4JVNA

Crystal structure of human estrogen sulfotransferase (sult1e1) in complex with inactive cofactor pap and metabolite of brominated flame retardant 3oh bde47 (3-hydroxyl bromodiphenyl ether)
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
291
structure length
291
Chain Sequence
SELDYYEKFEEVHGILMYKDFVKYWDNVEAFQARPDDLVIATYPKSGTTWVSEIVYMIYKEGDVEKCKEDVIFNRIPFLECRKENLMNGVKQLDEMNSPRIVKTHLPPELLPASFWEKDCKIIYLCRNAKDVAVSFYYFFLMVAGHPNPGSFPEFVEKFMQGQVPYGSWYKHVKSWWEKGKSPRVLFLFYEDLKEDIRKEVIKLIHFLERKPSEELVDRIIHHTSFQEMKNNPSTNYTTLPDEIMNQKLSPFMRKGITGDWKNHFTEALNEKFDKHYEQQMKESTLKFRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Estrogen sulfotransferase
publication title Mimicking of Estradiol Binding by Flame Retardants and Their Metabolites: A Crystallographic Analysis.
pubmed doi rcsb
source organism Homo sapiens
total genus 112
structure length 291
sequence length 291
chains with identical sequence B
ec nomenclature ec 2.8.2.4: Estrone sulfotransferase.
pdb deposition date 2013-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4jvnA00
2CNWA 4Q47A 3AB3A 3JVUA 4LHZA 2G77B 4EQ6B 4YMTA 1D2NA 2JLWA 2WVJA 5K8TA 1IN6A 1G4UR 5DSZA 3X1DA 3THXA 5K8IA 2OILA 4Q00A 2NG1A 1NP6A 5TY0A 1OB5A 1W36B 2KSQA 1KDPA 1Q20A 2AFIE 3C15C 1W2HA 2ZPTX 4HDOB 5GJBA 4BECA 1RKBA 4QJ5A 3SJZA 5FOSA 2ZJ5A 3NVAA 3CO5A 1ZRHA 2IYZA 4Q48A 2JEOA 4Q7JB 4Q4HB 4US0R 2H1LA 1NIJA 3SNHA 1N6RA 2IYTA 3MG9A 5DN6D 5KPJA 2NPFA 1OFHA 2X8AA 5K8LA 1MRNA 4IDQA 4GOJA 3ZLJA 3T1VA 4PPQA 1QZXA 2CMKA 3ZYCA 2UZIR 1RYHA 1E9AA 1F48A 2HLDD 2ZI6A 3VAAA 2IXFA 2ZI9A 2RGAA 5DIFA 4G1UC 4Q9IA 3BWDD 4PQYA 4C0KA 5FOUA 1QDEA 1G1MA 2B7CA 3WYFA 5JFGA 5BN5A 4LJ6A 4TQ9A 3LA6A 3QXJA 2XXAB 4DLRA 1G16A 1XEWY 3EWSA 4R98A 2IS6A 1X1RA 1N0VC 3QQ5A 4P32A 1FZQA 4KO8A 2AXPA 3B82A 3KKPA 4PPFA 1FP6A 4HDQB 3BIFA 4QFMA 2WSSD 3THYA 2WWHA 3PIRA 4WXRA 1KTVA 3AKEA 1BMFA 3BXZA 4BASA 2AN9A 5FOTA 2R62A 4DT1B 2BVNA 4M9QA 4JLDA 1UPTA 1OE0A 1OH8A 1XFAA 2WOOA 1IBRA 3CNOA 4B6FA 3B1XA 3RRYA 3GLFB 2WHXA 4IEIA 2ANBA 1GRQA 4KSCA 4YQFA 4YMWA 1SQ5A 1E1QA 3KTAB 1JR3D 4JSYA 4B75A 1FQKA 4B3CA 1HE8B 4A2QA 1OXTA 3R8CA 4TYYA 1ELOA 3PUVA 1T8TA 1G8YA 2FFQA 2FF7A 2GZAA 2Z0MA 2O52A 2IW3A 3OEHD 4FCTA 3Q72A 3UG6A 1ZM4A 3X2SA 2IUUA 4PFSA 5L3RA 3U3JA 3KXKA 3K70C 3LH5A 2ZAMA 1UBFA 1ZNXA 1QHYA 4MRNA 3SE0A 3ZZUA 4ZCLA 1TEVA 5F9HA 1X6VA 5FOWA 3TAUA 3QKUA 2QG6A 1OIWA 3U7FB 4PXAA 1SXJE 4WAUA 1KY3A 1JEDA 2PJZA 1XD8A 4MA4A 4D0NA 1E1RD 1NSTA 4RKFA 4YXWD 2WPDD 5JS8A 2XEXA 5F98A 3JVVA 2ZRDA 3K0FB 2C95A 4UXJA 1VDZA 5FTJA 1VECA 1IAQA 2XZPA 4QHSA 4DRZA 4KFUA 3VHLB 3SQWA 4MUBA 3D6TB 4KBGA 2Y8EA 2A5GA 3FKQA 3SHFA 5DHAA 1NMXA 3TE6A 3UWOA 5D3MA 1LY1A 3B8HA 1EFHA 2ZR7A 5EE0A 2VP9A 4HAYA 3KKQA 2IYYA 1KI7A 4LBZA 2FMXA 3FHCB 1D2MA 2ODBA 1T3HA 2QMHA 4D4KA 2FZLA 1E2KA 1GILA 3VR4A 2GF0A 4Q66C 1OSNA 1FFHA 2XZLA 4RD6A 3VNVA 1G18A 1Z28A 1CJKC 4U02A 3L43A 2ODEA 1ZC3A 2VP4A 3MLEA 4LHXA 4PTLA 3JZAA 1P2SA 5CYPA 1CR1A 2W0SA 4KYUA 3FWYA 4HB4A 4URXR 3GFTA 3U3RA 4BLTA 2C9YA 1F2UA 3QEOA 1ZINA 4OQLA 1Z0JA 2G0TA 3KJGA 2IF2A 4BRWA 5KNBA 2GEUA 1XF9A 1VG8A 3NKVA 2PCLA 4PQRA 2OLJA 3OESA 1F6BA 1R5OA 1KI1A 1SKYE 2B8TA 1Y63A 2I3BA 3IHLA 5EP3A 4EFLA 3A8TA 2GBLA 2GESA 4XD7D 1WMSA 4UNQA 1U9IA 1XD9A 1F5NA 2QP3A 2BMJA 4PO9A 5BXQC 3C7KA 3PEYA 1GNQA 3LVQE 2V7QA 4LPSA 4O0MA 3KJIA 4F91B 1KYIA 1IJEA 3E70C 3EZ9A 1R5BA 5H8WA 3U2QA 4M0LA 5JHGB 4QGAA 3VR1A 4OQNA 4G5SA 4N0DA 1WBDA 1GITA 3FHTA 1A7JA 3VR6A 2O8CA 3U6BA 4HLCA 1XD2B 1LTQA 3AKDA 3RLFA 2AWNA 2NO6A 1W0JA 2HXSA 4ZPXA 2QRNA 1AGRA 3THWA 1SVLA 1JAIA 1DAIA 1VHLA 1ZVQA 3VHXA 1P60A 1P73A 2YOGA 2V55B 2V4ZA 3VX4A 3UWKA 4GRAA 4M22A 4B44A 5BN4A 1E99A 3BBPA 3ZD7A 2JIZA 4TQAA 3RABA 2IXEA 3GFOA 1UKYA 4B43A 1UBGA 1RC8A 5KNDA 3K0CA 3PV0A 3MWLA 4KSBA 2BDTA 1ZUNB 2BBTA 2N1BA 3K0AA 3MWJA 1E0AA 4MRRA 1YKSA 5HR5A 2PZGA 2VP5A 4PO8A 1OJLA 2R6CA 3PCRB 4KI0A 3PXGA 1TQ4A 3BE4A 1J7KA 2X2FA 5IF9A 1Q1EA 2G3YA 4L9WA 4MDEA 1GL6A 1FUKA 1ZD9A 4V0KA 1IM2A 2ZJ2A 4TTRA 4A15A 4OJKA 1JXOA 1KK1A 2YJTD 2IBMA 3HYRA 3ADKA 4TMVA 4C0QC 5JEEA 3IILA 3VU9B 4H1VA 1Y3AA 2BBOA 1N0UA 4WOPA 5J47A 2R8RA 2ZYWX 5FUXA 1AK2A 3LVRE 1JALA 3NHBA 1F60A 3K9GA 4JLMA 4NCJA 1TTTA 4DB4A 2HDNB 2QMUA 2PJRA 1M6NA 2DYKA 4LBYA 2FPKA 3ADCA 3K70B 1COWA 1P9RA 1AJEA 1Q0UA 2VLIA 4PHHA 4RD3A 4QGFA 4AYWA 4CT4B 4D0GA 4P31A 2BKEA 2EFDB 3BORA 3EPKA 2XTNA 2LCFA 3KUCA 3LNCA 3W3AA 4HLUA 1FP7A 4EFNA 2WWGA 2YINC 3MGCA 4JLKA 4TYNA 4BQSA 2ZEJA 1UKVY 3ND8A 2FPMA 4JSTA 1LB1B 2JJ2A 5FL3A 4R71A 1R10A 1KI8A 2YNMA 3MUFA 5B30A 5L3VA 3U7EB 4Q1BA 2XNSA 2XX3A 1Z63A 4FCWA 5FBQB 2RGNA 1SGWA 5EXPA 2V1XA 2FSIA 3AV0B 4KYIB 4S35A 2DFLA 4JKIA 2CEAA 2CXXA 1W0KA 4CDGA 4EUNA 3SHWA 2O8EA 1YR8A 1N6NA 4HZIA 3IBYA 4RFSA 1NRJB 2JJ8A 3OHMA 4QHTA 1E2EA 5C4GB 5J4VA 3PR1A 4IOJA 1MKYA 5KU1A 2H17A 1IY2A 4R7ZA 2QQEA 2HF9A 4LHWA 2QE7D 1W49A 5SZHB 1CR0A 2GJ9A 5CDFE 3SEAA 2IHYA 5E7JA 4B35A 2GTPA 4EPRA 4Q02A 1DEKA 4AKHA 2ERXA 1Z06A 4AY2A 2HUPA 3Q8XB 1PJRA 5GADl 2ZTSA 1YR7A 1Z2CA 2EQBA 5CIWA 4OQMA 1ZU5A 4HAXA 3MFYA 2QL6A 4HLDA 5TDHA 2CK3A 4UQOA 3T35A 4N3NA 3GJ0A 2MMCA 1XJQA 3PEUA 4CEHB 2A9KA 1XBTA 4GOXA 5AUOB 4KJZA 2AFHE 3MRSA 4M1YA 