4KPUB

Electron transferring flavoprotein of acidaminococcus fermentans: towards a mechanism of flavin-based electron bifurcation
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
263
structure length
263
Chain Sequence
MNIVVCVKQVPDTAEMKIDPVTNNLVRDGVTNIMNPYDQYALETALQLKDELGAHVTVITMGPPHAESVLRDCLAVGADEAKLVSDRAFGGADTLATSAAMANTIKHFGVPDLILCGRQAIDGDTAQVGPEIAEHLGLPQVTAALKVQVKDDTVVVDRDNEQMSMTFTMKMPCVVTVMRSKDLRFASIRGKMKARKAEIPVYTAAALEIPLDIIGKAGSPTQVMKSFTPKVTQVHGEIFDDEDPAVAVDKLVNKLIEDKIITK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Electron transfer flavoprotein alpha subunit
publication title Studies on the Mechanism of Electron Bifurcation Catalyzed by Electron Transferring Flavoprotein (Etf) and Butyryl-CoA Dehydrogenase (Bcd) of Acidaminococcus fermentans.
pubmed doi rcsb
source organism Acidaminococcus fermentans
molecule tags Electron transport
total genus 78
structure length 263
sequence length 263
ec nomenclature
pdb deposition date 2013-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01012 ETF Electron transfer flavoprotein domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4kpuB00
3TQIA 3SZGA 1ULHA 2DLCX 1WQ4A 2X0KA 3BL5A 1HYBA 4ZCPA 4BWVA 1WXIA 5LLTA 4ND6A 5LFAA 4YP6A 1MOPA 2G36A 4DNXA 3FI0A 1F7UA 4ZT4A 2JANA 3IUEA 2CYAA 3CLSC 1M8FA 2CV1A 1Q11A 1XNGA 1YI8A 3FNRA 3ILVA 4R2LA 4F4HA 4RPIA 3ZUGA 2DEUA 4MWDA 3RBAA 5LM3A 3MLBA 3SDBA 4YP5A 5HG0A 5K0SA 1N2JA 1N77A 3RFFA 1I6MA 1GLNA 2C5SA 2HGZA 3TQOA 4CDMA 2A84A 2I1LA 2V0GA 1IH8A 2HZ7A 1GPMA 2DR2A 2A1TS 1N2HA 1WJGA 3COWA 1J20A 3GUZA 1U7XA 3G59A 4KKVA 1T6ZA 2O5RA 5DK4A 4XSVA 4YP7A 1ILEA 4KPUA 2Z3VA 4MVXA 4MW5A 3NV7A 5H16A 1F4LA 1IRXA 1O95D 4G5YA 4EG1A 1JEDA 3H9CA 3AIIA 5EKDA 1D2RA 4Q93A 4EGAA 3U1VA 4RUKA 1EUYA 4U8HA 1GTRA 3ZXSA 1MBZA 3CR8A 2ZUFA 3DO8A 2QUHA 4MUGA 4MW0A 3PNBA 4U63A 2NSYA 4MUHA 1K4KA 4NAUA 3AG6A 3P0HA 3S3TA 1N2EA 4MUIA 1Q19A 1I2DA 1G8FA 3CLRC 3PRHA 3ZJVA 1EFPA 2GM3A 4EG3A 5J59A 4NX2A 4JFAA 3TNJA 4AQ7A 2D13A 2Z08A 1H1TA 3RHSA 4ARCA 2IP1A 1NURA 4GRIA 3QE4A 2WSIA 3IVXA 1NSYA 4DDMA 3H05A 2YWBA 4G5FA 1YIDA 3RK0A 3CLUC 3RK1A 3LOQA 1EFVB 3Q12A 4MUEA 2EJCA 1JILA 2DETA 5JBNA 2BYTA 1NZJA 4JXZA 2QTRA 1MJHA 1JECA 1PFYA 3COYA 3FG9A 1J70A 3P0IA 1SURA 1OWMA 3OP1A 1N2IA 4NAHA 1XJQA 4YBRA 2CFOA 1KAMA 4AS1A 2VTBB 4MLPA 1U0BB 1LW7A 3FETA 3TZLA 1WXEA 3A2KA 1G59A 5AHWA 1VBNA 1F7VA 3G6KA 3X1KA 2J4DA 2CT8A 1GAXA 1V8FA 1TQ8A 3GMIA 4KR7A 1NI5A 1TYBE 3X1JA 2QJTA 1I6LA 1M8KA 2YY5A 5TEVA 2AKEA 3E27A 1M1ZA 4QBTA 3H99A 3H9BA 3PNYA 2A86A 4CQNA 3KT0A 4HK4A 4PBTA 2A1UB 2GOYA 2QUJA 3VGJA 1KQPA 2DXIA 1JIKA 2XRYA 3M5WA 3K32A 3VRHA 1PFWA 1TYAE 3DV2A 1GTSA 2NZ2A 1A8HA 3GLVA 1TFUA 1KQNA 4H3SA 1VBMA 1T6XA 3UY4A 4ZT7A 1QU3A 3AG5A 2D54A 1JIIA 1Y42X 2A1UA 1EUQA 4MWBA 1PFUA 1WQ3A 2YWCA 4QREA 2PXHA 4OUDA 1N2OA 1NUUA 3LE8A 1O95C 5TGTA 3HFJA 1N1DA 4JXXA 2QJFA 1BS2A 1NUSA 3HV0A 3N05A 2J5BA 2DUMA 1U3CA 3FY4A 4KPUB 4ZCSA 1IQRA 1GZUA 1MAUA 1PG2A 1O0BA 4I6JA 2RD2A 3I05A 1GN8A 2WB2A 2CV2A 1R6TA 1R6XA 3F3MA 3VU8A 3D6VA 1XNHA 4ZCRA 2E89A 2QTNA 5IHXA 1O94D 3ZJTA 4XFJA 1O97D 3MMXA 3N9IA 4K0RA 3G5AA 1O6BA 3MLAA 5DEOA 4JYZA 1EFPB 4UZEA 1K97A 4MVCA 2RE8A 2E0IA 2R5WA 4DJAA 3ZJUA 1KH3A 1NUPA 1JMVA 3ELBA 1KP3A 5FNZA 1X6VA 2XRZA 1O96B 5F23A 4HPWA 3AFHA 3CLTD 4EG8A 1WZ2A 4MW7A 3IODA 5KWVA 1K92A 4EF6A 1WXHA 1DNPA 1MAWA 3HZRA 3ND6A 3RJZA 3ISJA 1KORA 1WY5A 4NZPA 4U7JA 2J09A 2WQ6A 2CUZA 4EG5A 5FO1A 4ZT6A 1O96A 3CVVA 4NDAA 4MW9A 4MVYA 2PZAA 3ZXIA 4MWCA 1NUTA 4MULA 4ZT5A 3IMEA 3SEZA 1KR2A 3L92A 4EFKA 3SYTA 1RQGA 5J5AA 4ARIA 4MUKA 1JEEA 1JZSA 3IUBA 1NUQA 1ZJWA 2IELA 1KH1A 1LI5A 1TYCA 4TS1A 5TEWA 3COZA 4EG7A 4G6ZA 4YMIA 1NYLA 4NATA 5J58A 4ZCQA 1J1ZA 1UFVA 4MWEA 3FHJA 1T9GR 2E21A 4PBSA 4L2IA 2H2AA 5TS2A 2A7XA 1J1UA 4WNYA 3HGMA 1EJ2A 2IJGX 1YULA 4DE5A 3ND7A 4J75A 1N78A 4QRDA 4EG4A 1JHDA 4MW2A 3MUEA 4ZCTA 4GU5A 1VLHA 1QTQA 1QRUA 3PXUA 4ZT3A 1MRZA 3QTTA 1OWPA 5KCMA 2CYBA 5DB4A 4OUDB 1J09A 4CDNA 4PY2A 1MB9A 3IMCA 1O0CA 2JAXA 5HUHA 1IQ0A 3CLUD 3Q10A 3AKZA 1YUNA 1IQUA 3Q4GA 1KP2A 4ZT2A 1LI7A 4MW4A 4J76A 1QNFA 1N75A 3HMQA 2OV4A 4DDKA 3TZEA 1KKUA 1M8PA 4DLPA 1O94C 1O97C 2DPLA 4XFDA 1EXDA 4F3RA 1R6UA 3K9WA 2DERA 1Q15A 4R2MA 4KR6A 4K03A 5BNZA 1IVSA 1O5TA 1WXGA 1PG0A 1VBKA 3KT6A 2Z09A 4HJRA 2VXOA 1B6TA 3D6UA 1QRTA 1JZQA 3DLAA 1COZA 2WQ7A 3FIUA 2ZP1A 2BTEA 3SZ3A 2QJOA 4MW6A 3CVXA 3CLTC 3N8HA 3ZIUA 2X1LA 3P52A 2A88A 3FOCA 1T9GS 2PZBA 1OWOA 4X0EA 1TEZA 1NP7A 3MXTA 2X3FA 3JXEA 5IJXA 2CSXA 2PG3A 3IOBA 4CT0A 1IHOA 1N2GA 3UK2A 1VL2A 3FWKA 1H3NA 4EG6A 1U7DA 4UZFA 1X8XA 4S1OA 3UMVA 4E1AA 2CV0A 2ZUEA 3IH5A 3TS1A 1TYDE 3NBAA 3X1MA 4HJXA 1ZH6A 3CLSD 3OTWA 3CA8A 1PFVA 1MC1A 3C8ZA 3H97A 4MUJA 1EE1A 1I6KA 1IFXA 3CVWA 1FFYA 1OBHA 3INNA 3KT8A 3A4IA 3KFLA 2GKSA 4DDHA 3SEQA 2B7LA 3LCJA 1OD6A 4MAFA 1ZH0A 1QRSA 3A05A 2OQ2A 1YIAA 3FDXA 1QQTA 3AL0C 4A91A 3PNVA 3P0JA 3IOEA 3ND5A 2QUIA 1K4MA 5DASA 3IVCA 1KQOA 2YXNA 2AG6A 2O8VA 2PZ8A 4MUFA 1G8HA 2JA2A 4L2IB 1CT9A 2X1MA 3A04A 1JIJA 1H3EA 2PFSA 2J08A 4R0NA 4MQ6A 3IDFA 3COVA 3QTBA 1M8JA 2QUKA 1KH2A 3ZGZA 1WKBA 4I6GA 1WOYA 1M83A 1OWNA 3FH0A 3UC5A 2V0CA 5HUJA 1J21A 2PIDA 3IMGA 4OJMX 1P7PA 1FYDA 3N2YA 1N2BA 2J07A 1V47A 4JZYA 2TS1A 4MVWA 2HMAA 4FZJA 1G8GA 2EL7A 4PBRA 1KAQA 4WSOA 3CLRD 2CYCA 1EFVA 2A1TR 5FO0A 1U3DA 2AZXA 3IVGA 1OWLA 5K0TA 3CVUA 1Q77A 4P2BA 1YUMA 3SP1A 3UOWA 4KR9A 2A4MA 1OBCA 3NBKA 1F9AA 4Q16A 1T6YA 1M8GA 1WXFA 2E18A 4MW1A 5H7XA 5KHAA 1QU2A 1S4MA 2D5BA 3CVYA 1ZUNA 3DPIA 2VTBA 1MB2A 3KT3A 4I6EA 4ND7A 3L93A 2QTMA 1XNJA 3HL4A 1JGTA 1N3LA 1QJCA 4MUNA 1H3FA 2H29A 3IOCA
