2WM9B

Structure of the complex between dock9 and cdc42.
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
179
structure length
179
Chain Sequence
SHMQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Activation of Rho Gtpases by Dock Exchange Factors is Mediated by a Nucleotide Sensor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
molecule keywords DEDICATOR OF CYTOKINESIS PROTEIN 9
total genus 55
structure length 179
sequence length 179
ec nomenclature
pdb deposition date 2009-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2wm9B00
3RRNA 1SQ5A 4QJ5A 1NY6A 2JLXA 2O0KA 3KQNA 1NF3A 5KUTA 3QBTA 4I1UA 3IEVA 1EFRA 2P65A 3QI2A 1KK3A 1AJEA 2REXB 4AKHA 1WBDA 1GITA 1PZNA 1YZKA 1T91A 2G9NA 3I8XA 1W36C 1K8RA 3PITA 1A2BA 1E6CA 4P3YA 4DWJA 1OKKA 4KFRA 4KCGA 2WAXA 1BH2A 2EYQA 2ZJYA 1UEJA 2B8TA 3B9PA 4R9UC 4KSCA 1CRPA 3QPVA 2K5UA 4HYYA 4JL5A 1ZU4A 4ERNA 3EZ2A 3X1ZA 3OEEA 3IIKA 2YWFA 4JYCA 4DLXA 5CITA 5EE5B 3KFXA 1Q1EA 2YOFA 5LB4A 1KI2A 4E07A 4DLZA 1EGAA 3KTAB 3ASZA 4H1VA 4B6EA 3GLHA 3Q7QA 2P2LA 1E3MA 4GOJA 4C0KA 1QHGA 1KO7A 4JBWA 4JBYA 2PLRA 3KKPA 4X8HA 2XZLA 4XSGA 2UZ3A 3J81k 3B7GA 2VP5A 4TQAA 5GJCA 1G5TA 1D9XA 2GETA 2GRJA 4TT3D 3KKMA 1S3GA 3DM9B 2AXPA 3TMKA 1TEVA 1OH5A 5TDHA 3SE0A 3SC3A 3K8YA 1RJ9B 4F4JA 4G01B 2GILA 4EPYA 1GM5A 4PANA 5JJLA 2P5SA 3F0TA 4C0SA 3EPJA 2VP6A 4B74A 1E2HA 3U7HB 2Q3HA 1NG9A 1W2HA 5FTKA 4CEIB 3UMFA 4A82A 4HAWA 2OM2A 1KI3A 3DMNA 1NBMD 3NC0C 4ZDKA 2QP3A 1COWD 1E2PA 1LS1A 1NSFA 1D6JA 3AV0B 4RZ3A 1TU4A 5L3QA 1G3IA 3KQLA 1IY0A 1UBFA 3TLXA 3SJAA 1AM4D 4PQFA 2BEKA 1IN8A 3K0FA 4M1MA 2C99A 2F55A 1MABA 4WAUA 4JL6A 3CRMA 2OXCA 3CR8A 3VQTA 4GP7A 3NVAA 3C16C 4B34A 4QHSA 2P3SA 2F3RA 2ZQ5A 2WSSD 3CPEA 3X1WA 3RLFA 1R5OA 3REFA 3VNVA 3H84A 3O8DA 2AD1A 2YVUA 4DRZA 2JJ1A 1E1RA 1G7TA 2G83A 1E32A 3BE4A 3C8UA 4Q1EA 4O2RA 5FOTA 2CCKA 4DJTA 2GF0A 4YMVA 3TW8B 5C1BA 2ZROA 3B8HA 3TVDA 1Q1ZA 1W5SA 2PT7A 1VECA 2PBRA 1YR7A 5B57C 1Q3TA 1JPJA 2QE7A 3JVVA 4OI0A 3QKTA 2FG5A 2ATXA 2D2FA 3GJ5A 1XCMA 2ODWA 1FUKA 1SVMA 4PO8A 3T12A 4B43A 2ZXUA 2GJAA 2GNOA 3ZS9A 4CEHA 2DYKA 1M1YE 2R6AA 4ARZA 2IF2A 3M0EA 2QUZA 4F93B 3GFTA 4KODA 1G3RA 1ZNWA 3SQWA 1EX7A 5TARA 1EFRD 2PCJA 3CRVA 3QE0A 5DSZA 1S3SA 5HKKA 5J47A 2XSZD 3C5HA 4XWOA 3RDPA 1FX0B 1QG4A 1Z3IX 2RH5A 1GRQA 1M7HA 2CVHA 1ZM3A 5D3QA 1R8QA 1KSJA 1M34E 2FJUA 1YZTA 1A7JA 3LO5A 1I4LD 1E2GA 1H8HD 2UKDA 1ZUHA 1DAEA 2FU5C 1MRSA 4FD2A 4B3GA 1KKLA 2GVDC 1G291 2A7QA 3BH0A 1GKYA 3WHKA 1BO6A 2IA5A 2JIZA 3P20A 5A4JA 2P0EA 3AVPA 4BZXA 3MUFA 4WVFA 1FTNA 4IDQA 1AS3A 4AKEA 1Z2CA 3AF4A 5JWHA 3QENA 4ZDJA 1SVLA 2ZI5A 1GVNB 2WWFA 4TLAA 5J4KA 1WQ1R 1P3JA 4FCTA 2GDJA 4LOAA 3EC1A 4KLNA 4AG6A 3KUCA 2BBWA 3V4FA 4DLUA 4C0JA 3I5YA 3RS0A 1DEKA 3ZZ0A 2D2EA 2CCJA 2DWPA 4WXRA 4NCIA 4LV6A 4D4MA 1G7CA 4RD2A 2BJVA 1D9ZA 4ZCLA 2NO9A 1W44A 4JLOA 2OFOA 1GKUB 4I81A 1OFHA 4MDEA 4ACBA 2JJ8A 1II0A 2C8VA 3EPKA 2YINC 4B2LA 1U0JA 2FSHA 5JEEA 1CU1A 3A1VA 1N0WA 4L16A 4NL4H 2WJVA 3S1AB 3D7MA 1QHNA 2D62A 3SBEA 3WBJA 1O3YA 2VF8A 4M1OA 5TVKA 2D7CA 4Q4HB 1B0UA 1CR0A 1M2OB 2OBLA 3IILA 4FMDB 3X1XA 3RRYA 5KNBA 2NPIA 4KFTA 4BWYA 3O8BA 2VHCA 4Z51A 4RCYA 4D2IA 5AJZA 3I92A 2J0VA 4HAZA 1YR8A 4DLRA 4JLAA 4KBGA 4B33A 2ONKA 4Q9HA 2KWIA 3N2EA 1KZ7B 2QROA 2WSSA 4OYHA 3QOFA 3GLHE 3AVTA 1GNQA 1M6NA 2WKRA 2O8BB 3TNFA 1S9DA 2F1RA 2QMOA 3D31A 3CKLA 3Q5DA 1ZD1A 2N42A 1OYYA 1ZD8A 2FZ4A 3TGPA 2VYFA 4KBFA 4V0MA 3OIWA 3M1IA 2H5EA 4ZIRA 4OHXA 1HE8B 2JJ2A 4RKEA 1RPZA 2ZU0C 3AGQA 4PR0A 3GLIB 1OSNA 2H8KA 2GCNA 2FEOA 5DI3A 1LVGA 1IXRC 1FUUA 1Q1BA 3AF2A 1BYIA 1QRAA 4HLUA 2CCGA 4LGMA 4V0OA 2N1BA 4F7WA 1GAJA 1LFDB 4TN1A 3K1JA 1ZUIA 2IYSA 1G3QA 1R0ZA 3OIYA 1XD9A 1Z0FA 3LA6A 4Q1FA 4MGYR 4PQRA 4TL8A 1R5BA 4DSTA 4ZDWA 3QG1A 1NN5A 1GNRA 4Q00A 5EQTA 2DCUA 4ESHA 5DLQC 1XEWY 4CVNA 2ZAMA 3BK7A 5J40A 5AUQA 5LB2A 2UVQA 2FE4A 4OKSA 1DTSA 2HXSA 2WJIA 1OJLA 1XBTA 3MWYW 4V02A 2J0SA 2DHRA 4LPKA 2G1JA 2IHYA 2Q0HA 2J59A 4IW3B 4HLCA 4Q18A 3AH8A 2CK3D 1UDXA 3OF5A 2CNWA 2PEYA 4MGIR 4ESVA 4LBWA 1HT2E 1P61B 2IT1A 3PG5A 3Q7PA 3B1WA 3HPQA 1JB1A 4TMKA 1OIWA 2VHUA 2VSOA 4M9SA 3T1QA 2ZE7A 4BFTA 2XOKA 3CR7A 1KZGB 2FF7A 5DIFA 5H1YA 4ZKEA 1T4GA 1ZM2A 4QJ3A 4PAMA 4EQ6A 2IWHA 3TW4A 3OEED 2G0TA 4NPHA 3AF1A 1EFHA 2XTMA 1ZCBA 1XMIA 2FFHA 4F92B 3I72A 1G6HA 3RHFA 2YJTD 1GP2A 1KDTA 1E2EA 1N25A 2PLFA 2PCLA 2J46A 1QHYA 3RNLA 2NO6A 1NJGA 3EAQA 5BYJA 4X8OA 1IHUA 4N0EA 2QSZA 1FX0A 1NRJB 3QXXA 2F9LA 5LD2C 1KJZA 2BJWA 4UJ3A 3K09A 1CULC 4HZUA 2WWYA 2A5FA 3FVQA 1GILA 1XTKA 2KSQA 1ESNA 5J5CA 1YZUA 3QXSA 1E9SA 2RGCA 4AYXA 1OXXK 1ZU5A 5KPDA 2FNAA 1A2KC 2OHFA 3CH4B 5BQ5A 3O8RA 1KNQA 2DFNA 4HZUB 3B82A 4MKGA 4ASUA 2PZEA 5G53C 4NTZA 4RD6A 4TL7A 3U3KA 1NKSA 4QBGB 1MO3A 3I73A 5JSZA 4MH0R 1TX4B 4C3ZA 1NN3A 4CIDA 4C2TA 2EW1A 3BB1A 1N6OA 3C4JA 3NHAA 4BLTA 4URYR 2C98A 5EP4A 4AWXA 3PEVA 4I99A 1Z6XA 1DO0A 4OQNA 2W2VA 2O0HA 3CBQA 2IHBA 2V6JA 2ZI4A 1T9HA 1E9RA 4ILEA 4UXIA 2NIPA 3N70A 1NN1A 3TE6A 3QKSA 1NBME 2W58A 2ZSDA 1XZQA 1Z0KA 3BB4A 4YONB 3W6OA 3IO5A 1DARA 3R7WB 4IXNA 1ZC4A 1RW4A 4XTCS 2BDTA 4XJXA 1Z06A 1DAMA 1E1RD 1NIPA 1ZM7A 4RZ2A 2CLCX 