2WM9B

Structure of the complex between dock9 and cdc42.
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
179
structure length
179
Chain Sequence
SHMQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DEDICATOR OF CYTOKINESIS PROTEIN 9
publication title Activation of Rho Gtpases by Dock Exchange Factors is Mediated by a Nucleotide Sensor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 55
structure length 179
sequence length 179
ec nomenclature
pdb deposition date 2009-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2wm9B00
4D81A 1XEXB 1G1MA 4AYTA 2ZITA 2BDTA 5FPKA 2DY1A 2F1JA 3LA6A 5KSOA 1SXJA 3PV0A 2D74A 4JLMA 4ZDIA 4TLDA 3W3AA 3EIEA 1OE0A 3MWLA 5CJPA 1E2QA 2WWFA 3TSOA 2IUUA 3SDZA 4S2EA 3KKMA 5J4VA 2P6RA 4Q4AA 4TLEA 3OAAD 2H7VA 1WRBA 4ZIRA 5IRCD 4YXWD 2JEOA 1SHZA 1DG1G 1TUIA 5EP1A 5AJXA 2WJVA 3K9LA 2C96A 3G5UA 2JJ8A 4TL8A 1OXTA 3MSXA 4JSTA 4UKDA 2BBSA 1TQ2A 1UBGA 4YDHB 1I2MA 4PR0A 3LO5A 4HUQB 1T5IA 2A7QA 4QL3A 2QN6A 2VHQA 4RFSA 5DYIA 1E2PA 4DXAA 2YWHA 3DKVA 3UK6A 2Z43A 3CO5A 2AHOA 3NXSA 4I99A 3EASA 1KYIA 3QF4A 4JYBA 4NDZA 5HZKA 1P75A 3CB4A 1U8AA 3B78A 4PFSA 3AVPA 4LZZA 2W6JD 3ADDA 2AKYA 2DFLA 1UEJA 3PUWA 5FBVB 3PITA 2R65A 3QKSB 3LW8A 3CZPA 2P65A 4JKYA 4N0EA 1OW3B 3TAUA 2IYWA 2G9NA 5FBRB 1RJ9A 2FGJA 1UF9A 1FL9A 2H1LA 2OCYC 4LI0A 4Q9KA 3PEYA 4HSEA 4MYUA 2W6IA 1OB5A 3IHWA 3KJGA 3A1UA 4IDNA 1S0UA 2CBZA 4W5HA 4W5JA 2ZRGA 3R7WA 4A15A 1U0HC 1X8KA 4Q4HA 1PUIA 2ZYTX 5KSPA 3QPUA 1TU4A 2JJ1D 1XTRA 3VHXA 2BC9A 4EIWA 3DMDA 2ZUBA 4KLNA 3RSOA 4HYYA 3GLGB 1E6CA 4E22A 4MDEA 5BQ5A 1XTIA 2HF8A 3LV8A 4OK5A 2DBYA 1N5KA 4ESHA 2LKCA 1AJEA 5BN5A 1XEWX 1TTTA 4US1R 1E99A 3B5JA 1DBSA 2QY9A 2XJ9A 3JVVA 2R62A 4HLCA 5CK5A 2IL1A 4LJ5A 5FI1B 2VIIA 1OKKA 3AGPA 1IBRA 4BFZA 1MKYA 4JBYA 2IWRA 2NQ2C 4C0AC 1QHIA 1TX4B 1ZNWA 3DVLA 2FV8A 2AXNA 1CULC 2VP6A 3PEUA 4NHOA 2GCOB 5HE9A 1FTNA 1TQDA 4BLPA 2ZU0C 3QKRA 2PX0A 1Q0UA 1G64A 2FFQA 1W47A 3UATA 1F2TB 1NVVQ 1XX6A 2XGJA 3WP0A 1TU3A 2UVQA 3NWJA 2WIAA 2ZJBA 2FEMA 4NYMR 4C0SA 3UMSA 3U2QA 3TH5A 2CCJA 1JBKA 2X19A 4RD2A 1DTSA 3SNHA 3GPLA 2DFTA 4Q02A 4Z8YA 3CM0A 5DI3B 4OHYA 3PQCA 1ZIPA 3L82B 1U81A 2A5DA 3R20A 4M22A 1AKEA 4UJ3A 1FPMA 1IXZA 3VR1A 2ZSDA 1FMJA 4LHXA 1GG2A 2BBWA 1U0JA 3RC3A 1QHGA 1LV7A 3K8YA 2CCGA 1H65A 4LCBA 4Q9LA 2ZVPX 1L7VC 4A0GA 4Z54A 4HZUA 3FFAA 1QHXA 3IBGA 1YZNA 2BWJA 3CX7A 3FKSA 5FTKA 4DJTA 5KYKA 1E1RA 2OFWA 1G19A 4GZMA 4BRUA 1R5OA 1OSNA 1U99A 4KFRA 2ZRIA 3CONA 1OXXK 3KTAA 1Z0KA 1FMLA 2FSGA 4CEHB 4Z1MA 3K70C 2QAGB 4I1VA 4MKHA 1G3UA 3OHMA 2ZSEA 1HURA 5FI0B 5J4KA 3AM1A 3QVUA 1TPZA 3MJHA 4XOIA 3GLGE 1Z29A 1VCOA 5K8UA 3AUYA 2ZRDA 1UDWA 4BLTA 4IOLA 3QF7A 5DN6D 3I92A 3IPXA 1LS6A 4GL2A 1UM8A 2FJUA 2OV2A 3B7GA 3OEHA 4KODA 1ZU5A 2XTNA 4IVQA 3BB4A 1Q3HA 1W36D 1U90A 3BS4A 2WSSD 1UBFA 3TUIC 2ZJ2A 4DUGA 2C99A 1CJKC 2VP0A 4B6FA 5F9HA 1DPFA 1RYFA 1UKYA 4MGKR 3L43A 4AG5A 1G5TA 3B82A 2V6JA 4NCIA 2IBMA 5CYPA 3I4LA 2XB4A 2UKDA 1TF5A 4RFSB 3NH6A 721PA 4M0LA 4XTCS 3IGFA 1Z8FA 4TYNA 2ZRBA 1OIVA 5EE3A 5KDOA 3HP1A 1MO5A 2C9OA 4US2R 1SVOA 5CDFA 1OH5A 3UPUA 3VKWA 1ZUNB 1N5LA 3LDAA 4L5BA 4C0LA 2IHYA 3O47A 4JT4A 1S4QA 5FUXA 2IYSA 3R9XA 4MQBA 1NY6A 2ZRLA 4F93B 1FX0A 1XMSA 1S8FA 5IK2A 1A2BA 4URYR 1IY2A 2QTVB 2EFGA 2CK3A 1FNNA 4TTPA 2ANBA 2XNSA 3KDSE 5FTMA 1YKSA 1NRJB 1F60A 1N0WA 2GJ8A 4QG7A 4JZKA 1G9XA 2C77A 2AKAB 3H2YA 2NZ8A 3HYTA 3KFXA 3K53A 2XNDD 4HLUA 1CEEA 4U7DA 1N2CE 3M4YA 1ZINA 1GVNB 3N5CA 4URZR 1QHHA 5SZKB 5D3MA 5JRJA 1TF2A 2J7KA 3KXLA 5HKKA 1KIMA 3OFNA 5M04A 1AGRA 4PPFA 1ZVQA 3T1OA 1G8YA 1R0WA 4LJ4A 1XJ0A 2D7CA 1AS3A 1D5CA 2QU8A 2OG2A 2NZJA 1T4GA 5FUVA 3THXA 1S1CA 3UG7A 5LPNA 1FUUA 2EFHB 3I1FA 4I1UA 3L0PA 5GJVC 2KB0A 4X8HA 4Q7LA 2ASEA 5JJLA 2OLKA 1XP8A 3D8BA 3GJ6A 1A5TA 3IQWA 1DARA 3HYRA 2OEPA 5JCZA 5CB8A 3RS5A 4Q1AA 1GRQA 1OB2A 2P5SA 2CL0X 3WYAA 1R0ZA 1E2IA 1E2KA 2GILA 2QSYA 3C8UA 2PLRA 2EU8A 2NG1A 3FFBA 1EFUA 4CT4B 2CNWA 1YZGA 1P3JA 3LBHA 3K0FA 2REOA 3OIWA 2JJ2D 3DZDA 4JJKA 1A2KC 2ZRNA 4TQUS 1TMKA 4LX0A 2VBCA 1ZD8A 3A4LA 3AKEA 2WKRA 4GRAA 5FPSA 3T34A 2MSDB 1KDPA 2IYTA 3WBJA 1UDXA 1PZNA 1XTQA 2FSIA 5FOUA 1EFTA 4WXPA 3VX3A 4HZUB 2ZS9A 1OIWA 1JQLB 1R7RA 2W2VA 3KXIA 1AM4D 1HEIA 3DM5A 1Q3TA 4KO8A 4NZYA 3P32A 1D2MA 2YWEA 2KBEA 3FPAA 4H9GA 4B2PA 4RZUA 2NOAA 4HUTA 2VHJA 3WMGA 1XTJA 4GOJA 2F1IA 3RNLA 3CR8A 1ESNA 3LX8A 5G53C 1P7CA 4ZKDA 1R8SA 1HQYE 2E9SA 4F4CA 2C8VA 2ZRHA 2IUSA 2R6DA 3T1QA 2NO6A 1FZQA 1VYVA 4CZ2A 1SKQA 1HQCA 1IONA 1Z0IA 2HUPA 3CRVA 4TMZA 4C2UA 1KK1A 3IIMA 2A5GA 1KMQA 3U7FB 2IS6A 1KAOA 1HE8B 3V4RA 1M1YE 1P62B 1QVAA 2FE4A 1NIPA 4G5RA 1XCPA 3GJ8A 3F3YA 3RABA 2ZI9A 3QOFA 2A9KA 2F43B 1VPLA 2ZI7A 1UKEA 4X8MA 4BUJA 2C9CA 1Z07A 3CUEF 3HJNA 1W4RA 4QM6A 2JDIA 2IS4A 4TYPA 1NBMD 4DCUA 3HPRA 1Z47A 2VLIA 3QXXA 3OE7D 3T06B 4DT1A 4JBWA 3RANA 3F8TA 3QPWA 3LWNA 1DS6A 4NMMA 2GEVA 1N25A 2PZGA 2Q3MA 4JLNA 2G1JA 1BMFD 4GPTA 3ZZUA 4RZ2A 4TYWA 4B3XA 1AQYA 1RRCA 1XCMA 4CEIB 2Z4RA 4JKIA 2R6CA 2R2AA 3PEWA 5F3WB 1DELA 5E7MA 3WP1B 5KHOC 1JEDA 1PLJA 4Q47A 3OAAA 2ZRMA 4HDCA 3B6EA 3GJ3A 1ZMXA 2OUKA 3A36A 3TQCA 1EFCA 2WOOA 1E2LA 3QKUA 