chains in the Genus database with same CATH superfamily
5HS6A 4MDFA 1E0AA 4FFBA 5K03A 1LWOA 3GAAA 3ILSA 5ENZA 2QYOA 1KI3A 5CH8A 3BRQA 1U9JA 3TW8A 1AHHA 3ACDA 2PEZA 4E21A 4ZQCB 1LPPA 2IEZA 1MOPA 1PHRA 5IKPA 2ZTHA 3S2EA 2JJMA 3K9CA 1WCWA 3OP4A 1GUBA 3R09A 4KH0A 4Q4HB 5EWJA 1FFWA 3ACBA 3VX3A 3DF9A 4D44A 4R2LA 4RPIA 1MHPA 3UBMA 3DB2A 3JASB 3R0VA 4WBNA 2DEUA 5CVVA 4H4EA 1M1YA 3WWOA 5FBHA 4EW3A 1A97A 1XVAA 5CVUA 3G0BA 2FMTA 5TF4A 2OVFA 5C8XA 2QV7A 3DDWA 2CHQA 2VBCA 2GXAA 1B7GO 1RLJA 3R8XA 2ORWA 1CX9B 4H1WA 4BN5A 2NO4A 3WB9A 1F4VA 4QX6A 1W4ZA 4CW7A 2DU8A 3R3ZA 2OD7A 4L74A 4ZI2A 5BWCA 5A04A 3V1UA 3GUCA 3Q8MA 2ZRPA 3SM3A 2YJ6A 2VCHA 4DJ5X 2GJAA 4J91A 4GOMD 3UJ8A 4HWPA 3TBKA 3QLVC 3HKCA 3G59A 1OAOA 1UKVY 2ANBA 3B51X 3C16C 1JG4A 3S44A 3NTOA 4U7PB 3V42A 4WX2B 5LCXA 4GVLA 1W36B 2PGLA 2JS7A 5HZHA 3C85A 3B8EA 3QWFA 3C2QA 1E3JA 4PIPA 3HVRA 4AY6A 1M1NB 2PWAA 3NBMA 1SCDA 4R8VA 3TB4A 2WHRA 3RB8A 2IEGA 1UDAA 2RG7A 4JIGA 4B8WA 4DR7B 3HCCA 4MV0A 2OFWA 2GYVA 5F5LA 3SEAA 5MN4A 1ULTA 4NONA 1NWHA 1UBFA 1YFZA 2ZUUA 3BXPA 2AT1A 4NYJR 2ALJA 3UK6A 2CNWD 2Z4SA 1IUNA 2XMDA 1NNEA 4C7KA 1CZNA 4K9NA 5KKNB 1N6HA 1YQ9A 2MU1A 3H5NA 2X15A 3EY4A 4P5DA 4CDRA 4YJ3F 4ZOBA 2D13A 5K3OA 4ES6A 4I55B 4I1RA 1H1TA 3HKEA 2ACEA 2OD2A 2RSLA 1BVHA 1PJ4A 1QKIA 1WD7A 5JMWA 3LGAA 4DDMA 4CIYA 5E3HA 1DWPA 2QYTA 2NUBA 2YWBA 3FB4A 4GQBA 4DUPA 3KETA 3FKJA 4H3KB 1SKYB 4LE2A 3OMLA 4HDSB 4Y6SA 4TVKA 4YRJA 3PR3A 3IPYA 4YMGA 4KSYA 3U3KA 3B1XA 4BOYA 4HLDA 3B13B 2HSGA 4R81A 3IV9A 4N8SA 3D8RA 1ZCZA 3YASA 4OY3A 1P0QA 3IXQA 4D25A 1ZHHA 2BEUB 2RH5A 3Q7QA 3RRBA 3RBZA 3RC8A 2VDLB 3BDVA 3KKNA 1W1WA 4PZLA 4YJKA 4UFOA 5D86A 2HL6A 3G68A 3GRFA 1XJQA 4MJ3A 4UEOA 5FUWA 2XVXA 3WIDA 2VJPA 3C3JA 3NDIA 2PMBA 5I7VA 4ZZ2A 2JFOA 2QRZA 4JGGA 1EK0A 2PTGA 4AS1A 3L8ZA 2PKWA 2XWPA 1ZUNB 5JCXA 2C2YA 1TIKA 1GAEO 2WFLA 1BXGB 1UKBA 2AZDA 4NTZA 4O4JA 1VPLA 3ZWBA 4F5WA 1TU4A 5JNRA 4R16A 3NLLA 3DQPA 3P9RA 2XWBF 3UVEA 1UL1X 2ZSBA 4OFWA 4UM9B 4AVYA 4A6XA 1VMDA 5AKJA 5FP0A 5EJ4A 1MMFB 1NBWB 4P9NA 1T8WA 2VP4A 4DEVA 4XQEA 1YRLA 5ES3A 4PPGA 1W48A 1MEJA 5A3RA 2JGEA 3NONA 4G4SP 5L7WA 1J9ZA 2JJYA 2OBBA 2CE2X 1M2GA 1TA4A 2C4WA 3KKEA 3OC6A 1PEYA 2PSEA 1Z2NX 4ZC8A 2CMHA 1QHXA 2Y1WA 3ZWMA 4E1BA 4XX0B 4U2KA 1CJCA 2FN4A 3ZGLA 4EB6B 1ZH8A 2AOXA 1WPXA 4YHHB 4W5OA 3D0RA 4XPIA 4TXJA 1UM9A 5GINE 1LDGA 3DFIA 4CLRB 3UWKA 3DV0B 2GF2A 1TM3E 1JAYA 4M83A 1GEEA 1QHSA 3KHUA 3OF2A 4RHTA 1X94A 1EFHA 2VNKA 1DRVA 5JCPA 5HWSA 2H1SA 1IHXA 2XBLA 3AY3A 3N8KA 1YB5A 1XPOA 1VCNA 3MQ2A 3UMRA 2QMQA 1EUQA 4GYKA 3AL3A 1U94A 2FUCA 4QREA 4BQFA 4UDXX 1EMDA 1FQWA 3WGMA 4F06A 5AD1A 1DZIA 1Y6GA 3LCVB 1A5SB 1E79A 3BGIA 3JQ8A 1ZI9A 4LY0A 1VMKA 5F77A 5BSMA 1RRFA 3EFHA 4D4GA 1JR4A 4IJQA 1PTJA 4NHEA 2KLHA 4S12A 3TIIA 1I3OA 1N1DA 1LDEA 3RDPA 2IPMA 3SKYA 5BSFA 5I9IA 3W79A 4GI3A 1A7KA 1LPBB 2RGEA 1SXJC 1QIEA 4K9PA 1M75A 3E2MA 3CZ4A 4MVJH 3LJKA 4NOJA 1R6AA 1Z08A 1W88B 1R9JA 1IUPA 3AJRA 4KVFA 4WKBA 4Q01A 3G2PA 1WZNA 5CJ2A 5EPOA 1T2VA 3I05A 3UV3A 4XYMA 3V7WA 2WKSA 3STVA 1P0MA 4EUNA 1LF0A 3WGKA 1R6TA 2LTAA 2ZS7A 4YQZA 1N0HA 1RBMA 3HK2A 2O8BB 2WSYB 2FE1A 2WJ6A 4X20B 2UZ0A 5SV2A 3DHYA 5AXAA 2O8FA 1MNAA 2A92A 2DWQA 2EBHX 2VJKA 1EVJA 2QI9F 2MIIA 2AA3A 1VG1A 3UGQA 4NBUA 3IQIX 4DBZA 4FUQA 1EK6A 1WD5A 1CDDA 2XD9A 4RE6A 4TUYB 5AK5A 4BMNA 3KVOA 3VJLA 3AI2A 3UFBA 5DEOA 1HLFA 5L7YA 2CKDA 3DHWC 4KRXA 1X74A 1A5TA 2PR7A 4MVCA 4I4TA 4YALA 1T4CA 5D8DA 3TW4A 5E1MA 1F5SA 1S2OA 2QRHA 2X6RA 1JIUA 3DLIA 3EQ2A 3INYA 3M5PA 4GBED 1FU7A 2BJVA 2DECA 3RT7A 2R5WA 4WY8A 2A9PA 5I51A 3ER9A 2VQEB 4N40A 5DM0A 2RHDA 4GOND 1GAWA 2ANCA 4CG0A 4KG7A 2VJYA 1SVIA 3FNGA 4BE7B 4M99A 1V5GA 2JKZA 3KSDO 4Z9YA 5H9WA 5F4ZA 3AFHA 4U0JA 1R0CA 4X97A 3EJ6A 3EWAA 4QU8A 4JVNA 2HW8A 4M0EA 4MJLA 1KO1A 3S2YA 2ZFUA 3TVDA 3WBJA 4N7RA 4DMMA 4D6YA 1IIRA 3RRZA 4LHZA 2CL7X 3HNPA 3NW9A 2VPYA 3R7DA 2YWRA 1NZDA 1KYYA 4KL8S 3U4CA 1UT8A 1B0AA 1P4AA 3DMGA 1P44A 4BFSA 1YVEI 1NXTA 2ZIFA 2OORA 4GPBA 1UOPA 2R8OA 2XF2A 1J39A 1H42A 2VSYA 3FVWA 3UV6A 3ZBPA 3WWYA 1YCGA 5DM70 1G20A 3MBOA 1QTIA 2P91A 3VR2D 3GRPA 1W9HA 3HS3A 1DT3A 2PS9A 2C0QA 3OX3A 1ECLA 2FZGA 3IMEA 4J16C 3SEZA 5CG1A 4WGFA 3WP0A 4XZ3A 3W2IA 2X41A 2FWMX 2P27A 1UJ5A 3FKQA 4QEKA 2B1QA 3H0KA 3T4PA 3WTCA 1YDGA 4R83A 3KXPA 4LDAA 1NUQA 2R751 2C1XA 4FDUA 1U0LA 2VN8A 4TQUS 5ILGA 3ZWXA 1KH1A 1UDXA 4KIFA 4GDFA 1KC3A 2QRUA 3BF7A 4N5HX 1P75A 2I7XA 2K7ZA 2ZUBA 1F3LA 1YMUA 2PSDA 2I3BA 3NJ4A 4WWHA 5T57A 3K6JA 4L9SA 4Q7JB 2IH2A 2A78A 1ZL2A 4TLEA 2H2AA 3LAWA 1BE0A 4QULA 2X9VA 1HOXA 2FFHA 2YYSA 3ANSA 1LRKA 2HA4A 2B20A 4IRMA 1KJNA 3B3QA 4WINA 4PCAA 5JT1A 4S04A 1DHTA 1L7NA 1PDWA 1RHJA 1TFRA 1XZHA 2DVMA 4PHTA 1TE2A 1U0RA 4J1QA 4FYXA 4UUNA 2R1TB 1IXSB 3ETJA 2Q4EA 4PG4A 4WT7A 1QTQA 5JECA 3PRJA 1E7SA 