2AN9A 1SVWA 2IUTA 5DGXA 5KDDA 2BC9A 5IT5A 4E5UA 4PC3A 1OXUA 5EUQB 5F2EA 2QP4A 4LCBA 1LTQA 1WBBA 3IIJA 2Z6VA 2RGEA 5CIQA 2ZREA 3WXMA 4URWR 3W5IA 2QE7D 1I4TD 1AIPA 1CXZA 1CJMA 1NIJA 4A92A 1GUAA 1E1QA 3U5ZB 2IW3A 4DT1A 1NI3A 2GCOA 5GVRA 2F1IA 5CYPA 2OBMA 1VHLA 3K9GA 4V03A 3IQWA 4URXR 2EFEB 5EP2A 1F5NA 3AVUA 3ZVMA 4IDHA 3GLHB 5B58C 1KSGA 4MRNA 4AKGA 3FPAA 1CJKC 5FOSA 2BEJA 1Z83A 3DOEA 4D6PA 3EIHA 5GADl 2WAYA 4QGFA 2ZI7A 3KQKA 1E4VA 3EPHA 1IY2A 3BRWD 1G18A 3LW7A 3PUYA 4QC2A 2C9CA 2VSXA 3K0CC 4TLDA 2FN4A 3VHXA 2WMOB 4G5OA 1FW6A 1HUQA 2O0JA 2ZR7A 2GAOA 1E2IA 2QZ4A 4A6PA 3W6NA 4EJSA 4Z1MA 1T5IA 4GOXA 3QVUA 1KI1A 4H9GA 5LPNA 3MWJA 2ZJ8A 4DCVA 1K6MA 1WRBA 4V0ME 3WMFA 2QBYB 2D74A 5HE8A 3THWA 2Z83A 5CYOA 1BMFA 1L2TA 2QM7A 1F2UB 1ZIOA 2ZU6A 4HDCA 4WXPA 5E7IA 2CNWD 3AVVA 1W49A 4PAQA 5AK0A 4LHWA 3FWYA 5L3RA 3LW8A 3Q85A 4X8MA 5DO9A 3PVSA 1YQTA 4F38A 2VP0A 4UKDA 4D80A 2VQSA 2YKGA 2QPTA 2CHVA 2ZSEA 2WJHA 1E2FA 2EFCB 1J7KA 4TWZA 1Q22A 4CDGA 1XCPA 4P32A 1PUJA 4D4KA 3LQQA 5CM9C 1W1WA 5FL7D 2WSMA 3W9YA 2HDNB 1YZNA 1R6BX 5FR2A 1S8FA 2QGNA 1E2DA 1TF2A 1RKBA 4NE2A 2JCSA 2ZJAA 1DAKA 3IHWA 5HZHA 4BFVA 3GEEA 1KI4A 4HUQA 1G5PA 5EXTA 4ASUD 1N6HA 3CLVA 4G3XA 3P32A 4C0AC 3OESA 5DYGA 4GDFA 5K8IA 4HB0A 1N5KA 4JVSB 1G16A 4LBZA 4DEXA 3SZRA 1E2QA 2QG6A 4Q1CA 2ORIA 3EXAA 1KDOA 5JECA 3DPUA 2MMCA 3NBZC 4DCUA 3H86A 2ECKA 5EZ5A 3L8YA 4FCWA 4HUTA 4NYJQ 1G8HA 4C7OA 1FOEB 4BECA 1HURA 5FOWA 1E2MA 4A9AA 4XVUA 2D7DA 3ZIAD 4F4CA 2ZRPA 1F2TB 1Z0AA 2WM9B 3QKUA 4A2WA 5L3SA 3A1SA 3VU9A 2I1VB 5L3VA 4EKDA 3G82C 1UDWA 3LDAA 3P27A 1VG8A 2QGZA 2P67A 3KUDA 4XD7A 2VLIA 2IS6A 1SXJA 1Z08A 5K8TA 1A82A 1AKEA 1NSTA 1KI7A 3RABA 1XEXB 1S2MA 3RSOA 1RE0A 1H65A 2V4ZA 4JKIA 4Q03A 5J4HA 2OFWA 1LV7A 5JJKA 4Q4JA 4V0LA 1OH7A 5CM8B 4CF7A 3L0PA 2Q9CA 5D3MA 1XPOA 1GL6A 4MA4A 4R98A 1KYIA 3TQCA 4JJKA 4N3NA 1ZP6A 3UIEA 1D8TA 1ODFA 2QTVB 5FOXA 4OHWA 4M1SA 1ZIPA 2PEZA 1E2JA 2JAQA 3B78A 5UKDA 5BN3A 3HU2A 1ELOA 2IXEA 1JQLB 1E1QD 4LJ9A 2CK3A 1W36B 4D0NA 4B76A 4XSHA 1N6RA 4FN5A 4PPFA 4LY6A 2O52A 4NYIR 1WDTA 3CZPA 3U7EB 3U7GA 4IEEA 1RZ3A 4JVNA 4K46A 4LJYA 4TYQA 4MITA 3GLIA 1BMFD 1YR6A 4Q4AA 3T06B 5K8LA 3AQ4A 3GJ6A 4PPNA 2BOVA 1TF7A 2F7SA 2J1LA 4OHZA 1KK2A 5BYKA 2OG2A 3KJGA 4HB2A 1U90A 2OCBA 3NKVA 4BLSA 4GPTA 2PT5A 4HAXA 4QGAA 2QY9A 2PX0A 3AVQA 5KTYA 5E3HA 1JQJC 1LNZA 2X2FA 2IXGA 1KNXA 2QRZA 1VHTA 4HAVA 2DFTA 1X8JA 4PO1A 1Z2AA 5FUYA 1CIPA 4O0MA 2O8FA 1YVDA 1OH6A 1R0YA 3T1TA 1P2SA 5FI1B 4DLTA 1R0WA 2GEUA 2QNRA 2ZE6A 4ZCIA 3T1VA 4B47A 2C2HA 5FH9A 1D5CA 4MGKR 3DL0A 4ZO4A 2XAUA 3ZH9B 4OK3A 2PJRA 4EPWA 4US0R 4QBFA 4C0LA 3KQHA 3TR0A 1RVDA 1SKYB 221PA 2F1JA 2XJ4A 4CEIA 2J0UA 3SI7A 3AVWA 5DHFA 3EG5A 3LNCA 4URUR 5HTKA 3VAAA 2YC2C 4IOMA 1OW3B 3TSWA 1A1VA 4TT3A 3KL4A 3A4LA 3DKVA 1N5JA 3NBFA 4HLDA 4LJ6A 5BWMA 1OIVA 1J99A 3B1XA 4YC7A 4FI3C 4FWTA 2IYQA 4Z8XA 3VX3A 1QHIA 3B1ZA 1KAGA 4DC9A 1EX6A 4QM7A 3GLGB 1DPFA 2B8WA 2HF9A 1G8YA 3EZ7A 1B23P 1JXOA 2QTFA 3U61B 4HZIA 4KU4A 1ZRHA 3BC1A 5JJIA 1ZINA 2ZM5A 5L3QB 3ZIAA 4ZKDA 5FPYA 2V55B 3K70C 1JALA 1XFAA 2WWGA 4B2IA 3BD9A 2XJ9A 1R2QA 5JSZB 2NO1A 5JLJA 4GMDA 4QGHA 5J4LA 2ZIAA 3B6EA 2ZJ5A 1UKVY 3FHTA 1L4UA 2JLYA 3FHOA 2VSFA 1U81A 3A4NA 5JWRA 2CMKA 4TLEA 1NY5A 4MRRA 2I1QA 5B64A 1F60A 1VYVA 4QNRA 4DUGD 1EWRA 4MUBA 4ABYA 3BH6A 1KI6B 2MSDB 1T8TA 2ODNA 1G7SA 2C9YA 2Z4RA 3AUXA 5IF9A 3VNUA 3NBYC 2DFKB 4BQSA 2HF8A 2WIBA 2YZ2A 4Q5IA 4LUCA 3C14C 5KDLA 1UBCA 1OB2A 4LJ8A 4CEJB 2FWRA 4B2PA 3LV8A 2RHMA 4JL8A 1R10A 2IYTA 3IQXA 4NU0A 4DSOA 3C5CA 3A1UA 3DZDA 3AVYA 4A8JA 2EWWA 1KSHA 4BFYA 4TTQA 4KXFB 2W00A 1WB9A 3VTKA 2GBLC 5AJXA 4RD4A 3LX5A 1UAAA 4Q1DA 1HT1E 1P6XA 4M1TA 2B7CA 3VU9B 1U0LA 3BFXA 2V9PA 3BGWA 4M2LA 4POAA 1GFIA 1MOZA 2ZUDA 2CL7X 2G1KA 4IOJA 1BIFA 1XJCA 3M4YA 4KSBA 1Q3HA 2BKEA 2QAGA 1XTSA 3LQRA 1PLKA 3K0CA 3PQCA 1MKYA 1VCOA 5EE3A 3GLFE 1XTIA 1CEEA 2GXSA 3NDPA 3PXGA 4Q4JB 4TMXA 2VP2A 2ZVQX 1G21E 3R20A 5D3MB 4HDQB 421PA 1X1RA 1YR9A 2FX3A 4PHHA 1E99A 2YC4C 1LF5A 2IS4A 1NVXQ 3UANA 3GLFA 3WYGA 1XEXA 3IBYA 4D26A 1FPMA 2R2AA 1P60A 1TTTA 4OK5A 4NZYA 2EYUA 1CR4A 3W5JA 3QG5A 3LD9A 5SZHB 4LJAA 1JPNA 1GL9B 3IEUA 2ZRFA 4D25A 1KAOA 2HCJB 4WOPA 1GRRA 4QRHA 2O8DA 1O87A 1PLLA 3KZ1E 4DLVA 2BMJA 3U4QA 2DY1A 1N0VC 4EPVA 4HB4A 1OT3A 3FDIA 4KO8A 2WTUA 3K9LA 4M8NE 1QHHA 4JLBA 1LW7A 2C9OA 2YWEA 1W46A 5JHHB 4JZKA 2AWNA 3FGNA 3EZ6A 3B1VA 3TIFA 4L9WA 4PSKA 5JS8A 3LVRE 4UNRA 2QTHA 4D4JA 3NEJA 4W5HA 1FTSA 5C46F 4LDJA 1JR3E 1T6NA 2AWOA 2Q3FA 5CB8A 2FGJA 2I4IA 3AP1A 3PUXA 2JLZA 3K0FB 1IBRA 3MWLA 5G3YA 3FE2A 1N6KA 2P5TB 4JJZA 2X2EA 3CWZA 2OILA 4C30A 5DNYB 3F3YA 3MSXA 4JSYA 2A30A 2ZI6A 3CF6R 4HAUA 2KBEA 1U2RA 3NTUA 4CYMA 4BEBA 4BZPA 3PENA 4FXPA 5HCIA 3HDTA 1TAGA 2N46A 5FUXA 2JJ1D 3PEYA 1KMHB 2JDIA 1G8PA 2QSYA 5AUNB 5JZVA 1JJ7A 4YXWA 1JXMA 2PL3A 2BM1A 4NBSA 1N6IA 4A0FA 2VA8A 4HI0E 1XEFA 2ZSFA 5DI9A 5C18A 3QNUA 4YDSA 1DBSA 4M0LA 4R2HA 3U6BA 1A4RA 2VIIA 3REGA 4BRUA 1SHKA 4M53A 3AP2A 2OFXA 2QM8A 2ZI9A 2ZI3A 3WYFA 2AK3A 1TNDA 3GLGA 4YLGA 1MO5A 1DVRA 3U2QA 1NMZA 4RVCA 3W8RA 4XVRA 3JZAA 1QHHB 3KXKA 2RB4A 4OI2A 2NZJA 2IYZA 2ZUCA 2MSEB 2R6DA 