2NU7A

C123as mutant of e. coli succinyl-coa synthetase
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
287
structure length
287
Chain Sequence
SILIDKNTKVICQGFTGSQGTFHSEQAIAYGTKMVGGVTPGKGGTTHLGLPVFNTVREAVAATGATASVIYVPAPFCKDSILEAIDAGIKLIITITEGIPTLDMLTVKVKLDEAGVRMIGPNSPGVITPGECKIGIQPGHIHKPGKVGIVSRSGTLTYEAVKQTTDYGFGQSTCVGIGGDPIPGSNFIDILEMFEKDPQTEAIVMIGEIGGSAEEEAAAYIKEHVTKPVVGYIAGVTAPKGKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGEALKTVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Participation of Cys 123alpha of Escherichia coli Succinyl-CoA Synthetase in Catalysis
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ligase
molecule keywords Succinyl-CoA ligase [ADP-forming] subunit alpha
total genus 108
structure length 287
sequence length 287
chains with identical sequence D
ec nomenclature ec 6.2.1.5: Succinate--CoA ligase (ADP-forming).
pdb deposition date 2006-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00549 Ligase_CoA CoA-ligase
A PF02629 CoA_binding CoA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 2nu7A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2nu7A01
1BXZA 3VH4A 3WIEA 1XYGA 1QG6A 4YRBA 1W6UA 2V6MA 2GGSA 2BLLA 3G0OA 5EL0A 5G0UA 1C1XB 5JPIA 1LRJA 4LISA 3GRKA 4KUGA 2DBZA 3CH6A 5IN4A 4Q3NA 5F1OA 3T4EA 3PQDA 4RF4A 3H3FA 3H9QA 1PJQA 2GUGA 3VKVA 3F47A 2YDYA 2R6JA 4GLLA 1PJ2A 1VJ0A 3ETGA 4XQEA 4XYLA 1KVUA 3QWAA 2YUTA 1GUFA 1O94A 1A4IA 3T4XA 2OHXA 4D7AA 5IFLA 4FFOA 5A1TA 2E4AA 2YQ5A 1KY4A 3U4IA 4P22A 3TOXA 4B4OA 4BB6A 1JTVA 2NTJA 3RUHA 2ZB4A 1X7GA 4OAQA 1FDWA 3DWFA 5I7VA 5KWEA 4E2YA 3DZBA 1UXGA 1ZH8A 1R15A 1CETA 1SNYA 3A1NA 4YAGA 2I3AA 5H81A 3WJ7A 2ZB7A 2CDAA 2NQ8A 2X9NA 1X0XA 4KQWA 2RAFA 4ILKA 1P33A 1U28A 5AVOA 4ZA2A 1WLYA 2X0RA 4AJNA 3U0BA 2DUWA 1U7HA 2FP4A 2Y1EA 5JE8A 4AL4A 4MVJI 1BW9B 4LW8A 4BV9A 3L6OO 5EQDA 2C2YA 3LC1O 1V8BA 3AI1A 1Y1PA 3HZZA 2X5JO 2DUUA 2DLDA 4BO8A 3QY9A 4A27A 3JQAA 1P0CA 5CEJA 4BNGA 4H7PA 1PR3A 3DEYX 3WBBA 2VT2A 4AJ4A 5DZSA 2ZQYA 2P9CA 4M89A 2GD1O 2FPGB 1KETA 3IUPA 1PQPA 5G0VA 1I3NA 1DPGA 4FJ2A 3MTJA 4HY3A 4YJFA 4CM9A 3BMQA 2VRCD 1BTOA 5A9SA 3SBOA 3ZW8A 3TN7A 1SB8A 4MVJG 1U2GA 2X58A 1TI7A 3DZKA 4NFYA 1C0IA 4IINA 3ZGYA 2F1KA 4IDCA 3LYLA 5CPBA 4YQZA 2IEDA 1E7SA 2C7VA 1LLDA 1FDTA 3KV3O 1GZ3A 4NU5A 1JKFA 3TFQA 2WDZA 1X13A 2O50A 1BDBA 4M55A 3MJEA 2VT3A 3ENNA 4XGIA 4BO4A 3VPHA 1JKJB 3FNGA 3WGTA 2EF1A 1PZHA 4GX0A 4YT2A 5JCXA 1EFKA 1D8AA 1R66A 2FR1A 1N1GA 2B37A 3AY6A 2G17A 5C3MA 3I3OA 2J6IA 5L3ZA 3QVTA 3B1FA 2NU7A 2A4KA 3RUCA 3NDIA 2JCXA 4RPKA 4M87A 4PG4A 4C4OA 2EW8A 2B36A 3JQ7B 4L4XA 2RCYA 2PGLA 5JLAA 1F17A 1GD1O 4FGWA 4WLOA 1WNTA 3WXBA 3NDRA 5G2OA 3V2GA 3RJ5A 4LK3A 2PZJA 3GVPA 4FCCA 4CLHA 4WOKA 2V6BA 1MLDA 1V35A 4IM7A 5LC1A 3HFGA 2X6TA 4BO0A 4M1QA 2PH3A 4ID9A 5DF1A 1SOWA 4JCOA 5KCZA 2ZTVA 3W8EA 5A9SB 2C59A 2GPTA 3E82A 4YR9A 1E3SA 5G0WA 3IL2A 4IJKA 3WICA 1QR6A 5KVQA 1QP8A 4J43A 3PJDA 1JQBA 4L74A 4NBUA 3CUKA 2GR9A 4DRYA 3H5RA 2B5VA 1F8FA 1NR1A 1I3LA 2O7QA 3ETDA 2RHRA 5IDXA 3Q9NA 4XWYA 5AXAA 2FPGA 3DL2A 2EERA 2O3SA 3AW9A 4PIVA 3WJAA 1UZNA 2JJYA 2PD3A 1X14A 4EJMA 4BNFA 2R2GA 1X1EA 5FWNA 2YDXA 3O8QB 1Y8QB 4A26A 3QLJA 4ALLA 3UW3A 3ZU3A 1H5QA 5DOVA 2XAAA 3TPCA 2FR8A 2J3JA 1I0ZA 3UHAA 2NU7B 3RUIA 1WVGA 2HMVA 3DAGA 3VPGA 4IY1A 4CLOB 1HE5A 1NVGA 4MINA 2HJSA 3WGIA 2YFQA 1D4FA 4AG3A 3DMYA 1XLTA 3RROA 2YW9A 4BNYA 3ZV4A 3NJ4A 1WAMA 1DHTA 5BSFA 1PS8A 3EZYA 1GPJA 3ZU2A 4H3VA 5TSDA 2DBQA 3BTUA 3OETA 3SC4A 2GZ2A 3OMLA 4NMHA 4OXNA 5MDHA 1U3TA 1U4OA 1FMCA 3PDJA 2EP7A 3PHGA 1PJ4A 2VHXA 3ZH2A 1NHGA 1Z6ZA 5JAZA 3A14A 3I9OA 4AJ1A 3GZNA 3DTYA 1VL6A 5ES3A 5A9RA 4YA6A 3LZ6A 3H5AA 4XB2A 1NFQA 5L4SA 1NTOA 4H15A 4XA8A 2GLXA 4J49A 1LLUA 4RDIA 2RHCA 4DYVA 4LVCA 3SLKA 1GCOA 3NKLA 3A06A 4W9NC 1NWHA 3ASUA 5ENDA 5JYDA 1JN0A 2HQ1A 3WMXA 2OO5A 4UREA 2F00A 4J4BA 3L9WA 4E5NA 2NLOA 4R9SA 1AE1A 2FZWA 3DBHB 4CQMB 4GKBA 1AHIA 4ZVVA 3Q6IA 5JFOA 3ANLA 4UVEA 3RBXA 3K8ZA 3NTQA 5I8ZA 2FPIA 4NQZA 3O8QA 4HNHA 2VUSA 4HADA 4BGEA 2O3JA 1Z7BA 4RL6A 2QHXA 1JKIA 3NT4A 3FNEA 4ZRNA 3QVOA 2NU6A 4UVGA 1SB9A 5G4KB 3WMWA 4B7XA 5B4TA 2V65A 3E5RA 4EYEA 9LDBA 3W4JA 3C1TA 1GV0A 2W2LA 1QKIA 3FPLA 5T64A 1K6JA 2HRBA 3UXYA 5KVCA 1PJTA 4EUEA 4DPLA 1G0NA 3E1KA 3U49A 1DIRA 3QVWA 3FR8A 5C37A 2Q1WA 2JHGA 4R9RA 3TDKA 1O0SA 1CQJA 4YEDA 3S2GA 2NACA 3T7CA 3C7AA 1EK6A 4CM1A 3PDUA 4BUCA 1ZSVA 2DBRA 3W1VA 4CLOA 5A04A 2Y66A 1MX3A 4J1QA 1WDMA 5TS3A 2NVUB 2JFHA 1EE2A 1ZKMA 3DBLA 3RCBA 3U62A 4O63O 4L75A 3OEWA 1DOHA 1KEWA 3UOGA 1ZEMA 3BA1A 4J0EA 2Q99A 3RI3A 4GMFA 3FSRA 4J2HA 2VWPA 3CTMA 3HFSA 4N5NA 1F0YA 4DYDA 2YFHA 2YZ7A 2NWQA 2VUTA 4J2OA 4BV8A 2OUIA 3LU1A 1ZK4A 2NU9A 4BMSA 1VJ1A 3PHJA 4EBFA 3RBZA 2V7PA 4IXWA 3ROMA 4O5OA 5IN5A 3S2IA 3GZNB 3JQCA 2Z5LA 1H93A 1HXHA 3WOHA 2GF2A 3HG7A 4RLSA 4URFA 1SOVA 4WCDA 4XYEA 1BVUA 1N7GA 4GLOA 4K1LA 1GL3A 4IZHA 3PJEA 1C14A 4OSOA 4AJIA 4XRGA 4CMAA 1WDKA 1KVTA 1GYQA 3RU7A 5THQA 4CQLA 1MG0A 1UDBA 2BFAA 4I9UA 3RC2A 1YXMA 4QT0A 1PZFA 1DC4A 2HMWA 1W0CA 1R0KA 2CVQA 3GQVA 4GWKA 1YB4A 4AJ2A 3LVFO 4GL4A 5GZ1A 4UEJA 1QYDA 1HDOA 3TZQA 3WQQA 3WNVA 2B83A 3IKTA 4WUVA 4WLFA 1K89A 3K73O 3V5NA 4CODB 