2NU7A

C123as mutant of e. coli succinyl-coa synthetase
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
287
structure length
287
Chain Sequence
SILIDKNTKVICQGFTGSQGTFHSEQAIAYGTKMVGGVTPGKGGTTHLGLPVFNTVREAVAATGATASVIYVPAPFCKDSILEAIDAGIKLIITITEGIPTLDMLTVKVKLDEAGVRMIGPNSPGVITPGECKIGIQPGHIHKPGKVGIVSRSGTLTYEAVKQTTDYGFGQSTCVGIGGDPIPGSNFIDILEMFEKDPQTEAIVMIGEIGGSAEEEAAAYIKEHVTKPVVGYIAGVTAPKGKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGEALKTVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Participation of Cys 123alpha of Escherichia coli Succinyl-CoA Synthetase in Catalysis
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ligase
molecule keywords Succinyl-CoA ligase [ADP-forming] subunit alpha
total genus 108
structure length 287
sequence length 287
chains with identical sequence D
ec nomenclature ec 6.2.1.5: Succinate--CoA ligase (ADP-forming).
pdb deposition date 2006-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00549 Ligase_CoA CoA-ligase
A PF02629 CoA_binding CoA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 2nu7A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2nu7A01
1ML3A 4DMLA 4CMHA 2X9NA 2PTGA 4UUMA 5KWEA 4TRMA 1B8VA 3AY6A 2PKRA 3INTA 2NADA 3BTOA 2GASA 4NBVA 3ZWXA 4B79A 3QY9A 4WASA 5JO9A 4CQLA 4DLAA 3E9MA 4BMSA 4O5OA 4PRKA 1PIWA 1GCOA 4ZN6A 1LTHR 2W2KA 4RVFA 3OECA 1TT5A 4AJHA 4FBGA 2DTDA 3BMCB 2XXJA 3DOOA 3W8EA 2I3GA 3QP9A 4CMKA 1WDKA 4RPJA 4JROA 4CUJA 1NYTA 4ITUA 3HNPA 3HWRA 3UCFA 3UVEA 2Y0CA 4OXYA 3U09A 3VVBA 3Q9UA 3I23A 4IZIA 1DEHA 5DCYA 5A02A 2WMDA 3WMWA 1BDBA 2NUAA 3UFXA 3F47A 4DVJA 5BQFA 2X22A 3GZNA 2BD0A 1U7TA 1WVGA 2X9VA 5IN5A 2Z1NA 1KS9A 4PG8A 4XYEA 1PZFA 2CVZA 4GX1A 1K5HA 4IJWA 5DBGA 3JQ6A 1R4NB 3ZHZA 5IZ4A 1H5QA 4NQZA 1SEVA 3K5PA 4L76A 3L6EA 4JIGA 4MIOA 1SAYA 5I9MA 4KWIA 3S8MA 1NQOA 5BSEA 4QUKA 1HDCA 2YY7A 4B3JA 2HO5A 3ZWCA 1XG5A 1IUKA 1VJ0A 3WGYA 3KRTA 1PU2A 4G2NA 1UZMA 3ZU2A 1CIVA 3U3XA 2IDZA 1WDMA 3V1UA 3E82A 2AXQA 5T67A 1JVBA 1NTOA 5TGDA 1LI4A 1NAIA 1BTOA 3GVHA 1HYEA 3H5NA 5JDIA 3AK4A 3RUEA 3QV1A 3C1AA 4J43A 5G4LA 1UP4A 3KV3O 4BNHA 4R51A 4PVCA 1E6WA 2Q99A 4CV2A 3H9EO 2WM3A 2FR1A 3BTVA 2YV2A 1YRLA 3TNLA 3INGA 6ADHA 4WUVA 1F12A 2PD6A 3PZRA 3M2PA 4I5EA 4ZQEA 4B4UA 2EGGA 2HU2A 5BSFA 2Z1MA 1MX3A 4PLTA 4EBFA 3ASUA 4E4YA 5EJ2A 3JV7A 3V1YA 3WNQA 4XGNA 2D8AA 1YKFA 3AUSA 4B7CA 3PLNA 3ANLA 3Q6IA 4ROSA 3G49A 3QJ5A 1AHIA 2YDXA 5L9AA 1N9GA 4O59O 1B2LA 3RFTA 4W4TA 1CYDA 5A03A 4NBWA 3ZN2A 3I83A 1UZNA 1PS0A 5G0SA 3HB5X 1M6WA 4OOFA 1JQBA 1EEHA 2J3KA 3S2GA 1KBZA 1NPDA 1Z74A 1ENPA 5DP2A 4U0JA 1P1FA 2VWQA 4BNNA 2JD2A 5JLAA 2QZ9A 1ZFNA 2A9FA 1AGNA 4P4NA 1EUCA 3ICPA 3VHRA 4CR8A 1TEHA 2C82A 3OEWA 4XRRA 2C07A 2X5OA 5F1KA 1C0LA 1WW8A 5IG2A 1P45A 1E3EA 1LUAA 2PY6A 3GG2A 4KOAA 4DMMA 4YJFB 3ZWAA 2O7QA 2GYYA 1DC3A 4WPGA 2NTJA 2R00C 1RYDA 1LQTA 3HDJA 5H81A 5JCXA 2EKPA 4JGBA 2NACA 2D5CA 4II2A 4MVJD 4BNJA 2JCYA 3PDUA 3EUWA 3TZCA 4DREA 2FZEA 2NLOA 1BVUA 5B37A 3WJAA 3DZGA 3PHHA 2AA3A 3VH3A 5TJ9A 4D79A 1LDMA 1ZIDA 2TMDA 3G1TA 5DOZA 3DBRB 2E6UX 2AEFA 4X54A 4DQUA 4Q3AA 3FPLA 2HDHA 3U62A 4YT8A 4RVGA 4MPDA 3BMOB 5CAEA 5DNAA 2DBVO 1NBOA 3RC7A 2DM6A 2AHRA 4XR9A 3VH2A 4BMNA 1BW9A 4YAGA 2AG8A 3D64A 3FCOA 3PQEA 3WX0A 1P1KA 2OP0A 1IZ9A 1UXJA 4P4LA 4R68A 4Z0TA 3MCVA 1R4MB 4LSWA 4P22A 4YR9A 2HQ1A 1E6UA 1DBVO 1YQGA 2IEDA 3B1JA 4XZ3A 1BSVA 4CLEA 3DWFA 4I1IA 5L51A 4EUFA 2NU8B 1W0CA 3UUWA 4CR7A 1YOVB 3JD3A 5KJEA 1XSEA 2CVOA 1NP3A 2NVUA 3AUUA 4H3VA 3ETDA 1R12A 4Q3BA 4II3A 4UULA 1IULA 1LLDA 1FXSA 3I6IA 2Z5LA 2E49A 1JAYA 3PGXA 1T4BA 3T7CA 1IY8A 2SCUA 4WKGA 4TRJA 1OMOA 3C1OA 5I9LA 2OBNA 1NQ5A 1NVGA 4OMUA 3DEYX 4EUHA 3ZWOA 3EW7A 4B3IA 2YHIA 3ETGA 4J0FA 5COAA 4YEDA 4E5KA 3IAHA 3WOHA 3ZZNA 4ZQHA 4OGWA 4F3YA 4YBZA 2NU6A 2QIOA 2ZQYA 3QWBA 4CLRB 3ZI0A 5GZ3A 1EUDA 4NR0A 3RQSA 1E1MA 1PX0A 4BS9A 3FTPA 3OEYA 3K2BA 4IIVA 2X9GA 3AM5A 1Q0LA 1ARZA 2HKIA 1ZJZA 1U7HA 3GPDG 1GUFA 2NSDA 4TKLA 3MOIA 3AFMA 2FPPA 3K8ZA 4F46A 2EJVA 4W7HA 3INRA 4RPGA 4PVDA 2G1UA 3WTBA 2BRUA 3LYLA 4ZHSA 4J1NA 1O94A 1PGQA 2PD3A 2X23A 2BFAA 4BNVA 1MFPA 4TSKA 4MVJG 2YUTA 3LLSA 3K2EA 1PTJA 4HFMA 4CLHA 4CM4A 5J23A 3KOUA 3JQCA 3FHLA 3V2GA 4FDAA 3RD5A 3OJOA 4C4OA 1CERA 3DZBA 3JQEA 4JP3A 1QYDA 2YQ5A 5C7OO 1LC3A 3GY0A 1A7KA 4EEXA 3PJEA 4OHUA 3MTJA 1C1XB 1UP6A 2WE8A 1KVSA 3I4FA 3PP8A 1R37A 3OBBA 3LQFA 4LCJA 4BO2A 2FPIB 1HZJA 2D1YA 1ZEMA 1HYGA 1CWUA 2ZIZA 4IS3A 4WCFA 3EAGA 3CKYA 3ZH2A 1H6CA 4YRDA 1U3WA 4O6VA 4FD3A 1GPJA 4L8VA 3MOGA 3OHSX 4DRYA 5L4SA 3OF2A 3Q1LA 3DBHB 4CM5A 1A9YA 1O6ZA 4QFCA 2V6MA 3HDHA 1S6YA 3PJFA 4YJGA 3GQVA 3PWSA 1N7HA 3E03A 1LRLA 1MV8A 1C0IA 1TT5B 4XIYA 3NUGA 2X7HA 3L6OO 5IXYA 2PZJA 4RPHA 1ONNA 2Q46A 3MJTA 3F5SA 4DYDA 4HXYA 3IIEA 2FRDA 3GRPA 1GZ4A 3B70A 4XDZA 2GN8A 4D3SA 3O4RA 2WD8A 1EUZA 1G0OA 1Y8QA 4E0BA 5EESA 1PJBA 1ISMA 1KOLA 1E3IA 1V9LA 4BNXA 3DZIA 3AW9A 3QWAA 4YJDA 1Y8RB 3W6UA 1E7QA 4CQLB 1SB8A 2A94A 3NYWA 3M6IA 1SCUA 1M2WA 3V2HA 3WQQA 4IDGA 1RPNA 4IDBA 2CDBA 3H9GA 1DPGA 5TF4A 3WWZA 4J1QA 3SC6A 2UUPA 1D1SA 1P31A 2NQ8A 1HE2A 1FMCA 4NPCA 4WJZA 2ZKLA 4DLBA 3RROA 1PS8A 3GEDA 3KYBA 4KDFA 4XIJA 4O1MA 4A0SA 1OC4A 3RUAA 4R3WA 