4UTOA

Crystal structure of pneumococcal surface antigen psaa d280n in the cd-bound, open state
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
278
structure length
278
Chain Sequence
KLKVVATNSIIADITKNIAGDKIDLHSIVPIGQDPHEYEPLPEDVKKTSEADLIFYNGINLETGGNAWFTKLVENAKKTENKDYFAVSDGVDVIYLEGQNEKGKEDPHAWLNLENGIIFAKNIAKQLSAKDPNNKEFYEKNLKEYTDKLDKLDKESKDKFNKIPAEKKLIVTSEGAFKYFSKAYGVPSAYIWEINTEEEGTPEQIKTLVEKLRQTKVPSLFVESSVDDRPMKTVSQDTNIPIYAQIFTNSIAEQGKEGDSYYSMMKYNLDKIAEGLAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MANGANESE ABC TRANSPORTER SUBSTRATE-BINDING LIPOPROTEIN
publication title Dysregulation of transition metal ion homeostasis is the molecular basis for cadmium toxicity in Streptococcus pneumoniae.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Metal binding protein
total genus 100
structure length 278
sequence length 278
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01297 ZnuA Zinc-uptake complex component A periplasmic
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 4utoA02
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 4utoA01
4WZBB 2ETVA 2OV1A 1N4DA 4MDYA 3TLKA 3GI1A 4H59A 1KAHA 4OVKA 2YNMC 4XPIB 2OGWA 3PDIA 1G21A 2PHZA 4ND8A 5M34A 3AEUB 3LHSA 3MWGA 4G07A 1TOAA 2AFHA 2XDQB 1QH1A 3AERB 4K3VA 5M3BA 1M34A 2R79A 2R7AA 1ESZA 2MINA 3PSAA 2QI9F 2RG7A 4OXQA 4OXRA 1K0FA 4TKUA 1M1YA 2AFHB 4HMPA 1KAEA 1M1NB 4HN9A 1K7SN 4MLZA 5JPDA 5KOHA 4INOA 3EIWA 4UDNA 2Q8QA 4TKUB 5GGYA 3AESB 5HX7A 5KHLB 1M1YB 3ZKAA 3UJPA 4H0FA 3U7QA 5AFSA 5BVHA 2PS3A 1PSZA 3MFQA 2O1EA 5JG7A 5KOHB 2XV1A 3G9QA 3NU1A 1M1NA 4N01A 5M29A 2PS9A 4TKVA 1H1LB 5CR9A 1QH8A 5FLYA 3U7QB 5BVHB 4FNAA 3MD9A 1N2CA 4M7OA 3HJTA 3AESA 3AEKA 4BBPA 1FP4A 3CX3A 4UTPA 4DBLE 3R5TA 4TKVB 3ZK9A 2OV3A 1QGUA 1QH8B 1K75A 4WNAA 5I4KA 3TNYA 4UTOA 3K1AA 5CX1A 1N2CB 3EIXA 4G09A 2XQVA 1H1LA 3AEKB 2XUZA 1FP4B 3MINB 4INPA 3ZK8A 1MIOB 1QGUB 3HXPA 1K2VN 5JOQA 4WNAB 5KOJA 3K1AB 4WESA 5CX1B 3ZK7A 1N2ZA 4NNPA 3TEFA 3PSHA 3BE6A 4IRMA 4FILA 3BE5A 1N4AA 4HMOA 5KOJB 2PS0A 4WESB 3HH8A 3MINA 5B58T 4MO9A 1PQ4A 4LS3A 1MIOA 4B8YA 5JJ5A 2OSVA 4WN9A 4FI3F 5HDQA 5BVGA 4MX8A 1KARA 2WI8A 3R5SA 2Q8PA 3AEQB 3MWFA 4FKMA 2M6KA 2X4LA 2XH8A 3AETA 4CL2A 1XVLA 3LI2A 4WN9B 2PRSA 4HMQA 4LJSA 5GGXA 1G20A 5BVGB 4WZAA 3PDIB 1G21B 2YNMD 5M2QA 1L5HA 2AFIA 4ND8B 4WZBA 3ZTTA 4PAGA 1QH1B 4GICA 3AETB 4XPIA 1M34B 4UDOA 2MINB 4PM4A 2M6LA 2XY4A 3AEUA 1EFDN 1G20B 2WHYA 3AEQA 4NNOA 2XDQA 4WZAB 3AERA 1L5HB 2AFIB
chains in the Genus database with same CATH superfamily
1PZFA 2XQIA 4JOQA 1OLSB 1U11A 3EFBA 3JQEA 2W2LD 4X1KB 3ZZ0A 3SKVA 5DCLA 3IPAA 4BIIA 4RTLA 2M6RA 3QFRA 4KSCA 1X7ZB 5FTMA 2IGBA 3NT2A 4UFPA 1BC5A 3I32A 4MVJP 2DJ5A 3IO5A 5IT0A 5I7SA 3V4OA 4AVYA 2IHTA 1IG3A 1I2DA 4IMIB 1OLOA 1U1CA 2PMWB 2FE4A 1EB8A 3ABQB 4WKPA 4RXTA 2WRZA 1D8TA 3UW3A 2EF1A 1OI3A 2FWJA 2ZS9A 4RDXA 1APBA 1HQYE 4KIWA 5T6MA 4OHZA 3DE2X 3QXXA 2IHKA 4X54A 3M83A 3K0FB 4GL4A 1UBFA 4C4OA 2ENUA 4W63A 1PFVA 5JWRA 3I6QA 3MYRA 1GTJ1 1N6KA 3ZG6A 2GS9A 3STTA 1BOOA 1OREA 1YS7A 4FIZA 3VZDA 1NMXA 5MFPA 4TWBA 3WLFA 2WC1A 2XWJI 3GAMA 3N7AA 4K1LA 5BMVF 2FW6A 5HSGA 2NIPA 2QD2A 5DGTA 4P53A 3UF0A 4ZO4A 1MR3F 2OKGA 4C4RA 3IMCA 3SHWA 3OOYA 1DG9A 2GEBA 3S2FA 4M9CA 4C5BA 4QPJC 1FRVA 1XJ0A 4S1TA 2ZPAA 4ISCA 4R2LA 5JS1A 2A1TS 1NFQA 3T1TA 1Z7BA 3DTYA 4NECA 2IEGA 3FNFA 1ST3A 2WJ3A 3PXEA 4MUBA 4WIAA 3BXZA 4QTUB 4RY2A 5ALVA 1R8YA 3SSOA 1ITZA 2JCVA 3RGGA 1PZHA 2JEZA 5TSDA 4CV2A 1BN6A 1UWCA 4UHJA 2NG1A 4PV7A 3C16C 5AOBA 4WADA 1J6UA 1E9BA 1IHXA 1VJ1A 1YI8A 5DIFA 1DDIA 4R68A 1Z5VA 4BX3A 3HL0A 2CLDX 1N8KA 3NBKA 2C7OA 4HWKA 5IKEA 1GRQA 3AL0C 4J7UA 2H3EA 2QE7A 3A10A 2AR0A 4LZLA 5E7QA 5A3RA 2IY8A 2AX4A 2FP3A 5F51A 4V2UA 3SICE 3O4IA 4F96A 3ZV4A 5JI3E 1HDEA 3VA7A 1TVMA 3OFND 4TRNA 5TJ9A 1JLRA 5LA6A 1EE1A 2ECKA 1OBVA 2A5GA 3FGZA 3FKSA 2ZUSA 3H1BA 3VOTA 1F7VA 3CT4A 2JHAA 1XZ8A 2WM8A 3D6MA 3QKIA 2NP7A 1E2DA 4X41A 5AKEA 1VE7A 3UKDA 5TJHA 4WFQA 2P9YA 3TTVA 1MA3A 3UWOA 5CLLA 1E4OA 4B8YA 4EI9A 5F1PA 3V1UA 3M70A 4JI4B 3JVDA 3ZDRA 1Y5IA 3IT3A 2EDAA 3SE0A 1TT5B 3ZJ5A 2F9FA 3JQ9C 2C0CA 2IP1A 4JVNA 4O3FA 2DKFA 4MI6A 4D8WA 3H1FA 3E9RA 1N1GA 1Y1PA 4H3VA 3NGMA 5AJZA 2ZSEA 1ZVJA 1VGRA 4LJSA 2PZKA 4EG3A 4DB4A 1WD5A 1N2SA 4ALJA 1PFKA 1PJBA 3G2NA 1VI2A 1CY0A 4WACA 3N58A 1BE8A 1T34A 3ENNA 3NBUA 5T57A 5CLIA 3ZU5A 2W8BB 3G79A 521PA 4QX6A 4D46A 5ALKA 4BJHB 3JU3A 1P73A 4TT3D 4XD7D 4Z4FA 3QZUA 1HNWB 4MKGA 1YRWA 4OOFA 3RANA 1MENA 2BF4A 5AW5A 4FU0A 2UZ1B 4PLFA 3V48A 4H3SA 2DWPA 3A0UA 5EP3A 2ETVA 2IXBA 4XIYA 2EFGA 1DTWB 1MO5A 1DAIA 2A0WA 3RK1A 1J0BA 1PP4A 1Q16A 3F7MA 3CH7A 4QDOA 3KIPA 3AF5A 5C7LO 1ATIA 1VSUA 2UUCB 1WZUA 2QRQA 2XHEA 3JQ7A 4EECA 1YJBA 1OD6A 1IJBA 3THYB 2BSQA 4A23A 2W43A 3JARB 1CJMA 4ZEXA 3U13A 3DC2A 1J8MF 2Q0HA 1E62A 3D5TA 3L7KA 2P6MA 4WFJA 2OCKA 1PYOA 1H2YA 4RE6A 5GV8A 1C8LA 1KDRA 1MJ5A 1NVFA 1ZUIA 1L4KA 1GNQA 1DWQA 2VDQB 3D2BA 1RBYA 3V1YA 4B80A 2NLOA 4PGMA 1DEKA 2ZR8A 3W9UA 1KYIA 3Q7SA 3EH2A 3G49A 3G88A 1LZLA 3EARA 1CR2A 4DNFA 3EA5A 3PUKA 3CVVA 4YRQA 2F8MA 4GR5A 3RF7A 1QKIA 3A1WA 1ZMRA 3F2IA 1EJBA 5AM3A 1D07A 2GHTA 1XZLA 3OBIA 3DG9A 3T0GA 1M7GA 2AUTA 