4D0SA 2FPIB 2O3TA 5DCWA 1ZSNA 3JSAA 4J7UA 1LNQA 1LJ8A 4NK5A 3ROKA 2Q1UA 1Y5RA 2RBEA 3GUCA 4NHEA 5AQ1A 1U9JA 1MUUA 1B3BA 1O89A 3H65A 3WGQA 1OC4A 2VWHA 1Y9EA 4CLDA 2AEFA 3CMMA 2W98A 4Z9YA 1Q0LA 4D3DA 3KYDA 2NVUA 4AFNA 2QX7A 4YT4A 2VHZA 1DBVO 1J4AA 2HCTA 3OM9A 1EVZA 2E82A 3AFNA 4KP7A 4BNIA 4DBVO 3ZWBA 5TT0A 3U9LA 2V6FA 3KTDA 3LF2A 4II2A 1IULA 3GN1A 4F45A 2FOIA 1JW9B 3BMNA 2NQTA 3KHUA 3SX2A 4BNHA 4EJ6A 1IB6A 1V6AA 2RH4A 2WWRA 2EKQA 3I9KA 3UUWA 3C7CB 5C7OO 4PRKA 2Y0DA 3PZBA 3INGA 3GC6A 1J0XO 3CINA 2I5PO 4PCVA 1UAYA 1M76A 1ZK2A 2DTDA 1FDUA 1BXGB 1ZSYA 4BOYA 4PG5A 4KUEA 4DVJA 4FDAA 4A2CA 1LC3A 2GNAA 3JYPA 3WFJA 1RPNA 3IQDB 3JTMA 4S1VA 1EVIA 1P1KA 4X54A 3HNPA 4CV2A 1QLJA 4CJXA 4ONEA 4PLYA 5BT9A 4AICA 3H7AA 4HP8A 3OJ0A 3QV1A 1M6HA 5L7YA 4WJZA 1ZJZA 5CDSA 3Q9UA 3UH1A 4ZQFA 4AJEA 1HDYA 1YH3A 4E2ZA 1JU9A 1ISFA 3H9JA 4IQ8A 2E49A 1WMAA 3ZZNA 5EMHA 3UICA 1H2BA 3DHEA 4FFMA 2IODA 3LC7O 4CQLB 4DPMA 1YJQA 2X22A 1OFGA 4NZ9A 3ZU5A 3ROQA 4E4YA 1NR7A 4XIJA 4J7CA 4F3YA 1LBEA 1WDLA 3GNSA 3W4KA 4IQ0A 4KWIA 4JP2A 4Z0TA 1LDYA 1Z74A 2IRWA 3ZV3A 4IJVA 3VH2A 2ILTA 3FPCA 1X7HA 3ST7A 4OKIA 3D3EA 3PHHA 4MPDA 1A72A 2GN6A 3QWHA 4MP6A 2Q45A 1IE3A 1NASA 3GLQA 3C24A 4EJ0A 4W4TA 4JP3A 3RASA 3P5SA 1CQIB 1MFPA 1R12A 3COSA 4IJWA 2VYVD 4G5HA 4DIFA 3SVTA 4B8ZA 4WK6A 3EGOA 1LEHA 3GMSA 4UUOA 1CWUA 1U3WA 1J49A 5I7SA 4WASA 2O4CA 1Y5MA 2VTDA 3BMNB 1E1KA 4Y6PA 1K2WA 3ULKA 1D1SA 2PY6A 3F1KA 3OHSX 3AM5A 5A3JA 3FBGA 1KY5A 1NFRA 3RUFA 3ETEA 2OBYA 3HQ4O 1R0SA 4RF3A 5T57A 4YTEA 3VH1A 1IZ0A 1LSJA 2Q3EA 3PQEA 4BO9A 1MC5A 3VZRA 3HDJA 3GHYA 1U3UA 1YGYA 2HK8A 2JAHA 2OMEA 4I5FA 2P5YA 5G0SA 3K2EA 3KYCB 3RC7A 3B20A 1IPEA 3F1LA 4NJOA 4QXMA 2I66A 5IDWA 3FD8A 2O2SA 3T7EA 1XWFA 3R0IA 4CMIB 3S2EA 1I5RA 3ZV5A 3E9QA 4R68A 5T8KA 1DHRA 5BSEA 3LT2A 1E0DA 4BMNA 4DXHA 3BIOA 3INTA 4PVDA 3ZWWA 3E5MA 4IS3A 5K0ZA 3GDFA 3HJAA 3LF1A 3P2YA 4WLVA 3H2ZA 3DQPA 2NUAA 3Q11A 5DBGA 2Q4BA 3KB6A 2C54A 3S8MA 1QLHA 3SXPA 1UXHA 2NV6A 4IQGA 3RQSA 5LDGA 1ZK0A 1PGJA 5JYEA 4YJGA 1GYRA 3JD0A 1ZEJA 3NT5A 1B7GO 2DPHA 1VI2A 3GGOA 3K2BA 2Z1MA 4RZHA 1YKFA 5CDUA 1ZCJA 4BVAA 4MKXA 3EC7A 1T1SA 1RYDA 3AWDA 1HLDA 1GQQA 1N1EA 3L4BA 1XG5A 4EEZA 2EXXA 4BO7A 5TX7A 2B0JA 3BTVA 3C1OA 2WD8A 2FRDA 2P2SA 4H16A 2G0TA 4TKLA 1XEAA 1HDCA 2R00C 2AMFA 4YBZA 1YOVB 2PZLA 4OJNA 1PJCA 4CM5A 1RYEA 4YAJA 3EY4A 4U6SA 4OMUA 3HADA 1CQIA 5CPFA 4FQ8A 2P4HX 4DLLA 3VVBA 3D4NA 3L0DA 2I6TA 5JXWA 4MVJH 4D79A 4IPTA 3O9ZA 2D5CA 2YHIA 4R3WA 4WEOA 1CF2O 5EESA 3DAPA 4KOAA 1GQYA 3QQPA 3VZQA 1HSZA 3GEGA 1FDVA 4WE3A 1P1JA 3OICA 3LDHA 4WPGA 3WBFA 4CUJA 2FHSA 8LDHA 1WMBA 4XZ3A 2Q2VA 4IZIA 3RKRA 4XYMA 4ALMA 3ZWCA 1LQUA 2AQKA 4WLUA 3IDSA 1GDHA 1P74A 5F1PA 3GZ4A 2OZPA 3KLPX 4TRMA 1YBMA 2B69A 2WD7B 1L7EA 4FOSA 4Q9NA 4XQGA 5BSGA 3PYLA 5KIAA 1U3VA 2P9EA 5DBFA 5ILOA 5EN4A 4ZN6A 5FF9A 4E5MA 1XKQA 4TROA 3RFTA 3Q2KA 3P7MA 4FS3A 4GVXA 1I3KA 1Y8RA 3JYLA 4LRSB 3L07A 2DPGA 4NDNE 4FFNA 1QMGA 5EPOA 2FY8A 5EJ2A 4CMKA 1JWAB 5G4LA 1XA0A 2D1YA 1JAXA 4FR5A 4IGFA 3U3XA 2W2KA 3OBBA 1YL7A 4CPDA 1NQ5A 3JQ9A 2BGKA 2YJZA 3R6DA 4UVIA 1MC4A 4MIOA 3MOIA 1JLLA 4BO3A 2HAEA 2ZYGA 1KBZA 4YAKA 4OOEA 1CDOA 3JQ8A 1MV8A 1LQTA 1ONNA 3LT4A 4TRNA 1IHXA 4YJGB 4ZD6A 4E32A 2IXAA 3IOYA 1YQDA 3ZWMA 3L9XA 3VDRA 3R3SA 3ZWYA 1VL0A 1C0KA 4LSMA 1VE9A 2VTEA 4JNKA 4CMBA 4QSMA 1ZO8A 1T2CA 4A0SA 3B70A 3K30A 3HWRA 5KJCA 3EUWA 1YL5A 4EI2A 1LU9A 5CDTA 3GK3A 3PPIA 1P9LA 4MP3A 1NPTO 3ZU4A 4J1TA 4BGVA 1HDGO 3D64A 5AXCA 5IDYA 4K9DA 4XKJA 2X0IA 3WX0A 2DC1A 1CRWG 3PZRA 4JGBA 5AYVA 5CDYA 2BF7A 4Q3AA 4HBGA 3MWDB 3JD4A 2V6GA 3DTTA 4MOWA 5HS6A 4AJHA 4TVOA 2W2LD 5L7TA 1JAYA 3VVCA 3GFBA 4G81A 4J6FA 1BW9A 4IXTA 4ALIA 3TRIA 3OA2A 4O59O 4J1NA 2JCYA 2Q46A 3AOEC 1A4UA 1V0JA 2HK7A 4INAA 5DNAA 4JJIA 1DIGA 2B35A 3KSZO 1AXGA 3OJLA 1ZK1A 2CD9A 4E13A 1EUDB 2BKAA 5JMPA 3ZHXA 1VC2A 5JW6A 1ENPA 2JKVA 3CZRA 3WSVA 1CJCA 5AXBA 4J9VA 2EGHA 2C29D 1NP3A 1GZ4A 5T8KC 1EVYA 3GVCA 4YJFB 1DIHA 2ZYDA 1U1IA 1YE3A 3C1AA 2DAPA 4GI2A 1KC3A 1IUKA 1QRRA 2VN8A 4RQTA 4BNMA 2CF5A 2J3IA 1JLLB 3MCVA 2I67A 4DIOA 3Q3CA 4PLVA 3NGXA 4NBTA 2Z95A 4RV9A 1OOEA 1NAHA 1IY8A 4RQUA 1ZZEA 4P4NA 1E1LA 3DOJA 1ZJYA 3WIDA 3UF0A 4BNWA 4II3A 1XQ1A 1I10A 1W73A 2GZ1A 2QW8A 3E6AA 4D3SA 1NVMB 1JKJA 2O3UA 2O3QA 2Y68A 4B79A 4DQVA 2G5CA 4NU6A 1VPDA 1ZMOA 1I36A 4YJDA 3W4IA 4UEKA 5TIIA 5B4UA 2ZYAA 1ZW1A 2D8AA 1ULUA 1N9GB 2C5AA 4R41A 1C1DA 3ON5A 3RC1A 1O5IA 4JBIA 4FFRA 3S1LA 4DGSA 1T25A 3F46A 2IZ0A 2BGLA 3UAGA 5K6AA 2WEKA 3MWDA 1P45A 4K6CA 4PG6A 3DHNA 3TZHA 3IJRA 5JDCC 4DLAA 2DFVA 1E1MA 4BS9A 4EEXA 2O23A 2BELA 4FB5A 5A9TA 2JHFA 3VH3A 2ZB3A 2Y0CA 4KDFA 2AEMA 3JD3A 5DULA 3FTPA 2Q50A 1TT7A 1BVRA 5A06A 2I3GA 4XR9A 1MXHA 1X1TA 4B4VA 2FN7A 3JCZA 1LXCA 4M49A 3VZSA 4F6LA 1PS0A 3VHRA 1U5CA 5KJ6A 3QWIA 1KERA 1HETA 1GY8A 2CDBA 4J3FA 3DB2A 1HWYA 4DMMA 3RAJA 3ZWNA 5I7FA 5F5NA 5DT9A 2J3HA 1JDJA 4CM4B 3KM0A 1SCUB 2VNSA 4AJLA 3IUSA 2NVBA 3JV7A 1IOLA 1SEVA 1HYGA 3GGPA 4IDEA 1I2CA 2FWMX 3OA0A 3WLEA 2LDBA 1Q7BA 2HO5A 3OECA 3ZW9A 1AGNA 1K5HA 1ONOA 2HUNA 2UVDA 2EV9A 4B3IA 4CR6A 5I9LA 4TRRA 1Y7TA 2VHYA 5L40A 1QYWA 2X0JA 4BNKA 3VAZA 3W8DA 4CL8A 3M6IA 1ADBA 4I5GA 1G0OA 2D2IA 2J8ZA 2PLAA 2XXBA 3AU9A 