1UBCA 1KJYA 3QJYA 3BK7A 4II7A 2ZSBA 2OILA 3KQLA 1QHHB 3Q85A 3R9IA 3MUFA 2ORWA 3NC1C 3DMNA 3SHFA 3I8XA 2YOGA 1W4BA 4KLZA 2J3EA 1SVKA 5EZ6B 4TLBA 2Z5FA 4WZAE 1IJEA 3VMFA 3FWYA 4RD1A 3Q3JB 2AN9A 5H70A 5KPJA 2X2FA 4S35A 4LRWA 2V8OA 3PFIA 4LYJA 3VR5A 5KSZA 3W6NA 3ZIAD 4DLSA 4HLDA 2YWGA 5CIQA 1JAHA 2X77A 1FQJA 3EIHA 3QY0A 3E70C 1OXSC 2X1VA 1HT1E 1E4VA 1NJGA 2DCUA 4M1SA 5EUQB 2O8FA 2QP4A 2ERYA 2QMOA 2RKOA 2ZUDA 3EA0A 3GJ4A 3K0AB 4B43A 1E94E 1E2GA 4B3FX 5IF9A 1GL7A 3KJHA 1ETUA 4IOJA 3QE0A 3IEUA 4FIDA 3CBQA 4I4LA 4LDJA 2FDCA 3CF2A 1NVUQ 1KJWA 5J4HA 2CCKA 4LHZA 2PCJA 4BEBA 2AWNA 3LQRA 4JLPA 3AVUA 2O8EB 2OBMA 2H8KA 1TEXA 1RPZA 4PAOA 4RVCA 2WWYA 1IAQA 4TT3A 1G4AE 2IS1A 4A2WA 1ZNYA 3P4YA 4MA4A 2D62A 4PSAA 1JECA 4MGZR 5AWFC 2ANCA 5CK4A 1PUJA 2QM8A 1CRQA 4Q4JB 5P21A 3NIBA 1NJFA 2WICA 2GETA 3W9YA 5J47A 1W4CA 1KMHA 3BFKA 2XITA 5EXPA 3S1AB 1NG9A 2P5TB 2PMDA 2FPLA 3NC0C 1OHHA 1KDOA 4BLRA 5A4JA 2K5UA 1E2EA 2CE2X 4PPGA 3LVQE 2KE5A 4DSUA 1E2MA 1NLYA 3TQFA 5IT5A 1G20E 4HI0E 1WMSA 1NY5A 1GKUB 1XD9A 4Q66C 4W7SA 1AGPA 4JL5A 1VIYA 4WZBE 4ZCMA 1J8YF 1GUAA 3ZQ6A 4JLKA 1SQ5A 2IYQA 3AUXA 4RD6A 2YC2C 3X1DA 4ZDWA 2ATXA 4HUQA 4P4SA 2L0XA 5EZ5A 3GCGA 1TUEA 1KI3A 2IK8A 4DIDA 4QJ5A 3A58B 4ABYA 1NN3A 2ZYVX 5C18A 1N6IA 4Q4LA 1G7RA 3AP3A 1GIAA 1CJMA 1O3YA 1BS1A 1CJVC 4M9ZA 4IFEA 4L16A 2G3YA 4TYQA 5DHFA 3B8HA 2QAGC 1DAEA 2ZU6A 4NYIQ 4WBSA 3W90A 3L0IB 2SHKA 4BQSA 3TGPA 1Z28A 2B7BA 5TB5A 1IY1A 4QBHA 1N6HA 1Z22A 3SQWA 4LPSA 2ZETA 5E95A 2V9PA 1EESA 3RS2A 4DLRA 1OH6A 3QG1A 3LXRA 3CRRA 4OQLA 2GNOA 4IDOA 4EPTA 4TMVA 4XTRA 2YC4C 3V9PA 2J0SA 1E1QA 3NDBB 3U61B 5KOYA 3FHTA 2RHDA 2WOJA 3PG5A 2B8TA 3QPVA 1TQ4A 2ZANA 4O0MA 1MV5A 1E0JA 3NDPA 1R6BX 3OIVA 3GLGA 4FCVA 4IEIA 3RYTC 3C7KA 3BGWA 4PPQA 4EJSB 2IXGA 2HYDA 4Q01A 1G8GA 3THYA 5GVSA 1W46A 4DRZA 2QE7A 2RGBA 2BIFA 2O0HA 3QBTA 4C9BA 3A4NA 4DDTA 5JHGB 2GK6A 1T3SA 1Z6XA 5DLQC 4O25A 2GCPA 2F7SA 3LX5A 4MRRA 3CZQA 1W44A 3TAHA 3VR4A 4JLJA 3TNFA 2GCOA 4KXFB 5LDDC 4TYYA 3OF5A 1II0A 5AJWA 1F2TA 4D0LB 3U5ZB 1LTQA 3F5FA 4O3MA 1Q1EA 4YMVA 3ONWA 4OL0A 1DAKA 1FP6A 1AN0A 2VP2A 4LJAA 1Z0AA 2H5EA 4BFVA 1GDDA 4NP6A 2QGZA 3M6AA 1E0KA 4PAQA 5DI3A 1XNJA 3T35A 3H4MA 4DEYA 4FWIB 1Q1ZA 2JLZA 1AS2A 2OCAA 2FZLA 2VF7A 4EPYA 5IHPA 2ZXUA 2IXFA 2OSBA 4J0QA 4JLDA 2ZJYA 1W48A 2GXUA 3B1WA 2IT1A 5C46F 5L3VA 3ZS9A 4B44A 3BB1A 3FE2A 1E0SA 3QXHA 5FOSA 5H68A 1EFRA 2AD1A 1KK3A 1A1VA 1JQJC 3IIKA 1WB9A 2AK3A 3ZZTA 1DG3A 4WVFA 3QUSA 2EW1A 1SVSA 4CEHA 4LUCA 1S96A 2FFHA 4MRVA 1VG8A 2C98A 2QAGA 3TBKA 1GTVA 3TRFA 4F4JA 1CLUA 1GSIA 2BJWA 2XZOA 3BC1A 3AF3A 3B1YA 2ZJ5A 2W0SA 2GVDC 3B85A 2V1UA 1X8LA 3RVBA 3H86A 3HU1A 5B30A 4LGMA 2IYUA 2JCSA 4YMUA 1OLOA 1OF1A 2C5LA 1ODFA 4G5OA 1W0KD 2CHQA 4B2LA 1OXVA 1YR7A 5KDDA 1P9NA 2TMKA 4DLUA 2FMXA 1AA9A 3EA5A 3AB3A 4OI2A 4LPKA 2ZYWX 4C0JA 1KO8A 2GJ9A 1QG2A 1GNRA 4E03A 1DAIA 4UNQA 2Z0MA 4CYMA 3U7EB 4CIDA 4EKDA 2MMGA 4MKFA 2F55A 2J87A 2NO1A 2GXSA 4P4SB 2OLJA 1JPJA 2AXPA 2Q6TA 1ZUIA 2O8BB 3I32A 2VYFA 1ZCBA 3RRZA 1Z6AA 3BXZA 4FINA 1WBDA 2KSQA 3ASYA 3MWYW 3LBNA 1S9DA 2GZAA 4D82A 4KYUA 2D2FA 1COWA 1G4UR 1CR2A 2XB2A 2WIBA 4PO1A 5FTNA 3MMPA 1ZU4A 4KSCA 2CEAA 1A7JA 4PXAA 3ICQB 2A5JA 3FDIA 4QGHA 3O8BA 4UNPA 2YYZA 3BJIC 5C4GB 3E5HA 1VG1A 3GLIB 3MJRA 4RD4A 2UZ3A 1R10A 2WMNB 5K8TA 4XIGS 2V3CC 4DKXA 2QL6A 4GSYA 5JSZB 1NP6A 1FNMA 5AUNB 2CLDX 4DDUA 1ZW6A 5JECA 5FBQB 1XJQA 1HH4A 1KO7A 3Q5EA 4GP6A 3R8CA 4HB0A 2YOHA 2JA1A 4UJ5A 1KKLA 5L3RA 3ADCA 4DSNA 1W36B 2FZ4A 1VECA 4HDQB 4WAUA 1OFTA 4QJ4A 5JS7A 1BYIA 4LV6A 4UNNA 2ODEA 1GITA 1GRNA 2X8AA 2HF9A 2CMKA 4Q18A 1PV4A 1KK0A 2OAP1 2RH5A 5L3QA 1JPNA 3THYB 4JLVA 5KNCA 4MUBA 4Q9IA 3LQQA 4BFTA 5E7IA 3MWKA 4B3BA 4D4MA 2ZR0A 3KUDA 1JJVA 1T0JB 2QBYB 4PQYA 2YOFA 1SULA 2FSHA 4JVSB 3GQBA 2EFEB 4LYHA 1S9HA 2V7QA 2VQSA 3A1VA 5G40A 2CHVA 5FTJA 3WRXC 1N6NA 2PH1A 4ON9A 5FOTA 5FL3A 2XOKD 1D9XA 1VG9B 1YR6A 2YNMA 4KAXA 5CITA 3GEIA 4RY2A 3SFVA 1H8ED 1G7CA 5DO9A 5LB2A 2ZRPA 1T91A 3VAAA 4LYAA 2CL6X 1TEVA 1W0JA 3KKOA 5FH9A 1CU1A 1NMZA 3TKLA 3K0CC 5AJYA 3TLXA 2FN4A 5FL7A 2ZM5A 4GFDA 3DPUA 2ORIA 2ZE5A 3P1JA 2IYYA 4R7ZA 4QBFA 4HLUC 4TTRA 5FPTA 1M7GA 4IVRA 2OBNA 2XTZA 4RJLA 4P4UA 4DSOA 3SZRA 4GDFA 5JJIA 3D7MA 4HAVA 4KJZA 3GLIE 4ZI2A 1IQPA 2GF0A 1EG7A 1Q12A 1KNQA 4JLAA 2O0JA 1KY3A 4ZCLA 3SJBA 4QKQA 4Q1FA 4V0LA 2BKEA 3RWOA 3AEZA 4D80A 1M8PA 1MR3F 2HV8A 3GEHA 3H1TA 1OV4A 3G0HA 2JIZA 4D2IA 4LBZA 3WNDA 4B47A 2FX3A 4TN1A 4PHTA 3W34A 3VTKA 2QUZA 1XXHB 2ZRCA 4IDHA 3MFYA 4M9SA 3SC3A 1OXUA 1JB1A 3LLMA 5GVRA 2FOLA 3EZ2A 1X86B 4JMPA 3SEAA 3PR1A 1RRFA 3G82C 2W00A 3DOEA 4YC7A 4KI0A 5BWMA 2QTFA 3KZ1E 2WJIA 3BAFA 3I5YA 4HAWA 1NIJA 2DWOA 2IC5A 3A1SA 5AK0A 1E2FA 1JEEA 5DE3A 4YMSA 2A78A 2OBLA 1RKBA 1US8B 1YR8A 6Q21A 3Q9LA 5EE9A 4P4TA 4OI1A 2UZIR 4LK2A 1W7AA 2GJSA 3GD7A 2G83A 4OYHA 2EQBA 4KVGA 4PO9A 1UEIA 2OT3B 3D6TB 4FMBB 2XSZD 3IPYA 1G5PA 2F43A 3U6KA 1KY2A 4NE2A 4L9WA 4ZV4A 1N0VC 2GRJA 4U5XA 5DHAA 4MRNA 3A8TA 4HATA 4D4KA 3ZVNA 2ZIAA 1Z08A 1Y3AA 4I1OA 4BGDA 1E2HA 4G3XA 3SHWA 3EC2A 5FPHA 1IOZA 3RC8A 5JEEA 1F5NA 1Q57A 2B7CA 2C95A 3EX7C 3T5GA 3TUZC 4E5UA 3KKQA 2O8CB 4CEIA 