3VYTB 4A2PA 1JHQA 3TI9A 3T5PA 5SY9A 5CIYA 4OP2A 1R0RE 4J2TA 5EHGA 1EWVA 1SCDA 3P4YA 5CMLA 2J3JA 1LPBB 3QE0A 3NUQA 4NZOA 1QRDA 3M3DA 4EDHA 1Z5GA 5KEIA 1WY7A 3AHFA 2AE2A 4TKMA 1H85A 4WK6A 4YC7A 4E3WA 2DR2A 3DTVB 1UM8A 2YWCA 2GXAA 4LNHA 4HUQB 1FP4A 2JAXA 2VHUA 4X45A 3ZEIA 4DA8A 3AVXA 4XSVA 4G5OA 3OBBA 4KXNA 3DDUA 2VBFA 5CFZA 1K75A 3BE4A 1JDJA 2HTEA 1EFKA 1Y9JA 4CKWB 1IPHA 3W79A 2UYGA 4KR2A 3O8DA 1OW3B 2ZAGA 3H86A 4Q3OA 5AUOB 4ZZ2A 1V4BA 1H42A 4OKNA 3RU7A 4Y2JA 1N5IA 3WB2A 3HXPA 3L0BA 2ORYA 3QLTA 4IUYA 3DXFA 3EC7A 4HH1A 4LNAA 1BYIA 1U2GC 4AZ0A 4EABA 1RRFA 3S2SA 4UNSA 5JJLA 4QOIA 4Y6GB 4A27A 1D8AA 1IE3A 1Z08A 4A8HA 4AKTA 5CFQA 4FDMA 2IIQA 2AGVA 2OHFA 3G3EA 5LVAA 4OLBA 1QV7A 1YU6A 3V33A 3W9YA 3LTEA 1V11B 1QDUA 2PGJA 4JYBA 3ZPXA 4GZ6A 2DRIA 4F4JA 3DBLA 1U9YA 4Z53A 5HQ3A 1L9XA 3DKPA 1Q3KA 4XLZA 4MARA 3U37A 2I3AA 3VR5A 3KXIA 4BLOA 1II8B 3DWEX 4TGLA 2BKLA 4R41A 4XWAA 5JH7A 3ZCRA 1ZGCA 1EUDA 1EQ2A 1VECA 2FW8A 2IEAA 2OK8A 3AUAA 1CJUC 3I9OA 4WXRA 4YFYA 4JLOA 4QO7A 3QPBA 5BYJA 4Q7QA 4WCFB 4BJ6A 1TVKA 4AN0A 1S4MA 3RG8A 5AD1A 1T13A 1C9NA 2SKCA 1XU9A 2JFOA 1CTQA 2LE0A 3ELYA 3QNWA 4BLRA 1C30B 4FFDA 4RKFA 3FB1A 2CHQA 1FFXB 1W85B 3D9QX 3K2IA 5A6SA 2P69A 3VNAA 1E99A 1AY0A 2B7CA 4DV2B 2WFAA 2E5WA 1GYPA 2D7DA 2Q9BA 2QTWB 1U28A 3LFHA 2UDPA 3NBAA 5A4FS 3DOHA 3HVRA 3LOUA 4NE7A 4JYCA 4IZOA 2V7EA 1QHYA 2GSDA 4PBSA 1XP5A 1GZSA 1ZCZA 1H3FA 2EJVA 1K7YA 4UUMA 2NGRA 3DFUA 3HJBA 1ZPDA 4WECA 4F4FA 4H6VA 4AY4A 3SR0A 2CMKA 2R11A 3GMSA 1WABA 2YYZA 3C4QA 5CHYA 1PZGA 2P77A 4JHLA 4PS0A 3GQBA 3U3DA 2NUTA 4UVGA 1MUUA 4M7RA 1GGJA 3GJ7A 4MV3A 1ZW1A 2VATA 4NQRA 2P2SA 2Z5FA 4Z0NA 1OFIA 3DTVD 4RHYA 4LYDA 2BYTA 5DYIA 2DUUA 2I8CA 4Y98A 2ZYTX 1VKRA 4BKOA 1DPGA 1Y8QB 1NJGA 1W5FA 2P78A 3RRNA 1C3OA 2W00A 2Z04A 3VH2A 5FH9A 1ILWA 2ZZNA 1RW4A 1MAWA 1L6IA 4O4JA 4UAUA 5AXDA 2Q29A 4C3ZA 3ROGA 2DWQA 4DVJA 2RD2A 4NBKA 3G5AA 4WKGA 1I3KA 4TKUB 2V45A 4E1AA 1XRQA 1D2NA 1X7YB 2P75A 3H3FA 4MS4A 5B53A 3RV4A 4DMFA 4CMIA 4Y6SA 1YRYE 1RYMA 2A84A 3KEMA 4MV5A 4KR3A 4MMXB 4HUTA 1HEUA 2C0QA 1GM5A 1Z12A 1E1QD 3FLMA 3L49A 3M5WA 4IZ6A 4XJVA 3BAFA 5FTJA 1Z6QA 4U2BA 3ADDA 5ALWA 5H70A 5KQMA 1Z2PX 4JLUA 3HN7A 3RD5A 4OREX 3DDSA 3MA0A 3UWDA 4BVFA 4GBED 3HP1A 5JV5A 3AJ8A 1MJHA 1PJTA 2QVLA 3ZOZA 4NCBA 3VHXA 1IM8A 1GPKA 4BFVA 3OM0A 3DZ8A 3GJ8A 3MNFA 4PZDA 4G5XA 3ZK9A 5B6IA 5B7QA 1L0BA 2G9UA 3DHNA 1Q22A 3NWBA 1CPYA 3RRMA 2DBRA 2QTGA 4YMSA 4ND2A 2R8XA 4JCOA 4O1HA 4ZVVA 2MJLA 1XTJA 3N5CA 4FFSA 5CH5A 2V96A 4FQ7A 3VSCA 4FCWA 2VJCA 4TLLB 4AUEA 4BP9A 4DEVA 4Y1RA 5B1IA 5I9NA 3R8FA 1R5NA 2H1SA 3TXAA 5A3QA 3QKRB 3AG5A 3FTCA 3DDCA 4P0TA 5DWVA 3CF4A 3RBZA 3D0QA 5CB4A 2CXUA 2I3ZA 4Y1GA 2MIIA 1E3WB 1FUKA 3JD3A 4FWTA 4FFBB 2XCRB 3DMFA 1X1EA 3L6BA 3K71B 1GRNA 4JWTA 4JYMA 3EXAA 3N3AC 1RHUA 4ZANA 5JS8A 3B1FA 2J32A 3KYDA 3OC0A 3A4YA 3PC3A 2QP3A 4IJ6A 5GONB 2ZJFA 2F1RA 3CYFA 2WWYA 5J4HA 4YRLA 4ZK6A 4Q9IA 1R18A 2XMZA 2KYRA 1EXWA 4HFRA 4AIRA 4I2NA 1YJCA 5HFNA 3FSGD 2ZSBA 3WYAA 4URXR 1XG5A 5DNCA 2R9VA 4JFAA 1E4EA 5CH8A 1OZHA 3EZLA 3IEIA 4HRAA 4YRDA 2WVAA 1KJNA 5PGMA 3VOAA 4CPDA 1YACA 2AOVA 2Q6KA 3LLMA 2IUEA 2YVLA 4GLLA 2Z09A 1NSYA 3OZDA 1QK5A 4KL8S 4UEJA 5AW8A 5C8DA 2NAPA 1RQXA 2WWVD 3U81A 3L4SO 4UDXX 2AJLI 1ZKMA 2PJZA 4D9GA 1ATZA 1QJCA 3E84A 1TM7E 4LQ4A 3SQOA 4AJOA 2CDNA 3Q6IA 5DHPA 3UAVA 4HAWA 4L3VA 4D44A 4EI7A 4UBJA 4CCSA 1XR3A 2BR4A 4XGQA 4ZT4A 4YRKA 3TIXB 3WLSA 3UGTA 4MUKA 3IA2A 3T5GA 1Y3IA 1XZQA 3L1KA 5DNYB 3IODA 4IVRA 4XDGA 3JR7A 3U5ZB 1ODFA 2FZEA 3CW8X 3GWZA 4U0KA 1ULZA 1LWOA 2H7VA 4WXYB 4MI9A 5DCWA 1F3LA 2D0DA 4Q1BA 2A7QA 4JSTA 1E6KA 3HR4A 4Q9NA 1XK7A 2FEPA 2P3OA 1PR2A 5ITSA 5JALA 2Y6VA 2XEDA 3PEWA 3ZDFA 3EPHA 2NO4A 3PXUA 2Q2NA 4Z3DA 1BE6A 2OO3A 1Q1AA 2J4DA 2ET6A 3ANXA 4MYUA 3MUEA 4AF8A 3IPCA 3G1TA 2P9HA 3A32A 2XEXA 4TVBA 2HK6A 5AK3A 2QVYX 4I50A 4B74A 2ZJ4A 1NXWA 3EFEA 1T1IA 2GEKA 4JBNA 2GZHA 3NYRA 2EX1A 3LWNA 3VSBA 1W4AA 5JCOA 5A1TA 1WCV1 5CA0B 4GKJB 2Z6VA 2Q2OA 1TUIA 2VNAA 4JZYA 1P4GA 4CQJA 4DTCA 2AQIA 1M34E 1NF8A 3JX9A 2BFWA 2ZXUA 4NYMR 4B3FX 3OUUA 5KSZA 1QFMA 2OXEA 4Y6LA 1FPQA 4C05A 4B6EA 3FVTA 3I9KA 3KBBA 1P7YA 5IEBA 4Y7CA 1IHDA 4EAQA 4RAOA 3OIDA 2D8AA 3FVVA 2ATEA 1EQUA 4WNAA 4J0CA 1M2WA 3AHDA 3S2GA 3IBTA 3AVYA 5T3YA 2ZT5A 3M0EA 3AKCA 3PNBA 4LWZA 2QLTA 3EB9A 4JJ7A 3EZ6A 4MA5A 1KFJB 4D3ZA 5HZHA 1LDEA 1NRXA 1Y3DE 5TS3A 3OZCA 4QOGA 4X1IB 3PNLA 2Z8YA 3M1IA 3NNDA 4FKZA 2Z8XA 4G0MA 1WZ2A 1NNLA 3JTMA 1NUQA 4MR7B 5CX4A 4E4YA 3RS8A 3UVEA 1MOZA 1X1RA 1AV7A 2QAGC 4L22A 5DMHA 2G4CA 3IR5A 4FONA 4R1OA 4RNDB 2Z5VA 4YR9A 1UPXA 3I8OA 3ONNA 4MVCA 2DLNA 1RBQA 2O48X 4W5WA 2YWDA 1O9HA 1N77A 3D7RA 3OLCX 2HMTA 2HDWA 1JQBA 3LYLA 3B60A 4OAQA 4PINA 4PO9A 4QDZA 2BGGA 4K86A 3SYRA 1RC1A 1M5UA 3EG9A 4BNUA 4CNQA 2F48A 5HMMA 1L4YA 3OCYA 4Q3NA 4O4HA 5FULA 3ZDYB 1LDMA 4R2MA 1XZNA 2R6ZA 1W7AA 4TV8A 4GL2A 3VR1A 2WICA 1NI4A 3C7TA 4D8UA 1I24A 2OP0A 2IK8A 1CZUA 1JKJA 2J1LA 2XODA 4RHCA 5EMKA 1OFUA 5M2QA 3K7EA 3ROXA 1IHPA 4OKIA 4B31A 4BFXA 3ER9A 3NZEA 1ZD4A 3BB4A 4RA9B 4FE4A 4P82A 1GP2A 1PWXA 1W93A 2G80A 4BNLA 2VAXA 2VDKB 3O90A 2PJUA 4CEIA 5G41A 3M1LA 3OLYA 4FI3C 1VBMA 2OBMA 3GA7A 4IHAA 4PRZA 5DTJA 4N5NA 5U4QA 2PLNA 3LP5A 3OQPA 