4JVNA

Crystal structure of human estrogen sulfotransferase (sult1e1) in complex with inactive cofactor pap and metabolite of brominated flame retardant 3oh bde47 (3-hydroxyl bromodiphenyl ether)
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
291
structure length
291
Chain Sequence
SELDYYEKFEEVHGILMYKDFVKYWDNVEAFQARPDDLVIATYPKSGTTWVSEIVYMIYKEGDVEKCKEDVIFNRIPFLECRKENLMNGVKQLDEMNSPRIVKTHLPPELLPASFWEKDCKIIYLCRNAKDVAVSFYYFFLMVAGHPNPGSFPEFVEKFMQGQVPYGSWYKHVKSWWEKGKSPRVLFLFYEDLKEDIRKEVIKLIHFLERKPSEELVDRIIHHTSFQEMKNNPSTNYTTLPDEIMNQKLSPFMRKGITGDWKNHFTEALNEKFDKHYEQQMKESTLKFRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mimicking of Estradiol Binding by Flame Retardants and Their Metabolites: A Crystallographic Analysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Estrogen sulfotransferase
total genus 112
structure length 291
sequence length 291
chains with identical sequence B
ec nomenclature ec 2.8.2.4: Estrone sulfotransferase.
pdb deposition date 2013-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4jvnA00
2JJ8A 5FTMA 2QGNA 3B1ZA 1KSHA 4TYPA 1JAIA 3EZFA 4DT1A 1JR3D 4B3FX 2GK6A 1M2OB 2J45A 4M1KA 3U3KA 2GDJA 1X8JA 5J47A 4C9BA 3CONA 3DMDA 2VTKA 1VIYA 3CX6A 4TLEA 4M8NE 2D3WA 5GJVC 2CHGA 1VECA 4PZYA 5EUQB 2FWRA 1NJGA 5EP1A 4C4PA 1TUEA 3AEZA 4BE7B 2WWHA 3R9XA 1G7RA 2WIAA 1WBBA 3TSOA 2WWFA 4RD0A 1GDDA 3AGQA 1FQJA 4LJYA 1YZQA 2QA5A 4OHYA 2QPTA 5E3HA 3FOZA 1S9DA 2J0UA 5JEDA 4Q7MB 4DWJA 3SC3A 5BN4A 2YINC 4X8OA 1BIFA 4BLOA 5KOYA 2HV8A 3P4XA 3Q8XB 4DB2A 3AVXA 3KTAA 2WZQA 5HE8A 1JR6A 3DHWC 2FN4A 3LLMA 1DAIA 4QGHA 4BECA 1RW4A 1JI0A 3SYLA 4Z1MD 2JIZD 1W0KD 4B35A 3KJHA 3CF0A 2O8DB 5HZHA 2IS2A 3PV0A 5F2EA 2P6RA 1Q1EA 3M4YA 1FQKA 3E5HA 1NLZA 4Q1CA 3UK6A 4E07A 2BJVA 4POAA 3CNOA 4PR0A 4B3CA 1E1RD 1J90A 2FGJA 3IGFA 1EFCA 2J9RA 4M22A 1UBFA 2CMKA 4JLOA 1JJVA 4BEJA 5GJBA 3AUXA 4KAXA 3A4LA 3AKCA 3SJAA 3ZS8A 4ZCLA 5DYIA 1CULC 2EVWX 1TUIA 5LD2B 2X77A 3THXB 2IYSA 4OBEA 2Q3HA 1OH5A 3GJ4A 1NMZA 2CK3D 3KKPA 1QG4A 1T0JB 5CM9C 4HSEA 3RS2A 3ZVNA 1SULA 5IHPA 2P5SA 3AF1A 1P62B 2NOAA 2VP2A 2QMHA 1JB1A 1XFAA 1MO4A 1SXJC 1PLKA 1NLFA 4NYMQ 3SS8A 5BWMA 5FOVA 1TX4B 4V0MA 4ZO4A 1ZIOA 1EK0A 2BWJA 4C7OB 4UNRA 2F9LA 4A2PA 4MYHA 3JVVA 1F2TA 1DAFA 2ANBA 3JZMA 3MD0A 2YOFA 5AJYA 4LK2A 5C18A 3OESA 1JXMA 1M8PA 1S96A 4MA4A 3HP1A 4P0TA 5EUMA 4C30A 4FD2A 4IDOA 4QL3A 5D3QA 1ODFA 5AWFC 2ZRMA 4JSYA 5JBQA 2CNWD 2O8FA 3TAUA 3W8RA 1U8YA 2DR3A 4EQ6A 4EJSC 1E0SA 3KKOA 4Q03A 2OFXA 2UVQA 1NN0A 2DFNA 1YHNA 4AYTA 1DS6A 4IOMA 2PCJA 3B6EA 3RC3A 2ASEA 4Q9JA 1T3HA 2GCOB 1S4QA 1TQ4A 1FMLA 2LKCA 2EWVA 3MAAC 1B0UA 4RD2A 1WRBA 3PENA 2CE7A 3MG9A 2CJWA 1EWRA 2FPLA 2AL7A 2OEPA 1B23P 2A5DA 4QHYA 1RRPA 1UF9A 5KPJA 3U6BA 1E0JA 4QC2A 2VHQA 2EFCB 5CYOA 2DCUA 2A3RA 4B74A 1KO4A 2ZRJA 3H2YA 3AP1A 3D8BA 4TQ9A 3IIMA 3Q7PA 4ABYA 1Y63A 2WSSA 3FHOA 4C0AC 4KODA 4B3BA 5BW8A 5KPDA 4TWZA 5JSZA 4JL8A 2WSSD 5C4MA 3L2OB 2J87A 3N5CA 3ADKA 4UNNA 2J0SA 4OI0A 4DCVA 5E7MA 2PEZA 2ZANA 2Z83A 3L0OA 2ZI5A 4BZPA 4YQFA 2RGCA 3THOA 3TMKA 4A92A 2FEOA 2GKSA 3NH6A 3ASZA 1UDWA 2AD1A 2G3YA 1KAGA 2HYDA 3W9YA 1RC8A 2IS4A 5DI3B 4KFTA 1E0KA 2GCNA 3KB1A 1ZJ6A 2FSFA 3KXIA 5FOSA 4NTZA 2PCLA 1CU1A 4PAMA 2NPFA 4GBMA 1KYIA 3P26A 2OLJA 4ASUA 4DXAA 2ZI6A 1QG2A 2IYLD 2ZRDA 2KJQA 2FFBA 1GVNB 4PHTA 3R9WA 3N2EA 5IK2D 5GVRA 1Z0AA 1O3YA 2IF0A 3SE0A 2QP4A 1T6NA 2ZRKA 5JJLA 5K8IA 3BGWA 2J0UB 4GOJA 2EFEB 2CNWA 3EC2A 4ZDIA 3WP0A 1CIPA 2FFHA 3EASA 4JLDA 1MKYA 1P9WA 2GBLC 4LJ7A 2J1LA 4WXPA 4WOPA 4XTRA 4DLWA 1TF7A 3FMOB 1KDTA 2G6BA 2PZGA 2J0VA 4TT3A 1IBRA 4FMCB 5JEEA 4DVGA 1KDRA 4DDWA 3IPXA 2GJAA 3QXSA 2QMUA 4AYWA 1Z2CA 1II9A 1C4OA 2RHDA 1TQ2A 2WMOB 4PC1A 1FUUA 3R9IA 5KYKA 2J7KA 2QTVB 1QHSA 4K81B 1E9SA 3GP8A 3BK7A 2X8AA 4X8MA 3QUSA 1CR4A 3MWLA 3X1XA 1F48A 1M7HA 2R6CA 2P6UA 1E3MA 1G7CA 2NZ8A 4W5HA 3KX2A 3FPAA 1DELA 4WA7A 3WYAA 5L3QB 2HYIC 1GNRA 4OI1A 1OKKA 2Z0MA 3C15C 5DH9A 3OEED 4K46A 1JPNA 5HCNA 1COWA 1HH4A 2QNRA 4IOJA 3ZJYA 3ZQ6A 3CPHA 1VHLA 5EP2A 4PQYA 4GNKA 3LRPA 3IUYA 4YXWA 2QAGC 4D4LA 1J8MF 2HF8A 4LJ4A 5FTLA 3KL4A 3C8UA 3VR3A 4URZR 2QMEA 3VQTA 4LV6A 2ZUBA 3QXCA 2F6RA 3LDAA 2NQ2C 3I8SA 2Q3MA 4CW7A 1KSJA 3ICQB 4C7OA 1ZNZA 2XNDA 4JLNA 5FTJA 4EFMA 2ZEJA 1GSIA 2ZIAA 2V9PA 1AS3A 4MRVA 4C0LA 4BWYA 1GITA 1R4AA 3CR8A 2LCFA 4A8JC 2IYXA 5AJXA 3ETLA 5B2ZA 3RHFA 2GEVA 4D82A 4HLQB 3MWYW 4CF7A 2ODNA 2XNSA 3FWYA 3PEUA 1HV8A 4TLDA 4YONB 1OXVA 1RVDA 1S9HA 1M6NA 1DO0A 1GTVA 1QHGA 1DEKA 3G0HA 4H1UA 2P2LA 1XTSA 3HU1A 2GEUA 1U0JA 2XSZA 3CUEF 3PEWA 3BFXA 2W2TA 3KQLA 4XOIA 4L4UA 2NZJA 2Z43A 4QGAA 4KBFA 5JWHA 1OB5A 1H8EA 1IXZA 3K0CA 5FBVB 1GG2A 4ZDWA 1SVKA 1IM2A 1E2JA 2QAGB 1OFUX 3LNCA 1DTSA 4XH9B 1ESMA 2P3SA 3IKJA 1WMSA 3BH0A 4IJMA 3DZ8A 5JJIA 1BMFD 2HUPA 3CWZA 4DLZA 2ZU6A 3B1WA 1UKYA 3LWNA 1Z29A 4EFNA 1E2KA 2H17A 3GCGA 5CM8B 1XEXB 4G0NA 5H1YA 2DWPA 5IDVA 4F92B 1P9RA 4GDFA 3AKEA 2WKRA 3EC1A 1U94A 2QP9X 1T0HB 1OFIA 2VQSA 2QSZA 4ZPXA 3VR2A 2WKQA 1MV5A 1XCGB 1L8QA 4LV8B 5FPKA 3I5XA 1DG1G 4J0QA 1OXUA 1IQPA 2RAPA 3R8FA 1G3RA 1KTVA 2QRNA 1TQDA 1R8SA 5FBQB 2WVJA 1YZNA 2REXB 3SJCA 2ZU0C 1ZNXA 2ZAMA 2AKAB 1N6PA 5BN5A 1DAKA 2Q0HA 4QGGA 