2WM9B

Structure of the complex between dock9 and cdc42.
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
179
structure length
179
Chain Sequence
SHMQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Activation of Rho Gtpases by Dock Exchange Factors is Mediated by a Nucleotide Sensor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
molecule keywords DEDICATOR OF CYTOKINESIS PROTEIN 9
total genus 55
structure length 179
sequence length 179
ec nomenclature
pdb deposition date 2009-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2wm9B00
3PEVA 4B73A 4MGZR 3ZD7A 1U8AA 1OT3A 1YR8A 3UMFA 3NEYA 1FUUA 3EG5A 2QPAA 1W5TA 3KJHA 3TQFA 2IS4A 2H7VA 2OEPA 4XWKA 1KDRA 5EQTA 2WOOA 1FMJA 4IVQA 3QF4B 2P6UA 2WWIA 2Z43A 3KUCA 1ZCAA 2REXB 3R7WB 5HPYB 2QT1A 4RFSA 5KTYA 5D3MA 5L3QA 1OKKA 1WRBA 1MV5A 1T5IA 3NDBB 2HF9A 2PH1A 2NOAA 2X77A 3D3QA 3ECCA 5B58C 2J7KA 4A0HA 4JVSB 3TSWA 4Q4AA 3T12A 1DAGA 2OCYC 2ZJAA 1KAOA 5AK0A 4DCUA 3PEWA 2XZLA 5JHHB 1T3LA 5FTJA 4TLAA 5KSPA 5EXTA 1KK3A 2GCPA 1R0YA 1II0A 5FFMA 2PT5A 5FL7A 3T1VA 4CT4B 4W5JA 3R20A 2QP3A 8OHMA 5IK2A 5IK2D 1XEWY 4Q4AB 1NBME 4DSUA 1KO7A 3CNLA 2ZRNA 2W83A 3WYGA 4CF7A 4W5HA 3CR8A 4Q19A 1T8TA 1NNEA 3CH5A 4UNRA 1Z2AA 1XB2A 3QSYA 1X8JA 1J8MF 1IXSB 4M1WA 2OFXA 3RSOA 2W2XA 3MWJA 3RAPR 2JJ1A 5JS8A 4ABYA 2R6DA 4Q5IA 4OI1A 3HR7A 1MKYA 1QBKC 1T0HB 2HLDD 4OQLA 5GADl 3GLGE 1M1YE 1KI2A 3ZJYA 3D7MA 3G5UA 3JZMA 3FTQA 3M0EA 2PJRA 5EP1A 4Q1BA 5TDHA 3ZVRA 3QPUA 3AM1A 2J0UA 2QUZA 1OYYA 2YOFA 1X86B 4B47A 3KKMA 1E2KA 4Y0VA 2IA5A 2IYTA 2V4ZA 2DYKA 3HR8A 3QBVA 4IOKA 4LPKA 3EXAA 5CB6A 1JR3A 2WKRA 2VF8A 2GJAA 5DN6D 1Z6XA 1NIPA 1E98A 2CCGA 4XWOA 2Q0HA 1J8YF 4Q7LA 2H92A 1KOFA 2ZI4A 2GAOA 4EAQA 4LHZA 5DO9A 1WB9A 2VPPA 4DDVA 5EXXA 2AWOA 1HE1C 2YC2C 1FX0B 3K53A 1S4QA 3CO5A 1KO1A 2FZLA 4EKDA 2VL7A 3C41J 4CEHB 1Z0KA 2XOKD 3QBTA 2CMKA 1TMKA 3PR1A 2JLWA 2IS6A 4MH0R 2SHKA 1Z2CA 3MSXA 4C3ZA 3GEIA 4Z8YA 1MO6A 2HXYA 2F1IA 4TMXA 5DI3B 4BFYA 4TSFA 1YJ5A 1NVVR 1X8LA 3QF4A 2J45A 1YZLA 3WNCA 2FPMA 4HAZA 1XMVA 2NPIA 3NTUA 1JXMA 3X2SA 2WJIA 3KL4A 3X1YA 1KNXA 3THYB 3T35A 3QKTA 4F4CA 1KI4A 4WW0A 3SYLA 4A8JB 3FE2A 4NCJA 2Q3FA 4LJ5A 3T5DA 1JXOA 3C7KA 1FQKA 4NL4H 4ZDKA 1LV7A 3DHWC 1GRRA 2LKDA 4KAXA 4AK9A 3G0HA 4ZCLA 3NBYC 2OBLA 4JBXA 4QM6A 2WSSA 3GLHB 4Z1MA 2JJ8A 1JEDA 2BBOA 4LZZA 1BYIA 4A0RA 4OL0A 4UXHA 3UXMA 2IYQA 4X8MA 2DCUA 2WJYA 1KY3A 4A92A 2ZE6A 2ZU6A 3B6EA 221PA 2WICA 3FGNA 3U3JA 2O8CB 4UKDA 3F5FA 5E3HA 4LJ7A 1FNMA 3REFA 2ZE7A 3GEHA 5L3RA 4R71A 3QXCA 2QAGA 3HWSA 2EFEB 4Q47A 1NN3A 5FR1A 1NN5A 3VR4A 2JASA 3MG9A 4IHQA 3GJ3A 4EPWA 1I4TD 3L0IB 4D82A 1QG2A 5KUTA 1KKLA 1L4UA 1V43A 2I1VB 2WAXA 1XBTA 4M1OA 1E0JA 2XGJA 2QTVB 1KJZA 2JJ2D 2IUSA 3MJRA 1SKYB 121PA 1E2QA 1W0KD 2GTPA 3GFOA 4TTRA 1RVDA 2FFBA 2GK7A 1RRCA 3RRYA 1GOTA 4LPSA 4PQYA 5CIQA 2W6IA 2KJQA 2CBZA 4LJ4A 3I73A 1KO4A 2ZSAA 2GJ9A 4P4SB 3ZZTA 4E07A 1G8HA 4EQ6A 2GJSA 4AURA 1E0AA 4URWR 5K8TA 5DH9A 3VNVA 2YNMA 3B1VA 4TL9A 1CR0A 1AZSC 4KLZA 3K70B 3RS2A 3WMEA 2A78A 1DO0A 5JSZB 3QXXA 1VG8A 4EQ6B 1M7HA 1Z6AA 3MWYW 2X2EA 3CZQA 3O47A 4DDUA 1AK2A 1NMYA 1MOZA 4B2PA 4ZCMA 2RGCA 1D2MA 1MO4A 2WM9B 4HUQB 1CU1A 1XCGB 4DLVA 4IDOA 1XXHA 1ZC3A 3AF2A 3I92A 4KVAA 1N6PA 4DZZA 2NO1A 2JLXA 2ANBA 4TQ9A 3AVTA 4B6FA 2OXRA 5TVKA 1HQCA 1CXZA 1HTWA 2CLSA 2GXAA 3C8UA 3T06B 4A36A 4ZKDA 5F3WB 4IW3B 1EFRD 4KYUA 2IYWA 3QIAA 3U3OA 4WXPA 4ARZA 2ODWA 3FWYA 3ASZA 1N25A 4TLEA 1KTVA 1P7CA 2ZYWX 3EPJA 4JSTA 2ZJBA 2ZEJA 3CLVA 4HLCA 4YXWD 5AR1A 4XD7D 1SGWA 3QKUA 2ZRIA 2GEUA 1KI8A 3KZ1E 2JLZA 4G1UC 3LLMA 1TEVA 2PL3A 4G5QA 4ASUD 4LGMA 4KLNA 4BLOA 2CCKA 3BE4A 1ANKA 4O2LA 4Q1FA 3U7FB 4G5GA 1CKEA 1R0ZA 2VHJA 1XTSA 1G7CA 1NN1A 1RKBA 3NVAA 4UNNA 4DLSA 3KB1A 4QRHA 3OAAD 5FOWA 2QY9A 3WNDA 3OE7A 4L9WA 1FOEB 2IWHA 1IJEA 4XVRA 1KYIA 2UZIR 5BYKA 1VCOA 5JZVA 3BAFA 4QKQA 2CE2X 4OQMA 1F2UA 1N6KA 1SXJD 1VPLA 1RFLA 4LCBA 3U60B 2GRJA 3HU3A 2GXUA 3CW2A 4KFUA 2NIPA 4DLRA 2PLRA 2XZOA 2WZQA 1OB5A 4GPTA 4OQXA 5DLQC 1FPMA 4Q1EA 4CEIA 2B8TA 4POAA 3B82A 3B7GA 4DBLC 1DADA 1E2FA 3SBEA 2AX4A 4R7ZA 2TMKA 4QXAA 4BLPA 4IDHA 3WRYC 3P26A 4JLDA 3QI2A 4I1UA 1CJMA 4GSYA 4E5UA 2FFAA 4XVQA 2IYVA 1W44A 4N3NA 4F7WA 4TMKA 4W9MC 1YU9A 1JQJC 5HCIA 1JB1A 1Q3TA 1XX6A 2XSZA 3L43A 1Z6GA 4V0KA 2IXEA 4JIMA 4NBSA 5E7MA 4C0LA 2JLYA 4D25A 1P73A 3QKSA 3WY9A 1QHHB 1LS1A 2FMXA 2OG2A 2JDIA 1SQ5A 1KMHA 3AEZA 4HUTA 1KDOA 4HDCA 1MT0A 1OLOA 2V1XA 3QXSA 4HAVA 4LY6A 1W36C 3A4NA 2YVUA 2ZYTX 4LJ6A 1KMQA 3WP1B 3AVWA 4B6EA 1SHKA 3RC3A 3V4RA 2V1UA 5E7JA 1K6MA 4WZ6A 1SZPA 4ACBA 4MYTA 3L0OA 1SXJE 2WV9A 3OIVA 2EWVA 1WBBA 1HURA 2AK2A 5JWOA 2OCPA 3BB3A 2AL7A 1N6HA 1GTVA 1KJYA 1G5TA 2IBMA 3ETLA 3TW4A 3KFVA 4CDGA 1NY5A 4ZV4A 1AQUA 1F3OA 1ZRHA 2UZ3A 2YHSA 5BN3A 2XB4A 2JJ1D 3SDZA 1NVWQ 2HYDA 1OKKD 3AV0B 4PC2A 2YOGA 4PC3A 3UPUA 2X2FA 2Z6VA 3RHFA 2AXNA 1R6BX 3UKDA 4PPFA 1UKYA 2PT7A 4E09A 4UQOA 2QI9C 5JRJA 3B13B 1RRPA 2XXAB 4V03A 3FOZA 1EX6A 4R9UC 1YZUA 4NCIA 4UJ5A 3R8FA 2JIZD 5HKKD 3KUDA 2ZVQX 2RGNA 2IT1A 2DFLA 3DEFA 4E22A 3I8SA 2RGNC 3PUZA 3KQUA 1GAJA 1H8HA 1TAGA 2IYZA 2VP5A 3QXHA 2BVNA 3V9PA 1IY2A 2GDJA 