4Z2YA 3T5TA 1K5HA 3OZBA 4F1JA 2NTJA 3HTXA 1YZNA 2G88A 4BO3A 1IFXA 2CK3D 1NBAA 2VJMB 3N07A 2DBYA 4Q9HA 3WR5A 4YROA 2FR8A 3AV3A 5TF0A 1OXVA 3CJTA 2C82A 2NT4A 4W9MC 2NYUA 3GJYA 4RQBA 1N78A 3QBTA 2ECOA 3TQCA 1GTSA 4DCVA 4WKOA 1B76A 3DFKA 3OLZA 1L4LA 1UAAA 3SAJA 5I7OA 4LN1A 3K1JA 5CPBA 1CB7A 1CRLA 1Z6PA 5F2EA 4DW8A 5EVJA 4UU7A 4B87A 4D0GA 3N2EA 1LBEA 1Q95A 4F6RB 5KYGA 3FUXA 3ZC3A 1F5SA 2WU0A 3HB7A 4QNNA 3FFXA 1FX0A 1OVMA 3BK1A 3PL5A 5KAPA 2RI0A 1GOTA 2MR5A 3GLQA 3ZR4B 2I6SA 4AG3A 1LS6A 2E1RA 2OGSA 3CVUA 3IVAA 2JGDB 1ZC4A 2OMKA 2WWWA 5L45A 4W5RA 3MUFA 5KTNA 2BH9A 2DT5A 1SXHA 4K03A 2BKAA 5FFNA 4JJ4A 5IMSA 2CYCA 3B3AA 4RESA 2AI2A 3DZIA 4PZEA 5ICGA 3A6KA 3FR7A 3PCRB 1BW9B 3G8CA 3KOUA 4LHZA 4EJSB 5CLJA 4MKFA 5BV8A 3LVQE 4N65A 3PXCX 3IVMA 2JGLA 3DO6A 4US0R 1SXJA 3DLAA 2HHLA 3CRZA 1EK1A 2YIDA 4JLWA 5KNCH 5LYJF 3IAM1 3UFBA 3X3HA 2LVBA 4G23A 2Y68A 3HKBB 2RGWA 1NI5A 1AX9A 4MA4A 3EZYA 4IDOA 1QV6A 3L7YA 3R24A 4B45A 4BRSA 1JJAA 3PVZA 1QGUB 4PSDA 3ORQA 2CJWA 3EXG2 4MS1A 1KNQA 4MNTA 1O1YA 3HM9A 2XGGA 1OF1A 2J59A 4CCYA 2XGJA 3C85A 1E1DA 4LWPA 4OKSA 2PMDA 2PV7A 4L8YA 1P3Y1 3UMYA 3ASUA 4HGQA 4P3PA 4QFCA 2PKQO 3R1IA 1MLDA 1TGVA 4CEJB 1K6EA 3KQTA 4QDTA 1GDHA 2C4TA 5KVQA 2HU8A 1FFEA 3H17A 1XEWY 3FZNA 3MINA 3RF6A 4K9SA 2J5BA 5IC5A 2C1EA 2D7CA 4C3OB 3SXUB 1HH4A 2FV8A 4I1VA 3Q8MA 1JIIA 3C6ZA 1I7LA 2C3YA 4TTPA 3BD6A 3FGPA 1I3OA 2OC4A 4G89A 3L8MA 2BV3A 4JBWA 2REXB 3TEFA 4JJGA 3VNSA 3OAAD 2BPOA 4NATA 3X44A 4KO8A 3ROEA 1RNLA 1OZ0A 4MPJA 1T1RA 3IQIX 1WV1A 1GQ2A 1W5SA 5B3KA 1VPDA 1DAFA 3QWHA 2OXTA 4EQ6A 4DVGA 1WSAA 4U7JA 1M0SA 3N6VA 2VDVE 2SECE 2WG0A 4MTCA 1TM4E 3GRPA 1BNCA 2N9UA 3ZXUB 3FNIA 2PYDA 3AHEA 1NMYA 5KTTA 1D4FA 2OGUA 2GNPA 5IUNC 5E8RA 5C53B 1KSHA 2X1MA 1NW5A 3OX4A 2PVPA 4LY0A 1D2GA 5D86A 1R88A 3DBIA 3G85A 2HI0A 5J4VA 3CH4B 4LDNA 3WQHA 4ETNA 1UH5A 2PQ2A 3L7BA 3LLCA 2H7CA 2PH5A 1NPTO 4HXYA 1FU7A 4HX5A 5G3ZA 3QPCA 1PJAA 3FVWA 1NW7A 1AQLA 4Y0VA 1UPAA 3T3HA 2YYAA 3BMNA 3H9UA 2PUJA 4B9EA 3DAFA 4EKYA 3T7CA 2PJRA 3GK3A 1MV8A 4KE6A 1V9CA 3WMXA 4CLHA 1R6UA 1QHHB 1UZNA 1HDXA 1GZ7A 3B9PA 4R7ZA 4FYMA 3V2UA 2WWTA 2VDWA 4RHUA 3CNOA 4OQ4A 3TZLA 2QY6A 4BZWA 5BXQC 2OKCA 4MVYA 2I6FA 3T9DA 1V39A 1Z2AA 2ZZKA 1P1RA 1EVEA 2PS3A 3RRXA 5HJ7A 5AHWA 1LLFA 1TM2A 2A9OA 2VJBA 1RRKA 2VA9A 4PN3A 4GXRA 4B84A 3KFLA 3MWEA 1R00A 4YP6A 3SFVA 4Q1EA 1FFDA 3O2NA 3T61A 3ZWXA 1YV9A 3P2KA 4B09A 2XMRA 4HUJA 1QH8A 4C2AA 3FPAA 4YP0A 1GGFA 4HQFA 1GPAA 3T7KA 4B2LA 3OEWA 3S2UA 4D4JA 3EHDA 2H52A 1H05A 5LKRA 2AOXA 3I76A 3OKFA 4RV5A 3ZDBA 1FDIA 2OXIA 1FMJA 1YDHA 4PZLA 2EKZA 3V1TC 2CMGA 2H2FA 3ILVA 3J80A 1NKSA 4HDRA 4C0KA 2QKYA 4KXLA 3IERA 4LOLA 4DANA 2I91A 1L7OA 3W2TA 4DM4A 5KPDA 1K88A 2W2KB 3EAGA 4UBIA 5DH9A 1IYZA 2VOEA 4FW8A 2IU3A 4HGZA 1HI9A 5EZQA 4XQGA 3AI7A 1NBHA 2WKSA 5E7MA 2CHGA 5AM2A 4AWBA 2A30A 4IS2A 4MGIR 2WSIA 3IBCA 7REQA 4BNDA 4B3BA 2FZLA 2ACVA 1LW6E 4A2WA 3SLRA 3C3WA 5AVSA 4N76A 1X42A 2GTPA 1BS1A 2YTZA 4X00A 4ZWNA 2I2FA 2D5AA 3OM1A 5C3MA 4EJ2A 4I5EA 3PCTA 2R6FA 1UZLA 1XZMA 2IOQA 3C6BA 3IUBA 3O8BA 4KQJA 3JPYA 4CF3A 1AHPA 4P7GA 4QHYA 3EEFA 2YZKA 5CFMA 1REQB 2ZJ5A 3DFZA 5JO9A 2RH9B 4CF4A 1QONA 1SOAA 3BWEA 3OQOA 1RAFA 3ZYCA 3SVTA 3D7LA 2ZB3A 3H1GA 5DTIA 4Q0MA 4ESVA 2X0JA 5C80A 4HYQA 1HF3A 1BU8A 4NULA 3HXKA 4I81A 5LYYA 3VJLA 3O4HA 2OO5C 1ECBA 3L8ZA 5BV2P 1EDOA 3H2JA 5I01A 2GERA 4I1UA 4MSUA 1AN9A 3P9IA 5LM3A 3WBKA 4OX9B 1UZMA 1E1CB 2Q27A 4ND8B 2GJSA 1N8TA 3F9RA 1P9OA 1EDBA 5H3CA 4WN9B 3RC9A 4X65B 4HXGA 3QVMA 3SHQA 1RXWA 1II9A 1DT3A 1LB1B 1EAMA 1OAAA 4R1TA 4RTKA 2CKDA 1SCAA 1S9DA 3PS9A 2KLHA 3GPIA 3O0TA 4REQB 5DBHX 4YT8A 4ZHQA 2PKYX 1NF3A 3W3AA 5LBUA 3SIWA 1BCSB 4L08A 5IT5A 1L1FA 1A71A 2KMLA 1CQJB 1VGQA 2SCUA 3BXFA 2NPFA 3ZKWA 4DZZA 4F8YA 3SYTA 2PK3A 3HXTA 2GCPA 2HMAA 4R84A 3G0HA 2XKJE 3LOQA 2WQ6A 1IRIA 1ZNYA 1J25A 4A73A 3NT4A 1GO2A 2HOQA 3I92A 4ZYZA 4A92A 2H4YA 1O9BA 3HJUA 2XZLA 1QE0A 2FSVA 1UPFA 1IHOA 2AS0A 2ST1A 3KTAA 1HLDA 2BKXA 4WSOA 4QTTB 3O6VA 4JUAA 4YMGA 1WTAA 3ZHUA 4TUYB 5CM8B 2B21A 3VRHA 1XC7A 3VR4H 2RI6A 1N7IA 3CUEF 3GPLA 3BHIA 3REFA 2GF9A 2Q8QA 3T5CA 3RUPA 1RWXA 5AI8A 5I4BA 2YASA 3GLKA 2HLPA 1F17A 4AECA 2R25B 1E94E 4HNRA 3LUDA 2FW7A 1Z0KA 4L5IA 4BVGA 1CJVC 1T2DA 4LMRA 8AT1A 1FFYA 4V39A 1KKUA 3IQGX 3A2NA 5TS2A 1M1NA 1QG2A 3FWKA 3G8BA 3AR9A 3U0VA 2XD9A 1XKTA 3SHFA 1PZXA 1MX9A 3MTJA 3AYZB 3QIAA 5CYOA 1YUBA 1EHYA 1NZFA 3NRBA 3BBPA 3ND6A 5ESRA 3HVJA 4AROA 2X86A 1NQTA 2ZBEA 1Z5ZA 1D4AA 2DY1A 4IOLA 5EIAA 1ONOA 3P96A 3JD1A 1F2TA 3IHWA 4QM6A 4HWTA 2IHVA 3K1AA 2H2HA 1ZM3A 2J4CA 3AW9A 4WV3A 4WBSA 3PEFA 2O8VA 4WBNA 5G4KA 1SBTA 3KLPX 5TDHA 1A9SA 1DFHA 2H5IA 4R0NA 1R1DA 1X70A 3F6BX 1E9FA 1XZGA 3MN1A 4GPBA 3D3KA 1T35A 5CLFA 4DV6B 3DMNA 4EF6A 1D0SA 4YPOA 7MDHA 3TX6A 2H92A 2C98A 2ZRJA 3N5KA 1HT0A 3GLVA 1TM1E 2H4HA 2YV4A 1NM5C 4QOFA 4BFUA 3MWLA 4N0DA 1PV1A 1TCBA 1TRKA 1HLGA 4XCQA 2QUIA 4CODB 3TLYA 2GFQA 3O8QB 4GOKA 3AONB 3KTDA 3ZWOA 3ANLA 1JKXA 5LQAA 4FBGA 2OV4A 4NY1A 3VU3A 1LVGA 2O6LA 3C5HA 5IARA 3G2QA 3ZY5A 4EPYA 5CTAA 3BTUA 3CSSA 5GZ1A 3H97A 2GJ9A 3GJ5A 4E0BA 4EOGA 3NXKA 3ZZMA 4EUFA 3OQMA 4BQFA 1EBBA 1Q0SA 3I5MA 4K3UA 2Q5HA 1KOJA 3GLIE 1Z4NA 1XALA 1TK2A 1L9KA 