1RWNA

Crystal structure of human caspase-1 in complex with 3-{2-ethyl-6-[4-(quinoxalin-2-ylamino)-benzoylamino]-hexanoylamino}-4-oxo-butyric acid
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
173
structure length
173
Chain Sequence
TSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Interleukin-1 beta convertase
publication title Structural analysis of caspase-1 inhibitors derived from Tethering.
pubmed doi rcsb
source organism Homo sapiens
total genus 50
structure length 173
sequence length 173
ec nomenclature ec 3.4.22.36: Caspase-1.
pdb deposition date 2003-12-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1rwnA00
3NS7A 4HQRA 2C2MA 3PD0A 1JXQA 5JFTA 2H48A 1SC4A 4QULA 4EHHA 4N7JA 3R7NA 5LU9A 4DCJA 2CNNA 4ZVSA 3V3KA 5LUAA 2AR9A 4N6NA 1I4EB 1RWXA 2J33A 3E4CA 4JB8A 4QU8A 1NMQA 1ICEA 2H4WA 2QL9A 4NOLA 4ZVOA 5I9TA 4JQZA 4I1RA 3QNWA 3IBCA 4N7MA 4QUJA 3P45A 5IARA 4EHAA 1RWOA 3R5JA 5IC4A 1PAUA 1SC1A 2QL5A 2XZTA 4JQYA 4QUEA 4QTYA 4QUHA 5IAJA 2H54A 3H1PA 2CNLA 2H51A 2XYHA 3NKFA 3PCXA 1RHRA 2QLFA 2H5JA 1RHQA 3D6HA 4AW9A 1QTNA 4NBKA 2HBQA 1RWWA 5IC6A 2Y0BA 1I4OA 3KJNA 1K86A 4DCPA 1RWMA 1BMQA 4EHDA 1RWVA 2XZDA 4IYRA 1QDUA 4JR2A 4ZVPA 4EHLA 1NMSA 3ITNA 3V4LA 2CJXA 3DEKA 4ZVRA 2CDRA 3R6LA 1RHUA 1CVRA 3K7EA 2CNOA 3EDQA 3OD5A 1RE1A 4D3ZA 4QUAA 5LUBA 1KMCA 2J31A 3UO8B 4NOJA 3V4OA 4LSZA 4PRZA 3S8EA 3H0EA 5IAEA 1QX3A 4HVAA 4D3XA 5I9BA 1PYOA 3NR2A 5IBPA 3V55A 5IABA 2DKOA 2QLBA 2P2CA 4JR1A 4JJ7A 1I51A 4QUIA 1RHJA 4PRYA 4ZVQA 4N5DA 4NOKA 1RHMA 2C2KA 4FXOA 5H0IA 1RWKA 2HBZA 1F1JA 1CP3A 1RWPA 4NBNA 4QUBA 3D6MA 2CJYA 3UOAB 2HBRA 3KJFA 5IBCA 4QU0A 2J30A 4EJFA 1GFWA 2H4YA 3S70A 4AWBA 5IBRA 3SIRA 3H11A 3DEIA 4IEFB 3DEJA 4I1PA 1SHJA 4ZVUA 1K88A 5K20A 4PS1A 1I3OA 2HBYA 2QL7A 1SC3A 3R7BA 2XYPA 1RWNA 2CNKA 2WDPA 3GJQA 2FQQA 2C2OA 3EDRA 4M9RA 4PS0A 2C2ZA 4FDLA 4N6OA 4ZVTA 3H13A 2C1EA 4QU9A 5IANA 3BIJA 5LU8A 4JJEA 1M72A 4D3YA 3D6FA 4EHNA 2XYGA 4JJ8A 3V6LA 2Y1LA 4NBLA 4FEAA 4EHKA 4N6GA 5IAKA 3GJTA 1GQFA 1IBCA 4QU5A 4QUDA 3RJMA 2J32A 5IASA 3R6GA 3IBFA 2FUNB 2H5IA 4QUGA 2H65A 1NW9B 3P4UA 5IAGA 3PD1A 3R7SA 3KJQA 1RHKA 3GJSA 4NOMA 1SHLA 1F9EA 2NN3C 2FP3A 4QTXA 4JR0A 4FGUA 4DCOA 3V6MA 4EHFA 3R5KA 3SIPA 3H11B 4AWAA 3GJRA 2QLJA 3DEHA 4HQ0A 1NMEA 2K7ZA
chains in the Genus database with same CATH superfamily
3IT1A 4PTYA 1IUNA 4U3JA 1T6BY 3TQSA 3GLGB 5EUQB 1H6BA 1ODKA 1T8RA 1X80A 2DUNA 2Q9CA 2Y66A 3OT4A 3QVMA 3ZR4B 1N7HA 2VDWA 1PFGA 3EDYA 4MX8A 3R7NA 5JAHA 3A1CA 1PV4A 4QX6A 3ND5A 4PM4A 4DJEC 1LJLA 3M3PA 4XYGA 4C0BA 5CDYA 5DNCA 3MINB 3IEXA 1S3SA 4K5QA 4OBWA 4AQ7A 3H5WA 1G8PA 1JEOA 1LPPA 2EJTA 4QYIB 3EWIA 3TYXA 4GKAA 2E5LB 3HN7A 1DGQA 2VNSA 4JQZA 3ZCPA 3N2KB 2C7BA 1Z2EA 3GFFA 4AYWA 1BS2A 1YT5A 3GLQA 2NUPA 3ZD6A 1C29B 2J9YB 1HYHA 4NAHA 3BD8A 1SVNA 3ZKWA 2I1VB 5AXBA 2W42A 5KO2A 1Z28A 2VP6A 1AJEA 4V0OA 3TKLA 1Z2CA 4OHBA 2HQ1A 5BVHB 4D92A 3LO5A 3Q87B 3VMMA 4HMPA 2C42A 4CIVA 1MO3A 2JAWA 1N2JA 1NW4A 2GKSA 2WYWA 4MMYB 4RJ2A 4EARA 5JWRA 1O6CA 2WAAA 2SCUB 2JFPA 2QJWA 2OKCA 1SR8A 2WINI 3U4CA 4M76B 5L4SA 1UEXC 3PL5A 1G0OA 5TQJA 4PG6A 3QEKA 4OGWA 2VS1A 4BQFA 4OQFA 3V1UA 3WI7A 2V0CA 4R1NA 4C6HA 1GA6A 3H2GA 3O3MB 2QTVB 1U98A 2HWUA 4LOHA 4HB2A 3QJGA 4TSFA 3C48A 4UCXA 4FWIB 1UDWA 3TIIA 5L3VA 4FJ0A 4YECA 2A88A 4Y98A 1ZHFA 2D5LA 2R96A 5HQ3B 5HIAA 4LJLA 5JXWA 2FHSA 1Z4PX 2WWFA 5DNEA 3A6LA 1A04A 1IXKA 2Y2VA 3UWKA 3W5JA 1VPTA 4R71A 1SXHA 2ZBVA 4BNIA 1AQLA 5CNIA 4FHEA 5AW8A 2X8JA 3RKRA 1JEAA 2FEAA 1G18A 3AQ4A 1PGJA 4D9GA 3U44A 5FO1A 3UHAA 3PXGA 1QPBA 5BMOA 2OV3A 1XEAA 2EHDA 3B3QA 4G8JA 4GQBA 2B8EA 2M9MA 1F8UA 3OX3A 4KN9S 5KX5A 3HJNA 3C87A 2W6OA 2YV2A 3ETHA 3THWB 4UXHA 3TBHA 1R16A 3LI2A 3NIGB 3P0IA 2ZTUA 3PTLA 4PAMA 4QQKA 5GV8A 1KPIA 1UMBB 1U7ZA 1YR2A 2X76A 1HKUA 3PNKA 4FZ5A 3RRJA 5H4GA 2WC1A 1HLDA 2P9FA 2RDMA 3MUNA 4KK3A 2PSSA 1OXMA 2B94A 5TVKA 3RAJA 3B2NA 3LZ6A 4LK3A 4N6OA 4OU5A 4GLOA 1NUSA 5CLQA 3X3HA 1C3VA 5LP6B 3PITA 4X24A 4MAMA 4YYEA 4D6XA 3CKYA 4E5NA 3AJRA 1Z0IA 4JJEA 3V8VA 1GYQA 1G7SA 2JRCA 3A4LA 2EW2A 3L8YA 4DN6A 5IFKA 5J2UF 4RGQA 4R2KA 3IV7A 1XMIA 5FI0B 2DHQA 4IF6A 3W2TA 3I4LA 1KDYA 4L7VA 5CLIA 3TZHA 1GCIA 1S6YA 3C8HA 3L3BA 3ABQB 5F64A 3RB8A 3VZSA 1AKQA 3UCEA 3C5CA 3AETA 4MLZA 2UZ0A 5J4YA 4TX1A 5JNSA 1Z75A 3L8FA 1I1NA 1KRXA 1QG2A 3REQA 2BUCA 2QN1A 2HUPA 1Q7TA 2I4MA 2V3WA 1PCXA 4XUEA 4UFNA 1YCGA 1OQAA 3FFTA 3N07A 1NI5A 2CLSA 3OUZA 4S24A 1Z36A 2AI2A 5E7IA 3V80A 5TIIA 4MLPA 4GICA 4DEXA 3I5XA 5JYDA 1AGPA 2Y1DA 3UAGA 4REQB 4QGHA 3BMOB 2FFBA 3GVXA 1FB5A 2WVAA 3ASYA 3SC2B 3V3KA 1BDHA 2H9YA 3SF8A 3E8MA 1XXHA 1G5PA 4J4BA 1FUUA 2ODPA 4P4TA 4ZI7A 3ND8A 1JHZA 3BTUA 4PGGA 1MX9A 1RBYA 1BWSA 1XVAA 3GH3A 4V0RA 3RIEA 3KFVA 2DKNA 3A9RA 1Q21A 3EHDA 2PL1A 2W00A 2QTCA 2LCQA 1UINA 1UPXA 2EZ4A 3FF1A 4WFQA 4EJSC 4CG0A 4EY7A 3PQEA 3GGJA 3BEDA 4ZAFA 4DOMA 3CE6A 4MWCA 1AB6A 2V7GA 5D1HA 3F3KA 1REQA 5A5VA 5B7PA 1RQGA 1XI2A 3AP2A 2GPNA 1W5AA 1EX7A 4B0PA 5AT1A 2A6PA 2V58A 4HDSB 4UHEA 3WR5A 2FPPB 3IKTA 3ANLA 1E1QD 5A6SA 1WIWA 2FZWA 3DEKA 4GWKA 3VHQA 4FSHA 1Z63A 4BKRA 1P1JA 2YZGA 4Q1CA 1E7QA 4BO8A 3A3OA 1H1LB 1NJ8A 