1RWNA

Crystal structure of human caspase-1 in complex with 3-{2-ethyl-6-[4-(quinoxalin-2-ylamino)-benzoylamino]-hexanoylamino}-4-oxo-butyric acid
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
173
structure length
173
Chain Sequence
TSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of caspase-1 inhibitors derived from Tethering.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Interleukin-1 beta convertase
total genus 50
structure length 173
sequence length 173
ec nomenclature ec 3.4.22.36: Caspase-1.
pdb deposition date 2003-12-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1rwnA00
3H1PA 3IBCA 2J32A 3GJQA 1I4EB 1NMEA 3D6FA 4ZVTA 4QUEA 1BMQA 1RWKA 5LU9A 3DEKA 2CNKA 4QU5A 2WDPA 3R7NA 4AW9A 1GFWA 4QU8A 4QUBA 4AWAA 4QTYA 4N5DA 4N7MA 2FQQA 4D3XA 3RJMA 1K86A 2CNOA 3NS7A 4IEFB 2HBRA 3PD0A 1CVRA 2H4YA 2XZTA 1RWNA 2C2MA 4N6NA 4D3ZA 4DCJA 4QUDA 2J30A 3GJSA 3OD5A 4N7JA 2QL5A 2C2ZA 3DEJA 4NOLA 4PS1A 2FUNB 3KJFA 4NOJA 3NKFA 5IAJA 1CP3A 4JQZA 1RHMA 3UO8B 3GJTA 4IYRA 4EHDA 5IANA 4JJ8A 1JXQA 3R5KA 5IBRA 4NBNA 1F1JA 4M9RA 1F9EA 2C2OA 1QDUA 3SIRA 5JFTA 1ICEA 3S70A 1KMCA 4EHHA 4QU0A 1SC4A 3IBFA 4PRYA 4LSZA 2H5JA 4QU9A 4ZVSA 2CNLA 3D6MA 5I9TA 5IC4A 3R6LA 3R5JA 4JR0A 4QULA 2XZDA 2DKOA 2J31A 2QLFA 3P45A 2XYHA 4I1PA 4PS0A 1QX3A 1RWVA 2Y1LA 3H11A 1RWOA 2NN3C 1M72A 2HBQA 3NR2A 4JJ7A 4ZVOA 4I1RA 4DCOA 3H11B 4FDLA 5IARA 2H5IA 5IAEA 5IASA 4HVAA 4QUIA 3EDQA 2QL7A 3PCXA 4EHKA 5IAGA 2QLJA 1RHRA 1RE1A 1SHLA 2HBZA 4HQRA 5LUBA 1I3OA 4NBLA 4QUAA 4NBKA 1I51A 3DEIA 3V55A 2Y0BA 1K88A 4JB8A 5IBPA 2C1EA 2CNNA 4HQ0A 4PRZA 4D3YA 4JQYA 4EHAA 3QNWA 4ZVQA 2CJXA 5IABA 4NOMA 2QL9A 1RWMA 2H65A 1RHUA 1RHKA 3DEHA 4FGUA 4EHNA 5IAKA 1RHQA 3KJNA 5LUAA 1RHJA 3H0EA 4FXOA 3ITNA 4QUJA 2H54A 2C2KA 3D6HA 3E4CA 1I4OA 3UOAB 4JR2A 5IBCA 1SHJA 5IC6A 1RWWA 4FEAA 1NMQA 4NOKA 3V6MA 3V6LA 3S8EA 2XYGA 4JR1A 2AR9A 2J33A 1SC3A 1QTNA 2K7ZA 3EDRA 1NW9B 2CJYA 2XYPA 3H13A 4ZVRA 3R7SA 4EHLA 1IBCA 5K20A 1PAUA 4JJEA 4QUGA 4DCPA 1NMSA 2H4WA 1RWXA 1SC1A 5I9BA 2QLBA 3R6GA 3V4OA 1PYOA 3BIJA 4EHFA 5LU8A 3GJRA 2H48A 4ZVPA 5H0IA 2HBYA 4AWBA 2P2CA 2H51A 3P4UA 3PD1A 4N6OA 4ZVUA 4EJFA 1GQFA 4QUHA 3V4LA 2CDRA 4N6GA 2FP3A 1RWPA 3R7BA 3V3KA 3KJQA 3K7EA 4QTXA 3SIPA
chains in the Genus database with same CATH superfamily
4DYVA 3WK9A 3I1YA 3I42A 5IVPA 1NXOA 2EJCA 4GYKA 2X0NA 4BV3A 4L8FA 3RBVA 3VR4H 1H0RA 5A0VA 1FY2A 3NQ41 5TX7A 1ML3A 3I2IA 1FFWA 3L5OA 1I80A 1JX6A 2FP4B 4EW6A 4DDUA 3O8CA 2VWHA 4RKFA 1MJ5A 4YMLA 2B36A 1RYNA 2B94A 3THXB 2H4YA 3BCUA 4V0SA 1Q0QA 3URKA 5E4TA 2CLMB 5K3FA 1FTQA 2EZ8A 1VE5A 1MGPA 2HXGA 3FY4A 5FHRA 4W5NA 5EKUA 1FFXA 3LUAA 3VRHA 4B6JA 2FK8A 4E13A 1JJVA 1LW6E 2FSFA 4RFSA 3PK0A 3D3WB 3ZQJA 4B3FX 1WB5A 1OFVA 5IANA 1DGQA 4KIJA 4TLEA 3RV3A 5CDGA 1Q0TA 1IJFA 2BGNA 2CNDA 2X5OA 4JJIA 3UW3A 2G09A 1Q21A 4W8GA 4URWR 3TLAA 2ILTA 2JFFA 4WWHA 1MO3A 3K1AB 4PN3A 5JCZA 1EH5A 2AOUA 2HO5A 2ST1A 1NZDA 3HO6A 1IPEA 3U3XA 1SHTX 3LCUA 1PBNA 1PEDA 4MB6A 1ISSA 4AP5A 2QMEA 3P45A 3TRDA 3HRIA 5BWNA 3NEYA 4EJ0A 1KI3A 2UZ3A 3IURA 2A33A 2QVYX 4P93A 4ZVVA 5LXTB 3QVOA 5TMBA 1SR8A 3ZQUA 1AK2A 3LWNA 4HX2A 2ABWA 4AS2A 1N2HA 2IHNA 4HDSA 1Y42X 2P1ZA 2AMYA 4YROA 4FFDA 5KVQA 1N7IA 1AT1A 3MAJA 4RVDA 2RH8A 4KFUA 1HNNA 1ZU4A 3JALB 4MS4B 1B16A 4MP6A 4Z2AA 1JFTA 1SG9A 4PZUA 4WVLA 1DRVA 1FBNA 4I6GA 5BWBA 1VIVA 1WIWA 5SY6A 4EHAA 1YVRA 2COKA 2O7RA 4IV0A 5JJKA 4ZEWA 3MIZA 1UBMS 4TT3D 4F56A 6REQB 1ZIXA 3JAWA 4LRXA 2QBYA 5LBTA 2GD0A 4S12A 1YB5A 1GADO 1EEHA 5HKLA 3G89A 5HJEA 3GWGA 2Y1WA 4RENA 4F3TA 2QY9A 1Y89A 1ORDA 4FIDA 2W98A 1V5EA 2Z8YA 2C84A 1CF4A 1WXFA 1Z8DA 6LDHA 1OTYA 4QJIA 1UAYA 2J0UA 2IIVA 5BP7A 4W5TA 4L95C 1PV2A 3FNRA 2VZ0A 3B3JA 3N0WA 4TN5A 3RV4A 3OE7D 2BTOA 1GPH1 2CL0X 1RBMA 2QZ4A 2SCUA 2I3DA 3MOSA 5GMOA 1DC8A 1A1VA 2RKOA 3KT0A 4ZO7A 5HEKA 5ULLA 3WGMA 1WXWA 5FULA 4EY6A 5CT8A 4Z9XA 1F5SA 1M1YE 2R96A 2XNHA 2ZYIA 3GOHA 4XGRA 5FOWA 2E4XA 1XU7A 2H2AA 4I1UA 1WD5A 3PG5A 4LDAA 4Q3EA 2PWYA 4Q9IA 3L82B 4W7SA 4MUYA 4DMMA 4LF5B 3ASUA 2HRDA 1T1EA 1KZ4A 3E3OA 3KVRA 5EXTA 3MINA 4F6CA 1TJNA 2GZAA 1AUOA 3I2FA 1RRMA 5HS4A 1FVHA 3AQ4A 3I76A 3PNLA 1WPGA 4JJZA 5KQPA 3FA2A 1P17A 3JAWB 2H0AA 1TNDA 2E37A 4EKYA 4P38A 4BCCA 3ESRA 4LXUA 2IOFK 1JHYA 1FVXA 2J32A 2EGGA 3T3HA 4LRQA 1Y1KE 2VAWA 4ARAA 3IVXA 5CBPB 2VP3A 2VCYA 1IONA 2ICAA 4NXMB 1TCUA 2SBTA 1KI6A 4NE9A 3WAKA 5IT5A 4UBJA 1MHTA 4QUBA 4ZU1X 3AKZA 4R41A 1KI6B 5H81A 1SURA 3HCAA 4Q7QA 1YIAA 4DUGD 1ZJ5A 3IOMA 1T8PA 2D1SA 1JLMA 3SX2A 2RAVA 3JQ9A 3JAKB 2O0JA 1HA3A 3KTFA 1M5RA 5DM0A 2D5BA 3TLYA 4QQNA 1E1CA 2VAVA 1B6SA 1LEHA 5LP6C 3EQ9A 4F4HA 3O1IC 3FCCA 2QTFA 4CF5A 4EP1A 1C7ZA 1Y0BA 4AY5A 2B1IA 1ZI8A 3HGMA 5KYUB 2C7PA 3MINB 4NBNA 4IIDA 4JBGA 1T9GS 4Q3KA 5ES4B 4S05A 4GX2A 1Y63A 1JKXA 1KPGA 1VTKA 4BB0A 3MM4A 4XA8A 3EXFB 2OTCA 2HF9A 4Q3NA 4BN0A 4GSLA 1GDHA 4XCXA 2F9LA 1XALA 4HS9A 2HDHA 4LWQA 3UGTA 4W7HA 3UF0A 1KJWA 1Z37A 2VZ9A 3R3ZA 2HK6A 1NKVA 1T9CA 1TMKA 3I28A 4JBNA 4MLDA 5D84A 4D8WA 1E9AA 1U3TA 2OBMA 1J8QA 2OHHA 1H2XA 1IHXA 5EQFA 5U1PA 1JIJA 2OGSA 3OTIA 1R66A 1WTAA 3TXYA 1T9HA 1FP1D 3T4UA 4BLSA 4YRAA 4ZCSA 