5FPSA 1YVDA 5CDFA 4O2RA 1PLLA 1JI0A 4RD6A 3B60A 3TSZA 5B57C 1KMHB 5KU1A 2NG1A 2ZVPX 4WIAA 1NL3A 1ZJ6A 2BCGY 3PUXA 3WHKA 1NLYA 2HF8A 4IDNA 4PAMA 3B1ZA 1KZGB 4MGYR 4RCYA 4DCTA 3SEAA 1YQTA 3CB4A 2ZRJA 2A5FA 4BFVA 4LV6A 1EK0A 3FMIA 1YHNA 3SFZA 5J4HA 4N0DA 3FYHA 2OESA 2DWOA 2H57A 1N5KA 4Q03A 2BJVA 5FI0B 4NPHA 4D6PA 5C2JB 2WJVA 4M1MA 4A2QA 2NO9A 5ELXA 3O8RA 3MLEA 3GLHE 4HSEA 1US8A 3C14C 3W9YA 3K9HA 4BFUA 4J0QA 1DOAA 3AF1A 1J70A 2H16A 2Q3HA 1II8B 2AD1A 1D8TA 4PHTA 1U9IA 1A2BA 2DWPA 3PFIA 1RPZA 4TYWA 4URYR 2G1JA 4DSTA 2QP4A 2EYUA 1PVOA 2VO1A 2EFCB 4KI0A 1H65A 2WSSD 2OAQ1 4LJ9A 3R9IA 3NBFA 4QBHA 1OH6A 1LW7A 3R9XA 4QGHA 2VP2A 4FMDB 2O8EA 2P2LA 2YWFA 3GMTA 4KHZA 3BS4A 2RMKA 3UANA 3VR2A 3KQHA 2QMHA 3A4MA 4BFTA 4QJ4A 2JATA 3CF0A 2CNWA 4AG6A 4DXAA 1P2SA 5EUQB 1A5TA 1E2DA 4BRUA 3LY5A 2Q9CA 3SNHA 4AC9A 2KI5A 3RDPA 4EJSB 2ASEA 2JGNA 3DM9B 1C1YA 1AIPA 4ILEA 4JL6A 2ZAOA 1N3BA 3SQWA 2C9YA 2O0JA 3A4LA 3GJ8A 4FCWA 3BC1A 4YMUA 4PPGA 2BIFA 1EX7A 1MRNA 1HE8B 1WBDA 1L7VC 2IYRA 3WBKA 1W7AA 2QBYB 3SQXA 1KZ7B 3DDCA 3P27A 4KYIB 4DLWA 4ASUA 4FXPA 3IDQA 2P5TB 2QEQA 2BMDA 5HKKA 4OK5A 2WKPA 5GJCA 2VA8A 2PZFA 1UJ2A 2OV2A 3H4MA 3FB4A 5LB2A 4M22A 4LYHA 2GJKA 3LBNA 2FV8A 3QY0A 3LX8A 4CRWB 2FF7A 4JBWA 1N0VC 1OIWA 4BE7B 1XPOA 2REOA 1DTSA 5DE3A 4KO8A 5FL3A 5KSZA 4L5BA 3VR5A 4JLPA 3R7WA 4DEYA 1DE0A 1TF5A 2ZS9A 3CRRA 1XTQA 1YRAA 1X3SA 3PUVA 5FOVA 5DN6A 3I8XA 4LBYA 1GNPA 2X8AA 4M4SA 1U2RA 4QBIA 4U00A 3LVQE 5B64A 1AQYA 4EPYA 4BFZA 4C0HA 5JFGA 1T9HA 2V7QD 1V5WA 2KB0A 5CM8B 1XD2B 3PXGA 4XOIA 2OCAA 4FMBB 2ZRFA 1ZU5A 3NC1C 2LKCA 2LWIA 2FA9A 3U5ZB 3SJZA 5SZHB 1T0JB 1G3QA 3EA5A 3M1IA 2FU5C 1FZQA 4M1SA 1E2PA 2OE2A 2B92A 2ZTSA 1OE0A 2D4HA 4TYYA 2QQEA 1QHGA 3QJYA 3BH0A 2I3BA 2G9NA 3VU9A 2GK6A 2WKQA 1G41A 3P20A 5DNYB 4IDQA 1I4LD 4UNPA 1U98A 1UKEA 4JL8A 2QMEA 1P62B 1DG3A 3LXXA 3W6OA 2W00A 5SZJA 2ZUBA 2VBCA 3CWZA 2P0EA 1E2MA 1US8B 4LUCA 2QTFA 3ZQ6A 1SXJC 2VTKA 1OIVA 5EE9A 1AJEA 5L3VA 1AS2A 2CXXA 3QF7A 4JJZA 1BS1A 2BEJA 2CJWA 4YMSA 3FFAA 3QQ5A 1K8RA 3RRNA 1VCNA 2WVJA 2PCLA 2HJVA 2WWXA 5DHAA 3GLFA 2Z83A 2JDID 1QZXA 1ESNA 5FH9A 1YRBA 1XMIA 3IIJA 5F9FA 2N42A 2C96A 2ZJZA 4I81A 3A36A 3QPWA 3U61B 1C4OA 2QPOA 4OI0A 1NI3A 4X8OA 3RS4A 1LS6A 3CUEF 4HZUA 4G5RA 1VG9B 4B43A 2EQBA 1VDZA 3CBQA 1G8PA 2ZRPA 3NEJA 1DG1G 2WMNB 2D7DA 4JSYA 1SXJA 2D62A 5FBQB 1M8PA 2FNAA 4JS0A 3BJIC 4AY2A 1OHHA 3D6TB 1TEXA 4W7SA 5JEDA 3C15C 3SHWA 2ATXA 2IHBA 2O5VA 4U02A 2RAPA 2W0MA 4TMTA 5EUMA 2YYZA 4Q7JB 3K70D 1JJ7A 2QGZA 3EARA 1W0JD 3OEED 3FHTA 2PMDA 3EA0A 1Z06A 1TQDA 1NKSA 3DKPA 3IBYA 3NH9A 5DYIA 1E1RA 2O8CA 2MSDB 3WP0A 2WJJA 3KKPA 4GT1A 3A1UA 5BN5A 3TUIC 2FFQA 1IN4A 1FP6A 1W46A 2HXSA 3AKEA 4MDFA 1E4YA 2WIBA 3NG1A 2NGRA 1J7KA 2YZ2A 4HAXA 1LF0A 1KO8A 4N1AA 4PXAA 1P9NA 1IJFA 5D3MB 2JEOA 821PA 2VF7A 2ZXUA 2CLDX 4HLUC 1QVRA 3TVTA 4A1FA 3VAAA 1M7BA 1Y3AA 1IXRC 4FCTA 2J46A 1NBMD 2BOVA 2OT3B 1YZNA 1SXJB 1NJFA 2VP9A 3EC1A 3EWSA 4NDZA 4Q18A 4XH9B 3U4QA 2QSYA 1FL9A 4TL8A 3H0KA 4YC7A 4HZUB 3ZVNA 2R65A 1FNNA 2ZI9A 3LBIA 1Y63A 5FPYA 4PHFA 3VTKA 4D4JA 2QTHA 1S9HA 3QNUA 2F43A 1ZP6A 2ZJ5A 4PTLA 4RD2A 4ESHA 1NMZA 2OLKA 4BASA 2ORVA 3K9LA 1E0KA 1SULA 1Z28A 1OJLA 2FWRA 2DWQA 3X1WA 1ZNZA 1G20E 1ELOA 1UADA 2ORWA 4URUR 1G6OA 2VP4A 5EE1A 1E2IA 1IOZA 2G0NA 4US2R 1N6RA 3CPJB 3AUXA 2NO0A 1EXMA 2B8WA 3IO3A 1FX0A 4BFXA 2VHTA 4NONA 1GL7A 1T4GA 5L3SB 4C4PA 2NQ2C 2DHRA 2J41A 2C04A 3BOSA 4Q02A 4CEIB 3EIHA 4MKFA 1S1CA 1PLKA 4PHGA 1VMAA 3CWQA 5LBIA 4JLJA 1KAGA 2OFOA 4G5SA 4PPNA 1W49A 1E1QA 2A9KA 3AVYA 4PQRA 1B0UA 5GJWC 3NBXX 4HB2A 1G291 4MRSA 5J47A 1TUEA 2X1VA 5G41A 4JZKA 5BW8A 1Q3HA 3O8DA 5C18A 3LNCA 2ORIA 2O8BA 4TQAA 4EPVA 4S2EA 2BM1A 4BPBA 2P3SA 4D80A 4OI4A 2IF0A 4R2IA 5HTKA 4DLUA 3BB1A 4NYIR 1AKYA 1E96A 1XF9A 4GNKA 4BZQA 2B21A 4YDSA 2IYUA 1CLUA 2FGKA 3LQRA 5FTMA 1GKUB 2IEZA 5LD2C 4BRWA 2YWGA 4ACAA 3KFXA 1KDTA 1E2EA 5G3ZA 3FMOB 4MUBA 3UG7A 3K09A 1PUJA 4OKSA 4AYWA 1VTKA 3T1TA 2C03A 4EFMA 4TLCA 4OHWA 1OXSC 2VLIA 2Q9BA 1OPXA 2C77A 1AZTA 3DMDA 3B1WA 1Q57A 4UNQA 4QC2A 2FE4A 4OBEA 4AIIA 2Z4SA 2A3RA 2ODBA 3OHMA 2N1BA 1W48A 4IOLA 2HUPA 3K0EA 3OEHA 3SFVA 3EAQA 5AUNB 3GJ5A 4JYCA 1G7RA 1DAIA 4MKHA 4FMDF 4MKGA 1QHNA 2XOKA 1KI3A 2AFIE 3IO5A 1E9RA 1MO3A 1P2VA 1DPFA 3OAAA 4B3CA 2O8EB 5JCZA 2ODNA 4H9GA 3GJXC 3A58B 1ZBDA 2QMUA 3HU1A 4KFRA 5AJVB 3FDIA 3QG5A 4V0MA 1KI6B 4OHVA 3ONWA 5C4MA 3B2EA 3MJHA 1W4RA 4DLYA 2OZEA 3HYRA 4GMXA 2PMKA 2VRWA 3AKYA 4QBFA 2GBLA 2C99A 4LK2A 4C0SA 2GXQA 1IONA 3WMGA 2YV5A 5HR5A 3R9WA 2XJ9A 4DIDA 2DFTA 3VQTA 2EU8A 1ZD9A 3A37A 2J3EA 2EFGA 4P4SA 4A6PA 3R8CA 5UKDA 4L9SA 4X8HA 1RIFA 1VCMA 2HT6A 1X8KA 1G8YA 4EPRA 5JS7A 4XSHA 2GESA 1EGAA 2FSFA 4LC0A 1OV4A 4LJAA 1SKQA 2CVHA 2VYFA 2VHCA 1S9DA 2AKAB 2J1LA 4JVLA 4QNMA 3W3AA 3TLXA 3A1WA 5KSYA 2V55B 1JALA 1RYFA 1TQ6A 3K0CC 3W5JA 5FTLA 4TZ0A 4ZIRA 2DR3A 3DOFA 4LWZA 3CNNA 1LTQA 1P9WA 1KJWA 3M6AA 2P5SA 1GKIA 3WXMA 3DMNA 4AD8A 3TUZC 1E2GA 3PQCA 1QHSA 4PX9A 4KCGA 4C0BA 2EVWX 2NO7A 1N6NA 2FPKA 4ZKEA 2WTUA 5E95A 3SR0A 3MRSA 1HT2E 1ZNYA 4TN1A 4DLZA 4D26A 3ICEA 1LY1A 3NWJA 1VECA 4P32A 1SHZA 4Q1AA 2QA5A 2GVZC 4B3BA 1ZM2A 