4IZOA 5ULLA 3KKPA 4D0LB 4ETIA 3RVLA 3OTQA 3V4OA 3KIPA 2IUYA 3A1UA 3HE3A 4LSZA 1GKYA 3Q0IA 3CH6A 1M73E 1GN9A 2IZ5A 1ZMOA 3JQFC 3WOVA 5F5LA 2JH8A 5E2IA 1VB5A 1I24A 1XNJA 3AEKB 2WTMA 4IIXA 1L5ZA 2O2HA 4MQ4A 3B82A 5CLHA 4Y2TA 4G9BA 4G0PA 3J7AC 1O5IA 2GEBA 2QR3A 1P1CA 2QMYA 1CY8A 2ZTLA 2DY1A 3OJOA 3BE5A 3MT7A 4OFXA 4B3CA 2CL6X 4D3SA 3HXMA 2OHVA 3HGTA 4XA8A 4IPTA 3RH0A 3R6TA 3OKFA 3GRVA 3KE9A 3UJ3X 1AQNA 3KSMA 1A4RA 1N6PA 2IZ1A 3LDHA 4PC7A 3ND6A 2MOKA 2H1LA 1NUTA 3AKZA 2QWXA 3NMUF 1CEXA 3CGGA 2ZRAA 4KRXA 4LGYA 2C2YA 3R5FA 1CU1A 3UA3A 2FZ4A 1UANA 2ZT8A 4XJSA 1KA9H 4YRNA 4GHWA 3U3KA 2F55A 3ERCA 2Q1XA 1WLSA 2A5FA 5JCOC 3WWYA 2Z4TA 3VI4B 4M0CA 2WJIA 3HACA 4W9NA 4HDKB 1CR0A 4RM3A 2EF0A 2B8WA 1MTOA 1T2AA 3T9DA 1GDTA 4BFUA 1EVLA 2PSJA 1SXJA 1V7PC 2CUZA 3CIFA 3LH5A 3I6YA 4EGCB 1XUOA 4ZTUB 4FQ8A 4JX8A 2VYVD 1X7WB 2Q29A 3F6BX 3CCFA 3BFJA 4ZC1A 2D62A 2RBEA 5FULA 3SZUA 5B1EA 2JLCA 5FOUA 3SEQA 1VLHA 2BHSA 2JIQA 3PR2B 4JLDA 1R6TA 4R1OA 4HX5A 1U8XX 5CJ2A 4AJ4A 2LIPA 4EY3A 4NQRA 4D8VA 4F9EA 1SOAA 2KBEA 2H07A 4P7BA 4H7IA 1ZD4A 4FFPA 4NATA 4Q9DA 1FBNA 3UT6A 3PFCA 2IYRA 5YASA 1IBKB 1CYEA 1MHTA 1GILA 5K6TA 1Z12A 2J07A 4KVFA 1P1BA 2LPMA 3ABZA 1ZAKA 3D0QA 2CC2A 4HG2A 3IPAA 1SD1A 2IXGA 1ZGJA 4QGBA 3CV3A 2A3RA 3WRXC 1LC0A 1K2VN 1NLMA 2QTMA 3GJ3A 1RNLA 1DEHA 1ST3A 2Q5JA 3G0GA 1NI4A 1MW9X 5FO0A 4YMUA 4XGKA 3ZDRA 1YNSA 3RFTA 2NX2A 2RGUA 1SIOA 4JT8A 2WNSA 1K7CA 5IYZF 2X0EA 4DRXB 2OXCA 1C4OA 4CLHA 2F9FA 2H0AA 1TD9A 2H06A 3KJXA 3QOYA 3ZBQA 4CLRA 1G21B 1JEQB 4UUOA 3FHTA 1BXRB 3JYQA 2FUKA 1CWUA 1PL7A 1R5NA 3D6HA 1VJRA 1JDVA 2AG8A 1MTZA 2FSVC 1CR6A 2FWMX 3PQ2A 2G6TA 3BAFA 4MKHA 5T4EA 5JI2E 3B1VA 3SEFA 4IJ6A 1ZXXA 1QANA 3QWIA 4LYYA 3KV1A 3NDIA 4CEHA 4D9BA 1CVIA 5LJLA 2V4UA 1AK1A 5DSXA 2XVMA 4Q9IA 1FNSA 3B9QA 3OCVA 2QSZA 1J8DA 3TTTA 1FMLA 4QXOA 4Z3OA 3I01A 4V38A 3EXIB 3UMSA 3LSTA 4G0YA 1BS9A 2HWKA 5L8VA 3AG5A 4WBSA 3DH0A 5KSYA 4N8SA 1YAJA 2QTAA 3IQZA 2JGFA 4FHFA 3GQVA 1SBTA 3TIGA 3OQ6A 2ZIGA 3D7RA 3O8LA 4BZWA 5I7HA 1V41E 1YXMA 2GLTA 4GL4A 3NHPA 3QV1A 4AKIA 2QTTA 4PTLA 5TDHA 3NORA 1SKAA 2MSCB 3LBFA 5H9WA 3W1EA 2FZKA 1N5RA 3KBBA 3R7SA 3A28A 1FPMA 4WNAA 2GETA 1J07A 1RWKA 1HRKA 2G25A 4FOLA 4HDAA 4WGGA 5KDLA 3GG2A 4HEQA 3TNFA 3BJRA 5FUYA 2JJ1A 3DBRA 1QP4A 1C50A 2FZLA 4B7XA 4P33A 4HFMA 4I8XA 1TCVA 4NFLA 1OU4A 5JANA 4XFJA 2G36A 4ZT7A 2AEMA 3E84A 1NXOA 1HORA 2ZVDA 3IQFA 4X3OA 2GLUA 2JAOA 4EKIA 3E6AA 4JIGA 5FR1A 3R8FA 5KNBA 4JT2A 2GA9A 2IYPA 4UNPA 5TMBA 2C2ZA 4IH9A 1BU8A 2DBYA 4BJ1A 4DIKA 1SXQA 1UMDA 4GOLD 1AKUA 4UZSA 1NHGA 3FB4A 1L4KA 1M6VA 1FFYA 1E89A 3BFXA 4BBPA 1KO5A 1P75A 1AN0A 3V46A 3VAAA 3V8RA 1UZMA 1Q1AA 4DCNA 4YRRA 3TTUA 2PGOA 1BA3A 1FTNA 3K8OE 1TMYA 3NWPA 3A32A 3STUA 4CFYA 2G72A 2PX4A 4AX4A 3H9GA 1PLLA 4II2A 3TL2A 5F12A 3BYZA 3TOZA 1K98A 4G5GA 3TOXA 1WXWA 2IPAB 4MR7B 3UAXA 4P93A 1KEEB 1FDWA 1VCOA 4MVJH 3WL5A 3ZVKA 4D56A 2B35A 3A1SA 2VHWA 5K3BA 5JOQA 3CSDA 5ILOA 4FFBB 1FQJA 1PVDA 2VC2B 3T7KA 3HJCA 2IZ6A 2P9YA 3H87A 3Q40A 3ZIDA 2ZRPA 1H2BA 1C0KA 2Y4OA 1JPNA 2P7IA 2PGNA 4HH3C 5JD3A 5SYAA 4DLBA 1QGZA 2M98A 4N5MA 3R4CA 4QFMA 4JCCA 1WHSB 1U0RA 2NU9A 3NBFA 2BFAA 4AAYA 2RHJA 2X42A 1NRWA 2R00C 4C07A 1DAHA 1SC9A 2O3TA 3UUWA 1K7XB 5A3SA 4DR6B 2C4WA 3R9XA 2QRPA 3BH0A 2XZPA 3H2IA 2ZAMA 1MFZA 3IS3A 4PLHA 1H05A 2CGEA 2UU9B 1J09A 2BBWA 2EAUA 4QBFA 3QBJA 4DADA 2GJSA 1B23P 4F8JA 1E2QA 4N4AA 4HFNA 1YKSA 3I2GA 4CMEA 2C97A 2FP4B 3GEIA 1YZYA 5F9FA 1JPJA 1WVIA 3EZ9A 1PJSA 1LK0A 1ZPDA 2VQDA 2Z95A 1N5DA 4UOQA 1LBHA 2OLEA 4BWGA 4QLOA 4AK9A 3ZHXA 2ZUWA 3I37X 3LPDA 2PD4A 5BMVB 2PVSA 4JLSA 1JBQA 1J8VA 1B1CA 5A4IS 4MOWA 2DLDA 2EYQA 3I8XA 4UU8A 1KE2A 4EIWA 4UOEA 3RNOA 2QT1A 1WXQA 1OIXA 1U3DA 2VQ3A 1WPRA 1D6MA 1QDUA 2PN1A 3IMGA 2O5CA 3VJRA 1HFEL 1OCEA 3ER9A 4MYSA 2VTBA 1WXDA 2PZMA 5EJ6A 1QONA 3DZJA 4UMEA 1JHXA 5G2OA 3F96A 2QX7A 3WTBA 5MHTA 3GVCA 5AYVA 3TZ6A 4ZO9A 2IU4A 4QG3A 1GUFA 3QW2A 4TM7A 2GEJA 3KTAB 4ZT3A 2QL6A 1TLFA 4CIDA 4R7GA 4AF6A 4LCBA 1YI0A 5HYVA 3C8MA 3GCWA 1BCRB 1ORIA 3BWCA 1QJCA 1ZOIA 4URWR 4WLUA 1Y7LA 2RB4A 1JFLA 2DKOA 1ADBA 2VDPB 1W94A 1N6OA 1DRKA 3B2EA 4MMXB 3RRZA 2G9VA 3FF4A 3M9XA 4RHEA 5H0IA 5I47A 3MOIA 3QBVA 4HS9A 1G38A 1KJYA 2DH6A 2UVDA 3EVTA 5K0FA 1ILEA 1FX0A 1WUIS 2XNDA 5ITZA 1QQ7A 4RMJA 4TSFD 1X1SA 1V7CA 3DR3A 5CLJA 2UUBB 2FRDC 2YJ5A 1IU9A 4ND3A 4R0NA 4ZVUA 2CXPA 2P5YA 2ZJ1A 4R9RA 3VFDA 1I3OA 4XIIA 4I0WB 3DJFA 3AEUB 3R7BA 4X7BA 1GUYA 2PMBA 3K2BA 4L95C 5K0LA 3TAXA 2P9BA 1RWNA 4HZGA 1XDUA 4JKOA 4YFVA 1B8NA 1PUXA 1Y34E 1CPYA 2QRMA 3F8WA 5JYCA 1P91A 3RSLA 4ENPA 5A4FS 3FWYA 4EVQA 2GZHA 2PSFA 4ACAA 4F86A 3HB4X 3A05A 2QZ4A 1ABEA 3K1AA 2XUPA 2J6HA 3C7CB 5DXFA 4BFCA 3FHLA 7ABPA 3LP8A 1S8OA 2JKZA 2W58A 2FH5B 5DH9A 4GPAA 4WADA 421PA 5CYFA 4XWOA 4K9QA 3UCXA 1H66A 4QJ4A 3DFZA 4U0KA 4Q9KA 5EWJA 1Q17A 1MV5A 1P7ZA 4CCYB 4F2DA 5CCBA 2A35A 1KYXA 1Z0FA 5GWXA 1G6OA 1PR4A 3PJDA 2AC2A 4OAPA 4PVDA 4GRDA 4LHZA 2FB9A 2VHEA 1TLTA 3BA1A 3LVRE 4LYJA 3QYPA 5AVXA 4IHJB 3GA7A 1U0LA 1WW3A 3A7DA 3DMRA 3HWSA 1J49A 1AMOA 4RK0A 5CVUA 3WQQA 1WB4A 1W2WB 4HLNA 1WCWA 1U7UA 2AFVA 3CLKA 3GFOA 1BX3A 2GCOA 3IV9A 2WIDA 1PD1A 4KK4A 4PYRA 