4LTDA 1T5BA 2X3YA 3TRKA 2CXSA 5DNAA 3CM0A 3H1GA 1UEIA 2OHIA 4IR7A 4TS9A 1IBMB 1Z47A 2D06A 2JPDA 3K9HA 1ZZEA 3LRXA 4JUIA 3V3KA 4DIUA 5CX1A 1KA9H 4BKRA 5CRIA 1SBIA 4CCWA 3VC2A 5A6VA 5DN6A 1S0UA 3CR3C 3L8GA 1JG1A 3PTAA 3NYIA 3AY0A 5FF9A 1KETA 3NOOA 3N0WA 3DHVA 3DLPX 2HBZA 4O02B 4KMMA 3DD1A 4TYPA 4AZVA 2QNBA 4RJ2A 2HIHA 3LSTA 4NFLA 5BN3B 3KJXA 3FGZA 3OD1A 3QU2A 3UICA 3ABZA 5LJIA 3TLYA 2D6FA 4NYIR 2JH9A 2JAHA 2VZLA 3QMMA 1MTZA 1AN9A 1DKQA 2BEWB 5DMHA 2DERA 5GZ1A 2OK8A 3CVJA 1N4AA 2FHPA 4Q34A 2Y4NA 2JFVA 2ODQA 4NMWA 3V8EA 1VSBA 3CXRA 2JAQA 1NNUA 1UODA 1XELA 1YJQA 2WWHA 3BKWA 4PYIA 5EHGA 2G5PA 3R76A 3UAYA 2QN6A 3KT6A 3EZXA 1B6TA 3BGSA 2M2IA 3SX0A 2D7DA 3RS7A 1X1CA 2R6JA 2XQGA 3ED5A 3MCUA 4G56A 3TIVA 3MTAA 4H7KA 4C5CA 1IUOA 3LKBA 3RS0A 4A0SA 4J1TC 2X4GA 3KEOA 1E18A 4URHA 2REXB 2OFPA 2FZ5A 1BFDA 3A4LA 1KRWA 4LC9A 2P9FA 3R6DA 1QX3A 4X1IA 3ZIUA 2I3AA 3KYCB 1J42A 2H4YA 5EE0A 2OTCA 4RETA 2C20A 3CEJA 3QVJA 3PUXA 4J2HA 3WK5A 1IEQA 4M9RA 4RM3A 1MX9A 2RAVA 4V1CB 3PUKA 2B69A 4FB5A 4E13A 1OH8A 4F3NA 1O03A 1HQYE 1K5GA 2ZYSA 4D79A 4WKPA 2XOEA 4JI8B 4L4UA 4CCYA 2CEKA 2Q4RA 1O8CA 2O4UX 1TT5A 1IOZA 3T7DA 2D0DA 5FOVA 2FPIA 3O4VA 4ON9A 3ZK7A 4BZWA 1JG2A 1YRHA 4JLSA 4EY8A 5CDFA 3TOZA 1MW8X 1YGPA 4EFLA 3VHXB 1X7ZB 2OCYC 3AOGA 4Q37A 2NAPA 4ZI7F 8ATCA 3OZGA 5I7HA 3SHWA 4Y3UA 5CAEB 2W43A 4BFZA 5IANA 3NBQA 5JR3A 2WTMA 1IFXA 3FDIA 3GRCA 1I10A 4HO1X 3GLGA 2XBUA 4Y7CA 3VI3B 3KFLA 3ZW7A 4X54A 4B80A 3JVUA 1DS6A 1X7WA 4ZQIA 3SEQA 2ZE7A 3QX9A 4HWKA 3FHTA 1TAHA 2YDXA 1NRWA 1NX6A 5ALJA 2Q8QA 3UNXA 4BX2A 5KDDA 3ZDRA 3KWLA 3KUDA 1Q7RA 3FX2A 4QQ8A 1KSGA 3G79A 3V8BA 2PKCA 5H3HA 1G59A 2GWRA 4Y9SA 3ENVA 3IKMB 2BUAA 1J2TA 2G71A 4II3A 4ZJZA 1RLMA 4B3GA 4WGGA 1KQOA 5JJIA 1SXHA 2QKYA 2PZ8A 2DFNA 2JA2A 2PBRA 1IHPA 1IATA 1U9ZA 1UANA 5CT6A 1AD2A 2PX6A 1RJEA 2R6HA 1HETA 3ML1A 4HBZA 1ODJA 3KVVA 4AROA 3QTBA 3E5MA 2AC7A 4WN3A 4C87A 3QZUA 3GWZA 3LA8A 4CIBA 1XNQB 5AI6A 2QN8A 4D4JA 1XQVA 1M83A 1TRHA 2Y67A 4G3XA 5EZYA 3L0ZA 3NASA 1GL3A 5HSGA 2BHNA 3ZN2A 1Z2PX 1N2BA 3L7OA 4KACA 4LJ9A 2MSDB 1QOPB 1Z39A 4ABYA 3O6VA 3BJZA 3URMA 1JHZA 2P68A 2Y27A 3BMCB 1AUXA 3EF0A 1DJPA 1H2AS 2X2OA 4JBNA 5JVDB 1QS0B 3CLRD 3UHPA 3W6ZA 2JCBA 4XVRA 4GRAA 1QG0A 1W8DA 4Z9BA 1PK9A 3O83A 1GDTA 2CCKA 1MB3A 4FSDA 1JHXA 3L06A 3ZE9A 3LC0A 4HFRA 4AXXA 5CDYA 1PR4A 3VDQA 3GROA 1Z6GA 2O1EA 4LYDA 1KZYC 3OBBA 4A36A 4B7AA 2JNWA 4H7HA 4DLNA 5JTUA 2OM2A 1D3AA 2P6UA 4W7IA 3AWIA 2VXBA 2AJCA 4Z4HA 4QZVA 5DGIA 3HKBA 4V2UA 3RSQA 1KAGA 3NOXA 1HE4A 4MUAA 4N8DA 3EXEA 3DMFA 3KOXA 3HVJA 2C07A 3SF8B 1HG1A 1UMBA 4Z99A 1GIAA 5WRFA 5LA6B 5I01A 3C5EA 3G8AA 3LX4A 1B76A 1D2HA 2QTWB 2AC4A 1H3FA 2GZSA 4YRTA 5KVQA 2WWGA 3QY9A 1Z8NA 3WYDA 1WXWA 4LXXA 5IF9A 4AG3A 3HU5A 2ZOSA 1VE7A 1WHTA 3PX3A 3LC2O 3Q85A 2ZK7A 3T7EA 2O8CB 3LP5A 1WQ4A 4ZOLA 3W3AH 1F0NA 3I9JA 1FDUA 2VNHA 5EIEA 2QBYB 1OX6A 4HLQB 1YA4A 3AFIA 4UE3S 4CHTA 3K71B 1KK1A 5DNEA 1YKSA 1U31A 2BIFA 4EJ0A 1KI9A 1KSJA 3DXFA 5ARCA 1JYEA 3UWPA 1XAHA 3NRCA 1HXHA 5AVQA 1AKYA 4LBZA 1XD9A 3CLSC 5COBA 1HQCA 2PRKA 1GQSA 5KSYA 3CZCA 3GEEA 1UK9A 2J9RA 3PDIA 1JE1A 1RIIA 2ZI9A 3B1JA 4P53A 2OG2A 1DOZA 1A9YA 1CEQA 4D0LB 5KMGA 2P1RA 2ZTLA 1H2WA 5ALRA 3ZD9A 2HGZA 2BFEA 3DWFA 2ZR0A 2EYQA 3FFTA 2QE7D 4YGYA 4I2NA 1SG0A 1TZJA 1PUJA 1X19A 2PMKA 4NI5A 4XRGA 2V0GA 1DELA 1J5EB 4ZYLA 1UM8A 1ONBA 1U7HA 2P4SA 1Z0ZA 4FEYA 2ZBFA 4MGHA 4A1OA 3OIYA 5A9RA 4R1SA 1Q20A 1XYGA 2WNIA 5BR8B 4FB4A 1VL6A 5FL3A 1W29A 4MVXA 3KO8A 4X1OA 1EDEA 2UVPB 3UCXA 2CNLA 3ABSB 3KTFA 1VKRA 3N6RA 4E09A 4EYSA 1B23P 1K3TA 1SKMA 1UWLA 3K2EA 3O3OB 3M82A 4MR9A 1VJ1A 4IYJA 4NG5A 4QNNA 2P2NA 4PXAA 4RUKA 3TOXA 3U1VA 3W7BA 2R1VA 4DJJA 4FYVA 4YDSA 1OV4A 2V3VA 3ETDA 5BQPA 3VDXA 3A1VA 4CF4A 2ZYIA 2A9FA 3H75A 3UMMA 3F78A 3KAJA 3BRSA 1Q0SA 2YFYA 4ZAYA 4GUAA 5FR2A 3I52A 1KKMA 3QPDA 1NRIA 4QXPA 3GARA 1LPNA 5JISA 1G8FA 4FOTA 3LVQE 3EEQA 5D84A 1R8JA 4XPZA 3ZJVA 1T5DX 3TGPA 2BD0A 1RJ9A 5HFNA 4QQKA 1PBTA 1P17A 3KR0A 2O23A 4LZWA 3RRNA 4G1CA 2VBFA 3GEMA 1TEXA 5KOJB 1E4YA 2PD6A 4HFJA 2X42A 1P61B 2IP1A 4QUAA 5EE9A 3U7JA 2FSVA 3K5IA 4QODA 3T8YA 3VNRA 4Z0HO 5MHTA 4MI9A 3E9ZA 3TIFA 4BGEA 1DQRA 4OI1A 3D3NA 2JHAA 3AIOA 3IJEB 2O3TA 4KR0A 1J8MF 3INRA 3KCQA 4I46A 3ZX5A 4DABA 4OIFA 4LTNA 3S81A 3U61B 1ZN8A 1Y8AA 2ZJ4A 3QW4B 3BAZA 1ULSA 1LLDA 2YJ3A 4I81A 5IKOA 4EA9A 1AY0A 1XU4A 4KQEA 1RP1A 3O47A 1DG1G 2B6NA 3JPWA 3FVRA 3JTMA 3JAWA 3EBLA 1BVRA 3CG4A 5CIWA 4BP8A 3U9LA 1A0OA 4RSRA 3JQPA 1KAHA 1OLOA 3DSRA 1YZKA 1VHLA 1P5FA 2GRUA 2B2NA 3CZ9A 3GFSA 1XCPA 3AMVA 1AUVA 1DBIA 3DBHB 1C7IA 2P0EA 3A2NA 4OK6A 3MINA 5I8ZA 4RTSA 1C1HA 1KI4A 4A23A 2VTBB 1E3SA 2DRIA 4MEJA 4YCLA 3VNVA 3SXPA 1R5NA 3OX1A 1RACA 4OQZA 2JGDB 5FTNA 4CQMB 2GYYA 2ZIWB 4R8KA 5EJEA 3BPSA 1N36B 4BVJA 1KZ7B 1T8SA 3SK0A 3ZWCA 2OHFA 4Q9KA 2GRAA 1X0XA 3SOZA 3GK3A 3M2TA 4R01A 2NWQA 3H4IA 3WJAA 1ZVJA 1YDWA 2IYEA 4WCVA 1V2HE 5K51A 3CONA 3EUEA 3TTSA 4MMXB 1RWVA 4G0MA 3CURA 2YXPX 3KT0A 3ZI4A 1EP3B 5T4FA 5IFKA 3N0TA 3OMWA 1J33A 3Q7TA 2XCQA 1L1RA 2QR3A 1KPHA 2QMYA 2OZVA 4YJ2F 5G41A 1ZUHA 4MS4B 1EVYA 1BDJA 1HR0B 2WV9A 1TC1A 4G2NA 4U5XA 4TV9B 2DH6A 4PZEA 1JMYA 5IKMA 3VRHA 1G5TA 4BBPA 4ERNA 5JASA 3BMQB 1KQNA 3I2IA 2NU8B 2PCLA 