2NU7A

C123as mutant of e. coli succinyl-coa synthetase
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
287
structure length
287
Chain Sequence
SILIDKNTKVICQGFTGSQGTFHSEQAIAYGTKMVGGVTPGKGGTTHLGLPVFNTVREAVAATGATASVIYVPAPFCKDSILEAIDAGIKLIITITEGIPTLDMLTVKVKLDEAGVRMIGPNSPGVITPGECKIGIQPGHIHKPGKVGIVSRSGTLTYEAVKQTTDYGFGQSTCVGIGGDPIPGSNFIDILEMFEKDPQTEAIVMIGEIGGSAEEEAAAYIKEHVTKPVVGYIAGVTAPKGKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGEALKTVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinyl-CoA ligase [ADP-forming] subunit alpha
publication title Participation of Cys 123alpha of Escherichia coli Succinyl-CoA Synthetase in Catalysis
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ligase
total genus 108
structure length 287
sequence length 287
chains with identical sequence D
ec nomenclature ec 6.2.1.5: Succinate--CoA ligase (ADP-forming).
pdb deposition date 2006-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00549 Ligase_CoA CoA-ligase
A PF02629 CoA_binding CoA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 2nu7A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2nu7A01
2OZPA 3K73O 3QSGA 1V9LA 3Q9UA 6LDHA 1YS4A 4BNJA 4M55A 3BMQB 3NTOA 1PS0A 4YR9A 4BNTA 3LT1A 4PG7A 4RF5A 3ZWBA 2QZZA 4BNWA 4OQZA 5I7VA 2GGSA 3QWBA 4TKMA 1OFGA 2WD7B 1UP6A 4RVGA 5TX7A 4ALNA 4ZICA 4XDZA 1VSVA 3RWBA 4AFNA 1Y5MA 2P4HX 4XCVA 5C7IO 4RVHA 4U8GA 4RVUA 4HV4A 1X13A 2RAFA 2WJPA 4BNKA 4K28A 4A03A 2IXAA 4G2NA 3FTNA 3HSKA 1NHWA 3AM4A 1LDEA 5KWEA 2CVOA 1WWKA 3MJEA 3H2ZA 1E92A 2FPPA 1E7QA 3UVEA 4F46A 1S7CA 1ADFA 1O6ZA 3PWKA 4RV9A 2WE8A 5HTOA 1L1FA 4PLYA 3KRTA 4HFNA 1YJQA 3DZJA 3AI2A 2OGUA 1U3TA 4IDBA 1C0IA 3I9KA 5IN4A 3CMMA 3P5SA 1JAYA 1T2DA 2X7HA 3FPLA 1MB4A 1OC4A 3GGOA 4OH1A 5AXCA 5G0TA 1IYZA 3U5TA 4AJLA 1WAMA 2X0JA 5I8ZA 3QJ5A 1HE5A 3RFVA 2O3RA 4I9NA 4IZIA 4FB5A 4YAKA 2C20A 3F6YA 5TLSA 3D4PA 3RC1A 1LXCA 4Z9FA 4NK4A 1VRWA 3GG2A 3GEGA 1KERA 2CDBA 2YZ7A 3RBZA 1TLTA 1Y9EA 3AOGA 3U3XA 2UYYA 2HKIA 5A05A 2EEZA 1NPDA 2EP5A 3GAFA 3GGGA 4J6FA 5HA5A 3GUYA 4JLWA 3TL3A 3X2EA 3QP9A 1D3AA 3GK3A 2CVZA 4EUEA 3WICA 4BNLA 5F1OA 2QRLA 2FOIA 4P22A 1HDXA 3GHYA 3GZNA 5DOVA 4NBVA 5B37A 2E4AA 4OXYA 4E33A 3RC7A 1CEQA 1QV7A 4NBUA 2BI7A 3U4IA 5ENVA 4D3FA 5IN5A 3H65A 1I5RA 5HWSA 4J0EA 4PZEA 2VQ3A 1LDNA 3ANLA 1ISGA 3H9QA 1DAOA 2DC1A 3GT0A 3KSDO 3JQAD 1SEPA 2ZATA 3Q2KA 5HBRA 3TZQA 4BO0A 4C4OA 2PK3A 8LDHA 5JBIA 3KEOA 5BNIA 3V2UA 4MVJF 2A9FA 4AJIA 3DL2A 1GUZA 4J4TA 4XRGA 3QVSA 1R37A 4IZHA 2OUIA 3N74A 3ZHBA 4D41A 1R6DA 3FHLA 4IJWA 1QLHA 1ISIA 1A71A 3GZNB 3LF1A 5DOZA 1X7DA 4DXHA 2BHLA 3G1TA 3RBXA 4U6QA 4WE3A 2FPIA 1YE3A 2EERA 1F06A 3VH1A 4NBRA 3K5PA 1C1XB 1I10A 4WCFB 1I33A 1A4UA 4GX1A 2E49A 4BMNA 5JAZA 3HWRA 1M6WA 5F1PA 5JXWA 1Q7GA 3FR8A 1WZEA 3I6QA 3DBLB 1QYWA 1KIFA 1PSDA 3PGJA 1G0OA 1M66A 2X5JO 3OFSA 3FWZA 3JYQA 4TMFA 4JCOA 4Z3KA 3FF4A 3MOIA 4NBTA 4CMBA 3I9OA 2B83A 3D0OA 4F6LA 4HFMA 2GCGA 1MFPA 5L7WA 2O23A 2FPIB 3DWFA 2GN4A 1PJQA 4CL8A 3E9QA 3EGOA 2PTGA 1BWSA 4BOYA 2HAEA 3V1UA 4LMPA 4YVFA 3BA1A 3JQGA 5TRTA 4B4WA 4AG3A 2HK9A 2YHUA 1SZJG 4LK3A 4XQEA 4B4OA 4WLEA 1EEHA 4A0SA 4B7UA 3QRWA 5A06A 3ZDFA 2HSDA 2IZZA 3HDHA 1O8CA 4DMLA 5T6BA 4JJFA 3DZFA 4B79A 2Q49A 4AJEA 4J49A 2B69A 1A27A 3RAJA 1V6AA 5JY6A 4GGOA 4Y8VA 4DLBA 5DZSA 4A10A 1PQWA 1U4SA 3WYCA 3TNLA 1HF3A 4E2WA 4EGFA 1GZ4A 5KKCA 4YAJA 2NU7A 2JCYA 2RHCA 1BDBA 1LDMA 1V8BA 2P9EA 4Q3BA 4JROA 3JQGB 4CR8A 1EDOA 1LX6A 1SNYA 1H6DA 2AG5A 2W90A 4BKQA 3E5RA 3JQAA 3VVCA 4ALKA 3OEYA 4BGVA 3JQ8A 2ZKLA 2J8ZA 2J3HA 3ZWWA 3VH3A 3ADPA 4JQCA 3QVTA 5A3JA 1U3VA 4QO7A 3VH2A 1H5QA 3H8VA 1R4MA 2BKAA 2PH5A 3SX2A 5BSGA 3C1OA 2ZQYA 2DBQA 5KOIA 1DC5A 5A5FA 5IAAA 2VZ9A 4D3DA 3QA9A 4DVJA 2NU7B 2VZ0A 4E5KA 4IBOA 1M2WA 2ZB8A 3GVCA 1N1EA 4KP7A 1T25A 2A35A 4J4BA 2PZKA 3EHEA 1B8PA 1U8XX 1E1MA 5A1TA 4PLPA 2ZJ1A 3JQAB 3AI3A 3IJPA 2NACA 3GN2A 4J7UA 3JQ8B 5DCUA 1IE3A 4CMGA 1N92A 5COQA 4QX6A 4Y67A 1CDOA 2Y93A 4ND5A 1LLDA 3N58A 4JGBA 3ZCXA 1R4MB 5CDUA 4BNHA 1HSOA 1LRJA 4MVJG 4ZVVA 4RLHA 2JCXA 3TZKA 2P68A 1ENYA 3OM9A 3TOZA 5TGDA 4XQCA 2Y1OA 3IP1A 4I5GA 5CEEA 4MO2A 5DCWA 1L7EA 2ZJ0A 3TFQA 1JVSA 2BI8A 3MTGA 3R3JA 2H63A 3T7CA 4CJXA 3OQ6A 3JQ7A 3WBBA 3T7EA 4TVBA 5L51A 4L4RA 2QYTA 3BTSA 1ZSNA 1PS9A 3VPHA 4AJ1A 4RCVA 4BNYA 1PL8A 3ZN2A 3K6JA 4PLWA 2YJZA 3ZWYA 4OMUA 1E7RA 2BF7A 4RLSA 2NUAB 2AEJA 4KUEA 1NPTO 3GGPA 4UAGA 1F17A 4BNGA 2SCUA 2CMDA 4UEJA 1PGNA 3G49A 4MP3A 4BIIA 2DBVO 4R9SA 2NTJA 2VWQA 2RH4A 2Z5LA 3JTMA 2VZ8A 2OXIA 3ZZNA 1E0DA 3MTJA 2DBZA 4J91A 5T67A 1UZMA 5CG1A 3E5MA 3JQ7B 4IDFA 4UREA 3QIVA 2NTNA 1QYVA 2WWRA 5ICSA 3AFMA 3K31A 3VOSA 1MLDA 3PYXA 3E03A 3RC2A 3ZNQA 1LRKA 4CODB 3U9LA 1DIBA 2AG8A 2GN8A 2D1YA 3D4NA 4XA8A 3VZSA 2GR9A 3HB5X 3PDJA 3L9XA 1ZNQO 2ZTMA 1YQXA 3TOXA 3EZLA 3Q9NA 3ZHXA 5KVVA 1PGJA 4TRJA 2HLPA 3GMSA 1W6UA 2X9GA 3QV1A 5K0ZA 4IGEA 2P2SA 1U3UA 2AA3A 3WS7A 1M75A 1LC3A 2D59A 3K8ZA 1Q7CA 1D4FA 3NTRA 5I8WA 5ITWA 1A9YA 4IS3A 1LQUA 1KBZA 2UVDA 3WXBA 1CQJA 1BG6A 4LCJA 3FNFA 1ORRA 3RD5A 1X7HA 4FFPA 2HQ1A 4L0QA 3GQVA 1P1JA 1ISJA 4XRRA 1ZKMA 2DAPA 1ZO8A 1NFRA 4RF2A 1IL0A 1E3IA 3M2TA 4AJNA 4OSPA 1VSUA 4GH5A 3NTQA 