0A 3UENA 2FMFA 4KSYA 3VYWA 5GMOA 2J9YB 1NRWA 1JSXA 3KK0A 1AM4D 4IVQA 2LKDA 3KJNA 4LMAA 5HWSA 6Q21A 5KNDA 2H8KA 1UPAA 2CFTA 3BRWA 2Z4RA 2XNKA 2FAXA 3AF3A 2Q1SA 4UEOA 1IBKB 1ZJZA 1Z37A 5IU6A 5C46F 3ZQKA 4ARIA 2YXBA 1E1QD 1Y9AA 2BGJA 3TLGB 2GSDA 4KACA 5B1YA 4CCWA 4QQKA 1DPFA 1OIWA 4Q39A 1TZ2A 4ZOEA 3PEEA 4YT4A 1OREA 1E9DA 2CJWA 3H6HA 4NCHA 3D7MA 2J31A 3UJDA 3RTCA 5E95A 3TTWA 2CHEA 1U65A 121PA 2DBZA 1XZNA 1XRRA 2GZ3A 4ZYVA 4O4HB 4X8OA 1RNLA 2QL9A 3VU8A 4MRSA 3D8HA 3L1VA 5JMTA 3MPUA 4KHPB 1C30B 1R9MA 2C2HA 2MINB 3GRPA 3NVDA 3OIDA 4UU7A 1VDZA 5FOVA 3WSWA 3PD0A 4IBOA 4JKIA 5KTPA 1FTWA 4P3XA 4FXOA 2INGX 1KEZA 3KE8A 4JEIA 3N8GA 2JAOA 3GT7A 3MT9A 3OZBA 2VPPA 5IARA 5BYAA 5BMVB 4URVR 5FUBA 4MV4A 1RD4A 1NT2A 4KO4S 4Q00A 2WIAA 3QIAA 3KTAA 3CT6A 4DLVA 4P5PA 1Y4DE 3R6DA 3IT3A 5H3CA 5HE9A 2OXTA 5BUCA 4HDSA 4BFVA 1KK0A 2J48A 4ZAGA 1UDRA 5DCUA 3MXTA 4AVYA 4EY5A 1Z35A 2CK3A 2W7TA 3HXKA 3RRJA 3SJAA 1VJGA 1WW3A 3E15A 2QT0A 4D3SA 1H2ZA 2FW7A 1N78A 4KSBA 1AKNA 1FFBA 2QLNA 3EPPA 5IKOA 4A0GA 3L1HA 4PZDA 5HIMA 2VT2A 1L5QA 2HGSA 1EFDN 3CKLA 3O47A 4Q37A 2C3MA 4UCXA 4D6YA 3P4UA 4P3PA 4P93A 3RANA 2XHEA 1EIWA 1HDIA 3R8FA 2EF1A 4AMZA 1AV7A 3EY4A 4U0JA 3IEIA 2OGSA 4TTIA 1YGPA 3RLIA 3FNFA 3HJFA 1E92A 3LL4A 2Q0QA 5EHXA 1CW2B 3A9TA 1O54A 3CEJA 4AJ4A 2NO0A 4PONA 4C0QC 3DT9A 1WLYA 4CQMA 1YB7A 1ZOIA 2GJ8A 2NZVG 2ZWVA 3A6KA 1HDOA 2JGNA 3QU7A 2V98A 1GRQA 1UMCB 3PFIA 2I2CA 1NP3A 1SK8A 5ALOA 2GO1A 1VSVA 3DQQA 3F96A 3Q3IA 4NZPA 5EXDA 4W4TA 5KTNA 3QFRA 4KE8A 2JLYA 3OPYA 1GZ7A 1Q12A 4JNKA 3Q5EA 4TV9A 1U2PA 3KYBA 3ZU3A 4RKEA 4D80A 2YUIA 3AZPA 3LCVB 1ULUA 3N8HA 2G63A 2JGFA 3OUTA 4P35A 2D8AA 1GA1A 2VHJA 5DCLA 2XVAA 2ANCA 1CUGA 1GT6A 4DG8A 5K4AA 1T4BA 2WUDA 1WXGA 4EELA 1VCIA 4LC1A 2QDXA 2RH9B 1I9CA 1IVYA 1YQUA 3L7MA 3MWDA 4MR9B 3U4MA 1C41A 1K86A 4OAOA 2AOTB 3OQ1A 1EUZA 1FLDA 2FWPA 2B2NA 1V4NA 1VMIA 