1E1MA 1SBTA 3LMKA 1XDDA 3U40A 5KO2A 1U1DA 1Y80A 2RH5A 4J2OA 1EB8A 2R00C 2RGDA 1N4AA 4CIWA 1DZIA 3FCUB 5KYXB 3DZJA 4R6XA 4OX9B 1M67A 4OHRA 4R31A 1CWUA 3W1WA 1BW9B 2BTEA 3MEQA 3VYUB 4OHXA 1N2CB 1SBZA 3JQDA 4JU8A 1SWWA 3OSZA 4EG8A 1XD2A 3NKVA 2EFJA 2W11A 4M49A 3TTVA 4B6PA 4DA7A 5JPCA 2ZOSA 4RC9A 2KX7A 1XDZA 1Z36A 2DFTA 2QVZX 2VK8A 3EWSA 4E2ZA 3Q3VA 1ZUHA 2YVAA 4W5JA 4RETA 1OJ7A 1QYCA 4BKRA 3NX4A 2PX6A 1TVMA 2P3LA 3FJ1A 5I3ZA 1YVDA 1Z7WA 2HMAA 3ZZNA 1NFQA 1MVLA 2Q5JA 3NW9A 4FQ7A 3ZQ6A 2OBFA 2Y66A 2CHFA 2NSYA 2VDUE 4Q3AA 5CT4A 3WSWA 5HSGA 3B36A 4H3VA 1NBAA 2XOKD 3LQYA 2OV1A 8ATCA 2AG5A 3TLEA 1NFFA 1W36C 5JANA 4RQTA 4XAQA 1L7AA 2X2FA 3ZCSA 3U6KA 2R11A 4JFRA 1KQ3A 3NM4A 2VT2A 2H7XA 1Z4KA 3TNLA 1TEZA 1Z3CA 1NBHA 2ZRJA 3DO6A 4FB4A 3PHJA 4HP8A 1W1UA 4D9HA 1EXWA 3DEYX 1A5TA 3DLPX 4KP7A 3I8SA 3O0DA 1AY0A 3ZLBA 2UV8A 1M74A 2OM6A 1OWPA 5LPNA 9LDTA 2GBFA 3DMRA 3FJOA 1C0PA 2X9GA 4E4RA 3NYRA 4NE7A 3IJEB 4C08A 1HLGA 4O3MA 1K5GA 1DQSA 1EQUA 4E14A 3CJTA 2WHRA 3F3SA 2HC9A 4IDHA 3HWWA 2B8EA 2YOGA 3C14C 3GJQA 4GI5A 3GRUA 4LFCB 2I6FA 1GA6A 1YCDA 3E8MA 1J33A 4BASA 1CR1A 2QZJA 3UK6A 4ZAVA 2PUJA 4MH0R 3EWNA 1M8KA 3KB1A 3LDAA 4MVJA 4QWMA 5DX1A 3KJXA 3BXZA 1VSBA 3GB9A 1SO8A 2VPQA 1W7AA 4TQUS 5A71A 1UBUS 3A9SA 1C8KA 5AKGA 1XEWY 2FWMX 1JTEA 2QRNA 5H8WA 2JA1A 3PTZA 4IGFA 4N3NA 1F38A 1RXEA 1YJ8A 2W6JA 3LT4A 3OLWA 3HWRA 4Z3OA 1QANA 1YR1A 2JEOA 2XQIA 2QM7A 2ORED 1TIKA 2QLTA 4LZNA 2XIJA 3K9GA 1PEKE 4JVLA 3BKWA 3BTVA 3OCUA 3WTBA 1KFBB 1C8VB 1EVJA 2Q3EA 4GBJA 1UBGA 4DA8A 1VCIA 3AV3A 3Q41A 4FTWA 3VR6D 3OX2A 5I7FA 2QI9F 3UPUA 1EFKA 5FTKA 5EC8A 5KYGA 1BU5A 3IQDB 3M9XA 1JIQA 2TMYA 3P9YA 3KNZA 4KLAA 2A5DA 2FQ1A 1M8JA 4FLFA 3S55A 4CUZA 2GEDA 4FS3A 1Z6AA 3PS9A 5LCXA 7MHTA 5IP5A 2WY2D 5FA5A 3HCRA 4MV6A 3CLUC 3TF5A 4FBMA 1J20A 1M2WA 2D54A 3EXEB 5LP6F 4BNIA 3IB6A 4L9AA 4C7JA 1XMJA 1O6CA 3E2MA 2JLXA 3LDFA 3AO0B 1OXVA 3HZZA 2QWXA 3GQVA 3TB6A 3PNOA 4OMDA 1B8NA 3F5QA 1CY0A 3KJEA 4JVMA 1J09A 4ZAWA 1NYTA 1HF3A 4EDHA 3UTDA 1JL3A 1GPKA 4Z4CA 1YNSA 3MERA 1FXWF 5AM0A 3ND7A 1XA4A 3Q7SA 2WV7A 2K4MA 2YJ3A 3ZCVA 5JT1A 4ABYA 1DQRA 1W9HA 1XDUA 1HO3A 1GU1A 2FUG1 2PQMA 1DMRA 4PHCA 3T99A 4FDAA 1QP4A 3T5BA 1JAXA 1MAWA 3PPWA 3EA4A 2XKBA 3N76A 3X2FA 4RPCA 4QNRA 4CMEC 1ZFNA 3BB4A 3TTTA 4BP8A 1FRZA 3K8ZA 3ZU2A 5CXQA 3MT9A 1WHSB 2BLNA 4IIJA 1FFEA 5LA6B 2C9DA 4NU6A 5AH0A 5JBQA 4LE2A 3W7VA 4OX9Y 1QUEA 3VDRA 1W1IA 1XEWX 2JATA 5EJ2A 5F3RA 4I19A 1UKAA 4H7PA 3WIBA 2W2OA 1KSGA 2RBEA 3KWJA 2FFJA 2ODEA 3DMPA 4C6HA 1PAUA 4BBPA 3S2IA 4NCBA 3B2QA 3QWHA 1V1RA 5JAPA 2IYOA 3K70B 3WKDA 3UC5A 2J1LA 4MYCA 4D3DA 1VECA 5T6MA 3QMPA 4QTTB 1L3IA 1QRDA 2EVWX 4AUEA 4G0NA 1RR6A 5K8JB 1F0NA 1ODSA 3PXAA 3CGGA 4HGPA 1JAZA 4AJ1A 2WM9B 3W79A 4C3ZA 4ENRA 6Q21A 2BJHA 2JJ1A 4HDCA 1CXZA 2H1CA 2XUGA 3H1PA 1YBVA 2JEZA 3KYJB 4WCFB 3SSOA 3TSZA 3D1VA 1XA0A 4BVHA 2V59A 3JCZA 2YXDA 1NLUA 1MX1A 2CVOA 3EDOA 1JNXX 1U7PA 4QWWA 1NASA 1V5WA 3BH7A 5EFOA 3GLVA 4CEIA 2QN2A 4EFLA 2KJQA 3P71T 1PR4A 4GEGA 4YH1A 1SNYA 2Y1FA 1YB7A 4AKSA 1VZ3A 4CLRB 3EA0A 4FWBA 1GKKA 3IQXA 3ZC3A 2QL5A 3AINA 1IY9A 1X70A 5SZIA 3SJUA 2RH9B 4K9NA 1B00A 3GFSA 5TJHA 3OZAA 2QB5A 1RJDA 3LUHA 5ALNA 1P6UA 2JZOA 5IM4F 3H1FA 3TI9A 3LZ6A 2O8EB 1OI4A 5ER6A 4QOEA 4A73A 2FPSA 2NV0A 2AKYA 5DOVA 2XT9A 3OQJA 2IA5A 2Z30A 3K8QA 3MFQA 4YRNA 2ZYHA 4D43A 3QA9A 4JI7B 2WMDA 4K1XA 4DPMA 2K7FA 4AF6A 1NVEA 2ZM5A 4LS3A 1Y1LA 4X65B 2CNLA 1ILWA 1PW7A 2BTQA 4M1YA 3HN7A 3ZU3A 4CE6A 1YHZA 4OQ4A 5FDFA 1BDIA 2BKAA 2GYUA 2ZRKA 3N8NA 3MJVA 4L78A 4B2YA 3L8FA 1C2YA 2Y6UA 1B8VA 3TNJA 3WAGA 4HVAA 4F8EA 5LKRA 3A25A 2YIJA 1FTNA 3MUNA 2QTVA 1Z88A 5C9ZA 2AQHA 3WK4A 1I2ZA 2P9BA 4BLUA 3PQ8A 2HBZA 3DNMA 4E70A 4OB7A 3FWYA 3DGEC 1TB4A 4UJ3A 4YCAA 5I7UA 3HUEA 5AUNB 2FZEA 4KQFA 5AW6A 1UQUA 2C03A 3DBLB 4TS1A 1RAEA 2FLVA 5F1PA 3QPBA 4CKCA 1B76A 2YXEA 1DRWA 4CUJA 5AK6A 1N6RA 2C0QA 2QGFA 1BEZA 3CKYA 2EZTA 1ZLYA 5D51S 2OHIA 1B3BA 2WG1A 4IQFA 4ON9A 3NAMA 4ZI7F 1H0KA 5KYYA 2DLDA 2B3TA 4OP1A 1XQWA 2VUHB 4DRXB 3KT3A 1YKGA 2WICA 4L9WA 3BGVA 2GN8A 3DWEX 4FQ8A 1ZRSA 3SHVA 4QAJA 4OM8A 1E2GA 3RRJA 5MF6A 1UZNA 5C81A 2FZLA 1XZJA 3HP1A 3L8YA 4C87A 5B3JA 4MV9A 2MTBA 3FHCB 5JXWA 3NDPA 2ROQA 3ZE1B 3EDRA 3TRIA 2EJVA 4D45A 2ZUCA 1W52X 3CLRD 4CL0A 5I4IA 4ESVA 2X76A 4JOBA 3BZUA 1X9HA 4HAIA 1A7UA 4I6EA 5ESRA 1IQRA 4LWOA 4BGIA 2BPOA 3GNLA 4DCPA 1DCFA 2WYWA 3OE1A 5F98A 3T5DA 4AJOA 2Y92A 2IE8A 3PE4A 2XDYA 4O2BA 2O8DB 1H9AA 1ESZA 2I76A 2ZR0A 4YGXB 1U2DC 4IYJA 2V8OA 3RPEA 4QG3A 4AJPA 1JMYA 3D2CA 1P3Y1 2HMWA 2V8BA 2UYYA 1FFGA 2XNKA 5HDQA 3DBLA 3R3UA 1WHTB 5FFNA 4KFCA 2EX0A 1KYIA 3TFWA 2PTGA 1E9DA 1C3VA 3LG2A 1O94A 2HV8A 3OX4A 4JLKA 1NU6A 1YKFA 3R0VA 3UOGA 4BBAA 4F2HA 5I45A 3O6VA 5I9IA 2A0XA 3N58A 4MZXA 2JVKA 3RSLA 3CRW1 3DV0A 4ZEMA 2ZJAA 3OOEA 4YMIA 1CJBA 2A94A 4AG3A 3EXHA 1TUEA 2Q8QA 3HR7A 3NHRA 5DFAA 1AB5A 3SYNA 2GD1O 3ANYB 1G20B 4E5DA 4BUZA 4IHQA 1EWQA 4EUFA 4NS1A 4YV2A 2IEDA 4G1FA 4X91A 2R1ZA 3C74A 3I30X 1CUXA 2GX6A 2R1TB 3W5AA 4TKLA 3VR3D 4WD3A 2J41A 3ND8A 3RH0A 3T0IA 2X40A 2HF7A 5I7WA 4UFOA 2XVZA 4ALJA 2JGFA 1IE3A 3GAAA 4LPKA 4U5XA 1RRKA 3HJCA 2JFQA 1M76A 1JXQA 