2NU7A

C123as mutant of e. coli succinyl-coa synthetase
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
287
structure length
287
Chain Sequence
SILIDKNTKVICQGFTGSQGTFHSEQAIAYGTKMVGGVTPGKGGTTHLGLPVFNTVREAVAATGATASVIYVPAPFCKDSILEAIDAGIKLIITITEGIPTLDMLTVKVKLDEAGVRMIGPNSPGVITPGECKIGIQPGHIHKPGKVGIVSRSGTLTYEAVKQTTDYGFGQSTCVGIGGDPIPGSNFIDILEMFEKDPQTEAIVMIGEIGGSAEEEAAAYIKEHVTKPVVGYIAGVTAPKGKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGEALKTVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Succinyl-CoA ligase [ADP-forming] subunit alpha
publication title Participation of Cys 123alpha of Escherichia coli Succinyl-CoA Synthetase in Catalysis
pubmed doi rcsb
source organism Escherichia coli
total genus 108
structure length 287
sequence length 287
chains with identical sequence D
ec nomenclature ec 6.2.1.5: Succinate--CoA ligase (ADP-forming).
pdb deposition date 2006-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00549 Ligase_CoA CoA-ligase
A PF02629 CoA_binding CoA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 2nu7A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2nu7A01
1RM0A 3A28A 5A9RA 4OXKA 3GNQA 1JLLA 4BGVA 1GYQA 1LUAA 3AM5A 4LW8A 3ZWPA 1BHSA 4NFHA 3VDQA 4NU6A 3U09A 5JAIA 4YQYA 3GDFA 1ZH8A 1LXCA 1V3VA 4DIBA 4X54A 4MP8A 1VC2A 3C8MA 1UXKA 3MWEA 1PWXA 5AYVA 1KBZA 1DIRA 2OXIA 1EQUA 4ILKA 5A05A 4CL3A 5KJCA 2DT5A 4BQPA 2NVUB 4PN3A 3GVIA 3PIIA 1PU2A 3GT0A 1K6XA 3D4PA 4JCOA 2A92A 1HDGO 3E9QA 3AY6A 1K89A 1UDAA 3OIGA 1O9BA 3PI7A 1LSSA 4CMJA 5TC4A 1GUYA 3PDUA 4WGGA 2FRDA 1P44A 2C29D 3JQ9A 3KLPX 4YJGA 1LEHA 4KQWA 3WBBA 3WYBA 2DBZA 1PTJA 3O8QB 4R9RA 2VOJA 2VTDA 3DZKA 1JVBA 2EP7A 2OUIA 3G1TA 4NNJA 5EL0A 5JO0A 4BHTA 3DHNA 3D4OA 2JCXA 3D1LA 1LLUA 2PGLA 1HDOA 2FSSA 4K1LA 1CQIB 1E92A 4IGFA 2HMSA 5I7VA 3IQDB 3DB2A 3GPDG 3O03A 3PK0A 4J9VA 1RWBA 4L4SA 4NG5A 1R16A 2YQ4A 1TT5B 4YT4A 5TLSA 4CL8A 1U8XX 1I5RA 3NRCA 4ND3A 4BB6A 3W8EA 3CXRA 2WEKA 3JYOA 5KVCA 3HJAA 2HRZA 2I6TA 2O23A 4L73A 1AE1A 3C1OA 3RWBA 4CQMB 3KM0A 6LDHA 4K28A 3KYCA 4AJLA 1NQAO 3AM3A 2D5CA 4FC6A 3KYBA 1FDSA 4RDIA 4DRYA 3GEMA 2OL4A 4ND4A 3ST7A 1MP0A 2YDYA 3H8VA 4D45A 8ADHA 4ZJUA 4FS3A 4INAA 1KVSA 1PL6A 3B20A 2FP4A 4D79A 2DFVA 3W8DA 3FBGA 3JQDA 3PJFA 4UUPA 1YJQA 1Y8QB 4JN6B 1HSOA 1I32A 1GPJA 3OEYA 3JQCA 4RGBA 1LDEA 2WJPA 5DULA 3U49A 1ADCA 2PK3A 1EE9A 1HF3A 1PQWA 3MJSA 3SC6A 1UDBA 4AJJA 3WSVA 3ZWVA 2ZQYA 1AHIA 3FCOA 1B0AA 3KOUA 1KEWA 1HEUA 4GPD1 3EY4A 2X5KO 1QV6A 1U3TA 3RASA 4W4TA 2JFHA 3VVBA 5KTKA 5KJFA 1ONOA 2JD1A 5JPIA 2FN7A 3WOHA 5ILOA 4K6FA 2CSUA 4CV3A 4ESOA 2FPPB 5L9AA 1V35A 5DBIA 4RDHA 4B3JA 2AE2A 1QKIA 3R6DA 3IJPA 4B3HA 2GZ3A 2VUTA 4RLHA 2TMGA 2V6BA 3IOYA 1TXGA 2OP0A 4Z9FA 2O2SA 3RUCA 2B5WA 3KXDA 4GSLA 4WCFB 2P4QA 2Y1GA 4BMVA 3E03A 4WLNA 3JQ7A 2OBYA 1YL5A 1IULA 1O0SA 3BTVA 4EW6A 3JQGA 5GZ3A 5BNTA 4KDEA 1J4AA 1Y9AA 3BTUA 1A9ZA 4CMBA 3TN7A 2VWQA 1YB1A 1WMAA 3JQBC 4CMGA 1PR9A 1IB6A 1FK8A 1B3BA 4PLWA 2Y68A 4FJ2A 5LDHA 2DVMA 3QA9A 3V1YA 2PV7A 1IY8A 1HE3A 1I2CA 3QP9A 1LSJA 4ZU3A 4CM3A 1AXGA 1Y1PA 1DIBA 2FR0A 3FF4A 4DGSA 3W4KA 1D1SA 3F9IA 4CV0A 4Y6PA 3GA0A 1Q0LA 4PCVA 4K9DA 4L8VA 2EKQA 1FF9A 3LC7O 3QVXA 4Z0HO 4A10A 1LRJA 1RM3A 5CAEB 2RH8A 4OKNA 3F46A 2VZ9A 1Y5RA 3DBRB 3NX4A 3V5NA 5AXCA 4D46A 4CLDA 4MDHA 3WMWA 2HMUA 2QX7A 2NTVA 5IN4A 3ENKA 4R3WA 3ZV4A 2WD8A 4IDBA 1E7YA 4ND1A 2AG8A 4J7UA 4ND2A 3GGOA 1EFLA 5BT9A 2FPIA 3ROMA 2JD2A 3PWSA 3PJEA 5T6BA 1U9JA 5FWNA 4XGIA 3UH1A 1XIVA 1PJ4A 5T8KC 1DC3A 4BNYA 1CWUA 4FQ8A 1YWGO 1ZJZA 1YO6A 3GK3A 5KJ1A 2V6GA 3CPSA 4J3FA 1RM5A 4RVUA 3H9GA 5A3VA 4YACA 4YRDA 1VSUA 1JA9A 3MEQA 3TF5A 3DMTA 1XWFA 3D3WB 2ZB3A 5A9SA 3QLJA 4BO6A 1LSUA 2X22A 4R1UA 4UREA 4IDDA 1ZFNA 3RBVA 5C5IA 1Z73A 1SB9A 4M55A 3ZU4A 2P68A 4BO4A 5ADHA 4L0QA 5I7SA 3QVWA 4R1TA 3MOGA 4Z9XA 1DLJA 3UUWA 5EQDA 1VSVA 3OF2A 3VZPA 1E7QA 2WYUA 4EUHA 3NGXA 1EUDB 3HQ4O 1UZNA 1Y6JA 2DUUA 3WTBA 4L76A 4MVJG 2BD0A 4GVXA 3KYDB 2EJVA 1D3AA 1NFFA 3FBTA 2B4QA 5HBRA 3D7LA 3BZUA 4O5OA 2Q3EA 4ZQEA 3ZI0A 3AOEA 3I3OA 3PFFA 3L6DA 5EIOA 1P31A 5THQA 3VC7A 4Y8VA 2H1SA 1Y8RA 3SBOA 4NI5A 2EERA 2GASA 4EJ0A 4MINA 2V65A 3CINA 3TL2A 1O5IA 5JAZA 1R6DA 2Q4BA 3ZWBA 1CQJB 2FHSA 1HRDA 5G0WA 1ZK4A 1ENYA 3ZHBA 4IIUA 1QORA 1I3MA 2AQ8A 3GN1A 1ZSYA 3CEAA 4HNHA 3N7UA 4FFMA 4R69A 3EAGA 3KETA 1L1FA 5CDUA 3WLFA 3L77A 4WUVA 5FFFA 4XR4A 5GZ1A 4IDEA 3E9MA 2HUNA 1YXMA 2UDPA 3LT4A 4BMNA 5KVVA 1U1IA 4CR7A 4JNKA 3O38A 2X5JO 4D0RA 1T25A 5B4VA 3CTMA 1PS9A 1UXHA 3Q9UA 3ONEA 3JQFA 3C1AA 1LRLA 4XJSA 1EVYA 4XJTA 1YL7A 3RUEA 5I8WA 1JLLB 4E5YA 5C3MA 3F1KA 1QXSA 5HTOA 3PHJA 1H9BA 3WGZA 1ADFA 1JQBA 3EW7A 2ZCUA 1ONPA 2QYSA 3FI9A 4CLHA 3EC7A 3GGGA 5B37A 4CUKA 3GVCA 4KQXA 4ALNA 1P9LA 3E6AA 2VRCA 3E48A 3WR5A 3DHYA 4XIJA 2HAEA 4U8GA 2YUTA 3ROPA 4FFNA 1MFZA 3WQRA 4D42A 3K73O 3MWEB 1O89A 1GY8A 4G81A 1JKIA 1T2FA 2B4RO 2W98A 4NH4A 3VTZA 1AXEA 1PGJA 5MGBA 5KNLA 3ANLA 3KVOA 4Y9DA 1XA0A 3Q1LA 4F6LA 2WWRA 4YJFA 3TZQA 4RV9A 2B4TO 4LGVA 3WICA 4BNGA 1K3TA 2GDZA 4NBRA 5TT0A 4P4GA 1U7TA 4RQUA 2QYTA 3UGKA 3JD3A 2IXAA 2POQX 3E5RA 3OM9A 3RUDA 4UEJA 1H94A 1QSGA 4MVJP 4Z6KA 3HADA 2X1HA 1BVRA 3JD0A 4YJGB 1F12A 1X13A 