1RWNA

Crystal structure of human caspase-1 in complex with 3-{2-ethyl-6-[4-(quinoxalin-2-ylamino)-benzoylamino]-hexanoylamino}-4-oxo-butyric acid
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
173
structure length
173
Chain Sequence
TSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interleukin-1 beta convertase
publication title Structural analysis of caspase-1 inhibitors derived from Tethering.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 50
structure length 173
sequence length 173
ec nomenclature ec 3.4.22.36: Caspase-1.
pdb deposition date 2003-12-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1rwnA00
3D6MA 2C1EA 1BMQA 1RWVA 3V4LA 4ZVQA 2H5JA 1IBCA 4JR1A 1ICEA 2J32A 3H0EA 4HVAA 5IARA 2FUNB 3GJRA 1M72A 4NOLA 1SC4A 4QUHA 1QDUA 1SC3A 2CNOA 4D3YA 4EHAA 2H4YA 4NBNA 3R7NA 3H11A 5LUBA 1NMEA 3SIPA 5IC4A 3GJQA 2WDPA 3KJFA 2CNLA 4I1RA 4NBLA 4QU9A 1RE1A 5IBPA 2QL9A 3S70A 2CNNA 2QL5A 3H11B 3GJSA 2QL7A 1RHJA 2C2ZA 5IANA 2J33A 3D6HA 4QU8A 3DEJA 1KMCA 3DEKA 4DCJA 2XZTA 3QNWA 1F1JA 5IAGA 2CJXA 4PRZA 2H54A 5IC6A 1I4OA 1NMSA 5I9TA 1SC1A 4QUGA 4EHHA 2XYHA 3IBCA 4ZVTA 4AWAA 4N5DA 4EJFA 4I1PA 4N7JA 5IAEA 4NBKA 4DCOA 1RWNA 3H13A 4IEFB 4QUEA 3RJMA 4N6NA 3V55A 3NS7A 4FXOA 4QU5A 2QLJA 1PYOA 4QUBA 5IABA 1K86A 4HQ0A 3GJTA 1CP3A 4EHDA 5IASA 2C2KA 1SHLA 3V6LA 5K20A 4QU0A 3R7SA 3DEIA 4D3XA 3UOAB 4QUJA 3PD1A 1I3OA 5IAKA 4D3ZA 3KJQA 2AR9A 3V4OA 3PD0A 5IBCA 3P45A 5LUAA 3R6LA 4QUAA 1I51A 2XYGA 3H1PA 4ZVUA 4QUDA 4EHLA 4N7MA 1CVRA 5LU9A 1RHRA 4ZVSA 4JJ8A 2H48A 1RWOA 4JR0A 2FQQA 4ZVPA 1RWKA 4FGUA 3OD5A 2Y0BA 3R6GA 2H4WA 1GFWA 2C2MA 4ZVOA 1F9EA 1RWMA 1RHMA 4JQZA 5H0IA 1JXQA 2C2OA 3E4CA 4NOKA 3EDQA 1RWPA 2QLFA 4LSZA 4M9RA 2HBQA 3R5KA 4FDLA 5I9BA 1QTNA 5IAJA 1QX3A 1RWWA 1NW9B 2XYPA 4HQRA 4JQYA 1RHQA 4PRYA 3ITNA 4QULA 3KJNA 2H51A 2P2CA 2NN3C 4IYRA 2HBRA 5LU8A 3DEHA 3NR2A 3S8EA 2CJYA 2HBZA 4QTXA 4AW9A 2J30A 3R7BA 5JFTA 1K88A 3D6FA 2H5IA 3NKFA 3PCXA 4AWBA 4QUIA 2FP3A 4PS1A 4ZVRA 1NMQA 1PAUA 2HBYA 4JJEA 2Y1LA 2XZDA 3K7EA 4JJ7A 4N6OA 4NOJA 5IBRA 3V3KA 1RWXA 4EHKA 3SIRA 3R5JA 4FEAA 2H65A 1RHKA 1GQFA 1RHUA 2CNKA 4JB8A 4PS0A 2K7ZA 3UO8B 3EDRA 1I4EB 4JR2A 4EHNA 3BIJA 3IBFA 2CDRA 3P4UA 1SHJA 4DCPA 2DKOA 4NOMA 2QLBA 4QTYA 4N6GA 4EHFA 3V6MA 2J31A
chains in the Genus database with same CATH superfamily
2Q1XA 4EUEA 4FLMA 1NAIA 2QUKA 4YQFA 1P7YA 3UMVA 4RHCA 4AO8A 3UJCA 2P2SA 3QOWA 2PXAA 1E1YA 3VVBA 3NFYA 5LYJB 1T26A 4X93A 4ZQBA 3PC8C 4WFIA 2V7TA 2O0JA 3BM5A 3UMGA 1J70A 4WHMA 1PFKA 4JZYA 4ZQGA 3UPDA 5EIBD 1CZKA 2IHZA 3ADOA 2NU7A 1H2HA 4MH0R 3SXUA 4PSKA 3DFUA 1J07A 4MQFA 1V39A 1ZIPA 1OJLA 1Z22A 2PFKA 2RK4A 1DJNA 1J21A 4BLPA 2Q7DA 2XBMA 1N5RA 5EMKA 3ET5A 3A25A 3PYXA 5IKEA 4HNAB 5J4KA 2K7FA 4AU1A 3B48A 2NPOA 2H29A 2XXAA 4C88A 5LB4A 4EG6A 1JKFA 2UYGA 4KIFA 4KACA 3VI3B 4C3ZA 4YV0A 3ETHA 4TZTA 5I9TA 3H19A 2IK8A 5EWLB 3RC2A 3RO7A 5B2FA 1UP4A 4L4ZA 4H1VA 4CT4B 4B6JA 5BRJA 2X0EA 5ALFA 3UW3A 3G1TA 4DCCA 1A69A 1EFPB 3SD7A 2PSHA 2BTQB 3EGWA 4D8WA 1HDYA 1N1MA 3OMXA 2A0WA 1FFEA 5H8WA 1DWPA 1SK9A 3HU3A 4BL5A 3KOYA 3QI2A 3T5DA 2R7MA 3IJEB 3SLGA 4QPJC 1W30A 3L8ZA 3NWPA 1E3SA 3PENA 2R2AA 1XZIA 1FQOA 4K26A 4LEIA 1E7YA 4LVNA 5F76A 3EPHA 1KAMA 1FP4A 1E94E 3T3HA 1F48A 4LJ8A 1K6IA 4NZNA 1HL3A 1Q7GA 2VDVE 3OZRA 3DXXA 4G0QA 4QXPA 4WCFA 3CZAA 4OKIA 1UFOA 5ADWA 4BECA 3QLVC 1NE2A 2PUEA 4PG5A 2JLVA 3UVEA 3ANSA 5CLIA 2HQBA 1E9CA 1GKKA 1LI7A 3NIFB 3IAEA 2IYWA 3TQTA 2HIMA 3UF0A 1RYBA 5ESRA 3CVVA 2AH5A 3CINA 3ORQA 4RFSA 1XQXA 2I22A 4ON9A 5KTMA 1CUUA 1KVSA 4PVCA 4NNPA 5I48A 4BEVA 4BV9A 4UTZA 2YFHA 4G36A 4PQYA 4O5AA 3QWHA 1M74A 2V4MA 3T5BA 5C8DA 1SZJG 4XGNA 4ZODA 1VFPA 1ONPA 4N7RA 4PVDA 3W34A 2IS1A 1SHUX 2GK6A 2VDQB 4OQZA 1EX7A 4BCBA 4N48A 2I1VB 2I6GA 4PHTA 3IBTA 1R5JA 1ISMA 2WJJA 4RWZA 3GDFA 5JECA 3CVWA 1WLYA 2QRVB 3I9LA 4D81A 2IBTA 3G88A 1BMDA 3F9CA 1B3RA 2GXAA 3TBKA 3Q2IA 1NI4A 5FF9A 5C5EA 5HQTA 3PJEA 4KFRA 2C3MA 4R3UC 1DGQA 3NP9A 1U2PA 3HKEA 5BMOA 3EWIA 1WOYA 1UADA 4NOJA 3KPUA 3R77A 4ZVVA 2ZYVX 1G9TA 3RRMA 1E2KA 3VU1A 1FUEA 4DQLA 1VMKA 2CN1A 2Q5EA 2X2PA 1OFHA 3AF1A 1ZH0A 1V95A 4UBJA 4XFDA 3RW9A 4OTZA 1V7PC 3WLOA 1JAZA 4BTLA 1DBRA 4LXHA 5ARBA 4CM4A 2B4TO 5CDYA 1GZ7A 1RKBA 2QJOA 2LZ0A 1R66A 2IYFA 2ABWA 1GO2A 4FHEA 1NYQA 1STOA 1MVNA 1E18A 4FHGA 5AVTA 2YZ7A 1E0SA 1WW2A 4GEKA 1Y1PA 5I3ZA 3I1YA 3K0AA 2OXCA 4WZAA 2UVDA 4GOND 5ECWA 1O5IA 2ZRPA 3B6KA 4E5KA 1K06A 3QG5A 2GJ9A 1AGNA 4W5HA 1QQ6A 1UPCA 4HB2A 2R6R1 1Q0UA 4G5HA 2HJRA 1IWOA 4BE4A 2OGWA 3N8GA 5AKHA 1MLDA 1Y1KE 1HL7A 4N3BA 3RYCA 1GOTA 3KJZA 1SVUA 4EGSA 1N2JA 3EMBA 2CXXA 4PRLA 2PT5A 3QW2A 5H80A 2GR9A 3BCUA 3TQQA 4GEGA 5AT1A 2BSXA 5DB4A 5EMJA 4WY5A 2NTNA 3W4IA 4OGLA 3ZWPA 1W52X 4E22A 4O2BF 3WL5A 1OUMA 4A91A 1BDJA 4AS2A 4AXBA 4HDMA 5JTTA 6ADHA 2JLYA 3OU2A 2PRJA 3DQQA 3MWEB 3SHOA 3RTAA 4LECA 4MVJG 4D74A 2D0OB 2FEKA 1A2OA 4X64B 4TV9A 2H1LA 3CYFA 3GFGA 3AINA 1SVLA 2K4MA 5FLEX 4HBZA 3TS1A 2ZUCA 1G8JA 1C4KA 2JAUA 1Z2OX 1EYZA 3MTIA 2FMHA 5BYAA 2HIHA 2Q5OA 2BFOA 1DG1G 1GITA 2NXWA 1CR2A 3QXXA 4L9WA 1LDYA 3DEIA 5CIQA 3WIBA 3ZJYA 4R7TA 1NATA 2X8WA 4FSXA 4KO8A 4QUJA 