4Y2HA 4WZZA 3JD1A 3OESA 1Z16A 1T5BA 2VO1A 4EB6B 2FEKA 4C0LA 4MWSA 4EHHA 1ESMA 3ZH9B 1T6XA 2QTTA 3IP9A 2R47A 4Y2RA 1AGYA 5KNCH 1ZL0A 2P9CA 3B60A 3G2PA 5EUQB 2OZLB 2E18A 2G7ZA 2ZSJA 2B4RO 2WU3A 1VJ0A 3HM2A 4QGFA 4BNKA 1RWVA 2PGOA 1ZWLA 5LR6A 4QFDA 4JI1B 1IN6A 1R5BA 2IIQA 1CS4C 1E60A 5KNDH 4FDLA 3MSCA 4NU0A 1ZWKA 4LPSA 4B4UA 3QENA 1FEZA 3AF0A 1F3LA 1P91A 1DHRA 1I9CA 3EUFA 2V74B 3I9V6 2YJZA 5INTA 1ZGBA 4BL5A 1VQ1A 4IH1A 4BX0A 3U4DA 4D9BA 2XITA 3T95A 3KP1A 2FPKA 4PC2A 3P9ZA 4RK4A 1FBTA 2ZRFA 4BE7B 4JROA 5I5EA 1CDZA 4ND6A 2QD4A 3EY4A 3ANMA 2G06A 3KIPA 3AESA 3MBOA 4TROA 1HE1C 1E92A 3PC6A 4QQ8A 3DQZA 3KT6A 4KWTA 2LV8A 4BMYA 5JNWA 1YUNA 4Y9DA 3OJXA 3H2BA 5LMUB 3JPWA 1KJYA 3QOFA 5DLPA 3A9RA 4CCYB 4PIPA 3UT5B 5JISA 6ADHA 2I2XB 2FGKA 1X9GA 3PQ3A 4D3SA 4UTVA 3CPEA 2JFUA 3OPMA 3QYPA 2FX5A 4M46A 4MQFA 1G6HA 4XDGA 5TQ0A 1HFWA 3LHFA 4AKGA 2CHQA 3RSHA 4KUHA 1DWQA 2QZPA 2JLCA 3FBGA 1SCBA 3CE9A 3IT3A 4C6TB 4F8YA 4PYMA 3LUBA 3C3JA 4RTQA 1VJ1A 3Q72A 3C97A 4BNVA 4IMPA 2V6MA 2GNPA 3F9CA 4QDKA 4XQEA 2IPXA 4BVLA 1X8LA 1EGAA 4N6OA 4FHFA 3D7KA 5E3JA 3HQ4O 3ST7A 3TE6A 5LJIA 2VCHA 4EA9A 4TXNA 4QPPA 4WLUA 4AUKA 4XH9B 1HG1A 2IEIA 4RMNA 4F38A 4II7A 1V1MA 4O4IB 4WFIA 3VR4A 1X92A 4HVCA 4X1KB 3P0EA 3D6VA 2XB6A 1ITZA 3CHYA 2C8VA 1JKFA 1ZMBA 3ONEA 4M1ZA 1YS6A 4EMBA 3MFYA 3Q11A 3KSZO 3QPVA 4LDNA 1M10A 3OEHA 2Q9CA 1Y3HA 3I0NA 3IAM1 3M6MD 3JQ6A 3OLQA 4J16A 4MYTA 1H0SA 2PFKA 3LQ4A 4REMA 4TTIA 2DEUA 4MQ4A 5H1YA 4EJSC 2GJ9A 4OFWA 3U7RA 4MQBA 2WWVD 4PLHA 5A9TA 1UP4A 1G8PA 2GDZA 1F8FA 1RYHA 1YRHA 1Z7YA 1ZSVA 3E6AA 2FMUA 3BMQA 4TMFA 1G7RA 2VAPA 4WDRA 3SC2A 1GDTA 1TA0A 3RAFC 2BKLA 1N6PA 3ZGNA 1NXTA 3NNDA 3Q4GA 4PZLA 4F96A 3QYFA 3GWZA 1R6XA 1N0WA 3DD5A 4DMHA 5JYCA 1CR0A 4NMLA 1OFUX 5SZKB 5KTYA 1QTIA 2YMLA 1K5PA 4YGYA 5KYVA 3F9RA 2FPOA 3V80A 4U2GA 2W70A 4OXKA 4NZPA 4MGHA 1NZFA 2OHGA 5EFZA 1RSZA 3W8EA 4UU7A 2VXBA 3PQ6A 2VAXA 2PEZA 3G9QA 4FWTA 5I9SA 3MWKA 4LHZA 4RMJA 3DZDA 4OYYA 1FZQA 1K06A 3OT5A 2I8AA 3CNHA 3QBDA 1TGYA 4MPJA 4YJHB 2BDTA 2VEOA 2PX4A 2QUKA 4R9RA 3LRTA 4DEXA 4I50A 4RLQA 1HFEL 2C4MA 4YRJA 4PG4A 5LUBA 2OAP1 5A3JA 2J4DA 5HZKA 3ERCA 4JZKA 3NTXA 1AD2A 2ISSD 1DADA 3G49A 4RF3A 1GT91 3GT4A 2DWQA 2ZBEA 3I83A 2C4HA 1WMAA 3DE1X 2JD2A 4QYTA 1H5NA 4KO3S 5HM8A 2V97A 1KEVA 3ZDCA 1QK4A 4URFA 4KGDA 1AMNA 4QO8A 1JB1A 2IEGA 3L92A 1LSUA 1XKQA 2V9ZA 3NRBA 3Q8KA 3KWFA 5H16A 2G6BA 3TRJA 3HCOA 1G9TA 4LBYA 2C2XA 2O3RA 4YV1A 4HNQA 2ERCA 3R0JA 3TAXA 3H0EA 3PNVA 3TQSA 4LF6B 2IHKA 3IH5A 3C7AA 1YHNA 2FPWA 2I8CA 4DCTA 1U5AA 4UM7A 4JUFA 3MWDA 2P2ZA 4F1JA 4CBVA 2Q1SA 2VUIB 1IOLA 2FRXA 2G4VA 1N7HA 3F9IA 1DTWB 4Y2QA 4UHBA 1SAYA 1QTNA 3C8HA 4YS6A 6YASA 2Q07A 2C98A 2J85A 5FBWB 3T1NA 3A4TA 4HL6A 4LW8A 4RL6A 2HHHB 3BL5A 1QIDA 1QJ4A 2QUJA 4PLCA 4CMBA 2ZFUA 3P26A 2FGJA 2GLXA 4Y6SA 5DNEA 5FUWA 5KQRA 1PR2A 1J4AA 5MDHA 3TG2A 4GM0A 2ZUWA 3EVBA 3ZU6A 1MIOA 3EIHA 3FMIA 3S1AB 1UXOA 2FZGA 2D5CA 4O4JF 4GXNA 1NW4A 1XX6A 2JC3A 5KJ6A 5J4VA 2HH9A 3DE2X 2XB2A 3CF4A 3HKDB 3I09A 1WNFA 3MJDA 3NWBA 1DX6A 1UC9A 3CURA 4RHYA 4ZANA 3ZIUA 5GJBA 2H17A 3DL7A 4RVGA 1PZXA 3DOEA 3B9BA 2QMYA 1Y8QB 1DUSA 2HAEA 4IIEA 5AHKA 1YU6A 3SKXA 1C41A 2W58A 4M9XA 5LU9A 1JWBB 1UH5A 1YDWA 1CUVA 4ZT6A 1ULUA 5EPEA 3HP7A 2X7XA 4PSVA 2XMDA 2F8MA 1E4EB 1T35A 1VE9A 5COAA 3G2JA 4BLWA 4PONA 4OI1A 3ZDZB 3AR5A 2JAPA 5E6RB 3V1LA 5LQUA 3KKMA 3MW8A 1G21B 1SM4A 3ZVLA 2HKIA 2PZBA 2I6UA 5EZYB 1W93A 4IYRA 4H31A 2UXDB 4INAA 2HQ1A 3G17A 4RHTA 3UC9A 1Z5VA 3ECCA 3THSA 2CUTA 3JVUA 1WTCA 2EFDB 3CLUD 4DCCA 4GL2A 3AEKA 3PRHA 2P62A 5AM5A 2YYYA 2P7HA 1OYYA 1T5DX 3E5HA 1RS0A 2J9XB 1BHO1 3R5JA 2DPMA 3PJFA 3FMOB 4N18A 4HX5A 4DVJA 1BHSA 1M2OB 1XV5A 1OUMA 4X9XA 8ABPA 1KJ8A 1YGYA 2E6KA 3TO5A 3ASVA 4P3OA 2EHDA 3BL6A 1HXHA 3R9IA 1HPLA 3AUFA 5DBHX 2O0MA 4BAUA 1R37A 4HUQA 3SEZA 2Z6UA 1U7ZA 3MLEA 4J94A 3S5UA 3ZE8A 1UEJA 5EP4A 4F3NA 4NU5A 1GG8A 1TQ8A 1YB4A 2JANA 2O1SA 3A11A 4DY4A 3ZIAA 1NKTA 3DEIA 5L7TA 3A6FA 1QS0B 5HBGA 4NECA 1N6IA 1ZN7A 1VCHA 2VAMA 4X7BA 1A8SA 3V00A 5CEEA 1XYVA 1N8SA 3VH2A 2XV1A 1YZ3A 4B48A 4BNHA 5JEDA 2HO4A 1PFWA 1TAHA 2BUAA 3P4XA 4RK0A 3SVLA 1P81A 1VL0A 2UKDA 2AGVA 1EJ6A 2YV3A 5L8VA 4FGUA 4PLYA 4L3WA 4R7TA 3RU2A 4ALLA 4X3CA 1KSHA 5ALRA 2D1TA 2HJ9A 2VTDA 3N8GA 5GGYA 2GHTA 3CT6A 4J1TC 2G0AA 3V8VA 2RKBA 1V1JA 4A8PA 1N9ZA 4LE1A 1IZ8A 2HRQA 2PANA 3AYZB 3IUMA 3OZEA 2JH3A 1ZONA 1OBVA 2NNLD 4NP6A 1XKTA 3QKTA 3EEQA 2I1QA 4TXMA 1HG0A 3HXTA 4WFKA 3PICA 2ZWOA 1P7YA 4QOHA 5BN3A 1NVUQ 3KXPA 4KXLA 2VEDA 4OQXA 2Z95A 2BHTA 1JQBA 2IHJA 4R54A 5D8DA 4LNUA 1KI1A 4NNOA 2H8GA 3QE0A 5D1HA 3ZBPA 5CEJA 5LQJA 3K8YA 4K6HA 3SEAA 1VLQA 2GAJA 3VU8A 2D3TA 2WJPA 3BWXA 2Z3WA 1FRFS 3EXAA 1RYMA 2HW8A 2CWDA 1KK0A 3S2EA 5L3RA 4J6FA 4BNDB 5KOHB 2KB0A 3FNGA 3NPAA 2QY6A 4HHEA 3TRFA 2REXB 3N74A 3ZZUA 1X14A 2GYYA 3AXTA 2JAUA 3ZI4A 1A4IA 4LZWA 4YJ2F 3KSUA 3UMVA 3GLIB 1LKZA 1YBAA 3KYIB 1VJRA 2WR8A 2FQYA 3I3SR 4UUOA 5DK6A 4AJLA 1SHZA 3CNLA 5BUZA 1LBQA 4A0SA 1MXFA 1HT1E 3HYCA 4U2CA 1FLNA 4FFSA 3QKSB 1X86B 2KHZA 2FPMA 1O8BA 1USVA 4D4KA 4ID9A 1Y9AA 1JH8A 3O3CA 4MVCA 2Z2IA 1WUYA 3H9BA 5E0KB 5JADA 4OGGA 3T9EA 3M4ZA 2VQEB 3NS7A 