2NU7A

C123as mutant of e. coli succinyl-coa synthetase
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
287
structure length
287
Chain Sequence
b'SILIDKNTKVICQGFTGSQGTFHSEQAIAYGTKMVGGVTPGKGGTTHLGLPVFNTVREAVAATGATASVIYVPAPFCKDSILEAIDAGIKLIITITEGIPTLDMLTVKVKLDEAGVRMIGPNSPGVITPGECKIGIQPGHIHKPGKVGIVSRSGTLTYEAVKQTTDYGFGQSTCVGIGGDPIPGSNFIDILEMFEKDPQTEAIVMIGEIGGSAEEEAAAYIKEHVTKPVVGYIAGVTAPKGKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGEALKTVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinyl-CoA ligase [ADP-forming] subunit alpha
publication title Participation of Cys 123alpha of Escherichia coli Succinyl-CoA Synthetase in Catalysis
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ligase
total genus 108
structure length 287
sequence length 287
chains with identical sequence D
ec nomenclature ec 6.2.1.5: Succinate--CoA ligase (ADP-forming).
pdb deposition date 2006-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00549 Ligase_CoA CoA-ligase
A PF02629 CoA_binding CoA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 2nu7A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2nu7A01
3TOZA 3RC9A 1DHRA 4GLOA 5TJ9A 3OEWA 5JFOA 1F12A 1PQWA 1NAIA 1PIWA 2P9CA 4GKVA 4A7PA 3KV3O 3DEYX 1TB4A 1J4AA 3PWSA 3UKOA 5L7WA 1TT5A 4XEHA 3DMYA 3JYNA 3PFWO 1BWSA 2J5KA 5DULA 2V6BA 3QVXA 3V2HA 3W8DA 4U7WA 2Z1NA 4WKGA 3ZWBA 4ZQFA 5BSGA 5ICMA 3WQSB 1YBMA 4J2OA 1JA9A 1VL8A 1NFRA 4WLVA 1X1EA 4MP3A 1ONOA 4XDYA 1UXJA 1VM6A 3PYXA 1GEGA 1T26A 1ADCA 3ZWCA 3FTPA 1P0CA 2A9FA 1D7OA 1RWBA 1Y5MA 1DIGA 3ORFA 2FN7A 3JQ8A 5G0TA 4IMPA 4PLFA 4DIBA 1ADFA 3RFXA 3ENKA 4FFLA 3K2BA 4QTZA 2I66A 4GLLA 4UVHA 3UN1A 3H65A 4ZU3A 5JDIA 2DLDA 3KHUA 1D1TA 2Z5LA 4CV0A 2VNSA 4MKXA 4YB8A 4Z3DA 1E7WA 1XSEA 4IXTA 4RQUA 3HJAA 4TRRA 3PWZA 3TFOA 4RVHA 1A72A 2HRBA 3R3JA 1A71A 3CPSA 5C7OO 3ON5A 2VWPA 3KEQA 4W6ZA 1E7YA 2BRUA 1Q0LA 3PZRA 2HMVA 2NVWA 2IDZA 4YVFA 4ZHSA 3OIFA 3KBOA 3W4KA 2PD3A 3FNEA 2V6GA 4CUJA 5EERA 2TMGA 4LCJA 3E82A 4I5FA 1RJWA 3ZWNA 3ZGYA 3PIDA 5HWSA 5U1PA 3RASA 1E3EA 1DC5A 5A05A 1QKIA 3UHAA 1EUZA 2NU9B 2NQTA 2WM3A 1LBEA 3WLEA 1P1KA 2A94A 1MC5A 4U8GA 3GR6A 1F8GA 2EGHA 3OA2A 4L75A 3V2GA 3FR7A 4BNKA 1FF9A 4IINA 4MVJD 4TKLA 2DM6A 4B4UA 5K6AC 5H82A 1CEQA 1GQ2A 2B0JA 1U7HA 2X5OA 4JIGA 1U5AA 1LSUA 1HYGA 3GH3A 3H5NA 3WNVA 4WCDA 3H2ZA 3UW3A 1ADGA 1EFLA 1GADO 1B16A 4AJEA 3BTUA 2AMFA 2YDXA 5AQ1A 1ZK3A 4CMIB 4DYVA 1DDOA 4J1QA 4RPJA 3EY4A 3BMNA 2JFGA 4FJ2A 4H15A 3IQDB 1ZCJA 1LSJA 2Q2VA 4ND3A 4RVUA 2IODA 3BAZA 3DMTC 3INGA 5DDIP 5HM8A 4BV8A 2P91A 5BQFA 2NU6A 1ENYA 4PFJA 2VT3A 4LW8A 4RVSA 5A9TA 2DFDA 3Q9NA 3FBTA 3OBBA 4WECA 1C1XB 3DR3A 2VRBA 1K6JA 4YAJA 4D0RA 1KEVA 1ZJZA 4Q3BA 3NDRA 5TLSA 2EEZA 2YV3A 3HN7A 4BS9A 1P45A 4I8XA 3T7CA 1R0KA 1IPFA 3L77A 4R41A 4XQCA 4P22A 3HDHA 4A5OA 4RPKA 4OSOA 4II2A 4BGIA 2BGMA 1R4MA 3H6KA 3WMXA 2FR8A 4NFSA 1I5RA 2NADA 2Z1MA 2VUSA 4OIMA 4BUCA 4DXHA 3ZNQA 1EDOA 1E1LA 2LDBA 3OETA 3BZUA 4FR5A 1I2CA 3ASUA 4GSLA 4YA6A 3GHHA 3QP9A 3RC7A 3K96A 3PQFA 4CPDA 2VTDA 4IDAA 2HJSA 4XYBA 4XR9A 3WGZA 4XWYA 3OP4A 4RO0A 1W8DA 4ZQGA 5G0UA 5L45A 2YY7A 3E03A 2B37A 2PKQP 4M87A 1QYXA 2X0JA 3OIDA 5CEJA 1D3AA 2GSDA 4A26A 5L4SA 3S1LA 3TNLA 3KLPX 1K6XA 1W73A 1YBAA 2HK7A 2C7GA 2DQ4A 4ND4A 4B7XA 4OHUA 3FWNA 4XGKA 3WQQA 4IQ8A 4D0SA 1LXCA 4NG5A 4NPCA 2JD0A 1IY8A 2WSBA 3WBFA 3DFUA 3JV7A 3HDJA 2R00A 3JQBA 4BO9A 2YW9A 4CMEC 4CM4B 2JKVA 1PJBA 3WGHA 5IZCC 2CNBA 4R5MA 4BQPA 4A0SA 4GX0A 1AE1A 2BELA 1HTBA 3GA0A 5DN9A 4UVDA 2VRCA 3PDJA 4OXNA 4F6CA 3A9WA 1EUCB 2Q2QA 4Q3AA 5A04A 5KNLA 1ADBA 2JJYA 4YJFB 1PU2A 3ZCXA 3ZNNA 3D5QA 1MB4A 1V9LA 2CFCA 3DHNA 1PJCA 4M1QA 1H5QA 3G1TA 3DONA 3ZH2A 2P2SA 5JAQA 3WBBA 1LRKA 3MJTA 2Q2WA 2P5UA 5TC4A 4FFRA 4W7HA 1XKQA 2OGUA 5FF9A 5G0VA 5I9MA 2A35A 1PGNA 1LDNA 1VJ0A 1GPDG 1ZK0A 1GQYA 3C1AA 1K0UA 1BVRA 1MV8A 3B20A 3DZFA 3TZHA 5KOIA 3H5AA 4GX2A 2BFPA 3DTYA 1PJ4A 3JQGA 4MVJE 1DFHA 1E7RA 1I36A 2G0TA 3DAGA 4R1NA 3Q3CA 7MDHA 5TS3A 3DDNA 3R6DA 4DGSA 3PJEA 4YXFA 1VI2A 3EC7A 2UDPA 3FHLA 2RH4A 1VL0A 4MO2A 3ZU3A 3V1TC 1PGJA 2ZCUA 4JCOA 4DMMA 1H2BA 2DPHA 3D0OA 5DBFA 2XAAA 3D3WB 2JD2A 3C1OA 3ROKA 1LU9A 1BTOA 3ZW8A 2Y0DA 2PFGA 2D5AA 3IP3A 4J2HA 3PQDA 1VE9A 1SMKA 3JCZA 4XIYA 3RCBA 4HFRA 2BD0A 3TWOA 3AFNA 1LI4A 1WXDA 3CINA 2W90A 3K73O 1N1EA 3ADPA 2W2KB 4IDEA 3HADA 1R0LA 4E2XA 4IDDA 2DPGA 3PLNA 1HDRA 1E1KA 2B4TO 1DLIA 4A10A 3G49A 1N8KA 4QEDA 3GRKA 4RPGA 4AJPA 4AJHA 1YDEA 5EESA 2C7VA 3IUSA 1BVUA 3AM3A 2I99A 4R16A 4RVDA 1P77A 4RPHA 4JJFA 2NSDA 2C2YA 4B3JA 1LRJA 5F21A 4TMFA 4LSMA 2FY8A 1I3KA 4OQZA 3WJAA 3JTMA 1ISJA 1A27A 1ZNQO 4ZQEA 3U62A 1DJQA 2CVQA 4ESOA 5G4LA 2FPIA 5IXSA 2OMEA 2Y1CA 3LVFO 4WOJA 3RIHA 3KYBA 4WASA 2VHVA 1I33A 1GV0A 5AXAA 3OHSX 3FI9A 4IJWA 2Q99A 3MJ4A 4EBFA 2ZYGA 3VH3A 4XDZA 3WSWA 1B8VA 3QA9A 1SPXA 1UZNA 3CZRA 2UVDA 1V3TA 4LISA 4B3HA 3ZHYA 3E5RA 4TKMA 4BO5A 2CVOA 4O1MA 4YRDA 4R68A 2GDZA 2Q50A 1YONA 4HP8A 3PXXA 1OC2A 2X0NA 4NQZA 1JU9A 5BNFA 1F8FA 1HE4A 3HSKA 3OM9A 3VZSA 4ZQBA 1V6AA 2WD7B 4UREA 3COSA 1JAXA 1ML3A 1TLTA 3C1TA 2NV6A 5JO0A 1YH3A 3ASVA 2I65A 3I9KA 1UAYA 5COQA 4RZIA 4HY3A 4WCFB 4I08A 3VKVA 2VYVD 2GN9A 4DREA 1CQJA 