1SRRA 2A35A 1LDBA 3O4JA 2C7BA 3NHSA 3LQFA 4ODIA 2P78A 3I72A 4X63A 5CVVA 3UB2A 2NYUA 4UDXX 5B4TA 4YV7A 3V8MA 4QFBA 2Q0SA 4R81A 2JIZA 5LDDC 1BJRE 1IDOA 3O26A 4J4HA 3GEIA 5JYCA 1VG8A 3KWJA 3IQFA 2Q4RA 3LT1A 3PUJA 1WMSA 4C4TA 2O1EA 4LJ6A 1BDMA 2WV9A 3FMPB 4JP1A 4DEXA 1ZL2A 3H2YA 2FJUA 1RFGE 3L43A 3P0HA 2QV7A 1VSTA 2Y0PA 1C7RA 2IOHA 3AUYA 3TXYA 3DAHA 2V65A 2ZR9A 4K46A 4XFKA 4UVDA 1IB0A 5JS1A 6LDHA 1J5XA 4Z1MA 1QFJA 1LS6A 1Z07A 5LD2C 4E46A 1PTJC 2J4FA 2FK7A 1H4VB 2J30A 1BAPA 3VJLA 3ADCA 4JT8A 1G9XA 3QZUA 3PNKA 2PD3A 4Z9AA 1JLSA 1E89A 3T7JA 1ZN9A 1OW3B 1Q0RA 3JQDA 2INGX 5A1JA 4HEHA 1RWXA 3VMMA 1L5LA 1D03A 1QX4A 3LY5A 3PRKE 3JQQA 3ZX4A 5BNIA 2GTIA 1Y5RA 4BVKA 4CQJA 3JQFA 2J5QA 3GDHA 1BROA 3FY4A 4LXIA 2FSUA 4LY0A 4L72A 1RVV1 1EFKA 5HZHA 2V1XA 3W3AD 3NAMA 2CT8A 1W19A 1YBFA 1Y9JA 2KM1A 2HWXA 3PKIA 4FMBB 3X0DA 1KSHA 3IR7A 5I4BA 5CA1B 4TTJA 4W5NA 3QVOA 4OO3A 2QMOA 2UYYA 1YMQA 2F62A 1JJFA 4H15A 1CUBA 3GLVA 1ZWLA 1YV9A 4MGIR 1G17A 1TM5E 4UDNA 5CAEB 3O9VA 3WWEA 3S6JA 2O3TA 1WXWA 4A15A 1RPNA 1NUUA 3KL2A 2ZE7A 2IZ0A 2Q3HA 2GF9A 1CDZA 4X91A 4V1CI 3LLVA 1T1GA 4KR9A 3H18A 2XGMA 2O05A 4NPHA 1G42A 2HRBA 1WNTA 4I1RA 1HH4A 1PU2A 2Q07A 3LGSA 4S3MA 5AI5A 4O1HA 4CQLB 4GLJA 2ACKA 3C3YA 1SOMA 1ISSA 4QHTA 3VQTA 2PS3A 2O52A 1WMFA 4GKVA 1OI3A 5LB2A 3E81A 721PA 5EFOA 3MMSA 5AOAA 1XMJA 2PWAA 1D8TA 4PYLA 5ALMA 1F3OA 2CE7A 5FADA 1RLMA 1U7HA 2DG2A 1T3TA 4EVRA 4OATA 4JLPA 3GPDG 2O2SA 3H4IA 5D8DA 3ZW7A 5JARA 4UM5A 1RCFA 4PFJA 5TARA 1FMJA 4HPXB 3EPRA 1KK2A 3GGGA 1N8NA 1P1CA 2A1IA 4YT5A 2GZ1A 4C7VA 4KSCA 5EIEA 4DLRA 5HZKA 2HF8A 4RMJA 1KZ6A 2IS6A 3KAJA 4WGGA 4CV3A 4DMKA 2X8BA 1MD9A 1U8XX 5EMNA 1K0UA 1XEAA 3Q72A 2VR1A 3OC6A 4RBNA 3WMWA 1J0XO 2VCEA 3ZHUA 5E8JA 1JDJA 1N2HA 1R88A 2R3SA 3A6EA 1XTRA 4HZUB 3CX4A 3ESZA 3CZRA 4X9XA 4HBGA 3HR7A 4GZ5A 3L8GA 4ZVMA 5SICE 2HDNB 1NSYA 3V1YA 5JU6A 4BP8A 3CH6A 3FAKA 3C6ZA 3PNYA 5DXAA 2OGUA 2B36A 1EFHA 4K8OA 4Y98A 3TTWA 1LRJA 3HJCA 5BOVA 2ZBGA 3IP8A 3V4FA 4RNCA 4JDPA 3ZGLA 2YNMA 2EFCB 2JKYA 3LLSA 1CJVC 1KHTA 2H63A 3M34A 3U7EB 2HM7A 3FPKA 3EH1A 4GQAA 2I3GA 3VHXA 5T41A 4IW3B 2J9RA 2ZXFA 3WL8A 1HRDA 5K0SA 3Q5EA 1CS0B 1YAJA 4XCVA 4XQ9A 4O63O 1QFXA 1XV5A 2VIIA 2O1WA 1EUDB 1HETA 1XZPA 3GH3A 3QVGA 1LQTA 4PZLA 3RUDA 3B89A 5EPEA 1E2QA 4Q3OA 1XQ1A 2L17A 3AKEA 3ANMA 4JLSA 4U63A 2REXB 1FX1A 2FSIA 1VRWA 3QBJA 4GZ6A 5JJKA 1DC7A 1AKRA 3IEVA 4LUCA 4Z99A 2FK8A 1ZCAA 2ZKLA 4YROA 3BXPA 2ZJ6A 4C7JA 3N74A 1TM4E 4OLAA 3FLMA 3HJAA 1W44A 5EWJB 4D2IA 1K75A 2MU1A 3EQZA 1FPMA 2BFEA 4FHZA 2XUOA 1IBRA 1U5AA 4HDAA 4M83A 2GBLC 4WN9A 2VZ9A 3PVSA 5G0UA 1LPAB 3K0CA 1YB1A 4GU5A 3SIRA 3JQ8B 2IUSA 3B9BA 1CD5A 3AILA 3JRXA 1RKQA 3ZOZA 2VHZA 3L6OO 1QUFA 3EYWA 4EECA 4UBLA 4WVLA 4EVSA 3BTVA 4DBVO 3UANA 4ZI3A 4IIYA 1ZSVA 2WWYA 2C58A 3HB0A 4FE7A 1Q0SA 4HWTA 3JQAA 1ZLYA 4EZEA 1QDLB 1R2QA 3VKHA 2L42A 4G85A 1M5TA 1NUPA 2A1UB 4NBVA 5IZ4A 2WKWA 2ZUFA 4CWAA 1TD9A 1ZXBA 4UUMA 3K53A 5JG7A 4AZ3B 2J32A 3FCAA 1QRSA 3IERA 4IAOA 4WOCA 3KJEA 3ET4A 4UDOA 2OBFA 4KBFA 1W25A 1WRBA 2V54A 3U3RA 5F9FA 5KKNB 1TZMA 2EDCA 2OWEA 1CHDA 4WUTA 3FXAA 3PC4A 2JBAB 3EAFA 3H5WA 3IT3A 3BGSA 4OYYA 1ESNA 3SM9A 1ZO8A 3CJQA 2ZSHA 4OP2A 3DEJA 1OFGA 1FLVA 2IXBA 3FHCB 3DPSA 1SNYA 1C0PA 3ESQA 3COYA 3NQ41 2FGJA 3CONA 2VHWA 1RYEA 2QTFA 3HUDA 1P6QA 2OFOA 5KSYA 4D9NA 4CF3A 1L5HA 1P0CA 1E3TA 2WIAA 3PHGA 4OHPA 4OSEA 2C54A 2EL7A 4QUEA 2CXTA 3PICA 4DQ0A 1XAHA 2G71A 3A8TA 1BC5A 3SZRA 2E49A 4DWOA 1VIYA 3PDWA 1XTQA 4JLBA 5PGMA 1E7QA 5LA6B 4AUKA 3WFZA 4R1MA 1R9JA 3FPHA 2OAQ1 5FUVA 1Z5VA 3V4RA 2BZ0A 3BK7A 5HK8A 2IX3A 4P7BA 1V11B 1XTIA 4MW1A 1RWQA 4JBHA 3CN9A 3WRYA 3K6JA 5BWBA 5TGDA 1S02A 2FPGA 1NBME 1KETA 4OHZA 5B36A 1EVJA 2H31A 3DLHA 4EKDA 3TAXA 1ANKA 4ZMRA 1J9ZA 1I51A 1RSZA 3ZQ6A 4TMKA 2CMKA 3OQVA 5ALLA 1AB5A 3HL0A 1IN4A 4HMOA 1IM2A 1OKKA 3IV7A 5JATA 4J1TA 4QOSA 2IOQA 1Z35A 5KU1A 2Y77A 3BTUA 2V55B 3NMUF 3RD5A 4DV2B 1DAMA 4UMFA 3K9WA 4DSZA 3U40A 1S7CA 2H9IA 1BEZA 2HY7A 3KVRA 4LJKA 3UAGA 3TF5A 2WJWA 4ALIA 5SY6A 2DULA 5L51A 4GSLA 2OEPA 4BV2A 5DHQA 5BY2A 2JD1A 3G2QA 4KFUA 4BCDA 1U7WA 1WB6A 1OBFO 3JASB 2VUSA 4NK5A 3ZHCA 1IVYA 4JQYA 7YASA 1SXJA 3JAWB 3KJNA 4FHCA 4M0LA 2I7VA 4KG7A 4DPLA 2Z95A 1QAOA 2EKBA 5BVGA 1CLEA 5KDDA 1PR0A 4BFXA 4HMPA 2I4NA 3AWIA 1YK1A 2ZYIA 3H2JA 2XQKA 3GELA 4W6QA 4UTRA 2XDQA 1IM5A 2A5YB 4G4SO 3VR0A 2X9VA 1VECA 3FOEC 5HDQA 1WPQA 3MYRA 2OCBA 4JB8A 1XDDA 3GAZA 2F1KA 2IZ1A 3R5HA 1CQJB 5B1YA 3EEYA 2PRKA 2X0KA 5CX4A 3P4UA 2D8AA 5JALA 1KAQA 1BIFA 2NPIA 1CZNA 3R8FA 3DMGA 2Q5QA 3KKPA 1EVKA 2PL1A 3OFJA 2LUOA 3BPSA 4Z7NB 2YHAA 2RAUA 4I2NA 1E0KA 2I4RA 2C5FA 1B8OA 3IPRA 4B0OA 4JR1A 2K87A 4B87A 1D4FA 5CDSA 5C46F 4URUR 4QZVA 4FCCA 2P3QA 3QKRA 1AJEA 3N2NA 4DBZA 2EKQA 1BD4A 3ICPA 4JP8A 3WA7A 2XZPA 1EK2A 1T1EA 3JZAA 1XK6A 4WGFA 1IQRA 1ZDMA 3JYPA 3DDWA 5H5JA 3K30A 2ZUVA 2VUUA 2Y66A 5JVDB 3VV2A 4BFTA 3G0BA 2VT2A 5IANA 3UIEA 4CYMA 4OOFA 4JX8A 2HMUA 1G6KA 3KSAC 5CYGA 3HJNA 4L4SA 4PZUA 4WK6A 4V0QA 3RWOA 1TCBA 3FHJA 1QNFA 2FW9A 1CS4C 1Z0JA 2A5GA 2VXYA 3HXPA 5AHKA 3PUXA 4IILA 4V0KA 3QPBA 3E1KA 1RQ7A 3RS7A 5BT9A 3ZE0B 5KJFA 3BRCA 4YAJA 1YU9A 2GYYA 1WBBA 3PNQA 