1IRXA 4YAUA 3VR0A 2GOYA 3M0EA 4IVPA 1OFUA 1PDWA 1E9FA 4LJYA 1W59A 5I01A 1CP3A 2QXTA 1IAVA 4YDSA 1LGYA 4UXJA 3NHYA 3V4VB 3TI7A 4GM4A 3T6KA 3UATA 1M0WA 4EGJA 1HDIA 3FSRA 4KH0A 3TOSA 4ECEA 1UDWA 1ZQ1A 1H42A 3TLBA 3IXQA 2Q1XA 5DNYB 5MFPA 4BO2A 5DNAA 1X7XA 1E99A 2OLEA 1YB1A 3ZWPA 3TNFA 3BN3A 3EC2A 4YQZA 1ZH4A 3ONVA 3GJ3A 1VYVA 2I91A 2JPDA 1Y8RA 4YRKA 3WOHA 1L5VA 2G07A 3OEYA 4GSYA 3FNHA 1WF3A 3BGIA 4M60A 2RG1A 1OMOA 2HCBA 4RIEA 2JIOA 5J2UA 1PR6A 2O7QA 3T5GA 3DPIA 4UFPA 3A1VA 4ZHQB 4DCNA 4YP9A 3LL7A 2VL7A 1VE6A 3KQLA 4LBWA 5F3DA 2V3CC 1DCKA 3QFCA 3TZQA 3PF8A 1LDMA 1LZKA 2PBRA 3L8ZA 4OLHA 2ODWA 2BKEA 2PH1A 1J06A 4XEHA 2ZB8A 1SVWA 1GAEO 2TECE 3PCTA 5ES3A 3U81A 2CNNA 4LXQA 1DUIA 3IUPA 4RH1A 5HHTA 2DCMA 1ACJA 1P1HA 1DBSA 3E9ZA 4X20B 2QMOA 3VKVA 2NXWA 4K9RA 5AW4A 4MMXB 4RD0A 3DE7X 3GEPA 4RADA 2OVFA 2VDRB 3AI2A 2ZJ5A 1ECLA 2MYUA 2L82A 3WB1A 4CF6A 5EMHA 1LVHA 1JLRA 2RH4A 5IAKA 1KE2A 3WGIA 2JCGA 1MFPA 5T8KC 3QFRA 5JECA 3J7AC 4HGRA 4GPAA 1XTKA 3RWMB 4ETMA 5LXTA 1U0BB 2ZIAA 2WMYA 3LQ1A 1PEAA 2ADMA 3QVMA 1EK2A 2NX2A 4Z1MD 5LL6P 4B0PA 2GJ8A 4DEYA 4F84A 3C6XA 3EHDA 2E82A 2I80A 4ZAZA 2FXVA 1PJ2A 1ZCAA 2XE4A 3MCVA 3QU5A 2OMKA 3FRHA 4Z3KA 4C88A 2JHPA 2C9OA 3JD4A 4EI9A 5HYVA 1S0UA 1SXGA 3Q85A 5M04A 1VRVA 1L4EA 3PXBA 2FRDC 5JASA 5HJ7A 3COJA 3DFFA 2YQ5A 5SYMA 2V0GA 3BTOA 5IRCD 1J07A 5LU8A 2IIPA 1SEVA 3E9YA 1FRNA 1N5DA 1KDZA 4BS9A 1Q0ZA 1K8QA 1MPTA 1D04A 2FP3A 5G0TA 4UNNA 4PG7A 2H3EA 3CNOA 2GNAA 2GDJA 1QOZA 3V7YA 1TZBA 1ZRMA 2PD6A 5KU1A 5HX7A 1QO0D 2DBQA 2I2CA 1FUEA 2ZZNA 3ESCA 1KZ7B 1O6BA 4XLZA 1OLXB 1WXIA 1QRUA 4HWSA 3ICPA 1GVNB 1E2PA 4RLHA 1PZEA 1W5SA 4QU8A 2ID4A 4MR8B 2YQ4A 1L4GA 3CH7A 4TL9A 2A1UA 3DFKA 3QUCA 4DADA 4IOLA 1RPZA 1QPBA 3S1AA 3FVVA 3HKDA 1TT5B 4FNGA 4I4TF 1X87A 2J30A 2ZEJA 3UMRA 1QWOA 2C2ZA 4W1QA 1CUDA 4NOLA 1Z2OX 2PY6A 4D42A 1X7HA 1LPBB 1DQPA 2Z1NA 3GFRA 2AQ8A 3GUYA 3I2HA 3II6X 1TLFA 1X7WA 4KQ9A 2PVSA 2XMZA 3ONDA 4Q9LA 4MUFA 4HDMB 2F1JA 3LPCA 4BRZA 4EVSA 2ACVA 5JZMA 2D0OB 3C6BA 2WUDA 1OSNA 4PCLA 1KAEA 1Z5ZA 1TYAE 5CDFA 1W2GA 1K7SN 3EBLA 2XNJA 3OCYA 5K09A 3GP8A 1US8B 1Q84A 3G9TA 4L8YA 2V0CA 3N8IA 4BX2A 3SICE 1Y5LA 5JI2E 1Q7BA 5HF8A 3PWTA 1J42A 3RO7A 1JW9B 1YMUA 3FLMA 2F1OA 1ZBQA 3LYAA 1SVKA 4YEDA 3VJMA 3A8TA 4C0JA 4AZTA 5HG0A 3A31A 2HMVA 3DVLA 4G65A 3HM9A 3ZVRA 3B3QA 3NDIA 2DR2A 3UA4A 4S0ZA 5AW3A 3U7QA 2CE2X 4BNTA 2YWFA 4RY2A 3AK4A 4XW2A 1E77A 2PSEA 3BBLA 5L3ZA 1RM5A 1I51A 2GO7A 2I22A 3K2BA 4R2KA 1V4VA 1W88A 1HY3A 1Q2XA 3GMSA 1UK8A 1XJQA 3AUXA 3TZBA 2RE8A 5E8RA 1PNOA 1OIWA 4KE8A 5A05A 4BJ5A 2GZDA 2M32A 2QVBA 3CXUA 4YXWD 1QIHA 4JSTA 1FQKA 1U2TA 2WILA 2WZBA 3NORA 4LZZA 4CQJA 2RGBA 4JT9A 4LSMA 3N7UA 2IYVA 1MTOA 2PN1A 5AM3A 2AX4A 1LF0A 4EHNA 1NWCA 1KVRA 1XRRA 4DLYA 1X2EA 1LS1A 4WAUA 4QODA 4AG5A 1B2LA 1FXSA 2BMVA 3B9QA 4XB6B 3RKSA 5L45A 3RS7A 2CCJA 2GF0A 5IH3A 2HU8A 4YRDA 4D3FA 1GR1A 5JZ9A 1A8QA 5B58T 4ZPXA 3IL2A 1YZLA 1QZ3A 4FFRA 3RC1A 4OLFA 1B6RA 3UB3A 1Y4SA 3V6MA 4BLRA 3RIGA 2NVWA 4AQYB 2UZ1B 4J3FA 4RSMA 3P19A 4NJEB 4QQFA 3M6FA 1PG0A 1BQ4A 1PUIA 4WCDA 5JATA 3RC7A 2W0MA 3OZVA 3WIOA 2V9CA 4BNUA 3ELYA 2YOFA 2AR0A 1RWXA 2BCJQ 3PFKA 2ZJ2A 4FUQA 2P0AA 3OEED 2VP0A 5L6MB 4GS5A 5T3UA 4HYTA 3H87A 3P4UA 5FUXA 4DBLC 1X7ZB 3T94A 2BKUA 2AK2A 3ET4A 2YZ7A 3K0BA 3RAJA 4MCAA 5CXUA 3QPAA 1UWLA 1YCHA 2VF8A 2GI4A 3NBZC 4PXSA 3HYNA 1DPFA 1XHEA 5KC8A 5KQLA 2IHYA 5DT9A 2JDID 2V7UA 4Q4JB 4DQLA 1NR1A 3VVBA 1RI3A 1WV1A 4WTOA 3D2AA 3O3OB 4EKEA 2J6CA 2OCLA 4RSHA 3AMVA 5LD2C 3PTAA 3QLTA 2CXPA 3UWDA 1VXRA 3NC0C 2W42A 3RQIA 4CM1A 4KNWA 4UKDA 2VTKA 2D1QA 3HSYA 5GAJA 1FNNA 2VK2A 3CF4G 5LLTA 1UDXA 3L7DA 1Z6GA 5BUCA 1IBSA 4PS1A 4I4CA 1ND5A 1E2UA 1Z29A 2AC4A 5KSWB 3AM1A 4XIGS 4HRYA 4UQPA 3FPLA 4K6MA 3V1YA 1AKRA 1IN7A 1NN1A 1YDHA 1PJLA 3ZNQA 1K9VF 1Q0RA 2REBA 3CUSA 3PQ5A 1Q1GA 2HSEA 2QRKA 3CIOA 1ZOLA 2YRWA 1K3FA 2GPJA 4RYLA 1F2DA 4MRNA 4V39A 3A3KA 1T3ZA 4Q3LA 3VU3A 3U4IA 5E7IA 1J0DA 2YNMD 4G01B 1EYZA 2EOAA 1PK9A 1E4YA 2ZG6A 2ZJZA 3P27A 4RAOA 4TMZA 3RK1A 3AY3A 2R8YA 2RC5A 1IK4A 2OCXA 1IUOA 3NETA 4NFSA 3JZMA 4ZCLA 4CFZA 3Q2OA 2WB4A 1GNVA 3RYFB 4DC0A 4X1YB 3A6EA 4JXZA 1E7WA 3LGXA 4IDDA 3OPQA 2J9YB 2ZE5A 4BIMA 4GECA 2YQZA 3L01A 1CQZA 1R8JA 1I7QB 2HJGA 2AN1A 1HH4A 1E3TA 1A2BA 4G9BA 3CF0A 2F9FA 4L50A 1FW8A 2ATIA 3NRJA 4OCZA 4LMBA 1NFRA 1PT7A 3BCHA 1XQXA 5DXJA 1A2KC 5DYGA 1FJXA 4ZA2A 4UOEA 1G20E 2JCXA 2VDVE 4ZCRA 1EX1A 4UAGA 2AIRA 2JW5A 3TNDA 2QOEA 3DBRB 4NZYA 1O4VA 4LYGA 4TS9A 4IOKA 4RPHA 2ZWVA 3AEUB 2P9TA 3L05A 3EIUA 1JEQA 3OD1A 3PTLA 1R9JA 1AXRA 1MAAA 2Q4OA 3DEHA 3I58A 3IQZA 1KERA 3M5PA 3OTHA 3Q8LA 3CMCO 3LGAA 4C6SA 1RC1A 2X42A 2EFHB 2MYPA 2AQKA 3QU9A 2F1HA 2JFGA 1EE9A 1MR3F 4FEYA 4UJ5A 1GAQA 1W5EA 1UIRA 3EXG1 4YJ2B 3W4KA 3KOWA 3U4CA 1RLJA 1RCFA 4B7ZA 3CH5A 3D6UA 3EHEA 4S2UA 1J23A 1NVWQ 3KHSA 4WZAA 3R1IA 1UBEA 4JUAA 4CTMA 3Q9UA 5ECDA 3FFWA 4BQFA 1GGKA 1PFKA 2FE1A 1IBCA 3DMYA 4UHJA 2FMFA 4DANA 3QLEA 4LOJA 3AVTA 1PLJA 2ATEA 4A5SA 1T3TA 1Z0ZA 2ZXEA 3NBKA 5K8TA 2QXUA 3H1GA 1XMVA 4QHSA 1KOLA 1Y7HA 3SZGA 3NIGB 1J2UA 5KPJA 1RQXA 2FF5A 4W63A 3FMFA 1LXCA 2OLJA 1PX2A 1OU0A 3O38A 3U7FB 3J81A 1F2TB 2JFYA 