2YDYA 3NTRA 3QVOA 3WYCA 1PQWA 4JX8A 3L77A 3WFJA 2DVMA 2Y05A 4LMRA 4AJLA 4E6PA 2CDAA 4LK3A 1WP4A 3VDRA 4EJ6A 3RUFA 2E37A 3B20A 1NNUA 3RBXA 1HSOA 4JK3A 2OL4A 1CJCA 3GHHA 1WXDA 2DFVA 1MUUA 1R0KA 1I24A 2EJWA 4Y6RA 5T6BA 1KC3A 5JW6A 3P2OA 2O3RA 1XU7A 2B5WA 3EHEA 3S55A 1QXSA 4CMIA 1D1TA 4J7XA 4WLOA 3WFIA 3VKVA 4B7XA 2JHGA 1HDGO 4NIMA 7ADHA 1E3JA 4GMGA 2BGMA 2RH4A 1LX6A 3UXYA 1ZCJA 5JAIA 3X2EA 3NRCA 4KP7A 1KVRA 1X14A 3TL2A 5F21A 1E3WB 1LDEA 5EMHA 2P9EA 4BO1A 3FBTA 3QVWA 2FPPB 4G81A 5A5FA 3FBGA 3GVXA 4UAGA 2AMFA 1U4OA 2RIRA 3C3XA 1VC2A 2FP4A 2WTBA 1YJQA 4YT4A 3IUSA 4XWYA 4Y8VA 1JU9A 3KO8A 1I3MA 4W9NA 4MVJI 3VVCA 3WGGA 3R3SA 5IZCC 3TWOA 4YB8A 5JY1A 4DIFA 3E6AA 2A4KA 2FR8A 2O4UX 4R01A 4RVDA 3ZW9A 3PIIA 1PL8A 4YVFA 1AN9A 2WSBA 1PL7A 2HMSA 4PIVA 4QQRA 3NT4A 3R6DA 1LXCA 2IZZA 4DWVA 3ABIA 1XHLA 1U9JA 3DR3A 5FF9A 4BNZA 3LF2A 4XRGA 3ASVA 4AJIA 1PJQA 3OIDA 2NU7B 4E12A 1U5CA 1H9BA 4YYZA 4KWHA 1IYZA 4L4XA 3VH1A 2VZ8A 1PGNA 4HNGA 1Y81A 3DAGA 1J5PA 1BXZA 4U6QA 5JXWA 3ZU3A 3IDSA 4DXHA 4YA6A 4XDYA 2C29D 4BIIA 3DZKA 4R5MA 1U8FO 2FPGB 3GN1A 4IINA 2GDZA 1VI2A 2AW5A 4N54A 1C1DB 1GYRA 3MWEB 1WWKA 1T25A 2P9CA 4DBVO 3UICA 1P74A 1R0SA 2VWPA 3L07A 4NMHA 4TRNA 4WNIA 3NJ8A 5JYEA 3NGLA 3DBRA 4Y6SA 3A4VA 5EERA 2J3HA 4E21A 1EZ4A 1LRKA 3E8XA 1ISFA 5K6AC 2YW9A 1XGKA 3O38A 2XF8A 1DHRA 2B35A 4FJ1A 4N5MA 4JQCA 4YAJA 5AVOA 3JQAD 4GWKA 5CFZA 4E30A 2BGLA 4RDIA 3E1KA 2Y0DA 4XYGA 1C0KA 2JJYA 2EG9A 2A92A 4I5GA 4WLVA 3VZSA 4CM8B 1DFIA 4GI2A 1ENYA 3G79A 5IFLA 2H9IA 4E32A 1PWZA 4I08A 4D0RA 5JDCA 1GADO 5TNXA 3VZRA 3OSUA 4MVJH 4WCFC 2EP5A 1Y5RA 1GEEA 1ZMTA 2W8ZA 5TX7A 5KJFA 4Y67A 4XEHA 2AE1A 2O50A 2DAPA 5IF3A 3JYLA 1CQIA 3NGXA 1BRMA 1E3WA 3TOXA 3V2UA 1R6DA 4MKRA 1U5AA 3PJDA 1QORA 3QHAA 1A71A 1VKOA 1LDBA 3LK7A 4AFNA 2G17A 4IIUA 1HDXA 5L4LA 3ZHXA 1U3UA 2Q2QA 2Y0EA 2P91A 1E0DA 3IOYA 5TIIA 1I0ZA 1WMBA 1K2WA 2ZB7A 1Z82A 1DIHA 4QFDA 3R0IA 3NTQA 4BB5A 2I67A 1TVEA 5JE8A 5EQDA 1OC2A 1H9AA 4O0LA 3GMDA 1BGVA 1NHGA 1U3VA 2PH3A 1VL6A 3GVPA 3SC4A 4MP6A 1ZVMA 1PL6A 1LBEA 1ZK3A 4NFHA 1H6AA 4WLNA 5C7IO 5B1YA 1JWBB 4IBOA 2I76A 2VWHA 1ZZEA 2GO1A 3VPSA 4FR5A 4FB5A 1X15A 1YB4A 3K96A 4ND5A 5KOIA 4J3FA 2DBQA 1HSZA 2FHSA 2I5PO 5G2OA 3WNVA 2X58A 1YDWA 3OA0A 1ISJA 3GNQA 4YQZA 5THKA 2ZTUA 4XA8A 3AUTA 2HAEA 3VTZA 1BVRA 3ADPA 3V1TC 3DMYA 3FPCA 3QWHA 4YAKA 4ONEA 5TT0A 3S2EA 4D44A 1E5LA 2OGUA 5ICMA 3TPCA 1PEDA 4KUGA 5LDHA 4KTTE 3WBFA 3KYCA 5FI5A 1JA9A 4MVJA 5B4VA 4PZEA 5KIAA 5FI3A 1YJ8A 4CMJA 1ENZA 4U5QA 3C7DB 4QT0A 1K6IA 3WGIA 1QP8A 1R0LA 3P5SA 3RC9A 4L0QA 3F6YA 4WK6A 5I7FA 2DLDA 1UZLA 3M1LA 4O63O 1Y6JA 2QRLA 4BO7A 4XQGA 3OIGA 1YDEA 5JMPA 4UEJA 5I8WA 4NH4A 4FOOA 4U0KA 1V3TA 1V3VA 2NVBA 2FZWA 2RCYA 5CPBA 4ALMA 1HT0A 4XKJA 3D4OA 3H5RA 2G5CA 4YJFA 4P8RA 5B4TA 3AI2A 3CE6A 3A28A 4R54A 4XB2A 3BMCA 4BKRA 2GZ3A 2FY8A 4BNUA 4Z9FA 4ND2A 2GZ2A 2H1SA 3JD1A 1P1HA 4HBGA 3SJUA 3ZGYA 3GC6A 1AXEA 4TZTA 3JD4A 4BNYA 4K1LA 4ESOA 3H4VA 4YRAA 4GAEA 3T7EA 4IXTA 3DC2A 1PJTA 3I6QA 1WPQA 4XQEA 4MO2A 4FIZA 1B8PA 1K6XA 2CMDA 3GOHA 3ONDA 3W4IA 2Q1UA 4IDCA 1FF9A 5HRUA 3GVIA 4A26A 1AE1A 5IZCA 4K26A 3UF0A 3RU7A 4ZU3A 3ONEA 5F1PA 1BG6A 1DRUA 2JAPA 1NQTA 2WYUA 3HDYA 4BGVA 3UKOA 2VHYA 4R16A 1NVTA 4NDNE 1HDYA 4HUJA 2JL1A 2NU9B 3BA1A 1ZSNA 1J4AA 1JVSA 3KLMX 4GBJA 7MDHA 3PQDA 4CL8A 2IYPA 2PH5A 4NK5A 4JBHA 4NU5A 2B37A 6LDHA 5MDHA 2PGLA 4JXKA 4PG5A 4UVHA 2VOJA 2AEJA 5KKAA 1UAYA 1YOVA 1EVIA 1NHWA 1OAAA 2B36A 5IDXA 3PHJA 5AXCA 3ROMA 2IXBA 2Q4EA 2VUTA 4JJGA 2VHZA 3VPHA 4W82A 4IMPA 1SEPA 4ND1A 3IS3A 1RM4A 5HBRA 2ZYDA 3ITKA 4DIBA 2QYTA 2GN4A 1F8FA 1EQUA 3W1VA 4BNWA 9LDBA 1DC4A 1MG0A 3AU8A 1DAPA 3FNHA 4N5LA 3TFOA 5T8KC 1T2FA 3KTDA 1GV0A 3KLPX 1GUYA 4UVEA 3I52A 2O48X 4QX6A 1I32A 3JQFA 4RVHA 3QIVA 3OH8A 4J16A 3PHGA 2B4TO 3C7AA 3AI1A 3D7LA 4CV1A 5G4KA 4DYVA 3GDOA 3C8MA 3DZFA 4AICA 5A04A 3A14A 5L4NA 2Q1TA 1Q0QA 5HM8A 5JMWA 3PLRA 5KVSA 3E5MA 3IJRA 3KYCB 1D8AA 3EYWA 4EUEA 4PZDA 3GEMA 2JD0A 5IDYA 3WS7A 1JAXA 3RUHA 4CQMA 3WJ7A 2AQHA 3Q11A 3H5AA 4AJJA 4GH5A 1VPDA 3GDGA 4YXFA 1DLIA 2E4AA 5L95A 1OI7A 1YXMA 3DXFA 1EUCB 1PJSA 5G4KB 3Q2IA 2D3TA 2G82A 4LW8A 4Q3CA 4AL4A 3L4SO 4RV9A 3RJ5A 1HL3A 2Y99A 4E5YA 2BFMA 1DJNA 4YACA 3ZNQA 2HMVA 4PG7A 3OQ1A 4IQ0A 2PD4A 4BL5A 5L45A 2IYOA 4DTIA 3D0OA 3WIDA 2FPGA 2PA3A 4INAA 1ZO8A 1K89A 4OIMA 4D7AA 1EK6A 3O03A 2VWGA 1TB4A 3T4EA 2W4QA 1E7SA 1Q7CA 3H2ZA 3PRJA 3E9NA 4GMFA 3GNSA 1LSSA 2EF1A 1O5IA 4KUEA 5A9SB 3PXXA 4R1NA 4FQ8A 5CEFA 4RPKA 4PCVA 3ZWPA 2EKQA 4M1QA 1TA4A 1Y5MA 3EK2A 3KYDB 3H9JA 4J91A 1YVEI 1NFRA 4AJ4A 3ANNA 5CAEB 4KQXA 1B8UA 2D59A 2Y68A 3OQBA 3D1LA 5LDGA 5G0WA 2P5YA 1L7DA 2V6BA 1QYCA 2JKVA 3G0OA 1E92A 4MKZA 1B15A 5FWNA 2PK3A 3SLGA 3PIDA 5JCJA 4DA9A 4W6ZA 3COSA 2VRCD 3DONA 3QE3A 3H9QA 4I9HA 4AJPA 4A73A 2PZLA 4BNFA 3I4CA 3UW3A 3D4PA 3PDJA 4U7WA 3EGOA 5DF1A 4TZKA 4DPKA 4E2WA 1XIVA 4D3FA 4WLUA 3ZV5A 1UXGA 4RF5A 2B83A 2P68A 1PJ3A 3AI3A 4E31A 1JKFA 1ISIA 3ST7A 4AVYA 4B3HA 2YV3A 2DBZA 4XD2A 1H2BA 2BGKA 3NDJA 3PWKA 1I30A 4ID9A 3GDFA 4R1UA 4S1VA 4K28A 1PJ2A 3EMKA 4BNLA 2ZYGA 2ET6A 3NX4A 5AOVA 3RUDA 5JO0A 3JYOA 3PFFA 2D2IA 2O3TA 4DUPA 4JLWA 1I33A 1R4NA 1X1TA 1EVJA 3JQ9A 3GRKA 2NU6B 1XU9A 4Y9DA 1Z75A 