4Z1MD 4DSUA 3K0EA 3D6TB 1G17A 2GA8A 3ICQB 4EFMA 1P2VA 1U9IC 4BPBA 4D0GA 1Z28A 3FFAA 2OSBA 1U8ZA 2RGXA 5FPKA 1X8LA 1GL7A 1U8AA 3ND8A 2FSGA 3G5UA 1ZBDA 4QOSA 3IIMA 4Q02A 3LX8A 3L0OA 1XTQA 2GJ8A 3CX7A 2G88A 2HCBA 1UJ2A 5JI2E 2F9MA 2WWXA 4F4IA 2WIAA 4A2QA 2QU8A 1AZTA 3OEHA 4N0DA 1L4YA 5FOVA 3KX2A 4TYWA 1NG1A 3EX7C 2H18A 4EUNA 3EWAA 1BS1A 2NO7A 1N2CE 3QBVA 1E79D 3PIRA 1G1MA 3L82B 3PEUA 2V8OA 1IJEA 3HU3A 2RGNA 4IDNA 2GXUA 1BOFA 3MGCA 3W8NA 4DLWA 3MJHA 2EFGA 4JVMA 4FCVA 1X86B 5H68A 2ZRMA 1XX6A 1ZNZA 2BCGY 1TPZA 5DN6D 1OE0A 1II8A 3CZQA 3QXCA 1OXVA 1D2NA 5IDVA 1XXHB 5TMPA 4QXAA 1GZSA 3HR8A 2C04A 3FKSA 4JLKA 4TLBA 3K70D 3CO5A 4I1SA 3IUYA 1NVVR 4IFEA 4WZAE 3BH7A 2IYRA 4EPTA 3LLUA 1XD2A 1VYUA 4NMMA 4ZI2A 2C95A 4RCZA 4DKXA 2EQBA 3IKJA 1Z22A 4H1UA 4IEIA 1ZNXA 1ZYUA 2H1LA 2AR7A 2BBSA 2WPDA 1G6OA 1E9BA 2ZRKA 4EFNA 2RMKA 3E70C 4JS0A 1Z0DA 2H57A 3U3OA 3L0IB 1R8SA 2G6BA 1N5LA 2H92A 1VTKA 2W83A 5FTMA 3PUWA 5SZJA 1I2DA 5F9FA 1P2UA 1UBEA 1UADA 3TUJC 3NBXX 4QL3A 3HWSA 3GLFB 2E87A 2X8AA 1G3MA 3CWQA 4EAQA 1U94A 4PZYA 1KK0A 2IYWA 2WKQA 2QMUA 2NOAA 3PR1A 4DHEA 2QQ0A 821PA 1I4DD 2E1RA 3MWKA 4GFDA 2O8BA 4JMPA 2FGKA 5JCZA 2ERXA 2JDID 2AKYA 4FMDF 5G3ZA 1FNNA 3V4RA 3HYRA 2B92A 1P9WA 2VH5R 3TQFA 1DO2A 5A5GA 4TSFA 1AK2A 4DUGA 2C03A 3OZXA 1P73A 2DBYA 1K5GA 3I8SA 2JJ2D 2BM0A 2G0NA 3LLMA 1OFIA 2HXYA 1Y3AA 5EE9A 3ZVRA 3DKPA 2FOLA 3CRRA 3ONWA 5CJ2A 1TQDA 1FP7A 2YWHA 1IY1A 3Q3JB 3CNOA 1OF1A 2GZDA 3JZMA 3AF3A 4BRWA 4HLUC 2D3WA 4LI0A 3M6AA 3MMPA 1Z6GA 2A78A 4DIDA 1FZQA 1JR3D 3ADKA 3Q8XB 2FV8A 3OHMA 4BLQA 4DT1B 1U0HC 4Q01A 4MUAA 4BFXA 5EUMA 1E94E 3ZVLA 2JIZD 2JGNA 2ZR9A 3R9WA 4MYHA 2GWHA 3NEYA 2F1HA 4EIWA 1UBGA 4IVRA 1XMSA 5E95A 2GEDA 4G0NA 4C9BA 1E2NA 1VG9B 2X77A 2ATVA 2RGAA 4A0HA 5FPHA 1G9XA 2YWGA 4KI0A 2GVZC 3FMOB 3QF4A 1YHNA 2ANCA 2GHIA 3OAAA 5EE1A 1NVUQ 4QBHA 3HJNA 1XEWX 3OIUA 3MG9A 2ZJZA 3VKGA 4BFZA 1TMKA 2BMDA 5B2ZA 4D0LB 3OEHD 1F48A 2LKDA 1W36D 2WMNB 3WMGA 2CBZA 2EWVA 4C7OB 1KO1A 2GCPA 3QKRA 4LC1A 4PXAA 2QP9X 4EJSC 3I62A 3H1TA 1CJUC 1KGDA 3C15C 5GJBA 1N5IA 1JR6A 4LV8B 5JRJA 3TR5A 5DH9A 2OBNA 2IUUA 4US2R 2ZPTX 3W90A 1UFQA 5FBLB 2PX3A 3UG7A 5C2JB 4A8JB 2ZITA 1KDRA 3W3AA 3AKDA 3W34A 1SKQA 1MV5A 1MO4A 3ETLA 1ETUA 2WWWA 5CIWA 4Q9JA 1E4YA 1XXHE 1R4AA 2FPKA 5AWFC 3ZVNA 3O47A 1JBKA 5KOYA 1EFTA 2JLWA 2LCFA 1Z0IA 4IOKA 1HQYE 1RIFA 2DFLA 2XNDA 1VDZA 1Z07A 3B13B 4UXHA 5HCNA 4M9XA 4I4LA 3LY5A 1DG3A 2V54A 2OCPA 4RZUA 4Q47A 2UZIR 2ORVA 4TZ6A 2WPDD 3GQBA 5SZIA 2SHKA 3RRZA 3CH5A 4B73A 3MFYA 1IOZA 4FMCB 3DMDA 3LBHA 4I1VA 3A1TA 3P26A 3QVVA 4PC2A 2XTZA 1NKTA 3RAPR 621PA 3U6KA 2QT1A 3QF4B 3KJHA 4PC7A 3FKSD 1WMSA 2J7KA 5E7MA 1CR2A 3HU1A 3LVQE 1P72A 5KPJA 1XJ0A 4QHTA 5FOUA 3AUYA 3T15A 4B48A 1CTQA 1T3HA 4EQ6B 1IQPA 2Z0MA 4R2IA 2CXXA 2PZGA 1II8B 2CE7A 3SYLA 4B35A 4HB3A 4PSVA 3U7FB 2VRWA 2WWHA 2JLSA 2J41A 5FTLA 5FPTA 4GZMA 5P21A 2EFHB 1E9AA 4MRVA 4TYPA 1YJ5A 1MH1A 1HA3A 4IVQA 2GBLA 2ZJOA 4Q4AB 4B71A 2VHJA 3KKQA 1W4BA 4IDPA 4GP6A 1H8ED 5EJEA 2A2ZA 5JHGB 4DDVA 4PAOA 3ZS8A 2ZRHA 2YYZA 2VP4A 1DAHA 4RD1A 4P33A 3A1WA 2WKPA 4DDTA 1SGWA 3Q72A 2C77A 4BFUA 2V7QD 1KK1A 4KYUA 5JFGA 4CZ2A 2OZEA 3EZFA 1QHXA 1OXSC 1SVSA 3SR0A 3K9NA 3AVXA 1SXJD 2NO0A 3ZJYA 1IJFA 5BN5A 4FMBB 3SJCA 1II9A 3RS7A 1QZXA 1BKDR 4PHFA 5TXGA 4KAXA 1NMYA 2FSIA 1RJ9A 1NP6A 4IHQA 5DHAA 2W0SA 5DI3B 4GBMA 1QBKC 4P4SA 3KKOA 4TL6A 2B6HA 4ZPXA 3N5CA 4WW0A 3T5GA 1OHHA 3ASYA 4G5QA 4LHYA 4HAYA 4EJSB 2J45A 3KQUA 1NNEA 2VEDA 4A0RA 1RRPA 2FDCA 1N6PA 3T61A 4PO9A 3A36A 1DOAA 3FHCB 5FUVA 3U3RA 4F91B 2AFHE 2C96A 2GJSA 4DXAA 3WYAA 1WXQA 1Z8FA 3VR6A 5H8WA 2GK7A 3IGFA 2AXNA 1E79A 2XZPA 1W4RA 2GJ9A 4PX9A 2J9RA 4CRWB 1JJVA 1L7VC 4JLVA 2NMVA 4OI1A 5CDFE 1Q44A 4PHTA 4NYIQ 1HQCA 521PA 4TYNA 1VKJA 5DE3A 1ZM9A 4FIDA 3CPHA 1TU3A 5JRZA 1CF4A 2QRNA 1K5DA 3OIVA 4LBYA 4NP6A 1XWIA 2W6JA 3OFNA 2Z4SA 4LYAA 5FL7A 1J90A 4KHZA 4M9ZA 1AQYA 3KXIA 4URVR 1XPRA 4BFWA 1RC8A 4FW9A 4G1UC 4BUJA 4TQ9A 5JI3E 4ON9A 2OUKA 2KBFA 4RKFA 2H7VA 2RAPA 3B5JA 4GZLA 1CP2A 1GOTA 3SQXA 4OHVA 4V0KA 5JBQA 5JMTA 1NL3A 2BBOA 4XTRA 3FKQA 4RJLA 1CLUA 5B30A 3QKRB 1E96A 4JIMA 4WBSA 1KKMA 4PTLA 1EESA 1CJTC 1CBUA 3R7WA 1XCGB 4W7SA 2IC5A 3WRYC 1XB2A 2AK2A 1XD2B 4O2LA 4JBXA 4IDOA 4AKIA 4GL2A 3EC2A 3H4MA 4EPRA 3GMTA 3QF7A 2JLRA 4PFSA 2QAJA 2XXAA 4MGZR 1KIMA 1WF3A 2W2TA 3ICEA 5CK4A 1NBMA 2GF9A 2P6RA 3R8CA 1X8KA 4G5RA 4AIIA 1NMXA 4L9SA 5DISB 1CRQA 2WHXA 2LWIA 1H8EA 2IBMA 3SU8A 1Q20A 1G4AE 2AKAB 2VHQA 4GI7A 4JLNA 2REBA 5SZKB 1U8YA 2ASEA 3GLGE 3WBKA 1SXJB 1FMJA 4WZ6A 1PLJA 3EA5A 3RYTC 1DADA 4B3FX 4L5BA 5HPYB 1S4QA 2D06A 5AR1A 5FBQB 3WP0A 4DVGA 2RKOA 3EW9A 3UG6A 3ZD7A 3I5XA 1XU4A 4C0QC 5J4YA 4LHXA 2C5LA 2XNSA 5EP1A 2R6FA 3W3ZB 2JEOA 4YMUA 4NHOA 2VHTA 2GZHA 1HYQA 1A5TA 1XF9A 1DG1G 4JLPA 4BLOA 4A0GA 2OXRA 3U4QB 1E9CA 3SOPA 1OHHD 3TSZA 1GTVA 2DWQA 3LAWA 4OQMA 1KI8A 3FTQA 3I1FA 4X8LA 1VMAA 3C41J 2J5XA 4MYTA 3U60B 3THWB 4NKRA 4DEYA 1HV8A 2OAQ1 1DAGA 5KHOC 3THXB 4M4SA 3VR5A 3UK6A 4W5JA 4EFLA 4R7ZA 1UEIA 4PZZA 1P7CA 1ZMXA 1YE8A 3A8TA 1M7GA 2NQ2C 1LS6A 1J8YF 3ECCA 4JT4A 4M1YA 5CJPA 3THYA 1KJYA 121PA 2XSZA 3THXA 3BBPA 