2NU7A

C123as mutant of e. coli succinyl-coa synthetase
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
287
structure length
287
Chain Sequence
SILIDKNTKVICQGFTGSQGTFHSEQAIAYGTKMVGGVTPGKGGTTHLGLPVFNTVREAVAATGATASVIYVPAPFCKDSILEAIDAGIKLIITITEGIPTLDMLTVKVKLDEAGVRMIGPNSPGVITPGECKIGIQPGHIHKPGKVGIVSRSGTLTYEAVKQTTDYGFGQSTCVGIGGDPIPGSNFIDILEMFEKDPQTEAIVMIGEIGGSAEEEAAAYIKEHVTKPVVGYIAGVTAPKGKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGEALKTVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinyl-CoA ligase [ADP-forming] subunit alpha
publication title Participation of Cys 123alpha of Escherichia coli Succinyl-CoA Synthetase in Catalysis
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ligase
total genus 108
structure length 287
sequence length 287
chains with identical sequence D
ec nomenclature ec 6.2.1.5: Succinate--CoA ligase (ADP-forming).
pdb deposition date 2006-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00549 Ligase_CoA CoA-ligase
A PF02629 CoA_binding CoA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 2nu7A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2nu7A01
1LSOA 2ZQYA 2PZMA 2I3AA 3FNFA 5DN9A 1XSEA 3GDOA 3PLRA 3PZRA 5DULA 3JD3A 5JNLA 1DIBA 1OBFO 4Q39A 1KETA 2X5OA 5CG2A 1DIRA 3PQDA 4D3DA 1PR3A 2PGJA 3I1JA 4CM8A 2GCGA 2BHLA 5G4KB 4E5NA 2B83A 4M54A 2JCYA 1MUUA 1E6UA 1P1JA 2FHSA 1B16A 4YVFA 4YBZA 2PA3A 1NAHA 3OF2A 1PGJA 4WASA 7MDHA 1FXSA 4YRDA 4D45A 5ILGA 4FQ8A 1D7OA 1IE3A 1MP0A 1Q2XA 2Z1MA 1Q0QA 4XX0A 4MVJP 1M67A 2B37A 5HS4A 2Q3EA 2IRWA 1IZ9A 3PIDA 1QSGA 4CV3A 1VL0A 3AM4A 4LN1A 4RVSA 1M76A 4J4HA 4MP3A 5JXWA 2CDBA 4LRTB 1LC0A 1I30A 4PLGA 4WECA 2UAGA 3BTOA 4CM9A 1A5ZA 3B1KA 4FOOA 4CM4A 5ICMA 5EPOA 2WE7A 1NAIA 2I3GA 4FFNA 2X9GA 3CINA 4M86A 4XYLA 1MXFA 3OH8A 4RF4A 4YEDA 2C2XA 3BHJA 4GX2A 1UDAA 2Q99A 4ND2A 4PLZA 3ZWCA 1U4OA 4GKBA 2B4TO 4Q3EA 3S2EA 5TJHA 1Y8QA 5DNAA 1B15A 4LISA 3KYCA 4YR9A 3VH4A 4IDGA 4TKLA 5DOVA 2BF7A 3TL2A 3MTGA 1DFGA 4MVJM 2A94A 4AJNA 3KSDO 3Q1LA 4D3SA 1NWCA 1BWSA 2H6EA 2X5JO 4E2WA 4YAKA 3SJ7A 3STHA 4BNMA 4FGSA 5IJZA 3AW9A 4TRJA 4CLOB 3NGLA 3MJ4A 4WKGA 3ZHXA 5BSGA 1HYEA 2YFQA 2OZPA 3GNTA 1EK5A 4WNCA 3V8BA 1G0OA 4A7PA 3UFXB 4WCFC 2V7PA 5DP1A 3DBHA 4PRKA 5B4TA 3M2TA 3DAGA 1EQ2A 5ENDA 3GLQA 2HMSA 2Q46A 3FPLA 5T57A 3ZNOA 2HQ1A 3VH2A 3QSGA 3QWHA 4DQUA 3W6UA 3FWZA 2EGHA 4NFHA 2EP7A 4M49A 2J3HA 4A2CA 4BNZA 1SZJG 3TWOA 3D7LA 3OQ1A 1ISHA 4L9RA 3RU7A 1GQQA 4OQZA 4ZGWA 3TZKA 3DOCA 1I32A 1AHHA 5AOVA 5MDHA 4JXKA 4QX6A 3VH1A 1TT5B 3E03A 1YWGO 2V6BA 3PXXA 3UH1A 3AM3A 3JQFC 2W2KB 3I6QA 4J6FA 3WQSB 4HADA 3PYMA 5T64A 2WE8A 4JJIA 1ZCJA 4LVUA 1QYWA 1P1HA 3I9NA 4JJFA 4UVIA 2AXQA 2RH8A 3EZLA 4LSMA 3T7CA 4IDBA 5TF4A 3UKOA 4NK4A 4IJUA 1T25A 1WVGA 3RIHA 3TZHA 2Q49A 4FFOA 4R3WA 3JTMA 1E3LA 5DCUA 3BMQA 3DR3A 1Z45A 1VC2A 4J2HA 4UEKA 3JQ9C 3JQGA 2DPGA 1HYHA 1YBVA 2WYUA 3LVFO 3MWDA 2VTEA 5JDCA 1EUZA 5KOIA 2R2GA 4D44A 1JVBA 1TI7A 3D3EA 1EDZA 1CIVA 2PK3A 3TSCA 2IDZA 3TPCA 3HDJA 4BB5A 4B4WA 2AG5A 3O4RA 2VHYA 2NQTA 2NSDA 3K30A 3RQSA 3ZWMA 5H83A 2P5UA 3RFTA 5A06A 3VTFA 3NTRA 2C2YA 4IY1A 2NU8B 1E3WA 1ADGA 4OXKA 2FPIA 4K28A 3VPGA 3PHHA 1NWHA 4B4UA 1X0VA 2PD6A 5G0SA 4OM8A 3A9WA 4ND1A 3KLMX 4CLDA 2C5AA 4DQXA 5JAZA 2X1HA 3NX4A 4QT0A 5GZ3A 4YTEA 5DBGA 4WLFA 4R3NA 5FEUA 5JC8A 3IUSA 1EVJA 3GVHA 3SEFA 3RASA 1E7MA 4WGGA 1J0XO 3QVWA 1RM4A 3FRJA 4JBGA 1NFFA 1JWAB 1XQ6A 4QQRA 1PWXA 4HNHA 3V2HA 1YKFA 3PHLA 5DT9A 5KJ6A 4GSLA 3GEMA 3GN1A 3JSAA 3VPFA 4QUKA 2NV6A 1U3WA 1PX0A 3EVNA 5JPIA 3A06A 3ASVA 1Y5MA 5A1TA 1WXDA 3GA0A 1V9LA 1RYDA 1P31A 1N7HA 1I3LA 4GVLA 2FZEA 5JYDA 3UVEA 2OP0A 1M6HA 2E49A 3DZBA 2OO5A 3DFUA 2A4KA 4KQXA 4KUHA 5CAEB 1DIGA 1XCBA 4CMEA 1OC2A 4YT8A 1L7DA 5DP2A 3OQ6A 1CERA 5IZ4A 3JYNA 5BSFA 3JQCA 1LQUA 3KLPX 3OETA 4FBGA 1KYQA 1GCOA 3LZ6A 1ISGA 5I7EA 4ZRNA 4MDHA 1VE9A 4HFRA 1LSJA 1R66A 1HF3A 5U1PA 4NZ9A 2PWZA 3TOXA 1GEEA 4ND5A 4NBTA 1YJQA 5H82A 5AYVA 4CMJA 1KS9A 3KRTA 4PN3A 3L77A 3PHGA 4E2XA 4I8XA 1C1DB 1SNYA 2PTGA 4MKRA 6LDHA 2NTJA 2FWMX 3MJVA 4CR6A 1LDNA 2R00C 2ZIZA 3QRWA 4DIFA 1YL5A 4RPGA 3BA1A 4AJEA 1E1LA 2GRAA 2QIOA 4LSWA 4H15A 4D0SA 4P4GA 1UZMA 2VWPA 3AFNA 2J5RA 2O2SA 4WJZA 2NU7B 4FFRA 1QV7A 1NPDA 3KETA 1A71A 2G1UA 3EHEA 4J1SA 4GKVA 2GD1O 4OSOA 3ONDA 1PZEA 2QYTA 3ZHZA 1HEUA 2WJPA 1X7HA 4XB2A 1VJ0A 1IHXA 3CZMA 3SBOA 3VPSA 1A9ZA 2WEKA 3OQBA 5CPBA 1XG5A 1GL3A 3WGTA 1CETA 3E5RA 2QRKA 3ZU2A 1PJBA 2AE2A 3INGA 4DLAA 1F8GA 1JVSA 3C3XA 3V2UA 5T8KC 1F0YA 2YDXA 4ZHSA 2CNBA 3OFSA 1HDOA 1X0XA 4O5OA 1YB5A 3F5SA 4S3MA 4WOJA 3DWFA 5EL0A 1CYDA 2HCTA 4L4SA 3U5TA 2ZYDA 2EV9A 1WDMA 3HDYA 1VPDA 4BNXA 4WEQA 4D43A 4OAQA 2IYOA 2V6FA 2PZJA 3ZGYA 4YQZA 4NU6A 3TRIA 3W6ZA 3VVBA 3D1LA 2JFFA 3GHYA 2VRCD 1ONNA 2I6TA 4R51A 3G0OA 4MVJI 3WJ7A 5I7SA 2I5PO 4NH4A 4Q3AA 1DC6A 1GQ2A 1KY4A 1QLHA 1R0KA 4KUGA 3M6IA 5CDYA 2GYYA 3HE3A 3QIVA 5GMOA 4BO9A 4F6LA 3IL2A 1PL8A 1N1GA 4NBRA 1BHSA 1H6AA 2W98A 3GZNA 4P22A 4CMIA 1WMBA 5JAIA 1C0LA 1IHYA 1NM5A 4WK6A 3ZV4A 3SX2A 3ZWBA 5KCZA 1N8KA 4OSPA 4JJGA 2VWGA 3ITKA 4CQMD 5L51A 5AXBA 3ZU3A 3TJRA 3GVPA 4MVJF 4AJKA 3X2FA 1T4BA 2IE0A 2F00A 3NT2A 2CFCA 4GVXA 1SCUA 5DOZA 1P45A 