1MD9A 4ITRC 1MGOA 2LR0A 4C0AC 3LF1A 4FUTA 4HPJB 4B3JA 2R1UA 1GTVA 2VH5R 4MK4A 2WICA 1V4BA 3TIVA 1ZNQO 3LYLA 2O1XA 2Q1UA 1S9DA 1UEJA 4N3GA 5J2UA 2L18A 3OIVA 3L2OB 4LRYA 3CH6A 3UWDA 3VDRA 3SBXA 2QN2A 5DTEA 1F48A 1HFJA 2Q6OA 4FZVA 4EUKA 3B7GA 5IKXA 1CY4A 3ZEAA 1WXXA 1P2SA 2DFVA 3GN1A 3O3MB 4R3UC 1IZ7A 4UTOA 3RVRA 5GPBA 4NZNA 2MYNA 2QYTA 3MINB 5DMXA 4ZVMA 2O5RA 2PZJA 4QYSA 4ZJPA 3JR3A 5HQ3B 3VR3A 4LF8B 1E6MA 3GY0A 3LHIA 3IEKA 3A1FA 3PUHA 1V6AA 3LPCA 4Q9KA 4M9RA 4MIOA 4R1PA 1B41A 3H3FA 1DEHA 3I0ZA 4Y2UA 1TAQA 1LD3A 2JLAA 3K09A 3SP1A 4UC0A 3F1LA 2GPYA 4D4GA 3IUSA 4MIKA 1TMYA 2ZRLA 3RREA 1MCZA 1MX5A 2ZS8A 5DE3A 5JEEA 2VEDA 1KJJA 2WJWA 3DE1X 3PB3A 3VPXA 4QNMA 4AURA 3N59A 2E7ZA 5CAEA 5KWEA 5CX1B 3RCBA 4G1EB 2QT9A 4CF4A 3FPFA 2F2TA 2V8BA 2VJCA 1AN9A 2XQFA 1TKRA 3E1KA 1MAWA 1VBKA 2PGAA 3AQIA 1R12A 2Y1OA 2CJYA 1PFWA 3JD3A 5FLKA 4E5SA 3GJXC 5BUZA 4ZCPA 2YJ6A 4BJ6A 1U5BA 1Z25A 1MJNA 4GGOA 4MVWA 4ZZ1A 1YZNA 4U7TB 3UWSA 3LUFA 4OB7A 3T1NA 4LCEA 2NU8B 3UC5A 1IB0A 1W5EA 5TDHA 4B6QA 3U7IA 2ZUEA 2DBYA 4OQYA 3W4IA 4DLLA 1VLQA 1SBHA 4JVOA 3BFVA 3FPJA 4OQXA 4C89A 4EECA 4WXHA 1B1CA 2HCJB 3U09A 1QCYA 3C15C 3Q98A 4AULA 3IEUA 1P0MA 4DLBA 5AVUA 1J0DA 3LW7A 2PKQO 1P4AA 2F1JA 4FIZA 2GD2A 3OQOA 2GSWA 2V59A 4R7ZA 1U9ZA 2CV0A 3QKTA 2Y0PA 4B82A 1V11A 5A02A 3KU1A 4G97A 3ITEA 4MLDA 3G9QA 4FOPA 1F5SA 3D31A 1GPUA 2OAGA 5L4SA 2QD2A 3IBGA 4YJ2F 3T1HB 3I09A 1RXIA 1EDBA 4PANA 2OFWA 4LX0A 1NUAA 4YAOA 1OMOA 4R8LA 4P4NA 4JK3A 4Q01A 4EJ0A 5A04A 2BGGA 3LX6A 3S70A 4CV1A 4F2WA 3KHKA 4HYTA 3SYRA 3E9RA 3VTAA 1FVOA 1GQOA 1Q0TA 5HIJA 1XTJA 2JH8A 1RQGA 3SC6A 3GCZA 5CU7A 3LC0A 1M1YA 4GECA 4QTUB 5DRTA 3VXKA 2C5HA 2VK2A 4C4SA 4YAUA 1BMFA 2P67A 4P7BA 2FDXA 1VSBA 1JPJA 1HH4A 2J9FB 3OFVA 3MRVA 3HCCA 1NRXA 4UTRA 1WEHA 3FWZA 4P3NA 4O29A 5ARDA 1GQSA 3V00A 5I5EA 3OX3A 4K6FA 3T0IA 2P9FA 1XZEA 4D0RA 3P0IA 4AN1A 3GNLA