1X94A

Crystal structure of a hypothetical protein
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
191
structure length
176
Chain Sequence
b'MYQDLIRSELTEAADVLQKFLSDDHNIAQIEAAAKLIADSFKQGGKVLSCGNGGSHCDAMHFAEELTGRYRENRPGYPGIAIDYVFSRYVEAVGAKGDVLFGLSTSGNSGNILKAIEAAKAKGMKTIALTGKDGGKMAGLADVEIRVPHFGYADRIQEVHIKIIHIIIQLIEKEMA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative Phosphoheptose isomerase
publication title Crystal structures of two putative phosphoheptose isomerases.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Isomerase
total genus 66
structure length 176
sequence length 191
chains with identical sequence B
ec nomenclature ec 5.3.1.28: D-sedoheptulose 7-phosphate isomerase.
pdb deposition date 2004-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13580 SIS_2 SIS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10490 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glucose-6-phosphate isomerase like protein; domain 1 1x94A00
2UUBB 2CXNA 1C7QA 1N34B 3CVJA 2CXRA 4TOIA 5FLXA 1IRIA 1I94B 1JEOA 1TZCA 1U0GA 4YY3B 4JI2B 2Q8NA 4DV5B 4LF4B 4DUYB 2ZJ3A 1XNRB 4LFAB 1U0FA 2CB0A 1N8TA 2O2CA 1IBMB 3FF1A 4DV3B 2HHHB 2UUCB 2CXQA 1J5XA 3SHOA 4DV0B 3T1YB 4DR1B 3BJZA 1XMOB 4LF5B 3IFSA 1DQRA 3J81A 5LMUB 5I01A 2CXSA 4X62B 3JAMA 2I2WA 3J80A 3EUAA 4X65B 3NBUA 3HJBA 5LL6P 2UXDB 3J7AC 1GZVA 1B0ZA 1X94A 2E5FA 1FJGB 3UJHA 4LFCB 1IBLB 4B3SB 1ZZGA 4LFBB 4JI6B 2XHZA 4M0DA 1TK9A 1X92A 1JLHA 3C3JA 1X9IA 3TRJA 1HR0B 3M5PA 2A3NA 3TBFA 4NXMB 1N33B 4X64B 4AQYB 3JX9A 5BR8B 3ODPA 2ZJ4A 4LF6B 1JXAA 3FKJA 2J6HA 3PR3A 1N32B 1U0EA 1MOSA 2PUTA 2VQEB 3OTOB 1XTBA 2ZM6B 2V4MA 3HBAA 1HNWB 1G98A 4JI4B 3I0ZA 4LF8B 2WU8A 2I22A 4U6NA 4LZJA 4DV2B 1XMQB 1X9HA 2CXUA 3QKIA 4B3TB 1C7RA 1HM5A 3OOJA 4JI0B 2X3YA 1TZBA 4IVNA 1JIQA 4JI1B 2PUWA 2CVPA 3Q88A 4LF7B 1T10A 5BY2A 3ETNA 4YHHB 2UUAB 4JV5B 2CXOA 2PUVA 2POCA 1IATA 2O2DA 2F4VB 4EM6A 2UXCB 4DUZB 3Q7IA 4KHPB 3LJKA 4DV1B 1Q50A 4JI5B 3T1HB 2VF4X 4LF9B 3FJ1A 4S1WA 5IWAB 1M3SA 5A2QA 2UU9B 4JI8B 4GKKB 4JI7B 4B3RB 1NUHA 1VI5A 1NRIA 1GZDA 4DR4B 4DR5B 3FXAA 2E5LB 4OX9B 4DV6B 2YVAA 1J5EB 4DV4B 2UXBB 4DR7B 1N36B 1IBKB 3G68A 1VI6A 4JI3B 2AMLA 2VF5X 1MOQA 4GKJB 2XBLA 3BCHA 5IT9A 4NXNB 1XNQB 5LMNB 1HOXA 1MORA 1HNXB 2DF8A 2PGIA 4S12A 1HNZB 4X66B 4K0KB 1KOJA 3KNZA 4B3MB 4DV7B 1VIVA 4DR2B 1VIMA 2VQFB 1WIWA 2DECA 4JYAB 4DR6B 4AMVA 4DR3B 2CXPA 2CXTA
chains in the Genus database with same CATH superfamily