2B7BA 5KNCA 1QHHA 2A5FA 2DHRA 4ZI3A 2XZLA 2ZE6A 1FW6A 5DLQC 3OEHA 2H16A 4NU0A 4LBYA 3E70C 5HE9A 2ZS9A 4F4JA 2XSZD 3LXRA 5KSZA 2O8FB 4IRUB 2FE4A 2ZRNA 3EXAA 4DZZA 3FFBA 1IAQA 1XMJA 3WMGA 4URYR 1JPJA 2A30A 1ZUNB 1J2JA 4OJKA 3ZDQA 4IEIA 2R2AA 2CE2X 1G20E 2P67A 5EP4A 3SU8A 1X8KA 2ZYUX 2B21A 3QEJA 2A9KA 2ZJ2A 3TVTA 3MGCA 4U00A 1XJ0A 221PA 1XP8A 1A5TA 4C3ZA 3P20A 2FSGA 5GVSA 1H65A 2F3RA 3QF7A 4CIDA 4YMSA 2HT1A 2W6JA 2WBLC 1U9IC 2WV9A 1TAGA 4Z1MA 3GLGB 4LOAA 1AGRA 2ECKA 2V6JA 2ERXA 2ATVA 4DSNA 3VU9A 2CL7X 4B34A 1E6CA 4XVUA 1CKEA 2JDID 4L5BA 3CPJB 3CH4B 1MABA 4JJZA 2YJTD 1NI3A 1ZMXA 2IS6A 3K1JA 3K0FA 4AIIA 3B60A 1WF3A 3UIEA 4LYJA 1E2MA 3GEHA 2NG1A 4NYMR 3KZ1E 3P32A 4WZ6A 3QPVA 3LQRA 2O8BA 1S3GA 3A1VA 1LW7A 1MO3A 5DI3A 3U7FB 1LFDB 1G8GA 4IVPA 2R65A 5FI0B 3B85A 3PCRB 4U7DA 5CJ2A 4HYYA 1KO7A 1Y3AA 3PIRA 1II8B 3T12A 4OK3A 1RJ9B 4TYQA 2ODBA 2DBYA 2QQ0A 1V5WA 1D2EA 4G01B 1HE8B 3DM5A 2IBMA 4OKSA 4JZKA 1I4TD 1Q1BA 1SVWA 3AUYA 4DRZA 3PR1A 2YC4C 5FOWA 1BOFA 2QL6A 1W4CA 3QXJA 1KK1A 5K8TA 2VL7A 4V0LA 5FUYA 3NEJA 3VX3A 4LJ8A 1W4RA 2X19A 1NY5A 1KJWA 1OIXA 4Q66C 4URVR 5FTNA 3AVYA 4JYBA 3T61A 1FFHA 3BE4A 1FMJA 2XAUA 3C14C 4LYFA 4A0FA 2IUSA 3JVUA 2DPXA 2FZLA 3EZ2A 5CK5A 1MO5A 2ZR7A 3TR0A 4ZDKA 1G1MA 1YR8A 2GZAA 3L0IB 1P5ZB 5F3WB 4RJLA 1P2UA 2HDNB 2YC2C 2ZR9A 4M53A 4TZ0A 3RAPR 3U5ZB 3GLFB 2EW1A 2WWGA 1OW3B 2GETA 2QMOA 3LLUA 2RH5A 3NC0C 1E9BA 4NL4H 5FH9A 2CVFA 2EQBA 3K0SA 1GP2A 2YKGA 1WE2A 1X86B 1CEEA 1U81A 4M21A 3EIHA 3GJ6A 2WHXA 1NN3A 1I4LD 3CNLA 5J40A 1XD2B 3VKWA 4US2R 3CZPA 5JJKA 4QHTA 1IN6A 1GL6A 4URWR 1W1WA 4MRPA 3PFIA 1YZGA 4BUJA 4NE2A 3U3MA 4AI6A 2BOVA 1NG1A 3CWQA 4KFRA 4QM6A 2RGGA 4JSTA 1F2TB 3QG5A 3AF0A 4MYCA 1C9KA 3BXZA 4G5RA 4ARZB 1RYFA 4WZAE 3BFKA 2BM0A 1UEJA 2PL3A 1DARA 2DFLA 4PFSA 3LVQE 2ZXUA 3EZ7A 3B8HA 3QI2A 4OI2A 2JATA 3K0CC 2QZ4A 3L8YA 1ZBDA 5UKDA 4EPVA 2FF7A 4PPGA 1CJVC 1EX7A 2KBEA 4DSUA 4YMUA 2ZJBA 1OPXA 5E7JA 5JHGB 2ZRPA 2IYWA 4KVAA 4TL6A 1YZUA 4ZDJA 1G19A 2XITA 2FGKA 5C1BA 4P4UA 1Q22A 2BEKA 2FX3A 3C16C 3BAFA 3UANA 3FFAA 1EG7A 4NHOA 1U8AA 4Q4AB 2ZJ5A 3NTUA 4TYWA 3B82A 5ANRB 2MMGA 1NNEA 3E1SA 4FI3C 3ND8A 1Z63A 4CEJB 3GJ0A 3E2IA 5ELXA 5B64A 1VG1A 2FJUA 3IO3A 4LJAA 2BM1A 1XDBA 3ZD7A 4US1R 4LYAA 3NIBA 5AJVB 4P4SB 4AK9A 1CLUA 4B48A 4D2IA 3WHKA 2FNAA 3LO5A 4NZYA 1R8QA 4ON9A 1NL3A 2DYKA 2CXXA 3TUZC 5DSZA 4Q9LA 5KUTA 2KBFA 1KKMA 2ODWA 3A36A 2ZRHA 3IQWA 4KLZA 3AVWA 4W5JA 3NXSA 3RSLA 4A6PA 1BMFA 4L8GA 1UM8A 5KTYA 2C8VA 3DMNA 1Z08A 3G82C 4IXMA 5G3YA 3UG6A 4O2RA 3EPHA 2G9NA 2JLZA 1D9ZA 3GEIA 3EX7C 1ZD8A 3OZXA 1XWIA 1Z2AA 3ZIAA 2XB4A 4ASUD 3U44B 1W4AA 2GBLA 2NTYC 1D9XA 5JI2E 1XX6A 2FV8A 2GRJA 2VP5A 1KAOA 3AKYA 4D25A 4D4KA 3LAWA 1XJCA 2F9MA 2QPAA 3CB4A 2WJGA 4UKDA 2DFTA 3H86A 1DVRA 1GFIA 1T5LA 2FEMA 3TUJC 3QKTA 1GL9B 4B32A 2GZDA 4Z51A 1E2PA 2WM9B 4BFZA 2OXCA 1CXZA 2AR7A 4UJ5A 1ANKA 1CF4A 4MKFA 4JVLA 1XB2A 3EA0A 1XJQA 4HZUA 2CVHA 3CO5A 2PX0A 1YQTA 1UBCA 3RABA 4QBGB 4G1UC 2QGZA 4A2QA 5JWRA 3ADDA 2GXAA 3P4YA 4M9ZA 2Z4RA 2OCPA 4AKIA 1FP6A 1R10A 3FYHA 1E2EA 4LI0A 5AUPB 2R62A 1RJ9A 1KI4A 1EFRD 1M1YE 1JQJC 1X3SA 2WJIA 1YR7A 3CM0A 4HAYA 4BFTA 1COWD 4Q21A 4D80A 3OEEA 1XRJA 3GJ5A 3K8YA 3I73A 4RFVA 2WAXA 3MUFA 2W0SA 2KB0A 1SZPA 4XIGS 1FPMA 3U4QB 4CEIB 4A0GA 4DIEA 4C0BA 1LV7A 1ZC4A 2GNOA 1SVSA 2MMCA 3BFVA 1VHTA 2N1BA 1KOFA 4JYCA 4CYMA 2JJ2A 2QTHA 3DL0A 1L4UA 2O8DA 3SQXA 1YZKA 1Q57A 2YHSA 2F1HA 3RYTC 4PZZA 3KKQA 5L3QA 3AF4A 3VNUA 5CITA 4MRNA 4D4MA 3WNBA 1N0WA 3O8DA 3TH5A 2BKEA 1QDEA 4KCGA 3KQUA 3GLFA 3K70C 2Q6TA 3T1OA 4YXWD 2F55A 4LJ5A 521PA 1S2MA 4A82A 1SXJD 3S1AA 1FTNA 4YDSA 1VYUA 2IYQA 4A15A 3K0AB 1OXXK 1TMKA 5K8UA 4HZIA 2CL0X 1DAGA 3B2EA 1YVDA 5JS7A 5JRZA 3P1JA 1Z3IX 1Q3TA 4OQXA 4Q1AA 3PUZA 4LJ9A 4A2WA 2G77B 1ZU4A 2C78A 4KI0A 5EE3A 3GFOA 4GMDA 4BFSA 2NPIA 1GRQA 3K0EA 3T06B 4HB2A 3KFVA 2GCPA 4EFLA 3X1WA 3DVLA 4EIWA 4JT4A 3MMPA 3B13B 3GJXC 4IDNA 3W5JA 4DSOA 4RKEA 3K9HA 2YV5A 4EDHA 4PC3A 3O8CA 3ECCA 3VU9B 2ZI7A 3FGNA 4AWXA 4F4CA 3QIAA 1E2LA 1OSNA 4WXRA 2B8WA 2HLDA 1E32A 1IJFA 2RGXA 3I8XA 2XTZA 2OLKA 4M2LA 1AM4D 1U98A 4IVRA 2F43A 4PANA 4HAWA 1N6HA 2QSYA 2V4ZA 4BRWA 4TTQA 5JMTA 1KK0A 3WRYC 2IYYA 4TN1A 3U7GA 2DB3A 1ZNYA 2VSFA 4RZXA 3ZIAD 2XZPA 1GKIA 1U8ZA 3MSXA 4II7A 4KITB 1E79A 3IDQA 1Q20A 2W0MA 3WYGA 2H7VA 2IEYA 2ZS8A 4C0SA 2GVZC 1MH1A 4QBIA 4PAOA 4ZI2A 2VF8A 5CLLA 2JLVA 4BASA 721PA 4L9SA 2ZVQX 2C95A 4UNQA 2QQEA 5EE0A 1LS6A 3NC1C 4Q1BA 4AURA 3BWDD 3FE2A 2H57A 3PJRA 4EPRA 4IEEA 3RDPA 1DAHA 1QRAA 4G5OA 2IUUA 1KI2A 3A4NA 3C41J 3QE0A 3LFUA 1KO1A 1R5BA 1JNYA 3D31A 1Z07A 2BCJQ 3SQWA 3K53A 3T5GA 4RSGA 3TRFA 1TF5A 2UZIR 3BB4A 3TSWA 3O8RA 5FTKA 1EFUA 1IHUA 1R0ZA 3QEOA 4N0DA 5D3MB 4PTLA 3W6OA 3GQBA 3KJIA 2ZJAA 4GOKA 1F5NA 5AJWA 1PLLA 4ZIRB 2V1UA 4QM7A 4V0OA 3BH7A 4BFYA 4PSKA 5B57C 3QJYA 3V00A 5FOTA 2C77A 3OFNA 2B8TA 1ESNA 2VHUA 3CRVA 3KJGA 4QNMA 3Q7QA 1VCIA 1UPTA 3SJZA 2V3CC 1NF3A 2NO9A 3GLHB 1XNJA 5LPNA 2WIBA 1UAAA 2DWQA 1YKSA 2Z5FA 4DT1B 1E2NA 2AXPA 2CK3A 4DLRA 3AVUA 1G5RA 3K70B 2IWRA 4TMTA 3I72A 1KI6B 4DLYA 3TNFA 1OE0A 1ELOA 1W44A 4Q7JB 1XCPA 1NSFA 1XXHA 3BRWD 4YMWA 2WTUA 3D7MA 4KV9A 4HAXA 4HATA 2XZOA 4BGDA 3LW7A 1HUQA 3EW9A 