2YINC 3UWKA 4RKEA 4M1YA 1XU4A 4TTQA 3OEEA 5ANRB 1VCMA 4TSFD 3ZZ0A 1XEFA 3QENA 2VF8A 4JL6A 4LV8B 1HE1C 2DFNA 3LH5A 2PJZA 3K0CA 2EYUA 1W49A 1ZM4A 1KI6B 1JJ7A 1B0UA 2QMUA 4MGIR 4G5SA 5GJCA 3WY9A 2FWRA 1PLLA 2RGEA 4OJQA 5C2JB 4GOKA 3TK1A 2R6FA 4JS0A 1RW4A 2QENA 4QGFA 1GAJA 3SR0A 3QEJA 3CRMA 3GJ0A 4C30A 1KJZA 4RZXA 1XXHE 2J7PA 5K8LA 2WSMA 1Z5ZA 3ZJYA 1E9EA 3C16C 1C1YA 1P73A 3W3ZB 1KKMA 1G18A 1U0LA 2F3RA 2FF7A 3Q7PA 5L3QB 3AVYA 2HLDD 3RLFA 2E87A 3W8NA 2QNRA 4M1WA 2CDNA 1KSGA 3MRSA 1X1SA 2RGGA 1DEKA 3ZQJA 4XD7D 4WW0A 4POAA 3HR7A 3AP2A 2A2ZA 1XZQA 2IYRA 4KITB 4LBWA 2ZRJA 4TLCA 2HJVA 4GMDA 1WBBA 2FNAA 3ASZA 221PA 3L2OB 2QA5A 4XSHA 4FMCF 2ZI6A 3I8SA 3NEJA 1P4SA 3ZLJA 4F92B 1OFHA 3K0AA 1IJFA 1G5RA 2BMEA 3TUJC 1DOAA 1G6HA 1D2EA 2FFAA 1TF7A 1RFLA 3N70A 1U2RA 1E9CA 4CDGA 3T1TA 1D2NA 5JEDA 4M1MA 4UNRA 4AYXA 3ZH9B 2O8EA 1A82A 4ASUA 3LRPA 4GI7A 1CJUC 4N1AA 1G291 2VL7A 2GF9A 4DBLC 1J7KA 2OZEA 3QNUA 4DLTA 2BHRA 1SXJD 3BORA 3W8RA 1DAHA 4EJSC 1L8QA 1WA5A 1CXZA 3QI2A 2DPXA 2PLFA 1JALA 1EGAA 1J99A 1Q1QA 2W58A 3KQHA 3EARA 1MO4A 1RZ3A 4FMDF 1GP2A 4Q4JA 4TWZA 2R44A 3VHLB 1ESMA 2XX3A 3S1AA 4AY2A 2P67A 4TQAA 3BE4A 1WCV1 2KJQA 3E1SA 3UANA 3KB2A 2FFBA 1GKYA 1VDZA 2KI5A 1E79A 2WPDA 2GHIA 4M2LA 1CF4A 1TAGA 4XWKA 1IY0A 4PC7A 1G3RA 3QXJA 3U3JA 3AVVA 2IYVA 2RGNA 4ARZA 3THOA 4NYJQ 2ZI3A 2JLVA 4RD0A 3X2SA 4GBMA 1E32A 1YZUA 2CLSA 4FD2A 1H8HA 2CJWB 3OIUA 4R2IA 4XVQA 4E07A 1HTWA 3K0SA 3R8FA 1QHYA 1XPRA 5G3ZA 1NBME 4N3NA 1K5GA 2JLWA 4GP7A 2WJGA 3AKCA 2OXCA 1FOEB 3CWQA 5EP3A 2IX3A 1N6RA 4AK9A 2OESA 4PHFA 2OXRA 1ZAKA 4ZCIA 1NN1A 5C4MA 5AUQA 3WYGA 2F3TA 2ZROA 2G6BA 3H0KA 2KBFA 2ZS7A 2P0EA 2QPTA 4G5GA 1FQKA 4AKEA 3FMIA 4DZZA 1RRGA 2Q3HA 2W6ID 4HAXA 4AURA 1OFUX 3CPJB 1J2JA 5A5GA 1L4UA 2OM2A 4NCHA 3F0TA 3RWMB 4NCNA 1KI2A 3NG1A 1OH8A 1M6NA 4DLWA 2RCNA 2GBLA 2BCGY 2V1XA 2VP4A 1NLFA 5KNDA 3LY5A 2F9MA 1IN4A 4BLQA 4QGGA 2MSCB 3U44B 1XD8A 1GL6A 4MH0R 1F3OA 3O8DA 4LHYA 4B6EA 2DYKA 1XEWY 3U3RA 5HPYB 2P6UA 3DEFA 4WA7A 1OKKD 1UBEA 3U3KA 3SYKA 3LFUA 2WJJA 4PZZA 1VYUA 4AYWA 4YXWA 4CW7A 3NBYC 2PL3A 5EQTA 1VMAA 2DWPA 2ECKA 2XAUA 4NTZA 4FCTA 1Z3IX 3B1XA 4D0NA 4FXPA 5EP2A 2RGDA 3FMOB 4CRWB 2BCJQ 3T61A 4EJSA 1YRAA 4B75A 5KUTA 4PQRA 4M1KA 1CKEA 1FW6A 3RRMA 4GZLA 2JLRA 2FGKA 3SBDA 4JJZA 4EPXA 3ECCA 2FPMA 2WHXA 4DEXA 3UMRA 3HDTA 4UXIA 4C3ZA 4F4IA 5IDVA 2Q9AA 4MKIA 5AJVB 2QORA 3UIEA 4V0KA 3ZGXA 2QP3A 3SQXA 1GNQA 2W6JA 2QGNA 2QQ0A 3B1VA 4LJ9A 1IXRC 1E96A 2WWWA 3D3QA 3REFA 1XBTA 3THWB 4I81A 1P9RA 4C7OB 4QRHA 1U8ZA 3AVTA 1E2JA 3NEYA 2JLYA 4MUAA 1XPUA 3FKSD 1CBUA 1M7HA 1E1RD 3KFVA 4B71A 3VU9B 1K5DA 5FFMA 4YONB 3WHKA 2ZSFA 5J4LA 2CXXA 1SGWA 1XFAA 1XMJA 3AKDA 4OK6A 2N46A 3A1TA 5KU1A 5A0FA 4OHZA 5F98A 2A5YB 5FUWA 2C9YA 3NVAA 2JJ1A 1T0HB 3FMFA 3SE0A 4KHZA 3PXGA 4C0HA 1J70A 3O8RA 5TV2A 3SYNA 3I62A 2E1RA 1Q22A 4RCZA 1N5IA 2EVWX 2HCJB 2LCFA 3DZ8A 3FHOA 1E4YA 3BD9A 1N6LA 3I72A 4NCJA 4KV9A 3OEHD 1E9DA 2Q21A 2RGXA 2VSXA 2ZE7A 2V4ZA 4WXRA 2I4IA 3W6OA 1U9IC 4Q1BA 4DUGD 1P60A 2OHFA 4F7WA 4G0NA 1LVGA 4C0KA 2GZHA 3MGCA 3HR8A 4OI4A 1UAAA 5KSYA 2BJVA 1W5TA 1KDRA 2BVNA 3UXMA 5JWRA 5FTLA 2ZRKA 3A1WA 4LJYA 3KUCA 5HCNA 1BH2A 4DWJA 1GL9B 3C5HA 4B3CA 3QXSA 4ARZB 2QRNA 3I5XA 3PVSA 4HB2A 2W0MA 3WRYC 3EWSA 4B3DA 4IHQA 4IFBA 4IJMA 4OHXA 2QP9X 4Q21A 5TXGA 5JJKA 1I2DA 2QROA 2B21A 3RDPA 2B92A 3IQXA 3B9QA 5IK2D 4MYTA 1VTKA 3AQ4A 3OESA 1KSHA 2O8BA 4BECA 2CLCX 2GDJA 3TW8B 2CK3D 2ZE8A 3P26A 3K9HA 3P4XA 1NN0A 4L15A 2G88A 1XTKA 1OIXA 4NBSA 1KDTA 1XF9A 5EUMA 4OI0A 4LJ8A 4ILEA 4QC2A 3FKQA 3N2IA 5DNYB 3A37A 3IO3A 1Z2CA 2B6HA 1E9BA 4QHSA 2NGRA 3C5CA 3TR0A 4ACAA 2WBLC 3GLIA 3FGNA 4BFWA 4URUR 4EQ6B 3OFND 4KFSA 5KDLA 2ZAOA 5JSZA 3A4MA 3K9GA 3GLHB 1LW7A 1XDBA 4PZYA 1K6MA 3K1JA 1SVMA 1M7BA 4A2PA 4BFYA 5H1YA 5DN6A 2WWGA 5LD2B 1NVXQ 4QGAA 3IHLA 1N6OA 2GESA 4QNMA 2WWIA 3PEVA 3L0SA 4JLOA 3WMEA 4A8JA 3K70D 5JI2E 1NN5A 1QZXA 2J46A 3U3MA 1GRRA 2QQEA 4D4JA 2WSSA 3R9WA 4AKGA 4UXHA 1YE8A 2PT5A 4XVRA 2ZQ5A 4URXR 5SZIA 1U94A 5FR1A 3SU8A 3GLFB 1FUKA 1M34E 3OZXA 3GFTA 1YZTA 1QHSA 1OFIA 5EXSA 1ZM9A 2CNWD 4D6PA 1YZQA 1L2TA 3GJ7A 2QBYA 4C0QC 2REXB 1S2MA 2HXSA 5HZHA 1QF9A 4LJ6A 3AVQA 1U9IA 3GP8A 4MGYR 2NTYC 2RMKA 4OJKA 2PJRA 3UMFA 3I61A 2JLSA 3BIFA 5L3SB 2PMKA 2J5XA 3VKHA 1DO2A 4CGZA 4LBVA 1KZ7B 1DAGA 4MKGA 4CEJB 4P31A 4IKEA 2VRWA 2BM1A 4V0ME 1IXSB 4QBGB 2IXEA 2VEDA 1P61B 3B13B 3FOZA 2ERXA 1ZIOA 3SJZA 3Q8XB 2R8RA 3W5IA 2IF2A 4JVMA 1YRBA 5DGXA 1G8PA 3RS3A 2XNDA 3ZYCA 2O8DB 5KNBA 4O2RA 1QRAA 1MOZA 1VHTA 2QI9C 3CF0A 4BZPA 5JRZA 5CM8B 3GFOA 2BM0A 4PO8A 1N6KA 3RS4A 2DWQA 4IOMA 4YQFA 1ZCAA 3RRYA 3GLHE 1J8MF 3EW9A 3RS7A 1CP2A 2QTHA 4HLQB 4OKSA 5JHHB 4D0GA 3X1XA 1MO3A 1E3MA 2OO7A 1PVOA 1E98A 4URVR 1G41A 2VH5R 4JYCA 2O52A 2GJKA 3AF2A 4NONA 5BXQC 1WXQA 2J41A 5JCPA 2W2XA 1UKVY 1XXHA 4TZ6A 3WHLA 2QEQA 4IEEA 3CF6R 4OQXA 5F2EA 4IRUB 4L8GA 4RZ3A 2HXYA 1QG4A 3M0EA 3NTUA 4EFMA 1E0AA 1MRSA 5GADl 3GLFE 1ZBDA 3EG5A 1RIFA 5JI3E 4Y0AA 2LKDA 1KO1A 1RYHA 1US8A 2JDID 3U7HB 1ZJ6A 2WWXA 4A0FA 3VKGA 2JJ2A 5DH9A 5CYOA 3DDCA 4V03A 1JI0A 1JXOA 4A9AA 5D3QA 3BB3A 2RGAA 3CPHA 4JT2A 3VNVA 4DLXA 