4JVNA

Crystal structure of human estrogen sulfotransferase (sult1e1) in complex with inactive cofactor pap and metabolite of brominated flame retardant 3oh bde47 (3-hydroxyl bromodiphenyl ether)
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
291
structure length
291
Chain Sequence
b'SELDYYEKFEEVHGILMYKDFVKYWDNVEAFQARPDDLVIATYPKSGTTWVSEIVYMIYKEGDVEKCKEDVIFNRIPFLECRKENLMNGVKQLDEMNSPRIVKTHLPPELLPASFWEKDCKIIYLCRNAKDVAVSFYYFFLMVAGHPNPGSFPEFVEKFMQGQVPYGSWYKHVKSWWEKGKSPRVLFLFYEDLKEDIRKEVIKLIHFLERKPSEELVDRIIHHTSFQEMKNNPSTNYTTLPDEIMNQKLSPFMRKGITGDWKNHFTEALNEKFDKHYEQQMKESTLKFRTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Estrogen sulfotransferase
molecule tags Transferase
source organism Homo sapiens
publication title Mimicking of Estradiol Binding by Flame Retardants and Their Metabolites: A Crystallographic Analysis.
pubmed doi rcsb
total genus 112
structure length 291
sequence length 291
chains with identical sequence B
ec nomenclature ec 2.8.2.4: Estrone sulfotransferase.
pdb deposition date 2013-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4jvnA00
2Q9CA 2KSQA 2C99A 3AKDA 1P3JA 4N0DA 3CR7A 5CIQA 3RSLA 4DCNA 6Q21A 4XSGA 1NSFA 4IVQA 2WTUA 1M7HA 2G83A 2QM7A 1JAHA 1KNXA 4ZIRA 1ZNZA 3THXA 3UK6A 1QHHA 4GRAA 1XTRA 2J0SA 3E2IA 4IXMA 4TYWA 1R2QA 3JZMA 3KX2A 4M1TA 4YMWA 1JEEA 2W6IA 2BEJA 4JIMA 1JI0A 1N2CE 3NH9A 1VCOA 2J45A 2F1RA 1FQJA 1T0HB 4DCSA 2QBYB 2VP5A 1JJVA 1LS1A 3FHOA 4KSCA 2GCOA 3IHWA 2QRNA 5CM8B 2LCFA 3LH5A 4MGIR 5A0FA 1QHYA 1NN1A 1KIMA 1N6NA 2Z0MA 2D7CA 4GP7A 3QI2A 5TMPA 5AJYA 1E9DA 2IF2A 4JL8A 5ELXA 2FSFA 4WXPA 3WYAA 2Q6TA 2IYSA 1BYIA 5J4YA 3REFA 3BOSA 2IS4A 2GZDA 1AGRA 2NG1A 4JBWA 5EE1A 3BS4A 2C5LA 5E7JA 3KKPA 3DKPA 3NKVA 2R6FA 4JVNA 1G3QA 3GLGA 2WZQA 3AKYA 2DFTA 2ZS9A 3EIHA 3TQCA 1HH4A 5JMTA 2CXXA 3HYTA 1Z0DA 1OH7A 2HUPA 1NLZA 3KXKA 2FU5C 3TIFA 4LYJA 1ZU4A 2WKQA 2Y8EA 4PO8A 3FYHA 4BFSA 3QIAA 4Q4LA 3RS2A 3UWKA 3FMOB 4N1AA 2HEIA 2H17A 1FOEB 2DFKB 1XFAA 2FGJA 4M1YA 1JR3A 3R9IA 4D26A 3OZXA 1IONA 1ZU5A 2IUTA 5FOWA 1DAFA 1T5LA 3TVDA 3U3RA 1N0WA 2R9VA 1GIAA 2IYLD 3KKNA 3G82C 2NPIA 2MSEB 2FF7A 3KUDA 5DNYB 3AKCA 5JBQA 4IHQA 1T8TA 3FMIA 4Z1MA 5ANRB 1IJEA 2D62A 5FL3A 2JLWA 1M7BA 1DADA 2AK3A 5CB6A 2PT5A 2QAGB 3LY5A 2WJGA 3QJYA 1XWIA 3IQWA 2UVQA 2ANCA 2ZSBA 3A58B 1AN0A 3AVVA 1YRBA 3O8RA 4RFSB 3QKUA 1Z5ZA 4KSBA 1E0AA 5DI3B 5BW8A 4HEJA 4CDGA 1GG2A 1ZBDA 4RZXA 1LVGA 5AJXA 4S2EA 4ZCIA 1CR2A 2DCUA 3GLGE 3L82B 3SHFA 3QKSA 5HCIA 1XJCA 2MSDB 4NYIQ 4LYAA 2CJWB 1VG1A 1FFHA 2GRJA 2OLKA 4DLZA 5FBRB 2ZETA 3CR8A 3F0TA 5FPTA 4PPGA 3V4FA 3W5JA 1S4QA 2FFAA 1NMXA 3AVTA 1E2FA 3A1WA 4DLWA 5CJ2A 5L8VA 1EWRA 4F7WA 1ZRHA 2G88A 2RGBA 2XZLA 2FH5B 2GKSA 1Q0UA 1G291 4LJ4A 1KI2A 2QT0A 4RCZA 1NN3A 2IYZA 1G3UA 5FOTA 3ADBA 5JJKA 4ERNA 1XB2A 2ATVA 2ZI6A 1E9FA 1EFUA 3T5GA 5DSZA 2ERXA 2GAAA 2KWIA 1BKDR 4Q9KA 3G5UA 1IOZA 1FUUA 2IHYA 4CEHB 4MQBA 2CHQA 4JJKA 4Q47A 3X1DA 2VIIA 3CNNA 3NC1C 2JJ1D 2ZVPX 2QAJA 3U7EB 1CLUA 1M6NA 1F5NA 2YWEA 3THWB 3H0KA 5DIFA 3SQWA 1AZTA 1E69A 4UNNA 5C2JB 3LX5A 5F2EA 2BBTA 1XCMA 4XWKA 3GJ0A 1WMSA 3CH5A 5FBVB 2ZU6A 1RZ3A 1TF2A 3EARA 1X1RA 4UJ5A 3KQHA 3QG5A 4JS0A 4GDFA 3CB4A 2GTPA 4LHZA 1L4UA 2FFQA 2ORVA 3LAWA 2ZYTX 4LSGA 4ARZA 3ADCA 1BH2A 1U0JA 3U4QA 2O8DA 4C3ZA 2I1QA 2PMKA 2YOGA 1OIVA 1EX6A 1FL9A 3UG7A 4C9BA 3BD9A 1PUJA 1R7RA 4Q7MB 4NZYA 4LJAA 2FFBA 2VL7A 4DUGA 3VR2A 3LW8A 2XNDD 3TUJC 2UZIR 3OESA 4DCVA 4AY2A 5EXSA 3T06B 3A1TA 3DKVA 5EE3A 2QMUA 3RDPA 1LS6A 4AURA 1EFHA 1U8AA 1X86B 1HTWA 2AL7A 2DBYA 3CH4B 1GNPA 1W4BA 3BXZA 1OKKA 3U3OA 4ABYA 5JWOA 1KDRA 3C14C 5EXXA 1E9BA 2BKUA 2RCNA 3IIMA 4LGMA 4C0JA 2O0KA 3W5IA 2JLZA 4AKIA 2NMVA 1VIAA 2J3EA 4HI0E 1YR8A 3VR1A 2EYUA 3IHLA 5TDHA 4XD7D 1ZUHA 4ASUA 1N6KA 3LQQA 4PSAA 3DMDA 1XMJA 5C46F 4OI4A 3W3ZB 2W2TA 721PA 2H18A 2FA9A 1T4GA 1VHTA 4URZR 1SHKA 3CNLA 5KYKA 1VG9B 3D8BA 4V0KA 4Q5IA 4RCYA 4I1UA 3SOPA 2ZRMA 3PIRA 3A1UA 3H4MA 2PLRA 5FL7A 2DFLA 3GQBA 1XJ0A 5FTJA 1T9HA 3BGWA 4JYCA 3PG5A 3PEYA 2XAUA 4WIAA 3SN6A 4FMDF 1ZAKA 2X77A 2QNRA 4CT4B 3EW9A 3QVVA 2QBYA 1G64A 2Q9BA 3M6AA 2GBLC 4YDHB 1E0SA 2FDCA 4BLQA 3RRNA 2PZFA 1TEVA 2K5UA 3LBIA 1VTKA 4Q4JB 5TXGA 2PX0A 3NIBA 1WA5A 3SNHA 2C78A 3RRYA 3CW2A 1D2EA 2W58A 2IYQA 3RABA 3DZDA 2R8RA 3EPJA 3BRWD 1DG1G 3KTAA 4XWAA 1OLOA 4DCTA 1G3IA 2ZJ2A 3QEJA 5FFMA 1JXOA 1CXZA 4PZLA 2Q9AA 3X2SA 1ZUIA 3D7MA 3FTQA 1P2TA 4OI2A 1J7KA 4Z8YA 2VHJA 1OB5A 4X8OA 3DM9B 2EW1A 1FZQA 2ONJA 2O8FB 4HZUA 4KYUA 1E9SA 2ZUDA 3QBVA 1IN4A 2AN9A 3IIJA 4YMTA 2Z4SA 2GESA 1COWA 1R8QA 2ZJYA 4FN5A 3B7GA 2D06A 3EPHA 3LX8A 1H8EA 4U02A 2C96A 1ZD8A 3I92A 1KO4A 5G41A 5JWHA 1Y63A 3KKOA 3GJ7A 1IY2A 5DHFA 1IN7A 2GAOA 5EP2A 4ZV4A 2J5XA 2BBSA 3BK7A 5G3ZA 4JLAA 3RVBA 3TRFA 1AGPA 2FPMA 2XX3A 3C41J 2PEYA 4JL6A 2JCSA 4JVMA 4NYIR 2ZRNA 3CIOA 4HUTA 5F3WB 4C7OA 1KMHA 1I4TD 4ITRC 3U6BA 3AEZA 5HE9A 3AH8A 4B3DA 3W6PA 2O8CA 1LF5A 5EE9A 4Q4HB 1GL6A 2O8EB 4US0R 3E70C 3K0CA 5FOVA 1BYUA 1G4UR 3RRMA 5EZ5A 4QJ4A 4KFSA 1ZUNB 3I62A 2JJ2A 1XXHE 3D6TB 1PLKA 2H8KA 1SVMA 1Z6TA 3MD0A 4NHOA 2QT1A 4UXHA 4EDHA 4IEEA 1NVWQ 4JBYA 1MKYA 3OFNA 3KQUA 2P2LA 3K70D 2CVFA 3MCAA 2MSCB 1XPUA 1IY1A 3GLIE 