3IBGA 3ND8A 1KKMA 3W6PA 4AKGA 2VQSA 4R2HA 1D2EA 4PSKA 4M1KA 3SC3A 4AG5A 3DVLA 3IIKA 2HJGA 3BH6A 1BMFD 5KNCA 4EPXA 3TUJC 3WYFA 2QMOA 1G4AE 1M74A 3RRZA 4A8JC 5JJKA 5FOXA 1F60A 1CBUA 2ZJ8A 3C5CA 2WPDA 4HAUA 3GPLA 3GLGA 1RRFA 2P6RA 2V3CC 4NE2A 5F98A 1E9DA 3F8TA 5EXSA 3KQNA 4GOXA 4WAUA 3EZ9A 2PJZA 3KKNA 2YJTD 3THOA 1IAQA 4TYPA 2ZANA 4RKFA 1TL7C 1XD9A 1YE8A 3ZIAD 5E7IA 2JLUA 5JECA 2FDCA 4C2TA 3QKRB 4GBMA 4URVR 2JLQA 1YR6A 3TJZA 1E1RD 5JWHA 3X1ZA 2F1RA 1RW4A 1IQPA 3KKQA 3TMKA 2W2VA 1NJGA 1Z0AA 2REBA 4US0R 2ZYUX 2ZRHA 2IXFA 1G17A 6Q21A 1G4UR 3PCRB 1TQ2A 1S3SA 3QKSB 1TADA 1R8QA 1T5LA 4B48A 4GRAA 4DWJA 3O8CA 1E99A 1EFHA 4QJ5A 1ZINA 1Z5ZA 5TARA 1VCIA 4QHSA 3DZDA 4NYJR 5IRCD 4CVNA 2IYLD 4IKEA 1D2NA 3Q5DA 3JVVA 2UKDA 3ZQJA 5DGXA 1GITA 3H86A 4D0NA 1A4RA 2GAAA 2PCJA 4PR0A 5DHFA 3IQWA 3O8BA 3V4FA 4C2UA 2WMOB 1VIYA 4LJYA 3JZAA 1HA3A 3ASYA 1JECA 1FQJA 2R6CA 3I5XA 2XTZA 1NLFA 1NLZA 1D9XA 4N0EA 4D0LB 1IN6A 3L82B 4LX0A 3AP2A 2WSMA 1DAHA 2Z0MA 4MKIA 4A2PA 1VG0B 5DI3A 2I4IA 4BLQA 2JLVA 3TK1A 2CK3A 4HZIA 3OF5A 2GA8A 2F9MA 1G1MA 4YXWA 3CR7A 3B1YA 2PX0A 1XEXA 1NY6A 3L8ZA 1NSTA 4FN5A 3FKSD 1G8FA 1G19A 1XJQA 4DUGD 1UKVY 2BBTA 1GVNB 2ZROA 5CIWA 3LBHA 4XVUA 4QFMA 2GXSA 2OSBA 2ECKA 5FUXA 4MDEA 3AF3A 4C7OA 1DAMA 1E32A 3ZDQA 3LDAA 1W36B 1ODFA 3B85A 1RRGA 5EE0A 3N5CA 2KSQA 1BYUA 3CX7A 3KJGA 4KSBA 2J0UB 1CJVC 2XX3A 3RNLA 1ESMA 1XJCA 1FP7A 1N5IA 2QAGC 5CITA 4OHYA 2O0HA 4Q9HA 2O8FA 3L2OB 1R5NA 3L8YA 2IEYA 3OFNA 3VR6A 2F43B 3CRW1 4RFSB 1RJ9B 5HE8A 1EG7A 3THYA 1IM2A 2QE7D 4B2IA 3U6KA 4US1R 1DAEA 3MMPA 1BMFA 2AK3A 3ZVMA 1NG1A 2MMGA 2IC5A 3UIEA 1KY2A 4B32A 4HAWA 4QHYA 2JJ2A 3Q3JB 5FBWB 1LNZA 3PG5A 3MWLA 1ZM9A 1JAIA 1L4YA 2HV8A 5IHPA 2AXPA 3ZLJA 2WWGA 2H1LA 2XTNA 2G88A 1XJ0A 4Q4HA 3W8NA 1YZTA 3BFKA 5FPHA 3RC8A 1NP6A 1B23P 3AGQA 4RKEA 3GQBA 2CJWB 3AH8A 4PO9A 1JAHA 3EPLA 2W6JD 4GZMA 5HCNA 2XJ4A 3GFTA 5JRZA 4G0NA 3EX7C 2ODEA 1Q22A 3LXRA 3EIEA 1W2HA 4I4LA 1N6LA 2QRZA 4NCHA 1ZIOA 4EJSA 4Q1DA 3WYAA 4KFTA 4M53A 2HCJB 4AYTA 1MH1A 4RD0A 4OHZA 4Z1MD 4Q66C 2ZSBA 5TB5A 3KJIA 1CR1A 1WXQA 4PO1A 4RVCA 2IYYA 1F5NA 2BCJQ 3FFBA 3T34A 3MAAC 2ZRGA 3UWOA 1ZM3A 3NDPA 3U44A 1T6NA 1N6OA 2R8RA 1QF9A 4DJTA 4A8JA 2O52A 3MD0A 1WMSA 4OQNA 3CPHA 1OXUA 1G5RA 1R2QA 3GLIE 2R9VA 2W6JA 2OM2A 1G5PA 3LA6A 3PITA 3AVXA 2WPDD 4PSAA 1TUIA 2WWFA 3ZS8A 4A4DA 4Y0AA 3QEJA 1LVGA 3SN6A 2GZAA 4D4MA 4YMVA 4TZ6A 1E3MA 1Z63A 1GUAA 3QVVA 1A82A 1KI1A 3Q85A 4DCSA 4LOAA 2QU8A 2XXAA 3PVSA 3PEUA 5GJBA 4KVGA 4O0MA 4PC7A 4ZI2A 1JR3D 1GP2A 1N0UA 1ZVQA 2RHDA 5K8IA 2QGNA 1E9SA 1UKZA 4PAOA 4BUJA 1Z07A 4CIDA 5DIFA 2FSGA 1P6XA 2G77B 1M6NA 1ZMXA 4HAYA 2ZRDA 1G64A 1IN7A 2F9LA 2GEDA 1G21E 4XD7A 4EUNA 2MSEB 2G3YA 4RD4A 1HY3A 2HT1A 4BLTA 4LHYA 3QOFA 4ZO4A 3LH5A 1S96A 4AYXA 2FEMA 1H8EA 2QSZA 1XU4A 1DAFA 1OF1A 3I72A 1OFIA 3GLFE 3ZD6A 3THXB 1T8UA 4V0ME 3M4YA 5EZ5A 4C0AC 2RKOA 4LYAA 1EFRA 4Q48A 1F2TA 1UF9A 1RYHA 4PC1A 1H8HD 4RSGA 4UXIA 1TU3A 4HATA 2CHGA 2IL1A 4I1SA 3W90A 3AKCA 4OK3A 5M04A 2WHXA 3Q8XB 4NHOA 4DKXA 2J0QA 1GG2A 3TSOA 4IXMA 1XMJA 3EZFA 4P4TA 2ZSDA 4EPTA 1U94A 1UEJA 3T1OA 1EFCA 1G7SA 4JT2A 4NTZA 4PAQA 3EPKA 1NBMA 2RHMA 5FOTA 4C0KA 1NF3A 1OFUX 5DSZA 4Q00A 1GIAA 1Z3IX 1W0KA 3TRFA 4RY2A 2ZR7A 1XTJA 3VU9B 2CHVA 1H8ED 1WCV1 4TYQA 4BECA 4CZ2A 2IX3A 5EE5B 1SKYE 3TBKA 4QBGB 1JR6A 1P3JA 3LFUA 2VH5R 1VKJA 4MYCA 1Z83A 2RCNA 2DPXA 1VYUA 3CF2A 3CRVA 2V9PA 3D31A 5AWFC 1BOFA 2CL0X 2R6AA 4Z51A 1PZNA 4ON9A 2W6ID 4MQBA 5SZKB 2O8DB 5H68A 4L16A 5A0FA 3SOPA 2QE7A 4LHVA 1BIFA 1ZYUA 3RS0A 1EWRA 3NHBA 1ZU4A 3TR0A 1NG9A 4LBWA 5C1BA 3ZZ0A 2GKSA 1ZD8A 1E9FA 3I32A 2X19A 1NN0A 1W0JA 3OEEA 4PANA 4Z8XA 5B30A 4LBZA 4C9BA 3DZ8A 2O8FB 4JLBA 1GNRA 1UDXA 4F38A 4ZCIA 1XEXB 2RB4A 2GZHA 4P31A 1II8A 4NKRA 3BGWA 5H1YA 3RANA 3TE6A 3VFDA 4TMVA 2YWHA 2CEAA 4KJZA 4TMWA 1GL6A 1D6JA 1U81A 1II9A 1XTIA 1Q44A 3I62A 3BFXA 2IHYA 3Q7PA 2HYIC 1VIAA 3PIRA 4KU4A 1ZAKA 1Q12A 2GBLC 2XZPA 1FUKA 1NRJB 4TLDA 4E03A 4NZYA 3DL0A 5KDOA 5KHOC 3LW7A 3NBZC 3GJ7A 3NH6A 3LV8A 4F93B 2JLRA 4KBGA 1Z6YA 3N2IA 2VSXA 3A6PC 2ZIAA 3BD9A 1XWIA 3B78A 1XPRA 5SZIA 1ETUA 1ZUIA 2ZREA 3K0AB 3LO5A 2ZI6A 5IT5A 1TPZA 2QNRA 1RJ9A 4MYUA 4CW7A 5JI2E 1IBRA 4IVPA 5J4LA 2IUUA 2CCJA 4B3FX 4CEJB 2A2ZA 3F3YA 4B33A 4AKIA 1AS3A 4GFDA 3HYTA 4FD2A 5BQ5A 1Z47A 3C4JA 3KXKA 5AJYA 3KQKA 3E1SA 3OESA 5CYOA 4EIWA 4ITRC 2O8DA 1GWNA 2HCBA 1NIJA 2I1QA 2D3WA 1AN0A 4UJ3A 1QHHA 3SBDA 4DSOA 1FTSA 4YLGA 2G0TA 5G3YA 1Q1QA 1P2UA 1NMXA 4DB4A 1G3RA 3AP3A 1CRQA 1P60A 2JIZA 4JMPA 1COWD 1JQLB 3RLFA 5JJLA 2QENA 3IIMA 1TU4A 4UNSA 2OHFA 5JWRA 2DFNA 1XPUA 1KK0A 4F91B 1EESA 2OLJA 2Y8EA 4LJ8A 3K0AA 1UPTA 4KITB 2ZI3A 1K5GA 4Q21A 5JI3E 4Q4HB 2MMCA 4XTRA 4QG7A 5F2EA 1YR9A 2GILA 1TF7A 1G18A 2PLFA 1JNYA 2JLSA 3GP8A 1GZSA 2IK8A 4G01B 1KGDA 1CIPA 2HEIA 2IF2A 2KBEA 1GFIA 2WWHA 1YZQA 2K5UA 2KWIA 2XNDA 5EP4A 4CGZA 4IDPA 1OFHA 3KJEA 3FPAA 4FWIB 4JL5A 1UDWA 1C9KA 1SVIA 2H5EA 5HZHA 4GDFA 4IFBA 4NH0A 3CPEA 4LC1A 3LW8A 2H17A 3AGPA 4QGAA 1AA9A 2ZRKA 3RVBA 4C0QC 1SVSA 3WBJA 5JHGB 3LQQA 1QDEA 5K8UA 3FKQA 3FKSA 1NVVQ 3GJ0A 3KTAB 4TTQA 2P67A 3OIUA 4IXNA 3TAHA 2EFDB 1TF2A 2OILA 