3M33A 2WSLA 3UY4A 2ZRQA 3TL3A 1RE1A 1PSZA 3AGQA 4ND4A 3AG5A 3SICE 1JEYB 4DRZA 3A1SA 2AI1A 4WXHA 3JARB 5KWSA 2PT7A 5ENDA 1X8LA 3OZCA 1DKOA 3CO0S 4MKFA 1L7EA 4Z53A 3GLFA 2QORA 4D02A 2BGNA 4RADA 2BGKA 3AV3A 1IY8A 1NUUA 2ORED 1XCLA 1JX6A 2J32A 1SCQA 1UBKS 3QBJA 3TM5A 4E70A 4TSFA 2OPBA 4RHCA 4IQ4A 4N76A 1J0AA 3ZDEA 1U0FA 2G3YA 5I7FA 1MZVA 3F97A 1VMAA 2CXNA 4TMVA 5AHXA 1EZZA 3K9BA 3M6IA 4Z3OA 1ISSA 2IYQA 1EZ4A 2QRLA 4QKQA 4IOLA 3D6FA 3W4IA 4KYIB 2HCBA 5BV0A 3RVRA 5LBTA 5HM6A 5ITZB 1JSRA 2JFUA 2GTIA 2F3SA 1UP4A 2W6JD 1P72A 2VH5R 3WRWA 1UBNA 4R7TA 3WNZA 1J07A 3KXKA 1AKNA 1KO4A 1W5AA 2B30A 4AS2A 1VLMA 5B2FA 3DT8A 1M10A 3ZGNA 2RK3A 1CQJB 1Z9BA 2VL7A 2XXJA 3RC1A 4MV4A 3TKYA 2QM7A 3C7CB 1CWUA 1P9RA 4JBWA 4XUEA 1AZTA 2ILVA 3R4CA 2XGMA 3GZNA 2BFBA 4K0RA 4JUBA 4AZ0B 2HWUA 4UNRA 1AMOA 2REQB 1H66A 1QQ6A 3PRKE 3ROXA 3HM2A 2F43A 3LCRA 1QDUA 2JLYA 1F48A 3C8MA 3P5SA 1PJ8A 4PLWA 2AF4C 3IV6A 3K70B 1H85A 3RV4A 3VU3A 4DJAA 4CKCA 3U5TA 3FMVA 5HILA 3DYBA 1ZO8A 1JMVA 2IXEA 4EYKA 4B3TB 3THYB 3VSCA 1AMNA 1S4QA 3CZQA 1KYIA 4UU0A 4OHVA 2Q3CA 1S2LA 4QARA 2Y1XA 4U6SA 1ZR4A 1LKZA 3OCWA 3EAGA 3KJFA 4Q1BA 2NXNA 4QTZA 3UAGA 3TLAA 4MCIA 1NW6A 3WBBA 2DHRA 1FSZA 3ZNOA 3OG9A 5HQJA 1D4AA 1U4OA 4EF6A 2H07A 4HDRA 5FTJA 5K0BA 4V03A 3GFVA 3QUSA 2FDRA 1JHPA 2G8LA 4JJ8A 2YVLA 4R6XA 3T9FA 3RANA 3OURA 2ECOA 4QUEA 1E8DA 2ZUTA 5LDHA 1E9EA 2O2ZA 1SG6A 4Y2QA 2Z30A 3BGDA 3H11A 3HLKA 5HM8A 2NACA 2OZPA 4BKOA 4CKEB 2BYTA 1Q12A 3RAJA 2X76A 3FD8A 4Y9DA 3JTEA 3OSUA 2W71A 4YAFA 2YC4C 4JB3A 1Q3HA 4N0PA 4ARIA 1JZSA 1L5NA 4D82A 5JRZA 4KLCA 1QFXA 2IELA 3L5OA 2X6QA 1M9NA 4I7EA 2I5PO 4P3KA 5JW6A 1XZMA 4D0GA 1UAYA 1NXQA 4EK9A 1LK0A 4D8VA 1WHSA 2EGHA 3DW1X 1AKWA 2Q9AA 5EIFA 1E9FA 1LJUA 1A8PA 4TMZA 4X84A 4L2IA 1J1UA 2BGRA 3QMWA 4GC9A 3PQCA 3H86A 3RH0A 1P0PA 3B78A 4B6SA 4KLZA 1N6RA 4LOLA 2AMJA 4ZYUA 1K3UB 3ECCA 1JLMA 2CL0X 2GASA 2AFIB 2O6HA 2BAGA 3DDHA 4O8CA 4OH1A 3IHWA 3W0LB 4YX9A 4ZCTA 3F90A 1Z18A 2GEJA 2QRMA 3PXUA 1PZHA 1DRKA 5KCMA 5M5BA 3CZAA 1E1NA 1EUCB 2RKWA 2AN4A 4PAGA 4Q9JA 3T9DA 4FGKA 2O7VA 1R4MB 1DV1A 3ELUA 2MTBA 1PS0A 2NPOA 1H69A 1PQYA 1LTHR 4K86A 2M6SA 3W06A 1RZRA 2NVUB 3UUEA 4CDGA 2NG1A 1XRNA 4RF3A 1IQUA 3F5DA 2J8ZA 4WK0B 1INLA 5FPSA 4OEHA 1KYTA 1WQ1R 4RQTA 1QNFA 1U4SA 4QO7A 3EIWA 4PN7A 1DEXA 5B55A 4CTJA 5JO9A 2WM9B 5K3SA 2IY9A 3LX5A 4GX1A 2B36A 3RSHA 3QF7A 4GOOD 2DPLA 2V54A 5C9ZA 1MO6A 1NI4B 2AEJA 3LXMA 2BSAA 4F3RA 1G3RA 2IF0A 1DIOB 1ZITA 4MOWA 2O2JA 5T67A 3A6HA 1A8IA 4XCQA 3DOCA 4Z1MD 5LQAA 1EVEA 1JDPA 2JGLA 2R7AA 3TUIC 2Q1WA 4LSMA 3C5WP 4B4OA 1Z13A 2W2XA 4PQEA 3WK7A 1NPTO 2P0YA 3FM9A 1BJRE 4IF4A 4EPTA 2ISSD 1IDOA 1PG0A 3AYZB 2J4CA 2Z09A 3NI2A 3BTVA 3EQ7A 4JX8A 2CLSA 1ZU5A 3D6UA 3R40A 4YREA 1JH8A 2IY7A 5C1IA 3NHRA 3N2LA 5AHOA 3WMRA 5JPDA 2RGNA 1VI5A 3NORA 5FD8A 5GONF 1GPNA 3WHKA 1UEXC 5AK4A 3UMBA 1X1TA 2GCOA 1G4UR 5KX5A 3SZOA 4F6LA 2D8AA 3B6KA 4A2CA 3UH1A 3FVTA 1CDZA 3PF9A 5FPQA 3DLBA 5BRNA 1TEZA 2BW0A 3BD8A 2SBTA 4Q1FA 5ALDA 3UHOA 3VR4A 1MC5A 2B9EA 4IINA 2IU0A 4IBOA 5C8YF 2KE5A 3C98A 5I7AA 2PQ0A 3PUIA 3RS4A 2C4HA 2HRZA 5IK2A 4NE2A 1OW3B 4ZAXA 3JU3A 2QU8A 1Z2OX 4JP2A 4ALMA 1MQ9A 4E4TA 1PG5A 3LO8A 1E7RA 1X13A 1D09A 1UJMA 1Z6AA 2QF7A 3C3XA 4IICA 3TS1A 3EVDA 2ZCJA 4HJXA 4ER7A 3PUZA 1A3CA 2GBIA 3HB5X 3OE4A 4JGIA 1H65A 5PGMA 4BKUA 4DY6A 4LG1A 3C3WA 1T8PA 4C05A 2OKGA 3BSFA 2PQ6A 1U1GA 4P3XA 4J0CA 2IUYA 4MWZA 2IHKA 4BQIA 2YHAA 3BJIC 4QUHA 4DCTA 1K6EA 3HCBA 3CKLA 2QN9A 4ZODA 3AB3A 1OV6A 5H3CA 4ZEOA 1MV8A 2AX3A 2FEOA 1ZOIA 5F51A 4Q9IA 1FNBA 1US8A 5ALTA 3FWZA 1SIOA 3R0IA 5LPNA 5E6RA 2XUQA 2X0JA 4OFZA 5CM9C 4PC3A 1FQKA 1QRSA 4ZMRA 5KYXA 4M6WB 4Q47A 3IOEA 2KMLA 1Z4NA 3GW8A 1K4MA 2I66A 5KQPA 1GRVA 4YRIA 3LMKA 5GJBA 2DLDA 2XHZA 4E5VA 1E2JA 1XQ9A 1JKJA 1W5EA 1P1RA 3L1VA 4L8VA 4YRPA 1F14A 1MVNA 2EBFX 2PFSA 2ZXEA 3C5HA 3HO8A 3K70C 1T0PA 5AI9A 2H4XA 2RIPA 3TL6A 3PJRA 2NNLD 3D4PA 1M8JA 5LBIA 3AVYA 1WUYA 2L69A 3RR2A 3PC6A 4DSZA 5E9WA 2VXCA 5C5IA 1LQTA 2PT9A 2QP3A 4QFCA 2VAWA 2EFEB 5DOVA 3WRYC 2H8GA 4IIUA 5DBHX 2Z9DA 1CS0B 2R5NA 4BNMA 4Z51A 5ICMA 5DNCA 3GCWA 4RV9A 1ODKA 3NVDA 3IUMA 3DNMA 3OPYA 3GQBA 3HDVA 2A7QA 4AW9A 1XKTA 3AEUB 2I8AA 3VTFA 3E3OA 4PHCA 2Q5JA 2ZYUX 3VKGA 2OKCA 4OMDA 1QANA 1R88A 2YINC 3KOUA 3N3AC 5IBRA 2WHPB 1GZ3A 1S3IA 1EFVA 1FFAA 2C99A 1GNRA 4I5IA 5FO0A 1GAJA 1T2AA 3BMNA 3R7AA 5AHRA 3RSCA 3NNSA 3OFKA 5G3YA 4L95C 2ZIXA 1RWPA 3C14C 2QMHA 4AN1A 5CNKA 1BMFD 1QB8A 1YUMA 4TYNA 4W1QA 4KR9A 1JFVA 2QG6A 4QGGA 3TO5A 3I4LA 3ITKA 3O90A 2ZCVA 4OGKA 3RFXA 3S2GA 4PYOA 3ENQA 4EO7A 3LL4A 4HADA 5DH9A 5AM5A 1KMIY 4TTPA 4IDOA 3OFVA 3DKIA 3KQVA 5DIFA 4KBYA 4ENSA 1CULC 3RVLA 1XALA 4ZK2A 3D3EA 2MHCA 1P0CA 1XQWA 5LB4A 4BNLA 1YAJA 2PH5A 3UJHA 2QTMA 1XNJA 4QO8A 3NAQA 4B73A 1U2GA 1JFLA 3FUVA 4Z4FA 3NO4A 2I2CA 4XE5A 3ORQA 2NO7A 1OU4A 3F4KA 1TI7A 4DV7B 4UOZA 5BW5A 5CFQA 1BHO1 4BZPA 1F0KA 5CD9A 4D92A 3L1HA 2XLCA 2GFQA 5AK3A 1QH1B 3B1VA 3MEQA 3EZ2A 2ZBQA 3UC9A 4PHFA 3ZHCA 1AO0A 3LCMA 3L4BA 2AQ8A 2P9EA 4RKYA 4IGIA 3H5OA 2CYAA 2MWMA 3R0ZA 4KNYA 3EZNA 2P9TA 3F6YA 1K5DA 4JNCA 1QO7A 2P7HA 3A9SA 3CF2A 3G0DA 4ZYWA 1NY6A 1KVRA 1YR8A 4FOLA 3U0BA 3BWCA 3ULKA 5BN4A 4B87A 3OTOB 3RAEC 3D0QA 2V0NA 4RAOA 