1LEHA 2J3KA 1PJ4A 1PQWA 4PZDA 5CG1A 5JDIA 3NDJA 3NT5A 1XU9A 4PLPA 3MJTA 3LF1A 4P4LA 1Y6JA 3U4IA 3KYBA 3DAFA 1ZXBA 3M1AA 3WGGA 3U4CA 3FNEA 4FOSA 1DJQA 4NFYA 3ABIA 5L40A 4BO8A 1D4FA 1DRVA 4CM8B 5G2OA 2I67A 3S2FA 3UGKA 4CR8A 2PV7A 4J0EA 1AGNA 2AEFA 2JD0A 3EUWA 4BL5A 2RCYA 4DXHA 3INTA 4IS3A 4XCVA 3WGOA 4IXWA 2QHXA 5A9RA 3NDRA 2GZ2A 3TZ6A 2J5KA 2VHZA 2PKQP 4MVJA 3B70A 4RF5A 1DBVO 4PVCA 4XX0B 4XR9A 4YACA 4R1TA 3O03A 2CVOA 3DZJA 4B3IA 4F45A 1S6YA 1TT5A 5F5LA 1UZLA 1ZZEA 3SC6A 3LSYA 1BG6A 3DEYX 4TROA 1WPQA 4GGOA 3WWZA 4CM4B 1T26A 3GVCA 2P4QA 3MTJA 5JY1A 2DC1A 4O63O 4ZQGA 4BGUA 1LDYA 3RKRA 2R6JA 4RZHA 4RPHA 1SB8A 1U2GA 5THQA 4DQVA 2P9EA 2SCUA 1SAYA 3KYCB 4BO5A 4ZA2A 4DC1A 1DHTA 2CY0A 3GK3A 2CMDA 3LC2O 1H6CA 3GG2A 1U7TA 4S1VA 2A92A 3WOHA 3O9ZA 4II2A 1U7HA 1GV0A 5G4LA 1IYZA 2YHUA 2XAAA 3L4BA 4E30A 1NPTO 4ONEA 3VOSA 4KMSA 4E5KA 3H8VA 3VDRA 5C7IO 1RJWA 4RF3A 2HDHA 3PWZA 3T4EA 2VNSA 1MX3A 4EUEA 3BHMA 3WNVA 4J3FA 2P91A 2GPTA 3NDIA 2YHIB 3IOYA 4DBZA 3PYXA 4J4TA 4IIVA 2O7SA 4R1SA 4DLBA 1EVIA 1UP4A 4BO0A 4E2ZA 2X0IA 2IZ0A 4YRAA 1NQ5A 4PG8A 5KVQA 4WLEA 1Q0LA 4F46A 3FBGA 1I2ZA 4Q3BA 3MZ0A 4B8WA 5JSFA 5L4LA 4ITUA 2JAHA 4ALJA 2FSVA 5KTKA 3B1JA 4O1MA 4J90A 2FY8A 1M6WA 1HDGO 1JAYA 4RGBA 1GTMA 1I8TA 4BMNA 3ZWPA 1HT0A 4II3A 4R16A 3ZHYA 3UXYA 4P8RA 1FDTA 1E0DA 2RH4A 3ROMA 1ZJZA 4QFDA 3BMQB 5G0WA 3F3SA 2Z95A 3JQGB 3W8EA 4LCJA 3AWDA 4XRGA 1GFSA 3VTZA 2D3TA 4EJMA 4UVHA 3KVOA 2CDAA 4I5DA 2ZTLA 4XB1A 2GN8A 1PS9A 3DBLA 4I1IA 4E21A 4TWRA 4HFMA 4PG7A 1NQOA 1TEHA 4NHEA 1MXHA 1OC4A 4GI2A 4XA8A 3Q9NA 5BQFA 4AJOA 1E3WB 3DO5A 5A9SA 4RLSA 2FPIB 2Q45A 5COQA 2GF2A 3U3XA 4P38A 4BMVA 5C5IA 4J43A 5F5NA 1QYXA 3JYPA 1YQXA 1C3VA 4TRMA 3RWBA 2FMUA 2JFGA 4GMFA 1C0IA 3PIIA 5IF3A 1LUAA 1H2HA 4B4VA 4XGKA 4XQ9A 3WB9A 3DB2A 2C5EA 4EBFA 4MIOA 1GUYA 3OJ0A 4LW8A 4CMGA 3OEWA 1N7GA 4BNJA 3E18A 5AXCA 1UAYA 3JQAD 4E33A 1N9GB 5L3ZA 1PL6A 4JROA 5JAMA 3DXFA 3Q2IA 4IPTA 1U3UA 2X7HA 1KVQA 4B79A 1TB4A 5DF1A 1CF2O 4KOAA 2G17A 1AN9A 4W4TA 3L9WA 1SBYA 2Q2WA 3LQFA 4ZVVA 3ZV3A 1U2DA 2HMTA 1LDEA 2OHXA 5MGBA 2YUTA 2YY7A 1XEAA 2Y1DA 3U49A 4IM7A 2EWMA 1MGOA 4NU5A 2O3SA 1X1TA 2BRUA 3JQ7B 2NVBA 4N18A 4NMHA 3WR5A 1XU7A 1SPXA 4CMCA 3U4DA 3ONFA 1KC1A 1LDGA 1R12A 2G0TA 2FPGA 3F5QA 2VZ8A 3KXDA 5B4VA 1JLLA 2QZ9A 3U09A 3KEQA 2JFHA 1HETA 3GEDA 3DTTA 3ZNNA 1T4DA 4K6CA 4TQGA 4BNUA 1AXGA 5F3RA 1VSVA 3ZH2A 3RUEA 2JL1A 3CMCO 4U7WA 4GX0A 2HMWA 3NKLA 3O8QA 3AUSA 1HE2A 1WAMA 2GASA 2Z1NA 4WEOA 3Q9UA 1GUFA 5ITVA 1G6KA 2RAFA 5L7YA 4J91A 4N54A 3I83A 3WSVA 5C3MA 3SVTA 2O3UA 5JY6A 4YT4A 3WFJA 1N2SA 3A28A 5IXYA 3HDQA 2E6UX 2OUIA 3GOHA 4HFJA 1GDHA 1QG6A 1ADFA 1V35A 2BLLA 1BTOA 4PGFA 3WG9A 5CDUA 1F17A 1FJHA 1YBMA 4QXMA 1JKIA 2CZCA 4RQTA 2VOJA 2OORA 4OXYA 4RF2A 1VKOA 3FD8A 4G65A 2OOSA 1WZEA 1T1RA 3I5MA 2CSUA 4Z9YA 4H3VA 3PP8A 4DLLA 2B4QA 4N5NA 3E82A 4Y6PA 1L7EA 3I23A 3VAZA 1DB3A 4R54A 3QWFA 1LC3A 4AVYA 3WYEA 3GMSA 3FPCA 4JCOA 5EIOA 1K6IA 5L4NA 1ISIA 3GH3A 5KIAA 2GERA 6ADHA 4GX1A 1LSSA 1UDBA 3HWRA 1P0CA 1PSDA 3AK4A 4U6QA 3WYBA 1GZ6A 1V3VA 5I8ZA 3H6KA 3IAHA 3KUXA 4LMPA 3OECA 3RU9A 3NRCA 5JDCC 4RORA 3GRKA 3CMMA 2W4QA 1BXKA 1B7GO 3LDHA 3PGJA 4R01A 5TRTA 4E2YA 1Z74A 5K0ZA 4DPLA 1GADO 1GV1A 4B4OA 5K6AA 1KVUA 2JCVA 1GEGA 3ANNA 1HDRA 3UHAA 5IZCC 1W0CA 1EQUA 1P77A 2X8LA 4QSMA 3HFSA 3HDHA 2I66A 3OEYA 4R68A 4DRYA 3M2PA 1OAAA 2W8ZA 3GZNB 3QW2A 4INAA 1VL6A 4PLCA 1E3EA 4CMIB 4BNLA 1F06A 3ANMA 3IP1A 1P9LA 3WGHA 3K6JA 1SOWA 1CQJA 2VYNA 3INRA 5IN5A 3ZWOA 1U5AA 1M2WA 3GC6A 1PJLA 2Q1UA 3G49A 4R9RA 4DVJA 1SCUB 1Y7TA 3WGIA 4RVUA 4N7RA 2BFOA 4QFCA 3RD5A 5A5FA 1LNQA 4OKIA 5C7LO 3JD0A 1ZK3A 3BMCA 3KOUA 1XKQA 1ADCA 1EMDA 3UICA 4CUJA 4CV0A 4UREA 3ROKA 4M87A 4L0QA 5AQ1A 2VHVA 3HSKA 4CLXA 3E48A 4ZQHA 1EDOA 4YPOA 1E1KA 5EQDA 5JLAA 3K92A 1FK8A 1GCUA 3AI1A 3RUAA 1YH3A 5I9LA 1CEQA 2YHIA 3GNQA 2DVMA 5L4SA 4ZQFA 1R4NA 4Z6KA 2BMAA 2YDYA 3IJRA 4CLEA 2NU6B 1RKXA 3WBBA 2X86A 4PG5A 5TLSA 5FF9A 3GDGA 3GFGA 3EK2A 1Z6ZA 1IULA 4A5OA 4CMEC 1LTHR 1EK6A 1LQTA 4XIYA 3PRJA 2BFMA 1Z75A 4A27A 3H3FA 4FS3A 4G5HA 1GU7A 5IFLA 5AVOA 1JWBB 2Y0CA 1QP8A 1IPFA 1B14A 1SMKA 1XGKA 1O95A 2AW5A 5IAAA 3I3OA 4YAJA 3UAGA 3WLEA 3HB5X 3WXBA 1GPJA 2CUKA 3AUUA 3GDFA 1Z82A 1J4AA 4PLYA 1K89A 4FFPA 4EZBA 1JU9A 5ES3A 1QXSA 1R0LA 4W99A 2SCUB 3DC2A 2PY6A 1RM0A 2WWRA 3HG7A 3RC2A 4CR7A 5I9NA 3DZIA 2FPPA 3JD1A 4EITA 3JD4A 1UXJA 4OXNA 3P7MA 4L75A 2Y0EA 2ZJ1A 2EKQA 1GYQA 4TVBA 2O4CA 2D4AA 1Y81A 3RUIA 1UH5A 2OP1A 1EZ4A 4O0LA 1YB1A 4OQYA 1DRUA 3I9JA 2ZCVA 3C1TA 2WSBA 1HDZA 1VKNA 3AY3A 4RQUA 3ZU5A 3GEGA 1I24A 1KEWA 2JKVA 2JHFA 3CXRA 1XR3A 4B3JA 2X0NA 3GG9A 1UXGA 3VZPA 1I01A 5EMHA 1P0FA 1T2DA 4B7CA 3KYDB 5JO9A 1JKFA 4FJ1A 2NM0A 4WOKA 2Q50A 2ZK7A 1N9GA 1XQ1A 4UEOA 1CDOA 1A7AA 5A3VA 3LT1A 4CPDA 1SC6A 1P3DA 3ANLA 3UOGA 1IOLA 3UW3A 4MVJE 1DAPA 5GZ1A 4MVJG 4JX8A 3D3WA 4K9DA 2Y05A 4KQWA 3BTSA 2FR8A 3PGXA 4J1TA 3TOZA 3DOOA 1YQGA 3K2EA 3PHIA 2ZATA 1EE9A 5I7FA 1BW9A 3L6OO 4E6PA 3QJ5A 4F6CA 1HYGA 1BMDA 1MB4A 3JQ7A 1EBUA 4NI5A 4XQGA 3W4JA 2VUSA 2UV8A 2P9CA 2ZB3A 1NQAO 2EIHA 3HQ4O 1HZZA 5AXDA 1DC5A 1HDCA 1ONPA 2J5QA 1UDCA 2O4UX 5G0VA 3ZWXA 2OBNA 5DBFA 1GYRA 3ICCA 3DBVO 3HJAA 3DBRA 4YWJA 2B35A 