5DCUA 4OXKA 1OI7A 2EW2A 1P0FA 1D7OA 1HSOA 1BMDA 4FFLA 1LTHR 1Y8QA 4XIYA 2GYYA 3I4CA 4NFHA 3WNQA 1R0LA 1N9GA 4HUJA 1C1DB 4DMLA 4I5EA 5C7IO 1B26A 3I9JA 1B8VA 5A5EA 5KJ1A 2D59A 3PJFA 1GZ6A 1PS9A 1YBVA 3DDNA 4UUPA 4Y98A 3A9WA 2UDPA 4K6FA 5FI5A 1L7DA 4FOOA 3OFSA 4XJSA 2CVZA 2X4GA 3M2TA 3RKUA 4KTTE 1PEDA 3H9GA 1SBYA 1YBAA 1I2BA 3GA0A 5J23A 4PLFA 1Q1NA 2CVOA 4XJTA 4Z3KA 4GX1A 5CEFA 3U4DA 2CF6A 4IIVA 4ALKA 5KVSA 2RIRA 1VRWA 5B4VA 2J5KA 1KEUA 2C20A 1DSSG 4CM4A 2NADA 2DBVO 1T2AA 3VPXA 3H5NA 4YDRA 4E5PA 5CHEA 3AI2A 3PXXA 1B3RA 3DAFA 4KDEA 3C3XA 1KEPA 4OH1A 4G65A 1P1FA 2OP1A 4NIMA 2NM0A 5TT1A 1UXIA 3U09A 1LDEA 4OSPA 4ZRMA 3BAZA 4YPOA 3ZHYA 3GH3A 4MVJM 1QXSA 1T4DA 2ZQZA 1E5LA 3BMQB 4E2XA 1G6KA 2ET6A 1DB3A 3PIIA 4PRLA 1E7MA 4EZBA 1QYCA 3RSHA 4B4UA 1JWBB 4E33A 4D46A 2RH8A 1E3JA 2C0CA 3DZFA 3OF2A 3RUAA 4XD2A 5TC4A 3PIDA 4CMCA 2EIHA 3FWNA 2O4UX 5L51A 1TA4A 3OJOA 3VC7A 4EUFA 3HUDA 5IF3A 2GO1A 2X7HA 1MFZA 2FMUA 1LLCA 4WLNA 2EP5A 3EAGA 4HV4A 4EW6A 2AE2A 4W82A 2FSSA 3TNLA 3W8FA 2VRCA 3AY7A 5JY1A 2BI7A 5B37A 2VYND 4WNIA 5HBRA 4IGEA 2UAGA 4MVJA 4BNNA 3BTSA 4BO2A 5BSHA 1ISGA 1CQJB 1LDMA 3EZLA 2AW5A 4UUNA 4YJHB 3BHIA 1XR3A 3RFXA 2LDXA 3TF5A 3DONA 3PYXA 4OIMA 5FYDA 2Z1NA 3HDYA 4XX0B 3AOGA 1HDRA 1A5ZA 1MP0A 2BRUA 3JQ7A 2GERA 1N92A 4R1TA 5B1YA 2X9VA 2C2XA 2HMUA 4NH4A 4PG8A 5K6AC 3BMOB 2HDHA 1UP6A 4XYBA 3D5TA 4IIUA 2Q2QA 5JAIA 1K6IA 4RPLA 4W7IA 1F12A 1ULSA 2YYYA 4O6VA 1QORA 3NT2A 1IL0A 2YV1A 2YQ4A 2JFFA 3JQFA 2EHDA 1H0KA 3V2UA 4YQYA 3O38A 4OHUA 3NEPX 2O2YA 4GBJA 4ZQEA 2HU2A 1KVSA 5KJEA 4YWJA 2A9FA 3DHYA 3N74A 4BKRA 5A02A 2H5LA 1UDAA 5F1KA 3DFUA 4BKQA 4D0RA 5L4NA 3DFZA 4RPJA 4W99A 2FPPB 4WKGA 4BGIA 3JQ9C 1X0VA 3E9NA 1DLJA 2A35A 4L73A 1GTMA 2DKNA 1GEEA 2QRLA 4CM3A 4IDGA 2HRZA 4ZICA 5DP1A 3AM3A 4O1MA 4N5LA 2OP0A 3OP4A 5CAEA 2VYNA 1P31A 4RPHA 4QECA 1YWGO 3I4FA 1DC3A 4CR8A 4BNJA 1V3VA 1EFLA 2HMTA 3RUEA 4DLBA 1E6WA 3VDQA 2PKQP 1HE2A 4HNGA 4QO7A 2ZTLA 2PKQO 5GY7A 3UKOA 4HFNA 4YB8A 3TJRA 4U6QA 2PGDA 3I6IA 5L4LA 3JD2A 2CUKA 2H63A 4AVYA 3GG9A 1E6EA 4I9NA 4J90A 4B8WA 3Q0EA 1KOLA 1SPXA 4XGKA 2DM6A 3GOHA 3DMTC 3GAFA 1XU7A 4CV1A 4RORA 3WWZA 1RKXA 1UH5A 3K96A 3ROPA 3CXRA 3R1IA 1A9ZA 1GR0A 4E5KA 3MJSA 2Q1TA 4S3MA 3D4OA 3WGYA 4PFJA 4BL5A 1BSVA 1RM4A 2B4TO 4IBOA 1LI4A 2DU8A 5DP2A 3MWEB 2IYPA 3V2HA 1X7DA 1HYHA 3ICPA 4Y67A 1BXGA 3LT0A 2WE8A 1U4SA 1Q0QA 1U5AA 1E3WA 2PD4A 1FK8A 2QYSA 4TZTA 5DCYA 4GVLA 1SMKA 2I76A 1ADFA 3S2FA 1I32A 1MXFA 3ORFA 3VZPA 1E77A 3LLSA 4GPD1 3BMCB 4MIEA 4B7CA 5HWSA 1QV6A 1ZXLA 2NNLD 3I83A 2FSVA 4ZQHA 2B4RO 1DFHA 2Q2WA 1GCUA 1H6CA 1VSVA 4QQRA 2O7SA 4BKPA 2OGUA 3UCXA 3GVXA 4YYZA 4EGFA 2AG5A 1Q0HA 2GRAA 4CV0A 4FN4A 4OQYA 1ZUD1 1A7AA 1HEUA 4JJGA 3UCEA 4TKMA 1JVSA 5U1PA 1DRVA 1ZK3A 2OFPA 2JCVA 1VM6A 5L9AA 4XRRA 2DTXA 2J3KA 4OKNA 1YRLA 4ND4A 4Q39A 1HDXA 2JD2A 1UR5A 2NU6B 4ZQBA 4XDYA 2W90A 4A73A 3NRCA 5KNLA 2PZKA 4QFDA 5JY6A 3OSUA 4GGOA 3D7LA 4OXYA 3ABIA 2J5QA 4PZCA 3CEAA 3F4LA 4CM8B 3KEQA 1XU9A 3IS3A 4BO5A 3PWKA 4DBZA 1KIFA 1E92A 1IPFA 1Y9AA 2IZ1A 3L6DA 2OXIA 2C82A 3OQ6A 3QP9A 1Y81A 3CKYA 1LDGA 4RVSA 1YDEA 3ADPA 1JA9A 4E2WA 4PLZA 1B2LA 1VL8A 3BHJA 3G1TA 3FWZA 3ZWAA 1Z45A 4NNJA 3ZWVA 5COBA 3RUDA 1ZXBA 4A10A 2VOJA 4AJPA 2WM3A 4GSKA 5IZCA 1WW8A 3C7DB 2GASA 4B4WA 3WQSB 3UN1A 5DN9A 3K92A 4ALJA 5A03A 5DBIA 3KSDO 5A4DA 5JCJD 4OO3A 3F6YA 4Z3DA 3ITDA 1I2ZA 2QRKA 4D41A 1P1IA 2AQ8A 3GDOA 2NU9B 3BYZA 4MVJF 1E7YA 3B6ZA 4G2NA 4WCFA 4XGNA 2CNBA 3BMCA 3QJ5A 4L0QA 5LDHA 2FP4B 1DEHA 1HE4A 1U2DA 4CM9D 3LC2O 4JK3A 3L6EA 1CIVA 1U7TA 3CMCO 3ANNA 3QHAA 4FIZA 1E3WB 1GU7A 1WP4A 2DVMA 1NYTA 4E3ZA 1FDSA 4F46A 3ONEA 1CEQA 4U5QA 2WYVA 2ZIZA 4I9HA 4UEOA 1UDCA 1UXKA 3FN4A 2NTNA 1SEPA 3EDMA 1HRDA 1GAEO 1PSDA 3MJ4A 5K9ZA 1B8PA 9LDTA 3MOGA 4L4SA 2X23A 3CPSA 3MZ0A 1LRLA 1T2EA 3GNQA 1T24A 1NQTA 2D0IA 5ICSA 1AUPA 1PL6A 3ZI0A 1E7RA 4NJMB 1MA0A 4MJLA 1HL3A 3NGLA 2WE7A 5ITVA 4FSHA 1ADCA 1KS9A 1PX0A 1R4MA 1BG6A 2EKPA 3DZIA 2W4QA 2XPCA 3I5MA 3P2OA 3PLNA 4R1NA 4RLHA 1NFFA 3C8MA 5THKA 4ESOA 4BQRA 5CG1A 2PFGA 4RGBA 4NPCA 4RVHA 4P38A 1EDZA 1TVEA 3KYBA 4R51A 4NG5A 4Y6SA 4A03A 1N5DA 2CY0A 1YVEI 5JCJA 1P3DA 6ADHA 1DIBA 1A7KA 1F14A 1K0UA 2BMAA 4PLGA 3STHA 4ALNA 4R5HA 4LCEA 5FEUA 4CM6A 5HM8A 1TLTA 3GT0A 5BNFA 4CM8A 5JDCA 3SEFA 2Y99A 5F5LA 1PZEA 3PP8A 3GY0A 4PLCA 5KKCA 2BGMA 1KVQA 3PRJA 1E3LA 5ADHA 4R69A 3AI3A 5C7LO 1DAPA 4DL9A 1UZMA 1YOVA 2BFPA 4Z0HO 2YHUA 3ZNOA 4DWVA 1Z75A 4WCFB 4B7UA 4MIYA 5KTKA 4JX8A 1VKNA 4HFRA 4D3FA 1T2FA 4NR0A 4YRDA 1QYXA 3JD1A 1H94A 3IJPA 4FJ1A 3GN2A 4GX5A 4PZDA 4BKUA 3AUAA 3AUUA 1RWBA 2WYUA 4R16A 1GFSA 3G17A 3IKVA 2BD0A 4MO2A 4RCVA 1DRUA 2IZZA 4HXYA 4PLHA 3LSYA 2D5AA 2HK9A 3FRJA 5H82A 5EINA 1I33A 1NQAO 4GSLA 4ZJUA 2PA3A 4LSWA 1H9BA 4NFSA 2PNFA 4TZKA 1W8DA 2PD6A 4IDFA 2OBNA 3PLRA 4ND2A 1ENZA 4GQAA 5F3RA 1SAYA 2QG4A 1R4MB 4R01A 4ZHSA 2IYOA 3I9LA 2WMDA 2POQX 3I1JA 4N5MA 3FF4A 3ITKA 3L4SO 3F5SA 5IAAA 2Q4EA 1YL6A 1NPYA 2GZ3A 3ICCA 3CE6A 4M8SA 4GKVA 5B12A 5HRUA 2BFOA 1DXYA 2FR0A 4YAIA 4WNCA 5BNIA 5ITWA 3JQGB 4AJOA 2C07A 5IXYA 4LVUA 3H8VA 4PZEA 2Y0EA 2Y93A 1AXEA 3H9EO 1L1FA 1O6ZA 1BXKA 4D43A 3QWBA 1Q7GA 3I9MA 4FPXA 3SC6A 1XDWA 1HZJA 3GFGA 3U4CA 4B3HA 1TXGA 