2Q2QA 3KTDA 2AEJA 4R54A 3G1UA 3QW2A 4W99A 2Y05A 1E3IA 4TVBA 3HN2A 1VPDA 5IN5A 3ICCA 3WYCA 3WJ7A 1P1RA 5IJZA 5JYDA 4ALIA 3IUPA 1DAOA 4BKRA 3JYLA 5CPBA 3K2EA 1EK5A 3EHEA 3ZW9A 4WK6A 2IZ1A 3LU1A 2HLPA 2VRBA 1ISJA 3DL2A 1WDLA 4MIOA 3R0IA 1NXQA 3FHLA 4MVJH 1LDGA 1XHLA 4YJHA 3PP8A 2FSVA 4R3NA 3QIVA 4I5FA 1HETA 1N2SA 7MDHA 2RHCA 3AUSA 1H6AA 1G0OA 3AUTA 3R1IA 4K6CA 4WOJA 4LRSB 1KEPA 5AXAA 1KY4A 5IDYA 5ITWA 4PFJA 1B3RA 3QWFA 4D43A 2EG9A 1DIGA 4GH5A 2XF8A 1MV8A 3KZVA 1NAHA 5GZ6A 1MC4A 1SO8A 5A4DA 1NHGA 1QR6A 4U0JA 4TSKA 1R15A 3GDOA 3OJOA 4U6SA 1DBVO 3WB9A 4PRKA 2FP4B 4NJMA 4XCVA 1HZJA 2BF7A 3GAZA 4IQ0A 1PEDA 3X2EA 3PXXA 1A72A 1I2BA 2O48X 4FC7A 4NZ9A 5T57A 2EP5A 4LCEA 4W7HA 4ALKA 3ZH2A 4BVAA 3QHAA 4E5NA 2J3IA 1V0JA 3D5QA 2Q4EA 3GOHA 1NWCA 4XYBA 4XX0A 4QO7A 1QLJA 2F1KA 3C7CB 3UAGA 5I9NA 2X23A 5EINA 1GFSA 1E3JA 4PG8A 1ZKMA 5BNIA 4R01A 1FDWA 4PIVA 1JKJA 1CYDA 3FNEA 2VQ3A 3L6OO 4Q3CA 4KOAA 5JFOA 4JBHA 5DT9A 1EUCA 3I23A 4DPLA 3RI3A 3A1NA 5KVQA 3GMDA 5EERA 2AEFA 3T7EA 4BO3A 4IZIA 1DFHA 3ORFA 2DPGA 4LMPA 1LDMA 4OYRA 4QSMA 5ILGA 4BNFA 4E12A 1HSZA 4CM1A 1MXHA 3JQ7B 4G5HA 1PQUA 3JQGB 3I83A 4J49A 2B35A 1GADO 1GCOA 1QP8A 3GVPA 5TX7A 5JY6A 3BTSA 2SCUA 5I9MA 4R9SA 4IXTA 1H6DA 1XSEA 1KYQA 2Y1OA 3VH3A 3L4SO 3Q2KA 1PSDA 1YDWA 3HDHA 1X7DA 4ZQFA 4OIMA 2P9CA 1LDBA 2JAPA 1N1GA 3BHMA 4JK3A 3QRWA 3HB4X 4N5MA 2HU2A 4BNIA 5CDTA 2I66A 3ASUA 4BGUA 3I1JA 4PLPA 4G65A 5G0TA 3INGA 4IDAA 2Q45A 3GVHA 4FB5A 3ITDA 2RBEA 4FSHA 4IIVA 2EIHA 1HDYA 3N58A 2B83A 2NVBA 4XYEA 3KLMX 2CMDA 1K0UA 4DWVA 3I9LA 1KS9A 2ZIZA 3OMLA 4FD3A 2GZ2A 1C0PA 3RFXA 1SB8A 2W2KA 2PZKA 1ZK3A 3INTA 4DYVA 2GNAA 5CG2A 5CEFA 1DIHA 2Q1TA 1MA0A 3RAJA 2BI7A 2Q49A 2AG5A 4FDAA 1C1XA 3NGLA 1YKFA 1EZ4A 1Z7BA 2J6IA 4ZRMA 1VRWA 1P3DA 5JDCA 3C3XA 1NPYA 1VKOA 2FPIB 1LSOA 5THKA 5A06A 1KVTA 5TF4A 3EVTA 5JNLA 1XR3A 2ZYGA 3DZGA 1XEAA 4A5OA 4FN4A 2O50A 2IEBA 1FJHA 2JJYA 2HMWA 2PNFA 5BSFA 2RH4A 2I67A 2XXBA 2WYWA 3BMOB 5CDYA 5IDWA 3PWZA 3KRTA 4E2YA 3EZLA 4XGKA 4RVGA 1NFRA 5A9SB 3W8FA 2B37A 3ZV5A 5ENVA 4OSOA 4HXYA 3GFGA 3GAFA 3BYZA 4YTEA 2HCTA 1PJSA 3LQFA 3QVSA 2VRCD 3OP4A 1YE3A 2GN8A 4RZIA 2QRLA 4A2CA 4BKQA 1QYCA 4E32A 4E3ZA 3EDMA 2I3GA 3VH2A 3GC6A 4BL5A 1C0LA 2DPHA 4MPDA 1PL8A 4RPJA 3AFMA 3DDNA 3I52A 4YBZA 3A4VA 3PZRA 3VPFA 2X0IA 2P5UA 4FR5A 2PY6A 3U9LA 1S7CA 3WNVA 4GL4A 4WPGA 2WYVA 1Y8RB 1P45A 2B69A 4E2ZA 4IBOA 4BKOA 4GLOA 3WGIA 1Y7TA 3B70A 3NJ8A 1ZK0A 5EESA 3RD5A 5G4KA 2BELA 4LVCA 4P4NA 3UCFA 4PLCA 4L4XA 3NYWA 3ZV6A 5B4UA 1AGNA 1HDZA 3GPIA 4ZGWA 1E3WA 3GY0A 4XB1A 3KSUA 3H5RA 3S2GA 3OJFA 3UCEA 4YPOA 1GZ6A 5L7WA 1A4IA 1UAGA 2AW5A 3MCVA 2Q1UA 5KJ6A 1BDBA 3AI3A 4OGWA 1R0KA 3G79A 2JKVA 2PR2A 2NLOA 4BUCA 3AY7A 4YRAA 1HT0A 1LQUA 2W4QA 1OC4A 1E7SA 4XQEA 5J23A 1GV1A 1SC6A 2C0CA 2YYYA 1SBYA 4MVJM 1NX6A 2G76A 3VDRA 4E2XA 1DRUA 4XGNA 1GTMA 5DF1A 4PZDA 5GMOA 5JXWA 2Y0DA 4MP3A 1E1LA 4NU5A 4PLYA 3RUIA 4RPKA 1Q0QA 2IRWA 3NDRA 4BO1A 5JBIA 3JTMA 4ZICA 4HFNA 1EDZA 4XYLA 1HLPA 4LMRA 1EQ2A 2AQKA 4YJFB 2ZCVA 3GVXA 1BG6A 4GVLA 3PTZA 1YBVA 4AJIA 3UVEA 3VHRA 1VI2A 1EK6A 1HE5A 3AUAA 1T26A 5DP1A 4PLFA 4PGFA 1LBEA 2EXXA 2DQ4A 1TI7A 3K30A 1H2BA 3DQPA 4XDYA 1ZVMA 1C3VA 4KWIA 3VVCA 1GAEO 4TWRA 4DL9A 1ISGA 3OA0A 2VYNA 1U28A 2ZJ1A 3CZMA 1VJ0A 3AK4A 4B4OA 2X9NA 2R2GA 5KVSA 3RFTA 3K5PA 3ZNQA 2O3UA 3OBBA 3RJ5A 4CUJA 3DOOA 4WOKA 5TIIA 3ROQA 1HYHA 2WSBA 5IXYA 1YH3A 1HE4A 4WLVA 3ADPA 4YJHB 4CMIA 2D3TA 4J1SA 2EJWA 2EW8A 1U5AA 3SX2A 1LJ8A 3ZCXA 4ALJA 2Y67A 3PLNA 1X0XA 5DBFA 3NTOA 2WE7A 4XIYA 3CMMA 3ZU5A 1E0DA 3W6ZA 1CETA 4AL4A 1MG5A 4TMFA 4CM8A 2EF1A 2C54A 4WCDA 1RJWA 1PGPA 2FPGA 1DXYA 4XYMA 2OOSA 3K2BA 4A03A 3JQAA 1GCUA 3IL2A 4CV2A 3WBFA 4ROSA 3DZHA 4J4BA 5L45A 1B2LA 1UH5A 5CEJA 4Z3KA 1Y5MA 2W2LA 2HMVA 2ZB8A 4CMKA 2V7PA 1PWZA 3D5TA 2D5AA 2BLLA 3DMTC 3TQHA 4TQGA 1ONNA 4HY3A 1PZFA 1PJLA 2DBQA 1OC2A 4GQAA 3Q9NA 3IUSA 4AVYA 4W7IA 1NFQA 4XX0B 3TNLA 4IJVA 5COQA 3PQFA 4JJGA 1HXHA 4D0SA 3OJ0A 5LC1A 5A03A 2NUAA 4IY1A 1S6YA 3NJ4A 5JW6A 1XG5A 4FFRA 1ENZA 1PJTA 4NR0A 4N5LA 4YT5A 1JKJB 2Y1DA 3Q3CA 4IQ8A 4FOSA 5HM8A 1EUCB 5F1PA 4MKXA 2VT3A 4OKIA 4Y6SA 1ZBQA 4J0EA 4CM7A 3UFXA 4RF4A 2PKQO 3A9WA 2UUOA 3AOEC 4DBZA 5IF3A 3STHA 3JQ8A 4XWYA 1A27A 3QV1A 5F5LA 3FTNA 3DAPA 2QRKA 2PD4A 3AU9A 5H82A 3ZU3A 3D3EA 5HRUA 1VJTA 3PEFA 4JLWA 2SCUB 1KETA 3E8XA 1T2CA 4FFOA 4IM7A 4RPGA 4CLXA 5TS3A 1M67A 4CQLA 1TEHA 2CDAA 4E13A 3ZWYA 1GR0A 2DBRA 3GN2A 3OQ1A 2VOEA 2EKLA 2VHVA 3DONA 1CIVA 4II3A 1BWSA 1P74A 4XB2A 1U8FO 5I8ZA 4NJOA 3S2FA 4N18A 3DFUA 2D0IA 2VTEA 2W8ZA 3DC2A 1P33A 1VL6A 3GZ4A 1CEQA 4IPTA 1W73A 3Q2IA 1GZ4A 2EWMA 1QV7A 3M2PA 1R37A 3DAFA 3JQFC 2Y0EA 4EGFA 1YS4A 2VZ0A 4RL6A 1A7AA 3HE3A 1UJMA 3O4RA 4WLEA 1E6EA 2W2KB 2FZEA 1XU7A 4PG6A 4ONEA 3WS7A 1N5DA 2PGJA 3DXFA 3ZWWA 4DYDA 1C1XB 4J1QA 3DTTA 1XELA 3KHUA 1YDEA 5K0ZA 2GN9A 2YHIA 1BRMA 4OOFA 1GZ3A 3F5SA 5TRTA 1MGOA 2Z1MA 3ETEA 3BAZA 1LLCA 1HKUA 4CM4A 3HG7A 3PDJA 4HNGA 1A7KA 2J8ZA 1KC1A 3NTRA 4AFNA 5F1KA 1SOWA 3QVTA 3U4IA 1K5HA 1L7EA 5U1PA 1RKXA 2XPCA 2X5OA 1H5QA 1GYRA 4Y6RA 5KWEA 4MVJE 1M66A 1C0KA 3KUXA 1YBAA 4OQYA 4DQXA 2EW2A 4NIMA 1QYXA 5TGDA 5A5EA 1GEEA 4MVJF 1D1TA 3EUWA 3NT5A 3JYQA 2G5CA 4BB5A 2G82A 3PJGA 