4D7AA 4HUJA 1JKFA 1N92A 1GL3A 1JKJA 1Q7CA 5HA5A 4Y67A 5TIIA 4J90A 4CLEA 2V6FA 2P9EA 3DBVO 4QECA 3EVNA 1H94A 9LDBA 2G76A 3WYBA 4NJMB 2UV8A 3RQSA 3RC2A 1NNUA 4NI5A 5AXDA 3B1JA 1BXGA 1KETA 1LSOA 1FDSA 4CQLB 5HS4A 1ZEMA 1D4FA 2PGDA 3QWBA 4LRTB 1P31A 1DHTA 2QZ9A 2DUWA 3DBRB 1C3VA 1PZFA 3GN1A 1E7QA 3TPCA 3HB4X 1VRWA 3VPSA 5L95A 2RIRA 4MOWA 1D8AA 2O3SA 1QORA 3JYPA 4AJOA 3S2GA 5FI3A 2J3JA 4MP6A 4PG8A 3W1VA 3RVDA 3BTVA 2VHWA 4YJDA 5ADHA 4QUKA 3WSVA 5DOZA 3O26A 2NLOA 3JQ9C 1I10A 1JVSA 1R4NA 3ETEA 4N7RA 5T57A 1L7DA 4BOYA 2P9GA 3KO8A 5AOVA 4D3FA 4BKUA 4J3FA 1NAHA 4BNXA 4CQMD 4DWVA 2BFMA 3U9LA 3M1LA 4GVXA 4YRAA 4CJXA 4PIVA 4FOSA 1T2AA 3MWDB 1YOVA 4XGIA 3W4IA 2C5AA 3GDGA 5JE8A 1EQUA 3P5SA 3K2EA 3OECA 4IZHA 4R3WA 4CLRA 1XG5A 4PG4A 4JBGA 2XXJA 3ENNA 3WX0A 1LQTA 4DQUA 3GN2A 2OXIA 1PL7A 4LMPA 4U0JA 1O95A 2PGLA 2ZB7A 4IS3A 2WTBA 2B35A 2FZEA 3E6AA 2OFPA 2JL1A 3GLQA 3H3FA 3PHJA 4YT5A 4WCFC 4CR8A 1JVBA 1HDYA 1U1IA 1SAYA 2VT2A 4IY1A 4ALLA 3DBHB 1UZMA 2WYUA 3E5MA 1KBZA 4NR0A 4GH5A 1Q1NA 3CMCO 5CEFA 3GK3A 3D4PA 4DRYA 4UEJA 3TJRA 5JAMA 3KSDO 3WGOA 5JY1A 3JQAD 4GVLA 2O7QA 1HE2A 5EQDA 1HYHA 1ZXLA 2YHIA 5DCYA 1PJ3A 5JLAA 3VDQA 3WGYA 4BKPA 4GSKA 1GZ6A 1KEPA 1T24A 2JCVA 4OOEA 1Q7GA 4E5PA 4G5HA 5BSHA 2BFAA 5L51A 3DZJA 2B4QA 4CLOB 1LLCA 3M2PA 5K6AA 3L07A 4Z9FA 2RBEA 2BGLA 4CMBA 4BV9A 2X23A 4KMSA 3U0BA 4E32A 1GU7A 4OYRA 1YO6A 2O48X 4YAEA 4UVGA 3H9UA 4W4TA 5L3ZA 3OH8A 1EUDB 4OGWA 2HRZA 3PYLA 1U3TA 1CETA 5A3VA 4WOKA 3R0IA 3AUAA 4BNIA 1C0IA 1MC4A 1DIHA 3GNSA 4XQGA 2AE1A 2PD4A 4W82A 4B79A 4R3NA 4CLXA 4DVJA 2O4CA 2R6JA 3ABIA 4CM1A 3DMTA 5TT1A 3IIEA 1FJHA 4QFDA 2O3TA 1HYEA 3GVIA 2OHXA 2Y99A 1K2WA 3WS7A 4DTIA 1C1DB 1E3WB 4JNKA 4D3DA 4GMFA 2OUIA 3RBZA 1JW9B 1YJQA 3WIDA 1T4DA 3U4IA 4IGFA 3JYLA 4KDEA 2ZQZA 3BMCB 2Y93A 5F5NA 2X22A 4EI2A 3CTMA 2PLAA 1M67A 1D1SA 4AJLA 2TMDA 5JAIA 1ENZA 2VWHA 3PRJA 2WD8A 3OJ0A 1BGVA 1NHGA 3EYWA 4RL6A 5IG2A 2PR2A 3L9XA 4BNYA 2NU7B 4RLSA 4LVCA 1T4BA 4IGEA 3QSGA 4L9RA 4J4HA 4PLCA 5GZ6A 4CM8B 5DOVA 3DBLB 1H9AA 1E3LA 1U3VA 3IJPA 1PSDA 3NT4A 4MVJM 3GT0A 4DLLA 2O4UX 4IJUA 3ZWXA 2WE7A 2AA3A 4E3ZA 2OBNA 2OBYA 3H9QA 5JBIA 2AW5A 3UXYA 2NU9A 4YT2A 3SX2A 1SO8A 4YDRA 2ZYDA 1FDTA 1DFGA 2HJRA 2ZIZA 1RM4A 1PZGA 3NEPX 2HSDA 4DC1A 2DTEA 4ZRNA 1M2WA 4NFHA 4BB6A 4Z0HO 1B7GO 3HFSA 3QWIA 5A1TA 2EKQA 3I83A 1E1MA 3X2EA 5ICSA 1OMOA 1UP4A 3RUHA 3Q2KA 2FSSA 2GO1A 4CMEA 1MGOA 1ZEJA 1WZEA 5IZCA 2GCGA 1Y5RA 3C7DB 4PVCA 3X2FA 3ZI0A 4Z3KA 4BO4A 1NX6A 2PKRA 4XJSA 4RLHA 4BQRA 1YGYA 4E30A 5L4LA 3ZW9A 3U5TA 1EEHA 4YAKA 1IL0A 2WMDA 1QYDA 4DQXA 4CR7A 3FTNA 3TZKA 4BVAA 3BHMA 1E7MA 2ZYAA 4N5MA 1TVEA 1I2ZA 4FJ0A 2PGJA 2X9GA 2E4AA 1XGKA 1DLJA 3EMKA 1B8PA 1W4ZA 8LDHA 3RI3A 3N58A 4NIMA 3ICPA 2EWMA 1HEUA 1P74A 3DL2A 3AI2A 3KTDA 3GQVA 1U3UA 2EV9A 2J3KA 1I01A 2EGGA 4IPTA 2FP4B 2GR9A 3LQFA 1ORRA 3WDSA 1J6UA 3FF4A 1UP6A 4OM8A 2CD9A 1IUKA 1JTVA 4CR6A 1BXKA 5JCXA 1O6ZA 4H16A 1N2SA 4BNJA 4BKOA 2IZ0A 1ZSYA 5B37A 1Y9AA 3QVOA 2J3IA 4YJGB 2RAFA 3F9IA 5COAA 1P1IA 3TN7A 1XWFA 3KRTA 2O2YA 4PCVA 2CDBA 2ZB4A 1YB4A 2VUTA 3DAFA 4IDFA 3SBOA 4S1VA 3EAGA 5DP1A 3SC6A 1V8BA 2I5PO 1M6WA 4MINA 5CG2A 4GKBA 3FSRA 3LDHA 1H0KA 3PHLA 5KJEA 1BDMA 3RROA 3GFBA 5EQFA 2AQHA 4WLOA 1ZSNA 3CMMA 3PGXA 4RVFA 3FR8A 3F5QA 2W8ZA 4XRRA 4F6LA 3S55A 2YV1A 1VKOA 4RV9A 2NM0A 3L4SO 4NMHA 3CZMA 3ZZNA 3W8EA 1N9GB 1KIFA 2HK8A 4CMKA 4CM4A 4G81A 2H5LA 1VJ1A 2PNFA 3ADOA 4BNMA 4CL8A 2WYWA 2QHXA 3DXFA 3OJEA 4AG3A 2DBQA 3HB5X 1QLJA 4E31A 3TZCA 1LDEA 4NDNE 4XB1A 4PVDA 1T2FA 3DZBA 4YJFA 1JDJA 1OC4A 1U5CA 4ND5A 4EW6A 4AJ1A 2DFVA 3RJ5A 1GD1O 2ZB3A 3RAJA 2SCUB 1ENPA 3B6ZA 4OAQA 4ROSA 1NPYA 3S2EA 5L53A 1LUAA 2H63A 1I3LA 4BGVA 1GV1A 3HDYA 3PHGA 3W6ZA 5KJCA 3SLKA 3PK0A 1HXHA 1C0PA 3ZV3A 4EUFA 3NYWA 3KSUA 3BMQB 4DLAA 1BHSA 3EZYA 1QR6A 1UAGA 2AEFA 3VH2A 3F47A 2FWMX 3L4BC 5ITVA 2X5KO 1DIAA 4BO0A 1YRLA 5G0SA 1T2DA 2D1YA 1MA0A 3FNHA 1GY8A 4EZBA 3F3SA 1MLDA 4BMSA 3MWEB 3NJ4A 4N18A 4BNUA 4BNFA 4XCVA 3TQHA 3RBVA 4FFNA 3F46A 3R1IA 2IXBA 4PZEA 2D59A 4R4JA 1WDLA 2H1SA 4AVYA 2EHDA 3DQPA 4O6VA 3B1FA 2C5EA 4I9NA 3M1AA 2EJWA 5LDGA 4R1TA 5C5IA 1Z75A 3JD1A 3HDQA 2IZ1A 5EPOA 4DPLA 3U49A 1KY4A 1J49A 3KSZO 4OJNA 4D42A 4CM9A 4UULA 4GWKA 1KOLA 3INTA 5ER9A 8ADHA 2QYSA 4YJHA 1C0LA 3ANMA 5CP8A 5F1PA 3VC7A 4I5DA 1ZK4A 3ICCA 4M89A 4OOFA 2I76A 1SOWA 4MIOA 2JCXA 4F46A 4K1LA 3W6UA 2V65A 4E6PA 2YYYA 4YWJA 3L0DA 3RU9A 2W2KA 4PLTA 5DCWA 1LLUA 1B3BA 1WWKA 4CM6A 1O0SA 1NPTO 1UDBA 2IZZA 4KWIA 2FZWA 2RCYA 1PL6A 2CF5A 2IRWA 4RGBA 3WFIA 5ITWA 3E1KA 3A1NA 4LGVA 2X6TA 1IE3A 2AEJA 4I1IA 1ZK2A 3MTJA 4QSMA 3NGLA 3GF4A 4PLPA 2NU8B 3DWFA 4E4YA 1N5DA 1P1HA 5JMPA 1PR9A 3Q6IA 4YEDA 3GZNB 4YRBA 1KYQA 3TF5A 3DTTA 1CIVA 3CH6A 3MJCA 2C2XA 1MXFA 2Q4BA 1QYVA 5T8KC 5B4TA 3LLVA 4Z6KA 2FPPB 3WJ7A 3JQ9A 3I1JA 1IB6A 4ID9A 2YQ5A 3GPIA 3OQ6A 5JAZA 3FRJA 3SLGA 3SVTA 3NKLA 1RM3A 3QJ5A 2PD6A 1AGNA 1ONPA 3LC1O 1A7AA 2VRCD 4HWKA 4OKIA 1EZ4A 1Y8QB 3RJ9A 4Y9DA 1P1JA 1NQ5A 3GG9A 1CYDA 1RKXA 1M75A 3V2UA 3U4CA 3Q11A 1F0YA 2Y05A 2UUOA 3I9JA 4TRMA 5DF1A 2WD7A 1U4OA 1U2DA 5A9SA 1YKFA 3E9NA 3FPLA 4W9NA 3HWRA 5IJZA 1ISIA 2D3TA 4WCFA 4TRNA 4TRJA 2X86A 4W7IA 3GY0A 1QV7A 2BKAA 4MVJH 4XGNA 1ARZA 