1JEEA 3K0SA 2FJUA 3CRMA 1XTRA 3BERA 3A8TA 3RYTC 3EZ2A 4ERNA 1G8GA 4MRNA 2XNDD 3PENA 4WOPA 4G5OA 1W36D 1R0WA 2F3TA 2V7QA 2H18A 3BORA 4XWAA 4M2LA 1GL9B 5J5CA 1YZGA 1Q20A 4JT4A 2WWYA 4JVMA 3TGPA 1OB2A 4FIDA 2VHUA 1I2DA 4U5XA 4TT3A 5C4GB 1F2UB 4RZUA 3SU8A 4EJSC 1WQ1R 3NKVA 4CT5A 1AKEA 3CONA 5IDVA 1M34E 3IILA 1XMSA 4CEHA 1KK2A 1JPJA 3AF4A 1IXZA 4K46A 4UXJA 2FZ4A 3CX8A 3KXIA 3QEOA 1CJKC 2ZE5A 3REGA 3SJBA 4M8NE 5AUPB 2D2EA 1XCMA 3U44B 1DARA 3MWKA 1E4VA 3IKJA 1W1WA 3QG1A 4JKIA 3WMFA 2XNSA 1CF4A 2JAQA 3B5JA 3QPVA 3IHWA 2E1RA 2GEVA 4FI3C 4JLOA 4ZDJA 2ZUCA 3BFVA 4JLVA 3W3ZB 4BFWA 2V54A 2FSIA 1KO5A 2ZETA 1E2LA 4LDJA 3CRQA 3U3MA 3UMRA 1E6CA 1JPNA 4S35A 3SYNA 2D7CA 1S2MA 2ZU0C 2N46A 3OIYA 4IRUB 4FWTA 1RC8A 3CKLA 5E4FA 1E1QD 2IS2A 2ZSEA 2R62A 2ZRBA 5IF9A 5HZKA 3VR1A 4JYBA 5HE9A 3RABA 3RRMA 621PA 1HEIA 3P4YA 4B76A 2AHOA 3QKRA 2RGEA 1DEKA 1MRSA 3QUSA 2J0VA 4M1TA 5FOUA 2Q3MA 2VHQA 3DOEA 5DISB 3SJAA 1PV4A 4IJMA 4Q4JB 2ONKA 3CM0A 2BV3A 2ZR9A 3P1JA 4NMMA 4NP6A 4A15A 1I4DD 1Q0UA 2D2FA 2RGGA 2QAGB 2FOLA 5FR2A 5FTNA 5KSOA 3GLHA 2V6JA 1WP9A 1JBKA 1OH5A 4DSNA 3VR3A 2ERXA 1Q1ZA 1Z8FA 2ZJ2A 1T3HA 3EASA 3BRWD 1SVOA 3IPXA 4MITA 2QBYA 3VX4A 1YR7A 4ESVA 4PZYA 3IUYA 5FUWA 1KSJA 2WJGA 3HDTA 4DB2A 3U3KA 4JLNA 5JJIA 5AJXA 3CF6R 1F48A 1U8YA 4HDOB 2GNOA 2BWJA 2BKUA 3MCAA 4MYHA 4XIGS 1XXHE 2AWNA 3MFYA 4Z54A 4LI0A 4RFVA 1E9EA 4IVRA 2VSFA 2VSOA 3EIQA 2WAYA 3PV0A 3UK6A 4YDHB 1E94E 1CULC 2GETA 2QRNA 3OFND 4NU0A 5TV2A 1JR3E 4TQUS 1ZCBA 4Q01A 4AKHA 1R10A 4LYFA 4BZPA 4P3YA 1OFTA 3QENA 3H84A 3ADDA 3CZPA 5TMPA 4YQFA 2VP0A 1OSNA 5D3QA 1OXTA 1ONBA 2RGAA 4B44A 4R98A 1CR2A 2QN6A 2C78A 2EWWA 2QM8A 4FW9A 4TL7A 3U7EB 3CH4B 2QAJA 1UBCA 3Q5EA 3HU2A 3CNOA 3HPQA 3RS5A 2W0SA 3Q9LA 3WHLA 4GOJA 5KO2A 4FCVA 1HH4A 4AKEA 1W4BA 4D4LA 2C5LA 1O3YA 2W2TA 4F92B 1E0SA 3SI7A 1GILA 2CHQA 4HUQA 3SHFA 1XEFA 5EJEA 1QHIA 3NIBA 3ZVLA 1U0HC 3DKVA 2QROA 3ZGXA 1NVUQ 3KQLA 1UFQA 3EZ6A 4QM7A 1Q21A 1Q1EA 2QZ4A 4HB4A 4MRRA 2E87A 5CLLA 2LCFA 2PBRA 1P2TA 2J5XA 3OEHD 1E79D 3KDSE 1NVXQ 4JLKA 4OK6A 1P75A 3VHLB 1AM4D 2R6FA 3W8RA 1LF5A 1W4AA 1XP8A 4WZBE 1G3IA 4O25A 4WXRA 4RZ3A 3W5IA 4BWYA 1ZUNB 3BIFA 4TWZA 1ZNWA 5FUVA 5G53C 2D06A 5JBQA 3L0PA 1I2MA 2BJWA 4PO8A 4TTPA 1BH2A 3N2EA 4C7OB 3U6BA 1O87A 2OBNA 4YONB 3K1JA 4RD1A 3BH7A 3I61A 2F55A 1ZM4A 4P33A 4H1UA 1GRQA 4OI2A 5H8WA 1HYQA 3KB2A 1XNJA 2W58A 1S1MA 1SVLA 4KXFB 3ADBA 2NPFA 3BK7A 3IHLA 2ZJOA 1MABB 3ZIAA 1CJUC 5G40A 1EFUA 2D74A 3B1XA 421PA 2H8KA 1XTKA 1G9XA 1P61B 1HV8A 2OUKA 1U9IC 2Z4RA 2XB2A 3VNUA 3GEEA 2F1JA 3U4QB 2C9OA 2GCOA 4DHEA 2QG6A 3KXLA 1XEWX 4TL6A 3SYKA 2CLCX 2WIAA 1CEEA 1XDBA 4V0LA 4M9QA 2GCNA 4F4JA 3TNFA 2CL6X 3AVPA 3EC2A 2IWRA 2AFHE 3FHOA 4Q7KA 2A5JA 2J7PA 1X1RA 1FMLA 5EP2A 3ZH9B 1PLJA 4I99A 2QQ0A 3I4LA 4V02A 1MABA 1W47A 1CS4C 1P72A 4HDQB 4LBVA 1E9AA 2RH5A 3NHAA 3GCGA 4DEXA 2Z5FA 3VKGA 5CLQA 1E69A 4URZR 4LHXA 3P32A 4D0GA 4LV8B 2KBFA 2ZM5A 4OYHA 3A1VA 2ZYVX 3T15A 4QL3A 4MRVA 2GF9A 2ZPTX 5FI1B 3BBPA 2PX3A 2ANCA 3IQXA 4RD3A 3TIFA 3EZ7A 2XEXA 2QL6A 3VKWA 2J7PD 4M9ZA 5AUQA 1Q1BA 3DPUA 1FFHA 2ZI5A 2DY1A 5BN4A 1DAKA 4IOJA 3SE0A 4DLXA 3IEVA 3AUYA 3B8HA 2KE5A 1JJVA 2ZUDA 4DDWA 4LV5B 3AVOA 4O3MA 4RZ2A 2OCBA 4DDTA 3ND9A 1ZM7A 2WOJA 3LD9A 4NYMQ 5J4KA 5CYPA 1KDPA 5KDLA 3AVVA 2VP6A 5TY0A 1W2GA 1N2CE 3MGCA 4BGDA 2P6NA 3GLFB 2HDNB 3RSLA 3AVQA 2RGDA 2ZITA 2AD5A 2G1KA 4ZDIA 3N70A 4XSGA 4EFLA 1N0WA 2IYSA 2F3RA 1XD8A 4BZXA 3HPRA 4IFEA 2OFWA 1G7TA 4Q4JA 2BMJA 3SS8A 4LHWA 4I1OA 2CK3D 5CK4A 1K5DA 4B2LA 1M7GA 2FG5A 5J40A 5A5GA 5LDDC 4JVNA 4MGKR 2CVFA 3LWNA 5EXPA 4BEBA 1NKTA 1UBGA 5BYJA 3H2YA 4BQSA 1GSIA 3AB3A 2V8OA 4H1VA 4NCNA 4YMWA 4DRZA 5L3QB 521PA 3K0FB 4ZDWA 3DM5A 4A6XA 2QP9X 2BMFA 3RWOA 3TH5A 2ZRMA 5B2ZA 1U8ZA 2CDNA 1CRPA 3AKDA 2ZI7A 3T5GA 4B35A 2ZRAA 3Q72A 2ERYA 4PQFA 2YOHA 1GNQA 1S8FA 2MSCB 3S1AB 2E9SA 3IPYA 1F6BA 3E70C 4GI7A 3AP1A 1G6HA 4HLUA 1OW3B 1HUQA 1PUIA 1KNQA 1GKYA 3B9PA 3DO6A 3CX6A 1U0LA 1S0UA 1ZW6A 4D4KA 5F9HA 2A5YB 4B3GA 1R5BA 4KODA 4Q9KA 1N5JA 3TW8B 1J90A 4EDHA 2ZJYA 3BB4A 2BMEA 3LRPA 4PSVA 1DVRA 4ZI3A 2B7CA 1W5SA 4NYIQ 4Q7MB 4A9AA 4G3XA 1Z29A 5H70A 4BEJA 2QORA 1U90A 5TXGA 4FMCF 1OHHD 1TX4B 1ZC4A 2BDTA 4AWXA 4URXR 5K8LA 3FHCB 1A1VA 3K9NA 4DVGA 5JEEA 2DFKB 1ZIPA 4JLMA 5LD2B 5J4YA 1M2OB 1HQYE 2V6IA 3UMSA 4QJ3A 4GOKA 4GZLA 2NTYC 2F6RA 3ADKA 2ZRCA 4GP7A 3U3RA 1OXXK 3UG6A 3GFPA 2A30A 3PUYA 3SJCA 4DLTA 3LLUA 4B3DA 4EFNA 3TAUA 2IXGA 2JA1A 1AGRA 1E9CA 3V00A 4V0NA 5P21A 4RJLA 1A7JA 1T91A 4PC6A 3TKLA 1RZ3A 2PZEA 2VIIA 2RGBA 1CP2A 2FX3A 2AN9A 2VEDA 3U7HB 2A5GA 2WJHA 1DS6A 1OXVA 3GD7A 4LRWA 5BXQC 1PJRA 4L4UA 1EWQA 3EPHA 3BXZA 4DT1A 3THWA 2IS1A 3VKHA 1Z08A 2QM7A 2R44A 3QE0A 4M9SA 5CK5A 5DYGA 4B3XA 1RE0A 4I1VA 3VX3A 1R7RA 2J87A 4BFSA 4DC9A 2BEKA 4ZPXA 4II7A 3QXJA 5KOYA 2BC9A 3K8YA 1VYTA 2OAP1 4B71A 4M9XA 5KYKA 4RCZA 3IGFA 3I1FA 4FMCB 1WF3A 1CR4A 1LB1B 4OJQA 4HLDA 5CJ2A 5FL7D 2O0KA 5GVRA 2P65A 2FFHA 4GMDA 4OQFA 5FTKA 1IHUA 2WBLC 5FPTA 5AJWA 5J4VA 5FOSA 5LPNA 1TNDA 1DBSA 1QVAA 3S1AA 3PEYA 1D9ZA 3K9GA 2Q6TA 5L8VA 2B6HA 3WRXC 1OH8A 4Q9IA 1DELA 4BLRA 2C8VA 2EW1A 3K70C 1OIXA 3W34A 4ARZB 