4RKEA 4EJSC 3FMPB 1NKTA 1OFIA 3K0CC 3RS0A 5AUOB 1GUAA 4OQFA 5J47A 5FR1A 4A8JC 2B6HA 2AKYA 4CRWB 2IYWA 2CCJA 1G7TA 4O2LA 5DH9A 1N25A 5EQTA 3U7GA 3BFKA 3R7WB 3NXSA 1I4LD 2G1JA 4MYHA 1SULA 1H8ED 4Q4AB 4RD6A 1GITA 4TZ6A 2QPOA 1DELA 4KVAA 3ECCA 2ZRCA 2OILA 5FPSA 3TR5A 5IK2D 5LD2B 5E3HA 1SVOA 2GXUA 2XTMA 1JXMA 4MH0R 3WBKA 4A2PA 3K0AB 1QHGA 4ASUD 4ESVA 3GP8A 4PSVA 3EX7C 1YR7A 2HF9A 2IEZA 5DHAA 3CWQA 4DWJA 3J81k 4C0AC 2EWWA 4BZQA 1GWNA 4DDUA 5BN3A 2O52A 1EK0A 2J7PA 3LQRA 2N46A 3B9PA 3BJIC 1R10A 1KGDA 3P1JA 1CEEA 4DXAA 3I61A 1PV4A 2JATA 2VTKA 1GOTA 3VKHA 1UKYA 3RWOA 2GXAA 1D8TA 4B43A 4PXAA 3W8RA 3B1YA 2ZUBA 1EFRD 2EQBA 1VMAA 1UBFA 3A1SA 3T12A 3C5CA 4ARZB 1KJWA 2RGNA 4ZCMA 4GT1A 4FI3C 4OHZA 3TK1A 4IDHA 2QP3A 1UBEA 1E2LA 1KSHA 1KI8A 4YXWD 1N0VC 2GVDC 2WWGA 5EJEA 1JJ7A 1JPNA 5EE0A 3IPXA 4TYPA 4CEJB 3LNCA 4JLNA 2WJVA 2X2FA 3ADDA 4LZZA 1F60A 2XTNA 2VP2A 3PITA 4US1R 3LXRA 4QBGB 5FL7D 1P2VA 1R5OA 2VYFA 3RS5A 1NVXQ 1XNJA 2IYVA 3EAQA 3H86A 1ETUA 2VBCA 3CLVA 3SJAA 1HE1C 4C0HA 3NBFA 4F92B 3QEOA 4URYR 1DAHA 4TT3D 1ESNA 3UMFA 2QP9X 3QXCA 2A2ZA 2J46A 3WMFA 3ZVRA 2FV8A 5FTNA 1DPFA 2BWJA 3IPYA 4QOSA 2Q3MA 3I5XA 4ESHA 3UANA 2IT1A 1T91A 4PHGA 5CK5A 4D81A 2WJIA 3I32A 2OCYC 4TQ9A 2DR3A 4LHYA 4DIEA 1OH6A 2GXSA 2NZJA 3VTKA 1JECA 4B73A 1LFDB 2BIFA 4I81A 2ZSAA 1TQ4A 1CRPA 1SKQA 4A36A 1LB1B 1NIJA 4MUBA 1U94A 2AWNA 2OAP1 4PQRA 1R0WA 3SHWA 5JLJA 4WOPA 2QG6A 2ATXA 5C1BA 3FFBA 4DDWA 1XTSA 1G5PA 2V55B 4GI7A 2RGCA 1OIXA 2VP9A 1AJEA 2FE4A 2C2HA 1KTVA 4CEHA 3UXMA 4HAUA 1MO4A 3K9NA 4YC7A 4V0MA 3B82A 4Z8XA 3WNBA 2MMGA 2QEQA 1IBRA 2ZXUA 1NN5A 2O8BB 2XNSA 2EWVA 2V54A 1N0UA 4BLSA 1T3HA 2W00A 3OE7D 2OBMA 3THYA 1NN0A 4Q48A 3K09C 2WIBA 1Q3TA 1T8UA 3OEED 1MRNA 1SXJE 2J0VA 2DYKA 4FWIB 4RD4A 4CYMA 2ZROA 3L0OA 3FOZA 1YZKA 2ORWA 4G5QA 2BOVA 2GEVA 3CX6A 4QGGA 3LBNA 1US8B 3MMPA 3C16C 4UQOA 1TPZA 2AR7A 2VSFA 1P60A 1UADA 1WBDA 1E3MA 2V1XA 2GJ9A 5H68A 1HQCA 1Z0IA 2BCGY 4DHEA 3NBZC 5KPDA 3R8CA 5H70A 3C7KA 1CS4C 3MSXA 1W49A 2D74A 2WBLC 3OF5A 4M1SA 4M8NE 3KXIA 1OXXK 4U7DA 3U3KA 2Z5FA 4MYCA 1XX6A 3M4YA 1KAGA 1GL9B 5CYPA 1Q1EA 1OIWA 3DVLA 1XRJA 5FUYA 3X1ZA 1MABB 4Q1FA 3WHKA 1NIPA 3GJ5A 4PPQA 1P6XA 2V7QD 1IN8A 1I2MA 4DUGD 4HAXA 4OJQA 1E9EA 2DY1A 2REBA 1MT0A 3F3YA 5H8WA 5CDFE 4DDVA 2VHQA 3GLFA 3AVOA 1UKZA 4RFVA 3M0EA 2HJVA 4A6PA 4MRPA 1E2HA 3EZ2A 4DLYA 3EIEA 3B13B 4B3GA 2F1IA 3FMFA 3GLHA 1NF3A 4JVSB 4B76A 3RHFA 4C0KA 2WJYA 5KUTA 5E4FA 1WE2A 2WPDA 2IF0A 3W90A 2XB2A 2QUZA 1U99A 2W6JD 3ZS9A 3GLFB 1M74A 3ZQJA 3AF4A 5TV2A 4Q00A 1VYVA 2BC9A 5M04A 3U6KA 2GJ8A 1J8MF 1VG8A 4Q1CA 4CGZA 3KFXA 4LBZA 1Z2CA 1QVAA 4JZKA 1ZINA 4DRZA 4B44A 2QI9C 2FSHA 1Z63A 1G6OA 3C4JA 4K8OA 1KDPA 1P73A 2BVNA 5GADl 2IYXA 3HU2A 3RWMB 2WM9B 4PAQA 5FUXA 1Q12A 1TF7A 2Q21A 1ZNWA 2NIPA 3ZS8A 4BLTA 4A82A 2WSSD 5E95A 3B1VA 2V4ZA 2HT6A 4LV5B 1Z08A 1EFTA 4GOKA 1XBTA 4AIIA 3PR1A 1RW4A 2IX3A 1NBMD 1AQUA 1X6VA 2CCKA 5FTLA 4YXWA 5HZHA 4YQFA 4M2LA 4BFUA 2CL7X 1UFQA 621PA 5JWRA 1N6OA 3KUCA 3T1QA 1YZNA 2V6JA 2ZRJA 2PCJA 3SEAA 2VLIA 4NMMA 2RGEA 4GMXA 4ZI3A 2GCNA 4HAWA 2OCPA 1DARA 1Z6AA 2VSOA 2CLSA 5E7IA 2IS1A 3A1VA 1NLYA 5FUVA 3CRVA 1FNMA 1H65A 3ZIAA 2Q0HA 4DKXA 4NCNA 2GK7A 3S1AA 2HJGA 4TMZA 5JFGA 4IOMA 2H7VA 1IN6A 4EPRA 2G0NA 4FINA 4GOJA 2YC4C 5HTKA 1XEWX 4I4LA 5FI0B 2JIZA 2B8WA 1OYWA 1Z0AA 4KV9A 121PA 4M4SA 2G1KA 3RRZA 2PJRA 5FTKA 1G3RA 1NY5A 2HV8A 2FSIA 3DPUA 2NPFA 1CTQA 3WMEA 4IDQA 5IHPA 3TAHA 5JEEA 4D0GA 4XWOA 2PJZA 3WNDA 1U0LA 3TR0A 2BMJA 4LBWA 4B74A 3SBDA 1A82A 4HDQB 4D25A 5L3VA 1TADA 2ZPTX 4EAQA 1JEDA 3ND9A 4TQAA 1OB2A 4DSOA 3VHLB 4HB3A 4LRWA 2ZU0C 5J40A 1DE0A 3F5FA 1U9IC 4UNSA 4LBYA 2QAGA 4O0MA 1X8LA 2UZ3A 2F6RA 4NP6A 3REGA 2IC5A 3O8BA 2OFWA 5EP4A 1PVOA 4V0OA 4ZDKA 4S35A 3U5ZB 5JZVA 2OE2A 1NNEA 2VQSA 3QOFA 2WSMA 3LRPA 4BWYA 1CP2A 1YZTA 1GKIA 3GLHE 2ERYA 1FTNA 4Q1EA 3OEHD 2NQ2C 2RGAA 3LDAA 4FW9A 4LI0A 4W5WA 4H1VA 1KNQA 1QHHB 2QGZA 4MA4A 2YHSA 2ZRIA 5SZJA 3ONWA 3GLFE 2KBFA 3TQFA 3U7FB 3MGCA 4E03A 2F43A 2CNWA 1EWQA 4Y0VA 2VRWA 4FIDA 4OQLA 3WMGA 4NCIA 3U44B 4ZDJA 5CLQA 4AYTA 3EZ9A 3RAPR 2LKCA 3R20A 1YZGA 4AD8A 5JI2E 4ZDWA 1OT3A 3ASZA 4JT4A 4TMXA 1KI7A 3NG1A 2N1BA 1MO3A 4C7OB 3P4XA 2J9RA 4Q9JA 4NE2A 2P5TB 4AG6A 4D0LB 1G8YA 1GZSA 1CU1A 2WMOB 3K0FA 3PUZA 1YR6A 1Z0KA 2BV3A 3T61A 2ZYVX 4PTLA 4DBLC 1E79D 2ZAOA 4B48A 2WIAA 1QHSA 3MAAC 4X8LA 2WSSA 2RGNC 2D4HA 2WAYA 4NONA 4OK6A 3SS8A 3CONA 4J0QA 3U3MA 3HPRA 5J4HA 4QJ5A 3QNUA 1II8A 3LD9A 2WVJA 2WMNB 1CULC 1XEXB 2EFDB 1WQ1R 3CRW1 4A15A 3R9XA 1Q21A 3NBXX 4FCVA 1VCMA 4R9UC 1Z29A 221PA 3TE6A 4AI6A 1YJ5A 3B5JA 3NTUA 1CIPA 2J59A 3THOA 1OFHA 4JSTA 4DEXA 5BQ5A 4URVR 5FOXA 1W2GA 2QL6A 4R7ZA 4W9MC 3EZFA 3K8YA 1XD2A 2IEYA 4JLPA 4KFTA 1VKJA 1E96A 3A8TA 2YV5A 2IHBA 3FWYA 2ZANA 5KNBA 1ZIOA 2YWFA 4LYHA 4LY6A 4Q4JA 5G3YA 3I5YA 3AUXA 3NEJA 3GEEA 2W2VA 5B2ZA 2H1LA 5DLQC 4IDOA 1DO0A 3WXMA 3OE7A 1ZIPA 2WV9A 1L7VC 1QHIA 2ZI5A 3OIWA 4GPTA 5AUPB 4PAOA 3THXB 1GNRA 1Q1ZA 2A5DA 2FN4A 1E2IA 3KQKA 1FW6A 4PFSA 2AK2A 3T5DA 1T3LA 2ECKA 3MUFA 3W9YA 2O8EA 2BCJQ 2BJWA 4Q4AA 2GEUA 1XTQA 4TYQA 2GILA 2BHRA 2FEMA 1QG4A 2RMKA 3WYGA 5LPNA 3QE0A 1B23P 1L2TA 4M9SA 4QBHA 1AA9A 4BZPA 4YMVA 4IVPA 2ASEA 4N3NA 