4IUYA 5CEJA 1DDOA 2P68A 3DBLB 1H93A 2PKRA 2I65A 1QORA 3KSZO 4WCDA 1IPEA 3NEPX 4BO2A 5JDIC 4BB6A 5DBIA 1E3IA 5A9SB 3T7EA 2UUOA 3SXPA 4IMPA 5TGDA 4HV4A 2NTNA 4ALMA 4JLWA 3ZWAA 4XD2A 3AY7A 1B2LA 1E7YA 4XR4A 2JJYA 3ZWNA 2GR9A 4EI2A 2BGLA 2GDZA 4WLUA 3WMWA 3WNQA 3GY0A 3TZQA 5KKCA 4PZEA 4XGNA 4KDEA 1O6ZA 4GMGA 1KVTA 3S1LA 5KVVA 5CDSA 3WWYA 3OJOA 4YA6A 1D1TA 3GF4A 4MP8A 1PS8A 2HRBA 4CODB 2HKIA 3RFVA 2H63A 3CPSA 2FN7A 1HLPA 3UCXA 2G76A 5EN4A 4DTIA 5T6BA 1DXYA 1UJMA 1GPDG 4M89A 3JQ9A 2UUPA 2UYYA 3ZWWA 3E9MA 1E1MA 2ZCUA 5KVSA 1DC3A 3OM9A 3R0IA 3K96A 4K6FA 1VLLA 1QYCA 2HJRA 1KBZA 1BRMA 4KP7A 1EUDA 3PZBA 2DBQA 1VRWA 3A4VA 3H65A 3VKUA 1NQTA 3WJAA 3TN7A 1RM3A 3GQVA 3R3JA 2RHRA 1LLCA 2HU2A 1YGYA 3GGGA 3CEAA 4IGEA 3ENNA 5LCXA 4BS9A 2P4HX 3IIEA 4B3HA 3BTVA 3U0BA 3VHRA 3GN2A 3SLGA 1LSUA 4OJNA 4EW6A 3ZN2A 2WDZA 4BOYA 1AE1A 5BT9A 2VHXA 2FPGB 1GUZA 3PWKA 4KWHA 2X5KO 3O38A 4QO7A 1JLLB 1PL7A 2GSDA 4ZN6A 1A27A 1MG5A 2OFPA 3TFQA 3WIEA 4CV1A 5JO0A 1YDEA 4MIEA 1W4ZA 4DIBA 4GX5A 3EW7A 3JQ6A 3QV1A 5DDIP 4BGVA 5A03A 3H9EO 2Q2QA 3E9QA 1CQIA 3AFMA 3O8QB 1U8XX 2HJSA 5G0TA 3AJRA 2A9FA 3C1AA 3L4BC 1U5CA 2C54A 5K9ZA 1IL0A 4N5MA 2Y1GA 3VZRA 3EAGA 2NVWA 5HA5A 3CZRA 5LDGA 4ND4A 1KC3A 2VN8A 5BSEA 2O2YA 5A5EA 1XIVA 4B7XA 1H94A 2FSSA 4IS2A 4Q9NA 1QRRA 3ZW9A 2B0JA 1LDMA 1PIWA 3BXXA 4HP8A 4D0RA 3L07A 4YRBA 5KWEA 5B1YA 4RPJA 4RL6A 2O23A 4D3FA 3D4OA 3LU1A 1XHLA 1ARZA 4DIOA 5TS3A 2GN9A 4Z9FA 5J23A 3OJLA 4FD3A 1ENZA 5L45A 3OSUA 1HE4A 1TA4A 1WLYA 2Y99A 3DZKA 2W2LD 2FR0A 1XLTA 2HK9A 5BNFA 4F3YA 3JQAA 1VSUA 4BGIA 3RC9A 4JBHA 1P1RA 1NTOA 5IN4A 2OMEA 1PJCA 3LT2A 3AOEC 1IY8A 4R1NA 1HE5A 3K2BA 3C85A 4JK3A 1KOLA 3WS7A 3QHAA 2VUTA 3KEOA 2BI7A 1LBEA 2PFGA 4IDAA 2YQ5A 4L4XA 5TT0A 3ST7A 2AMFA 3PQEA 2NU6A 3LC1O 2H9IA 4BUCA 4EEXA 2VTDA 3C24A 3UCFA 4J1QA 1UUFA 5DCYA 5CEEA 2VNAA 1U4SA 2GUGA 3BZUA 1U8FO 4NBVA 4CL3A 1GY8A 4NBUA 4NQZA 1K3TA 4AJLA 4C4OA 1YDWA 1YRLA 3GHHA 3IMFA 1ONOA 3IQDB 2R00A 2VYVD 2FR1A 3ZCXA 3FNHA 2AQ8A 1IZ0A 5CHEA 2HLPA 3OIGA 4NNJA 4RVGA 1JKJA 4I5GA 2OXIA 1NPYA 1TLTA 3LT4A 1QV6A 3RBZA 4P4NA 4LGVA 3RJ5A 3NJ4A 3TL3A 5EERA 4DYDA 3GT0A 3WIDA 5BSHA 1GZ3A 3H5AA 2DQ4A 2H5LA 2QQ5A 2J6IA 2NACA 4OOEA 4E5YA 1MC5A 1ENOA 1CQJB 4J1NA 1PR9A 2O48X 3LF2A 4FCCA 3JQEA 2EHDA 2PLAA 3V1YA 1P44A 1RYEA 1ULUA 4GBJA 3P2YA 4RVDA 2ZKLA 1BDMA 1N1EA 4CQLA 3DFZA 3F1KA 4H7PA 1LXCA 3K5PA 4EUHA 1JA9A 3BMCB 4YJGA 1PEDA 5I8WA 4PFJA 1ZSNA 2JD2A 4FSHA 4HKTA 4IJVA 1BVRA 4GH5A 3BYZA 3GAZA 2Z5LA 3EZYA 4XJSA 4L73A 4J9VA 3RC1A 1E3SA 1HKUA 1R37A 2WM3A 1PGNA 1Q7CA 1R4NB 3MJCA 3AUTA 3GPIA 3KYDA 2ZB7A 4DPKA 2WTBA 4GGPA 1PU2A 2XXJA 4A26A 1HWYA 2NVUA 3G3EA 2QRLA 3E1KA 5U9CA 2A35A 1E7WA 1NFRA 4CMAA 4UUNA 1M75A 3RKUA 1F12A 3DMTC 2DUUA 2Y0DA 2EJWA 3I4FA 1U3VA 3M1LA 1X7DA 3W1VA 5ADHA 4CL8A 3JCZA 3QY9A 2DBVO 3QWIA 4FIZA 1C14A 1JTVA 1N92A 1KVRA 3I52A 4EJ0A 3CH6A 4TKMA 5CEFA 2EJVA 1ISJA 1WW8A 2RIRA 3E9NA 3O26A 4BKOA 1YOVA 2DT5A 2NUAA 3EGOA 5EINA 2NLOA 5IDXA 3FWNA 3SLKA 4DMMA 2I76A 5IXSA 1ENPA 4GLLA 2ZTUA 1SEVA 2FPPB 3PDUA 5U4QA 5L7TA 4KDFA 4TZKA 4CM3A 2VRBA 2VWQA 3E6AA 4ZRMA 1ZFNA 3X2EA 2DU8A 4NR0A 5AXAA 1C0PA 4ZJUA 1WWKA 4RDIA 2PH3A 3JQBC 1J6UA 2FOIA 4AFNA 1NFQA 3G1UA 4FGWA 4ZQBA 3W4IA 1NNUA 3I9MA 5ICSA 3AU8A 1NHGA 5HS6A 1E7QA 3Q0EA 3RBVA 4CQMB 3KV3O 1ZMTA 4NJOA 1H5QA 4GAEA 3C7CB 4ND3A 4BO1A 3DQPA 2VWHA 3DHEA 4CUKA 5CPFA 3EC7A 1K2WA 3F6YA 3PPIA 3PWSA 1ZJYA 1DAOA 2EGGA 3HNPA 1JAXA 2FZWA 3E5MA 3WBFA 3DMYA 1XELA 2DLDA 3LLSA 4CLRA 4D7AA 1ZBQA 4C7KA 2DKNA 5COAA 4YJDA 1FDWA 1P33A 1CWUA 3FTNA 3MCVA 3FF4A 4FJ2A 4XDZA 2NQ8A 3ETGA 1UXIA 3NV9A 3GRPA 3TFOA 1E77A 2DPHA 4TRNA 1PJ2A 4J4BA 4M55A 4E12A 3GGPA 1D8AA 2IYPA 3GGOA 1H9BA 3QWBA 3S2IA 3F4LA 3W4KA 3D3WB 2X23A 4M8SA 1PGQA 2P9GA 5EJ2A 3W8DA 4X54A 3WTCA 2CVQA 4CMHA 1R15A 3BAZA 5LDHA 4EDFA 1BW9B 4N5LA 4AJJA 3H9QA 4YJHA 1TVEA 1DO8A 4A73A 5JMPA 3WICA 3OA0A 1LDBA 2HRZA 2XXBA 1YVEI 5L9AA 2QX7A 3FN4A 3RCBA 3TZCA 4NG5A 4ZD6A 1LJ8A 2D5AA 2P2SA 4WLOA 2VT2A 3W8FA 3QA9A 2CVZA 3GR6A 1E92A 3WDSA 2J8ZA 4BKQA 3DBRB 4J0FA 2V6MA 4AJ1A 3ITDA 4OKNA 1O89A 2C59A 3AUAA 4W9NA 3LLVA 1E6WA 3OIDA 1I5RA 2BKAA 2Y1EA 4R1UA 1P74A 4NIMA 1YXMA 1TXGA 5GZ6A 2EP5A 4OOFA 1MV8A 1QYDA 2HK8A 1W73A 1IUKA 2E48A 2UDPA 4FDAA 3DZGA 4BNVA 1BDBA 4I9NA 3D5QA 3RUCA 2EW8A 2OL4A 4YXFA 3S2GA 4AG3A 4YYZA 3H2SA 1CJCA 4YDRA 2OGUA 1NXQA 4PCVA 3OIFA 1KEUA 3Q3CA 1OOEA 5FI3A 5GY7A 5B37A 3H9JA 1I2CA 3CTMA 2GGSA 3PLNA 2J3IA 3QWAA 2O3QA 5A3JA 4DA9A 4R41A 3I6IA 1MFZA 4HUJA 4BV8A 4ALLA 4Z0PA 1I3MA 1NBOA 2EERA 3BIOA 2G5CA 5JCJD 4E31A 4JQCA 1QMGA 5TNXA 3G79A 1E7SA 1T1SA 4HFNA 3SJUA 4WLVA 3EY4A 4GWKA 4IINA 4Y8VA 3KHUA 2QW8A 3RROA 4L4RA 1EUDB 3F47A 4YAEA 4Q3CA 2OBYA 3SC4A 5CDTA 3ROPA 3ZV5A 1C1XB 3ENKA 2YQ4A 2NU9A 5TX7A 4YQYA 4OGWA 4WNIA 2Q4BA 3QVOA 1NP3A 4LMRA 2JAPA 1HLDA 1DPGA 3QQPA 1CRWG 4IQ8A 3DONA 3PEFA 4PLHA 4BKRA 4EGFA 1R16A 1NX6A 8ADHA 4J9UE 2FP4A 2PGDA 2C82A 3JD2A 3A14A 5JC1A 3I9LA 5FFFA 2X9NA 3U62A 4Y9DA 3H2ZA 1ZXLA 2CD9A 3KSUA 5A4DA 1SB9A 4Z0HO 1O0SA 3P19A 3DAPA 5L95A 3VKVA 2IODA 1A4IA 2I99A 1CQIB 5BNTA 2C7VA 2PD3A 3NYWA 3AOGA 4R5HA 1Q7GA 1Y1PA 3G1TA 4KUEA 4YAIA 1Q0HA 4K1LA 2O3JA 1PWZA 3UN1A 4ROSA 3PJEA 5EQFA 