3H1TA 2DBYA 2EFHB 1QG4A 2XTMA 3E5HA 5FBVB 3GLIB 1KSFX 2Q9AA 1OH7A 4Q4LA 4OJKA 2IW3A 4Q9JA 1KSGA 2J9RA 1ZNXA 1FW6A 3RS7A 3X1DA 4HEJA 2CL7X 1T3SA 1XFAA 3G82C 3JVUA 4AI6A 3X1XA 4K81B 3OIWA 4TYNA 4PZLA 3LX5A 2G83A 2L0XA 4JBYA 2IYXA 3OE7D 4TLBA 3ADCA 4PHHA 5EZ6B 3P4XA 1GRNA 3EW9A 4HB3A 4TMZA 4A82A 5KPJA 4L15A 2BHRA 4M0LA 1R4AA 2FSHA 3QVUA 4W5WA 1R5OA 1P5ZB 1W4CA 3FMFA 4MRPA 1SVMA 2R2AA 4PFSA 3A1SA 3ICQB 3Q7QA 5GVSA 1U0JA 1E2NA 4CYMA 1Z0JA 1Z22A 5JMTA 3MUFA 5ANRB 3NXSA 2XSZD 2PEZA 4PZZA 2F1HA 1WA5A 2C9CA 1KHTA 2GVDC 2C2HA 1UBFA 4QGFA 4WBSA 1UBEA 1XZPA 3A1TA 3FVQA 4NYMR 5KNDA 3TVDA 1ZUHA 2PZGA 3K0FA 3NC0C 4KV9A 3HJNA 1L8QA 1Z0DA 3KX2A 3WNBA 1IY1A 1OYWA 3LAWA 1VG1A 2QPTA 3OZXA 4RZXA 1X6VA 1CJTC 2NZ8A 4K8OA 5JCPA 2XAUA 3B9QA 1XRJA 1X1SA 5BWMA 3GLIA 1A2KC 1QRAA 3U2QA 2A5DA 3GJ4A 4QHTA 3PUWA 4OHXA 4F4IA 2EYQA 4JKYA 2C98A 4HB0A 3VHXA 1UEIA 1E79A 3F0TA 4P4UA 1XCPA 1ZD1A 4QNRA 3CIOA 1IY0A 5AUOB 5CDFE 1WDTA 5FBRB 2NZJA 2ZR0A 2GWHA 4B74A 3PJRA 2B7BA 1G3UA 1DO2A 3TR5A 1Z0IA 2YINC 3K0CA 3THXA 1KIMA 1QHXA 2OBMA 2HLDA 5L3SA 2ZS8A 4M21A 1KI6A 5KDDA 3FMPB 1KSHA 2FGJA 2FN4A 2BBWA 2BM0A 1QHYA 1XZQA 2GZDA 1D5CA 4DCVA 4M1YA 1KI9A 3D8BA 1XD2A 1N6IA 4A0GA 4JJKA 4HYYA 3ZZUA 2J0SA 2FPLA 1L2TA 4BLSA 4XJXA 1CTQA 4LSGA 2R6GA 4GP6A 1AS0A 3C16C 4MGIR 4CEJA 1G16A 1KK1A 2Q21A 4B75A 1MR3F 2GHIA 4MUAA 2ONJA 2OO7A 4X8LA 3T61A 2UVQA 1U99A 4P0TA 1NSFA 5GJVC 1VHLA 1Z0FA 3ZYCA 3SZRA 1BKDR 3T1QA 1GDDA 3GLGB 5CJPA 2C95A 3UATA 2IUTA 1IN8A 1COWA 1WE2A 1XXHB 2ZQ5A 4NCKA 5CM9C 4IOMA 5FPKA 2JCSA 2PEYA 2CE7A 2J59A 4PPQA 2YC4C 4DUGA 2GF0A 3KTAA 3AQ4A 3I3SR 5EP3A 3KKOA 5AJZA 2YWEA 4Q9LA 4Q1CA 2ZE8A 3LVRE 2XITA 4U7DA 1FTNA 4NYJQ 2ATVA 1R8SA 2ZAMA 4QOSA 5EE3A 3THWB 2ZRLA 2YKGA 5CB8A 1S3GA 5FUYA 3BWDD 4XTCS 2NO6A 3GJ6A 4A0FA 3RS3A 4YMTA 2GJ8A 2BBSA 721PA 3C5HA 1E2JA 4DCNA 4A2WA 3VMFA 4LYJA 2ZSFA 5JSZA 5KNBA 2NMVA 2F7SA 1E9BA 2O8BB 1IN5A 4GL2A 1E2HA 4ZIRB 4KSCA 5LB4A 4DT1B 1Z6TA 1UAAA 3ZS9A 4IEIA 3AF0A 3IEUA 1G3MA 2ZS7A 4D81A 1N5LA 2AKYA 4HLQB 3K09C 2G6BA 3HP1A 4WA7A 2WWWA 2CNWD 4WZAE 1BO6A 1GM5A 1TQ4A 1VHTA 1LFDB 4FINA 4C30A 3RWMB 5KPDA 2OXCA 4TSFD 1SVWA 1HT1E 3EWAA 5JLJA 2A7QA 4V0OA 3W6NA 3E2IA 1YZKA 4MA4A 1J99A 4WVFA 3AVUA 5FBLB 2QT0A 1AGPA 4L8GA 2AR7A 4KFSA 2DB3A 1TTTA 1YKSA 3L0SA 4C0JA 1VYVA 5DI9A 4D2IA 1SVKA 4B34A 2FEOA 4DIEA 1J2JA 3UWKA 1EFTA 4HI0E 3TQCA 2BKEA 4TT3D 4IEEA 3U7GA 4JLAA 4KBFA 2FH5B 3I5YA 5A4JA 1KI7A 1P4SA 1P9RA 2GCOB 5C46F 1F2TB 2RGXA 3J81k 4QGGA 1MO5A 1R0XA 1UM8A
chains in the Genus database with same CATH superfamily
3PEVA 2CBGA 4B73A 5KJ6A 4MGZR 4DR5B 3T3OA 1U8AA 1ZH8A 3RK4A 4PICA 1MX3A 3QFHA 4FMPA 3SIXA 3UMFA 3UAVA 5DFAA 2QPAA 5BURA 5HRAA 2OEPA 1ZWKA 2C4HA 4I9NA 5TF4A 5EQTA 2OLEA 3EXHC 1WXHA 1QGYA 3OD5A 3QF4B 4EHBA 5IAKA 4L6AA 1CZLA 2QU7A 1PWXA 2O2HA 4LOLA 1YFKA 1ODJA 4YJGA 3UCEA 1Z2OX 4IO1A 2Y05A 4RFSA 5KTYA 5JW6A 3P9QA 5AHRA 5IFLA 1PX2A 4HWRA 4F2WA 4TUYA 1TW3A 3NDBB 3GAAA 4J07A 2NOAA 5B58C 6REQA 1PG2A 3EHDA 1YB1A 2EL9A 1J56A 1VJ1A 4J16C 5D85A 4A0HA 4F2GA 5K0SA 2B1GA 5AM5A 3TSWA 3T12A 1DAGA 5AK0A 4KIUA 5TQVA 3RB8A 2XZLA 2V5AA 4G8DA 1LBHA 2CZCA 5KSPA 1QYXA 1EFPA 1BXGA 1KK3A 2HKIA 5F76A 3H8WA 1QR6A 5F35A 2ZDQA 1E1CA 4E21A 5CT8A 4Q4AB 1CDOA 3A6HA 1DXYA 3GMSA 4G1CA 3ZX5A 1G59A 2PMFA 5LP6B 2W83A 2D3TA 1YOVB 4JT9A 5F7JA 3BFPA 4JUBA 2F3UA 4Q19A 1EVJA 4RLHA 2COEA 3LP5A 5D1NA 4UNRA 3BD7A 1NNEA 3EE6A 1YS7A 2YBDA 3QSYA 5BWCA 1IXSB 1SG0A 4QPNA 2I2XB 1Q6YA 3G7NA 4BJ5A 1E6EA 5JS8A 2JJ1A 3PUKA 4UREA 1NJ6A 3K0BA 2E4WA 3BE5A 4X1KB 3HR7A 1MKYA 3ZWWA 2HLDD 5GADl 1V6AA 3CEJA 4WI1A 2ZT8A 4OSPA 2RIPA 3FI9A 4FGWA 3JZMA 3FTQA 4W9RA 3TG2A 1OLSB 2I66A 4BNHA 3EVBA 3ZVRA 3QPUA 3Q2OA 2J0UA 3FIJA 3IJEB 5LQNA 1PFUA 3NDRA 2Q2VA 4S1TA 1ILEA 3JCZA 2R47A 3U48A 3O4FA 4Y0VA 3SZGA 5A3JA 1T6ZA 1SZCA 2WFLB 3DL4A 5CB6A 4BNGA 4U9UA 2NT4A 3PZBA 4UEQA 3P2KA 3KHKA 3DD5A 3TDNA 2WP8J 2FPIA 3FY4A 3H83A 4B5LA 1NIPA 1W8DA 1E98A 2CCGA 1JKMA 5DTIA 4AJ9A 4XWOA 2Q0HA 3K92A 1J8YF 1BEEA 2ACVA 2BFEA 2H92A 4OU5A 4GSKA 4B4UA 1RHMA 3JQBA 4LHZA 3ZNQA 1WB9A 4RELA 1W5AA 2AWOA 5EXXA 2IBSA 1S4QA 3K2QA 1RQLA 2FZLA 1E7WA 3F4KA 4KDCA 4DA7A 2Q7OE 3F8WA 1K7EB 2XOKD 3I01M 2CMKA 4D6YA 2Z3ZA 1FX1A 4BS9A 2HLHA 5EIBC 4D0RA 3JZDA 3MSXA 3GEIA 3T9AA 2NQ8A 3TIIA 5IT9A 1MO6A 1ZRMA 1R9NA 4HGRA 3TOVA 1G20A 3OEYA 4XGNA 2BMAA 1NM5C 1U7UA 1V39A 1X8LA 1UBSB 2C4KA 2PWPA 3KU1A 4F5ZA 2FPMA 1KQPA 3CYFA 4HAZA 1JR2A 2NPIA 3NTUA 5F2KA 1E3TA 1KNXA 3MAGA 1UIRA 2OVFA 3CB2A 3QKTA 5CXQA 4F4CA 2A5LA 4F9FA 3C6BA 1I2ZA 2JZOA 3JATB 2FSVA 2H9IA 4LJ5A 3ZWNA 2HBRA 5SICE 3R9KA 3II6X 4ATNA 2EFYA 4R0MA 2E4VA 1UZMA 3A9UA 3JWIA 4ZDKA 3RHSA 1I5RA 1P0PA 3AOGA 3SQNA 3ZH2A 1DOZA 2JHAA 1GRRA 3WK9A 3VZCA 2BT4A 2QE6A 3EZLA 1JFTA 3MYYA 2LV8A 3DW1X 3LUDA 4JBXA 4OM7A 2WM2A 3T9BA 5AJTA 3W1EA 1IHYA 1P0MA 2WU3A 4G0WA 5D01A 5KOJA 2CSUA 2OYSA 3E1GA 2OGUA 4A0RA 3ZQUA 4UXHA 4U0JA 1RCTE 2BDEA 1KY3A 1BXRA 4RTJA 2ZE6A 5ER9A 5FXMA 5K6AC 2IUYA 1PJCA 5BQOA 2O8CB 3ND7A 4UKDA 2O3UA 4LJ7A 2VUSA 2BEUB 1V3VA 3B36A 3GEHA 5DWDA 1A5AB 2CUZA 3QXCA 2ZSIA 2QAGA 4YEDA 2DU8A 5A3SA 2RIRA 3ZHZA 5FR1A 3G59A 2XNKA 