4JT2A 1W0JA 1U0HC 1U90A 1CBUA 1WP9A 4MGKR 3VFDA 3CRQA 4A6XA 1ZD9A 4JBXA 4WBSA 2PH1A 2CNWD 2G6BA 5FUWA 1XD9A 3RLFA 821PA 4HB0A 1F2UA 3T34A 3CWZA 1R0ZA 4BLRA 4LCBA 4A0GA 3K1JA 1EFRA 2ZRKA 4JSYA 1U81A 3L8YA 3JVVA 2XGJA 5B58C 3ZQ6A 2PX3A 2VO1A 1S0UA 2EFEB 4TYYA 1KO1A 3K9LA 2Q3FA 5J4KA 1G7SA 1CJVC 2VP0A 4BEBA 2C03A 3X1XA 4EKDA 1WXQA 5CK4A 5L3QB 1IN5A 2HYDA 2QRZA 4OQMA 3LO5A 2IS2A 3QXHA 1TF5A 5DE3A 4LJ5A 4B32A 4BGDA 4JVLA 4BFZA 4HZUB 2FG5A 5SZIA 4O2RA 1G20E 3B2EA 2J0QA 5KDDA 2VHTA 4AWXA 3SYKA 2QGNA 1QBKC 1YZUA 2OV2A 5LB2A 4M9ZA 5J5CA 1KI9A 1W2HA 2QTFA 4DDTA 4F4CA 1YQTA 4L9WA 3QF4B 2ZTSA 3GFPA 3GFTA 3A36A 3QPWA 1TNDA 3LXXA 4LJ8A 3VU9A 4B3BA 4G5SA 4WXRA 3AM1A 1G5TA 2C9OA 2FZ4A 2I1VB 1RRCA 3SJZA 4C0BA 2ZR0A 4LYFA 1UBCA 4TZ0A 3TW8B 1VYTA 2QROA 4Q03A 4V0ME 1OSNA 2CL0X 4II7A 3AB3A 4LBVA 5KSOA 1LTQA 1W44A 1WCV1 4URUR 4G0NA 4OK3A 4G5RA 1P5ZB 5KNDA 4R98A 4QJ3A 1OHHA 3V9PA 1PZNA 1E2GA 3K0FB 5FPKA 1F48A 4ZO4A 3GCGA 2VPPA 3BORA 5G40A 4BFYA 4PX9A 4B6EA 4BQSA 3SFZA 5JECA 2CE7A 2DFNA 1G7CA 2BEKA 4A2WA 2DWQA 3S1AB 1G6HA 3VKWA 4JLOA 2W0SA 5IT5A 2NOAA 1E1QD 1SKYE 4TT3A 2X2EA 2YZ2A 4DC9A 4ZKEA 2ZSEA 3GLHB 1KJYA 1Z28A 2X1VA 1VPLA 3HJNA 4GZLA 4M1KA 5L3RA 3U3JA 4B2PA 4LHWA 4HB2A 4AYWA 1U9IA 3BIFA 1Z47A 2OXRA 4Q18A 5CM9C 2JLRA 4Q7KA 2G0TA 1NVUQ 3E1SA 1QHNA 2D7DA 1XTKA 4B3FX 3DMNA 4IDPA 2L0XA 3RS4A 3SDZA 1NSTA 4NDZA 3CX7A 4OHWA 3CZPA 1IQPA 1ESMA 3IGFA 5J4VA 1RFLA 2HXYA 4PSKA 4NPHA 3U4QB 2O8DB 3TVTA 3AVUA 1KJZA 3TH5A 3KZ1E 4LPKA 2QQ0A 3CRMA 4IXNA 2GA8A 4UNPA 3VHXA 1QF9A 5TVKA 3DL0A 3EWSA 3LA6A 4US2R 5TB5A 2ZJ8A 4BFWA 4OJKA 2Z6VA 1SHZA 3K0SA 1XXHB 4TTPA 1FP6A 2IS6A 3RC8A 3BFXA 3VR3A 2JJ2D 3KB1A 4PHTA 1HE8B 3SE0A 5B30A 2YC2C 4LK2A 4PHHA 1UJ2A 3SJBA 3ZIAD 1YKSA 2HDNB 1NL3A 5HZKA 4KHZA 2PCLA 5HKKA 4LX0A 4YDSA 1DG3A 3D3QA 1XXHA 3AF3A 3OIYA 3BB4A 3DDCA 5JS8A 4GFDA 5JSZB 1FUKA 4KO8A 1CJKC 3TUZC 3TGPA 1GDDA 3HDTA 2A3RA 4LJ7A 4DT1A 3MWYW 1G18A 1R5BA 1K5DA 1E1RA 4X8HA 2P65A 1UKEA 4JKYA 5J4LA 1U2RA 2PT7A 3VQTA 1P4SA 1L8QA 2V8OA 4AC9A 4PQYA 2O8BA 2IXFA 1G9XA 2IYUA 4LDJA 3IEUA 4P4SB 4PHFA 5F9HA 1W48A 5D3QA 2V3CC 1NKSA 1H8HD 5AWFC 5BYJA 4XD7A 4BLOA 3KXLA 1G5RA 1W46A 1C9KA 2WKPA 1ZVQA 2X8AA 2HLDD 4LC0A 4V0NA 1P9NA 3ZVNA 2IYTA 1VCNA 2NO0A 3CKLA 3QPVA 1S9HA 2REXB 4MUAA 3THWA 2AXNA 4RZ2A 2G9NA 2CLDX 2QP4A 4CEJA 4Q19A 3CPEA 1E2MA 3NHAA 5A5GA 2YNMA 2J41A 5EP3A 3WRXC 2ODEA 3NH6A 1AM4D 1G8HA 2DPXA 1NP6A 2ZE8A 4IJMA 4PAMA 4EIWA 4KBFA 2TMKA 3K9HA 4EJSB 3U61B 2JA1A 3BERA 3VNVA 4O3MA 5FOSA 2QSYA 4JKIA 4G1UC 3SJCA 4QM7A 2ZRAA 3NDBB 2ODBA 3MLEA 5GJBA 2HCJB 2F3RA 1Q44A 5TY0A 2V1UA 1N5IA 2P6NA 1Y3AA 2FEOA 4F93B 3AVYA 1VIYA 3DM5A 1JR6A 2A5GA 4DSNA 2QE7D 1ZP6A 4HYYA 4XH9B 2IL1A 1WB9A 1TU4A 2F7SA 2QZ4A 5KTYA 1KO8A 3QQ5A 1D2NA 3VAAA 2J7KA 4UXIA 2QORA 1W36C 4C2UA 2C9YA 4ZPXA 5LDDC 2WICA 4GMDA 3ADKA 1G8GA 2RHMA 4F4JA 2RKOA 3LFUA 1FQKA 3K9GA 4LJ6A 1T5IA 2ZSFA 4RFSA 2WWYA 1G8PA 1YVDA 1Q1QA 4M53A 1YU9A 2LKDA 4A4DA 5KNCA 1G17A 4CIDA 3A4NA 1E2QA 2XOKD 3LVQE 2JLQA 3PEVA 2BKEA 4KYIB 4LV6A 1TQ2A 1R6BX 4ZI2A 2F1HA 1S96A 2Q3HA 1II8B 4RZUA 3N5CA 3OEHA 2CEAA 3EC2A 3HR7A 1XEXA 2OHFA 1NG1A 3T15A 2VF7A 3JVUA 2IWRA 1OXVA 1MO6A 5K8UA 5HE8A 2AKAB 2ZAMA 3SR0A 4KLZA 2R62A 2ZYUX 3PCRB 3Q85A 1BS1A 1OJLA 2G77B 1JALA 1D2MA 3GJ8A 4KAXA 4G3XA 2AX4A 4IW3B 2VP4A 2ZRFA 2GZHA 1YZQA 1BMFA 1NBME 4IRUB 1JQLB 3ZD6A 2I3BA 5SZKB 4Q21A 2PZGA 1YR9A 3SQXA 2CDNA 1LV7A 1Z22A 3IO3A 1FPMA 2N42A 1KZGB 1W1WA 4G5OA 5HR5A 1D9XA 5IF9A 1KI3A 4DJTA 5HKKD 1E99A 2W83A 3LV8A 1N6PA 2D2EA 4GBMA 1Z2AA 3CZQA 5E7MA 3BB3A 1GRNA 4NYMQ 1R0YA 3GPLA 1XEFA 3O8CA 3DO6A 3VMFA 1SVIA 5BWMA 1B0UA 1Z6XA 2PL3A 1P7CA 4YONB 1PJRA 1DS6A 2XXAA 1ONBA 4BFTA 1DAIA 1E2NA 1KI6B 3AUYA 3B1XA 4C2TA 1TAGA 1G3MA 3KJEA 1YZLA 1EX7A 2IWHA 3CNOA 2ZJAA 3NEYA 4WVFA 1AS0A 1I4DD 3Q3JB 2HF8A 4L15A 1EGAA 5D3MB 3T35A 2DHRA 5FTMA 3QKRB 3QXSA 5DISB 4HLCA 1HUQA 1IXSB 1G19A 3A37A 1C1YA 4FWTA 1PLJA 1TQ6A 4HLDA 4AKGA 4JLBA 2Z43A 3LLMA 3EA5A 3ZDQA 3IEVA 2OBNA 1LW7A 3KKQA 4OHVA 2FMXA 1AS2A 5CIWA 4TLCA 1Z07A 3HYRA 4CF7A 1EG7A 4A1FA 1D5CA 2JJ8A 4JLKA 1KDTA 2DB3A 3KJHA 1QRAA 3K70C 3KJIA 1WRBA 1CR0A 1DAEA 2GBLA 1XJQA 2WHXA 4X8MA 3EWAA 5F98A 5FBWB 2C8VA 4AG5A 1L4YA 4EPTA 5JEDA 1N3BA 2A9KA 4B6FA 3I8XA 4P3YA 1M7GA 4NYJQ 3O8DA 3SYNA 5JCPA 3BB1A 3VR5A 5DYGA 4TMVA 2WAXA 2YYZA 2ZI7A 1UPTA 5AUQA 2AD1A 4OI0A 5UKDA 1KI6A 1CR4A 1V5WA 3PFIA 4OK5A 1A7JA 1I2DA 3N70A 4Q7LA 4I1OA 4FD2A 4W7SA 1ZM9A 4NH0A 2ONKA 2KE5A 1LF0A 4IOLA 3EPLA 2VEDA 2XITA 4V03A 2X19A 1E4YA 2ZRGA 4U00A 4B34A 2QA5A 4EUNA 3OIVA 1IY0A 3P27A 1XCPA 3HU1A 1E4VA 2NGRA 4P33A 4Q4HA 3T1VA 1FP7A 3KJGA 4PPNA 5AK0A 1KI4A 4BZXA 4TMWA 3PEUA 3U7HB 3AGQA 5FBQB 1S8FA 1R0XA 4JYBA 1W0KA 2YOHA 1X1SA 1NRJB 1HYQA 3BFVA 4URWR 4HUQB 2EFCB 2ZREA 3QY0A 3L0IB 3CF6R 2CL6X 4MGZR 1S2MA 1COWD 3MWJA 1NLFA 1YE8A 1SQ5A 4TTQA 3EA0A 2OXCA 3IKJA 4L5BA 4Q9IA 2KB0A 2ODWA 1ZJ6A 1XF9A 2KI5A 4XIGS 2BMFA 3ZJYA 4A8JA 5JHGB 4K81B 1E0KA 2BM1A 2C9CA 4C0SA 4OI1A 2ZITA 1XMIA 1HQYE 4EJSA 1G16A 1FX0B 1W4RA 2EU8A 3W6OA 1JAIA 3TSOA 3V4RA 3BH6A 4LWZA 3CF0A 3B1ZA 3TKLA 1N5JA 2Z4RA 1Z0JA 4HB4A 3B60A 3OIUA 4Q01A 1OW3B 2DWPA 4KI0A 3SI7A 1NMZA 3GEHA 5B64A 5KSZA 2WWFA 