1FMLA 1KHTA 1KY2A 2BCJQ 5AUOB 2IYYA 2V1UA 1DAIA 2X1VA 2IX3A 4GRAA 5GJWC 4Y0VA 4JYBA 3P4YA 3U44A 1G8FA 1X6VA 4NCJA 1QVRA 1R0XA 1Z0JA 4YMWA 2XGJA 1W5TA 5JWOA 1U98A 4TYYA 2NG1A 1M74A 1NLZA 1ONBA 4A36A 3ZYCA 1YRAA 4DDUA 4II7A 2QAGC 4WZBE 2GEVA 1F2UA 4Q1BA 1CR1A 2IYUA 3AKCA 1FL9A 4KVGA 4ARZB 4C0BA 4Q1AA 3UMSA 1KOFA 1BYUA 4BLRA 4DLSA 3LFUA 5KU1A 1OB5A 1MO6A 2R6CA 1SHZA 1L8QA 3AKEA 3WP1B 1VCMA 1YRBA 4D4LA 2W6JD 1G8GA 3OFND 1E0AA 1P4SA 4LBVA 3KJEA 3TUZC 1GKIA 1F2TA 4KFUA 1VCNA 2OT3B 1JNYA 2ZAOA 4LRWA 4HDOB 2PMDA 4WIAA 3I32A 1R7RA 3S1AA 1E2KA 6Q21A 4TSFD 1PVOA 1OV4A 3RS5A 4BASA 3IDQA 5KYKA 2HLDD 3O8CA 3MLEA 2DPXA 2REOA 4PC6A 4XVQA 1P5ZB 3HYTA 4YQFA 5CDFA 3EZ9A 4TTPA 2MMGA 2W6IA 1XP8A 1Z6TA 4LJ5A 1FNMA 4CT4B 2O5VA 4ZDIA 3EIQA 3VR3A 3AF0A 2IYLD 1IN5A 1IN7A 4U00A 3SHFA 5TY0A 1FP6A 1AS2A 4DLYA 5FBVB 1SXJE 3GJXC 1GNPA 1HE1C 2ZE5A 2V7QA 3B2EA 3VR1A 4DCNA 3RC8A 4OK6A 2R8RA 3CW2A 5ANRB 3GJ4A 4M9QA 1US8B 2A3RA 1S0UA 3K0AB 2QEQA 3CM0A 2XEXA 4ITRC 4U5XA 3L0SA 4DIEA 2W0MA 4B32A 5F98A 3RS2A 3VFDA 3CUEF 4JKYA 4LYFA 4CEHB 2JLQA 2YOGA 1AA9A 3OAAD 3PFIA 2FA9A 3V00A 4BLPA 2XZOA 1G20E 4WA7A 4NCNA 4A4DA 4O25A 1P62B 3GJ8A 1Q1QA 3NIBA 3X1DA 2ZS8A 4GSYA 4Q4HA 3HP1A 4XWKA 2B21A 1KO4A 4NYMQ 4L15A 3CONA 2JATA 4UJ5A 2PMKA 4LZZA 4QJ4A 2XOKD 3GD7A 3RWMB 2CLSA 3IPYA 4L8GA 3CRQA 1W4AA 3GJ3A 4OQFA 3UATA 3UXMA 4JSTA 4MRPA 2QQEA 2F43A 3PEWA 3PUVA 1W7AA 3X1YA 1G5RA 1UKEA 1VG1A 2QMHA 2IS1A 1TUEA 1J70A 3CIOA 2ZJBA 3CF0A 1EXMA 4D82A 2GZAA 4NCKA 4UNNA 4A1FA 1NLYA 4UXJA 1ESMA 2CVFA 3EASA 1T0HB 3TRFA 1AGPA 2ZRAA 3KTAA 4W5WA 2FPLA 3IBGA 2GXAA 4Q4LA 2CDNA 5HE9A 4LPSA 2QT0A 3ZQJA 1KI6A 5KSYA 4OQLA 1US8A 2CL0X 2BWJA 2WJGA 3I3SR 5LDDC 4Q21A 3ZZTA 2WICA 3DZ8A 2OCAA 3B60A 2PJZA 2RCNA 2QA5A 1EWQA 2Z5FA 4US1R 4P0TA 3DEFA 3VR4A 3JVUA 2NZ8A 3VKHA 3IO3A 3PJRA 1XMJA 5G40A 3FB4A 5E7JA 3THOA 1S1CA 4AY2A 1UM8A 1G4UR 3BERA 3BIFA 1N6LA 2HEIA 5AJWA 2IL1A 1XXHA 3LRPA 2NTYC 4K81B 5JS7A 3PCRB 4TQUS 1T0JB 3SFVA 2WJJA 2KB0A 1QDEA 2J7PD 1W0JD 2Q6TA 2RGNC 3A58B 4E09A 2O8EA 1RYHA 2ZRGA 5FI0B 4DBLC 4DB4A 1P9RA 1XMVA 2WOJA 3E1SA 1EFCA 3SJZA 4K8OA 4A15A 3R8FA 4OJQA 1J8MF 1OH8A 1W2GA 3NDBB 2ZETA 5F9HA 2VL7A 1W47A 2OCYC 2ZS9A 2VO1A 3MAAC 3WNCA 4QKQA 1T5LA 3ZDQA 3U44B 1MABB 4AI6A 2AL7A 4EDHA 2WV9A 1W4CA 2WVJA 3SJBA 4IVPA 1Q57A 4NH0A 2GKSA 3QEJA 4YMTA 1LF0A 2R6GA 3PUZA 3P1JA 3BFVA 1LB1B 1Y63A 2QORA 3BORA 4QM6A 4ZIRB 4C0HA 2IEYA 1HTWA 1IAQA 4M22A 1XD8A 3L8ZA 2HLDA 2ZRJA 1OLOA 2OAP1 4LSGA 1AKYA 3TAHA 1C9KA 3ZD6A 2A9KA 2A5YB 3TVTA 1V5WA 3R9IA 5HKKD 5J4VA 5ELXA 4URZR 4GOKA 1WE2A 4IKEA 3WNBA 3KXLA 2ORWA 3LBIA 4RZXA 1E9EA 3VR2A 2OLKA 3Q9LA 2OEPA 3W6PA 3GJ0A 5FR1A 2WJYA 5CB6A 4XOIA 4HSEA 3BXZA 1DELA 3MJRA 5E4FA 1AN0A 5L8VA 4PHGA 2BMFA 3AKYA 1ZUNB 5FBWB 4KITB 3BFKA 4LYHA 1E2LA 4Y0AA 3TAUA 4EPXA 1XJQA 1CS4C 2ZYUX 4HATA 4TMZA 4FMCF 4B3XA 4A6XA 4IRUB 2KJQA 3A4MA 4UNQA 2WOOA 3BB3A 4I1OA 4BFSA 5IRCD 1SKYE 2QENA 1NLFA 1UKYA 4NDZA 1G7RA 1OFUX 5CLQA 4OBEA 1QHSA 4FWIB 1AQUA 3LBNA 1KTVA 5IK2D 3NHBA 2H16A 3EARA 1LY1A 3QPUA 1Z47A 4LV5B 3I4LA 3KKNA 4YMSA 4AD8A 1PJRA 3KFVA 2QMEA 4RFSA 2IEZA 4PC1A 2EU8A 2IF0A 3LH5A 4BEJA 3LWNA 2BMEA 2BV3A 2QPOA 2ERYA 4OQXA 5EXSA 4B3DA 2OE2A 2OESA 2VPPA 2XB4A 5TB5A 4KYIB 5KSZA 4P4TA 3QEOA 3T5DA 4RFSB 1IN6A 2HT1A 3ND9A 4RSGA 2AD5A 5KSPA 4AC9A 4U02A 2HYIC 5EXXA 2GESA 4W9MC 4BGDA 3QXJA 1X3SA 1E0JA 4RD3A 4CEJA 4ACAA 1ZC3A 1WA5A 4LWZA 1OIXA 2KI5A 2ZRLA 1XPUA 2QAGB 2X19A 2YOHA 4YDHB 3TK1A 1E69A 2W2XA 3OE7A 5DN6A 2Q21A 2O8CB 2A5GA 3GEHA 3FMFA 4JT2A 2ZANA 2NGRA 1W0KA 4QFMA 2R65A 2GCOB 4M21A 1V43A 1VIYA 2H17A 5FTNA 3K9HA 2BBTA 2TMKA 1ZVQA 3UWOA 1S1MA 1TQ6A 1EG7A 2RHDA 4XWAA 4TMWA 2ZSBA 1YZGA 1U9IA 2HJVA 2ANBA 1M7BA 2WBLC 1W0JA 1E0KA 4LX0A 2R9VA 3TJZA 2F43B 2ZTSA 3KDSE 4NONA 3ZZUA 4MDFA 4Q7LA 3SS8A 1VPLA 4O3MA 3AM1A 3R9XA 1WP9A 3BS4A 2XNDD 1KO5A 1KO8A 1N6NA 3NXSA 4MQBA 5BN4A 2JA1A 3F8TA 3I61A 4XIGS 3T34A 2RGGA 4Q66C 1WCV1 4IFBA 4RD0A 2IS2A 3QIAA 1ZD9A 2QN6A 3B9QA 1KMHA 3GFOA 3IHLA 3L43A 3QKSB 2J3EA 3VKWA 4TMTA 1NVVQ 2FFAA 4LYJA 1KMQA 1XTJA 4QHYA 4MYCA 1KY3A 3ADBA 2I3BA 4PQYA 1IM2A 2GXQA 3ZLJA 3CRW1 1XRJA 1TQ2A 3E2IA 3QY0A 4PPQA 5CLLA 3TKLA 1PV4A 1UKZA 1P2TA 1QF9A 3VMFA 3QQ5A 4Z8YA 2ZYVX 4CT5A 1VG0B 2YHSA 1OPXA 2HV8A 4DCSA 1SVKA 1GDDA 4MKIA 1J2JA 2PH1A 1JAHA 2VBCA 4NYMR 1C4OA 2GK6A 2E9SA 3FMPB 3VHLB 2IUSA 2WZQA 3AEZA 2OV2A 1I2MA 3EPLA 3THYB 1DE0A 2BKUA 3AGPA 3MRSA 4B44A 8OHMA 3KB1A 3N2IA 1RRFA 2CJWA 1G3UA 1KDPA 3TBKA 2XX3A 2Q9AA 4Z54A 4RY2A 2YV5A 2RGBA 3RS4A 2BVNA 2P6UA 4TMVA 1Z63A 1UPTA 1TUIA 2FEMA 4DSNA 5KNCA 2ZRDA 3VX4A 4B3BA 2FZLA 1P75A 3T1OA 2EFDB 2G3YA 3BJIC 1FQJA 1C1YA 4KVAA 1EK0A 2AHOA 1IN4A 2ZS7A 3SDZA 3CPJB 2IWRA 1Z29A 3Q5EA 2O8FB 5C4MA 2VP9A 5FFMA 3GLIE 3LXRA 3CB4A 1E9DA 5CK5A 1MT0A 5BW8A 2QBYA 4MYUA 4L4UA 2ZRNA 4IXMA 4MKHA 3B85A 1SVOA 3TUIC 4AG5A 1RRCA 3WHLA 1H8HA 3GCGA 1HH4A 1IONA 3DHWC 4TL9A 1G41A 1ZAKA 2QPAA 5IK2A 4P4UA 2ZR0A 3MD0A 5FTJA 1T3SA 1TADA 1HEIA 1TEXA 2XTNA 2ZRCA 1F3OA 3AB3A 1XDBA 1D2EA 4KFSA 4AYWA 2CEAA 4NYJR 2DR3A 4LJ4A 2OLJA 2BIFA 3MCAA 2YNMA 1OXTA 4J0QA 3IPXA 3LXXA 4AYTA 1Z5ZA 1R5NA 4KV9A 