4M0DA 1E2FA 2GAFA 1U3FA 3ZNNA 1NI5A 5EERA 3ES9A 3UK2A 1SXGA 2QTWB 3AVPA 4G8BA 4IXNA 3RU2A 3AM1A 3R9XA 1T4MA 3G2KA 1Z4JA 2XT9A 2O7VA 1SHKA 2XT6A 4JY7A 1MMFB 2JKZA 4RORA 1XR3A 2HCTA 4I1IA 2PGDA 3TO5A 4DVJA 2NUPA 4CI0B 3QLJA 4R54A 2QT9A 3FCEA 5GGXA 3WK9A 2GN8A 2IEZA 1QGDA 5AKEA 1MTOA 5TY0A 1G7RA 3E35A 4EPVA 2P4UA 1ZR4A 4N41A 3DZCA 4KV9A 5K0NA 4QUAA 2GJ4A 2E3JA 2F43A 3H16A 1G0NA 5K6AA 3GQBA 1OFVA 2JIBA 2K2QB 1YZTA 4Q02A 1ACMA 3Q6IA 3MINA 5MFPA 1U9CA 1CETA 4ZVPA 4LFBB 1VLHA 1MF7A 3IUYA 3ICOA 4KPGA 1D4ZA 2ZAOA 3F6YA 4N0MA 4WFJA 2X0RA 3I3SR 1G3QA 3IT2A 3WLAA 1TQ4A 4NJMB 1KZHA 4JX9A 3SNKA 1JIQA 1RHMA 3RFXA 5CB0A 1TZKA 5IYZB 4B3DA 3P2YA 3WKBA 4RY2A 1EUQA 1V8OA 1JDNA 3CURA 1NI3A 2WSSA 4ZIRB 2ZS9A 1LSJA 4KWCA 3W8EA 1VHLA 3DZDA 1CRQA 1JIIA 1G6Q1 4GL2A 3SC6A 4Y30A 1MP0A 3WWZA 3IKMB 3DPUA 3ETGA 3ANYB 4KYTA 3MTAA 3STWA 1EA5A 4D9GA 3UXYA 1KS9A 2BAGA 4W9RA 5K01A 3SSAA 1D0VA 2WJPA 1TE2A 2I80A 3QFHA 4R9SA 1UC9A 1KEPA 3PC8A 1RPAA 2XE8A 4MZXA 1MH9A 4HFNA 3E27A 4ZOLB 1XLUA 3EA0A 4LZJA 4XWYA 3RC7A 4JJKA 1IK6A 4ID9A 1RHKA 2Q9UA 4F96A 3KHSA 3WNVA 2I2AA 5F51A 3A4VA 4P7GA 1OBVA 3LCMA 2C5BA 1B26A 1P0QA 2H3EA 2Q49A 1NLFA 3PRJA 3LUAA 1Y9DA 2FSGA 3TIVA 3UJ9A 4A0SA 3FKQA 4P4GA 3DC2A 3GYGA 3F8WA 3PSHA 1DIAA 4WLVA 2WTUA 1CZLA 2HU5A 2Q99A 2ZBQA 2ZIZA 3PFIA 5CUQA 1TW2A 4C4PA 4GC5A 3PL1A 5E1OA 3CLRC 5DM0A 2PUVA 4KNYA 3LF1A 3STYA 2KLBA 2WHXA 5JZSA 4WY2A 1T9KA 5F3RA 1J0AA 2BZ1A 3OCXA 3H2HA 3W9YA 1NG1A 5UKDA 1I3KA 1J20A 5CMLA 4PV7A 1U04A 4U6QA 2VF7A 1VG1A 5DW3A 3OE5A 1WCV1 2PPLA 1XDUA 2VNKA 2N9UA 3UK7A 3DBHB 1QK3A 2QQ0A 1R6XA 3JSXA 4W82A 2PGOA 3B36A 5B4UA 1UPBA 4JNKA 2QJFA 3IP9A 3P2OA 4WK0B 4DA0A 5J4YA 2I4MA 4V0RA 4GFDA 4TS4A 1ULTA 4MV4A 4RVHA 4ND2A 3CNNA 3TBFA 1RC0A 1GA6A 3DXFA 6AT1A 2GJKA 1TT7A 4RH3A 1QG0A 1URPA 3EG9B 3W3AA 4FIDA 3ZWWA 1K1EA 1ZS9A 3BB1A 4NZPA 4RZ3A 2RCYA 1RR6A 2IEAA 1M2NA 5LQMA 3D3JA 3OD1A 2JPDA 5HFJA 4A6EA 1P7WA 2PKXA 3D9QX 3I9FA 5M7EA 1LD3A 1J23A 3OEED 1X7ZB 3OP4A 2WHEA 1SHLA 1WLSA 1VBNA 3HJGA 5MFZA 3MTBA 4NU5A 3MC1A 3OY2A 3CO5A 4MWTA 5B7GA 3IDOA 1X7WB 3HCOA 1X1QA 4ARBA 2F3UA 2GD0A 2JARA 3OF3A 2A9OA 4RVUA 5AW2A 7GPBA 1Y8QB 4TKUA 4LX0A 4F8JA 3UJ7A 3G8AA 5LP6F 2VUHB 1FVHA 3DMTC 1QS0A 1T43A 1CUSA 4D6YA 4IMRA 4NDZA 3OPYB 4NZZA 1MT3A 4QO8A 4JL6A 2I29A 1ODFA 1DADA 2WJVA 4F4JA 5FLXA 1D0IA 1UDRA 4F1JA 2D06A 1BW9A 1JZSA 1CNMA 2BMFA 3L41A 3PFBA 4XOUA 2OXFA 3RKUA 3ZD6A 1DEOA 2WSYB 1TB4A 4B33A 2FSHA 4GE3A 4ZOEA 1YC2A 4X1IB 4B7CA 4L57A 4CCSA 1DC8A 3QUCA 3UUWA 1C9NA 1LNSA 4CTOA 3RC3A 5AI0A 3REFA 3T94A 2BP7A 5A3RA 1OH8A 1TO2E 4B8WA 4D3FA 1RACA 2ZT7A 4DPKA 4O4HB 3PI6A 1TL7C 4M4SA 4WWHA 2G88A 4YK7A 2B1JA 4ZXPA 4DM7A 3QEMA 4ES6A 3C3MA 3PHCA 3RAJA 2DWPA 1WXHA 3I30X 4IR7A 5K7SA 3TTVA 4MLZA 1D9ZA 4RK0A 1Q95A 1X1SA 1SVMA 2GRJA 5D51S 3ZU4A 4F56A 3UNXA 5LDHA 3DBLB 4HQ6A 2WINI 3V8BA 3CZ4A 4ZHQF 1LUAA 3GLGA 4HUQB 4C5CA 1LXCA 2R6FA 5HJ5A 3HYRA 1ZISA 1ORIA 1XXHB 1MJHA 1M8KA 1Z0FA 4MRAA 3OF2A 2V5UA 4Q9LA 1CRPA 3A31A 4JFAA 4MJ7A 4HADA 2D5LA 3UK1A 3T9BA 4HZIA 3HR4A 4NR0A 2PZJA 1RQNA 3NEJA 3WGMA 5HM8A 4XZ3A 4DB2A 4H59A 5EKUA 2J31A 2KQUA 1P4GA 4I8IA 4YJ3B 3GLIA 1MAWA 2FUG6 2VC2B 5BVHA 4LYHA 3RUEA 2GHQA 1GTJ1 2RG1A 2Q1YA 4HYEA 3TVTA 1VIAA 1C3LA 621PA 1VOTA 1P1HA 3ZWKA 1KZ1A 2F1HA 1W5TA 4H4EA 4WINA 2FPSA 3UCEA 1RD4A 5J58A 1XU4A 1EP9A 3LPDA 5CGQB 4KEAA 4BNNA 3DEFA 4C2TA 3QITA 4ADSG 2J0QA 3TDKA 2O3JA 4QBKA 2B2XA 3DFZA 1K9SA 2FLWA 1KKLA 2Q3MA 4JS0A 4BO7A 3SKYA 1KE1A 1WETA 6NULA 3MJDA 1OJ7A 4QA9A 1Y6ZA 5LZ5A 3W2EA 2HLPA 4ZZ3A 4QWMA 5HRAA 4X6LA 3V7FA 1JIUA 2X41A 3JSAA 4UU0A 5BNFA 3AKYA 3K2QA 4NYIR 1A1VA 5MGBA 4DDWA 3QEOA 3T1NA 2VK1A 2OTCA 4XR9A 1X15A 4DVGA 3PNLA 2B1GA 1L7XA 1LEHA 4NARA 4B7ZA 4QU5A 1VI2A 4GRAA 4O2AB 3DAGA 1F51E 5T57A 1HYGA 1PWHA 4D9CA 1H1DA 4YA6A 3KZOA 5IG2A 3STVA 1JIXA 4BLVA 1GSAA 2A57A 3V6LA 2YWGA 3D2LA 5KWIA 1QB7A 2YZNA 4BMSA 4FZVA 3AXTA 1RKXA 2CMFA 4UHHA 1SXPA 4XM2A 2O2CA 1DDOA 4J03A 3KE9A 1OT5A 3M4XA 1QH9A 3MJFA 1W88A 2JB9A 4FYPA 4CLDA 3H9QA 4M8SA 1E7MA 3HM9A 2EKDA 3PUZA 2VTBA 5LQSA 4FIZA 2D13A 3JCZA 5GZ3A 1ICIA 2AZXA 3LO8A 1GU0A 1PQUA 1PTJA 3V4VB 3ZTYA 4EEKA 2H4WA 1EK6A 1ZZGA 4OQFA 4C30A 3T4EA 2PNJA 2LW7A 3F5SA 2I8CA 2VUIB 4DBLE 4QPZA 1TADA 4RVGA 1CKEA 3EZLA 4Y9RA 4N39A 4ZCPA 4BUJA 5B1IA 2OXTA 2M2IA 3PDUA 3TI7A 4TLLB 4Q4AA 1D6SA 3BH6A 3Q3IA 3ZCVA 4GG1A 4D26A 2DWCA 3K5WA 1E6KA 2W83A 3UJPA 1M2OA 2DTDA 4HLNA 4IJ6A 4Q93A 3BZUA 2DX7A 2JA1A 3Q88A 3W5UA 5BV7A 4MKXA 4BJ1A 2WE8A 1J06A 2XTJA 4FMDB 5FORA 3R7BA 2RHHA 1UBLS 4YAIA 5KYYB 4LF8B 5I45A 1JKMA 3CJTA 5M3BA 4HLDA 1AQYA 1F60A 2ZREA 1YXMA 3RR2A 3GVCA 3EDMA 4MTLA 3P5SA 4FOPA 2JAQA 1AVTA 4CL3A 3PFCA 1S2MA 4NEQA 3UAWA 5L4NA 5J9FA 1UBMS 1WF3A 1USKA 4DYHA 2YR0A 1XRSB 2VP5A 3KLPX 2G08A 2WZQA 2VOEA 1R4MB 1UMCA 1TKCA 1V6CA 3EFOA 2B3TA 3DKRA 1H6DA 1VP9A 4LI0A 3VTAA 1P45A 4MIKA 5JCPA 3R44A 2BMJA 1KJIA 2NO5A 4DMCA 1K8RA 2ISSD 2ORVA 1HFJA 2V4UA 2VYCA 4IZIA 1JP7A 3K92A 4HY3A 2PPVA 4MGYR 3SICE 3LLCA 2JIPA 4Q4JA 2COUA 4K3VA 3LU1A 4BNGA 4ZOQI 2QE6A 2WOJA 1Q1AA 4MW4A 4DDHA 3PDIA 2Y1FA 3FNRA 3OQ1A 3PQCA 4TZKA 1FNSA 2REBA 4IIVA 3I4CA 1EX6A 3BB3A 4KQXA 