4E0BA 3VVCA 4I9HA 3UFXA 1MG5A 4DBZA 5JC1A 4B8WA 1NWHA 2PA3A 2G82A 2CDAA 1LA2A 1T2CA 4ND2A 1ULSA 2C0CA 2C20A 1MFPA 5HTOA 1R15A 3FD8A 2DUUA 4NJMA 2BF7A 1NQOA 1SC6A 2B69A 5A5FA 3QIVA 2Y1DA 4H7PA 4CQLA 5GZ1A 3B70A 1I32A 4RPLA 1E3SA 4E13A 4ZVVA 3QLJA 1ZMTA 5COBA 1BW9A 3DBRA 1A4IA 4HFJA 1DRUA 3PGJA 3WICA 1A7KA 1O94A 3DC2A 1PS0A 3H7AA 1A9YA 3O8QB 3WB9A 3ZWPA 3ZWMA 2XF8A 4EUHA 2OOSA 3LT0A 5DCUA 1DC6A 3L6EA 3NJ8A 1PGPA 2V6MA 1QRRA 4JJGA 3ROQA 1PWZA 4QX6A 1VL6A 4K6CA 4DYDA 1FMCA 1HDCA 2ZKLA 4XR4A 4OSPA 3QE3A 4XJTA 4J7UA 3T7EA 1QYWA 3NAQA 4CLHA 3GVXA 3PHIA 1IULA 2FR1A 3E9MA 4Q3NA 4BKQA 2D5CA 2JFFA 1F06A 3UVEA 3A06A 2QZZA 4J4TA 4LMRA 2Z95A 4GX1A 1XU9A 4NBRA 1ZKMA 5LC1A 1DC4A 4E33A 3H9GA 1F17A 1M66A 1JLLB 3AUSA 1G1AA 2EP7A 5AXBA 4XD2A 3OQBA 1NR7A 2EW2A 2EJVA 4UUPA 1ENOA 5CPBA 3KEOA 4WLUA 3RKRA 3WWZA 4B4OA 3GGGA 2NUAB 2VUUA 4RDHA 3VTZA 5I9NA 1MX3A 2O50A 2VZ8A 1IZ0A 2GGSA 2CMDA 1ZVMA 3C3XA 4OKNA 4MPDA 3PJDA 2VHZA 1YL5A 4ZA2A 3WXBA 2NU6B 2EERA 2HLPA 3LYLA 3I3OA 1NFQA 1HDOA 5CDUA 1IYZA 4INAA 4JLWA 1UJMA 2Y0EA 1NVGA 3GNQA 4PN3A 1GUZA 1E77A 1GZ4A 2AEMA 4DC0A 4ZJUA 4JQCA 2I67A 2PH5A 1PQUA 3DZHA 1ZW1A 3ZDFA 1Q2XA 5TX7A 1R4MB 3AUUA 3GZ4A 4U0KA 3WFJA 2AHRA 4EEXA 1NP3A 5HBRA 1PJSA 1JKIA 1SCUB 1GYPA 1TI7A 4FFMA 4RVGA 1LLQA 3IL2A 2NNLD 5TQVA 4IUYA 1EUDA 1P9LA 1YXMA 3IOYA 2GZ1A 4AFNA 1Y1PA 4DPMA 3NUGA 4CL3A 3DB2A 5I9LA 4JGBA 5B1YA 2NQ8A 4DMLA 3D1LA 1YJ8A 5I7VA 5JDCA 1GCUA 3GG2A 4BO6A 1T25A 3NTOA 1E6UA 1RPNA 4K6FA 4EEZA 1SNYA 5I8WA 4YT8A 5JS6A 1C1DA 1E3WA 1N7HA 4E5YA 4RORA 1YQGA 3MCVA 4D41A 1DJNA 3GVPA 3KVOA 3OFSA 4NZ9A 2HMSA 1Z74A 3BMCA 1YDWA 3JQEA 1LDBA 4EUEA 5KWEA 4N5LA 4L74A 5CAEA 4NU5A 2FHSA 2PY6A 3FNGA 1ZH8A 3GMDA 2YUTA 2J3HA 2FPGB 2HO5A 4Q3EA 3P2YA 2NU7A 2X4GA 3U3XA 3WOHA 1YWGO 3ZV5A 1HL3A 5BNIA 3I9NA 2GERA 3R3SA 4Y98A 3DBLA 1WVGA 4ONEA 4BO1A 2PTGA 2D8AA 4J43A 1I30A 2GZ3A 4H3VA 1DRWA 3QVWA 3L6OO 2VZ0A 4Y6RA 5IZ4A 1LDMA 1NYTA 3HFGA 1KC3A 3G17A 3IP1A 1Y8RB 3UUWA 3MEQA 2ZTUA 4CV1A 2G17A 3JQCA 4R54A 3ZV4A 4XIJA 4M54A 5C7LO 1NM5A 3MJEA 4FBGA 4TVBA 3GDFA 4BNNA 1IOLA 3DZGA 4CMAA 2P4QA 4CODB 3PP8A 5FEUA 4B7UA 5DZSA 1X14A 5G0WA 1XDWA 5IDWA 4LN1A 4RF2A 4WLFA 4CM5A 3ITKA 5J23A 1NHWA 1YB5A 4PZCA 1EK6A 1Y6JA 4NU6A 3TSCA 4CUKA 3C7AA 4GMGA 2BLLA 3OICA 1HDXA 5AXCA 2QG4A 3EGOA 3FNFA 3GNTA 1AXEA 4RDIA 5CDGA 2YJZA 1G0NA 3PPIA 4A27A 4FGWA 1EVYA 2B83A 1UDAA 2J6IA 1GR0A 3RFTA 2X7HA 4HV4A 5MGBA 1Z7EA 3BHJA 1V3UA 2EKLA 1X7HA 1KVTA 3F6YA 4YQZA 1UR5A 1YS4A 2PK3A 4BNWA 4AJIA 2ZB8A 2JAHA 2Q1SA 4NHEA 4URFA 5ILGA 2R00C 4PLHA 1HKUA 3E9QA 4NK5A 2Q46A 1UUFA 1XQ1A 3PHHA 4Y6SA 3K6JA 4JP2A 3GC6A 4ILKA 4P4LA 2Q1TA 2DU8A 3F4LA 2HMWA 4XYMA 3KETA 3AOEC 3L4BA 3NDJA 3S8MA 2IEDA 3IAHA 5IFLA 1P1FA 3RBXA 3GGOA 1DSSG 3BIOA 3OIGA 1SZJG 3OSUA 2JHFA 3PTZA 4YJGA 4KQWA 5L7YA 1X0VA 2FOIA 2XXBA 4XA8A 1HDZA 3MOIA 3BTSA 3DOCA 1G6KA 2QRKA 2D2IA 1NVMB 4GAEA 2O7SA 2GD1O 1OBFO 3ZWYA 1I3NA 2VN8A 1ONNA 4RF4A 4GQAA 1X7GA 2O3RA 3WGGA 1GZ3A 3GFGA 1KVRA 2VZ9A 3GAFA 1KEWA 3PJGA 4G2NA 2X0IA 2IEBA 4FD3A 3NV9A 1XHLA 4JBHA 4NBWA 2FPIB 3NTQA 3FPCA 1NXQA 5THQA 3EZLA 4ZGWA 5LCXA 3D3EA 3PYMA 4IBOA 2C54A 3P2OA 4BO8A 3RUCA 3I6QA 4ALJA 3CEAA 4GWGA 4E5NA 1U8XX 1E6EA 5KVCA 1PR3A 4GBJA 5JYDA 3QY9A 3H8VA 3LLSA 1CQIB 3H9EO 4XQEA 3TZQA 1DBVO 4DPKA 3VAZA 2O3JA 2ZTVA 3QV1A 5KIAA 3FBGA 2FSVA 4CLDA 2YZ7A 4XB2A 2SCUA 1HE3A 3OF2A 1ZO8A 1TT7A 3A28A 5BR7A 5IXYA 1LNQA 3H4VA 3VPFA 3LU1A 2E37A 4RCVA 1CQJB 4L4SA 5DBIA 1CDOA 3JD3A 3RUAA 4E12A 1S6YA 3ZNOA 4BMNA 5EINA 1PJ2A 5A06A 2GRAA 4FIZA 4UUNA 1QMGA 3NT2A 2EW8A 4WE3A 3S2IA 1HRDA 3EHEA 3V5NA 3H3JA 4ALMA 5T8KA 3RUDA 5EJ2A 5FYDA 3SXPA 4R1UA 2EKPA 3IKVA 3AY6A 4G65A 4C7JA 5K9ZA 1O9BA 3OJFA 2DBZA 2ZK7A 3MWEA 3ZHXA 3D4NA 3TOXA 1R12A 2EIHA 2Y1OA 3U09A 1NWCA 2E6UX 4A73A 4CMHA 3Q2IA 1DXYA 4PGFA 3ANLA 4Z9XA 3OJLA 3C85A 4AICA 3RWBA 1J5PA 4J1TA 4YQYA 2HK9A 2NVUB 4CMIA 1PGOA 1SOVA 5L9AA 1E6WA 1XQ6A 1BXZA 4U5QA 3WYEA 2CDCA 1E3IA 1EE2A 2BHLA 3UCFA 5I8ZA 1E92A 4P4GA 3PI7A 4EJ0A 1J0XO 4IS2A 1Z73A 2DBRA 2AQIA 5JYEA 1Y7TA 1U8FO 5EIOA 5HRUA 2Y66A 4UEKA 4WK6A 1V3VA 2W98A 3JD4A 4C4OA 1SEVA 2UAGA 2WJPA 1H6DA 2H9IA 4KUGA 1WDKA 2WEKA 4OQYA 1C1XA 2CSUA 3VDRA 1HLDA 1LLDA 2X5JO 4CQMB 4MIYA 4K26A 1DIRA 5AVOA 5JNLA 4B8ZA 2X0RA 4GL4A 4JP3A 3K92A 5KVVA 4KP7A 3JSAA 1LJ8A 3OQ1A 2IXAA 3C24A 2FR0A 3WTBA 1BG6A 2QQ5A 1A5ZA 5GZ3A 1GAEO 3GVCA 5G2OA 3KXDA 1U3WA 3VHRA 1HZZA 2D0IA 4KQXA 4MVJI 5KJ1A 3AU8A 5ES3A 5F1KA 4J0FA 3GZNA 4FFOA 3A14A 4JK3A 3G79A 2ZJ1A 1E3JA 2BFOA 2P4HX 2VTEA 3GEMA 4S3MA 3IMFA 1HLPA 2F00A 1NR1A 3KYCB 3AW9A 3H9JA 4MDHA 2O3QA 4GI2A 3M2TA 3RUFA 4D46A 5KJ6A 3RUEA 4K9DA 4B3IA 2GASA 3WMWA 4Z0PA 2Y68A 5K0ZA 1HWYA 2DTXA 5JC8A 3JQAB 3RD5A 3NRCA 4O0LA 3QWFA 4OXYA 5CDTA 2YDYA 2POQX 3JD0A 3QVSA 1U28A 2XPCA 3WG9A 1EVZA 1PWXA 1KERA 3OEYA 4ZN6A 1Y8QA 3ETGA 5G4KB 4CUZA 3VZQA 3HG7A 2AG5A 2RHCA 1WMAA 4HNHA 3CUKA 4ZICA 2R2GA 1EUCA 1L7EA 2AQKA 3JYQA 4YCAA 3BXXA 3ZN2A 4WLNA 2DVMA 2C07A 4J7CA 5JSFA 2CZCA 1M76A 3ZWAA 2VCYA 4KZPA 4XRGA 5TNXA 1IPEA 5I7FA 1S7CA 1VPDA 5LDHA 2E82A 2GF2A 4N5NA 4ZQHA 4RZHA 3V8BA 2GZ2A 4BNLA 1JAYA 3DOJA 1T1SA 3CSDA 3UCEA 5B4VA 1SB8A 4CV2A 4R51A 1OZAA 3KYDB 1YQDA 1WP4A 2ZTMA 