4MKFA 4PZLA 4P31A 2ZYTX 4BZQA 1OFTA 1RRGA 4S2EA 3U3JA 1T8UA 1ZNYA 2CHGA 3DO6A 4JLDA 5TV2A 4R71A 3SNHA 1NVWQ 2FH5B 2IK8A 2IYVA 1VIAA 3WY9A 3EWSA 3D8BA 2B7BA 2ZSAA 3HPRA 3SN6A 3L2OB 4HEJA 5JEDA 3OE7D 3QPWA 4A8JC 4BE7B 3CX8A 1SZPA 5DYIA 3NC1C 1SVIA 1YZQA 1DAFA 2ZVPX 5EP3A 5K8UA 1U99A 2W6ID 1YZLA 3P4XA 4DCTA 3FFBA 2ODBA 4E22A 1N0UA 5H70A 5IHPA 2HJGA 4DDWA 1NJFA 4B3CA 4JLJA 3DVLA 2VF7A 2XXAB 1E98A 2J0QA 3K09C 1M8PA 5F3WB 4NCHA 4XH9B 4C4PA 2NPFA 1UF9A 3SFZA 2FFBA 4UQOA 1GSIA 4KLZA 5GVSA 2R44A 1VYTA 1YU9A 1JR3A 4IOLA 2CL6X 5KO2A 2CHQA 2F6RA 4QNMA 5AJVB 3RSLA 4MRSA 5GJVC 1IXZA 3BOSA 2GAAA 3UPUA 4TTRA 3A37A 2L0XA 4N1AA 2A5JA 1XTRA 2V6IA 1ZM4A 2AFIE 2ZRBA 5LBIA 2JASA 2J87A 2ZYWX 3SEAA 3UKDA 4V0NA 1KSFX 5LD2B 2O8EB 2VTKA 1OKKD 4AK9A 5A0FA 3NWJA 1GRNA 2P6NA 3NH9A 4E03A 2XB2A 2DWOA 1Z6YA 1ZCAA 3BWDD 5EXPA 1ANKA 1AZSC 1S96A 2CLDX 3E5HA 1QVAA 2QI9C 1KI9A 4P4SB 4PSAA 3TSOA 4ZV4A 3HR7A 5C4GB 4G5GA 3CNNA 1CKEA 4ZCMA 4G5SA 4PPGA 4JLMA 4FINA 721PA 5AJYA 1AGRA 4B6FA 3D3QA 2A5DA 1G64A 1Z6AA 4OHYA 4IJMA 4ZI3A 2AX4A 1XNJA 1QG2A 2GTPA 3NG1A 2EVWX 2PZFA 3RC3A 2HT6A 1VCIA 3NH6A 4LHZA 3CX6A 3FYHA 4GMXA 3H2YA 3KB2A 3EIEA 3FMIA 2HUPA 4UNPA 2QL6A 4M1WA 3SYNA 4AURA 2D4HA 2WWIA 1FQKA 3F5FA 2R62A 2CJWB 2MSCB 4QG7A 3ADDA 1E9FA 4DZZA 1DS6A 1Q0UA 4DB2A 3DOFA 5BXQC 1GG2A 2ZEJA 2OO7A 2Z43A 4Q7JB 3RS3A 3SYKA 2FPMA 1X1SA 2J7PA 1KJWA 4HUQB 1Q12A 5FPSA 3V9PA 1W0KD 2JLVA 2FMXA 2V1XA 2ZRIA 3QSYA 2CE2X 1ZW6A 3SHWA 5G41A 4TZ0A 1SULA 2FSFA 2IYXA 2LKCA 4Q9IA 3GJ7A 3G0HA 1NN0A 1Q21A 4LJ7A 2J0UB 5HR5A 1EFUA 5KSOA 3K70B 3K0AA 3T35A 3ZGXA 5FUWA 2Q3MA 1YKSA 1D2MA 3K0SA 3CF2A 1P9NA 2Y8EA 3ZQ6A 5KDOA 4GNKA 4Q7KA 3QXHA 3PV0A 1CJVC 3AVOA 4OJKA 3EA0A 3RANA 3ADCA 1TF5A 1TL7C 2O8CA 2XITA 2BHRA 2ZUBA 3B1YA 2C78A 3KJIA 1S9HA 4Q7MB 3UWKA 5EZ6B 1COWA 3GFPA 3GPLA 2ZJ2A 1JI0A 1HY3A 5FL3A 4OL0A 2ODEA 2FFQA 4KJZA 5AUPB 1F6BA 1IXSB 4OI4A 4CW7A 1TQ4A 5HZKA 1E0SA 3K53A 4M1KA 4XD7D 4C2UA 3UMRA 1RFLA 4LK2A 2V3CC 2ONJA 3AP3A 4RFVA 2IXFA 3WNDA 4A2PA 3WMEA 1XZPA 1FFHA 1SXJC 1OYWA 3QJYA 4QGGA 4CGZA 3X2SA 2ZE8A 5L3SB 1MRNA 3DM5A 2G77B 3DDCA 1ZJ6A 5JCPA 1GIAA 1JAIA 2HYDA 2RGDA 4LC0A 4UNSA 5FBRB 3SBDA 3U3MA 1JEDA 4Q9KA 3TH5A 3WRXC 4Q9LA 4U7DA 5M04A 1AS0A 4HLQB 4TLCA 3GP8A 3BAFA 4Q48A 1W48A 3CNLA 3RWOA 1MR3F 3A6PC 3QUSA 4LHVA 2GJKA 2DB3A 4JVLA 2JLUA 1G19A 1PUIA 2F3TA 1JECA 4QBIA 3H0KA 4B75A 3RRMA 2Q9BA 1T3LA 1JEEA 5KNDA 1N3BA 3FOZA 2O8DB 3GEIA 4Q19A 4S35A 4GT1A 1RYFA 5EE0A 3RVBA 3C7KA 1GWNA 4D81A 4YXWD 2KE5A
chains in the Genus database with same CATH superfamily
4Q37A 3D2LA 2DKFA 3R8XA 4ES6A 3D1LA 4OXQA 1NY6A 1AZLA 4GI2A 4PGAA 2IEGA 2O0KA 3A1DA 3T7DA 4BAUA 5AVQA 3LK6A 1P7VA 5KUTA 2HIAA 4I1UA 3WLOA 4DWVA 5HJ2A 2F17A 3QI2A 3HQ4O 5KTTA 3LUPA 1U0TA 3DCNA 1GITA 4GPEA 1T91A 1XN4A 2X3YA 4IZHA 2IP1A 3FUUA 4V0SA 3SF8B 3RT1A 1B73A 5J58A 1W581 4KFRA 4EA8A 4FZ5A 2GPAA 5EIAA 3C3BA 4N01A 5FP0A 6PFKA 3E61A 2EYQA 2ZJYA 3BT7A 4IFTA 4R9UC 3HVIA 3DG9A 3N2LA 2RJOA 4HD8A 5B3LA 1F4LA 3CLRD 5ALWA 5PGMA 2BRUC 3X1ZA 1B0ZA 2QXYA 3IIKA 2YWFA 5EE5B 1B2RA 1BVHA 1FBNA 1Q1EA 5LB4A 4ZC8A 4KK3A 2RB5A 3S2ZA 4FGLA 4R8RA 1Q0SA 2DUNA 4X93A 4C6TB 4C0KA 1QHGA 3D6JA 4LXIA 2WD7A 1Q0TA 5JQGA 3TTUA 2I3DA 1UJCA 5LUAA 3KKPA 4X8HA 2XZLA 4XYMA 1O77A 4C4SA 3ZZNA 5F23A 3J81k 1TEHA 3W8FA 2MSKA 1IUOA 2GETA 4UZFA 5KNCH 3T5TA 4PY2A 1X7XA 3CW8X 1WCIB 4DXDA 1K88A 1PS0A 2DUMA 3IOCA 3OT1B 4Z9XA 3NHRA 3WIEA 5JC8A 3SC3A 2DFDA 3K8YA 1ZN8A 4TMYA 1NSYA 2GFHA 4BNMA 1C3VA 4N8DA 2WJ6A 1XRRA 4M0PA 4PANA 4DIBA 2HK9A 4FHCA 4LXTA 4BVAA 2VJAA 4C0SA 3EPJA 4DR7B 2QUIA 1VOTA 5HIKA 2OLEA 4X65B 1BMDA 1ORRA 1H5NA 1NG9A 3FPGA 3DXXA 2BF7A 3NX4A 3TL3A 2OD7A 4UFOA 5DCWA 3D1VA 4AZTA 1U3UA 5C4IA 3NGXA 2QP3A 5JNSA 1COWD 1MEOA 2I6SA 1LRLA 1D6JA 3AV0B 2VDWB 4OOEA 4TV8F 4JI6B 5F5NA 2JFGA 3BWEA 2IE8A 3PLNA 1IY0A 1ZY2A 3E84A 4LN1A 2BJHA 4GUAA 4AUNA 1URPA 2DE0X 2HWUA 3PJDA 4NQRA 4ZQCB 5F7ZA 4EA6A 5LMUB 4JL6A 4X91A 4ZHQB 4CDNA 2QR2A 3IUNA 1L8LA 5BNFA 4H7HA 3OUZA 1CLEA 4I5EA 1SBTA 2VRBA 1KFBB 4WK0B 1K8ZB 1TUBA 2O2GA 2P3SA 4J7XA 3IAHA 4MQEB 4P3KA 1UOQA 2BGMA 4HDRA 1R5OA 1N75A 5LZ7A 5B3KA 3O8DA 4G5HA 4MV3A 2J08A 1VIMA 3KL2A 1UT6A 4DRZA 2WEKA 1KU6A 5BVGB 2JJ1A 3G2NA 4YQZA 3U13A 3FNFA 4ZT3A 3BE4A 3C8UA 4Q1EA 4YMVA 4D3XA 2GF0A 1YK0A 1IUNA 3PK0A 4MUEA 2IIQA 1N33B 2HRZA 2WDPA 4IIXA 3W7AA 2EGGA 2X13A 4F46A 3MVEA 5GPBA 4XD2A 3UH0A 1PGOA 1VECA 1NBAA 1SFRA 4LRYA 1RXUA 3DLBA 2FG5A 3BE8A 2ATXA 2D2FA 2Q4EA 2D0DA 1A50B 3OE4A 3J81A 1K9VF 1W9MA 3IKMB 4FT2A 5FPQA 1FUKA 1SVMA 1L7AA 1GR1A 2HJHA 1ITZA 1JDZA 1MPTA 1NXWA 4UCWA 2JB9A 3UH1A 2HO4A 3MRVA 2B4YA 2R6AA 1JILA 2O23A 3CHYA 1A8HA 1AV7A 2EGHA 2P2DA 2C5AA 4EKEA 3SQWA 3SM3A 2MSLA 2H6EA 1TJ3A 2JK0A 2J9FB 2C84A 1A97A 2PCJA 3HA5A 4TS4A 1GTZA 1H0RA 3O2JA 2E4VA 2ZR8A 3NHWA 4RIEA 4YR9A 5T5QA 5TR9A 4D0RA 4FGZA 5DYYA 2VLBA 2OENG 1QG4A 2RH5A 3R6WA 1GRQA 1M7HA 2CVHA 1NBOA 1P7WA 3GARA 3IP5A 5FCDA 1DRUA 2JFHA 3DLTA 3HXTA 3R7AA 1M34E 4K7JA 3WAJA 2C5FA 1HDYA 4U1RA 2AN3A 1DRWA 1I4LD 2ZBVA 3JATA 1JEOA 4IQGA 1JKJB 4P4NA 3KSDO 5EIFA 4ZI7F 1KGSA 2GT1A 2GPNA 4A7PA 3K71B 4RW0A 3NQ41 2ECQA 2AZXA 