3W4IA 1XQ1A 1E5QA 2YV3A 4B8ZA 2EHDA 1DFIA 2G1UA 3HSKA 3FWNA 3IC5A 3N74A 3IKTA 5JO9A 3ABIA 3AM4A 5G0UA 1MG0A 3K92A 3IMFA 3WTCA 4NDNE 4WJZA 2GN6A 4AJ4A 3I9KA 4LN1A 4RF5A 1GU7A 1WAMA 4MVJI 1QYWA 4YAEA 4ZQGA 1ENPA 1EVIA 4GGPA 4ITUA 1X7HA 5MDHA 3WGQA 3R3JA 1PJCA 2CDCA 3HUDA 4ZQHA 1DLIA 3UICA 1N92A 1XQ6A 2GUGA 3OIDA 1ENOA 1E7MA 2I3AA 1PX0A 2RCYA 3MTJA 4JQCA 4JBGA 3GRKA 1E3LA 2A9FA 3MJCA 2BFMA 1LX6A 2VYND 1LRKA 5G4KB 1VL0A 4CUZA 3O26A 4PG7A 4WEOA 2OHXA 3TZCA 1GPDG 2GGSA 1PGOA 4GX1A 2RIRA 4QX6A 4B3IA 1E3WB 3W4JA 5BSEA 5TNXA 2B5VA 5IZCA 5GY7A 1JWBB 4J6FA 3CE6A 2UV8A 1A9YA 1PQPA 3GEDA 3K96A 3QJ5A 1I3KA 4ALLA 3E82A 4J1TA 3AY3A 2HJRA 3F47A 5FI3A 5IFLA 3IIEA 1LDYA 3PQDA 4FJ1A 4XA8A 1EE2A 3OSUA 2Y1CA 4R16A 1H9AA 1P1HA 1MX3A 1FDVA 5IAAA 5JYEA 2J3KA 2XAAA 3JQAD 4J0FA 4OHUA 3V1UA 4EUEA 4W9NA 4BNXA 3JYPA 4UVEA 1GDHA 3NTQA 5AXBA 4OOEA 2W2LD 4EI2A 1CDOA 1F8GA 2VWGA 4FFLA 4UVIA 3VKVA 4YB8A 2X9VA 2HKIA 1Z45A 1ZSNA 2BGLA 4QXMA 2AE1A 2O3QA 2BH9A 1R0LA 1A4UA 4NBWA 1J5PA 2DAPA 3ON5A 2J3JA 9LDBA 1B14A 2ZTUA 3AW9A 4E2WA 1CJCA 3M1LA 5AOVA 1I3LA 3KB6A 1IPFA 5JAMA 3LLVA 1WVGA 1KEUA 1M6WA 5EJ2A 3G3EA 4WNCA 1H6CA 3WFJA 1ULSA 2VHZA 3GDGA 4P4LA 2P4HX 3HDYA 2IXBA 4CLRA 2AMFA 2HDHA 2NACA 3AI2A 4CLOA 2NU9A 4J43A 1G1AA 1RYDA 1WLYA 1TLTA 4OXYA 4XQ9A 3VAZA 3SLKA 5EPOA 3DHEA 3QWIA 3RVDA 4BNWA 1VM6A 1N1EA 3LT2A 3WWZA 3GR6A 1IUKA 3DBHA 3EYWA 4QEDA 2NM0A 4CMIB 2C2YA 4RZHA 3GUYA 1T2DA 3ANMA 4HFJA 5JS6A 3WGOA 3OA2A 4IZHA 5DOZA 5CG1A 1ORRA 4IS3A 2HK8A 2O4UX 5AQ1A 5DNAA 2HQ1A 5A04A 3I6QA 3FNFA 5JDCC 4YQZA 1XCBA 3FRJA 3M1AA 4CM8B 2YY7A 3TOXA 1WP4A 3NT4A 2FPGB 3OH8A 3PHHA 3RUFA 3JQAB 4IMRA 4XQCA 3H4VA 3V1TC 5K6AA 3NDIA 2YFHA 2Q2WA 3KYCB 3UN1A 1A5ZA 2PLAA 4OMUA 4B4WA 4M8SA 2YQ5A 4J4TA 2CVZA 4FJ0A 1PJBA 3ZGYA 4CM5A 4QQRA 4D3FA 1TA4A 3O8QA 4B7UA 2D59A 5G0SA 2A4KA 4EEXA 1YBMA 2PZJA 2X6TA 4GGOA 1V6AA 1U3UA 3DEYX 1PZEA 4XRRA 3WXBA 5C7OO 1YOVA 1DAPA 3H9JA 1UUFA 3LDHA 2C2XA 1ZO8A 1NBOA 2H9IA 1PL7A 1XU9A 5JE8A 2HO5A 4YA6A 2NUAB 1VJ1A 2X86A 1DEHA 3UF0A 3DFZA 2CUKA 2YZ7A 3MZ0A 3T7CA 3M2TA 3MJ4A 3P19A 1AHHA 2EEZA 3K9QO 4JXKA 4U6QA 2IYOA 3HZZA 3NDJA 4UEKA 1XLTA 5B12A 4PLTA 8LDHA 2GRAA 4M89A 1F17A 2DBVO 3HDQA 5L7YA 4YJDA 3UFXB 1VKNA 2GSDA 4XRGA 1H0KA 3NAQA 2Y99A 2B36A 1PZGA 1GQYA 3JQ8B 4TVOA 4HBGA 2VN8A 4BNNA 3WFIA 1OBFO 2VWPA 2X0NA 3DR3A 3MJEA 4RORA 1BW9A 1NR7A 3FN4A 4NMHA 3TWOA 4M49A 4PG5A 1QG6A 4L74A 2OORA 2V6MA 3RSHA 5IDQA 2WD7A 3R3SA 3U5TA 1SCUA 3G17A 2Q99A 2P9GA 4ZA2A 5JMPA 4DVJA 5TQVA 3JSAA 3CMCO 2LDBA 2DKNA 4CQLB 1C14A 3AJRA 3S55A 4CLEA 3LF1A 5CHEA 1HDRA 1DC6A 1DSSG 3I9MA 4UULA 3UOGA 4DPMA 4TZTA 5JDIA 3WYEA 1DB3A 4YAJA 2Q46A 3TSCA 4BO5A 3G0OA 3O9ZA 4JGBA 3JD2A 4BMSA 1IHYA 1UXGA 4A0SA 2C7GA 2Z1NA 2NU6A 5T67A 2C07A 4YDRA 3MJTA 1ISHA 1Q2XA 3OQBA 4KTTE 3GG9A 4HFRA 4DLBA 3FPLA 5DBGA 4WNIA 4ZVVA 3TJRA 3WSWA 2CF6A 2C7VA 2FPPA 1T1RA 3PFWO 1GEGA 3TZ6A 3QWHA 4Q3BA 1LTHR 4J9UE 2GR9A 2Q1WA 4NK4A 1WWKA 3ZV3A 2AEMA 3PYLA 3ZWOA 5KIAA 4RVHA 3AI1A 2R00A 4WCFA 1NNUA 4MJLA 4O1MA 1M2WA 4AG3A 4CM4B 1HWYA 1W6UA 4KWHA 5AVOA 5LCXA 1FDTA 1ID1A 5T64A 3Q0EA 5I7FA 1WDKA 4YWJA 4RCVA 3AU8A 3IP1A 4DC0A 5JCXA 4G2NA 4YAGA 1F14A 2ZKLA 3GEGA 1EDOA 4XR9A 3U4DA 5L4SA 4CODB 4E6PA 3RC7A 5L3ZA 1NWHA 1G6KA 1Y9EA 4FPXA 4GSKA 3KO8A 4F46A 4J90A 2AQHA 1O94A 3D64A 4JP2A 1WZEA 2B0JA 4TZKA 4I5GA 4XKJA 1ISIA 3HN7A 4WE3A 5DDIP 3T4XA 3RUAA 3ZWAA 4BNJA 3JQEA 3WX0A 4FFPA 3BIOA 2OBNA 3BMQA 4CM9A 3WLEA 3GUCA 5KOIA 3HFSA 3ZWMA 3IJRA 2UVDA 4I08A 4MO2A 4KUEA 4B4UA 4HADA 3GZNA 3HFGA 4FIZA 3JD1A 4GI2A 4M1QA 4AICA 4Y98A 1LC3A 2DTEA 3H2SA 3GF4A 1JWAB 2NSDA 2O3RA 2Q2VA 5BSGA 2C5AA 5F5NA 5IZ4A 3TL3A 2PZMA 5F1OA 1JTVA 3RJ9A 3WIDA 4C7KA 4OL9A 5IXSA 2YV2A 3CIFA 1B8PA 5BQFA 4WECA 3WNQA 4JJIA 4GAEA 2WDZA 3G49A 3P2YA 3DOJA 4CMEA 1V8BA 4GBJA 1BVUA 2JFFA 1W8DA 1P1FA 3DBVO 4UUNA 1ZK1A 1DFGA 1HYEA 4TRJA 1SMKA 1PJ3A 3K6JA 3CUKA 3X2FA 1ZXBA 2O7SA 3LC2O 4JIGA 3ZZNA 4C7JA 5TSDA 3GGPA 1ADGA 1OZAA 2GLXA 3PHIA 4UVDA 3LYLA 5DCWA 2QIOA 4QTZA 4PG4A 2IYPA 4D3DA 4TRRA 4AJOA 1Q0HA 4FW8A 4AJNA 2A35A 4PZEA 1E6WA 3PIDA 2AQIA 3DOCA 3ADOA 3U4CA 1F0YA 4Q3NA 3KEQA 3KYDA 2X9GA 2IZZA 2PA3A 2NU8A 4II2A 2GYYA 2FY8A 3LVFO 4CM6A 4A27A 1IYZA 1DDOA 1NYTA 1EMDA 1TB4A 4AJHA 4RVDA 3H2ZA 4R41A 3S2IA 2YFQA 2VYVA 3VH4A 1GQ2A 3B1FA 5G2OA 4Q3EA 1QMGA 3TZHA 1U2DA 2VHXA 5EQFA 4KTVE 2Y93A 4IJKA 3L4BA 2OFPA 2DU8A 1PGQA 3JV7A 1NM5A 4LSMA 3Q6IA 4IXWA 4OAQA 2OZPA 2UAGA 3PQEA 1YONA 3VZRA 2DFDA 3AUUA 3D4NA 4O63O 4AJPA 4URFA 5DOVA 5L51A 1I33A 4MIEA 4EZBA 2NV6A 4BNHA 4PLHA 1CF2O 4KMSA 1GUZA 4CLRB 4S1VA 4ZN6A 4DXHA 2W90A 1RM4A 1ZIDA 4CLOB 4GX5A 2NU9B 2CDBA 5ICMA 2JCVA 5COBA 5AXDA 4BGIA 1OOEA 2NTJA 3BMNA 1N7HA 3VTFA 3WWYA 2G17A 2HSDA 1W4ZA 4MKRA 4EJ6A 1ZCJA 4QT0A 4XDZA 3WJAA 2ILTA 3S2EA 3K8ZA 5LDGA 3DBHB 4N5NA 2X4GA 1VL8A 2AHRA 1XKQA 2O7QA 3F4BA 4B7XA 3K31A 3GH3A 1ML3A 2HK7A 3DZIA 1ZEJA 3RROA 2E6UX 3ONDA 2VNAA 1ZK2A 1P1KA 2VNSA 1GL3A 2HMTA 4TKMA 5CDGA 5FYDA 4YEDA 4TROA 3WGGA 2CF5A 3DMYA 1YQXA 3ONFA 2P91A 1O6ZA 3RU9A 3GG2A 4I9HA 1I8TA 2J5KA 3GLQA 3L6EA 5JAQA 7ADHA 1DO8A 1UR5A 3PLRA 4WKGA 2FOIA 2QW8A 2TMDA 2X0JA 3DZBA 4XZ3A 3BHIA 3IP3A 3ANNA 4PRLA 1BMDA 4D44A 4BO9A 2JL1A 