4HADA 5C7IO 5ILOA 2Y1FA 4YTEA 1QYCA 1EFKA 4JN6B 2Q1WA 4P38A 3TL2A 3KB6A 1E5QA 1WMBA 3ZV6A 2A4KA 1GTMA 1XLTA 3ZU5A 1LQUA 3SEFA 2QRLA 3SC4A 3P7MA 4O5OA 3Q0EA 2YFQA 3UICA 1YVEI 3JQ7B 1EQ2A 4Y8VA 3GPDG 9LDTA 1UZLA 2C59A 3O8QA 3T4XA 1MP0A 1O89A 5T64A 2JHGA 3O03A 1N1GA 2WE8A 2I3GA 3WGTA 4CM9D 5MDHA 1ZFNA 5IN5A 1QG6A 2YQ4A 4IXWA 4GGOA 2NVBA 3NX4A 1HETA 2VNAA 1LEHA 3I5MA 1RYEA 1DIBA 3D3WA 3HNPA 5TF4A 3UGKA 3ZHZA 2VHYA 1UXKA 3PIIA 1FK8A 3G0OA 1NASA 1F14A 2LDXA 3TFQA 4D43A 2QW8A 4MP8A 5KVSA 1OI7A 2B36A 3JQFC 1G0OA 4FDAA 3VKUA 3ZU2A 4BNZA 4FS3A 1UH5A 1UXGA 3LC7O 4EJMA 3QWHA 3ROPA 3ZWVA 3DZIA 1R16A 2CUKA 3IJRA 4IM7A 4MVJA 5T67A 3VPGA 1JLLA 4AJJA 1I24A 4DIFA 2RH8A 1VC2A 1CJCA 3AY7A 3ONFA 2HKIA 4I5EA 3BMOB 4D44A 4IIUA 4J1SA 2GN8A 1E1NA 3BA1A 1WNTA 2GPTA 1YBVA 1H93A 1HDGO 2NUAA 3VH4A 1HE5A 2E49A 2C29D 5B4UA 2ZQYA 5EMHA 1NTOA 4GPD1 4J91A 3K9QO 1T2EA 3JYOA 4LCEA 2P68A 3HHPA 5EL0A 3AM5A 3E18A 2O2SA 4XQ9A 1XYGA 4XX0B 2VQ3A 3PZBA 4JJIA 4L8VA 4N54A 4PLVA 4ZD6A 3MJSA 4YAIA 2ZJ0A 5A5EA 1NFFA 4FC7A 4NBVA 1GCOA 2AG8A 1I2BA 1P0FA 1KEUA 1ZSVA 2Q45A 4M49A 4J7XA 1CRWG 4FGSA 1Z7BA 1U9JA 1ZBQA 1FDUA 3C7CB 4NNJA 2OP1A 2Y1EA 4RF5A 3ZWOA 4DA9A 2PWZA 3K30A 5JCJD 1XEAA 4WLEA 4WGGA 4FW8A 3UCXA 4WNCA 1EK5A 2HMUA 1KY5A 3EUWA 4PLZA 4QO8A 1OAAA 3NGXA 4DBVO 1W6UA 5JPIA 4EYEA 5CEEA 4UUMA 5BSFA 1SCUA 1ZMOA 1BMDA 3JQDA 4BL5A 4C7KA 1X0XA 4IDCA 5JCJA 1ISHA 5BT9A 2X1HA 1MUUA 1U4SA 2BI8A 5DNAA 3V1UA 3DHYA 1TT5B 2ZATA 2Y0CA 2UYYA 4KUHA 4D45A 5CG1A 3MJVA 1HSZA 1NQAO 1E7SA 1EBFA 3F4BA 4YT4A 3WR5A 1SEPA 1PGQA 3VVBA 3KZVA 1YQXA 3AWDA 3OMLA 1DO8A 3VTFA 5IN4A 5I7SA 1GPJA 1VSUA 3IUPA 3U4HA 2VWQA 4M8SA 1PJTA 4TZTA 1LDGA 3GHYA 3MZ0A 4ND1A 1WW8A 5GMOA 1R0SA 5AYVA 4BO7A 2NTNA 1WDMA 5GY7A 4RJTA 3JQ8B 3RUIA 1H6CA 1Q0QA 2OORA 4JX8A 4BKRA 1WAMA 4OMUA 1NVTA 5IF3A 2D4AA 3QHAA 3ULKA 4IJKA 3AOEA 1QXSA 2GNAA 2FPGA 1IZ9A 3STHA 3ITDA 3JD2A 4II3A 4P4NA 1XIVA 1R6DA 3AY3A 3W4JA 4BIIA 3NDIA 1PJQA 1PTJA 1ZK1A 3K8ZA 5KVQA 4BO3A 4P8RA 1EVIA 3L6DA 6ADHA 2OZPA 1ZZEA 3WWYA 1GUYA 3DOOA 4XYGA 4PG7A 1DPGA 5H81A 2DTDA 3EK2A 2VOJA 4XYEA 4PLGA 1Y8RA 3NT5A 2B5WA 2E48A 3E48A 2BH9A 3AM4A 4OL9A 2ILTA 1MG0A 2PV7A 1ZIDA 1QV6A 1H2HA 4FN4A 2OL4A 4WJZA 2YHUA 2BMAA 3OJOA 4FSHA 3F1LA 1ISGA 1PEDA 4O63O 5FFFA 5HS6A 1FXSA 4A2CA 1P3DA 3IS3A 3L9WA 3TRIA 5L40A 3CXRA 3D64A 1B14A 1FDVA 4RF3A 1MFZA 5IDYA 4DUPA 4F3YA 3UH1A 1RYDA 1PZHA 4CMJA 3MWDA 1AUPA 5BSEA 1DRVA 3AUTA 2PH3A 4OO3A 2IYOA 3I23A 2I6TA 2YV2A 4B7CA 3FWZA 5CDYA 3HZZA 1LTHR 4KDFA 4YYZA 4BGUA 1T1RA 3U4DA 1C14A 5JMWA 3DHEA 5A02A 3VPHA 5DT9A 4PRKA 3VZRA 3WGIA 2H6EA 4UUOA 1QSGA 4GX5A 3LZ6A 1TXGA 3EVTA 2I3AA 4WEOA 1QLHA 4EITA 1DAOA 1X1TA 2HMTA 4JXKA 3BMNB 5THKA 1LX6A 2DKNA 1KVUA 2Q4EA 1TA4A 3CKYA 3DBHA 4LVUA 4MVJF 4YJHB 3IDSA 3HUDA 2B5VA 3WIEA 1Q7BA 2IE0A 1GUFA 3AI1A 1PS8A 4WUVA 2DAPA 5DP2A 1ID1A 1UXHA 4J0EA 1RM0A 3QVTA 3T4EA 3DZKA 3CE6A 5C3MA 4U6QA 5JDIC 4IIVA 1GDHA 3DAPA 4M86A 1R37A 4PZDA 5TT0A 2HDHA 3KUXA 4NJOA 3S2FA 4CLOA 1PJLA 1X7DA 4PRLA 1U2GA 2FRDA 3MTGA 1CF2O 3FN4A 2UUPA 3TDKA 2X9VA 4R1SA 2WYVA 1NBOA 4JBIA 4UVEA 2CF6A 3VH1A 3M6IA 4IQGA 1CWUA 3I4FA 2HU2A 2QIOA 4J4BA 4QO7A 2J5QA 1DOHA 1EBUA 4D3SA 4HBGA 4J16A 3HN2A 2G5CA 4CM7A 2XOXA 4LK3A 1O5IA 4DL9A 4YBZA 5T5QA 1ZXBA 3VZPA 5A3JA 4BNVA 3EW7A 1UXIA 4IJVA 4ALIA 2DT5A 4NK4A 1VJTA 4EGFA 4LRSB 2GN4A 3VOSA 4AJ2A 4E5KA 3RKUA 1ZUD1 5IDQA 2HAEA 2X58A 1W0CA 2VWGA 4B4VA 1PL8A 2Y1GA 3UAGA 5FI5A 1JN0A 1IHYA 4FC6A 3KM0A 1LC0A 4QT0A 3AI3A 4KUEA 5KKCA 3RC1A 4Q39A 5F1OA 1CQIA 1B3RA 2G1UA 4Q9NA 4QQRA 2JFHA 1Z6ZA 2VYND 1V0JA 1JQBA 1H9BA 1PS9A 4KWHA 3GGPA 2W4QA 1B15A 5A9SB 1L1FA 1ZJYA 3IC5A 1H6AA 4D79A 1DAPA 4EJ6A 1PZEA 2CVZA 1Z45A 4HFNA 3QRWA 3WNQA 4O59O 2C82A 1HT0A 3UF0A 2IYPA 2VYNA 4QXMA 5A4DA 1HSOA 4CM8A 1LSSA 4BHTA 5B12A 1Q0HA 3GAZA 3ONDA 3GOHA 3RU7A 3F5SA 3V1YA 4FQ8A 3UFXB 3PLRA 2B4RO 1X15A 2VYVA 2Q49A 1N7GA 4WNIA 2FMUA 1EE9A 5TGDA 1DB3A 1VSVA 4MJLA 3EDMA 2I9PA 3G1UA 4IMRA 5A03A 1BDBA 3RSHA 2VHXA 1BW9B 3PDUA 1BRMA 3JQGB 1TEHA 2J8ZA 4A03A 4Q3CA 4BNHA 2NWQA 1Y81A 2JD1A 4AJKA 1EMDA 4ZRMA 4W99A 4NH4A 1PX0A 4KTVE 1O8CA 2NVUA 5KJFA 1KVSA 4WPGA 5FWNA 4BMVA 4UVIA 4BGEA 4PG6A 5ENDA 2VOEA 2P5YA 3WGQA 5BNTA 2PZJA 3I6IA 4KTTE 3QW2A 4L4RA 5JY6A 2NACA 3INRA 1EVJA 1EDZA 3A4VA 5CFZA 4PLWA 1LDYA 4R69A 5ER6A 3Q9UA 3AOGA 4XZ3A 4FPXA 5U9CA 1GYRA 1WPQA 2V7PA 5F3RA 4AL4A 3JQBC 3E8XA 4CQMA 4HXYA 3O9ZA 4TQGA 1K6IA 3F1KA 3N7UA 1R66A 5TSDA 1ULUA 1GFSA 1WLYA 2NTJA 2HQ1A 3PWKA 3TZ6A 1XCBA 5L7TA 1JWBB 3FCOA 2FP4A 1M6HA 5IDXA 3PVZA 4DIOA 4W9NC 3HQ4O 2GN6A 1KVQA 5F5LA 4PLYA 1K89A 1B8UA 2ZTLA 3K31A 3KLMX 4ALKA 1U7TA 1QP8A 4RQTA 3GUCA 4JROA 1DEHA 5IAAA 4CM3A 3H5RA 4TZKA 5KKAA 4UAGA 2X8LA 1E5LA 3AK4A 3GEDA 2W2LD 3I9OA 1AHHA 4FFPA 1FDWA 5C37A 3KYCA 1P44A 5EN4A 3ZWWA 3TL3A 1P1RA 5CHEA 1LRLA 4BB5A 5CDSA 5T6BA 4Z9YA 1CERA 3IKTA 2W2LA 4Z0TA 2GYYA 3HE3A 3WTCA 3Q1LA 2OP0A 4E2ZA 3LF1A 3JQAA 1E0DA 2QYTA 4TSKA 4GGPA 3P19A 2DC1A 4E5MA 4Q3DA 1DFIA 2BI7A 4MIEA 4HFMA 4ALNA 5KTKA 1I8TA 1OOEA 2Q1UA 5CPFA 4KOAA 4B4WA 2A92A 1N9GA 2WWRA 3WYCA 1B0AA 3GDOA 3LC2O 3JQFA 5G4KA 4AJ4A 2YFHA 4E2YA 3LT2A 1LC3A 4AJNA 2J5RA 1PQPA 4FCCA 5L4NA 2O23A 3AJRA 3ETDA 3AU9A 