4M1WA 2VIIA 5L3QB 1KDOA 3A4LA 3RRMA 3CZPA 3V00A 1II8B 4ZKDA 3B1YA 1VCIA 4FMCB 1XEWX 3GJ6A 1MABB 2E1RA 4JYCA 5FUVA 4D4MA 1E2NA 1NG1A 4MKHA 1CJMA 4ZO4A 4E5UA 4JS0A 3GP8A 1Z07A 2FFHA 4TZ6A 3X1ZA 5IK2A 4R2HA 1Z2AA 2BJWA 4TL7A 3U44B 2D74A 2OUKA 2MSEB 4AURA 4PAMA 1DAKA 2NTYC 5H1YA 4DCSA 4BLPA 2YOHA 4RFVA 2X1VA 1MO3A 1P9WA 3EIQA 4QGHA 1DE0A 2EW1A 1WXQA 5AJYA 2PMKA 4A2PA 2JLQA 1Z5ZA 4DDUA 2F3RA 1YVDA 4GL2A 1U90A 2DY1A 2V6IA 3H84A 3ZQJA 3V4RA 1E2HA 1OXSC 4ZKEA 2GJSA 2AD1A 3QPUA 1R7RA 4Q01A 3WMGA 4ILEA 4GNKA 1KI6B 5ELXA 3AEZA 2QUZA 2IT1A 3AVTA 1W4AA 3LX5A 4LV8B 3B9QA 3EPJA 2J45A 3A4MA 3D8BA 4D2IA 1SXJD 1LF5A 2CDNA 3H0KA 1YZNA 3IUYA 5HZHA 4KLZA 4DEYA 1C4OA 1DTSA 1HH4A 2VHQA 4DWJA 1KAGA 4U7DA 4KU4A 3W3ZB 1U98A 2HLDA 2DWOA 2QMOA 1AQYA 1K8RA 4A92A 1IXZA 1TU4A 4O2RA 5D3QA 1Z22A 2JLSA 5ANRB 1T0HB 2IYVA 1NN5A 4OKSA 4QC2A 3D7MA 1BS1A 1R0YA 3HJNA 3M6AA 1XX6A 2VHJA 4ZI3A 1G4AE 1J2JA 4BE7B 1FX0B 2VHCA 3DPUA 3F5FA 4LJ8A 3PQCA 3WHKA 2YVUA 3IQWA 1NVUQ 3CRMA 4X8OA 2WSSA 2ZYUX 4LYHA 4PZYA 2GEDA 421PA 4A0FA 1IN4A 1ETUA 4F4JA 2R6FA 2JLYA 1U8AA 1S3SA 2GXUA 4NH0A 2ZS9A 4EIWA 1RRCA 2QN6A 4UNSA 1V5WA 1RRGA 5G40A 2W83A 4BFXA 2R9VA 4CRWB 3GLIE 2EYUA 1GZSA 3ECCA 2R2AA 3EIHA 4GI7A 1Z0FA 5FR1A 1KDRA 3AH8A 3LO5A 2PX0A 2RGEA 4M9SA 1JR3A 3GLHE 4L16A 1TUEA 4TYQA 2BC9A 1U94A 1JPNA 1S2MA 3QVUA 5FUYA 1P7CA 2OFOA 4M9XA 1NMYA 2GXQA 1ZM2A 1P9NA 2QGZA 3EAQA 3QKRA 3OEHA 3E5HA 5JWHA 1A5TA 5JJIA 2OT3B 1HURA 1GAJA 2BMFA 721PA 4ZCMA 4Y0AA 1CJTC 1ZNYA 1ZP6A 2ZUCA 5EJEA 4A8JA 2IYUA 1E9CA 3EWAA 4G5GA 4ABYA 2VRWA 1TADA 1W44A 2WJIA 1G8FA 1XXHA 3NH9A 4I81A 2C77A 5BQ5A 1EFCA 4D25A 2ZS7A 3IPYA 2UKDA 3C5CA 4IOLA 1E1RA 5KSOA 4YXWA 1XMJA 1US8A 1TF7A 2WPDA 3EZFA 3TSWA 1NLYA 5G53C 2XGJA 1G17A 4PZZA 3SJAA 3GLGB 3FHOA 1Z6XA 3GJ4A 3SBDA 1QG2A 2GDJA 4BWYA 4D0LB 4I1OA 5C2JB 1F2TA 1UM8A 3NBYC 4XTCS 3BK7A 2QM8A 3CH5A 3B6EA 1T5IA 2Q21A 4IDPA 1AA9A 2V3CC 3SN6A 2VPPA 3MMPA 4FMBB 2CBZA 4A4DA 4LX0A 3HR7A 1MR3F 4HB2A 3BERA 1GDDA 2AD5A 3MCAA 2QQ0A 1CP2A 4TLEA 1AZTA 1DARA 3DZ8A 4HAZA 5G41A 4LBWA 1T0JB 1YRBA 3QXSA 2BJVA 2JAQA 3ZD6A 1M7GA 5LD2B 2PH1A 4JL8A 3O8CA 2ZSFA 4MYUA 3VX3A 3U61B 2H16A 4DEXA 1OW3B 3U5ZB 3ICQB 5B57C 2IWHA 1VYVA 3BB1A 1JQJC 2QROA 1OFIA 3WMEA 3LY5A 3AVUA 2CLCX 1W5TA 4GFDA 1GRRA 3RSLA 2P65A 3IHWA 2J46A 1BO6A 3EASA 2IYSA 5E4FA 3SOPA 3REFA 5JI3E 3IGFA 3QBTA 4K81B 3AM1A 4JVSB 4NDZA 2DWQA 2OO7A 1XMVA 4Q4AB 2QAJA 5CJ2A 4ZI2A 5GVSA 5KSYA 2QZ4A 2F55A 121PA 2DWPA 3FYHA 5J4YA 1RPZA 4CEJB 1I4LD 4JBXA 3SFZA 2AHOA 4XD7A 4UXHA 2GCOA 1TQ6A 1WCV1 2WJVA 5IDVA 3U7GA 1WP9A 1KMQA 1TEXA 4HI0E 4LI0A 4MGYR 1HT2E 4Q19A 2EYQA 4URZR 4IVPA 5HPYB 1IXRC 4JL5A 1NLFA 1KMHB 3EIEA 4S2EA 4R9UC 1LS1A 1Z29A 2W6ID 4PC6A 3GEHA 5FI0B 1E9FA 3KDSE 5DNYB 2OFXA 1MRSA 2P67A 2F9MA 4GOKA 3SYLA 5KSZA 3HU1A 1PVOA 2FE4A 1E96A 2BKUA 3W5IA 4Z54A 3GLIB 3TW4A 1XTQA 5JCZA 4HUQB 1Q3HA 2QI9C 1HQYE 1NY6A 3TUZC 3LXXA 4A36A 3M1IA 5EP1A 2R44A 3HPQA 4PC2A 4NMMA 1M8PA 1YRAA 2EFHB 1ZCAA 1DPFA 3GLFE 1QHIA 2HT1A 2QPTA 4GZMA 1X8JA 4GDFA 3G82C 1AS0A 3U3MA 1XTKA 4ZIRB 1ESNA 1YU9A 1PV4A 5H68A 2AK2A 3H2YA 3WRYC 2FDCA 3HR8A 1UADA 3NBZC 2NO9A 2OEPA 4W5WA 3K9HA 5JECA 3QF4B 4V0LA 4D6PA 1P2TA 2BEKA 2CCJA 5FTMA 1Q22A 4V0OA 4A0GA 1PUJA 1XEFA 2WMNB 4YDHB 4TQUS 1Z83A 2FGJA 2OE2A 5GVRA 1YHNA 4Q4JA 2RGXA 1J8YF 3BFVA 1NMZA 3N5CA 5DYGA 5CB8A 3J81k 3OF5A 4Q7KA 2FPLA 4IFEA 4TTQA 1X8KA 3MJRA 3CH4B 2A30A 4WZBE 4CYMA 3W6PA 2F9LA 2NZ8A 1U8YA 1FNNA 1RW4A 1IONA 2D62A 2XTZA 1R0ZA 2VSFA 1AS3A 1CF4A 4JLBA 3IO3A 2YWEA 2QENA 4KAXA 4CF7A 4FCVA 3QENA 2C5LA 1E98A 3T34A 5FR2A 2G88A 5JMTA 1VPLA 5CK5A 1EFRD 2FSHA 4MKGA 4WBSA 1IN5A 3I1FA 3L0IB 1YE8A 3KL4A 2H8KA 2Z6VA 3DDCA 1CULC 2P6UA 1ZUHA 4IVRA 1N25A 5FBVB 3NG1A 4MRPA 1FMJA 3ETLA 4MGKR 4OI4A 4JL6A 2GETA 3RSOA 4B3BA 2ZRJA 3AVWA 3VNUA 4GBMA 1MH1A 2GJ8A 4OI1A 4B6EA 1AS2A 1HT1E 3B13B 4BLRA 3NDPA 1W47A 3KZ1E 1KI3A 3KJEA 1NF3A 4P4SB 2GHIA 3AUXA 4KBFA 1N6HA 5DI3B 1E2JA 1O3YA 5TARA 1A1VA 1E4VA 1Q1ZA 2R6GA 2W2TA 4M1TA 3NC1C 3KXLA 2HYDA 3SYKA 2ATVA 3T1TA 2PEZA 3WXMA 2QE7A 2I4IA 4UNRA 3MJHA 5C18A 2O8DA 1T91A 2WZQA 2FEMA 2FG5A 1NI3A 1NVXQ 1NLZA 1NY5A 3E1SA 1G8PA 1KK2A 1TMKA 2NGRA 2X19A 4XVRA 1H8HD 5J4KA 4DKXA 1UKEA 2REBA 3BD9A 2YWGA 4Q21A 1Z6TA 5AUQA 3ASZA 2RAPA 2WKPA 4LV6A 1GUAA 1EGAA 3R9IA 2ZRNA 3HPRA 1ZCBA 3DZDA 1KSGA 1J70A 1QRAA 3EA0A 5C1BA 4EPWA 1NJGA 2GXAA 1GP2A 4TSFD 4ARZB 1T3LA 3RRNA 5J4HA 1OXXK 3NWJA 2DPXA 1OYWA 4B32A 3CKLA 2JASA 1VYTA 1NBME 4FIDA 4RZ3A 1JQLB 5AWFC 3TVDA 3R7WA 2UZ3A 4JLNA 3W90A 4QM6A 521PA 4LC1A 2YYZA 4AKIA 2FX3A 1SVWA 2J9RA 3B9PA 1XZQA 2H18A 3LWNA 4LDJA 5A4JA 2ZANA 3ZH9B 1S1MA 1OFUX 3ADDA 1G64A 4MRSA 5B58C 1MO5A 1IY0A 2X2EA 3NIBA 4OHXA 4LYFA 2IC5A 2PX3A 5JSZA 2ZE5A 4NHOA 3MAAC 2VEDA 5EUMA 1P2UA 1AZSC 1P5ZB 5SZIA 3TK1A 2ZITA 4QOSA 3I72A 4L15A 1KI9A 2ZRKA 1GKUB 1UDXA 4F92B 1E9SA 1ODFA 2QORA 2ZREA 4EPVA 2VF7A 1ZNWA 2QRZA 2OBNA 4BFTA 3FFBA 3LW8A 4O3MA 5M04A 4BRUA 1Z8FA 2O8FA 3GCGA 3AF4A 2P0EA 3QPWA 3GPLA 4NKRA 4D80A 1M34E 3A36A 3PUZA 1G9XA 3ZVLA 4WA7A 1SXJA 1W5SA 1HY3A 4L8GA 5IRCD 2VP0A 3KQNA 2GZDA 1GL9B 3KFXA 4QKQA 4DLTA 2O0HA 4MGZR 2P5SA 4XSHA 3THXB 2ZI7A 4M1MA 5LB2A 1XPRA 3TQFA 3KX2A 