1U8EA 1TZ2A 4I9GA 2HOQA 3QE0A 2C88A 1Q1NA 1KZ7B 3Q15C 3GBSA 1RNLA 1JB9A 4MJXA 2NNLD 4ZZ0A 4W9MC 1SVOA 2XNCA 3LQ2A 3C1AA 3TEMA 2AB0A 3X1DA 1NQVA 2FWPA 3QHAA 2IF0A 2P11A 2ZAGA 2AJCA 2JFPA 2WIFA 3I52A 2B83A 1FBTA 3C2QA 3CQ9A 1M6VB 2DT5A 1Z8HA 3CX7A 2BE7A 4IV5A 3SJZA 1S5PA 1DRJA 1MGPA 3DJFA 3KLBA 3JVUA 2GJSA 3OMWA 4B6EA 1E5VA 1THMA 4DLBA 2QTTA 3NV7A 4G37A 2YKGA 1HDZA 3LUPA 2AFIE 4XJTA 1CP3A 1JI0A 2GXUA 1YFKA 2MT9A 1AKTA 4GZ3A 3MWDA 4XOIA 1VE7A 3L7DA 1GZ5A 1L1EA 3SYKA 4JI7B 3TPCA 3K8QA 4ASUA 3LUJA 3K8ZA 4XEUA 1HKUA 4G67A 5AVKA 1YAHA 4GMGA 5KQPA 1WX1A 1W2WB 1ML4A 1C9KA 4AG5A 1ZUNA 1N5JA 5CT9A 4YO7A 5ALWA 2VJAA 4FFDA 1TOAA 4IOKA 2C84A 2MSWA 5FL3A 5U4XA 2BMVA 2A33A 1A4UA 1SKUA 1WCYA 3H1GA 1ZIXA 3GT7A 4ZK2A 4CEHA 3V8RA 3LQRA 4BDSA 1T0BA 2AGVA 3DL0A 5AI6A 4HH1A 5JAUA 2VK4A 3DMFA 4D8TA 1SBZA 2XQVA 3R4VA 2E4WA 1R15A 4KDCA 4HTFB 1XBTA 4ZO6A 3F47A 3A4YA 2ODAA 2RC6A 1ILEA 2PSSA 3GRFA 1C4XA 4G5YA 2GBLA 2YX1A 3N0WA 4WNYA 1P0FA 2GNOA 1RLTA 3KQQA 5JZBA 4Z54A 5K0TA 3GA5A 1DOAA 1NBMD 4WBNA 5ALPA 2PR7A 3WGNA 2ECOA 4B3MB 3LCVB 1IATA 2ESRA 3RRNA 1F2TB 1GGHA 3SR4A 1FTNA 3R7LA 3BRWA 3QENA 8MHTA 1N7IA 2DKNA 2BFFB 2P68A 3Q9SA 4KXQA 1VJ5A 4ZQIA 3MPOA 2G0TA 3LBAA 3HKDA 4MS3B 3OCCA 2FP3A 2JGLA 2AZMA 4WLNA 2HSDA 2Y99A 2FYTA 1VCNA 4RJTA 3VR5H 2LBPA 4DDVA 3SHVA 2BJWA 3ER9A 3ZI4A 2BFMA 1TKBA 1ONOA 4EB0A 2BEKA 4JYCA 3KXDA 1AE1A 2JJYA 4YLEA 4WA8A 1RYHA 4P7FA 5CX1B 1S4QA 1N3IA 4AJIA 2F6RA 5AW8A 3D6MA 3EAGA 1BWPA 5C53B 4HDNB 4E15A 3ZVMA 4MRSA 1GNRA 3OZFA 5FUWA 4IHJF 2HWUA 3ZD7A 2WFAA 1BX1A 2TMDA 3L0SA 4ZJZA 4DKJA 2E2WA 2G63A 3AVTA 2CHFA 5DP1A 2VH2A 1KI3A 5CCBA 2VT6A 5JSKA 4F6RA 1E9AA 3IHWA 5HUQA 2H8KA 3LYAA 1ZYUA 2RH4A 4DLXA 3A1SA 1XYYA 1PP4A 1AD2A 1OAOC 2GCEA 2W2LA 3BJZA 4H6XA 4JIGA 4AMYA 4I5GA 5C5CA 1DBSA 2YCLA 2X0DA 5ESWA 2ZBRA 3HVIA 4DCTA 1M76A 3AF2A 3OFND 4M9UA 2WMOB 2ZJ5A 3EY9A 2G7MC 4WLOA 1PIWA 2FPUA 1AURA 1GP2A 3DCJA 4EENA 3CISA 4NBSA 1PT8A 1V0JA 3PNMA 4Z0HO 2BUBA 5A9SA 2MYUA 2WD9A 4KPUA 3BCRA 1SJ9A 2I1WA 2QKYA 3CBQA 4I1SA 3ADBA 1IAQA 1YVEI 3FVQA 4RGYA 1T13A 5KI6A 1H5QA 3WWCA 4YAOA 3OSUA 4KRYA 4E51A 3JQPA 1Q91A 3DE5X 2JI6A 4DTIA 3BVPA 3IDAA 4OV6B 1TEVA 4JJ4A 3TEFA 5KTTA 2XJ4A 3GARA 4GQBA 4AMUA 2V6IA 3KZ1E 1PYGA 3RAEC 1LNZA 2ZTSA 3OZTA 2I8AA 3JR3A 1C0IA 4QE3A 2CLKB 3I9V6 4UC0A 4X7RA 3WGOA 4LISA 1YO6A 2YYAA 4ZOBA 5C31A 4MR7B 2E4UA 4XD7D 5A3VA 3E8SA 2R6JA 3O8QA 2YMLA 1XMIA 3REQB 1QXSA 1KQGA 4O3FA 4HQLA 1YRAA 4OMDA 1JR6A 2OV6A 4ENWA 5A4DA 5EPOA 1EG7A 3CWQA 1T4CA 5LQCA 3L6EA 3LUCA 3HP4A 1U7TA 3AJRA 4R8SA 2ZYAA 4Q9JA 5G0TA 4AY2A 1GKLA 1REQA 1DVRA 1EVQA 3UFXA 2W8ZA 1F2UA 3EZ7A 1MOSA 4LY3A 1GN9A 2VNJA 5BSVA 1XPRA 1DHTA 3F98A 3IXMA 1FX0B 1SUIA 3ANLA 2WTAA 3HCDA 1ZKMA 4ER7A 2J5KA 4ALJA 2XB6A 1K98A 4WL0A 3TB6A 3AY6A 3VOAA 3ZCXA 2UUBB 3QEKA 3CLTC 4MUIA 1NMYA 2GUWA 1X7XB 3G23A 1HI9A 2WSLA 5JNWA 1JTFA 3NPAA 1RAHA 1YHYA 1QHHA 4FW9A 4IFBA 4PQEA 4ZCQA 1WQ4A 1BKDR 1BVUA 1XKXA 4DIUA 5GIPE 3CV3A 3VMFA 4B74A 1CT9A 3O7WA 4KITB 4AULA 3U7GA 4CHGA 4OI4A 2JLRA 4TWZA 4YIHA 3D02A 5JCOC 4P31A 1OX4B 2FPPA 2O0HA 3H3XA 4V0ME 5FOQA 2CNKA 2VPPA 1I7DA 5DHAA 3PQ7A 3PUVA 1II0A 3OZEA 5AP9A 5FBQB 5LVAA 4S1PA 3K0BA 4A5SA 1O77A 1T10A 1VPEA 2IKQA 3B6JA 3A9WA 4M6WB 1KGDA 1E99A 1WXEA 4AN1A 5I9IA 4CT5A 2IPOA 2PMKA 2ZS7A 3OE4A 1UBRS 1JU4A 2J5XA 3ZWBA 3HXMA 3HG7A 4H35A 3O4GA 2IYLD 3HQ4O 1KSFX 2NVWA 3LTEA 2EP8A 2B78A 3KUUA 3STXA 4PQFA 4QRHA 2OV2A 3DL4A 1DXHA 2H0QA 5FI5A 2BGWA 2Q21A 4O2LA 2QBYB 3CB2A 2Q29A 4OK3A 3V1NA 1WCWA 1ZD1A 2ZSIA 3D3EA 1W8IA 1FYVA 1XTJA 2YXLA 4LHWA 2QLNA 2CF6A 3FPLA 5JMOA 4CTNA 5EWLA 3DEKA 1XRJA 4X24A 1DBVO 2HUPA 4WXEA 3UY4A 3W78A 1ZLXA 1C3JA 2PRYA 1D07A 3H65A 5K9ZA 4OVKA 4AUNA 3A6PC 1FFSA 1I6LA 2FG5A 3O21A 1O96B 1TM2A 1HUQA 4IVNA 1FXWA 4H6WA 2BTQA 4QX6A 1C81A 2I2XB 2QP3A 3AIMA 3I04A 1QOPB 4NQZA 3TD9A 4EG1A 1IY0A 1FYDA 5FO0A 4EQ6B 1Z74A 9MHTA 4H7FA 1ZHOA 3PQ5A 1ESCA 3AC0A 1Q0TA 1VLQA 4DAOA 3DQPA 1WEKA 2AFHE 3NHYA 3OQPA 2IP1A 3I0ZA 4DKXA 4N76A 1VCHA 2HH9A 4M54A 5I3CA 3ZWDA 3RF7A 2X4IA 1U81A 2MYPA 3S81A 2IH2A 3FTEA 3OF5A 1BDIA 1TM1E 4DNPA 3IVMA 3URMA 5KOJB 3HXLA 4F3CA 1CYDA 4YMTA 3FCXA 3KAKA 1N5MA 2A92A 4KRFA 1E2LA 2FHPA 2DQSA 2P62A 2PMDA 4NH0A 5TMEA 4KH1A 4CJXA 3UHAA 2Z8YA 2OV4A 2DVMA 3K6RA 2GEJA 2P4SA 3KKNA 3KQTA 4G8CA 1SWWA 4EY6A 2BEJA 4P0QB 2VTVA 3AZOA 1FSFA 3KSUA 1S2OA 1VHJA 2ZRLA 1NDQA 4UFNA 4KQFA 1N5KA 2BKUA 3B1YA 1EGAA 4AUEA 1SUCA 2PIDA 2I2WA 1KJ8A 5AM1A 3IQXA 4EA6A 4LA4A 5AM5A 1WJGA 5DGDA 2WJ3A 4FWBA 4Q7QA 3M5WA 3KS9A 1BRTA 3UOWA 3A2MA 3B3QA 2Z8ZA 2LE0A 3E4CA 1NJGA 2B4QA 2OAP1 5F35A 1I13A 2DFLA 1USIA 3M6UA 4WBXC 1JEOA 4OFWA 3PBKA 3UJAA 2QRVA 4DLPA 1N3YA 1QX3A 2WSIA 3M89A 1QCDA 3GLQA 3BGIA 2X13A 4G0XA 3ZK9A 2EAUA 4FYKA 3P19A 1YKGA 3IKVA 4EMSA 4B17A 5A0VA 2R65A 1PG5A 4IG9A 4OUDB 1A88A 4EJ6A 1SCDA 3VZDA 2DFVA 1PT9A 1QGYA 2WOOA 3LKDA 3VNSA 1DC5A 5CH8A 3VU8A 4HDSA 5EG5A 4DRXB 2DCMA 5DI3A 4CTJA 4P8RA 3AUFA 1SB9A 1NR7A 3FIJA 3AFIA 4ZVKA 1HDIA 2W48A 2ECFA 4XDYA 4F5ZA 2HFKA 4B3GA 5F5XA 1P3JA 3R3JA 4MW2A 4B76A 4DIDA 4GH5A 5DGCA 1L7NA 3ZQKA 2CDRA 1DKOA 4ABTA 4P81A 1H4TA 3WFIA 5DISB 1L4YA 2XVAA 5M29A 5HVNA 