2PGJA 3AK4A 4J0FA 1N7HA 1EE9A 1YB5A 2VHWA 3G79A 4RPGA 4Q3EA 5A05A 3ZNQA 2XOXA 4CL3A 1GYPA 1WZIA 2VOEA 3KRTA 4N7RA 3ANMA 4U0JA 1M66A 1SC6A 3WTCA 4WGGA 4IS2A 1TT5B 4LCJA 4MKZA 1PJBA 4D44A 4J7XA 4GMGA 3KLMX 2SCUA 3GR6A 4CR7A 4NK4A 7MDHA 1YO6A 4O0LA 4TQGA 5AOVA 1VJTA 1RM5A 3EVTA 1PL7A 1Y6JA 3MTGA 3UVEA 3VPFA 3MEQA 4CUKA 5ICMA 3EYWA 4LMPA 1N2SA 2XXJA 2YV3A 2VYVA 4BKOA 3PWZA 4FFPA 3HHPA 1E6UA 4I1IA 2P68A 1I01A 4GGPA 1PQWA 4XQCA 5L7WA 1YS4A 3KYCA 3QW2A 3AJRA 4E30A 1C0PA 1TB4A 3HSKA 1NWCA 2ZB8A 1B16A 1FJHA 4YRAA 1YQXA 2O3RA 1E5QA 3DO5A 3ENKA 4XR4A 4OM8A 3RIHA 2UYYA 2YY7A 1UUFA 1BWSA 1DRWA 1DIAA 3MJTA 3V1YA 3V8BA 3VTFA 1X15A 3DBHA 1U8FO 1IHYA 1XHLA 1ZBQA 4C7JA 5JS6A 2NTVA 3B1KA 1FXSA 1PJ3A 4UUMA 5JAMA 3E9MA 2W8ZA 1LSSA 1KC1A 5COAA 4DREA 3JQDA 4UVHA 1ZIDA 1GEGA 4NBRA 3GGGA 3ZNPA 4BB5A 3H2SA 4R5MA 5FI3A 3KETA 1B14A 3V1TC 4PVCA 3K31A 3VOSA 2BFMA 3D3WB 5CP8A 2GN9A 3GUYA 3JQBA 2VWGA 1K6XA 1LA2A 2VQ3A 1K3TA 2VCYA 1DLIA 3JQGA 1WWKA 4RZIA 1I24A 2AQIA 1TT5A 3OIFA 1SZJG 2E48A 3PK0A 3TQHA 4LRTB 3GVHA 4DPKA 1WZEA 3HN7A 4BNTA 4NI5A 4CUZA 1EUZA 1W4ZA 4DTIA 3JQAD 1P77A 3EVNA 3ONDA 1HDZA 4BNLA 2SCUB 4E12A 3PTZA 4PG7A 1ZNQO 4OYRA 4CMJA 1D1TA 3DBLB 1PJSA 3AUTA 5DDIP 1FF9A 4RF5A 4QX6A 2BH9A 1NVTA 2C5EA 3PHLA 5TF4A 3NJ8A 3NTOA 5JMWA 1I30A 2YHIB 1UZLA 2AA3A 2BHLA 3F4BA 4YACA 4IDBA 2TMDA 1H6DA 3JYNA 3W6UA 2YV2A 5A5FA 2VHVA 4MP8A 3GPIA 4JN6B 1V9LA 4W9NA 5DOZA 3KOUA 3IP3A 4JIGA 1KYQA 3TSCA 3LLVA 4XQ9A 3KSUA 2ZCUA 4FJ0A 4CQMD 4DA9A 4EDFA 1NM5A 4P4LA 3AUSA 4QTZA 1E3EA 5IZ4A 4L8VA 3ZN2A 3WYEA 1OBFO 1EBFA 5F21A 4U0KA 4YAEA 3PJGA 4F6CA 3Q2IA 1M2WA 1PJLA 1UP7A 1H2HA 3Q1LA 4FBGA 2Y1CA 1ID1A 2GSDA 2FZEA 1EUCA 4K28A 3KO8A 4TRJA 1OAAA 4UULA 2PV7A 1PWXA 3FI9A 4JXKA 3N58A 2Y1DA 4EUHA 2ZJ1A 1PTJA 5HTOA 1EVJA 1C3VA 1Y8RB 3OIDA 4WEQA 1EZ4A 2TMGA 5L45A 3K6JA 1XQ6A 5JBIA 2DQ4A 1QYVA 2X5OA 1WPQA 3JQ6A 3KEOA 5A3VA 3X2FA 4AJKA 4UVDA 4BO1A 4E5YA 4J4HA 2OORA 3PI7A 3M2PA 3QVSA 4P4GA 2OOSA 5IZCC 5KJFA 4BGUA 2JAPA 4L9RA 2X5KO 4GH5A 4Z6KA 3FNFA 1HLPA 2AEJA 3TZKA 1DJNA 4OL9A 3WYCA 3JQ8B 4MVJD 3D3WA 3WR5A 3JYOA 3WLFA 3UFXA 1ISHA 3QA9A 3IAHA 4R1UA 3ZCXA 1PQUA 3RBVA 4ND1A 1MB4A 3DZGA 4MVJP 4IJUA 4W6ZA 3UCFA 1H9AA 1Z73A 3O03A 2QQ5A 3L4BC 5C5IA 1IYZA 4FC7A 1U8XX 3O26A 5I8WA 1Q7CA 1P44A 4I8XA 4PN3A 1M75A 1SO8A 1B0AA 2CZCA 2EWMA 4Q3BA 3DC2A 1PL8A 3NDJA 3PFFA 3FBTA 1GADO 2VRBA 1UJMA 2ZJ0A 4D42A 4A5OA 4HFMA 1UAGA 3RC9A 1BHSA 1DJQA 4XEHA 2E6UX 2JD0A 3PVZA 1EUCB 4NBVA 3BHMA 3WWYA 5EERA 4KUHA 4OOFA 3KBOA 3WS7A 1LC0A 3G1UA 2GN8A 3EMKA 2Q49A 3F9IA 3I52A 3RJ9A 5HS4A 2P9GA 1T1RA 3BZUA 1DO8A 2HLPA 4UAGA 2QYTA 3W6ZA 1LX6A 4CQMA 4XYGA 3WQRA 2GDZA 4CLEA 3TOZA 1ORRA 1D3AA 1H6BA 3FCOA 3SJUA 1R4NA 4TWRA 4E0BA 4LN1A 4JLWA 4CLRA 3FR7A 3KZVA 4JQCA 4DC1A 4R1SA 3E03A 5CG2A 1EQ2A 3DXFA 3S55A 5G4KA 1YJ8A 2E37A 4Z0PA 1HE3A 2WJPA 3HDHA 5JO0A 3EW7A 4RJTA 2G76A 3HN2A 4BQPA 5BQFA 4FGSA 3DR3A 2X8LA 4JROA 2CSUA 5I9NA 4FW8A 1VSUA 3R3JA 5T6BA 3ADOA 2D4AA 2GN4A 4HKTA 4YJHA 1XSEA 1LLQA 3WGOA 1E1NA 3AY3A 3UFXB 3GHHA 4E6PA 3MJVA 1TEHA 3I9NA 2DFDA 5TQVA 4KWHA 1CYDA 3CZMA 2X86A 4YCAA 1DAOA 3WGZA 2WSBA 3GEDA 3BMOA 1Q2XA 3TL2A 1PWZA 3GMDA 3I23A 5EQFA 3AOEA 4FC6A 2PK3A 1LSUA 3PHIA 4PLWA 4BIIA 2PH5A 3WDSA 1GUZA 1H6AA 1S6YA 5G0TA 1CERA 1NAIA 5GZ3A 3DOOA 1EQUA 1NQOA 2Y1OA 3D0OA 2ZTUA 3D4PA 3GG2A 4C7KA 1O9BA 3VKUA 3L77A 1XGKA 3AFMA 3IIEA 5TNXA 2WTBA 3D1LA 1LRKA 1SCUA 3HB5X 1HT0A 4BNVA 1NHWA 3A4VA 4OGWA 4M86A 1HKUA 3AU8A 2EEZA 2B4QA 1R6DA 5HA5A 5TRTA 3HDQA 2QRJA 5CDGA 1UXJA 1MGOA 5CAEB 3WG9A 3RFVA 2PWZA 4BNZA 4I08A 3HE3A 5JO9A 5U9CA 2VZ0A 5L53A 2JD1A 2O48X 3DBVO 2AXQA 2IEBA 2NUAB 2EG9A 2JL1A 3U4HA 1G1AA 4Y9DA 3H4VA 4E31A 1IZ9A 1R4NB 1ZMTA 4CLRB 1M6WA 3ZDFA 3EK2A 1PGNA 3G49A 2P5UA 4J4TA 1E7QA 4ND5A 4RDHA 5IXSA 4WLEA 4ROSA 1QV7A 3OIGA 4M54A 2J5RA 3F3SA 1YDWA 2HMSA 3KYDB 2NVWA 4YT5A 3QWFA 4EITA 2IXBA 3SLGA 3ZWXA 3OJEA 4R3NA 3NAQA 4JBHA 1OMOA 3O4RA 4QEDA 4CM7A 3OH8A 5T5QA 3P19A 4RVUA 4Z9XA 5ER6A 1EBUA 2QIOA 3TZCA 4CMEA 2OL4A 2AG8A 3PWSA 4MKRA 4QUKA 3JQEA 4U7WA 3RU9A 3FHLA 5JC8A 2EJVA 2VZ8A 4YVFA 2P91A 5KVVA 8ADHA 4TMFA 1S7CA 1PIWA 3HB4X 3VTZA 5JC1A 3I6QA 1ZVMA 2ZTMA 5AXDA 1Z82A 2PZMA 3PGXA 4R54A 2PTGA 1ARZA 2G1UA 2QZZA 4IMPA 3GNTA 5CFZA 1GV1A 1NPDA 2A92A 2CFCA 4IDAA 4IUYA 3SJ7A 3TZ6A 5IJZA 1T26A 3DMTA 3QE3A 2B5WA 2C7GA 4LGVA 2NSDA 3H9UA 1DFGA 5BNTA 4HWKA 2IDZA 3M1AA 5L95A 2X1HA 1HZZA 3INRA 2Y1FA 1EK5A 3ZWPA 5JSFA 3OQBA 3RVDA 5T67A 3V1UA 1F06A 1B15A 1VLLA 2HSDA 2WYWA 4I5DA 4DQXA 1R37A 5GMOA 1RM3A 5TGDA 2DT5A 3BXXA 4CLXA 3E8XA 1O95A 1B8UA 3QIVA 2X9GA 5TJHA 4GAEA 2ZKLA 1NBOA 1PU2A 4NBWA 3LT1A 1JVBA 4IDDA 1VKOA 4DUPA 5KOIA 4B3JA 3LQFA 3NTRA 4PLPA 1PZGA 1LSOA 4WECA 2H6EA 3MJCA 5IDQA 3RWBA 3K9QO 1YONA 4ZQGA 4AJJA 1PGOA 1ML3A 1ISIA 1XIVA 4J1SA 4K26A 4E21A 2IE0A 4RVDA 2W2KB 3WGHA 2CMDA 1HTBA 4RO0A 3H6KA 3TWOA 3ZHBA 1BRMA 4L76A 1DC5A 3H3JA 3DBRB 1ONPA 5I9MA 5BR7A 5ENVA 3NV9A 1XELA 2NU8B 1OZAA 1A9YA 2UV8A 3WYBA 2DTEA 2EKLA 4R4JA 2VWQA 1F8GA 3GDGA 1NXQA 1M67A 4HFJA 3GRPA 3PEFA 3FNHA 1J5PA 4XX0A 3PFWO 3RD5A 4RVGA 2JFGA 5KKAA 1MG5A 4LMRA 5CEEA 1EDOA 2PKRA 4DQUA 4Q3CA 5JAQA 1LUAA 3OJFA 5IG2A 4QO8A 3FTNA 3TL3A 3KXDA 3E48A 