2VYVD 4GL4A 3LZ6A 3K30A 4GX0A 4IDFA 3W6ZA 2BFOA 1M67A 4EJ0A 4RQUA 2B4RO 1PGJA 1Q1NA 3N7UA 1B0AA 3TSCA 3GGPA 3PPIA 4TVBA 4YAIA 3MJSA 4D46A 3FI9A 2OBYA 4BB6A 3HFGA 2JFFA 3ONFA 1GFSA 1SZJG 3FWZA 3KBOA 3O9ZA 1ZBQA 4CPDA 1B14A 1KIFA 1EBFA 4IS2A 1OOEA 4RO0A 1YS4A 3ROPA 3C7CB 1HYHA 3D3WB 2ZB4A 2J5KA 1KEVA 2P2SA 1YL7A 1I3KA 1ZK1A 1C1DA 2IEBA 5JBIA 2YYYA 4PLZA 4LN1A 2XPCA 4N7RA 2GZ1A 2Q3EA 3KETA 1EE9A 1VL8A 4W9NC 2ZB8A 4BNGA 2V7PA 4GSKA 3JQ7A 1EUDB 1DIGA 3KB6A 1JLLA 4K6FA 3GNTA 4UUOA 1TT7A 3JYNA 1KY5A 4EYEA 3QW2A 4MOWA 4DPMA 1A4UA 2Y93A 3LLVA 2PLAA 4FFOA 4D42A 4FFLA 3RBZA 2HUNA 1W4ZA 2YJZA 1T2EA 2BELA 2ZK7A 2R6JA 3F1LA 4NFSA 3G1UA 2ZTLA 2NU7A 4YJGB 4MDHA 1DIRA 2AQKA 3OMLA 2PGJA 3JQDA 3KM0A 5AQ1A 2NQTA 1ZEJA 4LVCA 4WOKA 5C37A 4IMRA 1SO8A 2OO5A 3KZVA 3MJCA 2HK8A 5KNLA 5KTKA 2YHUA 2HMTA 2D5AA 4QTZA 4B8ZA 1MG5A 2WD7B 4YRBA 5KVCA 2ZQZA 3ROQA 4A27A 1ISGA 4EEZA 3GAFA 4HX5A 1SOWA 2X0IA 4HFRA 4TVOA 2D4AA 4PLPA 2NUAB 3UFXB 3RBVA 4XYMA 4RVUA 5K9ZA 3H9UA 1XWFA 4J9UE 3JQAA 4E5NA 3VAZA 4JJFA 4BNIA 4CLOA 4P38A 3DAPA 1EE2A 1D7OA 2Y1GA 2RAFA 5JAZA 3RIHA 3H7AA 3GA0A 3E5RA 2PGDA 2WWRA 3F46A 1JN0A 3WDSA 1GYPA 2GD1O 2IXAA 4DL9A 3EC7A 3QWFA 4W7IA 3SVTA 3W4JA 2FOIA 2YFHA 4HP8A 4CM3A 3AOEC 5DBFA 4NI5A 2OUIA 2B4QA 1Z6ZA 3IP3A 4EITA 3HN2A 4L9RA 5JNLA 3FNFA 4RCVA 2CZCA 4J0EA 2GN6A 5FYDA 4MJLA 3STHA 3GG9A 1DC5A 3BAZA 1FJHA 2PR2A 2BF7A 2CF5A 1DOHA 4PRLA 2I99A 5K6AA 1MXHA 4YWJA 1PJCA 2WE7A 1HE4A 3JTMA 5CHEA 3FNGA 4CMEA 2EW8A 3AWDA 2FR0A 2GCGA 1GU7A 2IE0A 4J1SA 4PLFA 1P77A 5A5EA 1EFLA 3PI7A 4BKQA 4BNMA 3MJEA 5DZSA 5BSGA 1MP0A 4LSMA 4J2OA 4WLFA 2DT5A 1RKXA 5CDSA 1LQUA 2UVDA 2DUUA 3AM4A 1QRRA 1U4SA 2I3AA 2EEZA 3Q2KA 1V8BA 3F4LA 2BLLA 2Q49A 1M66A 3K73O 4TMFA 4D0SA 3RUIA 2B69A 3UH1A 1PGPA 4WEQA 2SCUB 4LVUA 4RZIA 1ADGA 2GUGA 1YBAA 4WE3A 5L40A 4Q3EA 3R1IA 2F00A 2HJRA 4NJMB 5C3MA 3WWYA 1E1NA 1HE3A 3VZPA 1DIAA 1UAGA 1TLTA 2RHCA 3NT2A 3PYXA 4CMAA 4I5FA 4IPTA 2EP7A 1V0JA 4NJOA 2ZYAA 1RM0A 3UGKA 5ILGA 4BGEA 4PGFA 2CVQA 3JQ8A 3KSDO 4RLSA 5JPIA 4A5OA 3TFQA 4ZA2A 2A35A 3H3JA 1T26A 4JCOA 1KEPA 3ZWYA 5I8ZA 1Y9EA 5BSHA 5CDTA 3IKTA 2QG4A 3HN7A 2HLPA 3UCXA 4R5HA 4WLEA 3DFZA 4BOYA 1WZEA 1GR0A 5IAAA 2CF6A 1XLTA 1VL0A 1NWHA 3DOJA 5T5QA 4J1TA 3DBLB 4IDEA 5DDIP 1QG6A 2FMUA 4ZRNA 5KVQA 1DAOA 1JWAB 1PR9A 3JQAB 4IDAA 5DOVA 2EXXA 3JQBA 4ILKA 4ALKA 2X0NA 2I65A 2EWMA 1DC6A 4M89A 3RCBA 1RM5A 1F14A 1HETA 5DCWA 3D5TA 2QHXA 3JQFC 4ZJUA 1I8TA 1CETA 3GF4A 2NTNA 2VUSA 2WEKA 4NU6A 3WIEA 1HF3A 1NXQA 2LDBA 1KEWA 4OSOA 1E3SA 1FK8A 2I9PA 1E1KA 1B3BA 1HLDA 4Z0HO 3WBBA 1WZIA 2B0JA 3EVNA 2BHLA 1DB3A 1PQUA 5L7TA 3V8BA 1RJWA 2F1KA 4Z9XA 4CM9D 3BMOA 1KVQA 4I9UA 4JJIA 4KUHA 2POQX 3CUKA 3L9WA 1C3VA 4OL9A 3KVOA 4U8GA 3A9WA 3OM9A 4UVDA 3ENKA 2VCYA 4IY1A 3UHAA 4IXWA 1HZZA 1V3UA 3C85A 2EGHA 3MWDA 4RDHA 1B7GO 2HK9A 2JFGA 2HJSA 4NG5A 1WNTA 2O2SA 3ZWBA 5EPOA 3WGZA 3PWZA 4D3DA 4DQVA 2OHXA 3VPXA 1XR3A 1LLUA 5GZ6A 4IGFA 1O95A 4I8XA 2CSUA 2E48A 4MVJP 1SNYA 3PYLA 3U4HA 1T2DA 4Z3KA 1V6AA 1Q7BA 4XYLA 2DTEA 1XCBA 2DPGA 2NNLD 4M49A 1QR6A 4OOEA 5T64A 3RU9A 3WTCA 3JQBC 2C54A 3JYPA 4TWRA 2Q4BA 4D45A 3FRJA 2BKAA 4XJSA 2RBEA 4IDDA 3LU1A 4AJEA 4URFA 5F3RA 1HKUA 2JAHA 4NBRA 3BHIA 3ZWNA 1EFKA 1PZEA 4K9DA 5EIOA 1PZGA 5TS3A 4FJ2A 3JD0A 2Y67A 1ULSA 4ZVVA 2GR9A 2YFQA 3CPSA 4J4BA 1NQAO 1PZHA 2UUOA 4FFRA 4GX2A 1T4DA 1J6UA 2I66A 1E7MA 5F5NA 4EJMA 2O3UA 4OXKA 3GUYA 3I1JA 1IL0A 2IZ0A 2EHDA 1G6KA 1E7WA 4PFJA 3GAZA 5KJ1A 1GZ6A 3HE3A 1VKNA 1NFFA 2J3IA 2BI8A 1Q7GA 3ZWVA 2P9GA 2X8LA 5JSFA 4MIEA 3KEQA 3SLKA 5IXSA 5ILOA 4NJMA 4BHTA 4HNHA 4RLHA 4WNCA 4PG4A 2UAGA 4FCCA 3LSYA 4M87A 1ORRA 5A9SA 2GRAA 2HMUA 4ALLA 2W98A 2ZATA 3JQ8B 2ZJ0A 5ER6A 4FPXA 3I3OA 1U28A 2DFDA 1X13A 3G17A 1KYQA 1YBVA 5EN4A 2HCTA 4J7CA 1GTMA 3CZRA 4FS3A 4BNKA 4CQMD 5DT9A 3BIOA 3WQSB 1N9GB 3VDQA 4BO3A 3RAJA 2C0CA 3ON5A 4YDRA 2HRBA 5DN9A 1LDNA 1SCUB 1X1EA 1A27A 1P3DA 4KTVE 4J49A 3FR7A 4IM7A 4BNTA 2H63A 1A72A 3DL2A 2AEMA 2O23A 4RZHA 4MP8A 2AQ8A 3TL3A 1Q0HA 3CZMA 4QO7A 3RSHA 5JC8A 1ISHA 2HMWA 3AOGA 3RFXA 3BYZA 1HE5A 3TZHA 1NR7A 1XEAA 2P4QA 1NAHA 3DOCA 3VTFA 3QRWA 1X0VA 1BXGA 2R00A 3GVCA 4K6CA 3RUCA 4M55A 1I01A 3GUCA 3QSGA 5EINA 4NFYA 3LT2A 4DLLA 1SPXA 2C5EA 4S3MA 1EVZA 2Y1CA 5A3JA 1P44A 3RFVA 3O26A 5CG2A 3DHEA 1NFQA 1ZMOA 3MJ4A 4WOJA 4UREA 2Y1EA 2BFPA 1Y7TA 4MVJF 4PLVA 4BQPA 1A7AA 3DZJA 3C24A 3RC1A 2C7VA 8ADHA 4CMIB 5DCUA 5ENDA 4OH1A 5TLSA 1F0YA 1XYGA 4J6FA 3LC7O 4UVIA 4UUPA 2VT2A 4ZICA 3GH3A 3QWIA 4M54A 4BO9A 5JCJD 2ZCUA 3KEOA 5A1TA 3OETA 3PHLA 4GVXA 5KVVA 1D3AA 3W8FA 3CH6A 2X1HA 1ZH8A 1O89A 1UXKA 2JHFA 2WJPA 4E3ZA 3RKUA 5JAMA 2VRBA 5A9TA 1UXHA 3FD8A 5I7VA 1BMDA 3IC5A 5I9NA 1IHXA 4FOSA 4L4SA 1ULUA 2Y1FA 4G65A 3AY3A 1OFGA 1Z7BA 2Q1SA 4Q9NA 1P1IA 1QYXA 1R4MA 5ICSA 4CODB 5TJHA 3HFSA 5CDUA 3LT1A 2VOEA 2DTXA 3TOZA 1N2SA 4R41A 2DQ4A 5EL0A 2AG5A 4LGVA 3ZU4A 5I7SA 1E77A 3U0BA 4CMCA 2OZPA 1WDLA 4L73A 1LRJA 1YE3A 2W90A 4AJ2A 1P1RA 1R15A 3ROKA 2ZB3A 2OORA 5I7EA 5H82A 3IKVA 4ZGWA 2X86A 5A3VA 1QYWA 4JNKA 5BT9A 1GAEO 2X5JO 1PR3A 4OSPA 4H15A 2H6EA 1ZJYA 4PZCA 1K6JA 3AM3A 3WGHA 1LA2A 2CFCA 4RF4A 1QMGA 4HFJA 2QRJA 4R1SA 4HWKA 5BNFA 1DO8A 3EZYA 5ITWA 2FN7A 3NDIA 5K0ZA 2XAAA 