4FR5A 4KGZA 5ALNA 5TF4A 2I8LA 4GRIA 3WV5A 1U0EA 3AF3A 2VJLA 1NVUQ 1JAXA 1NXOA 1RBMA 2EKPA 2OM6A 2R60A 3IOCA 4GI5A 2GMWA 4IXMA 2O2HA 1M7BA 3AGQA 1TD1A 2QHXA 3NDJA 4G9GA 4BNFA 5BSWA 5KWVA 2WRZA 2CNOA 3E0QA 1ZJJA 4GPAA 3R7WB 5IXJA 3ESAA 2ZBUA 1LVGA 2EEZA 2P6MA 3NM4A 4A10A 1S8AA 3TOSA 4J6FA 3RNLA 3L1VA 2FF7A 3LV8A 4ZHSA 3NW9A 1Q15A 2IITA 3U3XA 3NBKA 1E60A 3EK2A 3LK7A 3SBOA 2GPNA 4K9LA 3WHKA 2JEYA 5BN1A 2EQBA 3MWEA 1VJ1A 4KYVA 4X5OA 4MIEA 5EJAA 1ADJA 4RPKA 1KXZA 4U2EA 5C4GB 1HQYE 1RW4A 3VKVA 3OUUA 4L8WB 5FYQA 1E9VA 1NJ2A 3HSYA 1XVIA 1IPHA 1N0VC 1Q12A 5J1TB 4DFDA 4P4TA 5AESA 3DMTA 1NF8A 3K9QO 4GR9A 1FTGA 3H5VA 3RE1A 4BO5A 4Q3NA 1JUDA 3KXPA 4ACBA 4BATA 4EGQA 1RRCA 2XZLA 4P53A 4TQ9A 2X9GA 4QDOA 4Y18A 3EZ2A 4BN5A 4MUNA 3QXGA 3GGSA 1A8IA 3CF4G 2X0FA 3I04M 3SIXA 5JDCA 2C5AA 2BZSA 4GR4A 4OY3A 3UG6A 3RB8A 3WO1A 3E5NA 3DOIA 2Q2WA 2B4AA 4Y6SA 4GM0A 4X1OA 5CR9A 3B3JA 1Y4SA 1KGSA 4QOJA 5IJAA 3P0RA 3T0GA 1W76A 1YR3A 3IAM6 1AXGA 3LRTA 1FS6A 3MZ0A 4M7OA 3I28A 2BHTA 4NG5A 3M6VA 3ZQJA 3TD2A 1OX5A 4NCIA 4UFPA 3AOGA 3F8TA 3RWMB 3CTPA 2BCGY 5ALTA 1K5GA 5K8JB 4B3RB 3OD5A 3WL3A 3EGXB 4HZGA 2AI3A 1Y4UA 4F71A 5JLJA 3PUHA 4JQOA 1QGOA 3NVKI 3MWLA 3DDCA 4WERA 2Z8YM 3ZWXA 3U1BA 1WXIA 4PSVA 1PFYA 1KYIA 3EUEA 1WCXA 4Q7MB 3HWX1 1NONA 5BQOA 4BFWA 1ZG3A 4BVGA 1L5RA 4Z4QA 3TXAA 2AZTA 4WOJA 5GONA 4IHQA 3KB6A 1FB5A 3GNSA 1Y6FA 2YH2A 1AQUA 3R6WA 4HUJA 2SKCA 3I23A 4HN9A 3AIIA 1P1BA 1XLVA 2C7OA 4C4ZA 3QVUA 1LQ2A 3R3XA 4YRNA 4BYGA 4HDKB 3REOA 3RVRA 2IRWA 3TL6A 2O9JA 2YYZA 1QPZA 3MN1A 2XYVA 4OJYA 4Q4HB 4M1QA 1UBOS 1EBFA 3LF2A 3K0KA 3PC2A 5JCXA 1L5OA 1UXGA 3U4QB 3EHEA 1TQ6A 3OJOA 4GZMA 5EHQA 3U62A 2VK8A 1NV9A 3GUYA 2AC4A 3JATB 5G0SA 2W4QA 4CLOB 4UNRA 4EHNA 3UXEA 5K0JA 1YD7A 4EL0A 1XQYA 1XT6A 3DG9A 3L7KA 4QG7A 4ENVA 1V16B 4M8IA 2Q3EA 3Q10A 1JWBB 3RRBA 4L8GA 3X1XA 2JGFA 1TTQB 4H9GA 1NBIA 4UXHA 5BSGA 3PLAE 1XRLA 4R0NA 4AY5A 5ICGA 2DF8A 2WWIA 4UUOA 4GPBA 3NOQA 3L02A 4QGBA 1IEXA 3GAFA 3MF4A 4CQLA 3AG6A 4C0KA 3SDSA 3NC1C 4RANA 1TYAE 3ZXIA 2Q0HA 2IYYA 5IZCC 4UXJA 1XTZA 4TLEA 4AJPA 1ACJA 4YRZA 3SYMA 1MQ8B 3A32A 4PPQA 5DN9A 4J7AA 2IHJA 3K05A 4CMJA 5A3JA 1K7SN 2CDBA 2FVYA 3AR2A 3G1WA 3ONFA 2FE1A 5BSMA 3W2TA 3ONVA 1M0TA 2AL7A 4Q82A 3PX7A 4TRMA 1UKVY 1GV0A 4H3VA 5AQ1A 2IY8A 2ZXEA 1KEZA 3UWKA 2ZPAA 1PLLA 1SEVA 3C8ZA 1WABA 3U7QB 4NHEA 4B6RA 3G02A 2BWJA 1AXEA 1J5PA 1HMYA 5IBQA 2RHWA 4DL9A 4LRQA 2A30A 3TINA 4YUVA 5BSFA 5HF8A 2I62A 4E4RA 1J8QA 1UOQA 2ZSBA 2BHRA 4PNPA 4YUXA 2WFLB 3ZWCA 2IUFA 1HTBA 4A03A 4BFZA 1HSOA 2GZMA 2OBYA 2JF0A 2FSSA 2HPHA 1KH1A 1DKPA 2Y0DA 1U3TA 2ZP1A 3RABA 5IASA 4GPEA 4YFYA 5KTNA 5KYWB 2QTHA 2FXIA 3O0TA 1YGPA 3UMSA 1WE2A 1L5FA 3MUFA 8LDHA 4GPZA 3R8CA 1Z9BA 2GLXA 2ZR8A 4FQ5A 2NZVG 4H08A 3EFEA 4Y6GB 3V4OA 1CQWA 5JV5A 4RZ2A 1L5MA 1RJ9B 1C8KA 5AYVA 3O4HA 1GTZA 4KNWA 2GEKA 3GWGA 4OXYA 3S40A 5B6IA 2VYNA 1E1LA 1OCEA 2QTMA 3I92A 1MHPA 3OTIA 1PQPA 4WX2B 1BGXT 3L1IA 5DT2A 4OQPA 2ZSAA 3O8OB 3GHHA 1DJOA 2HWWA 4YGYA 4YI5A 4B3CA 3VNVA 2BRUA 1POXA 4DMUB 3B51X 3D8UA 5MN6A 1E2IA 3RS2A 1CS0A 2PKCA 3ESBA 1EFVB 1E3WB 2CJWB 2PZ8A 3HFSA 4ZVOA 2RGAA 4J29A 4QXMA 2JHPA 3FYCA 1CYEA 4EQZA 1VKZA 4G3XA 4UKDA 3AGPA 5HFAA 2A7XA 4OFZA 4MI6A 5FHRA 4H27A 3TUIC 1J39A 2HYDA 1ZIOA 1J1ZA 1NQUA 1ZESA 4S05A 4ARCA 2DT8A 4JLUA 3WGTA 2ZYHA 2XF2A 4OLJA 2IHBA 1SPXA 3Q5DA 2Q3LA 4P58A 3VUEA 1S3FA 1ZJYA 2NO1A 1S3GA 2V58A 5EWJA 3V9AA 4IDHA 4FOOA 1IVSA 1GGNA 2ZUEA 3SY8A 1QP7A 4FJ0A 4TXHA 2IEIA 3CGWA 3NVDA 1AN0A 2ZT6A 3KQNA 1SUFA 3DH0A 4GXRA 4TM7A 5ALXA 3ZVNA 3IR5A 4IUYA 1VYTA 1CUAA 1NXQA 4ZARA 2OBBA 4V0NA 1OE0A 4MGZR 4Q0MA 1U8AA 4IBOA 5DV9A 4TZ6A 5KNBA 2PSEA 2QUIA 2E1RA 2A1UA 2XUAA 4FWIB 3IE2A 4QHYA 4RK4A 3VNRA 2QMUA 3IIIA 3B1WA 3RFFA 3KALA 1UJ6A 1G4AE 3NKVA 1TUBB 3PU6A 2GVNA 4KVZA 4E1BA 2H1OA 4TYQA 1GRNA 2W58A 2RJOA 2ZJ8A 3QLTA 4DCMA 4NQRA 3V4LA 1P4SA 3AZPA 4UE6A 4EIWA 3G59A 2VBIA 4BMXA 3GROA 2J08A 1TPZA 4NZOA 5DRYA 1D2AA 4B48A 4J1NA 3CE6A 2JBAA 2UXDB 3OO1A 3NTUA 5HP4A 2ANBA 2WYIA 4K9DA 1ZH8A 2PRZA 1OIXA 2GDJA 4R1SA 4DNFA 2BGJA 4PWZA 3SZMA 4D3XA 3IPLA 3P9NA 3H11B 4PFSA 3K94A 1X1AA 2I4OA 4KWTA 1JMKC 1GPDG 1LPMA 2IYPA 2ZVPX 2X3FA 3GUZA 4IP0A 4A2WA 5C18A 4HXGA 1ZOSA 1XK7A 3EGEA 4MMYB 3W8NA 1EM8B 1MZVA 4EFKA 2QUHA 4PHGA 4MQUA 1TU3A 1QR6A 4I46A 3I3OA 5TF0A 1KDYA 3STHA 4HQFA 4PLZA 3HABA 3PLNA 3V4PB 2HU7A 4FKBA 4MUMA 2F1RA 2ZRQA 4IRUB 5C5IA 5L6LB 2ZYWX 3OZ7A 4IDAA 4PYJA 3PWTA 2HQ1A 3L9XA 4EPWA 1V11A 4LQLA 2PVCA 2I6SA 4LYAA 2GEFA 2XCTB 5AVWA 3LDHA 4RKFA 3T3IA 3L7YA 2QRNA 2Z5LA 3CPEA 2HEGA 3L40A 1Y63A 4JH0A 2HRCA 1W1IA 3EXEA 1USUA 4AVYA 3HDVA 4HGRA 1VIDA 2GS9A 2PH5A 3WGUA 4B2YA 2CL6X 1Y89A 4R2MA 5JSYA 5HS6A 4WRRA 1O0BA 5ETJA 3W5SA 3DO8A 5IRCD 1LDEA 2RGUA 3M2TA 4Q6WA 1JJBA 4KIWA 1GUBA 4RLSA 2IEDA 4OA5A 4UUNA 1UANA 2ZYRA 3IVRA 4CMKA 5JS2A 2EYQA 3C15C 1J7KA 4M1OA 1JEYB 3NOVA 3AT1A 2Z1MA 3LNCA 2PCJA 3NHBA 5DOZA 1PT7A 5EFZA 5CT4A 4ZKEA 1C3XA 4F11A 3CIOA 1DC3A 2BR3A 2QZ4A 3N86A 3JASA 3O38A 5EMLA 1C8BA 3KB8A 3BWVA 3MVEA 2IHTA 4H2DA 5JTUA 1M33A 1LBTA 4UNPA 4C0AC 4GPTA 3C3XA 4FGWA 3GLFE 5B64A 5I9BA 1LW7A 2IS2A 1ECPA 2DR0A 3BHIA 1ZVQA 2PH3A 2YYYA 1Z4NA 