2GCGA 2XF8A 1PR9A 4GWGA 3G3EA 2PR2A 2G82A 2I99A 4CMHA 3D5QA 3QSGA 2P4QA 3NUGA 1LDNA 3PYMA 4PGFA 4JJFA 1I8TA 2UUOA 1ADGA 5ILGA 3LK7A 3BTOA 5ER9A 1I3MA 3WGGA 4CMGA 4YXFA 1NNUA 4PLTA 1HF3A 4P8RA 1RJWA 3AM4A 4KMSA 3TFOA 4FD3A 2VUUA 1J6UA 5COQA 2FPPA 1GUYA 3CSDA 1A71A 1EUDA 1V3UA 4Y6RA 4CMIA 3WB9A 1EMDA 1C0LA 5I7EA 1YB1A 1EEHA 1QSGA 4BNUA 3WSWA 1ENOA 3IC5A 1KVRA 4N18A 2CDCA 2AHRA 2ZK7A 1A27A 3GF4A 3ONFA 4ND3A 4NJMA 5EIOA 4CMEC 1AN9A 4CV3A 1GPDG 3GVIA 1XCBA 3OEYA 4J16A 4W7HA 5TLSA 5JDIA 2D3TA 4J9UE 1ZFNA 4BMVA 4OQZA 4WOJA 3X2EA 2R00A 2NU8A 1O8CA 3ZHZA 2A94A 4YT8A 1PGPA 3K5PA 4Q3DA 2EJWA 1DC6A 2HJRA 3U5TA 2VNAA 4U8GA 1C1XA 3UGKA 3QRWA 6LDHA 1ISMA 2I65A 3EHEA 1NX6A 1E7WA 4IMRA 4KZPA 3VPSA 3WFIA 1DFIA 1PGQA 5MGBA 4DIBA 3OQ1A 4BNXA 2AQHA 3DBRA 3NYWA 5JNLA 4BHTA 4Z9FA 4JBGA 3CIFA 1P1RA 1DDOA 2AE1A 2X0NA 1BDMA 3JQFC 4BO6A 2H1SA 2Q1SA 3C85A 4J91A 1E3IA 5FFFA 1KEVA 3KVOA 3IP1A 4Y8VA 3QVXA 1V3TA 2VZ9A 1HYEA 4RF2A 3DZHA 3N7UA 3NX4A 4XDZA 3ZV6A 3DOCA 1LDBA 5JDIC 3MWEA 3KUXA 3PGJA 1OC2A 3JYQA 4TSKA 4ZU3A 1RM0A 1Z7EA 3F5QA 5U4QA 3PQFA 4MDHA 4HX5A 1UP4A 4DC0A 1GQ2A 2EGGA 1ISJA 5LCXA 3ZWOA 3B1JA 2Y67A 4XCVA 1AHHA 1P1HA 3GPDG 4TVBA 5TJ9A 4WCFC 2H9IA 3ASVA 2HKIA 3JQAB 1N8KA 3M1LA 4ZGWA 1WXDA 3DZJA 2I9PA 3JQBC 1BGVA 4GX2A 4ITUA 2Y05A 2Y1GA 4L4RA 3IMFA 4D45A 2WD7A 4KTVE 2UUPA 4N54A 2QZ9A 4A7PA 3WTBA 7ADHA 3GAZA 4MVJE 4KQXA 3ZNNA 2ZATA 1ENYA 1T4BA 2BI8A 3A28A 2ZCVA 3E18A 4RVFA 4XB1A 5GZ6A 1YQGA 1R16A 5H83A 4QFCA 3GEMA 1T2DA
chains in the Genus database with same CATH superfamily
5K09A 3L02A 3O93A 1QYRA 1XYGA 4YRBA 2SNIE 2C2HA 2GGSA 5G0UA 5JPIA 3GD5A 3P4XA 1EGQA 1OV6A 1VP9A 2OYSA 4LISA 1RW4A 1B0UA 2AIRA 3A9RA 5BSUA 1TJ3A 4KUGA 4BAGA 4BPRA 5HZGA 3P0RA 5IN4A 3EEQA 1MT3A 5K6TA 2PSFA 4DCCA 4ZRNA 1CRQA 2GUGA 2RGWA 3F47A 4EG8A 1JBEA 1ULAA 4GLLA 2HRQA 2JGLA 1PFKA 3A2NA 1MR3F 4NBSA 1DX9A 1RS0A 2EFGA 3DVAB 4C4SA 2C2OA 3ETGA 3U7JA 4CIYA 1CUSA 1H2RS 3Q87B 4ZCSA 3T1HB 1U7DA 2PUVA 1XLTC 1OT5A 2H2AA 3QG1A 3G0GA 4IL5A 2AG1A 4R2LA 3IYLW 3REOA 4D7AA 5B2EA 1U94A 3ET5A 4XTRA 3TOXA 2YQ5A 3U4IA 3FPKA 2WNSA 3GRRA 1BQ3A 1X7GA 1TM7E 2P9QA 4OAQA 5FR2A 1I51A 2FZLA 4AY4A 1W5EA 2H4YA 1UXGA 4MARA 1Z34A 3SQMA 5AM5A 4PSKA 1Y3IA 1RJFA 3A1NA 4H6VA 5EE5B 5H81A 1WZUA 4G4JA 1GPLA 1TEXA 2O06A 2X9NA 1JPJA 5DLYA 4N40A 2VA9A 4OAPA 4PBSA 4ILKA 4YLGA 1EDEA 3AZPA 3G9QA 2BV3A 2QLLA 2W6ID 4E6EA 4AJNA 3JPYA 2XUKA 5LBIA 4CNBA 3REFA 1RXCA 2DUWA 3V1LA 4M1TA 2FP4A 2BMJA 4Y2PA 1QCDA 1X7ZA 1G8MA 1PP4A 1PW7A 1SXJC 5JNVA 5JE8A 2AWOA 2IXDA 4AL4A 4MVJI 2EFDB 1TVMA 3O4GA 4HQKA 3WWDA 1E9RA 2ZJ7A 4X3PA 4TL9A 2YKGA 3FPSA 3AI1A 3HZZA 4R7GA 3KSBC 3QG5A 4EKYA 1QMPA 1Z6AA 4UHBA 1AKWA 3DVSX 1ICIA 1CFZA 1ZRSA 4A27A 4WA8A 5CEJA 1ADJA 1M6VB 2EWWA 4BNGA 3MF4A 3E70C 4EG1A 3GZJA 3B9RA 3BJZA 4TS3A 1P18A 1IVYA 4IVNA 4AJ4A 3KDAA 5K4AA 4D8VA 1NV8A 1XRRA 4M89A 1F7VA 1KETA 4PICA 1KY2A 5AKHA 2NYVA 2ZLBA 5IKPA 1Z37A 4YS6A 1V7ZA 3NKFA 3MTJA 3DWGA 4FJ2A 5BUQA 2SHKA 4O4JB 2VHUA 4RA9A 3UB4A 1JMKC 4FHGA 5DCLA 1BE0A 4I6JA 1W88B 3DZKA 1U7XA 1FMTA 1PNVA 1Q5PA 1C0IA 4R31A 4RS3A 1E2HA 4IINA 3UTDA 1WB6A 1CG6A 1HLFA 1QKJA 2OHGA 5CPBA 1E7SA 1UINA 1PDVA 5TDHA 4XD7D 3W9UA 4M1MA 5A1JA 4UHJA 1GPMA 3KV3O 1WKCA 4O02B 3BDIA 3CH7A 3KJXA 5DGDA 3PT9A 4GZ5A 4MKGA 4TPKA 3KPUA 3JRXA 1G3RA 7ADHA 5LFAA 2HV8A 1VSBA 3TUJC 4KODA 3ENNA 1MX5A 1E9AA 5JAOA 4BO4A 2JFWA 2EF1A 1UBCA 4D9FA 1OFVA 7ABPA 3SSOA 5K8LA 3GUZA 4LFCB 3NHLA 4OJMX 2V54A 4DCSA 5C3MA 4V0SA 3OU2A 5TPZD 4L4YA 2QRNA 5J40A 2A4KA 4R0MA 5CT6A 3NDIA 4JUFA 4KXMA 1PT8A 3GLIA 3QVGB 1BDHA 3SXJA 1JR3E 4PG4A 4C4OA 3LLMA 2B36A 4MRSA 2ODTX 3IRVA 4L4XA 1DTWA 2Z2XA 4XCQA 3IB6A 3EJ6A 3RT1A 5JH7B 4L0MA 3AYXB 1F17A 1GD1O 2F59A 1IQRA 2HA6A 2I9KA 4F1JA 3HU2A 2HCFA 1TW2A 4WLOA 5BYJA 4M88A 1N2OA 3ZDCA 4L5JA 1Z4LA 3M4XA 1TYZA 3TI9A 4IIBA 4B4DA 1TU0A 3RS3A 1J0AA 2OC9A 3BH7A 3PPWA 1KAQA 1E1DA 5JHGB 1BJRE 2ACKA 3R23A 3EYAA 1XI2A 2R4UA 3IFSA 4UTRA 4YUZA 3PFKA 2NNWB 4KGDA 4YRPA 5C7YA 2V6BA 2M9MA 3UJBA 4IM7A 1ZCZA 4Y2TA 1B41A 3LVRE 1WHSA 5AHKA 1MB9A 1UFQA 5KWVA 3GGCA 3WLNA 1OGIA 4ID9A 4P5DA 1D6MA 3QU4A 1BOOA 4G1CA 5CA1A 5BRAA 2UXBB 2PXXA 5J5CA 5KVQA 4ISCA 4L5BA 4ZFNA 1EFPB 4R84A 4K6OA 4DRYA 3UG6A 2HC9A 5DXAA 2Y2UA 3ZWQA 1F5NA 4BECA 2BFDA 3TTXA 4X5OA 2D1SA 2CZGA 2P9FA 4M37A 2FPGA 3DL2A 3GXBA 4RANA 1TPYA 1BQ4A 1UZNA 5BN5B 1Z8FA 4EJMA 2FWIA 4INPA 4W8OA 3UK7A 6REQA 1M2VA 3D8BA 4WWHA 4MICA 4GMXA 1QUFA 4YASA 3O8QB 5ALNA 2E85A 2EP8A 4QG3A 1KMCA 4IAOA 2CFRA 4UCFA 3QLJA 3PDWA 1YD7A 2SICE 2O5CA 4V3CA 4V38A 5DOVA 2XAAA 4AF6A 3A04A 1Y89A 1YCGA 5JZMA 3DLCA 4DT1B 5GAJA 1CRLA 4IY1A 4NY1A 4UM9D 1HDIA 4CLOB 1N0VC 2Y4OA 5CLJA 4TWIA 3BPSA 1JR3A 1AKUA 5ALPA 1P81A 2NIPA 3RHFA 4AG3A 4OMFG 1QP0A 2J3DA 1XLTA 3RROA 2YW9A 4E14A 1ZGGA 5FULA 4PYJA 3NJ4A 4G56A 3LDUA 2Q27A 2CLMB 1VTKA 1WEKA 4KXUA 5TSDA 7GPBA 2DBQA 4QHYA 1YR7A 2A5GA 3DZDA 1E64A 4H7DA 3SC4A 3DW3X 3ZE2B 4CCAA 2GZ2A 2X41A 3AWIA 4NMHA 1XMXA 2B1GA 3L0YA 1NHGA 4G0WA 1Z6ZA 4ARZB 2FCAA 1QGAA 1L7AA 1S2OA 1VG1A 2FH5B 3WB2A 4AJ1A 2E5FA 1R7RA 2XYRA 2H16A 3EWIA 1SUSA 3L1IA 5A9RA 4YA6A 1ZPDA 2C2KA 2EG5A 3HH8A 2XD9A 3OCXA 4P7GA 4ZHQA 1NFQA 5K3CA 1NTOA 4ZV4A 3IE0A 2X9LA 3QUTA 