2A7QA 1NNSA 3B89A 1R1DA 3BH0A 3OPQA 1YHZA 1E3WA 2IA5A 2FWAA 4YCAA 5B37A 3WHKA 1GPLA 1UPUA 4BZXA 3MUFA 3WV5A 1GNLA 3FGZA 3KT3A 4TROA 3PC8A 2BZ0A 3ZBUA 4TVSA 1DOHA 3VYWA 3WL3A 2CYCA 4IY1A 1QRUA 2ZIUB 2BGLA 1IY9A 4ZDJA 3UMBA 4CLRA 2UZAA 2WWFA 4Y9TA 3I9NA 3N0VA 5JSYA 3IXQA 5HILA 4Y2RA 1U65A 1B42A 2ZSUA 5J4KA 1WQ1R 2WJZB 3HCCA 5HUJA 5JQWA 1BVUA 4LE1A 2ID7A 4J1TA 5FEUA 3EC1A 1IULA 4RHTA 1OV6A 5JNTA 1I1NA 2HPHA 3A06A 4HDMA 4EELA 3FFXA 4LX8A 3AJ9A 1DEKA 1L1RA 4XPIB 2JFNA 2CCJA 3EWNA 9LDBA 4LV6A 5BQOA 1RJEA 2HPZA 1X1AA 3AIKA 4KE9A 1CY7A 4ZCLA 1VP9A 2TSYB 1X13A 1PGNA 1Y5RA 3RADC 4MDEA 1T2VA 1YB6A 2DQ4A 2JJ8A 3CZMA 3G0CA 4TM8A 5DCYA 4IRMA 3EPKA 3RAEC 1CUEA 4YJ3F 3JRXA 1MXFA 1TPYA 1U0JA 1XAIA 3L1UA 1RCTE 2C2XA 1CU1A 1N0WA 3GROA 2W90A 3K35A 2IU3A 2WJVA 3C6MA 4EKYA 2IIBA 3PX3A 4JH0A 2V4MA 5ABPA 1KAEA 4M1OA 2VF8A 5FO0A 2R6ZA 3E22A 5TVKA 2D5IA 5MN4A 1LTHR 2H29A 4Q4HB 4CFYA 1WJGA 3OZFA 1FRFS 1V25A 1ZICA 2OBLA 2XVYA 4OO3A 2BEUB 5EQFA 4BO6A 2F90A 2ISCA 4OQDA 2OGTA 2DLDA 3M34A 4KFTA 2AB0A 5FWYA 3GQBB 1DOZA 4R54A 2IH4A 3TZCA 2C2MA 3ZHZA 8LDHA 3MPUA 1L5GB 4C14A 3PS9A 1SUEA 2EJUA 2WSSA 3QOFA 3FWNA 3GLHE 2HHAA 4O0LA 1GNQA 4OYHA 5FWYB 2NTNA 4CM6A 3HNRA 3FWZA 1WD5A 1D4AA 1FU8A 1E7RA 1V1RA 3HO6A 3KOMA 3D31A 3DKKA 3GOHA 3L4EA 4PFQA 4ZYZA 3WB2A 4KBFA 4R84A 3LUHA 1G5IA 4AROA 3ZK8A 2H5EA 3OCJA 4BWGA 2JJ2A 3PGMA 3QX8A 3CZ9A 4RKEA 2ZU0C 3AGQA 4PR0A 3GLIB 4UUNA 1OSNA 1XR3A 3MD9A 4L9RA 5DI3A 1W1UA 3UN1A 1Z4NA 1JVNA 1XLWA 2B30A 1A8IA 1GAJA 5T41A 5EMLA 2IYSA 2P9ZA 3G2HA 3SQDA 3CUYA 1G3QA 3FTNA 1MXHA 3OIYA 3LA6A 1VJ0A 4GX0A 1CVIA 4JJAA 4PQRA 1R5BA 5J2TF 3PYMA 3C39A 4CMGA 1H22A 3VJMA 1GNRA 4G0XA 4UBMA 2DCUA 2JGIA 1XEWY 3PDJA 4BMSA 4CVNA 1TIKA 2H85A 5J40A 4E08A 5LB2A 4H4EA 3JQRA 5A9SB 2UVQA 3PDIB 4OKSA 4U63A 3PNKA 1NXTA 1DFGA 3TPFA 2MU1A 3R4CA 1ST3A 4ZTBA 3KQTA 3QH4A 1XBTA 3ZHSA 3DW1X 2BFPA 3A31A 4V02A 4MVJI 4UBKA 2DHRA 2OPBA 3KD2A 2G1JA 1DJMA 2IHYA 2Q0HA 2Y4NA 2YUTA 3JD0A 4IW3B 3A32A 3AH8A 1UDXA 3OF5A 4RQAA 1JX6A 2VZ9A 4KZKA 1I5OA 4ESVA 3HP4A 1A8QA 4X63A 5DX0A 4TMKA 1NOIA 3A6GA 4HFMA 3B1WA 4JJGA 3QLEA 3MPOA 1ZH4A 3NP9A 4NHEA 4BFTA 2ZE7A 5ALGA 2DLNA 2JRLA 4OBWA 6REQB 1AKQA 1KZGB 5DIFA 4ZKEA 1AUXA 4Q05A 3CE6A 3LT4A 4RV5A 3LDGA 1GTSA 3TW4A 2Y6VA 3OEED 5EUBA 1N5RA 2DLCX 1TFRA 2B36A 1DLIA 2PJUA 1C7RA 1H6DA 2QZSA 3ESCA 4ME6A 2GZMA 4HN2A 4NPHA 2EZ8A 3QVGA 3RSSA 3QRWA 4IG9A 1SG9A 4NENB 4I5GA 3U62A 1ULSA 3IMEA 1USIA 3F8SA 1TD1A 4QFBA 2ABWA 4WNYA 3V1LA 2TMYA 5T4BA 5A9TA 4MOWA 4NE9A 4MW0A 3CWCA 1IY8A 2E4AA 1KDTA 2PLAA 1XDGA 2QIOA 3GLSA 3QPCA 1JGTA 3AFHA 3WMWA 1SBYA 3R3HA 3VKUA 1ISSA 1QV7A 2PMBA 3Q1KA 1XNQB 4KREA 1LTKA 2J67A 4LTNA 1R4MA 4N0EA 1N3IA 2FPIA 2AJCA 2XADA 4FM9A 2H7CA 5KWEA 4E31A 5IJ9A 2YQ4A 1KJZA 1YR2A 4UJ3A 4WNAB 1P1FA 1CULC 3K16A 1GZHB 2FZKA 2WWYA 2A5FA 5J63A 5BPFA 2Z9CA 5J5CA 2PGOA 1WPXA 1YZUA 3OG9A 3QXSA 4C29A 4DR4B 2A9JA 2F62A 5G0UA 4JN6B 2RGCA 4NNPA 3P9CA 1IWBB 2MJLA 1A2KC 3CH4B 3ENQA 3OPYA 1ISMA 4UUMA 1U2QA 1OBOA 2DFNA 5ILGA 2IYFA 3C1TA 4MKGA 3RWBA 1I94B 3I9JA 2EFJA 2PZEA 1JEYA 1QX3A 3E9QA 2PZ8A 2Q5EA 4RD6A 2OP1A 4QBGB 2IXDA 1MO3A 3I73A 4COOA 1RAIA 3TJMA 5JSZA 5IG2A 2YXEA 2PZMA 1JE1A 4WFKA 2BI7A 4C3ZA 4C2TA 5D00A 3OCVA 3H5OA 1N6OA 3NHAA 4RPIA 2KMLA 1C0LA 1ODLA 2C98A 4X6UA 2CZCA 3PEVA 3KS9A 4I99A 3RGWS 4LE0A 4ND3A 1TTHA 2EC5A 2J31A 2IHBA 4C06A 1WUKS 4BV2A 5CAEA 5TMEA 5DM70 3C7DB 3S7TA 2ZI4A 4WACA 4QUEA 4OFXA 5CD9A 4GZ5A 3TE6A 1NBME 2W58A 3W6OA 1XZQA 1Z0KA 3GP5A 2VN8A 4QOJA 3IO5A 4EMSA 3R7WB 4IXNA 3U49A 4CV0A 2CN1A 4ZT4A 4HGYA 3O95A 4C4OA 1O0CA 3GEPA 2QRJA 2MHCA 1DAMA 4IBOA 3HH8A 3NR2A 1NIPA 2XGOA 5DHPA 3ZV3A 5K5EA 1EX9A 2AN9A 2IUTA 2LPMA 3Q7IA 4DMKA 1A7UA 5A5FA 2BYTA 4B84A 5FAKA 1ZD4A 3AHDA 4QUIA 1OXUA 2QP4A 4LCBA 3H0EA 3DW3X 1LTQA 3O74A 1WBBA 4EEKA 2BW0A 4JOSA 5CIQA 2WF6A 3G2KA 3O8QA 5BSKA 3KSAC 1FNCA 4LGCA 3VPXA 2WIKA 1AIPA 1NIJA 2QE7D 2VZEA 4A92A 1BFDA 3GG2A 3U5ZB 3HRHA 3L7YA 4IH4A 2MIIA 4JB2A 1UCFA 3I9KA 4DT1A 2GCOA 3CUKA 1RYZA 2F1IA 3IJEB 2BFAA 2BTQB 2ZDQA 2FPWA 3NVDA 4J4TA 5T8KC 3U7QB 3W5BA 1KYQA 3OZVA 2ZG6A 5CDYA 2EFEB 4HOYA 2G9ZA 4L4YA 4G9GA 2GVNA 3QHPA 4GZ6A 2MINA 3C3EA 4O33A 5BSEA 4GU5A 4V1CI 3MILA 4MRNA 4EJ2A 2NVUA 3KWLA 3FPAA 4JYAB 1XZNA 5GADl 2WAYA 4HPXB 1IVNA 2ZI7A 1E4VA 5A7HA 3T7TA 5BMVA 1VHDA 3FB1A 4C43A 5DRTA 4DMGA 2AQ8A 3GNSA 3EIWA 1BGWA 1LH0A 1WDWB 3H05A 2NO4A 1I7LA 1HDEA 4HADA 1U5AA 2DWCA 4MPTA 4RV4A 1N77A 2XKJE 1P1HA 2VDMB 1XK6A 5F3DA 1Z25A 2GAOA 4BNFA 1ONNA 2QZ4A 1PFKA 1SQSA 1QGED 3W6NA 1ZK3A 3NOQA 1GL3A 2WNIA 3HWX1 3E23A 1NZFA 1PX2A 2OV6A 2VPTA 4H9GA 5EQJB 1KI1A 4Z1MA 1IXYA 1W9HA 2CXUA 3V8NA 1JT2A 4NFYA 2RBGA 4EAAA 1OFGA 1GCOA 1PKEA 1WRBA 1WDLA 5AKXA 4BBZA 1FYVA 1UMKA 1Z62A 4AN0A 3PVZA 1DL5A 2QD5A 3PE3A 2HADA 3UQYS 1SBIA 2JD0A 5I7WA 4WXPA 3IH5A 1ZIOA 1C81A 3FCSB 3CVWA 4WXYB 2QVXX 2Q8PA 2CNWD 2C4TA 3OZSA 1ZNQO 4IRXA 1W49A 4PAQA 5H3LA 3VR0A 1IHOA 3FWYA 4MUKA 1U9YA 3AOEA 1GAEO 1DIAA 3KWJA 3A1EA 3ANLA 4RENA 5DO9A 1UMBA 2YJ4A 3CLTC 2D0PB 2CUZA 1FVXA 2Q6LA 3CG0A 1I7NA 4QPPA 4FILA 2CHVA 1WUHS 1IU9A 3MTAA 2XUAA 2OVBA 3S28A 2OTCA 2WYVA 3RAFC 2QW1A 