5HA5A 4E5KA 2GPTA 1NR1A 3ZNNA 1Q1NA 4UVGA 5CPFA 1ZEMA 2GO1A 4NJMB 4R1SA 3B1JA 4O0LA 2IDZA 1X0VA 3MJVA 1YOVB 2CY0A 5COAA 4TRNA 1OI7A 2GN4A 1R0SA 3FNHA 2HRBA 3NKLA 2NNLD 5U4QA 2NU7A 1WNTA 5CP8A 1E6UA 3WGYA 1AN9A 2JAHA 2ZJ0A 4KP7A 1MXFA 4I9NA 3RUHA 2YDXA 1U7HA 2QRJA 4ZQBA 1SPXA 3FR7A 5ITVA 1G0NA 3BMCA 1EBFA 3C7DB 4I8XA 4IDFA 4KDFA 4RLSA 1F06A 4Z0PA 4RO0A 2I9PA 1B7GO 1DHRA 4TKLA 1LLQA 2QQ5A 5A5FA 4CJXA 1ZXLA 4NPCA 2G0TA 3HNPA 1DOHA 1N9GA 2PZLA 3I9NA 2GZ1A 1TVEA 4ZRNA 3QY9A 4LVUA 1BW9B 1SEVA 4BQRA 5JC8A 6ADHA 4IJUA 2J3HA 4YXFA 1E77A 1NVGA 4DQUA 1KVUA 5JCJA 5C7IO 3HHPA 2WD7B 2HK9A 3TRIA 1HDXA 1SCUB 3JCZA 3EZYA 4GX0A 4M54A 3RU7A 4JJFA 3E5MA 4CM9D 2CFCA 2NVWA 1U4OA 1M6HA 4LCJA 1GQQA 1YB5A 2BFPA 1DRWA 4BO2A 1X1EA 4GMFA 3ULKA 3V2GA 1ZMTA 3T4EA 5HWSA 3U0BA 5IZCC 4U5QA 1V3TA 4WLOA 2FR1A 3TFOA 1C1DA 3H9QA 3GMSA 1JU9A 3OIFA 4NFYA 3WMXA 2VHYA 1NP3A 4IDCA 2NU6B 1P1IA 3DO5A 3MWDA 2FWMX 3ZU2A 4DA9A 1LNQA 4L9RA 1ZMOA 1ZW1A 2R6JA 3I6IA 3SVTA 3I5MA 5A02A 4FOOA 2PD6A 2HJSA 3LK7A 4BO8A 4DMMA 2E49A 1K2WA 3P2OA 5C7LO 4R51A 4W9NC 1L7DA 3TDKA 5FF9A 2QG4A 3H6KA 4PLVA 4WEQA 1U2GA 1RPNA 4P38A 1DC4A 2VUUA 2WMDA 1DPGA 3FD8A 3FPCA 4LK3A 3P7MA 3HWRA 3A06A 4F45A 3RFVA 3PYMA 2D4AA 2QZ9A 4HV4A 1E7WA 3ETDA 1P77A 1PJQA 1VE9A 4BNZA 1D4FA 2YJZA 5H83A 4J4HA 3ETGA 3KSDO 1TT7A 2DUWA 3LT1A 1LQTA 1Z74A 1E1KA 1BXGA 3IDSA 5DCYA 1I01A 3VOSA 4MVJA 3DAGA 1UP6A 3U62A 1E7RA 4J7CA 4DC1A 5ER6A 5L53A 3ZHYA 3SLGA 4A73A 1JKFA 4YT2A 1JAYA 4NQZA 3AOGA 3IS3A 4RF2A 2X0RA 5EN4A 1T2EA 2XXJA 4FGWA 4MKZA 2AA3A 4RF3A 4YAIA 5ER9A 4QUKA 1I30A 3VZQA 1DRVA 4XQGA 1KVRA 4IUYA 3S8MA 3FR8A 4DUPA 1VLLA 3MTGA 4MOWA 5DN9A 3NV9A 2VYVD 3BMQB 4PLZA 1ISFA 4WASA 2Q50A 3KV3O 1X15A 1DJNA 4HFMA 2RAFA 4I5DA 3RIHA 3PJDA 3OJLA 4ZD6A 1LLDA 2I99A 3VZSA 1EVJA 5ENDA 5KCZA 3GZNB 4B8WA 3SXPA 1Q7GA 1WXDA 3CKYA 5CEEA 1ARZA 4XD2A 4O6VA 1Z75A 3COSA 2BRUA 3MOIA 2Y1EA 1I24A 3DWFA 3FWZA 3D0OA 3F5QA 3GFBA 1E3SA 2D2IA 5L40A 3RC9A 2CZCA 4A7PA 3H5AA 2ZB7A 1I3NA 2JD0A 3SJ7A 3DZJA 5K6AC 1UDCA 3UXYA 3JQ6A 2BMAA 3DBLA 1J0XO 2RHRA 4LSWA 4RPHA 4UVHA 3V2UA 4EEZA 3BMOA 2QHXA 2PTGA 1EBUA 1FDUA 1T4BA 1XGKA 5CFZA 5L4LA 4DLAA 1D7OA 2Y66A 2EGHA 1Q7CA 1SNYA 2WTBA 3ZWNA 2QZZA 2ZB4A 4YYZA 3H3FA 4H16A 1PR3A 3QWBA 2VZ8A 4RVFA 4O59O 3ZWCA 2EGGA 3JYNA 1E1MA 1BSVA 3ZN2A 2GERA 2DTDA 2C5EA 5A9TA 2EV9A 1ZNQO 1T24A 2XOXA 3BTOA 4HKTA 1DC5A 2CVQA 2C20A 4AJKA 4DIFA 1DHTA 2GD1O 1NHWA 5BNFA 3W1VA 1NQ5A 5G4LA 1WW8A 2FR8A 3GHHA 1WMBA 2NU8B 2H63A 4KUGA 3RQSA 4PZCA 2WM3A 5A3JA 1M76A 1MB4A 1RYEA 2DTXA 1O8CA 4K26A 4OO3A 3V2HA 1QYVA 1UXIA 5K9ZA 5B4TA 1OMOA 4L75A 3OJEA 2ZTLA 4I9UA 4NBVA 2OGUA 1KY5A 4R1NA 1OFGA 1B15A 2J5QA 2O4CA 2PH3A 4MP6A 4Z3DA 3VKUA 1HDCA 4P8RA 2CNBA 3VPXA 4RVSA 1FMCA 3S1LA 4JBIA 1WDMA 2VHWA 1AUPA 3OEWA 1X14A 3RBXA 4BKUA 1SEPA 4GX2A 1P0CA 2PFGA 5H81A 4JP3A 2CD9A 3TZKA 4NK5A 3U3XA 2JHFA 1DIAA 1ISMA 2VUSA 3L9WA 5FEUA 4J16A 3WGTA 5JDIC 3GNSA 4EUFA 1IOLA 3JQBA 3H9EO 1HL3A 1T2AA 2E48A 4J1NA 2ZYAA 1U5CA 4IMPA 1NQOA 4DTIA 1QRRA 3E1KA 1C0IA 4GWGA 1O95A 3WIEA 1IPEA 3BMNB 2I76A 2PKQP 4DMLA 1YRLA 1LI4A 5JMWA 1E5LA 2UYYA 4U0KA 1R4MA 1B26A 3RKRA 3WG9A 4A26A 2Y1FA 4E30A 1R4NA 3C85A 1KC3A 3F6YA 3LT0A 5KKAA 1SZJG 2OP1A 3H3JA 4BNUA 1I10A 1SOVA 2DC1A 4JX8A 5I9LA 5JCJD 2BFOA 1ULUA 5TJHA 3ROKA 2GCGA 4Z0TA 1ZZEA 2NQTA 4OSPA 1MLDA 1JN0A 2R00C 4WCFC 4D7AA 3PGJA 3PWKA 5CDSA 4R5HA 4AJ1A 1DJQA 1YQDA 4DLLA 1PS8A 3LF2A 3H9UA 5JC1A 3H5NA 1W0CA 1T4DA 4GWKA 5EMHA 1MFPA 2BHLA 2D8AA 4R5MA 4BNVA 2NWQA 2C59A 4QFDA 4BIIA 2ZQZA 1LU9A 2NVUA 5T8KA 1I36A 4YR9A 5L4NA 5I7EA 1ZSVA 3ZW8A 5ES3A 4EITA 3OFSA 4BNMA 3PHGA 5JLAA 4QFCA 1ZUD1 1E1NA 2Y0CA 2YW9A 3OQ6A 3Q11A 2C82A 3AFNA 3GRPA 1IE3A 4RQTA 4EDFA 3FTPA 2NU7B 1ZJYA 1NTOA 3TOZA 3LSYA 3F4LA 4EJMA 1K6JA 2IE0A 5F21A 3OECA 4Q39A 2VWHA 3BMCB 3GNTA 5BSHA 4NBTA 5TJ9A 1N7GA 4QECA 1CQIA 4MVJD 2ET6A 2AXQA 1EFKA 3ENNA 4IGEA 5DCUA 4H3VA 2O2YA 4EBFA 3ZHXA 2I5PO 3RC2A 3U4HA 1R12A 3VH1A 1KIFA 4HP8A 1TT5A 3JD4A 4Z9YA 4E0BA 1LDNA 1N9GB 3L07A 2ZK7A 1UAYA 3DZFA 2NTNA 4NBUA 2X58A 1UXJA 1KOLA 5U9CA 3VPGA 4CQMA 1WZIA 3ZDFA 1YGYA 3UW3A 3QWAA 2ZATA 2FZWA 2F00A 4CMEC 3M6IA 4E21A 1CRWG 4DBVO 5FI5A 3L0DA 2PKRA 4BNLA 3EK2A 1HZZA 1IHXA 1NQTA 4Y67A 4BOYA 3F1LA 1UP4A 2IEDA 5DP2A 3ITKA 4Q9NA 5KJEA 1XYGA 3QE3A 2E4AA 4OXNA 2X8LA 3I9JA 4PVCA 1NPDA 1X7GA 2E82A 1C1DB 4BO0A 5BR7A 2GF2A 1YVEI 3KSZO 1Y8QA 3GQVA 2ZTVA 3ZNPA 4E5PA 2OO5A 4JROA 3MWDB 4R68A 1NAIA 4M86A 3ZNOA 1EVZA 5TT1A 1PGNA 1E3EA 2X7HA 3WQSB 1QLHA 1Y81A 3A14A 5ICSA 3KEOA 1EUZA 4GLLA 4DPKA 3PRJA 4J91A 3W6UA 5C37A 4IJWA 1H2HA 3QVOA 3LLSA 2J5RA 1P0FA 1T1SA 4N7RA 1QYDA 4UAGA 4J2HA 1NASA 3SEFA 1B8UA 1U3VA 1UP7A 2O3SA 2OMEA 2Q1SA 2BGMA 2BI8A 5G0VA 1KVQA 1JDJA 2LDXA 3AWDA 1GV0A 1LC0A 4AJEA 1V3UA 3WDSA 1LA2A 4OH1A 3L4BC 4CMHA 1BXGB 2YHIB 4NHEA 4MIYA 4EYEA 4E4YA 1I2ZA 2VCYA 1MUUA 2Z95A 4IDGA 4DIOA 3I9OA 4E5MA 1YL6A 2JHGA 2E37A 4PVDA 4S3MA 3LC1O 3CH6A 1GYPA 3NUGA 1MC5A 1X1TA 1F8FA 4H7PA 5L7TA 3VPSA 1M75A 1U3WA 1HTBA 1PIWA 3LZ6A 3UKOA 3P5SA 3EMKA 1U4SA 4J7XA 4I5EA 4I1IA 3NEPX 4ND5A 4BV8A 4CMAA 4J2OA 4CV1A 4QO8A 3PGXA 4FGSA 5B1YA 1NPTO 3HDJA 3PVZA 4CR6A 1N8KA 3QQPA 4H15A 4TRMA 1CERA 3FSRA 2A94A 