4BQRA 3IOYA 3VR4A 2PXCA 3E82A 4HNSA 2JASA 3LUBA 1ADFA 3DTVB 1DQNA 3MD9A 3GJ3A 4NS1A 4OMDA 3VO8A 1I4TD 4E46A 1FVHA 2PKYX 1V43A 1K9VF 2WAXA 1XBTA 3GP5A 1E0JA 3K5IA 5TT0A 2JJ2D 1C7ZA 2H9AA 2IUSA 3MJRA 3GI1A 1OZFA 4P81A 3HZHA 5AKIA 4CUZA 2JBWA 3LSYA 4UPEA 1TJ3A 2GK7A 3TM4A 2JI9A 1A9RA 2H2HA 1M6YA 3E27A 4LPSA 4PQYA 3IKTA 1S89A 1ZGZA 4HJXA 1BCSA 4XR9A 4D9JA 4QAQA 2CBZA 3EMVA 4LJ4A 4ZRNA 1XPRA 2GJ9A 2JLAA 1E0AA 1Q0ZA 4GC9A 1L1FA 3RPEA 5LQUA 1XKLA 3DE0X 1JPUA 2X13A 1CY1A 1LA2A 4OLHA 1H2HA 1K4YA 5C8XA 4KLZA 1USIA 2VZ9A 3K70B 1G63A 3RS2A 3SEQA 3IA7A 3WMEA 3G2QA 1RVV1 3HS3A 2GA9A 3KVOA 3P0HA 3QXXA 4Y9SA 3FDXA 5C1DA 1Z33A 3RTAA 3SJUA 1NHWA 1CQJA 3ZN2A 4HMPA 4HNTA 1AK2A 4ZCMA 1J1UA 4JP5A 2RGCA 2YMQA 1D2MA 1MO4A 2WM9B 3I6MA 1CU1A 1P0IA 3E81A 4U7FA 4LS3A 4HH4A 5K0NA 3T52A 3TNJA 3UOAB 2X1LA 2PKQP 2JLXA 2QX8A 1GXSB 1A9YA 1F8YA 4TQ9A 13PKA 4FYKA 3QOXA 4G4SO 4UTOA 4GOOD 1W85A 1LPBB 2BGTA 2CLSA 3DDOA 3KYBA 4LTNA 5F1OA 4KPFC 4XDYA 2R0QC 1YS4A 4ZKDA 3QK7A 5F3WB 1IRXA 3K16A 4RA9A 1Q0SA 4JQSA 1Y33E 3QIAA 4V0QA 4OQEA 1EFPB 5SY6A 1G2OA 1A2OA 4QELA 3HY6A 5CX4A 5BSRA 3TZQA 4GLBA 1V16A 5B3KA 1N25A 1PO7A 2DGDA 2X5OA 1CVIA 1VMEA 3KT0A 3KYCA 1D0IA 4JT8A 1C0LA 1D07A 2WG2A 4HTFB 2ZYWX 4DMCA 3F1KA 3CVXA 2W4MA 1F1JA 4IINA 3W1WA 4BE4A 3EPJA 3KAQA 4NFHA 4DLAA 1JSXA 1Q1NA 3ZHCA 1KYWA 2O2JA 1DRUA 3NHUA 5AI8A 5BSHA 5HDQA 4YASA 4LGMA 4BLOA 3JAMA 5F5XA 3RQSA 4CMEC 3BE4A 1ANKA 1MJGM 4OU4A 3UK1A 4FOOA 1R0ZA 4DV4B 1DV1A 1XTSA 1G7CA 4FJ1A 2B34A 1VSVA 3A4VA 4RQTA 3QBDA 2HPAA 3CISA 2TYSB 5FOWA 2NVWA 1P1CA 4RQUA 3PQ8A 2GCGA 3H0CA 1Z4LA 4KYTA 1IJEA 5LVAA 5BYKA 3WSTA 4X65B 3C3AA 1VCOA 1HO3A 5HMMA 3TW0A 3ZU6A 2CE2X 2I6GA 1R4MA 4L3VA 4KE9A 1VPLA 2HFKA 2VVTA 2PBLA 1EM8B 3DBLA 4LCBA 4YCDA 1JKFA 3HU3A 3TR6A 1TT5B 5ALNA 3PXAA 1JEYA 4KFUA 5HKBA 2IHUA 4HF7A 4P7JA 2O4UX 2XA1A 1ZJ5A 4CUKA 2F48A 2JHPA 4AAYA 1QH9A 3EFHA 2XZOA 1OB5A 1X7GA 2OWDA 3EWNA 1M5TA 4CEIA 1T8PA 2B8TA 3ZBPA 4D8YA 1J8VA 1HDRA 3B7GA 1DADA 1C3XA 4IIJB 1E2FA 1JU9A 5J63A 5ARDA 4FZRA 4KHPB 1LNSA 2VATA 2SKEA 4R1UA 4ES6A 5JFOA 3OI7A 3TFQA 4O2BA 1UXOA 3M1AA 5F33A 4PBSA 3WB2A 2HDWA 1M34B 3NIWA 5CBPA 2QW0X 1Y6ZA 1UT5A 1FZTA 1XZ8A 1O6FA 4G1BA 3C85A 5IKEA 5BNTA 2VYQA 5CB0A 4ZVTA 1UPXA 2GSWA 4XVQA 4GOND 1G6KA 2IYVA 2QRKA 5ALYA 1BDIA 1NJ2A 4TMKA 2PIAA 4W9MC 4PU0A 2PSFA 5BQPA 1R3DA 1Q3TA 4PSDA 2X8JA 4V0KA 4JIMA 5E7MA 1LXCA 1P73A 3WY9A 1FQWA 4GMFA 3BCRA 2W22A 3AEZA 1H22A 4HUTA 5CPFA 1SHJA 3QXSA 2O50A 3DG9A 2RG7A 3A4NA 2YVUA 2ZYTX 3DH0A 3UGKA 1KQNA 3WP1B 5K0ZA 2ZWOA 1G8KA 1WUJS 3H3JA 3G2NA 3O95A 4L4SA 2B5VA 3RC3A 2GPSA 4D56A 3O2JA 1M1NB 1KFCB 2QV0A 1C41A 3O7MA 1SXJE 3RUDA 2EWVA 2O7VA 4FCCA 3P9SA 2VDRB 4N0MA 5C0OE 4TWRA 1GTVA 2VSNA 2GOYA 2PZAA 5HA5A 4H1HA 3MJEA 1T4DA 4YMIA 2FMIA 1FDOA 2FETA 2OPBA 3DZBA 1GFZA 2XWSA 3QGMA 4U0KA 4MZDA 3C48A 3NDJA 1F3OA 5BN3A 2JJ1D 4O63O 2AFHA 3CC8A 4EY7A 2ZJ0A 3F6PA 4TROA 5KVVA 2PT7A 3O2QB 4PGAA 2C2XA 3INTA 5JRJA 5HF5A 1R8YA 1H2XA 1RRPA 4FC7A 1E6LA 5EAIA 4OQPA 3CSDA 4INOA 3E3OA 3QUQA 4KR2A 5HKKD 3KUDA 3D5EA 1UP7A 5KVQA 4MXDA 2PN1A 3DEFA 3C1TA 1BN7A 4QEDA 2D1TA 1H8HA 1TAGA 2IYZA 3MGGA 2GDJA 1EWKA 4R1NA 5J2TB 1YVDA 3FSGD 2EEPA 4N6NA 1PLLA 1QAOA 1ZHHA 3ANSA 3ZGLA 2NZVG 2QT9A 3VRHA 3TSZA 1LPPA 1T26A 1FUEA 2ODPA 4U7GA 1KZ9A 5B57C 1Y8AA 4ISBA 3L6BA 3CRZA 3Q3VA 4X62B 1E5XA 1WSAA 4AP9A 2IDJA 4WK2B 3BWCA 4FGLA 3TTUA 2V7VA 2P1RA 3IUJA 4LXYA 5KKAA 5LPNA 1ZVJA 3B1ZA 4PAMA 1CRZA 2VKTA 4RCYA 3IUEA 5FHQA 4DCTA 3WAKA 1YQTA 3CB4A 3OQIA 4NIMA 3RYIA 4CODB 4BFVA 1XV5A 2A5FA 4FU0A 4H4DA 4NY1A 5CX1B 1NXXA 3B1KA 4RXMA 3FMGA 3RU7A 4DZTA 3FMIA 5KHAA 1AHIA 1YHNA 4XIIA 3SNKA 1A4UA 4GWKA 1X1QA 5A3VA 5DWVA 2ZB7A 3D7LA 1MQAA 4HWOA 2FPSA 4XEHA 2HM7A 5DRTA 1PYGA 4FFPA 2O1WA 3OZRA 1Y6RA 1XRRA 4LQCA 1US8A 4NARA 3K9HA 2I2AA 4ND7A 4NV3A 3WYBA 3QFCA 4NC9A 3SSNA 4BFUA 1Y7TA 4J0QA 3CMCO 1XK6A 1LSSA 4MV3A 3AM3A 1J70A 1KARA 2A57A 1Z0SA 1I33A 2H16A 1QBGA 1DKLA 5LU9A 5MN5A 4PHTA 5CH3A 5AVUA 2RHCA 3FUXA 1QCCA 5JCJA 4M0EA 3H4IA 2VO1A 1BGWA 1HDEA 2EFCB 5HRUA 1H65A 2ECOA 2OAQ1 1WSBA 4P6VF 5A4AA 2C9DA 1O8BA 2DUUA 4PLPA 5EMLA 4FMDB 1N34B 2HEGA 2O8EA 3V4VB 1GZVA 3L7AA 2YWFA 4GI1A 4JMLA 4YJFB 3UW1A 4EGQA 4KHZA 3BS4A 4NCBA 4W1PA 2XDAA 1ICEA 4ZQBA 3CZ5A 2CJPA 1I0IA 2WMYA 3DR5A 3CF0A 4AG6A 3Q3GE 2GM5A 2XD9A 1A5TA 2NU7A 3GZTB 1MPTA 1UBTS 1WB4A 2RDMA 1WETA 1M2NA 1PDVA 1PJ2A 2Q9CA 2XY4A 4INZA 4AC9A 3RUAA 3UCFA 5IKOA 2O5EA 1P1HA 2Q6VA 3COZA 5E0KB 3DM9B 4UVHA 1AIPA 1Y34E 2ZAOA 3IELA 1C81A 2EJWA 2B69A 4AN1A 3HO6A 3GJ8A 2BW0A 4FCWA 4BV3A 3BC1A 4AXBA 1F0KA 2BIFA 1XHFA 2Z95A 2IYRA 3IVRA 4BMYA 1L1QA 4P2BA 3KOZA 3WBKA 5L95A 2QBYB 1KZ7B 3DDCA 3SQXA 2P2SA 1EQ2A 4LN1A 2VLBA 3N6RA 1OBFO 4FXPA 3F78A 4QT0A 1Y4AE 4G63A 1GLNA 2QW8A 1INLA 2GJKA 3V7YA 4DJDC 4R2XA 3QY0A 4JBWA 1LDNA 2J6BA 3QVTA 4RTQA 1KJQA 1XPOA 1S6YA 2P3QA 1EWVA 2X3UA 3TLJA 4JLPA 4BNJA 2FJ0A 1DE0A 3CRRA 3W8FA 3VU0A 3TFOA 5K3DA 2AC4A 4DRXA 1HBJA 3ACCA 5AVYA 5B64A 1JHVA 3QU7A 1CYEA 4KUHA 5JFGA 1T9HA 2V7QD 3A06A 3DSRA 5CM8B 1PK9A 1TJYA 1CFZA 1KH1A 4IZHA 4F3KA 1IPHA 2LKCA 5KNLA 4A26A 5K6AA 1IQ0A 1W76A 2FU5C 2YCBA 3W4JA 