1Z5NA 4G4IA 2Y0BA 4OUKX 1Q22A 4TWZA 4AS1A 1PUJA 4D4KA 2BTQA 2I66A 1DV1A 1HE2A 4DEVA 1ZN7A 2RHGB 3H11A 1ZG3A 5CUQA 4YRRA 1H0KA 2WNSA 4PTYA 3VUFA 1GPJA 2QGNA 1E2DA 4QD3A 4DABA 3BXPA 4ZOAA 1VE1A 2FW6A 2JCSA 4A16A 3S5UA 1FJGB 3V5NA 2O1EA 1SQGA 3HTXA 1DFIA 2AFHB 1SHTX 1IN1A 3OQVA 2YJ6A 2ECPA 1WHTB 2FMTA 5K3BA 3L6CA 2JH8A 3H75A 3DE1X 2CV2A 4HR7A 4GPBA 3ANNA 4NICA 5ALLA 4DAOA 5K8IA 4O4LA 3GFQA 2BHTA 3PYXA 3DPSA 1G16A 5AVSA 1BAPA 4LBZA 4CHTA 1HE4A 4DEXA 3LC1O 4LJSA 5B2FA 2G1PA 5JZSA 2A1TR 3EGIA 2C7RA 1OBCA 1MQ9A 4F5DA 1NMEA 1Z0UA 3UV3A 1AHNA 1CZUA 3U9LA 3A28A 3M4JA 5A3RA 3NHLA 4AP9A 2FZCA 2PA0A 3H2SA 4FCWA 6CHYA 4M0MA 1FOEB 5FOWA 1U3VA 4FKZA 1ISRA 4XLLA 3VU1A 3TECE 3R44A 3N1UA 2WIGA 4F21A 4XVUA 2FUEA 2C1ZA 4LISA 2LGJA 3QUQA 2QW8A 1U9ZA 1LNQA 3JASB 4NOLA 2V98A 4PZAA 4IIDA 3HEAA 5L3SA 2JFVA 3LHDA 3KAJA 2VHVA 1Z26A 4MP3A 3A3PA 4X3OA 3V2HA 1H4QA 1TU0A 1V48A 1Y98A 1YS4A 1A9XA 2OBXA 3B6ZA 4P2BA 2JGLA 1UP4A 2VDJA 1SUDA 3A7EA 3FCUB 1VG8A 4UUBA 1FVOA 3WGIA 2VQEB 2OB2A 4FS8A 2P67A 3DWGA 1L1EA 2I91A 1XWWA 3IUEA 1DIHA 4IR7A 2R7AA 4NXMB 1KI7A 3DZHA 4ZODA 1S2MA 2CZGA 3RSOA 5HKAA 2Q1YA 3BE5A 3RSFA 1H65A 2V4ZA 4HFRA 5J4HA 2NUPA 3DFKA 4AS3A 4L76A 4BVKA 3ABIA 3HY4A 4V0LA 2ZFUA 1L4BA 2H5JA 4CF7A 4J1QA 5ALNA 3QA3E 1XPOA 3QU2A 3E0XA 3PTAA 1H23A 4V24A 3ELBA 2PFGA 1DQYA 4JXZA 5M5BA 3P9IA 3UIEA 1WCIA 3WDMA 2Q1UA 2QTVB 5FOXA 4EA9A 5B4VA 3H16A 4URFA 2PEZA 3VC7A 5LL6P 4WY2A 1AH2A 2JAQA 2R7NA 1P80A 3L05A 4OV6B 3LT2A 4KZPA 4U6NA 4U3JB 5FB3A 2GUGA 3S8EA 1T36B 2CZQA 2FPGB 3I05A 4LJ9A 3HYLA 1K4YA 4JYMA 1GKLA 2P77A 4S1PA 3TOVA 3NO4A 4IDDA 1HKUA 2HC9A 5TGZA 3NV7A 4FX2A 1SO8A 2H4JA 3KQOA 4C88A 2J4FA 2GM5A 2BI8A 2Z09A 1AGNA 5B6IA 3EVNA 3ERCA 2CVPA 1A9YA 1UT8A 2OECA 2HWXA 1GUDA 1RZ3A 2EG5A 3BSWA 3FYUC 4BATA 4Q4AA 1PR3A 3HCAA 3WG9A 3MJVA 3AQ4A 3KZCA 4CR7A 2BOVA 3GEDA 2BI4A 1BW9B 2F7SA 3M70A 2VAMA 4JCCA 4K6HA 4AKSA 5ADVA 1UJ6A 4KPUB 4Y2UA 3OJXA 1N8KA 1F6DA 3HP7A 3BM5A 1NVMB 1JSRA 2PX0A 2QY9A 2R7MA 3D5TA 4WDQA 4MV6A 2IXGA 1H5QA 2JKVA 3K20A 3OPVA 4LQDA 2DFTA 1ATIA 1X8JA 2QVCA 2XNHA 5FUYA 4O0MA 1ISFA 3RC1A 1L5HB 1YVDA 3K96A 3SSMA 1N1MA 5CHYA 1TLFA 2Y0PA 4OHKA 3V2IA 1NR5A 4ARUA 3KT0A 2OC4A 2HX1A 5ALYA 2WU3A 2ZE6A 3A1NA 3N3BC 4ZCIA 1ZJ4A 3T1VA 2C2HA 3JQCA 3K5IA 1RYMA 2WTNA 1WULS 4GWGA 4MGKR 3DL0A 4S0XA 4WY5A 5A3JA 3EMVA 1N78A 1E3TA 1T1GA 3KQHA 2F1JA 1I0ZA 2YH2A 1RXEA 2ZSHA 4Q3AA 3SI7A 3EG5A 4FOPA 1UR5A 4NWIA 2FW0A 1A1VA 4IOMA 1ULBA 2G72A 3NKLA 2K2QB 1QXSA 4AXBA 3L7DA 4D74A 3N74A 2H11A 3ZOKA 4HLDA 3I2IA 4LJ6A 2GEKA 4IPTA 4AJJA 5BWMA 4IJQA 4MXDA 3SQLA 1J99A 1IZ9A 1R0SA 3OOYA 4P93A 4YC7A 2IYQA 5COAA 5EWMB 1HXHA 1NBHA 3B1ZA 3WGYA 1KAGA 1MH9A 4DC9A 5IJWA 5BNIA 5BWOA 3GLGB 1V16B 1G8YA 4UBJA 3WRVA 2FZWA 1P6UA 2PKQO 4HCJA 1KPGA 2X9LA 3BC1A 1YO6A 1ZINA 3C98A 4S12A 5LU9A 5EG5A 1ZRMA 1XAHA 3ZIAA 1TI7A 1LQUA 3QFTA 3OLXA 1JALA 4OEHA 1FE8A 4O5AA 4Y6OA 3BD9A 1GTG1 1R2QA 3CB2A 1JQDA 1CUSA 1T26A 2YVKA 4GMDA 1QG0A 4N39A 1GFSA 5GONB 5F5XA 3X1JA 2ZJ5A 2J09A 1TT5B 7YASA 3FHTA 1L4UA 3V2GA 2C4WA 5BQXA 4MX8A 2VSFA 3A4NA 1EJ0A 3UUEA 2H2WA 4G89A 1C1HA 4QUKA 4GLBA 3T38A 1SURA 2I34A 1XC7A 3L0ZA 1F60A 1VYVA 3I9V6 3KZNA 4QNRA 2EL7A 2QTMA 4MUBA 3VZCA 1PGJA 4BP9A 4ABYA 1UIMA 4O8CA 2N1MA 2AC4A 3BH6A 1KI6B 2MSDB 5DKFA 2YIDA 1M2HA 4DWWA 4DIOA 1RWBA 2Y9PB 3AUXA 5DIZA 1UJ5A 4AT1A 2DFKB 4BQSA 3CLUD 5MGNA 3ET5A 1RJGA 3RYCB 1C7FA 2FWMX 4PYQA 5KDLA 4CEJB 1HFJA 4LJ8A 1AKNA 4RJ2A 2FWRA 2RHCA 3EXHA 1D0IA 5K6RA 3DHNA 4OQPA 4OHMA 2F4VB 1RVV1 4C0XA 4DSOA 4NU0A 1SBQA 4CV3A 4YRJA 3DZDA 3RVSA 3BA6A 1Z2PX 2WT4A 3P9XA 2NN3C 4QOGA 4TTQA 1SC3A 4U6QA 5HGJA 4CTNA 5AJXA 4I4CA 2O7VA 4F3CA 1B41A 3H99A 4JXXA 1PQWA 1FLAA 1HT1E 4XB6B 4Y2TA 1JXQA 3NDJA 4DG9A 5I5EA 5IDWA 4J1TC 2ZIZA 3SSNA 3F9CA 1C9JA 4POAA 3M5PA 4DMUB 3QJ5A 4MWZA 1D1QA 3E7DA 2ZTMA 3OLVA 2L17A 1K5HA 3GRCA 2B4QA 4MR7A 3HDYA 3E2MA 4A26A 1E64A 3M4YA 2QTZA 5E3IA 1NNLA 3S0JA 3K0CA 3PQCA 3L1IA 5EE3A 5MGBA 1E63A 3CBGA 1JS1X 4Q4JB 3EVFA 1RYEA 3R20A 3Q3EA 2O2DA 1X1RA 2ZGVA 4FYHA 2ECFA 4K9OA 2B0CA 4PHHA 5IWCA 2QM3A 3KV3O 5ITVA 2IS4A 1BCSB 2QMYA 2X42A 3IB3A 2Z2ZA 1LBIA 1PEAA 3IA7A 3R5SA 2DM6A 1SELA 1NE2A 1TGVA 3UANA 1NQVA 1RYNA 3IBYA 3GLRA 4KQ6A 3WHIA 3WYGA 1KR5A 1THZA 2CFCA 1YJQA 1P60A 2M6SA 2EKZA 2YYAA 1M2VB 1DKLA 1T8RA 2I2XB 2PSDA 3QX7A 2XMPA 3W5JA 3J7AC 2J3DA 2G4CA 3LD9A 5K0LA 5CBKA 3OKPA 1R00A 2ZRFA 3H8VA 3OTQA 5HQTA 4D25A 1YQXA 3UOWA 2WHEA 4DYHA 1PLLA 1X2EA 3JQEA 1MP0A 1UMDB 2GN8A 4PAWA 5FT9A 1YFKA 4D56A 2B4KA 4MVJD 4NJMA 2DY1A 2WJPA 5EJ2A 4Q93A 2R2GA 4DV7B 4U3JA 4M8NE 4EARA 5FTNA 1JAYA 5IAJA 5KOIA 3KJQA 3E9CA 3FGNA 3ONVA 3EZ6A 1ZMOA 3B1VA 4MCJA 4CF5A 4DVJA 5JS8A 3I8OA 1G9TA 2QD4A 1V39A 2QTHA 3LVRE 4UNRA 3UVEA 2BFBA 4ARAA 4Y98A 3MHTA 3AC0A 1I4EB 3QFRA 3BYZA 1B8NA 3VVLA 1T6NA 1M73E 4GUDA 2Q3FA 5IT0A 5CTJA 4BMNA 1M5TA 2HA5A 3V42A 1RI2A 4KAJA 1IBRA 3QOWA 1N6KA 2RONA 2P5TB 4RQBA 4OMUA 3ZY2A 4C1NA 3CEAA 4NU6A 1L4MA 1N9GB 4BNDB 1JJIA 4Z4IA 2R87A 2C1EA 2YRWA 3IX7A 2F3PA 3A3YA 3QBJA 5EMMA 3ZNQA 3Q3IA 5JSQA 1QFJA 2A30A 4CM5A 5D6NA 4HNUA 4HAUA 1XQYA 3WIBA 1GZ5A 3WKBA 2UXBB 4RC9A 1LZKA 3NTUA 4L28A 