1Y5RA 1I36A 1ZO8A 3PQFA 3F1LA 4IDEA 2ZYGA 3H9UA 3ASUA 4FC6A 1PTJA 4YJFA 3JQ8A 3K31A 2XOXA 1I3NA 2AQKA 2Y1CA 4IZIA 1PJTA 3DDNA 2ZJ0A 4PZCA 2Q4EA 3ROQA 4XGIA 2ZTMA 1DLIA 3HN2A 2AE1A 1LLQA 1DHRA 3H3JA 4MVJH 3FCOA 4ZU3A 4BKPA 5HBRA 3K73O 5FWNA 2B5VA 3OJEA 4OO3A 4Z9XA 2Q1TA 3HZZA 3JQAB 2ZQZA 5JFOA 2CF6A 2D59A 1MC4A 3JYQA 4R4JA 4BNWA 4C7JA 1JQBA 4TZTA 3KB6A 1H0KA 1V6AA 3NGXA 1V3TA 1T2CA 3UUWA 1R4MA 1K6XA 4UAGA 1C0KA 4XWYA 1ULSA 5C37A 3BMNA 4ID9A 4OL9A 4CM5A 1QR6A 1DSSG 1VI2A 3Q6IA 2X4GA 4IXTA 4PRLA 2B69A 1ZEMA 1XYGA 3PFFA 4ALIA 1PQPA 3PTZA 1VL8A 4BHTA 3I9KA 1RM5A 4DL9A 4YCAA 3AI2A 1ADBA 2PH5A 4GWGA 3EYWA 1WNTA 4XYGA 3VPXA 1JKJB 1Y8RB 2YV2A 3V1UA 4D46A 3TQHA 1G1AA 4FN4A 3EDMA 1DLJA 4RZIA 4XKJA 1AHIA 1A9YA 1JN0A 1HDXA 3UCEA 5B12A 2Q1SA 1ZH8A 4O6VA 4QO8A 2BH9A 4D41A 1BGVA 4DPMA 2D0IA 4BO4A 3F46A 4GLOA 4R5MA 5ITWA 1O94A 4PLFA 4R69A 4U6SA 5TC4A 3AI3A 4W6ZA 2DBRA 1NR7A 1I33A 4FR5A 1EVYA 4KWIA 1X15A 2POQX 4TSKA 5HWSA 2VRCA 2PZKA 9LDTA 2UVDA 2V65A 4IBOA 2ET6A 1HL3A 2Y1OA 4IJWA 4J49A 1E5QA 4MO2A 4RVHA 4MPDA 1WZIA 3ZWYA 1WMAA 4E32A 4YT2A 1UAGA 4A03A 2X22A 4XYMA 7ADHA 3F9IA 3NUGA 4GQAA 1ZKMA 3IP3A 4CQLB 4FPXA 1DEHA 3ONEA 3NT4A 2VCYA 3DHYA 4YJGB 1U9JA 2ZB4A 4GL4A 4ESOA 1P1IA 4CQMA 3V5NA 3IS3A 3GAFA 4WUVA 4KTTE 1LU9A 3DL2A 4OHUA 5COBA 3PK0A 1E5LA 2D1YA 3PYLA 3R1IA 4BKUA 1LRJA 3FSRA 2HMUA 3WTBA 3S8MA 3NJ8A 5IZCA 2W2LA 2NVUB 1B8PA 1ZW1A 4Z0TA 1O5IA 2EF1A 3E8XA 2D8AA 3ORFA 3ZZNA 1BXGA 1UXKA 1G0NA 1B26A 1ZK4A 3HUDA 3BMOA 2TMDA 2HMVA 4FFMA 1BXZA 1ZMOA 2DM6A 3V1TC 1X7GA 1W8DA 3NTOA 4CV2A 3IC5A 4IQ0A 4CJXA 5DCWA 2IEDA 2NADA 4I9UA 3PJDA 4QTZA 1E6EA 3RVDA 1YOVB 4BNNA 3F4BA 2NUAB 1I0ZA 4OH1A 4MOWA 1YB4A 3QVSA 5JCXA 2PR2A 4BVAA 3EVTA 1HXHA 2WYWA 5KJCA 3WGZA 1EVZA 1BVUA 2VYVA 9LDBA 2O50A 2E82A 3DTYA 1EE2A 4NDNE 3CIFA 4RO0A 4XJTA 1ZVMA 3N74A 4RPLA 4WCFA 1ZIDA 3B6ZA 5T67A 3H7AA 3IJPA 1ZEJA 3AM5A 2DTDA 3CE6A 1UP7A 4BO3A 4NJMA 2XPCA 1E1NA 4YB8A 4J7UA 3ZWVA 3ADOA 2ZB8A 2BELA 3ZW8A 3MOGA 1D3AA 4XEHA 3IKVA 1QLJA 2RBEA 3VZQA 2C20A 4Y6RA 5F1PA 1F14A 1H2BA 4CM9D 1B3RA 2B36A 4MIYA 4JP3A 4AJ2A 2WD8A 2X0JA 3RBXA 1H9AA 4RDHA 2EEZA 3JQFA 1V3UA 3PJGA 4RJTA 3PHJA 2GO1A 3IUPA 4CLRB 3WQQA 1HSOA 3ZI0A 1YE3A 4HNGA 4OYRA 1KY5A 1T2EA 1VJ1A 3D5TA 5A02A 2G82A 4OIMA 3G17A 3NTQA 3MWEA 4AJHA 3DHNA 3FR7A 4GSKA 5BR7A 2VYND 1D1SA 4RLHA 1VM6A 2EKPA 1WP4A 1UXHA 3R3SA 3I9OA 2GZ1A 4A0SA 2WD7B 4LCEA 3TDKA 3PJFA 2HSDA 5KVCA 3GUYA 2YFHA 2YYYA 4CLHA 4EEZA 3ZNPA 1EBFA 2TMGA 4K26A 1B8UA 5G0UA 4DGSA 4CM6A 1C1XA 1RPNA 3MJSA 1S7CA 1Z7EA 3OMLA 4MKZA 3TF5A 1ZSYA 1DFIA 4YJHB 5KJFA 1W6UA 1YL7A 2AEMA 5FYDA 5CFZA 1NVGA 1UP6A 2GZ3A 4KTVE 3ETEA 1OI7A 1EUCA 3K8ZA 5L53A 4L76A 5DZSA 1DRWA 1HRDA 3WLFA 4E13A 1XWFA 1NHWA 4Y98A 1E7RA 2X6TA 3L9XA 3U4HA 5L7WA 2BFAA 3AY6A 3QP9A 4W82A 2PZLA 1ENYA 3ICPA 3H9GA 1YL6A 4TRRA 1X14A 3C7DB 3GVIA 5G4KA 4HXYA 2F1KA 3ZNQA 4NBWA 4DC0A 2NWQA 4XYEA 2Y67A 3WMXA 4I9HA 3JQDA 3ULKA 3WGQA 1GQYA 3B20A 4Z3KA 2C0CA 4RV9A 2WYVA 4IIUA 2W90A 4MINA 4E4YA 2AA3A 1B8VA 3MOIA 3ON5A 4IDFA 4UVDA 2QZZA 2DTEA 3JYLA 3OBBA 5JYEA 4BNHA 3QVXA 4RPKA 1R6DA 4JGBA 2VUUA 1UZNA 1QKIA 2BFPA 1FMCA 2VZ9A 3N7UA 4BNKA 1GYPA 4J16A 1I2BA 4PVDA 5LC1A 1LRKA 1T24A 2AQHA 1A72A 4PLWA 1PS0A 3V2GA 2EW2A 2HO5A 2VOEA 2IZZA 3FTPA 3GNSA 1O9BA 2X0RA 3LT0A 5KJ1A 8LDHA 3D64A 4UUMA 3VZSA 1ZUD1 2ILTA 1SO8A 4TVOA 2QG4A 2VQ3A 4NK5A 4R9SA 3MEQA 4E5PA 1GZ4A 4J2OA 4WE3A 2NU9B 4ILKA 4U0KA 1MLDA 1Z7BA 3KM0A 3I4CA 3GPDG 1B3BA 3HADA 4JP2A 2E4AA 3KO8A 3N58A 4CLOA 3H5NA 4PG6A 2B5WA 2EKLA 4MP6A 1N5DA 1ML3A 3KZVA 1X13A 1R0SA 2FP4B 3H4VA 5A04A 3UFXA 1GR0A 1Z73A 5A05A 1FDSA 4EUFA 1QYVA 5TT1A 5F1OA 2Y66A 3HN7A 4PG4A 1OFGA 2ZTVA 5EESA 4ALNA 4JNKA 4CM7A 4PIVA 2IXAA 2IXBA 3HFGA 5H81A 4A10A 4EJ6A 3VC7A 2JHGA 3RC7A 4D42A 4BQRA 3VDQA 2XF8A 3OP4A 1Y8RA 4E0BA 2X9VA 4FFLA 1XA0A 4NFSA 4ZICA 3D4PA 2IEBA 3ZDFA 1AUPA 3RUDA 3HHPA 1H6BA 4URFA 4HY3A 5BNIA 2H1SA 1JW9B 1U1IA 4TMFA 1MG0A 2PGLA 3UF0A 4B7UA 5HM8A 4J7XA 1U28A 1Y9EA 3Q2KA 2GN6A 4L8VA 2NNLD 1T2AA 3B1FA 4U0JA 3WFIA 2W2KA 3CUKA 4YJFB 3JQ8B 4KZPA 2VZ0A 1ZSVA 5ER9A 4FB5A 2DFDA 4BGEA 3OJFA 2PNFA 5I9MA 1YS4A 5T8KA 2DBZA 1LLDA 2P5YA 1KEVA 4PLVA 5CDGA 4IDDA 1LLUA 2GN4A 3RI3A 4E3ZA 3DZFA 4AICA 1Y8QB 1P1KA 4H16A 4Y6SA 4CMKA 1LI4A 1ISMA 1ZK2A 1PJ3A 1FF9A 2DFVA 5CP8A 1YBAA 1A4UA 3RUFA 1V0JA 2Y68A 3ETDA 4M1QA 4CMBA 4BNGA 4BQPA 4XQEA 2HAEA 3L6EA 5FI5A 5JCJA 3S55A 1R4MB 3L6DA 3ZV6A 5TSDA 4HX5A 2CDCA 4J7CA 1HSZA 4IQGA 3BMNB 1NVTA 3RAJA 4DMLA 2ZYAA 3JV7A 3T4XA 2NU8A 4AJPA 2J3JA 5ILOA 3VVCA 5IDWA 1T2FA 4U5QA 1K6JA 1LX6A 3C8MA 2FRDA 1M66A 3DBHB 3L4SO 1WDKA 5ENVA 5JAQA 4BNTA 1MA0A 3BTUA 4RCVA 5KNLA 2B4RO 5JS6A 1KVSA 2DAPA 3IKTA 1ID1A 2O3RA 4YT5A 4W9NC 4BMSA 1AXEA 2RHCA 2EXXA 1ZK0A 3ADPA 3LC7O 3QLJA 4BIIA 5TIIA 3L0DA 1DC4A 3Q11A 4OMUA 3RJ9A 2PD4A 3WGYA 1TT7A 3OHSX 2DUWA 1PJQA 2Y1FA 4LK3A 1RWBA 4LRSB 1OMOA 1ORRA 2LDBA 1JDJA 3FR8A 4JIGA 5HTOA 2NTVA 2HK7A 4XYBA 4QECA 1VJTA 1KEPA 4CUZA 3PVZA 2BGKA 4DUPA 3IDSA 3AOEA 3U9LA 3WX0A 1NASA 1XDWA 1PZHA 3EMKA 2CF5A 2C7GA 1K5HA 2X58A 4IGFA 4WLNA 5IG2A 1HZJA 5TQVA 4D79A 2AHRA 5C7OO 1L1FA 4DBVO 4O59O 2C07A 5A9TA 4ALKA 1I10A 1PQUA 5CAEA 5KJEA 5JMWA 3MWDB 1K0UA 