4V0NA 4IHAA 5E2BA 3W8RA 1EESA 4Y30A 1GG5A 1NMEA 2WY2D 4LVCA 4GBED 2ZOSA 1DE0A 3KR1A 1Z68A 2F90A 4QOSA 3A06A 4I7EA 4O4LF 1ORIA 4AQDA 2P9YA 4E1BA 3LYHA 4IFTA 5KDDA 4MPPA 5JYDA 3ZR4B 3NHJA 1QJ4A 2HQ1A 3HM9A 4BN4A 4GBMA 4N82A 5HHTA 5FYQA 2GARA 1AGRA 1KR2A 4BX0A 4DS3A 4YMIA 2F00A 4J4BA 3L9WA 3DTVA 1BWRA 1ITZA 1ZU4A 2XKAA 3P26A 4G9GA 3RYHA 3A3YA 2FZWA 3MAAC 4HAIA 1B93A 2ODQA 4ESEA 3VAYA 3CB4A 2QUAA 5ULLA 3K8ZA 5I3ZA 2PV0A 2FPIA 4NQZA 3IKLA 3STYA 1NV9A 2O3JA 3LUFA 4CG2A 3BC1A 3JASA 4KXFB 1U8UA 3QVOA 3HBFA 5H3CA 1WG8A 3RREA 4K8OA 5HKAA 1N5KA 5HBGA 3UENA 3TZBA 2OEPA 4RLQA 3RB8A 1IRXA 2XODA 1X94A 2ZZKA 3E5RA 4XIGS 2VUIB 3W2FA 5TVGA 4ECAA 3C1TA 3PB3A 4EYEA 1QKIA 3FPLA 4HDSA 5A4IS 2J85A 3DVLA 3IURA 3WSTA 4JCCA 3QLEA 3W34A 3ZUGA 1BKYA 3EZ6A 3REQA 3T0FA 4EUEA 4ZYLA 1DIRA 3QVWA 5C37A 1OVGA 1UJ6A 2Q1WA 4MRAA 4ZU6X 5G1OA 3TDKA 2E9SA 4HI0E 1ZLYA 3UA4A 1TU4A 2NACA 4B5LA 1QAOA 2RAPA 4LY0A 1TUBB 2QLJA 4BUCA 1ZSVA 2P3QA 2H85A 5K7SA 3BERA 3RRYA 5ERYA 1MX3A 1OJ7A 2ZVQX 2JFHA 3H5VA 3J7TA 3T1QA 4B35A 1RACA 1JKXA 4M83A 1ZR4A 2WVGA 2B30A 1YB2A 3FETA 4LMBA 1I94B 1KYYA 5B6IA 2HHLA 2QQ0A 5CYGA 4CIBA 1Y4ZA 3EZNA 2YZ7A 3R0XA 4OP2A 4RFSB 3ZGLA 4BV8A 3JATB 4DGQA 2HIMA 4HLDA 3HFRA 3R6WA 1EG7A 4WKCA 1VJ1A 3VUEA 3OPYI 3MWLA 2KS6A 1P39A 1QV9A 4Z4IA 4IXWA 3KUKA 3M34A 1YV9A 2IZ6A 4RHEA 1Z5VA 5LU8A 1XL0A 3RSQA 3LUBA 3CNBA 2Z5LA 4A23A 1SBIA 3AXTA 4YAFA 4CW7A 4QTYA 3SPXA 3FMFA 2AOVA 3QF7A 4N41A 1ODCA 4URFA 1SOVA 4XYEA 5CFMA 1N3IA 2E0IA 3IAS6 1SOMA 3HU5A 3V1KA 4GLOA 4MGZR 3VJMA 1BGWA 4B47A 2H4HA 2OZKA 2PAAA 2XUZA 1C14A 4YJ3B 3AR8A 4KVGA 4B6SA 5SY6A 4TYWA 1GKUB 4GO1A 4CIVA 1NW4A 3ODGA 1TE2A 5DI3A 5A6SB 3RU7A 1IHDA 1MG0A 2H9AA 1O95D 3LYAA 4GECA 4OQ4A 3CN9A 3UC9A 1UDBA 1KJJA 1WCYA 3VC3A 3WRXC 2QN1A 4PTLA 1YXMA 3RC2A 3SFTA 4CN8A 4ZYTA 3A3NA 4NCJA 1W0CA 1R0KA 3EC1A 3EIOA 5GM1A 1ZNYA 3K16A 2CVQA 4Y0VA 5LLTA 1YB4A 2HYIC 3LVFO 3RRJA 3CIOA 1HDOA 2PHZA 2BFEB 1W76A 2G1AA 1M74A 2OAQ1 3WQQA 4U7DA 2WB2A 1AZTA 5LBUA 4TM7A 4IEFB 4NCKA 4WLFA 5CXQA 3H8JA 3K73O 1NF2A 3LP8A 3R0ZA 4LRYA 2Q1YA 4AK9A 1FMFA 3IAEA 4PAOA 3UA3A 5CCBA 3FVVA 5GIOE 1T5LA 4J7UA 1CY4A 2IEGA 1LNQA 3DLHA 2RBEA 1Y5RA 3EOAI 3GUCA 3PQ6A 3DV0A 4AMVA 5AQ1A 2FUCA 1B3BA 2QE6A 4BEWA 5BV2P 5T4EA 5EE1A 3WGQA 1XZIA 3G6KA 3ZLJA 1YC2A 2AJLI 2AKEA 1ODLA 2O2CA 5BW8A 1UJ2A 3CMMA 1X1QA 3HEMA 2Z6AA 3RPEA 1XNGA 3L5KA 4DSOA 2NVUA 4D5EA 4E1AA 2FQYA 3DJFA 4YT4A 1UJCA 1TZ2A 2N75A 1J4AA 3N76A 4KP7A 3AFNA 1US8B 2Q5FA 3A32A 3NH9A 4L8FA 2AG0A 2K5UA 2ZUCA 3NH6A 4NCHA 4Q24A 4WQMA 3ZWBA 2PEYA 3CVUA 1XRQA 4J0JA 3OZWA 2YNMA 4F45A 5EA2A 3BMNA 1AKMA 2I4LA 1QOZA 4K6MA 1E2EA 1Y1LA 1WXGA 2NP6A 1FTWA 3DZ8A 2C5HA 1W0JD 2ERCA 5AI9A 1KMIY 2RH4A 2NSLA 1JG7A 3Q9SA 5LZ5A 5C7OO 1IHUA 1XZKA 1O96A 2Y0DA 3PZBA 5TQ2B 3T9DA 3UUGA 3ZHSA 3I1YA 4DLKA 3GC6A 1F20A 3PFIA 4C14A 3OP1A 4XFDA 3R9XA 2XE8A 1G1MA 4EH1A 3OTWA 1B73A 3CF0A 3N0WA 3IQWA 3PSHA 4OBEA 1BXGB 4PR0A 4EB0A 5CU7A 1C8VB 4P0QB 2FPXA 2EEPA 3DH0A 2W6NA 1U1FA 3DNPA 5EYPA 1ZMBA 1G6Q1 3S6JA 3UHFA 1LC3A 4QU8A 3IQDB 2ZBUA 4HJXA 3C70A 4G41A 2G4CA 2LTAA 4CV2A 1QLJA 3AF3A 5DJ5A 1OFIA 1X3LA 4PLYA 4DOMA 3OJ0A 3OOEA 4CGYA 3GLHA 4MVYA 1SBHA 2H1RA 3KZNA 1OLUA 3M4YA 4FGKA 2J6CA 3EXIA 4MEBA 5L7YA 4B34A 3DG9A 3UH1A 2ZROA 3UWMA 4EJSB 1YH3A 4JWKA 1UOQA 5KWIA 4LF5B 1JE1A 4YMTA 2C00A 2DX7A 2AJ8A 4LS3A 5GONA 4OV6B 3UC5A 1D4OA 4BE7B 1YFLA 5EEHA 1LI7A 1QQTA 3CHYA 5EMHA 3RR2A 3BUSA 3UICA 3JQRA 4IMJB 5I01A 3PJRA 4UUBA 3PDIA 3DHEA 1RJDA 1X7XA 4N8SA 1M5TA 4CQLB 1YJQA 2OGTA 2D2XA 2X22A 4BBJA 4DPMA 5ALLA 3D2AA 1X70A 3RIGA 5FORA 1NR7A 4XIJA 1LZKA 4F3YA 3OZUA 3HMQA 2GEKA 1NG1A 2RKWA 3W4KA 3RG2A 2OC4A 1HI9A 1L9XA 4KWIA 2NP7A 1DRJA 4MI6A 1XTKA 5A5GA 2HJGA 1LDYA 3EDYA 1Z74A 3V4VB 1QONA 3D6MA 4IJVA 2CLFB 4HWOA 1HKHA 3SZRA 2OBMA 2VP0A 3P9RA 4D3XA 4HNTA 5IRCD 1UBEA 3NWPA 3FPCA 1X7HA 2DPXA 2OVFA 3EQ7A 4K6HA 1YS7A 5JIBA 3FTFA 4MPDA 4I5IA 1CDDA 1M2HA 3QQ5A 4QREA 2BKLA 2ORVA 2WIGA 3MUEA 3GLQA 3FTQA 2YHAA 4W4TA 2XMSA 4JITA 5AK0A 5AW3A 3RASA 3KZOA 3P5SA 1CUJA 4GZ6A 1E20A 1D6NA 1AA9A 4G5HA 4JA2A 4DWWA 1E99A 3EGOA 1KZGB 4DY6A 1DRKA 2D1TA 2EZUA 1JXOA 1RAFA 1TJ5A 1U7OA 4WASA 1V16A 1ZD8A 2WWFA 3BEDA 4UTXA 2QDKA 5IBPA 3ICQB 4AF7A 3AVPA 3MMSA 4IWNA 2VHJA 4TV8F 4B31A 3LMKA 1K2WA 1NMYA 2YY5A 1H85A 3Q7QA 4MRVA 5CA0F 3BG5A 2YASA 5BQ5A 2ASVA 3ZDRA 1BS9A 1V45E 4L02A 3HQ4O 4ZT6A 5T57A 1YA8A 3C3KA 4YTEA 1GVNB 1Y6ZA 2D1QA 2DYKA 2Q3EA 2RHLA 4OIFA 4RIFA 4BO9A 2NXCA 3HCPA 4TYMA 1CJKC 4O2AA 5G0SA 2BP7B 3KYCB 3BSYA 1I1NA 2D54A 2OZEA 3IEIA 5EIAA 1Z12A 3EWAA 4TKUA 3X1YA 4BC1A 5DHUA 1WCIB 4NC9A 3Q5DA 3RS4A 4UM7A 1TFUA 1I1QB 1OROA 4KQJA 1SUPA 3RS5A 5IJZA 4OH7A 3S2EA 4R68A 3AQIA 4I14A 1HQKA 4MZXA 3KDPA 4DE5A 4WXHA 1GG8A 1OUMA 4CTKA 1WKVA 3LD9A 1QF9A 4PVDA 2HPAA 3VR4A 4U1RA 3LFTA 5IK2D 1N32B 4Y2XA 4Y2HA 4LYDA 5K0ZA 4LMAA 1TZJA 4DA0A 3Q11A 3WV4A 2IBSA 3KJIA 5DBGA 2C54A 5GJBA 2NV6A 4Z49A 1BO6A 1V5FA 4OCZA 2Q3DA 2HDOA 1PGJA 3ZX4A 4MCHA 1GYRA 1NMXA 1KMHB 2HEIA 3DR5A 2FJPA 2GAIA 4G4IA 3L84A 1L4BA 4RZHA 1YKFA 1ZCJA 4AW9A 4MKXA 2J5BA 3EC7A 2E55A 1T1SA 3AWDA 1GGKA 1YSCA 5BW5A 1Z2PX 1ZVVA 2AFVA 3KLBA 4B5KA 1XG5A 1SUFA 2EXXA 3QZUA 1IC6A 2B0JA 2YXEA 4HGYA 1RZVA 