1KRXA 1RQPA 4AKIA 4B4WA 4WBNF 3S5UA 3RFFA 1EI9A 2FSIA 4GMGA 4J8PA 4O4IA 5K01A 4TTTS 2QM8A 4YI5A 4MR8A 4CDMA 4R41A 1C7EA 1CRQA 1XU9A 3C6QA 5L6MB 1TXGA 3GO4A 2R8PA 4PZDA 3L84A 2WD7B 1V3TA 1B00A 3VH4A 1JH9A 1IH8A 2HZ7A 2NUPB 1GPMA 1QH8B 1O6GA 4TT3A 4R2WA 2IPLA 4YRDA 3JD0A 2K87A 4WCFB 2GVNA 1ACMA 1LSUA 5IG2A 4C3ZA 5JFTA 2BFFA 3UV7A 1S9HA 1SQGA 2HA0A 2PX2A 3SE0A 2BZ0A 3PXAA 4TVBA 1NAHA 3QBTA 3QFRA 1KJWA 1II0A 3FCOA 1E9SA 4F4UA 2G04A 3RABA 3QLJA 3VYUB 1E66A 1IBRA 2EEZA 2H06A 2QJWA 3K0KA 1ISIA 3P9NA 4RFSB 4UUMA 3SQLA 5J2TB 3UO8B 3GGDA 1WUKS 2G25A 3GJRA 4S2EA 3RWBA 4F38A 4AKHA 1GTMA 3HXLA 2MYUA 3NDRA 4OJQA 2R0QC 2K6GA 1SRQA 1BROA 3HCPA 4JASB 2O50A 2ZPAA 4OBEA 4RL6A 4G9GA 1HH4A 5EJ6A 2QL5A 1CF9A 4RENA 5M3BA 2KPOA 3OEEA 2Y1DA 5DHSA 5BYAA 1MQAA 3AG6A 4Q3OA 1D2GA 4CETA 2EVWX 4GM4A 3R9KA 1L7QA 2HB6A 2JZNA 3PEFA 5GJCA 4MS3A 4FFSA 3ZUPA 4TZ6A 2JATA 3ZCRA 4ZU6X 2GM3A 5LD2B 2IXTA 1H9AA 4NX2A 4BN0A 1PHPA 4IVNA 5AQ1A 1SKQA 3VR0A 5JYDA 3O9MA 3ECSA 3G0GA 1YQQA 3G5UA 6Q21A 5EAIA 3CXUA 3VR4H 2G9NA 3VPBA 2YFQA 1IZ9A 3G0CA 1SRRA 1AO3A 2E4WA 3IVXA 1RXYA 4N5MA 3U7QA 1RPNA 3LTNC 3L6UA 2BP7A 3RUCA 1KI6A 2JG3A 3Q12A 1D2MA 4OHMA 2J67A 4INOA 1V96A 1YOBA 4K87A 3F46A 3WLQA 2PO5A 5D1NA 2O3QA 2UYCA 2I29A 4CIVA 3C8HA 3NOVA 3NH9A 1BXZA 1W1UA 2WTBA 1VG0B 1EVKA 1HE2A 1SG9A 3PD1A 1QG6A 5IAKA 4BV3A 1GV1A 2Q9BA 5ALKA 1TK3A 5AR1A 4YLYA 4QM6A 1SURA 4TTAA 1WCIB 3ZZ0A 2JLWA 3OLWA 2BTOA 1TTTA 3ITNA 4QU9A 4RHYA 3WGYA 5IN4A 4KUHA 4BY9E 3GLHE 3DULA 2AE2A 3QRWA 5DLQC 1NBME 4BE4A 5A5EA 1CUFA 2ONZA 4DMGA 1BA3A 1XN1A 2XXAA 5JMOA 3QX3A 4L4SA 2JFFA 1G3UA 3CUUA 1XJWA 1BFKA 1BEZA 4GMXA 1I1QB 5B3AA 5K1ZA 3FCUB 4PG6A 3CRRA 2O2SA 4K9LA 3JQQA 1M1UA 2Z2IA 4KDRA 2J4DA 3L7CA 2CT8A 3ESZA 3C6YA 3MT9A 2XVMA 3GMIA 4P36A 4KBFA 5BT9A 3MWEB 3RNLA 3F9RA 4B6RA 2VYFA 1RPTA 2YY7A 4QBFA 1RQRA 2QX7A 5JS7A 2YQ4A 5EESA 4D42A 1QTNA 1J56A 3RCBA 1X8KA 4NZMA 4PCUA 3INTA 1UXHA 1U2DC 5J47A 3T12A 4ZV4A 1ZL0A 1U90A 4E3WA 3JSAA 4JR2A 1KWGA 3GCDA 2CMDA 3OH8A 3AJ9A 4MA4A 3THRA 3AVXA 2FFJA 2I2FA 1OXBB 3N2IA 3TDNA 4LJ5A 1E7MA 1VBMA 3SAJA 2BLNA 1SN7A 1D4ZA 2IH5A 1M2OA 2MSEB 1VQ1A 3B5JA 3Q3VA 4ZO4A 4ZT7A 3VH3A 3BMOA 2ZYRA 1ZCJA 2O3JA 4JP1A 4MQUA 2BRUC 1JUDA 4E2FA 2YZNA 3V8RA 2NU6B 1EU1A 1TIBA 3QVVA 1H9BA 1T26A 4X9XA 5FA6A 1L4LA 2G28A 3M9LA 5EP2A 3FGNA 3ZHRA 2X8LA 4F5DA 1QH0A 3M6LA 3BWYA 1QK5A 1KDZA 3VAAA 5LL6P 2IH4A 2XKAA 1KL7A 3PI7A 4M0MA 4JXXA 2ZZKA 2BI4A 3AEXA 2CJXA 1W6UA 2Q5HA 2IZOA 2UVDA 1U8YA 2G1UA 4HQLA 4TQ9A 3PA8A 3KX2A 2PGIA 4GBMA 2HREA 3A3YA 2B1IA 2FG6C 4KPUB 4PZAA 3ZE1B 1FJ2A 2VK1A 1NVVR 2C2ZA 3QXCA 4H31A 5JQWA 5EZ6B 2ARKA 1CY7A 1MJGA 4JEUA 4LX8A 1GY8A 2JHGA 4BLUA 2WB2A 2HUPA 3Q15C 3TXYA 3T1NA 1NPYA 3P2IA 2WMNB 4TYYA 3EOAI 3JQAA 3CUVA 1U7TA 4OK3A 1G9XA 1XRJA 2ZU0C 4LDQA 3CRMA 1Y8ZA 3RRXA 3K0SA 5FTWA 2NV0A 3RC2A 3ZPXA 1ZESA 5A0FA 3RU3A 4CU5A 4PLPA 2YFHA 4W9NC 4II2A 3WLOA 1Y1TA 2P3QA 4RPLA 5DBFA 3UJAA 5AUNB 1L7VC 4D4LA 4B45A 4JYZA 2XNJA 1V26A 1ZLXA 5KTYA 4HI0E 5J43A 5C51B 3RIMA 2FR1A 4QTXA 1NM5A 4GLBA 4N03A 4B3XA 4RTRA 1AXEA 2H8KA 2GTPA 3MTEA 3K20A 1UAAA 4XOUA 4EHLA 3BFKA 3NU1A 1LC3A 2AFRA 2I1QA 2I6QA 3ANYB 3MELA 3STXA 5B12A 5F3RA 5BMVB 3M6VA 2R47A 5IC4A 4FMCB 4NWIA 5T3UA 4EUKA 5KKCA 1XTZA 2IU4A 1HDRA 4G81A 5LUAA 4DR4B 5KB3A 1E79D 5CT8A 2W22A 1KP9A 3JYLA 4F46A 4BNNA 2G1JA 2BONA 1FXUA 2WUEA 2F3PA 2YZ2A 3FROA 3MMZA 4B6GA 3PC2A 3HVHA 3J7AC 4Q02A 2GJSA 2JI8A 4IKEA 2F1JA 4JP8A 3PEUA 3RJZA 2Q7XA 3EGEA 4X1KA 2NMVA 1KORA 5EG5A 3LQFA 2XCRB 5IVKA 1D2CA 1UBGA 2Q4OA 4HEQA 3DQQA 1BHSA 5EQDA 1L8QA 2H1RA 4Q1AA 1T29A 1XWWA 4ZCMA 1NLFA 2VQFB 3R8CA 4TLAA 3A7DA 4P5PA 4AF8A 5EOVA 3QA9A 1LVHA 4IX1A 4DLLA 1C7QA 3K1YA 1QOZA 1ISGA 3E3LA 1TM1E 1F2TA 2R8RA 1HEUA 1V71A 2ES4A 5ALVA 3EGXB 1MEOA 3L9WA 3RSSA 3ZU3A 3OCCA 5B1DA 3ZHSA 2H08A 5FBWB 2GMWA 4BQPA 4D56A 2XZTA 1ZBDA 4A2WA 4CM3A 1Z7BA 2WUFA 3ES9A 1ZMTA 3PE6A 4NATA 3L0PA 5DDIP 5EPUA 3OWOA 4CUZA 3TIXB 1UFVA 3PXBA 5TY0A 5LD2C 2EJTA 4J03A 4NCKA 4UFNA 2E21A 2HHAA 1DCFA 3P2EA 1KYXA 4Q1VA 4ZD6A 2H1IA 2I8CA 5P8WA 1A9PA 4DLTA 2PU5A 3H3JA 1YBAA 3H4VA 4GSKA 3LLCA 1DEOA 3VZSA 4HV4A 4YRMA 3HGMA 3ER6A 1E2MA 1FP4B 5F1OA 2OGSA 3GT3A 2E48A 3M9XA 3ESBA 3ND7A 2DX7A 2NSDA 2FX3A 1U5BB 1B93A 1MD9A 5E6SB 5HQ3B 2HF7A 3K0AA 1ODCA 1MJFA 4RKRA 4YIKA 3L77A 5FWYA 1I3LA 3OZBA 3RYIB 2HLDA 1MRZA 2XI4A 5JZVA 3L0YA 2PGNA 3GCZA 5DGCA 1YJAA 4ZVKA 1J09A 3AUTA 1ZD8A 2W2PA 2W7TA 3FCXA 1CERA 1Q1QA 1TU0A 2NZXA 3F9IA 4G25A 3F1LA 2X9QA 1N3BA 1PR0A 4I50F 1X7XA 4KIJA 3RSZA 1AIPA 3W5HA 1LU9A 2W42A 3EPKA 4ANFA 3BA6A 4AU1A 1E8NA 3AKZA 3EC7A 3SHTA 4AJHA 2F7SA 2ZTSA 4WXPA 4EKYA 3SC4A 3HWRA 4JSRA 4IIJF 3GLIE 4P4SA 4KQ6A 1WTAA 2CXXA 1N75A 3IX7A 4KH1A 4FW8A 1XMQB 5EFZA 2HQSA 3I9KA 4XQGA 1KVQA 1YRYE 2WWWA 2GXUA 1ZW1A 4DUZB 1HT2E 1ZR2A 3U81A 3U7HB 4P4UA 1W75A 2AK3A 1F6WA 2I34A 3KEFA 4YXWD 1EWKA 2FZWA 5CB4A 4WFQA 5B6IA 2ZT6A 4U6NA 3EA4A 2XB9A 4GWLA 4NOMA 2H9YA 4K03A 5BNZA 3X1ZA 3OQHA 2CFIA 5KNCA 3ZKWB 4PFSA 3O82A 3DQZA 1OGYA 2B8NA 1NONA 2YS6A 4DMFA 3VBCA 1OH5A 2PXXA 3DVQX 4FYHA 5EPEA 2FLWA 2RHJA 1BOOA 4WESB 3D2AA 4WQMA 1NKVA 1S3SA 5EINA 3RJMA 4QATA 1COZA 4MSUA 4QRHA 3WG9A 3FWYA 3KTAB 3EN0A 4ECEA 1SOUA 1B1AA 5TQ2B 