3PZBA 4U7WA 2BFAA 1ADBA 4HUJA 3ASVA 3EVNA 4KZPA 4GKVA 1Z6ZA 1GUFA 2JFGA 2ZYDA 3H65A 3UCXA 3OICA 2JCYA 1B16A 4OQZA 4UEOA 4RPLA 3DTYA 3BA1A 3TPCA 4CR8A 4YVFA 2NADA 1BTOA 5CAEA 1HE2A 3ZHZA 5IG2A 1PJ2A 1I0ZA 3FNGA 3DBRA 4P22A 1A71A 2P5YA 4E31A 1V9LA 5F3RA 4W82A 4F3YA 4M87A 1IZ9A 4YAKA 1YB4A 3INRA 4LISA 3SC4A 3L9XA 4AJ2A 4F6CA 4YRBA 3ICPA 4KUHA 4ALMA 3I4CA 5HS6A 2PH5A 2D1YA 3ZWXA 3DBLB 1Q7BA 2WE8A 4Q3AA 4YT8A 3JQ9C 3OHSX 1SAYA 4R4JA 4BO7A 2YHUA 3C24A 1JW9B 1Z82A 2BGKA 5DZSA 3V8BA 4LRTB 4BNTA 3PHLA 3I4FA 4PLGA 3RBZA 4L4RA 2O3JA 4IS2A 4D41A 2Z5LA 1UZLA 4WLUA 1PS0A 1Z7EA 4CPDA 5A1TA 1JVSA 3D3WA 3CSDA 3GHYA 3IAHA 3B6ZA 1BGVA 4HWKA 2CVOA 4B4VA 5L95A 1GD1O 3BHJA 1H93A 4IINA 4BNKA 1OAAA 1XDWA 4BS9A 3PYXA 4FBGA 3E18A 3EGOA 1K6IA 9LDTA 4ID9A 4ZHSA 2IZ0A 3QSGA 2P9EA 3F3SA 4OJNA 1HLDA 3HB5X 3WGHA 4BGEA 3E9NA 4BV9A 1YQGA 1R66A 4NFSA 3RKUA 1NVMB 2YV1A 1EUDA 4N54A 3OETA 4YCAA 4B79A 3NT2A 1IL0A 4E33A 5IDXA 2DLDA 2PD3A 3RCBA 4IQGA 4Q3DA 3IKVA 2P2SA 3BXXA 1BXKA 1KERA 4DREA 1D8AA 1HYGA 1JAXA 4HX5A 3TFQA 5KKCA 4CMCA 3PPIA 2IODA 2ZTMA 5T5QA 2VT2A 4D3SA 4GMGA 2DM6A 3C7AA 2I65A 1B8VA 2EKPA 2FMUA 4C4OA 1BDMA 4B7CA 5JSFA 1IZ0A 4BKPA 2V6FA 1PZHA 1CQJA 3H7AA 1NVTA 1J49A 2H6EA 4FCCA 5JY1A 3SJUA 1EEHA 4OM8A 3VPHA 4DQVA 3RC1A 4GKBA 1BXZA 2BKAA 4UUMA 4XYGA 2UUPA 1WPQA 3C1TA 1FXSA 1H6BA 3B1KA 1J6UA 2O3TA 2PGDA 1YJ8A 1KEVA 1R4MB 3KBOA 3WQQA 2PWZA 4W6ZA 1UZMA 1R4NB 3UHAA 4CQMD 2H5LA 4WLFA 5HS4A 2NQ8A 1P1JA 4RJTA 4UUOA 4XEHA 3CZRA
chains in the Genus database with same CATH superfamily
4B2YA 3T41A 4EB3A 3IV9A 4OXKA 5HG0A 2L82A 1T6BY 4UQOA 1XCJA 2EFYA 4WZBE 1VHJA 3VKGA 4LW8A 1NXVA 3GJQA 2ZI9A 1BHSA 3OT5A 3OZDA 4IFBA 1GNRA 1Z2DA 2WF5A 2PWYA 3BC1A 3VDQA 3RLIA 7GPBA 5F7OA 4Y2VA 1XHFA 1OFTA 1ZH8A 4OXQA 1V3QE 3GUUA 1GG5A 1U2PA 3D8BA 2OXCA 4V3CA 1LI5A 3WYNA 2QTFA 1F48A 4OHBA 4MP8A 2H2IA 3LVRE 3DL7A 1J0AA 3NGMA 4FKZA 4PC1A 3Q88A 2WAXA 4GF5A 4R05A 1YAJA 3ZCRA 3ENVA 1U80A 3R5SA 5AYVA 1QANA 2QSYA 3OESA 1UFRA 4EFKA 3AZOA 5A05A 1A82A 1YZYA 4BDSA 3FI0A 2Q07A 3BKXA 3TLEA 2QSUA 1PU2A 3GT0A 3ELBA 4EO4A 4WKPA 5HZHA 4JVSB 3CIOA 4LK2A 1HDGO 1ESZA 3FMOB 3IXLA 4MJXA 4P86A 3SYKA 4BZXA 3EW9A 4L08A 1LSSA 2VPWA 4PHFA 2PL5A 3QTLA 3UWSA 3JQ9A 1JEOA 3PNBA 4HZUB 3KLPX 4KGVA 5AK0A 4Q4HB 4G5QA 4YJGA 3ESRA 4B5KA 1K9VF 2ACWA 3CA8A 1P4SA 3EVGA 4DBLE 1M2KA 2PEZA 3WLTA 3AHIA 5EE3A 1RHJA 2VTDA 1JVBA 2OUIA 5HQ3B 4WJKB 4NNJA 5DIZA 5JO0A 4D9FA 1N5RA 3DHNA 1ZI9A 2E2WA 2PGLA 2Q1YA 3ER8A 3QELA 4EF5A 2FHPA 1VLVA 5LSAA 2FSSA 3OCCA 1Z63A 3ABRB 3TGWA 1DAHA 2JFQA 3P4YA 3BGOS 4QOFA 4W8OA 3C16C 4ZHQA 1Q0PA 2P2GA 3IILA 1BRTA 1R16A 2YQ4A 3BSWA 3ZC3A 1Q0ZA 4O29A 5TLSA 2JLYA 4KBFA 3ONVA 3TQQA 4GI7A 1IATA 5BOVA 1XDUA 1JSLA 4BBPA 1NT2A 2HRZA 3WYFA 1NUPA 1MO6A 1KYZA 3QVGB 4GYJA 4GKJB 1TZCA 4JDUA 3AUKA 4L73A 5CX1A 1CE8B 4DCNA 4PX3A 1M6VB 4RJIA 1UM9B 2AR9A 3UH0A 2VJOA 4K28A 3BN3A 4CZ2A 5BWMA 3A04A 1NQAO 2P9JA 3LSTA 3E9DA 3U7IA 3QMMA 3LY8A 4DRYA 3EB9A 1DRJA 4RMNA 1N3BA 4EL0A 1KI1A 3ST7A 2BGUA 2XZTA 2IPLA 2D74A 4M1EA 5DO9A 2YDYA 3SPXA 8ADHA 2XDQB 4ABYA 1P6XA 4KV9A 4FS3A 3L7KA 1KVSA 4INAA 4ZMSA 4MUFA 4QOGA 2OK8A 3FBGA 3C98A 1AKMA 4CGZA 4UUPA 1PRYA 3CLUC 2I3ZA 3CR8A 1EIWA 1IJKA 4JN6B 2PX3A 3N2KA 5IYZF 3ZZTA 4EPVA 1ZH4A 1CY0A 3OEYA 4RGBA 1LDEA 2VBGA 1YHZA 1AURA 5LM3A 5LBUA 1IOWA 2CE7A 2PK3A 1WCYA 2BAGA 3KUCA 3WSVA 3I1FA 1O6CA 3FCOA 1B0AA 1B8NA 5FLEX 2FR8C 1LZKA 1VE5A 2YINC 1FX0A 1YI1A 4GPD1 2HL6A 3EXEB 4WKBA 2X5KO 4X6UA 4AURA 4BPRA 2FMHA 1ZD5A 2ONYA 3TMAA 2IUUA 3P97A 3LPNA 4TTPA 2BR5A 5KOHA 5KTKA 5KJFA 4MRPA 4MGKR 1Q1ZA 2HI0A 2JD1A 1YVUA 3CSUA 3VYTB 3KD2A 4P81A 4K6FA 4EYQA 4C3UA 2R8ZA 2OCKA 4CV3A 1VBKA 4RDHA 4B3JA 4G97A 1N0HA 4OK5A 1N78A 1FFEA 2VJBA 2WJ4A 3IJPA 2H59A 1ODKA 3Q3IA 4E88A 3LUAA 2Q27A 3QEMA 3U7JA 1GR1A 1OTYA 1OZHA 3SZOA 2PUFA 1CUAA 3THYB 1ZWKA 1ZMRA 4I36A 3BDAA 3NBFA 1DG9A 2CKMA 2VJDA 1E2GA 3I45A 3E03A 2OVBA 1TU4A 3VXKA 5GZ3A 4X6LA 1PDWA 3ZDYB 5E6SA 1L5FA 4JKYA 1DV1A 2GN1A 3WLNA 3K1JA 3BTUA 4CMBA 4Z2AA 1GFIA 1NBHA 4Q9DA 1UKVY 1Z2EA 3R6TA 4CI0B 1VCHA 2XVAA 1PR9A 1Z5WA 3JQPA 4PNHA 4C3VA 2PJUA 3CLSC 5KNCA 1OHHD 3V1YA 1D8TA 2ROQA 1IY8A 1F3OA 3HYNA 4OQNA 3ZBUA 3EVEA 3QP9A 3NRBA 2XH8A 3FNQA 3MYYA 3T9BA 2AT1A 2DJIA 4UNPA 4BVKA 4V0NA 1EGMB 1MABB 1N25A 2R60A 3QKRA 1YI0A 4KXMA 5I9IA 3VNAA 1XZIA 3E9RA 4KH1A 5JEDA 1SKYB 3TO5A 3FF4A 3W2FA 3TEMA 2OSVA 4E07A 1TOAA 5I3ZA 5LOVA 1Y3BE 5FHRA 4OI0A 2XZDA 3DDHA 2XA9A 2R8YA 4WOPA 3N05A 4C20A 3CX3A 2SNIE 2V55B 1DAFA 2E4UA 3HB1A 3T7RA 3WNDA 1YR2A 4F86A 4KITB 1PG0A 4BL5A 4L8VA 3LC7O 1FF9A 3QVXA 4Z0HO 3X1KA 3EVBA 4A10A 3ZCPA 3LA6A 5CAEB 2ARKA 3B2NA 4OKNA 4E22A 4L0MA 1W4CA 5TVGA 3I01M 5FX2A 1XNRB 1A5AB 3COWA 5CA0A 4E4RA 5LLSA 5JYCA 4MDHA 1G42A 2OWDA 3VOAA 1OXXK 3WMWA 2IXEA 2HMUA 3TQRA 2QX7A 3GJ5A 3PKJA 4YP7A 4G4SO 2UUBB 5FBQB 2ZB2A 3ENKA 2PJDA 1BHJA 4R3WA 3NV7A 4IDBA 1E7YA 4D96A 3ZY5A 5B6IA 5JQGB 3R6WA 4UD2A 1L5HA 5HKOA 2AR0A 4J7UA 4UPDA 3RW9A 4DJFC 1VDMA 2Q4DA 4C21A 3PD7A 1CUEA 3ROMA 3PJEA 1U9JA 4Z7QB 1ESNA 1K4YA 2C98A 1ZGAA 2AJLI 1BFDA 2GT1A 3L1HA 1TF2A 4O8ZA 1PJ4A 5T8KC 3IULA 1E4VA 5H16A 3N5KA 1Q92A 4PBRA 3PRKE 3S5UA 5KYXA 2V6GA 1WETA 5ISMA 1K63A 1X6VA 