3BTVA 3MSCA 1VJ5A 1X42A 1X39A 2XOEA 2AYYA 4EVSA 2KB0A 2WD8A 3T1TA 5B36A 2HDWA 2G0TA 4EK9A 1HDCA 2EOAA 2R00C 1FA9A 4FQ7A 5CW2A 5FLEX 1J8QA 1N2GA 2PT5A 3EY4A 4OMUA 2ETVA 1DADA 5H7XA 2ESRA 3HADA 1CQIA 4KPUB 5CPFA 3JZMA 2P4HX 1N2CB 4KAAA 4PV7A 3GA7A 4PGHA 3K9FC 2LCIA 4FW9A 3D4NA 4KR9A 2I6TA 4C6TB 1LBSA 3OOYA 4MVJH 5JXWA 1Z62A 3PNPA 4E08A 3BQMB 3EVFA 1X74A 1TGVA 1JG3A 3G5TA 2E18A 4P5EA 2YHIA 5FBWB 1DJLA 4E11A 4AY2A 1CF2O 5IM5A 3SOZA 4KOAA 2VDQB 4ZVKA 2GPWA 2XCSB 5JNRA 3SR3A 1L4EA 2M2IA 4EARA 1DBQA 1QM5A 2YN0A 1WD7A 3COZA 1EWYA 1NJSA 1VKZA 3LDHA 3WBFA 1JDUA 2ZU0C 4B3SB 2A30A 3TRDA 3R76A 1CLEA 2E4VA 1ZAKA 4WZBA 4ALMA 2G77B 3FKJA 1LQUA 2ZRDA 1OA0A 2GCEA 2DBYA 4XGRA 2BT4A 4AT1A 1XCLA 3V4LA 5A4FS 1C81A 4AU1A 4A5SA 4D4JA 1UJNA 2OZPA 5EKDA 1YACA 1Z6PA 5IEBA 5B1SA 1JR3D 4KXLA 4DMKA 1CXZA 4Q9NA 1O7JA 4P3YA 1HORA 4RH1A 2WIJA 2FE1A 3C4JA 3STTA 5ES4B 2O6HA 5E1OA 3O3NB 2P9EA 3HV0A 3IOMA 1THTA 2J4DA 3NBZC 3S28A 1V4NA 4EYOA 4E5MA 1ILEA 4EECA 4F4CA 4RKYA 3FNIA 3KHKA 4K3UA 4ZYUA 1HK7A 1MPXA 2CNWD 2OVBA 3HI4A 4GVXA 1Y8RA 3C3WA 5JVDF 1GAXA 3EG5A 2DPGA 4JKYA 3N0XA 4NDNE 5HJ2A 1IQUA 4AUNA 1IXYA 2FWPA 4G0YA 5ALVA 1YHNA 2D1YA 3U3XA 1U2EA 2VKTA 1FYVA 4ZOAA 2W2KA 2JIRA 1YL7A 4C0AC 2OXFA 4L5AA 1P3Y1 3S40A 1NQ5A 1UFKA 2CN1A 1M33A 3CISA 4PCLA 5C31A 5ELXA 4NZYA 3M5WA 1VP3A 3QPCA 4M1SA 2G8LA 2BM1A 2XNDA 2WUDA 2X9QA 3CUYA 3ER6A 4BTLA 4IVPA 1CZRA 1MV8A 4YJGB 1IHXA 2VC2B 3P52A 3TRHA 4WFIA 4E32A 3IOYA 5IXJA 1ZESA 4EVQA 3ZWMA 3VR1A 2D5IA 3ZWYA 1KDZA 1GLGA 1C0KA 1LVHA 2P6RA 1VE9A 5EVJA 3PXGA 5HR5A 2MIIA 1L7OA 1FC0A 1ZO8A 4UPVA 4WMLA 1DG3A 1T2CA 2ZRQA 4GYWA 1W5BA 1HFEL 2Z8YA 3AEUB 3B70A 3I01M 4BRZA 2YWFA 3FMOB 3ISTA 3UW1A 1Y4UA 2GVZC 4BO5A 1Q19A 1AN0A 5CVVA 2YYZA 3HBMA 4B40A 4KNYA 5DH9A 4B6GA 4ZAYA 5A3RA 3LUHA 4YCJA 3B1YA 3U1TA 3QXJA 2LBPA 4C30A 4K9MA 4HNQA 3PZRA 2G8NA 3UV7A 1E3DA 4RZUA 5JUWA 4KLZA 4HBGA 2HMYB 4LOHA 4MUBA 3VSBA 3BSFA 3JZIA 5HS6A 3ZEIA 3R2JA 4ZC1A 3LHDA 3LKDA 4V0ME 1R5OA 2BBWA 3RVBA 1QH8B 1MV5A 4IXTA 3WGLA 3M0EA 4UW9A 2JCYA 4ZT4A 2Q46A 3O90A 4TN5A 5LPNA 3RJZA 3TLZA 4CKEA 5FUWA 3R7BA 1ZM7A 3IMKA 1KHHA 1C7RA 4JJIA 3M82A 5TQ0B 1K2VN 2FR8C 1K7EB 4E13A 2OGSA 3ZHXA 1Z0DA 2VCEA 3A9CA 3I53A 3GJTA 1ENPA 2Q7XA 2FFBA 3LPDA 4O4LB 2A5JA 1DJPA 1BH2A 2GTPA 2OXCA 3K9HA 3LCCA 3DE5X 4J9VA 5AXBA 4HT3B 5ICGA 3NHYA 4NVRA 5FLYA 2VAWA 4UQLA 2PXAA 4HB0A 3AP1A 1N36B 3C0KA 3DYBA 1J25A 1N7IA 1SVMA 2PAFA 2PEZA 3C1AA 3L49A 2GESA 3N3BC 5JS2A 4WK0B 1QRRA 2PBFA 5CVEA 2GXQA 2VN8A 5FWYA 3HVIA 2H2GA 2YV4A 2J3IA 2QM3A 1JLLB 1G16A 3MCVA 3CWZA 3L01A 4OBWA 5CNKA 2ZE7A 4GOJA 4PLVA 3NGXA 2FSVC 3E23A 3P9QA 4NBTA 1Q1ZA 1V41E 3AI7A 4RV9A 4D9MA 4LXTA 3LRPA 4JLMA 5D2CA 2ZRLA 3ROEA 3HXQA 4BZQA 3ICOA 4P4NA 3T61A 1YVPA 3QJYA 5D51S 4HNRA 4PYIA 3V9AA 4BNWA 4II3A 2IUSA 1XQ1A 2DFTA 1ZBDA 2I4OA 5C1PA 1FSPA 2BL4A 4F3KA 2AOTB 3E5HA 3TQCA 2H8KA 2PJRA 3E6AA 1DARA 5AKIA 4D3SA 4UNRA 1F9EA 2HLHA 4EF6A 4O25A 4OLFA 3BJMA 1ZMOA 4NU6A 3QE0A 1COWD 4Z4EA 3AVXA 4L72A 4Y1RB 3W4IA 4UEKA 5TIIA 3TTUA 2R44A 4ZODA 4ZO8A 4BIMA 1G8YA 2LKCA 1C1DA 1G64A 1MX1A 4PO8A 3V00A 5LQMA 1O5IA 1DUVG 3ZY5A 4PRYA 3S1LA 4L28A 4V0KA 3ZQ6A 3DZCA 3F96A 3T06B 4C04A 2QNBA 3KJFA 1CV2A 4EQZA 1JJIA 3MWDA 1PV1A 1A7JA 4K6CA 4PXAA 4XUDA 5DHPA 4KI0A 4Q7JB 4DLAA 4F3RA 4R9VA 1K7FB 1U0SY 2AC2A 2DFVA 4EEXA 2O23A 1JMVA 1K4MA 4HZGA 4W1RA 5HQ3A 2JHFA 2CLIB 2Y0CA 2ZB3A 3JD3A 3KYIB 3PD7A 4HHEA 4JODA 5DULA 3FTPA 1GZ7A 1TT7A 2Q50A 2CEKA 2G9VA 4DAOA 3HY3A 1V37A 4B4VA 1QR2A 4M0LA 2FN7A 4E09A 3JCZA 2ZUVA 4IYJA 4K2HA 3VHRA 1IWBB 5FUQA 1YGPA 1T4MA 4GKAA 3HKDB 5B1EA 1S8FA 4WJKB 5H1YA 5KJ6A 3QWIA 4MTCA 5AUPB 1GY8A 5U4XA 2C4HA 2GYWA 2WB4A 2PKYX 4N1AA 2R5FA 2V0CA 5KUTA 3RAJA 2Q5QA 2PX6A 3CJRA 4XSGA 2PGNA 5F5NA 1AV7A 1NTRA 1JDJA 3NP7A 1FS5A 4YHBA 3ECSA 4AJLA 1IOLA 3ND6A 4JLPA 3D4IA 1HYGA 4AROA 3ED1A 3ZLUA 3IEVA 1H2YA 2PIDA 2G9RA 3KQUA 4K9NA 4LHZA 4D8WA 4X71A 4CR6A 2H7YA 2W11A 1Y7TA 1WRBA 1FTQA 1YZHA 3MB5A 3B5IA 1ADBA 4CG0A 4I5GA 2I8LA 2FLKA 2PL5A 3SWWA 2PLAA 2O1WA 2ZSIA 3R5SA 4YHHB 4KHPB 4TYPA 2I6FA 1JHYA 3CXUA 4QJIA 1ZM9A 3B8HA 1OI7A 5K3FA 5C2JB 1MO5A 4C2BA 1D7OA 4TUYA 2B4YA 4UNSA 1XKTA 3TUIC 1JHOA 2XV1A 2P6NA 4XIYA 2GYYA 4RV4A 1N8NA 2ISSD 2JFUA 3BFJA 4CF4A 1R0LA 3HRHA 2W48A 3KT6A 4TT3D 3ONWA 1N9GA 2WAOA 1TLLA 3C3AA 4HUJA 5PGMA 1B0PA 3RNOA 5C7IO 3TQQA 1BFDA 5DK6A 4CEHA 2MHCA 3D8RA 3H3XA 5A5EA 1N5RA 4FWTA 2XYVA 2NYUA 2BTOA 4LJ6A 1O87A 4NX2A 3IVMA 1UMDB 2AX3A 2JARA 2NO7A 2PQ0A 1WMEA 2W6OA 2G6TA 2GN2A 4FYXA 5JNWA 3CQ9A 2JW5A 3G7UA 2FSPA 2XDQA 3A9WA 4FYKA 1MABA 4KDRA 4CKZA 2ZIXA 2ZUTA 5C8YB 1GXSA 2G83A 2EU8A 5K0LA 1L5GB 3ZCPA 2FFQA 1HFWA 1G7SA 3RKUA 4HMQA 1BU5A 3BD6A 4KTTE 2P79A 2RC5A 2GVDC 1TZMA 3DUFB 3LY8A 3NFRA 5E95A 4EYKA 1B1AA 1TD9A 3KOMA 2RGDA 5HJ7A 2EW1A 4W9RA 5BSVA 3IEMA 3UAXA 2GRUA 1DDGA 1K6EA 3NM4A 2IV7A 1P4GA 1OHHA 1VB5A 3BXPA 1P2UA 5FHRA 4AZTA 4YNBA 4HDMB 2XD4A 1L5HA 2RIRA 4IMIB 1DWUA 5BORA 3A7DA 2J5KA 2C20A 3D4BA 3OFND 4R8SA 1SBZA 3WHKA 1ICEA 3D2BA 2DBVO 3INNA 3OOJA 3VSEA 3NEJA 4Q7EA 2Z4RA 4X7PA 4L8WB 3RW9A 4IHKA 2QKYA 4KBYA 4YDRA 4H6WA 4D9NA 3T1VA 3U3RA 2VDWA 1B8NA 4HTAA 5CHEA 2GHQA 3RSSA 1TM5E 2Q28A 2AOXA 1OLXB 3CJTA 4G65A 4GE0A 