4LAFA 1UK9A 4ZZ2A 3X1JA 1H4QA 4KFRA 1BWQA 2REQB 4IMJB 4LVUA 4YIHA 3C45A 1YULA 2ZXUA 4DR5B 3ANLA 1I33A 3BRWD 3QOWA 3S70A 4AMVA 4ABTA 1GIAA 2YRXA 1DIGA 1H8ED 3DLAA 4PGHA 3LLCA 3JU3A 3U1TA 2G04A 2LPMA 2W5UA 4D9CA 3DPUA 1NTRA 3DT8A 3DV9A 1KDTA 4J07A 4MVJP 5U4XA 2ZB4A 4P53A 4CIBA 4CNBA 3A32A 1G5HA 3D2LA 1P73A 4WGFA 4B3CA 4XIJA 5K99A 3MGKA 2PQ6A 5LZ9A 1P4SA 3CBGA 3ZD9A 5B3AA 1ODFA 2LWIA 1ECCA 2KSQA 2ZSBA 4HB3A 3L9WA 3CF6R 3PNPA 4KXYA 4R71A 1MH1A 3N2YA 1Y3BE 4HDAA 1HDGO 5IYZA 3K70C 5JLJA 1CUHA 4QT4A 5FNVF 1UBTS 3ZBQA 2AE2A 1IOVA 1RHMA 3D0OA 3ODPA 3ASZA 5DN6A 9ATCA 3ELBA 1UEIA 3QTTA 4L8LA 3P52A 3OCVA 2C57A 2XYQA 4ZU6X 5JV5A 1ZCBA 4MEBA 1C3LA 4PC6A 4L8WB 3EOBI 2WF8A 3LVRE 2HGZA 2ACEA 3ZNPA 2GARA 5JCJD 3H86A 4NENB 3R6TA 4O2AB 4R84A 3ZVNA 2BR3A 1CPYA 3C5CA 4GOMD 4J0DA 4G3XA 4JT2A 2Q5FA 1W0KD 1AS2A 1L7DA 1SPXA 3HNRA 2QLFA 2J31A 1D5WA 2V9PA 4NAVA 3NMUF 4JC0A 3RUEA 1YC5A 3FKSD 2QVGA 1WUHS 4JEIA 1GGVA 5DWQA 3V8EA 2DWOA 4D0RA 3OPXA 5BRNA 2YIMA 5ICMA 2A84A 1N0UA 3PGLA 5BSGA 1J8FA 3MWDB 1GFSA 2GR9A 4I4IA 2WLSA 4KV7A 3ZCPA 1KJQA 4CIYA 3K30A 1TFRA 4MIOA 5BOSB 5FNVB 5HCIA 1TECE 2H7CA 4C4OA 4BQOA 5CVCA 2BGTA 3E9EA 3U17A 4S1NA 3T9CA 2VP9A 4US0R 3M89A 4JLMA 1MO2A 1TLTA 1N2ZA 2MU1A 1LDNA 3C7KA 4NCHA 3ZYZA 2PT6A 2IUYA 2AJDA 2P27A 3ADKA 2GZ1A 2MCFA 4COOA 1Z35A 4E11A 1V9LA 3KQWA 2RHCA 5ALPA 3L0YA 5K0ZA 5ISMA 4MOWA 3IP7A 2EKPA 3PI6A 3HWSA 3VVCA 1F06A 1GGHA 1Q57A 1WP4A 3OIGA 1N2OA 2YL2A 3WADA 1HLDA 2AN9A 3AIOA 3W0LB 4U7HA 4GO1A 1UK6A 1VI5A 2YVLA 1ZVJA 5A5VA 1QCDA 2YWBA 1D1SA 2IZ6A 2VJBA 2WA2A 5JTTA 5C4IA 4KMSA 4WZBB 2OYRA 1GPJA 4DIOA 2PUFA 1NF3A 3X43A 3I2KA 2O0HA 2C9MA 3ZG6A 4NQZA 3STYA 1GPUA 2CXSA 4HQ6A 2QU8A 4Q3DA 5DHUA 1GUYA 2WUVA 4XI9A 2C61A 2FXIA 1P9NA 1WHTA 1FDRA 1Z0DA 2HIMA 3AFGA 2C8LA 3E7PA 1KS9A 4K40A 4PSDA 4EQ6A 4QM7A 3C1UA 5LNK1 4EFNA 2Y1CA 2P8SA 2G4LA 4YRFA 4P98A 4UCFA 3VR2D 4KXXA 2F1IA 2WJ3A 5CX1B 4FZRA 1J8MF 2YYSA 3EG9A 2WPNA 3VR5D 3B78A 1HFKA 4CFYA 1GA4A 4ND2A 1RLTA 1KYZA 5CB4A 4X62B 2ONZA 4DV1B 1RLMA 1ZESA 2MDTA 5A6SB 4A9AA 1NVTA 3NZEA 3H83A 1WUJS 1U8FO 4ZI7A 3EIQA 3OQMA 1POXA 3FWNA 1M2JA 2WKPA 1ACLA 4QYIA 5CURA 5AHOA 4N7MA 5D6NA 3N53A 1EUYA 3L84A 5DF1A 4EJMA 1FMCA 4KKVA 4H3SA 2FEPA 4TLLB 3ZW7A 2IZ7A 2J87A 4RWZA 4A2CA 4MS1A 1ZI9A 3OJEA 4X84A 2QTRA 3DZFA 4Q7KA 3TUIC 4CHGA 2D2IA 3G7SA 5KWIA 1DINA 1Y7IA 1XZCA 2C3OA 4KBFA 5AI8A 4HSEA 3W6PA 1P75A 2PO7A 4OKIA 2CDAA 2PLFA 4AYXA 3K35A 1HRKA 3NHFA 4ZT3A 1KP9A 1YKSA 1YDFA 3IHLA 1SELA 4R81A 3V34A 4NYJR 2AW5A 2P67A 1S2GA 4DT1A 5ITZB 3T9BA 1JQJC 1K27A 2GTHA 2CYAA 3BMCA 5EUCA 2EW8A 2H5JA 3E27A 2CB9A 1JPUA 2JA2A 2BN4A 1EVEA 2VVTA 5AW0A 5CB0A 2P35A 1HDYA 5CAEB 3WDKA 2SKCA 2ZR9A 4NTZA 3B38A 1XZIA 1AKVA 1V43A 4ZRMA 3DJFA 3LX6A 2RHRA 1ZI6A 1RWOA 2EAUA 3PDIA 1QZZA 4G2TA 4I46A 4PRLA 1VIAA 2H11A 5JALA 5TSDA 4HGNA 4BQPA 2JL1A 1NOJA 3T7RA 4R8VA 1XWIA 4IFEA 2OHOA 2JHGA 2WA1A 4BO8A 2AZ4A 4C7KA 4OHMA 1K98A 2VWGA 3V8QA 3PV0A 4HLUC 2C4VA 3QUQA 4FMPA 3S2GA 5DPMA 2IH4A 2AD5A 3HMKA 4R2JA 1CUJA 3T1YB 3H1TA 4HQRA 2N42A 4QA9A 4MTCA 3PJGA 5K51A 4EHJA 2Z6AA 4MXDA 1E1KA 5TR9A 1RYFA 5E2AA 3IEKA 1IOZA 2Q3DA 5IBPA 4UXIA 1JHAA 1R6VA 1VMAA 1CQXA 1XP5A 2NZ8A 4BGEA 4CCYA 4XIYA 3V42A 2OBXA 1VKOA 5JC8A 2FVYA 3ETDA 1I2BA 3V46A 5J5CA 1QS0A 4KMMA 1X74A 1XNQB 1FTWA 4RH0A 4JC4A 3IALA 1WZIA 1CUGA 1UZMA 3DEFA 4YP5A 4TN1A 5I4CA 3IP1A 1PLKA 4ZVNA 2I8LA 1GT6A 2H4HA 2PSSA 1GTJ1 1D3AA 1ZIOA 4R1SA 4HWPA 4UNPA 4WXEA 4ZCPA 3VH3A 1TJ5A 3CR8A 2XDQA 3FLAA 4JIGA 2FPIA 1JPNA 3UK1A 4B4VA 4KH1A 1L4YA 1PI3A 1X7YA 2DH6A 4G0ZA 2B9EA 3O9MA 4V1CI 4C7OA 2WMOB 2VWQA 3DONA 3L1KA 4BWGA 3W3AH 4JB3A 4B3IA 5JQGF 1EAYA 1VDZA 1Z6YA 3G2KA 4ETIA 4J91A 1OBCA 1SMKA 1X7ZA 3C5EA 3DC2A 1GKIA 3K1ZA 4MI1A 1CD5A 1ZGGA 2IPAB 2JGNA 4QXAA 4WJZA 5HK9A 5ICGA 5JMTA 2FLKA 3A1WA 1QIMA 3IC5A 5FX2A 4BMSA 2NAPA 3Q7QA 5IN5A 4JKYA 5IUJC 2WIJA 3JS5A 2BC9A 3MT8A 3O92A 4J76A 5K3DA 4FW8A 5A7HA 5CBKA 1KY5A 1MVNA 5IJ0B 2HMUA 4ND5A 5KQSA 4FX5A 1R8YA 2WOOA 2I7VA 3OOHA 4M98A 1Z73A 1K2WA 4D25A 2X3FA 2IZZA 3A1SA 1RFLA 2AJCA 1Q1AA 1TKCA 1GFIA 4BU0A 5FEUA 3AGPA 2X6RA 1CUAA 4F60A 2X8LA 1J0BA 1K0FA 2HFKA 2PO5A 3K9WA 4ITVA 3NUQA 3RF6A 3SDSA 4KBYA 3R7LA 3EXHB 3PL5A 1IZZA 4GGMX 4XPZA 3WB0A 5H70A 3MBKA 3EFHA 3VR2A 3DL4A 1UPUA 3VTKA 3CYFA 3JQPA 1UMBA 1ND6A 2O7NA 3K09A 1L7EA 3AWDA 4KODA 3SYLA 3WXMA 4D99A 5F7OA 2RHDA 6PFKA 5HKOA 5LOVA 4M76B 4OMCA 1BOFA 1GN8A 2HDNB 1UPTA 2CVHA 2FFAA 1RXVA 5AW8A 1T2NA 4PFKA 4K1LA 5KWVA 4EUNA 2JLVA 1E0KA 4DM4A 1UANA 1OY1A 2DFVA 3D54D 3WHIA 3SXJA 1REQA 3WMXA 2G6TA 1IYZA 2B6HA 1V9CA 1XZHA 3KAPA 5CT6A 1UOOA 2YZNA 2BE7A 1WPRA 1B6TA 1FTGA 1VSQA 2X23A 1SC4A 3BWCA 4HC4A 4HMQA 1SXIA 5BW4A 3PHBE 1PVOA 1G0OA 1GPAA 1PZHA 1ENZA 3NVAA 4RM3A 2PYIA 4UPVA 4ZU3A 2IBTA 1NRIA 5JSZB 1VRWA 2EIXA 3N70A 4FR5A 4ROSA 2G5TA 5K5EA 2Y1LA 4TXLA 4DQVA 4UE2A 2B8TA 3COSA 1UFVA 1X80B 3B7WA 1B93A 3QV1A 3QVKA 2J3MA 5EMKA 5FRDA 1TUBA 5A3RA 2BYTA 1YQUA 2Q5QA 4BECA 4MDFA 3C6QA 2QD2A 3HU3A 3M1IA 1PGQA 2BGLA 4O2AA 3CB2A 2V6GA 2JAXA 4QVKA 5T57A 3W90A 4YMTA 1UMBB 4XJXA 4NBKA 4OV6B 2NZVG 3FDZB 5FBHA 4QJ5A 1GRQA 2CHGA 4MGZR 4R51A 4Z8YA 4H2DA 