1FNMA 1EESA 2C96A 4D4JA 2QGNA 3CPJB 3VU9A 2G1KA 5AUNB 2GBLC 4NCIA 3A1VA 4Q03A 1OKKD 1YZQA 1U9IC 4YMSA 3DOFA 3RS2A 2E87A 3I62A 4MH0R 2IF0A 1VIAA 5EUQB 5KPDA 3AVYA 5EXXA 3HP1A 4PPNA 1IN8A 4QBHA 3SC3A 1UBCA 3QJYA 2ZJOA 3D31A 1GRNA 4K46A 5FBWB 4P3YA 2CHGA 3FVQA 2A5FA 3FPAA 4IFBA 1FQJA 2EWWA 3Q3JB 5CITA 1J99A 2QY9A 2P6NA 4DCUA 1KO8A 3W5JA 2Z4SA 4MGIR 1E2LA 1MOZA 1W36D 2IYRA 2WV9A 3BC1A 3BJIC 4CW7A 1KK0A 1TAGA 4KHZA 4RY2A 1E79D 1XMIA 3QXCA 2WJGA 5KTYA 3WYGA 3WBKA 1XU4A 2B92A 5LBIA 4IJMA 3IBGA 4ESHA 3IPXA 4JLPA 2Z43A 5E7IA 3LQRA 4B3DA 2A5JA 2J5XA 2X77A 2QM7A 2F1JA 2C9CA 1VG9B 4HSEA 5EZ6B 3K0CC 2IUTA 1PLLA 4R2IA 2ZSAA 1QF9A 4EAQA 3THYB 4XVQA 3W9YA 4BPBA 1W4RA 5EP4A 3T61A 4DLVA 4C2UA 2OBLA 1T3SA 2JLUA 4DXAA 4TMZA 4EPXA 2P3SA 4Q18A 4TN1A 2CCKA 1QHNA 1ZD8A 3NBFA 1Z08A 2BIFA 1NVVR 2ZE8A 4HZUA 4BUJA 5L8VA 3LFUA 3V4FA 5FBLB 2ZUBA 2O0JA 4OQFA 3R20A 1WF3A 3UPUA 3N2IA 3K09A 1AN0A 3GD7A 3EC2A 4JBYA 2NQ2C 2H7VA 3UMRA 4H1UA 1OLOA 4LK2A 1YZUA 4YDSA 1EFTA 1VCOA 2ZR0A 4TLCA 2F1HA 4IOMA 3P26A 4LJ5A 3W8NA 1GKIA 2J7PD 1UKZA 2J7KA 2RKOA 1RJ9A 1EK0A 3ZVRA 4LWZA 2ZROA 2AXNA 3DM5A 2FZ4A 2REOA 4HLUC 4P4TA 5L3SA 1NG9A 2ZETA 4TYWA 4GP6A 3AVPA 1N0WA 1XTSA 5JCPA 1DAGA 1N5JA 1GL7A 4TL6A 1VHTA 4XH9B 2RCNA 2HJVA 1E9DA 1IN7A 1L4YA 2RGNC 2W6JD 3AF1A 3H4MA 3EXAA 5EE3A 2ORVA 3TGPA 2I1QA 1CR4A 1OXVA 2AK3A 3RS5A 4DLSA 3CPEA 3OIVA 1K5DA 1VKJA 2UVQA 4JLAA 2JGNA 3DVLA 1XEXA 2GZHA 1Z6AA 5D3MB 4EJSC 2WOJA 3UIEA 4IEEA 5CYOA 2VL7A 5BYJA 3CNNA 2P2LA 3BOSA 3QOFA 4PR0A 1ZW6A 5E3HA 1XCMA 4NYIR 1YZKA 2H5EA 1SVOA 2D06A 4D81A 4US1R 2WBLC 4G3XA 2F43A 4DC9A 3EA5A 1GWNA 2WSMA 4AC9A 5P21A 3GJ8A 5J4LA 4C0AC 4BFWA 3HU2A 2VTKA 1NVVQ 1TL7C 4JJKA 4PC1A 2OESA 3GEIA 5FOVA 2FSFA 5A0FA 5HKKD 3BH0A 4URVR 2W6IA 4C0BA 1BOFA 3UK6A 2GXSA 5H70A 4X8LA 3IKJA 1DO2A 1F2UB 1Z47A 4LYAA 4EJSA 5FPYA 2A2ZA 1YJ5A 3SYNA 4FD2A 3FMFA 3I8SA 4LJ7A 4DSNA 4DLUA 1JECA 4URUR 1HA3A 2A78A 1K6MA 2GEVA 4LJAA 3S1AA 1X8LA 2J59A 4ERNA 3EZ7A 4RD4A 2D7CA 3C8UA 3TKLA 1OHHD 1JR6A 1Z0AA 1KIMA 3RC8A 3QY0A 2IA5A 3CPHA 2ZRAA 2DFNA 2JLVA 1DVRA 1ANKA 3M0EA 4WZ6A 3CRW1 1BYIA 1NN1A 2Q3FA 4G5QA 5CB6A 3U4QA 2NIPA 4YLGA 4H9GA 1DOAA 1UEJA 5FFMA 1OV4A 1W46A 2ZM5A 4NZYA 4FN5A 2O8CB 4MQBA 3AGQA 1CJUC 4PPGA 5BW8A 4KV9A 1DG3A 1G7CA 3NH6A 4RCYA 1OF1A 2RHDA 1BKDR 1TF2A 2C03A 2YV5A 1ZBDA 2CL6X 5TV2A 3THWB 1GIAA 2FN4A 2XOKD 4JLJA 1AQUA 2YC4C 4PZLA 4NYIQ 2OM2A 2WKQA 3B1ZA 4PHGA 5E95A 2FA9A 3SJBA 4EFMA 1I4DD 4IVQA 3OAAD 4KLNA 1KI2A 3VR3A 5JHHB 1SVIA 3HDTA 1S96A 3RAPR 3GLGE 1P75A 2RB4A 4N1AA 5FOXA 3K0AB 4OHVA 2JCSA 1X1SA 2QPOA 3LBNA 2J0UA 4NCNA 1OIXA 4B2IA 3B2EA 4XTRA 3FDIA 3T06B 5KDLA 3UATA 3A1TA 4DLZA 3ND9A 2ZRBA 4MUAA 2IS2A 621PA 1EFRA 4C0LA 1JI0A 3ZS9A 2BBWA 4MDFA 4C9BA 1OH5A 1SULA 3I3SR 1CBUA 3CB4A 1PLKA 4ACBA 1U0JA 1SKQA 1Q1BA 1AIPA 2CL0X 2J0VA 1G6HA 2PMDA 1FUUA 2CVFA 3AF0A 4C30A 5KOYA 4AKGA 3LBIA 2JA1A 4ZDJA 1S4QA 3BB3A 1DAMA 3K53A 1L7VC 1N3BA 4B74A 3RWOA 2QA5A 3TH5A 2VF8A 1R6BX 2XSZD 2C98A 1CRQA 1JPJA 3I73A 4UXIA 4XOIA 4DHEA 3PFIA 4M2LA 5G3YA 1DADA 4GP7A 4C7OA 4JBWA 4TMWA 4HUTA 1T6NA 1C1YA 3LBHA 3UXMA 1LW7A 2IS4A 4L9SA 1ESMA 5FPHA 3IIKA 1G3MA 3G0HA 3QKSA 3VR2A 3FMIA 3T1OA 5EXSA 4CEIB 1BIFA 3CR8A 1LV7A 2O8BA 3BS4A 4XWOA 1A4RA 1H8HA 1FPMA 4FMDB 4UJ3A 3IQXA 2ZYTX 2GVZC 2MSDB 2W0MA 3PG5A 1E4YA 3K70D 3WP1B 3DMDA 2ASEA 2QBYA 4AG5A 2RGDA 3LQQA 1UDWA 2QAGA 4IW3B 2VP2A 4Q1EA 2O8EB 2OV2A 4GZLA 4OQXA 4TSFA 1AM4D 1DAEA 1HQCA 1K5GA 2W00A 1ONBA 3LV8A 4LJ9A 4RFSB 1GFIA 3CM0A 5AJWA 4A8JC 5LDDC 1E2MA 1BH2A 2VQSA 1DS6A 1YQTA 4QGGA 4FXPA 5JRZA 4JKYA 5J40A 2W2XA 2WAYA 1L8QA 1VG1A 5FTNA 3ZDQA 2QP9X 1Q21A 2O5VA 5AJXA 3TQCA 3PEVA 4U00A 3W8RA 2IYQA 2REXB 3Q5EA 4TLAA 4NPHA 2GF9A 4NL4H 1AKEA 3P27A 3AP2A 4NU0A 3SDZA 4K8OA 4HUQA 1QHHA 4DSUA 5JLJA 3REGA 2V1UA 3NTUA 2H57A 1D6JA 3VTKA 3QG5A 4CGZA 3GLHA 3QF7A 4BFVA 3AKYA 2IEYA 3RNLA 1E2IA 4KVAA 4Q1CA 3Q7QA 4A9AA 2LKCA 4ZDWA 1EFUA 2B21A 2NO7A 2DBYA 4F7WA 3ZQ6A 1H8ED 2QMEA 4Z8XA 2ZS8A 2ZVPX 3MWKA 4G5OA 1OB2A 1WRBA 3N2EA 4RSGA 4B71A 3CWZA 2OAP1 1Q1QA 1XXHE 1JJVA 1RRPA 4WXPA 6Q21A 1Q3TA 3CBQA 3CONA 1QBKC 2D3WA 2YC2C 3X1XA 4HDCA 4QJ3A 2CE2X 3OFND 4W5HA 5FTKA 1KK3A 4LYJA 3KJHA 1ZM7A 4QL3A 2XJ9A 3CX6A 5HCNA 2J1LA 1PLJA 5FI1B 3DKPA 2QTHA 4NYJR 5B2ZA 4ACAA 3C4JA 4OBEA 4JIMA 5DISB 5C4MA 2CLDX 4Z1MD 1QHXA 5F2EA 4EKDA 4DCTA 4OK3A 1OKKA 1C9KA 3QBVA 2PLFA 4W9MC 3KUDA 1NNEA 1WA5A 1UJ2A 1TX4B 1G3IA 1HE1C 2GAAA 5TXGA 3FMPB 1ZIOA 1F3OA 2PEYA 4Z51A 3R9XA 2JDID 1R0XA 2KWIA 2HCJB 2Z4RA 4X8MA 5KUTA 5HTKA 4EQ6A 4TMXA 1KAOA 4P33A 4IRUB 4DJTA 2Q9BA 4E03A 4V0NA 1G19A 1N6LA 2D4HA 3I8XA 5FBRB 2ONKA 1P6XA 1XRJA 1G7TA 4A1FA 1KO4A 1XB2A 1E79A 2ZE7A 4MYCA 3TRFA 1G5PA 3PUWA 3U3OA 3TR5A 5CM9C 1E9RA 4BLQA 3A1UA 5JJLA 1S9DA 4J0QA 5DYIA 2PZFA 3EPLA 4M4SA 1E2QA 4D4LA 1KKMA 4BGDA 3A1WA 3KQUA 4Q4HA 3GFPA 1TQDA 1SHKA 4M53A 4TMKA 3KKOA 4WZAE 4HLQB 2HYIC 4V02A 2HT6A 2J0SA 2ZRPA 1LF0A 4V0MA 1N5LA 2EWVA 3DOEA 5KYKA 2RH5A 1HTWA 3QSYA 2IS1A 4DZZA 2JATA 4RD2A 4CVNA 4RCZA 5FL7D 1G8HA 1EX7A 1XP8A 4DB2A 5JWOA 1D8TA 2CHVA 2ZAOA 2HXYA 1E0SA 2XXAA 3BH6A 4NYJQ 3E2IA 1G291 1RFLA 2QU8A 1RZ3A 3EW9A 3AGPA 1QVAA 4I99A 3AP3A 3AP1A 4JZKA 3VQTA 3WP0A 