5A03A 1J6UA 5AYVA 3S1LA 3R1IA 4J1QA 2Y1EA 3S2GA 2PKQO 3W8DA 2HO5A 4GL4A 3JYPA 1PJ3A 3DO5A 1WXDA 3DZHA 1P1HA 2AE2A 4IXWA 2C2YA 1GCOA 4FC6A 4I5FA 4CM5A 3WGHA 2V6FA 2TMGA 2O4UX 3I9NA 2H6EA 1XGKA 3GPIA 3L77A 4M49A 5JYEA 2NNLD 1M76A 1EUCB 2CF5A 1E3EA 4F3YA 4YPOA 1PGOA 1T4DA 4QEDA 2X8LA 3D3WB 4GKBA 5G0VA 5DBGA 1WZIA 1LDYA 1A7AA 3E9NA 3UUWA 3KB6A 1H93A 1T1SA 3Q1LA 4UVIA 4R5HA 4YA6A 3K30A 1QSGA 1IPFA 3LQFA 1UR5A 3AY6A 1ZMOA 4HP8A 1XKQA 2I9PA 1QKIA 2DTEA 1VJTA 2I6TA 4KDFA 3WIEA 4II2A 3GLQA 1J49A 1T26A 2JD0A 2VHVA 2JD1A 2XPCA 4FOOA 2BELA 5KJEA 1UZLA 3PHJA 2Y67A 3JQFA 1YB4A 2RH8A 3C3XA 4I1IA 2YYYA 3CEAA 3ZI0A 4PRLA 4PGFA 1UXHA 4J9UE 1SMKA 4AJHA 4DGSA 3GNTA 4XIYA 2O3UA 3B6ZA 2YFHA 1ZJZA 1OI7A 1GUFA 4E2ZA 3KLPX 4YXFA 5A9SA 1VL0A 5TIIA 1ULUA 4WLVA 4FSHA 1KVUA 3WGQA 1V0JA 3JQDA 2NWQA 2PD6A 4FW8A 4M86A 4QQRA 3LT0A 4B8ZA 3F46A 3NRCA 3AUSA 1B7GO 3UFXA 1BXZA 2NQ8A 1DXYA 3UXYA 1FF9A 2HK7A 1I3LA 2PY6A 1I0ZA 3ROMA 4I08A 1NFQA 1BXKA 1NR7A 2CDCA 4ND3A 3ASVA 4O5OA 5ER9A 4KTTE 3VVBA 1MUUA 1TEHA 2TMDA 5IDYA 2DPGA 3UGKA 1WDMA 4RZIA 2NU6B 2FN7A 1E3LA 3L07A 5B4VA 4BGUA 4XB1A 3OIFA 5A9SB 3TL2A 4DPMA 5A3VA 4E5MA 4YQZA 3LK7A 5JMWA 3ZWXA 2O7SA 3DC2A 3I23A 4DQVA 3DZKA 5CFZA 2AEFA 3MEQA 1GPDG 3MJTA 4BO7A 1MA0A 2W2KB 4J1TA 3AUTA 3S2FA 2F00A 1D7OA 2XOXA 1VE9A 3MJ4A 1E3WA 1HLDA 1VKOA 3ANMA 4ILKA 1E7YA 4QECA 3AK4A 4M54A 4UVHA 4J7XA 1FDVA 3RUFA 2X58A 1HDYA 1P1FA 1BMDA 5L7TA 4PG8A 4EW6A 3AY3A 1K6JA 2A92A 1JKFA 4BNIA 3PHLA 3JYNA 1GL3A 3NJ8A 4NZ9A 1T1RA 4ZA2A 2FZEA 2WDZA 3BHMA 5DP2A 4R51A 3OIGA 4WJZA 1YH3A 4HFJA 3OJLA 3F4LA 2J5QA 5ES3A 5KCZA 1GZ6A 1Q0HA 3CINA 1SPXA 3DHNA 4NI5A 3QQPA 1NM5A 1P1KA 1ZCJA 5GMOA 5FI5A 2OMEA 5CEFA 1E3WB 3ONDA 1J5PA 1XDWA 5AXDA 4YJHA 1PGQA 3A06A 4Z0HO 2DUWA 2VHWA 1YBAA 3E48A 3FCOA 3PRJA 1RYEA 1UXKA 3W6ZA 3IL2A 2J5RA 1NAIA 4MKXA 2HMUA 3GRKA 1JW9B 4LVCA 4R3WA 4E5YA 4WEQA 3D1LA 3GNQA 3JQFC 2BD0A 4K26A 4FFNA 4OO3A 1MC5A 4OQYA 3HDQA 1SCUA 4D3SA 4L8VA 3B1FA 5C7LO 2WYWA 1K89A 3DOOA 3ZU5A 2JFGA 5IFLA 3H5AA 5B1YA 4I9HA 5TSDA 1CF2O 3H5RA 3HJAA 2DTXA 4XGNA 1DO8A 1LQTA 4CLHA 4YJHB 3LT2A 3TZHA 1H0KA 1UP7A 1DFGA 4N5LA 5CDYA 1D1SA 1PWXA 1Y8QA 3PTZA 3E6AA 1K6XA 3G0OA 4U6SA 4ZHSA 5JS6A 4MOWA 3ZGYA 2JFFA 4ZQGA 2A4KA 4E0BA 3GZ4A 1QG6A 1A9ZA 3C1AA 3TQHA 3H6KA 2YV2A 3ONFA 2ZCVA 3NDRA 2E37A 3PPIA 1YQDA 4FGSA 5JLAA 4DQXA 1YVEI 1JDJA 4MVJM 5EESA 1N5DA 4YCAA 1HE3A 3LC1O 3VTFA 4KMSA 1P0CA 1N9GA 2NVWA 2Y1GA 4IDDA 4BO6A 4E13A 4TRNA 3CIFA 3F9IA 3MJCA 3ZV5A 3NT5A 2AE1A 2W8ZA 1DRWA 2Q2VA 1B3RA 1I2CA 2FR1A 3ITKA 3DZGA 3L6EA 3GOHA 3IJRA 3BYZA 3OP4A 1C1DB 4RPGA 3GUCA 4IMPA 1LRLA 2DUUA 4W6ZA 3TJRA 5KJFA 5ILOA 1XQ1A 3GFBA 2O2YA 3IUPA 3OSUA 1KEUA 4KOAA 3F3SA 3WGOA 3WSWA 1CETA 3I1JA 3CE6A 1AHHA 4ND2A 1JWAB 3T4EA 4E2XA 4BQPA 3MJSA 2B36A 4UULA 3V1TC 3KOUA 3WGTA 1VKNA 3RASA 3NX4A 4D7AA 1GV1A 3P2OA 3RSHA 5CDGA 1N9GB 1C0PA 2Y0CA 1TA4A 4U5QA 5JO0A 4JJIA 1PJTA 1HDOA 1Z6ZA 4RVFA 2GN6A 2VHXA 1NBOA 2GUGA 4MP6A 5EMHA 1YJ8A 1O95A 3H4VA 3WNQA 1AXGA 1PZFA 1SAYA 4Z9XA 4R69A 3DBVO 5K9ZA 1GADO 4RDIA 2E82A 3JYOA 5TJHA 2LDBA 2EP7A 3K2BA 4BB6A 3OQ1A 1DC6A 4NPCA 3SLGA 3NDJA 4L9RA 4MVJE 4OHUA 2G0TA 5A5EA 2NV6A 1EUDA 1LLCA 4DWVA 3GMDA 2YHIA 4DIFA 1UAYA 2I67A 3DFZA 3LT4A 2D2IA 5JDIA 2D5AA 1ZJYA 1BHSA 3SJ7A 1BTOA 1YO6A 3WMWA 3DZBA 3W8EA 1PJSA 1ZK4A 4A2CA 1YL5A 1BDMA 3R3SA 5AXBA 4ZJUA 2RCYA 3VTZA 4FJ0A 2E6UX 4XJTA 1NAHA 1V3VA 1VPDA 1YGYA 3NYWA 1R16A 1X14A 2R6JA 3PLRA 1GEGA 3WX0A 2B35A 2CD9A 2QG4A 1EUDB 1W0CA 1HWYA 1N1GA 5AQ1A 3K92A 2P9CA 1AN9A 2YHIB 3C7CB 3HN2A 4JXKA 3LU1A 4H7PA 5H82A 1PX0A 2GZ2A 3WGGA 4PN3A 1YKFA 2V6BA 2FPPB 5U1PA 1U1IA 1U9JA 1ZH8A 4YEDA 1DBVO 2X1HA 1EVIA 3IQDB 3BIOA 2J5KA 3OEWA 1IB6A 1LBEA 3U4CA 4CMCA 3S8MA 1XCBA 2OBYA 2CDAA 3GC6A 4CV3A 4DQUA 1ISFA 2GN9A 3LVFO 4J1SA 5TT0A 4BNMA 3ZWCA 4J7CA 3WTBA 1TT7A 4YTEA 1NQTA 1NTOA 3VDRA 3KEQA 4LN1A 1CWUA 2HMTA 3ZU4A 1WLYA 4XYGA 2VWHA 3FTPA 2O3SA 4W7IA 5IZ4A 5B4UA 1PEDA 3WJAA 5K6AA 4CUZA 3VZRA 2WM3A 1HYGA 2Z1MA 2ZYDA 2IEDA 2QQ5A 2VWPA 3BTVA 1UXGA 4J90A 5THKA 2GNAA 2OP1A 4ZGWA 4PLCA 4XX0A 4LRTB 3HDJA 1AGNA 1GQ2A 4PCVA 1H6AA 4DRYA 5HM8A 4B7XA 2O2SA 3AI1A 2PGJA 1W8DA 3RUAA 4KUGA 2BFPA 2X9VA 3BHIA 3TSCA 3PYLA 1P31A 3E9MA 3ADOA 1KS9A 3DMYA 1SEVA 3DMTA 3WJ7A 3LF2A 1HDGO 2Q45A 3ZHYA 2OBNA 3PXXA 2X0NA 4QT0A 3D64A 3G3EA 2D8AA 3MWDA 1T24A 2P5UA 3ANNA 4ZD6A 1UP4A 4CV2A 3INRA 1FXSA 3K9QO 4BNUA 5G4LA 3JD4A 1RM5A 1U3WA 4XKJA 2VWGA 2EW8A 2Y1FA 4GX2A 4B4VA 7ADHA 5KNLA 4QTZA 1NP3A 2HRZA 3GRPA 4JP3A 1GU7A 2G76A 3WR5A 2FMUA 5CEJA 5JDIC 5JYDA 3RUDA 5IJZA 2HU2A 2DFDA 5GZ3A 1LSUA 4N18A 1ENPA 4LSWA 5L3ZA 2H9IA 1DIHA 1GQYA 3B20A 2QRKA 3ZWOA 1VM6A 2GLXA 1HXHA 1LU9A 3HB4X 1OBFO 3KYDA 3INTA 3AU9A 3MWDB 4CM4A 2YW9A 1H2BA 4LSMA 5A9RA 4Y98A 4FQ8A 4YT8A 5JW6A 1E7MA 1EFLA 4PLFA 1Q7BA 3JV7A 3RUEA 3KO8A 2CZCA 1HE2A 3NKLA 5IXYA 5A9TA 3UCEA 2X0IA 3DBRA 3ITDA 3LC2O 3PLNA 4IJKA 2Q2QA 1UDAA 4IDGA 1A5ZA 1PJ4A 4M1QA 3SC6A 1U7HA 2PWZA 3ETDA 4IUYA 5J23A 1ENZA 2J6IA 4NU6A 1DLJA 4D43A 1RM4A 3TZCA 2B0JA 1A4IA 4U0KA 5JC1A 3U49A 3H9JA 3KYDB 1WDLA 1ZFNA 1XG5A 4RPLA 4CM4B 2QRJA 3PEFA 4ALIA 3LSYA 4W9NA 2PD4A 3JQBA 1E1LA 2GPTA 2I5PO 2ZTLA 2QYSA 3GVPA 3ZW9A 5K6AC 2VN8A 