3HI6A 3SZRA 5A2QA 1BXKA 2DVMA 2R3SA 3JSXA 1CEQA 4MHTA 2P91A 3FNQA 3IALA 1GY8A 2FPWA 2ERYA 3GJRA 3K0EA 4YREA 2OQIA 3PKJA 4IQ0A 3VO9A 3GZ4A 4U2KA 5KS2A 3HJNA 2A7XA 2CNDA 1UBUS 3R7BA 4R0VA 3VGPA 4QQ8A 5K09A 3D02A 5CLGA 3SC2B 6GPBA 1YR7A 3I42A 1AQUA 4M88A 3ZGYA 3JQDA 2WJHA 3GJ0A 3MB8A 4TTTS 4CWAA 3THWA 2IEIA 4OVKA 4HT3B 1WMSA 4MS3B 1WBJB 3VPHA 1JZSA 2R8OA 3QLUC 3UOAB 4X20B 3TW4A 2AG0A 1T2NA 5CDFA 3GW8A 2HRZA 4OGKA 4RPJA 4UMVA 1T9DA 4ZOBA 1IOWA 2PRZA 3GYBA 5K3FA 3B6IA 3QOXA 3BDVA 2JEOA 1KE1A 1YS9A 5BQFA 3HKDA 1ISFA 1ECFA 3CIFA 3A1FA 3OKPA 4P7BA 3W6ZA 5K03A 1AK2A 1R15A 1RFGE 4AJHA 3OWXA 3TSZA 1P60A 1A9ZA 1B6TA 3BILA 3MGAA 1BWRA 5BP7A 1PR0A 1YE3A 1ZH4A 2X4DA 4IF4A 4XR9A 4OK5A 3Q7EA 4L28A 5IH3A 1WAMA 4P54A 1CQPA 5EESA 1YDFA 3EBLA 3G2KA 1XYGA 3R0IA 3BFJA 3HDVA 2W90A 3E3AA 4S1PA 3DH0A 3VVBA 1Z83A 3UK0A 4B6GA 3C87A 3CNNA 2IU6A 3FOAA 3GNQA 3VZPA 5AFSA 4GMGA 3WK8A 2X1LA 5IKXA 3MUOA 2XWBF 4QD3A 4D9FA 1O6GA 1Z5NA 4NENA 4U9IS 2FMXA 3FYDA 1I4OA 1KYZA 1MDBA 3GH3A 2ZBFA 3ZQKA 4D4KA 3R9KA 1L3CA 1RI2A 5JNWA 4HDMB 3KQNA 2IBSA 2JBAA 3KQVA 2GASA 1JHRA 1GG9A 3PTZA 2HA0A 2GBLC 5EP4A 4FCCA 4IMJB 3I9V6 3FROA 2XVXA 4D9IA 2QXYA 3T41A 1JBKA 1BA2A 2XMCA 2BBTA 3O9VA 3WLJA 4C0LA 2G9QA 4ZDIA 2V5UA 4G86A 3FBTA 4DDHA 3EGXB 1V3QE 1WX1A 5SY4A 4GR4A 3H11A 2VSOA 5EP1A 4DJDC 2PYZA 1Y6RA 3EZFA 1N3BA 2HWKA 3L0CA 5KOIA 2D2IA 2FPPB 1PJLA 3Q3HA 2CV1A 5DT2A 1HLPA 1Z0DA 3O1JC 4W8HA 4WD3A 3RGWS 2YINC 1OU0A 3FPLA 3PDUA 4J91A 2ZYSA 1J06A 3ZK7A 2Z5LA 4IY1A 4B43A 3I04A 4D80A 4HLQB 1A8QA 1DMRA 2ZSIA 3EGCA 2VTDA 3UXEA 3BMQA 3ZZ1A 1D2RA 3PR3A 5T8KA 2G25A 2BRUC 4MYTA 1NQUA 2IGTA 1RWPA 3EVFA 5FWXA 4CU2A 2EJBA 1YA8A 4E09A 1ZFNA 3IJPA 5IYZF 3NOQA 2PU7A 3WAJA 2JIZD 3NJ4A 4EO4A 1F6BA 2QVXX 3D81A 3MZ0A 3QE3A 5I9MA 2FRDC 2HW8A 1PLLA 1VP3A 4UOZA 3GU3A 4JB3A 4Q9DA 2IXFA 1EGQA 3UW1A 3MAAC 1TQ2A 4UUOA 5H16A 4FFMA 1E92A 3IUEA 2VSNA 3B53X 4R1MA 3OU7A 3GN1A 2Z2XA 1RTKA 2XWSA 5FNVA 3VC3A 5CCDA 3A3PA 3D3WA 5I9TA 4YCAA 4CMKA 2HCFA 4EYSA 2IYYA 1M6WA 1X92A 4JBXA 2DFVA 2E82A 5CVVA 1UXJA 1T24A 3NR2A 2MYUA 4LMPA 2XW6A 5CNJA 4B33A 2WIFA 2BW0A 2CWDA 5COAA 3T5BA 5B2FA 5IJ0B 5ILOA 4O59O 1EFUA 1SK8A 4F9GA 4O4IA 3PIRA 2IEBA 2ZTSA 2AYXA 1OLXA 1XTKA 2QTNA 3V97A 1N2OA 3NV7A 2JFPA 1UJCA 2ATCA 2ZROA 4RLQA 1IC6A 1F8GA 2O7RA 3DE6X 3KPUA 4DABA 5EXEA 4NH4A 2PWZA 1ZJYA 1HG1A 3C14C 2OESA 1UBCA 1RP7A 4MW2A 3QFTA 1XAGA 1NJFA 1P5JA 1QR2A 2C7RA 4JKOA 1SCBA 4FEAA 2NXJA 1H65A 3HVUA 3VR2A 4P7FA 4B5KA 1OBOA 1URPA 2KW5A 1XELA 2YFKA 3RVQA 3O74A 4Y6PA 3KWJA 3PQ6A 4IAOA 4C22A 1M1YB 2C83A 5KX5F 4YXWD 1NVTA 4DQXA 1Y5NA 3CRQA 3ZCQA 1OZAA 4G8BA 3RIEA 3ZVMA 2JD0A 3IDOA 1TKAA 1XQXA 3PXBA 3V80A 2NN3C 5JXHA 4HWPA 1PV2A 1T5BA 2JFGA 2HA5A 2Y99A 3RFTA 2QBYA 1UJNA 5LIPA 1EVYA 3VDXA 2Q5EA 3KJGA 3PHJA 2PUCA 3BH7A 1SVWA 3NKFA 4L4SA 3HY4A 3M89A 4K6OA 3W5IA 1HDOA 2V0GA 3MQ2A 4DC9A 4FSHA 4KMRA 4JBHA 4LJLA 1X9GA 1R64A 1FXSA 1XTRA 3WICA 1BCRA 1YKGA 2X8LA 3ZV5A 5IXYA 2GYYA 2XUIA 1K7XB 3QV1A 4YCJA 5BN3B 4ILEA 1I8TA 1BOFA 2NO0A 5HP4A 1TL7C 3Q9NA 5DNAA 5ECDA 1UXOA 1YH3A 3C8UA 3RRFA 3M5CA 3KDAA 1GKLA 2X0FA 4Z4CA 3SS7X 5KNBA 5AUPB 2OAEA 1T6YA 3B7PA 2ZSHA 3FCEA 4J76A 1IN4A 4NV3A 3PA6A 1M7BA 1W87A 1PS9A 1EFPB 1YOVA 2ZR7A 4YP9A 5BNFA 4OI4A 1I4TD 1IVSA 3ICCA 3NBQA 4G25A 4KPYA 2YR0A 4OLHA 3NHWA 2JCYA 1H0KA 4CUJA 3FVQA 4PHFA 3V4ZA 3ZI0A 4D4HA 1D5WA 2DBZA 4G1BA 4H7DA 3CR8A 2BZGA 2OSBA 4ZT3A 1EE2A 1JEDA 2YW2A 2BSXA 3K6RA 5FUMA 3B3QA 1V8DA 2AL7A 4OU4A 4Q05A 5FBVB 3CO0S 1VKHA 2NO7A 3FZQA 4OI1A 1U2SA 1C1DB 5B3AA 4GYKA 1DQPA 3IYLW 4ESEA 1KIMA 4JT8A 5FOWA 5HM6A 1HNZB 5HBRA 2Y1XA 4EA8A 3JQFA 3K5HA 3AWDA 1B8VA 1SQ5A 3PQCA 2WE7A 3FNEA 3L43A 3P9SA 2PQ6A 5JSHA 1SHUX 1U7ZA 1PGQA 5CDGA 4S35A 2BHTA 4I8DA 4C0SA 3W9BA 4DIDA 2P0YA 2JLQA 4JIMA 3ELBA 4X1OA 3WL7A 2O8FB 3LPMA 5EMLA 1FF9A 3TQTA 5C8VA 4CR6A 4ECEA 1DC8A 4D3YA 1T5OA 4EW6A 2QE6A 121PA 1FP6A 3DZBA 5DBGA 1ZIDA 1RU3A 3PUWA 2F2TA 4NMLA 4RK6A 3GGDA 2Y2VA 1J90A 4ZALA 5E7JA 4KAFA 1I5RA 1DC4A 2JS7A 2XGSA 1JR4A 3MMZA 3NM5A 4ND7A 5AJTA 4LQCA 4YAIA 4N7MA 5ADUS 4DYHA 1R6VA 1U2PA 2VNHA 5HJEA 3D7NA 1TUBA 2JI6A 1BWSA 1E2QA 1XQYA 4HB3A 5DM60 2PWBA 4RA6A 4NPAA 2B6NA 1ULUA 2Q62A 3AJDA 4L95C 4EM6A 5EUMA 2JC3A 2A1UA 5BV0A 4DWOA 2VSXA 1CQIA 4D96A 3MWDA 2YY6A 1Y3CE 2O0KA 1KY3A 3JQBA 2D59A 3AUKA 4FKBA 3JYQA 4AFNA 2A0UA 1A9XA 4MAAA 2I5PO 4MRMB 3LF2A 4OA8A 3BWMA 1KMQA 2XECA 3UJPA 2X1HA 4RTSA 3NRCA 2W2XA 1AZSC 1N5OX 5DT9A 3VHQA 2YXBA 3OD1A 3ZDZB 3F2VA 3HDJA 1HOXA 3HCDA 3GELA 3RAJA 5LQSA 1TTTA 3DQQA 1GT6A 3TIFA 4NZPA 4KPGA 4N5DA 3KD2A 2EFDB 3DXYA 3EXHA 2WMYA 3CF4G 4JLDA 3SHOA 4YK7A 3L8FA 1NG1A 4MEJA 4O8ZA 4GMFA 2CFRA 4BV3A 3UJ6A 3B3JA 5U9CA 3ICEA 3ONVA 1MA0A 4JENA 2PYIA 1IQUA 1S8FA 1SHJA 3GFTA 2OBBA 4S05A 2IW1A 3LGXA 4RNCA 1E58A 4LXIA 2FPGB 2QRKA 3JASA 3UAYA 2H17A 2GKOA 4M8IA 4ZYTA 3FZYA 3CVOA 3AJEA 4PONA 3JWGA 1B4DA 2R97A 2V7VA 3LU1A 4JL5A 1GGNA 1KC3A 2O0JA 3PDCA 5LOVB 1WCIB 2JAWA 5DWDA 3VTAA 1E0AA 2VRNA 3MTQA 3BWYA 4OYRA 1ORTA 4Y9DA 5LU8A 3DGEC 1EWKA 1TLFA 2WHEA 3CU5A 4D3DA 1IQ0A 2ZT7A 1VZ2A 4GW3A 2Q7XA 2GYVA 3LW8A 4CT5A 1YB6A 1SVMA 2NO6A 4KO1S 3U1BA 4QRDA 1O95C 4JKIA 1RJGA 2B99A 1LPSA 1C0LA 4U8GA 1CS4C 2CC2A 4GLJA 