4ZDKA 2WVJA 3KQNA 3ETLA 1GZSA 3QSYA 1GNPA 3WYFA 2X2EA 4OHVA 3QXCA 2AR7A 2AL7A 3Q7QA 3ZDQA 1R2QA 3SOPA 1W1WA 4B32A 1MABB 3EZ7A 1ZM3A 1UADA 3H84A 4DDWA 2ZS8A 2XEXA 4MRPA 1MT0A 1IM2A 2VHTA 1JXMA 4Q03A 3VFDA 4IOKA 4JIMA 2ZTSA 2HT6A 4HAZA 5FOXA 2ZJAA 3TIFA 3MWJA 4D25A 4LC0A 2O8CA 2QRZA 1XZPA 5JWOA 5KTYA 1PLKA 3AH8A 5DIFA 1NVVR 1AK2A 4G1UC 1BYUA 4Z8XA 3SI7A 3IKJA 3DHWC 4EUNA 4GOXA 1X6VA 4WIAA 4TL6A 2BKUA 2IUTA 1MRNA 2F1RA 5FOVA 1SVWA 3AF4A 3EPKA 1KI6A 2O5VA 3B60A 3HPQA 4IW3B 1MO6A 4XJXA 1LF0A 5UKDA 4XVUA 2A5FA 3AGQA 4DSTA 2PZFA 2G0TA 2YZ2A 4A8JB 3LD9A 1R8QA 5J5CA 2KWIA 2N42A 3IUYA 4NCKA 1YR9A 2ONJA 2CVHA 2IF0A 2IYLD 5DYGA 1J90A 4R2HA 1YU9A 4TL7A 3L8ZA 3LAWA 3MD0A 2J45A 3FYHA 2W2TA 1P2VA 2ZAMA 4XWAA 2ZSAA 2NO7A 4FN5A 4K8OA 3C41J 2QT1A 2WJYA 4LJ7A 1WF3A 4RFVA 3TMKA 3I73A 1E69A 1NBMA 3NHAA 1P2SA 3B9PA 4PC3A 3OE7A 3K09A 1E2DA 1CRPA 5BYJA 4AKIA 4Q7KA 3NH9A 1ZNXA 2N1BA 5L8VA 1M2OB 4UNSA 1BMFA 1ZD9A 3IDQA 4LOAA 4TT3D 1KSJA 1D9ZA 2EYQA 2ODBA 5LBIA 4W9MC 4BLSA 2Z83A 1NF3A 3RS0A 1TADA 1HUQA 2F1HA 1YJ5A 2ONKA 4LV5B 3A6PC 5LB4A 2ZJOA 4EFNA 1XD2A 2OFOA 3DO6A 2J9RA 2VA8A 2IW3A 3CKLA 4DDVA 1IN8A 2EWWA 3IIJA 2FU5C 5EP4A 3TVDA 3NHBA 1GM5A 4BLOA 2V55B 1I4LD 1NMYA 2J0UB 3DL0A 3LVRE 1Z0FA 3EPLA 1OHHD 5CIWA 4B34A 2XZLA 1II8A 3CNOA 3NBXX 4DLYA 4PANA 5HTKA 4DIEA 1TQ6A 1XMIA 4RKFA 1F2UA 4HAUA 1RRPA 3MLEA 1SVIA 5SZHB 4OQFA 4FCWA 1E9AA 4KFUA 4N0DA 2BV3A 3FHCB 4CT5A 4B2IA 3HU3A 4DHEA 4QJ3A 1M74A 4LY6A 3B2EA 1KSFX 1ZRHA 1WP9A 2G1KA 1KGDA 2PEZA 4RCYA 2AD5A 4DB2A 1JR3E 1IN7A 3ZIAA 3X1WA 3EIQA 4A92A 4URWR 4TL9A 4C4PA 4RSGA 1IN6A 1F48A 2VP5A 1NMXA 3SN6A 1XTSA 5HCIA 2QT0A 3TE6A 4EFLA 3UKDA 1P6XA 4RD3A 1U8YA 2CJWA 4HZIA 4LWZA 4Q5IA 3NBZC 4LSGA 2CL7X 1DE0A 1OPXA 2FH5B 1Q20A 4HAYA 2B8WA 1JR3D 3BERA 1KK2A 5AUOB 2WAXA 1KZGB 4A0RA 5CLQA 4BZXA 5JFGA 4G5QA 4MDFA 2QSZA 5C1BA 4HEJA 1AKYA 1NSTA 4HDOB 1W2GA 3EAQA 2VSOA 3K0EA 4NYMQ 4V0OA 4YDSA 1KI7A 5B58C 5JS8A 2XZPA 1SXJB 4ZDJA 2D3WA 4PC6A 2D2EA 4PX9A 3KKNA 3EPJA 4M1TA 2GXQA 4L4UA 2HT1A 1T5LA 3QQ5A 3RRNA 4Q7JB 3J81k 2BMJA 3BFXA 4YLGA 1QBKC 3PIRA 5SZJA 1R0XA 4Q4AB 3T5DA 3QEOA 1E1QD 4B3GA 4ZIRB 3W5JA 3IBYA 4Q1EA 1NKTA 1T8TA 1N3BA 1I4DD 1DADA 3C15C 4TQ9A 3U44A 3SS8A 4G01B 5EE1A 1C9KA 4PC1A 1ELOA 3U6BA 3TSWA 2AFHE 3CNLA 2QE7D 2W83A 2BBTA 1UFQA 2D4HA 3VR2A 5BW8A 3AP1A 4YMWA 3ND8A 4A2QA 2RGNC 2GCNA 2ODNA 1E9SA 4JVLA 3QF4B 2ZR9A 2YV5A 5G41A 5F9FA 4B35A 4Q19A 1ZC4A 4H1VA 4DCNA 4MITA 4FW9A 4PSVA 3UWOA 1CIPA 3VR6A 4NL4H 1DVRA 1E9FA 4QM7A 4Z51A 1G3MA 4A1FA 1G16A 1T3HA 3EZ9A 5AR1A 1BIFA 1K8RA 1LFDB 4Q9JA 1KI4A 1RJ9B 2NIPA 2EFCB 4QFMA 3EZ6A 3VQTA 1KO5A 1UJ2A 4JLBA 2GKSA 4B74A 3R7WB 1G7TA 4KBGA 4ZPXA 3KL4A 3WNBA 4WZ6A 3SFZA 3THWA 5CLLA 3ND9A 4Q4HB 4Y0VA 2GBLC 2FEOA 4GMXA 4C7OA 1IHUA 2NPIA 1XB2A 2XTMA 3C14C 2H18A 2EFDB 3M1IA 1EFRD 5KPDA 4TMWA 1GKIA 2QPOA 3KX2A 2C78A 3BFVA 2XXAA 1Z6YA 2H16A 2H17A 3E2IA 4A36A 1SXJE 5J40A 3VU9A 1NNEA 1O87A 2Q0HA 4F38A 1WQ1R 3CW2A 3JZAA 1EK0A 1G3QA 3DOFA 4NYJR 4A0HA 5LD2C 2YKGA 3U7GA 4D4LA 3GMTA 1EXMA 2V54A 4ZI3A 3FTQA 2G0NA 2J0QA 1AZSC 1ZNZA 4QHTA 1XD2B 2ODWA 4AG6A 4Q9HA 2ATVA 4CVNA 2GAOA 1IN5A 2O0KA 2Z4SA 4K46A 4QHYA 4R9UC 5BN4A 3DM9B 2ZRFA 1L4YA 4NU0A 1LB1B 3QKRB 5GJBA 3Q72A 121PA 4P0TA 1II8B 1ZM7A 3TR5A 4IDQA 4ITRC 5K8IA 4BZQA 2MSEB 1F2UB 2P6NA 2YHSA 4PHGA 1CS4C 4K81B 3U4QA 5G3YA 3KQKA 1ANKA 5ELXA 5EE5B 1A4RA 4BPBA 2IEZA 4AC9A 2BBOA 5E7JA 2VPPA 3SJCA 4B33A 5EE0A 4JSYA 2PX3A 1R5BA 1N5JA 4OQNA 4A6XA 2A30A 4DCSA 5TARA 4BEJA 1E2NA 3CX6A 5JMTA 5FOWA 4B73A 4B76A 5FPYA 1C4OA 4HB4A 4PTLA 2RHMA 3TW4A 4BASA 2VO1A 2GJAA 4WOPA 1WDTA 2D7DA 4CF7A 1OYYA 2CE7A 5B2ZA 2IWHA 3X1ZA 4EPVA 1ZD1A 2QZ4A 2PBRA 3TJZA 621PA 5JLJA 2VHUA 4YMTA 1KI1A 4DB4A 3GEEA 2H92A 1COWD 3C4JA 3GJ5A 4M21A 1N6PA 2FSFA 1VCNA 5CB6A 4M8NE 3KTAB 2NMVA 1LNZA 2WWHA 1YZLA 1R5NA 1KAGA 5DSZA 5TVKA 3T15A 1N0UA 2IA5A 2YVUA 1HYQA 5CM9C 3REGA 4V0MA 1ZUHA 3ADBA 4UQOA 1G17A 3PUVA 2DHRA 1ZC3A 2IYZA 1BKDR 3ADKA 3PCRB 3JVUA 5BYKA 4BE7B 2PCLA 5FUYA 3PUZA 3V4FA 4OK3A 1KO4A 1DAMA 2WKPA 1OH7A 3LXXA 3BH0A 5FBWB 3HWSA 3CRQA 3ICEA 2C2HA 4IXNA 3DKPA 3P20A 4QNRA 4M1OA 3PUXA 2DR3A 2PT7A 3LW7A 1CR0A 4XSGA 2I3BA 4F91B 3TSZA 2P3SA 3RHFA 1CTQA 2J0VA 4EQ6A 1QVRA 3GLHA 2BMDA 3I3SR 3LBIA 1XCGB 3IILA 2JAQA 4BWYA 2NO9A 1Z06A 421PA 3EWAA 5H8WA 1KOFA 1JNYA 1LY1A 1CJTC 1R4AA 3W6PA 1Z6TA 1W0KA 3MG9A 3AKYA 4IVPA 2AFIE 2GA8A 3CWZA 3RAPR 1Q21A 2VSFA 2ZPTX 1KI8A 3FMPB 4Q1CA 2A3RA 2XJ4A 4L9SA 1KTVA 2Z6VA 2JLXA 2AX4A 2V7QD 4AI6A 3BH6A 3AV0B 3GLFA 3JZMA 2AK2A 2RAPA 4GNKA 2G77B 1W2HA 1FX0B 3PUYA 1NKSA 2JGNA 1AQUA 4NH0A 3CR7A 1W0JD 1P2UA 2F9LA 3OIYA 1Z63A 5E4FA 1V5WA 3EC1A 3SJAA 3BH7A 4PAMA 4KCGA 4NPHA 2NPFA 3AF1A 1F6BA 1Z83A 5FL7D 4EDHA 3AF0A 3QKTA 4OQMA 2JLQA 5L3SA 1P5ZB 3Q5DA 2R6GA 1NL3A 3GJXC 3X1YA 2HEIA 2GEDA 1Z2AA 2YWFA 3T1VA 4ESVA 1LF5A 4CEJA 1Q44A 3QIAA 3CIOA 4C2TA 1LS1A 4IXMA 1RC8A 3FVQA 5D3MB 2AWOA 2IHBA 2ZR7A 1UKZA 1U98A 4ERNA 2XXAB 3FB4A 2GK7A 2HYIC 1S3SA 2ZI5A 1EX7A 4LBYA 2GZDA 2IYXA 3KJIA 5EJEA 3NBFA 2I1VB 3THXB 1GOTA 3B1ZA 5JBQA 3V00A 3IEVA 2R6AA 4U02A 2JIZD 2RB4A 4Z1MD 2O8DA 3SYLA 4A8JC 3K70B 