1JNYA 4HAVA 2CK3A 2YWGA 3C15C 2OSBA 1E0JA 3PXGA 5BYKA 3O47A 1J2JA 4WW0A 3K0EA 4JLVA 1YRAA 3W6NA 1ZM7A 3KL4A 1E2KA 2FOLA 1O87A 1F3OA 2IXGA 1NBMA 1HURA 1ZC4A 1T3SA 4PQFA 1GKYA 4HLUC 3I73A 1FMLA 4UNRA 3WHLA 1Q3HA 1GKUB 1KSGA 2OT3B 5KU1A 1D9ZA 5KDLA 4FMBB 2YOFA 3UKDA 1V43A 4TMKA 1G21E 1XEWY 2UKDA 1TL7C 1XP8A 1OXUA 2OM2A 2B7CA 4E22A 4A0RA 3DHWC 1NY6A 2AXPA 2R65A 3PUYA 4M1WA 4W5JA 4MDEA 3A4LA 2GXQA 4MKFA 1VCIA 2QPAA 2RGGA 1S1CA 1EESA 3WYFA 5L3SB 2JLUA 1SVKA 3WP1B 1DEKA 1F2TB 3LW7A 1CJMA 4C0LA 1CF4A 2ZE7A 4DIDA 2ZI3A 1HA3A 4QG7A 1K5GA 2W0MA 2W6JA 1Z3IX 5GVSA 3GLIA 2CJWA 1OFUX 5GJVC 3OAAA 1G7RA 2CLCX 2FSGA 1W36B 4HZIA 1LNZA 2WWIA 4WAUA 4OYHA 5L3SA 3QUSA 1CJUC 3EC1A 4FMCB 1BO6A 2O5VA 4PC1A 4TTRA 5DI3A 1GFIA 4I1VA 2QN6A 3GD7A 3L8ZA 4Q02A 4C4PA 2C77A 3GLIB 3LWNA 3EPKA 4PC3A 2BMEA 1GVNB 4DZZA 4Q9HA 2AHOA 4E09A 1X8JA 4MRSA 1E9RA 2F55A 3BE4A 2PZEA 1TU3A 2OBLA 2OUKA 4WA7A 1N5KA 3AVPA 4PZZA 5EE5B 2HCBA 4G01B 5CITA 2I4IA 3RS7A 2IK8A 2QM8A 1XTIA 5LBIA 4LV8B 3TW4A 5KSPA 4RD1A 2QU8A 4QXAA 4P31A 2ZR7A 2HXSA 2FNAA 2P3SA 3PUXA 3CUEF 3B8HA 4KFRA 2OCAA 4D6PA 1TTTA 5CLLA 5AJVB 1UKVY 1KK3A 1AS3A 2ZJ5A 5DYIA 4EPYA 3FDIA 1JR3E 3EASA 3A4MA 1N6LA 2RGDA 2GCPA 421PA 1D6JA 4ACAA 5JRJA 3KFVA 2ZI9A 2ZVQX 4TL7A 2QMEA 1E2EA 3IIKA 1E32A 3Q9LA 3EZ7A 3ZYCA 4PO1A 4D4LA 1GTVA 5JHHB 2IUSA 1RYFA 2XTZA 4TLAA 4HATA 4V0LA 3Q7PA 4I1SA 1NJFA 4O25A 1E94E 4LJ9A 1ZM2A 4BUJA 3LLUA 1MR3F 3KQNA 3QBTA 4OHXA 1S3GA 3AF0A 4BASA 4UNQA 4A8JB 1EFCA 4D82A 1SXJB 4IDNA 3QF4A 1T0JB 1KO7A 2XJ4A 3AVXA 1CR1A 3A6PC 3X1WA 2OESA 1FX0A 3AV0B 1Z6GA 1ZCAA 8OHMA 4H9GA 4EQ6A 3IDQA 3ICQB 2J0UB 4BFVA 2ZIAA 5H1YA 1P2SA 2AFHE 3MWKA 2C95A 1BIFA 1P61B 2A7QA 3TAUA 3OFND 2YVUA 2ZYWX 4LJYA 5KOYA 1CJTC 1QG2A 2E1RA 2XZOA 1ZCBA 3GJ4A 4ZIRB 3NWJA 2ZM5A 1NMYA 1O3YA 1ANKA 1XDBA 2VSXA 2XEXA 1Q57A 1TEXA 4P4UA 5C4GB 4C30A 1A4RA 2RHDA 3B78A 3NBYC 3BWDD 3TSWA 2GJKA 2OZEA 2PEZA 4NCKA 1Z8FA 2WJHA 2XOKA 1G1MA 2PBRA 4E5UA 2EYQA 2GDJA 1K8RA 1P72A 4QGAA 1TUEA 5BXQC 2GK6A 4BECA 1KOFA 4Z51A 2J87A 3VKGA 3V00A 4MYUA 2FGKA 4TSFD 1XD8A 2IUUA 3HR8A 4L16A 1GSIA 1U8YA 3BH7A 1RE0A 1IHUA 4B33A 3L0SA 2P6RA 1HEIA 3ETLA 4AKHA 1OPXA 3FKSA 4TL9A 4DLXA 2B92A 2RGXA 1OFTA 2A5JA 4P4TA 2F1JA 2P6UA 2EFGA 2JLVA 1XU4A 4TL8A 2RAPA 5FBLB 1XZQA 4BRWA 5EXTA 5F9FA 4RSGA 5C4MA 1E98A 4EPXA 1W5TA 1VECA 2ZSDA 1DBSA 1KMHB 1UF9A 2VH5R 2AWOA 3OAAD 2JDIA 1QZXA 4KVGA 4NL4H 4OL0A 4RY2A 4ACBA 4BRUA 1GM5A 3N2IA 3IBYA 2ZRPA 2JASA 4B75A 4UJ3A 3SU8A 4DB4A 5FPHA 4D4MA 3UIEA 1RIFA 3M1IA 3WP0A 3KKMA 4YLGA 3WRYC 4N0EA 1RJ9B 3TSZA 4G5GA 3ZVLA 1AZSC 4UXJA 1ZM3A 2CBZA 3FHTA 2ZEJA 1ZD1A 1KDOA 5JRZA 1W4CA 1KK2A 1WF3A 4NU0A 3PUWA 3EXAA 1BMFD 3BBPA 4H1UA 4NYMR 2B7BA 4F91B 2ANBA 3CO5A 4PANA 1A1VA 1Z06A 4XVQA 5IK2A 2P0EA 3UMSA 3FFAA 2JEOA 4LHXA 4TWZA 2FFHA 2PLFA 3C8UA 4QBIA 2WWHA 2G3YA 1E2JA 4GOXA 2GJAA 4M9XA 4PC2A 4D80A 4TYNA 3MJHA 1GILA 2ZJBA 3I3SR 4IOJA 1JBKA 2AD5A 3PV0A 4PC6A 2CE2X 4MITA 2FJUA 4NKRA 4DSTA 2RH5A 4CEIB 2C98A 2R6AA 3K53A 5KSYA 4IKEA 3ZZTA 2RB4A 2J0UA 4TMTA 2YINC 3Q5EA 3NC0C 1GRRA 3K0AA 5AR1A 2F43B 4MYTA 1XD2B 4HLUA 3Q8XB 3N2EA 2SHKA 4F38A 4TL6A 1NJGA 1DOAA 3MWLA 5IDVA 1OF1A 5HCNA 1DO2A 1UEJA 2AFIE 2ZS7A 1TX4B 2QQEA 1G4AE 2IYYA 1RRGA 4TQUS 1N6RA 2E9SA 1RVDA 1Z6YA 1ZW6A 2GETA 4A0FA 2XSZA 4L8GA 1UM8A 2WOJA 4DSUA 3B85A 3DEFA 1X8KA 2ZE6A 5LD2C 4GZMA 4OKSA 4ON9A 2GWHA 4D4KA 2R6CA 3CPJB 2J7PD 2H5EA 1JQJC 1GRQA 5KPJA 1UBGA 5K8LA 4HDOB 4EFMA 1S3SA 3IBGA 2YKGA 2BJVA 4QGHA 2H57A 2R6DA 2ZRDA 4DLUA 4KFUA 1TQDA 1GP2A 2JGNA 3SBEA 5JJIA 4NBSA 1W0KD 2GF0A 3RNLA 4LC1A 2OFOA 1K6MA 3SYLA 4NTZA 1LY1A 1MH1A 4KCGA 4Y0AA 1SXJD 2VP6A 4D0NA 1DVRA 2J1LA 3BC1A 3U44A 1OH5A 4ZCLA 2WOOA 2W6ID 3KDSE 4HSEA 1Z83A 3UMRA 5GJCA 2KBEA 4XVUA 1W5SA 2A78A 1U8ZA 3ZLJA 3CPHA 2FZLA 4WZBE 1KAOA 4CT5A 1AQYA 1GAJA 4OQNA 4MDFA 1RYHA 5EP1A 3LBHA 2R44A 3U60B 1KO5A 4R2HA 4BFXA 1OKKD 1C4OA 3CX8A 5AUNB 1ZM4A 1H8HA 4DVGA 1DAGA 4QC2A 2OFXA 3EZ6A 4HDCA 4Q9LA 2GEDA 2YJTD 3VNUA 4QHTA 4B35A 3TNFA 1OXSC 5EUMA 5EUQB 3VX4A 4B3CA 2NO9A 3Q72A 4LUCA 4EPWA 2CCGA 3QKRA 5DN6A 2XNDA 3TMKA 3VR4A 4RZ3A 4CW7A 3EG5A 1IXZA 1YHNA 4QGFA 4QNMA 4P32A 1N5LA 3W8NA 3KTAB 1MABA 3BH0A 1NVVR 4JL5A 4ZKDA 4D2IA 4PO9A 2CHVA 2KJQA 2WJJA 5CDFA 3GMTA 4D4JA 5FPYA 1DAKA 3W34A 2O8FA 2ZQ5A 4L4UA 4LHVA 1SVWA 3CF2A 3MJRA 2GVZC 1FNNA 1SKYB 1NI3A 1W0JD 2LWIA 4A2QA 3IUYA 4Q1BA 4B3XA 2V9PA 1E9AA 1II0A 2B8TA 3EIQA 3QENA 5TARA 3NHBA 2GZAA 1AIPA 1SVSA 2FPKA 3FKQA 4XOIA 5P21A 1Z0FA 3ZGXA 1N6HA 2A5YB 4BE7B 1HV8A 3WNCA 3H2YA 3IO5A 4PC7A 3T1OA 3DOFA 1S9DA 4HLQB 1US8A 3AF1A 1E2PA 1IJFA 4XJXA 5FI1B 3TBKA 3R8FA 4DT1B 3ASYA 2IW3A 1KSFX 5EZ6B 2B21A 1M34E 1XMVA 2QAGC 4PZYA 4QRHA 2Z83A 4IFEA 5EXPA 4P0TA 1KSJA 4A92A 4EQ6B 4TLBA 4QBFA 4JLMA 1AKEA 2ORIA 1RC8A 1J8YF 3C5HA 4OHYA 3TLXA 1FMJA 2FPLA 4Z1MD 4PPFA 5BN4A 1SXJA 1GL7A 1XZPA 3FB4A 1RRFA 3PQCA 4FXPA 4LPSA 4QKQA 4NCJA 2OLJA 5HPYB 5K8IA 2IYRA 3SFVA 2VA8A 3TJZA 3ICEA 1TUIA 2FX3A 4Q1AA 4OQXA 1QDEA 2OO7A 1P2UA 4V02A 2OG2A 1OH8A 1DTSA 4KODA 2F9MA 4K46A 2ZRBA 3WY9A 3FVQA 3K09A 1E79A 2ZS8A 1RRPA 4DLVA 1W7AA 2EFHB 4JLJA 4MRRA 1JB1A 3Q7QA 4QHYA 1KMQA 4ZDIA 4TLDA 1NG9A 1AKYA 2NTYC 4C0QC 4GL2A 1R5NA 3GFOA 