1ENOA 4NBTA 4Y98A 4IZHA 4CV0A 1MC5A 2VZ9A 5HS6A 1KETA 4E2ZA 1UUFA 5G0VA 2LDXA 2Q2VA 3HQ4O 4BUCA 1H93A 2RH8A 3BXXA 3GK3A 4RQTA 2Q50A 1W6UA 3DHYA 4UUNA 1XELA 3L4BA 3ZV3A 2J3JA 3OJLA 1EK5A 1Z73A 4PLCA 5KJ6A 4YJHB 2P4HX 2Q45A 1T1RA 4WGGA 4CJXA 3MTGA 4W99A 4BKOA 2QYSA 1PJ4A 1ZXLA 1SOVA 4PN3A 3TZKA 3QVXA 3TN7A 1E7RA 5JS6A 3FWNA 1BXKA 1IB6A 3BMNB 3TDKA 3BMQB 2C59A 3KHUA 4XX0A 2ZTMA 3DMTC 5A4DA 1C14A 3KUXA 2H5LA 3HSKA 1T1SA 1X7DA 1JDJA 3E18A 5T57A 5GY7A 5C5IA 1VLLA 3CIFA 4CQMB 3HZZA 1L1FA 1UJMA 4AJKA 1CQJA 1NPTO 3GLQA 5IN4A 4B4WA 4R69A 2NVUB 4ZQBA 1AXGA 3NV9A 1UH5A 2P5UA 3PEFA 3LDHA 1YL5A 3Q3CA 3DBHA 4XYBA 3AFNA 1XKQA 3S2FA 2VNSA 2Y1OA 2Y66A 5ADHA 1KC1A 2O7SA 1LEHA 1YGYA 3B6ZA 1Z7EA 1LSOA 2V65A 5KCZA 1T24A 3OICA 2X5KO 4JBIA 1LDGA 2O3SA 3M2TA 4FW8A 4ZQFA 5H83A 4EI2A 5B12A 4HFNA 1ZXBA 1AUPA 3WXBA 3F9IA 2O3JA 4NHEA 4Z0PA 3HUDA 2GLXA 4MIYA 2J5QA 5LC1A 3IUPA 1N92A 4CM6A 3VKUA 1Y1PA 1GCUA 3OQ6A 3I9MA 4XR4A 1I3LA 5JFOA 1DHTA 1N1GA 3WGOA 1YO6A 2NM0A 3WGQA 1VJTA 4J2HA 3U49A 4CR6A 5CDYA 4YT5A 5L7WA 4A03A 4J4TA 1I2ZA 4DGSA 3ZWMA 4BQRA 2C2YA 4TQGA 1KVTA 3OIFA 4KMSA 1FDUA 2FWMX 1NWCA 3PHIA 2NU9A 1U3TA 2JFHA 3PQFA 1B16A 1DRVA 1LJ8A 3F5QA 3N58A 1K0UA 3GGGA 4E2XA 5U1PA 3H8VA 2WYWA 3TZ6A 1A5ZA 4YAEA 3V5NA 2JCVA 4AJNA 1IE3A 3JQ9C 3QVSA 4H7PA 3HB4X 4B4OA 9LDTA 4R9RA 1P1JA 3EZLA 1T2AA 3OP4A 4PLWA 2HRZA 3WSWA 3WMXA 1N7GA 4ND4A 2CUKA 2G0TA 3QQPA 4C7JA 3FF4A 3HJAA 1A9ZA 4CM1A 1MGOA 3LC1O 1UXIA 1IHYA 3H2SA 5COBA 2OXIA 1J49A 3RVDA 3ZNOA 3R3JA 2CDCA 1QKIA 5DP1A 5G0UA 1FDWA 1H0KA 3ZWWA 4A2CA 5T8KA 4JP2A 3SX2A 3ZNNA 5L53A 5C7LO 3L4BC 3NKLA 1JKJB 5U4QA 1M76A 4N18A 1CF2O 1JLLB 1HDOA 4CV3A 2B5VA 3RKRA 3NJ4A 4D41A 4OJNA 5G0TA 1BHSA 1NX6A 3FTNA 3U5TA 4B8WA 3Q0EA 1YONA 3FNEA 5TQVA 1UDCA 2QW8A 2VNAA 2VHWA 1VSVA 5AXDA 5THQA 1IPEA 3D4NA 2EV9A 4B4VA 3ETEA 1ZKMA 3KSUA 4TRRA 4CMEC 1CRWG 4KQWA 4WCDA 4IQ8A 2WDZA 1PS9A 2IRWA 3MZ0A 2CNBA 3T4XA 1GYQA 4CM9A 1M6HA 1QV7A 3FR8A 4FSHA 1IPFA 2FSVA 2NV6A 3BMQA 3U4IA 4YCAA 1LU9A 1YBMA 3K6JA 3UN1A 3M1AA 5A05A 4E33A 5TT1A 1GD1O 3ICCA 3DTTA 5ES3A 2EIHA 3DFUA 4Z6KA 3MWDB 3WQRA 4XX0B 1SMKA 2O3QA 2NWQA 2ZTVA 1YWGO 2OFPA 3P7MA 4E5MA 5F5LA 4RJTA 3RWBA 1BXGB 1D4FA 3H3FA 1E1LA 1ZW1A 4TKMA 5JAQA 1NVMB 3LT0A 4LISA 2PZMA 4L75A 3K31A 3QA9A 4GLOA 5L3ZA 4I5DA 3UCEA 1ZK4A 4HKTA 3TZQA 5JDCC 3ZHBA 1I36A 3RC2A 3I9JA 3G3EA 4KDEA 5ENVA 4RPLA 1YB5A 1GY8A 4FFMA 3W8DA 1B26A 2DU8A 1AHHA 3DDNA 4R4JA 1VJ1A 2PZKA 3U4CA 1NR1A 3OFSA 4B7UA 2XXBA 3LF1A 1E3LA 4GWGA 2YQ4A 1I2CA 3NTOA 1LSUA 1YQXA 4J90A 2VUUA 4E2YA 3B1FA 1OBFO 2QX7A 2PV7A 4Q39A 5HA5A 3JCZA 3DO5A 1ZSVA 3KXDA 3S2IA 1BDMA 2BMAA 2J5RA 3IQDB 4GLLA 3WLFA 4UEOA 1B3RA 1YQDA 2AQIA 3SEFA 4R1TA 2PNFA 1DIBA 5TSDA 4OYRA 1DFGA 3NAQA 4OO3A 5CG1A 1FDSA 3WG9A 4ALNA 3O8QB 1SBYA 4NK4A 1GQQA 4ND3A 3VH4A 4R3NA 1DFHA 1SC6A 4IJVA 4IQGA 5KKCA 2YHIB 4NNJA 2J6IA 1PJLA 3ADOA 1HDRA 1MB4A 3HADA 2CD9A 3A06A 4JN6B 3D3EA 1ZK0A 1HXHA 3CINA 3GHYA 4XJTA 4P4GA 1JKIA 3SBOA 5HWSA 2XOXA 1W73A 3DAFA 4CMBA 1P0FA 3F3SA 4L74A 4LCEA 4F6CA 1GV1A 4XB1A 2J8ZA 3BZUA 3KSZO 4RL6A 2DKNA 1WAMA 2NTVA 4GQAA 2IZ1A 4PG6A 1WMAA 3DQPA 3ITDA 3SXPA 3TJRA 3JYQA 3W4KA 1QLHA 4IGEA 1G1AA 4OQZA 2QZZA 4GPD1 1M75A 1CEQA 1DRWA 3LC2O 4Q3NA 1YB1A 1ONOA 3E9QA 2ILTA 3I9KA 1ADCA 1Q2XA 1DDOA 1GPDG 4Z3DA 3ZCXA 4WECA 4YTEA 4BO8A 1ZSYA 3MEQA 2VHVA 3WB9A 4CM7A 3JD2A 1Y9AA 3LT4A 4FN4A 5CDGA 4XGKA 4FFNA 1RWBA 3GFBA 3HG7A 4KZPA 3VPFA 3GT0A 4ZRMA 3ZU5A 1P9LA 1F17A 1JKJA 2D0IA 3ORFA 4RORA 2PFGA 5AXAA 1QLJA 1YL6A 4GVLA 4BV8A 4IUYA 3GZNB 4LRTB 3WSVA 4JBGA 5FEUA 5L7YA 4G5HA 3OJ0A 3DBLA 3RI3A 4A10A 3PZBA 1GEGA 3GFGA 5TC4A 4E5PA 2Q1WA 3IMFA 5JY6A 2UDPA 2GPTA 3AY7A 4BMVA 1X7GA 1N8KA 2BI7A 5CP8A 1JW9B 2DBRA 3BMNA 1A4IA 3WR5A 1K3TA 1MLDA 1ZK2A 1V35A 3E48A 3PJGA 1XQ1A 4HADA 1E6EA 5DULA 3JQ7B 3JSAA 2VN8A 3LVFO 1N1EA 4UEKA 1JTVA 3AJRA 3P19A 3PVZA 4YJHA 1C0PA 1I5RA 1Y8QB 1HRDA 2GGSA 2O4CA 5AXBA 1FDTA 4F45A 3DZHA 1GL3A 4OXNA 3KYDA 3MJVA 5KJCA 4DPLA 2HK7A 1O9BA 2VTDA 3L9XA 3I9OA 4PLGA 5IDQA 3ZNPA 2CY0A 3F1KA 1H6DA 5GMOA 3U4DA 3WYEA 1EDOA 3BTSA 1UDAA 3DHNA 3WLEA 1E7YA 4XCVA 1ADBA 1HDZA 1YH3A 2YV1A 1WLYA 5TRTA 4QSMA 5JC1A 1NM5A 4GKVA 3TF5A 3QLJA 1KERA 2HSDA 4OKNA 4CUZA 4BGIA 3EDMA 1EMDA 4FC7A 3UAGA 4MKXA 3L0DA 3K92A 2VT3A 4XQ9A 3PTZA 5LCXA 2C5AA 3I9NA 4HY3A 3WICA 3DB2A 4EW6A 1MC4A 1GDHA 3VPGA 1RYEA 4R9SA 3GEGA 4M86A 3CEAA 2NVWA 4CL3A 1LNQA 4IJKA 4FJ0A 4PLHA 4U6SA 1LLCA 3CSDA 4M8SA 4BKPA 3O8QA 2Q2WA 1LDYA 3WYBA 4AJ1A 3ZW8A 1GQYA 3HDQA 1MA0A 4GKBA 4F6LA 3PYMA 4YT2A 1PQPA 3JQGA 4EDFA 2VYVA 2GERA 4OKIA 4ALIA 1HEUA 1CDOA 2NU8A 1QYVA 2DC1A 2EW2A 2ZCVA 2E82A 2X0JA 1ADFA 4WEOA 3F4BA 3TQHA 1W8DA 4BO0A 5ITVA 1UP7A 1XQ6A 1U2GA 3NDRA 3GZ4A 4GX5A 8LDHA 3CMMA 2IODA 2EERA 2Z95A 4FC6A 1PSDA 4YQYA 2C2XA 2TMGA 1H2HA 1HWYA 2C7GA 3CXRA 3CMCO 4LMPA 4J9VA 4J7UA 2DPHA 4YPOA 3H6KA 5ER9A 1F06A 1S7CA 1QV6A 5BNIA 5FFFA 1DSSG 4GGPA 2GF2A 1J0XO 1X0XA 3DBVO 4NBUA 4DQXA 3OA2A 1EVYA 3Q9NA 2AE2A 4HV4A 4AJOA 3HHPA 1EQ2A 4RF3A 1LSJA 1HLPA 4BV9A 2OP1A 1MXFA 1CQJB 3X2FA 4TROA 2VYNA 4BVAA 5IJZA 2V6GA 2WD7A 3ULKA 2GSDA 4MP3A 1KVUA 1VSUA 4BGUA 2FSSA 3BHMA 5BR7A 3DMTA 4RGBA 1PWXA 4LRSB 4I9NA 4DBZA 1ZUD1 4UVGA 