2DFVA 2CFCA 1PWZA 3PGXA 3Q6IA 3C8MA 3SC4A 4MIYA 1NQOA 4FD3A 1EBFA 1DB3A 5JFOA 2AQIA 4HNGA 4JX8A 2HMWA 4K9DA 4O6VA 4AJPA 4BS9A 3H9GA 2GF2A 2FPGA 4WECA 1F12A 4BHTA 3KBOA 2Y1DA 1X0VA 4PLGA 3BMNA 1DJNA 2X6TA 4CLXA 3AU8A 4ND4A 3PFWO 1MV8A 5G4KA 1LSOA 3O03A 3DMTC 4NH4A 3VZQA 4ZQBA 3BMCA 3LLVA 2EGHA 1XU9A 1SB9A 4NDNE 4UEKA 2XAAA 4BO9A 1OMOA 4FFLA 1TI7A 3QY9A 3VC7A 5I9LA 4ZN6A 2FR0A 4YYZA 1PTJA 4Z9YA 4GLLA 1T2FA 1T2EA 4R9RA 3VPFA 1DIAA 4FGWA 4BV9A 1PS8A 5CHEA 3ICCA 3GPDG 3KVOA 3KXDA 2YY7A 1HL3A 3RKRA 4R41A 4DYDA 2O4CA 2IDZA 4FIZA 4QO8A 4IIVA 4HADA 4R1NA 4KWHA 1ZW1A 5F1KA 3BMNB 1CYDA 3PP8A 1NFFA 4BNXA 2UUOA 2HJSA 2VHYA 3T4XA 1BW9A 1PJCA 3BMCB 1JWBB 3DAGA 3QWFA 4FC7A 4UVDA 4IQ0A 2W4QA 1OAAA 2EW2A 2IZ1A 4OKIA 3HFSA 4MKZA 1HYHA 4MJLA 4OKNA 1C0LA 1NWCA 1P74A 1TXGA 1UH5A 2I3GA 4CM1A 3RU9A 1O5IA 4Y6PA 4WASA 1WMBA 3RJ5A 3FBTA 3ZWVA 4Z0TA 1LLUA 1M6HA 1RPNA 3ASUA 3HE3A 5GZ1A 1YDEA 3GDFA 4YJDA 1O0SA 3WQSB 1H94A 4GVXA 1GQQA 4IDEA 4EUFA 4AJJA 2FR8A 2P4QA 4YT4A 4BGEA 4OXKA 2R2GA 2D0IA 1BW9B 1KETA 3OICA 3R0IA 4Y6RA 3EC7A 5MDHA 3GF4A 4CMKA 4IQ8A 4EBFA 4W9NC 3CZRA 2DM6A 1JU9A 3I9JA 3JQBC 2OP0A 4GQAA 1Y8RA 4IS2A 2JD2A 3DB2A 3PYMA 5TF4A 2GRAA 3ZHZA 1EE2A 4FFMA 1XEAA 4OL9A 1IZ9A 3OBBA 2P9GA 1IZ0A 1B2LA 4CMEA 3P7MA 2CVQA 1E3SA 3IKTA 2SCUB 4Q3EA 4RORA 4BUCA 3ROKA 3G79A 2B4RO 1K3TA 1ONOA 1OZAA 3JD2A 4D79A 3WB9A 2YQ5A 1V3TA 4FCCA 1R12A 8ADHA 5FI3A 2DBRA 3KZVA 4BKPA 5BQFA 4FOSA 1PIWA 3GEMA 3VKVA 1LSJA 1LJ8A 4NJOA 3JQCA 1NHGA 5JPIA 1YXMA 3W4IA 2C7VA 5L4NA 1Z73A 4HWKA 3JSAA 5GZ6A 4Z6KA 1WPQA 3UAGA 1P9LA 2QX7A 4PIVA 3ENKA 4O59O 2CF6A 3C1TA 3JQ6A 4XB2A 7MDHA 2FP4A 3N7UA 5C5IA 4EITA 3COSA 1ZK0A 2H1SA 3PIIA 5F21A 4AJ4A 2WYUA 1E1KA 2H5LA 3ST7A 3KLMX 3KTDA 1DHTA 2PGLA 1G6KA 3KUXA 3V5NA 4BB5A 1MC4A 1PL7A 2PFGA 1DSSG 1Z74A 4XWYA 2AHRA 2DQ4A 2HCTA 3OECA 4XYBA 4YAIA 2IYPA 3JQ9C 3AFNA 3M2PA 4GI2A 1LSSA 4EDFA 4L73A 1DLIA 1X1TA 4CM6A 3WSVA 1CQJB 5G2OA 3ZU2A 4EI2A 1QMGA 2IYOA 3JCZA 5DNAA 4XYLA 3JYLA 2NVBA 5IF3A 4U7WA 2RHRA 1PZEA 3ROQA 1B16A 5B12A 5KJ1A 1UJMA 5LDHA 3HN7A 5DN9A 5JAQA 4BV8A 5DULA 1KY4A 2WE7A 3VZPA 1IPEA 2NU9A 2EJWA 4PZDA 4TZTA 5IG2A 1GDHA 1HSZA 4L74A 1ZEMA 1VLLA 3QWHA 4UUMA 4K1LA 4CM7A 5H83A 1KYQA 3GVHA 2FSSA 1PZGA 3PJFA 3WBFA 1LC0A 1NPYA 1DIGA 2Z95A 4PG5A 3STHA 4TVOA 4B3HA 1KY5A 4CLOA 3FN4A 1MXFA 2GSDA 3JQEA 3U4HA 4WCDA 1FK8A 4DYVA 3I6IA 1GTMA 3TRIA 4OIMA 4WKGA 4XDYA 1Q2XA 1N8KA 4F45A 3NDIA 2BH9A 2HMVA 2VNAA 1JTVA 5T5QA 4E5PA 1PGPA 4CM8A 2Q99A 3EMKA 3OQBA 2NU9B 4HNHA 2ZYGA 2WMDA 2YUTA 1OOEA 4A5OA 1XELA 2AQKA 4KUHA 1R15A 4BNNA 4CMEC 4DL9A 2EIHA 1PJ2A 1YL7A 1IY8A 1SBYA 1CIVA 4PZCA 4YB8A 3RIHA 2VTDA 3K2EA 1JN0A 4PVCA 1NWHA 3PHHA 1YB5A 2BFAA 3A4VA 3HDYA 1GFSA 3I5MA 2JKVA 2Y99A 4N5MA 4UVEA 4Y9DA 4FFOA 3ZU3A 4CLOB 4D42A 4YT2A 1U5CA 5BSHA 2YV3A 1ZZEA 5CPBA 4B4UA 5JSFA 2V6MA 2J3IA 3AUAA 1ARZA 2GD1O 3FNEA 3L6DA 4GVLA 4H15A 3WGZA 4D0RA 2I65A 3AW9A 2PH3A 3E18A 3RJ9A 3SBOA 3ZWMA 1ZXBA 3KSZO 4AVYA 4CM8B 5HS4A 2NADA 1HEUA 3CH6A 4P4LA 5EQFA 3FBGA 1QV6A 1B8VA 4Z0PA 4P4GA 3OJFA 2UUPA 5AOVA 3QE3A 3SJUA 2LDXA 2GASA 1GV0A 5DDIP 4E4YA 2GYYA 4RF4A 1XHLA 3QW2A 4NR0A 2Q3EA 3KHUA 3UFXB 1DC3A 1NXQA 1KVRA 4IGFA 1CRWG 2WYVA 4O63O 3KETA 1YOVA 3NT2A 5A02A 1Y81A 4QFDA 3L4BA 1I2ZA 4CUKA 2JHFA 3NT4A 5U4QA 3C7DB 2ZYAA 1ZEJA 2FHSA 3S55A 2ZIZA 1IHXA 4R1TA 3PHIA 3IUSA 3DAPA 1P44A 3LC7O 5F5LA 2HDHA 4BNFA 3F4BA 4JIGA 3FWNA 1QYXA 3FR7A 1PR9A 2ZTUA 4ONEA 4R54A 4ZU3A 5FFFA 1GY8A 3WTCA 3M1LA 2AQ8A 4IDAA 4WLFA 3AM5A 1DRUA 1O9BA 4L4XA 5L40A 3FNGA 3WOHA 3AY7A 3Q0EA 4PLTA 2O50A 3QWAA 2PLAA 1UAGA 1KEVA 1YOVB 2UDPA 5KKAA 4I8XA 2O3TA 3SXPA 2OL4A 4BKRA 1GYQA 2PZLA 5ICMA 1HE4A 4NBWA 1VJ0A 1L7DA 4CMAA 1K6IA 5DP1A 4JN6B 2FY8A 4S3MA 4R3NA 5DF1A 1KOLA 3ORFA 5DT9A 5T57A 4MP8A 4UEOA 1DFHA 4XR9A 2IE0A 4WGGA 1QRRA 5JNLA 1QLJA 3BTOA 3A28A 3G17A 2YFQA 5I7FA 1B0AA 1QXSA 2PKQP 2V65A 4A73A 3NAQA 1EK6A 5JC8A 3PQEA 4J16A 4NFSA 3VKUA 4AJOA 4CLDA 4ALLA 4KQWA 3I9MA 4LW8A 1MG0A 4ZRMA 4BMSA 5JCJD 1T4BA 4WPGA 5L4LA 1XSEA 1ADBA 1KVTA 1HYEA 4FDAA 4BO2A 2EKLA 4CLEA 3D7LA 1SOWA 3OF2A 3E8XA 1SCUB 3BXXA 4I5EA 4J9VA 3HUDA 5L9AA 2Y05A 4OAQA 4ROSA 2IODA 3GFGA 4TQGA 4DMMA 1EFKA 2DPHA 4Y6SA 3ZNNA 3FRJA 2WTBA 2VOJA 2HMSA 2DTDA 3DEYX 4LGVA 1N7GA 4JBHA 2X9NA 2Y1CA 1KVSA 3PJDA 3ZV4A 3RCBA 2G17A 1GPJA 5MGBA 2EKPA 3L9WA 3RQSA 1E6UA 3JD0A 3UHAA 1Y8QB 3U4DA 4RL6A 2PV7A 3DBHA 1JKJA 4BL5A 3O4RA 3CSDA 3PVZA 4N54A 5CPFA 3W1VA 4B3JA 4WNIA 1NYTA 5KJCA 3R6DA 1FMCA 2XXBA 2X5KO 4MVJH 2BFMA 4PG4A 3RU7A 3ICPA 3L4BC 1HRDA 4YAEA 4INAA 5TNXA 2ZB7A 1TB4A 3PI7A 4XIJA 5JY1A 4NNJA 1RYDA 3WQQA 1DPGA 3AJRA 1E6EA 1H9BA 1Q1NA 2V6GA 2X23A 3DAFA 4AJ2A 5L45A 3IOYA 2C82A 3UCXA 1E5QA 2Q50A 3DHYA 5BR7A 4IJUA 1YWGO 3C24A 5L53A 1UDBA 3DBHB 1JKJB 5GY7A 1LNQA 1Q0QA 2WD7A 3DTYA 1BXGA 2ET6A 3RVDA 4OGWA 3UOGA 4RJTA 1QYDA 1KEPA 1MXHA 1XR3A 4IPTA 4M89A 1LI4A 4CQMD 2VUTA 4KQXA 3TPCA 3U62A 2AMFA 1J4AA 1I3KA 2CY0A 2Q4EA 4P8RA 3IAHA 3PWSA 4G5HA 3F1LA 3O26A 4RVDA 3DXFA 3UH1A 4WUVA 2VT3A 1PQPA 5C3MA 6ADHA 4H3VA 4HX5A 2O48X 3RUHA 1IULA 1P77A 1Q0LA 1XU7A 5CDSA 3A1NA 2VUUA 2QZ9A 4MVJP 1BRMA 4J2HA 4J4HA 4WLNA 1X15A 1MX3A 3FSRA 4CMHA 2J3KA 3HQ4O 2C7GA 3IKVA 3PQDA 