5A4KA 3BJZA 2Q5QA 5EWLB 4KIGA 2GNOA 3ZY6A 1TUBB 2QJWA 3HP1A 3SC2B 2OAP1 4A0FA 4BMXA 3OCJA 1DWQA 3DMTA 1XXHB 2HIGA 4NZPA 4RKFA 1XWFA 3COYA 3RU2A 1TVMA 5DLQC 4UOZA 1W36B 2ZB3A 5JNRA 3AR5A 4ZTUB 4BO6A 2H9YA 1IG0A 2X22A 3I64A 4R1UA 1RVDA 1TJ5A 4ER6A 4CKWA 1PW5A 4KNVA 4BDTA 3P32A 4M55A 4Y9RA 2P68A 2NIPA 3AILA 3DM9B 3AHFA 4MV0A 3D8UA 1QHGA 3AO0B 4IL5A 3LYHA 5ICFA 4F85A 3R8XA 1QMPA 3UV7A 1I0LA 4K6GA 4R1TA 3V8VA 4GUAA 3VAAA 4ZJZA 2FK7A 2HLDA 4PQYA 4HWTA 3HA7A 3RS5A 3R44A 5KSWB 4UMFA 2Z04A 4TMWA 1NMQA 1E3DA 1TO2E 1Y6JA 2IQIA 4MVJG 3WGNA 4XPIA 2GVDC 3CVUA 3THWB 4GVXA 1D4OA 3A2LA 3KYDB 2P11A 4OGLA 2PXAA 4F60A 4HQLA 1T3SA 2CBZA 3A3YA 5M3BA 1PV1A 4JOSA 1P3Y1 2Q3EA 4ZAVA 5FYQA 1XMSA 3ZI0A 2GZRA 3PX2A 4KN9S 3MGBA 3L6DA 4Q1AA 4JT8A 5IFKA 3HP7A 1P31A 3GJSA 2BTQB 3IHLA 4PCLA 4UBLA 4F06A 4K0KB 4Y8VA 3VU0A 1Y8RA 2I2WA 4NECA 4UTXA 3UT5A 3WHKA 4KG7A 3TLGB 3KQQA 2IU3A 1WEHA 4GRAA 4F3TA 4KQKA 1T9HA 4MINA 4EJ0A 3LHDA 1Y8AA 2V65A 2B7BA 3B5EA 1LPBB 1CQJB 1QVWA 4XM0A 3MSCA 1CY7A 3PTAA 3GD7A 3B1XA 1ENYA 1F3LA 4IIUA 3GROA 2QL5A 3H1FA 2I7TA 4HNHA 2D06A 4XAQA 2GEVA 1QUEA 3KETA 1YNOA 3B89A 2BMDA 3H0CA 5FFFA 1WZCA 4TSFD 5ELXA 5DNDA 2EYQA 2OO3A 3RV4A 3K53A 2OFOA 4I3GA 4NMXB 5HFNA 4CI9A 1D2MA 5HW0A 1KDOA 3THXB 4KR9A 1N6IA 1XN1A 1XVVA 3IDFA 5DGXA 5H9WA 4FONA 3R7BA 1KR2A 1NQWA 2QVLA 3PNKA 1T25A 1Z17A 4PZPA 1SG9A 4QXOA 1PS9A 3Q9UA 3LKVA 3R24A 2LRHA 3FLMA 4KQHA 3JQFA 4WY5A 4Z1MD 1N32B 1E79A 1XTZA 3L5OA 2GESA 1EIZA 2JK1A 3RUEA 2ORYA 3ILHA 4REOA 5C3MA 3PHJA 1H9BA 3PB3A 3H2KA 4HQKA 2OM6A 3WGZA 2HV8A 1A7JA 4BMCA 4L50A 3KXPA 1BEZA 3V3KA 2RHTA 2PUEA 4CLHA 2QD3A 5BQ5A 1WABA 4CUKA 3A9CA 3BIXA 3NBKA 1QCCA 2GK6A 3FHCB 2AG0A 4GGMX 4N03A 4D4LA 5AW7A 3A31A 3HABA 3DHYA 4C07A 3KQHA 2HAEA 1Z2PX 5BRNA 1FDRA 3K0AA 4XQ0A 4ZGGA 5A5DA 3V4LA 4HLQB 3FMFA 3EZ6A 1O89A 4U5XA 1GY8A 5G41A 5KNLA 2DRIA 1PGJA 1D2EA 1G5TA 4PCAA 2Q1XA 3ANLA 4Y9DA 4F6LA 5B2FA 4F91B 1KO1A 2JFNA 2B4TO 3L7YA 4BNGA 1UEIA 1XDZA 2GDZA 3I04M 3LXMA 4NBRA 2XUKA 4P4GA 3PC8A 4DM7A 1DTWA 3RUDA 2R68A 3E5RA 3WFZA 4C2TA 1C7JA 4E1AA 3Q6NA 1H94A 1SIOA 5IZ4A 5IBRA 3ESCA 1QSGA 1XZBA 2RHJA 4YIKA 3IB6A 5HJ5A 4LYGA 3JD0A 5CVJA 1WMSA 4HBZA 4YJGB 4CDMA 1UANA 2FWAA 2GLUA 3DDOA 4TTAA 4CYMA 3I5XA 2UXDB 1QQ6A 1U2EA 1ZC4A 4I4LA 3HR8A 1IRXA 3BD6A 4QRHA 4ZI3A 4NC9A 4UM9D 5EIEA 1O97C 2WKQA 5EUBA 4MTLA 3A4IA 3QELB 1V9SA 3IUPA 3RQIA 2AG1A 1DAOA 3JYLA 1X2EA 4L5AA 2FN3A 4Y2YA 3SHTA 5JTUA 3AR9A 3ZW9A 1PLKA 3QXCA 3K9NA 4DA7A 4ECAA 5EHNA 4ZHQB 5B57C 1WDLA 4OIFA 2FZVA 4MVJH 1LDGA 1XHLA 1D2AA 4EG7A 3WK6A 4R3NA 4ARSA 4F5ZA 3QPVA 1DDIA 3SHQA 1ZDMA 1M8KA 1IWPB 7MDHA 5F9FA 3BM5A 1H6AA 2JJ1D 4U63A 5CX1B 1XD2A 1KEPA 4PPQA 5AXAA 1KY4A 3TNJA 3W3AH 3RGGA 3DH0A 3H2JA 1Q84A 1KJYA 2ORWA 1E8DA 2Q3DA 4KK4A 1DIGA 4DQ0A 2L18A 2H57A 3KZVA 4HB3A 2P30A 1NJGA 1Z6PA 4CHTA 3AETA 5F3DA 2H5JA 1NHGA 4W5OA 3OZWA 4TSKA 2XBUA 3S1AA 3ZW7A 4JC0A 4BIMA 6Q21A 3QE0A 4U6SA 4GOOD 4DKXA 5C52B 3IPAA 1FMLA 2EF0A 4HAWA 3HJBA 3ZOZA 3DE7X 4FGKA 3X2EA 1VCOA 3IJ5A 4GZLA 5HCIA 3PXXA 1A72A 1I2BA 2GCOB 1B8OA 4JR1A 5T7BA 1NDHA 1HMYA 1RRVA 1SELA 2I1QA 3BD8A 3N2KB 4FC7A 4NZ9A 4B40A 2EP5A 3SHFA 5FQNA 4DOMA 1EU1A 1XK7A 2B4AA 2NOAA 4GBMA 4PHCA 3V8EA 2F4NA 2DKFA 1FCJA 4BVAA 4D98A 1N2GA 3RVNA 1DXOA 4AKSA 2PPLA 2Q4EA 1NWCA 3P2IA 3ISVA 4PYOA 1YZUA 3Q9LA 4P3NA 1XRSB 2C0QA 1U8ZA 1ESEA 2V7EA 3DR5A 3PGMA 3R5KA 2Z8YM 2X23A 1FX0B 3H8WA 3W5UA 3FUVA 4HTAA 4P32A 1E0SA 1KJJA 5BSRA 3GJRA 4PG8A 1ZKMA 2V4MA 5KOHB 1MDBA 3MWGA 3KKQA 2WWXA 4P0PB 1E5XA 5AKIA 4R40A 5CT6A 2QRVA 2FOLA 1QLWA 1K5PA 2I3BA 5EJEA 4QBKA 3HBJA 3MQFA 3FNEA 1K8YB 1P2BA 4B6OA 4F93B 3NHLA 4QRDA 4JBHA 3ZDAA 2XKJE 5DT9A 3SF0A 2Y1WA 3LGAA 3LH5A 1F20A 3OJWA 1K2VN 2YYSA 3QEMB 3CB4A 3WHPA 4DWWA 5JSZA 2GZMA 3K20A 4LE0A 3IEXA 4RJLA 5IH7A 4DCGA 1LDMA 2BN4A 3PC7A 3N76A 4OYRA 4C0JA 4GXNA 1HSZA 1Z5PA 1KYWA 4PGHA 4A0QA 4UAUA 2FXIA 4G5HA 2JIZA 5ALJA 1H2RS 4FK8A 3U1VA 3BKWA 5E6SB 1XEWY 5K0FA 5CH3A 1Z0DA 2WHEA 3I83A 2QD2A 2NU8B 3DLBA 2QR3A 4ZZ2A 1NULA 3GLGA 2SCUA 4H7EA 4R9SA 5DHUA 3TB4A 3VC2A 5DI9A 3CURA 1UOQA 2NXJA 3IVMA 4FCWA 4IRMA 4M21A 5DXFA 3VH3A 5KNBD 3L4SO 1JEEA 1PSDA 3WNBA 4NCHA 4PSKA 2WFMA 3KJFA 4IZOA 1TMYA 3DMHA 3E2IA 4M8NE 5EEGA 2HU2A 4HZGA 3BICA 5U4XA 1PYGA 4A6DA 2I66A 2IKSA 4BNIA 5CDTA 1QGED 1H1DA 2AKYA 3PX3A 3QKRB 4B48A 2Q45A 3GVHA 5IHXA 1YC5A 4FB5A 1CUZA 5LYJF 3M5PA 1IMJA 1VHWA 3N2IA 2EIHA 5CNIA 3JSXA 4HLCA 1Z6QA 4LDRA 4DWVA 1CF9A 2NVBA 4BWFB 2CMDA 4FHEA 5LOVB 4II7A 4ZYTA 2ZIZA 3OMLA 2HBYA 3B36A 4D0LB 3FJOA 1FE8A 4G25A 5KYXB 1L2TA 3RFXA 1C0PA 1HFEL 1J22A 4D9MA 3BF7A 1YQTA 1U7UA 2C8VA 2GNAA 5CG2A 1JT2A 1DIHA 3CKLA 3DO8A 2IOYA 3RAJA 5CA0B 2OV6A 3FGNA 3QM1A 2CXPA 4EM6A 4OB6A 1L1QA 1WUKS 2H2GA 5AJTA 2PVPA 1YR1A 121PA 2YJ3A 4H2DA 4UQLA 1L5HB 5ALEA 3EPJA 1K6EA 5LMUB 1NPYA 1Q50A 2VPPA 4A8JA 3PDIA 4WZAE 4ZAFA 2IOFK 4D26A 1SBIA 3LVBA 4G89A 1ABFA 1J70A 4FZRA 2EL7A 3NM5A 2WIKA 1XEAA 2R6FA 1O54A 2YASA 3ZHOA 4C3OB 4F1WA 4KPYA 2ZBUA 3C74A 2IEBA 1FJHA 3FYUC 5AI8A 3V4ZA 3WNCA 4IOMA 5E7MA 1G19A 2FA9A 4C0BA 2OKGA 2XNKA 4RNDB 5JS1A 5IEJA 5BSFA 2TS1A 1GSIA 5E4JA 2VXOA 1W48A 1HNWB 1LPAB 3KRTA 3TG8A 4MGZR 4FU0A 2AFRA 3QYAA 1OH8A 4RVGA 4D02A 3W8FA 