2BGMA 4WPGA 2GNAA 1EFKA 1NYTA 3D4NA 1PGOA 1ISFA 3GUCA 3KTDA 4BNFA 2E37A 4IZHA 5HRUA 3GZ4A 3P2OA 5I7VA 1Q7BA 3RUHA 3FBTA 1EEHA 2AG8A 2QRJA 3BHIA 3K9QO 1PZGA 3RFXA 5JE8A 2D5CA 4JBIA 3CKYA 1WDLA 1YQDA 3NAQA 2QYSA 4UEJA 4LVCA 1J5PA 1NR1A 4UULA 3D0OA 5F1KA 1BXGB 4IMRA 3VH3A 3BMOB 1SOVA 1J49A 1GD1O 3CSDA 4Y67A 4AJIA 2WD7A 1C1DA 1Y9AA 3FI9A 2AQIA 4HWKA 1HDYA 4MKXA 2JCXA 2PKQO 4GPD1 3C7AA 2O7QA 3FNGA 1B0AA 4RVFA 4FW8A 1PGPA 1H6DA 3LYLA 4XRRA 5K6AC 4HBGA 1ZK1A 4NPCA 5KKAA 4UVGA 2JD1A 3OICA 2DTXA 2NU7A 2WMDA 5JW6A 2O3TA 3C1OA 1YO6A 3PDJA 4G2NA 2LDXA 4Q3DA 4BNIA 4WCFB 1MFPA 1SEPA 3HB4X 4Q3NA 4DYVA 1PJSA 1YJ8A 1LRLA 1DOHA 4MVJD 3MJEA 1BSVA 1IB6A 2VHWA 2YW9A 4BO6A 1PZFA 2YJZA 4NJMB 1UR5A 1FDUA 1DFHA 2Q2VA 2YZ7A 3PI7A 4U8GA 4ZQEA 4DWVA 5ER6A 4XDYA 2I9PA 4YAGA 4Z3DA 3WSWA 1E3JA 1HE3A 2EG9A 4MJLA 4QEDA 4IJKA 5F21A 5THKA 3DOJA 3RSHA 4XZ3A 1O8CA 4XIJA 1EFLA 2IZ1A 3H5RA 4B8ZA 3DMTA 5B4UA 4IDCA 1U3TA 2D2IA 4E5MA 5JBIA 1DJNA 3PFWO 5TJ9A 4XQCA 3WYCA 1YONA 2HUNA 3GFBA 3KBOA 2Q1WA 3R6DA 2AEJA 3GVXA 1P1FA 4I08A 3OA2A 3P5SA 1KERA 1ZNQO 3AU9A 3MWEB 4PLTA 4AJ4A 1KIFA 2GLXA 4W7IA 4L74A 1GAEO 1DIAA 4UUPA 4W7HA 2Y93A 3WQRA 4EYEA 5IDQA 2C29D 4UVEA 1F8FA 4FJ0A 4AL4A 1X1EA 3VPHA 2VT3A 3FHLA 4CM1A 3GMDA 2BI8A 4I5FA 3TNLA 3LK7A 1A7KA 5T5QA 2BD0A 4FC7A 1HTBA 1NVMB 4G81A 3ZHBA 3QE3A 1DIHA 1FDVA 3COSA 3DZHA 3JQBA 4I5EA 4JN6B 4UUOA 5IDYA 1V8BA 2V6GA 1LA2A 3ZU4A 3JYOA 4BV9A 4DREA 2YV1A 1I3KA 1OZAA 1Q1NA 2YV3A 3A1NA 3QVTA 1EUCB 4BNYA 4BO7A
chains in the Genus database with same CATH superfamily
4FDUA 2ZQYA 3L8EA 4AX4A 2ZT6A 3FNFA 1ZR2A 3GDOA 3PUHA 2WG2A 3JD3A 2CLOB 3K0CA 4LDZA 4MQMA 1Q84A 4Q39A 3RUPA 3RYTC 5CG2A 4LSGA 2HT6A 2ZZNA 4D3DA 1VGQA 2GF0A 1S9DA 3KOXA 1PR3A 2ZU6A 4KRXA 3WY9A 1WMEA 3I1JA 4OL0A 2QL5A 4QYIA 1NBWB 4GLFA 3PX7A 2GCGA 1YDFA 3UMJA 3IPYA 1QE5A 3DBOB 4YGYA 3VNUA 2FHSA 1B16A 3P27A 4YP7A 2PA3A 4WASA 2LCIA 5LA6B 4BBJA 3KQHA 3T7SA 3I2FA 3C3MA 1AS2A 4OUKX 5ILGA 3PT9A 4FQ8A 4O25A 1CY0A 1GIAA 2Y3IA 5DGXA 5FKJA 1CE8A 1D0VA 4LFAB 2I80A 4HLNA 1U3FA 2HNAA 3EFOA 4E6EA 5I8PA 1IDOA 2CEAA 3WL8A 2VDRB 2OCPA 3PIDA 1QSGA 4WXMA 5FNVB 4CV3A 3SDZA 4ZKDA 5F64A 3IULA 3VPCA 1M76A 2G4LA 3MQ4A 5JAHA 5EFZA 4PLGA 3LXMA 3HCOA 3FDIA 4MLCA 3UMRA 4Z7QB 1E8DA 4EFDA 1GNRA 1A5ZA 1EWTA 1XI2A 4FOOA 2AYZA 4JJAA 3VNSA 2ZP1A 4B17A 4MS1A 2Q0XA 2YRFA 3EFBA 4JP1A 2H1VA 5BN3A 2X9GA 4OAPA 1K08A 1RQPA 4JI3B 2C2XA 2FPRA 2R68A 1E1QA 2QMUA 4V3CA 4GX2A 1J2JA 4EVQA 3T15A 2V03A 5F35A 5K8UA 3ZD7A 1AS0A 1G21A 2HL6A 3QBVA 4UTOA 4C2AA 1MVOA 1U4OA 2RFLA 4GKBA 5HF6A 4D3XA 2Q5HA 1CY7A 1Y8QA 3EXIB 3P4XA 1KZYC 1WZCA 3H1BA 3KYCA 3M89A 3SSOA 1LBQA 4UTNA 2HRQA 1TQDA 4LOIA 3TL2A 3E7FA 4RPCA 5B5SA 1N33B 4QNMA 2R1UA 3P26A 3L8FA 1W88A 4I0WB 5J4VA 2H6EA 3DWIA 1IN8A 1JT9A 4E2WA 3GLVA 4BNMA 4DT1A 2RK4A 4NENA 4TRJA 5IAKA 5HPYB 4F91B 5K0NA 1Z7WA 3NWJA 3W5UA 4CLOB 1ZD4A 5L3RA 5ITSA 4QJBA 4J07A 2M32A 3SY8A 1Z0AA 3DSRA 3O8DA 5C4IA 3LDAA 1FRQA 3ZZ0A 3DYIA 1Q7TA 2I3ZA 1EK5A 3V8BA 1G0OA 5EWLA 2PUCA 2XX3A 2V7PA 5DP1A 2BHTA 1S8OA 4QEKA 4LY3A 4PRKA 4LUCA 3LE8A 2WJIA 3UUGA 4UHHA 2PSHA 1W9HA 1H2WA 4DABA 3UPTA 5BSRA 2Q46A 3FPLA 5T57A 1MEOA 2XMSA 2EHJA 3EXG2 1SXQA 1T8UA 4MQ4A 3VH2A 3QWHA 4FR2A 4UE3S 4JI8B 1TJYA 2P62A 3MUEA 5BRJA 1UDRA 2EGHA 5LIPA 2HCRA 4YFVA 4D26A 3NHPA 2IHKA 1YIAA 3G59A 3KOYA 3DEFA 4PPFA 3TWOA 4BNZA 2WIDA 1XO1A 4ZI3A 2IYRA 1C4WA 4IQ4A 1RVV1 3RU7A 1GQQA 4OQZA 3UBMA 2WT9A 4J3NA 2OCBA 4ZXPA 3SF0A 3DOCA 1NW6A 5AKGA 4AQYB 5GTDA 4F3CA 3EGDA 4YWHA 2IYYA 3MT0A 4ON9A 4REQB 2ZBPA 4QX6A 5I4IA 1AHPA 1TT5B 3EOZA 2VXYA 4FLFA 3UH1A 2AN9A 1WM1A 2R4UA 3G8CA 1KMCA 2W2KB 3I6QA 4J6FA 4HADA 2VJMA 4CKEB 5T64A 4YRIA 3QJGA 4JJIA 3MXTA 4LVUA 3O1IC 1P1HA 3BCRA 2PX3A 4UVIA 2AXQA 2GWHA 4WESB 2RH8A 4LSMA 4C5AA 4IH4A 3STWA 1A9XA 1IN1A 2J0QA 2BJHA 3R6WA 1T25A 1WVGA 2I2CA 1JQJC 4IJUA 2Q49A 4FKZA 4GS5A 4RX1A 3RIHA 1C9JA 2ZWIA 1WBDA 4PAQA 3TSYA 5DCUA 2XNSA 1XAJA 2D6FA 1VC2A 4Z4HA 1RZVA 1R0YA 2R47A 1VHQA 1FU4A 1MT0A 1GT6A 2G1AA 2BDUA 2QW1A 3NIGB 4UCFA 3M6XA 3L7IA 4PX2A 1RYBA 2DPXA 4YP9A 4XASA 1IVNA 5KYKA 4YRCA 5CX4A 4D4IA 1EDZA 2PGXA 2IU3A 1KMHB 1NATA 4MMZB 4BB5A 3WIOA 2WJWA 2VHYA 1FNMA 3RQSA 4IGAA 3HWSA 2C4UA 5DXAA 5HP4A 5KPJA 1L5YA 3NTRA 2VDJA 4IY1A 3G1WA 2FZVA 1EDEA 1LPBB 2PMFA 3IV7A 3LCVB 1M2OB 4OXKA 3VPGA 3QX7A 5LP6F 1TA9A 2PD6A 1Z0JA 3FAZA 4F56A 1NXOA 2VVTA 2XZPA 4ZI7B 5LZ9A 2FX2A 1QO0D 1Y48E 4ND1A 1JEAA 5HJ2A 1T9CA 4JA2A 1CY6A 1XHFA 2H07A 4QT0A 1IG3A 3U1TA 1G8AA 1J90A 1OGIA 4U8HA 3UJCA 4YTEA 4HAVA 2BISA 4NULA 2COKA 5FEUA 3IUSA 4IUDS 3GVHA 1NKSA 1Z4QA 2CXXA 2UVQA 3SEFA 4Q66C 1B74A 4F84A 3BF8A 5JZMA 2P1RA 5EKSA 1J0XO 3LECA 2GK3A 1NURA 4IDQA 4RNCA 3MWJA 2P77A 1XQ6A 4QKQA 4UPEA 1IUOA 3ZLJA 2AZTA 1D2HA 3K0FA 1PWXA 1V4NA 1X7ZA 4BEVA 1THGA 3PHLA 4JIMA 4Q00A 1U02A 3G9QA 4JEUA 1XZPA 1L7PA 3ET4A 3JSAA 5DLPA 1GPUA 4QUKA 1KJQA 4KQIA 5M2QA 4BVGA 3E4CA 3AILA 3L0CA 3R3XA 4UM5A 4RZXA 5JECA 1XD2A 4LC1A 1ML4A 2IEZA 4X1IA 3PXEA 1RYDA 2OHGA 3FLAA 1OLXA 2I7XA 1JG6A 3IVRA 2JA1A 4XUEA 4FEEA 3HVUA 1DTSA 1GOTA 4QPJC 4EKDA 4ZK6A 2E49A 3G85A 2P11A 3DZBA 3PHBE 1OPRA 4XIFA 2ZSHA 2LGJA 2C9ZA 2ZE8A 3F2IA 4C6RA 1Q0PA 4H7JA 1K8ZB 2CKDA 3H83A 4YT8A 