5FF9A 5T64A 1BXGB 3H3FA 4FR5A 1GCUA 1E3JA 3RC9A 1Y7TA 4NU5A 2X22A 4GMGA 4K6CA 3RFTA 3RUIA 4IDCA 1LUAA 2EG9A 5JCJA 3WFIA 3C7AA 4JP2A 4RQUA 1IHYA 3PWZA 5KTKA 1MGOA 3OMLA 4MDHA 1D1TA 2G1UA 5LDGA 2JCVA 5C7OO 4RZHA 3IC5A 2HRBA 4A7PA 1B3BA 1P1IA 4B7CA 3NEPX 2UV8A 1ISMA 4AL4A 3INGA 3ABIA 4IXTA 1RJWA 3UICA 5L4SA 4FJ1A 4N5NA 4QXMA 4GWKA 3LZ6A 2C5AA 3TZ6A 3UW3A 3WNVA 4DBVO 2I3AA 1CERA 4BO1A 2ZB4A 3GVIA 4GX5A 1DOHA 3WG9A 3ETEA 4AICA 3JD1A 1GZ3A 2ILTA 1ONNA 5KVQA 3EK2A 1T2AA 1ZSYA 1B26A 3AM3A 1GAEO 3GHHA 3ULKA 4ESOA 1QR6A 1GYRA 1LTHR 4TWRA 3B70A 5AXAA 5JMPA 1FDUA 3WLEA 5ADHA 1BGVA 1Y6JA 3EDMA 2B5VA 3WMXA 2C2XA 1KVQA 3ZW8A 5IDQA 1EZ4A 4ZQFA 3NUGA 3KM0A 3ZH2A 2X4GA 3BHJA 1J0XO 5F3RA 1A7KA 3PFFA 1RKXA 2GO1A 1LA2A 3PZBA 1E5LA 1XLTA 1EBUA 2ZQZA 2BFOA 2GZ1A 1K0UA 3P19A 4E32A 1YQGA 2D5CA 3H9EO 1LEHA 4D45A 2C29D 1C1XA 3H7AA 1QORA 3FD8A 4WCFA 1U28A 4XEHA 4XGIA 4CPDA 4UVGA 4AJKA 4CQMA 3OH8A 2OOSA 1R0KA 2WEKA 4XQ9A 4CM3A 2VRCD 2PD3A 2ZTVA 4GGPA 1I2BA 4R1UA 2QIOA 4RO0A 4ITUA 4RPKA 1G1AA 3DBLA 2VTEA 3DFUA 4EUHA 1HDCA 2PZMA 1EQ2A 1DRVA 3CUKA 3DOCA 1ZUD1 4GKVA 3HZZA 5AVOA 4XX0B 1E7WA 1YBMA 4DLLA 4MIOA 4Q9NA 3SVTA 5DCYA 1F0YA 4JBIA 2NVUA 3EYWA 4J43A 2Q1TA 2EHDA 3NJ4A 1T2CA 3PQFA 3WGIA 5G0UA 4YQYA 2UAGA 1UUFA 3DDNA 1B14A 1CQIA 3WDSA 2YDYA 5JAMA 3CKYA 3MCVA 1MG5A 2Q1UA 4CQMB 2NLOA 1NVTA 3L4SO 2C07A 2NSDA 2OO5A 4GLOA 1WNTA 1V35A 4YJGA 1X7GA 4WLUA 5FYDA 2Q46A 2JHGA 1X1EA 2I66A 1BVRA 4RQTA 5EPOA 1UDCA 3EW7A 5KVSA 3JD3A 2EV9A 4HFRA 3QLJA 4IMRA 3D5TA 5JE8A 1JAXA 4FN4A 2NVUB 3H5NA 4A27A 4JJGA 3AOEA 3DTTA 2DT5A 4PVDA 4Z3DA 4BNZA 2ZK7A 5HRUA 1CJCA 1AHIA 4DPKA 2YV1A 3VH4A 4IINA 4JK3A 1CQIB 3IP3A 4Q39A 4WOKA 4D0SA 3RFXA 4MVJD 5THQA 3TN7A 3DQPA 2O3JA 3RBVA 1K2WA 2X0RA 4IM7A 4ALJA 1JA9A 1VL6A 3GVXA 3KV3O 4M87A 3VPXA 4J1NA 4YJGB 1PU2A 4NQZA 5ENDA 4XJSA 4YBZA 4F6CA 1HDRA 4RPHA 1EVJA 4BKUA 4E30A 1TT5A 3WYEA 4CQLA 3D5QA 4HBGA 4IQGA 3V2GA 4OYRA 5EINA 1ADCA 3DBRB 3EY4A 3W6UA 4N7RA 4FPXA 4RF3A 3WWYA 3S2IA 3RI3A 2D4AA 5A04A 1AE1A 4BNVA 4HY3A 2Y66A 2FRDA 4P4NA 4TZKA 1I01A 1V3UA 2I76A 5F5NA 3W8FA 4I5DA 4LRSB 4OJNA 2VYND 2CUKA 4P38A 1Y1PA 4IJVA 4YAGA 3NGXA 5LCXA 4ND1A 2Q1SA 3VPGA 3QWIA 4EJ6A 3B1KA 4OOFA 4DLAA 4RGBA 1I3NA 2JFHA 4DC1A 1SOVA 2JJYA 1TT5B 4WCFC 4X54A 4CQLB 3LDHA 1F8GA 3GN1A 4TKLA 9LDTA 2PZJA 2VRCA 4E21A 2E48A 3KYBA 4TRRA 4D44A 3IIEA 1NQ5A 4CV0A 2O7QA 4E5NA 4XYMA 5EL0A 1BVUA 3VAZA 4PLHA 4W82A 2FPGB 4ZQHA 5EN4A 1GYPA 2CSUA 3GH3A 3AWDA 2BGKA 2Q4BA 2VOEA 5G0WA 3NGLA 4QSMA 5EQDA 5BNFA 1ULSA 3JQ9A 1H2HA 1DFIA 5G4KB 4MIEA 1I24A 4FS3A 2XF8A 5I9MA 3A9WA 3TF5A 1N2SA 4BGIA 3CPSA 1F8FA 3WQRA 2IEBA 3PJGA 4YDRA 5DBIA 3EVNA 3ON5A 1E7SA 4MKRA 2V7PA 4EEZA 1FJHA 4Q3NA 4E12A 1G0NA 4CM9D 4C7KA 2EJVA 2IZ0A 3MJVA 4XYEA 3ZWPA 3EZYA 4LCEA 4QUKA 2NUAA 1EUZA 5CP8A 5LC1A 3PDUA 1QYCA 1B8UA 3F47A 5L95A 5COBA 4XZ3A 3E1KA 3OETA 3HHPA 1WDKA 3WGYA 2Q1WA 4O1MA 2Y68A 3OJEA 2FZWA 2O3QA 3AOEC 3V2HA 1K5HA 3LYLA 2EKQA 4ID9A 4C7JA 3ONEA 2HK8A 4OM8A 3BMOA 4HKTA 1DHRA 2YQ4A 4Q3DA 4G81A 3FI9A 1JKIA 1RM3A 2B4QA 4MVJA 1P3DA 4RPJA 1ZIDA 2X5OA 3EVTA 5TJ9A 4BO4A 1WVGA 3Q2IA 4DC0A 3NV9A 4EEXA 5ILGA 5TC4A 2EWMA 4GSKA 3ROPA 1DAPA 4KZPA 5EIOA 2DU8A 1Z82A 3EAGA 2C59A 1ZK2A 2AQHA 4GSLA 4TSKA 3P2YA 3ETGA 1ISHA 1YB1A 3HNPA 4UUOA 4YRDA 3UN1A 4XD2A 4DBZA 5FWNA 2VNSA 1F14A 4M8SA 3OJOA 2FWMX 4CUJA 1R0LA 3DONA 3S2EA 2C54A 2NTVA 1YBVA 2A94A 4NIMA 4CR7A 2NM0A 4UUNA 3RUCA 3OHSX 5IXSA 1JQBA 4W99A 1DEHA 3I4FA 3BMOB 3MWEA 1DC4A 2POQX 4YRAA 1E77A 1VJ1A 3VDQA 1NVGA 4BMVA 4QFCA 5KVCA 2VYNA 3GEDA 1GD1O 3BTUA 2NQTA 3CTMA 3ZNOA 3ZNPA 3QVXA 3VPSA 4Q3AA 4ALMA 1FDTA 1ENOA 4RDHA 3X2FA 4IY1A 1AXEA 1R66A 1PZHA 1Y8RB 1ZVMA 4GMFA 1P0FA 3WLFA 1O89A 4R5MA 2FSVA 1ID1A 1XWFA 2ZCUA 2VYVD 5BSEA 4GPD1 3SEFA 2VT2A 1LDBA 3TDKA 1WMAA 2OORA 3L0DA 4KWIA 2JL1A 3MWEB 4LISA 5I9NA 2WSBA 3OA2A 2PGDA 5CG2A 4NK5A 1ONPA 2DVMA 1YDWA 1YL6A 3PK0A 2GZ3A 1EQUA 3I9LA 5JO9A 2YDXA 2ZB3A 2F1KA 4R4JA 4BVAA 1ZXLA 2Y0EA 1JVBA 1ADGA 1DJQA 2VUSA 3F5QA 1AUPA 4KTVE 1YRLA 2JAHA 4H16A 1XQ6A 4L75A 4DIBA 4EJ0A 3DZIA 2BGMA 1EUCA 1H6CA 3EUWA 3M1AA 4PLZA 1HETA 1WP4A 3CXRA 1EK5A 4CM9A 3D3WA 4PFJA 2IXBA 3F5SA 3H3JA 2FP4B 4J0FA 1Z7BA 5ITVA 3KYCA 3Q3CA 4WOJA 3GR6A 3BAZA 1VC2A 5DBFA 4DUPA 1RM0A 1W4ZA 4O0LA 4DIOA 2JAPA 1I3MA 1X0XA 2Q2WA 2VCYA 1C3VA 1U2GA 3OJ0A 3MOGA 1U5AA 2EXXA 2HJRA 1P1RA 1MFZA 3H2SA 2VHZA 3A14A 2W98A 4D46A 3DR3A 1C14A 1N7HA 3O9ZA 9LDBA 1P45A 3FNHA 1P33A 4DA9A 3FPCA 3WWZA 4FBGA 3Q11A 3KYCB 1GEEA 1I30A 3D3EA 5HS6A 1E6WA 5JAIA 1ZMTA 2PA3A 4Q3CA 2PR2A 2J3JA 3O8QA 4TROA 3K96A 2C0CA 1IUKA 2R00A 3IMFA 1LLQA 2HUNA 3GNSA 5IZCA 3GY0A 1NNUA 4OXNA 3HFGA 4BO8A 3WYBA 1HDZA 3L6OO 2XXJA 4JNKA 4II3A 4NG5A 1HZZA 3U0BA 2QW8A 2G82A 3CZMA 1VL8A 2NU6A 3CMCO 2IRWA 1I32A 1ZSVA 4EJMA 4WK6A 4PRKA 5CAEA 2DKNA 2VYVA 1Z75A 4YRBA 3O8QB 1EVYA 1UZNA 2DLDA 1QP8A 4E6PA 1DIRA 2W2KA 1R0SA 3HG7A 3O38A 2B37A 4OOEA 3V1YA 1XYGA 1IOLA 2C5EA 4DREA 3KSUA 4GWGA 1DDOA 5T8KA 1LDGA 1PJBA 2AXQA 1NQAO 3RROA 3PIDA 4EYEA 3OA0A 1C0KA 1PR3A 4DTIA 1HTBA 3W4KA 1SO8A 1Y9AA 1PQUA 4LVUA 4CR6A 2D3TA 1RWBA 4CLRA 4BQRA 1NR1A 1ZK3A 2W2LD 3GAZA 3QHAA 4NFHA 4R68A 3ZWNA 5JDCA 4BO5A 5CAEB 1KEWA 2AEMA 4EZBA 