3AVVA 4NTZA 2Q3HA 1Z6YA 3QKRB 2V8OA 4DT1A 2KJQA 4B34A 1CRPA 1CXZA 4BFSA 4ZDKA 1KJYA 4TYPA 3V9PA 2ZRIA 4EPYA 3UANA 3GLFA 2XZOA 3QXHA 2J7PA 4JJZA 2FJUA 3BB4A 4A8JB 2YOFA 2QT0A 3SFVA 3RRZA 4JT4A 2SHKA 3KTAA 1XXHB 3CF6R 3QKTA 4GPTA 4IDNA 4JYBA 4QNRA 1TUIA 2JLZA 4M1KA 2ZRCA 3VMFA 3FTQA 2ODWA 3A37A 2HF8A 2EFEB 2W6JA 4Q9LA 4AIIA 1KOFA 2Q9CA 4A6XA 1A82A 1GM5A 2ZRHA 3HWSA 3LXRA 4Q9HA 1E2FA 1F2TB 2G0NA 4ON9A 2G9NA 1FW6A 3K0SA 5DO9A 4G0NA 4FINA 3RWMB 2QSZA 4M1SA 4Q7LA 5AJZA 4Z8YA 3WNDA 4US2R 2ZXUA 3ZIAD 4DIDA 3QXXA 5F9FA 4B3GA 3K0FA 3ZGXA 2XNDD 5F3WB 3B60A 1CEEA 1X86B 2G1JA 2WAXA 1NL3A 3OEED 1D5CA 4HB0A 4IHQA 3RANA 3NEYA 3BFKA 3TNFA 2MSCB 3GJ5A 4PAOA 3LRPA 1DELA 5HKKA 4PQFA 3PUXA 1II9A 2V54A 5FUWA 2ZRLA 4AG6A 3KKNA 4LZZA 1KO1A 3TR0A 3WMFA 1XTJA 3TUJC 3IEUA 1FOEB 2VO1A 1YZTA 3X1WA 2A3RA 2PT7A 2AKYA 1JB1A 2JLXA 1W2GA 1OHHA 3SU8A 2ZI5A 3RS0A 1N5KA 2GCOB 3RHFA 3TSOA 3R9WA 2VHUA 1G5RA 2TMKA 3PITA 2GK6A 3QG1A 1SHZA 1AGPA 1Z0KA 2OLKA 5TVKA 2QTFA 3WHLA 1E94E 1JEEA 1I2DA 2GJKA 2EVWX 2IYWA 1WQ1R 3T1QA 4DIEA 2IWRA 3Q5DA 2AR7A 5LPNA 1TU3A 1RIFA 3NC0C 2IHBA 3I32A 4I1SA 1E0JA 1ZAKA 5DH9A 5EE9A 5BN3A 1VYUA 2ANCA 4NP6A 2FFBA 1XJCA 3H86A 4I4LA 4QNMA 3VR5A 3CLVA 4EPTA 5CLQA 4DLWA 1M74A 3TVTA 3TUIC 1S0UA 4UKDA 4A0HA 2XOKA 3QI2A 4KITB 3L82B 1N6IA 2RHMA 3MWYW 4AYTA 2YWFA 4ASUD 2D7DA 3QE0A 3OAAA 3A6PC 2WWYA 3FMOB 4KVGA 4ZV4A 1NBMA 1PZNA 1SXJC 1E0KA 5CIQA 1XTIA 4YONB 1J90A 1XD2A 2B6HA 3ICEA 1XDBA 1JAHA 1E3MA 4URYR 4E22A 1G8GA 4B2PA 4C0HA 5DLQC 1NJFA 3TBKA 4F4CA 4B2LA 4MKFA 2R65A 3B7GA 4XSGA 3FGNA 1NVWQ 3PUYA 1LNZA 4O25A 1QG4A 2FEOA 2HV8A 4AI6A 1CIPA 3C14C 3OZXA 2FV8A 2JJ1D 4KFTA 2ECKA 3CW2A 1YZGA 4QBIA 1R2QA 2ORWA 4Q4JB 3RS3A 1DG1G 4XJXA 2F1RA 4LCBA 3RVBA 1KNXA 1ZNZA 1E2GA 5IT5A 2FOLA 4PAQA 1G6OA 1KNQA 2CJWB 2NOAA 2B7BA 2XSZA 5JBQA 1RYFA 5TB5A 4DBLC 3NHAA 3KFVA 4OHYA 2F6RA 3FKSD 2Q6TA 2J3EA 3GJ3A 1NIPA 4KFSA 2WWFA 4B3XA 3U6KA 2QP4A 4I1VA 4OK6A 2WKRA 1KSHA 3BGWA 2QNRA 1R5NA 2KB0A 4B73A 1QHSA 3GJXC 1UF9A 1R0WA 1P62B 2J0QA 2D2EA 4HYYA 2NPIA 4QHYA 3TLXA 1OFTA 1Q44A 5CK4A 4TT3A 4TLBA 5EQTA 2L0XA 1ZUIA 4V03A 3SS8A 1XCGB 3Q9LA 4LOAA 2F3TA 1GKYA 2ZR9A 4JLVA 3NDBB 1EXMA 1MO4A 4IXNA 4NBSA 2GAOA 3BH7A 2RGCA 3T5DA 1YR6A 3UKDA 2BMEA 1OXUA 1W4CA 1X3SA 3OE7D 2OZEA 3ZS8A 1U81A 1HUQA 1VIYA 1N6OA 4CIDA 1OT3A 1Z0DA 4A2WA 1ZJ6A 4JT2A 2C04A 4RD1A 4BEJA 3ZZTA 3ZVMA 2O8DB 1KDTA 3Q85A 5E7MA 5DHFA 5TMPA 3SZRA 3VKWA 1U8ZA 3K09C 3O8BA 1FL9A 2WM9B 4I1UA 4OJQA 4XIGS 3PVSA 1XPOA 3QUSA 1ZD1A 2YWHA 4JVNA 4DUGD 5AUPB 4EDHA 2K5UA 4URWR 4ZCIA 1KI4A 4PHTA 3UG7A 1PUIA 1R8QA 2VA8A 3CNLA 3IDQA 1KZ7B 4KCGA 4AK9A 1R8SA 4F93B 1IHUA 2A5DA 4PSVA 2O0KA 5HZKA 3TMKA 1TQ2A 4F38A 3KKMA 1H8EA 2BV3A 3R7WB 1KKLA 1YZLA 2PT5A 3QNUA 4Q7MB 3NEJA 4TWZA 4FWIB 4DDWA 2ZU6A 5IHPA 2IYXA 5C46F 1ZIPA 4TL8A 3LD9A 2KBFA 3K8YA 4CEHA 3UMSA 3CRVA 3OFNA 2R6DA 3CIOA 4QXAA 4RZ2A 4DDVA 2XB2A 2OHFA 3QEJA 3ADBA 1LFDB 1CU1A 5L3QA 1UEIA 5JSZB 3IEVA 1OPXA 4B33A 5AR1A 3AF2A 2VH5R 1II8A 4LJYA 1W48A 4DLYA 1S1CA 1MABA 3U3KA 2QT1A 4BFZA 2IEZA 4Z1MA 3SR0A 4LSGA 4BZXA 5EXTA 5JZVA 2W58A 1JBKA 3AVOA 4OHWA 3U44A 3G5UA 2BBSA 2O8FB 1Q57A 3A1SA 2ZU0C 4LHYA 4A0RA 3FB4A 3CX7A 3Q7PA 2JDIA 1ZM3A 4U5XA 3F0TA 4G01B 2C8VA 4D82A 1SXJB 3LLMA 3DM9B 3TIFA 4F4IA 1OIVA 2D2FA 3L8YA 4LBVA 2BHRA 2ZYVX 3FOZA 2ERYA 4RVCA 5HE9A 2Q0HA 2GNOA 2E9SA 3ZVNA 2ZI3A 4HAVA 4CZ2A 1ZMXA 1IY1A 1KI6A 5JWRA 1U2RA 4YMVA 2WMOB 3CX8A 2KBEA 4PSAA 1WBBA 3L0PA 1A2KC 4PC3A 3GEEA 1G41A 2PCJA 4TZ0A 1HEIA 1QVRA 2BEJA 3I5XA 4E09A 1YR9A 3TAHA 1I4TD 2XITA 2CNWD 3LW7A 2FGKA 2OXCA 2KI5A 3EC1A 4BLOA 4NCKA 1IOZA 4MYTA 5LB4A 1XTRA 2DFTA 3MD0A 4GMDA 4JVLA 3TSZA 4IKEA 2QEQA 4BFYA 2PBRA 5FL7A 3L0OA 3GJ7A 4DLXA 4CEIA 2Q9AA 2PLRA 4NYMR 1N6KA 2ZSBA 2CCGA 3BRWD 4O2LA 3W34A 4M8NE 2YZ2A 2IUSA 1EX6A 1XMSA 2C9OA 2GILA 2FH5B 3CUEF 2C2HA 1FX0A 1P3JA 2WICA 2ZE6A 3I92A 2ZI4A 4ESVA 1A2BA 3LDAA 3THOA 3PEWA 5J5CA 1T9HA 4MITA 3AUYA 3SJCA 1FMLA 1CKEA 2LKDA 3AKCA 5KSPA 4GSYA 1D9XA 1SKYB 4OK5A 5DGXA 3WNCA 1B23P 1Z0IA 5FPSA 5CDFA 2VSOA 4B48A 4KXFB 2F7SA 4HATA 3QIAA 3WYAA 4ITRC 3O8RA 1NKSA 2ZIAA 3PJRA 4UJ5A 2PL3A 3WBJA 1JNYA 4XVUA 3CR7A 2FFAA 3GQBA 2IYLD 2FSGA 1G3UA 4B3FX 4HEJA 3AQ4A 2VHTA 3L8ZA 4QBFA 1T4GA 4HZUB 4RZUA 4B47A 2DFKB 2ZJ8A 4PO1A 1M2OB 2NO1A 2WWXA 4WIAA 4CT5A 5UKDA 3K9NA 2J87A 4QBGB 3DEFA 1SVMA 2DR3A 1BMFD 4IOKA 5BYKA 2LWIA 1NBMD 4OL0A 1SVKA 5EE1A 1ZC4A 4HAWA 4JMPA 4C0JA 1TF5A 3SQXA 3B1VA 4LPKA 4WVFA 4AWXA 5JEDA 1I2MA 2FWRA 1UBEA 2OFWA 3ZIAA 5AJVB 3M4YA 3BFXA 2DCUA 4DCNA 5B64A 1G3RA 1RJ9B 5GJWC 4X8HA 8OHMA 2YHSA 1NSFA 5LD2C 3W6OA 3WY9A 1M7BA 2VSXA 2XNDA 2Z5FA 3OIWA 5L3SB 3UMFA 1E1QD 3DHWC 1T8UA 3BAFA 3GLGA 3KB1A 5JI2E 3OEEA 1LVGA 4NYMQ 2QSYA 2JLRA 1IQPA 3B78A 3P4XA 4NONA 1GNRA 1Q12A 4OI0A 3A4NA 3A58B 3X1YA 4JVMA 4LY6A 1VTKA 4IXMA 3ZZ0A 3I4LA 5HCIA 3I5YA 1GNPA 1KY2A 2A7QA 3EG5A 4M9ZA 2BM0A 1XNJA 2QAGC 5KDDA 2GCNA 1N5IA 1XEXB 1WE2A 1ZU4A 2OXRA 1VG0B 2W2VA 4DSTA 2ZRGA 1GG2A 3LAWA 5GJCA 5EE5B 2RGBA 2CLSA 2MMGA 2OSBA 3K9LA 3KB2A 3ZJYA 2F43B 4GT1A 1E6CA 1G21E 4QJ4A 2P5TB 2I1VB 1P2VA 1DAHA 1GOTA 2CE7A 5AK0A 5DN6A 2RGGA 2EU8A 4LJ4A 2GK7A 4TT3D 2OG2A 1W4BA 4II7A 1JXMA 4C0SA 1XCPA 