1HKUA 3V8EA 1A2QA 1AA6A 4PXSA 5JW6A 3HCEA 1XDGA 3H4MA 4MRPA 1C81A 2Q41A 1MORA 1G16A 1XYYA 3A1DA 2Q4DA 5LQDA 1Q1ZA 2IYXA 1YFKA 5ALGA 4WJZA 2IVZA 3WIOA 4YMTA 4L51A 4U6SA 3H0CA 2QLFA 2YFYA 1V4NA 2H2AA 3ZXIA 1FRQA 4BLUA 4X8OA 4YALA 1NYRA 5J1TB 3M82A 1BX1A 4RK0A 1MQSA 2ODWA 3CX4A 1XPJA 2P2ZA 2IKQA 3QNMA 4S0ZA 1C9JA 4TWRA 4BV9A 2FWPA 3P0HA 3N86A 4EG8A 5I8PA 1P3DA 3D4OA 4M9QA 4ZAVA 1D09A 3ZJVA 4OH7A 1EFDN 3JAWB 4WZAB 2B4QA 3TXYA 3F96A 3UMRA 4TSKA 3U17A 1PR3A 2V58A 4N0QA 3ZHZA 1A9PA 1KNXA 1YIDA 5FO1A 3ZW9A 5BT9A 2ISCA 3RK4A 3A7DA 1AMOA 4BNYA 4D5GA 5JHHB 3SBDA 4UZEA 3P0JA 2WM3A 3TTTA 3GIWA 2YQ5A 3HCAA 5JNRA 2VN8A 4EG0A 2R68A 5DP1A 4R1SA 4C78A 4BFYA 2QYHA 2DFNA 4JB0A 4ZVPA 4CG2A 3JYOA 1VIAA 3BZUA 2I6TA 4OCZA 2Z2IA 1ZN9A 2ZRMA 3Q3IA 4KE9A 3PRKE 3O2QB 2WV9A 1VJCA 1YRQA 4HB2A 2DBVO 3E7PA 1L7AA 1OTYA 1PT5A 3E35A 5BN1A 2XB6A 2HA6A 4BFTA 2NYVA 4HY3A 3CW2A 1WKBA 2QV0A 3HKCB 3HCNA 4Q9KA 3EJWA 2CXXA 1A5TA 5A4IS 2BE9A 4P5PA 4PYIA 5JXJA 3MTDA 5AWFC 1MFZA 3U3OA 4B6OA 4J9UE 4OL9A 2YWBA 4WNYA 3BMCB 4S1WA 3QH4A 3VVLA 2QB5A 3CCCA 4WCFC 3TLXA 4KLCA 1KGSA 3JYNA 5KJFA 1U02A 1IBRA 2IU4A 2YYYA 3LOPA 4EW2A 5GIPE 2W2LA 4LXXA 1Y7IA 2VRCD 2QJFA 1ZK2A 3VU9B 1R4NB 3DBRA 4IHJA 1HORA 1ZUHA 3X2SA 4DV3B 3D5QA 4KXVA 4OPMA 1YZYA 4DRZA 3P4UA 3ADPA 5F4BA 1BMFD 5HF6A 4O25A 5FI0B 3GYGA 2VDJA 2MU1A 2D6FA 5IUJC 4ZKDA 2PS1A 3E9CA 1T9AA 4DSNA 2LNDA 1RHQA 3OEHD 2L18A 3D3EA 3TWOA 1TFUA 3DKRA 2I4TA 3QXJA 2QM8A 4Z4HA 3IEUA 3IP6A 1SR8A 2CF5A 3C5EA 4KH0A 2FZKA 3RAPR 1EGAA 2H6EA 4JUCA 2OM6A 1DLIA 2BFAA 5K2MA 2EKLA 1G3IA 1OXXK 2YC4C 2HCRA 4WLEA 2Y1DA 3HWX1 2Z9CA 1DUSA 3MAJA 5IDVA 5F1OA 1U0SY 3W06A 2J3EA 3I4CA 5HS4A 3JD0A 3FMVA 5JJ5A 1JEEA 4PTLA 1UAYA 1XTQA 1JV2B 3L06A 3T9FA 3U62A 4LI3X 1MO4A 4RJJA 5IM4A 1PU2A 3O75A 3BXGA 1A27A 3GA5A 4AY2A 5TPWA 2XRMA 3L77A 3RU3A 1R0SA 2CDCA 4H77A 1FMTA 2HZBA 1GNLA 2I7CA 4FIDA 3AF6A 3AVPA 1MAAA 4UEOA 1UF9A 4YBRA 5AW4A 3WGHA 4HTFB 4JODA 1N5JA 1OZGA 4NPCA 5C4IA 4RTRA 4GKBA 1I13A 3CF6R 4TZTA 5BORA 1WU8A 3QVOA 1TK3A 1H9AA 1CG6A 2H9AA 4M21A 3B36A 1XZHA 1G63A 1JSCA 2UUAB 1FUYB 1TADA 3SFTA 2WJ6A 1WOMA 4A4DA 4LPSA 3CW9A 1OMOA 2VAVA 2YOGA 1FPMA 2HO4A 2ZRLA 4X71A 2R60A 1AQYA 4B2IA 1H94A 2HA4A 3OPQA 2XRFA 3VV3A 2ZATA 3CNLA 4ZFNA 1U9JA 1EAYA 5BSVA 2OGWA 1FTSA 2Z4RA 3CXUA 1QX3A 5A5FA 4NX2A 5EWMB 1UOQA 2IWHA 3EAFA 5EVCA 3IVXA 2A9KA 5KYXB 2ZVQX 3QPVA 2Q4BA 5ADHA 4R71A 3LQ1A 4PWYA 3G9ZA 2C4VA 1YBHA 2W6CX 8ABPA 4YCLA 4OSOA 3K32A 1RYYA 3JD4A 4TX1A 3L4BC 2DHQA 1X7ZA 1PNTA 2CFSA 1T8YA 2J9YB 3SQDA 3IV9A 1I80A 2WQZA 4AKEA 3E7DA 3PEEA 2EJWA 2J3MA 3LA8A 3H0EA 1M75A 4ON9A 2XQKA 1PUXA 1HURA 2WKRA 3E7WA 3W8DA 4BO4A 2A59A 1ZJZA 1RDFA 4MQLA 4CEHB 4QUBA 5LB2A 2RHRA 2CD9A 1DV1A 3W1VA 4WLVA 1P33A 4CM6A 3KXKA 3D6AA 3QM1A 1RM3A 1K27A 1EB9A 2GMWA 1DKUA 3I28A 1FW8A 1Y63A 4TT3A 1EBFA 4XD7A 3BCUA 3SQXA 1E3EA 2O7NA 4FFLA 3TZKA 4ADSG 2V9CA 2GESA 1SUWA 3AVQA 3L46A 1GQYA 2R1TA 3HLTA 3OM8A 4TLAA 1GNVA 2FEOA 3M81A 1KK1A 2WUWE 4IGIA 4C43A 4DNOA 3QKUA 4EPWA 2ATXA 4IIGA 1FXUA 3DBVO 2CLKB 3KFXA 3LW7A 3I1YA 4JOSA 1W4LA 1XEXB 4F38A 1CS0B 4NU6A 1UEXC 5DOZA 5HGJA 5AJXA 4CM7A 1QB7A 3ST7A 2RONA 2FQ1A 2EGHA 2VQSA 4YMIA 5FJIA 4ND5A 2WSYB 5FOXA 2FETA 4RK1A 1RAGA 4WI1A 3TM5A 3O4VA 4HH0A 5IKPA 1KMHA 3M4XA 4WEQA 1I2CA 2OA0A 1IZ7A 3JV7A 4FSDA 3VO8A 4EH1A 4OMCA 1IUPA 1TKRA 4PPQA 3C6KA 1A1VA 3WB9A 4EA7A 1W1UA 2G63A 4B9AA 2JIDA 1YNSA 1RKQA 1U0HC 1QAMA 4W9NC 5DNDA 5GOZA 4HMOA 1FLVA 1RKVA 3R23A 3R6GA 2XIQA 3KQQA 1WWKA 3LQ2A 3IJRA 1J8VA 3BRCA 4ZJZA 3B1VA 1KEKA 1JSLA 1J9EA 3C7AA 4UJ5A 3SF8B 1NGSA 2WFMA 1YVPA 1XNJA 1QIHA 1XYVA 3FFBA 4KBGA 5EGNA 3QTBA 3TZEA 1T4CB 1KOLA 1QYWA 1AKMA 4OK6A 5AW7A 2JGNA 3KWMA 1QE5A 3UATA 2GZRA 4AKHA 2PQ0A 7ADHA 1SBCA 3F7NA 3QWIA 2GBGA 2WM9B 4PICA 4HNVA 4D4LA 6YASA 3OPYI 1G21B 2HHCA 2NV6A 3NAZA 1IY1A 2TS1A 5C37A 4XFKA 3FYTA 4N7BA 3VKWA 2YJ3A 3RVRA 3RS5A 2NZ2A 1EWQA 2AN1A 1U5BB 4XQEA 5D5HA 3LYAA 1KDOA 2XNSA 3RQSA 1XCJA 2YJTD 2FPRA 1ULAA 3HB1A 4P31A 2EW1A 4KN6A 3HL4A 2BR3A 4CG1A 3OTWA 4FOOA 4CYMA 1JA1A 1DX6A 3UJ7A 4LHVA 3WL5A 4ZJYA 1V8PA 3KKZA 1W6UA 3RWMB 1YQGA 5IF3A 4ZODA 4YJ3A 2NZXA 2VPPA 2XF8A 3QYPA 4FW9A 4NL4H 3U44B 1IH8A 4K3VA 4YAKA 1ULSA 2XNJA 3N0RA 1Z4LA 4J43A 4QBFA 3TGPA 4CGZA 2W2TA 2EP5A 2LCFA 4WVLA 4Y2QA 3OCCA 4HWOA 4A8PA 4GBGA 4BMDA 2RH5A 4AMVA 3HRIA 5JTUA 1JB9A 4URHA 3V4LA 3IOEA 1T0PA 5B12A 1DTWA 1H22A 3FHCB 1VLVA 4HDNB 4HN9A 4XVHA 2PKWA 2MHCA 1GL7A 3E27A 3G7SA 1MB9A 1XLVA 3LIPA 4FJ2A 4QPZA 2XUFA 3VI3B 5IH7A 2BHSA 5AXCA 1X74A 3HBLA 1JFVA 4ZI7A 2MYNA 3RU2A 1MP0A 3E9MA 4HAVA 4TRJA 3WXBA 5BSFA 5CAEA 1V1MB 1NR7A 3DLHA 1MKYA 2A57A 2ISSD 3ID6C 5BVHA 4V02A 2AOUA 5CT9A 4NDNE 2R96A 5FV7A 4ZZIA 2QU7A 5C46F 2XVAA 2CGEA 2XTZA 2JGFA 5HEKA 3G9QA 1K2WA 1DBWA 2JIRA 5K8JB 2NTYC 2FWIA 4PSVA 1GAWA 1PQWA 2Z4SA 4YTEA 2A35A 3F5QA 5FXMA 1OC2A 2VNKA 4XH9B 2NYAA 4FEYA 3OCUA 4BNMA 1D1PA 5BN5A 2OGTA 1G2IA 3TF5A 2V3CC 2XBUA 1E61A 4HLUC 1YB1A 4ZQFA 4BP3A 1PO7A 4RK7A 5JAIA 2GZAA 2F1IA 3EISA 4G9EA 3S99A 1JF8A 3WIUA 5MGBA 3AVUA 4RKRA 4KO2S 2CKMA 3NAMA 3T7JA 2HF9A 4PZYA 5EGSA 3OY2A 1O0CA 2P9QA 1SU8A 4LWOA 2I99A 3DTVA 1MIOB 1HO3A 3ZXYA 1EXMA 4XQ9A 4UE3S 3WBJA 2XUOA 4FFVA 5MN4A 