1I2MA 4PC2A 4B3XA 4DCUA 1AGPA 1XBTA 3CNNA 3GFPA 4WIAA 3SZRA 4DEYA 5FPTA 1OIVA 2TMKA 4HUQA 4Q9KA 4AYXA 2HXYA 3ADCA 4IDHA 1LF5A 5G41A 1N2CE 1HQYE 2QE7A 4RCYA 1ZU5A 2A78A 3PUWA 1PUJA 3QXHA 1JEDA 2PJZA 2H8KA 3I1FA 4B6EA 4Q18A 4QOSA 3BERA 3SHFA 1T5IA 2GEDA 2O0JA 3T15A 3TGPA 1XZQA 3AB3A 2JLQA 5HCIA 2OCAA 3HPQA 4BLRA 2RGBA 2C2HA 3WRXC 4C0JA 1KY3A 1N6NA 2W83A 5EZ5A 1KK3A 1X6VA 1S1MA 3MJRA 4FW9A 4Q4HA 3TSZA 1NSTA 1EXMA 1BYIA 4HDOB 4AKHA 4W7SA 1L2TA 2FG5A 2RMKA 3GLHE 4F4IA 1DAEA 1G6HA 3U3RA 1GL7A 3F5FA 4YMVA 3AF2A 1NIJA 2NMVA 1XD9A 4Q47A 3BB1A 5LDDC 1N5LA 2GHIA 2AN9A 1YR9A 2Q9CA 1NLYA 3DPUA 4CGZA 3TIFA 4QBFA 1ZINA 3R20A 4N0EA 1TU4A 3AV0B 1KMHA 3FHTA 1Z83A 4HAUA 3EA5A 4XD7A 3REFA 1Z22A 3U60B 4NCHA 2Q9AA 5FR2A 2VH5R 4WZBE 3ZD6A 5HTKA 1OHHA 2EYUA 2FSHA 2V7QA 4B44A 1JBKA 1CP2A 3HU2A 4NCJA 3I5YA 3TK1A 4QKQA 5J4VA 3UATA 2DY1A 2RGDA 5AUNB 121PA 1G41A 1HYQA 1RRCA 4H9GA 4FCWA 1SKQA 4DUGA 2F1RA 5DN6D 5J4HA 1U0HC 1YU9A 1G3UA 1SVMA 2JJ1A 2XOKA 2QU8A 4DDUA 4FMBB 4R71A 4YMTA 4RVCA 3EAQA 3QENA 1NBME 2QPOA 2BBOA 2PMDA 3WY9A 1OYYA 3ZS9A 1EESA 3I92A 1CTQA 4OHZA 4KXFB 2ZRFA 3CKLA 1P61B 1H8ED 1WA5A 2RHMA 2RGAA 3GD7A 1U9IA 1R7RA 1OIWA 4HUTA 3EIQA 2DFKB 4MGIR 1FX0A 1QHIA 1XTJA 1XEXA 2H18A 3SYNA 1E2GA 1Z0IA 3G5UA 1QBKC 1G5TA 2BHRA 4LHZA 1ZCBA 1TPZA 4YLGA 1QVRA 4R2IA 3KQKA 3SDZA 1W0JD 4V0KA 1ZAKA 2IK8A 2JLYA 4LGMA 2QBYB 2H5EA 5F9HA 3LV8A 3IHLA 2VA8A 2O8CB 1Z6GA 1XMSA 2ZM5A 3A1UA 5L3RA 3T1VA 2OM2A 4Q7LA 3TAHA 4ARZA 5JFGA 5AR1A 4HLUA 3X1DA 2HEIA 2RGEA 3K09A 3AVOA 2O8EA 1M74A 1S3SA 2EWWA 2AK2A 2ZJ8A 1E1QD 3DKVA 5FI1B 2BMEA 2GZHA 4AKGA 5EZ6B 2G88A 1TEXA 1D5CA 4UQOA 1SKYE 3UWKA 4XWKA 3QNUA 1GZSA 4IFBA 2BBWA 1R5OA 1CR2A 2A5GA 5C2JB 2Q9BA 4NONA 4GRAA 4R9UC 4DIDA 2C5LA 3RWMB 2ZRGA 2BJWA 2ERYA 4M1MA 1E2FA 5EE9A 3B7GA 1AS0A 1QHXA 3OAAA 3I32A 2V6IA 5IRCD 1MRNA 4PQRA 1F3OA 2VSOA 5G3ZA 1DBSA 5JWOA 1W4BA 3NHAA 3SI7A 3ZZUA 1CJKC 1RYHA 1P60A 2ZUDA 3I61A 2ZI4A 1XD8A 1XXHB 2X2FA 3BBPA 3C5HA 4A1FA 1KNXA 2KE5A 5EXSA 4FWTA 1DO2A 2WSMA 3IIKA 5FBWB 5JS8A 2CLCX 1YZLA 1QVAA 1KO5A 3KXLA 1BYUA 2J7PA 2QM8A 4D0LB 1E98A 1VYTA 4LPSA 4LUCA 1W36B 5DE3A 2IL1A 4Y0VA 1L7VC 2ZPTX 1Q1ZA 1ZP6A 1U0LA 3IBYA 3MFYA 3RRMA 2J59A 4KFSA 4QJ3A 5JZVA 3OFND 2R44A 1KK2A 3RC8A 2Z4SA 2ZUCA 3NDPA 2ONJA 1FOEB 4A36A 5KDDA 4M1TA 1UJ2A 2ZI3A 4OYHA 4NCIA 2WJHA 1VTKA 3AF3A 3K0AA 1E9RA 4DLSA 3LXXA 4JBWA 1XTIA 1P4SA 4JLJA 3PUYA 4V0ME 2VHCA 1CJMA 1RFLA 2FZ4A 3Q5EA 2REOA 1Z8FA 2AHOA 3IEUA 4UXJA 2IS1A 8OHMA 4QRHA 4O25A 5FPHA 2ORIA 1DAMA 1G17A 1QHYA 1CRPA 5JLJA 1UKEA 1HE1C 2YOGA 3NEYA 4O0MA 3MLEA 4JLMA 5KDLA 1ZM7A 2BV3A 2R6GA 1HQCA 2PH1A 2C9OA 2EYQA 2JLRA 1IN4A 1G8PA 1OT3A 3AH8A 5DHAA 2D62A 4JKYA 2BC9A 4V02A 4BLPA 5C46F 2NO0A 4PC7A 1AK2A 2AFHE 2YWEA 4FMDB 5HR5A 3C7KA 4IDQA 1JEEA 1R2QA 4CEIA 4B33A 2IXGA 1E79D 5EP3A 1OH6A 4O3MA 5J4KA 1FZQA 4NP6A 4G5GA 3W3AA 4URXR 4PQFA 4DDTA 3AP3A 4N3NA 4HEJA 3GLIA 2OG2A 1A7JA 1VCOA 3HPRA 1KJYA 1XPUA 3BOSA 2G0TA 2O52A 5J4LA 3IBGA 3LVRE 1OHHD 4FCVA 2D2FA 4EJSA 2OCYC 3P27A 4HLDA 2W6ID 3ZZ0A 4UNSA 2GXSA 3QSYA 3THXA 1F60A 1LS1A 3KB2A 4HB3A 1EX6A 4KHZA 1A4RA 1N5JA 3K70D 2JCSA 4FMDF 2ORVA 3O8BA 3U61B 4B2LA 3ZYCA 1CBUA 3F8TA 1PLJA 3QPUA 1SQ5A 2B92A 1GILA 1W36C 2ZROA 2ZE5A 3AVPA 4LHYA 4RZ3A 4W5WA 5F98A 3PQCA 2D2EA 3JZAA 2C04A 1Z6TA 2SHKA 3CPEA 1K8RA 5C4GB 4NYJQ 2EU8A 1ZUIA 2NIPA 2ZI9A 4HLUC 4P33A 4Q1EA 4GZMA 4MUAA 1XMIA 3SBDA 2H1LA 4A4DA 3UPUA 1N6OA 4KO8A 5HKKA 5EXXA 3UMRA 4BLSA 3H4MA 3AM1A 2ZITA 1ZC3A 4C2UA 1Q44A 4KBGA 3ZH9B 5A0FA 3NBFA 4Q1DA 5B30A 3OIWA 2AD5A 1G9XA 4Z8XA 2C98A 2J3EA 4IW3B 5FUVA 3GFTA 4WBSA 5EXPA 4D81A 1UBEA 2PMKA 1BO6A 2W58A 3W6PA 4C0KA 3KDSE 2CL6X 3QOFA 2IHYA 2N46A 2A5YB 3CR7A 4GFDA 3IO5A 2VRWA 2PEYA 1ZD9A 2OFWA 2ZTSA 1J7KA 4OQFA 4QJ4A 3U6KA 4EPWA 4XJXA 1UKZA 1ZNWA 1XPRA 2VEDA 1IXSB 3WHLA 1OKKD 3ZQJA 5J4YA 2XXAB 4OL0A 4BFWA 3T1TA 2QN6A 3AKDA 1OXTA 2RCNA 2J41A 3BB3A 4LCBA 4M9QA 3RRYA 4ZKDA 1MR3F 1IY2A 3BC1A 4I81A 4ITRC 1UBGA 1PVOA 4TSFA 4DDVA 1SVOA 4NMMA 1TQ6A 4D0NA 3ADBA 5AK0A 3OHMA 4IOLA 2UZ3A 2MSDB 4LHVA 1SXJA 2BCGY 5L3VA 2ZYTX 3KXKA 1DPFA 1AQUA 1XU4A 3D6TB 2YZ2A 2OAQ1 3PITA 3RSOA 2CCGA 1RPZA 4ACBA 1IONA 1P3JA 3V4FA 1G16A 2R6AA 2CDNA 4TL7A 3HU3A 4M1SA 1E1QA 3I62A 3VHLB 1HY3A 1KI6A 2FA9A 1VIAA 2CJWB 2YYZA 1SXJE 1Q0UA 1KSGA 1W49A 2CBZA 2GVDC 4PHFA 3HR7A 3K09C 3TQFA 1AN0A 421PA 1JALA 1NN5A 4LV5B 2FFAA 1G8FA 2OCBA 4NYIR 4TYYA 2G1KA 2ZJYA 2KI5A 821PA 3H1TA 3PVSA 1EFRA 5LD2C 5FFMA 1Z28A 2PLRA 3QKUA 3FHCB 4YC7A 1E1RA 3U3JA 4Q7KA 4OHVA 3A8TA 2W00A 4B3GA 4TQUS 3FMIA 5M04A 2NO7A 3KUDA 4XWAA 3X2SA 3EIEA 1W47A 4MKHA 4OHWA 1NJFA 4ZCIA 5CIWA 2GK7A 3CF2A 2YWHA 3GLHA 4NPHA 1GM5A 2CCJA 2ZSFA 2RGNC 2NGRA 2V8OA 1R0XA 3CRW1 4D26A 4C2TA 2VSXA 1GNQA 2ZYWX 1N25A 4NBSA 1ZW6A 3MWKA 3CZQA 1X1SA 2F1IA 2OT3B 5CDFE 3HWSA 3ONWA 2P65A 1IOZA 4MKGA 5HKKD 4HI0E 1Z6YA 4RD1A 3RANA 5HZKA 1E69A 1G3IA 1P2SA 5HPYB 3J81k 3T1QA 4IVQA 2HJGA 2GF0A 2GXUA 4MDEA 2B7CA 4Q5IA 4HAZA 2BBTA 4DLVA 1VG0B 1HA3A 2RGNA 1S0UA 1VG8A 3WBKA 1Z6XA 4M1OA 6Q21A 3NBZC 4QHSA 5JHHB 4KLNA 4PO8A 3RRNA 1G8HA 3K9LA 3Q72A 4B3DA 3RS4A 3FKQA 5L3SA 1SVLA 5GJWC 2BMJA 4MGYR 4HB0A 2W6IA 2BVNA 4Q48A 4B43A 2E9SA 