3DTYA 3IL2A 2W2KB 1Z45A 1ZNQO 3I5MA 3IJPA 2G76A 4MVJE 3C1TA 1TI7A 1P0CA 3AUAA 3GMSA 4PLYA 4CLXA 4EZBA 2PKQO 5AYVA 1IOLA 1UDBA 3N74A 1ONPA 3NT5A 1HTBA 2VYND 3MWEA 2VQ3A 3AU9A 4OM8A 4DIOA 1G0NA 5HTOA 4XQCA 4N5NA 3B1KA 3PGJA 5U9CA 2JD1A 3A1NA 3BHJA 4Y6PA 5HS4A 5BNTA 4NZ9A 4GGOA 1LC0A 4ZQGA 4A7PA 3EVTA 4RF2A 3GN2A 2QRKA 4ZD6A 5MGBA 4QXMA 1I10A 1MFZA 1DJQA 1L7EA 5F1OA 2C20A 3PK0A 3TRIA 2W2LD 4CLDA 5JYDA 1R66A 5A9RA 4L4RA 1TXGA 3OJEA 1NASA 1H6BA 4IJUA 5COQA 2VRCA 1U8XX 3GPIA 4XGIA 1RM3A 2GN9A 2JCXA 4FGWA 5GZ1A 1I2BA 4CLOB 4CM8A 4EGFA 2OOSA 1U1IA 4Z9YA 5CEJA 2EKLA 4C7KA 4FGSA 1BW9B 1SB9A 1EDZA 1I3NA 1GUZA 4DC0A 3I9LA 1VRWA 2QQ5A 2VZ0A 1N5DA 3U9LA 1F8GA 2YZ7A 4OAQA 3ZV4A 1DLJA 2X6TA 2W2LA 3VZQA 3UOGA 4BO4A 1O8CA 2ZJ1A 4E13A 5B4UA 4CLRA 3H65A 1CQIB 5EQFA 4ALJA 2RHRA 4AG3A 1OZAA 2O2YA 2PWZA 3WGTA 3OJFA 3L6DA 1X7HA 3CTMA 1KEUA 2V6FA 1LLQA 5DBIA 3AOEA 2X0RA 1KY4A 2I6TA 4CM4B 2Y1DA 2UV8A 1H94A 3D5QA 1ID1A 1VE9A 1XA0A 3ZV6A 3EY4A 4J4HA 3ENNA 1FDVA 3ANMA 3PFWO 3K9QO 4QEDA 1XDWA 4BO5A 4H16A 2DUWA 2WYVA 2UYYA 4MVJM 5CPFA 1EBUA 1VM6A 4GSLA 3ZDFA 1QSGA 4MINA 1E5QA 4BKUA 2R2GA 3JQGB 1NPYA 1C1XA 4QO8A 4DC1A 4WCFB 2VTEA 2FP4B 5A06A 3IP1A 2BH9A 1O0SA 3NEPX 1P33A 2X4GA 1IZ0A 2OMEA 4FFPA 4RVSA 3SJ7A 3VOSA 4D43A 3FN4A 4CUKA 3QVTA 1GZ3A 3D3WA 3VC7A 3RASA 3GR6A 1PGOA 3S1LA 5IDWA 2VHXA 3RJ9A 4QECA 2PKQP 3BTUA 1R16A 4Q3DA 4BO6A 1UR5A 3ZHYA 1GQ2A 1BWSA 3P2YA 5CEEA 4CMGA 1T2CA 1DXYA 3FSRA 5JDIC 1U2DA 3GGOA 2GNAA 1Y8RA 4OQYA 2FPIA
chains in the Genus database with same CATH superfamily
4QDOA 1S01A 3IT1A 2FK8A 4OA8A 4CIXA 4UPEA 1VHDA 2LD4A 3AEZA 4F8EA 1GO2A 1VCIA 2HSEA 3I32A 3L0CA 1I0LA 2ICAA 3EVDA 3A6KA 2DE0X 3ELWA 5LFAA 1BKYA 3ZJ4A 4F9GA 4NBVA 4AQYB 4JOCA 1TEZA 2Z6QA 3EVBA 3HM9A 1BQ3A 3FYUA 3WI7A 4AY5A 4M46A 4FM9A 4D3YA 1OA0A 5DXFA 4BMSA 1OR8A 3QOWA 2BGRA 4M36A 2AYZA 1Y1TA 4PRKA 5KNDH 1PIWA 1HYQA 1J7JA 1KQ3A 1RWXA 3EE6A 2HA3A 3I37X 4BN5A 1QF6A 2W2KA 1TT5A 3A7EA 2IHUA 4FBGA 3VSEA 2DTDA 3BMCB 4AJHA 4BVBA 1ZAYA 3JAWA 1QPZA 3WGHA 3WDKA 2IUSA 4CMKA 3H3XA 3KZ1E 3Q8WA 4KNWA 4D6PA 4CUJA 3ERCA 3NVMB 2HA6A 2RBKA 1SOMA 3B2EA 4QJIA 4YMWA 2H1RA 1Q91A 4ZCPA 2HIHA 1J9ZA 3DWIA 2O5RA 3Q9UA 4L0MA 1K8RA 4ARBA 1DEHA 3AJEA 3WMWA 4QT4A 5A2QA 2CXOA 2NUAA 3UFXA 2E4UA 1DKPA 2PDAA 4KXVA 5BQFA 3VYVA 2F9LA 4QGAA 2C2MA 3D6AA 5IN5A 2Z1NA 4PIMA 1KS9A 16PKA 3KOZA 4UNSA 2OT3B 1PZFA 2JIRA 3CW8X 3P9ZA 4XYEA 5KU7A 5DBGA 1O2DA 3JQ6A 1NVBA 4YRKA 2D5BA 1GZVA 1R4NB 5DT2A 1NRXA 1SEVA 4IOLA 4PHCA 3ZWDA 2CXNA 4JIGA 3FAKA 4U1RA 3ILSA 1SAYA 1M8PA 2VF4X 3R44A 4KR7A 1WVMA 3ZE6A 3MQFA 1K66A 1MU0A 3OLVA 5AM2A 2YY7A 1VJ0A 5HCUA 1LVGA 3H2YA 5B53A 4PX2A 2GTHA 1FL9A 1CIVA 2XB6A 3MAAC 3MBOA 3U3XA 4ZCRA 5JJ5A 3ZZ0A 3L8EA 1WZCA 2AXQA 5ECWA 2NYAA 4ESHA 2H1OA 1HNWB 1VDMA 2COUA 1OHHA 5I4KA 3TXAA 1R8SA 1ZP6A 3FWHA 3CEPB 3TVTA 2VBGA 5TGDA 1NAIA 1H8ED 2WHRA 1IXZA 3OZIA 4TM7A 4P7JA 1HYEA 2PE5A 3H0CA 1XZMA 1TTTA 3AK4A 1T0PA 5G4LA 4WESA 3RT1A 3AQIA 4MUHA 3TEMA 2W2PA 4F91B 1USVA 2PTHA 3T34A 3QEBZ 2DUJA 3STVA 3IXMA 3VZDA 3G2QA 3D02A 4AWAA 4R51A 2LKCA 1M6VB 3TH5A 1Q84A 2QNBA 1BA3A 2ZSHA 2XGGA 3CNQS 3I5UA 1NRIA 3GRZA 3Q7EA 3IBGA 2NZYA 1O6BA 3INGA 4WUVA 2PRKA 4CZ2A 2XMZA 1PR6A 3WAGA 2EYQA 4I5EA 2LZ0A 4B4UA 2EGGA 4WBXC 5BSFA 4GE0A 2N47A 5EHIA 2LPMA 5EJ2A 3JV7A 1QUFA 1R18A 3PC4A 4XGNA 3V1YA 1YKFA 1V3QE 4D4IA 2CVFA 3ANLA 2W6JD 3DUFB 1DTWA 5LLSA 1AHIA 1E6KA 3C6MA 1KP3A 1SVWA 4RTKA 2QRGA 2OCXA 5FLYA 1EFVA 2AR0A 4W4TA 3PENA 2AXEA 3FDJA 1VE1A 3L7CA 4C0AC 4ES6A 5A03A 3PFGA 1QH1B 3I83A 1YQUA 2GI4A 2ZYTX 1M6WA 3UUFA 3HRHA 4OOFA 5BXYA 4OU4A 4YMUA 1NJ2A 1G20A 3S2GA 1NPDA 1Z74A 1ENPA 3T1HB 1WHTB 4U0JA 1G2PA 4XCXA 2B8JA 4YRJA 1P1FA 5KAMA 5HUQA 3E53A 3GLIB 5F73A 1J24A 4P4NA 1AGNA 3VHRA 2BN4A 2R7NA 4CR8A 3D3QA 1PR0A 2NSYA 1Z8DA 4XRRA 2C07A 2X5OA 3H4MA 2G40A 4HX9A 3IUNA 4ZEOA 3KL4A 4KOAA 5EJ4A 3P96A 3WWEA 1V2HE 5CLFA 4ER7A 1O77A 1SUBA 1J1IA 3DNPA 1JI0A 3F74A 2JJ2D 3TAUA 4MIKA 3TR0A 5BN5A 2VDNB 3ZJUA 1F6WA 4TS9A 4JGBA 5B2FA 3RRZA 4RL4A 4BNJA 4MR7B 4EZIA 3GJZA 3R20A 2MHCA 2JAXA 2HHJA 3GFVA 1OU0A 1WU8A 3SJCA 1BVUA 1ZG3A 3GLIE 3KB2A 4ZJPA 4NU8X 3A1SA 5CIWA 1JFTA 3A4YA 1F48A 5EE0A 3RFCA 1ZIDA 1BO6A 2ZRIA 1WZNA 3E5HA 4EWLA 1JNYA 4KSCA 1PNVA 2AEFA 5ALWA 1XP8A 4EVRA 5L3QA 2PLWA 5MFPA 2EW1A 5JCZA 2PL5A 2HDHA 3EPPA 1OX6A 3QMVA 4YT8A 3UMSA 4L3VA 4RVGA 5E7IA 3EPLA 3BMOB 1TQDA 4HXFB 5SYNA 3QUSA 1SU8A 1Z07A 4JC0A 3VYUB 2FEOA 1VHQA 4B6FA 1SHZA 2DM6A 3S2UA 1NW5A 5CA0B 3U17A 1P2SA 4BMNA 3BJRA 2GBFA 1BW9A 3OEHD 4Q82A 2QW1A 3TXYA 4YAGA 1AZLA 3ODGA 1P1KA 2C83A 2HWYA 1IZ9A 2SNIE 4PGGA 4R68A 5K8IA 5KWVA 1R4MB 5LP6F 3FYHA 4RFVA 1V1JA 4K9OA 4LSWA 4P22A 3A6DA 1YQGA 1DBVO 2BBWA 4P3PA 2IU0A 4I1IA 4OYHA 3DJFA 2R1TA 3JR3A 2NU8B 4I6EA 2F62A 1XSEA 3QFSA 2IFTA 5SYAA 4CEJB 5EZ6B 1R12A 5HZGA 2CUZA 2X3YA 3N8HA 1XWWA 1IULA 1YJAA 3I6IA 1F2VA 1ODJA 4KQIA 3RYTC 4BEJA 4ETMA 2C7OA 1GTJ1 2IHVA 5LR6A 3AHEA 2E49A 3K3PA 1J09A 1JAYA 2G1JA 1WOYA 3PGXA 1E1CB 4JYCA 4P08A 2P11A 5B3JA 4CFYA 3D31A 3PUHA 5CT6A 1P0QA 4YQFA 2ADOA 1OMOA 1U9IA 1KR5A 2G04A 1NQ5A 2RIPA 4QUGA 3C3DA 5I9LA 3OTQA 3COVA 3QYFA 5KTNA 1K75A 3A4IA 1HFKA 2YHIA 3ETGA 1VYHA 2PL1A 4YEDA 5EWJB 3CURA 