5AJZA 1OE0A 4XTCS 4AK9A 5DN6D 1VHLA 1ZYUA 2NO6A 3FPAA 2VHCA 1WBBA 1UEIA 1MV5A 3AP2A 1J90A 2BM0A 4BLPA 2JJ1A 1J70A 4HUQA 1MO5A 1TMKA 3I8SA 2PMDA 2MMCA 3VX3A 4Q7JB 4FCTA 3AP1A 3W3AA 4F4IA 1PLLA 2F3TA 3FHCB 3IQXA 4MGYR 1G41A 5G53C 3AVQA 1N6IA 3LVRE 2O0JA 4B2IA 5JJLA 5FR2A 4IOKA 2WWXA 4KXFB 2H16A 2ZUCA 3QF7A 4M9QA 4DLTA 4B2LA 2P67A 3L0PA 4KU4A 4HAYA 1KZ7B 1SZPA 4U5XA 1XPOA 2D2FA 2NZ8A 3L2OB 2QY9A 3CM0A 4KBGA 3ZH9B 2ZRLA 4WZAE 1XTJA 4W5HA 4A0HA 4RD0A 1XPRA 1OV4A 2NO1A 3QPUA 3AQ4A 2BBOA 3P32A 3OHMA 2XB4A 1KI1A 3PENA 1Q22A 1R8SA 4MKIA 4RD3A 4UKDA 4RVCA 4XVRA 4YMSA 3PEWA 3NDPA 1E1QA 2REOA 5GVRA 3G0HA 2GNOA 1ELOA 3UWOA 1ZNXA 3B6EA 3E5HA 3QG1A 1P9WA 1S1MA 1X3SA 1A2KC 1RKBA 3HWSA 2ZJOA 5KO2A 2WPDD 2VHUA 3GEIA 3NVAA 2BBWA 3VU9B 4WZ6A 1VYUA 2JIZD 5K8TA 1QVRA 5JSZA 2QMOA 4ILEA 3B1WA 5L3QA 3GJ6A 5AJWA 4E07A 3QKTA 4XSHA 3SC3A 1SVLA 4NCHA 2QTHA 2FWRA 3RYTC 5C18A 521PA 1ZNYA 2ZI4A 2JLYA 1CKEA 1Q1BA 3BAFA 5DO9A 4YMUA 2QMHA 3AP3A 3PVSA 1IAQA 3HP1A 1KKLA 1OXTA 3ZZUA 5DGXA 2GHIA 2IBMA 3FKSD 4MKGA 4TSFA 4LOAA 4AKEA 1R4AA 3QKSB 2CVHA 1EXMA 1HT1E 3AGPA 1VG0B 3RC3A 3R7WA 1UAAA 1F2TA 1CRQA 1ZC3A 3QXXA 1F2UB 3CBQA 3T1TA 2H92A 1F6BA 4URXR 1II9A 3AKEA 1P9RA 2JLXA 2OAQ1 3VR6A 2BDTA 2C04A 4B47A 4RJLA 1A2BA 2CMKA 5IRCD 1DAMA 4M1OA 2IA5A 1NVVQ 4CZ2A 2QTVB 4DEYA 3U2QA 3FE2A 5CYOA 5JCZA 4BEJA 1SGWA 1FTSA 2QENA 3ND8A 3TUIC 2P5SA 4DLRA 4M22A 4JLDA 3SZRA 3UG6A 3QVUA 1MOZA 4QL3A 4A9AA 2ODNA 3CRRA 1J99A 1BOFA 2JDID 1KK1A 4I99A 4L9SA 5GJWC 1QHXA 2ZE5A 3L43A 2V6IA 4KLNA 1E2DA 3RANA 2WKRA 3UATA 2HT1A 4MRNA 2DWOA 2XZPA 1AK2A 2GJSA 2ZR9A 3F8TA 2VF8A 2A30A 2XJ9A 2O0HA 2V7QA 4KJZA 4FCWA 1KHTA 4TN1A 4EFLA 5BN5A 3THYB 1W36D 3AVWA 2QPTA 1KY3A 2QSZA 1M1YE 2IXEA 4EFNA 1GNQA 4IVRA 3B9QA 2JLSA 5FH9A 3MG9A 4RD2A 4FMCF 4CEIA 3QXJA 4GNKA 3X1YA 3GJ3A 5CB8A 4FMDB 1HY3A 4M21A 1A5TA 1UDXA 2ZRHA 5KHOC 3ZZ0A 2JAQA 3H1TA 3RS3A 2R6GA 2W2XA 4GP6A 4HAZA 3GLGB 3ZD7A 1T6NA 1OYYA 2ZJZA 3D31A 4R2IA 3WBJA 1Q20A 1SXJC 1JR3D 2NO7A 4POAA 1KK0A 4Q66C 5D3MA 4EPVA 1M8PA 4DCUA 3AF2A 1ZMXA 1P75A 1KYIA 5SZHB 2HYIC 5JS7A 3R9WA 1PUIA 4RKFA 3Q5DA 5FOUA 4M1MA 1JPJA 2HLDA 3KQLA 1HT2E 4IEIA 5LB4A 3ZVMA 3I1FA 3OEEA 5JI3E 3UPUA 3HU3A 1M2OB 1WDTA 2R2AA 3RSOA 1MRSA 3K70B 3DOEA 1RJ9A 2F9LA 1OHHD 4KITB 5DI9A 2GCOB 3IILA 4MKHA 2EVWX 2E87A 2OCBA 1RPZA 2GF9A 3FGNA 1IXRC 4GSYA 3P4YA 4QM6A 1E1RD 5B57C 2BMDA 3KB2A 1G8FA 4JJZA 2WWWA 3P20A 1KKMA 3I72A 2QE7A 2O8CB 4TLEA 1W47A 1U98A 4QHSA 4M0LA 1IM2A 4DB2A 3PUVA 3HPQA 4XTRA 1W4AA 1XCGB 2CK3D 1P62B 4R71A 1E6CA 2YWHA 4AYXA 4BPBA 3GJXC 4OBEA 2A5FA 4NYJR 4QNRA 4CVNA 3QSYA 3MRSA 3PJRA 3JZAA 3H84A 2OEPA 4B71A 3DZ8A 5CJPA 4Z54A 2XXAB 5KDOA 2XSZD 3P26A 4Q1DA 2CHGA 1UDWA 4JMPA 4MRVA 4DLSA 1VDZA 3MFYA 4PR0A 1ODFA 2D3WA 4P4SA 5A4JA 1E9CA 3I4LA 4IFBA 1XMSA 1KY2A 4QFMA
chains in the Genus database with same CATH superfamily
3PFHA 2C99A 1KR2A 4I9FA 16PKA 3G7SA 4QOHA 3T9BA 4E5PA 2EOAA 2YMPA 3LCCA 4HEHA 4XSGA 2JFOA 2WTUA 3N2YA 2VS1A 2QM7A 1N1DA 1JAHA 3LQ2A 1KNXA 5I9MA 3A4YA 4CKEB 4MB6A 3THXA 3UK6A 5GOTA 4DR7B 3H3JA 2H2WA 2PQ2A 3VR0A 1XTRA 2J0SA 5HXAA 3EEYA 3JZMA 3KX2A 3KZOA 3ZE7A 1JEEA 4N40A 2BEJA 3T9DA 4B31A 4BZZA 4EL0A 2OBXA 1Q7BA 2YJGA 4LX8A 4QECA 4R6WA 2ET6A 3HB7A 3PDHA 4GKVA 5DEOA 4ZQHA 4NRDA 2BDEA 1JJVA 4C4AA 4E5MA 4KUEA 4INAA 2GCOA 3WL6A 3WLSA 3IHWA 1BFDA 3BHNA 3C74A 3KU4A 3KJZA 3CSDA 3HZHA 2V5UA 4EHJA 4DKJA 1N6NA 2C97A 3M9LA 2O7QA 2WU3A 5HZMA 1P3Y1 5DNUA 3QI2A 3W2FA 5TMPA 5AJYA 1P5JA 1E9DA 2FEAA 2IOHA 2YICA 3NIFB 5GMOA 3NIGB 2W4MA 3GFRA 4NIMA 1RPAA 4JQYA 4MJ7A 4UCFA 4QPPA 4NVRA 4X1YA 4I9NA 2Q6TA 2EFYA 1A5BB 2IYSA 2JZNA 3ED1A 4Z0PA 3REFA 5DV9A 4KGXA 5J4YA 2ZIUB 3ZJTA 4BKQA 2IVFA 2Q6VA 1P2GA 4KEAA 2R6FA 5KQGA 1I6WA 1ZWLA 3FKJA 2WY2D 3CUUA 2WZQA 3AKYA 5HKLA 1WLSA 2ZS9A 1RTKA 3EIHA 4CQMB 1L5GB 1Z4MA 2Z9BA 3O4FA 1BXZA 1HH4A 5E2BA 4D8XA 5JMTA 1ISGA 1KZ6A 3AG5A 2XQJA 3HYTA 4Y2RA 3MSCA 1Z0DA 2F1OA 3DFUA 4G23A 5EKXA 5CYGA 4A6EA 5KYVA 4F2HA 3DP7A 3OPVA 1MZVA 1Q0LA 1ZU4A 2BL4A 4QTXA 2B82A 3H65A 2WKQA 4J1NA 4C3OB 1HM5A 5BNFA 4UD6A 1FYVA 3BMXA 1MFZA 1CVLA 1G21B 4BAUA 1NNUA 5DM0A 4EVQA 4Q4LA 1UM9A 2Y77A 3UWKA 4MKZA 3FMOB 3JQ8B 2C4UA 1FOEB 2ZZKA 1JR3A 3JASB 4D26A 3OZXA 2DPMA 4KVFA 4MLCA 4MWZA 5D3ZA 5TGTA 4MGHA 3RBXA 3CEHA 3IA2A 3WLRA 4C06A 1MAAA 2R9VA 2EBFX 2YXLA 2YHIA 1FVXA 3G82C 4MVJG 2FF7A 5JLAA 3RUHA 1EM8A 5K2MA 1CY2A 5LBTA 3AKCA 2FUNB 1JE1A 4IHQA 3IMKA 4J7CA 5T3UA 1GZHB 4Z1MA 3H2HA 3MEQA 4QUDA 5F33A 4P5PA 1QP0A 5CB6A 3RSGA 2QAGB 3U3XA 1I36A 2ECPA 2ZSBA 1JFLA 2INGX 3O0TA 3ZY6A 1FXWF 1XCBA 3G0BA 1V71A 1WMEA 3L8FA 5F77A 3O8RA 1JW9B 3AK4A 4ITUA 2Q5QA 2ZSHA 3KHUA 5E6RB 2GO1A 4DJ5X 4N41A 3HSKA 2WUWE 4LF4B 4RF5A 2YWRA 1HMYA 1ZD5A 1RXSA 1N8KA 4HEJA 1ZBDA 4RZXA 5JXWA 1X1EA 5EZYF 4IHJF 3PRYA 1BVRA 3EIUA 1H5UA 2GH1A 4S2EA 3ROFA 3SHFA 2H51A 2MSDB 4JQZA 3ABOB 5IXJA 3CLRC 5FT9A 1P7VA 1QG6A 2ZETA 4WHMA 4I0WB 3V4FA 1E4OA 3Q1KA 1Y4ZA 3G6KA 1S4QA 4F12A 4LVUA 5KKCA 3D0QA 2VJKA 1BU5A 2JIPA 2QN2A 3PC8A 5CJ2A 3W1VA 4PEVA 8AT1A 3HB1A 2ZAGA 3I04A 3QVTA 4CMEC 2RGBA 1KJJA 2P5UA 3GA7A 3HO1A 2GKSA 1OLUB 1QO7A 1SUEA 2P79A 4EHLA 1J56A 1PX2A 5AVQA 3CLUD 4CQMD 5SYAA 4XGKA 2VUUA 3KHKA 5AI4A 