3DFUA 1V43A 4D41A 1HMPA 5EWLA 2C7GA 3RVRA 1OXTA 2EKQA 3EIUA 2Z2YA 4QGFA 5EAIA 3TMAA 1XF1A 2V3VA 1UZUA 1ZD8A 2RI1A 2ZREA 3IPYA 2HQBA 3TZCA 5JW6A 3DSRA 5B6JA 4WKOA 4MNTA 1K8RA 3SQWA 4EO9A 2QXUA 2IYVA 4F1JA 1G3UA 1N25A 5AW5A 1EHCA 1RXUA 4M83A 4F1KA 1OFTA 2ZJ0A 4DC1A 3LCCA 2CE2X 4IX1A 3TSYA 4EB8A 2NIPA 2RH9B 2BFDA 2UYQA 3C6QA 2FPWA 2VHXA 2BFOA 2FAXA 3TWOA 3WSTA 3JAKA 3PENA 3FGZA 4BNTA 3P7MA 5GIOE 1FFCA 5EIAA 1RMYA 1L9KA 4X3PA 2G67A 2Q3BA 3DDHA 3T3HA 2JI8A 3IB6A 3K0FB 3JYPA 3T7TA 1EK2A 1C1HA 1VRVA 2E55A 2O52A 1I3CA 3QVGA 5EJ2A 4GM0A 4CHTA 5KJCA 4RKWA 3DVAA 4Y3UA 3B36A 2CJWB 2X1HA 2BI8A 4LDPA 4BRUA 4GR4A 3ZXUB 1EBBA 1M6YA 1FU4A 4DBVO 2NG1A 1I7DA 2UVQA 4B09A 3L18A 3WB1A 4QVIA 5BR7A 2Q3LA 3HNPA 1NZDA 4BLPA 2OFPA 1CG6A 1JPUA 2PAFA 2XUFA 3QKRB 5AI6A 2VQSA 3DAGA 5F1KA 1M54A 5FA5A 1FIUA 4LV8B 4J7XA 5K8LA 1G5HA 2KYRA 1BSVA 2BLNA 2Z8YM 4Q5IA 1FLDA 3CCCA 4KQIA 2C3UA 4Q7JB 3UWPA 2WSBA 1NJ1A 2PWBA 3RQSA 5BSWA 4TXJA 4QYXA 3PRYA 4WX2B 5CA0B 1DZIA 4ZJYA 1QORA 1SUBA 2W98A 4Y0VA 3RVPA 1T8YA 2J4CA 1YB7A 2XNJA 3TMYA 4C7KA 4ZJZA 2QAGC 1XVTA 5JU6A 3VVBA 3ZQ6A 4EA6A 4PYOA 1O0BA 2JGJA 4YJKA 3ZDDA 1E2EA 4CKCB 5E6SB 2V7BA 3MMPA 3ZGOA 4DWOA 1E59A 5JFGA 1OOEA 4HDCA 4K7JA 5I7WA 2QRHA 3K5IA 1PS0A 3VX3A 2XXBA 2NOAA 4JXZA 2G1PA 1CUGA 3ZDYB 1VJCA 1ULSA 4DLNA 4C05A 1BYUA 4CTOA 1JDSA 4IXMA 5IAKA 4N41A 1TCCA 4YDQA 1YB1A 2IW3A 3K92A 4RHXA 3RLFA 3FVWA 2P68A 4QGGA 4R2JA 2WLSA 1GUAA 1YL5A 2XODA 3E8XA 4RFSA 5H3LA 4E3WA 1WVMA 2XWBF 4P6VF 4BNHA 4QGSA 1YR6A 2JGRA 4MW7A 3PPWA 3ZGZA 4I6JA 3CUYA 3MWFA 4N54A 5A6VA 2WSMA 1O0CA 1A7AA 2NN3C 1B6TA 1YB2A 5LBTA 4EAQA 5IBQA 4XCXA 1NDHA 1XNGA 4J16A 5I4KA 3KXKA 4M7OA 1KH1A 1EI9A 2YMMA 1NFQA 1Z37A 3RANA 5JI3E 1CZOA 2QTZA 1RAGA 2XGOA 3IAS1 2HWYA 4M9CA 5ALKA 1E6WA 1SXJD 2XUDA 5FEMA 3DE5X 3KJIA 2X0IA 1IRXA 1FX1A 3E3AA 1VL0A 4MPPA 5LBUA 1G8AA 3BGOS 2P2DA 2CSUA 3KXPA 2IUFA 2OQVA 4BFVA 3L92A 5CGQB 4HX2A 2FSGA 4LTNA 3FNQA 5FPHA 2MMGA 4ZA2A 2IZOA 2QMQA 2ZJBA 3DT6A 2VTDA 3QG1A 4TL9A 3LY5A 4I50F 2RIPA 3U39A 1OKKA 3P9ZA 4ME6A 3GDGA 4R16A 3E1KA 2NZUG 3IJPA 4EHIA 1GT91 3RUIA 4Z9FA 1UPCA 1W5TA 2OBFA 1RHQA 3W9BA 3ZZ1A 2WHYA 4G4IA 5B1IA 5BV2P 2YHIB 2CN1A 2X3YA 5LDGA 3KQQA 5JE8A 5KWSA 3G3EA 3G8DA 2O7SA 2KMLA 2W2MA 3DUWA 4WUTA 3CLTD 3M4YA 5FBVB 5C53B 3EEYA 3FI9A 3N7TA 4DDTA 1U9ZA 3HZOA 4ZT2A 3LUGA 4G5QA 2LUOA 1F9AA 2B4YA 1ZQ1A 1J0CA 2FR8C 5KDOA 4WGFA 1QZZA 3ESZA 2V65A 4CTNA 1SMKA 5KSZA 4QYSA 3EPLA 2QENA 3OLXA 3ANNA 5I5EA 2YFKA 3Q72A 3U49A 4RA6B 3ST7A 4BEJA 1ACMA 4WINA 1ZGCA 3MNFA 2C9YA 2V0GA 2DPYA 3PHIA 4RH1A 1M34A 2QD3A 3HSSA 3K09C 3A26A 1ZISA 2DFTA 3W3AA 2FNAA 4TS1A 3TXAA 3QELB 3S70A 2EFEB 4Q4HA 5B36A 2VPIA 3MJSA 2HBZA 2RGAA 1QXSA 1EE1A 3F9CA 3CPHA 3N74A 4R8VA 3ZE7A 1LY1A 3CLSC 4TS3A 3LQFA 3MS7A 4MUEA 3UFXB 1E1KA 1XTRA 4H1UA 4INPA 4HHEA 1L7MA 3O2JA 1X6VA 2AC7A 4MLCA 2BMEA 2GZAA 4QDJA 1NBWB 2PCLA 3HCNA 4L2IA 4S1VA 4UVIA 4W9NC 1QX4A 2AN9A 2R84A 3AR6A 5EIEA 1K88A 2OCYC 4IDBA 3UV7A 4R84A 3NJRA 2ZE6A 4DJJA 4LC0A 4C0SA 4AI6A 3CLUD 4HNSA 3LUKA 5KVQA 3RVOA 4E14A 1FSPA 3F67A 1XU4A 4YDRA 3UHJA 4URUR 3UJPA 3A4IA 3FYTA 1ONNA 3NAMA 1IUKA 4WVFA 5ECDA 4KAXA 2BGRA 2P9JA 5FEUA 1KDTA 1FFXB 3AZQA 4ND1A 3JQ8B 1UM9B 1ZEJA 2VXBA 5DJ5A 2HJHA 4LS3A 3KJEA 4ESHA 1QGUB 2JGNA 4IQ4A 5DASA 3RS8A 1PJRA 4X8MA 4OTZA 1BKYA 5JAQA 3Q2KA 2LD4A 2P3SA 1E2NA 4QBHA 1K8QA 3CT6A 1QZ3A 4UUMA 5DHRA 1F2DA 4FGUA 4P5EA 5KNBD 3VR2A 1XVVA 4HEA1 4OMUA 4BY9E 4EGFA 1AKRA 3K0EA 3PYXA 1SWVA 2AJBA 4D1YA 2PHZA 1G8JA 1PR2A 3NH9A 2ZG6A 4QLBA 5FNVF 5C8ZA 5HRUA 3CLTC 5CXSA 4A2CA 3UGJA 5L6LB 5C9ZA 1C3OB 1Z07A 2CUKA 3HL4A 1CJSA 4F4FA 5IKPA 4DIOA 2O2GA 3JS5A 1P2BA 2QM8A 1SC4A 1L5MA 2VYND 4TROA 3DA8A 5AKGA 5TS2A 4DV4B 2FW0A 3KPUA 2YY7A 3G59A 1QQAA 3VTFA 3NNSA 4HNGA 2O8DB 3TR6A 3W5HA 3O1IC 5JWOA 1RYDA 2GS9A 2JCVA 3ABOB 4BAGA 4DHEA 1R5OA 1KI9A 4HKTA 4NENB 2G0NA 3L8EA 4HXGA 1DQPA 1PAUA 2P6MA 2RBGA 3N6XA 3VKFA 1IOLA 4RFVA 2N3ZA 2XH8A 4FN5A 1KEKA 2OECA 2O2IA 1F8GA 1NZFA 2G5GX 3T5GA 3HKBB 4U7GA 4A2PA 3LCJA 3OQJA 4KQMA 3BHIA 3GV0A 2D2XA 3OJLA 1QYDA 4GXNA 4D9JA 4KP7A 3HM9A 4C5CA 1T2VA 4X0EA 3ANTA 2IHBA 2XR1A 1KVTA 3O92A 5CB4B 1A7UA 3BH6A 4ENQA 2YZ7A 4J29A 4J76A 5CFQA 2HJ9A 3I6IA 1IIBA 1O7JA 3HY6A 3Q7EA 1Q0QA 4JNKA 5F52A 2BC9A 1R7RA 3W77A 4JJKA 5IUJC 4R6WA 5CLGA 5TQ0B 4QOHA 5LR6A 5LB2A 4H1TA 4LEIA 4IDEA 4DZTA 1R88A 2EFYA 3L01A 1ZCJA 1Y0BA 5LA6F 2R7LA 3RHSA 3N39C 4EUKA 4WY8A 3AFHA 2VHVA 3TLGB 1UK8A 4LF5B 3FKSA 1G9TA 1BD3A 2C5SA 4NZOA 4BO9A 4HYEA 4C7BA 3ZJVA 1UCFA 3NR2A 4PZYA 4A8TA 1SD5A 1JEYB 4TKUA 2HSGA 2XYRA 4G01B 1N9GA 4OAQA 3UOWA 5HGXA 4K6FA 1COZA 1OTHA 1HEUA 2P4SA 3C98A 5EKUA 5FIUA 4S0XA 4Q47A 5EIBD 5JRDS 4NMHA 4J0FA 4MUJA 2BMFA 3EC7A 2R8PA 2XW6A 2I9KA 2QVCA 3SXUB 4Y2PA 2O2SA 3PJEA 2E4AA 2QI9F 4YVFA 2AHRA 2H1RA 2QSUA 4WZBE 2WJJA 5M5BA 2JARA 3QVKA 1KP9A 3KTDA 3F71A 3ADPA 3MPUA 4FGZA 2WDPA 3ICOA 3PR3A 2BBOA 4KPUB 2OO3A 4MCIA 3TLEA 4BMYA 1BMFA 3G2PA 2RHWA 2IWHA 3TTVA 5JMTA 3MJDA 2DECA 3BGWA 4OL9A 2PMCA 4UW9A 3WLKX 1QIJA 2IQIA 1CE8B 4AZWA 4DE5A 4B6RA 3H5TA 2JJ8A 1XZNA 3E58A 3EPPA 2XNDD 5EJMA 1E69A 3U13A 4V1CA 1KK1A 3T5MA 3T7SA 2O19A 4IWYA 4MDEA 