3O8RA 4I5DA 5D86A 1G8SA 4JGBA 3HJBA 4J0JA 3WR5A 3TTSA 1UOEA 2QTAA 2R1UA 5IKXA 1NQ5A 2PFSA 4OYRA 1PJ4A 1PS0A 2PPVA 1V3VA 4IGEA 1KRHA 1ZGHA 3KTDA 3K9CA 4P3PA 5DNVA 3ECAA 5KS2A 3R8XA 4DG9A 3SC4A 4FYHA 3GDOA 5JG7A 3VPBA 4ZK2A 1KMHB 2J67A 3RS5A 2C1ZA 1M1NB 2GHRA 5EZQA 3AVQA 5E9JA 2COUA 2ECPA 2D7DA 2I9KA 5AKJA 5FNVA 1CLUA 4U2DA 4ZCMA 3OFVA 4NZMA 2B30A 1ISPA 2DF8A 2Z8YM 3L7NA 4TTQA 4HG2A 3STTA 1QIJA 1NY5A 1AN0A 3CZAA 1XZEA 3D3JA 3DBOB 3LSYA 4JR1A 1YZGA 2F90A 4MRRA 4TWJA 1LLQA 4UAJA 4AX8A 2C7RA 1YONA 5B55A 1H2BA 4DIUA 2FJPA 2C9BA 2I4MA 3DDUA 3ETGA 4TKZA 4W5WA 1JHPA 5D5QA 4EX6A 3B6IA 1FSZA 4J1SA 4HMOA 4RLFA 3CZQA 4AKIA 3HG7A 4ZVPA 1TKAA 5H0IA 4DMFA 2H51A 4G25A 4H3KB 4IDBA 2JD0A 2O05A 3TZCA 5IWAB 2PUWA 5DV9A 2HJRA 2OD7A 3WLNA 1DJPA 5ED0A 1BX3A 1UZAA 1ONBA 4MQEA 3DDOA 3LP5A 3PEYA 1CULC 4N0EA 5JXIA 3NT2A 4GBED 3BWMA 2WTAA 1M33A 4FGLA 4RTRA 3E70C 4MO2A 4C14A 2A4KA 3GLHE 4GKVA 4MI3A 3ZHUA 3KPWA 2XGGA 3V8MA 5DT2A 2EG5A 4AUNA 2NXEA 4KQEA 1DEOA 4R5MA 3BXHA 3HKEA 4AUMA 5HBRA 5FAKA 5CYPA 4CDNA 4PNPA 5C7OO 4C7XA 1L1RA 3WLHA 4K8RB 1KU0A 2CFSA 3UB4A 3NNNA 3U61B 1S1CA 1P29A 1CE8A 3SS7X 3M34A 1UJBA 2QRMA 1J8VA 1CF2O 2SECE 2WD8A 5ENZA 1P1FA 2C92A 2EQBA 3DDHA 3K0FA 3QLJA 1P0CA 2PA0A 4PWZA 1L5FA 5CVEA 4JI4B 3ISJA 1WBBA 1U8ZA 2HFJA 2I1LA 4MWZA 4ZXFA 1Z68A 4XIFA 4M54A 4ZVSA 2IXFA 1ENYA 4L02A 2NO4A 3WLFA 1CCWA 5JRJA 3EB9A 1U04A 5BV1A 3ZLTA 3LXRA 2VDMB 2XZDA 3UJDA 3M5DA 4BNWA 1KZHA 2XODA 1PF7E 2GLUA 4IV8A 1XELA 3IAFA 3IT1A 1XJWA 3IR5A 1H1TA 2NT4A 3SYMA 1QG0A 3ODGA 3K1JA 5IASA 3U31A 4F6RA 3WNVA 1D4AA 1VMEA 1R15A 3NDRA 4JBXA 2CHUA 4QGBA 3MQ4A 2FOLA 4V0RA 2L19A 1GRCA 4F97A 3UGQA 2YH2A 2R8XA 3TINA 4GQAA 2INGX 4RY8A 2I2FA 2G77B 3OAAD 3SP1A 1NW7A 2QP4A 1TF5A 4EKNB 3ADBA 2Z57A 2GJKA 2WFLB 3I6QA 3ACCA 3KUXA 4QUKA 1N5JA 2RK4A 2XECA 4ICIA 2WJHA 3MTJA 1ULBA 2H06A 3OE4A 4JX8A 4K46A 2EBHX 3KB6A 4ZEVA 1QGUB 1UPAA 2RGYA 1TCCA 1TM4E 1E79D 2QJOA 3ETEA 4G09A 2ZRDA 1CB7A 3WV4A 5JNTA 1RRVA 1WDMA 2Q0HA 2CCKA 5FBQB 3MTBA 3WJ1A 3BILA 2FY8A 5KC9A 2XNCA 4QL3A 3DDZX 4I5EA 3G88A 3AUSA 4GWLA 4I14A 1BH6A 5HA5A 5T8KA 3IS3A 4N3BA 1KFKB 3JQ8A 3PQEA 1NMQA 1BD3A 1JDJA 1M0SA 1YI1A 1CRQA 4JLAA 3WLLA 3AF4A 3B5EA 4RPLA 4O4HB 1RD4A 1X1QA 3VOTA 2G1KA 4AXXA 2WWHA 4OQYA 2IH5A 5EZYA 1P2DA 2GLTA 2H4JA 3G5MA 3K4QA 1PNRA 2OCKA 3OIUA 3SS8A 4M8SA 3HBJA 2GCEA 2HGSA 2ZETA 2TMGA 3A2LA 3AJAA 4DN6A 1U2QA 4O4LB 5D7NA 4LMPA 4DG5A 4NXNB 2D4HA 4Q03A 4MMYB 2FHPA 3WIVA 1L7QA 4CM3A 3L8EA 5CTJA 5A6SA 3IEUA 1YVUA 3IJ5A 5EHQA 4F85A 5JOQA 5BVHB 5AYVA 3TKLA 3OURA 4LWPA 4P4GA 5DCUA 4NE2A 1GNRA 1SUEA 3NASA 3FYCA 1P2BA 2NV6A 3FOAA 4D9EA 2NU6B 1QGAA 2EQAA 1E9SA 1P2VA 5KX5B 4ROTA 3RFCA 5D85A 3RCBA 2HLDA 3TLMA 3RS2A 2GVZC 2B8JA 4OD0A 5JJIA 3PUVA 1YUMA 3K2QA 3OA0A 3GLFA 4K9SA 3ZLVA 2N1BA 2WDPA 5CITA 2WM3A 2XMPA 1I36A 1TQ2A 3I01A 2WTBA 4E5VA 3JZFA 1NNSA 4O1MA 2BHSA 3FGOA 1QP8A 5KIAA 5FD8A 2J9GA 4N41A 3AEXA 3TVYA 4C0XA 1LK0A 3FVWA 3QXSA 4XTRA 5EJMA 3ICQB 1MW9X 4CL8A 1VG1A 4DT1B 2P78A 1LX6A 4NOJA 2YWJA 2AZMA 3D9QX 3OWXA 1UXJA 3OICA 3BMCB 2XCQA 3WYBA 3W78A 1CIJA 1NONA 5EKDA 2MSKA 2ZR7A 3BT7A 1TEVA 3SF0A 1JQ3A 4UMEA 4OBXA 3OTGA 3OUZA 4UBMA 3W8NA 3ZDDA 3O8OB 3ABIA 3H05A 3ITDA 1U2DA 1XYYA 3ILSA 3OH8A 4NATA 1V6CA 4CU2A 2C2OA 7AT1A 2QP3A 2YJNA 3G9XA 4L4YA 4CM9A 2R86A 4MCIA 3ZY4A 2GHIA 1BQEA 5K03A 1PTJA 3DZGA 1I7NA 2KM1A 4AY4A 1G7TA 4Q9JA 1Z0UA 3R6LA 4YI3A 2E5WA 4JR0A 3BM5A 3NHKA 2VHTA 3PYXA 1JHMA 4CLOA 2N9UA 5HXAA 1LU9A 1UKBA 3W2FA 4N5NA 3NJRA 1GO2A 1IQ0A 4HNTA 4MV0A 4EATA 4EJSB 2NXCA 1J25A 2R7KA 5THQA 3H0KA 3M9LA 3FZEA 4K3VA 4R3WA 4KL8S 2P11A 3MJEA 4XR4A 3OZBA 1QHSA 4BLPA 1KAOA 3CA8A 4I55F 1C3JA 4UUAA 1X9IA 1FFDA 1J90A 3V8NA 3ZW8A 2Z5LA 1EUDA 1ODCA 2OGWA 2WWTA 3NOXA 4DA4A 3O95A 1IXKA 2H85A 2FSHA 3MMPA 3NFYA 4GOND 5FPTA 4R2WA 4F7DA 3AV0B 2HCJB 1U8YA 3NANA 1FCJA 4KQJA 4RORA 1FE8A 3FH0A 2ODPA 1GPYA 4DWWA 4YK7A 3P2EA 4G1VA 4WJLA 3U19A 3BL8A 5AKZA 4QO7A 2V7TA 3A2NA 4Z4FA 4GOKA 1N0HA 4WOCA 3THYB 5BN4A 5EIBD 1VSVA 4FD2A 3FTCA 4FWIB 1PW5A 3MRSA 1IATA 5B7PA 2WJ4A 4KQKA 2XMBA 3ZXXA 4C5AA 3GO4A 5G4LA 4DR6B 5B2ZA 2W8ZA 1H3EA 5ALWA 4YDHB 1G7CA 1EDEA 4LX0A 3WLQA 3H99A 5CYFA 3VGJA 1E5TA 3WMEA 1XFAA 4KWHA 5GJVC 1J56A 3JSAA 2Y99A 1ULSA 1JAIA 1JG7A 5I9MA 1BMFD 1OILA 1BGWA 3DCYA 2O8CA 4HVLA 2QSJA 4ZYUA 1WZNA 3T0FA 1TVCA 1U0RA 5G2OA 5AIBA 1T3SA 4P84A 5B4UA 1EZ1A 4IIBA 4II3A 2A78A 5IXJA 5IDXA 2YN0A 3BF8A 4YJFB 1MOPA 2Q5IA 2XT0A 3GVCA 5JO9A 1CSEE 4I8DA 3FW1A 2F67A 5IEBA 1AA6A 2JLYA 2W6IA 3AKDA 4X71A 2H3HA 1E8NA 4H08A 1KAQA 3CVUA 1SVOA 5A0TA 3LQ2A 4GRAA 4BVKA 221PA 3NP9A 3B3AA 2WJJA 4OL9A 4HYEA 4OQQA 3HTXA 1KJZA 4MP3A 5KYWA 1PD0A 1EQ2A 2NUPB 4MMZB 2W2NA 3KR0A 1G60A 2PMDA 4RNDB 4CT4B 4C43A 4N0QA 5EN4A 3PX2A 4ZCTA 1E6LA 5TVGA 1FNBA 3F3MA 3V7NA 1NJ5A 3K94A 3V4PB 5CLFA 2AVNA 1GV1A 3KWLA 2FQXA 3AOEC 1X7WB 5LZ8A 3HWX1 3LPNA 3GDWA 4IXMA 4XDHA 3BREA 3C3KA 1NF9A 2H07A 5C51B 3DEJA 1OJLA 5L4LA 3IODA 2PMFA 2HJSA 4RD3A 2WVHA 5EWJA 3TIXB 3CH4B 4ZALA 5JZVA 4EPXA 3JQGA 1JLHA 2ZU6A 4EW2A 1RMTA 2UZAA 5DEIA 1KDRA 5K3BA 2VF2A 2IX3A 1NWHA 3MK31 1GU7A 5IBQA 4A6DA 1NP7A 4J03A 4P4LA 2G9UA 1U2EA 2BTQB 