1W1WA 4Q4AA 2OBMA 2F1IA 4Q5IA 221PA 4DCVA 1XWIA 2YKGA 1CLUA 2HJGA 4A6PA 4EJSB 1KJWA 1E69A 2C78A 2ZJYA 2ZRMA 4L4UA 4CEJA 1IJFA 4B76A 2C99A 3TJZA 4XWAA 2OCBA 2GCPA 4OYHA 1E2DA 1KO7A 3F8TA 1L4UA 1XZPA 2B8WA 2Z83A 1KSFX 1P61B 3S1AB 3SBEA 4M21A 2IK8A 2VBCA 3RS4A 4AKEA 2RMKA 3LX8A 2AWOA 1OH6A 1KMHA 2WJYA 2AL7A 4LV5B 4ASUA 2XAUA 4W7SA 4QRHA 1G3QA 2ATXA 2GWHA 2ZSEA 3P20A 4KFRA 1JR3E 2OCAA 1O87A 2V9PA 4LC0A 3U4QB 3DKVA 3P1JA 3GLIA 4RZXA 2ONJA 1SVSA 4G5RA 4AD8A 2G83A 4DVGA 5KO2A 1H65A 1J8MF 5JRJA 3EZ6A 4RKEA 4TL9A 4PHFA 5GJVC 3HU3A 1S9HA 4W5JA 4LUCA 1M1YE 1AKYA 4WW0A 1L2TA 3P4YA 2ODNA 3L2OB 4Q4LA 2P6RA 2JJ1A 3NXSA 1E9BA 4XWKA 1GSIA 2DB3A 2V7QD 2OCPA 1IXSB 4PC7A 1KJZA 5CM8B 4ZIRA 3NBXX 1KGDA 5KHOC 4P4UA 4HAUA 1MV5A 4Q9JA 1SZPA 4IDHA 1E32A 1NN0A 3FE2A 4N0EA 2ZJAA 4TTPA 2XB4A 1XPUA 4UNNA 3KQLA 3W6NA 2CL7X 2N42A 1G7RA 1S3GA 3VFDA 3QF4A 2Q3MA 2VYFA 1N6PA 4BLSA 4Q1FA 2J0UB 2IL1A 2WIBA 3U7HB 1W0JD 4NE2A 5FPKA 2H92A 1OYYA 2BCGY 3OIUA 1HV8A 5HE8A 5FTLA 1W36C 3FKSA 3C16C 4PSKA 4TMTA 1R4AA 5DE3A 2EFCB 1U99A 3U60B 1TNDA 3KQKA 2BOVA 4PANA 2JIZD 4MKIA 2IX3A 1V43A 1NKTA 1KZGB 1VCMA 3QVVA 2HCBA 3OIYA 1E9EA 2GJAA 1ZM9A 1Z3IX 4LRWA 3F3YA 3CRRA 4IDOA 4M1OA 1N2CE 2AKAB 2R6AA 4DDTA 1G5TA 3MSXA 1LS6A 4TLDA 4QM7A 4FW9A 2WIAA 2WJJA 2IXGA 3IIMA 4KODA 5JS7A 1P4SA 1RE0A 4FI3C 4DSOA 4C7OB 2GA8A 3DMNA 3CF0A 2CHQA 4UNPA 1CJVC 3WRXC 3OE7A 4GMXA 4QG7A 4E07A 3AF3A 3FFAA 4FMCF 5G3ZA 1DAFA 1CTQA 3QKSB 1ZYUA 1DBSA 1II0A 4JLOA 1XJ0A 5KNCA 4C3ZA 2FU5C 4MRVA 2BMDA 2NO0A 3DO6A 2KE5A 821PA 3EX7C 2O8BB 3AVQA 3T12A 4YMUA 1E2PA 1VCNA 1COWD 2ZSDA 1GVNB 4P4SA 5DI3A 2QBYB 3AVXA 4OI2A 2QAGB 4DUGA 3C5HA 3EARA 4RD0A 3VKGA 1EWQA 4Q9KA 2DHRA 2BWJA 2BM1A 4V0ME 4D26A 3SI7A 3JZMA 3B5JA 3KXIA 5BWMA 5EP2A 4YC7A 2WWIA 3O8DA 2AX4A 2JJ2D 1RVDA 3B85A 3TW8B 1JJ7A 1W7AA 1OH7A 1WDTA 2XJ4A 1D2EA 3DL0A 3WNBA 1EG7A 4OHZA 3CF2A 3L0SA 4BZQA 2QTVB 1T5LA 3K1JA 2OCYC 1TPZA 2N46A 4POAA 3T5GA 2NMVA 1D9ZA 1W0KD 1UAAA 1M7HA 5SZJA 4C2TA 4ARZA 1U0LA 3RYTC 4RJLA 1B0UA 1G7SA 5CJPA 3ASYA 1U0HC 3CZQA 2WJHA 2BCJQ 4C4PA 2NZJA 1QHHB 1KHTA 2XTMA 4LGMA 3GLHB 1S8FA 5K8UA 4BEBA 3RC3A 1BYUA 2ZRFA 2WTUA 4NCHA 3R8FA 3I61A 1CS4C 4Q1AA 2ZJZA 3P32A 2ORIA 3PENA 3EPHA 1FTSA 2ZJBA 4Q1DA 5FH9A 1US8B 4ZDIA 1CR2A 2ZUDA 2OAQ1 2GVDC 4FMDF 2CVHA 3K0EA 3ONWA 3GMTA 4P0TA 4PX9A 2CK3D 1UFQA 3HYTA 4MYHA 2PZEA 3B1WA 3T15A 5A5GA 4AYXA 1KSJA 2G6BA 3H1TA 2VP6A 3RS7A 5DI9A 1Z6GA 1HYQA 1MO6A 2GKSA 1QHGA 5CLLA 5EZ5A 5FPTA 3KQHA 2QPAA 2HEIA 3RDPA 1NN3A 1DO0A 2EFGA 1FTNA 3CRQA 3IO5A 3O47A 5SZKB 2J41A 4BZPA 3D3QA 4A82A 5KDOA 3QPVA 4FWTA 1RRFA 1EWRA 4Y0VA 3CWQA 1KO5A 1P72A 3EZ2A 4LHVA 4L5BA 1G20E 3C41J 3IIJA 5IK2D 2V6JA 4HB3A 1WB9A 3VKHA 4BFUA 2CJWA 2WWWA 2ZQ5A 2ZVQX 3LLUA 2A5YB 1GTVA 1VMAA 2FNAA 2GRJA 5JJKA 3N70A 1MT0A
chains in the Genus database with same CATH superfamily
3FWKA 1FE8A 1PDWA 2JGFA 4LHZA 2G77B 5DWQA 4EB8A 4YMTA 3JXEA 3L84A 3THXA 4YR9A 2HQSA 2IU0A 5A4AA 1G59A 4MS1B 1ULHA 5KTTA 8AT1A 2N3ZA 3QUAA 5CFZA 5D85A 4TLLB 1G63A 1ZD2P 3BWBA 2G8LA 2NUBA 3ASVA 2KSQA 3HDHA 5A71A 4C14A 5JROA 1W36B 1QC5B 4H7DA 5IAEA 2XE4A 4DCJA 4I9FA 4DEVA 1Q20A 2AFIE 4ESOA 3C15C 3MVEA 4WFJA 4MS3A 1R6VA 5CHYA 4O4IA 3FBWA 4BECA 4ZJUA 1CDDA 3LOQA 4J49A 4MVJH 3SZGA 4MVJP 1EUQA 4RK7A 3P0IA 5FPPA 1WX1A 5CEFA 3HJBA 2JEOA 1DCMA 1I8TA 4CTOA 3S44A 3K15A 4A5SA 3RBAA 3SNHA 3G0CA 3UMGA 5FV4A 3ZGNA 4DA6A 1D2RA 3MG9A 5DN6D 1HG1A 1VHQA 4O2AF 4G5HA 2ALJA 1Z4OA 2CXQA 5K8LA 4Q7EA 3AFHA 1MRNA 4GOJA 1EEHA 1V1RA 4K9MA 4X54A 3WLJA 1QZXA 2CMKA 4MO2A 1THTA 1RYHA 2UZIR 2V7XA 3LFHA 3MAJA 2YJ3A 2ZI9A 4K6FA 2P3LA 5DIFA 3IDAA 4BKRA 1PZEA 2B5OA 3BKWA 3JRWA 2W90A 3HGMA 4C5CA 4DDHA 5I5EA 3DL7A 4LAFA 4UDNA 3LUJA 1SUFA 3PKJA 4UUNA 3VISA 2FP3A 5CURA 5FOUA 4FT4A 4PCAA 3WYFA 3WGGA 5IX8A 1TXGA 3P0EA 2QRJA 1OU0A 3LA6A 3PL5A 2XXAB 4JXJA 3LPLA 1G16A 1IB6A 1XEWY 3HA7A 3QQ5A 4UASA 3H5AA 3KKPA 1IPFA 4PPFA 1PWZA 1OI7A 1SWVA 2GWRA 1CQWA 3F96A 1ZH8A 3T4PA 3T3GA 3W1EA 5FRDA 1TYAE 4IJWA 5FOTA 2BVNA 1MAHA 3PHJA 1LBTA 4M9QA 4JLDA 1MEOA 1OE0A 5EN4A 4ZVNA 1PBTA 3CE6A 4CMIA 1OH8A 2WOOA 4P08A 2AFVA 1IBRA 2APJA 3V4ZA 1IEVA 2QXYA 2ZIWB 5AH0A 3ZXUB 4Z9YA 4K9KA 1U5AA 2SNIE 4LYGA 4C1BA 1PFQA 2ANBA 5F7XA 4BBPA 1XZHA 5DBGA 4KSCA 2RJNA 1GKKA 1WV1A 1GEEA 3D3EA 1SQ5A 1ZW1A 3HYCA 3T9BA 3U62A 1FQKA 4HNTA 1DBQA 4A2QA 3FYTA 3KZVA 1SQGA 3BF7A 3PUVA 1Y48E 3E7DA 1T8TA 1AC5A 4MAMA 3NAQA 2BP7B 2FF7A 2QZSA 3TX2A 1Z0UA 4YJHB 4E0BA 1U0BB 2IW3A 1QONA 1FVFA 1J5XA 1IJBA 2R8ZA 1NRWA 3K70C 3LH5A 2ZAMA 1UBFA 3PQ6A 1UZAA 1J0DA 3FW1A 3LT0A 4WDQA 3SP1A 3VOAA 4FEGA 3ZWNA 1X6VA 4N47A 4YJGA 3QLVA 4DG8A 3QKUA 2QG6A 1OIWA 1ECLA 2EP7A 4QLBA 1SZCA 3NBMA 2FPSA 3HP7A 5ESXA 1KY3A 2VDRB 4WK6A 2WT4A 5IBRA 1E1RD 5AW7A 4YXWD 1P31A 2DRIA 2WM2A 2XEXA 5IKMA 3UKOA 1QZUA 2IU6A 3P5BA 4R0VA 3VJMA 4EY3A 1VDZA 1BX3A 1EDZA 4PGGA 3JQAB 3R5XA 4TKLA 1UBMS 4FTWA 3TEFA 4YTEA 1N92A 3QEMB 4PZ0A 4R5MA 5I4BA 2PX8A 1JMKC 2B3DA 4WXEA 3VHLB 1FNBA 3F67A 2V6MA 2Y8EA 4KBGA 1N34B 3MINA 1T3TA 4UD2A 5FI5A 3SHFA 4KO3S 5IVDA 1N4AA 4GLOA 1WPGA 3TE6A 3UWOA 5JVDA 4BNHA 5D3MA 3UOGA 1LY1A 3EBLA 3GOQA 4FZRA 4L73A 1IBCA 4B45A 2ET6A 2IPLA 2EERA 5EE0A 4FUTA 1JJFA 3EOBI 