4ZQHA 2NU6A 2ZROA 5HIIA 5TPWB 4AZSA 3QWBA 4CLRB 2OC9A 5LZ8A 2R6ZA 3OAAA 5J4LA 5KTMA 5FA5A 2R7KA 1E1MA 1PX0A 1SIOA 2CL0X 2JHAA 1AQUA 2DGDA 2Q3LA 1EZ1A 4HK4A 4IIVA 2E5LB 2P2LA 2HKIA 4MB6A 2Q27A 4HH4A 4M6WA 5ADVA 1DWPA 2FPPA 3K8ZA 3NB0A 1AB5A 2P9YA 2FPKA 4RPGA 3RODA 4GI5A 4M1EA 4PVDA 2G1UA 4HH3C 4YREA 5C51B 5CIQA 5EJAA 5BN1A 4ZHSA 5LMNB 4HRYA 4LJKA 1O94A 1PGQA 2PD3A 1A9QA 2BFAA 1YFKA 2REQB 4FZ5A 4D6YA 2UZ4A 1U63A 4TSKA 5I8PA 1TK2A 3K2EA 3JVDA 4R81A 2F8MA 4LEIA 5GONF 1PTJA 1V1RB 4HFMA 3PHCA 3DLPX 1NKTA 3HUTA 4IV5A 5JS2A 4FDAA 1NVXQ 4C4OA 2GPWA 3HB0A 3WIOA 1CIJA 1U1DA 1QYDA 5C7OO 5CM8B 3EIUA 3GY0A 2JA1A 2IYWA 4OHUA 1PWHA 4PZ9A 3MTJA 3RM3A 4RESA 5L6MB 4FQ7A 1CIPA 3I4FA 3COWA 2PN1A 5E4FA 2CDRA 1Y1QA 1WSWA 4LCJA 3O4FA 1A5TA 1M34E 5J5AA 3CRVA 4RACA 2XB4A 1P3Y1 3K8OE 1IBLB 3KVRA 1INLA 1HYGA 1CWUA 4JI3B 5LOVA 3G9XA 4IS3A 3RVKA 3DF7A 4LHSA 2PPLA 1K86A 3CKYA 3P9XA 1XD2B 4FD3A 3RPEA 4G8DA 3EEYA 4PSUA 3MOGA 4TKVA 5KYKA 4DRYA 1ZM3A 3K72B 1E2KA 3DBHB 5K8UA 1JIXA 2ODAA 2V6MA 4U9HS 1SUDA 1OWMA 4JLJA 1TW2A 4DR5B 1N7HA 1E2FA 3E03A 1CTQA 3EGDA 1F5SA 3OTHA 4LWOA 2PUCA 2FUEA 2X7HA 4YMTA 3F90A 1Z6XA 2PZJA 3W05A 4AXXA 4M0DA 2QUJA 1NBIA 3VUFA 1ONNA 2Q46A 4IF4A 1YF3A 1EK1A 4JBNA 4AMVA 3I5AA 2EYUA 2FRDA 3LP5A 3A9VA 3GRPA 3B70A 4BZWA 4Z4IA 2D00A 3O4RA 3F7TA 1H05A 2WD8A 2JGNA 4OGKA 3V42A 3Q15C 1K4KA 4F38A 2RFLA 3GW8A 1E3IA 3QKUA 3R3ZA 5A9TA 2HJ9A 3H1AA 3NXKA 3GQBB 4CQLB 5GVSA 2A94A 5D1HA 3NYWA 4RC9A 4N0QA 2P9ZA 2V7QA 3BQNB 4RTPA 1M2WA 1XCJA 3MWGA 3WISA 4AN1A 1FDOA 4ZFNA 2ZIVB 3EARA 3H9GA 4ZAWA 2IS6A 2QVZX 4D56A 3BE8A 3H5VA 4ZV4A 1U2EA 3FYUB 3CVWA 2W22A 2RHDA 4JAVC 3QE0A 5TGZA 3QKWA 1PJAA 4DLBA 2D7DA 4XPIA 3A6ZA 5LD2C 5ALKA 2WM9B 1FYVA 3CKMA 4Y7DA 3BXOA 5F7OA 1IJEA 2JLZA 5LIPA 3NYRA 4O1MA 2XZPA 4K9MA 3FVRA 1OC4A 3R7LA 4LA4A 4R3WA 4LGCA 3FCUB 1S89A 1PQWA 4JX8A 4JZYA 4E6PA 5BUZA 4MJ3A 3W5JA 1IDOA 2PX0A 4LOJA 2OY0A 1C4WA 3RUFA 2L69A 4CKYA 2D1SA 1LJUA 4UARA 1HSOA 1DKMA 3SVZA 4JK3A 5JTUA 4Y2RA 5BOVA 2R751 1O08A 4TN1A 1KPIA 2A58A 5B1IA 3U2QA 1MUUA 3BICA 3L6BA 4OEHA 4W5QA 2BI4A 1R0KA 1UXOA 4V39A 4G5FA 4YRZA 1R9JA 4UTOA 1JHYA 3ZV7A 5FPYA 1QRSA 2GEVA 3AKZA 2ISQA 4N0PA 1XU7A 2D1QA 3SN6A 4N41A 2Z5VA 3OZUA 1UZUA 3EJWA 4CMIA 1D1TA 4WLOA 3ELUA 4C4PA 1P4AA 2JLAA 3EYAA 1Z88A 2LNDA 4KX3A 4NIMA 2CJFA 5SICE 3SQMA 4BFYA 4FXOA 2V9ZA 2H2AA 3UWDA 4CRWB 5AVQA 2GHTA 4JJKA 3FHOA 3I09A 5KQGA 1VSQA 1ZCJA 4UDOA 3WBKA 2CYAA 2FZCA 2NZUG 3IV9A 4D92A 3KQOA 4OP2A 4BFVA 2YJGA 2FLKA 3ER9A 2H08A 2DY0A 4Y2SA 1E3WB 2FMFA 3FLEA 4BO1A 2OHGA 1W88B 3QVWA 3IPRA 4RZ3A 5C3UA 4GNKA 5E38A 3W04A 1FP4A 4IIJB 4RJJA 2RIRA 5CDHA 4ZO7A 1RACA 2DHQA 4Q7JB 3EQZA 2DHDA 3G5AA 4NULA 3P4UA 3WMFA 5D3ZA 1XZBA 3G5TA 3GEHA 4FE7A 1RRGA 4KR6A 1NDQA 2EFDB 3AESB 2NPIA 1PD1A 3GIDA 4OGFA 4DIFA 1UEXC 3DVAB 2C9OA 5DHFA 4Z7NB 1Z12A 5IYZA 5KNCH 3IE0A 2QB5A 3WJ2A 4US2R 1AN9A 2IYZA 4PNPA 4PIVA 1YTLA 3NT4A 1LXCA 2IZZA 4DDHA 1UM9A 5C7YA 3PI6A 3X3HA 4IG4A 1EIWA 3LUPA 3QYJA 4DA8A 1ZIXA 5M5BA 2CHGA 1PJQA 1QIIA 3I04M 3KQYA 2HYIC 4XFDA 1E9AA 3AJ9A 2VRNA 1N0VC 1XA4A 2ONCA 4EF4A 1XDSA 3FMGA 3M3HA 5FPPA 2BHNA 1PGNA 3OC0A 1R5NA 2V6IA 4BVHA 3DYBA 3G0CA 3RV4A 4U6QA 9ABPA 3IDSA 2FRDC 3W5DA 4BIIA 4YRPA 4R5MA 4S05A 5DCLA 4DJDC 2AOWA 2A0FA 2AW5A 2BEUA 4N54A 2WJAA 2FFHA 3I42A 4I8IA 4DV0B 4LJ5A 1T25A 3NPMA 3OCZA 4DBVO 5IKEA 2VWPA 4BB0A 4CKEA 3EIQA 1AGRA 1SC3A 4CCWA 2QV0A 3DBRA 1R6TA 3NC4A 5EJMA 1C1YA 5EERA 2J3HA 4E21A 4CQJA 3IVCA 2FDCA 3T9FA 3HYSA 3LL7A 3O38A 1DHRA 4QU0A 2FVYA 1E4YA 1M74A 4N5MA 1TC1A 5K3DA 5DNUA 2QGZA 5CFZA 2QUHA 1OVGA 1VYVA 5J4VA 3MRXA 4E30A 1U7PA 5F98A 2XCQA 3EEQA 1KPHA 2Y0DA 4FWTA 5ALPA 3IFSA 1AVTA 3ICOA 2BTQA 4UAVA 1CS4C 1ZY2A 5EFZA 3UC9A 2JLXA 2OUKA 3JY6A 2ID9A 3S7TA 4CM8B 4E1BA 1X80A 4KVAA 1PZNA 4LX0A 3KTFA 3P9KA 1GSOA 2Z8ZA 2HNAA 5ERYA 4E32A 4BXOB 2WUGA 1NN0A 3EDQA 1Y8CA 4QC2A 5D6NA 2B20A 1J0EA 1MQ8B 1G8JA 4D0RA 4YRGA 2UUCB 3SOZA 1A9PA 1SKYE 1SURA 2HMAA 3KBBA 2HU7A 1GEEA 1DEAA 4P80A 3UK0A 4KXYA 4QXAA 2AE1A 5K0NA 2PSFA 1LNSA 5IEJA 2WHXA 4U2FA 2VBFA 4HNRA 4F8JA 4IYJA 2HRDA 4UHFA 2KYRA 4A0GA 2G17A 1AUOA 5C4GB 3GBVA 2C8LA 5EUCA 5IKMA 3A05A 2O5CA 3DOHA 1JYFA 1N4DA 2Y0EA 4DTCA 2C94A 3IOYA 2GA9A 5A4FS 3QEAZ 5TIIA 1N34B 1WMBA 1K2WA 2GFQA 4XM2A 1DIHA 1ZR2A 5KSPA 1PX2A 4FI3C 5FAXA 1XI2A 4YAOA 4BRZA 3NTQA 3K71B 4I6JA 2J08A 5EMJA 3NAGA 1E0JA 1H9AA 1V7ZA 3HCNA 1NHGA 4O0LA 1F3OA 1VL6A 2PKEA 2AKYA 2OCAA 3PC2A 4MP6A 4P7KA 3VISA 1H8EA 2FOXA 3OOEA 4REQB 1Z2EA 2I22A 3K15A 4EMTA 1U04A 3R4VA 1Z5GA 1RYHA 1W85B 4TKVB 4TTPA 4BFZA 3PEUA 1LW7A 2ZE7A 4CG2A 5A5GA 1ZR4A 1N2EA 2I76A 2SICE 3HZRA 3WLOA 3CONA 2XT6A 4OQPA 3EF0A 2IUFA 1GKKA 1Y42X 1YB4A 5KOIA 2DBQA 4RDXA 3BQMB 1HSZA 2FHSA 5EZSA 4AO8A 3P0JA 3KZMA 2B9VA 5G2OA 3IDQA 2X58A 3ADBA 3D6FA 5J2UB 3C16C 5THKA 2FETA 4GOJA 1C8VB 3AUTA 2R5NA 3WYNA 2E4YA 3ADPA 3GWZA 3V1TC 2OBBA 3FPCA 3UV3A 3ZY3A 1E5LA 2Y3IA 2YL2A 4NV0A 4KJZA 3WKBA 1MVLA 1L4KA 4KUGA 5CYPA 3SX0A 4FLFA 3WBFA 3KYCA 5FI5A 1CDZA 4MRMB 2V1UA 3GAAA 3TKAA 3O3OB 3T54A 2XCTB 4QT0A 3SYLA 2DPXA 1K6IA 4OXQA 4YCJA 5BQXA 1QP8A 3WGIA 3P5SA 1ICIA 3OO1A 4YJ2F 4ZPJA 5C5DA 3WIBA 1AKMA 1QLWA 4WK6A 5I7FA 3KUUA 4RTRA 2DLDA 4R8MA 1Y6JA 