4J2HA 1NW9B 1KMQA 2P4QA 3H3XA 1XK7A 4MR9B 4B4DA 1C9JA 2EFDB 4U5XA 4MV6A 3VR4D 3DYIA 3Q2IA 4B2LA 1L1EA 1MA3A 2O1EA 3NAGA 5I6DA 4Y9SA 4YPFA 3HYNA 4IHKA 1LX7A 1TT5B 4DZRA 4Z54A 1ZMRA 4JBGA 1EWRA 1NLFA 2FPLA 5F3DA 2XDYA 2FN4A 3NGMA 4KXLA 2GCIA 5GAJA 4PPFA 1U1EA 1IN5A 3AW9A 4CMEC 4HEHA 3AI3A 3IEPA 5G0SA 2AFHB 4K03A 3UC5A 2ZS7A 3L0IB 1FZQA 1JYFA 3H9QA 4L0CA 3IQIX 4B79A 3PC6A 1BCSA 1NN5A 1XMVA 4RE5A 4JBLA 1C4WA 2ZRKA 5G3YA 4CZ2A 3IVCA 3TPCA 4QTYA 4FNOA 3MQ4A 5CJJA 4QUHA 4TN5A 4X6XA 2GN2A 5IP5A 4EQZA 2GZ2A 2BYTA 5DDIP 4DZZA 1K6EA 4IFEA 3D0RA 2HFJA 3EVCA 4HUTA 1Z13A 2GSWA 4S2UA 4HMQA 3M81A 3HEMA 2RJOA 3OO0A 4MEAA 4WWHA 2C4UA 4FSDA 3R41A 2X0RA 4ZT6A 3KDSE 3R8CA 2AG5A 3GNQA 1B0AA 2W4IA 5EIBC 1QRRA 4ZALA 3MWKA 2BFBB 1LBEA 2F8TA 3KR1A 3NBQA 1W76A 3DOIA 1P9OA 1RU3A 2ZJAA 5DULA 4X8OA 5G0WA 1OH6A 3RVMA 1DAPA 5DNWA 1DADA 1YQWA 1EUDB 3EIOA 3JAWA 1P7CA 1U5BA 2QRGA 4ZV4A 4EG4A 5JZVA 3OIGA 5CAEA 3QKWA 1E8DA 3OAAA 2V1XA 1DWOA 4YAUA 2MIIA 1A4UA 3I92A 4EJMA 4BOYA 5ADVA 1QGAA 3N5KA 1T1RA 1EYZA 1ZINA 1USGA 1NVEA 2I2XB 3QPWA 5BSFA 4LWZA 2EFJA 1R9MA 2OV2A 3DD1A 2RMKA 3J7TA 3IBYA 2BEWA 3R0QA 4GI3A 1GPH1 3AHEA 3EGXB 3OZDA 4K0RA 3QVWA 1JUDA 5EP2A 4YP1A 2IYYA 5F1YA 4Z4CA 2IH4A 4ZOEA 1JR3A 1TVMA 3O26A 3AC0A 3KEOA 5K3FB 2QTWB 2A3NA 4QUIA 2VDOB 2WNHA 3M83A 1JAZA 3A10A 3K9CA 1B3RA 1HDYA 2QP3A 3OM1A 5A0FA 3R0VA 3FOZA 1QF7A 2HBRA 1CZLA 3OOJA 3I52A 4AZ0B 4YRLA 4COKA 4Y1RB 4XQCA 1U90A 1MPTA 1IIRA 1BE1A 3G7UA 1AUOA 4P3PA 3W90A 3P5SA 5EFZA 4LRSB 1USVA 3C3JA 2VT7A 3W2GA 3AMVA 5KX5F 4ZHQB 3FJOA 4UZFA 3HWX1 5CX4A 1T2FA 2R8EA 4GVLA 2AN5A 3HVUA 5FWDA 2RG7A 1SU6A 1WCV1 2FJPA 2H1HA 2W2QA 4F9FA 1E3EA 1P0QA 3H13A 5T41A 1W4RA 4G8DA 1TXGA 3KBOA 4K8OA 1JDBC 1Q7BA 1MX1A 3OQVA 1A7JA 1NMZA 2WIKA 3EGVA 3KUCA 4MRMB 2P2SA 1TUBB 2R1UA 2WD7A 3LGXA 5AKLA 3KZKA 2BY4A 3PPVA 1P5RA 4V2UA 4RL6A 5EIHA 3KSRA 3GQBA 1T8TA 3PNVA 3TQHA 1L1RA 3L93A 4G0OA 4CYMA 5IDYA 1U0BB 3KJQA 2HN9A 3QBEA 3QK7A 4P7FA 4U2KA 4X1IA 5C52B 3C97A 5BVGB 2HR1A 1L2TA 1H1TA 3A3KA 4JUFA 2JLSA 2XGGA 121PA 4NNPA 3UH0A 1AKMA 4B2YA 3PPXA 1KSHA 1MF7A 4Q37A 1DOZA 5J23A 4PN7A 2HH9A 1G5RA 4H31A 1NMEA 3RLIA 3SQDA 1QRUA 3LLVA 1ESDA 1SU8A 5AVKA 2YQ4A 2QAIA 1QGYA 1R6UA 3MJ4A 4PONA 5KTOA 1TYBE 2Y99A 1DEXA 3B89A 3NEPX 1YU9A 4FD3A 1SKYE 1WEHA 4PQRA 1QCCA 2IHTA 4H3SA 3G13A 2Q4RA 4H17A 4DLPA 1DC8A 4JLJA 5C18A 4M46A 1BMTA 3ZZTA 4R51A 2ZCJA 1UJ6A 1G5IA 1OFUA 4ZI7F 4IDAA 4JIMA 2FQWA 1MNQA 2ZT6A 2BM1A 3FPCA 3IIEA 3ZDCA 3PCXA 5BORA 3I61A 3LGSA 2NT3A 3EULA 1RZ3A 3ZDFA 2ZM6B 4CEIB 2OHOA 2OCPA 4NJOA 4PICA 4WA7A 3RPEA 3LQ1A 1JG7A 4RMHA 1KYVA 1WQ1R 4HDNA 4EG6A 1QQ6A 3HC7A 1BHSA 4MUMA 5HUHA 3S81A 3E15A 5A03A 3K6SA 5HOEA 3EQ8A 1Y8ZA 1JIQA 1YZHA 2OYRA 3RQIA 3CRVA 2JLWA 1O5OA 1FSFA 2BKVA 2FPUA 1QRTA 3AONB 3BWBA 1MLDA 3ZE6A 1ZSVA 4WEQA 1MEOA 4F4CA 2FMFA 4MRNA 1OKKD 4QOGA 1L5OA 3RK1A 4DC9A 4E2ZA 1KI7A 2H3EA 3GEEA 4ZZ3A 2C04A 1YZUA 3RT7A 2IHUA 3EZ6A 2ZRQA 5SICE 2G9QA 2GO7A 2VNHA 3O21A 1TF2A 2WNIA 2X0NA 5KWEA 3STXA 4R2WA 1UH5A 5L40A 3IILA 3S27A 3UN1A 3CNBA 2HK9A 4JEIA 4E30A 4RTKA 5EYPB 2PZFA 1EQ2A 2B4RO 4WN9A 2YTZA 5IN5A 2H00A 1QBGA 5I9TA 1A1VA 5I3ZA 3VR1A 3P4YA 2XRFA 3H9EO 4I55A 2YDYA 2Q8QA 2XQGA 3AB3A 3QKSA 3RTEA 3FNHA 3G2HA 2IOHA 4Q3BA 4YHBA 4E5UA 2J3MA 2YW9A 2ID8A 3X1YA 4MGKR 1XN4A 4MI1A 4CQLA 5JJLA 4XJXA 1J7KA 1L4YA 1BDJA 3UAOA 1WPQA 4BQPA 1R6VA 2FMKA 1DNPA 5FOVA 3DL0A 1DKPA 1WU8A 2VJYA 3QUTA 1LV7A 2PU5A 2R4QA 4PQFA 3LDGA 3HVRA 2IUUA 3FYHA 4URYR 3W3AD 3NAZA 2J3LA 1XDWA 2DE0X 4DQVA 1GDDA 4EGAA 2Q7OE 5AVWA 1ZJJA 4A2QA 1Q7GA 3MBKA 3SAJA 5EJFA 5KYUA 3ZJ4A 3FCOA 1DIRA 2J5QA 2Q8NA 3N86A 3RWBA 4URZR 5JAMA 1PHPA 1C81A 2ZIXB 5KUTA 2ZI9A 5MDHA 4J16C 5C0OE 4K9LA 3RC2A 2D0DA 4OBEA 1H94A 2ZRIA 3MWEA 4FILA 2K7FA 2HJRA 2MYNA 4RZXA 3VSAA 2JAHA 4HYYA 1RXCA 3LAWA 1SHLA 3CWQA 5TC4A 4ZAXA 4YX9A 2FP3A 3QYJA 3ZYZA 4JSYA 4M54A 4AMZA 4URVR 5IULC 1FSGA 3BJMA 4LRQA 5CJPA 2BJVA 1QP7A 2OZKA 1NYLA 1YASA 1IZ9A 2J7KA 2CEAA 3O4FA 3C45A 3T3DA 3NBYC 3EGDA 3TZQA 1V8FA 1K8ZB 3NUZA 2XKJE 2ZE7A 3OLZA 4PRLA 2GR9A 2PEYA 2BP7B 4TV9A 4JWKA 2XNKA 2BD0A 2ORED 1UXJA 3JZAA 1P17A 3UUEA 3C1AA 3I64A 4BB0A 4ENVA 2O7NA 2F43B 3UFBA 1NFRA 4GMFA 1UJBA 4AJLA 4QU8A 5CVJA 1FDUA 2FEPA 2GK7A 4I4TA 4AULA 5JR3A 5KTNA 4YRAA 1U2ZA 4OKNA 2XZOA 3MJHA 1RXSA 2OORA 3I34X 5KHLB 3VR2D 2OHJA 2YHUA 1YWGO 2GNPA 3O31A 1LS1A 4YMIA 3LRPA 1Y4ZA 3NWEA 3D1JA 1N6NA 4GKJB 1PWZA 3IQGX 2DC1A 4K6CA 2IOFA 3JPYA 3NTXA 2ZR8A 4FI3F 1PN3A 1TKBA 2C5EA 2PQMA 2VPXA 1XXHE 2EP7A 3CF0A 5K05A 1AMUA 4OJTA 5B3KA 3KPYA 1F6WA 2YS7A 3MFYA 1FUYB 3BHMA 2JFBA 1B8PA 1Z0AA 2R68A 4KIGA 3H7AA 4EA9A 3NTQA 2FPGB 1IN7A 2OZEA 1P6XA 2QZZA 3DD5A 4JC8A 4LKRA 4B6QA 4F4HA 4DUYB 4XVHA 2PUJA 5EXTA 4BGEA 4F3CA 5GJBA 2YNMA 1JSXA 3CO0S 3NP9A 4X45A 5A3VA 2I66A 1BEZA 1B7GO 1P6UA 3A6ZA 3CXRA 3K0SA 1TECE 2ATCA 3LIPA 3EWSA 4HGOA 1XRLA 4LTMA 5G0VA 3CGWA 3PHLA 4DLKA 5EQFA 2WF9A 3AUYA 4KE9A 4D3XA 1QX3A 8ABPA 1QO9A 1A71A 3ZCVA 2ZIVB 1PYOA 3FZNA 2P77A 5COQA 3SX4A 2W83A 4JUBA 1SK8A 2UXBB 1A4XA 2AG1A 2BDTA 4F04A 4BS9A 3EVBA 3FPHA 3KSUA 3OSZA 7YASA 4ZGGA 5JQWA 1EFVA 1Q57A 5E9WA 3DNPA 1CP2A 1L4BA 3GIWA 1N2GA 