1J22A 2OE2A 4EUFA 4FDUA 4XLTA 2D4HA 2QQEA 1QHGA 2QVYX 1B93A 3QJYA 3VU9A 1J6UA 4LWOA 1EK1A 3DKKA 4RLQA 4YCLA 2X4IA 3P20A 1FDRA 2DX7A 4IDQA 4K6OA 4OBBA 4OYLA 3D8SA 1LLQA 2WNSA 5BO5A 1Z2DA 1U98A 4UNPA 2QMEA 2QVBA 4N5HX 4MMZB 4A23A 5REQA 5E6RA 3VR5D 2W00A 5ICSA 2Y9PB 3G8YA 4D7AA 3TLGA 1G21A 5DGHA 1LBEA 4PWYA 1SXJC 2XMCA 4ZV9A 1E7SA 4ETMA 1EVIA 5EE9A 1AKRA 1MB0A 2DY0A 3D3JA 1H4VB 1Z3CA 1NULA 3QF7A 1PG0A 4IZIA 1BS1A 4DMGA 4TS3A 5KVAA 2CJWA 2NZ2A 4KQHA 4RKQA 1DQYA 4BMDA 3QJ5A 3QQ5A 1K8RA 1VCNA 2WVJA 5A4KA 5HUQA 3GLFA 3H16A 5JJ5A 2Q1XA 1BGXT 4UTNA 3NP7A 4QLBA 3MCVA 1ESNA 4WCDA 3RYHB 1XMIA 5CCDA 1HZZC 2CLFB 5F9FA 3EVNA 1E1NA 3CTPA 2FPWA 2C96A 2I54A 2VNKA 2ZJZA 1VJCA 4YYZA 3QPWA 4ARCA 2HN9A 1UWLA 3W7AA 3O8NA 3RS4A 2B2NA 2ODQA 3KT3A 4HZUA 3ITDA 2EQBA 3HRKA 3A3OA 1VDZA 5H7XA 4YIHA 3WRXA 2WMNB 3ZCXA 4KQIA 4WFKA 1SXJA 4BNDA 5FBQB 2EGHA 3KVNA 3G9TA 2FNAA 3VYRB 4QTUB 2ZIXA 5AT1A 1EJ2A 3D6TB 2SCUA 4X44A 4AJPA 4HFMA 3EGDA 5LLDA 3C15C 2ID4A 3MK31 3RG2A 3BD8A 3GIDA 2RAPA 2HF7A 3GHYA 2YYZA 3K70D 2CEKA 1YBVA 4MUNA 3T3PB 3ZE8A 1LQUA 4YAGA 2V7GA 2C0QA 5FWNA 1U6IA 1CR6A 4TTIA 1BCRA 2BF7A 3OCCA 5C8YB 1MAAA 2JVJA 5EUBA 1TQDA 1PV1A 3IBYA 3NH9A 3HXLA 5FB3A 2MSDB 1FDUA 2AHRA 3PHJA 1ST2A 2H2AA 2DPYA 1NXPA 2BHSA 3A1UA 3L4SO 1TVMA 3NANA 4PNHA 4QDUA 1IVYA 3TEJA 1WJGA 1DWPA 4DEVA 3ZCTA 3NAZA 4M55A 2AF3C 3RAFC 2VF4X 3VJLA 3AKEA 3AFGA 4MS3B 1L3CA 5B3AA 4G0ZA 1I3OA 2QL9A 4HAXA 4PXAA 1ABFA 1U3FA 1BTOA 2LTAA 3D7RA 1P9NA 5FULA 1IJFA 3S2YA 5D3MB 2JEOA 821PA 3TCKA 3WNQA 3KYJB 1WLSA 3FPHA 3R41A 4K9QA 1NUAA 4YRDA 3VAAA 5AKKA 4TKVB 5H3HA 4MKRA 3RF6A 4IGIA 3E2PA 1L5YA 1RXIA 2OT3B 3CLTC 1YZNA 1SXJB 3AIKA 3EWSA 2GARA 3QVSA 4O2AB 3LGSA 4Q18A 5KWVA 3RS8A 3H0KA 4OQQA 3A3PA 4X6XA 2PQMA 3F90A 4R1PA 4V1CI 1FNNA 2QJOA 2ZI9A 4S1OA 5G0SA 4DF3A 2O2YA 2GKOA 1PL8A 3AEXA 1C80A 1NQ5A 4R8VA 1EVEA 2QMZA 4WN9B 4F6CA 1PR1A 2FN3A 2BFOA 4D4JA 1L5FA 1ZP6A 4NF2A 3H99A 4JYAB 2G36A 3K9LA 1SULA 2JLBA 1OJLA 3C98A 3IH5A 4IUBS 3DVQX 2PRIA 4JOSA 5LDGA 4NMXB 4X3OA 3WADA 4CT0A 4URUR 4Y0NA 3OJLA 5IUJC 2O2IA 4WWHA 1VBNA 5EE1A 5DBHX 2G0NA 1B8NA 1H94A 4L8VA 4US2R 4BLWA 3I6YA 1N8KA 1IAVA 5DM0A 2B8WA 3BM5A 1FX0A 3CQ9A 2FR8A 1KVRA 3WIOA 1A04A 4KPGA 5HFJA 3SQLA 1Y82A 4G86A 1ISRA 1WZIA 4BFXA 4H1WA 1NNLA 4B84A 1RAFA 1ZA2A 4NONA 1KVQA 1T4GA 3SM9A 1IB6A 5L6LB 2ATCA 4Q3KA 3BOSA 4CEIB 4Q02A 1BD3A 2VT6A 5MHTA 5EXDA 1CQIA 1KAGA 4URHA 3ZWQA 4BMOB 1CERA 4L2IB 5DPMA 1W49A 2A9QA 3CZ4A 3RSSA 4PQRA 3VTFA 4PO3X 1SUWA 3SBXA 3K9BA 1G291 3VC1A 4F8JA 3MJVA 1TUEA 3V34A 2ZYAA 1WTAA 2ORIA 1QNFA 2ILTA 3L01A 1OWOA 4KRXA 5J5VA 1TAQA 2G06A 4BPBA 2EHJA 1I4OA 2QZJA 3OETA 3R3HA 2ZSKA 3ZW8A 1R9GA 1DCTA 3I53A 4LZJA 5DVZA 2E4ZA 1E96A 3T4UA 4BZQA 5JXIA 5T8KC 5TEVA 2FGKA 5I4BA 1O96A 1GKUB 2IEZA 3ABIA 3F5SA 3KZNA 3KFXA 3RVJA 4OFXA 3T41A 5KYYB 1VKZA 3KJFA 4BQOA 2OORC 3D3WA 5H9WA 2VPTA 1JFFA 3JYHA 4AYWA 4XUEA 2WHPA 1OV6A 2AOUB 2XWPA 3WKAA 3ZXYA 4C7VA 5HUJA 3GZNB 3DV2A 5EVCA 3KOYA 5C5IA 3ENZA 2Q9BA 1GCOA 3DVAB 3E2MA 3GLSA 2IOYA 2P90A 2QTMA 2RHRA 4FFNA 3B1WA 4ZREA 1P5RA 1IWBB 3AO0B 4F5YA 1W88A 2QGFA 2Z4SA 2A3RA 2JC3A 2VQ6A 2IE0A 4QD3A 2N1BA 1W48A 2PTGA 4IOLA 1L4GA 2A14A 2HUPA 3MCWA 1M9NA 1UKCA 4QJ3A 2MYPA 4CCYA 2AR9A 3OEHA 2Q07A 3EAQA 4EI7A 2MSKA 4RJKA 5JDCC 3SPXA 5AUNB 2JHFA 2K4MA 2I91A 2EX1A 1BJTA 3LO8A 3RT9A 4E4YA 1KQFA 1PDOA 5ALTA 1MO3A 1SN7A 2BLLA 2VXBA 2VUUA 4B3CA 3OZIA 4D3FA 1VIMA 2REQB 2H29A 1CUZA 1A7AA 3AMVA 2X3FA 3MJ4A 4H9GA 1U2PA 1VPDA 2QMUA 1X9HA 3FDIA 1RWOA 2Y92A 4XXHA 5C4MA 2Q5EA 3B2EA 3OLVA 1W4RA 4C2BA 1LK0A 4DLYA 4YAKA 4A8PA 1T0PA 4UHDA 3ZHYA 2J30A 2PMKA 4GMXA 4HPJB 3M81A 5MDHA 4Y1GA 3PRYA 4KIWA 2J5KA 4UHBA 3AG5A 2AA3A 2C99A 4LK2A 3VZPA 2GXQA 2ZT7A 1GRVA 2JAWA 3WMGA 4J2HA 5JH7A 3R9WA 2CDBA 2AN5A 1PF7E 3GELA 4DIDA 3DUFA 4QRIA 1TPYA 5ALUA 3VQTA 1ZD9A 2ST1A 4C7XA 5FKJA 4DNOA 2JEZA 1GY8A 5CHYA 3R8CA 4FS8A 4LCJA 4HWPA 2PWAA 3HCEA 4L9SA 4X8HA 1H0SA 1N7GA 4BN0A 1FDWA 3SHVA 1G8YA 2FCRA 4ZVKA 1I6MA 4EPRA 3Q3EA 2ZBDA 3WL6A 3K6RA 2B0JA 4Z3OA 4RF4A 4B87A 5KTTA 1PQPA 1SMKA 2VYFA 3IMCA 4CKCA 4LZAA 5DW0A 4PLYA 3P2YA 4Q15A 1XYVA 3A1WA 3KTOA 4TZ0A 2JFWA 3EDMA 2IHNA 2Z3WA 3TL6A 2DR3A 4ZZIA 4LWZA 1Z8HA 4H6PA 1M2FA 1BE1A 3M6AA 2W4QA 1GKIA 1MXFA 3QPCA 4C29A 2IEDA 5ECYA 3G79A 3MS2A 2X41A 2R48A 1EM8A 2I4RA 2GPBA 2H31A 2NO7A 4LW8A 1T8SA 4R3WA 1RLOA 3MMNA 2PL1A 5E95A 3I34X 3SR0A 4BNKA 1HT2E 1ZNYA 3DDWA 4DLZA 2I76A 3U09A 5FTWA 1MDBA 1YL6A 1QB7A 5BVGA 3ICEA 1ULUA 2XUFA 1SBZA 1MT3A 5CVUA 2WD7B 3MQ4A 5A9RA 1L4MA 4II2A 4O08A 3ETGA 4P32A 3UYKA 2XRMA 3H2SA 5HGXA 1A8HA 2CVZA 4NBUA 1IXYA 1KKMA 4LSWA 2LDXA 2PWBA 1JWLA 2VQSA 2FP3A 4C6TA 2QYOA 5FQNA 3Q41A 3SC3A 1O95D 1Z6PA 5HCUA 2IOHA 2H7YA 3OMWA 4L78A 1L4EA 2HJGA 2C5SA 1EHIA 2PKEA 3EQZA 4JJIA 2QMOA 2IITA 3RRZA 3WYFA 4A8JC 5H83A 5JJKA 1F60A 1PQUA 3S0JA 3MM4A 3H9JA 3M6VA 2OSVA 3LXUX 3G49A 1P0FA 2V3CC 5EYPA 3OLCX 5EXSA 5M7EA 4GOXA 3KQNA 3ZCVA 3KKNA 3DMPA 3MS7A 1GCUA 3F6BX 1JQ5A 3L7KA 1VA4A 2GERA 5E1MA 5DYYA 3WZMA 1I94B 4JKOA 3PT9A 2ZANA 5FYDA 2HTEA 1TL7C 1NASA 1YE8A 1VMDA 1LDEA 2JLUA 4FT2A 1HFWA 3MILA 4XX1A 1CQXA 2HJ9A 4GBMA 1LJ8A 