2O5RA 3N3BC 5IMBA 3C4VA 2YWHA 3F8WA 3P9ZA 4JY7A 1Z74A 3Q9UA 3A9VA 2NZUG 1O87A 4RZUA 3WG9A 3FETA 1ZXBA 3FSRA 3RC8A 1PFYA 1NW9B 1E2EA 3FSJX 4HX9A 4DCUA 3LECA 2E55A 2YHUA 2R85A 4RENA 2EEPA 1QQBA 4PSKA 4OTZA 5E8JA 4NCJA 4M0UA 4F4HA 5A3SA 5JMWA 5DNEA 2C4KA 2I2DA 4DMUB 1E1QA 4F5EA 4M1WA 2VEOA 1VPTA 4AM8A 3I2GA 4EAAA 3K94A 5A5DA 1UC4B 4U63A 1CY7A 1U0NA 3CLRC 5LMNB 5BMVA 1U0LA 1T8WA 2NZ8A 1OIVA 3E4CA 2Y92A 2OCGA 4MKZA 1G7TA 1FJ2A 1XGKA 4II7A 1GG8A 5AM5A 3GVPA 1VHWA 1E3TA 2JGAA 3GLGB 2IX3A 2QTRA 4KDRA 3SQLA 2Q6IA 1QHEA 2MWMA 2R5FA 3IIIA 3IP7A 4HNHA 4JS0A 3WS7A 2JGMA 1RYBA 5I5EA 1Y0BA 5JMOA 3U80A 1Z82A 2ZG6A 4YHBA 2SNIE 2QN3A 4ILKA 2VDLB 1YHYA 2RAPA 5EKDA 4RMIA 3VKVA 4CMIB 1FXWF 2PFGA 3W5VA 4EJSC 2Z30A 3FBGA 3WNQA 1WY5A 3H19A 2XVMA 1FFBA 2CE7A 3PFKA 3LKVA 3QITA 4G07A 4PAOA 1FMCA 1U6IA 3KPYA 3ONWA 4J1QA 4LJ6A 2OG1A 4C14A 3EFOA 4X91A 4JASB 4JZKA 3QW2A 4OQFA 3MAGA 4TV9F 3N2GB 4E46A 2QW1A 4NJMA 1SUIA 3BD8A 3KQSA 4H15A 4BVJA 3IT1A 3PUVA 3KJFA 4LBYA 5DRTA 4LECA 3S5UA 3WWOA 2JIPA 2RMKA 1RPZA 4LHEA 2RH8A 4ZOEA 5SYNA 1DCKA 3AR6A 1F60A 4UE6A 2GXUA 1R0YA 5CYGA 4N0EA 4N8SA 4CXMA 1G8YA 3GNTA 4L5YA 4ZJUA 3FSGA 1E9EA 1Z4QA 2W6IA 4Q48A 3E53A 2F3QA 5DCUA 1UDBA 4P58A 1L1RA 5K6AA 1KJZA 3EXIB 2RGRA 1OPXA 4LGMA 5JTTA 1QLWA 3SEZA 1X8JA 3GFVA 4HVLA 3GC6A 1AK9A 5EQFA 5K3CA 3TZCA 3VYUB 4FFPA 4NXNB 1BDIA 1Y8QA 3RK0A 2RGAA 3EQ2A 4GWKA 4AXBA 5LP6F 1T4BA 3W6OA 1ZVKA 1H2AS 4WY2A 2GKGA 2FP4B 2CXPA 1QM5A 2BMWA 5I4IA 2COEA 4BPBA 1BGWA 3O83A 3QTTA 3GUUA 1XZEA 4ENQA 5B5SA 4BEBA 3HUTA 2I6XA 2ZIUB 1RLOA 4W7SA 3QA3E 1DELA 4BGVA 4LY3A 2JZOA 2GA9A 3LUPA 4ZICA 5IT4A 4RKEA 1CUHA 4CT0A 1POWA 3WIBA 5CCBA 1EFAA 5A0VA 2QYOA 3BMOB 5HRAA 1RXEA 1XD2B 3HDTA 4A1OA 4G4GA 2BEVB 4HHEA 4QAJA 1XTIA 3QJ5A 1NV8A 1QIJA 2GZ3A 3CV3A 5DYTA 3V7YA 2YJ5A 3CZPA 1E9VA 2IS6A 1PK8A 2W4MA 1AKWA 1YVEI 2CEKA 3U6BA 3JQQA 4QDKA 1OH7A 5F7OA 1QVZA 4NWIA 3ELUA 2YFHA 1CBUA 1PWEA 4Q37A 4WK0B 2FLWA 2ZM5A 5FL3A 3VC7A 2HC9A 3F98A 4L9WA 1D7OA 2ZTHA 1PL8A 2PS0A 2C2OA 2D74A 3SJBA 3ZBQA 4MUEA 2PPLA 2PZGA 2IUTA 2WY2D 3UJDA 4B3TB 1AF7A 1WLSA 2R4UA 5J2TF 2JFXA 4DT1B 4A10A 4J16A 4LYEA 1YAJA 3WISA 4YRTA 4TVOA 1Y3AA 4E3ZA 3EPLA 4PAWA 3ZZUA 2HWUA 1RP1A 1BHQ1 2FDCA 1AN0A 1O4VA 5D00A 5KQRA 4ZIRB 1KYTA 1UMBA 1C50A 1G291 2G1AA 4S2UA 4AYWA 1RQ2A 1SBNE 1I7SB 4MR9B 3OZEA 5CVEA 1SIWA 1L5KA 2R8ZA 2OPHA 1LPAB 5JDIC 1XNHA 4YRCA 1L2TA 2PMCA 3PNQA 4O2BF 1GTVA 3TRFA 2ZJ2A 5B30A 5GONA 4FFRA 1MO2A 3EVGA 3V2GA 1FQKA 2WMOB 2YN0A 3IUYA 4EYGA 4UNIA 2W93A 3ZCXA 1MW8X 2RH4A 3VAZA 3LYUA 4PZAA 1SEPA 1P2UA 3R0XA 2V4MA 1DL5A 2EG9A 1PKXA 3N1UA 3S55A 2ZB4A 3EAQA 1SMKA 3A1EA 1GQRA 1QX4A 3DL4A 3OJWA 4ID9A 4U7GA 3GT0A 2G1JA 3J7AC 2NZYA 3N7UA 2PHZA 2X8JA 4UFOA 1AQIA 4Z9BA 4XB6B 2D3TA 3HBJA 2PX0A 5EQDA 5M34A 3M2TA 3RFXA 3OEED 3WYNA 3LUFA 3OTQA 1N0HA 1JLSA 5FBHA 3OCZA 2Q9UA 2B4AA 2FX3A 5B4VA 4G63A 5E1OA 4ZARA 4EBBA 2IQIA 3FPFA 4RD3A 3S2YA 1E9AA 1ISPA 2HNAA 4RM3A 2O06A 1L8QA 4E70A 1IZYA 4ZEOA 1P9LA 1Y7LA 2BCGY 3HG7A 3KT8A 4QECA 5SZIA 1E2NA 4NE9A 4C2UA 2C7GA 1YRAA 4GSKA 4RBNA 1IVYA 1I32A 4LE1A 3GLIA 2PKRA 4DOMA 3OCWA 1SIOA 4UCXA 4U00A 1S2DA 2XQFA 3OKAA 2BGMA 3X1WA 1L4BA 5FUXA 4WL0A 3GARA 2GJ8A 2NU8B 2JLYA 3QG1A 2ON6A 1A1SA 1VBFA 5IW8A 2VDNB 4F5WA 3ZN2A 5L8VA 4YO8A 4IFBA 5FOQA 3ZUPA 2HWWA 3O47A 4EQZA 2XTJA 3W3ZB 2FJUA 3TW0A 4CTNA 4DIEA 4QYWA 4BYMA 2DQKA 4JR2A 1PVVA 1SG0A 3SX4A 1NUTA 1ZYUA 3HKEB 4MQUA 4R40A 5EHZA 1EFCA 2P5UA 1YKFA 3IAAA 4DLKA 4DLZA 4XWKA 4YMLA 4KDEA 1ANKA 4XCVA 1HYQA 1FYXA 1Z6ZA 3VKUA 2WHPB 4EGFA 4F9EA 4FYKA 3AUUA 4G24A 2CK3A 1OT3A 3AHGA 1W36B 1EVLA 2JBHA 2Z1NA 3N8DA 4R3UC 1ULBA 4Z0PA 4R2IA 1N3YA 1PDWA 3ESRA 4ZC1A 4E13A 3IP3A 1V2GA 3K0KA 4OQNA 3CUTA 4W6QA 4DDVA 3NFYA 2PMEA 1YS4A 2FF7A 3BA6A 2AYZA 2HA2A 3ESAA 3KB2A 5THKA 2DF8A 3A1NA 1M7HA 3TN7A 1BRMA 1R4ZA 1O97D 4FILA 4CTJA 3SZLA 5EINA 3QRWA 4R01A 1WXFA 4M37A 2GZSA 4PG4A 3W5HA 1Z56C 1TAGA 4JQSA 1MN6A 2W2PA 3KSMA 5LWHA 1YFLA 1MEEA 3HDYA 5ARCA 4I5DA 3TPFA 4BO2A 4AN1A 2Q1UA 2QR3A 2C7QA 2P6NA 1JKMA 5PNTA 2Y27A 1O77A 2ZETA 3BHMA 3ETGA 5KWJA 3GGOA 4XASA 3WMFA 4FYHA 4LSGA 3CBQA 2P6UA 3L18A 5LA6F 5HOQA 3DV2A 2OTCA 1DHTA 3MELA 1A5SB 3H83A 1F0PA 4NSNA 1C9EA 3GLSA 1SUDA 5HBGA 4YP7A 5DLYA 1GQQA 3SZMA 3ESZA 3I62A 1O5IA 1PL7A 2PX8A 3EC2A 3HXLA 2CJFA 3IXQA 4LYAA 4XPIA 4WW0A 3CWCA 3RRZA 1U7DA 4PX5A 2AMYA 4UE2A 1S2MA 2LTAA 1EFVA 1SWWA 3C6QA 2FPSA 3LHIA 4BNKA 1XLTC 2ZWIA 1GR0A 3BORA 1CUDA 2ZT6A 4N0MA 1ZIPA 4W7IA 4CJXA 4KITB 3QX3A 5EYPA 1YCHA 4J3NA 4HATA 1M0TA 2BEUA 2XBLA 3ZTYA 4C4XA 2ZI9A 5KCZA 4K6KA 5AK5A 4CV1A 5JCJD 3KVYA 5J3JA 5JYDA 2V9ZA 1ODKA 3M4JA 3WSVA 2A1TR 2Z2YA 4FDAA 4IFEA 4Q4JB 4CVNA 4QATA 3ERCA 4RSGA 1DXOA 4UUPA 1XWIA 2BTQB 1BDBA 1FEZA 3M6XA 4FGZA 3RUDA 2R48A 3H5WA 1OVGA 1WHSB 3NHPA 4MGZR 5SY6A 3KFVA 2V0CA 1U8ZA 4GI5A 5BSWA 4BX0A 1XJ5A 4CN9A 4YNBA 1LI7A 1X7XA 2JFFA 1BMQA 2D5BA 3ACCA 4YFVA 5IF9A 4MWZA 5ALZA 2TMGA 4HQLA 5KWVA 3BXXA 3ZWYA 4MRRA 4LJRA 4BCCA 5ALLA 4F97A 1YR9A 4D02A 1ZHOA 2VJMA 5JVDF 2D5LA 1ORHA 2F6RA 2Q0SA 3FNGA 1FX1A 3H18A 1M1UA 3KJXA 1V5GA 3OAAA 4FT2A 1S2IA 4G5QA 5IKOA 4F4CA 4NBUA 2VP5A 3SD7A 1Y9DA 4OHCA 4RVCA 1F20A 2WB2A 1PEAA 3NEYA 4AX4A 2KBFA 2X5OA 2X8AA 