3OMXA 5BWOA 4PF1A 1L5QA 3A3KA 5BSFA 3AG6A 1PSWA 3LQQA 3FUCA 1LQUA 1NNI1 1MO6A 3OETA 4FBGA 1AK9A 3A2KA 4TN5A 2CXTA 2OSBA 1FPMA 5LJIA 1EXMA 3A6LA 4HSGA 3FPKA 1V11B 4HFRA 4GW3A 1LSJA 5E4FA 5JVDB 3OTOB 3DKVA 5LLTA 4RXMA 3E9ZA 4Z2YA 4JDUA 4C01A 2REQA 4HUTA 4NZ9A 4KLNA 3OM8A 1GEEA 4ND5A 1U0NA 3Q7PA 4NBTA 3HKEB 1OLSA 4RZSA 1Z6QA 5EMJA 5AYVA 1MGPA 1Z07A 2P69A 5LXTB 1H2ZA 3M5PA 2C4WA 1XDSA 2EU8A 3K1ZA 3I8XA 4L08A 1T5TA 1F6DA 4MKRA 4EB0A 6LDHA 5DYNA 5ALWA 3DO8A 2DFKB 4F2DA 3U48A 1ZLXA 3QRWA 2PJDA 3MJHA 1ZISA 1KMNA 4RPGA 2WTMA 2F3UA 4AJEA 4BEJA 4D25A 1WP9A 4CKWB 3DD5A 4BGDA 3T5MA 3FPAA 5G1NA 4EPVA 1G42A 4D0SA 4IVPA 1YS1X 2NU7B 1UQTA 2G0NA 1M5TA 3V4FA 3QIAA 1NPDA 3TKLA 1A71A 3KETA 4WZ6A 4GKVA 2HY7A 2P6MA 3U6BA 1D1QA 3MJDA 1TCAA 4HAZA 4LMBA 2X8AA 5TGZA 5JQGF 4WY8A 3MYYA 3OIWA 3GBPA 2BGJA 3A3YA 3X1DA 2AK3A 2O1EA 4XB2A 4I3HA 4R83A 4URVR 1ZOPA 3H8SA 5DN6A 3PKIA 1UBHS 4JLPA 2EYQA 1LBHA 3E7PA 5DHUA 3GP3A 3PLAE 3E5RA 3RNLA 1R9NA 2N3ZA 3JPWA 2AE2A 3INGA 4WJKB 1QO7A 2RGUA 4B76A 4BVFA 4PHCA 4DG9A 4F5EA 4QULA 3KQNA 3V2UA 2IH4A 3CNNA 3K6SA 4BLVA 1Z7GA 3ORSA 1VDZA 4OHVA 3T41A 4GQIA 4HLUA 1YB5A 3UAWA 3IMGA 1E6KA 3K4QA 3DWFA 4QUDA 1E9FA 1ZN8A 3B89A 3AHHA 4HAUA 4LRUA 4JBLA 4RHUA 5BR1A 1DADA 3DKPA 2V0GA 4HNRA 4UCWA 1QG2A 3DR5A 4EHAA 2GJ4A 1RW4A 2ADFA 1HM5A 2IYOA 2O0HA 2PZJA 2I0FA 3KS9A 2ID8A 3ZGYA 4YPVA 1DQPA 2C5LA 4NU6A 4PPYA 4AP9A 3KEFA 1OXSC 2AFIA 2M98A 1XZNA 2CBXA 1HH4A 3GHYA 1K2VN 1S3IA 1ONNA 2ORWA 2VRCD 3G0OA 4HDMA 2GB4A 4BRZA 4DDHA 1TJPB 2IYWA 1R0KA 2ZYIA 1B43A 1TZKA 4KUGA 4NCKA 2FX3A 4PSUA 1ZAYA 2GYYA 2VSXA 3HE3A 4QGBA 4BO9A 4F6LA 3TKYA 4PQRA 2AR0A 3E9DA 3H2GA 3QKIA 2IYEA 2RB5A 1HFEL 3AH8A 2DFPA 3RT9A 4KJXA 4C0XA 2IDKA 1TZ2A 2FRDC 1WMBA 2JFQA 2PSEA 3KXPA 1PFWA 1NM5A 4GWLA 3ZV4A 5JAIA 3SX2A 5KCZA 2RHMA 1N8KA 2A4MA 2J3LA 4PICA 2PUDA 4TTAA 2VBCA 2FFHA 4QJ5A 3IFSA 3T34A 3TJRA 5GVSA 3GVPA 1SH7A 1KWKA 1WXWA 2B8JA 4DN6A 4AJ9A 3L6RA 4GVXA 5GVRA 1SCUA 4A6EA 4OEHA 2WILA 4OXQA 5DW3A 5HQTA 2VA9A 2V3CC 3KKEA 1KH2A 1PJ4A 2E18A 1H0HA 1BHJA 4HB0A 1E0JA 2G09A 3FZGA 3V80A 2JJ1A 1D2CA 2FZLA 4GPZA 4B1FA 3LOUA 3MJTA 4KBGA 3GGDA 1Z0IA 4P4LA 3LCMA 5HJEA 1RI4A 1GPBA 2ZI9A 4UMEA 3RRMA 1NBAA 4W5NA 4G0MA 1EK1A 2X19A 3AP1A 2EZTA 1ZXBA 1OX5A 2ZIXB 3GJ3A 4R81A 4KPUA 4XD7A 1V8FA 3FNEA 3QUTA 4ARVA 4P33A 3CYFA 3KNZA 4YIKA 4FOSA 2QBYA 5JZOA 5L40A 2FPWA 3MRSA 4GHWA 4BBAA 1DRVA 1WXHA 3TXYA 3IBGA 3UGKA 3ZPXA 1FSPA 3IHKA 4QT4A 4P0PB 4ZV4A 1YZTA 2YZ2A 2AN4A 2LW7A 4BCCA 4DHWA 2FUEA 2RCYA 3INTA 4XCVA 5EY5B 1XVLA 3QVMA 1PG2A 2OZLA 1IUPA 2QPOA 2A59A 1NV8A 3TZ6A 1NLFA 1SA0A 3MMXA 2P6UA 4Q9LA 4JYBA 5J2TA 1F5NA 1DBVO 1PV1A 4PVCA 1T4MA 3BERA 4FNAA 3NHRA 1E99A 2WKPA 2XNCA 5B6IA 2ISCA 3OE1A 1QCCA 3GWZA 3HGQA 4PGAA 5F5LA 4X62B 1U5BA 1UT6A 2P9ZA 1UZLA 5JR3A 1ZZEA 1FYWA 2I33A 4EG4A 4ZOLB 1U8YA 3H3XA 1DV2A 4FU0A 3TVDA 1RXSA 1X70A 4TPKA 2JCBA 1G5IA 4M9XA 4TWZA 2ONJA 4GGOA 3VO8A 4BLUA 5KDLA 4Y9RA 5CA1B 3MM4A 2P4QA 3UHFA 2H2HA 4ZOAA 4OXRA 5EZYB 3L3BA 2W6OA 1KZ7B 2OR3A 2H5JA 3NHZA 3VO9A 1T6XA 3UOWA 1P6QA 3TIXB 3AVUA 3FYUB 3H1AA 3ND9A 4L9AA 4RPHA 5KNBD 1JEDA 1GGHA 1ORTA 1FDIA 1LK0A 1U2GA 3DAHA 3JWIA 4K8OA 1W44A 3USES 1BCSB 5C5EA 3KBBA 1JMVA 1ZINA 1H2EA 1UM8A 4B2IA 1CS4C 1AKQA 5H3LA 4O3MA 4XAQA 1N6PA 1P18A 3LQYA 3PX2A 1T8WA 4Z1MD 1P19A 1IYZA 1CZNA 2YHUA 3LKBA 3MGKA 3E84A 2BFDB 1DS6A 4DEXA 2QGNA 4ONEA 1ULZA 3GLGE 2QUBA 4KMSA 4E5KA 1EB8A 4RMNA 3HXOA 1B6TA 1PK8A 5FTNA 1YE5A 3VPAA 2X4IA 4RF3A 3T4EA 1M83A 1W5EA 2EOAA 1MX3A 3QOWA 4AWBA 1ND6A 2PKXA 3BIJA 3WNVA 2P91A 1AQYA 2O1XA 2GPTA 4M8NE 1W4BA 1XRLA 3G8AA 3KU4A 1NI4B 2YHIB 3PDIA 1ZN2A 4OYHA 4DBZA 5L6MB 3IUQA 4J4TA 1NU6A 5K4AA 3AKYA 5LQCA 2ZRKA 3BB4A 1VPVA 4LHZA 5C1PA 4XSVA 3ZKAA 4W1PA 3RYCA 3MT7A 1SUEA 2AF3C 3W77A 2PUVA 3WLAA 4YRAA 1PR0A 4EY7A 3LUCA 2J41A 4F5YA 4F71A 5CURA 4PG8A 4RTOA 3IAS1 3FHTA 1SHLA 1FSGA 2PZFA 3QUCA 4ZYTA 1E4VA 1YCDA 4WH0A 1R0XA 4JKOA 4B9AA 1DBRA 1I2ZA 3MZ0A 3KAQA 2HSZA 3GV0A 2FSVA 4O1MA 3FB1A 3OE5A 2B1GA 2MR5A 4Q37A 1P4AA 1JAYA 1G6Q1 2A0FA 1GTMA 2D2VA 1DKQA 4M6WA 5E7QA 1YR2A 1HT0A 3HVRA 2DYKA 1FDTA 1TQHA 1US8B 2IPXA 3L7AA 3WLKX 5KINB 4RAQA 1ZJZA 4OMFG 2XE8A 5G0WA 4MUGA 3U7IA 2Z95A 1JFSA 1FX0B 3HJGA 3SEAA 1Z29A 1ZOSA 1BOOA 3OCZA 4RPKA 2R85A 3JATB 3UAOA 4TXJA 3VTZA 1M2VA 3AKEA 2D3TA 2QA5A 3OX3A 4I55A 4EJMA 1AMNA 3KVOA 1A9SA 1MN6A 2CDAA 5FNZA 2WG0A 3H0EA 4MQFB 4LCBA 2Y0BA 1NXSA 5BWLA 2QT1A 2JLYA 2O2CA 2IVZA 3DT8A 4DLWA 5HIJA 1ODCA 1V5GA 2W0MA 3VNRA 4CFYA 3BS4A 4HFMA 1JH8A 1TEHA 4JX9A 4N9QA 5LN1A 4DA4A 2AYXA 1P2UA 4GI2A 1TMGE 3U7JA 4MI9A 4KX5A 3HYLA 1Y3FE 7REQB 3U3XA 3C3JA 1VA5A 1IK6A 3RVOA 4MAAA 2OM2A 4I5IA 4B3FX 5F5NA 4DDTA 2JGIA 3JYPA 1NRWA 1C3VA 1H1DA 2WUEA 2FMUA 3HCAA 1D09A 1PT9A 1Z18A 1LUAA 3LW7A 1H2HA 4XQ9A 5E4YA 1H65A 2PRJA 1VG8A 4EBFA 2QI9F 1LZLA 3HJCA 3UMCA 3OEWA 1T8TA 2CNDA 4IILA 3E9YA 4BNJA 5JRZA 4DUZB 2QD4A 1JDTA 3CGWA 4M7RA 1UKZA 2SICE 3ZX4A 4IPTA 2E5WA 2HRRA 4KV9A 4P7BA 1U3UA 1TTTA 2X7HA 4JLSA 1PLKA 4KQ9A 4KQGA 5EWJB 1L5HA 3MAAC 5DF1A 3TLYA 2GNPA 4ADSG 2MYUA 2K87A 4KOAA 4O4IA 5B6PA 1AN9A 2C31A 1NOJA 1ZW6A 4MRVA 1N32B 1Z56C 3IHLA 4EF6A 4E14A 1UPTA 2OCKA 2HMTA 3T1QA 1ZNZA 1DO0A 4UD6A 2A6PA 3TVYA 