4F45A 4OXKA 4DLBA 2WDZA 3GMSA 1ISFA 1KC1A 4EDFA 3SJUA 1KS9A 1RM5A 4R5HA 2GUGA 3WQRA 7ADHA 5JW6A 4TROA 1AN9A 3ONEA 1YE3A 4L4XA 4HX5A 2JCYA 2EF1A 4CV3A 4J9UE 4QFCA 3WLFA 3K5PA 1BSVA 3G3EA 3H2SA 4U6SA 3PJFA 4NBTA 4TVOA 4NFYA 1NQTA 1K3TA 3KYDA 1JKJB 3KOUA 3LT4A 1YB1A 3BMQA 3GVHA 2JAPA 3D5TA 5ENVA 4OH1A 2AE2A 5DBGA 1V35A 1YL7A 4K28A 5U4QA 5CAEB 1Z82A 2PKQO 1GQQA 3CIFA 1SBYA 1A9ZA 3JQ6A 4J6FA 4J49A 3OA0A 3LF2A 3O38A 3D7LA 2ZCVA 6LDHA 2X9NA 1BXGB 3LSYA 3JQ7A 3PFFA 3QWAA 5H83A 3I4CA 4J9VA 1H6BA 1P33A 2AXQA 1X13A 2EXXA 2QX7A 1IHXA 3I9MA 4I5GA 3PQEA 1I3MA 4E2WA 1ISMA 4XYLA 1GYQA 2O3UA 5I7EA 3PEFA 4R01A 4L76A 4YAGA 5TJHA 4CMGA 3NTRA 1XELA 3ZU4A 3AFMA 5JO9A 4BO2A 4HNGA 4HKTA 4L73A 4R9RA 2AQ8A 4R9SA 3ANNA 1NPDA 3VPXA 4YACA 3GEGA 1HF3A 3MOGA 4IZIA 2PZKA 5KCZA 1R4NB 1VKNA 2PZMA 2OO5A 3UOGA 4CMCA 3QQPA 2PZLA 2CY0A 3GUYA 2NTVA 2Y67A 4IDBA 4BNGA 4M55A 1GEEA 2DBVO 1Y9EA 1C0KA 1YOVB 1JWAB 3I52A 3C8MA 3BTOA 4BNTA 5TRTA 1YL6A 4FB5A 3BMOA 2BGKA 3I9LA 4CLRB 1XA0A 4TWRA 2F1KA 3RFVA 3ZHBA 2EG9A 4WEQA 4PG5A 1A4UA 1VLLA 4MKZA 5JDCC 3GRPA 1XU7A 2RHRA 1UP7A 3N74A 3O4RA 4J1NA 3LT1A 2NU8A 3ST7A 2ET6A 4XX0A 1B2LA 1K5HA 4FOOA 3B1KA 3LK7A 4FJ1A 4IQ0A 4E21A 1DC3A 2HUNA 2QRJA 3DFZA 4ITUA 4NBUA 1MXHA 4L0QA 4XKJA 1B26A 1I0ZA 1XR3A 3ROMA 4YR9A 4MKRA 4Y6PA 3W8FA 3D4OA 1UDCA 4UEOA 4YPOA 4MVJP 1WZIA 3BHIA 1OFGA 1HZJA 1AHIA 2Q3EA 2YHIB 2HCTA 2FPPA 3DO5A 5A9RA 4DQVA 2EP5A 1AXGA 4MVJG 3ZNPA 2GLXA 5JXWA 1SB9A 3SJ7A 4I9UA 3BYZA 4X54A 4LSWA 4IDGA
chains in the Genus database with same CATH superfamily
4DIEA 4E7OA 2GBLA 1GCIA 4GLOA 5C8ZA 5GOZA 1SUDA 4XXHA 1OASA 4D9FA 1PQWA 1MVOA 1A8HA 2F3SA 1FP4B 4KXUA 3TQQA 3IODA 5DM70 2VLBA 5ALZA 3PGVA 3UKOA 2KSQA 4FD2A 5AW2A 3IFSA 4XEHA 5FPYA 3PFWO 1YRYE 4EMTA 2IUSA 1UBHS 3R0JA 2CC2A 4HGPA 4P3OA 3B7GA 3AZPA 5LA6F 3D2CA 1P75A 4LOJA 4U7WA 3U4MA 1VHLA 4CG3A 1I1OA 4DJJA 1Z5WA 2EL9A 3ECSA 4EA6A 3PQ7A 3IUYA 1A69A 2GJ4A 3JASB 4H7KA 1HC7A 1YJCA 1I94B 1JV2B 3TIFA 3HRIA 1X1EA 1XMOB 1ONOA 2AUNA 3D31A 1UXJA 1KAOA 1VM6A 1GEGA 2GXQA 2IA5A 5H3LA 3I5UA 3ZWCA 2O8CA 1TPZA 1NRIA 1UQRA 3FTPA 3M33A 1D7OA 4AQ7A 4TKVA 1Y5MA 5ESRA 2PCLA 4F3TA 4XWGA 5F4BA 4RFSB 3HCAA 1U0SY 3GYBA 3W90A 3VPDA 3N8IA 3ZKWA 1MABA 4FFLA 2AC4A 3K2BA 2F4NA 4X44A 4QTZA 2LD4A 1JHDA 2Z2XA 4WD3A 1YUMA 3LUBA 4QWMA 2FFRA 2JAOA 1FYXA 3H65A 4ZEWA 1OD6A 5CVJA 1AURA 5JDIA 1JEQA 1QH8A 2DLDA 3KHUA 3AR6A 5WRFA 5A7FA 5IM4F 4PSKA 3D81A 5ALNA 1NBMD 5HQJA 4W5QA 1WD5A 3I09A 4TRRA 4RQUA 2FEKA 3PWZA 5LU8A 3TFOA 3V7NA 1A72A 2HRBA 3HYNA 3U6KA 1ZX1A 4CF7A 1BKYA 2VWPA 4JJKA 4FNOA 3WZ2A 4QVIA 4LJ5A 2GYUA 4BQEA 2WVAA 1G66A 4ARVA 4GBGA 1AMUA 2BRUA 4YO8A 1Q0LA 3EIWA 3PZRA 4A8JC 1B8NA 1L2TA 3ZLVA 4BX3A 1SKBA 3KBOA 1Z29A 4B6FA 2PD3A 3HUUA 5KYUB 2ZR0A 3GA7A 4LCJA 2O0KA 2QRVB 2ONJA 4L2IA 2Q28A 4N0QA 1XAGA 5IH7A 3RASA 2WAYA 1DC5A 1DTWB 2BN4A 3STYA 1QKIA 3UHAA 4DLKA 2WM3A 3HMKA 2QZSA 3USES 1C50A 1MC5A 3FCEA 3ZJYA 1AD2A 4OK5A 1JLMA 4U8GA 1DKMA 1PEYA 4I8IA 4V1CA 2MYUA 4IINA 3T1QA 1OUMA 3WL5A 5K6AC 2ZBVA 4Q7KA 1DQNA 3A4LA 1GQ2A 4FLEA 2B0JA 1U7HA 3D8HA 4XM2A 4ANFA 1U1DA 1U5AA 1LSUA 2YV5A 3H5NA 1NMZA 4WCDA 3RO7A 3SC2A 3TLCA 2ZRPA 3RVMA 1XXHB 3UW3A 3ZBPA 3IJ5A 3TO5A 2ZFUA 4BU0A 4ZDJA 3OSZA 1CS0A 1R00A 3CRRA 4AJEA 1UF9A 2AMFA 2P2CA 4O4HB 5AQ1A 3MCAA 1QOZA 1ZH6A 4KAAA 3NAZA 4J1QA 5EZQA 2WU0A 3UV3A 2IP4A 4WXEA 4LWPA 3RSQA 3BMNA 4EPWA 1EWKA 2OV8A 3M34A 3P9RA 4H15A 5FYQA 3WL7A 1ZCJA 1BS9A 1Z8HA 2Q2OA 4KE7A 4KE9A 4M1ZA 2K6GA 5GJCA 4YMUA 3GCZA 3LXUX 4RVUA 1PR2A 3KJEA 4ZT6A 5HQTA 2ZBGA 4EGAA 3SR3A 5JNTA 5DNYB 3HKDB 2QROA 2XWSA 3USZA 5LQDA 2HR1A 5BQFA 3R9IA 1ENYA 4R2WA 4LW8A 3DNFA 4NH0A 5G53C 5A9TA 2QD3A 4WECA 4XE5A 1Y9ZA 1U1FA 2WWFA 3LX5A 4R3WA 3TLKA 1TK3A 4M83A 1ZJZA 5JLJA 3NDRA 2EEZA 2YV3A 4GS5A 3T7CA 2V45A 2B25A 1C41A 4W63A 4A5OA 4F9FA 4OSOA 4C5AA 1FLDA 4II2A 2J9GA 5C80A 2XBMA 4HB0A 1AGXA 1N5OX 1Z33A 1JR3D 2P7IA 4A6DA 3FYUC 2VTBB 4Q18A 2OV2A 1CXZA 4MROA 3VR3D 4ERNA 3IQHX 2XUDA 5D5PA 5ECYA 5EQTA 2I4MA 3AGQA 5IAJA 1JDUA 2ZI4A 4DXHA 1EDOA 1E1LA 1PSZA 4HN4B 5GGYA 3LFTA 3ASUA 3HMQA 4GSLA 4YRTA 4CPDA 3KUUA 2P8SA 4PGAA 2YVKA 4OHKA 3WGZA 4ZQGA 3DDHA 4IEEA 4P0TA 3TVYA 2H5JA 4B2YA 5K0FA 4TYYA 2R47A 4BZQA 5GGXA 3I8SA 2E7ZA 2QRHA 3IIKA 4M87A 3S99A 2HLDD 4KVGA 5CEJA 1RWQA 1CJVC 3EG9B 2GSDA 2WSMA 3OWXA 4I6GA 1KSFX 4N82A 1UPAA 2OLJA 5EJ5A 1JDTA 4H2DA 1MA3A 1EXNA 1W73A 5FKJA 2J3DA 4CDNA 4MRSA 1V25A 1SBTA 4TL6A 4OHUA 1NY6A 3MK31 4XGKA 1MH1A 1BCRA 2A9RA 2BFWA 4WXRA 5KOHB 3RIMA 4Y6GB 1IY8A 2WU3A 4QGBA 3K0AA 3DE2X 3KXPA 4MX8A 4B71A 3JV7A 5J2TF 5AVWA 2ZM5A 5K5EA 3HDJA 2IDMA 3HWWA 4G67A 4KJZA 2G83A 3CW9A 5FWAA 4F84A 2BF4A 5HCNA 4CEHA 4MI1A 1GTG1 4CM4B 1M2VB 4EL0A 4A0SA 1HLFA 4GX0A 3RK0A 4ACBA 3ZJTA 3SCZA 4DC9A 2BELA 1JHOA 4UHHA 2Z8YA 3PDJA 4B31A 1EIZA 1NNSA 4C03A 1M0EA 1NSTA 1UZUA 1TIBA 3NVKI 1MTOA 4YJ2F 5HFAA 5A04A 1T5OA 1ADBA 1COZA 1G42A 1RIIA 1P0PA 1S4QA 1W96A 3K0KA 4ZO9A 2FEPA 5ESWA 4DA0A 1V9CA 2HU5A 2I6FA 3FDZB 1IJEA 3KALA 3OOHA 4OQMA 2PQMA 2PHZA 1TLFA 1L5HB 3RJTA 4TV8B 3G1TA 1G3UA 2OQ2A 1YE8A 3DONA 3MT0A 2WWWA 2P2SA 4EATA 3W2EA 1RMTA 3C3BA 2IQ5A 1YS2X 1L9XA 2FHPA 4PC6A 2CV0A 1E2KA 5JHGB 1P4RA 2Q2WA 4RPIA 2P5UA 4NBSA 