1MGOA 1BWQA 1R8QA 1TYDE 3G5AA 3HDVA 2RB5A 4LJAA 1SC6A 2ASVA 3HFRA 3KXIA 3GVIA 2GAOA 3H11A 2D00A 1P74A 3R3XA 1OXVA 3ITKA 5CP8A 3BT7A 4PY2A 2Y93A 1XNRB 3FKSD 2N1BA 4R2MA 4LQCA 1F2TA 1KEUA 5ALGA 1KP2A 2FFJA 2W7TA 3E5HA 2QX8A 3EG9B 3EAQA 4JJ4A 4LZZA 4F1WA 1L5FA 2JKYA 3BFPA 2A4MA 5E4YA 5DIZA 4FM9A 2GXAA 5B3JA 5DMXA 4YRPA 3DEYX 3EUFA 2OCXA 2DTDA 3PE4A 1WMAA 4RENA 5F77A 4CMHA 3MMXA 1EVJA 2F6RA 4DPLA 1BQ4A 1DC3A 1E7WA 3W5VA 2PV0A 3QUQA 2JFXA 3PHCA 2JAXA 2DUMA 1CZNA 2ERXA 4G9EA 1Z0DA 3JASB 1W4LA 3OT1B 2ZQZA 3ZCSA 1IYZA 1NW6A 3PHJA 2ZDHA 3EXHA 3KB1A 1T8UA 4JR0A 1W48A 4B75A 4HCJA 3CUSA 3VGJA 4HEJA 3T5BA 5JECA 1DJPA 2X7XA 5U1PA 3I04M 1YH3A 3OZAA 4BLOA 4LISA 4PEVA 3QWBA 1QHXA 4X65B 1RJEA 4BEVA 1QC5A 2WUFA 4BO4A 1Z4JA 3MG9A 3NGLA 3W05A 1PT6A 2Q2NA 4IF4A 4R31A 1B42A 4A6XA 3ZD7A 1KO1A 3EIFA 5HM8A 4DR3B 4OQ4A 3HSKA 1HDRA 2O2YA 1GCGA 3HP1A 3S1AB 5ALIA 4O5OA 1Y42X 1MP0A 1LDYA 1EKXA 1CDEA 1M5TA 1SZDA 2AGVA 2VPZA 2MSWA 3H2SA 3P9CA 4P3YA 3R7WB 5B3LA 5CA1B 3U60B 1XA0A 1E5LA 5GJWC 4UBNA 1JN0A 1PJTA 3P32A 3QFTA 2XIQA 2Q5LA 3MD9A 3PUZA 1O6GA 3NTVA 5JSZA 1MENA 4OYHA 3C7KA 2ENUA 1HT2E 4OKIA 3IPCA 1U0TA 3DWEX 3JR7A 2M1XA 3NBAA 4LOLA 1K06A 3CR3C 4UTNA 4GOMD 1FP4A 5B1HA 4A15A 3ND9A 2NVUA 1QV6A 4N48A 3I9V1 2FN9A 2NM0A 2WICA 1QYWA 2ODWA 1JWAB 2M2IA 4RIIA 5J2UB 4PYIA 4AY4A 1P77A 3OEEA 2XOKA 4KUHA 5THKA 4A0QA 4I3HA 1DO0A 5CYPA 3EVZA 1W6UA 4OHYA 3WBKA 2WM3A 4Z8XA 5GOTA 1D5WA 2BGLA 2CNOA 3E61A 2J3KA 4EM6A 1WF6A 4MTLA 3O8QA 1AXGA 4CMBA 2OAEA 2QUJA 3T9FA 1X87A 2GK4A 2OZLB 4K87A 4MO9A 2P69A 4F21A 4BO3A 2VCYA 4PYKA 4QASA 3KX2A 5FBHA 3ZLJA 3EZFA 1R5BA 1NE2A 5D3QA 3WDMA 4AZTA 1W5SA 4HFJA 4OMDA 3RK0A 2JH3A 3OF3A 4DG9A 3TG8A 2ZCVA 4CJXA 2AG6A 2EG9A 3FOWA 5CYOA 4PPQA 1PL0A 1R0SA 3FBWA 2PT5A 5JCPA 4C6TB 4GP9A 3RFXA 3LK6A 5T64A 1F1JA 1O9BA 4UDYX 4FOSA 4BX2A 3RUFA 1MAWA 4Q3LA 2Z6AA 2D5CA 2HJVA 2WIGA 3KQPA 1P3Y1 1A9PA 2HXGA 2GVZC 3B6EA 3OAAD 2IWRA 4DMMA 3O5AA 3VQTA 1YFKA 3KJGA 4HQOA 3DDZX 4F93B 2PZJA 4HYTA 5IT9A 2R62A 3MUOA 2XYPA 4JLBA 3CONA 2O1XA 1ADFA 5EC8A 4EYEA 1HNNA 2H9IA 4FDLA 5DBGA 4AXXA 4BGDA 1JR3D 4DV1B 2J87A 4QXPA 4MDFA 5KHOC 2YY6A 1MO5A 5C81A 5LU8A 4B3SB 2X1MA 1IQRA 2VP0A 1C3LA 5DM2A 1S5PA 4QXRA 1XQWA 2D0OB 2FN7A 2WWHA 4FHZA 5ADWA 4WJKB 1F6DA 1LI5A 3G88A 1LV8A 5JDCA 4JVMA 5FI1B 1ORHA 3TEJA 1RZRA 1ADYA 1J21A 4OBXA 3WV5A 5IAGA 1RR6A 2YFQA 3MTGA 4Z0PA 4JB2A 4LHEA 3QPUA 1GQSA 5EP1A 3UWOA 3U9TA 3VYSB 1C7EA 1U8EA 2I4IA 3BXEA 1C41A 2G70A 2K6GA 4FT4A 1T2UA 2WWIA 4RIHA 3QMVA 5IK2A 2NNWB 3WRYA 2CXNA 2Z8ZA 2HA4A 4LN1A 1TEZA 5E38A 5CDHA 2A33A 1ZN7A 2O6HA 2PH3A 4KR9A 1L7PA 3ZPXA 4EB6A 4EVIA 5C7YA 3ZI0A 3OEHA 3VNQA 4GM1A 1X7YA 2JNWA 2NO7A 2JLBA 3NETA 2G77B 5KQPA 1JR2A 3OX4A 4ESOA 4ZMBA 2CFSA 3V48A 3PL1A 3JWEA 3NU1A 4ZVSA 3FPSA 1C8VB 2BFNA 4IL5A 4ZAVA 5HA5A 4UBIA 721PA 5K8CA 2N46A 1EFPA 3L7DA 3DS8A 4KL8S 4KYIB 4LXHA 3TIXB 1BH2A 1QHHB 4P86A 4CL2A 6YASA 3SMVA 3LO8A 1UDAA 1CUUA 1II9A 1PT7A 3BCRA 3HV2A 2AEJA 4MV9A 1XTUA 1Y5IA 3LRTA 4XEHA 2CB9A 1YKFA 1NOIA 1V3VA 2ZDGA 1GG8A 2K2WA 1V16A 2Z6QA 1HLFA 4FCTA 2H2FA 1KAHA 1CQJA 2UYYA 2JI7A 5SY4A 4CEJA 1AH2A 2GDJA 1N9KA 3M7IA 4C0JA 1Y9AA 4CDRA 4BKUA 1QWOA 1GEEA 1ZA2A 1Z0SA 5JRZA 1UXIA 3AWIA 2MINA 1D1QA 1WPXA 4B3JA 3E3NA 1SG0A 5E7MA 2ZYGA 2M6RA 3BXGA 1Z2AA 1KMHB 2WIFA 3L7BA 1I5RA 4INOA 5B1SA 1E92A 2O0KA 4QDKA 3O4HA 3E53A 3KC2A 1DWUA 4AFNA 2BM0A 4EL0A 1FRNA 1E32A 1CUSA 4WZAA 1V1RA 2C2GA 2JFUA 2HMVA 4DPKA 5AK5A 3C39A 4W1PA 1Y3AA 2YWJA 5EJ5A 4C7OB 5FLXA 4I36A 3DHVA 2NTEA 3CLRD 2PX8A 2JGEA 2OUIA 2XCLA 3ITEA 3MCZA 5BR1A 4HVAA 4REMA 2AW5A 3EH2A 4XCQA 2UZ1A 3MERA 4D79A 5IABA 4GZ6A 2FPIB 2I2AA 2IHYA 4JR1A 4NFYA 5G02A 3U62A 5BSHA 4X91A 3UQZA 4IGIA 4M60A 1JQ3A 2FRXA 4P53A 1RJGA 3KT8A 4JYBA 2C2KA 3DLTA 3GO4A 1B8OA 3IV6A 3HXOA 2OD7A 3UXEA 5C80A 4BU1A 1OZ0A 4B3TB 1SUPA 3Q7QA 4LZAA 1CQXA 1Y98A 3AUKA 3PK0A 3T4EA 1Z0JA 3ROGA 1J2YA 2ETXA 3QRWA 5IG2A 3NM6B 1NIJA 5IJXA 3QVOA 4I1PA 2MTBA 1OVGA 1J99A 1ZK0A 3L04A 2O59A 3GBVA 3PNBA 2ZSKA 4PS0A 3T1VA 3IQHX 3JQAB 3RC7A 3TFQA 3ORSA 1ZL0A 3O8BA 4GBMA 1QKIA 5C34B 3K70D 1V2HE 1PW7A 5P8WA 2YBEA 5KKCA 1U0JA 4XKJA 1GPMA 5L3QB 2FG5A 1STOA 1J2RA 3IE2A 5AUOB 3L7CA 2GPWA 1NLUA 4DYVA 3AGPA 2P27A 2H5IA 5KPJA 4CFZA 2BR5A 3GRPA 2G09A 2BTQA 3LWDA 4PYLA 3RRYA 2ZRFA 9GPBA 5SY6A 2Q50A 2A8YA 3GRAA 3HWRA 1TQHA 2HYDA 3Q3CA 5HQJA 5J40A 2OOKA 4BP3A 4DREA 1KYYA 1MMFB 1XKTA 3NASA 4O1MA 1XNQB 1PFYA 4JI5B 3E03A 3RG2A 4EF6A 2GHIA 4CRWB 1H1DA 4Q4JA 1ZDMA 4YPVA 1NG9A 1QO0A 3WNVA 1T0HB 3AL3A 4MINA 3HZZA 4OBBA 2HTFA 3WYAA 4CM8A 4TVSA 2I91A 3EEQA 4HNRA 4R83A 3BGDA 1KOJA 4FYMA 4V0ME 2DU8A 5LZ9A 2H5LA 2AR9A 5FI5A 3GLIB 5BN4B 5EIFA 1F1BA 1KSFX 1RI2A 2VXYA 3FMOB 5HF5A 1JJAA 1Y3CE 3I23A 4NESA 4W82A 1F4PA 1OX4A 3CLRC 3UB4A 3HYRA 4MKZA 3BE6A 3C1UA 3QM1A 1KJ9A 4MSUA 1MAUA 1I5EA 5A4KA 1XPOA 1AQJA 1NXQA 1L4LA 1SBIA 5DF1A 1Z4QA 1JJFA 5JEDA 4GNRA 4RCYA 1HX7A 1EMDA 3IALA 4ZQHA 1NVVQ 3GUCA 3QSGA 1PK7A 4LC1A 4Q16A 2HU8A 1XRSB 5CCDA 4A8JB 3UAYA 2H7XA 1ZBQA 5HF9A 4LVUA 4MS3B 3KSBC 3DLHA 5EA2A 2H2AA 2QN2A 2BPOA 2HU5A 1TVKB 4WLVA 3WGYA 3FGNA 2WB2A 1ISPA 4XQGA 4D4HA 4JKIA 5EHXA 2OESA 