2HBRA 3TPZA 1JPNA 5KNDD 1OI7A 4RWEA 2B5OA 1T1JA 3TECE 1Z2EA 1P39A 1ZNXA 1NWCA 5EUMA 4MGEA 4QARA 3Q7SA 5K03A 3ZD9A 2O57A 1T6ZA 4DUGD 2XPCA 1K97A 1G55A 1CQJA 3SQMA 4DIEA 1POWA 4NDAA 1FIUA 3HSSA 1DQPA 3U1TA 3GAMA 1WKCA 1Z8DA 2IW1A 1XF9A 3H5OA 1KI9A 1I4EB 5LIRA 2UYCA 2D6FA 1HURA 4CKXA 5KTRA 3NYWA 4MW7A 5DNWA 1OAOA 1K2WA 4Z4HA 4P0PB 1LA2A 1NURA 4HAVA 4UHEA 2HAEA 3MGCA 3NKLA 4BNWA 3QWFA 1E6CA 1XWWA 3GLTA 4C78A 4QTYA 3WGIA 1IOWA 2OHIA 1UWVA 3EA4A 2OSBA 4GM4A 1EWYA 4MAAA 2VRCA 3U4HA 4K40A 4BLRA 4CR8A 3UA3A 3ZI7A 1SUPA 2ZVDA 5DNUA 3KV1A 3U37A 3RYHB 3F7MA 4DBLC 1OR8A 3DUFA 1JSLA 3C7DB 4OAQA 2AX3A 4D8YA 4EY8A 3A9SA 1B42A 2A1TR 4D82A 5JVDA 4RD2A 2BONA 3WQBA 1E0DA 1P2FA 5H3HA 3P5BA 2CVZA 3X1JA 1O6ZA 1N2XA 2HL6A 3DP9A 5G0WA 1Z34A 4EYOA 2JFYA 3EQ8A 1QP0A 1PTKA 1KAOA 1NOJA 2BFDA 3L0CA 3L84A 5BQPA 3W79A 2VJNA 2Q3JA 4QEZA 4F7DA 4CFSA 4YR7A 4XYBA 5IJZA 3FWZA 3HE3A 5KHLB 4UW9A 5LMNB 2JG3A 3EMDA 4W99A 3RBZA 1EFDN 4RUKA 1F1JA 2FFHA 1KJ9A 1NG9A 1BSVA 3ZXUB 4NI5A 4LYEA 1V1RB 4TYMA 5EIOA 4DV0B 5DYTA 1QVZA 2IC5A 3LYHA 1XZMA 4RXTA 1DXQA 5ER6A 1FLDA 2NYAA 1QVAA 5KTSA 1CUEA 4Z7QB 4FFBA 1LGYA 3MD9A 2IYEA 2X58A 3ZV4A 2XA2A 4C7OA 3GPCA 1BCSB 3BJIC 4J0KA 4YP6A 4D8UA 3AWDA 1H3EA 2SKDA 1M66A 4DUYB 1OWPA 3TNFA 3TLCA 4Q7JB 4XARA 3H83A 2E4YA 2NM0A 3RVOA 4OHCA 5BOSB 3F46A 3BAZA 3GJ6A 4OBEA 1RXEA 2EFHB 3KOMA 1YR7A 3N8IA 3N7AA 1UWKA 4RDCA 1PNQA 4RHUA 1FRQA 3L06A 3MK31 2GSDA 3P97A 3LBYA 1L4KA 1FYWA 3LY7A 2GKOA 5EKXA 1TT5B 3UHJA 1UDCA 5KSOA 3INRA 2H57A 3IBGA 1H2FA 1XZFA 5BURA 3Q7TA 2Q41A 3W06A 1ID8A 4NJMA 3IO5A 4H1HA 5K1ZA 5C1OA 4BVFA 1RRGA 5ARDA 1P73A 2PG3A 4UHDA 1LU9A 5BN3B 5IYZA 3WLNA 4JYMA 1W0JD 3UT5A 4MQBA 3GRCA 1V5FA 1Q7EA 2GD1O 4D57A 2WVJA 4N0DA 5CTAA 4BQQA 4KZKA 1PR2A 4LGVA 5C1BA 4RTOA 4ZIRA 3KK0A 3BQ9A 4M98A 2JHCA 3IRVA 5JCOA 1FMCA 3WBJA 4LDJA 5LP6B 3WXMA 2R751 1U1IA 2V6JA 2JI8A 3ACBA 3EQ2A 4GX1A 4YJGB 3H3JA 5SY9A 4IS2A 4YRGA 2XGSA 1DOHA 3WMFA 3MFYA 2BY4A 1LK5A 5BMVF 1TTPB 3KELA 1M8PA 4FQ8A 4MB2A 1JBKA 5AXAA 3K4QA 3EOBI 2I54A 4HK4A 3LVFO 5GPBA 1Z7GA 2DPYA 5E1MA 1PI3A 1UP7A 2BSAA 3MMZA 4WMLA 4H4DA 3TOXA 1U11A 3CG0A 1U8CB 3WG9A 3AL0C 1GEEA 4N6OA 2BGLA 1QG2A 1GUFA 4GWKA 2AOUA 2W37A 4U6NA 5EE0A 5I8ZA 3NATA 2NAPA 5IUNC 5LWQA 3G9TA 4KLZA 3SEZA 2VXOA 4EUHA 5LJLA 3BTOA 4A8JA 3K70D 2VPTA 2QG9A 3ICWA 4WDQA 2FPWA 1FSSA 3MRXA 2CXHA 1JDPA 2ONCA 2GBFA 1E2DA 3DVAB 1BMQA 4US1R 4A8HA 4J1QA 3MSCA 4RO0A 4IPTA 4P38A 3FTQA 1ZC3A 4IDGA 4PLWA 2EF1A 1PWYE 3AETB 3H5RA 3HDJA 4YRFA 4EFDA 5KEIA 1LZLA 2OGSA 4KE7A 3LUKA 5JWRA 2GHIA 3C3KA 5JFGA 2ZVQX 2QTAA 3E5RA 3HJUA 4NBLA 3IAFA 3KSMA 2IF2A 3ZV3A 3LL4A 1P5FA 2C5GA 4DLUA 1FY2A 1OIVA 1GNTA 4JSTA 2CE2X 5C1DA 1NJ8A 2X8LA 2J33A 1U2TA 3UGKA 4IOMA 5F73A 1KYXA 4O4LF 4QYMA 2GLUA 3TR0A 2CJXA 4RVOA 3AKCA 5EKSA 4XKJA 4FOTA 2ZU0C 4LRSB 2WABA 4M1MA 4I55B 1KARA 3KG2A 4MS4B 4FX2A 2BGIA 4JWTA 4NBKA 3RTGA 5E3HA 1L4UA 1W2GA 1L6IA 2PDAA 1FP2A 1K6MA 2Z1NA 1V6AA 2Q6KA 3ITDA 4QPNA 5ALQA 3K35A 3TQOA 3C6BA 1WM1A 1X7WA 2AOVA 2YZ2A 1JHYA 5BYKA 4IWNA 3WGGA 4WNIA 3SQWA 1CEQA 5HM6A 3B52X 3VR3A 1FRNA 1VJCA 1Z3IX 3MW8A 4JEIA 3U44A 3DFMA 1FJXA 2V4ZA 3LZ6A 1JDSA 5KDLA 3V34A 1SZPA 1GDTA 4O5OA 2XVZA 3ZY2A 4QO7A 3ZN2A 5D7BA 2DP4E 1G38A 7ABPA 3G13A 1ZM2A 2I2FA 1CUXA 2GX6A 5I7VA 3OHSX 3OZGA 1NBHA 2OP1A 1IG3A 3MS4A 5HJ2A 2GWRA 4KFCA 4E5MA 2BJVA 2W98A 3NIWA 2CVFA 2TS1A 3W8RA 5ICEA 4X66B 1YCGA 3Q11A 1I6WA 3QY0A 5C3UA 2SNIE 2HJ9A 2XB4A 2Q4TA 4N12A 2WM8A 4AJ9A 4CKYA 1JIVA 1GPKA 2C57A 2DXIA 5B30A 4PG4A 5LXTF 4DRYA 5KCMA 3Q8XB 4XVCA 1WVMA 4JBNA 1DWOA 3HYTA 4KX3A 1WF6A 1XX6A 2JEOA 3W9BA 2DPMA 2JNWA 3T1TA 5L3QB 2ACVA 4G0WA 2GAJA 4CGZA 3MB8A 2Q1TA 3HVHA 2GAOA 1UBCA 2HA7A 1B8NA 2E5FA 1UPFA 4O4HA 1XZLA 4K05A 4F38A 2YN4A 3CLHA 3PF9A 5LZ2A 5FIUA 1PWEA 2OCKA 2H1VA 2DH5A 2WTXA 3Q3HA 1CRLA 1AM4D 2W8BA 1A4IA 5AWFC 1N0WA 1IAVA 2AW5A 1E6MA 4U3JB 5I4CA 4K9OA 3DBLA 1DELA 1E5XA 4AI6A 1JHQA 4DAEA 4HUQA 2VP0A 1R4NA 3IAAA 1I7QB 1V5GA 5EXXA 3MERA 2I2BA 4RD1A 1EE2A 3PCXA 2A67A 4G0UA 3OUZA 4G89A 1UPTA 2HKIA 1XZNA 3KZVA 4P0TA 1SAYA 1U3WA 2OQRA 4JXXA 3ZR4B 3LIPA 4EI7A 1Z0DA 2QRLA 4C7MA 2IH5A 4FSHA 3DF9A 1G8PA 2B6HA 3GJ4A 3BMXA 1Y7HA 1FFDA 2D4AA 3M1LA 4RGQA 4KPFC 1MZPA 1O1YA 4WVFA 2PJDA 4YJ3A 3UWOA 3IAS6 3HLTA 4KFTA 2OYSA 3JALB 3R0QA 2F67A 3TAHA 3WXBA 5JMPA 4GMXA 2ECKA 3F49S 1K7YA 2OV3A 4KXFB 1I10A 1QC5B 1CR0A 2PA3A 4AMBA 2DCUA 1J33A 1SPBS 5KNCD 3RVMA 2FEWB 3C98A 4MXDA 4P32A 1PFWA 2NVUA 3D81A 4NONA 4BKPA 4DIBA 5JNVA 2PUFA 4LDNA 4LW8A 3NVMB 1QIIA 3CY6A 4QAJA 4DYDA 2FWJA 4R40A 4PN7A 2HQSA 2W5UA 4BLSA 1ELOA 1PR4A 3TIFA 3WB1A 2PAFA 3A0RB 3D4IA 4J0GA 1KI7A 4MIYA 4P3YA 2QL7A 2FZGA 3UYKA 1Q0LA 3KU1A 3QFCA 5DW0A 1J0CA 1D2RA 3DCYA 3CUTA 3MMNA 4HR7A 3W04A 4LRYA 4LY9A 3O4FA 1RYYA 3W0LB 1VE6A 3ID6C 5GV7A 1ZNZA 4EG0A 3GFSA 1WULS 1RXSA 3I6YA 1ZH4A 2EEPA 3IBCA 3KHUA 1ID1A 4IZHA 3S99A 1GA1A 5IWCA 3NAQA 2YN0A 5E8RA 2Y27A 3W3AH 3UV7A 3KEMA 4FU0A 2VJQA 3GN2A 3L7MA 4DR1B 2VUTA 1N1EA 2GD2A 4PYIA 4BAGA 1T25A 5LP1A 2I03A 3R6TA 4P83A 4IIHA 4MOWA 1YZ3A 3ZGNA 2EFEB 3D5EA 4Y0NA 2BHNA 1IXSB 1KDVA 2XZOA 5HK9A 2JZCA 2FEMA 2X8AA 4OXNA 5P21A 1Q83A 4B4WA 