2G5CA 3ZV6A 1HLPA 4K6FA 1O94A 5EJ2A 3MZ0A 2P91A 2GERA 5TT1A 2RIRA 1NVMB 1PL6A 4BO3A 3V8BA 1I36A 5U9CA 3UCFA 4CL3A 4YACA 3E82A 5A4DA 3I52A 5KJ6A 3PHGA 1SC6A 1NX6A 4NMHA 5I7EA 3VHRA 4DPLA 3IDSA 3SLKA 5TS3A 1Z7EA 4E2YA 2CNBA 4FJ2A 4B8WA 4CLRB 1PJLA 1U8FO 4XGKA 1ZK1A 5C37A 3GDOA 2B5WA 5H81A 1UXIA 4PLVA 2P5YA 5JCXA 1U4OA 1HZJA 3H9UA 4NFYA 4CMJA 4PG6A 4ZQEA 4S1VA 1NASA 1TVEA 3DHEA 1ZBQA 1U7TA 4MPDA 5BNTA 1GR0A 5COAA 4URFA 4BKOA 1R4NA 3TWOA 4GAEA 1XIVA 2AW5A 3M6IA 4UUPA 4YJFA 4W4TA 2QHXA 1HKUA 2R00C 2Y0DA 3GG9A 1A72A 4XQGA 4NJMA 5IZCC 5BSFA 4A26A 4E31A 3UF0A 3F1KA 4CMIA 3UKOA 4CV1A 4ZRNA 1H9AA 4MINA 4WLOA 1H6BA 2BGLA 2OHXA 1B15A 1M67A 4HXYA 4JBGA 3G1UA 4KDEA 4MVJI 1R4NB 4FFRA 5FEUA 2NU8A 3C85A 3PJEA 3QVOA 3D4OA 3ZV3A 5IDXA 3AUUA 3I4CA 3TFOA 4L76A 3ENNA 4GBJA 3RKUA 4L4SA 4YJFB 1S6YA 4YT5A 2X86A 1C1DA 4R01A 4NHEA 4RVSA 5T8KC 4NJMB 4U0JA 2EF1A 5G0SA 5I7SA 2OFPA 3QVWA 1ML3A 4I9UA 5B4TA 1VI2A 3OIDA 2B4TO 1YONA 1XA0A 5L7YA 2GDZA 4GX0A 4J2OA 3LLSA 1EE9A 2EGGA 3WFJA 4CMIB 1SB8A 3ZWAA 2VRBA 5CDTA 1FDWA 2BLLA 3BZUA 3PZRA 5BT9A 2W2LA 2WD8A 1E1NA 4TRMA 5JDCC 1GUYA 1JLLA 1KC1A 1I8TA 5TQVA 3B1JA 3GA0A 2NU8B 1HT0A 1EMDA 1EDZA 2Z1NA 4OSOA 5ER6A 1MP0A 4W7HA 2BRUA 4G65A 4E3ZA 4WEOA 3BMQA 1UXJA 2RBEA 1Y5RA 4WNCA 4R1SA 5IDWA 1FDSA 1BSVA 1KC3A 2I99A 4R16A 1EVZA 3I83A 4J3FA 3WIDA 3W4JA 1D8AA 1WW8A 4B3IA 2PKRA 2PNFA 1W73A 4LMRA 3DOJA 3IS3A 3HADA 5KIAA 4YWJA 2BMAA 1OC2A 1Z45A 3GDGA 3U09A 1U2DA 1JLLB 4HUJA 4IIUA 4XR4A 5EERA 3I3OA
chains in the Genus database with same CATH superfamily
4LYEA 3AUFA 1JHRA 1QIDA 3K73O 4WRRA 3TUIC 3QSGA 4BVKA 2C0QA 1CZRA 1Z17A 2YUIA 1YS4A 4GLBA 3UB2A 2HZBA 3BMQB 1HT1E 3NTOA 2H1FA 2X0KA 4H17A 4RA6B 1PS0A 3I6ZA 4DABA 4LRQA 1JHPA 2DKOA 5GM1A 1FQKA 1XVAA 3B9PA 1VJCA 2XW6A 4PWYA 4RF5A 1HT3A 4OQZA 3NEAA 1FNNA 1M83A 2C83A 2VKQA 4QVKA 2CL5A 5EZ6B 1D5WA 2C61A 3ZI7A 3OLWA 1L4MA 4EX7A 5TX7A 3KTFA 3A05A 5LWHA 4GE3A 4JJ8A 4KAAA 1XXHE 2P4HX 2XDQB 4XCVA 5H02A 3PGA1 5BWNA 1QQBA 4RVUA 3SF8A 4FYYA 3N70A 2AR0A 1UBJS 1X13A 3SQDA 4AQDA 1TZJA 3J81k 4ABTA 3GCXA 1CJKC 3DTVD 1O5TA 4LV6A 3P9RA 3WL8A 5IJXA 3AFOA 2VYFA 2YHAA 4IIFA 4ZI7F 1M6NA 2XDYA 1MPTA 3JTEA 3QBJA 5KWEA 2JAOA 3ZBQA 5D51S 3M83A 1US8B 1NLFA 4R2IA 3PWKA 4BEVA 4PN7A 4CKCA 2QM8A 3WDLA 2WE8A 4H18A 4PICA 1L1FA 1A8SA 4HFNA 2C94A 2WDPA 3U19A 5LQJA 1SD2A 2GBGA 4MAFA 3UZUA 5BSKA 4NPAA 3CMMA 1JAYA 2OAEA 2VP2A 3GGOA 4MDYA 2KPOA 4MKIA 4MYDA 4ZOBA 1G4AE 1IYZA 2J9GA 2QG6A 2VYQA 3ID6C 4MRSA 4UNQA 5G0TA 3OQJA 1K4MA 1VDMA 3QJ5A 3U9SA 4FB5A 2EJCA 2G9RA 4CTKA 3NNSA 2J31A 4Q00A 2Z58A 4Q9KA 4F11A 5KKNB 3A6PC 5TLSA 3GEIA 3T9AA 1CEXA 5P8WA 3ZKWA 3CBQA 4C07A 4F0JA 4Z9FA 3EUFA 1R2QA 4NK4A 1VRWA 3TQRA 5DI9A 2JKZA 4ZZIA 3GEGA 3K0FB 1KERA 5K8IA 1PV4A 2CDBA 2Q9CA 3AKEA 5EE0A 5LVAA 1TKAA 1Y9EA 1VG9B 2IEIA 2EEZA 3GAFA 3GGGA 3NC4A 4J6FA 2HA7A 3GUYA 3TL3A 3VZRA 4COOA 2B7BA 4D96A 1D3AA 1ZUNB 2QF7A 3KTAB 1EA5A 2ZWVA 5I45A 4AKTA 3DDSA 1POWA 4MVYA 1FFGA 4LHVA 2BRUC 1TE2A 3H1TA 1BEUB 1YZQA 1DCFA 2NXNA 2Y2UA 3RR2A 1Y34E 2IUEA 2DFTA 4G67A 1KIAA 4QXPA 1QVAA 1ZGBA 2E4AA 1H8HA 5EHXA 3R7NA 2X2OA 3HCAA 4E33A 3P9SA 2DHEA 3MS7A 1CEQA 1ND5A 2P9JA 4RY0A 4JELA 4X1YA 2XRMA 3BAFA 2H0AA 3H65A 3MNFA 1EXVA 1QHHB 2IHTA 2WZBA 2AUMA 4J0EA 1LDNA 3ANLA 4WZAB 3M1YA 1SWVA 5AW4A 1VLHA 3H0CA 2I91A 1FZQA 5FWAA 1USVA 2OOKA 1XV5A 3NWOA 1NVBA 3MB8A 4AJIA 4F86A 1NXOA 1GUZA 2AI1A 3DAOA 3KXIA 3OOHA 4UPDA 3RHSA 4LKOA 3SSAA 4XRGA 1GVHA 3C8HA 1R37A 2O2DA 3QVSA 3TBKA 2V54A 2L18A 1IEXA 2DUJA 1XB2A 3HL4A 4IJWA 4IW3B 1YCHA 1ISIA 1RPJA 4MS4A 5E0OA 4Z4FA 2C77A 1X7DA 4MAAA 2DWPA 3ECSA 4QXQA 2LP4Y 3JW8A 3GLRA 5BVGA 1FYDA 2RHOA 1C41A 1KMQA 4MUMA 1X1BA 3QFCA 3RVOA 1F2DA 4U6QA 4Q15A 2B3DA 2FPIA 4GGMX 1UPTA 3RBXA 4ES6A 2GILA 5AR1A 1HFWA 2Z2KA 3O4IA 3T06B 1G5HA 4WCFB 2OBLA 2C7BA 2QVYX 1A4UA 2E49A 4YLEA 1IEWA 4HQLA 3DTVA 5F1PA 1Q7GA 5GVRA 4M9SA 5JXWA 3AL0C 3DBLB 3UUEA 3E1GA 1PSDA 5IAKA 2ZAGA 3ODGA 3FJOA 2X5JO 3PGJA 4QAQA 1ZC3A 3OY7A 1CNFA 4IICA 4ZHQF 2YH2A 4EABA 1IZYA 5EZYA 1V1JA 1HDEA 2PRYA 3C3YA 1NBAA 2OXCA 5ESXA 3S27A 3MGBA 5C7YA 4NCKA 1ISSA 3HJBA 1FS4A 4GEKA 4Z3KA 2CFRA 3MOIA 3DV0A 5ECDA 2XGOA 2Q9BA 4DM7A 1Y8ZA 1K8ZB 2B83A 4O8ZA 3D0OA 4UOZA 4F91B 3TTUA 1FJ2A 3MJFA 1M2KA 5L7WA 2I6GA 2R8XA 2ZZKA 2FF5A 1PJQA 2JK1A 5DU2A 2F62A 3QITA 3LKZA 3EGOA 4PYOA 3EA0A 2I0FA 5HZMA 4BOYA 3MTAA 2BPOA 4LMPA 4O1IA 2FDRA 1T4CA 1WU7A 2Z2YA 3WIUA 2WT4A 4QOEA 3E15A 2X42A 4WXEA 5A7GA 4B4OA 3SC2B 4EG0A 5BUCA 3K0SA 4B7UA 1EEHA 4A0SA 5LJLA 1NG1A 3PXEA 3ADBA 5JRZA 2XADA 2ECQA 4N0QA 2FUCA 5EMNA 2QY6A 5CCDA 3RT1A 1D7AA 1NVKA 3DZFA 3P9IA 1YFKA 2REQA 2YWXA 5J4LA 4BTVA 2RFLA 4P7FA 1PUJA 2Q49A 3B38A 4I50B 1VMEA 1CF9A 3ROXA 4MGZR 2CMHA 3QVJA 4AJEA 2XV1A 2B69A 1A27A 4H35A 1Z6AA 2NQ2C 5HJEA 5JY6A 1GDDA 2XCIA 1X9HA 5DZSA 4YFYA 2MR6A 2Q6LA 1AUXA 4A10A 1U4SA 3MMNA 3AIOA 3TNLA 3WYCA 4EGFA 4B6QA 2Q6IA 5IT5A 4MYHA 5KKCA 1VIMA 2NU7A 2VDKB 5A62A 5I9TA 2RHCA 3CEHA 1BDBA 2G09A 2JPDA 2P9EA 4HEJA 4HGYA 3TLKA 4CMEC 4D56A 1E9BA 1AGRA 3OU7A 2I1VB 2B8TA 1KMNA 3K0BA 1C8BA 1DRKA 1KI7A 4OP2A 3PITA 2BFBB 4M8IA 1QUEA 2OBFA 1THGA 2ZKLA 3JQ8A 2J3HA 3ZWWA 2NZ8A 2HH9A 1XD2B 1C9MA 2R68A 2QN2A 5EYPB 1KMHA 