1YR6A 3TJZA 3M70A 3EF0A 5EEGA 1V5FA 3E3LA 3MC1A 4MV0A 4JNKA 4YPVA 4BU0A 1JZQA 2PX2A 2IXFA 1GZ3A 3DO5A 5BW5A 1EUDB 1Y81A 1G4UR 2E55A 3QKSB 4Z7JA 2ZCVA 3FUVA 1KP9A 3AYZB 4GRAA 4RWZA 4DWJA 1CVRA 1S2LA 4GU5A 3SS9X 4MR8A 1FC0A 3PR3A 4PINA 4HRAA 4HPXB 4TV9B 1ZD2P 1C0IA 4D1YA 2QZ9A 5BSMA 3IDSA 2R86A 3DZDA 3RNOA 3AHDA 5IT0A 3B3GA 4PY2A 4CVNA 2IYLD 4IKEA 5HIIA 4ZK6A 1KE2A 2RAVA 1L5VA 3B48A 2GBGA 4RE5A 4X71A 5DX0A 5IC5A 4F9GA 5IAAA 2Y1LA 4IX9A 1C50A 2ZBRA 2OYCA 1VCHA 1GITA 3CKMA 3IBTA 3QKWA 3H86A 4UMVA 5E4JA 1LPAB 2QN8A 4J0IA 4MV9A 4EUEA 4YX9A 5C3UA 1VIYA 4JR1A 1I9GA 1IDN1 4RABA 2IZ1A 2FW6A 5SV2A 5KBYA 2Z2IA 3DPSA 1LPMA 1BS2A 1QR2A 2QS9A 1PZMA 2R6CA 3I5XA 5JXJA 4O2AA 2GJ4A 4MS3A 4RTLA 2YVQA 1D9XA 4N0EA 3B12A 4W1QA 1NF2A 1RTKA 7YASA 4GD3Q 2G72A 1V16B 2FAXA 3TAXA 1GA1A 4B7CA 1DAHA 2XCLA 2Z0MA 4MKIA 3DZJA 1ZIYA 3DVAA 1H2RS 5DI3A 3NHJA 1EXDA 2H06A 4WLNA 3UFXB 3K2IA 4XQGA 2ZYDA 1L7QA 4HZIA 2F9MA 2Z9CA 1G1MA 5KYWA 1TVKA 3K6KA 3L7YA 3FFXA 1WZNA 1NY6A 1XEXA 4COOA 1BJRE 1UJ6A 4ZTZB 1XJQA 2D0DA 4QUGA 1JDUA 1L7MA 3M3PA 3JQ7B 4QTXA 3E9QA 2ZROA 3HDVA 4DIKA 5KKNB 1EZ4A 1GT6A 4OVKA 4CTMA 1EGMB 4HKTA 2QHXA 3HA3A 2B3TA 4XB6B 4Z9YA 4P7KA 4Y2SA 3Q12A 1PEAA 5FUXA 3UJ7A 3LDAA 3S81A 4RENA 3I6ZA 2YJZA 2BCEA 5G0TA 1VB5A 4WESA 1RRGA 3R24A 3VV3A 1LRJA 4KQEA 4R8LA 2XADA 2PGAA 3LK7A 3PDUA 2J0UB 1CJVC 4KSBA 4TV9F 1WOYA 2OXTA 4YDQA 4MZXA 2CNNA 1XJCA 3I5MA 5IDWA 3EZGA 2A1TR 5JAHA 1T9GS 2O0HA 3L2OB 1R5NA 3L8YA 3O9ZA 3B6MA 4N48A 1EG7A 4UM8B 4FN4A 1QAMA 3DBVO 1AMOA 3CGWA 4B2IA 1EQUA 3CV3A 2D2VA 4JHLA 4US1R 3ZVMA 4ARIA 1NXTA 3N6XA 4X54A 4GPD1 1A9ZA 4I36A 2IC5A 2C2YA 2R1TB 3AJRA 4W9NA 3I9LA 1WVMA 4EZEA 2JJ2A 5FYQA 1LNZA 3PG5A 3MWLA 3CSUA 2WJ4A 5TSDA 3ZDDA 3D4LA 3OX3A 3E7PA 3QOWA 4NE9A 1ZM9A 4HGZA 4DANA 4ZAWA 4UFPA 2FWMX 3IQFA 2FWBA 1I2CA 2HMWA 1F0PA 2AXPA 2Z6QA 1A76A 1NV8A 4GUDA 1VIDA 2XTNA 2G88A 1XJ0A 1E1DA 2UZ4A 1TU0A 4NOMA 3BFKA 4RWEA 1KGSA 3RC8A 5HKLA 1RQXA 1B23P 4E14A 1JQDA 3AGQA 3D81A 4J76A 1SD5A 4LDNA 2HA7A 3AH8A 3G0CA 1NWHA 3QLUC 3EFOB 4QAJA 4B40A 4BBZA 1VHJA 3H8SA 4XRGA 3LF1A 3L77A 2W6JD 4GZMA 4XQCA 1TE2A 2X23A 5HCNA 4BWVA 2WFAA 3MTEA 4FFDA 4G0NA 4FNMA 2GYUA 4JQCA 3ANXA 1QLJA 3AILA 3TBHA 2YHIA 1IFXA 4I4LA 1VKOA 5IP5A 3UAGA 5ITZA 2N9UA 3OF2A 4GICA 4Q1DA 3DOOA 3H2KA 1F8GA 4FR2A 2HCJB 1TZBA 1GGVA 2W6MA 1PDWA 1WMDA 3PQ2A 5L9AA 2QVCA 3QLTA 4NSNA 3KBOA 1ZKMA 1CR1A 4PO1A 3RM3A 2BH9A 3BWYA 3KELA 1ZMOA 1JDTA 2A4MA 3FFBA 3I45A 2NW6A 3PXEA 4Q82A 3T34A 2ZRGA 3TZBA 1UMBA 1C1DB 3H2ZA 3K0HA 2JRLA 1TD9A 1WABA 3V7WA 3NDPA 1QCYA 1RJWA 1SXIA 2OV4A 3HCRA 4WBXC 5BOSA 1P17A 1GZ6A 1PT8A 1FFDA 1GTZA 5C8VA 3ZJ4A 1NFQA 4R54A 2EGUA 3B7PA 5FORA 5ESDA 4R01A 4C1NA 3Q3IA 3GLIE 4RUKA 4WMLA 2R9VA 4W7IA 3SD7A 1G5PA 1Q91A 1AQIA 3MS4A 2BHNA 2NSJA 3SE7A 4NBLA 3LA6A 3WSVA 3PITA 1KYYA 3BE6A 4O4LB 2WC1A 3L8FA 4GH5A 1GNTA 3RBAA 4KFCA 1Y1QA 4PSAA 2PKWA 3ZS8A 4D4MA 4E13A 3Q9UA 3IAFA 1A72A 3PA8A 5AKZA 1C9DB 3IL2A 4TZ6A 1MTZA 1Z63A 4ZVPA 3GN2A 4P82A 3I9KA 1QORA 3QVVA 1C3OB 1JHYA 1KI1A 3FPJA 3FYUA 1X1EA 3Q85A 4WY8A 3N8HA 4LOAA 2QU8A 1G5FA 4IIDA 3W2IA 4AS3A 2BGUA 4GXQA 1XTBA 3FW1A 2XBLA 1H2AS 2HIMA 3CFYA 3PEUA 4JJGA 4O0MA 5I7FA 2HPZA 4GEKA 2NP6A 3VDMA 3WO0A 1GP2A 2GYWA 2RHDA 3IIIA 3RYIB 1GDTA 4HH3C 1AT1A 4Q39A 4YP0A 1Z07A 1L1EA 2LDBA 2EATA 2V9CA 2ZWPA 5H0IA 5JMWA 4DG8A 4Z5XA 3SLRA 3URMA 3UV3A 4JYZA 3RBZA 1ZMXA 2VDOB 4FSHA 3WGUA 3OZ7A 4UPVA 4HXFB 3NUGA 4EJFA 4O4JA 4CN9A 2JFPA 3IEMA 1QO0A 2G3YA 2MSEB 3HMQA 4MW9A 1JLKA 4BJ3A 4BLTA 5JH7B 1U1CA 3LH5A 3PWSA 2OV1A 1VP9A 4ZO8A 4RXUA 2FEMA 9MHTA 1YB4A 3PU6A 1RD4A 3NTVA 1L8XA 2VQ3A 1OF1A 3A6JA 4JN6B 5IXSA 3WGNA 2PMCA 4P0QB 1T8UA 3QWAA 5EZ5A 2VCHA 5EL0A 4MAMA 4LYAA 2ZIGA 4DGSA 3UT6A 4D92A 1JVSA 1TO6A 2H11A 2O48X 2C8LA 1RYHA 4RSGA 1H8HD 4FDMA 2YHBA 4O4IF 1YIDA 2CHGA 4B8YA 4AQYB 4DA8A 4I4TF 1NUHA 1C9MA 2R60A 2VJDA 1GQSA 4K28A 4NHOA 3OLZA 4KPUB 4NAHA 4MYDA 3TSOA 4P4TA 1BD4A 3DMTC 4UM7A 5INTA 1TUGA 1OUMA 4ZVOA 2Q1SA 1AXGA 1U94A 1O94C 1UEJA 2CMHA 4FHEA 3ANYB 4JR2A 4MWBA 2HZBA 4NTZA 4YBRA 1V8BA 3EPKA 2RHMA 1XGKA 1UXHA 4HMOA 3IOEA 3CLHA 5F77A 4RY2A 3ZR4B 2ZR7A 2CHVA 4UVIA 1H8ED 3HB4X 4C6SA 4B9EA 1TGYA 4CV1A 4OXIA 3JQRA 2NT3A 4BECA 4EW6A 1BKYA 1E7MA 3C97A 5KAMA 3AEUA 2G70A 3OIGA 4JBGA 1DTEA 3NOVA 3LFUA 2VH5R 4QREA 4HWSA 1VKJA 4JC8A 4WK0B 2E2WA 3WK4A 1GU0A 1S4MA 1VYUA 3HNPA 4EL0A 1W87A 3IURA 5ARBA 4ZEMA 2EOAA 3QVLA 1PZNA 3P9ZA 4ON9A 4MQBA 3E7XA 2DR0A 5D7NA 5IDXA 3H2JA 1KETA 4HR7A 3JQFC 5A0FA 3JRNA 2QE7A 2CVPA 1ECFA 1ZU4A 3M5PA 4TVKA 1NG9A 1JFFB 4LBWA 2PV7A 1G8SA 2QUAA 4RIHA 3C5EA 1UXJA 1WD5A 2J3HA 2ZJ7A 3I32A 1NN0A 1ODLA 1XLTA 1P4GA 1GNRA 4F38A 3HXMA 2Z3VA 2YY5A 1QP4A 1C3LA 2RB4A 4RY9A 2YIJA 5MN6A 3M7IA 4OFBA 2HDHA 3RJMA 1VXOA 4TMVA 3O8OB 4UBLA 4P3PA 2RE8A 1D6JA 4I4TB 8LDHA 5I9NA 2V9ZA 2VYNA 1Q44A 2WYHA 3BFXA 3LOQA 2IHYA 3NASA 3Q7PA 3VU1A 1VIAA 4BOYA 1OXMA 3PIRA 2HYIC 4KU4A 1ZAKA 2XZPA 1W5EA 3S7TA 1FFAA 3VC7A 2X5NA 5KTRA 1QOZA 1XZJA 3LW7A 4MQ6A 5HJ5A 4WOCA 1M33A 2B4AA 3NBKA 2CF5A 4KBGA 2FQQA 3WZ2A 2XQVA 3ZE2B 3A6PC 2A1UB 4PAWA 5DCYA 5SZIA 2D1RA 1ZUIA 4EA7A 2AOXA 4NV1A 5AFSA 1OX4B 4EUH<