3NKVA 3BWDD 4A82A 2QM7A 1W36C 1D8TA 2FA9A 5FR2A 4KSBA 1YZKA 2QG6A 1SZPA 1X8JA 1OT3A 2IEYA 2REBA 2H57A 4PSKA 3AVXA 1TNDA 1NI3A 1EX6A 1YQTA 5DI9A 2BEKA 2GTPA 4KU4A 4EPWA 3BOSA 2GWHA 4DLVA 2ORVA 2WTUA 3U4QB 1FFHA 1X1RA 4PC2A 3ZVRA 2RGCA 5JZVA 1TL7C 3K0FB 1Q1BA 2JATA 4O2LA 2VTKA 1T6NA 2P2LA 4Q00A 4P32A 4OBEA 4HB3A 3T12A 2WV9A 2FG5A 5CDFE 4DLZA 2ZJZA 1RE0A 1P2TA 1G8FA 2Q3FA 4NYIR 3QVVA 1HY3A 4LHWA 1YVDA 4V02A 4A6PA 2PEYA 2XOKA 1FP7A 2J59A 5J4YA 4FMCB 4I1SA 2VHCA 4Q7MB 4KVAA 1H8EA 1G3IA 3UG6A 1R0YA 3KXKA 1MH1A 1SHKA 1E9RA 4M9QA 1T3LA 1SKYB 1EWQA 4A4DA 1QDEA 1EFHA 1XEXA 3VNUA 3N2EA 4C0BA 1VIAA 1KNXA 3KJEA 3TVTA 3QBVA 4E09A 3ZD7A 2ZVQX 3KKPA 3KB1A 4DCVA 1HA3A 3MCAA 2WJHA 4QBIA 2JLUA 3OEED 2OCPA 1G6OA 1NLZA 1MABA 4JL8A 2WAYA 4BFUA 4PQFA 4XH9B 3KQUA 1V43A 5TY0A 4AKHA 2ZREA 2JASA 3CH5A 2HCBA 4FMDB 4TMTA 1BOFA 4MYHA 3L0OA 1II9A 4IDPA 3AVWA 4MYCA 1OJLA 4X8OA 4LHVA 1NG1A 3EZFA 4KBFA 4H1UA 1KHTA 4MRSA 1HV8A 4M9XA 1XPOA 2J7PD 5AUPB 3D31A 1GILA 3U60B 5HKKD 2D06A 4LYFA 2GVZC 2OE2A 3K9NA 4JBXA 1G7SA 2QMEA 4TZ0A 2GXAA 1JR6A 2DFKB 4US0R 1EWRA 4EAQA 3ZVLA 1VCIA 4DCTA 1Y63A 2DB3A 8OHMA 1Z6GA 4EPRA 4TMKA 2BEJA 1JR3A 2F6RA 4B48A 2ZI4A 3PENA 2QPAA 3WNCA 3HU2A 2ZJ8A 4Q1DA 1P9WA 4QXAA 1VHLA 3QKSA 1AS0A 1VG0B 1GWNA 4ACBA 4DT1B 1UPTA 4M4SA 3RSLA 3BBPA 2ZUCA 3CPEA 3L8YA 1Z0DA 1GFIA 1T8UA 1PJRA 2XSZA 4BFXA 3VX4A 1AIPA 2VP9A 4X8LA 5EXXA 1SXJC 4V0NA 2EWVA 1ONBA 3IO5A 1NVWQ 2WMOB 5DISB 5EXTA 1XRJA 4NKRA 4FWTA 1S3GA 1YHNA 1SVLA 3CH4B 4P33A 3CNNA 1WE2A 1QHNA 4TMXA 2Q9BA 3EXAA 4ASUD 2FPKA 1SKYE 4U00A 4D26A 4AD8A 1XMVA 4PZLA 5AJZA 3VR3A 2HJGA 1KI9A 3WXMA 4AWXA 4R71A 1ZP6A 2QMHA 1I4TD 2Q9CA 3ZS8A 3ZD6A 5CJ2A 2QAJA 4TSFA 3QG5A 3P27A 5TDHA 5TMPA 1AZTA 2C04A 4ZO4A 1JAIA 1HT2E 2I1QA 2BMFA 4DVGA 5FBLB 1DO0A 3CRW1 5GJWC 1OYWA 5B57C 2BOVA 2ZYUX 4BFSA 1G8HA 1B23P 2MMCA 2J0UA 1FTSA 2CHGA 4KYIB 4GT1A 1XJCA 4Q48A 4TLAA 4QOSA 1D6JA 5B64A 2V6IA 3EPHA 1E79D 2WPDD 2WZQA 4KFTA 2Y8EA 4PPNA 5KO2A 2WKQA 2PZEA 3BRWD 3MAAC 1P72A 3GFPA 2GAAA 1W5SA 2OCBA 1CR4A 4XWOA 5JWHA 5BN3A 2O8FB 4P3YA 821PA 1BO6A 2R9VA 1H8HD 1DAFA 2HLDA 4AIIA 2OAQ1 3WMFA 521PA 3CLVA 1S1MA 4JVNA 3AVOA 2HDNB 3PJRA 3CX8A 4PHHA 5HR5A 4FI3C 4XD7A 4BRWA 1W4AA 2WM9B 3K09C 2ZEJA 1ZYUA 2YJTD 3LNCA 1VYTA 2OFXA 1XWIA 1G21E 1CR1A 4W5WA 1Z0JA 1ZM2A 1RVDA 2J1LA 3ZVMA 1X3SA 1T9HA 2CVFA 2ZRAA 5E3HA 2LWIA 2NO0A 4M53A 4ZKEA 3LLUA 1VKJA 3SBEA 3O8CA 2ZE6A 4OHWA 4LC1A 4DC9A 5HE8A 3WBKA 4R98A 4UXJA 1KMHB 2GEUA 3U3OA 2IS2A 1NSFA 2C03A
chains in the Genus database with same CATH superfamily
3LF2A 3IBTA 2B0JA 4D81A 1G1MA 3P2MA 1VLQA 3HZOA 4K9MA 2V45A 4A0SA 2OYCA 5A3JA 2F1JA 3LA6A 3S7TA 4XYLA 1N77A 3CUVA 1IZ9A 4TLDA 1OE0A 2CXOA 3SYRA 3E4DA 5HJ2A 2X5KO 3TSOA 4LVNA 1Q16A 1V5FA 2JS7A 3KKMA 4FE4A 1OWMA 2VQ3A 1Z5GA 4FUTA 4KMRA 4MV1A 4X61A 4N4AA 1KYYA 4QUGA 1CQZA 5F76A 3TTXA 3W4KA 1WLYA 1HL7A 2CB0A 2BUBA 4OUDA 4G09A 1Y7PA 2Q6LA 3G9TA 3HZRA 3WNZA 3L77A 4PXSA 2YIDA 3TLMA 1DOZA 2VNKA 2PGAA 5AT1A 2YDYA 3SSMA 4XYMA 3GFFA 5BUCA 3GXBA 1OXTA 2HB6A 3MSXA 3TQHA 5FJIA 3ZWVA 4UKDA 2XZDA 1KVTA 3ESYA 3QNWA 4ONEA 3RIEA 2AQHA 3LBAA 3GEGA 4EAAA 5DBFA 3LO5A 3QPAA 5L6MB 2A7QA 4KVFA 3PJGA 2PN1A 4RFSA 5DYIA 1NFRA 4DXAA 2YWHA 4O4JB 2Z43A 3CO5A 3LTNC 2HBRA 4EMTA 1OASA 2AHOA 3EASA 3OJ0A 3QF4A 2POCA 4ZCRA 4OREX 3IIIA 1JXAA 2WIKA 5HZKA 2C42A 1GV0A 3KCNA 2GEKA 5HS6A 1WVMA 2DP4E 5C34B 5LZ7A 1C3EA 5DX1A 4QU8A 1UEJA 3PUWA 3PITA 1NQUA 2R65A 3QKSB 2HGSA 1PJ2A 3LW8A 3T7EA 3H2HA 1JWLA 1YTUA 4B3HA 4D8YA 1DJQA 4C78A 3TNYA 3NPMA 4D8WA 3I6BA 3P2IA 1PX2A 4H6XA 1FU8A 2IYWA 3QLUC 2YWJA 2FZWA 1CUXA 1V9SA 3OP4A 3NS7A 5TS2A 1Y3IA 1W29A 2DX7A 5DHPA 2PJUA 4HDKA 2WKSA 5D51S 5JPCA 1GCUA 2YHUA 5B58T 4BBZA 2WB2A 4TPKA 3AW8A 2BZSA 5JD4A 2PKQO 1PUIA 2ZYTX 3M2TA 4TWBA 5KSPA 4C3OB 3KB6A 4I55A 3C1OA 4JIGA 4W7HA 3BICA 3GLRA 3UB2A 2NU6B 2A33A 4LZLA 2V74B 4JUFA 2ZUBA 4BHTA 1H2BA 1MAAA 2QL5A 3M89A 4TVOA 3GLGB 1E6CA 3CIFA 3MQFA 2C4MA 4GGOA 4IY1A 5A1TA 1BN7A 4OK5A 5KQGA 1N5KA 3TJRA 1JHMA 1NVDA 3BCSA 1XFDA 1Z5NA 1E99A 3B5JA 4XIYA 4HGRA 1QK4A 5JYBA 5F9MA 2FZVA 3FSEA 4MP6A 5CK5A 4ZC1A 2JAXA 5AM5A 3D6HA 3BSYA 1IHPA 3UJAA 3OTHA 1HQDA 2PHZA 1Y1TA 2ZPAA 1C7FA 3DVLA 1V8BA 5H3HA 4E5MA 4KE6A 2BCEA 1V2HE 3PEUA 3ITEA 2GCOB 3WISA 4X44A 2SICE 5IXYA 3DKKA 3IC5A 5FXMA 5M29A 4UUQA 1KGSA 1NVVQ 2HFJA 3EUAA 1Z4QA 2B98A 2X8JB 2WIAA 3BL5A 3L6RA 2EHJA 2VG8A 3U2QA 4JJGA 5CEEA 1CJBA 3TH5A 3CUUA 5AHRA 1A9SA 1JBKA 2X19A 5FWYB 4KMOA 2W2NA 3T4EA 4F46A 1S5PA 3K9FC 2WYWA 3AR7A 4Q02A 3CM0A 1ISGA 1ENPA 2C3MA 4Z8YA 4ENSA 4OHYA 3E27A 1AKEA 1FPMA 4CKZA 1IXZA 4ZQEA 2VJBA 3F47A 2FVYA 2X5JO 4KQKA 4FZJA 4LHXA 1FYDA 3HKCA 3ANNA 1U0JA 3AF6A 4AZ0A 4R69A 4BP9A 1RWOA 1WPRA 5K0BA 1SHUX 1U4SA 4LCBA 3LOUA 1L7VC 4Z54A 3H9CA 3N0RA 4K9NA 4TN5A 2BFDA 1YZNA 3CX7A 4DZTA 3OFVA 1A5AB 3EG9A 1Q50A 2OFWA 4RTLA 4B17A 1XG5A 1JZSA 1U3GA 3RK1A 1U99A 1UOPA 2GN0A 3FNRA 4KFRA 5HFAA 4YV1A 1G0OA 1LPSA 5SYAA 3RU7A 4D0SA 1OXXK 3KTAA 4YYEA 2JIRA 3WV4A 3FB1A 3RSHA 4XPIA 1FMLA 4CEHB 2WTAA 4MHOA 3UBTA 1KAEA 3FRIA 3ZK9A 1V71A 4TWRA 3S2EA 2QAGB 2A4KA 1XL1A 3PXAA 1QGUA 1HDXA 2V58A 3UH1A 