1LLUA 2LCIA 2XCIA 4L9AA 1GFWA 1U2RA 4P38A 3PQEA 5K3SA 4CIDA 1LJUA 2MSDB 1MH9A 4P83A 4DDWA 3FUWA 4Q1VA 4GX0A 5I8WA 3TTXA 1XIVA 2O2XA 5AESA 4BQQA 3QVKA 1HYHA 4BBPA 4E5YA 2AOTA 2FPIB 1C4KA 5C5DA 3RFVA 4P98A 5SICE 2RK3A 2WJGA 2ZAMA 1T4MA 3C3YA 5CX1A 2FMKA 2YMPA 4Q3LA 3RVMA 1Y82A 4W1SA 4IH1A 1GSAA 2ZRCA 4ALIA 4KQHA 1EVQA 3RSZA 3GLFB 4K7JA 2Q7DA 1HUQA 2FUCA 2YMLA 1GG2A 4E14A 3OTHA 3O92A 3T1OA 1X8XA 3WDSA 1C3JA 2ODPA 3G0GA 5DW3A 2CUNA 5ELLA 5TQ2B 1K8XB 5L4LA 4IILA 4O0LA 1JXAA 1A82A 4EG4A 1A2BA 1U3GA 2GAFA 4QPCA 3PRYA 4AJ4A 1MOSA 1JECA 1NVGA 1WZIA 3EK2A 4LDPA 1HFJA 4UHHA 4IGAA 4YAEA 5B1EA 2I76A 1MG5A 1D6MA 3IUNA 5D3KA 1VI5A 1TF2A 1E32A 2BFFB 2EBUA 3M4YA 4GPEA 5DI3B 1QF7A 4CMBA 2I7XA 3DCJA 3T7RA 3QI2A 2X0NA 4NFSA 3H9JA 1K89A 1MJGA 1W34A 1WXIA 2C5LA 2W2NA 3B3FA 4U7TB 1N1DA 3D1VA 2J07A 3F1KA 2CVFA 3V9PA 2HAEA 5K3EA 3BSYA 3D7KA 4V3CA 4FOPA 4N5IX 1DCMA 1E6LA 1L4FA 5CYFA 3TKAA 3TVYA 1EUCB 4BLWA 4CEJA 2YUIA 1PEYA 4BVHA 5JCPA 1B0UA 3PEYA 3A3OA 3BYZA 3GCXA 3OZIA 3PQ4A 1A4UA 3HGTA 2AC4A 3RKRA 2BLNA 3RSFA 1AT1A 1J0CA 1XCOA 2H1OA 1IN6A 2XT6A 1A5AB 4E6EA 1V9SA 5AKGA 2PT7A 3B20A 3SXUA 4HFMA 2BKUA 4FZ5A 2J5RA 3UT5B 1N3IA 1U7PA 2O14A 2DR0A 3C8MA 1QTQA 2FOLA 3ETJA 3PNKA 4L8VA 4YMHA 4RPGA 4D0NA 3HDQA 1N2HA 2RFLA 2VZ0A 3A7EA 3DS8A 5KYTA 4EB0A 2ZYRA 3CH5A 1BVUA 4R9SA 3IAUA 4RZQA 4XYGA 3UHFA 1BU5A 4AO6A 5MDHA 4B3MB 5DISB 4FN5A 2ICAA 3K9WA 1K8ZB 1YR3A 3V8VA 1XTUA 1LRKA 1W19A 1CQZA 5KNLA 1I7QB 4A8TA 3AERB 2WIGA 2Q4TA 1DKMA 1GR1A 1K86A 2L82A 3VC1A 2JIOA 1ELOA 2ZI6A 5FIUA 3PUHA 1RJFA 5TMBA 1RZVA 1RHKA 1Y1SA 2OV2A 1PZNA 2F67A 2JKVA 2O20A 2OD7A 4HMPA 4OMFG 1L4HA 2FFJA 4PGAA 3CXRA 3QGMA 4RKYA 2JHFA 4ZOAA 1DRJA 1QS0B 3R3UA 4EZIA 3RVDA 5HIIA 1T2EA 4LOKA 3TNJA 1IY8A 2FZVA 2P9CA 3LQQA 1LBTA 4Z9XA 4MYHA 1MU0A 4EHIA 3WWPA 5KVVA 1GL3A 4MULA 1JHPA 3AFOA 3PUIA 3RFCA 1KIFA 3H5OA 1YE5A 3GJZA 1JHVA 1GQOA 1HMYA 2HIAA 3OICA 3GUZA 3PC6A 4AAYA 4LMBA 4JC8A 2R1VB 5JY6A 2YW9A 1T29A 5CBPA 1JZQA 1Q6YA 3VAYA 5E3HA 3GJ3A 1QIKA 4YVFA 3ZWAA 2QTCA 5IJ9B 5HKOA 1L5VA 4RC9A 1TZ2A 4S3MA 2HA7A 4LCJA 2VHZA 1S2LA 1GGKA 1ESNA 2HIMA 5BR4A 1SELA 2P4QA 2DFPA 1QCZA 3MCUA 5FA6A 4TLCA 4WQMA 5REQB 3UV6A 4LFCB 5HS6A 1PG0A 2G7ZA 1GQFA 2Z9BA 4TKVB 1EHIA 1EDEA 1QG6A 2B9EA 2ZYGA 3EQ7A 4UW9A 5AICA 4OJYA 4AURA 3MRTA 4RFLA 3HXMA 2CHEA 5LZ5A 3IAHA 4QOSA 4JJIA 4A8JB 1D4OA 4C4SA 1IB6A 2JGIA 3BK7A 4D9MA 3QFFA 4Y2YA 5ECWA 3L7NA 4NMMA 1CUFA 3K09A 4K2AA 4DC1A 2O59A 1DBRA 1PD0A 2PH3A 4GH5A 4DJJA 2XUDA 4F92B 2SKDA 1IWOA 4TMZA 1ZAKA 2FEWB 4HNAA 3ZU6A 1P2DA 3EDQA 2NO1A 2BFOA 2RDMA 2FF5A 4X64B 3DT6A 3DXXA 1K6IA 1JIQA 4LDZA 4P4GA 1CUGA 3IDZA 4HLDA 5DHTA 1N4AA 5DXJA 2JJ8A 1M2VB 3CN7A 4BRUA 4YUZA 1SUEA 2Q1WA 2ZYHA 4HAXA 1B3RA 4D9NA 4URVR 3T3NA 4IOJA 2IS1A 3IDQA 5G40A 2L2QA 1FP2A 1GU7A 2UYOA 3VH3A 5BXYA 3Q41A 2QN6A 3K0CC 4PZUA 1Y3BE 1AKTA 3JQ8B 3TQHA 3U49A 3MT7A 5F9HA 4PRLA 4RH3A 1QFXA 3PF8A 1WZCA 3KKLA 3EZGA 2VO1A 4P32A 4NDAA 3RB8A 4BFCA 4CQLA 4D98A 2JI9A 2ZIEA 4BMCA 4K9NA 1NXXA 4V24A 1HT3A 3SEAA 5A9SA 2J0SA 3WK7A 1RLUA 4N54A 3F7OA 3COWA 2H9IA 2OCDA 4R5MA 2PX5A 2RAFA 4QWWA 4Z1MA 2B25A 2C9ZA 1OGYA 4RM2A 1J0AA 1ODLA 4ZTZB 5AKYA 1F6DA 5EEHA 1E7MA 3I9NA 3WADA 4F2PA 3HPRA 4RZ2A 2IV3A 5I4KA 2Z56A 1WDTA 1FNNA 1S8AA 2OV1A 1U3UA 1PSDA 2CY0A 3Q7QA 4FMBB 1GPWB 3SGLA 4F4DA 1V37A 4E31A 5EJ4A 2XDAA 3DOOA 5LYJA 4ND8A 4LWQA 5DM4A 1QHGA 2QTFA 2YOFA 2W42A 1WKCA 1FBTA 3ZBUA 1PBNA 2BUCA 4EF4A 4OYYA 2HK9A 4X63A 2WAAA 3ORHA 1BH2A 1JSRA 1KI9A 3OQBA 4FFNA 5GY7A 3VPAA 5F7XA 2ZJOA 2JW5A 1W2HA 4RD0A 2HRBA 3QMWA 2P9EA 2QT0A 3D1LA 1UJ2A 2VUHB 3BH0A 1CQJA 1JMYA 4L0CA 4HXEB 4FINA 4U7PB 4UREA 4LDJA 4YRFA 3ZGXA 5LXTB 4R05A 5IAJA 2WQ7A 5F9FA 1SKAA 4LC1A 4RS3A 1U65A 2X7JA 2GD1O 1I94B 1N5RA 4J7CA 1O6BA 2L19A 3KB1A 1KZ7B 1NLMA 3NTVA 3VZSA 5IN4A 1SCUA 4ZQGA 5EFOA 2QX7A 2XCOA 3VMFA 4OX9Y 3G2PA 3ZU4A 3IB6A 1R27A 1OZFA 3P0FA 3BGWA 3ODPA 5FEUA 4NCAA 3SVZA 3KLNA 5D6NA 1S1MA 3HWWA 3Q10A 3SOPA 3QVGA 3G59A 2BEKA 2ONYA 3WVNA 1X1CA 1H1LB 3SEFA 2PUBA 4INZA 1DARA 1I4LD 1TYDE 2ORED 4J4HA 4QPPA 2VAMA 5U1PA 2UZAA 3V34A 2HJRA 4MV8A 4E4RA 2XF2A 3CZMA 4RK5A 3KOWA 1T0IA 1OXTA 1M54A 5HF5A 4MVJF 1NJ2A 2I8LA 1NDHA 2OV6A 4ABYA 2F8LA 5FPTA 1Q7RA 4FVTA 1NVKA 3FE2A 4MUIA 1NVXQ 2CZGA 4DG5A 4JNKA 5LUAA 4LQDA 4RXMA 1XKXA 1KDPA 3H2HA 5L3SB 1C8BA 2O4UX 4I50F 1TCUA 2J0UB 7AT1A 1GGHA 3NASA 4XYEA 1QHSA 4MV7A 2PSDA 1QHXA 1BMDA 2HLHA 2Q3CA 3SSNA 2VJPA 4XX1A 3OQ1A 3HJCA 4X95A 2F1HA 2ARKA 4IH4A 4JAVC 2QT9A 5E6SA 4E2YA 2OZVA 5TF4A 2PUDA 4BAUA 4TZ6A 2VPYA 3I2KA 4MW5A 1LW7A 2HF7A 1O94D 1XZJA 2H3HA 4MVJH 2G8LA 2ZUVA 5EXXA 2YHAA 3MMSA 2RHWA 3VZCA 3PE4A 1SVIA 4IVQA 1JR6A 1KAMA 1X7WA 2FN3A 2NV2B 3TEJA 2BGUA 1VXOA 2HTFA 3M3HA 4BBJA 4C3UA 3H2BA 3IDAA 1FP7A 3V4RA 1CDZA 4GKVA 5IXSA 4GWGA 1FLDA 1RYDA 1VFPA 4LISA 5BSKA 1PW5A 5EL0A 5F3WB 1YASA 3DEIA 4UEWA 2M6KA 1XMOB 4MCJA 3FPBA 1U8EA 1XVLA 3E1SA 3MJVA 2WU8A 1QIGA 3QNUA 4AJJA 4DDKA 4UARA 1FRZA 1I6MA 2IUYA 5H1YA 4ZCMA 3F9CA 5AW1A 5GZ3A 4KSYA 4RY8A 4GVPA 1OSNA 1R0CA 2JARA 3OQJA 4E5NA 3QEJA 1G5TA 2DX7A 3R2JA 4V38A 3WGZA 1HEIA 4BNVA 1XA3A 3ZHTA 3Q8XB 4WTOA 3IH5A 3FTPA 4MROA 4NQZA 2HQOA 3TR0A 1AUPA 2Q6VA 2B2CA 3B1XA 3DMTA 3RJ5A 