1MRSA 1OYWA 1NIPA 2QY9A 1G64A 4EPYA 2ZVPX 1P9NA 1OF1A 2ZRLA 4Q4JB 5FUWA 1N6KA 1WP9A 4XTCS 4HDQB 4MDFA 1P72A 4OQLA 1IY0A 4K8OA 4RFSA 4JJKA 4B75A 1G5PA 1HT1E 2IW3A 2XB2A 2QROA 4EJSB 5LB2A 4XWOA 4KU4A 3QG1A 4TMXA 5FBLB 1GRRA 2CHVA 4Q19A 4EAQA 1IXRC 5FPSA 2P6NA 1XCMA 4MH0R 2ZJZA 3BIFA 2WWXA 4TMVA 5J5CA 2WKPA 3MCAA 4WW0A 3RS0A 4F91B 5B58C 5TXGA 3KUCA 4JMPA 2IXFA 1Z06A 3B9QA 2OILA 2Z6VA 4LY6A 1G7TA 3V4RA 1WB9A 1NVXQ 1W5SA 4LHXA 4QFMA 4DHEA 2ZR0A 3ZLJA 4DBLC 1GRNA 4M0LA 4IXNA 4RCZA 3M0EA 3OIVA 1WBDA 3W34A 4PC6A 5FPYA 5KU1A 3IIJA 3TBKA 3BS4A 1A2KC 2WWYA 3L0PA 1JECA 1O87A 4B71A 3VNVA 3RRZA 4HB4A 1RIFA 3MJHA 2C9CA 1G18A 4NH0A 1K6MA 1KHTA 1KJZA 1G291 3Q9LA 3OE7D 5JCPA 1BH2A 3CW2A 4DCTA 1HEIA 2F3TA 1W2HA 5BXQC 1W46A 3ZVMA 4B47A 4DJTA 2IYVA 2GCOA 5H8WA 1FX0B 3LY5A 2C96A 5TY0A 1CJTC 2HXSA 1QZXA 1EFHA 2PJRA 4RD3A 3U2QA 2WPDA 3FB4A 2QT0A 2W6JD 1LTQA 3AQ4A 1WXQA 4A8JA 2OV2A 4P31A 1W0KA 1E96A 3LA6A 2QUZA 4MKIA 2QM7A 5SZJA 4D4JA 4GOXA 3VMFA 1US8A 1YR6A 4BFXA 4IFEA 2OXRA 4B2PA 1Z0JA 2FH5B 4E5UA 4A8JB 4LPKA 4D6PA 1A1VA 2J0QA 4E03A 1FTSA 4PO9A 4EPTA 3WYFA 3QY0A 3W6NA 2GTPA 5JSZB 4QGFA 3N2IA 1GIAA 5JI3E 4I1UA 4Q02A 2FOLA 1D2NA 4V0NA 5TMPA 3GEEA 5AUQA 3R7WA 1IY1A 2UKDA 1K5DA 2GJKA 2VIIA 1QF9A 5SZHB 3EPKA 4MITA 5CB6A 3L82B 4JT2A 1N3BA 2IHBA 3KFXA 3NBXX 5KO2A 4NYJR 2ORWA 4JL6A 1ZUHA 4OHXA 1RKBA 2R9VA 2WWWA 4OK6A 2WJYA 4R98A 3SEAA 4Q9HA 2QAJA 4L15A 4P32A 1R0WA 1NG9A 1JJ7A 2NO1A 5KSYA 1MOZA 2GJ8A 4JBYA 4RKFA 1I4DD 4OI4A 1QHHB 3THYB 5TVKA 3SR0A 1VMAA 2GF9A 1HTWA 1XTKA 1H8HD 1S1CA 2LWIA 4GZLA 4DEXA 2JLXA 2GJSA 3QXXA 3A6PC 1VKJA 2GWHA 3VKHA 4GPTA 3TLXA 4JL5A 3ZGXA 2VLIA 3W3ZB 4DLXA 3BJIC 1SGWA 3F0TA 1CS4C 3ZVLA 2ZE8A 1XTQA 1E99A 1KI8A 1TADA 2CHQA 2QE7D 3LBNA 3A37A 3CRMA 1NBMA 5G40A 2IWHA 4TYNA 1YJ5A 2JDIA 2VP0A 3QPWA 4KSBA 2WPDD 3Q85A 4AD8A 2WJVA 3SFVA 2GESA 3QVUA 2JJ1D 2XOKD 2IUTA 1L4YA 4HZUB 4HUQB 1W5TA 4ESVA 4B2IA 4LJ6A 4I4LA 1KDPA 2OBMA 1D6JA 1AQYA 3LX8A 5FOXA 4Z54A 2PZEA 4L9WA 4EKDA 3THWB 1VG9B 1N5KA 4MYTA 2OAP1 2ODEA 5KSPA 4TL8A 1LF0A 3VAAA 2WICA 1R5NA 4C0QC 3QBVA 4AG5A 3THWA 2MSEB 3QKSA 2ZSAA 4TTPA 4B73A 2FPKA 4NCKA 2H92A 2F1JA 4FXPA 1XMVA 2ZETA 1QHNA 3BORA 4WVFA 1E2DA 1LB1B 4BFUA 2E87A 4JLBA 2CLDX 4X8LA 4NKRA 3IQXA 4LX0A 1NN1A 4QNRA 5DYGA 2ZRCA 2BIFA 1H8HA 4M1WA 2PBRA 1AJEA 4V03A 4ILEA 1N0VC 4JBXA 4Q4JA 1NVVQ 2XNDD 3NWJA 2G0NA 3LW8A 4LC1A 2XTMA 3TQCA 3QVVA 4A0HA 1ZM2A 4Q4AA 1XEWY 3F3YA 4NYIQ 4TMZA 4RFSB 3CBQA 1KDOA 1VDZA 4PAQA 1Z5ZA 3FMPB 4XVQA 1X8LA 1XEWX 1SXJB 2Q3FA 1Z0KA 3EARA 3PUXA 4Q4LA 3RVBA 1G4UR 4ZV4A 3A58B 1P75A 5FL7A 2HJVA 2PT7A 1NY6A 1ZYUA 4P4SA 1ONBA 4YDHB 1J70A 3QKSB 4BEBA 1RRGA 3QF4B 1RZ3A 3WMFA 1SKYB 1T3LA 3DKPA 3M6AA 2N42A 4FWIB 4KFUA 4MQBA 1P7CA 4O2LA 1HT2E 2G1JA 2IT1A 2JLSA 2W2XA 4QXAA 4GL2A 1Z47A 1E0AA 1JXOA 2IF2A 4PPFA 5SZIA 3EPJA 3RWOA 1Q3HA 4MRSA 5P21A 5IF9A 2AXNA 3HYRA 3ZVRA 3NDBB 3Q5DA 3GJ3A 2BDTA 2QT1A 4R2HA 3MWJA 5CIQA 4EPXA 2FPMA 1XXHE 1J8YF 4OQNA 1NMYA 2PZFA 4BLTA 4RD6A 1N5IA 4NDZA 3TR5A 2J5XA 3TW4A 2VHJA 3DEFA 1AKEA 3TE6A 1GUAA 4I1OA 1E9AA 2IEZA 4S35A 4Y0AA 3U3OA 5GADl 5KNDA 1KIMA 1XEFA 3NVAA 3RS7A 4A6XA 2IYZA 4FINA 3WXMA 2XX3A 2NO6A 1IN5A 1E9DA 3GMTA 1DG3A 3L8ZA 3ND9A 4C0HA 1ETUA 5TDHA 2VPPA 1MT0A 3SHWA 1GAJA 5IT5A 1T8UA 2YWFA 1XZPA 3V9PA 1BS1A 1TU3A 1KSFX 3MRSA 4ZKEA 1T91A 3L43A 1W2GA 1TEVA 3B1YA 2O8EB 4CZ2A 3B1VA 3U44A 1A2BA 2ZS7A 1UDXA 1UKVY 4IHQA 4R7ZA 2ATXA 5BYJA 1OLOA 2IC5A 2GAAA 2EFDB 2BKUA 2P0EA 4PX9A 1OV4A 2HF9A 5JCZA 1NVUQ 1E2IA 1P2TA 1M34E 3B5JA 4LBVA 5CK4A 2XTNA 2AFIE 4DLTA 1AS2A 3M1IA 4BRUA 1YRAA 3R7WB 2BBSA 3VR1A 2KSQA 3K0FB 5E7IA 4LRWA 1S8FA 3L0SA 2IA5A 4B76A 3X1YA 2JAQA 4PHGA 4ERNA 1KI3A 4CVNA 2ZREA 2YNMA 4G3XA 4MYUA 4GI7A 1T9HA 2R8RA 3KKMA 4JLPA 4PSAA 4TSFD 4US0R 2JJ2D 4BQSA 4BPBA 2VP6A 4Z8YA 3UG7A 1OFTA 5KDOA 4LC0A 1ZM3A 1US8B 4DCSA 5L8VA 3VKGA 3PUVA 1KI7A 3EZ9A 3DO6A 5E95A 2XEXA 4TT3D 1NVWQ 1KY2A 1J99A 2KWIA 2MSCB 4KYIB 1TTTA 1Q1QA 1KI9A 1AA9A 2P5TB 1E9EA 2VHTA 2FMXA 3RLFA 1MABB 4M1YA 1AZSC 2GAOA 4KYUA 4Q00A 4F7WA 4M9XA 3N70A 5BQ5A 2D7CA 3AP2A 3TVDA 3T34A 2L0XA 4TZ6A 1FL9A 3NKVA 1KGDA 5CLQA 5BYKA 3CRRA 4F93B 2A2ZA 5KNBA 5DO9A 4HLCA 3AGPA 1G8YA 1ZVQA 3EPLA 4A9AA 1D8TA 1OFHA 2Y8EA 4I1SA 1F6BA 4LWZA 1R0YA 5K8LA 3EWAA 1MO6A 3THYA 5LB4A 2QG6A 2OUKA 4HAVA 1KMQA 3K9NA 3PXGA 1GOTA 2AWOA 1N6LA 3CRQA 5A5GA 1KKLA 4IKEA 3RS3A 3UMFA 2WMNB 4TMKA 4TLAA 3VX4A 1OXSC 4TMWA 3REGA 2ZYVX 2DWOA 4GP6A 1E4YA 1NRJB 1XD2A 1T3SA 3A1TA 3DOEA 4U5XA 3GLFE 2WOOA 4RY2A 1KMHB 2A5JA 1IN8A 4G5SA 4PPQA 4PSVA 1II0A 3T35A 2X1VA 4AKEA 5JRJA 3LBHA 1A82A 2FU5C 1E2HA 3FTQA 4P4TA 2QTFA 2ZSDA 3CLVA 3ICEA 2QP3A 1T4GA 2OFOA 3U7EB 1G3MA 1WDTA 1EWQA 1NMXA 1T8TA 2XJ9A 5CB8A 4W9MC 5BN3A 3SOPA 3C5CA 5DI9A 2IX3A 2FDCA 2VO1A 4DSTA 2EFGA 1G4AE 4GP7A 3WP1B 1YRBA 2JIZA 2J46A 2WWIA 1ZIPA 2X2EA 5DIFA 1CRQA 3I4LA 3IPYA 1UADA 1N0UA 3Q3JB 621PA 3LX5A 1P2VA 4JLKA 5CJPA 4LYHA 2ZSEA 2JLUA 4PZLA 1AIPA 1C1YA 1Z0DA 2FSIA 5L3SB 1W36D 1U99A 4PO1A 1PZNA 1GNPA 2BEJA 4CT5A 2ZE7A 3B78A 1RRFA 3QF4A 5IK2A 4I1VA 1GKYA 3VHXA 2XJ4A 3OF5A 2VBCA 1IJEA 3EZ6A 3UWOA 1OJLA 2OE2A 2G83A 1OH8A 1TNDA 2IYRA 4OQMA 3DDCA 1U90A 4ACAA 4JVMA 2A7QA 1ZM9A 