3ZW9A 2Q5EA 4P7JA 2ZSEA 3KQQA 4C03A 3NVDA 4FS8A 1EDDA 1ZSVA 4EGSA 1VJ5A 3KV3O 3QVUA 1TPZA 2B8NA 2G04A 4GI3A 4FZ3A 4XOIA 4ZI5A 5SY6A 1VOTA 5C7IO 4BVKA 2ODAA 3V42A 1M2VB 4PG8A 5ALYA 3QF7A 2YV2A 4I5EA 1L5NA 4D02A 1GQSA 3AUSA 3B7GA 4PLGA 1GLGA 1Q92A 2B2CA 2XHEA 4FFSA 4IJ6A 4TXHA 1OZ0A 3BB4A 3U37A 1JDNA 1FS4A 4BZWA 1Q3HA 3SLGA 5BP7A 5C5EA 2FLWA 2IUEA 5EHXA 3BS4A 3KM0A 4GLOA 2WSSD 3A6ZA 3TUIC 2QLMA 5KQRA 2VJMB 3V80A 3N2LA 1QANA 2NO5A 5EJ7A 2BR4A 2OWEA 1W6RA 1BJRE 4UEKA 1UKYA 4MGKR 3L43A 1S01A 3ZWDA 3SVZA 3B82A 2JCXA 1EHYA 2IBMA 2V6JA 4K9QA 2UKDA 1XVUA 1TF5A 1HE5A 721PA 3A9UA 4XTCS 1PK9A 1UPBA 2ACKA 3Q15C 3Q9SA 1Z8FA 4TYNA 1GPLA 2JFNA 2V7PA 4PLYA 1MGOA 2WWTA 4US2R 1MO5A 3H7IA 5D84A 3I9FA 5CDFA 1OH5A 3VKHA 3VKWA 1ZUNB 1N5LA 1A8HA 2X0KA 5C9ZA 5K8VA 3R4VA 4XIIA 3DHYA 1Y8CA 1U5AA 4N3CA 4EI9A 5JAIA 2YCBA 2JFXA 1C7RA 4F93B 3LS2A 4C22A 2ZUWA 5ES4B 3BMCB 1A2BA 4R6WA 1YR2A 2Y0BA 3SF0A 4Q15A 2JLCA 4GEGA 4AECA 5K3OA 2RG7A 1EQAA 2XCSB 2F2TA 3CEMA 1AGXA 1MOSA 1RR6A 2XNSA 3HXPA 2V6GA 1YKSA 2WF5A 2X9GA 3AWIA 3BJMA 4FMPA 4WNAA 2P11A 1BHJA 1N0WA 3WVNA 3G2KA 5MHTA 3OQ6A 1JU3A 1MAWA 2AKAB 1CUBA 2WVGA 1Q7CA 2XWJI 3K53A 3KFXA 3DBLB 4H1TA 4DCCA 4WUVA 5LJIA 3DDWA 5AIAA 4U7DA 1GVNB 1Y37A 4NZNA 1GTSA 5KWIA 4CF5A 5BSFA 1FA9A 4RC9A 1XMOB 2ZTMA 1KIMA 3OFNA 4XR4A 3W05A 5M04A 1ZVQA 3DL2A 3T1OA 1R0WA 1XJ0A 3D3JA 2OO5A 2D7CA 4P4GA 1D5CA 1P31A 3PDWA 1RTTA 2GQ0A 4OMDA 4RY8A 2EKDA 1X7XA 1T4GA 3PQ5A 1ST2A 4JITA 4X64B 1XQ1A 3UG7A 3THXA 4FN4A 4DXDA 1I1QB 3EPRA 3GFGA 3M3DA 4I1UA 1EVYA 3KJQA 3CHYA 1GD1O 5BVHB 2PLNA 4AJKA 3B3FA 4TKUA 3DLHA 2OLKA 2C2KA 3D8BA 2Z2JA 2G1AA 3EJWA 4IILA 1A7KA 5FA6A 3IQWA 4GE0A 1KOJA 3EIFA 1DARA 1JDUA 3H11A 5JCZA 2OBFA 5IJ9B 4Q1AA 2V7VA 2WF9A 1ZBQA 3QJGA 1BQ4A 1Y89A 2CL0X 2OC9A 2NXJA 1FRVA 3E0QA 3MOSA 4GSKA 4LFAB 4ETWA 2ZIXB 3C8UA 2PLRA 4IGEA 2RK3A 4CT4B 4M54A 9GPBA 1QTRA 2HHCA 1YZGA 1P3JA 2REOA 2GRAA 1C4KA 1JG2A 1KYTA 2JJ2D 3CUTA 4TQUS 4BO3A 3ILYA 2AJTA 3JALA 3NHUA 2C4KA 1S7GA 2V5UA 3EMKA 4IFTA 2ZIZA 1ZD8A 3EXG1 3I6MA 3IHKA 4GM0A 4MUMA 3JWEA 4QUDA 3WKAA 2F1OA 2W48A 4DJEC 1RRKA 3E3OA 1B93A 5COQA 3QFCA 4WK2B 4YLEA 2MSDB 3H6GA 3WBJA 2HV9A 5BMVA 3FNQA 4M0UA 4JH0A 1PZNA 2KLBA 2QTWB 2Y92A 1EFTA 4MKZA 1ZD3A 5EPEA 2W6ZA 4HZUB 4O4HB 1HXHA 2V0CA 1OIWA 5HIIA 1J0DA 2RBGA 2P30A 3EGOA 3LWDA 2XYVA 3KXIA 2A9QA 1WDKA 5ESRA 1EK2A 4CM9D 2G5GX 3TOSA 1UWLA 4DNQA 3P32A 2GARA 2VH1A 2YWEA 4QVGA 1BCSA 1RC1A 2KBEA 2GI4A 3BJZA 4R3NA 4CKCA 2WE8A 4KB5A 4NMWA 4S05A 2Y1EA 4MO9A 1CVLA 1FDRA 3E5NA 5T6BA 2BEUA 2AI2A 5JAQA 5HTOA 4HUTA 4BC1A 5BVGA 2F1IA 4LE2A 3DMPA 2I8LA 2B37A 1AO0A 1T26A 3REOA 2GN8A 3RFTA 1PT6A 3MK31 1E8MA 4FGZA 2RAFA 5E6SA 1YS2X 4M9RA 2E9SA 1XVLA 1MOPA 1Z5WA 3PHLA 2QTBA 2R6DA 3KOYA 7REQB 4J4TA 3EQ2A 3L3BA 3RK4A 1ATZA 1OTHA 4MS3B 5C52B 2HIHA 2ACVA 4W1PA 1L7BA 1G6Q1 1E6WA 2QAIA 3QE9Y 2IELA 3DZFA 3V4RA 2ADOA 3JAKA 3GROA 1XUOA 2FE4A 4NAVA 5K01A 2DULA 1Q7EA 2C92A 3GJ8A 3MJDA 3SLKA 1IMJA 1GFSA 2D8MA 2ZBVA 3QOFA 3GRPA 2F43B 2ZI7A 1UKEA 2QB5A 4X8MA 3ROPA 4BO1A 4BUJA 4ENPA 3CUEF 2A0KA 2GPJA 1T4MA 4IV5A 3HJNA 3HSSA 4TWAA 1QFXA 2O59A 2JDIA 1UPAA 2FQXA 4TYPA 4E09A 3MTQA 3I2HA 2GFHA 3M4ZA 3C6YA 4GZ5A 4MTLA 2EJWA 1OU0A 3DCNA 4BAUA 4NFSA 5BPFA 5JR3A 4JBWA 3KUUA 4UAVA 5FFFA 2CHEA 3T7DA 4L7VA 2WZBA 2ADMA 3BXGA 3KYJB 3OM0A 1N92A 3P7MA 4RD1A 3RPEA 3DH0A 1R8YA 3CMCO 4PQEA 1J0EA 4RZ2A 1N1EA 4M8IA 1UM9B 4B3XA 2XKAA 3SR3A 5K45A 3OX2A 2Z4RA 3S8MA 5KNDH 5AKZA 3D3NA 4P2GA 2N0SA 3NT2A 3GVPA 4R40A 2WINI 3PEWA 5EHNA 1E6LA 3WP1B 1PHRA 4PY2A 1IDOA 1PL8A 3GQVA 1VB3A 3LQKA 2Q0QA 2ZRMA 4HPJB 4RVDA 3B6EA 1BMDA 1P33A 4C0HA 5CP8A 3BA1A 3A36A 1UMCB 1EFCA 4QTZA 3TQCA 3V4SA 3G2OA 2WOOA 4L8FA 4A16A 1UBCA 3BTOA 4ZJPA 1GSHA 1YBFA 3GCZA 5H80A 3ZR4B 4L0QA 2ZSBA 1JF8A 4F9GA 3S7ZA 4HVAA 4BX8A 3AEUB 4AZSA 4B3JA 5IC4A 4IG9A 4JHLA 1ZJYA 3R9IA 4ZT5A 1YS4A 1M3SA 2ORWA 2ZBGA 3JTEA 4XIFA 3I8XA 4MVJI 4WKOA 3SHFA 13PKA 3COJA 3QPCA 4CI0B 4BLUA 3UA3A 3I42A 3I1YA 2Z5FA 4OTZA 5EJGA 4AO6A 1SJ9A 2AN9A 2FPIB 4ZOLB 3HSYA 3FUWA 4RIGA 4DGSA 5KPJA 5J2TB 2Y9MB 1E2BA 4LRWA 4LYJA 3DHVA 3VR5A 3QEKA 1A9ZA 3C1TA 3M6XA 2W7TA 3ZIAD 5HMLA 3K3PA 3EULA 1YZVA 4DLSA 1YCGA 1Q1NA 5CIQA 3IT1A 3WK4A 1X2EA 2X77A 4JGIA 3PKIA 2ZAGA 4JI5B 1JLSA 1HT1E 3M3HA 1M2FA 4WCVA 2ZJ4A 1Y6ZA 4BV8A 4LNHA 1J8QA 2H1OA 4I8DA 2ERYA 2C7VA 2JIPA 3EA0A 3GJ4A 3D6VA 5ITSA 3H97A 3W7VA 1E2GA 4MUKA 4IOJA 4R1TA 4S24A 3QE0A 4I4LA 3LT1A 3A9SA 3CBQA 4LDJA 4RDCA 3G7UA 5DHUA 2CSUA 1GFWA 2NZ2A 4L1KA 4Q3LA 3RARA 4ALIA 5AVZA 1RM0A 3REQB 2XH8A 4NENA 3USZA 4LHZA 4B87A 2VPZA 1FP1D 1HT3A 3LMKA 1YASA 4BEBA 4LW8A 2O8EB 2J32A 4DMCA 5CB4F 3RVQA 1RAHA 4FVTA 2R5WA 1V9CA 2FSSA 1G4AE 5J1SB 4A2WA 1NVBA 2FRDC 2PQ0A 4FDVA 1QNLA 2PGOA 2ZAYA 4RGYA 4XB6B 4NBRA 3ZW8A 3COPA 2ANCA 3H9GA 3MMXA 2CWWA 1Y1KE 4LHEA 1D6MA 1TKBA 1M0SA 2YW2A 5B3JA 3QX3A 1W4CA 5LDGA 4WASA 1C8KA 3BFKA 2XITA 4LKRA 1NOIA 2P5TB 3GB9A 3OIGA 5IVPA 3AFHA 1O0CA 2FPLA 4LRYA 1I7SB 4E2FA 2OY0A 4TS1A 1QFMA 5A4JA 2K5UA 5TQ2A 2CE2X 4XW2A 5B6IA 1YMQA 2ZSJA 3LVQE 4QU9A 1EXNA 4CL2A 4JEMA 1UR5A 1E2MA 4QLOA 3TQFA 5IT5A 2CLEB 2E3JA 3KWMA 3NWOA 2QD5A 