2IYZA 2HMUA 4DPLA 3ADBA 1KYQA 1NNLA 1TCCA 2F3PA 8ADHA 4ERNA 3OF3A 1KJNA 1MAHA 1P7YA 2VPXA 3NR2A 2X9VA 4O33A 2YS6A 2ZI6A 4YAIA 1JBEA 1WVIA 3GZJA 3NUZA 2OWEA 5TSDA 2ZYSA 3LBYA 3G5UA 4ZC1A 4JJKA 4Q47A 2C88A 1O96B 1AK9A 2A5LA 4AJ4A 3ZKAA 5IKXA 4OU4A 2JJ1D 5CX1A 2PUVA 3K8ZA 3ZWCA 4YPFA 1QZUA 3LDFA 1E61A 2XZDA 3BX1A 2DKFA 2XCOA 1JDNA 3I5AA 4CU5A 1X39A 5F2EA 1WDMA 4YNBA 5DB4A 1ZJYA 3C4VA 3PNOA 1XCMA 3P9SA 4RIGA 3W2TA 4XWKA 1WMSA 3UKOA 2ZU6A 2C2MA 1LV8A 4JR2A 4UJ5A 4C08A 1TJPB 2JANA 2HK7A 2RHRA 1M10A 3UA3A 1P0MA 4JS0A 3CB4A 2VCHA 3GK3A 2VPYA 2GTPA 2XQIA 2RD2A 4MV6A 3TD6A 1REQA 1W9HA 5JARA 3CVOA 3QW2A 2ORVA 4H08A 5JPIA 2QTRA 1OASA 5LQCA 3E8SA 1BH2A 1U0JA 3Q8WA 4C3ZA 3KOWA 3BSWA 4C9BA 2BGTA 1U0EA 2IPNA 3LHKA 4LJAA 4BATA 1ISHA 2BKVA 4NJOA 4RKQA 4FLMA 1MXHA 3VR2A 4X66B 1WHSB 4RTPA 3RUDA 4DCMA 2XNDD 5C4MA 5LVAA 1I3MA 1RAHA 1QOQB 3HUEA 1TYBE 3T06B 4MPRA 1HZZC 1W85B 2GBFA 3DKVA 5KTNA 4PVCA 4QAQA 3RDPA 3ANNA 3P0JA 4BMZA 1DHTA 1KEEB 3TLMA 2ZXEA 3IPLA 2AL7A 4DSUA 3DE4X 3CH4B 1W4BA 3DMTA 3I28A 5F1KA 5K0TA 5E9JA 2H1SA 4MVJD 4ZT6A 1DCFA 5JO9A 3CE9A 1M72A 1VIDA 3BIXA 3WJAA 2BM8A 1CEQA 2HWUA 3EVGA 4F04A 2DQZA 3GY0A 5EXXA 1E2UA 5HQTA 4GLFA 3IIMA 5IVDA 4AKIA 2O0KA 3K6JA 3R0XA 1HDEA 1VIAA 2NACA 2OHGA 2ZDHA 4C7MA 5ICGA 4KYTA 3MWDB 2V0CA 1YR8A 3VOTA 2F17A 3GRYA 1XNQB 4KIJA 4EKNB 1O08A 2D54A 5TDHA 1Y1KE 2WR8A 1ZUHA 4DUYB 1MW8X 5B1HA 4JWKA 2H9YA 5DGIA 3TM5A 1AQLA 4JI0B 4YLGA 3S8MA 4Y1EA 2VPTA 4PSAA 4TKZA 2FY8A 2O0LA 3ELUA 3X1MA 3ZHVA 3W3ZB 4KC0A 1BGWA 4MR9B 4URZR 3RUPA 3HVKA 5BWCA 5CD9A 1SHKA 3KR0A 4YP5A 3CNLA 4ZC8A 4J29A 1K6JA 2XT9A 1ZOIA 1QR2A 2B98A 3ND7A 2VNIA 2P1DA 1U11A 4A23A 2ZRMA 1KBZA 2W4QA 5C34B 5K8CA 2QNIA 3Q6MA 1RFGE 1V6CA 2PLRA 1UM9B 2MCFA 1TQHA 3SX2A 3AHEA 1FMFA 1D09A 5AI8A 1CUUA 3HBMA 5AVOA 1LLUA 3GCZA 3PEYA 3THSA 4P4LA 1QK5A 4FMDF 1ZAKA 4N39A 2X77A 4R01A 5EHXA 3K1AB 5CB0A 2QBYA 2YYYA 1CPYA 3H9QA 1KZYC 3OD1A 4ALIA 3VO1A 1CUBA 1BDIA 4GAEA 3CKKA 1UMCA 2J4DA 4WSOA 2J9FB 2OYCA 1WA5A 3DR5A 5KTRA 4IIXA 5G0UA 1YJAA 2QYOA 3U0BA 5AIAA 5ALOA 3IAM1 4HT3B 4BBAA 4Y98A 1D2EA 2AXQA 1K06A 2GK4A 3REOA 2VYCA 3WRXA 3RRBA 4M38A 2OCKA 2R8RA 1N33B 1DI0A 3WLIA 1OLOA 2ZJ2A 1LSOA 1CXZA 4NNPA 1H2HA 2AW5A 1DBVO 1Y6QA 3D7MA 4BWGA 1OB5A 4CQNA 3NHYA 4EUHA 1LW6E 3N8GA 2DT5A 3E9EA 2O8FB 4CV3A 1M1XB 4G9BA 4A5SA 2QL7A 1M8FA 2P0YA 3G1UA 4YMTA 1CEYA 5BVHA 2HSGA 2ENWA 3B7GA 2MSWA 3LX8A 2QL5A 3RS9A 3V4SA 2C96A 2QOEA 1JQKA 1M66A 3RK1A 5JWHA 3C3YA 2JW5A 3GLFB 1IY2A 1N78A 4O4HB 4P7JA 1CDDA 2GAOA 4ZV4A 5B55A 3C8DA 3P9QA 2ZJ0A 5DXJA 1YJXA 3RRJA 2AVNA 3TRFA 3RVBA 4MP8A 4KAFA 1TZKA 5GV8A 1MAVA 1P4GA 3DUWA 4R69A 4CR7A 4ZYXA 2TYSB 4JL6A 2JCSA 2FKAA 4DV6B 3GP3A 5M7EA 1KMHA 5EVCA 4DV0B 4LWOA 5AKZA 4MB2A 1U7XA 3EISA 1LF5A 2XRFA 4LSWA 4LI3X 3E70C 3K0CA 2GN6A 3L18A 4TXNA 3W1WA 2LV8A 1LI7A 1W25A 5EZ5A 4RPGA 3JAKA 4UATA 3GRUA 1QJ4A 2O9JA 3D6TB 2DWCA 1GTRA 3I62A 1O6CA 3GHHA 1Z6TA 5CDHA 3DWFA 3AR3A 5J63A 2QTGA 1H0RA 1DBQA 1MIHA 2QG4A 4PINA 4UXHA 3WK5A 1Y1TA 2P2LA 1RZRA 2CVFA 2P40A 2VYVD 3HUFA 4UBIA 3GPIA 4WNIA 1MJGM 1TTPB 4G1MB 2Q7OE 1UXIA 2G25A 3LYHA 1YL6A 5TMDA 2PH3A 3FMPB 3ZLBA 1PWZA 3BFJA 3V1UA 4MICA 3JWEA 1TT5A 1A7AA 4NV3A 4OQFA 3S3TA 4CMCA 2B6HA 2AKYA 2QUAA 3D0RA 4H0CA 3TINA 1G7TA 1CNEA 2Q1UA 4TS9A 5DK4A 3B5IA 1PF7E 5ERYA 1E1CB 1QWOA 3BG5A 3RREA 4ZOEA 3BFKA 3I05A 5A0TA 1PFVA 4BGVA 5FUBA 4MYHA 4K9PA 5F51A 4E94A 3ZCXA 2WD9A 2PX4A 3PWTA 1MOSA 3TF5A 1U7DA 2J6CA 3I0MA 4M1EA 8ATCA 4CKBA 2NSJA 5NLLA 3VAYA 3ECCA 3WYCA 2OILA 1H5NA 1MGPA 3ED5A 4B6RA 3ZDXB 1UPFA 2RG1A 3KLPX 1U28A 2Q4EA 3WBKA 4A2PA 5I8WA 1QHGA 1Z7WA 4ESVA 1EXWA 2EKBA 1YR7A 2G76A 2HF9A 5F7JA 4G0UA 1RBQA 1WDLA 4G07A 2ZUVA 3J81k 4BGIA 1OXBB 1OZHA 1ZJWA 4F11A 3KM0A 1GSHA 1BHQ1 1LGYA 4NV0A 4EGCB 2BGJA 3H17A 3LQRA 4OXNA 4DSAA 4ESOA 4CKBB 3IEPA 1XVTA 4W5TA 1GHTA 2HSWA 4O2AA 3I61A 4PQGA 2PGLA 2JATA 1GOTA 3CNBA 1M6EX 2X0IA 4H6XA 8ABPA 2C20A 3NDJA 1T26A 1UKYA 2BEVA 2FFRA 4FX2A 3KT0A 4MO9A 1UP6A 4MJLA 3B1YA 1EFRD 2EQBA 1VMAA 1UBFA 3A1SA 1A72A 2Z8XA 3JARA 1IQRA 2RGNA 4HFRA 2GS9A 4S1NA 4YQZA 4E51A 4ZCMA 3A6KA 3RADC 4IDHA 3CNEA 3QE2A 4IIUA 3AONB 3HM9A 3S1SA 2I8AA 1UBEA 3X1KA 4CKCA 2GARA 2WYVA 4IR7A 3A1NA 3PGVA 1GZ3A 1VRVA 5DASA 3C6XA 4ER7A 3FVRA 3VZCA 5EJEA 2Z6QA 4IL5A 3IPXA 3UAOA 1U2GA 2ODTX 3ZWPA 1R6XA 1G1AA 3IAXA 3LKVA 1F60A 1WXGA 4NMHA 1K7YA 3BWCA 2AOWA 2PTGA 4CLOB 3FLAA 4KO4S 3KSZO 2NU8B 4BNNA 3HYSA 4DMKA 5DM2A 5BR7A 2VYFA 1YIAA 3W4JA 1NVXQ 1P1IA 4DJEC 4DA4A 3I9V6 2G71A 2IYOA 4PNZA 3PQ2A 3F6PA 5H3CA 3SJAA 3ZHXA 4GM0A 3IMEA 4C0HA 3NBFA 4HQKA 1FNBA 1MQSA 2VPWA 1ZO8A 2RK4A 5DSTA 2I67A 1JAXA 1P39A 4CT0A 2QP9X 1EINA 3RYHA 1F4PA 4DPKA 5DCYA 3WMFA 3VNUA 3AZOA 5FTNA 3ZVRA 5ITVA 3I5XA 3NAGA 3HDYA 3EXHB 3OZWA 4JVOA 1V9SA 5ALHA 2WKWA 1PJZA 4H1HA 4D81A 4X95A 1AO0A 3LKBA 3SF8B 3JZDA 5B5SA 2DPHA 5DMXA 2NW6A 4Y2VA 2GXSA 1JRLA 1MX1A 3M2TA 3OJOA 4GWLA 3SBXA 4W7IA 3GQVA 1DBIA 3BMNB 1CRPA 5K1ZA 2AA3A 1JU9A 1KYTA 1U94A 2AWNA 3ABIA 4MUBA 2HPZA 3E3AA 3FBWA 4CI9A 1YTLA 3FNQA 3SHWA 3G2LA 4XYLA 1VFNA 3GRAA 2R48A 2QG6A 2ZWMA 3GZNB 4TS4A 4ZYUA 5A1TA 5C1BA 2R3SA 3HDGA 4H7DA 3DOJA 3P2YA 4B09A 2VWHA 4MUKA 2RGCA 5CLFA 2C4NA 2VP9A 3QTTA 6ADHA 