1NBEA 1NM5C 3R7SA 4YXWD 2QYTA 3HMQA 2MDTA 4L3OA 1G8AA 1M7GA 1NDUA 3DAPA 3IPYA 4RKWA 5TPWB 3UQYS 5FAKA 3BGOS 2W6ID 1QJ4A 1YBHA 4RS4A 5CG2A 1X74A 3O95A 4GAEA 2C96A 4J0FA 5BUCA 5IPFA 4R2HA 3ROEA 2LIPA 3W5DA 1J99A 1XVTA 2D74A 1T3LA 2PU7A 3C8HA 4PBTA 4ZVSA 2YASA 1JSXA 1YR1A 5CIWA 3T1YB 3K71B 2YBDA 2CVOA 4NY1A 1GFWA 1GLGA 1DZ3A 2PZLA 1NF3A 1WO8A 1RRVA 3K2EA 5FCDA 3RT1A 3UFBA 4H4CA 1BRMA 2JD2A 1N9GA 2CXPA 4P98A 2EZ9A 2DHCA 4ZEWA 2IBSA 2DUNA 1AGPA 4JCOA 3UAOA 5DCLA 2RGWA 1BGVA 1OLSB 3GEBA 1IXKA 3IB3A 3COVA 3G5AA 3QW4B 4WIAA 1GR0A 3VAYA 1L5GB 5KYYA 1SQFA 1O9GA 1IJKA 1IHOA 1R16A 3E9NA 4EHIA 3H86A 4GYWA 2XKKA 4YCNA 1RT9A 2O0KA 3CVOA 3LW8A 5CT8A 5KBYA 1M1YE 3OPXA 3HZOA 1PEDA 4MUFA 2F3RA 2OMKA 3PUIA 1I6KA 4P35A 2BM8A 1M2HA 4L95C 3WGHA 3WLLA 3EVZA 3DA8A 1NW7A 3G2JA 4XGQA 5IZCA 2IHKA 2ZB3A 1LY1A 4ZMBA 2ZDHA 3L0PA 4PE5B 2QT0A 2GF2A 3R75A 1F0YA 4L85A 4DCPA 3H9EO 2AV6A 5JO9A 2IX9A 4BVBA 2WIKA 4X92A 5A02A 3U80A 4W5QA 2H1FA 2HC9A 2V03A 4W8OA 5EJ5A 5JPDA 5BW8A 1B43A 3GMDA 4KBGA 4IICA 1RU3A 4FI3C 1I0ZA 3OCUA 4JBXA 1VJGA 3U26A 1E2HA 1ZUIA 4GVXA 3DF7A 3ER8A 5ABPA 1A9OA 4AJ4A 2FZCA 4U5XA 1SOUA 3KVNA 1WDLA 1EJ6A 1E2MA 3FZEA 3HO1A 2VYFA 2OZKA 3I9NA 5DGXA 1M6VA 2HA2A 3A36A 4GI3A 5IVDA 1TO1E 2FW8A 3L5OA 3QVKA 4HFMA 5B3AA 4BZQA 3JWEA 3W5IA 4BUZA 2VJCA 3I0MA 1U9ZA 4QUGA 2HADA 2O2IA 3DOCA 3MWYW 5K8LA 4TSRA 2QM0A 3IEPA 3DTVD 4D4JA 4ZDKA 3U1VA 4I1PA 1KMIY 2QTBA 4EWLA 1MFZA 2OAGA 4ZWNA 4ZD6A 3EGIA 3FWYA 4H1TA 4MV8A 2WQ6A 3C3CA 5AKZA 1I1OA 3D1JA 1R8YA 3TSCA 3LSTA 1UQRA 2Q1UA 2FMUA 3OZWA 4GRDA 4URFA 5JSFA 4X6YA 4EVIA 2JH8A 2A3RA 4TTSA 1T29A 3F1LA 1MG5A 1AMUA 1J9GA 2V6GA 4PAOA 3DZBA 4RESA 2IYRA 1M83A 2ETVA 4MWSA 4DDTA 4PPYA 3BCSA 4DV4B 3SE0A 2NQ8A 2UVQA 3CBGA 4FW8A 4B82A 3RYIB 2FN9A 1KFKB 5GY7A 4PZEA 4E7PA 1D4OA 1G63A 1N92A 1RJGA 3R6LA 4P1ZA 3I12A 4XW2A 2YJ4A 4PZPA 5KHOC 2VS1A 1TU4A 4RTRA 1P0MA 4JODA 1L2TA 4LZWA 4EHLA 5HJEA 5GINE 4HTFA 4KXUA 3O75A 3TZLA 4BX0A 4PCLA 2AN5A 1YA6A 5F1KA 1IU9A 1AO0A 4C6RA 3IQEA 4BV8A 3QOYA 1IQPA 2XUPA 5ELMA 8ATCA 4PX2A 4LPSA 1ZI8A 3USES 1P18A 2VEOA 4MINA 1YIOA 2EJVA 4YLGA 1PS8A 1YC5A 2W6JD 4IDQA 1YTLA 1YOVA 5JIBA 1F2TA 2P0AA 2WM9B 2NU8B 4BNKA 4U7FA 2NOAA 3O1HB 5DLEA 4HVCA 1UAYA 3QX9A 3ZZTA 4D0SA 1YR6A 4TVKA 3EXG2 4UD2A 2ZROA 1EFRD 4MS3A 4LSGA 4HAIA 2YW2A 1H0SA 2J7PD 3MSXA 4BWYA 2XVMA 5JJBA 4M8LA 5ULLA 3WMRA 3A27A 3KYIB 3LXMA 1AUPA 2QWXA 2ZYUX 3O6VA 4PIVA 1WZIA 3DHYA 3G9QA 2J09A 3TLEA 4EMUA 3VR6D 1PNVA 3K09C 5I7OA 1VL0A 1JLLB 3KD2A 3ZXXA 3CU5A 1LSOA 2V0GA 1FNDA 1DCMA 1HQCA 4G4GA 5H82A 5HBGA 4YP0A 3RVBA 3MUEA 4Y8VA 3O47A 4HDNA 5I7FA 5MGNA 4QOHA 4W8HA 2NLOA 4YCMA 1W0JA 4WOKA 4DSNA 4OM7A 2ZANA 2NO7A 3FVRA 3NNDA 5HKLA 3O9ZA 2J9GA 4JA2A 1D2MA 2QUJA 2QUAA 2V7QA 3M4JA 3H0EA 4LQCA 3RIXA 4EYSA 1A8SA 3ON5A 3JTEA 1S2IA 3VAZA 3EGDB 3FNIA 2HD4A 4NU6A 3VPFA 3R7NA 3DVLA 2D2EA 1HZZC 3Q5GA 1Q2XA 2PEZA 3DV0B 3TRHA 1Z6YA 4J9UE 1QRAA 3I34X 1ZK4A 3HO6A 3NVAA 5JWHA 3VH2A 1A8HA 4FD2A 1MX1A 2ZI5A 2ZCUA 4M99A 3B12A 1J2UA 1TKAA 3NETA 4HQOA 3KOWA 1KYVA 2CGEA 2VPQA 4JVOA 3UKJA 4ATNA 1MAUA 5FBWB 2OBNA 2XWJI 3G7SA 4XTCS 3FYDA 3SXPA 2FPIB 1H9CA 2GFIA 4F5EA 4M38A 2CLOB 4WNCA 1ZFNA 1ZGBA 2EERA 5JROA 2QLJA 2B3DA 2BEWB 3OG9A 4JB3A 1H66A 4KQ6A 1SUSA 5T6BA 4MR7A 4WZBB 2WVHA 4TXMA 1MX3A 4YMVA 4ID3A 4BGIA 1JQEA 3T3PB 1T5BA 1FUYB 2BDTA 3AEKB 4FDUA 5H3CA 3VYSB 5TE9A 3ZTWA 3LBIA 5D6OA 2OZLB 3EYAA 3RYFB 1V3UA 5SZIA 5JNUA 3UMFA 1JPUA 1C1XB 1YZKA 3S1SA 3AHFA 2IELA 2JAOA 4IJQA 4QYIA 1E2EA 1XTVA 3ZBTA 2XECA 2CJPA 2P90A 3ICVA 3NTXA 4H7HA 1ISJA 4IVRA 1IRIA 4JEMA 3C3PA 1TK9A 2P0EA 3DO6A 3C3EA 4MR9B 4DN6A 4DZTA 5FPKA 2HXYA 3CW2A 4LDRA 5ECYA 4DCNA 1RWOA 2Z56A 1MJNA 2P5UA 3ABQB 1JJVA 1QUEA 3SS9X 2A9VA 1JKJB 2CD9A 3LI2A 4FCVA 5CFMA 3LG2A 1TVCA 2BM9A 1TQ8A 2JFHA 1QQ7A 4JLKA 4DG8A 1L0BA 2C2OA 2QR3A 3GJ5A 4NMHA 4AJNA 4RDXA 3UG7A 1X7XA 3CF6R 5EZ5A 2CXRA 5H9VA 4XVHA 3X43A 1I30A 4WLEA 1NW9B 1GTRA 3ANXA 3Q8MA 1UBEA 1NIJA 2ENUA 4HLQB 4QULA 5T64A 4BV3A 3NOXA 4EA8A 4C0HA 2GD6A 5E1BA 4GMHA 4GICA 3FNGA 3H1EA 1QLHA 3DEHA 2OE2A 3HJRA 1K7EB 3FPSA 1UKZA 2YHIA 5LP6C 1OX4A 4CQNA 4A6XA 4WK2B 2H4FA 4GGPA 3V2IA 5I5EA 4K6HA 1N33B 5DT9A 2W2KA 3ZVKA 2R96A 2IODA 4A92A 2H2FA 2WKQA 1J7JA 3MWGA 2G4LA 3P7MA 5F3DA 3H9UA 2Q8NA 1ZGGA 2FFJA 2DQYA 4L27A 4M6WA 4OH7A 1KDZA 1N6LA 3FA2A 3T9FA 4JENA 1Y6JA 4KPEC 5DTIA 2OHHA 2EARA 1N32B 2NX2A 4UHBA 1ETUA 4ZYVA 3W4JA 1T6BY 2P2NA 4Z0PA 1QHEA 4IKPA 5TQ0B 2SECE 2EKLA 5KC9A 1B23P 1E79D 2Q5JA 2QJTA 5JXGA 3ND7A 1NXXA 4J43A 3ZXYA 1H1LB 4OBWA 1ZKDA 3P9QA 1DV2A 3T7DA 3U0BA 4GBGA 3OOEA 3GCDA 4MCIA 3UMCA 1JLRA 3OQMA 3DHEA 2QBYA 2VDPB 4BAZA 4KQ1A 3NOOA 2JGNA 3CR8A 1ZC4A 2FEOA 3BXHA 1ZI9A 2AEFA 3IA2A 1RI3A 5DOVA 3B9RA 1R64A 4JLWA 2CKMA 1JQ3A 2O1XA 4MQ5A 4K6KA 3VR2A 2E4ZA 2C3YA 3GT4A 5LJIA 1OAAA 4QATA 4CKWB 1QVWA 2IP2A 1VJTA 2O4UX 1M1UA 4M8KA 4HGPA 4JC0A 5AI9A 4E5UA 2BCJQ 3VH4A 1O96A 1KMCA 3OOSA 2IPAB 4JHXA 2W6PA 4RVCA 4YMHA 1A9XA 4ZTZB 2RGYA 3EOAI 2YJZA 2YIDA 5AUQA 1Z2CA 4YRDA 3EEFA 5TRTA 4BWFB 4F93B 1AC5A 1EVEA 4NYMR 2BKVA 3E18A 2HQRA 4IKEA 4EQ6A 4UTPA 3GGJA 2BI8A 4WKCA 4DHWA 1P7CA 4MUYA 2FMFA 4HAYA 1E3EA 4IV8A 