2AK3A 3HR8A 1AKYA 3T5DA 3QBTA 2IXEA 2C9YA 2QENA 3QQ5A 1XF9A 4E22A 1X1RA 2QORA 4MGZR 3DOFA 3NBYC 1JAHA 4KVGA 5FUXA 3UKDA 1G21E 2HT6A 2HCBA 3H0KA 3B1XA 5DGXA 2LKDA 3WNCA 5AJZA 2QEQA 3X1ZA 2C03A 1CR1A 2GXQA 3HYTA 2ZAOA 1JR3A 3A4MA 1VCMA 1CR0A 1DADA 4Q9IA 2JGNA 2K5UA 4CT4B 3PEYA 1P6XA 4WAUA 1WCV1 2XXAA 2XGJA 3KQNA 1ZCAA 2ANCA 4FMCF 4IDPA 3VTKA 3AVQA 4AC9A 4CEJA 2F7SA 1VCNA 3GLGA 1KO8A 2R6DA 2O8CA 1XTRA 2YWGA 1G3QA 2AX4A 4XSGA 3CX8A 1I2DA 3QKRB 4NCNA 4PXAA 3LH5A 1UFQA 5FBRB 1KI1A 3DM9B 2D4HA 4JIMA 2O5VA 2CLSA 4DKXA 2C99A 1CJUC 3BD9A 1PV4A 4UXHA 3SN6A 3KTAB 4TLCA 1ZM4A 4Q1FA 4P3YA 2BMFA 4M4SA 3AVVA 4H1VA 4OK5A 2OBNA 1F2UB 4JS0A 3WNDA 3OEHD 4GT1A 4QBHA 2QI9C 3I3SR 2O8BB 1Z0FA 3SYKA 4DC9A 3WBJA 4Q4HB 2VYFA 4ESHA 3NG1A 2I1VB 3PG5A 3R8CA 1KZ7B 3ASYA 4X8HA 2QRZA 2V54A 1NBMD 5H70A 3RS5A 4ZIRA 2V55B 5G53C 4QJ5A 3KQHA 2ZRIA 2WJJA 2GILA 2OBLA 4TQAA 3C4JA 3GJ8A 3W8NA 4LBWA 2ZSBA 5EXTA 4F38A 3VR5A 1VPLA 3FMFA 4Q01A 1UEIA 1FP7A 3SNHA 4AY2A 1LVGA 3OAAD 1II8A 3PEVA 1W0JA 3GPLA 1PJRA 2R6FA 4LSGA 2ZRBA 4DB4A 3OIYA 4XD7D 2I3BA 1E94E 1AZTA 3TUIC 2AWNA 2VF7A 1E4VA 3NH9A 1G6OA 2YVUA 4GSYA 5EE5B 5F9FA 2D06A 1FNMA 1NP6A 2WOJA 2PT5A 4BFVA 1D2MA 1YE8A 4MGKR 4IOKA 1M7BA 4PHHA 3A1WA 2PLFA 4MUBA 2JASA 4CEHA 1EFTA 3CH5A 4LZZA 4RZUA 3W90A 4D0GA 4RZ2A 5EQTA 1WQ1R 3GLIE 4JLVA 2QAGA 3UXMA 3FDIA 4BZXA 1N6RA 2BMDA 2PX3A 4CEHB 3H84A 3SFZA 2OESA 2B6HA 2WAYA 4XVRA 4AG6A 3WMEA 3TW8B 5CYPA 3S1AB 2JA1A 2REBA 1G7SA 1V43A 4KJZA 4JKIA 3U4QA 2D74A 5DNYB 1SVIA 5A4JA 1FUKA 1VYVA 3SJBA 2OSBA 1NKTA 3KKNA 3A1SA 4CDGA 2J7PD 3FKSA 4EUNA 5TB5A 5CDFA 1R6BX 3K9GA 2OHFA 3ZZTA 4DCNA 4UXIA 3CF6R 4G5QA 5DHFA 1SHZA 3OE7A 2OZEA 1IN7A 4I99A 3GLIB 1DOAA 1TL7C 1DE0A 1LNZA 4JVSB 2CCKA 2HCJB 1OB2A 5FL7D 1GWNA 1ZRHA 4TL9A 1OH7A 3OIUA 4BZQA 4L16A 1E9CA 1E9FA 2I4IA 2IYUA 4CRWB 3BH6A 4HDCA 3RNLA 2ZRAA 3DZDA 1PUIA 3HJNA 2O0HA 5TV2A 2HLDD 4TLBA 1YZTA 5AUOB 4LBZA 2E1RA 5E4FA 2F43B 4TTRA 1BKDR 1GKUB 1KNQA 5LBIA 3NHBA 4UNPA 2QBYA 1Q12A 3EG5A 1K5GA 3B9PA 4B6FA 1HURA 2I1QA 2ZJOA 1ZD1A 2Q21A 3GLGE 2AKYA 4FCTA 4E09A 1NKSA 2JEOA 2GA8A 5SZKB 4KSCA 5EE1A 3W5IA 1N6IA 1Q21A 3LBIA 2ONKA 2V1XA 3CIOA 2IYTA 3D3QA 3KJEA 4URUR 5KSOA 1JQLB 4S2EA 2D7DA 4GMXA 5GJCA 4FIDA 3IHWA 5KHOC 1XPOA 3IEVA 2EFHB 4JLAA 4EQ6B 1LY1A 5JECA 4ZCMA 2YOHA 4DLUA 3LD9A 2CEAA 5TARA 1JR3E 1M7GA 4U02A 5FL3A 1RE0A 5FR1A 1U2RA 1E2QA 2FFQA 4JVNA 1P73A 4LHWA 2ZQ5A 4XSHA 4QG7A 2W2VA 4MRRA 1NVVR 3TKLA 4FN5A 3SBEA 4PPNA 1F2UA 3TJZA 1W48A 2OO7A 3EWSA 4OJQA 1KZGB 2GJ9A 3CX7A 3VFDA 2O0KA 3O47A 5D3MA 3UMSA 4RD4A 4BLQA 1TF2A 3U7HB 4LDJA 5FOUA 5H68A 3VR4A 5EJEA 1EGAA 5DN6A 4DUGD 3GJ7A 2VP4A 1Z6AA 2RB4A 3FVQA 3HDTA 3QKRA 2VP9A 3IILA 1FNNA 4UJ3A 2JLWA 4A0RA 3VR6A 3FKSD 3AVTA 2V7QD 1SHKA 3LQQA 2RKOA 5DISB 1W7AA 4M9SA 4N1AA
chains in the Genus database with same CATH superfamily
3MB8A 2JJ8A 5FTMA 3E23A 3QMPA 1CWUA 4UFOA 4X7MA 5H3HA 3CLRC 2Z9CA 3N07A 3LU1A 1TYEB 4RVHA 3PPYA 1SRQA 2NQTA 5DVZA 3FLAA 5TPZD 2POCA 3CUTA 4TMYA 2F3UA 4PXSA 1VIYA 2LZ0A 4M8NE 3KJQA 5GJVC 3TR6A 4IJ5A 1C4XA 4FZ3A 3UAXA 4C4PA 4OFZA 5CVEA 3AUJB 1XTBA 5HKOA 4DR3B 2OY0A 1K6EA 4Y6PA 1OFUA 1YB1A 3UUFA 1FRNA 4EA8A 3ESAA 1WBBA 5HQTA 4KKXB 1TAQA 9ATCA 2AEJA 3ZGLA 5HF8A 2P11A 2VQ6A 3IQHX 4H6WA 1KBQA 2QTTA 3U19A 1SOAA 1J25A 2VZ0A 1O9HA 1WPQA 2YJGA 4L50A 4OYLA 5ES3A 9GPBA 5FUQA 1B15A 5BOVA 3NHYA 3QH4A 5KOYA 2HV8A 1T13A 1LZKA 5IKMA 3KTAA 2GN0A 2XY4A 3IUPA 1AXGA 1TPYA 5C7OO 3RE1A 5JFOA 4H7HA 4HV4A 2DJ5A 1I01A 5BV0A 1JR6A 1V11A 1QP0A 3FJ1A 3C5VA 3N76A 4QGHA 1JI0A 3VHXB 1ZOOA 1D0SA 3OQHA 3ZE0B 4CQMD 3D1LA 4G8DA 2F17A 1W0KD 1GPAA 3OLWA 4MINA 1N5MA 3CF0A 1JG6A 5IAKA 1PF7E 4WFIA 3F8SA 3N87A 1DBWA 4NJEA 2AZMA 2XTJA 1OASA 4G81A 1PQUA 1NLZA 4JOCA 2V7TA 3UK6A 4W5OA 2M98A 1J5PA 3MTIA 2HNBA 4MI3A 2VFAA 4TRRA 1TCAA 3U31A 3WO0A 5INTA 1UBFA 3IHKA 5CFOA 1JJVA 3DTVB 4YQZA 3AUXA 5IUJC 1B6SA 1UKCA 3E05A 3MTQA 4TM8A 5DK6A 4LDAA 5DYIA 3DBLA 1GO2A 2EVWX 4PS0A 4YO8A 3SZ3A 1TUIA 4HPJB 2IYSA 2VNIA 3COSA 2D5BA 3N3AC 4Z7NB 1R9MA 3RVDA 3KKPA 1QG4A 1RZUA 2JK1A 1Q16A 3U39A 2ACEA 1PT5A 1RU3A 1SULA 1G8SA 2DJIA 1JU9A 5LIRA 5A9SB 3GVXA 2XUDA 2OCGA 4EGQA 4JX9A 5E9QA 4XRGA 2OHGA 4Y2UA 1XFAA 1MO4A 1YUBA 1SXJC 2I6UA 4ND6A 1ZJYA 3OP1A 5JSFA 1B3BA 1U9CA 3U7QB 5FOVA 1M2VA 3V80A 1MJHA 1ZIOA 4D46A 2BWJA 1LXCA 2W2LD 4FC6A 4EB0A 4U3JA 1Z4QA 3DCIA 2XWSA 5I7OA 3V2GA 3V4ZA 4IG9A 4EL5A 3MD0A 5J63A 3TSAA 1YVUA 3W5DA 3AL3A 5AJYA 4LK2A 1C7IA 1V2HE 2XGMA 3OESA 3T6KA 1M8PA 1TTHA 3W5HA 4F2DA 1VJCA 1O7JA 4MA4A 1JZQA 4X1YB 4C30A 2IPLA 2QF7A 4D56A 2P9FA 3AETB 4XSVA 1TM4E 4N41A 4JSYA 5LQJA 3KC2A 4RKYA 2EZUA 3TAUA 5FQOA 1CB7A 3ENNA 2QU7A 4EQ6A 3HP4A 3L06A 1JDUA 1XZGA 1NN0A 2DFNA 3G8CA 1YHNA 4JYMA 5DLYA 5FF9A 4AYTA 3NDIA 5HYVA 3RC3A 1DQNA 2ASEA 5ALEA 2YV1A 2GCOB 1I14A 4CUJA 4BY9E 1KPGA 2FR0A 4UATA 2VPTA 3ONNA 5DTMA 2CE7A 2RBKA 3T1HB 2ZB7A 1GTL1 3RS9A 4PRYA 2Y1LA 2UYOA 4QHYA 5KPJA 5KDLA 2IZZA 4ZGWA 2HNKA 1FRQA 3UWPA 4IF4A 4F9TA 4INOA 1Q77A 1RYEA 3FLEA 3NTXA 4MDYA 3MMSA 1I5RA 1T1GA 2B78A 2VHQA 3CLTD 1XCBA 3D64A 3QA9A 1PFUA 4GS5A 1VCHA 4OMUA 5BO5A 4LECA 4AY4A 3OU2A 4FGZA 3KBBA 1T4CB 4HRXA 4EKIA 4RVUA 2R8PA 1JJBA 3D8BA 2PSDA 4X1YA 