3IT1A 2OLKA 2PX3A 1C5KA 3S0JA 1URPA 3P52A 1ZS9A 1O8BA 4MRMA 4RESA 2W6PA 3C3KA 3MGGA 3L1IA 4NOLA 5A06A 3E9CA 3ZLTA 5K9ZA 6LDHA 3OTIA 3LZDA 1M6NA 1ZONA 2ZSFA 4M7WA 4DARA 1DBPA 1SU4A 3CG0A 2DWPA 1N9GB 1EXMA 4MICA 1VCMA 4IHQA 3IOBA 2I4LA 1T8RA 1VL1A 3IQWA 1MF7A 2XTAA 1BCRA 1OX5A 2BUCA 1VP3A 3PVCA 5ICGA 4QJ3A 2RAUA 3W78A 2VHUA 4M9ZA 5DN6D 4E15A 4DIFA 3PI6A 3IH5A 3CNLA 1C1XA 4U4AA 3NBAA 3X1MA 3HBAA 4LDNA 4QYWA 4RMHA 4RF2A 5FKJA 3DEJA 3BRCA 2ZATA 1E61A 2YOGA 1M7BA 1ISPA 1R4NB 1V5EA 4MUJA 4RLFA 4RY0A 1I6KA 3CVWA 5IWAB 2HU2A 4RZIA 3L0SA 3CPJB 4I9FA 1VLLA 5BOSA 3LT5A 4ND2A 3DS8A 4US1R 5C7OO 4RDXA 5AKIA 1NP3A 2VP6A 1T36B 1E1CA 5LMUB 4QEDA 2JRLA 2P2CA 4PG5A 5DK6A 3UT5A 1TKAA 1P2FA 4XQ9A 4CCSA 4Q1EA 5LP6B 3E84A 4O2AA 5B37A 2Q0XA 2V98A 4QOFA 4L78A 4ND5A 7YASA 1AKRA 5DE3A 1OMOA 4JBGA 5AI0A 1CT9A 2AUMA 3ZGVA 4C4RA 4B33A 1USKA 1WBJB 2GT1A 2XQVA 3G7NA 2YNMC 1PFKA 4V0LA 3TW0A 2ECPA 3BQNB 4OSEA 4B40A 5BWOA 1H2XA 5B36A 5LXTA 1X80A 4HDQB 2PT5A 3HUDA 1K63A 4PRYA 1KDYA 4F8EA 1C81A 1QCZA 4OJNA 3KZXA 3DE7X 2GBFA 1H2RS 3NBXX 3H8SA 1WOYA 1NATA 5C31A 5FTLA 1QWOA 4XGKA 3SC2A 5HRAA 1JPUA 2C7BA 1IY1A 1JSLA 2AG8A 2AMLA 2Q6KA 2F90A 3WXMA 4DKJA 7MDHA 5FBLB 2Q07A 4F6CA 2IWHA 2A9VA 4YN3A 3FUXA 4BNDB 4OYHA 1VHQA 3SQOA 5CT5A 5IW8A 1SVNA 3QV2A 1IONA 3KFVA 4FZJA 3VVCA 4H7DA 2OHHA 4EKGA 4UHDA 4DCPA 4GKVA 1U3GA 3GYBA 3WA6A 5IRCD 5K3EA 2A1TR 3CNNA 5AKKA 1QGUB 3GGOA 4CFZA 3LX8A 5LQRA 3G1TA 3OA0A 5GADl 4GPTA 4HGQA 5KYKA 1BIFA 3UN1A 4LY3A 3VDNB 5AW3A 4OG2A 5K0GA 2P30A 3A70A 2XYGA 4Q9NA 3BFXA 2OSVA 4C0JA 1XTVA 3PX2A 5AVOA 1AOXA 2REOA 3HP4A 3L7IA 3EGDA 1K3FA 4FC6A 4MH0R 2ZJ2A 4QOEA 2GHRA 2X3UA 4ID9A 1U8XX 3FBWA 1IB6A 3H4MA 3LBFA 4JENA 5FWXA 5JXWA 3K6SB 3PLRA 3GVCA 2OV8A 2IUEA 4HNAB 1P1JA 3SJAA 1KDVA 1O95A 5TQ0B 1T4MA 1V43A 4GMFA 3S7TA 1VJRA 3WZ2A 2QRPA 3PFFA 4URZR 1HEIA 4LYYA 2Z5GA 2VPTA 5TGZA 3AVQA 4LMAA 1ADFA 4P84A 1CF4A 4CWAA 4Z9AA 1KEUA 2OL4A 1N0IA 1F3OA 2DHCA 3D81A 4LNHA 4FS8A 5JXHA 1GKUB 3PFIA 1ZN7A 5ESWA 1OPRA 1J0CA 2CBZA 2VJOA 3MN1A 3BFPA 3NVMB 4FKBA 4Q1DA 3T95A 2O0KA 4ZHQF 2XYPA 3IURA 1KI1A 3TMKA 2OCGA 1XDZA 4XM1A 3DP9A 4BFLA 1IN1A 3QUTA 3QI7A 3SBDA 5BUQA 3ENWA 4UTPA 2OOKA 2IYSA 1OT3A 4F4IA 5L4NA 2I33A 2YHBA 1UIRA 2R3SA 2PWBA 4FDLA 4PZ0A 1L6IA 1QYXA 3HY6A 4QYIB 4CM1A 1N77A 1CQIB 2WIFA 4G65A 4GWGA 4R31A 4GXTA 2ESRA 3TTXA 4F1WA 1FSGA 1DE0A 2AVNA 3HFSA 4N9QA 3RAFC 1Y63A 2R7NA 2WJ4A 1ID1A 4NABA 3DVLA 3JQ9C 3VPDA 2G80A 2DR2A 1P2DA 4V0SA 2YZMA 3DBRB 3LC1O 1FMCA 4J29A 4TV8A 2J31A 3N2KA 5D3MB 4HMQA 3I37X 1PGOA 3A1DA 4QLAA 5JCJD 1WR8A 2OO5A 3GUZA 4AAYA 3HY4A 1PT6A 2ACVA 3KOWA 4D97A 4A82A 3WSTA 3MD0A 5JNVA 2VTDA 1YFLA 1M5TA 3EWIA 3G2KA 3T1YB 4XRRA 4GPD1 3MJ4A 3S70A 3H9CA 4LQDA 1EWYA 5JYEA 2YQ5A 5BRJA 1KWKA 3AETB 1XDDA 1C4WA 3ASUA 3LP6A 1FEZA 4NNJA 5HF9A 1A1VA 4ZIRA 3W05A 4CV0A 4XYEA 2ZUSA 3IB3A 4YUVA 4YROA 3SQDA 3I8OA 4YCDA 1GV0A 4IQ8A 4OGWA 3RGWS 4HXFB 4AKEA 4PLYA 5AW8A 1XD2A 4BO4A 5JD6A 5JFGA 1QYRA 3KV3O 4XUCA 1IEVA 4GNKA 2DQKA 5JRJA 3JWJA 3OIUA 3U0VA 4F71A 2I3GA 3MWDA 3UJ9A 2PA0A 5EJIA 1FFDA 1WG8A 2GVZC 3HB4X 3BB3A 1FFCA 1X38A 3I2YX 3M8KA 3O1JC 3OZEA 3UEOA 4AQ7A 4NECA 3WTBA 2Z43A 1Y82A 4MQFB 2G17A 2BM8A 2Q6VA 4CMCA 3FPFA 3QOWA 1FS6A 3RT1A 2Z9CA 4M4SA 3M3DA 3CZPA 2CZQA 1M34E 3WLHA 1SC1A 1T4DA 2CFTA 4WN9B 3HCDA 1E0DA 4MR7A 1YQEA 5JALA 1V16A 3EHDA 1KDRA 3OJXA 3TQFA 2WF8A 4AMYA 1GG9A 1UBEA 2FKNA 2ODBA 2VJMA 3K15A 3HRHA 2OZEA 1RJWA 1T25A 2VUHB 3R5TA 3P0IA 4GP9A 1E98A 5AWFC 3SS7X 1OWMA 4PC7A 3DFUA 4QGFA 1II8B 4POOA 1O3YA 3WKAA 4EDHA 1C0IA 5A4FS 4E30A 4MV7A 4Z2AA 4TWZA 2BF7A 4ARZA 1TF5A 2WVAA 4K5QA 3O3NB 5ESXA 3REOA 5K99A 3S99A 1W0KA 4U9IS 5CDTA 2ZJBA 4G8DA 1GFSA 3P9QA 4GYYA 4WXRA 2QGFA 2F1RA 3ETHA 4LC1A 4X90A 5LP6C 4BZQA 1XPUA 3NM5A 2CW5A 2W2OA 2FN3A 5K4GA 5C0OE 3TXAA 1MIOB 4JV5B 2DWUA 4MEBA 4Q3BA 1FTNA 1OAAA 4L3WA 3SS8A 3EMVA 3IDAA 3U56A 1Y5RA 4GG1A 1KE2A 3RHZA 4B85A 1WE2A 2YWEA 1CVLA 2VJLA 4C89A 4P38A 1E9RA 3AZOA 3HEAA 3VHQA 5A1JA 5C1OA 2WYOA 4UBIA 1OROA 3H8WA 3E7XA 5JPCA 2BH9A 2N46A 1LLUA 2ORYA 3BHJA 3PLNA 3ORHA 5IEJA 1MAHA 4JMPA 4NAVA 2XXBA 5FAKA 1XZAA 3G7SA 3Q8XB 3FJOA 5T4HA 3ZHXA 3O4IA 1KKLA 4ZHSA 1RZ3A 2ZJ6A 1NVEA 4BEJA 4H7PA 4P7FA 5AW9A 2VBIA 2HWWA 2HCFA 5I8WA 5CEEA 1EBBA 1FSPA 1UMCA 2CJPA 1RYDA 3CTPA 1BW9B 4HQKA 4S1WA 4X94A 4LSWA 2FXVA 1Y4SA 1A95A 1LDNA 1JFFA 1NW4A 1N2OA 3LE8A 2MSCB 1U98A 3FPKA 4ZVOA 1QC5A 4PIVA 5FPTA 4F45A 1IY2A 4RTQA 2J0VA 6REQA 1SUWA 3WAJA 1PIWA 3CSDA 4HB3A 4E12A 2IITA 4RVFA 3ESQA 2NU7A 3N70A 4WZAB 1Q7TA 3TTTA 5KTTA 5EMLA 3D0OA 3OEHA 1V11B 5AT1A 2AMVA 4RWZA 3PFNA 1FDOA 1GZUA 1X1RA 3WMEA 3K4HA 5ALUA 1PR5A 4I6JA 5CLLA 3EXIB 3B82A 3IR6A 5A0VA 1RRKA 5HP4A 5JAOA 3IR5A 3QKRA 5HBRA 3NVKI 2P1DA 1YKGA 1ZD1A 4TTJA 1ODTC 4U9HS 4F3YA 3DVAB 4JR1A 1LPMA 1OLSB 2AEEA 4JITA 4OHYA 4WZ6A 3E0XA 3H13A 3VU8A 5HX7A 3KEGA 2JIDA 2X0IA 2WILA 4M1TA 1TO2E 3RARA 2AHOA 1GPWB 3NIDB 4FGLA 4G0UA 3OM9A 1Z38A 2R8YA 3IHTA 4JL8A 3C41J 2VHWA 3FCAA 4L72A 4XVHA 5EVJA 3ETLA 3GAFA 4U2CA 5JATA 1GD1O 1U99A 2C3YA 3GRRA 2OECA 4LZAA 1NU8A 4P82A 1YA6A 4KXUA 2WJJA 3WIBA 2VDUE 1E4EB 4XLTA 4OYLA 5IKEA 1FRFS 3CJQA 2LPMA 4L9AA 4FFRA 1E63A 1N0VC 4YT5A 2P65A 3FE2A 2ZIUB 4ATNA 