5HJ5A 4HAYA 4V2IA 3LZ6A 4QYIB 3W5AA 4LBZA 1KI7A 1R0LA 1D2MA 1P4GA 2XCQA 1UC4B 2QRQA 5B2FA 4IXDA 5LQSA 1GILA 4Z7JA 3VR4A 1YC2A 4M0KA 1QQBA 1U2GC 1OSNA 2QMQA 4K9DA 1FFHA 1ARZA 1WZ2A 3IP7A 1G18A 1R8XA 5HM6A 1Z28A 1JFSA 4U02A 3L43A 3NYIA 4TM7A 4PTLA 4MYSA 1AU9A 2Z8YA 3V32A 2R7NA 1P2SA 1UM9A 3GRFA 2QOEA 3ABIA 3JZAA 3M4JA 3P2EA 4YBZA 4NMXB 4F9GA 5DMXA 2XLBA 1P45A 3LDFA 3D0QA 3QEOA 5JC8A 3IVCA 4H18A 1K63A 1O97D 3KJGA 4ZT3A 2FPOA 4NJOA 2IPAB 4I4TB 3SEFA 4WLUA 1XF9A 4IF6A 4E94A 3CJQA 1VJRA 1XC7A 4TVSA 3NKVA 4PQRA 2OLJA 3K2QA 3OESA 2GZMA 1KI1A 4XWTA 3W4KA 1Y63A 3TOVA 4EFLA 4ZODA 1RQPA 4ZCMA 4LSWA 4KC0A 2GBLA 2LRHA 3OFJA 5CVJA 5EGNA 1U2GA 2QTLA 4XD7D 1OLSB 1PN3A 1U9IA 3D8SA 3U56A 4ZVOA 3RU3A 1AGYA 2IKQA 3OZGA 1GLGA 5AKGA 3PEYA 2V7QA 4LPSA 4M7WA 3M6UA 1WMEA 3A2KA 1E5VA 1M6VA 4IM7A 5JQGF 2XQJA 1CVRA 3F6PA 4YQZA 4TV9A 3PDHA 3UAVA 2QTZA 5H8WA 4QGAA 2WVHA 3VR1A 2BGKA 4EH1A 3EFOA 3KHSA 2UYQA 4UTOA 4I8DA 2QRVA 2OYSA 3GGPA 1E20A 4GW3A 1UPFA 5IMBA 3UQYS 4BQFA 2GPYA 4Q82A 2NO6A 4DYDA 4EMSA 4UBJA 3PL1A 1UMCB 4ZPXA 4B6PA 3ABZA 5AIAA 3JQFA 1AGRA 1FDRA 3MQFA 5HXAA 2FW8A 3JAKB 3EK2A 4MCIA 1VE9A 1DAIA 1VHLA 4D6XA 1ZVQA 5LZ7A 5EJGA 3MLAA 1P73A 2Y76A 1CZHA 2X0KA 1KQFA 2PKQP 4ZOCA 3N8NA 1EJBA 3ZD7A 3EVTA 3BK2A 2IXEA 2H4FA 2PXHA 3MGGA 2Z1NA 4B43A 1DAPA 1RC8A 3MK31 3S3TA 1N32B 3S2SA 3K0AA 5KQGA 1RLTA 2Q4OA 4INOA 4EFKA 5CT5A 2C2MA 2JJYA 1YKSA 4I5GA 2ZQZA 4X1IA 1OJLA 4ZO9A 4ZOEA 2I7CA 2R6CA 2B4QA 3JYHA 2YN2A 5A6SB 2Q5HA 1U7DA 3PXGA 5TVGA 3BE4A 2X2FA 5IF9A 1Q1EA 3DQZA 5SY9A 4CMEA 1GL6A 4MDEA 3NTQA 2AG0A 1W85B 1KKUA 4TTRA 4OJKA 3DBLA 2BRUC 3P97A 4ZYLA 3H5OA 3HYRA 3ADKA 1GEGA 4C0QC 1YCGA 4OAPA 3IILA 8LDHA 5K0SA 4MZDA 5BV0A 1DC3A 2LDBA 2ZJ6A 1XL0A 2BFNA 5J47A 2VF4X 2ZYWX 4NQRA 5FUXA 2G71A 4DAOA 4JLMA 1F60A 1O7JA 3AK4A 4LVNA 1L3CA 2H52A 2JI6A 3G9UA 2DYKA 2O5RA 3TTXA 4E1AA 1I7PA 3C6XA 3L0CA 1Q0UA 1E7YA 3AFMA 1NYLA 3DW3X 3OCJA 4G67A 4NX2A 4PHHA 2I8AA 5KYXA 4Y2YA 2BKEA 2Y1DA 3MPUA 5DCUA 5L6LB 1U9JA 3KUCA 3W3AA 4HLUA 5L7YA 1FP7A 4L28A 5T6MA 1XLWA 2YINC 4JLKA 3BSYA 5COQA 3WL7A 4C1NA 4H16A 3ND8A 2FPMA 4JSTA 1LB1B 3ZK9A 3ZW9A 9ATCA 2WILA 2CHFA 5B30A 4EGJA 1VC2A 3STYA 4CKEB 3WLSA 1ULZA 1Z63A 2QXUA 1KBZA 2HSWA 6ADHA 3PUIA 3ROMA 2FYTA 3IAS6 4JEIA 3K6SB 1I4EB 2FSIA 2V1XA 1Y34E 2V65A 5TJHA 1O5TA 2BUCA 1P6QA 1S7GA 3ESYA 3F2IA 1ZCZA 3I6MA 2CEAA 1HT0A 2COEA 1MX9A 3SHWA 3OPXA 3PDUA 4FR0A 3OPQA 3R7LA 1N6NA 2HA7A 2XOEA 3ZCSA 1NRJB 3OHMA 5C4GB 1H2YA 5J4VA 2O3TA 4BN0A 1PDOA 3G13A 4HN2A 5ICFA 3RW9A 5KU1A 3L4JA 1GGMA 3EVEA 2QX7A 4B5LA 1WXXA 1IATA 3CVJA 4P2GA 4RO0A 5KTOA 2IPOA 5CRIA 1GPJA 2GSWA 2WJ6A 4KRGA 1TIBA 4JX8A 3BQMB 2I65A 1USGA 2GJ9A 1VMIA 1NP3A 5IKOA 2GTPA 4EPRA 3SKXA 2O14A 5LJIA 2VJQA 1CERA 3TYXA 1BHQ1 1PAUA 2WUWE 2HUPA 2REQB 2ZYGA 3CNQS 3OQPA 1L1EA 2YCBA 3ONEA 1YR7A 1Z2CA 2EQBA 4UEQA 4X60A 5CXSA 3QV2A 4KIUA 5ALQA 2OZLB 1Y9AA 1NATA 4O4IF 2NAFA 3LIIA 3MFYA 1QV6A 3VI3B 3DMTC 5BSMA 4CUZA 5E6SA 3TIXB 3VU8A 5K3AA 3PEUA 1XBTA 2DZDA 4QFBA 2GD6A 4O8CA 5AUOB 4R1LA 3G85A 1NW3A 2I2BA 2C5BA 3GT7A 3MRSA 1CEXA 5I4CA 5L3QB 2XCRB 2DPYA 3C7TA 4XGIA 4TMYA 1C1DA 2B82A 5JE8A 3KOXA 3FKJA 4OX9B 3GCDA 4D4MA 5FUVA 3JWEA 1QG6A 4UE2A 2X6QA 1V2HE 4CLEA 1E2NA 2OORC 4ZMSA 2LIVA 4C76A 1BNCA 2HL6A 5ALZA 3RK4A 4E5UA 5JDCC 4IIFA 1XRNA 4TZ6A 1P1KA 1IVSA 5K0GA 2B20A 4ZXFA 1UXJA 3G2PA 4HJXA 1Z2AA 2BJWA 5DTEA 4BQPA 1JTEA 3DFKA 2YTZA 4INPA 1BE6A 1ZGBA 2G08A 2P1RA 2NTYC 3GUUA 5ESDA 4TVKA 3T7SA 1JHDA 5TS3A 2EEPA 2YOHA 4RFVA 3CLUC 3EIQA 4GP9A 2P9YA 1DE0A 3N87A 5FQOA 5D7BA 2QVXX 3USCS 2MYUA 1PR2A 2EW1A 3QVXA 4YECA 4DARA 4A2PA 2HWKA 4FEAA 3V1YA 1W34A 5HWSA 3CXRA 5A5VA 4ZVQA 3SBXA 1JP7A 1Z0SA 3DR5A 4MUKA 1WXFA 3ENQA 3HYNA 4IO1A 4FNOA 3VA7A 4GNKA 1KI6B 1U4SA 2PSHA 4X3PA 5JDIA 4BO4A 3ZU6A 2FSSA 4DLPA 2YWRA 2C58A 4MJLA 3SIWA 1W4AA 3IBFA 2F8LA 3LX5A 4FFMA 2J45A 2I6SA 3A4MA 5HZHA 5A4FS 1TJ4A 4KLZA 1HH4A 1G8AA 3H2KA 5EIOA 2SKDA 3FWHA 1ZGGA 4NEGA 2VJMA 2Q0QA 1JI3A 2GBFA 4D0SA 1FP2A 1K8RA 2JBAB 1A9ZA 3G0DA 4IUCS 1KEEB 1USVA 3AL0C 1Z22A 2BSAA 4MQEA 5ANRB 5H0IA 1NN5A 4HDRA 3ZWBA 3J7AC 2D7JA 2MIIA 3JW8A 4EX7A 4LDPA 3ORQA 1X7DA 3AZOA 1XA0A 1PFUA 4HNQA 3RK0A 1R0YA 4RHEA 1SHUX 1TEZA 1XX6A 5IH3A 2G63A 1V4NA 2C9MA 1L7DA 3WO0A 1KYQA 4ZI3A 5DM4A 3T9DA 5F3DA 4JBHA 1FX0B 4BE7B 1H1DA 5TT1A 4D8WA 3ETEA 2WSSA 4X8OA 1QP0A 5JT1A 3S55A 1DDIA 1IN4A 1YDMA 4C01A 1H2EA 3I23A 1DT3A 2R6FA 4I55A 4LWOA 5FT9A 4CF5A 2JLYA 2H00A 4LFAB 3EXIB 1RRCA 3P45A 2QN6A 3ICOA 5EHGA 4UNSA 4DDMA 1V5WA 4O4HA 1RRGA 1L8AA 4PIMA 2O2CA 5G40A 5JVDF 2I4LA 2W83A 4BFXA 1JVBA 3EXHC 1NFQA 3ECCA 1DX6A 1Z0FA 3H04A 1KDRA 2XRMA 4QEZA 3V2UA 1KA9H 4JYPA 2BMVA 3KSUA 4OQ4A 2XMQA 3A1EA 3EZXA 4L16A 1C3EA 1TUEA 4TYQA 1WD5A 1S2MA 1H9AA 3QVUA 5FUYA 1P7CA 4XCVA 1ECBA 3G0BA 5GAJA 5HIAA 1P9NA 1LPSA 3A28A 2N75A 4HNVA 1K7EB 4JHXA 1ZJ5A 4RPGA 3UHFA 4OYYA 1G8KA 4MVJD 2D3TA 721PA 1BRTA 3COSA 1V41E 4GPIB 3RVJA 4Y0AA 3OOWA 3TBHA 3OJOA 1N8TA 1ZNYA 1ZP6A 2B8NA 5BVGA 4LA4A 2HSJA 5EJEA 4YJ2A 1VE1A 4A8JA 2ARKA 4AZ0A 2ETXA 2KW5A 3IV7A 1TADA 3E5NA 1CNFA 1HGXA 1W44A 2FEXA 2WJIA 1USIA 1KJIA 1HDGO 1XXHA 3CZMA 3M6MD 4JZYA 1GQSA 1P3DA 4C22A 1KZ9A 1VGQA 3IPYA 5EJIA 1XMJA 1TF7A 