2DH6A 2DH5A 3A70A 4UFNA 4B09A 2P9ZA 3GLIA 4KRGA 3VH2A 1H5QA 2ARKA 1R4MA 2RI6A 3H8VA 3UWOA 3DVRX 3HKCA 2A6PA 4DMRA 5BSGA 5GINE 1QUFA 3PX7A 5EEHA 3C1OA 3ZXYA 1SG9A 4XWOA 4NEHB 3AESB 2ICAA 2V0CA 4C4XA 1M9NA 4LDJA 5A5FA 4R3UC 1Y1LA 2VZ9A 3Q1KA 2J6BA 1XZLA 4XOUA 1JR3E 1YULA 2JIQA 5IT9A 4CIXA 1IAVA 3Q41A 4F5WA 2QPOA 1EXMA 3IQIX 5HEKA 1Y9DA 2ZT8A 2KMLA 4CT5A 2A35A 3NATA 4J4BA 1A5BB 1B8PA 2XT0A 1NYQA 2QMZA 4OBBA 4PLPA 5A1TA 3QF4B 1PBTA 5CVCA 2ZJ1A 4RZ2A 3GZJA 5DBEX 4TS9A 1N0HA 1OIVA 3M5WA 1YCGA 5JWHA 3ELWA 4JMLA 4D9CA 2NVOA 4CMGA 3KXPA 5COQA 1SQ0A 3F71A 1LLDA 4JGBA 3ZCXA 5JRJA 1NXPA 1LTQA 2Y4OA 1GZHB 4MVJG 1FFBA 1I7SB 3TGPA 2P68A 1ENYA 3DPIA 3QVGA 2Z5GA 1E5XA 4KO8A 4X44A 3TOZA 3DHVA 1F0NA 1O08A 2Y1OA 2YZNA 3IP1A 4Q66C 3V55A 5BRAA 5LMCA 3L7CA 5DCWA 1L7EA 1N6KA 5DHSA 4A92A 1PSWA 4BCDA 1Q0SA 2WAXA 2XVYA 2RC6A 2YFYA 4GZ3A 3BQ9A 4AMZA 2JCSA 3R3JA 2H63A 4O2AA 4DQLA 4DLWA 1GHTA 5KEIA 2VF2A 2WAMA 3ZZMA 2J9RA 3RJTA 4TKVB 1DQPA 4EGAA 3KFLA 5L51A 2QYTA 3VYUB 1AA9A 1WCV1 2GJSA 4G4JA 4JHLA 4LV5B 3VPHA 1T6BY 1T3ZA 1TJ5A 2JBWA 2QTLA 1VL5A 1EGVB 1RZVA 2I4NA 5D2CA 1Q1GA 3AX6A 1PL8A 4ZVLA 1TIBA 5ALHA 4BNYA 4BN4A 1NIPA 4NXNB 1Z4QA 1BXRA 3OZTA 4MRMA 3ZWYA 4DN6A 2X2FA 3GYBA 1P7VA 4RLSA 3BWBA 4HF7A 1CIPA 3C70A 2SCUA 2CMDA 4UEJA 1PGNA 2V1XA 4BIIA 1TQ8A 1RMQA 4PTYA 1MTOA 5DTQA 3ZPXA 1GT91 2DBVO 1JQDA 1RU3A 1J97A 2VWQA 2Z3ZA 3M89A 3OY2A 4I3GA 4R9SA 4KOEC 2XUJA 2JS7A 2WUDA 2VP0A 5K0FA 2B3TA 1JJAA 1GJRA 4UZSA 4INPA 1JR2A 4OHBA 1LTKA 2PS0A 1AHNA 1BDHA 3RS8A 1ONSA 1AUVA 3JQ7B 5E7MA 3TTYA 1OU0A 1KXJA 1WW2A 3LQ1A 3S68A 1U7ZA 4DE5A 2JLVA 5ICSA 3AFMA 3YASA 3AUKA 3K5IA 2IS6A 3E03A 1V39A 4FFVA 3RC2A 1LRKA 4ER0A 5CHYA 1NVWQ 5EP3A 5IC5A 4C76A 5M04A 3M6VA 1HC7A 2I9KA 2GN8A 1WQ1R 2D1YA 1X9GA 4LJKA 2QTFA 3O8RA 3P1JA 3HB5X 4AS2A 3EQ2A 3L9XA 3CH7A 3G7NA 4C4RA 4DR6B 1RXUA 1TJ3A 3Q9NA 5DMXA 5TVKA 1PGJA 5B1IA 3R9KA 3NBXX 2AG1A 4ZDWA 1TF5A 3H2YA 1JG6A 3QV1A 4ENRA 4UTPA 5K0ZA 2FDCA 2XLCA 2PS1A 4X8MA 1XVVA 1M75A 1LC3A 4LI3X 2D59A 2QT9A 5K3CA 1ZN9A 2FWIA 4CE6A 1NVEA 3NTRA 4K5QA 2HB6A 4CTMA 4RDXA 3PNQA 4S04A 1FPQA 1H2YA 1Y9JA 3C3JA 2UVDA 1ZAKA 5JU6A 3RD5A 1IZ8A 1PJ8A 2MMCA 4FFPA 5CLFA 2QW0X 4L0QA 1IZ7A 1N2GA 3HJGA 2GVDC 4PC2A 4Z49A 1IM2A 1ZKMA 5H3LA 2JF0A 2V7XA 3R5XA 1IL0A 3M2TA 2PFSA 3OEHD 4OSPA 2GBPA 2Y1WA 5ERXA 3LHSA 1JT9A 3F49S 4NLLA 1QOQB 1E59A 3RTCA 5A03A 1JEEA 3AVTA 1HOXA 3S1LA 4ZC1A 1QH0A 1RRGA 1SXJD 2Y1EA 5FFMA 3S2GA 4B3SB 1AD2A 2E4UA 3W8DA 4YMTA 2HO5A 2QENA 3T95A 1GXSB 3TW8A 1WXDA 4PSKA 4ZVRA 1DE0A 2WMOB 2AE2A 1ZIOA 3B2QA 3FPFA 4O2LA 3SY8A 3LFHA 2C2YA 3EOAI 3H0KA 4I5FA 2LCFA 2I6UA 5FTWA 2GCEA 2GZAA 4AX8A 4CM5A 4EMUA 4OJQA 3GCWA 1J00A 2V6FA 2OCGA 3ZDEA 3I9NA 1PNRA 3GFFA 4MKFA 2H6EA 5EIFA 4ZDIA 3ZJUA 3PF9A 4ZMSA 3CISA 5E8JA 2QN3A 3BBLA 4ZRDA 1PF7E 4L5CA 4IAOA 1U8TA 2P2DA 4NPHA 1EUCB 2YBEA 3B9BA 4I9GA 2Y92A 3H9CA 3KKOA 2G7ZA 1PGOA 1T4DA 2VPZA 4QYWA 3UO8B 1F38A 5E7JA 3D3WB 1F8XA 5G0VA 3SZ3A 5DBGA 1WZIA 4YN3A 4CIAA 4ZOCA 5CCBA 1IN8A 4IEFB 3UUWA 1M2VA 1H3EA 2QRZA 2XA2A 3I09A 1OGIA 5C52B 2R25B 4M9XA 3TLAA 2KHZA 4C20A 4YA6A 1JQJC 1QONA 1RLUA 1VFNA 4J0HA 1ZMOA 4HP8A 5AHOA 2I6TA 3T1NA 2B8JA 2ZJ2A 1CS4C 3GLQA 4R7GA 2ZZNA 3AJDA 1C9NA 3NIFB 1CRLA 1G5PA 4YHHB 2JD0A 1TW2A 2VHVA 3Q3GE 5J47A 4ZARA 5KYXA 3MINB 2BELA 4HAOA 4UMDA 2V7WA 2G70A 3PHJA 2YYSA 1KPGA 5KJEA 3JQFA 2R96A 1Z5VA 1XEXB 1DX4A 2J5BA 3E3LA 2I4OA 3G88A 4GYYA 4MRNA 1R6TA 4M4SA 2OG2A 1U80A 1VA5A 1DXHA 4PRLA 5J43A 4J9UE 2OCLA 3TNJA 1DI0A 1OTHA 2HIMA 3S5UA 2YFHA 3B6IA 3ML1A 5I51A 1OI7A 1EP9A 1JG4A 3KT6A 3MD0A 1NUPA 4L9SA 2X1LA 1JBKA 3HZRA 4WLVA 5DYIA 2RHWA 4FSHA 4DRZA 5HQTA 4B3GA 1P6XA 3ZXIA 4WK0B 1V0JA 3JQDA 5DKFA 3AM1A 3DUFA 3OFND 3OLXA 1USUA 4M86A 4GKAA 4C1BA 1MQ8B 1PE0A 3LP6A 3LT0A 1TK9A 4B8ZA 5JH7F 1RE1A 1VBMA 1A8QA 2WJGA 3TLMA 3EXAA 5JXJA 1QFJA 1Q57A 2ZUCA 3RM3A 3MBKA 1FF9A 5EXTA 5A7FA 4Z8YA 1EFAA 3ROMA 2Q8NA 3W5JA 2LTAA 2PGOA 7GPBA 1I0LA 2DPYA 1QRSA 3MK31 4ND3A 3ASVA 4GW3A 1JNYA 1FFHA 4G01B 3H5WA 1OBHA 1D2RA 1MUUA 2H18A 2TMDA 5A0TA 1NLMA 3AHDA 1FX1A 1ZUHA 3H17A 3UGKA 4BE9A 3PDWA 4RZIA 1E3LA 4BEJA 1MEJA 4Z5XA 5B4VA 3OFJA 3EEOA 2C2HA 5IJWA 2I7TA 1KK0A 3SICE 4WNAA 2EBWA 4E5MA 2OGWA 5JMWA 1UFRA 3OEHA 3E7WA 3AXTA 1NW3A 5T7BA 4YLGA 3MJTA 1SXJA 1Z0KA 3AUTA 5CJ2A 4OHZA 5HTKA 1D7OA 2R66A 4RANA 5T4FA 3RRBA 1HLDA 3ESXA 1KK2A 1X77A 3U1VA 4NV1A 1ODFA 1FA9A 1E7YA 4W5JA 1Y82A 1G63A 4DR1B 1TD1A 2NT3A 3FVQA 4FW9A 1HDYA 5JT1A 1T4MA 2OPHA 13PKA 1F8UA 2A92A 1PX2A 1JKFA 5DXJA 3W8RA 5I3ZA 3FHCB 1ESCA 2YC2C 3PHLA 4MGHA 4BPBA 2H0QA 2QB5A 4YJ3A 4CNBA 3CWZA 8GPBA 3GLFB 4QYMA 2FZEA 5CLHA 1NXWA 2WDZA 2EZ9A 1S0UA 3BHMA 3OZEA 4HRXA 3BCRA 2GYWA 1UM9A 3OJLA 2NXJA 1PFUA 2J5QA 1ZRHA 5ES3A 2Q9AA 3QQPA 1NM5A 3NVMB 3ZDBA 2XBMA 1RWPA 4JDPA 3ZE9A 5KOYA 4M0EA 3SBDA 4TN5A 5LQSA 3ANXA 2NW6A 5CEFA 4HGPA 4MO9A 4YJHA 1DIOB 3NKFA 2DUWA 3HS3A 2PUAA 2F2TA 4Z4CA 5CDFA 1CULC 1UXKA 2CXQA 2DCMA 3OUZA 1UDWA 1J0CA 2DY0A 2R65A 1E6MA 1IWOA 1PBNA 2IIVA 2XUHA 3Q5GA 4X6UA 3WLPA 6REQB 1E6KA 4ID3A 4R3WA 4JP8A 2YFKA 5J2TF 3RVKA 3HPQA 1OW3B 1R00A 2BZ0A 4WBNB 2J3QA 2QU8A 4EMBA 4F9FA 2VRNA 1XRSB 2IHNA 1SKYE 3EG9B 1EFTA 1KJJA 3KDSE 4H6WA 2XQGA 1YF3A 4ZT6A 