3KEGA 1EFKA 4KX3A 2FPSA 2Q21A 1XVIA 4DDKA 5KTSA 5C46F 4RPCA 3PDWA 4WK0B 3EY9A 1F51E 3GP3A 2O1SA 5B3AA 5F1OA 4XWWA 4Z4GA 4LY6A 4OUDB 4YEDA 3UXYA 4N8DA 3CIOA 2FSIA 4CV3A 3K70C 1EP2B 3UJHA 1R9JA 3PV0A 5AM0A 2PGIA 3HFGA 4LYGA 3TQIA 4BWVA 1U28A 1P60A 1XHFA 5JMPA 2IXTA 3JD2A 2P6RA 2HTEA 5BOSA 2PNFA 5JJ5A 3TQTA 3VO2A 1J25A 1TO2E 2FSUA 2IEYA 3WP0A 1JGTA 4FINA 3ZE9A 5B6IA 1FU8A 4KQ1A 1MB2A 3EBLA 4D46A 1NW7A 1JH9A 2KWIA 2CKDA 2GEUA 2JA2A 2ODNA 3PFHA 3D8HA 4KQKA 5ERXA 5JG7A 5KAPA 4NOKA 3K2EA 2E18A 1N1GA 3C6KA 5C1BA 1BOFA 3N75A 2GSDA 1XDSA 2YNMD 1N32B 1KU0A 1UIRA 3A4VA 3UHPA 3ICQB 2GBPA 1NJ5A 3JALB 4KACA 4UTOA 3BSFA 4RZ3A 4ZOCA 1GGVA 4R1SA 3C5VA 4Y6RA 5DW0A 1NQOA 2BDEA 1Z4MA 3I73A 4JDUA 3KQWA 2GZSA 1C0EA 1HPLA 1UMCB 3K0HA 4ER5A 1EWVA 1AZLA 5H9VA 1XF9A 2QBYB 2Q3CA 4B7ZA 5AXAA 1FJXA 4A1OA 2C1EA 4IJQA 1M67A 1YRLA 2J5BA 3LQYA 4BVEA 1M72A 4NFSA 1CVLA 1I4WA 2GFHA 4ZYZA 4F46A 3KQHA 2O05A 2QG6A 1LUAA 2WU1A 3ER6A 5CDUA 3G0CA 4BIIA 5FXMA 5IW8A 4C2BA 1MCZA 4KGDA 3ZE2B 3AM1A 3W2EA 3HCCA 1JIKA 2W2NA 3EOZA 4Z4FA 2IOQA 1JEDA 4KWHA 3HY3A 3BK2A 3P0FA 2Y4NA 3SX2A 2A9QA 1KOLA 5GQSA 1W2GA 2H18A 2ZETA 3PC3A 1FNBA 4INAA 1M6NA 3SIXA 3V33A 3EBOA 2X9VA 3RSOA 4TTJA 3S4YA 3W9UA 1YZFA 3E5MA 3SI7A 4BFZA 4ND2A 4PLCA 2C0QA 2SBTA 1CKEA 1XTJA 3CA8A 4S3MA 2C84A 2QR2A 3F49S 3W8DA 3GFBA 3G82C 5LFAA 1E98A 2QEQA 3T1TA 3LBYA 1TEHA 3F4LA 1U1FA 4IZIA 3M1IA 1D5CA 2VYCA 1K92A 1WRBA 3GOQA 3D2CA 1THZA 3P71T 1TTTA 2OORC 1Y81A 5FBKA 5B6PA 3DO6A 1O8BA 4UD2A 4KODA 3OLVA 3RT1A 5ALXA 3ONDA 4YJ2F 3G2LA 1IQPA 2G5CA 4X61A 6CHYA 5LUAA 3SSNA 3TNYA 4CL3A 3CVVA 1QFJA 4N0MA 4O1HA 1YOVA 4UDNA 4C7MA 2QSYA 2CHGA 4DAEA 3EZ2A 3HDQA 1E63A 2W43A 1CJCA 3HWWA 4KE6A 1RYMA 3CUWA 1QIHA 2HCTA 1RRPA 4WOJA 1EGHA 2A58A 3PNMA 2HF9A 1P1RA 4FGKA 4X20A 3DW1X 3L1VA 4FC6A 1SY7A 4F4JA 2DBQA 4RHUA 1KBOA 3NQ41 3Q1LA 3L1KA 2TYSB 3W5DA 1ECCA 4F7WA 5HCIA 2NT4A 5AW6A 3KZCA 1HT1E 2YNMC 1W5FA 4QVGA 1PJ2A 1RD4A 2O7RA 3GAFA 2RHHA 2PAAA 3GT7A 3QVLA 4KVAA 1CY0A 2HLPA 5L7YA 4HATA 3AEQB 4BN4A 3PIIA 3NX4A 2XXAA 4EG5A 2CYAA 2H4HA 5IZCA 2Q9BA 4CBVA 5C4MA 1CS4C 2E1PA 3I2JA 4ARIA 5J5VA 4I4NA 1RE1A 2C98A 3BQMB 1HTTA 1CNMA 3OOYA 1P0PA 4QWMA 3N2EA 3E0QA 4Z1MA 3ISJA 4U2BA 4YRDA 2DT8A 3PQ4A 4OHZA 3OESA 3SVZA 1N6KA 2AK2A 3DOOA 2HA0A 5AMXA 3WGZA 4BVAA 2P9HA 4GX0A 3M0EA 4HBZA 4N3BA 4BO2A 4DPMA 1UFVA 1V8DA 1T6ZA 4QDOA 1LLQA 1OFHA 3HHEA 1VM6A 3OEED 2XOKD 3N8DA 4WNIA 5I8ZA 3UGTA 4DM3A 4M9QA 1O1YA 1T25A 1X70A 1PQUA 1DE0A 3CMCO 4WXMA 1QIDA 3H04A 1H22A 3D6MA 1EHIA 1NX9A 1TMOA 4X1YB 4ARBA 1QAOA 4TYPA 3HMKA 2FX2A 1PWYE 3LXMA 4Z2AA 2VP4A 4PQYA 2Y6UA 3THSA 1LW6E 3G0HA 2BN4A 3FDZA 4CNQA 2Q5EA 1CUXA 3K53A 1N1EA 1M34E 5B3JC 4DB4A 4BRZA 1TAGA 1MRNA 1U1CA 1S2OA 1XQ1A 2DSTA 3S0JA 4TTTS 4TKLA 5JS6A 1AKYA 4ZCSA 1HQCA 1N2ZA 1XYGA 4RTLA 2IPNA 4KMMA 4FMDF 3NBXX 5EJGA 3U3JA 4BNGA 3ETEA 3BICA 4BO6A 1J23A 1EE2A 5BV0A 2CD7A 3CMMA 3RUCA 1XMJA 2Q4OA 4NZMA 2R1VB 3V6LA 1PNRA 3MS4A 3AYXB 3MQ2A 4X92A 1JXAA 3AF5A 4N0DA 3DKVA 4YRMA 4Z9AA 4A6PA 2ATEA 4HAVA 3SJBA 4DKJA 4P81A 1IRIA 3BMXA 5DXJA 4C89A 4EJSB 4EL5A 5L95A 2KQUA 4LDAA 1FVHA 1TJPB 3AH8A 3RJZA 4MV8A 3JX9A 2Q3JA 3HQ4O 4RV4A 4XE5A 2P5TB 3D5QA 3K9QO 5TQVA 4NHOA 1H0KA 1QG0A 5EXEA 5EXDA 4KU4A 4EQ6A 1M5UA 5F33A 2QMHA 4F2PA 1G2IA 3PLRA 1K4MA 1C9DB 4KZPA 2DHEA 2J3DA 1R4NB 4A91A 4OI1A 4YAIA 3OBIA 3CE9A 2Q3MA 5ALLA 4B4OA 2APJA 3CSUA 1NP3A 3WKBA 1MABA 1X8KA 2I55A 3GJZA 2J67A 3MB5A 2Z2IA 3LTNC 1SQ6A 4IOLA 1Z3CA 1HTBA 3M5DA 4MPJA 1LWNA 5B7GA 1BO6A 3VOSA 4BVBA 3DT9A 2ZSAA 2Z0MA 5IK2D 4V3BA 2AI3A 5ADUS 4G41A 3OZWA 4H4EA 3OE4A 3PE6A 1T4BA 2HQOA 3QUCA 2JCBA 3W6NA 1EAYA 1U3VA 1X2EA 2HK6A 5CUQA 3SMQA 1YS2X 2YICA 1SUEA 4ALKA 3IVXA 4MRRA 1SPXA 2O5RA 3WXBA 1SOWA 2R1ZA 4NRDA 1HQYE 4YRFA 1VBKA 1ZJZA 2J0UB 2SNIE 2DPHA 3L0CA 4ZT5A 1VPDA 5L3SB 1JLSA 3B52X 3EZYA 4KOAA 3A36A 2XWPA 4XPIA 9ATCA 3M6AA 4JN6B 4ZOLA 3S2UA 1OXKB 3KNZA 1BDIA 1GU7A 2X3FA 4DBLC 3HXQA 1I01A 3BWMA 1KKMA 2ZUSA 2IVFA 4U7HA 1MR3F 5EE3A 3K8ZA 3BPSA 4JDPA 1UJNA 2P4EA 2JIOA 1A8QA 1D03A 1K3FA 1VPWA 5T4BA 3UTDA 1PR3A 4NK4A 1JNXX 1WS6A 1RKUA 3GXOA 4BMXA 2GJ4A 4RY9A 2HHJA 5ALTA 2BHLA 1GTMA 1RIIA 3W6ZA 3DZGA 1L7OA 3KJHA 1FVXA 4J91A 1ZUNA 2PDAA 2P75A 3NM5A 4MUKA 3V55A 4BVKA 3K71B 4JL8A 2YYSA 1DI0A 3ID6C 2R0QC 3GVHA 4IVPA 4LTDA 4QYWA 2V1UA 4RC9A 4A8PA 4MA4A 2NUTB 1F6BA 1KJNA 1NI3A 1CP3A 2ESRA 3RO7A 2C9OA 4HI0E 1M1NA 5D3KA 5BPHA 4MQEA 2YOGA 3RKSA 5JSQA 2VATA 2XADA 5IT0A 1PKEA 4N5NA 1JIIA 1GNSA 4FX2A 3O4IA 4X6UA 2LCFA 3SSAA 5KWVA 2QQ5A 3ZZ0A 4I50B 5K03A 4YRGA 2AMYA 3JYHA 4HWGA 2JD1A 4KAAA 3BZWA 4P83A 3VU3A 3MS2A 3AY3A 4NF2A 4BPBA 5A5FA 1FOEB 1U7HA 3MQFA 1VKHA 1UPTA 5EXPA 2NO0A 3VAYA 1EM8A 2W2KB 4FR5A 4FQ5A 3UJ9A 4L72A 4BE7B 4ZHSA 5JPCA 5JDCC 1I1OA 1SCBA 3KLPX 3E2MA 1AD2A 1GARA 1QHIA 2V7UA 4D3YA 4MS4B 2D3WA 3C4VA 1QYRA 2Y1LA 2RGXA 4OOEA 1QM5A 1GQFA 2NZJA 3L9WA 4B1FA 2QW0X 1WD7A 2V6JA 3C24A 2VNIA 3FVQA 2FW8A 3OZUA 3QVJA 1BQEA 3ZY4A 4NFHA 3CFYA 1DIGA 3VU0A 2QT9A 2POQX 3KLNA 3MJEA 1VCNA 3CH4B 3W8RA 4AS1A 1V25A 2C29D 4ZEWA 1Y8RB 1L4EA 2EL7A 4PF1A 5EPEA 3SICE 5TV2A 2QN8A 3H6HA 4HDRB 1QH8B 3GH1A 1KYWA 3NS7A 3PHGA 3ELUA 