4YCNA 4XDZA 4LRQA 3GLSA 1O96B 5AJWA 1JQLB 2XRZA 5G0VA 1QO9A 2ZQZA 5AKEA 1HI9A 2R6GA 1RLIA 2AW5A 3WK4A 1I94B 1G5QA 5GGXA 1EIWA 1K92A 3O93A 1K1EA 4JJFA 3G8BA 4E5PA 1PR2A 2ORIA 2FPGB 1VLQA 4TSFD 1ECCA 2O6LA 4YAJA 5JU6A 3CB2A 4PQYA 3WIVA 5CFMA 1RLUA 5LKAA 3D43A 4JI2B 4YI3A 3K96A 1G4HA 2VT3A 2CUZA 2QQ0A 3LCCA 2XYQA 4EG5A 3U4DA 4ZU3A 2LKCA 3HP7A 3KKOA 4HX2A 4MV1A 3SJ7A 1XXHE 1AH2A 1R37A 3CCFA 1SXJE 3ZXIA 1COWA 3NEYA 1PP4A 1C3OA 1EINA 2C84A 4FI3F 1PZGA 1T3HA 3DNPA 3ZWQA 5A2GA 5EJ9A 3DEZA 3KPYA 4H3VA 1JALA 2CVFA 2IEAA 1I4OA 3EIOA 2Y93A 2DHQA 3DDUA 2X0FA 4DREA 4CMEC 1IZ7A 3KYDA 4RD3A 4A27A 1A2BA 2X0EA 5L3SA 1G7RA 1Y5IA 3RYFB 5G0WA 1SR8A 4EG7A 4G6ZA 4WFKA 1P7YA 2WTNA 3HCFA 3WDSA 4D6XA 4ZCQA 4XWOA 1J1ZA 3KQWA 1EVQA 4NMXB 1FDSA 2FPLA 3LLMA 5EGSA 3DZHA 3F4BA 4PBSA 2X0RA 1I0ZA 4BLRA 3WGVA 4GXQA 5BURA 2I7TA 2QYHA 4OB8A 4FONA 4HZIA 4OKIA 5IZ4A 3NEPX 3DCNA 3HNOA 3L7LA 3PEVA 2J3QA 4W1RA 5I9SA 4OQ4A 1H4TA 1XRLA 1V5FA 1PJLA 3RSLA 8OHMA 3K1ZA 2GH1A 2C54A 1C0PA 3E05A 1NF9A 3RLIA 4E2WA 1ONOA 3K92A 3IXMA 4O4HB 4ZJYA 2NV2B 3W5UA 3WGIA 1TGYA 1VLHA 3W5SA 4NBNA 1Y89A 3TR6A 4YR9A 5AW0A 2VP5A 4KQIA 2FZ4A 3C3EA 3D4LA 3NP7A 1H1DA 4M7PA 3T9CA 1CIJA 4I5DA 4ZTBA 4DV2B 1QH9A 2GQ0A 2IOFA 2QM0A 1V9LA 1ND6A 3GJYA 4H2DA 3F8TA 1NJGA 1G0NA 1T0JB 1EVZA 2B3DA 1EE9A 4EB3A 3AT1A 4LJYA 2FPPA 4PZZA 5COQA 3RG2A 1LI7A 3LHKA 1DX4A 1KMNA 1BQ3A 1MC4A 1JBEA 5KINB 3DVRX 2EYUA 1IE3A 2OV4A 3EG9B 1MO4A 1P9OA 2A0XA 1V4VA 2JGRA 2P9GA 2WJYA 2XEDA 3OIGA 4L5IA 3UFXA 4DLPA 2P75A 3NRJA 1XTRA 1GYPA 3T15A 4QXAA 1TM5E 1FQOA 4FNMA 4UHHA 5K3BA 3W8DA 2Y8EA 2I2BA 5KAMA 1XQYA 3KJZA 3OZ7A 3BH6A 1GZ6A 3GRUA 1V8DA 4H3HB 1IVSA 1S3FA 4NBVA 4B43A 4D8TA 1XCGB 4AQYB 3H9QA 4MV3A 5JDCA 3N8IA 3HN6A 1TK2A 1JFSA 4MJXA 1N5LA 5BV7A 1O87A 2ECQA 2VHYA 1KYZA 4E4YA 3QLUA 4RO0A 4K9QA 4RQUA 4EUHA 3L4SO 1RLOA 4NHOA 3GLHA 4RQAA 2ZJFA 4RHFA 2X1LA 2BJWA 4NARA 3CW8X 2C61A 2AG1A 2A88A 2RC5A 4Z1OA 4YECA 1GCIA 4N3CA 4URVR 4GR5A 5EUQB 3AKCA 2PZBA 5EC8A 4EHBA 4TKUA 4OI2A 1UADA 3LDUA 2D1FA 3VYTB 3WB0A 5JH7F 4DR5B 4MTLA 1MR3F 4BO5A 4AMZA 1KTIA 2PFGA 2XUIA 4JJKA 1U8ZA 2P3OA 2VSOA 1XHEA 4NMMA 5AESA 4JT9A 1E3MA 4HAOA 2AKAB 3B1FA 4D57A 3R23A 1RZRD 4IRUB 1P91A 2CMGA 1EH5A 1ZVQA 1DQSA 1MG5A 2ASEA 3M1IA 3PQ7A 1XFDA 3K09A 2BCEA 5HKLA 4YRNA 1FPQA 4S1OA 5CLJA 3DAYA 1Z88A 2M1ZA 3QVXA 4NNPA 3VUFA 3OIWA 4RY2A 5IKXA 1TF7A 2NO0A 2Z2ZA 3AUJB 2AG5A 3BVPA 2YYZA 3FWNA 4GLLA 4NBSA 5TVGA 3X2EA 4E32A 1ZH6A 2WNSA 5EXXA 1DAMA 1SUSA 2ODPA 2QS9A 2I2WA 2QAJA 1Z4MA 2OLEA 3AF1A 3QJYA 4DLBA 1U9CA 5HCUA 3UUWA 2QY9A 2JGFA 1RRGA 3P9YA 3MJVA 3R8FA 1WF6A 3QYFA 4UDOA 2JFWA 2RK4A 4ED9A 1AZWA 3HPRA 3O8RA 2B0CA 2CBGA 1GGFA 4GLJA 1SEPA 2C2HA 2OQ2A 4MP8A 1DP4A 3R3YA 4FJ2A 3FDXA 4MV6A 2Y0BA 4KXWA 4ZVQA 3T99A 3AHGA 2YXEA 2XZDA 3D7NA 1OI7A 4LUCA 4C6TB 1DWUA 5DASA 5FPKA 3KDSE 3EG5A 3IP6A 3MSXA 1OZAA 5GWXA 5HMLA 1I8TA 3ZWKA 3ZI7A 1AXGA 1TJNA 2G6TA 4MUFA 2RGCA 1CJVC 1PCXA 4C6SA 3KM0A 3VU0A 5KYTA 2J08A 1LRLA 3LLUA 5HUQA 4D43A 1ZI8A 4XM0A 3RQSA 1VPWA 3GT7A 2JLXA 1JJFA 4OMCA 1NR7A 1V39A 3EK2A 3SKVA 2QUKA 2PZGA 2Y2VA 1WKBA 1HE5A 2P6MA 5JNWA 2N3ZA 5F7XA 3LHIA 4ENVA 5JRDS 2V0CA 2FCAA 4JBHA 2DSNA 2FGKA 5HUJA 2HHHB 4OJMX 4QU5A 2VFAA 2JASA 4W4TA 5IK2D 4CIAA 3N7AA 1C50A 3OZVA 4AF6A 1DWQA 1MUUA 2E4ZA 2ZTMA 3H5LA 4Q3LA 3TQQA 3WFIA 4EDFA 5C1PA 3EFOA 1E5QA 4BRSA 4MYTA 2FSHA 2JZCA 4M9CA 1GSOA 3EFBA 1L4UA 2EL7A 3OJEA 4YO8A 4PBRA 3HEMA 4ZQBA 4Z6KA 3VC7A 4QFBA 1E0SA 1HKHA 3REGA 3GCXA 3D3WA 3GDOA 1JXQA 2CDBA 4QUIA 4U2GA 4F11A 5A5GA 1XZEA 3WV4A 2WWRA 4LGYA 4L3VA 5JANA 2QXYA 3IEMA 5AM4A 5K0TA 2PV7A 3OQIA 4ZFNA 2XVYA 3EIFA 4XIYA 3UOWA 3IPRA 5EE3A 2IYRA 3IO5A 4QELA 4X8HA 4ZPJA 1UT6A 5BO5A 1NYQA 4DYHA 2HTFA 1LX6A 2BN4A 1S02A 3LOUA 2NYVA 4JNKA 2HJRA 3MGCA 4UNIA 2Q1UA 4EAQA 1ZXBA 4NSNA 1ZYUA 1W25A 5G1OA 1HE3A 3HXOA 1AB6A 2IZ0A 2QLFA 4CQLB 3IAXA 1C9KA 4OSPA 1DKNA 3ZCXA 4EFMA 1DSSG 3VA7A 4NENB 4FCTA 5EHZA 1NBAA 3KXDA 2OR3A 2ATEA 4G5OA 3EIUA 1JGTA 3BF8A 5CMLA 1XK7A 1JI0A 1J22A 1NTOA 2OC9A 4UVIA 1Q3TA 1X0VA 1Y6JA 4EO9A 3FFXA 4P22A 2ZB4A 2ZVDA 2YJNA 2DLCX 3GLKA 3O1HB 3TOVA 3QV1A 3F3SA 2DPXA 1HLPA 1KU6A 1W59A 5B3KA 5EJAA 4MGYR 2H6EA 5LLTA 2H1LA 4X63A 4HAYA 1QHYA 2VLBA 2X5NA 1G21E 1ONPA 5I7UA 3FI0A 1GPAA 4U8GA 4OXQA 2NXEA 1FIUA 1N2CB 3BULA 2Q3EA 1EFTA 1YI8A 2ZUWA 3AR9A 3E9RA 5EXPA 3IE2A 4WASA 3TG8A 3A28A 1H05A 4HRAA 2HCRA 4J07A 5CVDA 3WMGA 2ZAOA 4RMIA 2FR8C 2EJWA 2GPJA 4QL3A 3MLBA 3NKVA 1YJ5A 1L5SA 2I3ZA 1YA8A 3AW9A 1RXCA 3JYOA 1Z83A 3IPAA 3QFSA 5CA1B 3TFWA 4AKGA 2PBLA 3B52X 3L05A 5HE8A 2C5SA 1Q0RA 2ZRGA 1VIMA 3G2QA 1BVYF 2DLNA 4U9UA 1HK7A 4MYCA 3C4QA 3G0HA 1M6VB 2I71A 1C9DB 4J43A 2ZYAA 4Q3DA 1B43A 3MAJA 3D6AA 3ZTTA 1JA0A 4OHBA 4GM0A 3AFNA 4PXYA 3TLGB 1SHLA 2BGMA 2EWWA 3OLVA 3W2EA 4YRRA 1PS8A 3PA6A 1J2JA 3N59A 1XRRA 3AOEC 1EQUA 2BM9A 1SBCA 3FMOB 4KO8A 4YP7A 5K4AA 4EZBA 5LJLA 1ACJA 4ALNA 2XMSA 1TCBA 4AJJA 2ZRDA 3D2LA 4HZGA 4WLOA 1C1DA 4PGHA 4G1VA 4DDTA 5IJ0A 3FYUB 4RE5A 5L45A 1P5ZB 5EWMA 3GDFA 5FXMA 3PJEA 2QAGB 5FI0B 1TA9A 3BWXA 3AEYA 2HFJA 1YBMA 1ZIPA 2DJ5A 3HU2A 4MXDA 4NNOA 5DTRA 1JE0A 3LHDA 3GLIA 6PFKA 4MQMA 3OZAA 4HFNA 3LPAA 1D03A 4IHJB 5DHUA 2ZQYA 2ONJA 4RXUA 1CEYA 4DXAA 4CXMA 2XCIA 