1BDJA 3PENA 1MG5A 3HDTA 1TAGA 1VIVA 1UOEA 3IJ5A 1KMHB 2QSYA 3ETEA 5JZVA 1YQ9A 4U2FA 4EI8A 1JJ7A 3PD1A 3TPZA 4J76A 2QYOA 2AVDA 4WINA 3MYYA 5CYFA 4BNUA 2VA8A 5I51A 1RTKA 1DBSA 1XJWA 4JNKA 2A94A 3TL2A 1O95A 5CLIA 1R27A 1WZIA 3AP2A 3KEFA 3B51X 1DI0A 1XDUA 1Z7BA 1T2FA 2OFXA 4COKA 4MEJA 2YZGA 3EGXA 5HTOA 2BFCA 3WYFA 2XUHA 3E5RA 1TNDA 3V1TC 2AFIB 3N53A 1DVRA 4GMFA 4RVCA 4UTNA 4INAA 3DMHA 3A4VA 4KPFC 3WICA 1J8FA 4UNIA 1SJ9A 4P9NA 3LP6A 3T3MB 1VHQA 2MSEB 2Y1EA 4H7DA 3Q40A 1M1YB 2VJKA 3DV0B 4RM3A 2GPBA 3K0EA 3J7TA 1GPKA 3VJKA 5B7NA 1G17A 1IZZA 4DF3A 3ICQB 1JAXA 5HKBA 4MB0A 1GO2A 4D0GA 1NOKA 2LBPA 4JJFA 2GLTA 3HMKA 3RFTA 2OSBA 5LQCA 3C3PA 5F7JA 2RGXA 2ZBRA 3DP9A 3AUAA 4MVYA 1R3UA 4J03A 3ZHOA 1IHYA 2XWQA 1A9OA 1IH8A 1ZBDA 3AZOA 3M3DA 4ALLA 2CD9A 3IMGA 2VHEA 3L0OA 3CX7A 3OZAA 2I1LA 1UJ2A 3K1ZA 2F9MA 4TM7A 5GONA 3TLJA 1L5ZA 3Q41A 4Q3DA 4F4IA 3RFUA 4L22A 4Z0NA 2HJWA 1HC7A 4RH3A 4JJ7A 5FOVA 4JXJA 1XN1A 4RAQA 1YS6A 4TYWA 1RMQA 2RE8A 1BS1A 1N2CE 3QBVA 3TGLA 2ZJ4A 4X44A 3T9BA 2X9QA 4WGFA 2CSUA 4EW6A 1IJEA 3HU3A 4ZI7B 1YR1A 2GXUA 4OF4A 1T6YA 1KPIA 2X0IA 2QYTA 4DQLA 5IN4A 1PR5A 4FPXA 4I4NA 1ZR2A 2EFGA 3MT7A 4JVMA 4DDKA 4FCVA 1X86B 1NQOA 2RGUA 1EP9A 1XX6A 1VLJA 1J8DA 4XIFA 2H59A 2GKOA 1DT3A 1VE3A 3V4VB 3WL7A 4ID9A 2BSXA 2R5WA 1OXVA 3C1UA 3QXCA 1I32A 3KOUA 5IDVA 3RPEA 5JAPA 1J5PA 1IL0A 1NR1A 4QXAA 1KZ9A 5HJ5A 3G1WA 4J0HA 4OAOA 3K70D 3OJLA 2CXOA 1NVVR 4WZAE 3VSAA 3BH7A 4L07A 2E4ZA 4JBNA 5HMLA 2IYRA 2I6GA 3MJEA 4KIFA 3UJDA 4EPTA 2IHZA 1XD2A 3O93A 1VYUA 3M6IA 4MTCA 4YAOA 1A1SA 4INZA 4ESEA 3V7FA 1WXDA 3RYFB 1FJXA 4DKXA 3GJZA 1NC3A 3V7WA 1XVIA 4GVXA 1ESDA 3K9WA 1PRYA 1NXSA 5DN9A 1I3OA 2COEA 1E9BA 2OFPA 4F4FA 4L8WB 2ZRKA 4KN5A 3E22B 4JS0A 2C00A 2PKRA 1IE3A 1Z0DA 2WKWA 1EVEA 3LHSA 3GVPA 3UYLA 4F9FA 3ZWVA 1R8SA 1TTPB 1N5LA 4XGRA 4JQCA 4LY9A 1VTKA 3JATB 1BN7A 4HXEB 1J2EA 1G2IA 5SZJA 4ZZIA 1I2DA 2QTRA 1JVSA 3GLFB 2E87A 2O2YA 3OZEA 4OYRA 1G3MA 3PL1A 4TWRA 2WPNA 2PWPA 2A58A 1KK0A 1WU7A 3LX4A 2WKQA 2NOAA 2HRQA 4HMQA 5FWXA 821PA 2E1RA 4H7EA 4LZLA 4QT0A 4R83A 2R47A 2V59A 3URMA 5IBCA 1S2NA 4MV8A 2FGKA 4IHJA 4NY1A 4YRTA 4DLKA 4MR9A 2GMWA 3SX2A 1QQ5A 3HBMA 2PV7A 3CH7A 5KQLA 2HQOA 1XGKA 3KJNA 3MJ4A 2GD2A 4TSFA 1AK2A 4PYMA 1GUFA 1P73A 1VRVA 2DBYA 4K1LA 5KYUA 4EG3A 4CM9A 5DGHA 1DKPA 2HXYA 4FUQA 1MFZA 2I2FA 2G63A 5EE9A 3CRRA 3PUKA 5B1YA 1J0XO 1TQDA 4G8DA 5IBQA 1IY1A 1ZVMA 3PI6A 1UBKS 4XB1A 1OF1A 1PJZA 2GZDA 1GZUA 4JI3B 4BRWA 2AEMA 5LYJB 2HOQA 1XVTA 1BE1A 1UMDA 2D3WA 3DDWA 3FNBA 3M6AA 4HLUC 3TIVA 4REQA 3UMCA 4BKPA 2CDBA 4TKLA 4R69A 2Q0XA 3R7NA 2M2IA 1GPYA 2YVLA 1PR6A 1QE5A 2JIDA 3N6VA 1TM5E 3EXG1 1H1TA 3QVWA 4QYSA 3RK0A 4GL4A 5HKOA 1LX6A 3GT3A 3GAZA 2C97A 4UARA 5CCEA 2VQFB 1VSUA 5EUMA 1OTHA 2HRBA 3D7SA 5C1IA 4WL0A 4CG2A 4EHAA 1YCDA 3ZHVA 2ZR9A 3D8HA 1Y8QA 1P4RA 3NTLA 3TG2A 2I7DA 3B3AA 3L6RA 1RCUA 5DLYA 4HDKA 2F1HA 2YNMC 3CTMA 4IVRA 5G4LA 3V3KA 4B9AA 5KWIA 2IZ0A 3BXEA 3F97A 3UQZA 2DFVA 1NFFA 3ZWWA 1YTLA 2X77A 2ZUEA 1N0HA 1C7EA 2ZZMA 2RGAA 4W1PA 3OQPA 1KEEA 1PFUA 1G9XA 2D6FA 3I0NA 3QF4A 1KH3A 1ADCA 2ANCA 3HKEA 5EE1A 4CKBB 3WGUA 4QBHA 3C5EA 1ATZA 2XLCA 2XYGA 5I6DA 1W6UA 4UM9D 4LFCB 1XZBA 3VKGA 2PS1A 3GNLA 3ETGA 5FFFA 3GFBA 3RD5A 4D0LB 1I4OA 3N2KA 4M8IA 1XVLA 2QNIA 3DAYA 2CBZA 3A6HA 1EFDN 1A76A 3X0DA 1UPAA 2V8BA 4EJFA 3EULA 4EJSC 5FWDA 1W93A 4DNOA 2K7ZA 4Y8VA 3DH0A 3KETA 1EVZA 1KGDA 4P3NA 3FMVA 1N5IA 3E48A 3W5VA 3G2PA 5GJBA 3PWTA 1U1DA 2IEAA 1W4LA 2C3OA 4LXUA 2OBNA 2RJ3A 1EWKA 4BY9E 2ZPTX 1Z35A 1UFQA 3EY4A 2QN7A 1JH8A 1SY7A 2PX3A 2IX9A 3IMCA 2I4TA 1F6WA 2OUIA 4A8JB 3F9IA 1T6XA 1T9GR 4X3CA 4LDZA 5B6PA 3AKDA 4WXHA 1MV5A 1MO4A 4ZT5A 2WFAA 2PHZA 1JIUA 2NSDA 2NW6A 2UV8A 5AKEA 5I8WA 4Q9JA 3FVTA 1E4YA 3AI7A 3PNQA 5FYDA 5HVNA 3UENA 1KRXA 3R09A 2JLWA 1JE0A 1Z0IA 4QEZA 4ZYYA 1C3JA 5DNAA 5TJHA 1Z07A 2F2TA 1OXMA 2ZJ6A 1DG3A 1J8VA 2OCPA 3EH1A 3H19A 3PHCA 4GRDA 4TS3A 4EG4A 1TW3A 4R7GA 2O7NA 4KC0A 5FRDA 4Q9DA 1SOWA 2SHKA 2H8GA 1VBFA 2WVAA 3MFYA 3VH2A 1LWNA 3JYPA 1K2WA 3RAPR 2CFRA 3BBLA 4F7DA 3UPTA 4G5XA 1PFWA 2D8MA 4L4XA 3KVYA 3IIIA 4BNZA 1Z8NA 3C6QA 4QU5A 2CMHA 3M9XA 5HIIA 3WGNA 4AJKA 3GGPA 1NQUA 2J7KA 2RK6A 5ADUS 5C8VA 1QIEA 5M7EA 4TTVA 3V48A 3VNQA 5FOUA 3RYHA 3TEMA 2H65A 4L78A 1PNRA 3L0CA 1T3HA 1U7XA 2Z0MA 5BO5A 2PZGA 5KBYA 5ES4B 3R7LA 4PSVA 4O59O 2VRWA 1NDQA 2WWHA 2J41A 4PVCA 2EFHB 1E9AA 1GT91 1UFKA 2DTEA 3CN7A 3D3WA 4Y2VA 1QR2A 5IUKC 4GE0A 3RJ9A 1MH1A 1HA3A 3WQSB 3ZJTA 1P1KA 1FRVA 1ZCFA 2Y93A 2WZDA 5LUBA 3DPIA 3BX1A 1H8ED 4ZALA 5EJEA 2A2ZA 5I3CA 2P9BA 1CUBA 1X19A 2YYZA 1QR6A 4F1WA 1V4VA 3TQTA 5J2TA 3A1WA 3MS4A 1SGWA 1Z74A 5THXA 1LXCA 4BFUA 1KK1A 2F8LA 4KYUA 4ZCQA 4EHJA 3RW9A 1R9MA 3DDHA 2QZJA 3UM9A 5JFGA 2RHLA 4MKXA 2OZEA 3HKDB 3A0UA 1I6KA 4DG5A 1JTVA 1GLNA 3SR0A 2FUKA 2BGTA 3K9NA 3AVXA 1SXJD 4GLLA 4HNSA 4YJKA 2D1RA 3TBFA 2P1ZA 2NO0A 3R74A 2QUHA 4RXUA 3U0VA 1EFLA 5ES3A 2JG3A 4ZTZB 3LKZA 2GA9A 3DR3A 2JCXA 1NMYA 2XB6A 2CVZA 4H31A 5CA0A 3HU5A 4ZEXA 4UW9A 1DC5A 1XKQA 1QBKC 4RDCA 1F06A 4TL6A 3EZYA 2UVPB 2DUJA 2J8ZA 4ZPXA 3LOPA 4NU5A 4JYPA 4BB6A 1MAUA 3I30X 4LHYA 4UU1A 3VHRA 2J45A 4GLJA 3HYCA 1NNE<