3WLSA 3JSAA 4BNUA 4F6CA 4H16A 3CZCA 1RQLA 1Y5MA 3HJUA 4L5YA 4YREA 3MUFA 4UQOA 5K8JB 3RYCB 3P9KA 5IKXA 3DG9A 4CETA 1XELA 4GLFA 2JI6A 4WZBB 1N2IA 3U26A 4M6WA 3NBZC 3NDRA 4YP7A 1KTVA 5GV7A 4EEZA 5DHAA 4KSYA 2R65A 1P4SA 4LNUB 5I9IA 1EJBA 3INGA 4Q02A 3OM8A 3PUHA 2VLIA 4LV5B 4N3CA 2BEUB 2GHRA 2AH5A 4JT9A 2ACWA 2VDVE 4WBXC 4KQHA 4UJ3A 3K31A 4GQAA 4EEXA 3SKYA 4Q01A 3H3JA 1QO0D 2FSSA 1W88B 4U9UA 3IOCA 1UWKA 2RCNA 2PY6A 3A1VA 3FXAA 4MGYR 3MB8A 4XCVA 5DHUA 2C03A 4DLXA 2D8AA 3AHHA 5LC1A 4NS1A 3Q98A 4K3VA 1AK9A 1ZA1A 1RWMA 1D2HA 1EFTA 3CRQA 3DV0A 3DUFB 1MIOB 3DBLB 2R8BA 1M74A 4ZVPA 4Y2UA 3EJWA 1KAEA 3JPWA 3A14A 4X90A 1CZRA 1DBVO 1R3DA 2VEDA 2FU5C 3OETA 4ZVLA 3VR6A 5ELXA 3RTAA 5HMMA 1V6CA 2RHRA 5IFLA 1AS0A 3EQ2A 4QDTA 1OAOA 5KOIA 2I2CA 2P62A 4UBLA 3H5RA 3E81A 1YZTA 1V96A 1P4RA 2R8XA 2HT6A 3PC4A 3A3YA 4GWGA 4IVQA 4L74A 1UBNA 4F5WA 1NPDA 1D07A 1MT3A 3T7EA 5ENVA 3OZRA 4FDUA 3MJVA 4NPHA 2VK4A 5FNVB 4EO4A 4XUDA 2J8ZA 3EK2A 4GDFA 4HTFA 1ZY2A 3C3KA 4LPSA 1DC5A 3SS7X 4MPRA 3G0DA 4RLSA 2VF7A 4B83A 4QD3A 5J2TA 3IQDB 1GITA 1ZXBA 3OU7A 2B1JA 5FTMA 5FQNA 4AKSA 4IYJA 5E9JA 2BRUA 1TJ5A 3EXEB 3ZJ5A 1CD5A 4BN5A 1MA0A 3K6RA 2C1ZA 1QE5A 2Z8YA 4DKXA 4I55F 3L1IA 1Y9ZA 2GRUA 5GY7A 3L8MA 4RE6A 1WKBA 4H4DA 3U3MA 1DU4A 2R6JA 4XVUA 2I76A 2R751 3P9PA 3ND7A 2L42A 4OAOA 2V9ZA 3N28A 4K2AA 3OTHA 3VI3B 4MW1A 2GCNA 3A2NA 1VHQA 2IPXA 1XZHA 5FOTA 1GTG1 2RK4A 4WASA 1ZNXA 1Y6FA 2HL6A 1I8TA 1T5BA 2WPNA 2X4GA 4IMIB 3TINA 1TPYA 1TZMA 2QA5A 3OZ7A 4L57A 1WZIA 2PRZA 2VL7A 3AO0B 4P4GA 3T3PB 2EDAA 1E3WA 1GYPA 3OKCA 4EFDA 5B7QA 2MSNA 4NMWA 5JPIA 4PG7A 3UJ6A 4PNHA 4C06A 5JNRA 1V3TA 1X1EA 3GLVA 4PCUA 4PFKA 5FBRB 5TRTA 1O96B 3E2PA 1EQUA 2DBZA 4KWIA 5AKZA 3TDNA 5LA6B 1DS6A 2A67A 2O8CB 1H2HA 3D4BA 1F2VA 2FN3A 3HUTA 2VZ9A 4XX0B 4XSVA 5CVDA 1SHUX 1XQXA 2A0KA 4Q00A 1NP7A 3PP8A 4ZJUA 5TSDA 4LDJA 4PNPA 1T24A 5T4FA 4LF4B 3SXPA 2OAP1 4QHTA 4CQMA 4RTQA 2PUBA 4B3HA 5HG0A 1SUSA 1DRUA 2YVKA 3GZNB 3SVLA 1R8XA 4PC2A 1JKJA 4TS9A 4BTEA 2W2LD 3MLBA 4GGOA 4DJAA 4B3MB 4Q82A 1MAHA 3RC9A 5G4KA 4OQMA 2DXIA 3ZJTA 3N6RA 1NNI1 3R5TA 4QULA 4KHPB 2DJIA 1IK6A 3GRKA 3K73O 1K89A 1V48A 4G4SP 7REQA 3WDLA 4YT8A 3I9KA 3NHRA 4ZDKA 4TV9F 1G4AE 4QJBA 4DNXA 3KR2A 1GGFA 2IX3A 1D8AA 2PLAA 1CY4A 3BERA 3IJEB 3QNWA 5IVDA 4YT4A 5BSEA 1XK6A 3RABA 2P67A 2ANCA 2XZTA 3BS4A 5ARCA 1J8YF 3UNXA 4YP0A 2YX1A 3NWJA 4CKWB 1B0UA 1QP8A 4B0OA 4I2VA 2ZU0C 4B6PA 4O29A 1C30A 2P6OA 1KZ4A 2CDAA 1RYFA 1THTA 2W2PA 1E0AA 3O95A 3G68A 3WIUA 3G0IA 1I1HA 4IY1A 1H42A 3ANYB 3PI6A 3TDMA 1CS0A 3NDPA 1N7JA 3K1YA 4JP1A 2JFQA 3OZTA 4RHTA 4IZ6A 2CVOA 4BLWA 1VA4A 5EHQA 5EMLA 4EY4A 3CNOA 1ZJ6A 3RG8A 1FJHA 1ISJA 3U9LA 1H93A 3ZWKA 4NYMR 2GASA 4ZJPA 1UBMS 4AP5A 5BSGA 2PGXA 2Z04A 1HK7A 4RVDA 3NOQA 3WJ1A 1FXUA 1H5UA 4HF7A 4QJ3A 3ZIAD 4B8WA 1JNYA 2TMKA 4NDAA 3RUHA 1GCUA 2ZJ2A 1SKYB 4EKGA 3DPUA 3QPBA 3DZBA 3TTYA 3WBFA 4AS3A 2D1FA 2OBBA 2D06A 2IS4A 4PLWA 1QQ5A 2DWOA 1UPFA 2P2GA 2WZQA 3HUFA 3OM9A 4G25A 4GECA 4JJ7A 4JLWA 5CBPA 3U16A 1I30A 1RHJA 3TECE 1ULZA 2C58A 3RROA 1X77A 3RYIA 3W7AA 4H1WA 4P9NA 1J90A 4Y7DA 1X80B 1TRHA 1VECA 1ZOPA 2VDWB 1GR1A 3THXA 2IH2A 3FMIA 3WLLA 4U2FA 3WLQA 4DMHA 4KB5A 3N70A 1U4SA 3BILA 2IBMA 3W04A 4AJOA 4Z1MD 1E79A 3TH5A 3UXMA 2IIPA 3AF6A 1TQ4A 1ETHA 2QD5A 1OX5A 2VHYA 1Q19A 2CNKA 4N9WA 1P0FA 1U6KA 1YZKA 1HFKA 2H31A 2HSEA 2NUPB 5BURA 1G6HA 4ARVA 5GZ3A 2DVMA 4TTIA 4YNBA 3VNSA 3W8FA 3ZKWB 1P9NA 3F9RA 3QY9A 4XWTA 1B16A 5H81A 1DC4A 2ZQYA 3BN3A 3K2IA 1ULAA 4PHCA 4L3VA 1PZFA 5AOCA 1ESMA 4C7JA 4P0PB 2AFIA 4J1NA 3BWVA 2O0JA 3NHAA 3Q5GA 5JJIA 1G20A 5JVDF 3K35A 4AF7A 2M6SA 4IILA 1P80A 2C7VA 1HQKA 4X7PA 4P0QB 4RVCA 5B4VA 1VHLA 5E8RA 4MW9A 4LQ4A 4AQDA 3L6DA 5DHFA 1ZHOA 4BMOB 3L46A 3HCEA 1EG2A 5JH7A 2R6CA 2W0SA 3O38A 4BHTA 2JJ2A 5A3QA 2ORWA 3LRXA 3GUZA 2FPKA 2DWPA 4XJVA 2CLHB 2HDOA 1O6BA 5GJCA 2O3QA 2XPCA 4BGIA 4V0QA 5BXYA 3ONVA 3A2KA 3IT2A 1S9DA 2I6QA 4X1OA 1PDOA 1L8QA 2W93A 1XZJA 4WBNA 1DXYA 3AR7A 4FOPA 2X8JB 1VLVA 3KLMX 4WK4B 5C8YA 3SQOA 2VZLA 2FZVA 5HK8A 5J4LA 3OQMA 3DOJA 4PXSA 3FPEA 4R8LA 4G67A 1SKQA 5HCUA 3U44B 2O5EA 1TC1A 4ROSA 3MHTA 2ZVQX 4IUDS 2ZRBA 4Y6OA 4OQQA 3PGXA 1U8AA 3JQDA 1HF3A 3EWAA 1B4DA 4G4SO 1DOAA 1FP2A 2VK2A 4DGQA 4K1XA 3UT5B 1E5XA 4JU9A 4CM7A 4KWEA 5CRIA 3L1HA 3D3WA 3WGJA 2QG9A 1N8NA 3DHNA 3OLYA 1Z45A 3D9QX 2FRVA 2CFTA 5ITWA 1GZUA 1NBHA 3MTEA 2W6CX 2BZ1A 2VNJA 2C5BA 2NU8B 1X38A 2QAGB 2C9BA 2RGNA 1JLLB 4L0MA 4MI9A 3TMKA 2FGKA 1UDRA 4PGHA 1VJ1A 3NFYA 5AI5A 4X3CA 2W6IA 1TKRA 3M3DA 2Z1NA 3I72A 3WIOA 4BBJA 3R3JA 4RZQA 1H2FA 2QTRA 2ZRDA 4NKRA 1T4GA 3MK31 1JIUA 4JLVA 3AUSA 3MRSA 4YALA 4E33A 3NEYA 1ZIOA 2R48A 3AETB 5GINE 3TX2A 1N5IA 3K94A 1F0KA 3ELDA 3SNKA 1AKNA 4X6YA 3TD6A 1U2DA 1U94A 2VUIB 2ZYIA 3REQB 4B4KA 1QPGA 3JVIA 2E5FA 2L0XA 1ZD1A 3O9VA 4M1QA 2HI0A 3FUWA 3GLRA 4B32A 4KQXA 1OHHA 5KU7A 4XM1A 5CGZA 3ZN2A 1ZN8A 1AKEA 3AFIA 1B6GA 3HA5A 4PCAA 5DWVA 3TQQA 5IUNC 1UP4A 4NCAA 1VLLA 4J0IA 4U5QA 5KNDA 1IY2A 5IAOA 1YQEA 5LXTA 1RQPA 2XOXA 1A9YA 1SO8A 1GGEA 2XLBA 5KYKA 3H9BA 3SF8B 1TU0A 3ZDQA 4EI9A 4OX9B 1XXHB 3G02A 1WY7A 1P2FA 4MV7A 3ZWXA 3TBKA 3TXXA 4OFZA 5JFOA 5JD5A 1FYFA 4O4HB 