4Q6BA 1NM5A 3FHOA 2GN8A 4NU5A 4C0AC 3TRHA 1O03A 4DCMA 2UYCA 2VDWB 4RIEA 1H5QA 3JAKA 1JHRA 1A97A 3M7IA 2BFEA 4TZTA 4BGIA 4LFAB 4BN0A 1OGJA 2J0SA 1DIGA 3ADKA 4P58A 2F8SA 4BQIA 5E7MA 3DA8A 2JL1A 1XDDA 2PEZA 4YAOA 4XDGA 2HJ9A 4ZZ2A 4ER5A 3VHQA 3DFFA 3ISTA 1O6FA 4EJ2A 5K05A 4CNBA 2FUNB 1FMFA 5HUQA 2J5QA 3THOA 4A92A 2GLUA 4A23A 2AC4A 3GF4A 4ZHQB 2EQ5A 3I2JA 3JVDA 4QEKA 1UZNA 2AD1A 2HYDA 1KAGA 1LDMA 2OZLB 2RDMA 2X15A 3W9YA 1YMVA 5DI3B 5TLSA 3NJRA 4ZU6X 2GCNA 1KFJB 3WWCA 1ZJ6A 2I87A 3KXIA 3NDRA 4FS8A 1RBZA 4PAMA 2BHSA 3NNSA 2NPFA 4GBMA 2OM6A 5CFRA 3A3NA 2BGWA 1T0PA 3AJRA 2I4RA 1W9MA 1P7ZA 4HDSB 1S2NA 1LI4A 3ML1A 4JLWA 3KE8A 1ORTA 5KAMA 3U48A 3HUEA 4UHFA 2QP4A 1LLCA 4GOJA 1ULZA 4B3JA 1EK6A 2RC5A 4F5YA 3OE1A 3L1VA 4WWHA 3EASA 4CM9A 3JPYA 4M54A 4QD3A 4WESA 1SXPA 2GBLC 1CRWG 2NT3A 4LJ7A 2J1LA 4WXPA 4KDFA 2HDHA 5E1MA 2C84A 4AJKA 5SYNA 1SU7A 3ZBPA 4WKBA 5JDCA 2O1EA 2PRYA 4ZHSA 1X2BA 1HNXB 3CX4A 1TMOA 2BGLA 3H11B 1TQ2A 2WMOB 2EX0A 4O29A 5KYKA 3FY4A 3ZCVA 3N2KB 1GTG1 1FVHA 3V8QA 3H0CA 2R8BA 4X8MA 4XE5A 3S28A 2P8JA 3DLAA 3ILYA 4MS4B 4QT0A 3RK1A 1QS0B 2EHDA 2B9VA 5B6IA 2GPBA 2XIQA 1JGTA 2P6UA 4HBGA 1E3MA 3H5AA 3BWVA 3UOWA 2JI4A 1D7OA 2HYIC 2JBAB 4H3VA 3QFCA 2J3KA 5JO0A 2PZBA 1PR9A 3HNRA 1MHTA 1L6RA 3OEED 1TVKA 3ME5A 4WADA 5BR4A 1HH4A 2QNRA 4IOJA 4NS4A 5TJHA 3UT6A 3ZJYA 3O38A 1WNFA 1VHLA 1QVVA 1Y34E 3CPHA 1QX3A 4Z4CA 3IUYA 4ZEOA 1A69A 1UMDA 1PX2A 2HF8A 2FHPA 3C8UA 5DGHA 4JXXA 4ZVNA 3KL2A 3C7TA 2VT3A 3KQWA 1V16A 2BCEA 3QBJA 3QXCA 3LDAA 1WUKS 4JJ7A 3I8SA 2XI4A 1BOOA 1SCJA 2IIPA 1Z2EA 2Y0DA 1KSJA 4C7OA 4EGJA 1Y1PA 4JLNA 3BKXA 2Z5VA 4UCFA 2VJYA 1HE4A 2WKWA 3U5TA 3TNLA 4FR0A 1BCSB 4KH1A 2V9PA 1PYDA 2NZVG 4CV1A 1F4PA 4R1TA 2NSDA 1GITA 2PMWB 1OGYA 1XNQB 4A8JC 2IYXA 5B2ZA 3DBRA 2IEGA 1T2FA 3ETLA 1XYVA 1M0SA 1PCXA 4XFKA 5EQJB 3MWYW 2CVQA 1AKTA 1KXJA 3QV2A 4JGBA 5F3RA 5L3ZA 5CMLA 4HG2A 4YT8A 5CD1A 4J1TA 3PDJA 1HV8A 4TLDA 1A9PA 3R7FA 3WLNA 3W9UA 1M6NA 1X7YA 1GD1O 1GTVA 4IS2A 4QBKA 4CLRB 1AQLA 2APJA 3QELB 1QFYA 4UU1A 4X85A 1XTSA 4OUKX 3VI3B 1RQXA 1L4BA 2GEUA 5AFSA 4YHBA 5JPIA 5HKLA 3LCCA 1YI8A 3PEWA 2W2TA 4KE9A 4MQFA 1EM6A 4QGAA 3VO1A 3VU0A 3QLJA 2WE7A 3TD6A 1KJNA 1HOXA 1PIWA 2OB2A 1GG2A 2FLWA 2GB4A 3ELWA 3KTFA 5B7NA 5IJ0A 1A4XA 1Z7YA 1ZK4A 1JMKC 1QIHA 1OFUX 3LNCA 4XH9B 3I6YA 1ZOLA 3K6SA 3ZDAA 4IJMA 2JZOA 2ZZMA 1SC1A 2JFVA 1BMFD 2HUPA 4KPUA 3I2YX 5G02A 3B1WA 1FTYA 4UAGA 4UBLA 4M9RA 2VJAA 4UULA 1S5PA 3HWX1 1CG6A 3D54D 1CUUA 2NV6A 2WG0A 4ROTA 3OU6A 4DFDA 1JDBC 2DWPA 5GAJA 1J2TA 4YCMA 2NYRA 4MPDA 1JPVA 2W6MA 4Y6GB 3AKEA 3RIMA 4CU5A 2WKRA 3EC1A 2X4LA 2R96A 3K8OE 2CV0A 5JMWA 1T0HB 2VQSA 3UQZA 2QSZA 4ZPXA 4BIIA 3VR2A 2GBFA 2IHUA 1MV5A 4KUEA 5J2UF 3T7IA 5FPKA 1RZVA 2K7ZA 5H7XA 1CFZA 4HNHA 1KTVA 1WXHA 2ZYHA 3C5WP 1TQDA 1T2UA 3OZUA 5FBQB 4D8UA 3GLQA 1YZNA 1RKQA 3IOBA 2QUJA 3NYWA 3HY6A 1KAMA 2BFCA 5EIHA 3L5OA 3RIYA 2P2ZA 1VOTA 5JV5A 3A6KA 2OGWA 3D6HA 1Q6YA 1U9JA 1DAKA 1T1EA 3GGGA 1E5XA 2HPAA 2B7BA 4QGGA 3TQQA 3UFXB 3SC2B 1D1SA 2A5FA 1JZSA 1OAOC 2BGNA 3H1PA 2ZE6A 4ZI3A 4L51A 3RFVA 4AZ0B 4KPUB 1GAQA 4MVYA 2BFWA 4NU0A 2XCIA 4MQMA 5AVZA 1VPTA 1C81A 1JHMA 4LJRA 3FF4A 5KNDD 5KKNB 2O8FB 2WA2A 3OZVA 4GBJA 4HDNA 1AF7A 1YJQA 3PQ2A 4LQDA 3T4UA 1PQWA 4H6VA 1IAQA 2CB0A 2MYNA 4RAQA 1JPJA 2JIRA 1SQ0A 3PWSA 1N34B 5E4TA 2CXRA 3KD3A 1FW8A 2PA3A 5EP4A 3C3AA 2WNHA 4K9LA 2ZYUX 4BMCA 2X0EA 3HE3A 5A4FS 3D6VA 3QEJA 2BFBA 2ZJ2A 3TVTA 2WB2A 3MGCA 2XZDA 4UAJA 3QWAA 4YJ3A 2H51A 4U39A 2VCEA 1WPRA 3KVVA 1NVKA 2J31A 2XXJA 3ZU5A 4F2PA 2D5IA 2EBUA 5I7SA 1M6YA 3KWMA 2PRIA 3P20A 1RM5A 2ECOA 2ADOA 2QQ5A 2F3RA 4X61A 2HT1A 1ZA1A 2WBLC 3DVAB 3ICVA 4Z1MA 1RXWA 2KLHA 2ZUSA 1LK5A 2CXTA 5DXAA 5HZMA 2BLNA 1JFTA 3DD5A 3SM9A 1J21A 2FZGA 4D3SA 4L5CA 2CL7X 1E6CA 1Q1NA 2EP7A 1T8PA 2QYTA 2XA2A 2BDEA 5EIEA 5AVOA 3GYGA 1N7JA 4L5BA 1ADCA 2FTKE 3DUFB 3R3VA 1OPRA 3CLSC 5FLKA 3RJMA 1T2CA 3ITDA 1TO2E 5SYMA 2VRCA 1SUWA 2C2BA 3N8GA 1JHAA 1ZUNA 4YT2A 3OHPA 1WF3A 1AGYA 2WT9A 5KNCD 3IKTA 2FK8A 3V32A 4QDJA 2PZKA 1E2MA 3GEHA 4NYMR 4TWAA 5AKYA 3WZMA 2PX2A 1Z6QA 3P32A 4BMDA 5E6UA 3LQRA 1P77A 4YGXB 1LW7A 2IP2A 3RREA 1HETA 3NNDA 4XPZA 1G8GA 3YASA 4V3CA 3ZWPA 4B4KA 2R65A 2QN9A 1ZK2A 4HYYA 4IIVA 1K66A 3HGTA 2ODBA 5B55A 1V5WA 5TMEA 1UZUA 2RCYA 4HDSA 1D2EA 3P0RA 4G01B 3BIJA 1HE8B 3PFFA 4KXUA 1Z2PX 2FFRA 4WCFA 3WIVA 1Q1BA 1JW9B 3HM2A 3AUYA 1H4QA 1XALA 3PR1A 5KWJA 2QWXA 1BOFA 2UUOA 1Q7EA 1YL7A 5K8TA 4OH1A 4ND8B 3WB2A 1Q3KA 4RC9A 4BX0A 1TJPB 5DMXA 4LJ8A 4D9JA 2HMVA 1E2UA 4NRDA 4EY4A 3OOEA 4CM7A 4HTAA 1SCBA 3ILVA 3QU7A 4R2JA 2JLBA 3I4CA 3CURA 4FYPA 4JYBA 2P35A 3BE4A 4RZIA 2XAUA 1RBYA 3ILXA 4IYRA 3TQIA 2JLCA 2A0YA 3D2LA 5M7EA 4BNXA 2XV1A 4M0FA 5TPWA 1C1HA 3TIXB 2Z2YA 1YR8A 2GZAA 4OXQA 3B3GA 2GQ0A 1P5ZB 5U4QA 5IG2A 1LTHR 4G1CA 4QDKA 4R8RA 4PYQA 2QTBA 4RJLA 1P2UA 1QV9A 2JI6A 2YC2C 1PGNA 3VR3D 1Z45A 4TZ0A 3RAPR 5EVCA 5GIPE 1GVHA 3U5ZB 1IB6A 2EW1A 2W6PA 2Y4OA 3JW8A 5PNTA 2GETA 1YNSA 2RH5A 3JWEA 5REQB 2YKGA 3VR2D 1E1DA 1X86B 3L79A 3QJ5A 4NI5A 1VE7A 3EIHA 4M21A 5CLGA 3GJ6A 2R1UA 2WHYA 1AHNA 1TE2A 1PJTA 2YR0A 2AG5A 4ZCPA 3W1VA 1XD2B 2NUTA 4BNNA 3CZPA 3PPVA 1Y4UA 2NO4A 2RI0A 2I9KA 1IN6A 4EG0A 1Z8DA 5K0ZA 4Q9NA 