1Y8QB 3AY6A 1XPJA 1NLYA 2PUVA 3LXMA 3R4CA 1Z6XA 3UM9A 4YK7A 4ZANA 3O8NA 4BWYA 1GPLA 4QIHA 2VZ0A 4O2AB 3ZGLA 1PP4A 1UM8A 1ZJJA 3BK7A 5JV5A 2QM8A 3R3ZA 4GVPA 2PBFA 4NU8X 2BZ0A 4WNAB 3T9EA 1AA9A 1FCJA 5TQVA 2LUOA 1Y82A 2E55A 1TFUA 4TV9F 3N2KB 5AOCA 3D5QA 3E84A 3MMPA 3RIYA 4MPDA 1XMQB 3TJRA 5GZ3A 4MVJF 2CBZA 4IMPA 2GS9A 1HO3A 1C30B 1MR3F 2VR1A 3BERA 3BMNB 2QQ0A 1CP2A 3DKRA 4KQKA 1AZTA 5T64A 4WLNA 3TLYA 2C97A 2PH7A 3IJRA 2G28A 4IDCA 4LBWA 5D6NA 3RREA 1YRBA 3QXSA 1VL2A 5CXXA 1BZYA 3QX7A 3VU1A 2YHBA 2JAQA 4ENSA 3CUWA 3EH1A 1M7GA 4BJHB 1WUJS 3WMWA 1E58A 1TZ2A 3UICA 3L6BA 5LD2B 5BNZA 3CVOA 4AUKA 4MYUA 4GC9A 4J7XA 4YAOA 1RWVA 4NE7A 5E6UB 1KPHA 4BKQA 4ETNA 2VHYA 3C6BA 3ICQB 1SC9A 1VM6A 2LDXA 1QIDA 2OQ2A 1JQJC 3BL8A 2QROA 3FD8A 3NHRA 4PYMA 4WXYB 2HJWA 2OHXA 3AESB 3LY5A 2XZDA 3D6MA 3FOWA 4YAJA 3DMFA 3TE7A 1GRRA 3RSLA 2C4TA 3UF0A 4DMRA 3IHWA 2WIKA 2J46A 3G3EA 3EASA 4NZOA 4IP0A 5D5HA 3VR5H 1G5FA 5JXGA 2IYSA 5U4QA 5JI3E 1GFZA 1L5LA 2DWQA 2OO7A 3FG9A 5CJ2A 2J6IA 3BMOA 4ZZ2A 4J90A 3JQGA 4R9SA 1DFGA 3AERA 1UJCA 2FKNA 121PA 3UK1A 5GGXA 2GYWA 2DWPA 4YJ3F 5J4YA 5J2UF 3KUKA 1ZVKA 1TTPB 3RU9A 4MR7A 4HRVA 5AW4A 1AVTA 2AHOA 4HDSA 4IZHA 4LN1A 1AUQA 3II6X 3M34A 1EWVA 3GFBA 1TQ6A 3PE4A 5EIWA 5EYPB 3M7IA 3S29A 4ZZ1A 4CKWA 3S8YA 5LDHA 3DD1A 3SEZA 5AMXA 5B6JA 2BHLA 3L0BA 4LI0A 1AUXA 3T7RA 2R00C 2D5CA 5C8DA 2BM8A 4IVPA 2GMWA 2Q4EA 1IXRC 2QVGA 1NLFA 3PU6A 4TS1A 5AFSA 4PHCA 1UJNA 2DJ5A 3W5SA 2CB9A 2V03A 3KVOA 2BFFA 2FRXA 3WGZA 2EDCA 1S5PA 4PC6A 4EB3A 3NIDB 4Q4DA 4RS3A 3DTNA 3TSYA 6ABPA 2L69A 2M9MA 1YJXA 3SYLA 1PW7A 2FE4A 1ZOPA 2BKUA 4H7IA 3GLIB 4P3NA 3GC6A 1XTQA 2H6EA 3LF1A 5ERYA 3VVCA 1V8DA 5EJ5A 1MQAA 1CUIA 3VOBA 4A36A 2PDAA 3M1IA 3IOYA 2CJXA 3LYAA 3Q40A 4JJ7A 1T4DA 2QKYA 4HGRA 1YDGA 1SELA 3HPQA 3FDZA 3R3YA 4CIAA 3HLKA 1XQ9A 1WJGA 1YRAA 1M1UA 1DPFA 3G0GA 3V7FA 2JGDB 2QPTA 3ORFA 5DOVA 3EHEA 4S1WA 4GZMA 1X8JA 4WCFB 4R8KA 1FS4A 2HK9A 4E1BA 1B0ZA 3WSWA 3TTUA 4YV0A 3LLCA 4ZAGA 3OQIB 4PCLA 2WLTA 3BE8A 1VP9A 2ADOA 1KPGA 2CJFA 3LGSA 2C7VA 2WHQA 3I2JA 4I4CA 4GOLD 4S0ZA 5HVNA 5BWBA 3KP1A 4OHMA 1SCQA 2E82A 4I6JA 5DM70 1OLUA 5K8VA 1UADA 4YJFB 1E7QA 4BO8A 1MAWA 4D0RA 2ZJ1A 1U8CB 3BN3A 3Q3EA 3NORA 4FXOA 3A3OA 3FNEA 3GO4A 4GGOA 4YGXB 4D6PA 4IQ8A 3CIFA 3SD7A 3DD5A 4V0OA 1U7WA 4EVQA 4RTLA 5L53A 5HTOA 2UUOA 3GFRA 4B7ZA 1NLUA 3PGVA 4HJRA 4TQUS 1XRRA 2RJ3A 4G1MB 5GVRA 5KJ6A 1FS5A 3I2GA 2R4UA 4JBNA 3ZOZA 2RGXA 1RRVA 1J8YF 3BFVA 4P54A 1HDOA 4RELA 2VPXA 4JB2A 3OF5A 1RTKA 5C1OA 3EPHA 2Y92A 3ZJTA 2FPLA 2DT5A 4F5WA 1X19A 3IE0A 2O2SA 4X5OA 4OA5A 2DKOA 3FROA 2ORED 3RHZA 4AZTA 1R0ZA 2I7DA 1CF4A 1AS3A 2R11A 3BM5A 3IO3A 4Q3NA 4C6TA 5CG1A 7ABPA 4KAXA 4AIRA 1YV9A 3PNQA 1D2AA 5EHXA 3L18A 2AJTA 5JMTA 3E3AA 2ZBDA 5AQEA 3MNFA 5K3EA 3AI2A 1ZK3A 1FC0A 1YE8A 4JOCA 3SSAA 3NRJA 1N7HA 1Z4PX 3L7AA 4KLAA 1Y5NA 2EQ5A 2GEFA 5JQGB 4KO4S 5CM2Z 4P86A 4MRPA 4Y2HA 2JIDA 2ZIFA 2GETA 4JL6A 4B3BA 3VNUA 1SK8A 3NUQA 4XPIB 1SBNE 2CV0A 1LI7A 1TU0A 5D6OA 5DWDA 1JEOA 1CQJA 1M2WA 1PFGA 2DUMA 3A2LA 3HHEA 4XM1A 1R0SA 5DULA 4G4IA 4DCPA 3D6VA 1QWSA 3EUEA 3NDPA 4YRNA 3ER8A 3MYRA 5TIIA 1OX4A 1M2EA 1NF3A 3TNYA 2GHIA 3AUXA 3KOYA 4DSAA 4OB6A 1E2JA 1NW6A 4S1OA 4P53A 1A1VA 3EEFA 1DG9A 5K3BA 3NC1C 2I2FA 4U5QA 2E85A 3CT4A 5JARA 3I5XA 1K68A 2OO3A 5TGDA 5B7GA 5K3DA 5JD4A 4WZAB 1ZIYA 4K9PA 5SY4A 4QT4A 2O8DA 1QWOA 2JGLA 4L5YA 5E3IA 1IUKA 4GYJA 2UYCA 4RNCA 5U1PA 5F2NA 1YZFA 3OF3A 1NY5A 3PTZA 3E1SA 3NRCA 2YH2A 3QVKA 5KHLB 4G26A 4PX5A 1E3JA 5FX2A 5L51A 1R37A 2REBA 2VHWA 4XARA 4HSGA 4Q21A 3F3SA 1V45E 2JIPA 3AFOA 5EIEA 2RAPA 2Y1OA 4LV6A 4YNBA 1GUAA 2IITA 3WBBA 5CD9A 1I2CA 1K7YA 3ZXSA 3HPRA 1ZCBA 4A03A 1KSGA 3FZNA 3U1VA 4K6CA 4EPWA 1GP2A 4ARZB 3EDOA 1F51E 2JHAA 2VQFB 2FQWA 1KH1A 4CMCA 1OXXK 3AHDA 3C5EA 3NWJA 1OYWA 4B32A 3CKLA 4D7AA 5GGYA 1KVRA 3R0VA 1EUYA 4TOIA 1NJ1A 4AUMA 1NBME 5IN5A 1JQLB 1U0EA 3RAJA 3LXUX 1PTJC 5AWFC 3WLFA 4UAGA 4ADSG 4Y67A 4YX9A 1J1ZA 3ZDZB 2P6OA 5JH7A 4RSMA 3W90A 5FUBA 3G79A 3OJCA 4Z3DA 1JT9A 1S8AA 1SVWA 3JR7A 4RC9A 4AKIA 1XZQA 1E6WA 1T2EA 1UPBA 3RC7A 1S1MA 3ZH9B 2FZGA 2GPBA 3QY9A 5LLTA 1K0FA 2RDMA 2H51A 2TSYB 4U9UA 3JQ6A 4KR0A 3OZBA 2C00A 2X2EA 3JQ8B 1IY8A 2PL9A 4LYFA 5G0WA 1TYCA 2AZMA 2OM6A 4D4IA 4XPZA 1FDVA 2HWYA 2ILVA 1UBHS 3MAAC 1ORTA 3QYAA 5EUMA 4CBVA 4DYVA 1D07A 2XBLA 3JALB 2NXEA 4DG9A 3I4FA 3OTHA 4EYSA 2IYFA 5JASA 4Y1RA 3UJ6A 5EWLB 4AJPA 2QJRA 3BFPA 5F7ZA 3X1JA 1PTJA 1MZPA 4EPVA 5F7JA 1YS4A 1I7SB 4O4HF 2C2GA 4WH0A 5F78A 2OKGA 4GHWA 4HL6A 5M04A 1AG9A 2HBRA 4BRUA 2XBMA 1Z8FA 2O8FA 4WZBB 4Y2JA 3BTUA 1IPEA 2CFRA 3AF4A 1S01A 2P0EA 3GPLA 4NKRA 4D80A 4ZARA 3ZNNA 2NUAA 1M34E 1U1FA 4PYLA 3A36A 4LJLA 1SD1A 4Q15A 4XXHA 2V96A 1G9XA 3E9QA 1GSHA 3ZVLA 1QYXA 2ISSD 4C3VA 3HFGA 3L04A 5EAIA 3DNFA 4YH1A 1NJ6A 7REQA 1Q6YA 4RXMA 2GZDA 4TVBA 5AXCA 4NVRA 3Q7TA 2O0HA 2CNDA 3BWMA 3ORSA 1CZKA 4EA9A 4XSHA 5CJJA 5G02A 3THXB 2ZI7A 2GEKA 4UFOA 1XPRA 3WAJA 5AK5A 1OTHA 5FBZA 3H7AA 3TQFA 4BNXA 2JEZA 3KWMA 2VN8A 3VU9A 5AUNB 1R4MA 2G1KA 5AM2A 1VIMA 3OFSA 4FNAA 4IHJF 4EABA 1X92A 1XZJA 3LJKA 5AK3A 1OKKD 3RK1A 5ILGA 4FKZA 5AP9A 3RS2A 3KT0A 4MS3B 5L7TA 4O4IB 2Q5LA 1XDZA 2EJBA 4JB0A 4DC0A 3AVYA 2Y68A 3LKVA 1O03A 