1TLLA 2DTEA 2HI0A 3F5QA 1OLUA 4D9EA 3KEQA 4D6XA 1AGPA 1VIYA 3NRJA 1SCAA 3LUHA 4I4TB 5I7SA 1CUUA 3GDHA 3M9WA 2HD4A 3WSVA 1FTQA 4X3OA 1SQ5A 1XI2A 1BZYA 2IYQA 5FWXB 4CBVA 1GYRA 2DHQA 3X1DA 4FJ0A 2ZBQA 3M2PA 3NM5A 4HUQA 2L0XA 3CS3A 4LJKA 1M83A 4YCLA 3LPNA 1MC8A 1QQBA 4RTJA 2ZK7A 4ARUA 5DEOA 2HMSA 5EINA 5B1HA 4DIDA 1NN3A 1UBRS 4C5BA 4YRMA 3VAYA 3P4UA 1T24A 1I3CA 1DWUA 1WS6A 4M9ZA 4NU6A 3WYBA 3ZTTA 5BSEA 5H59A 1PFWA 1JIIA 3LHIA 5DHFA 1DDIA 3G13A 1RHUA 3OOWA 3K6SA 4IXTA 5H02A 1Y9EA 1TIPA 4L02A 4WBSA 3EFOB 2OP0A 3C97A 4BQSA 6ABPA 5HILA 1FMCA 3VNQA 3W8DA 1IMOA 5AKEA 2ZWVA 1G21B 3ERCA 4H1WA 2J3JA 2Z2YA 5CMLA 2RHCA 1HYBA 4PIVA 1U0RA 2V9PA 1ULUA 3M5DA 4WCFA 3HLTA 3RS2A 3I04A 3LKVA 3OSUA 4II3A 1GQRA 3HRKA 4CCAA 1ZGZA 3QX8A 2J0SA 4XTRA 3M1LA 5CFOA 2PKWA 4GL4A 1DUIA 1ECCA 2Q49A 5IARA 1I6WA 3M5CA 5J3JA 4Z4EA 3PG5A 4U7PB 3O26A 3VPCA 1ZY2A 5KINB 1HT0A 4L4ZA 1DBVO 2H59A 2H6EA 3TJMA 3C7KA 3BGWA 4KWIA 8ABPA 3MBIA 2JNWA 1H1LB 3O8OB 4DE5A 1U3FA 1JEYB 3THYA 1KA9H 2C4TA 5GVSA 1W46A 1Q91A 2EBWA 2O0LA 3CE9A 3KQMA 4YJ2A 3JRNA 2RGBA 2BIFA 3PNYA 4EG5A 1T43A 2C0QA 4R83A 2Q5HA 4DDTA 5JHGB 3B2QA 4BNXA 1W8IA 1T3SA 1XRRA 1Z6XA 2F8MA 3FGPA 2GCPA 1FFWA 2F7SA 2AT1A 3CZQA 3M82A 2A8YA 4Q82A 3B3AA 1DLIA 5LZ2A 1JHXA 3F7NA 1FC0A 2X3FA 4W5NA 4TYYA 2JFOA 2YDXA 3TM5A 4MK4A 5K8CA 1GU7A 5JARA 5LU8A 5HMMA 1XKTA 4O08A 4MI6A 1L5QA 2WA1A 1LTQA 4DKJA 1GTMA 2QF7A 5IH3A 5AK3A 3LCRA 5C1PA 2QVGA 1AV6A 1DAKA 3HDHA 3BZWA 2VP2A 3DMHA 3JAWA 4LJAA 1Z0AA 4MJ7A 2IPMA 1NYRA 4LA4A 4GW3A 4DLKA 2QGZA 1Z7WA 3M6AA 1V47A 5DI3A 1BCRB 4WHMA 3WRYA 2ZBPA 4FWIB 1TMYA 2HQSA 2JLZA 1AF4A 5LZ8A 5BY2A 2IPNA 2ECOA 4QTTB 3TR6A 1DIBA 1ZK3A 2WE7A 2WFLA 4JLDA 2ZJYA 2G7MC 3R76A 2VHYA 4MAMA 2C2XA 5L3VA 1WXHA 1JS1X 3BPSA 2HU2A 5FOSA 1E0SA 1F2VA 4B44A 3NM4A 5COAA 2AD1A 5KVSA 1JQJC 4M99A 1PR6A 1K88A 1WB9A 3SJ7A 2AK3A 2YJ5A 2AUNA 3WK9A 2B35A 4WVFA 3ZZTA 4RTSA 2EW1A 5CEJA 3ZJUA 1PEAA 2F3QA 2J5BA 1BFUA 2WC1A 3C98A 3IOCA 3JASA 4LUCA 3JQPA 4TRMA 1N2CA 3VDRA 2H2GA 1U28C 1WP4A 3D8SA 5J5AA 3TBKA 4ETMA 1D6NA 2QWXA 2EJTA 1JHRA 3TRFA 4Z7OB 2PS9A 4IHJB 2WYOA 2GZSA 3AM5A 3DR3A 3F78A 4EJ2A 1Y82A 3NDJA 2FQ1A 2W0SA 2E4UA 2BFWA 3AEQB 4FKBA 5LZ9A 1HBJA 1EBBA 8GPBA 5IPFA 4L5AA 5BOSA 1EE2A 3ZU3A 5J43A 1A71A 2QD1A 3H83A 1UINA 1QYDA 4BQOA 2PH7A 4HZGA 4AF8A 5BSUA 1YBMA 1U9ZA 1YRQA 2C5LA 2GLXA 4J8PA 4MDYA 4RHFA 5BQPA 3UGTA 1W0KD 2CHQA 3WRVA 3JQCA 1EGHA 1YR7A 5KDDA 2TMKA 4X62B 1BNCA 3EA5A 3OLQA 3AB3A 4FEYA 2NUTA 4Q3DA 3G2LA 3MQ2A 1SR8A 1KO8A 2GJ9A 3R7SA 5F2NA 5HRCA 1L8LA 1ZRNA 3R0IA 4CIVA 4I2NA 4UNQA 1EUCA 1WDMA 3U7EB 1ONNA 3O0TA 4EARA 2I2CA 3DWFA 3MWEA 3ND5A 3T5MA 1FRQA 1XYVA 4BV2A 1ZI9A 1JPJA 2PWYA 3ANTA 4P35A 4C0XA 3B1KA 1E3JA 4O5AA 2VYFA 3OTQA 4RWZA 3ABIA 3Q7TA 3F49S 3QFFA 4FINA 4KAAA 1XZMA 5JVDA 4EM6A 3LBNA 1EFVB 1YBAA 2GZAA 3AW9A 4PLVA 3ZDRA 1ULHA 4KYUA 4QTYA 5JYDA 4N18A 4KPEC 3MMPA 1KMIY 1SIWA 1T3ZA 2CNLA 4PXAA 3FDIA 2A1IA 2CNKA 4I55F 2Y67A 1M1NB 3UGQA 4E32A 2SCUB 2XT9A 3E5HA 4NNJA 4W6QA 2B61A 4RD4A 4MX8A 4G89A 2HREA 1PQUA 5D1NA 2WMNB 1ODLA 2JGRA 3S2SA 1YRWA 3IE2A 4O29A 1NP6A 4ZV7A 2CVQA 3KZMA 4XDYA 5JQWA 3BUSA 3LUKA 4QEDA 4RLHA 3ICCA 5EJMA 3LL7A 1HH4A 2QT9A 4G4GA 1KO7A 4BS9A 4MCAA 1IULA 3R8CA 4HB0A 5CGQB 2K7FA 3IESA 2P6PA 1MV8A 2PAAA 3CRZA 4P82A 5E6UB 3IVAA 2C00A 4Z9FA 3PQ2A 1T10A 5T8KC 5B7NA 5I48A 1TM5E 2H48A 3IPCA 1O1YA 1N5OX 2FZ4A 3AZPA 4I5FA 4HDQB 4J49A 1J8DA 4WAUA 3VAZA 5JS7A 1X7WB 4C7OA 2D59A 1YB6A 2F4VB 4OEHA 1BGWA 3DVSX 4IH9A 4CCYB 4RIIA 3LDGA 2OAP1 2ZBDA 3L4BC 4P2BA 1D0IA 3RUDA 2I2BA 3ONVA 2O2IA 3OOJA 4MUBA 4TROA 5F23A 1VSQA 4IDDA 3KUDA 1T0JB 2I99A 4PQYA 3D3KA 3HHEA 3FWPA 1NI4B 1SULA 1A9XB 2FSHA 1VL1A 1DC5A 1IIRA 1M1YA 3GQBA 3OJLA 4YR7A 3QY9A 2P1RA 3DYBA 3L8GA 3JCZA 4M86A 1B14A 2JHCA 4LYHA 3C8DA 4DF3A 4GKBA 1S9HA 3FDZA 2V7QA 4LC9A 2D00A 2VQSA 3ETJA 1E3QA 5ED0A 5KJ1A 5EFZA 1ZSYA 4HT3B 2F8SA 5JSFA 2C3YA 2HZ7A 4YH1A 1P4AA 1N1GA 2BN4A 4HN2A 1QQ7A 4GIBA 1YR6A 2YNMA 4KKVA 3OM8A 4KAXA 3ZHRA 3SFVA 3LE8A 2FYTA 1D04A 4XXHA 5LB2A 4JP2A 2ZYRA 1N7HA 2RONA 3KT6A 2WD9A 3VAAA 4CUJA 3PRYA 4Q24A 1TA0A 3WICA 1NMZA 4KP7A 5JAPA 4WXYB 3WA6A 1L5HA 3HO8A 4P38A 1TA9A 2PD4A 2O50A 3A1NA 3DPUA 3PX2A 4AY5A 4L3VA 2VYND 4LOLA 1F8FA 2IZZA 5T3UA 1A96A 2FQYA 2P9JA 2WIJA 1KMCA 2I65A 5CVDA 5TMDA 5LNK1 4NPAA 5LP6B 1M7GA 4ZRNA 3BDIA 1EB8A 5KTSA 1W8DA 3AUTA 3LRTA 4I19A 5JJIA 3BL8A 1VLMA 1IQPA 4MNTA 3WGGA 2GF0A 3I5UA 4QT0A 5TNXA 4ZI2A 1SCIA 2Z56A 4CM4A 1SCJA 1W581 4RKWA 5CXUA 2CYAA 4LE1A 5EXEA 3RTCA 2NU9A 4WWHA 4V0LA 1P7YA 2BGUA 2GJ4A 1FZTA 2OK7A 1M8PA 1KL7A 2XKKA 3NNDA 1P5FA 3HUUA 4NESA 3DLAA 3RIYA 1ZN8A 3OOYA 4D2IA 1LWOA 4H7JA 2PU5A 3E6AA 4X1KB 3WGUA 4J16C 4KIUA 3WQSB 3M1YA 3BMQA 4FTWA 1QO9A 4IDHA 1XXHB 4N0PA 3IVGA 4ND8A 2YRWA 4PYKA 2O2ZA 4XJVA 3SC3A 4O63O 2XGOA 3EZ2A 1X86B 5EZQA 1REQA 5KOIA 3G82C 4BO8A 5BWMA 2GCEA 1M6YA 2QTFA 2EDCA 2VKQA 2IH5A 1I5RA 4HAWA 4WZAA 2DWOA 3D1VA 3B2NA 4AMZA 1H6BA 2AC2A 4X1OA 5JXGA 4R31A 1Y4SA 4RIFA 2A78A 4PYIA 4J0FA 3RT7A 3S68A 4JA0A 5F5LA 3BQMB 3O4IA 6Q21A 2SBTA 1V7PC 5T8KA 4QPNA 1XNRB 3TMYA 2GJSA 3HVJA 4UTNA 1MC4A 1J56A 2Q5CA 3KDPA 