3HA3A 5EE9A 1S5PA 1AD2A 1FLVA 1P0IA 4YTEA 2QTHA 5CVDA 3DSRA 4CKWB 3LQFA 4O4IA 4U9HS 2DETA 3ZJUA 3STVA 4KQMA 1RJEA 4K46A 1ND6A 4DHWA 3MTEA 1JJAA 4L5CA 3TVDA 4KYUA 4LVOA 3C6YA 2IIPA 4RZIA 5EXPA 4A2CA 1LPSA 4Z5XA 4EO9A 4YMSA 2FZLA 5E4YA 2QN7A 5K3CA 1Z8FA 1YFZA 2ZI5A 1CLUA 1IAQA 2QJTA 1PW7A 1JH8A 1C0LA 1E0KA 4K03A 4XPIB 5GGXA 1H69A 3LUKA 5IULC 1DS6A 1MW8X 2PHZA 4RD6A 3V1NA 3RSSA 4OLFA 4YBZA 4E6EA 3ECSA 2FUKA 1Q57A 1QWOA 2X0IA 2VAWA 2RGDA 2XUFA 3I2HA 4D9EA 2C4TA 5T4BA 4QBFA 3PFBA 2WAOA 2QZ4A 2R8BA 1D2GA 1RHMA 4CF6A 2IY7A 1FQKA 5J1TB 5A5GA 3BEDA 5HUHA 5LP1A 4DT1B 3TX6A 3ZWKA 3NIBA 4F11A 5CM9C 2GPSA 1QBKC 1Y8RB 3UT5B 5HFAA 3QX8A 2PX0A 4NOKA 3Q7PA 3UAVA 3OLXA 1CKEA 5LNK1 1TQHA 2BEKA 1AGRA 2BDUA 2LTAA 4K9PA 4MCJA 4LVCA 2J5XA 3GJ4A 4OEHA 4WACA 1YR8A 4LWQA 4PLCA 4L4XA 3QU2A 2W6JD 4PC6A 4D8WA 3W06A 3ZV6A 5HRCA 2VIIA 1QHFA 4ARVA 3F3YA 1HDZA 3LD9A 4S0XA 3NHRA 5KSPA 3WRXA 4LI3X 4N6OA 3G6WA 3KAKA 3UJBA 4UJ3A 2BUAA 3KSUA 3SQDA 3S2GA 4OVKA 1GZ6A 1A4IA 4JI6B 3ORQA 4TQAA 2AW5A 4M4SA 1FP1D 3UG7A 1JR3E 1NVWQ 3PC2A 4JJEA 2PIAA 1OPRA 4WKOA 4OGWA 1R0KA 4GFDA 1E63A 1YCHA 2NLOA 2PR2A 1VYVA 4YRAA 2XMRA 1LQUA 5AO9A 4EPRA 2W4QA 1BQEA 1OC4A 4XQEA 1SC6A 1X1RA 5B30A 2YYYA 4FLEA 4B47A 1PV2A 1U7OA 4MGEA 4BEWA 2G76A 5GOTA 3GRZA 4E2XA 1DRUA 1EYZA 3RRXA 1N5IA 4CTMA 3KALA 3GZTB 4K81B 5M29A 4IMJB 4HH4A 4MR8A 5JXWA 4Z8YA 1XPRA 2D00A 3K9GA 3LP5A 3AVQA 3K0AB 1CBUA 1KRXA 2O0MA 3ASZA 2K6GA 3AQIA 4BO1A 3ZTTA 3A6ZA 4ZICA 3U4GA 1I5OA 4KR2A 1NVKA 3IMCA 3TXYA 3IR7A 3GEPA 3MCTA 1IEXA 4Q19A 3NHSA 5DRYA 2QTLA 3T7TA 1MZVA 1BG6A 1T0UA 2M9MA 1UPFA 3GFVA 2N1BA 3CGWA 3GCXA 1DTWB 4C08A 4D3YA 3VHRA 4YUWA 2L19A 2A9JA 3I28A 3N8DA 1Q0UA 1T26A 1U7DA 1JPJA 1TO6A 2JC3A 3N8KA 1WB5A 4PGFA 1AB5A 2EXXA 1RLIA 3IMKA 1CNMA 3K30A 3NCTA 1H2BA 4XDYA 5DNUA 1FL9A 2GJ4A 4U2DA 1AKWA 1SY7A 2NT3A 2Y9PB 4KWIA 4MWGA 3VVCA 4DL9A 1VB3A 3E1GA 2HDOA 2GDJA 3HJUA 3IV6A 3F7NA 1ISGA 1KIMA 1TCVA 2EFGA 4NE9A 4C01A 3OA0A 1OV6A 4R71A 5KTTA 1EFRD 1VJCA 2MSDB 3ZD9A 3AK4A 2X9NA 4I6GA 3K5PA 3QE2A 3RAPR 3ZNQA 3OBBA 2A9VA 5D6OA 3RJ5A 3D6MA 2OHHA 5MN6A 4WOKA 3OZVA 3RC8A 5IXYA 1YH3A 3FETA 3OCUA 1M2NA 3MJRA 1Q1QA 3W9BA 5FPKA 1JEAA 3PDWA 2WU1A 3S2UA 5FI0B 3PLNA 1X0XA 1YZVA 3I8SA 3AG6A 3NONA 1KTIA 2WE7A 2R86A 4BY9E 1KPGA 1XD2B 3K9CA 1P3JA 3CMMA 3ZU5A 4HH1A 1E0DA 2IYXA 1J07A 3FCAA 4G2TA 1DJMA 2GBLA 1QH9A 1ZNXA 4AL4A 1MG5A 4NHOA 3HU2A 3O9MA 5GM2A 3G9TA 1IK6A 1SWVA 1U02A 4M0EA 3VGJA 2FPGA 1DXYA 1PR2A 1FRVA 4XYMA 3W5DA 2AXPA 1NMXA 1XL1A 3AETB 3HJCA 3JQAA 5AOAA 4Q7QA 3S1AB 4CV2A 3KZXA 2MINA 4CW7A 3E4CA 4ZU6X 2YR0A 4DG5A 2ZVDA 5IYZA 1FIUA 2BBOA 3MILA 1TC2A 4A9AA 4Z3KA 2W6IA 5D5HA 4CMKA 3FYDA 3NFYA 4IDPA 3IUBA 1I13A 3H5IA 2D5AA 2Q2OA 3QENA 1JGTA 3TQCA 3TQHA 3KAPA 1ZN8A 2BZ1A 2JI7A 2UZ1A 2UZ3A 3AESA 3HBNA 3KP1A 4N0DA 4PYLA 5JD4A 2DBQA 4ZKEA 1WF6A 1NF2A 4GQAA 3VU9A 4NCBA 3TNLA 5EJFA 1AF7A 3USCS 2K7FA 2JS7A 5FHQA 2PV0A 1XL0A 4IHJF 4I6JA 3NASA 1PNRA 3LUDA 5LP6F 1HXHA 3K70C 1P17A 3PNPA 3N0TA 4MK4A 3EGWA 5BV1A 3L79A 5LC1A 4D0SA 1CVIA 5F2NA 3EAFA 1S6YA 3LCRA 3NJ4A 5JW6A 1Q83A 1AQ6A 1XG5A 2R6AA 3M4XA 3NFRA 4FFRA 4MW4A 1W581 2QRVB 5A4AA 3VR5D 4OBBA 1ZIYA 4JVNA 2Z3ZA 3R5TA 1YULA 3G0BA 1KZ1A 4DNQA 1QF7A 2NSJA 1G2OA 3EQ2A 4LKOA 2RHHA 3ROZA 3U6BA 4OKIA 2PGNA 2ZXEA 1UWLA 1QNFA 4QFMA 1WO8A 2CBGA 4G63A 2LKCA 4CM7A 1YMVA 4GMXA 4RF4A 2HHHB 4Q7MB 2PKQO 2HWXA 2UUOA 2JGRA 1A2OA 3AOEC 3EDQA 3IBFA 3IBCA 3SMQA 5IF3A 1OROA 3JQ8A 3NETA 1A27A 2WOJA 4MI6A 4XWYA 2QY6A 3STHA 4D3XA 3KQWA 1VA5A 1QJ4A 3BK7A 5JJLA 3FNRA 5C3UA 2QF7A 1PNQA 2QRKA 4ETWA 5JJ5A 4ZIRA 4AW9A 2Q4RA 3FIUA 5HRUA 3ZHCA 4JLWA 3GLGB 4RENA 2SCUB 3N2LA 4MV4A 2PMEA 2CFIA 1H8HD 2C5GA 4U3JA 5H8WA 2QD1A 4CLXA 3NHZA 4CQLA 1SHTX 3NQ41 1BOOA 4BU0A 4KRFA 1EVQA 2NZJA 1GR0A 4IO1A 4ZAZA 2I2CA 2GXQA 2VHVA 3U31A 3T5AA 1CIVA 1S9DA 3IP6A 2ZTSA 1GNSA 2AOVA 2JLSA 3ZJ5A 4POOA 1CUSA 2VKTA 3FUWA 4NJOA 3DFUA 5H4HA 3EAQA 3TTWA 5AKEA 3W5JA 1D6SA 1P33A 2C8KA 2WJYA 1Q2UA 4S1OA 1DEXA 1K7CA 3E23A 4KWEA 4YPVA 4N49A 1MOSA 2IDKA 4LHSA 3DM5A 3EHDA 4EGFA 1YDGA 2FV8A 2VZ0A 1UBMS 1A7AA 4ZO7A 3O4RA 3KQKA 5CXSA 1Z68A 3TLCA 1EDEA 4A0RA 4ZCMA 3ANSA 1B1CA 1UMCA 1CK4A 4NJEA 4PG6A 1NW9B 3THOA 2V5UA 3FWHA 3DXFA 1VZ2A 4A6EA 3FWKA 2I4OA 3VVMA 2Z4SA 3F9RA 4C7BA 2AEEA 3L7MA 5BXYA 3BAZA 1CULC 4YUVA 1JR3D 3ENWA 2C42A 3U1TA 4IIJF 4CM4A 2OD2A 3PDIB 3HG7A 5EZYB 4BFWA 1ZM2A 4HNGA 4GG1A 1ULTA 2J8ZA 4LQCA 4RTPA 3FZQA 3QYFA 2GMWA 4QDTA 3B7WA 3AYXB 3DEFA 5A2GA 1PVDA 1XTIA 1PP4A 2C2WA 2XPCA 1JPUA 5BXQC 1GYRA 2V54A 1M66A 2VHQA 3CJRA 3DYVA 1XALA 2DMRA 1ULBA 3IA7A 4KN6A 5AJZA 5EYPA 4P84A 1MX1A 1TKRA 2QW0X 1YBAA 2JFVA 3NB0A 4OQYA 1GQSA 1QIGA 4DLXA 1Q1AA 1G5RA 2WT4A 4NIMA 5KX5F 3RWMB 1SXIA 4MVJF 4BYGA 1Q3KA 2O7NA 2JZCA 1NXSA 3NT5A 2G5CA 3TQFA 4DLKA 2H4WA 5GONA 1RRMA 2B3DA 2O2IA 2IYZA 1Z8NA 3UMMA 10MHA 5F76A 1E5QA 4GNRA 2YOHA 4UDNA 4RCZA 5JHHB 1YVRA 3FWNA 4X0EA 2VSYA 2JASA 3C2QA 1KFBB 5G0UA 2IXTA 3EXHA 5CM2Z 1J2UA 3WLLA 2ZUCA 4NDNE 1FJXA 2Q3HA 1JFRA 4ZV7A 4LN1A 3TGLA 1GU7A 4F7DA 5HOEA 3F67A 1E0AA 3QPAA 4ITUA 1DQZA 3FGOA 4FVTA 3WGQA 2GPYA 1LBHA 2FSUA 3L0YA 3R3JA 4NZOA 4PQEA 5DSTA 4ZCTA 3OHPA 1X19A 1T1IA 1JECA 2WJJA 3UICA 1XQ6A 2GUGA 