4W7HA 5TC4A 1U0TA 5BPHA 1QE3A 4DA7A 1X8LA 3TM4A 1IVYA 2DWUA 2YWBA 3IQWA 1PGNA 2G4VA 4LI0A 5JJIA 3K05A 2GBCA 1VJ0A 1KMNA 2F4VB 3B20A 4G9EA 1MV8A 1SU8A 2FE4A 4QU0A 4V3CA 2QF7A 1L7RA 2NO1A 1USVA 1JB9A 2Q3CA 4NATA 3TB6A 1Q50A 2TS1A 2PCJA 2XX3A 3IPXA 1RLUA 5K01A 2ZYRA 4G1VA 3IESA 4Y2UA 16PKA 1ZGCA 3Q3CA 4CDGA 4NEGA 4BPBA 5BW4A 3PJEA 1RAIA 4IYJA 4JSRA 4K9RA 2O8DA 1VI2A 2IEZA 2UDPA 3DGEC 2HPVA 3EC7A 4HCJA 4JOQA 3QZUA 4DJ5X 1VG1A 2QVGA 4H6XA 1K66A 4HYEA 4O4LB 5LSAA 1GU0A 3ZOZA 2HBZA 5A4JA 4A0GA 4DR4B 2WIFA 5SZIA 1J8YF 1OB5A 3G2JA 3R3YA 5LIRA 1KJQA 4IHAA 2ZYSA 3TGPA 2HQBA 3R4VA 2C98A 3JATB 4LV6A 4CTNA 4W5WA 5E6SB 4KB5A 4DWWA 1QZZA 3BFPA 2JD2A 2NUBA 4ZI7F 3ROKA 2RGNA 4RPCA 5H0IA 3JWIA 4KCGA 3ZW8A 4Z1MD 1JMYA 1PG2A 3E3OA 1WP9A 5E8RA 3PCTA 3PQDA 3T9AA 1VE9A 1SMKA 2LRHA 4XIYA 3RCBA 4M21A 3VU8A 2C4UA 4QOHA 3SJCA 1LI4A 2WT4A 1LH0A 3S7TA 1ZL2A 1UWLA 3CINA 1QYIA 3L7AA 2CE7A 3U7GA 4QULA 2GS9A 4NYIQ 3UJCA 1T4CA 3SG0A 3OE7D 1XTTA 3PLNA 1HDRA 1MOQA 4AT1A 2R0QC 4A10A 5KNDH 3F6EX 4F1KA 5H59A 1N8KA 2WJ4A 1DS6A 4AJPA 1EXDA 2CJYA 5DYTA 5EESA 3TINA 1MIOB 1WQ4A 1BC5A 4XEUA 2C7VA 3WYDA 3IUSA 3ZJVA 4PM4A 4RZ2A 2R6FA 3MUFA 5CGZA 2QU8A 2F1IA 4RVDA 1F2VA 4RHEA 2B8NA 4UU8A 4W8GA 4X1KA 4ZP1A 5JFTA 1D6SA 2G9RA 4RJJA 4TMFA 1S2MA 1T6XA 2CHVA 2YNMD 1VI5A 3R23A 4OQZA 1LK0A 1IBMB 1A0OA 4HLUA 4HDQB 3C0KA 4HN9A 3PFBA 5FPTA 1W36B 3CEJA 3HJRA 4ZQEA 5D8DA 5DISB 2FH5B 2YL2A 4KXXA 4OREX 4KFUA 4PIMA 3W3AH 1XJWA 2O2XA 3KYBA 4PNHA 4WASA 1VG8A 3RYIB 2OC4A 3OHSX 3FI9A 1JJIA 3VJMA 1IY9A 3VXKA 3WQHA 5EWLA 4GRAA 4PICA 3VH3A 3I8OA 3TGWA 3RWMB 3NC4A 1SPXA 1UZNA 2LP4Y 3QA9A 2JJ2D 5JSUA 1AQJA 1FU7A 4CFSA 2PG3A 2YC2C 3H4IA 3LC0A 4RKFA 3VNAA 4O1MA 4YRGA 4H9GA 5BOSB 2PUGA 5KDOA 3PICA 2Q6TA 2Q50A 2A84A 2ZVQX 1OC2A 1JHRA 4NQZA 1F8FA 4DDUA 3F3MA 1GRCA 3HSKA 3OM9A 3PNLA 2WKWA 1D03A 1KE2A 3CURA 3ZWDA 4AROA 4MVWA 1EFTA 2D7CA 3P96A 3C1TA 4Y9UA 5IVHA 6AT1A 4HY3A 4JLPA 4WCFB 1FVFA 1QQAA 5B1DA 4C0JA 1D2HA 1B0PA 1VBKA 3H75A 4PX2A 4DWJA 4DREA 5DLPA 1Z2PX 3QVLA 1R18A 5JCZA 3R5KA 4BZWA 3H99A 4OHRA 3LS2A 3NU1A 5F12A 3ISVA 4I5IA 3OMWA 4AULA 4OH7A 4MI9A 1Z22A 2WOJA 2G77B 4WCVA 4B80A 2IWHA 1NU6A 3COZA 1MT0A 3V1NA 3DEKA 1N57A 2V6FA 5ALYA 3RE1A 4B6OA 4PYMA 4XVQA 1HFJA 3DBVO 4QECA 4ETWA 2EP8A 3FB4A 3N2ZB 4MQ5A 2PMEA 1WXEA 3AG6A 4JL8A 2Z56A 3CXUA 3LK6A 1FYEA 4BTVA 4GC5A 2UV8A 1LBIA 3RQSA 3GB9A 1E2FA 1NNUA 1OT3A 2F3TA 4NI5A 3UAYA 3B1JA 1BXGA 4YDQA 2AK3A 4PHHA 2DKOA 2PGDA 4LRTB 1CUDA 3R74A 1XN1A 1DHTA 4UQPA 3B3QA 4BP9A 2PX4A 1YZKA 1VBMA 3LP8A 3DPSA 4OMFG 3TPCA 1MX1A 1ODCA 1ZQ9A 1VHJA 4QTTB 1WL8A 5L95A 2G04A 4M37A 3MTIA 2BTQB 4LYJA 4AYTA 1D8AA 3BGWA 3UGQA 1U8CB 4UU0A 4AJOA 3L8GA 3MT7A 3WLKX 2J3JA 3TQTA 2VHWA 3L0SA 4MQBA 5T4EA 2WJ6A 2H85A 3N8NA 2IXEA 1AS2A 2EZ8A 4M22A 3FROA 4AKIA 2FZVA 3ETEA 5T57A 1CZUA 1L7DA 4ND8B 3JWEA 3N0TA 3O7WA 4YFYA 4IW3B 4CQMD 1R64A 4XASA 2C92A 5ED0A 2QQ0A 1TRHA 4N0EA 4INZA 1RWVA 4XGIA 2P5TB 5BNWA 4QQKA 3GDGA 1MTZA 4RWEA 4TTTS 5HYVA 1U9CA 3KD2A 3ZE6A 3ZY3A 1PFGA 1V26A 3P5SA 4JY7A 3TSWA 1TTHA 2RI1A 3KJQA 5F9HA 4A92A 4PG4A 3B82A 2XXJA 2CD7A 4Q4AB 3ENNA 3NHJA 1LQTA 1A8QA 4HPXB 2ZE5A 3HV0A 4M0UA 5I7OA 4WA7A 2NSYA 4GNRA 4LMPA 1O95A 2PGLA 3MCWA 1OX6A 2FZEA 1W25A 1U0RA 3GLQA 1D1QA 1JVBA 3BB1A 2P9HA 1NUPA 4YV7A 1U1IA 1AKYA 2GHTA 4G01B 1NXVA 5FL7D 1X94A 1LPSA 3B8HA 4XH9B 3DBHB 3RVPA 2WYUA 5CB6A 1KYYA 4G8DA 4GH5A 3NVDA 4KO2S 2GT1A 4EJFA 3PUIA 3CMCO 1FTYA 4TXJA 1Z34A 5ESDA 5JAMA 4KAFA 2WT9A 3WGOA 3LP6A 3JQAD 3NBXX 4JDUA 5FL7A 4X93A 3AVWA 5EQDA 3CLRD 4CE6A 3NRJA 3MB8A 4M9RA 2PL1A 5DM4A 2BGTA 3K70D 1A2QA 2WV7A 2IYTA 4ZXPA 1WKCA 1GZ6A 4GSKA 4PX9A 3ZHUA 1ORVA 2PBRA 2AI3A 2MR5A 3ABRB 4YUVA 4GXRA 1RRGA 3N59A 2BKXA 4WIAA 2BFAA 4PPNA 1AKWA 2XJ4A 5LZ7A 3DYIA 3RR2A 3SIXA 3SVZA 2OKCA 2Z6UA 2VZLA 4U9HS 5L3QA 1ADJA 1W1UA 2H1RA 4HLDA 1IQUA 1WULS 1LLCA 4JT4A 3CRMA 3MIIA 4HL6A 4WY8A 5AWFC 5AVYA 2BM1A 1O94C 3TS1A 4F56A 2VJQA 4E07A 3OX4A 5E38A 3ASZA 1AG9A 1GU7A 2A9KA 2B7BA 4DV1B 5HVNA 3TG2A 2E4ZA 4GG1A 1N25A 4M1WA 2BWJA 4W4TA 1E6CA 3OH8A 1DDIA 3AF1A 4GC9A 3WK4A 3E4CA 4RY2A 2R86A 4W8HA 2BSAA 1QGDA 1QGAA 3AUAA 5JROA 1E18A 3IEVA 5JJCA 3TR5A 2VDRB 1M2KA 2X7JA 1MC4A 2FN3A 3K5HA 4WACA 2K2QB 1XP5A 2GM5A 4JBWA 3JXEA 1E6MA 1T0HB 1WG8A 1CF9A 2A9OA 2FG5A 2GUWA 2BISA 4HSGA 2H06A 2R6JA 4MRVA 3UYKA 4CCAA 1XB2A 2YMQA 5TT1A 2OSVA 1KRXA 3QEJA 2TMYA 2QLJA 4Y2XA 5KWVA 5ESXA 2KBFA 2Y99A 2OHJA 3LY8A 4RBNA 4URXR 5CLIA 3ZE1B 3N2NA 3N5KA 2OUIA 4PQFA 4UD6A 3RBZA 1YJQA 2FPLA 5ITSA 3VA7A 3EOBI 4HTAA 2Y2UA 4AXBA 3FYTA 3TDNA 1W46A 1VCNA 1XRNA 2ZQZA 3BMCB 4DCPA 3DL7A 4MSUA 1YA6A 2PDAA 3KQYA 4AZ3A 1PHRA 4XJVA 2N75A 3EVAA 5J40A 5AM3A 1MZVA 4AJ9A 1RVDA 4Z8XA 4Q9LA 5JAIA 5GONB 1ZRMA 3KOYA 3TTVA 4L9SA 4Q4LA 1RJ9A 2FZ5A 4QOSA 4XLZA 3GLKA 2BFEB 1UK6A 2PR2A 3JS5A 4RLSA 4I6JA 4LVCA 2A30A 3R4CA 1A9XB 1EDEA 2YC4C 4IOMA 4JGGA 3QSGA 2JLBA 2ACVA 2FW1A 4BMDA 5IHPA 2AR9A 3EXAA 1BEZA 2P41A 3BBPA 1PSDA 4EHHA 2OENG 4MRMB 4IJUA 2BFBB 4JHXA 1RYFA 4UTOA 2WF8A 5IKMA 5AI9A 2FW9A 4BUJA 5K8UA 4UXHA 2WTUA 1II0A 2WE7A 4E3ZA 2UZ4A 1T36B 2OBYA 3H9QA 5JBIA 2AW5A 3DTVB 2WP0A 3EIHA 2OA0A 5CA1F 3Q98A 4EJSB 2GJAA 1ESEA 1FDTA 5F78A 3UK6A 2JVIA 2HJRA 