4G5XA 2G83A 4JODA 4KVGA 3ZPXA 4BXOB 3H2JA 5EMKA 3VPSA 3PD0A 1SVUA 1KY2A 4NE2A 1XZEA 3BIJA 1N0VC 4ZV4A 4DV7B 1W4ZA 2B36A 1S2IA 4KQWA 3QWIA 2Z98A 5BQOA 1H0HA 2QK4A 5AVJA 3ZWWA 1Z08A 4B3MB 3TQSA 4AJLA 3T9AA 4JAVC 2QX9A 1T25A 1D7OA 1SVNA 2RAUA 3EC2A 4V38A 4XRRA 1IOZA 2BISA 4GYYA 5H5JA 3B38A 4EFDA 1PKXA 3RC8A 2O19A 1TECE 2P2YA 1F5NA 3SIWA 2B9VA 3VR3D 4ERXA 1JLMA 2C95A 3TUZC 1XNQB 3DAOA 3KKQA 1S89A 4M0PA 4V2IA 3EEOA 5ER6A 1GPNA 1Z35A 2YINC 4YJHB 1QLWA 4CEIA 1ZL0A 1FFXA 4TTQA 2FK8A 4XA8A 3MXOA 2QS9A 5I9BA 4H7FA 3C5EA 3ZZ0A 1GGFA 1XEFA 2I7VA 4JL6A 1KYXA 4LV8B 1G0NA 2DFNA 2OHJA 4NOMA 1DWQA 2H1SA 1RKVA 1VM6A 4FEEA 2P77A 3KG2A 4ZVQA 4B40A 2GWRA 1B0UA 4LQLA 1X7DA 4G5SA 4K9OA 5EZYB 5GJCA 2O2YA 3V1NA 1Z16A 3PF9A 2RGEA 3AHEA 5CUQA 4AL4A 1CQXA 2XB6A 5AVYA 1RW4A 5AI4A 1PW7A 2DSNA 2HQRA 3GJ0A 4FYXA 4H3SA 1CQPA 1EVLA 2WD8A 4MARA 2WSMA 3FI9A 5K8LA 4DUYB 4RX1A 2J33A 5AW5A 2POQX 5KAPA 3H7AA 1E3LA 1G20A 2HSGA 1KKMA 1U0LA 4NI5A 3C3XA 2VPTA 3QXGA 5JNRA 1RQXA 3QHAA 4J0CA 3TWOA 3W8NA 2QNRA 4L5YA 5LCXA 3O4FA 2DVMA 1O94C 3HKDB 4F8EA 3PZRA 4I1RA 3MRSA 2FZCA 1KSGA 4J16A 1F20A 4OBBA 3F71A 4XD7D 3IV7A 4POAA 4TVBA 2XNKA 4XDZA 5IW8A 5PNTA 1XCOA 1QMGA 2AJBA 1W9HA 4LBWA 1JQKA 1PT7A 1UMDB 2ZRJA 3BKWA 2OP1A 4OLFA 3GT3A 3L2OB 4HH4A 5BMVF 4R05A 4WESA 1K0UA 4P5PA 3L84A 4KWCA 2YH2A 4JGBA 1IJFA 4LRUA 1G5RA 2EJUA 2OR3A 4ZVPA 2IDMA 5CHEA 2G06A 2OYRA 2BMEA 3I83A 3VYRB 2IPOA 4QX6A 1CX9B 1Y4ZA 2P35A 3IEIA 4XJSA 4KXXA 5CVCA 3VHQA 3ZDAA 2JKZA 2CJPA 2FFAA 2HDWA 4UUOA 3UA4A 1U2RA 1IEQA 1HMYA 1D2NA 4KIJA 4S2UA 4M1MA 1EK5A 2GPYA 1RSZA 4CDGA 1HKHA 4GS5A 4UNRA 5I7HA 5EIFA 2IBSA 5F5NA 1CJUC 5A5EA 1JA1A 3AL0C 1G291 1YCDA 4KQ1A 3H5LA 1SIUA 5KKCA 5I9SA 1T4CB 1J7KA 2OZEA 3KR2A 3MNFA 3W8RA 1YA8A 3BORA 6REQB 1JNXX 4UCWA 1FLVA 4F5YA 3UGJA 2W2LA 1DKMA 3T3HA 1GXSA 1I14A 3HA7A 4B82A 4H4CA 1KARA 2NV6A 2W6PA 1Z2OX 2BKAA 3O1LA 3OUZA 2P6OA 2C59A 3H9EO 1QV7A 4MPTA 4UUAA 2QRUA 5T67A 3EARA 1K89A 3HP7A 3C4VA 3HGTA 5JZ9A 1ESMA 1XAHA 5IC6A 3NEPX 1MQSA 2QJOA 4MQUA 1U1CA 5I4BA 3A7DA 4MGHA 7MDHA 3E1SA 4AQ7A 5C5CA 1KXZA 1N34B 2CGEA 2ZPUA 2HX1A 3KYCA 1L4KA 4R51A 4KPYA 1WZUA 4GQAA 1QYIA 1VDZA 4QT4A 4UNIA 5EY5B 1JG6A 2WPDA 4M2LA 3UJBA 4JP8A 1IY0A 4JKOA 1CK4A 1T13A 2QYTA 3QXJA 2Z08A 4J0JA 4MMXB 5EQJB 4CKBA 5BWOA 2O3RA 5JXIA 2OMEA 4ECEA 2JLVA 4L27A 5L45A 4RD0A 2CLSA 4C6SA 3KAJA 1DX9A 3T7SA 1H8HA 2XYPA 4R2IA 1G8SA 2ARKA 2GPBA 3BMNB 3WQRA 3K0SA 2FPSA 5GZ1A 5JZMA 1XPRA 1NBME 5JJBA 1K5GA 1XN4A 2QLFA 4GOMD 4RK6A 4GP7A 2WPNA 2LTAA 3AKCA 2OXCA 1FOEB 4M38A 3TZCA 3G3EA 1N6RA 3RVMA 3WLRA 4AK9A 2TMGA 1XQXA 4MWSA 4ZYTA 1KWGA 4JYZA 4PE5B 5AUQA 3LM8A 3WYGA 5DT2A 3TW8A 4TKVA 1Z6PA 2KBFA 4R7TA 4M89A 2HMYB 1GN8A 2ZS7A 4N5IX 3TYXA 2YQ5A 3E7PA 4ZEXA 1OFUX 4YAOA 1O94A 2FR1A 2GCIA 3CPJB 3EVAA 3BA6A 4NCHA 5FOQA 4NCNA 5AKGA 2BP7B 1T5SA 2GBLA 2WYVA 4U2DA 1VKZA 2BCGY 4R5HA 3RE1A 2V1XA 1UBJS 3WIEA 1TM3E 1NLFA 2VTDA 3DXFA 3GJSA 4OOFA 5CA0A 1QP4A 1K2WA 1FVHA 1KJ8A 1SAYA 1XD8A 3DS8A 3T7IA 4MH0R 1F3OA 1ZDMA 3AHFA 4LHYA 3ZX4A 1GPKA 3PQDA 4EY7A 1EVJA 2P6UA 3DEFA 4TTAA 3ZCPA 5AVRA 4E94A 4I9UA 2HA2A 1R6XA 1OKKD 2Z6QA 3OSZA 3AEXA 3TZBA 4L7QA 2P8JA 1DV1A 3FYUB 3RJTA 2WJJA 4E5DA 5F1OA 4YXWA 1UQRA 3EEIA 1WW2A 3QELA 2X0DA 4IR7A 4OHBA 4E21A 5ADHA 2ZG6A 4X7PA 5EQTA 1VMAA 2DWPA 3NAGA 1LEHA 4NTZA 1SRRA 5EP2A 3CFYA 4INZA 4J7XA 3PNQA 3T61A 3VKVA 3SXUB 1QIMA 5JQGA 1YRAA 1H2XA 1JKFA 4FKZA 3KB8A 3CY6A 5NULA 1FW6A 2DJ5A 5AHXA 4CMEC 3WLEA 1QUFA 3TLYA 4GZLA 4KN5A 1F0PA 2Z4TA 2PUAA 1SNYA 4X41A 4DQLA 1UWVA 4REOA 4EPXA 2FPMA 1U0SY 3HDTA 5IDVA 2Q9AA 4ZHQF 1FYWA 5AJVB 4ZICA 4V0KA 5SYNA 1GNQA 1JHVA 5DVZA 2J9GA 2ZVDA 3LLSA 3PJEA 4LJ9A 1N8SA 4BKUA 5ED4A 4IIBA 1K3FA 4PAGA 1RCUA 1P9RA 2DTXA 1AURA 1E9VA 3AUFA 2B4QA 2C8JA 5I9MA 4C4SA 4MW9A 4N8EA 4MUAA 3CSUA 1XPUA 3FKSD 1CBUA 1M7HA 3LUCA 3WWCA 2XOEA 3BRSA 2HIGA 3OFKA 1U1GA 2ROQA 3VU9B 1QG6A 5FFMA 3WHKA 2ZSFA 1FFGA 3K9CA 4IX1A 3WMXA 1A72A 2B4TO 3IH5A 3O8QA 2YVLA 2GLUA 1XFAA 2YJNA 3AKDA 3RRFA 4BL5A 4BKPA 1H1DA 3DE5X 4J0DA 3VSBA 3LHSA 5A0FA 1ECJA 3GXOA 4CQLB 4J7UA 4UAUA 1CY6A 2VA9A 3IE1A 4P0QB 1OLXA 3ZWOA 1TUBA 1UBTS 2BMAA 2JJ1A 3IAFA 4KHZA 3AO0B 1J70A 3MRTA 1YDGA 3OFJA 4P84A 3PXGA 4PIPA 4MVJP 5BN4B 1BROA 4PGFA 1LCIA 4OMFG 1A95A 5BSKA 2QUJA 2QHXA 4J1NA 2VUSA 2E1RA 2P91A 4KLRA 4LGCA 4W5OA 4UDXX 5HCUA 2EVWX 5FCDA 1P0CA 3TD9A 4F2HA 2XIQA 1S3FA 4FE3A 1E4YA 1Q6ZA 1PRYA 4HGNA 5BWCA 1KRHA 4NCJA 4KV9A 3OEHD 4EVSA 4MJXA 2JHFA 3BXHA 1OZAA 2PUFA 2RGXA 4QARA 4ZTBA 1ID8A 3W6OA 3IP5A 5GAJA 2XMPA 2PWPA 1V16A 1NC3A 2O4UX 4L95C 1KQOA 4HMOA 4ARCA 4MYSA 3FAKA 4F7WA 4G0NA 3CZCA 1Y7HA 1UKCA 4C0KA 3MGCA 3WHPA 4NQRA 4L6CA 4OI4A 4B0PA 3QITA 4R6XA 1KDRA 2BVNA 5JWRA 3I39X 2VUIB 2WW8A 3HI6A 4LJYA 1ZJWA 3K6KA 1OU4A 5T6MA 4YFYA 2AE1A 1Z4NA 1MT3A 3OJWA 1A1SA 2C7BA 2QRNA 3I5XA 3C45A 4ZZIA 3EGXB 4HB2A 4L4XA 3MTEA 3U7QA 3KU1A 2ST1A 4BVLA 3RUFA 1BKYA 3SQNA 4IHQA 1E3WB 2ETXA 1AUOA 2PRYA 4KL8S 3TI9A 2PS1A 1HNNA 1ULBA 1M6EX 2MYTA 3Q8WA 2P9TA 5L51A 4K9PA 1I2DA 3RDPA 3RREA 1OBVA 5KYWA 4IL5A 4WXEA 4BNZA 4LECA 2I5PO 1W96A 1PKEA 1UOQA 2GDJA 3GAMA 3L1UA 1WU8A 4YWJA 3IEPA 3W6UA