3NQ41 4ZGWA 2XQGA 1P9LA 3HY6A 3LUKA 4LXIA 3HB5X 1QRRA 4N12A 4NABA 1NXVA 5CVEA 4A3SA 4JT9A 2CFOA 4QVKA 4Z8XA 3WNBA 3PKZA 1E1MA 3FZYA 1ILWA 2ZXUA 2A9OA 5I5GA 4LMPA 5JQWA 3HM2A 2XNSA 4ZANA 4NH4A 1NNI1 2B5WA 2PKQP 4HC4A 3EDYA 4ZYVA 3ZCVA 1T3HA 2W00A 5B58T 2WJ3A 4I50A 4EKEA 5FV4A 3L4KA 2BEWA 3OH8A 4Q48A 4KDRA 4G0ZA 4RE6A 1K1EA 3K09C 2WIBA 5AW7A 2K2WA 4MW5A 1BMQA 3FTPA 1MRNA 1SXJE 3BRQA 5K8JB 3COWA 2DYKA 1X2EA 5LQDA 2ADOA 3O75A 1JLLA 4CYMA 2ZROA 2EJTA 3NGMA 4EG1A 2ZBUA 1S4MA 3CUKA 4QGGA 3CX6A 1US8B 3IMFA 2MIIA 2Z56A 1ENYA 3C16C 2HDWA 1ECFA 2HXGA 2Y1XA 3HO6A 2CLKB 2W8BA 2VSFA 1POWA 3M9XA 3M5CA 3R09A 1CDZA 2V1XA 1T6ZA 5H68A 1HQCA 3QKWA 4MWCA 4C43A 1UMDA 3O92A 3VPGA 4QYMA 3V8NA 4RY9A 4Y2GA 1CS4C 3IAS1 4OB8A 1UKAA 2D74A 1NBOA 4M1SA 3O8OA 5E1OA 1EEHA 1K4MA 1OXXK 2HZBA 3LUBA 2I65A 3COPA 2QNBA 1NWHA 3TRIA 2WVAA 1M1YA 2JBAB 1XHEA 3G0CA 3MBOA 5K4AA 4D1YA 3OPXA 3P5SA 3G2MA 1T9CA 1VA5A 3DVLA 5IN4A 1YZHA 4RJIA 5TPZA 1OZFA 1RR6A 4LSMA 3WHKA 3GZNA 3AF6A 3JAWA 4MRMA 4RCVA 5K8VA 1IN8A 2JFHA 3BFPA 4OQ4A 4OJQA 4JXXA 4QPCA 1R00A 5BSRA 3EZLA 1E9EA 1XDSA 4MVJF 2COEA 2P8JA 1N9KA 3KT8A 3R3ZA 5CDFE 3UXYA 1JQ3A 1H2XA 4DDVA 3NATA 3DV9A 2JPDA 3SXPA 3GLFA 2NYUA 3TPCA 5JDCC 3ZLUA 1VL1A 3F78A 3M0EA 5BMVB 1E3LA 1AKRA 2HJVA 2QUBA 2P2DA 1KXJA 3D6FA 5HSGA 4MRPA 4RHFA 3VU8A 2X0FA 2HLHA 3RHTA 1V3TA 1ISPA 1K97A 1FFGA 1IY9A 3B13B 2F1IA 4JVSB 4B76A 5AM5A 3RGWS 4D79A 2QUZA 3W79A 4KQ1A 3NX4A 5K3SA 2C29D 2GNAA 4OXXA 1MC4A 2I62A 3IP3A 5BSUA 5TV2A 1DAPA 2BC9A 1PWHA 4YUVA 3F73A 4UU8A 1T0IA 1VG8A 4Q1CA 4CGZA 2H48A 3STHA 4IWNA 2AFVA 1P77A 3CISA 2D13A 1AT1A 1N2OA 1BHSA 1WVGA 1ZINA 1T9DA 3BDVA 3SZMA 4DNXA 4DRZA 1RI1A 3R5XA 2FSHA 5EQJB 1G6OA 3COZA 3OBBA 2Z2KA 4B9AA 2VK1A 1I0LA 2WSYB 5ER9A 2PA0A 4ARSA 5BR8B 4EVIA 4DM4A 3RKRA 4OYLA 3U13A 3WGKA 2UYGA 2ZLBA 2P9JA 1N2ZA 3ZCRA 2NIPA 3RS8A 4DA7A 2WSSD 4P93A 3B1VA 3DZKA 4KH0A 3WWDA 1OVGA 1ZMBA 3F7OA 3K32A 4GOKA 3H1GA 1KOLA 3ZYZA 3ILVA 3PR1A 1RW4A 3G7UA 4J49A 5ALKA 5AXCA 1PR3A 2CCKA 2O3RA 2TMYA 3PUHA 1QOZA 5JWRA 4BFUA 1IE3A 2CL7X 1UFQA 3MTQA 5AW9A 1KE2A 3PEFA 3KUCA 5AD1A 621PA 4CG0A 2X7XA 2V6JA 1Y42X 1ZGAA 1K9SA 1UAGA 1UPBA 2PCJA 4OM7A 4U8HA 3GC6A 3FTNA 5DX1A 3RNOA 3SXUA 4ZI3A 5B2EA 1AVTA 4YQEA 3W3AD 4IHKA 1W8IA 3I39X 3A1VA 3LCUA 4MMYB 3CRVA 4P4GA 1H65A 3L79A 4YI5A 5FUVA 1VB5A 3DF7A 2Y68A 3MA0A 1M1UA 1U2TA 2HJGA 1VRCA 3C3DA 1VLLA 2HBRA 2WMDA 4IOMA 4YJGB 4EPRA 4GOJA 4E08A 5IAJA 3HVRA 1XMOB 5AKHA 3L6EA 2QR5A 4W1PA 4EYEA 2JIZA 1BXKA 1OYWA 4KV9A 5H16A 4RPJA 4EYSA 2VAMA 3H5NA 3F6SA 2P4HX 1NY5A 3OI7A 2HV8A 3OM0A 4LMAA 4U7WA 1CTQA 5LYYA 4A7PA 5IHPA 1GADO 3RT1A 4NAUA 5AOCA 3TAHA 2X0RA 1NC3A 1E8NA 4KE9A 4ENQA 1LDNA 2X2OA 2A33A 2VCEA 5AVVA 1XRPA 3MQFA 1WMAA 2VHZA 3SBDA 3H16A 4B74A 1VP9A 3QHPA 4HDQB 1B6TA 4W8HA 2FYTA 1HDCA 1JEDA 4RL4A 2LGJA 2X23A 4ZOBA 5DOZA 3AY0A 4MVJE 3VHXB 1XTTA 1DE0A 4UNSA 1U9IC 3K16A 4K9OA 1AUVA 4O0MA 3UHAA 1X8LA 2DC1A 3LQYA 5FO0A 3HCDA 1W5BA 3QEKA 4Q05A 1G63A 3E8XA 3AFNA 1J0EA 4S35A 1Q95A 3KD3A 3HLKA 4GRDA 2VQSA 2WSMA 1CY0A 4PCLA 2FZ5A 3RVJA 2CVQA 3VPHA 4KPEC 5DWDA 5FB3A 5J1SB 1XTZA 2ZQZA 2XDWA 1GKIA 3GLHE 4L95C 2ERYA 3WAKA 2PLNA 4OHBA 2OGSA 4YMHA 2RGAA 2F3UA 2J6BA 3C6ZA 1Q50A 4FW9A 4W5WA 5TF4A 3S68A 4QU9A 3L07A 4H1VA 5TX7A 1KNQA 1FTQA 1LEHA 3RT9A 1JLMA 2YHSA 4MA4A 1QGOA 4Q39A 5DBGA 3VDNB 2DFVA 2OV4A 3Q7EA 3ODGA 4R51A 4YCLA 5SZJA 3ONWA 4ZCRA 1TFUA 1QP7A 5I7FA 2KBFA 4AFNA 3F9CA 3U7FB 1P1BA 2WJPA 3OQJA 4KNVA 1LDYA 2O1WA 3PBKA 1FSGA 4QASA 1GG9A 3DMFA 2ALJA 4NCIA 5A1JA 1CJSA 3ZD9A 2OHOA 4LQCA 3RAPR 1D04A 3BULA 3R20A 4I46A 1MZPA 1R27A 1DC6A 3AEUA 1KI7A 3NG1A 4XLTA 2N1BA 1MO3A 3G2OA 4YRLA 1BU8A 2P5TB 1GL3A 3EFBA 4NE2A 4UBNA 3RV4A 3WIVA 4AG6A 3QX3A 1GZSA 2AE2A 2QL9A 3HY4A 3WISA 1GA6A 1YR6A 2LW7A 1B3RA 2BTOA 4PTLA 1E79D 2WHRA 3HDJA 2J3JA 3FWNA 1ZK4A 1V1RA 5EXDA 3SS8A 2RGNC 4OK6A 4DTCA 3G9TA 2D4AA 3NTVA 4OXIA 3EAGA 4QJ5A 1T0PA 5U4XA 2JF0A 4PHCA 1II8A 1P1HA 3LD9A 1CRLA 1L7OA 3LPLA 2WVJA 2WMNB 3UMBA 3PGMA 3T4UA 1WQ1R 3HLTA 2D1RA 3GA5A 2EZUA 4R9UC 1VCMA 3TE6A 1Z29A 221PA 4J2HA 3ZW8A 4CLRA 4AI6A 2DZDA 4OL9A 1V1RB 3PUIA 1OFHA 4MWDA 4KXNA 5D01A 4EMUA 1L5HA 4MARA 1YTUA 1W2GA 4G0XA 3CQ9A 3IIEA 2FPXA 1WU7A 1XD2A 2WUGA 3TFWA 1NW7A 4F1WA 2GN9A 1ARZA 3PQEA 5HRAA 1EUCB 3A8TA 2H59A 1U28C 3O1LA 3TLYA 2ECQA 3DQPA 1H6CA 4LRXA 4NMWA 1ID8A 2WKSA 2RH9B 4LY6A 4YGYA 4M83A 5M2QA 1PV2A 1SBZA 2ILTA 1GCIA 4FYVA 4G4GA 1RC0A 3K2BA 3NWEA 1FDSA 4QWMA 3VSDA 3ITEA 3K73O 3WXMA 3ZUGA 3R8FA 1ZIPA 2HREA 5A7FA 1NVBA 2ZI5A 4Z3DA 5DYNA 3I4CA 1Q1ZA 1Y1QA 5BOSB 3ZV3A 3H2GA 1BJTA 1IEVA 2FN4A 4FOSA 2R4UA 4R2MA 5AMXA 3KQKA 3T5DA 2JJMA 3HN7A 1T3LA 1SRRA 3G2KA 5ALPA 3C85A 3A06A 3NASA 3N2KB 4Q4AA 4TYQA 2GILA 2BHRA 4DA9A 1D5WA 4FZJA 4M9RA 1HDIA 4NZMA 2DH5A 1AA9A 2ETVA 1GEGA 1ZEJA 2EW2A 5CURA 4OJNA 1T34A 1W0JA 1U0HC 1XQ6A 4RSMA 1T29A 4B7AA 2QD2A 1ZD9A 4YMIA 1CUEA 1XD9A 5KQSA 3VYSB 2RK3A 1YFZA 4LOHA 4PZ0A 4O2BB 4EY3A 821PA 2E4ZA 4W8GA 5ENVA 1A88A 1GPYA 4EGSA 1C5KA 5AICA 5HDQA 4RXMA 4KO2S 3K1JA 2BRUC 2X86A 2ZRKA 3EXHC 3N75A 3WGOA 3WB9A 1EGHA 3ITNA 4L5CA 3AETB 1ML4A 4XX0A 1VLVA 2VPZA 3PIIA 4MKRA 4CIBA 1ZY2A 4XGRA 2B4AA 4K03A 3DONA 3SXUB 3VVCA 4TYYA 1V2HE 