2DSTA 4N8DA 4ACAA 1GKIA 1XCOA 1YQEA 4ZAVA 1C9EA 3MCTA 3T7KA 8ABPA 3JWHA 5GIPE 3LUFA 1FFAA 4DC1A 1T0UA 1Q3KA 4CKZA 1T4GA 4ZRNA 1XCMA 2WDPA 4Z0HO 3YASA 1FY2A 3QI2A 4GOXA 4KFRA 3G9XA 4MHSA 2MSKA 5FT9A 3ZVMA 2A1UB 3O21A 4H0CA 4V39A 5GV8A 1KZYC 5FO1A 5B7QA 1ZG3A 2HU7A 3T4PA 2AMVA 3CZ9A 1WZEA 1XRPA 1ZIOA 3L7YA 3RLIA 5IZCA 3C7DB 3LUCA 3A4YA 4BO4A 2VT6A 4MKGA 1CUCA 2A7QA 2XRMA 4Y9SA 2R6GA 3UMSA 3ZK8A 3DHWC 1RTKA 3L1HA 1P72A 4E1BA 2XCTB 3L4KA 3U5TA 2MSNA 3DV9A 4JKIA 3TPFA 1LCIA 2M9MA 3OEEA 5D01A 1SQ0A 4M0DA 4DQXA 5EJ7A 4TTSA 4CR7A 3FTNA 3AXSA 1WBDA 3KPJA 1CIJA 1SQ5A 5DXAA 1KQNA 3T35A 4G5SA 2ZYAA 5IARA 4CQNA 2J07A 1OXBB 1FLAA 3O3CA 4QRIA 1IHDA 4UE3S 5EC8A 1HO3A 1VJRA 3SS7X 4C0LA 1WMDA 2EU8A 1VJDA 1C9JA 4PC1A 3AH8A 4UEWA 1G8GA 1UMDA 1JZQA 3ICPA 1P74A 3CNEA 3DL2A 3AI2A 1U0FA 4ZO7A 4A1FA 2C61A 4M8LA 1M1NB 4X6UA 1I01A 2DUJA 3D3JA 3ER9A 3V8EA 4DB4A 2GR9A 2G0AA 5HIJA 4WBNA 1H05A 3AT1A 4JC4A 1S7GA 5FBWB 3WDSA 1E2EA 4G5QA 4OATA 2JA1A 2R5WA 1OHHD 2IYEA 4LOIA 4OLAA 4LRXA 3NHUA 1O6ZA 2ACWA 1YBFA 1CR6A 2XB4A 3D7NA 3P5BA 1ZCFA 4YQEA 3D4BA 1AZTA 2ATCA 2SECE 4BNJA 3I64A 2ZJYA 1U1GA 4Y2GA 3CVWA 3HFRA 1MJFA 2QTBA 3MMXA 3QVOA 1CULC 3LLUA 3ZCUA 1JSZA 1EWQA 5COAA 4ZO6A 1R6UA 1Y4ZA 2JJMA 3TN7A 4B7AA 3T1HB 1A98A 1XWFA 1PBTA 3KRTA 3N8HA 3BL5A 3MTEA 1KNQA 1TNDA 2O2YA 4MYUA 4ZVUA 1YDHA 1LK5A 2VUTA 1F6DA 5I7RA 2OXEA 3EAGA 4QDJA 2CVHA 1M6WA 2CJFA 2HJVA 3RS5A 1YZ3A 5CG2A 1G21E 3PHLA 3SXUB 2YTZA 1TCBA 1NM5C 2DQKA 4WKPA 1L1EA 2EJBA 3GMIA 3QKIA 5EQFA 1OLOA 4DMRA 3OTQA 4GYYA 1ZSNA 3CMMA 4I2NA 4L07A 4LYAA 4QPNA 4K46A 1G5QA 4MVYA 5AJXA 3DLBA 2RGGA 4XRRA 3S55A 3KLBA 1P4GA 2NM0A 5CX4A 3CZMA 5IH3A 3L7CA 3W5AA 3I0ZA 1KIFA 4XCXA 3L41A 5YASA 1KQPA 4ZARA 5FA5A 5KUTA 1VJ1A 1GRQA 2FWRA 4OCZA 2VJKA 1LTQA 2OC9A 3MRSA 3PA8A 3IAFA 2DBQA 3HB5X 3SHTA 1TKCA 2E4UA 2QKYA 3PQ2A 2WTAA 4X90A 1LDEA 4HWOA 1VLMA 4P5PA 2FK8A 4EA7A 3OF5A 1T3ZA 4YJFA 1U5CA 4HEJA 4N5DA 1JFLA 2CXQA 5KC9A 2ZRKA 5EKDA 4GXTA 3UK2A 4AYXA 4DT1A 3O9VA 3RJ5A 3T94A 3QI7A 4UMVA 3D0KA 4QOEA 2W2VA 3C6KA 5CCBA 2X3FA 5JXIA 2DLNA 4V0NA 1NBEA 1NPYA 3U7JA 2UKDA 2H63A 3K4PA 1V11B 3SIWA 3ZQ6A 2MYNA 5KJCA 2XE7A 1M34A 3HKBA 3PK0A 5B64A 1HXHA 4KIUA 1E5XA 2A9VA 4X60A 4XSHA 5AJVB 5DTRA 3CVXA 3PUWA 3R3ZA 4Y0VA 4DLAA 1L7NA 2OO7A 3S8YA 4HDNA 1Y42X 4JYMA 2FWMX 3L1VA 1KEZA 1MMFB 2QD2A 1G8MA 1BD4A 4M9UA 3FCCA 4MICA 2ZS9A 2X5KO 3G0GA 2EX0A 3BREA 5BMVB 1TO6A 4NZOA 3RYCA 1T3SA 5G0SA 1T2DA 2WFZA 4R1PA 1Q57A 3FNHA 4EHAA 3HWSA 4TLBA 4ZT3A 4OFXA 4B3MB 4BMSA 2OFWA 3EYAA 4MWEA 4C4SA 2P6RA 2DP4E 1BXRA 1YACA 1PL0A 4GO1A 2IEYA 4E51A 3HXQA 1VIYA 1XNRB 1V5EA 4RM2A 2I91A 4V38A 1NLMA 1Y6RA 4FFNA 3R1IA 4PZEA 1JHZA 2AT1A 2JGRA 3RS3A 2WYIA 3CRQA 5B58C 4WRRA 3PGLA 4D6YA 1M74A 4N12A 3EPLA 3G9ZA 4Z1OA 3VX4A 2OY0A 3W5HA 3QF4B 1X1AA 3W6NA 1NJSA 3JD1A 4G24A 4LEIA 5EPOA 2HPZA 4LDPA 3S0JA 4F8EA 1M2GA 3OLCX 4RXMA 1J49A 1FYWA 4OJNA 1E8DA 2ZSEA 3F3YA 3ZD7A 3ENZA 4AIIA 2ZIVB 4AKEA 1GPKA 4PAGA 1DT3A 2GQ0A 2QYSA 3PGA1 3ANMA 3MAAC 1FP1D 1QHXA 2OBMA 3G89A 5F1PA 4O4HF 3TXAA 2XUKA 5IVDA 4LGCA 4FR0A 2ZRMA 2ATEA 1DCMA 2R9VA 2W37A 2HTFA 2I76A 4YO7A 2VYCA 1F3LA 1SOWA 2O2HA 3O4HA 2DERA 4FX5A 2C8JA 2PN1A 3IJEB 3W6UA 1FQKA 2PEZA 4ZC1A 2HTEA 1DCFA 2W2KA 4PLTA 4F6RA 3U6BA 1B3BA 1IHUA 1WWKA 2BCJQ 4CM6A 4GP7A 2IZZA 3DT6A 3M5WA 3F6PA 1VE1A 3L8EA 2CF5A 1OE0A 1C9NA 1WSAA 2BBWA 1W7AA 4KFCA 2JIBA 4JGIA 2WUDA 3SE0A 4UD2A 1UPXA 3A1NA 4LGVA 2X6TA 1IE3A 4I1IA 2FSVC 1SHUX 3EN0A 3B6JA 1KAMA 2XJ9A 1USKA 3IRUA 5CXXA 5AJTA 5FWYB 2VRNA 5EHGA 1MO6A 2RBKA 3S4YA 3UK0A 4WNAB 4DMKA 3LYHA 3TM5A 4ES6A 4TLLB 3KQVA 1UBOS 2H8KA 4JVLA 4P1ZA 5JMPA 3Q6IA 4YONB 3GZNB 4UBLA 1JG4A 1OLXB 3RPEA 2O6HA 3TF5A 1F6WA 1NJ5A 3G0CA 4KG7A 4NLLA 4IFBA 3WLMA 1E58A 1N3LA 2C2XA 2P4UA 1Y7HA 2YYAA 3P71T 3R5TA 3SWWA 1O5OA 2X0FA 1WIWA 3K1ZA 4GQBA 4IQFA 3L06A 4KZKA 5T8KC 3ZLTA 3DEIA 5EMLA 2FPPB 2ZZKA 3OTOB 3JQ9A 1UM8A 3I1JA 1IB6A 1W4RA 4ID9A 2CFSA 4YCSA 5EGSA 4ZPJA 2YQ5A 3OQ6A 2EF0A 4BU1A 5JAZA 1MW8X 1QTRA 3F0TA 4O4IA 3QYFA 4QDOA 2QAGC 4YRZA 4EDHA 3AV3A 1ONPA 1Z2EA 4D57A 3KAJA 3UC5A 4AP5A 3R77A 4HWKA 2WB4A 4OP1A 1Y8QB 1A2OA 5L3SB 1C7FA 1J0AA 1P1JA 1A5TA 1NQ5A 4DNQA 1RPJA 2IUTA 1RKXA 1M75A 1U0LA 4M6WA 2WB2A 1KZGB 5BYJA 2APJA 2IZ7A 3Q11A 4RWZA 5DF1A 3ZLUA 5CITA 3MSCA 1PFVA 4ILEA 2IT1A 1VZ2A 1U2DA 2F3PA 1G9XA 2H65A 2ALJA 5JVDB 2WIAA 3X2SA 5IYZB 1NF8A 4MMYB 4LNUB 1URPA 2OYSA 4BRWA 4NV0A 5LQKA 2AZTA 3H18A 5DMXA 3LUAA 1CT9A 1W1IA 2XB6A 5BMOA 4TRJA 1CLEA 1HURA 2BSXA 1KMMA 2NGRA 4K2HA 4O3MA 4W7IA 4DNXA 1QV7A 4AWBA 5MN4A 5FPPA 2BKAA 4WK4B 5KNDA 3QM1A 3L7LA 4KX5A 3VVCA 2A0YA 5BO5A 1MG5A 4YJ3B 4DBZA 4FP9A 4JEMA 3DV0B 5JC1A 5MFZA 2IH2A 1PUXA 3RS7A 5JSZB 2PA3A 2Q3JA 2PM8A 1T2CA 1EEXB 1YCHA 2G5GX 3QXXA 3THSA 4UHEA 4YBRA 5AIBA 2O54A 4NOMA 2L17A 4HRYA 3RVLA 1DV1A 2F9LA 3O47A 1R15A 3FD8A 2CXUA 3WV5A 3DJFA 2OFXA 3QE2A 5KAPA 1TEVA 2BF7A 2QE6A 1F4LA 2B69A 4MLZA 5GZ1A 1KZ6A 1HKHA 4LI3X 2QRNA 2X1MA 4KE6A 5TEVA 1OH7A 5HJ7A 3CM0A 4L22A 1QGUA 1CE8B 5K0EA 1Z0UA 2VDWB 2C88A 3UTCA 3PGJA 4FEYA 1LLFA 3C5WP 3EAQA 2VJLA 3W3AA 5KX5B 4JC0A 1Y8ZA 4W1QA 1Q16A 4JUDX 1PV4A 4EKEA 3AEUB 4U9UA 3ZWPA 2WJVA 3ZWMA 2CZQA 2LIVA 2OOSA 3AHJA 3LT0A 3H5VA 