1DXHA 1HPLA 2QRLA 1NXWA 3FMIA 3FMOB 2A78A 4RWEA 1GFZA 1OFVA 2M6RA 5EQJB 4OHVA 5CH3A 4OXIA 1G66A 2X1LA 1SIBE 4GOMD 2I29A 1YR6A 2C00A 5FOUA 5KO2A 4FOOA 2JDID 3AV3A 4F21A 3VVLA 1V3VA 1JG7A 2AJDA 2NVBA 3VR6D 4ALMA 2F7SA 1CLEA 1I2AA 3HU2A 2ZT5A 3D4OA 5CA0A 2WUEA 2JVIA 3ZKAA 4FYIA 1OFUA 1FVXA 4BCBA 1Y1RA 3K9NA 5DLPA 4UTRA 5B4TA 1NW4A 4JUBA 3UBTA 2YHBA 2GZ3A 3LUCA 3M6FA 4EG3A 1W9HA 4Z9FA 5DNCA 3DP9A 3WRWA 3ZDBA 2GZ2A 1L5GB 4BAZA 4YMHA 5JWRA 5FNZA 3V32A 1VJRA 4DDKA 3KWFA 2ZRGA 4RXMA 2HF8A 3K5HA 2JJ2A 3ZGYA 5JT1A 2XTMA 3Q8LA 3FYUC 3JD4A 4TZTA 5IW8A 1B8NA 1WO8A 3G0GA 1TYAE 3H4VA 3NWPA 2GVDC 5D84A 4YRAA 1KR2A 4U2CA 4IXTA 4MQUA 1PJTA 4EPVA 1JGTA 4YMGA 5BN3A 1EAMA 4FIZA 4RABA 1B8PA 1LF5A 2CMDA 3CCFA 4BU1A 5JJCA 2Q1UA 1WHSB 1OTYA 2H59A 3KVVA 2PYZA 4IDCA 5CFLA 1Z2PX 3GVIA 5HRUA 2GYUA 5IZCA 1S8FA 1CB0A 4X6YA 2IYLD 4GLBA 4PQGA 2WHYA 4NATA 5KPDA 1JDBC 1KP2A 4GDMA 4CHGA 5F1PA 1BEEA 1U8EA 4XVRA 3T7KA 4F7WA 2W42A 3MTDA 3HDYA 5KS2A 1U1GA 3QVGB 2VJAA 3OZ7A 3CLVA 1NTRA 3FWYA 4AY6A 5FRDA 3K20A 4QLOA 1QHHA 4LY0A 3U4QA 1FQKA 3COYA 1NVTA 4EHFA 1ZONA 2VP0A 4BB9A 2JL1A 1XYVA 2NU9B 3BA1A 3SI7A 1GUBA 1JVSA 3KLMX 3TB4A 5IFKA 7MDHA 1XVAA 2IYPA 2PH5A 2XUDA 3DE1X 4JBHA 4UUAA 3OEHA 1DKUA 1CUBA 1QGUA 3OU7A 3SXUA 2C4UA 2BGTA 5CBKA 2FSHA 1DG1G 2VTKA 3A27A 4Q9HA 3I30X 5U4XA 3U7QB 1YOVA 4PGAA 3PHJA 3QKSB 3ESDA 1N1MA 2ZSBA 1M5UA 3ROMA 4DAEA 3CO0S 1UWLA 3DKRA 2IXBA 5GOZA 3U40A 1KBQA 1WQ3A 2H7YA 3LY7A 3REGA 3S70A 1RS0A 3E8SA 5DGIA 3J80A 1OILA 1U2GC 2JFQA 4LV8B 4MW1A 3RE1A 4Q47A 4GIBA 4P98A 5BPHA 2BFBB 2H29A 1QBKC 2ZG6A 1RM4A 3EQ7A 2ZYDA 3HKCB 3KR1A 5HBRA 3VYTB 3B8HA 2PR7A 4AZTA 3O1IC 4ZK2A 4IP0A 3QVUA 4QDJA 5E6UA 5G3ZA 1AUXA 5DSZA 3PVCA 4KFCA 1T13A 2CLKB 1MG0A 3D4LA 3PFKA 3AU8A 4AMGA 1DAPA 3L05A 1CUWA 4QNMA 1FXWA 2BFNA 5JSZB 1ATIA 1GV0A 1VPLA 3KLPX 1OWNA 1SH7A 3GAMA 3IOMA 4N65A 1J5XA 4UVEA 5K0SA 3E70C 1SUEA 1ZJ6A 2H4FA 3KL2A 4Q6WA 3QIVA 5EZQA 7YASA 5ICGA 2IY9A 3OH8A 1SY7A 1U0GA 1UKAA 4IWYA 4J16A 3L7MA 3L7KA 5CVVA 2WMYA 3AI1A 3OAAD 3JPYA 1SVUA 2G25A 5DLQC 1KMHA 2VS1A 5PNTA 4YRIA 4HDKB 2O54A 3P9YA 3GDOA 2VATA 1JG1A 3PNBA 2EBFX 5ERXA 3VC2A 3C6YA 1MW9X 1E94E 1RYMA 4L02A 3UGTA 3PLRA 2Q8PA 2R1VB 5I4IA 4DT1A 3O6VA 1EGMB 3E5MA 1IZ8A 5ERGB 1F4VA 4L8LA 3KYCB 1D8AA 3EYWA 2ZDHA 4EUEA 1MMFB 4P32A 3NPAA 1C7RA 3GEMA 4GRIA 2V97A 1SD2A 1T8UA 3CWZA 2VAMA 3T3PB 3WS7A 1GG2A 4JB8A 3W5HA 4D9MA 4JVSB 4AP6A 4EHLA 3WJ7A 3IVMA 2PV0A 3ACBA 5TPZD 4NEQA 4AS3A 1VPDA 2MMGA 4B6QA 2AMVA 2JF0A 3EUEA 1IWPB 1AM4D 4JT2A 4EHKA 1OI7A 4M9XA 3DXFA 4Q02A 3G6KA 1Z8NA 2JEZA 2YKGA 3Q0TA 1EA7A 1XTIA 4LW8A 4Z8YA 1D07A 4AL4A 5KSWB 2VYQA 4WY8A 2HF2A 4LYFA 4RV9A 1FYEA 3STWA 1APBA 1HL3A 3B60A 3R3XA 2PRYA 1USKA 2BFMA 3ZNQA 3I5YA 2X9LA 3TX6A 5DRTA 3OQ1A 4G67A 1N9KA 1IIBA 1FW6A 1PUXA 5BV2P 3IP6A 1WZUA 4INAA 1K89A 5CT5A 4D2IA 1EK6A 3KZOA 5JVDB 4B43A 1BA2A 2QTMA 1LH0A 1R6AA 4M1WA 1J56A 4QEZA 3RABA 4MWZA 4RANA 1B4DA 1T9GR 2PZEA 2W4QA 3M82A 5DYWA 2W9XA 4DV4B 2HU8A 1TU0A 3E9NA 3PRJA 3DE0X 1CQXA 4WADA 3U6KA 2CC2A 4RZXA 4XCQA 5AVJA 4F72A 1SXIA 1DC8A 1ESNA 5EIBD 1SHTX 5A9SB 3PEYA 3NC0C 4R1NA 3L0ZA 4BFTA 4UTVA 1G291 2QN6A 2E85A 1U2ZA 5M2QA 2R8XA 3K6RA 4F11A 1TA4A 3THYB 2B30A 1Y5MA 3KYDB 1YV9A 1M0EA 4J91A 4FEYA 4AJ4A 5CAEB 2C9CA 2YYAA 1U81A 3G82C 2R96A 2Y68A 5IXJA 2XXAA 4ICIA 3U19A 2P5YA 4ND8B 1N8SA 3A6LA 2JKVA 1S2IA 3G0OA 1E92A 3QV2A 4EA6A 2OOKA 5GWXA 1QHNA 5FWNA 1KJZA 1A1VA 2RJOA 4GPTA 1E63A 3QSYA 1IBCA 4DIUA 1OX5A 1TUGA 5HF5A 3RIXA 1S3SA 3A6HA 4CBVA 3PUJA 5BNZA 3QE3A 4I9HA 1VDZA 5FTKA 1CG6A 2E5FA 3ORSA 2I03A 3QQ5A 5BWBA 3I4CA 3RK4A 4U7WA 5DF1A 4CKWB 3KVYA 3I73A 4TZKA 2ROQA 4O3MA 4D3FA 5L3VA 4WLUA 1OY1A 1YIDA 2B83A 2P68A 1PJ3A 3AI3A 1J0BA 2WU4A 4HF7A 1L5MA 5DMXA 1TKBA 1KEZA 3A1FA 2QE7D 2NUTA 1H2BA 3NDJA 3FOCA 3H11A 2FXIA 4X92A 1D4AA 5DLDA 4ENPA 1PJ2A 3CX7A 5LB4A 4CEHB 1OV4A 2VHCA 3ANSA 2ZYGA 2ET6A 3RS3A 3DEFA 4GPAA 1AU9A 4UW9A 3PFFA 2D2IA 4KO2S 5AUOB 2GHQA 3GB9A 3NBQA 1KNQA 3LBHA 4DUPA 4PV7A 3EXEA 2YVQA 1I33A 1VCHA 3G5LA 1R4NA 2MR6A 5AH0A 5TDHA 3V8RA 1EVJA 4J29A 4LDZA 3HYLA 1K8YB 1L5OA 1VB5A 4NYIQ 3D6UA 3J81k 2VYVD 3BM5A 3IP9A 1A69A 4ZT3A 4QJ3A 1SHUX 2BFOA 3T95A 1FFEA 4EJ0A 4OK5A 1PGJA 2GF9A 3DKVA 3MXOA 3PPIA 2OMKA 4U9IS 3T52A 1X94A 4REOA 1U7OA 4AQDA 4EUNA 4BB6A 4ESVA 4DV7B 1FBNA 4C04A 3IP8A 1GFSA 1VBKA 3PB3A 4LYEA 3FWZA 2HCFA 1XPOA 1I94B 1SCKA 1U2PA 2Z4SA 3HVIA 4QPDA 4Y6GB 5DKFA 4AKHA 3UWPA 1WCXA 2B3DA 3U44A 5D8DA 1B14A 1FEZA 1XEWY 3EGEA 4M1OA 3IQXA 3KDPA 5I6DA 1RPTA 3DVQX 1EK2A 1NA5A 3C7CB 4OHKA 2GLTA 1HURA 3IMKA 1SBQA 4TUYB 3S5JA 1CXZA 1PV4A 3TSYA 3DW1X 3MS4A 1IXYA 3EBPA 3T35A 2Q6LA 4RYDA 5AW0A 1BZYA 5EMNA 2XRFA 5HG0A 2Q3EA 3KETA 1EE9A 1D03A 1P5ZB 2KB0A 4W9NC 2DEUA 4CQNA 4OFWA 4BNGA 4GSKA 3UUGA 3KB6A 4M8LA 1KY5A 1WOMA 2W6IA 4I9GA 4L9SA 2P9HA 1OIXA 1S4MA 2Q3DA 2FU5C 3QBEA 4HQ6A 4D42A 3MXTA 1IH8A 4JDUA 5JD5A 3V4PB 3AP1A 1QG2A 2B6NA 3DP7A 3WRYA 1UC5B 4OHMA 3DOIA 5LQRA 3G1WA 4LF5B 1RIIA 2ZTLA 1Y7LA 2QG6A 2F3QA 4YJGB 4QPCA 1WW2A 1AF7A 2AQKA 5DI3A 5HEKA 1HH4A 2PGJA 3BSWA 1NUAA 3JQDA 3HWWA 5K2MA 1D2MA 4EY3A 3WO0A 4WOKA 2AC2A 5C37A 1T36B 4TPKA 2V7WA 3HJTA 3URKA 3HNOA 4CF7A 4MS1B 4HRVA 4M3NA 4I2NA 2J41A 