2J5RA 5BRJA 5KSZA 2CDBA 3L7CA 3T0GA 4I50B 2DVMA 5C5CA 4ENVA 1XZBA 2MSWA 2O8BA 3B51X 4P4SA 1X0VA 2WDZA 4DSOA 4MV4A 1RW4A 2H08A 2WJAA 4ZXPA 4ZJUA 2OSVA 3NONA 4YMHA 3A6HA 3GPBA 1LBIA 4NCJA 1MMFB 2M1XA 1NRWA 3DVQX 4B31A 2DB3A 2Q7DA 2PR2A 4WFQA 3CLTC 4YCDA 1DJLA 1Q0PA 4F8JA 1F1BA 1GDDA 3LW8A 4M88A 1TC1A 4R8SA 2NTYC 1PWXA 4BUJA 2OORA 1E96A 2CFCA 2ODQA 5T67A 2BOVA 5A5DA 3ZDBA 4ETNA 1KJNA 3Q12A 3WV5A 1XKLA 1OYWA 3OZIA 4C4RA 1UM9A 2G7MC 2JLUA 4W8OA 2R0QC 2AG1A 2CKDA 2PSJA 3MMXA 2VYFA 4K6FA 2VJCA 3UKDA 4EKGA 5HTKA 1TAQA 4CKBB 1HDRA 5ADVA 2ZJ0A 3FHLA 1HNZB 2Y68A 3AHJA 2NU8A 2GNOA 4YCJA 2HPHA 3VR6H 1WMDA 3EXIB 3MAAC 4NDAA 4DSUA 2QM8A 3CM0A 1YR7A 3F67A 3ZUPA 4MW0A 2CLSA 2DECA 3JD0A 4HB0A 5H3CA 3EGOA 3U2QA 2WSMA 4NI5A 1U7WA 3NOVA 3TM4A 2E6UX 5C8YA 3G8DA 1DIAA 3WGYA 4URVR 2IFTA 4B6RA 4D41A 1Y81A 1AQLA 1KF0A 4AZWA 3LJKA 4JP5A 3SBDA 4B73A 2QP9X 3L6OO 3SD7A 3I0MA 4ESOA 3UT6A 5CIYA 2BMEA 2P1DA 2PUVA 2JHCA 5AK5A 5H68A 2WJIA 1H4SA 4Q3OA 5AUOB 1Z0KA 2PR7A 3UICA 4U6SA 2WU4A 3H2GA 3EGIA 3K5IA 4EKDA 3KJHA 1ZM2A 1W6UA 2LR0A 4ESHA 1P1BA 2F48A 4RA9B 4Z1MA 3FTEA 5AKYA 1WSWA 2IZ0A 3ESQA 1TM3E 4YMVA 3T7JA 3LOUA 2BFFA 2QQ5A 2HMTA 4TWBA 4S1TA 1BMFA 1LRLA 1L8QA 2A57A 1B42A 1PQPA 2QG4A 4KXQA 5LYJA 3SIPA 3VBCA 4OLAA 1PS8A 3ITEA 2XUJA 5DTJA 1EK1A 4G1MB 4JC5A 3DSRA 4DXHA 3EODA 1KXZA 3F0TA 1HK7A 3R7NA 1FP4B 1GFWA 3USZA 4N76A 1Q92A 1XZFA 3BFVA 3U3DA 3UMBA 4UM9B 1XXLA 2IYPA 4PAGA 3HB0A 3N07A 4D98A 3PD0A 2IBMA 3I12A 3AR3A 2ZAMA 1ULAA 2HEGA 3HKCA 2LZ0A 2QN9A 3K8OE 4MUGA 4PVDA 4DIBA 1RQGA 3BHNA 3KX2A 3WYDA 4O2AF 1W5AA 1R6BX 2WOJA 4PC7A 5BMOA 2C83A 3D81A 1D4FA 3O4IA 5AWFC 2PEYA 5FWYA 1DKRA 5LXTF 2X6TA 3EEYA 4O2BF 2QX7A 1ZHHA 3ZPXA 4LJ8A 4G0UA 2D8MA 2D74A 5IJZA 3V9PA 3WK6A 4D8YA 5K6TA 1T8RA 3ISVA 5CD1A 1CRLA 1YZYA 3L77A 2E5LB 4GQBA 1BRTA 2X8BA 4EPVA 1AXEA 2R97A 3C8MA 4TVSA 4RQAA 4GEKA 5B6PA 3U4AA 4B32A 2IPNA 3DTVD 4HGZA 2C20A 4MHTA 4LYFA 1C8BA 2AEMA 4RGBA 3FX2A 5IEJA 4YAIA 1Z25A 1PJAA 4PF1A 1CIVA 5JH7B 1U0LA 4G8BA 3IMKA 4OUDA 2WWXA 4Q39A 3OJ0A 2BMFA 3L8GA 3VHRA 3OZ7A 3IQHX 3AXSA 3AHGA 1B15A 4NMMA 2F1KA 3KVOA 1U6KA 1T34A 2FKNA 3B9RA 5HJ5A 1SHLA 2ARKA 5DSZA 1HZZC 4L57A 4AZSA 3I04M 3DYVA 1MIHA 3I2GA 4QARA 1E3WB 3FDXA 4HXEB 4V0OA 5HOEA 2P40A 4N8EA 3MGGA 5FA6A 2WZQA 1WEHA 1XEAA 1J2JA 2I1WA 2P9EA 2H00A 4R98A 2CL6X 1I5RA 3F97A 3JYNA 4RIFA 4AY3A 3ZKAA 3LK6A 1TQ4A 2PNFA 2C7GA 2X0EA 1TLLA 2ZSUA 2NPOA 1HLPA 4O4LF 1GZDA 2H6EA 2G4CA 5IDQA 1R6TA 1U3CA 1XDGA 2OG1A 5A02A 1UUFA 2YYZA 4HY3A 1G5PA 5LMCA 1MGOA 1NBME 1RHQA 2QTWB 2X6QA 3LHKA 3VISA 1TDJA 1KYVA 2I7TA 2P79A 7REQA 3SK0A 3RC8A 1DX9A 3HABA 3ER9A 3KZCA 3A3OA 3H84A 2WUWE 3KQUA 1JJBA 4IXTA 4KDRA 5DTMA 1C0EA 2JIMA 3SQLA 1WLYA 1XFDA 4HDRB 2PSFA 4OEHA 4R0NA 5F21A 4TZTA 4WGGA 3KL4A 3MWJA 1CDEA 3B1FA 3NXSA 4GP9A 4EW3A 3IE1A 2VI5A 3CR7A 2IDKA 5D1NA 2KBEA 1J49A 3ICCA 3WB9A 3DR3A 1I10A 1M1ZA 2VJQA 1K68A 4D92A 2AKEA 2XJ4A 4QFMA 1SFRA 2WJVA 4H1VA 1WU7A 4RTPA 1L8AA 4BDTA 3F1KA 2DQSA 2XE8A 3SZRA 1YHYA 1GQRA 1E2MA 1GZ3A 5DP1A 3ZR4B 4QREA 2QYTA 3UQYS 4MAAA 1ODLA 3DF9A 3LTEA 4DRZA 3D7RA 4U8GA 5GVRA 2R6GA 2RKWA 3HVJA 4BOYA 4TWAA 5FXMA 2CLHB 2CLIB 5BV0A 1NULA 4WNYA 5AP9A 1VPEA 1F6WA 4RABA 1GGMA 2NSJA 2FMXA 3C3AA 3T9AA 4CKWA 4P2BA 4IAOA 5TPWB 4PTYA 2ZWMA 2WJZB 1RXIA 1U9ZA 4TVBA 5JQGA 1YAHA 5L3SA 5JE8A 4P4SB 3ZCTA 5J5VA 1II0A 1Z8HA 1WU8A 3AUAA 3EZLA 4QVGA 1JT9A 4N7JA 5EWLA 1NXSA 2FG7C 3O8OA 2NV2B 4KVGA 2PX0A 4KWCA 5LYJF 3S81A 3DLBA 4KPGA 3WLAA 3PQ4A 1W87A 3GZTB 4ZT7A 1QFZA 3ACBA 4U7DA 1FLAA 1QBGA 3L7IA 4XIIA 2OXFA 4ZOBA 4EMSA 5J2UF 1FYEA 2BEUA 1ORVA 3OX3A 2HWWA 2FDRA 2R1VB 2VHCA 3FTDA 2EWMA 3LUCA 3WNDA 2RI1A 4EG3A 5CLIA 2PK3A 1IZ7A 5JCPA 5TT1A 2RHBA 3SJAA 3W5JA 4WEQA 3TQIA 2BCEA 1YFKA 3UK7A 3U4HA 1RCUA 1FDSA 4EEZA 1H6AA 3CUVA 3A14A 4LXGA 2AUTA 4HATA 2D59A 4OGLA 1EX7A 2AZDA 5FWXA 1NUAA 4E3ZA 1Q0SA 2HT1A 1R0YA 1J1ZA 3VYRB 5F23A 2OP0A 2RI6A 5BMVB 1LLDA 4EENA 4FGWA 1CFJA 2QAJA 2HA0A 2YZKA 4HXGA 5F52A 5HGJA 3CVXA 4HAOA 5KMGB 3S8MA 2GCOA 5LMZA 1JJ7A 4LXIA 3R4VA 4H0NA 4MW4A 3ZVMA 4O5AA 1JDBC 4WNIA 5DYIA 1Z75A 2C42A 4HGOA 1FRVA 1U02A 4DGQA 2X3UA 4RVSA 4EKIA 4EG7A 2XRMA 1E3SA 3OFSA 2ID7A 1DWUA 5JXJA 5SYNA 4BLOA 1G4UR 1JRLA 1MRSA 3UAWA 4KNYA 4CIAA 4HLNA 4ZREA 3RSFA 3E9RA 2P0YA 3UXYA 3AU8A 4Q37A 1U3FA 4WH0A 3D2BA 4BO5A 4A5OA 2JH9A 1N0VC 4MW1A 1L7MA 4QX6A 4I8IA 4NYIR 4ND4A 4C1BA 1VL5A 4E46A 4MI9A 3NBQA 2XB9A 3HA7A 2NIPA 3UJBA 1W49A 3HV0A 4X00A 3B6MA 1AUPA 2ENWA 3IHKA 5BVGA 4BVEA 4EQ6B 5B1SA 3EZ7A 1K3TA 3DYIA 3KZVA 3IVAA 4Z49A 1E6MA 3INNA 4NESA 1GL7A 2G1AA 1YA6A 2G63A 1Q20A 4HCJA 4S04A 2DG2A 3Q8MA 4BNYA 3RVBA 5DYYA 2BH2A 3AEQB 3DUWA 3SYKA 3KOXA 5AHWA 5KNDA 3ENWA 3PNKA 1AKEA 4HDQB 4Y9TA 2J46A 4HTFB 5DK4A 5CDHA 2PD4A 1GQFA 3H4MA 2MMGA 3ANXA 1H8HD 1KMIY 4JT8A 4JP1A 5TC4A 3WO0A 1JBQA 4N40A 3RHZA 3EEFA 3PR3A 4UASA 4X93A 4RJTA 4Q19A 3F5FA 2IP2A 3IBCA 2Q5LA 3VSEA 1F0KA 2O59A 3EZ9A 4AC9A 5TQJA 2FAXA 5LA6A 5TF4A 3BORA 3L6DA 3M70A 4QUEA 1CTQA 4CMCA 5DISB 4HDKA 1QHGA 4EA7A 4IXDA 4N5DA 2FPXA 3QI2A 3QPUA 3DCNA 4B2IA 2QBYB 1JFFB 2WABA 2BKVA 2R68A 4FFLA 3NI2A 4ZOLA 3KPYA 3QI7A 1S2DA 5H5JA 2I6GA 