4PR3A 3WHPA 5ISMA 1N36B 3AJDA 4IIXA 3IHLA 4D0NA 2C2YA 2C98A 1SULA 5KOIA 2P4EA 3LC2O 2W2PA 3RS4A 3JZFA 1SGWA 4UZFA 3GVIA 3O1IC 4AYWA 3V32A 4HEA6 3EUAA 4G4JA 3I2YX 5B3KA 4J2TA 4YHBA 3GXOA 4CUZA 2XCRB 4IIJB 5AD1A 2EBHX 1A4XA 4AKEA 4FFOA 2X8JB 1P9WA 2NZXA 5LL6P 2DFDA 4MVWA 3O3MB 1T4GA 4NZMA 2J3QA 3NJ8A 4Q00A 1P1KA 4K9SA 2JKVA 2DBRA 3CF2A 2P2ZA 2XUHA 3KE8A 4INPA 2QXUA 4TKZA 1O94D 4LK2A 1QHFA 1L5VA 8GPBA 4EGFA 3AUAA 3UMMA 2QB5A 1OBCA 2XAUA 1RZVA 3WGZA 2G07A 2CEAA 1L4GA 2FQWA 3QGMA 1V8FA 4MUBA 4TTVA 2JFZA 3TW4A 3OCZA 4B3SB 1RP7A 5B3JA 1NRJB 5BXYA 1G4UR 2NT3A 4O6VA 1ES9A 3TR6A 1T1IA 3LJKA 2Z0MA 3LBNA 5AW3A 1YCHA 2UZAA 3CT4A 2WAMA 2WAAA 3PYMA 4OMFG 4CQMD 1G59A 4L74A 3KB2A 1EWVA 1FRZA 1OGYA 5KYXA 2XA9A 4GI7A 2I0FA 4JOBA 1JG1A 4R1UA 4V3BA 1B8VA 4EPXA 3KSRA 2QROA 2ZIXA 5IH7A 4OUDA 4LSMA 1V47A 1G21B 1PF7E 4RYDA 2C5HA 3KVVA 3KQWA 1FFBA 1MQ9A 1VG0B 4DRXA 1PQYA 2ICAA 3OIVA 2BFCB 4IQ8A 1U8TA 4YXWA 4P92A 3KXIA 4EUFA 2GI4A 2RIPA 1RIFA 2QAJA 4NH4A 3W2IA 2D4HA 1P2BA 2GCPA 3V2UA 5KVVA 4CNQA 2FFQA 3F71A 2XZDA 1QO0A 4K0KB 5CEJA 1PQ4A 1RXYA 1W4RA 4RHYA 1MO5A 2P5SA 2J0UB 3L6CA 1LLQA 3V42A 5GWXA 5IFLA 2X86A 1GAQA 2I6QA 1U6IA 1KI1A 3SVZA 1KERA 4U2GA 1U0BB 2IQ5A 1JJAA 2ZRDA 3E82A 2Q2QA 3ZCTA 2P9GA 1CNFA 2WV7A 1QGED 2JFFA 2D1RA 3AHEA 4HJXA 4N6GA 1QV7A 4Y6LA 1K9VF 3ZWQA 4Q66C 4D8VA 1S8NA 1CJMA 1E20A 1T36B 2J9YB 4TX1A 4YFVA 3D3KA 5DNAA 3R7WA 1TU0A 3DE2X 1NRXA 1ICEA 3QF4B 5ALYA 3S4YA 5TC4A 2DU8A 1P0IA 2Q1WA 2C5SA 1IY8A 1XG5A 1HNNA 1Y4AE 3M0EA 1EBBA 3JYQA 5DX0A 2VH1A 3DV2A 4MX8A 4W6ZA 4MVJA 5AKJA 3SN6A 4YYZA 5HRUA 4WOBA 1TMOA 1V37A 4MLCA 1XD2B 4CU5A 4U4AA 2XIJA 3H8VA 4KOEC 1PS9A 1ZM3A 4EATA 5AFSA 4Y1EA 1T2DA 2OHXA 2OVFA 1E8DA 4TUYF 5E38A 4HYQA 1BXGB 1Z4OA 3BXFA 2B7BA 2J6CA 1P72A 2ID8A 2FWAA 1RYMA 4AICA 4C06A 5A9RA 4FB5A 2QOEA 1RP1A 4NAUA 3PJDA 5TNXA 1RYZA 2DFPA 1ESZA 4MULA 2QD5A 3BOSA 4TS9A 5HA5A 4MRNA 4EI8A 2JANA 1U4NA 1A9RA 1KP3A 3I5MA 3G8YA 4M9QA 2UZ4A 1U8FO 3TZCA 2FWNA 3C45A 3W1WA 1JU9A 2IEBA 3ZDQA 1UPUA 2O3UA 3L0OA 4NL4H 5BR1A 2G9ZA 1OB5A 3QP9A 2HIAA 2R8XA 2D3WA 1QHNA 4R2LA 2Y6UA 1RS0A 2RH9B 4L50A 5ENDA 2F9FA 2FWMX 1WTAA 2JAPA 3M1AA 3UH0A 3RRJA 3HACA 3E9RA 2VRNA 2WWFA 2YY6A 3PKZA 5E0OA 4HGNA 3I5AA 4PZDA 5KCZA 4RIFA 3SWWA 4UHKA 3DMYA 4I4TB 4G86A 1JEDA 4JU8A 1P1JA 4WESA 3TLYA 2ZRJA 3GA0A 4N03A 5T4BA 1NYLA 3BSWA 4RW0A 3FE2A 4ZCSA 3WYAA 4BMZA 4LQ4A 2ILVA 1VLMA 2K5UA 3EGXA 2G8LA 1Q22A 3ILHA 3MLAA 5H3LA 3U9LA 4JVSB 5G4KB 3WP0A 2JCVA 3OIFA 3UMRA 3QTBA 5LFAA 3JWGA 4C08A 2I2CA 3B2EA 4OPMA 3KYCB 1YR8A 4BNIA 3K0EA 3M49A 2PIAA 3CLUD 1HYEA 4FNOA 4QYXA 5THXA 3ZNQA 1J9EA 3CSUA 4BNDB 2CSUA 2D2FA 2VTKA 4L8LA 1JXQA 1CEXA 3C5EA 2FW0A 2WNSA 1D7AA 2XGGA 3CX6A 1O5TA 4CPDA 5J3JA 2I7CA 3D8HA 4NNOA 4QDKA 2HB6A 4P4NA 4PR0A 1ZK2A 1Z25A 2HPVA 3FKSA 1R5NA 2J3DA 3D59A 4YCCA 1X1CA 3O74A 4CLRB 1AHPA 2NN3C 4HDKA 4KVFA 5IN5A 2O19A 2FN7A 2WTEA 4CM1A 4OYLA 3GJXC 4Q4HA 5BSHA 3QVLA 2I76A 3LT0A 1E4EB 2WR8A 2XI4A 5JOQA 3O8CA 3ZDEA 3U4QA 1PVOA 2J9XB 3D4NA 2FUG1 4P08A 4WFQA 1U7DA 4UNNA 4CLOA 3JATA 5L8VA 1UXHA 4DQXA 3GFOA 2Y1LA 1RJFA 1RZ3A 3CXUA 4OHKA 3WZLA 1QBGA 1OT3A 1KNQA 3HMKA 4FEAA 3ZH2A 2NU6B 2R47A 1RCUA 2VK2A 2ZSEA 3QMWA 3DM9B 3SR3A 2XD4A 3DE1X 4I4CA 4RPGA 4K8RB 3AHHA 1SUBA 1C3VA 1S2GA 3KKEA 2WF7A 3Q0IA 2C20A 3R4CA 2DLDA 2GA9A 5EGSA 4EHFA 1DXYA 1CY4A 1DQSA 3KZCA 1O6CA 1M0WA 2CV1A 3HC7A 1F8YA 4YO8A 4Q16A 5BWMA 1YB7A 2QZSA 5KPDA 1CZOA 4S24A 1C8VB 2BPOA 3HCRA 3LC0A 4K86A 4B3FX 3V8QA 2YN2A 4ZV7A 3PTAA 1Q5PA 2B35A 2JVJA 1S2LA 5DMHA 2AE2A 3OZBA 4R16A 5JBQA 1XMQB 5TPZA 2XHZA 2LTAA 1I3LA 2CYCA 3MNFA 4JI6B 3QU5A 4FB4A 2HHHB 2I66A 3T3GA 1BVYF 1L5ZA 2ERXA 2Z2ZA 4RA9B 4BUCA 1DV1A 4UCQA 2CNNA 1M8JA 3U7QA 4AKGA 4WZAE 2F8MA 4L9AA 1PR3A 1EWQA 1XTSA 3C24A 2C9YA 3CM0A 2OGTA 3GDWA 3MIIA 3PCTA 3HDYA 4BEBA 1JQKA 1KPIA 1NM5A 3NT4A 2G4VA 4ML3A 2H4ZA 4UPEA 3KTDA 1BKYA 1NR1A 4QQRA 2AXNA 1WXDA 1N57A 1U1CA 2WFLA 2DQKA 3D3WA 1GRVA 2I6FA 4MVJM 1XMXA 3INNA 1NVVR 3C7KA 1YZUA 2HPZA 2IZZA 3KU4A 4ZI5A 3RSOA 3F3YA 5ESXA 1JXAA 1YZHA 3EUFA 3I53A 4DDUA 2F3SA 3EA5A 3H9CA 4NCAA 4QNRA 1I1NA 4QLAA 4ZI7B 1M34B 5FX2A 4AX4A 5KYWA 4M3NA 2B2NA 4F45A 4AJLA 3NALA 3WICA 1OROA 3PFFA 2D00A 1JHAA 5E9WA 2X3UA 2QD1A 4RJIA 3VC2A 1OU0A 2GZHA 2QN8A 4A4DA 5AR1A 4EKYA 1DPFA 1GQOA 4OYHA 4GP6A 2GASA 5CCDA 1L7QA 2YDYA 3OUTA 1Y3HA 4UEJA 4YAFA 3RSZA 3O8OA 1M7HA 3G0OA 4R31A 5LKRA 2GPWA 3KSBC 3K9CA 1LI4A 1H1TA 3WAKA 3ZWNA 3LHSA 2QMYA 4LNUB 3N3BC 3NJ4A 4ZPXA 1WSDA 5T3YA 3PK0A 1VA4A 4DF3A 4F85A 1EFVA 1P6UA 2CJWA 1JB1A 4R3NA 2C2WA 5B58C 1CF4A 3WRVA 1K68A 4IIBA 1YIDA 2CYBA 4JI1B 3PXGA 4CDGA 3U4IA 4Q9DA 3K8OE 4JP3A 2DUWA 3L7JA 4RM2A 5CBKA 3GL9A 1ULZA 4Q24A 2UXCB 3IIKA 3B6EA 3WB2A 1MCZA 3EBPA 4ARAA 3FOBA 5H9WA 3KQHA 4M49A 4C0BA 2YWJA 4KVAA 1IVNA 4UNSA 3MJ4A 1MRSA 4I3HA 1WWKA 2HJGA 5K6RA 4FEYA 3RVLA 1RPZA 1KR2A 1XELA 5IF9A 4F84A 2OCPA 2VSXA 2YV4A 3MOGA 3AI3A 3NYIA 1J8DA 3PUYA 4LVCA 4G1VA 2OORC 1ZW6A 4R1LA 3CRQA 4U7JA 1BS2A 3HH8A 2P91A 4Q18A 3I42A 1W85B 4G5OA 4FSDA 4G0YA 3T3DA 4HNHA 4MV9A 3V00A 1Z0KA 1QWSA 2H92A 1KZ9A 3OCWA 4LBVA 5CNMA 3SAJA 2ENWA 5LQNA 4O29A 3KYBA 1KJQA 1TUBA 3FLBA