4KHPB 3TBHA 2CHQA 1KFEB 1R8JA 2GTHA 4KIFA 1PGPA 4YMGA 4W5TA 4CIDA 2IGTA 2JIMA 1PWHA 5FFMA 2B99A 3ROQA 5JWHA 3F98A 4ZT2A 2H4XA 1Z7YA 4CKBA 4GYWA 1G60A 1ZOSA 1NGSA 4O4LF 4R7TA 5FBRB 5DHFA 3FLAA 3NHYA 1BQ3A 1HDCA 3A05A 4XR4A 4BQQA 4OSPA 3QE3A 4UNRA 4DR3B 2OK8A 1NBHA 3UWSA 2PUHA 1QK3A 4IKEA 4PF1A 1QYWA 4NHOA 3W9YA 3L7BA 3NRBA 4YUAA 4IH1A 4LY9A 3K3PA 1A8IA 1GZUA 1Z6TA 4KFTA 2WILA 2ZYHA 2E2WA 1F06A 2H07A 3TVDA 3IE2A 2O1XA 3P2JA 1GVNB 7ABPA 5AHKA 3OIUA 5LC1A 4E33A 4KXLA 1F17A 1CD5A 2ECFA 4YAWA 2P40A 5AXBA 3WLIA 1DJMA 4Q48A 2FOXA 1VG0B 4RKEA 1EFPA 2N9UA 3GGGA 4PX3A 2VUUA 1W5EA 1JU3A 1UBJS 1MX3A 1Y1SA 2O50A 2R8PA 2IHZA 1KKLA 3ND6A 3SDBA 3FCYA 3Q7SA 3R44A 2WUWE 1O96B 3IQIX 5JNWA 3ASYA 4LTMA 2VHZA 1GZ5A 4ZA2A 4DY4A 4RZQA 5EHQA 4D4GA 1UWKA 5LQNA 3PUZA 1NFQA 4KXMA 4TV9A 1IYZA 2ZIXB 4INAA 3AKDA 2XZTA 1NVVR 3H8JA 4ETNA 2IDKA 3BE6A 4X24A 3SLRA 5JYCA 3THWB 4XTCS 3T7AA 4QUHA 1OLSB 2GCNA 1TPYA 3L8FA 3NETA 1XTKA 3EQ7A 3RGGA 4KPUB 5BUSA 3AVYA 4AKSA 1GZ4A 3FNRA 4M0CA 5E1OA 4A0FA 5IVPA 3PLAE 2XNKA 4BWFB 1Z7WA 5ELLA 2VAXA 3LQ4A 1RXEA 3LNCA 3F2IA 3A2NA 2G4CA 2I67A 3SZMA 1L7AA 1HNZB 2QVZX 5A5DA 2EARA 3ZDFA 1Q2XA 5TX7A 4Z7QB 1R4MB 1UJNA 2X5NA 3HP4A 4EPTA 5JEEA 2EFEB 3HU3A 1KHHA 3ENQA 4XUEA 5C8YB 1SCUB 1E9AA 1LI7A 1HK7A 2JLQA 4N39A 6NULA 2F1OA 3IAXA 2JVKA 4FYVA 2OHVA 2IH4A 1P9LA 1YXMA 5CJ2A 221PA 4KN5A 4AI6A 3HJGA 2XSZD 5AW3A 3G88A 2VQDA 3GBVA 1K6MA 4K0RA 3RRYA 1XVLA 5K8VA 2BGGA 1NNLA 3B3FA 3T3HA 1HUQA 4O1IA 4W1PA 1TF5A 2NQ8A 5I9LA 5K09A 3M3HA 4DMLA 1JE0A 2QLTA 3BIFA 1T8YA 4C6HA 1WKVA 3S44A 1GCUA 3GG2A 1BX0A 4LQLA 1N6LA 4BO6A 1DWOA 5JPCA 1TZJA 2ZBPA 3PC4A 2MMGA 4EEZA 5B3KA 3L79A 1QBKC 2JGLA 2WIJA 1T8PA 3H1EA 5LXTF 4RTLA 1E3WA 3P45A 4EQZA 1NKSA 4E5YA 4RNDB 2HA7A 1Z4NA 3R5FA 3OFSA 3KVOA 5HIMA 1OZHA 1H2XA 2WNHA 3V8PA 1YDWA 3HKEA 1D1PA 1LDBA 2GJ9A 3LVBA 4B7ZA 3QU2A 5KWEA 3FGNA 3CLUC 5IULC 5AJUA 4FHGA 4AWAA 4BEBA 4Q9HA 1M72A 2C31A 2FPKA 2EDAA 3GMDA 3OM1A 3DEHA 3FSJX 5CTJA 2FPGB 3P2YA 4X61A 3WOHA 2J6CA 1M6YA 1PFQA 5BNIA 2BBTA 4HWRA 1B74A 3CJTA 3R3SA 1JEEA 3N70A 1Z2DA 4RD1A 3R7SA 1FVXA 2AMYA 4A0QA 4TZ6A 1NJ2A 3DBLA 1WVGA 2BTOA 4D98A 4NYIR 3ORSA 4J43A 4OIFA 3G8BA 5GJBA 2I7TA 3QVWA 4B0OA 5C34B 4AZWA 1K7FB 1NYTA 1ZHHA 4ZYVA 4KBGA 1VPLA 3NBFA 1XI2A 2QDXA 1P4JA 2DGDA 3VYVA 4UFNA 4R54A 4BLOA 5M7EA 2WG1A 2XNDD 3CYFA 1Q14A 3MJEA 1OT5A 3L18A 4JOCA 5DYGA 1NMEA 4IIYA 3MD9A 2YIMA 2NTEA 1QIMA 4PBRA 4DMCA 3PP8A 2P1RA 1SBCA 2YICA 4FEGA 1L4HA 1M2NA 4JJ4A 4GOOD 4XM0A 1WMSA 5HGJA 4OMCA 1KRWA 3AI7A 1N6HA 4LN1A 3LOUA 1XLVA 1R9NA 2BUAA 4CM5A 3D4IA 3WDKA 1P1CA 2H2DA 3DTNA 3DVLA 1YB5A 3GRZA 3OZAA 4MYSA 4UM9B 3PEWA 3C7AA 2WOOA 1U3FA 4PEVA 5BUQA 1J39A 1W4AA 2VDMB 1AXEA 3HV2A 3NNDA 2YJZA 3PPIA 1AVTA 1EVYA 1M2HA 4DSAA 3DF9A 3VFDA 2J6IA 3RFTA 3P97A 4KO1S 3I9V6 4YASA 3MWLA 4L4YA 4JLOA 3U7QB 1V3UA 4PRYA 2JGDB 5KI6A 1SKQA 1XTBA 2CLOB 5JEDA 3D6AA 1RIFA 3TAXA 2D3WA 3KFXA 4AG5A 4P33A 1PX2A 2LW7A 1MO4A 3O3MB 2PK3A 3MPUA 2GEDA 2Z9BA 3ITNA 3X0DA 1PP4A 4AJIA 4YCMA 2ZZMA 1I7PA 3FMGA 3TVTA 2Q1SA 2N3ZA 4NHEA 4CCYB 3FTFA 2HF7A 1NJFA 3FPJA 1OU0A 3BJEA 2OR3A 3H1BA 5L8VA 1J22A 4CT0A 4NK5A 2CLSA 2Q46A 3IIJA 2JHAA 3OOYA 3PHHA 3LW8A 4IKOA 4F7WA 3GC6A 2JCBA 2Q1TA 1Z2CA 3A31A 4N9WA 4UPDA 3F4LA 2QYOA 5KNCH 1T43A 1XJ0A 2V7EA 4UDYX 3KETA 1UC8A 1FFGA 2GN2A 1Y3HA 3QBVA 3UPDA 3OHPA 4WZBE 1P1FA 3MCUA 3GGOA 5JG7A 4CG2A 1Z63A 3BIOA 3KJHA 3L7KA 4XDGA 4CJXA 4KPEC 1XDSA 3OZDA 3SM9A 1NRJB 1X0VA 2QWXA 5EPUA 1XDBA 1H2AS 1XZGA 2FOIA 2REXB 3TSOA 1I6LA 2L69A 1G6KA 2XE8A 2PVSA 4IVRA 4JQZA 3TRHA 4YV0A 1LBQA 5LOVB 3LWZA 2JC3A 3NWBA 1BE6A 3PR3A 4LQ4A 3P9NA 1X7GA 1E5VA 5G40A 1KWKA 3E3MA 3ZXUB 3OP1A 3T5DA 3EZGA 1FRNA 2RD2A 1GZ3A 1GILA 3CGWA 3O3NB 1EFHA 2H2AA 5AJYA 4V0OA 1RZ3A 2GNPA 2UU9B 4TL9A 4CKEA 1Q6YA 3R9KA 4FD3A 1JILA 1Z5ZA 2PWAA 2PWBA 3H2BA 2IXTA 1TQ2A 1X86B 4PWYA 3SJZA 3FPCA 1ZNYA 2BR3A 3ZY5A 2QQFA 4G4SO 4EMBA 2HYIC 2QGZA 3EZLA 1WF6A 3C3KA 4WFQA 1Q0TA 3NM5A 1UKCA 3UATA 2I34A 1TC2A 2MSLA 1VJCA 2ES4A 2VEDA 4FFVA 3NBZC 5ALPA 1YR9A 5KSPA 1IIRA 2XMZA 4ALJA 3CEAA 1PFKA 4G0UA 4WBSA 4GWGA 4Q00A 1DO2A 3REQB 4E5NA 4O5AA 4Q4HB 2PH7A 3IR7A 5AK0A 4Y2JA 3ZUGA 3LLSA 5SYMA 2AZ4A 3OQOA 1KP2A 3VOBA 3VAZA 3H11A 3MJFA 2ZTVA 3N0VA 3QV1A 5CM2Z 1E4EB 2JLUA 2I6XA 3FBGA 5HX7A 4LIPD 1QQBA 1HE3A 4GDFA 3L8CA 3OF2A 4H77A 4C0BA 2FFHA 1ZUHA 4DABA 3OT4A 3V4OA 2E37A 5DBIA 3EQ6A 4QOFA 1S6YA 1NL3A 3U39A 4DLZA 5EINA 4AQDA 5FH9A 4JLKA 1VDZA 1WOMA 4MS4A 1QMGA 4H1UA 2HLNA 4REMA 5IRCD 1NXXA 2RHJA 1X80A 1HT1E 2WZBA 5DEIA 1NZFA 1OFHA 3S2IA 1MZPA 5E9QA 1VP9A 1V9SA 5KQRA 3CA8A 4ALMA 2QXYA 3RUDA 1H1DA 1ETHA 1QHEA 4UMFA 5FYDA 2BKVA 3SMVA 1VMAA 1C4XA 4R1UA 4BFUA 3AY6A 4G65A 4ISCA 3V48A 1WX1A 3EF0A 3KDPA 3N0WA 2ORWA 3OJFA 4HAWA 1UZAA 4MGYR 1RC0A 2QTZA 3OBIA 3QLUC 1GFIA 4D8UA 3B7WA 3D4NA 3TOXA 1N9ZA 3ZE9A 3I2HA 2N42A 3IT3A 2JIQA 3T5GA 4E5SA 4KR7A 1ZI8A 5JADA 1TL7C 2E6UX 2RARA 4A73A 2DHEA 4XPIA 4EHNA 3Q2IA 1DXYA 1EX7A 1EE1A 3MS4A 2CXOA 3K8OE 2C7BA 1AZWA 1X7XB 1ZN7A 2Z30A 1EAYA 3L6UA 3OJLA 2J33A 3OUUA 5SZKB 1NW8A 3WGJA 1J5PA 2HCJB 2VF2A 3MRXA 4EB6B 2XXAA 1DZIA 4BFYA 2FMTA 1SOVA 1D2MA 5KDLA 2X6RA 4LJ4A 2FKAA 3D7KA 3T5MA 3K9BA 4N1AA 1Z17A 3WYEA