2GLXA 3GY0A 4XQ0A 2GEKA 1I13A 3TI7A 3ESXA 5FPQA 1PJ3A 1SVMA 4OXIA 3AIKA 4P08A 3LLSA 3FH0A 4Z9YA 3IOEA 3BWXA 1MT0A 3TLXA 2IEBA 2BZ0A 8AT1A 2JCGA 3M1AA 5EINA 3V4SA 6REQA 1XZCA 3QZUA 2ZZNA 3PGA1 2PD6A 2GZMA 5H82A 1REQB 1U1DA 3ORHA 5DM0A 1KQPA 5K2OA 2Q27A 4WJZA 5KVSA 3RJ9A 4D6PA 3HP7A 5IDWA 3PD1A 2C2HA 3V1YA 4BLSA 1JI0A 1G3QA 5A6SB 1DWPA 3FWNA 1QVRA 1NSYA 1PEKE 1NUPA 2CLKB 1Z4KA 1T2EA 3O91A 3FPFA 4J90A 4NBUA 3MJRA 4B8ZA 3OZBA 4E94A 4ECAA 2O20A 2JHCA 2F48A 1NWCA 4DSNA 3PFGA 3EC1A 3EB9A 1A9OA 4RLQA 4W6ZA 4E31A 3A04A 1GG5A 4GSLA 2EIHA 3QFCA 2GESA 1NWHA 4C0KA 1ZKDA 3A9WA 3VPGA 4CLDA 2I33A 4LOAA 2Q1YA 1UKCA 2GTHA 1NR5A 1EDDA 2YV4A 1ZH0A 1GGKA 3DOFA 4GR5A 3QSYA 2Z5LA 3EMBA 4PC1A 4AN0A 3ILVA 1PFQA 2Q4TA 2XTMA 3PXEA 1WUJS 3X44A 1KI3A 1U3TA 4HS4A 4HN2A 5CU7A 5KQSA 5DSTA 2WF6A 3UENA 1C0IA 2CHEA 4POOA 1KMNA 2QRJA 1ZSYA 2AFRA 2O2CA 2ZRHA 2ZULA 4TV8A 2JHGA 1UDCA 4ZPXA 1QNLA 3CLHA 3T9BA 1GNRA 3JVVA 3OUTA 4U00A 4UU7A 5F73A 3VOBA 1Y9DA 4XASA 5C2JB 5KWIA 3NHKA 4GD3Q 3SR3A 3EYWA 4DV6B 4YPOA 4P1ZA 3VHXA 4UBKA 4J49A 2HXYA 2AWOA 5BN5A 5JO0A 3QE9Y 1Y7TA 2RKBA 4HRYA 3NDJA 2FJ0A 2C54A 2I3ZA 5E3IA 3UC9A 1RXEA 3ZU5A 3KYBA 5K3SA 3T5DA 3NJ4A 2YN0A 2N47A 4PLTA 1NDUA 5C1OA 2B0CA 5EJ9A 1YVUA 2XDAA 2XHEA 4R8MA 3MHPA 4Y0NA 1SXJB 4OQLA 3B6JA 2XMZA 1P72A 1T3ZA 1KI4A 3IR6A 1NX6A 2GHQA 4Q1DA 3WJ7A 3U81A 4DA6A 5AUNB 4YCJA 1EXVA 4B5KA 4UNQA 4L76A 1TT7A 5FOQA 3I8OA 3UF0A 2H7YA 1GCOA 1ISGA 2MU1A 2RKWA 4L9WA 4QOIA 4DC0A 3ZLTA 5ES4B 5K01A 5KQMA 2UUAB 3IIMA 1CDDA 3EPRA 1NN0A 1X1DA 3Q11A 3P8ZA 4O08A 2GWHA 4ZAZA 1HTWA 3GW8A 1LXCA 5TGZA 1O08A 3VDXA 1W9MA 1M0EA 3EMKA 1HSZA 1T4CA 2HJWA 4M2LA 1XFDA 3I76A 4QATA 1Z8NA 3FYUC 3U3ZA 3KTOA 4A1FA 4WXHA 3VR6D 1WBDA 3FCXA 4GE3A 1P4GA 2WKSA 2J30A 3P9YA 4ERNA 3N05A 4P2BA 3UG7A 3PGVA 3GJ0A 3U4GA 4DBLE 2GTIA 3KD2A 1BMDA 4M9XA 1LJ8A 2A30A 3U1TA 4OF4A 4DLTA 2ZM5A 1JR4A 2P2NA 3G2IA 2EBWA 4PZZA 4QEDA 4BECA 4E13A 2B4TO 1C4XA 2UUPA 2X8WA 4UOZA 1JSRA 5FJJA 3CS3A 3KG2A 3N8IA 1J0DA 1D09A 4KLNA 4UFOA 4CLRB 2ODBA 5TR9A 2WKRA 4YASA 1VL2A 4YCLA 2F8SA 2BJHA 2DH5A 1IEWA 1Q0UA 2P8SA 2WU4A 2EQAA 2O5VA 3HLYA 3LY8A 3P9IA 3R3YA 5DTEA 4BB6A 3TFOA 2VJQA 2PANA 4HNQA 4J1QA 4UC0A 5MN6A 2AL7A 4ZQFA 4KQ2A 1JG3A 1YHZA 5D85A 4UQPA 3KAKA 4HBGA 1U2SA 3V34A 5FB3A 2ZBFA 5ICCA 1E2FA 1VFNA 3JQBA 4P84A 3B6MA 3VMFA 4XYBA 2BE9A 4FHCA 5K99A 4OHOA 2V7QA 1VMIA 3VX4A 4FMPA 2H1CA 3K9HA 1T35A 2Q6VA 4HQ0A 2W48A 1X7GA 2XE8A 3I6MA 5DVZA 3F98A 2HDWA 2SKEA 3JWJA 5KSPA 2GAFA 4M9SA 2C2MA 4MWGA 5EUMA 3ZY6A 1HFWA 1FFBA 2VA9A 5C37A 1NRIA 1N0WA 1U2QA 2VAMA 2C4NA 5DLQC 1I7PA 4NU6A 3FPGA 2DPXA 3K2QA 1RW4A 3MRXA 5HF8A 1CNFA 1T3SA 4GMHA 1OZHA 5LYJA 2PRSA 1V11A 5BWCA 5DYTA 4RK7A 1QBKC 1R6DA 3R74A 4BMCA 1X9IA 4EH1A 2YN2A 3HNRA 2EJBA 4RA9A 1E18A 1R50A 3ELWA 3JWHA 3P45A 5BN3A 1JU9A 3GCXA 3OBBA 3DBRB 1CYDA 1TK3A 3DLIA 5JCXA 1NXXA 3NKFA 1ND6A 2BFWA 3EEOA 4CQMD 1B15A 1KMMA 4PX2A 3KQVA 2QYOA 3R5HA 2ZYTX 3QXXA 1BOOA 3F47A 4G0QA 1P81A 4NR0A 5IRCD 4IKPA 5AUQA 1NBEA 4EABA 1E5DA 1QR6A 5TT1A 1QRAA 3OKPA 2LP4Y 4B7CA 1UMDB 3R8XA 1OAOC 2QXTA 2XZDA 1HM5A 1JKMA 1DIHA 3DVLA 4E5VA 3V4LA 2ICAA 5I9LA 2ZJ8A 4QAJA 1LDNA 3NYQA 1YK1A 4UBMA 4DQ0A 3BF8A 3OVMA 10MHA 3S2SA 2JLXA 3LYLA 4R6XA 1DKMA 3R75A 1V8BA 3GLHA 2R7NA 4R9SA 4MJ7A 3OY2A 4N40A 4OH1A 3ICVA 4EITA 1EM6A 1WV1A 1NURA 1K2WA 2MSEB 2VRBA 4PRZA 5BNIA 3DYBA 3UY4A 5JBQA 3R6WA 4MWZA 3D3EA 1E3SA 1ND5A 3WMXA 2BFPA 3GEMA 3LA8A 1M0WA 1PYGA 2FPMA 4E15A 4DDMA 3OOHA 5JPDA 4WZAE 1M2NA 4G0MA 2YYZA 2ZYRA 4C3UA 3AUJB 4Z0HO 5HIIA 1NJFA 1U7OA 3TK1A 1ZMTA 4LRXA 5FUWA 1E2LA 1S2LA 5LZ2A 3BGSA 1CUWA 1DX4A 4RTOA 1S1MA 5BNTA 2BOVA 4DDUA 3D81A 1EJ2A 4D3FA 4IMJB 1SFRA 2DP4E 3R9XB 3AZOA 1U0EA 3PFWO 5BT9A 5BR8B 3M6UA 2IHJA 4YLYA 1Y3IA 2CCGA 1GU1A 1SC3A 1IJBA 1MQSA 4M0EA 2BSXA 2XUZA 1T6NA 1YU6A 2WAYA 2PLRA 2B5WA 3P9NA 3TOVA 3IDSA 1TZCA 1Y4AE 1TYCA 1Y9EA 5E6RB 3ZQKA 4AZVA 4ARCA 1HE8B 4H7PA 5K0SA 3QIAA 4MRVA 3IUBA 5SZJA 4L8WB 4C76A 2ONKA 2HY7A 4YP6A 2P4UA 2YXDA 2SECE 2PJDA 3P9RA 1IH8A 4LECA 1T2DA 2NUAA 4D3DA 3DE0X 4BQRA 5K3EA 2Q28A 4JP8A 1NVDA 1EK6A 3HKCA 4D9FA 4F6RA 1JFRA 1E79D 1DJOA 4GOOD 1LU9A 3AT1A 4A92A 3VNVA 1QS0A 1RC8A 2RE8A 1DUIA 2VTBB 2XVAA 3G17A 4N7BA 1Q0ZA 1XD8A 2B4KA 4J4TA 5B7NA 2IDKA 4J03A 1IXSB 2YH2A 3EF1A 3QFHA 1E4OA 2HK8A 1CY1A 1EWKA 4KIFA 4G0ZA 3EGOA 4G0XA 1XROA 3UMFA 4ENTA 4LE1A 4UHJA 3D0KA 3LLUA 3WGMA 4D4MA 2P3LA 2KBFA 5IHPA 3ZHTA 1PJBA 3NFRA 1KY5A 2Z4RA 4OLFA 5HXAA 4WW0A 5CVCA 4RAQA 5G1NA 5JSFA 1OROA 2DQZA 3PRKE 1V5IA 2RHOA 4X1KA 3ZOKA 1AS2A 1PT8A 5H3CA 1U4OA 3SE7A 5J3JA 1BH6A 4K6MA 3PEVA 3K5WA 1PHRA 4I5FA 4M1MA 2ZYSA 1KSGA 2B7CA 1EZZA 4E1AA 3JARA 1XJ0A 3B1JA 2ONYA 3A3PA 4QUJA 1VE1A 4R7TA 1W5BA 2GPYA 3LKVA 5HIMA 3F9IA 1RC0A 2CXSA 2W6PA 2C9CA 5ITZB 2NLOA 2HC9A 4MV0A 3ZNQA 4LJ4A 1ZN9A 3LUDA 2QLMA 3CW8X 1Q15A 4L4ZA 2XD9A 1A8PA 5DLDA 4LOKA 4IQGA 3BRSA 4U2DA 2J85A 1Z7BA 2A9KA 2EBUA 2FUCA 2ZT7A 3NT5A 1FP6A 1I3LA 2QM7A 3RW9A 4K46A 2YYAA 2C2WA 4JEUA 4O33A 3QEOA 5DOVA 3UUGA 2Q6LA 3HCOA 2CWWA 2W6QA 4CI9A 3GXBA 2JD0A 1MOZA 1RABA 3RSZA 2C2BA 1OZFA 1ZIPA 2R6HA 4PSUA 4U2EA 3D3NA 1U1GA 2UZAA 1GQRA 4FGWA 1BYIA 2F7SA