2V7EA 3KZVA 1RRMA 4KN9S 2G0AA 1A95A 2RK6A 4TQ9A 1C4KA 4AG6A 2HMTA 4Q18A 3WIUA 1W87A 5BW5A 4EG5A 2F4VB 2WD7B 4N7BA 5EP4A 4P2BA 3ROQA 2OHVA 1ISGA 4DR1B 4N3CA 5EMKA 1G3IA 3L6RA 2L0XA 3CT4A 2HZ7A 3FNIA 1B6SA 4FVTA 3S0JA 4OB6A 3UM9A 4ZODA 1II0A 5JISA 4OLAA 3PS9A 4DNFA 4GBGA 2DBYA 2XWBF 3G7SA 2IUUA 2XRMA 4E5VA 2GK4A 2AFRA 5CRIA 1NUQA 3BWDD 5JRJA 5K9ZA 4UM7A 5AUQA 1YFLA 3H9UA 3QPUA 4E11A 3HXOA 2XYHA 3KUKA 4NL4H 4JJFA 4BQNA 4CLOA 1ZNZA 3FFTA 1EE2A 1SBCA 4DM4A 4FGLA 1R7RA 2OV1A 4HJRA 3TTSA 5ALQA 5JSYA 2O6HA 4NYMQ 1Y63A 1GPUA 2OKCA 4J3JA 2JKZA 3WDSA 1Z5NA 2O2EA 4W7IA 3RIYA 4JKIA 2WSIA 2FOIA 2YN4A 1KSHA 1JE0A 3OQJA 5DBFA 3RFUA 1WB9A 3QX7A 4C9BA 1ECJA 3BBLA 1XZPA 2ATCA 4IDPA 3IP3A 4X1KB 3KQLA 4MI9A 1EXDA 2MIIA 4BMOB 2BFCA 1QZUA 2E4ZA 4RCVA 1DNPA 4J0EA 4W8GA 4BC1A 2FZ5A 2H2IA 3P9RA 1FUEA 4XVQA 4URVR 3GG9A 1Q44A 4L5CA 4C78A 1SXJE 4RS3A 4D3ZA 1AMNA 1QGOA 4DMFA 4PRLA 5CDFE 4G5GA 3H2IA 1MXHA 4Q4AA 5CGZA 4D4KA 1UKVY 1W48A 1HM5A 4QOEA 1U9IC 5DBHX 1NMXA 1QAQA 2EBWA 2X4IA 2NO4A 2EW8A 3WK9A 3SHWA 3W5SA 4OUKX 3FNQA 3QY0A 3ZBPA 4J1SA 2CVHA 1EFLA 2CNWD 3SZ3A 3W6PA 4BNMA 1TQ8A 3H8WA 5DZSA 1MP0A 3CRNA 5JNWA 1JQJC 3BL8A 3S81A 3V80A 3FPKA 2DT5A 3CZCA 4KI7A 4QTXA 4WLFA 2B4AA 2Q3CA 1L4MA 3KQVA 4XD7A 1LQUA 3IKLA 2UVDA 2DUUA 3LRTA 4AP5A 6YASA 3AM4A 1TJ5A 2I3AA 1FB5A 2P30A 3Q2KA 2BFWA 3DAOA 3RS9A 1SKBA 3G2KA 1JWLA 2BLLA 1M66A 1PT5A 3OP1A 3KX2A 4HZUB 5KSOA 2B69A 4KV7A 2BKEA 4NVRA 1XPRA 1PGPA 3SAJA 2QGNA 1GN8A 2BY4A 5EWLB 5BSUA 1V48A 1YBAA 1G8YA 3WZMA 2C4MA 1L4LA 1II8A 5L40A 3F5MA 4HAYA 2V45A 2F00A 4KN8A 4HPJB 4EG0A 5P8WA 5C3MA 2AI1A 1DIAA 2C2ZA 1U7WA 3PYXA 1I7NA 2VSQA 3D3NA 3ITEA 4A0HA 4N3AA 2PVCA 1N5LA 3GU3A 4W8OA 4NKRA 4PN7A 5C1PA 1G64A 2EP7A 2QN8A 1TF2A 1MJ5A 2ZYAA 3DLAA 4NJOA 3UW1A 3UYLA 2PMDA 5G1NA 4CIVA 2DHRA 1GL9B 3NIBA 1YZFA 4PGFA 2CVQA 1G8KA 1ULZA 3E9EA 1AA6A 2CSXA 1IHOA 3LDUA 2GH1A 3CFYA 1L4NA 5DISB 4BE4A 2CLHB 2A35A 2I2BA 1T26A 3L7BA 1ZOPA 1XTRA 2FWJA 3GGSA 3OQHA 4L4UA 4S24A 1G9TA 5I8ZA 3TBFA 2A9JA 4F9EA 4UNQA 2QG4A 3UAWA 3HN7A 4BV3A 2HLPA 2B1GA 3UJ8A 3TLEA 4BOYA 4DHWA 2R7LA 5J40A 5CVUA 1GR0A 1WR8A 4NCIA 2A1UA 3I76A 5JWOA 1UMBA 4KPUB 1NWHA 5AJWA 3AHJA 4J1TA 3DBLB 4IDEA 1QG6A 4WZBA 4D1YA 1JHZA 3PNLA 3A9TA 1JWAB 1PR9A 2DWUA 3JQAB 4IDAA 3RRNA 1TCBA 3PFIA 5FR1A 3TW8A 2D2FA 4ILKA 2YMPA 2X0NA 3R0VA 5TVGA 4LQCA 3NTVA 3I64A 1FFGA 4YDSA 2GXUA 3LH5A 1HETA 4ITVA 1OWPA 3ORYA 4C6HA 1GGJA 4Y9RA 1VYTA 4XOIA 1Q22A 4B84A 4WMLA 1N2IA 3O83A 4L1KA 2EOAA 2NTNA 4HH1A 2AOUB 3WIEA 3RHFA 3N8KA 3LL4A 2GK7A 1FK8A 1WB4A 1E1KA 1B3BA 1HLDA 3HC7A 3R3HA 2VDMB 3ABRB 3A10A 1WZIA 3AGQA 1JBEA 1ZQ9A 3Q9LA 1AC5A 2EQBA 4RJIA 2YXEA 3VYSB 3DLCA 3OHMA 4WTOA 2F1KA 3ZCVA 5JNSA 4YJ3B 3Q8KA 1W0JD 2JC3A 3PF9A 5FHRA 4ZXFA 3SQNA 4R8LA 3NTLA 3Q0IA 3RNLA 4NC9A 1NVFA 3TTTA 4F1WA 3NHZA 1NVDA 1Z22A 1J00A 4DDUA 2IZ6A 2QNIA 2X2FA 3H9CA 3L9WA 3BGSA 4IKPA 4LY3A 4OL9A 3DG9A 4U8GA 2ES4A 4F6RA 5LA6B 3AIKA 221PA 2Y0BA 2BMVA 1F0KA 3EPJA 1QK5A 2JJ8A 1SU7A 3LYUA 3TNJA 5M34A 1EG7A 1I13A 4ZHQA 4AUNA 4RDHA 4Z0NA 2QYOA 2HJSA 3EPRA 3ZWBA 1N5KA 3HBAA 4V02A 5EPOA 3WGZA 1RFGE 3OKAA 3I5XA 4R3UC 4YALA 4D3DA 2OYSA 1G60A 3FOAA 3KU1A 4LHVA 5KOJA 3IO5A 4JYZA 3AKDA 1KYTA 2WYOA 3PC8A 1Z4JA 1XLTC 5ETJA 4DMUB 1O95A 3K9LA 1AS3A 2E48A 5HDQA 3PYLA 3H9BA 4JB2A 4FZ3A 4EGQA 1H0HA 1XCBA 2EL7A 2YWGA 1IY0A 4OOEA 4PGMA 3W5IA 2WPDA 1K5DA 1JEAA 2C54A 3JQBC 4PONA 1U99A 1ZCBA 4LOLA 4D45A 2IS1A 3FRJA 4B81A 3OZXA 4DT1B 3RTBA 3ZTYA 3L7JA 4TZ6A 3MAJA 4FNMA 3IBYA 4KDRA 4EMBA 3RGWS 4X63A 4CF5A 3EUFA 1M34A 5KYUA 4EHNA 4PC2A 4K9DA 2R6GA 3ILVA 3PKIA 4MCIA 3WXMA 2I6SA 4FJ2A 3OPNA 4JOSA 3SIXA 2IVZA 1TQHA 1Z6QA 3CPSA 1NQAO 4FZVA 4RUKA 4HQKA 3W9UA 2BM1A 3AXTA 2YMMA 1DMSA 4R71A 3FOEC 2INGX 3LM8A 1SGWA 2YIJA 4OXKA 4YCBA 3I1JA 4JB3A 4KQHA 2WJIA 1JZQA 4KGZA 1E7WA 5FUQA 5KJ1A 5GGXA 1OBVA 1W5FA 4ZVPA 3VNAA 1QIFA 2BI8A 2O1WA 2VFAA 2P9GA 3F9RA 3ZWVA 3KEQA 3KT0A 4N7JA 1Q74A 3GO4A 4NNPA 3SLKA 4R1PA 1NBMA 4GZLA 3B1YA 3QE2A 4ZWNA 3BKXA 3GD7A 2Q7OE 4OSEA 3R6WA 1C7IA 4CCSA 1N2ZA 3Q10A 5FR2A 3T5BA 4EIWA 4CIYA 3STUA 4I4CA 3TLZA 5IU6A 4M8KA 3OESA 2VCHA 1VHWA 3W2TA 2OCBA 1MRNA 3VR5H 5LWHA 2P65A 7AT1A 4G9BA 4M87A 1J8MF 1K6MA 4REQA 2LR0A 2HMUA 2R6AA 1QFXA 3GX1A 2G8LA 2OK7A 3Q72A 2OXTA 4QM6A 3I3OA 1U28A 4QU8A 1ZMBA 3KQWA 2DFDA 1Y9JA 5D7NA 1RZ3A 3EXG2 4A6XA 2HCTA 2ZYVX 4FCTA 1GTMA 3CZRA 4H4EA 3VYRB 5LYJB 1N9GB 4JJ7A 1IRXA 5SZJA 4PNHA 3RAJA 3ROZA 3ON5A 1P72A 3P0EA 2HRBA 1NJ8A 4HXGA 4YDRA 3SC3A 1SCQA 1GRVA 5BN5B 1EFAA 1RBMA 3K0BA 4QQNA 3TTWA 4C0XA 4RFSB 4UM5A 4AYWA 4DLZA 4BNTA 4E5SA 1GRCA 1A72A 1FJ2A 3LFHA 3EBOA 2BONA 2XOKD 2AEMA 2O23A 1XK7A 3TL3A 1Q0HA 1CZNA 1WXEA 2IYUA 2FF5A 3IMGA 3Q88A 4UM9D 4WNYA 3TS1A 3AOGA 2XSZD 2YYSA 3RFXA 1QRTA 2RHGB 2RI0A 4B6OA 1XEAA 1YZYA 8OHMA 1LY1A 2ZRPA 5ARDA 1VE5A 2QTBA 1N8NA 3DOCA 4IHJA 1X0VA 3BIXA 4RAQA 3VTFA 2R00A 2QNRA 2UZ1B 1P5RA 1M1ZA 3I2IA 5E6RB 4M55A 3GUCA 3PNKA 3B38A 2PVPA 1JIIA 5EINA 5FBZA 4XWOA 1M1XB 1Q92A 1W5SA 2OPHA 3RFVA 1BHQ1 5CG2A 2FUCA 5KEIA 1TQ6A 4GR9A 1O7JA 3QE9Y 1I51A 3DHEA 3DLIA 4MULA 3UJ9A 4LQ4A 3MCUA 1NVKA 2BEWA 4WOJA 5FWYA 3SR4A 5L8VA 4KRFA 2BFPA 4WXPA 4JGIA 3VR2D 4JHLA 2AJBA 1FW8A 3C24A 2VZEA