5A4KA 1D9ZA 3H75A 1KA9H 1SHZA 1TKRA 4PCAA 5FBKA 4Q1EA 2H9YA 4WINA 3GAAA 2WVAA 1AGPA 2JGMA 4LRWA 3T9AA 5JCZA 5DNDA 2V8OA 1ORIA 2YFYA 5AI8A 2PN1A 4NMHA 3JQ7B 2B82A 2NVBA 4KI7A 2NX2A 2G1JA 4N18A 5GGYA 3DQQA 3WO1A 3I5XA 3FYUC 1WXQA 1SPXA 2FWIA 3VDMA 1MIHA 3CF0A 3ONFA 3U4DA 3ZQ6A 4D1YA 4H31A 4F9EA 1FPQA 1LDGA 2FPGA 2VZ8A 3KXDA 3V7FA 2FG7C 3ZK7A 3AJDA 3RK0A 4BN4A 1CUUA 5ICCA 2CLCX 1RKVA 3RS0A 3GEDA 3LVRE 1T4DA 4J8PA 2WSYB 3CQ9A 4TQGA 5CYOA 5G41A 1W85B 1I6LA 3B1YA 3RUEA 4NS1A 4AYTA 1TEZA 1OJLA 2IEIA 2Q6VA 2HMWA 2H3EA 3OIUA 2IYAA 4U2DA 1HE2A 2WWXA 1JS1X 1A2OA 1Z34A 3N1UA 5CVVA 5IYZF 3SK0A 1WAMA 2PGAA 2IYVA 4M4SA 4WDRA 4P31A 3M4XA 2C98A 4INPA 3BM5A 5EXPA 3A6ZA 2VF5X 1GXSA 1OBOA 2D7JA 3OWHA 1S5PA 4AN4A 5LNK1 2XOKD 1WRBA 2BM9A 2RGDA 4NCNA 2C2ZA 1YS9A 3Q0TA 1T13A 1P7ZA 3I1YA 4PGGA 3OKAA 4ZAZA 5KQPA 3FDFA 1FP7A 3ODPA 3R6LA 4HFJA 1XTUA 1GDHA 4XTCS 2P9TA 2PFSA 1CUZA 5E8RA 1XOIA 4F97A 1OFUX 6CHYA 2VYFA 4PGFA 3GJ0A 4DLTA 4KH0A 3WRWA 3CZ4A 1FJHA 4F96A 2NMVA 3NRJA 1MEEA 1JKIA 2CZCA 4QDOA 4QXMA 4RQTA 5FTJA 5JNUA 3GJZA 1JXMA 2V9ZA 1H23A 2VOJA 1E96A 2H1IA 1SKYE 4RVOA 3NRBA 2FQ1A 1NQXA 4OXYA 2GCEA 2C2MA 3IE1A 1PG5A 5AQEA 1UC9A 5HIAA 2FFBA 3RRFA 3VYTB 1FBTA 3FD8A 2GBFA 3QLVA 3A37A 1WZEA 5JNTA 3PXBA 1Z4JA 3DUFA 2IY7A 3I5MA 3L1UA 4KDCA 3PP8A 4JD5A 4LZNA 5ESWA 4F12A 4WXRA 4F5WA 3F7NA 3I23A 3QWFA 4N39A 3FVWA 4CZ2A 4D8YA 2XECA 3D0RA 3DL7A 1ISIA 3K9BA 4DQDA 1N0HA 3NBQA 3LY8A 4ENRA 2GERA 1L4UA 4GX1A 4B75A 3DGEC 1T15A 1LSSA 1NMZA 1CQXA 2HF2A 4ZO8A 4C7MA 1P0CA 3R4VA 1M8KA 1QZXA 2WW8A 3AK4A 3ESZA 3NG1A 3D0QA 4GBGA 3WYBA 5AR1A 1V9CA 1V3VA 2CL6X 1MF7A 2VSYA 3H6KA 3FA2A 2ST1A 4FHFA 3RU9A 3EQ7A 3VC2A 4RORA 2H4WA 3ITEA 4AO8A 3VQTA 4DCPA 2MIIA 4UHDA 4YREA 5DH9A 3L0PA 1OYWA 4PC2A 3TFWA 4XUGB 1MRSA 1XK7A 4PV7A 3K8YA 1Z74A 2CVPA 2W6ID 4KAAA 1ESZA 1FLVA 1FRFS 3W5SA 4B4OA 1JB1A 2GM3A 3IJ5A 4EP1A 5FQOA 4U7DA 5IZCC 3KKKA 4YGXB 1RZUA 2HWXA 4Q19A 3NPAA 1P77A 2WAXA 5IS2A 3ORYA 2OXRA 4IOKA 4MYUA 4R68A 3O83A 4QODA 2EDAA 2BSXA 1NZFA 3K53A 1YD7A 2R7KA 1AMOA 2HEIA 5ERYA 3QW2A 2RD2A 4INAA 4PLCA 3ELDA 4HZIA 3P2JA 1RMYA 1KPIA 5AW8A 3CSSA 2FTKE 1NUHA 3RS3A 3IP1A 3Q3VA 4DF3A 1QHHA 1P9LA 2JGDB 3WGHA 1NUSA 3DF9A 5E6RB 1DJOA 3B1WA 1K98A 3AP3A 3OTIA 5K03A 3GC6A 4LKRA 2Q1UA 3JVUA 4BNDB 3V4LA 4DIDA 3H42B 1H05A 2G40A 3ZIAA 1UBRS 4QFCA 3SJZA 3UV7A 1ULTA 3EIFA 4OKIA 4DILA 3GMTA 4FYXA 5TVGA 3KOUA 3BMCA 3PCTA 4UZSA 4PCLA 4CV0A 3VJRA 4M87A 1NUUA 2QN3A 3C14C 3F90A 4FHDA 4ARZB 2H54A 1YE8A 3KP1A 1U2QA 1ZG3A 4OHKA 4C88A 3TUIC 2ZR7A 4G5FA 5F2EA 1U8UA 2JLXA 1TAUA 1CEQA 3GNQA 2P2LA 3HBJA 2ODWA 4Z6KA 3L06A 4HLDA 2BMAA 2CWDA 5IH3A 3SD7A 2BM0A 2XADA 4WHMA 5FF9A 3ZY2A 3W5VA 5JSHA 3U7GA 1RRCA 2VBGA 3GDGA 3GFGA 4HYQA 4K7JA 4G0VA 1QFJA 2CWWA 3QEJA 4Z4FA 1IULA 2JAUA 5AUNB 1CJUC 1LTHR 3AVQA 3FTCA 1TYBE 1M8FA 2ZIGA 3HWX1 5DHAA 3M6UA 5I9SA 5JFGA 3RSGA 2BFMA 2ZUDA 2QMOA 3EVEA 3HV2A 5AK3A 1ICEA 5LOVF 3TJZA 3TG8A 1YVPA 4FS3A 4XXHA 4QJ4A 5IMBA 1JWBB 2Y0CA 4B6QA 5T7BA 1XGKA 1QP8A 1SMKA 3CWZA 4XB6B 3WL3A 2VPXA 4EATA 4YAJA 1G1MA 5E38A 1HGXA 1M1NA 1M1UA 1YZLA 3BJMA 1GPJA 2OV8A 4JT9A 5FLEX 3DNFA 2GCIA 5HIMA 3Q8MA 4FMDF 3NFRA 1D0IA 1K89A 3EGVA 3ILYA 4FFPA 5T6MA 2B3DA 3HPQA 3NYIA 2FPMA 1JXOA 1QXSA 1FOEB 2BP7A 1MX9A 1SZCA 1YRWA 2A7XA 2SCUB 2X8BA 3CEHA 4L16A 3SKVA 3NXSA 4DR1B 1AM4D 3DZIA 4HPWA 4GZLA 2WHYA 4I6EA 1MOPA 3HMQA 3RIXA 4OXNA 3UM9A 3NETA 2G72A 3AHEA 3WGKA 4TLAA 1OI2A 2C2OA 2G4VA 5K0TA 5L8VA 2O8DB 2H3HA 1GYQA 2V6IA 5KNCH 1MABB 1W8IA 4D6XA 1Y81A 1MDFA 2GYWA 2ZOSA 3N5KA 4AQDA 2FJPA 1OT3A 3K0KA 1QG4A 2MSDB 4NJEB 4NVRA 4AZ0B 2GA9A 3HCNA 3OQOA 3OPNA 1M8PA 3C1TA 1BU5A 2OGTA 2CFOA 1LX7A 1QK4A 3BQ9A 2FSUA 1MC8A 4BX0A 4RQUA 4XEUA 3WA7A 3WKBA 1KEWA 2G07A 3SYRA 3V1NA 5EJAA 4BVLA 2GCOA 2JHFA 2W2XA 3IMCA 4QOIA 3UG7A 5LMCA 1E0KA 1T9ZA 1Z7YA 2XB2A 3RS4A 2XCIA 3LTEA 1OAKA 4G67A 1O57A 2DHEA 4K2AA 1FTNA 2HPVA 3VZPA 4CT5A 1YCGA 1P0FA 1A82A 2N42A 2RGWA 4B7CA 3CBQA 4XDHA 2P6PA 1Z5NA 2IPMA 5HGXA 2POCA 2XTAA 3NQ41 1YRBA 1T0HB 2ZK7A 2E4UA 3COWA 4LOAA 3M6WA 4JYPA 1AV7A 3RF7A 2UYOA 2R65A 4TV8F 1X19A 1FSSA 4N8EA 3WXMA 1SC6A 3WGVA 4YCCA 1CTQA 3B3FA 1DKUA 1C5KA 3DFFA 5CYFA 2AOUA 4KN8A 3U7QA 4BZPA 4R1PA 3VR3D 1EFDN 4R05A 3VOBA 2QRGA 4MVJE 1MH9A 1DAPA 5GZ1A 3O47A 1LW7A 5HG0A 2Y05A 3DAYA 5IH7A 3U61B 1IBMB 3N2GB 5CW2A 3WAKA 5C35A 2C2HA 4JL8A 4RDXA 4HQRA 5LP6A 1L5SA 1VI6A 1C8LA 2YN4A 3FGNA 3JR3A 3PHIA 3UXMA 2ZATA 2AOXA 1N2JA 4E08A 4DCSA 1OBVA 4AD8A 4FFDA 521PA 4F6CA 4W5OA 3OZCA 1HYGA 3FHJA 1BMTA 1ES9A 1VBKA 1WUKS 3D2BA 1BMDA 4B48A 2R6HA 4QM7A 1H2AS 1MHPA 5KCMA 1CNMA 4QDTA 1GGEA 3AR7A 3D3QA 1F5SA 1AKWA 2ALJA 4IICA 2Y71A 1KE2A 1Y7IA 1C3OB 5J2UA 4KWEA 1AURA 1PFGA 4BMDA 1HDCA 3BREA 2MSKA 3HXPA 3RWMB 2XYVA 2OAGA 2RARA 3QVLA 5L3QB 1UDCA 4HQOA 5DMHA 2A9KA 5G0VA 5UKDA 1M33A 4QOGA 5TQ2A 3C5HA 4IWNA 1L7RA 3DBRA 3UA4A 2CNOA 4IUYA 1EFUA 1DDOA 3DBLB 2V9CA 1H93A 1NXPA 1T8SA 3PPYA 4MWTA 5CEJA 2I65A 3VDNB 5JRJA 1FVFA 1IPEA 1N3BA 4V0RA 2XQKA 3RVPA 3MINB 1EIWA 5DBIA 1HE8B 3C70A 1WKBA 3Q88A 3VBCA 2FG5A 4EB6B 4XD2A 3KE9A 3AEXA 5HWSA 3NH9A 2NZYA 1XMQB 3AVWA 1YUMA 1XZAA 4XR4A 3H2KA 2VT6A 1CY4A 2R8YA 2Q9BA 5C8XA 4H9GA 4WLUA 3HYNA 1OH7A 1BH6A 