1KFCB 4QBHA 3SC3A 2QD1A 2WIDA 2RONA 1GRNA 4K46A 4MWTA 5FBWB 2XVAA 2CHGA 3L1VA 3EXFA 3GIWA 1RSZA 2PWYA 5ECDA 3P52A 2EWWA 5HQJA 1XELA 3GIDA 1TC1A 2JHPA 1J99A 3EJ6A 1E3SA 2WD8A 4MRMA 1XKXA 4RNDB 1JG3A 2AJDA 2BISA 2BTOA 4N5NA 1V1RB 3FZEA 2QUIA 3W5JA 3BC1A 4CW7A 4G6ZA 16PKA 3ETHA 3QXCA 1XMIA 3MPOA 5KTYA 5CW1A 1XU4A 4PZAA 5KEIA 4XM0A 2HF7A 2V0CA 4YFVA 1I80A 4ESHA 2Z43A 4MVJG 1YR2A 3OMLA 4UUPA 4ZI7F 5BW6B 1FYWA 1EXNA 1TCVA 1SUPA 2VUIB 1ATIA 3KKLA 1QPZA 3IRVA 4RENA 3F71A 2QM7A 1OD6A 1JIJA 3K0CC 2GUGA 3MCVA 2XDQA 4DR6B 1G0OA 1W7AA 4JEUA 1QF9A 2DUWA 4RMNA 5EP4A 1QAQA 1AMUA 3NT4A 4I3GA 5CU7A 4B0OA 4MCHA 3DEZA 1V5IA 3GARA 1H4SA 1C50A 1UBRS 1TPYA 1N2BA 3ZD9A 4CJXA 4CMIB 3HDVA 2QXTA 3QFTA 4R84A 4Y9TA 2P3SA 1TJYA 4TN1A 1RPAA 4RF5A 4FNMA 3QEBZ 3NBFA 1C9MA 4F3NA 4YAEA 1NVVR 2YMLA 3OPMA 3OSUA 4F6CA 3RC1A 3V4FA 2H1OA 1U5BA 1SOUA 2N47A 1ZUWA 3R20A 6NULA 5BYAA 4WSOA 3UPUA 2Q45A 2V45A 3NAGA 3OJFA 1GPWB 2Q8PA 2XKBA 1OLOA 2QV7A 1HI9A 4LK2A 3G59A 3P2IA 4LECA 4ZP1A 5FBKA 4D8VA 4YAIA 1YZUA 2GZ1A 3STUA 2B7LA 1VCOA 1S8OA 3PNBA 2F1HA 3ICCA 3P26A 3QWHA 2J7PD 3FOBA 4KPYA 1MRZA 1FLDA 4X85A 2RHJA 5D51S 3FJ1A 1TMYA 1TZMA 2AXNA 3DM5A 3QW2A 4R5HA 4RYDA 1NG9A 2ZETA 4ZGGA 3W1WA 3FPKA 1KP9A 3AVPA 1N0WA 3P9QA 1DAGA 4EG7A 5DIZA 1N5JA 4DZRA 1GL7A 1SIUA 1I30A 4I7EA 4OXIA 3V3TA 1WF6A 3H4VA 3VPGA 3WE7A 1YF3A 3F49S 4ISBA 2UUAB 4MOWA 1W2WB 4XYLA 1SUSA 2RGNC 3K30A 2MOKA 1PK8A 3AF1A 1ZHFA 3OTWA 3R2JA 5FQNA 2AZTA 3QIVA 1CR4A 4MEBA 2VYND 1D4AA 2YV4A 3RS5A 2VJOA 3CO0S 3MWFA 3DFIA 3MINB 1J22A 1Q0ZA 2UVQA 3UUEA 1T4BA 3UJNA 2JGNA 3SR4A 5FWYA 3DVLA 2X7XA 5JVDB 1V8BA 5D3MB 2PIDA 1JR2A 2WOJA 3NWBA 1XYGA 3N0TA 4J2OA 5K0FA 2QVCA 1POXA 5BYJA 1A69A 4LF8B 4TLMB 3HHPA 5HP4A 1ZW6A 1XCMA 2H06A 2BZGA 1P7PA 1SVOA 2D06A 2H5EA 3QMWA 4CMBA 1KJNA 4US1R 3VV3A 1LW6E 4WY2A 2WSMA 1GPNA 5P21A 3GJ8A 3AC0A 4OKIA 2XMCA 1T1RA 3PFHA 4DUYB 1T34A 4RM3A 5CA1A 3AEKA 3HU2A 4G0YA 4S0XA 1WL8A 1TL7C 3COPA 4AF6A 4WTOA 1O94A 1V39A 3JAWA 3N7AA 3GEIA 1UM9B 3IQEA 1HM5A 3H9BA 3BH0A 2W6IA 4TN5A 4YAFA 4GSLA 2KLBA 4DIMA 1XG5A 3IKJA 4GKBA 5B6IA 1JQEA 4LYAA 4G0OA 5EHNA 2VCYA 2P11A 4LJ7A 1WVMA 2DC1A 4HWKA 4DLUA 2SECE 4EVSA 2A78A 4ZTUB 3D4IA 1XCOA 3KSDO 4ERNA 3BXXA 8GPBA 1GUDA 4EB0A 1TK3A 1J0CA 4WFKA 4P1ZA 4R68A 5ALSA 4ZT6A 1JR6A 3RC8A 1WKBA 2YMMA 5GOTA 1QPBA 3K9WA 2JLVA 1QYIA 4MMZB 1MEEA 4C7JA 5LP6C 1GPDG 1NN1A 2V3WA 1IOLA 3Q7IA 5E9QA 4G5QA 3VDNB 1RKUA 1XQYA 3BBLA 4QU8A 1DC4A 2V74B 4QO8A 4TV9B 1F1BA 2J6BA 4H9GA 2ZIEA 3RYCA 3E9CA 1UEJA 5FFMA 1HL7A 3SC6A 3UTDA 2Y1EA 2C4UA 1TRHA 4O6VA 4R1OA 2CB0A 3TQIA 1V95A 1BKSB 5I7WA 3EFOB 2F3QA 1PJTA 1KYXA 4HGQA 4YROA 4ER3A 4RTRA 4AS1A 2QRVB 3U1BA 3I6YA 1J25A 5ALNA 3ZY2A 4BL5A 4BMPB 5CT9A 2DQKA 4RTKA 1JDPA 1CJUC 3E03A 3IMGA 4PPGA 5DM1A 1A8QA 5BW8A 4FGUA 1G7CA 3VR5D 5A03A 5JIBA 5ALDA 3N7TA 4KFCA 2RHDA 3FPHA 1JS1X 5TV2A 2HFKA 1KTIA 3P9YA 2ONCA 4RCVA 5NLLA 2PYIA 2VTBB 1K3UB 2OM2A 2WKQA 3B1ZA 3INTA 3U7RA 3KJNA 4UHJA 4LRTB 4LVCA 3TOXA 4EHDA 5KWIA 3RGWS 3VR3A 4MJXA 2D5BA 3DLIA 3HDTA 1IM8A 4QYWA 1S96A 2IVFA 4N18A 5JNVA 3V42A 5JS2A 3GLGE 4D57A 3C39A 5FOXA 1RWWA 1HEYA 1YVRA 3K0AB 4HYTA 3AWDA 2B4YA 2AZXA 1IZ9A 2PKQO 3LBNA 3LKZA 1QO0D 3CVVA 1OIXA 1LLQA 3IXQA 1KVUA 4MARA 1D03A 4HFNA 2XZTA 2RH4A 4X1IB 4XTRA 4BNTA 3UATA 5KDLA 3AEYA 3WFZA 3PRYA 1N0HA 4AU1A 1MXFA 3ND9A 2ZRBA 3EULA 3PFBA 4V0SA 5HZGA 1RYEA 3VZPA 1JI0A 3BYZA 4U1RA 3ZS9A 1F4LA 3NC4A 1OTXA 1V3VA 3OLYA 3DBLB 1BJKA 2HIGA 1RWOA 3OLZA 5JC1A 1PLKA 4ACBA 1L1RA 2CXHA 1YZ3A 1SOMA 1SKQA 2VDPB 3REQA 3TI9A 4OM7A 1YBHA 2CL0X 2J0VA 4X6UA 3W0LB 1FUUA 4HV4A 3BIOA 4MCJA 4NRDA 4Z7QB 4AKGA 1NJSA 1Y3DE 2I3DA 3FSGD 2HMWA 1B8OA 3BB3A 3BSWA 3HCCA 4MRAA 5BQXA 2ZB3A 1RYYA 4F1JA 2QA5A 4B3RB 4N6NA 4KR3A 1R6BX 1PYOA 3IMCA 5JCOA 1CS0B 2OK7A 1OZFA 4Q9NA 1EA7A 2FXVA 3CUUA 3FF1A 3PFIA 4GP7A 5E4JA 3F5DA 3UV7A 2ZZMA 3AEQA 3VHQA 2C31A 4FBLA 1T6NA 5KYXB 3AHJA 4FOTA 4RUKA 1C1YA 1LSOA 1R1DA 3LBHA 5DX1A 5HUHA 2ZSUA 1D04A 1LW7A 3UXMA 2IS4A 4DM4A 1GQFA 1ESMA 3INRA 2HNKA 3IIKA 3NV9A 1G3MA 4GPZA 4XQ0A 3VR2A 1AUVA 2EFJA 2ZUUA 2FW0A 3EEIA 1X14A 4GI2A 5EXSA 3STXA 3AMVA 3T1OA 4CEIB 2QTWB 1SH7A 2P41A 1GPH1 3BS4A 3ESCA 4OXKA 4R1QA 1X1CA 4XWOA 1H8HA 2HLPA 1FPMA 1O89A 1ZK0A 4W82A 2C84A 4YRLA 5DRTA 5F5LA 1QF7A 3CRNA 1DAOA 4UVIA 4MIYA 3IULA 3WOHA 3WP1B 3BPSA 2WT8A 3A1DA 3SIRA 3I45A 2ASEA 4KRXA 1UXGA 3B48A 3R23A 4TTVA 4DBZA 4Q1EA 3JQBA 1AB6A 3K5PA 3P9NA 2NTVA 2CXTA 4H6WA 4HX5A 1B42A 1KR2A 4GZLA 5DCLA 3WSVA 1HQCA 4PTYA 3JR3A 5LDDC 3GPBA 2FK7A 1GFIA 5AJWA 5IF3A 4FP9A 4KPFC 1E2MA 2HREA 2P9EA 4UE3S 1L5YA 1U4OA 1VL0A 2P4QA 5T4FA 2QE6A 4QGGA 1XN4A 1YZVA 1DXQA 2V6FA 3L0DA 4ME6A 3ZLVA 1MVOA 2GLTA 3EPRA 4A23A 4OU4A 1MX1A 2EKQA 5FD8A 2CZCA 3ZDQA 1C5KA 1XDGA 2O19A 5ALIA 3TQCA 2WFAA 1T0IA 4UHCA 1I4WA 3RKRA 2IYQA 3W8RA 5HS4A 4ZU3A 4N9WA 5FKJA 2VDMB 4BOYA 2W93A 1REQA 2JK1A 2JH9A 4NPHA 4X41A 4ZPJA 5E2IA 3OJWA 1AKEA 5HIIA 1YHZA 3L7BA 4X1KA 4BWGA 3PNPA 1S2OA 4NU0A 4XQGA 3SDZA 1MX3A 3DKIA 5E6SB 3LO8A 4J0CA 5BSFA 4DSUA 3OZTA 5C7IO 3ILSA 3VTKA 1RCFA 3QG5A 4CGZA 1YJ8A 2IEYA 3Q0TA 1FA9A 3RNLA 1N3LA 1U7PA 1E9VA 1GN9A 2JGKA 4BBJA 1R88A 1WHTB 4A9AA 3HCWA 1ZOOA 3BVPA 2LKCA 2PANA 2OB1A 1U3D