3IL2A 4FMDF 4HQ6A 1BC5A 3KK0A 1EBFA 3GDHA 3HZHA 3PRHA 1FW8A 2VT7A 4H15A 4I9GA 4ZWNA 2JFNA 4RV4A 4CMKA 1SOVA 3E7FA 1Z45A 1O6ZA 2GPYA 2I4NA 2JCYA 4TN1A 3OOSA 4LJ6A 1O6FA 1LJLA 2WG1A 3QPWA 2XDQA 3E1SA 1VLVA 1N2SA 4UTRA 3PGLA 3PC8A 1J5XA 4KTTE 5F21A 2AF3C 3HADA 1FFXA 1I3CA 3NKFA 3ZWVA 3KJHA 3E7WA 4EMSA 3LKVA 2HIMA 4UXHA 4YNBA 3KKKA 3ZWYA 1MPTA 4G5FA 1K2VN 2O2GA 1M73E 1XKXA 5JCOA 3LOQA 1WMAA 1KMMA 1VPTA 3N8GA 4JJ6A 1GTVA 5F7ZA 3ZKAA 4UAJA 2AFHE 3G2IA 3I42A 5DXFA 1NZJA 5G1PA 5HJ2A 1Q1ZA 1MJHA 4JLWA 3ROMA 1JECA 2BHLA 2FPOA 2QLBA 2UZ1A 2CL6X 5EQFA 1GCAA 5K3FA 2FSGA 3V7UA 2P8JA 3AJ8A 5IHPA 5LOVF 3GPDG 1YL5A 2Q0QA 2OGZA 1CYEA 1VKHA 1G19A 2C5HA 3PTZA 2JEOA 3L04A 2GZHA 2W4QA 4V0ME 4CEIB 1Z6XA 3CBQA 3B36A 5DU2A 1ZCAA 1N5RA 3IKJA 4UEKA 4M89A 5BR7A 1BZYA 1Z26A 3FRJA 2Q3LA 4BRWA 5D3ZA 4RXMA 1DDGA 3P27A 2OY0A 2XUKA 4JKYA 2XNCA 3CNQS 1JU9A 3E5HA 4RL4A 2A57A 3DDZX 4J0HA 3ZLJA 2ACWA 1K8XB 2VRWA 3T0GA 5B3JA 3OEED 5F3WB 4Y2HA 1TQ8A 4FFBB 2VF7A 4MRAA 1M8KA 3A9WA 3EGVA 3JZMA 4NY1A 3ZEAA 9LDTA 4B2YA 3EEIA 3A0RB 4ZTUB 1RTTA 1SC9A 2Q4TA 3BUSA 2G7MC 3GJ4A 1GDDA 3TW8B 1ZICA 2A1UB 3CEAA 2GOYA 4KAJA 4XD7A 5JXJA 1PQUA 4G0QA 4JQZA 3D1VA 3X2FA 2D4AA 1I2AA 5EWJB 2FUG6 2P2SA 4W6QA 5AK6A 1S2GA 1PT9A 3RS8A 3K32A 2FN8A 3VTAA 4BEBA 1ZUIA 3HCRA 2QAIA 3JR3A 2H52A 1QIGA 3PIRA 4G41A 4WBNB 1PWYE 2J59A 1M1YB 2IZ7A 2OCKA 3VI4B 1TJPB 2HTEA 2WSMA 3VR6A 3SR0A 2VYNA 2ZXFA 4LJKA 4IIHA 3MT7A 5EP1A 3O9VA 2ZZMA 3JWIA 3QJ5A 2AQHA 1WQ3A 4J3NA 1IZYA 3I1YA 1NXPA 1QHIA 3P2KA 4G67A 4KIGA 3VSDA 3ZWAA 1EHIA 1C9JA 1Z06A 2G63A 2NN3C 4KQXA 5AJUA 1AA9A 1CETA 4REQA 2ILTA 1ZM9A 1SBYA 2UKDA 4ZVUA 3X0DA 1FMLA 1VGQA 2QD2A 1CVIA 2PZMA 2XTZA 4OI4A 1POXA 1U7PA 4MV8A 3L7NA 5BSVA 1E1QA 1E2NA 3OD5A 1WZCA 4FIZA 1Y7PA 4AB1A 3HKCB 1JIVA 3KALA 3GUVA 4MUYA 4ZZ1A 5ITVA 3PZRA 3UG7A 2PYIA 4OBBA 2QN2A 3WV5A 4Q4CA 4B4KA 2V1UA 1GL7A 3I6IA 3J81k 1O0BA 1MRSA 3P94A 5BQFA 3SYRA 3U4MA 1I7SB 1JL3A 4YWJA 5JAMA 3QK7A 2WJWA 4PW0A 1WOMA 1IWPB 1YWGO 2DHEA 1THGA 1GGNA 1LWNA 1R0YA 3P2JA 2GK6A 3O5AA 3UIEA 4YCCA 1IJFA 1H22A 4TWAA 4KDCA 3F3MA 2ODTX 3K31A 4I0WB 4HNHA 1N5KA 4YHBA 1WTCA 4K2AA 2XGSA 1FFBA 2I9PA 4QXMA 1IQPA 1J00A 1Y1LA 4J7CA 5JARA 2W00A 2YWFA 2FRDA 4Q9HA 1TQ2A 4IV5A 1FZTA 1L7XA 1HL3A 4UU7A 3A4TA 1GPLA 1I2BA 3MMXA 1N57A 3G5AA 4XB6B 4P3YA 3L1UA 4Q7LA 3UMGA 1K97A 8LDHA 3T7SA 2NOAA 2SKDA 2HSJA 5JD3A 1F8UA 1JHOA 1ZIDA 2TECE 5BV1A 3DO5A 4ZMSA 2H7YA 1QIJA 5ALGA 5F2NA 1RWWA 1RXWA 1J8FA 4H6PA 3HKEB 1Z82A 5FJJA 4C0LA 4I1OA 1IWBB 3F6RA 1SVLA 1VB3A 4XWKA 1P2SA 2D74A 4GVXA 4K6HA 3OAAA 1UFQA 4PYQA 1XZLA 3JALA 3OBIA 5TT1A 1OLUA 3RD5A 1U8UA 1WZIA 1TPZA 4JQYA 4M54A 3WXBA 3L8HA 3ZIDA 1VI2A 2H54A 3PGKA 3E8XA 3EMDA 5I4KA 1LB1B 1NT2A 5KSZA 3U31A 1EFUA 4EX6A 1PWEA 2F8LA 4L4RA 2C8VA 2XHEA 5DO9A 3FMFA 1BVUA 4D3ZA 4DMLA 1X1SA 4JQCA 4EQZA 4YRCA 1VKZA 4K3UA 3SDSA 3VAYA 2J09A 3AJDA 2HRRA 1ANKA 2G09A 1KGSA 1N8KA 3PJDA 1MVOA 4FLFA 1MH9A 2OCPA 2GFHA 4RK0A 4C08A 2O0HA 4PSUA 5B6PA 3E23A 4MVYA 3KWMA 2A9KA 5JCZA 2PZAA 1GTJ1 3U7GA 2C3PA 3V3TA 4J0KA 5TMBA 2QV0A 5C3MA 2WFLB 4O4JB 4U7TB 2IYOA 2O2YA 3O7WA 3JQAD 1KR2A 1L7MA 4Q3KA 4G07A 1Y4UA 1F06A 3U3OA 4X61A 2AJTA 4F1JA 1JEEA 2V58A 3NHBA 4C0HA 5HIMA 4EPVA 4DRXA 3A9RA 1LI5A 3F6EX 3M6MD 4AMVA 5L4SA 3WLLA 3COZA 3KEQA 3V8MA 3KYIB 1JBKA 1TZKA 2BY4A 1SVKA 4NPCA 2E6KA 1E77A 2GHQA 5FBQB 2YYYA 1T35A 4L5JA 3PE3A 2CF6A 3C7DB 4JKOA 1DAPA 3WLSA 3PCTA 4XPIB 2WAAA 1XQ1A 2P9QA 1UM9B 1ZM2A 3VMFA 1FJXA 2X22A 4C03A 2W83A 1W4BA 4OAQA 4C4AA 3KJNA 1KI7A 4A0HA 3I01M 4ZQEA 4FDTA 5FUBA 4A5OA 4BB0A 4EA7A 5ADUS 4UHCA 1JHDA 5B6JA 3EPLA 1Z17A 2EV9A 2OUIA 4MB2A 2CKMA 4UPVA 3RUAA 3L18A 3I1FA 3L0CA 3WB2A 4F96A 1JPNA 3OZWA 2O57A 3AM4A 1V5WA 2EKQA 3T9EA 3I6MA 4Y9UA 3TTVA 1Z3CA 4ILEA 2DMRA 3JQ8B 3NWOA 5JVDF 4J3JA 5K3DA 1Q2XA 2Z5LA 2E5WA 4EATA 1Q2UA 2X14A 3CR7A 2OB2A 1GQYA 3EEBA 3L46A 4NJMA 3U62A 2MDTA 3ZIAA 2WKQA 4KQFA 1T4BA 3C7TA 1XJ0A 2GZ1A 1M2JA 1IBSA 2K7FA 4FOPA 2Y6UA 3GDWA 3QU7A 5LWHA 1XDBA 4FYYA 2VWQA 1YR9A 5U9CA 3CT4A 4YEDA 1XB2A 3ZTYA 2PWPA 2C3OA 3L9XA 3E53A 1YE3A 3R24A 3RG8A 3W6UA 2QZ4A 2V6JA 1R6UA 1UC9A 1XQ6A 3E2PA 3OF5A 4RNCA 3A10A 4YBZA 3H19A 3HJNA 4CMJA 2WOOA 4PLCA 4R2MA 2O8FB 1A8SA 5ALWA 2WFAA 5CB4F 1OYVA 1FLNA 2IPOA 1MIHA 3KE9A 4MRNA 3T1QA 1ZCFA 2COUA 1ZIOA 2DBVO 3AF4A 3GG2A 1Y80A 3EXFA 3JS5A 2XTMA 4IFEA 1GA4A 3B6MA 4V0NA 2CNWA 3LDFA 4EPWA 4N5NA 1OX4A 3HWSA 2WQ7A 1LVGA 2J9ZB 1PX2A 1QCDA 3RUIA 3L0OA 1XRPA 2V9ZA 1T4CB 3N8HA 4I4TB 5TE9A 4OMFG 1TVCA 1XPJA 3JX9A 3W6NA 1CUGA 3CKYA 4JB0A 1R7RA 4JKIA 1FK8A 2XZPA 4TKVA 3A3KA 1N1GA 3DBLA 2R44A 2BGWA 4UVDA 1U3VA 2GBLC 3KZ1E 3CCCA 2HLDD 4KSBA 3R9XA 3I9NA 3GWGA 4B34A 1F2DA 2I80A 1LJ8A 5T7BA 3PIDA 5LMCA 4KLNA 3TOCA 3RAPR 4MB0A 1FU4A 3ZTWA 5CDSA 1EJBA 2Q29A 4QASA 5T41A 2D7JA 3W5CA 3L40A 3GJ5A 5TMEA 3I8SA 3OJLA 4MPTA 1DUVG 1X8XA 4M21A 3N5KA 4H6XA 4TGLA 5EIHA 3L4EA 2EIXA 3OQ1A 2OZKA 1L4GA 1NULA 2ETVA 4PAWA 1NG9A 1K2WA 3ZQUA 4I1SA 3IYLW 1G20B 1KYWA 3OTWA 3TVYA 2UYHA 2PMFA 1H5QA 2Q5QA 2YV4A 5ERYA 4DMCA 4GR9A 2SNIE 3PK0A 2GDJA 1FFYA 4O5AA 3ZVMA 3GJSA 3WZLA 3KAQA 4KDFA 5MDHA 2X0NA 2ODEA 5J23A 4RVSA 4PO9A 1X9HA 2W8BA 1R15A 2QB5A 2G72A 3Q0TA 5J4HA 3PS9A 5KNCD 4A8TA 1N0WA