1RAEA 2Q3FA 1YQWA 4EHHA 4ZRNA 1EMDA 4FYYA 2OOKA 1SR8A 3X1XA 3DLCA 2BONA 3WYDA 3UAYA 1RSZA 2PUDA 4GX2A 1S01A 1RDFA 1YJQA 1VLJA 2QRZA 4FEGA 3WRWA 1PK7A 5FADA 5A5FA 5DE3A 2C5EA 4NK5A 1NYQA 4IXWA 1NYLA 4UBOA 4J1TC 2X76A 1WO8A 2A14A 2HK6A 5IAKA 4GECA 3QEMA 3M8KA 2VHTA 3O2NA 4HX5A 1TGVA 3SYKA 4I55B 3UY4A 3DPSA 4EG7A 5ADHA 4D96A 3SIWA 1FFCA 3AEKB 3RLIA 3OOEA 2QTFA 4NG5A 3SYTA 3V8EA 2ZTSA 4DCGA 1R18A 1O94D 3GAAA 1BRMA 1LK0A 3B12A 1HPLA 3GFTA 3VU9A 3W2EA 4FC7A 4PZDA 4E3ZA 5I3ZA 2IHUA 3GNQA 5E2AA 2IHNA 3U4MA 2I1VB 5K9ZA 2ZR0A 3BZUA 1VYTA 2QROA 4V0ME 1VL2A 2NAPA 4II7A 4D99A 2QJRA 4LBVA 5KSOA 1LRLA 3AESA 1WCV1 4URUR 2ETXA 3CC8A 3PJFA 1YC5A 1I3LA 3A6GA 5CH5A 3T5PA 4N4AA 3V9PA 3K0FB 3LCJA 4JEHA 4AF6A 5LPNA 3WADA 3QVWA 5KTKA 1KA9H 3BORA 3AERB 2ZCVA 1X1BA 2QRLA 2AQ8A 4BFYA 5ICCA 1M9NA 4QYWA 3S40A 1U8FO 4OQQA 2BGNA 1ENPA 3S1AB 4XX1A 8LDHA 3AYXB 4AQYB 2QJFA 3V97A 1IEWA 1MA0A 1G0OA 3O9ZA 4CWAA 1OILA 4JLOA 4JJIA 3UW3A 3LUPA 5IT5A 4LFAB 1E1QD 5HF6A 1YGYA 1SKYE 1JBQA 2B20A 2DKNA 2X2EA 1L7BA 4TT3A 4DC9A 1ZXLA 3HN2A 3HJNA 1Z28A 3ORFA 5HTOA 1VPLA 1X1QA 3H1BA 5KX5F 3C3PA 1OAOC 1ZUWA 4I1IA 4AYWA 4HWSA 1H9BA 4RC9A 1XTUA 1Z47A 3IT2A 2WIDA 5BOVA 1IULA 1BCSB 4Q7KA 1D1QA 4IIVA 2A9RA 1ZXBA 2VXBA 1NNSA 1VE5A 2G80A 1ORTA 3WYEA 1ZONA 4AT1A 3EGIA 2D7DA 4RUKA 3CZCA 3P9NA 3V4ZA 4Q4DA 3HFRA 1T24A 3DMNA 4B3FX 2G9UA 3B2QA 4IDPA 3D1LA 2HF2A 3L77A 3NDIA 4KWTA 4JOQA 4BNLA 5HHTA 2F8SA 4CV0A 4OHWA 3CZPA 1ESMA 1IQPA 1E7MA 4MRMB 1RFLA 4R3NA 1E1NA 1ISSA 2ZIEA 5F4ZA 1DFGA 2IHKA 4M9UA 3A28A 4LA4A 1QHFA 2QQ0A 5JJCA 1QDUA 4OAQA 3WHPA 1VCHA 4PYRA 5TVKA 3NBMA 3FR7A 4CMGA 2K6GA 2RJ3A 1B4DA 3EWSA 3LA6A 4US2R 3CU5A 5IXYA 2NQTA 3VU3A 2AI2A 1HKUA 4QXMA 4DLSA 4BFWA 1T9KA 3RFXA 4R1LA 4HMPA 3K0SA 1XXHB 2VYVA 3RQSA 2Q5OA 1IUPA 1JEJA 3JYOA 2W98A 4Y6RA 3ZDFA 3KB1A 2H3EA 2NP6A 1U3UA 4MPJA 4LSZA 4M37A 1NTRA 4CIXA 1J9EA 2PSSA 2XB6A 4PHHA 3SJBA 5GAJA 1NL3A 4HDRB 4YRAA 2WI8A 4FGKA 1DQPA 3DOIA 3FYUB 5HKKA 4LX0A 5DGHA 1FYWA 4YDSA 3HRKA 3D3QA 3OIYA 2OO5A 4HS9A 3PPXA 3NHZA 5JS8A 5JSZB 4GMFA 1U0SY 4QFCA 4QGBA 2LXNA 2D3TA 1DIHA 1U3GA 3HJTA 4AMUA 5LKAA 1C8BA 4BX0A 1I6KA 5E9AA 4TS1A 4RKYA 3AI2A 3DKKA 4EGFA 5CBKA 1C50A 2BELA 1YR2A 1TYZA 3EGDA 5YASA 1GU7A 5IT0A 1SBCA 2O2DA 1WULS 1JB9A 3BXXA 3VQTA 4WX2B 2V8OA 3QU9A 2A92A 5JS6A 3DDNA 4AC9A 4IKPA 4BPRA 1C3VA 3E4CA 1ZVMA 3DPIA 3BM5A 3LZCA 2IXFA 2PMWB 4PPGA 1DOZA 5G0VA 5CT8A 1NKSA 2GAIA 3EVDA 1UC4B 4XD7A 1SUPA 3KXLA 3T1NA 2HX1A 1G5RA 2X0KA 1XZ8A 1WDKA 1ZVQA 4FGWA 2HLDD 1BX1A 4V0NA 4E5VA 3K5PA 1CQJA 1MBZA 1VCNA 2IYTA 2WWTA 3CKLA 3QPVA 4A8PA 2QG9A 5C0OE 3THWA 4WNAA 4K8RB 3ESAA 4ARIA 2V3VA 2EQAA 4JYMA 3DA8A 3O84A 3UC9A 4GE0A 3RAJA 2IELA 4CCAA 1VI5A 3A6DA 3FLEA 4UZEA 3PJEA 1G8HA 2DPXA 2XNJA 3WRXC 1NR5A 4ZTUB 3GRKA 2FWPA 1FFDA 3W3AH 1YL5A 2O2ZA 3BERA 3T41A 3VNVA 3JWIA 4PO3X 1IM5A 1TZCA 1AK1A 1NX6A 2A88A 3LCRA 1J00A 1MQ8B 1Z0ZA 1HTBA 2ODBA 2R5WA 3BHJA 2LE0A 2F3RA 2VEOA 1YRLA 3R3XA 5TY0A 1BXRA 3TGWA 3UWSA 3PX3A 3V1MA 1K08A 2P6NA 1KEVA 1X0VA 3KFLA 3AVYA 4FC6A 1VIYA 4JCCA 1LRKA 2WJWA 3ZY5A 4DSNA 2QE7D 1WB9A 4AO6A 1TU4A 1SY7A 2F7SA 5LLSA 4DEVA 1ONOA 3DV0A 3QQ5A 3HXKA 4UXIA 2RGRA 2CNDA 2QORA 2H08A 1JTFA 2GBPA 1BS2A 1UPCA 3RSHA 2RHMA 4NY1A 1L4EA 2EKQA 5DYTA 2JFXA 4WXEA 5FCDA 2JJYA 4ZMRA 1V6AA 2D1SA 2X8LA 2WWYA 1NW6A 4UW9A 4C4OA 4M53A 1PCXA 4Q16A 2W2KB 1A7KA 1OVMA 1E2QA 2AYYA 3TTVA 1UT8A 4NU6A 4XJTA 4KFCA 2JLQA 4AZ0B 5AO9A 3MCTA 3I5MA 3LCMA 4Y2XA 3ZU6A 5DNCA 1H2ZA 4RPIA 1HFKA 1S96A 5CCDA 1RXCA 1II8B 1RU3A 4RZUA 3WO0A 3HR7A 4NQRA 4IGIA 1L7RA 2XCLA 3AOEC 4NBVA 5E1MA 1A76A 2P27A 3ECAA 3JVUA 5JNRA 1LTHR 3I1YA 5CLGA 4CKCB 3HRIA 4H17A 5JD5A 1RQPA 3SR0A 4KLZA 1RNLA 1GA4A 4WBNF 1QIDA 1PT6A 1BS1A 1OJLA 1TQ8A 1BKSB 4NFYA 2VF2A 3JASA 4B4UA 1XPJA 5JU6A 4CDNA 3ZVKA 1A2OA 2AX4A 1XA0A 1T3TA 4M6WB 4R8VA 2BMVA 4FDTA 1K4KA 2VP4A 2ZRFA 3KSRA 3TL6A 4DB2A 2PVSA 1TD1A 4XWWA 3H99A 1YZQA 3V4OA 1HR0B 2W42A 2QTCA 1XQ9A 4N0QA 1JZTA 1JLKA 5DX0A 1JQLB 1P31A 3L1KA 1QQ5A 2E55A 2KW5A 1X1AA 1N5DA 2I3BA 3FUCA 3F2VA 3LKZA 4BCDA 4EB8A 3UXHA 4KACA 5F64A 1NTOA 1T15A 1YR9A 3VBEA 4B6QA 3SQXA 3FPEA 4DJAA 1PT9A 3IO3A 4Y6LA 5IYZF 3QI7A 1R15A 1KZGB 3D2LA 1CF2O 3K9QO 5HR5A 4DR6B 1VKNA 2CVZA 2E49A 3CT6A 4FONA 1IHDA 2BP7A 2W83A 4FGUA 2D00A 5ICEA 2E7ZA 3Q7TA 3DBRA 1HDRA 2G82A 4HNTA 1L5YA 1N5RA 2VHXA 3RPEA 2HHCA 3GPLA 1B0UA 3L49A 1SXPA 3WNZA 5C5CA 1NVTA 1DS6A 3UEOA 3DTNA 3DLBA 4RPLA 4DR5B 1ONBA 1IBSA 4E15A 5KEIA 2R5FA 4KL8S 3AUYA 1OR8A 2QT9A 3E61A 1JKJB 2R7NA 3DAOA 1LQ2A 5DGCA 1YZLA 1G8JA 1EX7A 1SOWA 1UT5A 2QTMA 2XIJA 2PZBA 2WU1A 3Q3JB 4OLBA 2HF8A 2POQX 4FFOA 3N9IA 4HK4A 4L15A 4QUKA 3G49A 5EIEA 1F7UA 5D3MB 3VO8A 4FYHA 1D1PA 1ONNA 3ZXIA 2RJOA 1LJLA 1BTOA 4G4SO 4IMJB 4PG6A 5K4HA 1Y3FE 3QXSA 5DISB 1E63A 2HD4A 1HUQA 4FB4A 3A37A 1C1YA 3DBOB 4ZVQA 2ST1A 3IJ5A 2IY9A 4FWTA 4LEIA 3DHYA 2QD4A 1ZIDA 2VDNB 1NLUA 2JGJA 3FWKA 1LW7A 3N0WA 5CIWA 3HSYA 1Z16A 3Q88A 2DCMA 3HYRA 2EZ9A 4CF7A 1A96A 3WDMA 4A1FA 2ZT6A 1V5IA 2PBFA 3AOEA 5LXTF 2JJ8A 3T3OA 2VTBA 1F0NA 2H1CA 2ZUTA 4TZTA 3P2OA 2DB3A 3DVQX 1RJWA 2AJTA 2OD9A 1ZH2A 4Y18A 4MWSA 5BP7A 4CMEA 3WGNA 3FNBA 3I9JA 2CLIB 1BSVA 5EEGA 3TDMA 2J09A 3EWAA 3Q7IA 2VQDA