3E61A 4IG9A 2CKDA 2FTKE 4JUIA 3ZU5A 4G0UA 3WLHA 3W5BA 1QVWA 4B76A 3G85A 3H5AA 1CUSA 1VSQA 4PSDA 4I9HA 3E3MA 2CHEA 3KVRA 2QL7A 4UBKA 3UK7A 1OB2A 1F5NA 4DCGA 1YIOA 4XGNA 2FCRA 3OFNA 3N8GA 4BQOA 1QCZA 3LT2A 4RK6A 3L0OA 2EKZA 4KFUA 4RENA 5LBIA 3TZHA 3DLBA 1H0KA 1COZA 2KBEA 1V8DA 4XIGS 2IYNA 5EJMA 1D1SA 4AXXA 5F64A 1QF9A 5I3CA 1NQUA 3DP9A 5B30A 3EE6A 5AW2A 4U6SA 1NF8A 2C2MA 2B9VA 3MTEA 4EKYA 1ULHA 2Q5JA 4NQRA 4ZQGA 4C7XA 6AT1A 3OLVA 4HVCA 2LNDA 1ZH0A 1ZGCA 2JGAA 2O7NA 4OEHA 3AERB 4K9NA 3C1AA 4QOGA 3ZLBA 3Q3JB 4JBXA 3TQHA 1GGVA 1VCHA 1SUPA 2LD4A 3LUGA 4LRYA 4O2RA 4FK8A 4FGSA 2ECKA 5IM4A 1BA2A 5EESA 1IQPA 2GJ9A 4WX2B 2XZPA 5AMXA 1GZUA 1MA3A 2Y1GA 2YJTD 3ITNA 4PNHA 1L4NA 4Y0AA 1Y4SA 3F9IA 3MJCA 3ZV5A 4U7FA 1TCVA 1X1AA 3OCJA 4FCWA 4ND7A 2IY9A 3N0VA 4RHFA 4MYTA 2WKWA 1I2CA 5GJBA 3MTIA 4U9HS 3I64A 3TSOA 4AP6A 1FEZA 1N7JA 5DI3B 1E2KA 3L6EA 3EDCA 2O8BB 3OP4A 1ZXXA 1W581 3GUCA 2OCKA 3FZYA 3FWYA 5IRCD 2SNIE 3A1CA 3TJRA 3UHOA 1A9OA 1XZMA 3GFBA 2O2YA 1KEUA 3MWYW 5KWSA 1FE8A 3WIOA 3O84A 3T4EA 1JWAB 2O0LA 4MCJA 4FQ5A 3MILA 4QWMA 1QQTA 4BQPA 2PVCA 4OPMA 3URMA 5D87A 3WGTA 2PANA 2PXAA 3AL2A 3J7TA 1MC8A 4X95A 2IYLD 1JPUA 2Y0CA 3TMYA 4HDMA 3U39A 5JSUA 5JO0A 3FWHA 1PJTA 3FUVA 4NCHA 2GN6A 3EZGA 2P6RA 2KX7A 3SYKA 4BBAA 2BKXA 3VBEA 2VDWB 1MX9A 1T5IA 1R0XA 3HGQA 3UJAA 2CEAA 2Y0BA 1WQ3A 3B3FA 1YJ8A 4P08A 1FZTA 3M8KA 4MVCA 3MC1A 5HR5A 3LH5A 2PKCA 2G4LA 1OFHA 4M0KA 1A9QA 1X1DA 3ZYCA 1XBTA 4MWDA 3RHFA 4IIJB 3P4YA 5HF8A 3QG1A 3F6EX 1OWLA 1N3BA 1CC1S 5H9VA 3I5YA 1I3CA 5E6UB 4AX4A 1GG8A 2X2EA 4M7RA 1F3OA 4E5SA 1L7AA 2R5FA 1NVVQ 1FFWA 3I6YA 3OQ1A 3KT3A 3PUJA 1XZQA 4G97A 4PYNA 4U2KA 4NPCA 1KMIY 1KNQA 2O06A 4WXPA 5EGSA 3SLGA 3DLPX 3REQB 2NV6A 1J2UA 1H5NA 3H2JA 2W11A 2VT7A 1G6Q1 3EDYA 1VLVA 2EDAA 1W25A 1TU3A 2P2LA 4OSEA 4A82A 2YHIA 1KQFA 4AZVA 2KWIA 3DFZA 3L7DA 1W1IA 1Z18A 2IW1A 4S24A 4AP9A 1ZJYA 1BHSA 3K1TA 3ZY6A 3DZBA 1ZRNA 4NS4A 4CKBA 4OXQA 1T5LA 1ZK4A 4LOKA 3F6BX 4TV8B 4Q18A 4RJ2A 2Q8QA 3ENWA 3JATA 3QUSA 5AXBA 5TR9A 3UFBA 2PMFA 4W8OA 5HJ2A 5IJ9B 1NXVA 4UBJA 2FFAA 3LHFA 1XWIA 5LLTA 2A8YA 1M1XB 3T7TA 5EVCA 1VPDA 2YXLA 4QWWA 1GA4A 4RMIA 3NYWA 2OXEA 2RB4A 2I4MA 4QEKA 4JASB 3SHWA 2C03A 4B6RA 2JI7A 3TRFA 4G0VA 3U13A 4HXGA 3WX0A 3TSAA 1X7ZA 2ODEA 5HDQA 1FSPA 1QGUA 2Z43A 3WZ2A 2AFRA 2WSLA 1HWYA 4FR2A 4EF5A 5AQ1A 2P9CA 1AN9A 2ZR9A 2AI3A 1U0GA 2H3EA 3PPWA 1E3QA 2DWQA 3HN2A 3PU6A 1VLMA 2OFWA 4X93A 1WUIS 3VQTA 4EK9A 2Q3CA 4H7PA 3O31A 4LHWA 2FP3A 4UDXX 2GZ2A 4NECA 1XAIA 3FM9A 1BKYA 4HG2A 5EMLA 2X1HA 1EVIA 3OEWA 1XTQA 1JEJA 2GCNA 1JS1X 3VR1A 1DELA 4UDNA 1G1MA 1TUBB 1U2PA 4ZTBA 4DY4A 3S8MA 3A4LA 4F12A 2OBYA 4X64B 2EZ4A 3GC6A 4HGZA 2B6HA 3H16A 3WO1A 2GN9A 1QHXA 2I6QA 3C7TA 4J1SA 4BNMA 5MN5A 3ZWCA 2G1KA 1JQ3A 4YTEA 5E3HA 3KEQA 4ZMBA 1GG9A 4GIBA 1QFMA 3CRVA 3HCDA 2HMTA 3R7DA 4NFLA 3SSMA 3VSAA 1C9EA 2VWHA 2XYPA 4JVSB 2XRFA 3H3XA 4KC0A 1JQEA 2KB0A 5IZ4A 1PEDA 5KUTA 1X1RA 1NBIA 2QRHA 1AK1A 2BI4A 3K9GA 4GOJA 2NYUA 1V1RB 4L3WA 1HYGA 1RYFA 4X97A 5EIBC 4PAGA 3N3AC 2VWPA 5BW4A 2OSVA 2PHZA 4Y3UA 5E95A 4IRMA 4J90A 5KSWB 5CIQA 1E4OA 1QU3A 3MT9A 3A6LA 4PLCA 3W2HA 6Q21A 4GE0A 5KNCH 1AGNA 3TIGA 3EB9A 3GJ8A 2ZQ5A 4IMIB 5DO9A 3REFA 1H6AA 1QPBA 1TQDA 1Z08A 2QDXA 1OGYA 4B7XA 2O2SA 3AI1A 1P7ZA 2BGTA 3RUAA 1BQ3A 2QUIA 4KUGA 4DXDA 1FXUA 5BOSA 1O95C 4R2WA 4LWOA 5CT4A 2WG2A 3PYLA 5DM70 1PJAA 4YXWD 4FQ7A 1G5FA 2BLNA 2NV2B 2ZAIA 2W37A 2JFOA 3CJRA 4RZ3A 3WJ7A 1NRJB 2YZMA 4NABA 1BOFA 3L8GA 3RVPA 2A1UA 2OBNA 4UPEA 2D8AA 1PN3A 4KXQA 1JBEA 2W93A 1T24A 2GHTA 3RTAA 4F4CA 4BLOA 4O4JF 3ANNA 4ZYVA 4CCYA 4CV2A 4H59A 3INRA 2XHEA 1U0EA 4EA7A 4BNUA 821PA 2JJ8A 4RADA 1X19A 1E9AA 3HU2A 1A8IA 3JD4A 4KHZA 4C2BA 1WB4A 2GLUA 4HT3B 2YC4C 3AH8A 1WSWA 2Y1FA 3N8IA 4GX2A 3PFCA 5CA1A 4B4VA 4ZTUB 4LF6B 1L5HA 4B80A 4LK2A 1NP3A 2NXCA 1DAGA 4FE3A 3WR5A 1BIFA 5CEJA 4TMXA 5E9WA 4YPFA 2ZXUA 3ZZ1A 4LF4B 4GI3A 3KEGA 5ICEA 4G5QA 4RTRA 4N18A 4WKNA 1CJSA 1B43A 1MABB 3B20A 5K20A 4Y6GB 3AW8A 2HTEA 4YUZA 2QRKA 3H5TA 5L6MB 2Z4SA 3INTA 9GPBA 1F2TB 5LQUA 1Z15A 3MWDB 5EKTA 3OQVA 2YW9A 4Y98A 5CRIA 5AJWA 3GFQA 4IVNA 3SGLA 4BVHA 3MGGA 1XQXA 1Q7BA 1R50A 2FWRA 1U1GA 2PUWA 1JJ7A 2B20A 5A9TA 4D8YA 1Z5GA 3R75A 2ADMA 2X0IA 1AXRA 3EGXB 5GOTA 4IDGA 2QT0A 3QVUA 4I1UA 4OHCA 1PJ4A 4BQQA 1U31A 4PHGA 3GDWA 1U7HA 2YJGA 3A1WA 2W6ID 3ETDA 5F2KA 3T3NA 1KY3A 1BE8A 1U0TA 3HGMA 1U2QA 1WMFA 4NU6A 3OZFA 4TKUA 1DLJA 1DEXA 4DIMA 2OQ2A 3I28A 1MVNA 2GZMA 2DWCA 4HI0E 5BQOA 2R2AA 3D2LA 4JR2A 2OXRA 5JC1A 2ISQA 3QXJA 4CKWA 5KNBD 3PE3A 4CN8A 1DBQA 1G8YA 5SYAA 3FIJA 1XA3A 4GI1A 2PPVA 3PTAA 1M0EA 3SEZA 4IJQA 1XG5A 1DT3A 2X9QA 4G1BA 4CM4B 1JIKA 1STOA 3DYIA 4BQNA 4J2TA 5KX5B 1Q21A 3LSYA 1FFEA 4EP1A 2A9OA 3A9VA 2J9XB 3EA4A 3LDGA 1GAJA 1XMJA 2HRDA 2PD4A 1JMYA 4ZAYA 4KR2A 1MW8X 2GPTA 1EG7A 2ZTLA 3ZW9A 5K6AC 2BEVA 2WUGA 2DFVA 4JLPA 4MW4A 3PGXA 3Q98A 4UM8B 1NQOA 4FD3A 4W5RA 4LNHA 5JFOA 1UL1X 1OKKD 1NF9A 4RBNA 2CB9A 2O20A 3H9GA 3GUHA 6PFKA 2FPGA 3O8OB 4A23A 2YIDA 2KM1A 1P7PA 3F97A 4GMKA 4E5VA 3E58A 4KE9A 2DGDA 3BG5A 4EG7A 2QS9A 2X6TA 4L4YA 3AU8A 5KHOC 3B1ZA 5ABPA 5JD4A 4ADSG 1YAHA 2A0WA 4KE7A 2ZBRA 4RD2A 1P1CA 4WK2B 5AJUA 2ECOA 4RKQA 1FB5A 5BW5A 4DTCA 1NG9A 