3FXAA 3PXDA 3HXQA 5K4AA 1KWGA 3MMSA 1QNLA 1ID8A 4TV9A 4Y6OA 4P80A 1HL7A 2HA4A 2O2ZA 4YO7A 5ARCA 3AY6A 4BKOA 3GVIA 1A77A 2FPGB 4DDTA 3GROA 2GXUA 1PP4A 1ATIA 4LDPA 4W9MC 4KE9A 4HWKA 4MK4A 2YMPA 4QBGB 1U3DA 1VJCA 1ZGZA 3BDIA 3PEEA 4NZOA 1UMKA 2G40A 3N2ZB 2O3UA 4QU9A 1SBNE 4UTOA 3R74A 3PD7A 5BNZA 2WSSA 4P6VF 1J9GA 1XYGA 3QWIA 1JDZA 4DHWA 5T7BA 1KVSA 4XE5A 4AJNA 1MEJA 3PUZA 5G0SA 1P6QA 1N2GA 1EWVA 2ZW9A 2B98A 4JI5B 3WE7A 1QR6A 5ER9A 2GH1A 5FLXA 1ZZGA 2SNIE 3A6JA 4NG5A 4G0YA 4TUYB 3NHLA 4JB0A 1JLLB 1MCZA 2FRVA 5FWYB 1EG7A 1U5CA 2OCAA 3NALA 5D00A 7REQB 3KV1A 2I4OA 1SG6A 1R0WA 5HDBB 1XMPA 3CZMA 3R75A 1OIVA 2BFCB 2RJNA 4LJ9A 4RESA 1WXGA 1DVRA 2ZSIA 3UT0A 4TZKA 1EUZA 2NADA 4PPGA 3T7KA 2NXJA 3GZJA 2Z98A 2QUBA 1DEKA 1FU4A 1YV9A 3O4FA 2R2AA 4O0MA 1IEWA 3TZHA 2ZRGA 4ACAA 2ID9A 4O5OA 1D2GA 3T61A 1JDPA 3ZWAA 4B3HA 1XT6A 4C4AA 3EUAA 4HPWA 1YRAA 4Q82A 3TQCA 3AUTA 1NP3A 3C7TA 3FCYA 1S3FA 4RZ3A 4MV5A 3OZDA 3RTGA 1KTIA 3EIXA 1ZD8A 2DFDA 4RK7A 4H4DA 2IS6A 3AHIA 2NZYA 3C16C 1SB9A 4YP0A 5B53A 4B47A 1JN0A 5IJ9A 1OB2A 2A0KA 4HAYA 4RZUA 3MGCA 3VSCA 1CRZA 4UUPA 3ZWVA 2GD6A 1CW2B 3I52A 3KR9A 4HGYA 5KYTA 1R4MA 1KI2A 3JWJA 2Z3ZA 3L18A 5LZ7A 3H7AA 4Y0NA 3C39A 1P8JA 3D0KA 3N1UA 3L43A 3QXJA 4MLZA 4DMUB 4PZAA 2VH2A 4EA8A 4XPIA 1JVNA 1XZLA 3PIRA 4FT4A 1BFDA 1MC8A 1Q7EA 3MTIA 4Q4JA 3WRXC 2PZMA 3GT3A 1YQXA 2I5PO 1E62A 1KU6A 2UAGA 4JP2A 1XWFA 2XQKA 3CO0S 3KB8A 5AKHA 5L7WA 1NN3A 2BFDA 1WNTA 2IZOA 2TMDA 4AMGA 1QGZA 1EDOA 5L3SB 2HPAA 4JJ6A 3QE9Y 1YZHA 1KPIA 2HBYA 2JNWA 4OREX 3HYSA 2WHXA 1P5HA 3MUOA 3OZFA 4MULA 1GILA 5ALZA 4DG8A 4BATA 2H7VA 1XP8A 1PR3A 5C52B 2R2GA 4MVJM 5KCMA 1LV7A 1SZDA 3NTVA 1RZUA 4XQCA 3STHA 3O73A 4URZR 3TSCA 2QYHA 2VDNB 4H7HA 4PQGA 3R3YA 4K0KB 3C1AA 1DJQA 2EF1A 2G9VA 3DCJA 4R6WA 2C5FA 1J0AA 1YZFA 5HCUA 3U6BA 2P9JA 3GLQA 3TDNA 1SK9A 3L07A 1XCGB 3BMNA 4TLCA 4J16C 4P7FA 4YIKA 4PCVA 2QQ0A 4B44A 1JQAA 1SKUA 4OHZA 3RG8A 3H5IA 4WSOA 3V8BA 4D9NA 2C88A 3IAAA 2HZBA 4NV1A 2CJWB 2R87A 4D6XA 2OILA 4BZXA 1ZK3A 3S0JA 1QK5A 1VIMA 1BE8A 2VDQB 2WM2A 3D8UA 3QHQA 4DJFC 4EAAA 4EHBA 4EJ6A 3D1JA 4G5RA 2LDBA 1YQWA 4CR7A 3RBZA 2QAGC 3U4MA 1ISGA 1PFGA 4IOJA 4K6GA 4K86A 3GP3A 2DR3A 2V7QD 2Q27A 1M6NA 3IPRA 4NYMQ 1SCDA 2VNHA 4ZOLF 3OQNA 2Q2QA 3E53A 3L6RA 3O0TA 4XDYA 4PYQA 4YREA 2XCTB 1T2AA 3UW1A 1KYWA 1R0CA 1WBJB 2C4WA 2VRBA 3P5SA 2F6RA 4QULA 4DMGA 1YFJA 3IUSA 2HLHA 2V54A 1WPXA 2QF7A 2FWIA 2PBFA 2W7TA 2XYHA 3EVTA 1LBHA 2ZJYA 4UARA 5EZSA 1ZAYA 1A96A 4H17A 3ENZA 4WY5A 4EY7A 1L5RA 3O75A 3BMNB 1XTJA 3C6KA 1Y6FA 4C29A 4LJRA 2QPTA 2DPHA 2J3LA 5B6IA 2ORYA 3MTGA 2QLJA 1TW3A 3C43A 1UPXA 3PVZA 3UNXA 1PQYA 1DBVO 1JVSA 2X5KO 4GUDA 4L4UA 4NBLA 4TWZA 3WGGA 3V2IA 4UC0A 5A3VA 4OKNA 4WBNB 3QG5A 3DFZA 2CFTA 3O7WA 4LZOA 1XEFA 3RFFA 4YV0A 5I4KA 1U2SA 3KTOA 3NC1C 4M0FA 5CRIA 4DKXA 4O59O 3IIMA 1ENPA 2BDUA 2FR8A 5EIEA 3IAHA 1MOZA 2Q45A 3H6GA 1Y4UA 2F64A 4JJ4A 4M2LA 3P2JA 4IWNA 3EC1A 2BEKA 4KLZA 3VGPA 1E4OA 2GWRA 2EXXA 2GT1A 5ADUS 4G1BA 5MN4A 1COWD 3TTWA 3UFXB 2ZZMA 1WM1A 2X0RA 3HMQA 4R9SA 4ZVLA 4A0RA 5AESA 3OPNA 1PVVA 2PV7A 4MW7A 1BDHA 1G8MA 4TSKA 4FFOA 3E9QA 3AFMA 4GYWA 3X1WA 4BO3A 1XROA 4JJAA 3RUFA 3LKZA 4RKWA 1QTQA 3OSUA 4BEWA 1YOVB 3JWPA 3LQFA 4J3JA 1VSTA 2G3YA 4DS3A 3N3BC 4JXKA 5K20A 1RZRA 4ZN6A 5FTJA 3BH6A 4GXQA 1IHDA 2Y1DA 2IHBA 4QHTA 1S2IA 4RMGA 1DBWA 2CNBA 2J45A 1NMSA 2WLTA 4XWAA 5BYJA 4K9MA 3JATB 4KXFB 1A8PA 3G59A 4M8IA 2C4UA 1SVIA 2H48A 1J0CA 3WZLA 4A15A 4NCXA 5IYZB 3NBAA 1Q14A 2O8NA 3RBAA 1E9EA 1L4FA 2NTNA 2ZVJA 4NFHA 4BV8A 4FZ5A 2HMSA 2WT9A 1HMPA 1GLNA 2E89A 2AJ8A 4JGGA 1NUUA 1E5XA 1JXOA 4JX9A 2AN4A 4UDNA 5ETJA 3F8TA 4EQZA 4N01A 5L3QA 3RNOA 3VKFA 1S8FA 3CS3A 3DOOA 3FDJA 2J9RA 3GFPA 3DH0A 4XFDA 1ODIA 3VBEA 3REOA 5TT0A 2CNKA 1AQUA 3T5AA 2C7OA 2P69A 3AYXB 3SVTA 4DHEA 3OOYA 5D3QA 3WMFA 5G02A 3DBHA 5J58A 1PIWA 2NUTA 3ZEIA 4B4OA 1G4AE 1XVIA 2X15A 5L3VA 4B79A 2Z0MA 4HXYA 1USIA 4RF4A 3I32A 3HN2A 4IP0A 4U7GA 2NU9B 3UAYA 4K6OA 1C5KA 1M7HA 3A1DA 4IQ0A 2H0QA 1Y6ZA 3O4VA 121PA 1MBZA 1DQZA 1DBPA 2W00A 3KKNA 2ZITA 3Q8XB 2XDWA 1XF9A 3WHKA 4NDZA 1RWQA 2DBRA 2R5FA 2Z83A 5CT9A 3R5KA 4WA7A 4MLPA 4DDVA 6CHYA 5HWSA 1VG8A 3VUEA 3UXMA 2HJHA 1GTSA 1QC5B 1REQB 2ZSEA 4X20A 5K0EA 2D1RA 2WINI 1DO8A 3QVSA 3TPFA 3IILA 3U44B 3ZDAA 1X13A 3CUUA 4JLBA 4RNCA 4YDQA 5ITWA 1MORA 4DC1A 2FDCA 4L28A 3PQ7A 5C8VA 3CWQA 2P6UA 3H9JA 3P0FA 1WEKA 5FUQA 2DP4E 2AK3A 3L93A 1FF9A 3KAKA 4FN4A 5BQXA 1U9YA 3WGKA 3ABQB 2PG3A 2O8BB 13PKA 1J8YF 2NSHA 3AOEA 3EG9B 4TUYF 3SKVA 3TQRA 1QH0A 4BTEA 1P18A 4ECAA 2DKNA 4DBZA 2QRQA 1XQ6A 2ZQ5A 2YV4A 2QW8A 3M6LA 1Q77A 2GKSA 1E2JA 2GPBA 5JCJA 1XRJA 4I1VA 4KAXA 3PXXA 4P4TA 4KHPB 2XKAA 1RJGA 1C7QA 1YZUA 2NG1A 3FNEA 3G6KA 4FYKA 3DPSA 4K9DA 4R7GA 3RVQA 1F8XA 3CX7A 4CM9D 3EVDA 2V58A 1PX0A 3O2NA 3BSSA 4YALA 4L0QA 4MKHA 3N28A 4JI6B 2IEYA 2OCGA 4B3XA 1PKEA 4PXAA 1JZTA 2CLFB 1OVGA 4QPZA 4MO9A 3V8RA 1T1RA 3VOSA 2AKAB 1ZJYA 4N3GA 3OQIB 1GKLA 2FW9A 1P7CA 2CGEA 1FPQA 5REQA 2RB5A 1GSIA 2ZP1A 3CQ9A 1NN5A 3ZNNA 4B83A 3W5UA 3LK7A 4ZO6A 3TBKA 2BFCA 1A7KA 4PYKA 5JH7A 2P4EA 1Z47A 4FEAA 3HKEB 1TAGA 2HJVA 4NJMB 3PF9A 5FLKA 2R66A 3WDLA 4ZZ1A