1XV5A 3PFIA 3VNBA 1WCYA 1Z74A 2GTHA 4B6QA 4BUJA 2VH1A 2FPXA 4DTCA 4JK3A 1HGXA 3A6ZA 3I6BA 5IAGA 3LCUA 2OGTA 3U3MA 4AI6A 3KQSA 2CWDA 4IHKA 5GONA 3DE1X 5DJ5A 1M5RA 4CQLA 2WNSA 1PEDA 3QG5A 1NJ2A 4H31A 2ALJA 3TS1A 1WSWA 5JQWA 4Q3NA 1RYMA 4TGLA 4JI7B 4X1IA 1LPNA 1MGOA 1BVRA 1VBNA 3ABQB 4RGYA 1T4CA 4WZAE 4E51A 3S81A 4NMXB 4BV2A 4XVHA 2DFLA 3M83A 4MO2A 4G2TA 1UMCA 4PFSA 5B6PA 1KMNA 4CXMA 5BT9A 5EY5B 1FY2A 3L8YA 1KQ3A 4EPVA 2B34A 4FQ8A 3V2IA 1F7VA 2C5EA 5AI8A 1QAOA 3DV0A 2AZDA 1EX7A 1P1IA 4IGFA 4YMUA 5LKRA 1E7WA 1TA4A 5E7JA 2IYWA 3TPFA 1H85A 2RGUA 1HLPA 1HO3A 2CB9A 1IEVA 2XITA 4DEVA 5TIIA 5C1BA 1YMQA 3P0HA 4P4UA 4L9AA 3TMYA 1H42A 1VSQA 1DOHA 5K45A 3C16C 1LVUA 3GPIA 3UANA 1JLRA 3FFAA 1U8AA 3LF1A 5CNKA 2R8OA 4IJWA 3L6UA 2JCXA 4DMMA 3E1SA 2Z3ZA 3ER6A 4PZPA 3ZCUA 1Z63A 4XGNA 2YDYA 3E2IA 3GJ0A 4H4CA 4L8VA 4MIOA 2HTEA 3C5EA 4HWGA 4K86A 4OH7A 5ALZA 5B64A 5DM0A 4LZPA 5JH7B 2MSNA 5EJIA 4KWHA 2G25A 2OMKA 1WV0A 3G17A 3LFHA 4F84A 5FIUA 3T3PB 1NVGA 1KIFA 3G79A 2VWGA 3HJCA 4US1R 4LYAA 5AJVB 4N39A 4AK9A 2DHQA 4RZQA 1IMJA 4GUAA 3N8KA 1GUFA 1I2ZA 4D2IA 5EJFA 2HA0A 4ON9A 2CLLB 5DEIA 5HHTA 4KO4S 1QPZA 4L9RA 2LCQA 4Q3KA 4WCFC 5KUTA 2KBFA 3C7CB 3A36A 1GQRA 4L2IB 4RADA 5IWAB 4D3ZA 3B20A 3UJCA 1P2FA 4A6PA 2JAPA 5CLIA 1LWNA 1UM8A 3UF0A 4ZVKA 4K9DA 3RPEA 3UG6A 4BN4A 1T9AA 2G9NA 4CWAA 1KP9A 2V0GA 1NOKA 3I5MA 3OE4A 4UDOA 2BHTA 4HGRA 2QN7A 1Z2AA 1Y3HA 1YS6A 2WG2A 4FXOA 3PDIB 2IPNA 3TZQA 2VP5A 1I10A 1ONNA 3NEAA 1ZGCA 2V65A 4YQEA 4D4KA 4KRYA 4MUFA 4CF5A 5LP6F 2F9MA 4GG1A 3IP6A 1YIAA 2WJGA 1AMOA 3WKAA 5DNWA 4GWLA 1RXEA 2QV7A 3RRXA 3D6NB 1GFIA 1T5LA 3WE7A 4BVJA 2VBGA 3X1MA 5ENDA 1PJQA 2PGXA 4B32A 5IT4A 2GZDA 3ESQA 4P7BA 3IAFA 2WM9B 1HLGA 1Z8NA 2O8VA 4KL8S 4P3NA 1CXZA 3DVQX 3M6MD 4UJ5A 5L53A 5B4VA 4R54A 3A6DA 2HCFA 3UEOA 1ANKA 4EABA 4MIKA 1EIZA 5TQ2A 3Q2OA 4EGAA 2VJMA 5FOQA 3QVGA 4MKFA 1BEZA 1NW8A 2PLAA 1QIIA 3IP5A 1Q19A 2W71A 4MUYA 3WQQA 5CYFA 5CG2A 1YK1A 1XCJA 4D3FA 1GNTA 3E5NA 4YJ3B 3RABA 3HYCA 4BLUA 4YCBA 1EFKA 1UEXC 1FDTA 1H1TA 4B84A 1RI1A 5M2QA 4C1BA 1WETA 3ON5A 4AKIA 2IZ0A 1RYYA 3R3XA 3FYHA 3PA8A 1E2EA 3ZWNA 5BMVB 2II6A 3HKCB 4A73A 1JQJC 4ZI7B 5GIOE 4NK4A 4F11A 3CM0A 4MMYB 3TKAA 1BW9A 4O4LF 4EF6A 3IELA 4JEMA 4LF5B 2EFYA 4EELA 1X13A 3OBIA 1XRJA 3ZXUB 3GJ5A 5K3AA 5HTOA 3K8YA 4HQKA 5AOBA 1JDVA 1GZVA 1XHEA 3TTTA 1AK1A 1H66A 1CYDA 3MUFA 1XZIA 4BZZA 5AM4A 4XWYA 3CLUC 2JZNA 4CEIB 5HKBA 1A04A 5IU6A 4DLNA 5CRIA 3BIWA 1OI2A 1CZHA 1SVSA 3S4YA 2VC2B 2OTCA 1GCIA 1KOFA 4L5JA 4QA9A 1J1ZA 3X1KA 3ZJ4A 1L7RA 2YRXA 2YQ4A 2JJ2A 2A9FA 4DQDA 2AJ8A 2SBTA 1GTJ1 1YKGA 5JALA 1BXZA 1JT2A 3ORFA 1MVNA 3RYTC 2PFSA 4PZZA 4F8EA 2O2ZA 4MULA 4CM8B 2YICA 1XI2A 3OTOB 1FU8A 2VBFA 1T34A 4A7PA 1N0WA 4CMEC 3EDOA 1Z56C 5KU7A 5TNXA 2Q6TA 2CNBA 3FTCA 5AKIA 4LJ5A 3HMKA 3RJZA 3G13A 4XAQA 2JJQA 3JXEA 2CWWA 2PWPA 3HA3A 1VYUA 1GCUA 2AT1A 4YDSA 1E3DA 1BE1A 1M67A 2J3JA 2OBFA 4BNKA 3AHFA 3K0AB 4M1ZA 4TTTS 2CL0X 5ALGA 1JAXA 4FDAA 3VYVA 1H1LB 4CKCB 1Q3TA 1YS1X 1RXIA 1XR3A 3BHNA 4OQXA 3R5JA 4FZ5A 2LCIA 1OLUB 4LJ9A 1DEOA 3SFTA 3SF0A 5IC5A 2PKCA 4KI0A 3DOOA 1AKVA 2C57A 3NPAA 1JVBA 4GMDA 4PG4A 1RHUA 4Y6RA 4BFSA 5K01A 1GRQA 4IGKA 1K98A 3MCVA 3TKYA 4OBBA 3GJZA 5LMNB 1BVYF 2FX2A 3GA0A 1RHQA 1E3SA 3ED1A 3KFVA 5K09A 4V0RA 2DHEA 2G4VA 4RHXA 1IIBA 3B13B 3MN1A 4AJ4A 4DSOA 1E1CB 2D0OB 2YV5A 3NX4A 2GN2A 3G8AA 3ECCA 1T5SA 2JHGA 2A1TR 2Q4TA 3DL7A 1OAKA 3GFGA 1PZXA 3FGNA 3JSAA 5AHKA 3TEFA 3TJRA 4AWXA 4F4CA 1OSNA 2R7AA 3MYRA 2RGXA 3OZDA 4GC5A 5JG7A 5HEKA 3CVOA 3N7UA 1CYEA 1FRFS 3RVPA 2OLKA 3V34A 2HPZA 1AM4D 1WEKA 5FWNA 4IJVA 5BNWA 1FP1D 2V4ZA 1RP7A 1ZMRA 5JMTA 3NLLA 4WK6A 5HK9A 3FYTA 1VE5A 3PHIA 3BHMA 3KB6A 3T7DA 3R7DA 3GRAA 1Y8RB 3HKDB 3ZXYA 4Z4FA 3MCWA 2Q5JA 4HNAB 1AUXA 7ABPA 3AK4A 3MSXA 2PO5A 4KR2A 4ZQFA 4DUPA 3UGJA 1Q20A 2YMPA 2XQIA 4L07A 3WYGA 4C0SA 1DUVG 2ZS8A 4FILA 1Y8RA 3CEJA 4X91A 5T3YA 1G21B 1KEWA 3I5AA 4R41A 1XC7A 1MH1A 1SBNE 2GVZC 2VPQA 3C8HA 4PAOA 4QBIA 4HQ6A 2XVMA 4XFJA 2JLVA 1GPLA 3IQFA 4PNHA 5CNIA 5ITSA 1PZMA 4LE2A 3JWGA 2PGAA 2QQEA 4UNQA 3L8CA 3GEBA 4YFYA 4Q1BA 4J6EA 4KDCA 2QIOA 2EW2A 4EYQA 3LOPA 2C2MA 4EPRA 1JDZA 3EXG1 3PJRA 1FYWA 1T9BA 5FA5A 4BLVA 1FUIA 1DAHA 2OHJA 4UPVA 3RDPA 4IHJF 3GUYA 3RHTA 4W63A 1N3YA 4V2IA 1EUDB 4HJRA 1V4NA 1KO1A 5I01A 1JNYA 4LHEA 3D31A 1N1EA 4G8CA 3V2HA 3K53A 4RSGA 1QZ3A 3BB4A 3FPKA 3W5CA 3KPUA 1JX6A 1HOTA 3BWXA 1Q92A 3P0FA 4BNDA 3TZLA 2V1UA 3L0DA 3R3WA 2FWMX 2ZTHA 1G8AA 1Q2UA 2GBCA 4MDHA 5ALYA 3NDJA 4CL2A 3A4YA 1XLTC 3L04A 1YDMA 1SBCA 3RROA 4OHCA 4EUHA 1CHDA 6NULA 3OPVA 4CMCA 1ESNA 5T4HA 1TFUA 4IGIA 1EM8B 2G9RA 2BLLA 2WA1A 3KLPX 3Q7QA 4EJ0A 5LJIA 4LZJA 3TLMA 1S7CA 2J9ZB 2H1FA 1XNJA 2C4VA 3RHZA 1UAAA 2VDLB 1YACA 2Z5FA 1MD9A 1E2NA 1UMDB 4DLRA 2FF5A 4QTUB 1G5RA 4E2XA 4KQGA 3K70B 2QS9A 2H2IA 2XNJA 4DLYA 4YDQA 3H3XA 5CT4A 2WHRA 1NXQA 3E9NA 4BMZA 1RWNA 3UTDA 1NVMB 2ZKLA 3I04M 4HAXA 3NU1A 2XZOA 4BGDA 1HSZA 2OK7A 2FDXA 2FG6C 2XWQA 3ZE6A 2IUEA 1SKAA 2I1WA 4MI1A 4BVGA 4DCUA 1AGPA 1DZIA 3GFPA 3K32A 4I4NA 3K31A 3WYDA 4EJ6A 4ER3A 1W5BA 2TMKA 1YJXA 3TF5A 2HXYA 2YMQA 4WTOA 3TB6A 5ECWA 2FP3A 5FT9A 5KBYA 1N2CE 1HQYE 4RLFA 1KYVA 4HFNA 4R40A 4RCYA 1ZU5A 2A78A 3FZGA 