4QAJA 3WO0A 1NUHA 2R48A 3EX7C 2OP1A 3RIXA 3RABA 1UXIA 2Z56A 4R8KA 1LDEA 4R8MA 5J2TA 4RX1A 4ZI7A 1GGVA 1SC1A 3BAZA 5AICA 3RO7A 1HQYE 5ESRA 3ZHYA 1T4DA 1UMCB 4ZI5A 3HKBB 3H0CA 3W5SA 2IA5A 1DB3A 1MHPA 1DO2A 4PRLA 3T3DA 5LYJB 4MUXA 1UPAA 2VH5R 1WX1A 1X7WA 1CUBA 1ODKA 4PQYA 4MV7A 3ZZMA 1ORHA 1OCEA 1CU1A 1E3JA 2MR6A 3RUAA 1O1YA 4EY3A 3EVGA 3GBPA 2JIQA 1R18A 2LV8A 2PMDA 2Y0BA 4JSRA 3FWNA 2A5DA 2O4UX 5HF6A 3OJOA 3WIOA 2QR2A 4O4IB 5AI8A 5DXJA 2BR3A 4WKNA 5EEGA 5K0SA 4EUFA 5LQJA 2NOAA 4X64B 5IF3A 1XNJA 3A36A 1PWEA 1A76A 1CR2A 2V8BA 3DDOA 1VYUA 3O8DA 4FMBB 4R8RA 3EAGA 5JATA 3UBTA 3FPFA 1PV4A 3QX3A 1E3MA 2QAGB 5IARA 3TNLA 3SF0A 3KT3A 1HFJA 3W8FA 3RC8A 2VRCA 3C6QA 4F8JA 2VYND 5EHZA 3ZCTA 4DADA 4BNNA 1TU3A 2UAGA 1M8PA 1YCHA 3BTSA 3Q1KA 3MVEA 5BSHA 3UWKA 1XDBA 2PMWB 5KSPA 3BM5A 4KCGA 2ISCA 1Z9BA 2OTCA 4WD3A 2ZXUA 1C29B 4DA4A 3E2MA 1SRQA 3DONA 3PYXA 3EEOA 3G8YA 3LIIA 4XX0B 2X8JB 4L8LA 4AI6A 2C03A 5F3DA 5BN4B 2RK3A 3RFTA 2BRUA 2G0AA 3JR7A 3ZOZA 2B8WA 4C7OA 5G41A 1Q17A 2GBGA 2HK6A 5CH3A 4PG8A 3IT2A 4G09A 1NIJA 5IK2A 1UP6A 3D5TA 3ZBUA 1FYXA 1MA3A 2BMDA 1J2UA 2HXGA 2Q2QA 3AERA 1K6IA 1VI5A 1XMPA 1F12A 1G5IA 3IAUA 1T9HA 2G9QA 1ULSA 4RPLA 4W7IA 3ZY6A 3IUEA 1QORA 3NT2A 4Y6OA 1KYZA 2YQ4A 1TL7C 2JFFA 4TUYF 5DNVA 1ZC4A 4BWVA 1V7CA 1CVIA 1XZAA 3O38A 4D2IA 4ZQEA 2VP6A 1JFSA 4P0PB 4TZ6A 4BDTA 2Z8ZA 3AEQB 3KKQA 1W4LA 2POCA 5AM4A 1AO3A 4I36A 3DHYA 5JSZA 5LN1A 2OXEA 4IVRA 3GWGA 4KVZA 4LJ7A 4MITA 5F1KA 3DFUA 2LD4A 4BKQA 4MK4A 3WFZA 4D0RA 1SD2A 4RPJA 4D9HA 4W99A 5D5HA 4BGIA 3JQ9C 4PPQA 1X0VA 5IC4A 3K94A 1DLJA 2A35A 3P4UA 4CEJA 1KI4A 3O4VA 2B61A 3IPYA 5IHXA 1RMTA 1Z13A 1QHSA 2OPHA 2HO4A 1MO3A 3SFVA 2WWWA 4R1PA 3W5VA 3W2TA 1F0NA 2MYTA 5KNDH 3OP4A 4XOIA 1FSSA 3Q12A 1H5NA 4QECA 3ZU6A 1RYYA 4ENTA 2WSLA 1IMOA 4LY9A 3I4FA 2IYEA 2W8BB 3Q3JB 4QJ4A 4DV4B 4ZOQI 2XCLA 2B8TA 1EFLA 5FPTA 2E89A 3HTXA 3K3PA 2G40A 2C83A 5K45A 1CQXA 3BH6A 3EOBI 2PYDA 4HNGA 2OYRA 3ZDAA 1QFSA 4EFDA 3N2GB 4OQPA 5KWJA 2FEWB 4Q02A 3TJMA 3SD7A 1BC5A 2I3BA 3RC3A 2PGDA 3CRZA 3JD2A 4FNOA 3OZEA 1QC5B 2DUNA 3V46A 2TYSB 4AVYA 4ZPXA 1PG5A 4RS4A 4JLAA 5HG0A 4I9NA 3ZDDA 5HTKA 2OORC 1ZVQA 3HVRA 1G2IA 2ZM6B 4DCGA 4PZYA 1GP2A 3MMNA 1KOLA 2IT1A 1UC4B 5FBLB 2IXFA 1UM8A 3DMTC 4A91A 3PX3A 1NUAA 1XU7A 2YMPA 4HYTA 5BNZA 2A59A 5BSFA 4E3WA 1M1YE 3WWZA 4YRZA 3WAGA 4IF6A 3FBWA 2VDKB 3K96A 2XRFA 3ROPA 1DTEA 2HGSA 2CNOA 4UNQA 1GR0A 2DKOA 2WWIA 3WGYA 1ZIOA 4JYZA 1M2OB 2JHAA 4TWJA 4ZAWA 3CLSD 1OBHA 2B4TO 3QU2A 2FZGA 1L7BA 2NT4A 4OHXA 4YI3A 3VDMA 1T1EA 2R8ZA 3HA5A 4C7VA 1LKZA 1X7DA 3ETHA 3UK2A 2ILVA 4Y67A 3VNBA 1JYEA 1TKRA 4F5YA 1HNXB 3KPJA 3LT0A 3OM0A 3DD5A 3LUPA 2WU4A 3L7BA 2QYSA 4TZTA 1P19A 1UWLA 4GVLA 4HNSA 1SY7A 1SMKA 2FUEA 2Y8EA 3E7XA 1ADFA 3SF8A 1WQ3A 3EGXB 1KK2A 3SKVA 3ZDQA 4L0DA 1MXFA 4M8IA 4FNMA 5IW8A 2VI5A 5CBPA 1E77A 2PVSA 4GPD1 3BMCB 1KEEA 4YCLA 1QV6A 1ZXLA 3GGJA 4LZAA 1KJNA 3CKKA 3HKCA 4XH9B 4ZQHA 1DFHA 2MYNA 3TLGB 2R8BA 1HTWA 3L4KA 2HF7A 1M1NA 2O5RA 4B85A 5ITSA 5AI4A 2PN1A 1CBUA 1BMFD 2GRAA 3D59A 4E03A 1E4EB 2DZDA 1A7AA 1QE0A 2O2ZA 1AURA 3UCEA 4TKMA 2YTZA 1JVSA 2QWXA 2XT0A 1DRVA 4POAA 2OFPA 4ZOLF 4M0KA 2I4NA 2QQEA 4A2WA 1YRLA 2VZLA 1LK7A 4ND4A 3NS7A 1VXOA 3TUZC 4P36A 1A5AB 1AY0A 3WK4A 3P0JA 4ZQBA 4XDYA 4A73A 3T9CA 3NRCA 5DYWA 4J3JA 4NYJQ 2WIDA 4NMLA 1M0EA 3K70D 3FTCA 4MWGA 3K53A 3F71A 2VK1A 3U48A 2GKGA 2FETA 4YAWA 1IIRA 3VC2A 3THYA 4DZTA 1R8XA 3M9XA 3G9ZA 4DBZA 2WG1A 4G5FA 1KIFA 1E92A 1U2GC 3HKEB 3L6DA 4QQNA 5AESA 2C82A 3PTAA 4KRFA 3PUIA 3ZC3A 3CKYA 4IDHA 5I4CA 4RW0A 2RHJA 2ANBA 5K0FA 3RSCA 1E2UA 2WV7A 1D4ZA 3BHJA 1K6MA 1XT6A 2QRVB 1EQAA 4H3SA 4XD7A 1Z45A 3I4LA 3SBDA 1EFHA 1TZBA 2GJKA 1ZXBA 2XA2A 3WIBA 1TAHA 1VFNA 2C8JA 4GSKA 5KSYA 4B2PA 2QROA 5IZCA 1R1DA 4MRMB 1WSWA 1ML4A 2ZSBA 4FHDA 4B4WA 1JR2A 3AR2A 5A4KA 3UN1A 5A03A 5A4DA 3U6KA 3KSDO 5HKLA 1PT5A 2HHHB 3M49A 2R25B 4TSFA 3TR0A 1F6WA 2A9QA 3HUUA 1MN6A 3PVSA 4N12A 3TNFA 4D41A 1P1IA 3NQ41 1F4LA 3GDOA 2NU9B 4AURA 2L2QA 1VBFA 3B6ZA 2NYRA 1L5NA 4XGNA 5BOSB 1CUWA 3P9ZA 3LWZA 1GKLA 1J8FA 2YBDA 2WFMA 4QBFA 1YIAA 5ECWA 1HE4A 4J07A 1OREA 1GT6A 1U7TA 4HEA6 5K3SA 2UYQA 4BC0A 2QVZX 4HRYA 3JRWA 3K71B 3CMCO 3ANNA 1R6BX 3CE9A 2HU8A 3EAFA 1P0IA 4ZC8A 5A7FA 1WP4A 2R1ZA 2XQVA 2CCJA 4N76A 2WJHA 3V7YA 1RQRA 2B7BA 3TSOA 1UDCA 3I76A 1K8YB 4US1R 3PNLA 4GEKA 2XWJI 4RSMA 1GAEO 2FN3A 3KT0A 1J99A 1RPTA 3C3CA 3TD6A 9LDTA 5K9ZA 1N8TA 3FJOA 2X23A 3MZ0A 1PUJA 1RYMA 1E2IA 1T24A 4G4GA 1PUXA 1PRYA 4FHFA 4FFSA 4L8GA 3CLRD 4OQXA 5EPEA 3TKYA 4CDGA 3OURA 3QPVA 3UJ3X 4DBLC 3N75A 4MJLA 3FI0A 3LKVA 3NGLA 5FWDA 2XKKA 3THXB 2FFHA 1RRGA 1OI2A 2R47A 2CL7X 1R4MA 2G5GX 1BG6A 1MRNA 2LR0A 2W4QA 2XPCA 3DZIA 2EJTA 5IVIA 3LRTA 5F33A 4BQRA 3D8UA 1TKCA 3EPKA 1GFWA 2C92A 1GA1A 1N5OX 4RGBA 4NPCA 3H5WA 2ZW9A 1EDZA 1TVEA 2DF8A 2V3VA 4NU8X 4KR7A 1E79A 4DQLA 1AKEA 4EWLA 1N5DA 2CXQA 2CY0A 1Y82A 2FX5A 5ALQA 5JCJA 2QEQA 3O8LA 1THGA 1XRJA 1A7KA 1K0UA 1O4WA 2WM8A 4OFWA 1DKOA 4KGVA 2VTKA 1NJ2A 4MQFA 4X41A 4IEEA 5E2IA 5H59A 3D8TA 3TLCA 5HM8A 4IIFA 4EO7A 3ACBA 4B9AA 1KF0A 1V6CA 5WRFA 2YS6A 5IM4F 2GZDA 1U8AA 1VLMA 4PLCA 4P3KA 4ZI7F 1SCDA 1KVQA 2NTEA 3OLVA 4GKJB 1RZUA 1G8GA 4E94A 3UGTA 4F72A 3KPWA