5J59A 2IF0A 3OIDA 4XTRA 5TQ2A 1AQIA 3RRNA 2QM8A 1ENOA 1W35A 1H1LA 3B6IA 3C5CA 3O6VA 4EX6A 1TEZA 3MTJA 1KAMA 2NQ2C 3LW7A 5BVGB 5A0VA 3GRKA 5EZSA 1KAGA 3FVQA 1LX6A 2VYND 5DK4A 2DUJA 3O26A 4LA4A 4WEOA 1M34A 1UBGA 1IPHA 2BCGY 1L3CA 3LWDA 4QX6A 1K7YA 2HA4A 2HF2A 2VSQA 3LYUA 3WO1A 1E2EA 1ECGA 4B6PA 4DLRA 5TNXA 2ZAIA 1HLGA 1TIKA 5IZCA 1MJGA 2ABWA 5EHZA 2ZZNA 1O7JA 1A9YA 3KQLA 3GEDA 1EVEA 1GNTA 3K96A 1I3KA 1HYBA 3EFEA 3Q5EA 4G5YA 5EHGA 5FI3A 2BFNA 3IIEA 1KZGB 1LDYA 3PR2B 4YLGA 2JIOA 1BVYF 3G68A 4NABA 4C0WA 3HM9A 1E66A 4Q4DA 1RAEA 1H9AA 1X42A 4ZEMA 2YUIA 3S3TA 4PRYA 4FZ3A 2PCLA 3FRHA 3HA5A 5KWVA 2OGTA 2JVKA 2WWGA 4CIDA 4BNXA 2J07A 4FKBA 3WB1A 5I4IA 3JYPA 1L7BA 1GDHA 4UVEA 2P2DA 3NTQA 1A2BA 1QQ5A 2M2IA 3O0DA 3JARA 5LLDA 4MR8B 1REQA 1CDOA 1YB6A 4GOXA 3VKVA 1NVEA 5YASA 2TYSB 2X9VA 3ENQA 3K8OE 3J7TA 4FR2A 3PX7A 3V55A 1WU8A 2RGUA 1C8VB 2ZE6A 3ZZ0A 3QIAA 4WBSA 2J87A 5DX8A 1Z7WA 2VDWA 4AZSA 4YMVA 1R0LA 5DYYA 5IC5A 4L6AA 1XUOA 2FN4A 3ON5A 4ER3A 2J3JA 9LDBA 1ZD3A 3PPWA 1I7SB 1VFNA 3UUGA 2QYHA 3G2QA 2OV2A 3M1LA 3AGQA 3PHBE 2F62A 3ZZNA 1I3LA 5JI3E 3GJXC 1NBMD 3PBKA 4Z2YA 5JAMA 1YBHA 5CR9A 1WVGA 1KEUA 2ENWA 4BLOA 1WPRA 1ULSA 3GDGA 4NOLA 4P4LA 1L5ZA 1YJCA 4INZA 4QBIA 3RO7A 4PAOA 1GPH1 3UPDA 4RYLA 4EABA 5HSGA 3ERCA 4ID3A 4E5VA 1G1AA 2REXB 1WLYA 1TLTA 3N86A 4HB4A 4BBZA 1JHUA 4EB0A 1SKAA 3SLKA 5EPOA 4AMZA 1UFVA 2PNJA 2DULA 3RVDA 3ZZMA 4FTWA 2MSWA 4NYJR 3GR6A 1IUKA 3DBHA 4LAFA 4PFSA 2NM0A 1NSFA 1DX6A 3HUUA 3GUYA 1TQ4A 4F1JA 1QGDA 2NO4A 1DT5A 1EWKA 5AKLA 3WGOA 2WV9A 2NYAA 4BLVA 5BW4A 4IS3A 4DLTA 5JZSA 1JVNA 2G9NA 5AQ1A 3WB0A 1JEQA 4BFZA 4DRXA 5EXTA 1EX6A 1NT4A 1DCMA 1UM8A 2CLDX 1CIPA 3GL9A 1DX9A 3AVTA 4D25A 1Z26A 2P4SA 3BGIA 1P8AA 3VU1A 3TBKA 2YY7A 4NEQA 3PR1A 1LKZA 1M1UA 2YOGA 3TOXA 4W9MC 1UJ2A 1WP4A 2FPGB 3ND9A 1G4AE 1NP6A 1T3GA 3ES9A 1U63A 2RB4A 1ISPA 3PHHA 2WPNA 1XD8A 1G2PA 1V2HE 3JQAB 2XZPA 1G66A 5CW1A 4AY5A 1UAAA 3H4VA 1S9HA 5K6AA 2VNJA 3LO5A 5K0NA 3R9KA 5IYZB 1UWVA 1RT9A 1RADA 2F1IA 3H8JA 3PCTA 4UM8B 3UN1A 4B4WA 4RFVA 4FJ0A 3L8FA 2P1DA 4RK4A 1ODIA 1S4QA 1KO5A 1OWNA 2XB9A 5A5VA 4QICA 2O8FB 2BW0A 2UZ1B 3AESB 3GFOA 3IPRA 2CLMB 3P0EA 1SH7A 2A4KA 3M3HA 4EYOA 3VU9B 4XRRA 2CCGA 1V6AA 1U3UA 3C6KA 5IK2D 1DAPA 3H9JA 5ALTA 1GT91 1FP6A 3LDHA 3SDZA 3NBYC 1NBOA 4L5IA 3TI9A 1CUBA 4PSCA 5EHQA 5JE8A 4LV5B 1OI2A 2RSLA 3ZVNA 1VJ1A 2MR5A 2X86A 1DEHA 2ZRAA 4TTIA 4LZJA 3FPSA 1IFXA 4ND6A 3L0IB 2YZ7A 3MZ0A 3O8NA 1NMSA 5HMLA 4HH3C 3V7FA 4EPWA 1X94A 3T7CA 5HEKA 3EDRA 3FDFA 3K9QO 2JRLA 3L7IA 3O4IA 5B12A 4UEKA 5LKAA 4G3XA 4BYMA 1XLTA 2NNWB 3VR6A 4M9QA 4D5EA 2XTAA 2WC1A 3A70A 2DBVO 5C8DA 1NDQA 3FB1A 1G64A 2FGKA 5L7YA 3U13A 4B0PA 1Z8DA 3K6RA 3NAQA 5ES4B 5JATA 4HL6A 2IBSA 3KSRA 1YRHA 3VKWA 1KI8A 3JQ8B 4HBGA 2VN8A 4G0UA 4G1EB 2VUHB 1OBFO 3CISA 2ZREA 4MJ3A 6CHYA 3DR3A 1QDLB 3FN4A 3MIIA 3L4EA 2A0UA 4Q1DA 1TFRA 3KQYA 2XGOA 3BE8A 4RWEA 3SR3A 2RGRA 4X7BA 1QZXA 5BN3A 2JFOA 4XEUA 4L74A 4B85A 3RSHA 3IAEA 4D8XA 1NVDA 4ZIRB 1TKAA 5IDQA 5EE1A 2BR4A 5AW8A 1TCAA 4LNHA 4O4JF 4DVJA 3AHEA 1P4JA 1DOAA 2LCQA 1PFWA 3TH5A 1J2YA 1UBNA 2ZBGA 4ICIA 4MWOA 3G1WA 5LDDC 4CQLB 3GP8A 4E7PA 1OPXA 2PSHA 3S55A 2O1SA 1RKVA 3C5VA 4ZVPA 4M22A 4YLYA 4DPMA 1LQ2A 2D7DA 3TUZC 1DB3A 1SWWA 3K8YA 2Q46A 3TSCA 3ZIAA 2PJRA 1HPLA 4XUGB 3K2QA 4RESA 2PL9A 5CA1F 5ANRB 1SG6A 2BFFA 4K2HA 3TINA 3CRVA 4R2HA 3X1WA 4A0SA 5GIOE 2QPOA 2JKYA 4C4YA 2PSSA 1GO2A 2P35A 3OQBA 4GPEA 4HXEB 4KTTE 3O83A 3S8EA 3TR6A 1BDJA 4Z54A 4LY3A 1L5WA 4ZVVA 2C7VA 1XAHA 2ICAA 2FPPA 1CUWA 2F4VB 3O47A 1IZ7A 4UZEA 3SXJA 5BUSA 3O1JC 1UMCB 3O95A 4NJEB 4A5SA 2F2TA 1TVCA 2C5HA 2D2EA 3QWHA 5FTWA 5GQSA 1BCRA 3M6VA 3BDVA 4QU5A 3NHFA 2Q1WA 3FPKA 3ZWOA 2J5BA 5H9VA 4RVHA 4JB2A 5DBOA 2QRZA 4ZYXA 1ZR2A 2QP9X 4WCFA 5DISB 1NNUA 3KWFA 4FBMA 4M0KA 2AFVA 1B6TA 1FTGA 1UK9A 1W6UA 4KWHA 5AVOA 4CM4B 4U9IS 2ASVA 4L0CA 3SI7A 1W52X 2QNIA 4EY6A 4LOIA 5MGBA 3IUNA 4RV4A 1CIJA 1Z5GA 2B2CA 4H17A 4PBSA 3BHNA 5CTAA 5EY5B 4ZI5A 2JJ2A 2FW9A 5JJIA 1NW4A 1COWA 4CODB 5EYPB 3GRVA 3OFVA 1DZ3A 1H4VB 1XFAA 2WSLA 2EZ8A 3OKFA 3PXCX 4F84A 1G6KA 3SIWA 4GSKA 2IVFA 3KO8A 1OAKA 1R6AA 4YLEA 1MOZA 3WP1B 3DT8A 4F46A 2AQHA 1XCMA 2VDMB 2QN8A 5GONB 3VYRB 1QG4A 1STOA 2ZT8A 4KVZA 5F2KA 4ZQIA 5T4FA 1ISIA 2HPVA 1G3IA 5DDIP 1TM1E 3RUAA 3I58A 1U2QA 5E38A 1IUNA 1EFVA 2HCFA 1PT5A 2CNNA 3AL2A 3EXHB 4GBED 3DE5X 4FFPA 1TKCA 2PRJA 4QBTA 3BIOA 4GDMA 5AM1A 2OBNA 2Q5OA 1FYXA 4FHZA 5J9FA 2LZ0A 2OLKA 4OGGA 1ODCA 3GUCA 4TV9A 4ZOCA 5KOIA 1H8EA 4ZOBA 4I1PA 2GJSA 2UVDA 3IJRA 1R3UA 2YWGA 4HADA 4FMCF 5AVVA 3FDZA 2XKAA 2IS2A 3TAHA 3QEBZ 1HFWA 4L8GA 4LJKA 4NS4A 5D01A 5L3QA 2HPZA 2J3EA 3W6PA 1QF6A 4JAVC 1HG0A 2PSFA 5K8JB 2PX6A 4HDAA 3ZE0B 1W5SA 2FWPA 1JWAB 2O3RA 5AVQA 2Q2VA 4QARA 2B98A 2HOQA 5TQ2B 1LCIA 5F5NA 3RPEA 5BYKA 1QFMA 1H1LB 1JTVA 3VVLA 3G0HA 1VMKA 1G6HA 1K8QA 3F96A 3QOFA 2BEVA 1M0TA 4GR5A 4OL9A 3VISA 2RGXA 3KOXA 1JSXA 3CIFA 3VTKA 4FX5A 4AROA 4WNAA 2J0VA 1KWGA 4WECA 1WOYA 2P67A 4JJIA 1RJDA 4O2AF 2IHBA 2WDZA 3DOJA 2G1JA 1V8BA 3K6SA 4GBJA 1PFVA 4EY8A 4JLDA 5IMBA 5A0FA 1HX7A 4BJHB 3UWKA 3WYAA 5LBIA 5LD2B 1JXMA 4MULA 3IQHX 4R8RA 4GP6A 1HYEA 3C3AA 1SMKA 1PJ3A 1K9SA 3TZLA 1N77A 1PFYA 5AKJA 1B93A 1P7VA