3PUWA 4FTWA 3RVJA 4MS4A 1VL1A 3UUEA 4YI3A 3O8OB 4Q18A 4X3CA 5BN4B 4PAGA 1T5IA 2GEDA 2O0JA 3N0XA 4QUEA 4EHBA 1Y48E 3B48A 3TTSA 3G6WA 5H4HA 3UK2A 2UU9B 3R5XA 2QMYA 4D3YA 2OCAA 2C2HA 4IUBS 3WRXC 4WNIA 1HLDA 1KY3A 3L6DA 4N7MA 4UU8A 3EEQA 3M2PA 3PRKE 1QQAA 4Q4HA 3BG5A 4LW8A 5JMPA 3TSZA 1NBEA 1NSTA 2CDBA 3W5BA 2HF2A 4AKHA 4FKZA 5FD8A 3RVOA 4EI7A 2DBRA 2LDXA 1L2TA 3JYOA 3ZTWA 3H2ZA 5EZYF 3GLHE 4YMVA 1DAEA 1G6HA 2R47A 1GL7A 5K6TA 3FFTA 1CEYA 1L5LA 3LGXA 2W5UA 2OR3A 4BNVA 1HFJA 4M0CA 1K2WA 1ZKDA 5E9JA 1MOQA 1QC5B 3HR4A 4PZCA 4UVDA 2XUIA 4B40A 1CB0A 2BW0A 2YIMA 1O58A 3H18A 5CX1A 3KWJA 1Q74A 4FB4A 2B4TO 4DKJA 1NGSA 2QR5A 2G9QA 1JFVA 2A88A 5JLAA 2OFFA 3TTWA 4OHPA 1KMHA 1PR0A 2D59A 2QVLA 2XCLA 1BHSA 4B8ZA 4NCHA 5LN1A 3FIJA 2UVPA 2FQ1A 1O6GA 2VH5R 4MI9A 4MEAA 3ELBA 1QORA 4KXMA 1MJNA 2FSHA 3ROFA 1KE2A 1WU7A 1WZCA 3O93A 3TK1A 3UATA 3A25A 2ZQZA 2RGDA 4FP9A 1G41A 3UBMA 1K68A 3QW2A 1HYQA 2Q28A 3OZTA 3JALA 1P6UA 4LKOA 4FCWA 5CHYA 3ANNA 4MQLA 3SX0A 2F1RA 3W04A 4BJ3A 3EEIA 1YU9A 4H0FA 4NEGA 5J4HA 2PWAA 2XB9A 1CUAA 1VLLA 2H59A 3IS3A 2H2AA 4D79A 1RYDA 1UMKA 2QU8A 4R71A 1I6MA 4PGAA 1AMUA 4HDKA 3EDCA 3ZS9A 1WNTA 3TNYA 2BGGA 1NMSA 3I9LA 3I92A 2WC1A 3CZMA 3JAWA 1VSVA 1Y5MA 3V4OA 1U9YA 1P61B 1H8ED 2PN1A 4XI9A 4WY2A 4RDXA 5LSAA 2WJWA 2JI7A 3I6MA 3DKRA 4Z0HO 1DHRA 2H9IA 1F9EA 1BJRE 1Z0UA 2YN2A 4MGIR 5L40A 4ZV9A 1PZHA 1QHIA 3GELA 2CDRA 4F3TA 3SYNA 1THTA 5TEVA 4FFLA 1G5TA 4MV1A 4PCVA 3WZLA 2PJUA 4JV5B 1D0IA 1QVRA 4QVGA 4R2IA 1X9IA 1IOWA 2IVFA 1T24A 2R6ZA 2WD7A 1CS0B 3EW7A 5FAXA 1ZJ5A 3TTYA 5I7VA 2JLYA 1U0RA 2C2ZA 2JLAA 2KX7A 2Q27A 1Z6GA 3JYPA 1J4AA 1XMSA 4I46A 2C5BA 3GJQA 3JQEA 4YCSA 4P5PA 3JPWA 2FMHA 1QFMA 4Q7LA 3BN3A 5JFGA 1CNEA 2I22A 3DBHB 2AC2A 2RGEA 3K09A 3SKVA 3AVOA 4Z7QB 5LZ7A 4NC9A 4DANA 1Z62A 5FRDA 1AVTA 2ZJ8A 3NTQA 1QO0D 2A86A 3KG2A 5KYWB 3W0LB 1PR3A 2VAMA 4I4IA 2WDZA 4HWTA 2BMEA 1V26A 2GN9A 4HTFB 4YTEA 5EZ6B 4F2WA 3S70A 4UQOA 3SC2A 4OATA 4FHDA 5LC1A 4XWKA 4QECA 3ANYB 4UVEA 1GZSA 4IFBA 2BBWA 1R5OA 1CR2A 2H5IA 3TM4A 3MQFA 4GRAA 4KPEC 3IE2A 3NMUF 5G0TA 4BQSA 3Q1LA 1E2FA 3VYUB 4CCSA 2CVZA 1QLJA 4EMUA 3OAAA 2V6IA 4G4GA 4E94A 4L3VA 4BQQA 4EA7A 1THMA 2Q4DA 2QX4A 2YMMA 1LBHA 2Y92A 4R1PA 4WKNA 4EK9A 4RTSA 1CJKC 1ZL2A 4ZVPA 2ZTMA 1T29A 2ZUDA 3IVAA 3RIEA 4E5YA 1XD8A 2X2FA 3BBPA 3C5HA 3N86A 1DXQA 2AOWA 3S3TA 3FXAA 1UJ5A 3A4VA 2FRXA 5EXSA 5K0NA 5JARA 5HG0A 4F9EA 3IIKA 4RENA 1EGMB 3JQAB 4J0FA 1LTKA 2HMYB 3DTVA 5C7LO 1QVAA 1KO5A 4Y1FA 5ALIA 2J3IA 3U13A 2E4VA 1NW3A 4D0LB 1EBFA 2DPHA 2GBGA 1Q91A 2WW8A 5DE3A 1SMKA 3PWZA 5F1OA 3G9QA 3BSFA 1Q1ZA 1U0LA 4BFCA 3F7NA 1R0RE 4QJ3A 1BX3A 2WLSA 2R44A 1KK2A 3C3KA 3GCXA 2WUDA 1CZOA 1FOEB 2HF7A 2WTBA 3VZCA 1DDGA 2UUBB 4OYHA 2WJHA 2WTNA 3K0AA 3U4GA 1EG2A 1PZFA 4GEKA 4F3KA 3ZLBA 5IFKA 3LXXA 1Q14A 1XTIA 4MP6A 2VH2A 4OGKA 3ZK7A 1ZJJA 3M6LA 4JLJA 1D1TA 4V0ME 4EG8A 5IT0A 4LOHA 2D6FA 4GGMX 5EIBD 1JP7A 4BC0A 1Z16A 4MVJH 2FZ4A 2DLNA 1Z8FA 4ML3A 5AHXA 2FSVA 3IEUA 3RSHA 4UD6A 6GPBA 1GPWB 4WKOA 8OHMA 4YI5A 4O25A 1H6DA 2LP4Y 3KU1A 1DAMA 1W75A 2QDKA 1NYTA 3DE3X 2YOGA 2Y6UA 1W1IA 3FPBA 2NVOA 3PP8A 5CBPA 2Z2XA 3VBEA 1RMTA 2QG9A 4L7QA 2Q5CA 3LDGA 3HI6A 4NZ9A 1LRLA 2C9OA 2JLRA 1IN4A 1G8PA 1MEJA 1WO8A 2BDUA 2QJFA 2ZB4A 4TTIA 3D5TA 4OCZA 4YWHA 2O0MA 3V1YA 3MW8A 2Q62A 4S0ZA 1N3IA 2R48A 3CHYA 4OGLA 1BEEA 5C46F 1KRXA 3K1AA 3T4XA 1X94A 2HJWA 3OICA 2IXGA 1E79D 2JVJA 5BV8A 3QEAZ 1L5HB 1OH6A 2R8YA 4O3MA 2PFGA 1FZQA 2GEKA 2H7XA 4PG7A 3W3AA 4ZXPA 3DVRX 3O1IC 4HGOA 4PQFA 4DDTA 3PDUA 2B69A 2XYGA 1XU7A 3DHNA 4GU5A 1NUQA 4HEJA 1H2EA 1N9GB 4O2AB 3ITEA 2H65A 1KJYA 1XPUA 3PYXA 2HFJA 5J4LA 1E3JA 3IBGA 2DEUA 4FCVA 4J43A 3CRZA 5I7WA 3BUSA 4HMPA 2IY7A 2HPHA 2A67A 1R27A 5AJHA 3ENVA 4UFPA 2DLCX 1IPHA 2FZVA 3A3PA 3MD9A 2W6ID 3OLYA 4AMUA 3PC8A 4UNSA 1WHTA 4OAQA 4CBVA 1IAVA 5JTTA 3THXA 2Q0QA 3QVSA 2VHWA 4GDMA 4HB3A 3AR3A 4KHZA 1Z4PX 4HX2A 3IMEA 4OQ4A 3UJ3X 1KE1A 3ZVKA 3QW4B 4Z0TA 3O8BA 3U61B 1VB3A 1VHWA 5K2MA 5C8YA 2Z08A 4B2LA 5LWHA 3T3DA 1U0GA 4KBYA 2Z6QA 5A4IS 1JKJB 1JSCA 2ZIXB 2ZROA 4RZ3A 4O02B 4W5WA 3N6VA 1CUSA 1NULA 5F98A 3GRYA 2CF5A 3EGVA 3PQCA 2D2EA 5K3FA 1K63A 2C04A 1JLSA 1TOAA 3PFHA 3KB8A 3E3MA 5DLDA 3SBDA 3EDRA 4JI0B 4BNLA 4P34A 4BNDB 5I9LA 4J7UA 5EXXA 3RTDA 1ECBA 3H4MA 1ISPA 3A6GA 2ZITA 3WG9A 4XQGA 1RAGA 4KBGA 4PLHA 3JV7A 4CM4A 4EHIA 3JARA 4J1TC 5BN5B 3T7RA 3HJHA 3LRXA 1CRLA 1JDJA 2QMZA 5B5SA 3PNMA 4Z8XA 4C6SA 5EJ9A 3A6LA 4TVBA 3P2OA 3VPGA 4D81A 2UDPA 5AW7A 4EWLA 1KZYC 1OA0A 1W59A 1JHYA 1HM5A 3Q11A 1U2TA 4MW4A 4C0KA 2XT9A 4K9OA 2WQZA 1MIHA 3QOFA 1HG0A 2IHYA 2JIMA 3G0DA 3R3SA 4G56A 3CU5A 3IO5A 2E7ZA 4GFDA 4KOEC 3P9IA 1ZD9A 3CYFA 4XJXA 4HRAA 2VEDA 3REOA 1RRKA 2DG2A 2J07A 1MT3A 4V2UA 1OKKD 2D2VA 1ORWA 3F5SA 4NG4A 4U4AA 5J4YA 4BFWA 2VOEA 1C3EA 1OXTA 4K6HA 3RM3A 4ZZ1A 4KGXA 5LA6B 4H1WA 4ZKDA 3IIEA 4YCDA 3KVOA 3I05A 4TSFA 2A84A 1OTXA 1ILWA 1K8ZB 1Y4SA 3D2AA 2E3JA 2WJZB 2YIVX 5EMMA 4IOLA 2UZ3A 2EL9A 2JD0A 2YYSA 3L18A 4QPNA 2G5CA 5FNVB 1DPFA 1AQUA 2Q6KA 1SKBA 4NZNA 4E07A 3OPXA 1Z34A 4M1EA 3D6TB 2HXGA 1JEJA 3O3MB 4D1YA 3FOFC 3VVBA 2YZ2A 3OT4A 3RSOA 4E1VA 1GRVA 3ZU6A 4Y2YA 1ZCZA 3GNQA 1IONA 1H9AA 1P3JA 4TX1A 4RM2A 3DEIA 3WFIA 4DC0A