3WNQA 1U0BB 1Q1GA 4C76A 4Q02A 2D06A 1F60A 3Q98A 4XGNA 5IJ0B 5KKCA 4DR6B 1KVTA 4I4LA 4MSUA 5SY4A 3S1LA 2EFJA 1FW6A 2XQVA 3UAYA 4YV0A 5DSXA 4N7MA 4MP8A 4BQEA 2VNJA 2HRBA 1A88A 3S99A 3RFVA 5IK2D 1Q20A 5KYXB 4X20A 2FN7A 1HDEA 1HLPA 1SULA 1IHUA 2GZSA 3JQPA 3DE5X 4L3OA 4P86A 5EN4A 5K3SA 1PP4A 5T6BA 1V95A 3LPCA 4E5SA 2WF9A 1F0KA 3JRNA 4XQ0A 3HR7A 1Z2EA 2V7GA 2ZCUA 2R48A 5KVSA 1GRRA 3CRRA 2Z4RA 3R0IA 1CSEE 2AL7A 4QTYA 4KNVA 1KBZA 2ZVJA 1BRMA 3H8WA 3HP1A 3HWWA 3OZIA 4L0DA 5LR6A 3CF4A 4D99A 3O4FA 2Y92A 1RXUA 1NQTA 4X66B 4OD0A 4JI4B 4QHYA 1T6BY 2RHRA 2VDOB 2ORIA 3SCZA 1BRTA 1PJZA 3GGGA 4ZO9A 3WK5A 3ENNA 4BPRA 1J9GA 3IIEA 1Q0SA 3BTVA 3AZPA 4JUCA 1VJDA 4I4IA 4LXHA 3V32A 1FYVA 1VFPA 3HLKA 3ZN2A 5EGNA 2WDZA 4BOYA 1U7WA 1I2AA 2QD1A 1L4LA 3M6LA 3U44B 2V7VA 1J0CA 4KWHA 2O1SA 1SUIA 3MWFA 1PL7A 2Q4DA 2ZJ2A 4O4HA 5AHOA 5DCLA 5HQ3A 4JUDX 5H68A 1KGDA 1C9YA 5AM5A 4ZAYA 1YDEA 4IFTA 4DIBA 1W4ZA 2AUNA 4YRQA 5LIRA 4ZEOA 1FJGB 2DWPA 1G8KA 4B6JA 4UE6A 3K9GA 1OBHA 4MB6A 4BGVA 1BD4A 4PAOA 3R0XA 4FYIA 5A03A 3IIMA 1KYZA 2GILA 3AJRA 4LZJA 2A9FA 4G86A 1B0ZA 4A3SA 3QKWA 3K20A 4EKNB 4ML3A 2WTUA 2V58A 5KBYA 5K9ZA 1JHMA 5EJMA 3EIUA 2GBCA 4XSHA 1KYXA 3MJFA 4YI5A 4F4FA 3EAGA 3MN1A 1KZGB 2KW5A 1YJXA 3TRHA 3CZRA 5DMXA 1A8UA 3EZ7A 4R0VA 1NVWQ 3SHTA 1ZD1A 3UWOA 2ZUEA 1FP6A 4DCNA 3NBZC 5AW4A 1INLA 1WY7A 1H94A 2B99A 3WGJA 3CUEF 1QLWA 4HDQB 1DP4A 3LIIA 2B0JA 3K05A 1PIWA 2E6KA 2ERXA 2Q6KA 2PRSA 4HP8A 4ZO7A 1TZMA 5I7WA 1ZVQA 2XGJA 3NTUA 4H2DA 5I5GA 5B1YA 1QHGA 3G2MA 1KQOA 1Z9BA 3DB1A 2PWAA 3D4OA 5CJ2A 4EDHA 4IIHA 1GGNA 2VEDA 3LUAA 2PX5A 2XYRA 3WDMA 5TS3A 1E2QA 2JAXA 3JVEA 5M5BA 1JHAA 3OZGA 3UNXA 1OXVA 1AG9A 1VG0B 3AONB 2GO7A 3BB1A 4Z9FA 4DIUA 3OJLA 5KYYB 4FD3A 3Q7EA 2F1OA 1TA4A 3DV2A 4WZBA 4X3PA 5H5JA 2BZ1A 3S6JA 2W2LD 2GD6A 2A1TR 3Q8KA 1E5TA 4EKIA 4F3YA 3FAKA 2D1RA 2GCNA 2JS7A 3OCVA 3PFGA 4X8LA 3RC9A 4BFWA 1AO3A 3EWIA 5AVWA 2DHQA 3MB5A 3S27A 1OXBB 2F3SA 1NE2A 2FMTA 2C4TA 5B2EA 1IY8A 1MVLA 4YBRA 1UKVY 4OB6A 4ATNA 1VYUA 4JK3A 3TJMA 3WS7A 3ZYCA 3DZ8A 3NR2A 1N34B 2HADA 1CR2A 1SBTA 1QFXA 3IQZA 1L5OA 2PSJA 3B7WA 1IRIA 6PFKA 3PQEA 1BC5A 2NU6A 4NCJA 4TL6A 1GQOA 3U26A 2H9IA 4BUCA 3M6MD 5EUQB 1EA7A 3C24A 4KZKA 1P7YA 1U2SA 3UCFA 4J1QA 1DO2A 2G5GX 4AXBA 1PV2A 2HIAA 2VH2A 4K1XA 5FFMA 1E4OA 1U4SA 5E6SA 4E5VA 2BEWB 3CO0S 5E2AA 2QTTA 4AJLA 1YDWA 2FPUA 2Z9BA 4K86A 4I4TF 2QN6A 2E0IA 5HW0A 3AVXA 1NIPA 4JBWA 3SZOA 1A9PA 1IZ0A 3VHLB 4Q4JB 4LHSA 2BKVA 4NNJA 3IO3A 4I5GA 3ND7A 1E9VA 2X3FA 4YYEA 1UJ6A 1NJ6A 2I2BA 4YCDA 5ECWA 1NPYA 1QHFA 3E4DA 1J1ZA 2ZT5A 1EX9A 1BQ3A 2GTHA 2CLMB 3RBZA 4B34A 1CXZA 5I7AA 3HGTA 4MUXA 3NJ4A 3C5WP 3TL3A 3N87A 3GT0A 4D9FA 5BSHA 2PGOA 1Z8NA 3H5AA 5TEVA 2HCFA 3ZGNA 2HF9A 1IHOA 4UXJA 4GQBA 3UPUA 3VX3A 3C87A 2NACA 4OFBA 3NAZA 4ARSA 3GLFE 1Z68A 4R6WA 2IELA 3COJA 3V97A 3G8DA 1L9KA 4BYGA 3X44A 1ACJA 4KODA 4IHJA 3GCZA 3VAYA 3A9RA 3KR0A 5AM3A 3G0IA 3QUSA 4MV9A 1WZUA 4GECA 3V1YA 1P44A 4GBJA 3U3OA 3HKBA 1NG9A 4O2AB 2V6JA 2ZKLA 3IQHX 4JU9A 2ZI4A 4H7PA 1EGHA 3F1KA 4PR0A 2A9OA 3SVZA 3K5PA 1RXYA 4AY3A 1JA9A 3T9EA 4YJGA 4DA6A 4GM0A 4EUHA 3DLHA 1E4EA 4LAFA 2JCSA 1X8LA 1IQRA 2W6MA 2Z8ZA 3CLRC 1AQLA 4UXIA 3MIZA 5B2ZA 1CEEA 1RAAA 2YY6A 4G1VA 3D2LA 4M1OA 1U1DA 4TMZA 1XCPA 4ZHQB 1K5DA 5A7FA 1VE6A 2YIDA 4DJ5X 1YGPA 4V2IA 3TSWA 2RKWA 3EOAI 2Z5LA 4Y2TA 4ETIA 4L73A 5CNMA 4H6VA 1RJ9A 2A9JA 1HKUA 1PGNA 1GQRA 1R4NB 3OFVA 3LQ2A 4G5SA 3IHWA 2B8WA 2XXJA 3C4JA 3VSEA 1HWYA 3I0ZA 5B1HA 2H08A 4INJA 3SE7A 4EKEA 1X8XA 5EMMA 5GM2A 1YR9A 3L41A 2R4QA 5DBHX 3EXHB 1GA1A 3ZEAA 1F12A 5E1DA 2I4TA 2DUUA 4S0XA 2F9LA 3OOSA 3W1VA 5ADHA 2ZKIA 4CL8A 3A25A 3QI2A 2WWTA 3QY9A 5AESA 2AZMA 1TK2A 1MOQA 2EX1A 3AFGA 2J0UB 3IQWA 5LLDA 3UAZA 2MYNA 4HGNA 1QQ7A 4IXDA 2C3UA 3N0VA 4Z8XA 3I52A 5CFPA 3NAMA 1RAIA 4TKMA 5CEFA 3CISA 4AX8A 3ZY4A 1Z4KA 1S01A 2N75A 3E9NA 3O26A 4N0PA 1JLRA 1ZY2A 4LJ9A 4BKOA 2X2PA 2JI4A 3LHKA 3SDBA 3VR0A 5E3HA 5LQNA 5IDXA 3FWNA 3B9BA 2I76A 1GCGA 2Q6TA 4Z4EA 2QRVB 3DC7A 4X91A 2QR3A 5CLLA 1SEVA 2EKBA 3IOMA 1AQIA 4B7AA 3OZTA 4MS3A 5CX1A 3OJCA 5E7IA 3NFYA 4TZKA 4CM3A 1ZX1A 2A1UA 2VWQA 3A4NA 3E6AA 3LUFA 1L4MA 1C0PA 2GBLC 2J30A 2Z1DA 5ADWA 1O2DA 1J6UA 5B58T 4UATA 3ANSA 2GS9A 4FGWA 2R7AA 5JSZB 4R2HA 3BRCA 1BQ4A 1JLHA 1NNUA 4I8DA 2C9DA 3VBEA 4ZKEA 1YZGA 1THZA 3RS8A 1K5PA 4G0UA 5AJYA 1LWNA 2JG3A 4CQMB 3T3IA 2R8BA 3KLBA 2BMEA 2H57A 3O91A 3D9QX 4GAEA 4WD3A 3C7CB 2VKTA 3HM2A 2Q21A 3M81A 4N5IX 1EH5A 4OLHA 5EVJA 4QVKA 4XUDA 3WRVA 4ROTA 2NO5A 5DK6A 1CS0A 3TNFA 1L4KA 2RSLA 1ZJYA 4EG3A 3HNPA 1JAXA 3E5MA 2R6AA 3DMYA 4HDSB 4CLRA 1ZBQA 4C7KA 1ORWA 5JEEA 2WJJA 5COAA 3SBXA 4ZTZB 3H2IA 4ZIRB 1S89A 2Z3ZA 4HJRA 2ACVA 1EK2A 1RMQA 1UJ2A 3PEEA 4WFQA 4XDZA 2BBTA 3ETGA 5IEJA 1UXIA 3EF3A 1OV4A 1E2PA 1E77A 3GRPA 3G5UA 4L8YA 2WVJA 3L7MA 4M55A 1Z0DA 3R23A 3DEZA 1VCHA 2IYPA 3GGPA 1HMPA 3JVDA 1UMBA 1JV2B 1TVMA 2GETA 3GGOA 3QWBA 3ECSA 3S2IA 3HUTA 1VG1A 3D3WB 4CIWA 2DEUA 2C61A 2VQSA 3H11A 1YDMA 2R44A 2QJOA 4JLDA 4ZVSA 4YRMA 3W2FA 4EX6A 3IKLA 4BMXA 4O4JB 3KZMA 3OZSA 5FPKA 1R50A 3O31A 2G3YA 1UK8A 3EQ8A 1I94B 2IITA 1VRCA 3UMBA 3AUFA 1DQSA 2MWMA 3H9QA 4YPFA 1TVEA 2PANA 4C7VA 4YV7A 3UH0A 1Z12A 1S2IA 2CCGA 2Q3HA 1KO7A 3FN4A