1OX4A 2W22A 3D8RA 3QUTA 3IXLA 4XUCA 1R8XA 3NH6A 5A3RA 5BSVA 5LOVF 4HN9A 2JI9A 2GK6A 1CR2A 4Z9YA 3RJZA 4B5KA 5A5DA 1IH8A 1UBHS 1JNXX 4R9RA 3S5JA 1T0UA 3ZDCA 2E3JA 1TQ6A 5JJIA 1CHNA 3SKVA 5E9AA 3QU2A 4ZU1X 1KO1A 3RKRA 3UATA 1AS2A 3E9CA 3CUUA 3GJXC 4IIEA 3A1SA 1DV1A 1OYOA 2WA1A 4EMSA 3GFSA 3EGDB 1D2NA 1UWVA 5F1KA 3BMNB 2GEDA 3PPYA 1A04A 2VHQA 2FF7A 4KXNA 1WE2A 4JLDA 3V33A 3O2JA 5B1EA 3JPWA 3U2QA 1CW2B 2O1WA 4PS0A 1JBQA 1I9CA 1O57A 1OT3A 5FBZA 4B2LA 2JLSA 1YMUA 3QWFA 2Z04A 2QMOA 5F73A 3T7AA 2ON6A 1AHPA 3MN1A 4XIIA 1G41A 2A5FA 4HBZA 2AKYA 3HFSA 4YR7A 1GLGA 3D3NA 4MJLA 2H51A 2O2ZA 3A3YA 1P74A 4Q9HA 2ZI4A 1YCFA 4Q4DA 2PX0A 4CM1A 2NPIA 1XTTA 1NC3A 3O9MA 2FUG6 3EA5A 4LZJA 4HS4A 5CNJA 1GVNB 4LPKA 5ICGA 3I92A 5FX2A 5AW9A 2W6IA 4EGSA 5GZ1A 3GDFA 3QPUA 4J76A 2CUZA 3WQSB 2X40A 4UE6A 4DDVA 4GVXA 4C0QC 4L6IA 4EUFA 5A5VA 3M6MD 3FZGA 3WK5A 2PUGA 4JQOA 3E5HA 3S1AA 4II7A 1PJRA 2P4QA 2OHHA 1ZCFA 3QPWA 3WIBA 3JYHA 3AIMA 4YT4A 3RQIA 5KNBA 4OXKA 2R2GA 1BW9B 1I13A 1KETA 2FSFA 2XWBF 3DZ8A 3KSRA 4Y6RA 4YCJA 5FPYA 3EC7A 2CLIB 4X45A 1XRJA 4RV5A 5MDHA 5IUNC 4Q4CA 2BT4A 2P90A 1P4JA 2W2VA 1WKBA 2QQFA 4EBFA 2FQXA 3IHLA 2JVIA 4AT1A 2GPJA 2OP0A 1RQ7A 3VYSB 4JC4A 1B6RA 3OTWA 1C7FA 3PYMA 1EWVA 4OCZA 1ZCBA 4W1PA 1MAWA 3QEKA 2QVCA 1XEAA 4FFMA 4C0WA 2WPNA 5FV4A 1IZ9A 1OKKA 3GPLA 1L9XA 2AFIE 4M9CA 3F4KA 5FUBA 5LPNA 3A6KA 4CMEA 3QKSA 1L8XA 2PYIA 2FAXA 5FYQA 5IUKC 4GKKB 2ORWA 3DNMA 2NMVA 3CONA 1N5RA 3G79A 2I6SA 1KSJA 4E1VA 2B4RO 2CXRA 4MV0A 1AKYA 4FKMA 1N6HA 2YQ5A 3G5UA 4RQBA 1V3TA 1I3OA 5ECYA 3LQ2A 3KZVA 1G6HA 4YS6A 5DMHA 4X71A 2UYOA 2IYSA 3L0CA 4DR2B 1E2EA 2QPLA 2ZXFA 4BKMA 4TVSA 1LJ8A 2W4MA 4FLMA 1NHGA 5LKAA 2X0DA 2OUKA 1ZM4A 1Z73A 4QPPA 2EARA 4TS4A 2IHUA 5DGDA 5IULC 1XNQB 4HYYA 4L2IB 4MW1A 4AB1A 2WF9A 5FUMA 2IYYA 3ENKA 4FE7A 3C1TA 4J0DA 3KWMA 3QVLA 4XB2A 5LU9A 4JUDX 1MB2A 1PTJC 2H1OA 4DIDA 2GXQA 3C1UA 1V45E 4OMCA 2R1VA 3PIIA 4X00A 4Q9AA 5F21A 5TEVA 3UXMA 2OGTA 1E1CA 4AJ4A 4BP9A 2ZM5A 5ED0A 3ST7A 4O4HB 4P92A 4IV5A 1G6KA 3ZD7A 1E2LA 2DQYA 3R77A 4WA7A 2AHRA 3PNSA 4PHFA 4D4LA 2ZU0C 4EFDA 4Z2AA 1TO2E 2CLSA 3JQ9C 1YR3A 2EZ8A 3GP3A 3L4JA 3BCUA 3QNWA 5LMUB 3AR5A 4M3NA 2NZYA 1TPZA 4EDFA 2VF5X 4FGLA 2HQRA 1X1TA 3W2FA 5B64A 2P5TB 1C2TA 3WMGA 4CI9A 5ALUA 2H17A 3FIUA 5I9BA 3LDUA 1WG8A 5DNAA 4L9AA 1GSOA 1GGNA 3GRUA 2XA9A 2QTBA 2NVBA 3D7RA 2PM8A 1MQSA 2FA9A 2PRKA 3O4JA 1NDHA 1NJ1A 2B1IA 1B16A 2PGAA 4G89A 4EKEA 2WYHA 1YVDA 1S3GA 2BFCB 3HN7A 1OZHA 5JAQA 4BV8A 3H84A 3KR0A 4V2IA 4C22A 1F8YA 1XJ5A 4OF4A 3V6MA 1XNRB 2XB2A 3FGPA 2WE7A 5JI3E 1I7NA 4IKPA 1E20A 3H8WA 1HSZA 4L74A 2QMQA 3SM3A 1L4YA 3QWHA 3QJYA 4Y6OA 2GTIA 4LZLA 2GYUA 2Z95A 5C51B 1YU9A 3S29A 8OHMA 2PBFA 1J8MF 4Q9LA 4ARSA 1KY5A 2ZWAA 1J42A 2Q3FA 8ATCA 4GPZA 5MGNA 2GETA 1AOXA 2F43A 4X61A 2HXSA 1AIPA 2OK7A 3A11A 2QVXX 3U4HA 5LP6B 1FK8A 1FFXB 2PT7A 3I6IA 3T3PB 1EFHA 1UBKS 2C98A 4WKGA 1WABA 2FH5B 3ESYA 4NHOA 4EELA 3KZ1E 5HQ3A 1ORWA 2UVPB 4HMOA 1Z8HA 4LQDA 4C01A 2IKSA 1JTVA 1E0JA 3GARA 4JR1A 4WZAE 3E3NA 4KRYA 1U5BA 3ZVMA 1XK6A 5BP7A 3ZDRA 2WSYB 4XM2A 2EIHA 4X60A 4AG5A 4HO1X 5KC9A 2V9PA 1H66A 4C5BA 1SBYA 2PX5A 1CIVA 1L5MA 4PZCA 5IASA 1JN0A 3IMGA 1GSHA 1RHMA 1YB5A 2J59A 3I5MA 2OBBA 2ZSIA 4D9MA 3M6WA 4M0LA 4N5MA 1A9XA 2AXPA 4AN0A 3PQ8A 2JBAA 4K6KA 2AOXA 5ADUS 5C31A 2GEFA 4C14A 3G5LA 4YMSA 4ZDKA 1JGTA 1V95A 2VP6A 3AUAA 3L6DA 5JS8A 2EG5A 2RAUA 3WGZA 4O1HA 1FTNA 1K2VN 3FCUB 3WK7A 4F6RB 1QM5A 3FCCA 3F7TA 4MUIA 3SBOA 2BTOA 4D9EA 2NADA 3TW0A 4C2AA 3WHLA 3EPPA 3KKMA 4BQIA 1Q15A 2GAFA 4KO4S 1W5EA 4QGFA 5DW0A 5EQFA 1NW5A 1Z4KA 5ALGA 3KNZA 4YRQA 3KQQA 3LPDA 5BUQA 4KNYA 5GPBA 4Z0PA 3CVYA 1L5YA 1NV9A 1FYXA 3C6BA 3ELUA 4MB0A 5AOVA 2LDXA 2Z3VA 3UV3A 3BORA 2CXSA 2RAPA 4BFUA 1N1MA 3LA8A 4TLCA 2E9SA 4E4YA 4L4ZA 3HRIA 5CK5A 1W1UA 5HFNA 4NR0A 2A78A 3EXHA 4HH0A 1DC3A 4XXHA 4D92A 4YJ2A 5EWJB 5AVJA 1QIHA 4AKGA 2WYVA 3I6BA 2HC9A 2BFEB 2DT8A 1YOVA 3PUIA 3NT2A 3PVCA 4JKIA 4ZOEA 4E08A 5B2FA 3HLTA 3H1GA 2WVAA 2IEZA 3PT9A 1EVQA 2P77A 5JRDS 1Y3AA 1S8OA 2AOUA 2NPOA 3HBNA 5CB8A 2JHFA 3NALA 5U4QA 3U4GA 1D1QA 3VJLA 1FFSA 4B35A 2JFQA 2ZIZA 2R8RA 4PR0A 4R9UC 4V1CB 3WISA 2IEGA 1NW4A 4R1TA 4E15A 2EATA 2IOHA 2P11A 5AVVA 5H4HA 4XTCS 5F5LA 4NYMQ 4O5AA 5JSKA 5KHLB 1KE1A 1G59A 3FR7A 1U11A 5FFFA 1ODIA 4ZU3A 4DWJA 3FCYA 1D2GA 4WLFA 3GX1A 1F1BA 5IH3A 1QVVA 3OOYA 4G23A 3MERA 1XVLA 4L4XA 1R4AA 3LOQA 4WMLA 4ZO9A 3TLZA 3BEDA 3M6XA 1T5OA 1XZEA 1E2IA 1ZH4A 3VI4B 3WWOA 3WOHA 1QZUA 3AY7A 5L40A 3HVRA 3P0IA 2XRYA 1PR2A 3QWAA 1UAGA 4L28A 3BFJA 1QIEA 4DWWA 3ORRA 1SCIA 5EIXA 4KQCA 4C06A 4QEZA 3GEEA 1SVMA 4R31A 3DL0A 3VUFA 5CH8A 3LUAA 1HE4A 2CLLB 4YMHA 1P8AA 1K6IA 2ZYIA 2Q4DA 4LBYA 1KQNA 3SM9A 5DP1A 1RHKA 3OIWA 4TTJA 2MR5A 3GV0A 1T3HA 4R3NA 1KOLA 3SHVA 3WWEA 1M6VA 1PUXA 2OZLA 1T8WA 1J5XA 3ET5A 3GZTB 1QS0A 5T57A 4MP8A 4UEOA 1DFHA 1ICIA 1USGA 2XMDA 3IBCA 3TQOA 4LOAA 5K45A 2HF7A 3OLCX 5JEEA 3GUUA 4WGGA 1QLJA 3LGXA 3LTEA 3G17A 2RDMA 2YFQA 1QXSA 4F2WA 1QYIA 1IEVA 2FRXA 4OYYA 2H31A 3B6MA 5HJ5A 1ABBA 1KAHA 1E62A 3ONWA 3RF7A 4H1WA 4R7TA 3ZIUA 2WF5A 4KQWA 2AI2A 3I9MA 4BN0A 2VLIA 1MG0A 2MCFA 3RSFA 1JLSA 2I33A 4BMSA 3WKEA 3BDIA 3JVDA 2FSGA 1EYZA 1HYEA 4N01A 4M1EA 3TBFA