3K72B 5CA1F 3OT1B 2YNMC 2ACWA 1HDIA 1BHO1 2DMRA 5K2OA 2B8NA 3SU8A 2YVQA 3L7JA 5IEJA 3VR0A 5DN6D 3WLTA 4YAUA 1RWBA 3GRYA 3RIXA 1MT0A 5KVCA 2XOEA 4JH0A 4XOIA 1F9EA 1ESZA 5A5VA 1OH8A 3T9BA 4CR7A 3E9EA 4D9KA 2Q3HA 3COSA 5DBOA 1K0FA 1XEFA 4ZCRA 3E9QA 4PFJA 3F4LA 2ETXA 1C9MA 1GNSA 2VCEA 4L0QA 3ZE6A 2OLEA 1IHUA 2BBSA 1Z28A 4MS3A 1W0JD 3EQZA 3OLXA 3D8TA 4PCAA 4JI5B 1PWYE 1WMFA 5MFZA 1Y34E 4HC4A 2VHVA 4IZIA 3T15A 4JJKA 3PTLA 3VZRA 1TU3A 4A0QA 3AB7A 1V35A 2C5EA 1QHNA 3ENKA 3K2EA 4LK3A 1K98A 5CITA 2ZREA 3UAGA 1ISRA 1Z8NA 4HEA1 3O8OB 4Y30A 4F9FA 1JS1X 5JG7A 1F8UA 1LRLA 4F5YA 2OGZA 3MB5A 3DVAB 4BKRA 2AZMA 1SHLA 2GO7A 3RW9A 3X1MA 1SIUA 3SIRA 3ACBA 1JG4A 3QXCA 4Y6RA 3RLFA 4WKCA 4F4IA 2GZMA 1O08A 5E3JA 4F3KA 2H5EA 3T3EA 1DAGA 1NVAA 1SVUA 3GDGA 3EF1A 1G20E 4OJMX 3AUTA 4PLZA 4W5OA 2CCJA 1QVWA 2DT8A 1G38A 1W4CA 2POQX 4DBLE 2DPYA 3AOEA 4KYTA 2CFTA 5D3MA 3N75A 3DEAA 3ZD7A 3IQWA 4X60A 2XB8A 1LH0A 2QUBA 2VK8A 2EQAA 3GEGA 3FRHA 5M04A 3RYHA 4XYLA 3VKHA 4HDMA 3USES 4DLYA 1BWQA 1R8QA 3TW8B 1NKTA 3DD1A 4HPJB 3NAQA 5DGIA 2VPTA 3F5DA 4P36A 3U9LA 1OB2A 4XIFA 3FWPA 3QVVA 4PCVA 1UPCA 4RQUA 3DPIA 4MV9A 4DLPA 1E2IA 4BKQA 3DZKA 3VKFA 2BDTA 1ZBDA 4Y7DA 4OI2A 4WASA 3ZIDA 4I2VA 2JI4A 1EXNA 1BE0A 3ER6A 4MZXA 4BJ3A 2YZGA 2J9FB 4P7KA 1I2AA 1RTTA 4LSMA 1XDDA 2JAOA 3K8YA 1BX3A 4U2DA 4CKBA 2F4VB 4XDYA 3T9AA 1N5LA 4YXWA 5CT4A 4QSHA 1JI0A 2YV3A 2EFCB 4E12A 3QXSA 3GRZA 5AKLA 1EXDA 1YXMA 2WNHA 2AZXA 3M5PA 1F2VA 3V7NA 1J1IA 1SHKA 2HIHA 1SU7A 4CHTA 2JGJA 1EM6A 3N8NA 3G89A 4UM8B 1KK2A 3LKZA 4Q6WA 1F38A 1QAOA 4G1VA 3FF1A 3ECCA 3BJEA 4TN5A 1NVBA 1KVUA 3RVJA 1UXIA 3WB0A 3FR8A 3AFMA 2Y1OA 3NI2A 4M0MA 5J2UB 3WWDA 4A0GA 4NJOA 5AI4A 1YR6A 3CNQS 4X1YB 1U1EA 2PSJA 1P2FA 2ZCUA 4J1TA 4YJGB 3QEAZ 4M2LA 1Z7EA 2J8ZA 1P9NA 2QV7A 2H31A 1A2KC 2IIPA 2YFQA 1EFLA 3BJZA 3Q5GA 1YDGA 3G8AA 3L0PA 3WGTA 1K0UA 2XCUA 4TMYA 1EK6A 3I9FA 3RADC 5COQA 3IKVA 1AMNA 4K26A 3MFYA 3OIWA 2JL1A 1LDNA 4CLXA 1QHFA 2BEJA 1L5WA 2NQ8A 1KO5A 1X94A 2ZRHA 3E4DA 7MHTA 3IOYA 5AW6A 4NS4A 1DXQA 3GOQA 3ANTA 4IMRA 1NASA 1ZM2A 1MFPA 1JFFA 2DPHA 3GCDA 2ZTVA 4RF3A 1MJFA 1Y5MA 2UYCA 1E5DA 3DQZA 2AFVA 1TCCA 3AHIA 1U4OA 3L1IA 4I4TF 3N2IA 1J07A 3BZBA 3AGPA 4R16A 1Q21A 1KI1A 1YK1A 3BG5A 3KV1A 2DUMA 3CSUA 4NHOA 4TMFA 5HILA 2B7BA 3GBVA 5LB4A 1OXMA 4PYJA 5JANA 1D6JA 4B4DA 1WE2A 2DWOA 4QJ4A 1JVBA 5DSZA 1YUMA 2PO7A 4QUKA 3EDYA 1FFHA 2Y1LA 4G41A 3R9XB 3VHRA 3N87A 5IKMA 2XA2A 4U2EA 4JU8A 5DTMA 1RXCA 3EE6A 1DAKA 1N7JA 3EDRA 2NUAA 2VI5A 3R3HA 3RODA 2PV0A 3KAKA 1SN7A 4QG7A 3O5AA 2HU2A 4EFMA 2YKGA 3A28A 1DIHA 5ITZA 3JQPA 3KC2A 4RY9A 4V0QA 1U2QA 4RSRA 1YQDA 4C7BA 3FHLA 2BC9A 5BYAA 3BE8A 3AIOA 1CR1A 4C21A 4WLFA 4XLLA 3EBOA 3I0ZA 5TQ0A 1A9RA 1I1QB 4MKRA 1KVRA 4ZGBA 4G8JA 4FCTA 1VP9A 1LTKA 3THRA 2WT8A 3VUFA 3K20A 1FFWA 1XRLA 2H1RA 1O4WA 2F9MA 4QVGA 1OROA 1FDTA 3MC1A 3PI6A 2WF5A 2K6GA 1TKBA 4B75A 5BSHA 2VL7A 2SBTA 1CE8B 3GG2A 4CI9A 1DJNA 3EASA 2PD4A 4IOKA 4R6WA 1Y80A 3TRJA 1H2EA 3DWIA 4FWBA 4ZCTA 1MVNA 3AK4A 3GMDA 3FCYA 1L7XA 3R40A 4B35A 1U7HA 1G3UA 3LZDA 5DYNA 3FFWA 2YJGA 4B6PA 3LTNC 1JT2A 2PNFA 2Z9DA 4HD8A 5AJVB 4CFZA 1Y9ZA 4CLDA 3S40A 3D0KA 4MW9A 3DB1A 3B52X 1CLUA 4Q4AB 2WE8A 4REMA 4UOQA 4ER5A 1R6XA 4H6WA 4KPUA 3TSCA 1PNOA 3P27A 3QLEA 3IEXA 4X62B 2DGDA 5TE9A 1IWPB 1G2PA 1I9GA 1XDWA 3B3GA 4FZRA 1XQWA 4K9RA 2ZJZA 2FCAA 1SOWA 4ND1A 4E1BA 3SIXA 3RKUA 1LPPA 1DWOA 1L5HA 3WGLA 4BU1A 2OWEA 2JLRA 5EE0A 3Q8KA 2WJIA 4ARVA 2Z57A 4QASA 3AOGA 5GVRA 3MBIA 5FLXA 1MBZA 1BKDR 2ZJBA 2G8NA 3PKIA 2N75A 1FJXA 1PX0A 2HRRA 2RGNC 3BFVA 3PG5A 3GWGA 3LL7A 4M9ZA 4OUDA 1RADA 2QYSA 3OP4A 4HFNA 5EZSA 1YQXA 1XROA 3ES9A 1LBHA 2ZYVX 3NIBA 5HJ5A 3PGJA 1DC3A 2OCIA 2O8CB 3CNHA 2I67A 1J99A 2QNRA 2XITA 3A6JA 4NHEA 4I1PA 4W9RA 4YCDA 2VEDA 4NYJR 2CXHA 3AW8A 4PHTA 2WOOA 3NYWA 4GYYA 1D03A 4XLTA 4AO8A 2JJ2D 3L6DA 4CM8A 3A31A 2G82A 2FK7A 4HTAA 4UBLA 1DE0A 2X42A 5CJ2A 3HMQA 3C1UA 3WGMA 4EVIA 4RJTA 3FI9A 1NSTA 4MUYA 5FWAA 2OYRA 5LQMA 2NZWA 3BWBA 3KM0A 1SBHA 4FHGA 4YDHB 4JI1B 5HIKA 2GBCA 1O96B 4K40A 1GZHB 4AG6A 3SNHA 3WLOA 4AP6A 4H1WA 4ZYXA 1MGOA 3PJRA 1SC6A 5MN5A 2P65A 4LOJA 4ZHQF 2IQ5A 3ZGZA 4YJKA 2QM0A 2AJDA 3PPYA 1XAIA 4HEHA 4PAMA 2AF4C 4QNRA 2CXOA 1H1TA 1Y1QA 3RM3A 1RYFA 4XYMA 3TPZA 1GPLA 2IOFK 4JXXA 3FMOB 2Q5IA 4ENSA 3C8HA 1Z35A 2GAJA 4JLPA 2V4UA 5ALTA 4E22A 4NOMA 1QZTA 3PHGA 2DR3A 4E11A 2EFYA 4TS1A 2LGJA 2QVBA 4CMHA 2ZYWX 4TPKA 4TTAA 3E61A 1V9LA 2I54A 4AKGA 3RPEA 3IESA 1EQAA 3W3AH 2XGOA 3LC1O 4MKHA 3WK6A 1JXQA 4H7FA 4U9UA 3WQSB 5J4YA 2DLCX 2IFTA 1A97A 3FOEC 1QU2A 1RSZA 1ZITA 5C31A 1ZEJA 1ZN7A 5JPIA 3GNSA 3KB8A 3KR2A 2LPMA 3UB2A 4QEKA 4TWIA 4QXPA 4J0KA 4CLOB 3SDSA 3UAOA 4BQIA 1T5SA 4P4SA 1W5BA 4CV0A 1UBLS 4RPCA 4D81A 4HAZA 1N2CB 4C0BA 4QYMA 5CEEA 3F9IA 2YY5A 2P9BA 3FDZA 5JAUA 1OV6A 2P2NA 1FJGB 2UXCB 3B6ZA 3GVXA 2X76A 4S04A 4JXZA 3G5MA 4D3XA 1NOKA 5EPEA 2MSKA 1UMCA 3ZBPA 4YUVA 4YYZA 1FFAA 4EI8A 5JNUA 2NW6A 2QUHA 1OB5A 4G0UA 4LCBA 2CMHA 2FFAA 3S5JA 4EUHA 2XCTB 1NZJA 1XLUA 2XAUA 5DHQA 4JUIA 2Q5QA 2XYPA 3WRVA 1RQLA 2DJIA 4MUGA 1GPJA 2BTOA 4EYQA 3FWHA 3P9RA 4DLTA 3KUUA 2VJNA 1H2HA 3HM2A 2BMJA 1T9GS 3R75A 2NSLA 3L1VA 3NORA 4OM8A 4X7RA 2GT1A 3BC1A 2P4UA 2WIBA 4LS3A