4IIJB 3CGGA 1Z82A 5AIBA 1QK3A 4EKEA 5EE5B 5GJWC 4L22A 1N2SA 2JHAA 3AXTA 2ORWA 1NHGA 1MXFA 4LI3X 1K06A 4P3NA 4R9RA 2GD0A 3PQ2A 3C3MA 4LFAB 4PFKA 1PFWA 2LD4A 2PYZA 2XCRB 3SEQA 3LBHA 1K6IA 2Q3HA 4G1EB 4XX1A 4Z4CA 1TTPB 1Z0ZA 2HRDA 4KMRA 3GJTA 4LTDA 3R2JA 2AW3A 4R8MA 3VPXA 3KQNA 3BJZA 4QUJA 1Z5UA 3H17A 2JA2A 3I2YX 4OQZA 4BQIA 1XZDA 3FPLA 3KPJA 4LA4A 4AW9A 4ZQHA 1PZGA 5K8CA 2Y71A 5DGCA 1H3FA 1AB6A 4ZGWA 3ILSA 4QJBA 1X39A 3J7AC 4HUQB 1A8QA 4ICIA 1DBPA 2A6PA 2AXNA 3HBMA 3LP5A 2GTIA 2ODEA 2VYNA 2FMIA 3IRVA 5G4KA 2P5SA 3R77A 1GYRA 4O8ZA 4LDZA 5D3MB 5EXTA 1TC2A 1CUEA 4JJGA 3PP8A 4G3XA 4B6PA 4D0NA 1KSFX 1Y7TA 4RC9A 2ZYSA 2WZCA 1VOTA 4TTVA 5FOSA 3PGXA 2YWFA 3DR5A 4ZU1X 1VKRA 2WWGA 4JP8A 1E59A 3IDFA 4RL4A 2J7PD 2VJQA 4TKZA 2VAPA 2HPAA 2WA2A 1I3NA 1WDWB 3KZNA 2IOYA 2FX5A 3ENVA 5FOXA 3SMVA 3W2FA 1KMCA 2PH5A 3KWJA 4A10A 5IJ0B 1IAQA 2Y0EA 3PLRA 2C9ZA 2XH8A 4AB1A 4HGPA 1CB7A 2P9BA 5D85A 4NCXA 3DPUA 2YWCA 3PV0A 1A95A 1X7YA 4D41A 3BWYA 2XCSB 2B6HA 2X2EA 1U7DA 4RSGA 2WWXA 3GLIB 4JGGA 2HTFA 2DVMA 4M8IA 1ISPA 3LKVA 4MR9A 1Y1PA 3CXUA 4BIIA 2R68A 5ALWA 1AJEA 4IXDA 1I7NA 3MB5A 4X1KA 3SR3A 5HUJA 2UUAB 1K5DA 3E2MA 5DW3A 1KDOA 4RFVA 3VYVA 5J3JA 4PPYA 1DQSA 3WVNA 4B84A 4F8JA 5AESA 1EZ1A 3E4CA 1TCBA 2C99A 2O8CA 1ZY2A 4LRQA 3JATA 4YAIA 4ND2A 1Y3AA 4EHNA 3H2ZA 4GPBA 1KEEB 4B45A 5BV7A 2QM0A 2H9YA 1MXHA 2P2GA 2QMZA 1OA0A 1WQ3A 2HLNA 2OCLA 3CSUA 1L4GA 2GD1O 3NIWA 4DLXA 4NBTA 4P4LA 4HR7A 1J5EB 4E03A 2Z5FA 2YV4A 3DE4X 1U3DA 4ZVSA 1UM9B 3LBYA 3OO0A 4XUCA 3AH8A 4DKJA 2BFMA 1JKXA 1LJUA 5E8RA 1VMIA 3FTDA 3JQCA 1KZ9A 2KWIA 4MQEB 5DKFA 4CCAA 7YASA 3WK4A 1XE3A 1S1CA 1JA1A 2WF9A 2XD4A 1ZSYA 3ITNA 2GB4A 3I23A 3L6DA 4EY8A 1AN9A 4RTLA 3FJYA 2JBHA 3LSTA 4P83A 3ZHTA 3NB0A 4L5AA 3TIGA 2IOHA 1CDZA 3ANLA 1T2VA 3RROA 4XDYA 2R8ZA 1ZM4A 3G8BA 1AQLA 4YRAA 1KL7A 1JB9A 3FTEA 4JUAA 4BFVA 1KMNA 1YOVB 1JTFA 4JH0A 4NZYA 4GEGA 2UUOA 3CUVA 4TKUA 4K9MA 3DDHA 5G2OA 3V3TA 4R1PA 1K4MA 4QARA 2GK6A 4YRRA 2EHJA 1N8KA 4KMOA 3PUWA 3BWXA 3K6KA 4LVOA 5I5GA 1Q0PA 1PP4A 3E8SA 1N6OA 3O03A 1QV6A 2PR7A 4Y9DA 1J21A 2ASVA 2P0AA 3OLVA 5GIOE 3MGKA 3V4SA 2A14A 2GF0A 3PX2A 4W5WA 2JDID 4X65B 3ZY6A 5ICCA 4QXQA 3BRWD 4UAVA 4NCAA 3PIIA 1IHXA 2GGSA 3IPYA 3STHA 1G8GA 1PF7E 3LUGA 1BS9A 1LDMA 1SD1A 3QBEA 3QBTA 1C7FA 3B3QA 4FFPA 3PHHA 4TV8A 5EWJA 3WRYC 3EH1A 2A1IA 1L5FA 4FEYA 3WLIA 5K0ZA 2HK7A 2PWPA 1UFVA 4JLJA 2CVZA 2OWEA 3DA8A 1C3EA 2FWPA 3VU8A 4UOZA 4TMWA 1TL7C 4RD3A 4QUIA 3AJRA 2G70A 4DGSA 4DWVA 3BMQB 5E9WA 2GN2A 3QG5A 2WSSD 3WB0A 5A4JA 2QY6A 3LQFA 1N32B 4FI3F 3WBKA 2BGMA 4KK4A 3ESYA 3CPJB 5KQMA 4GZ5A 1R9MA 2ZI9A 3DT8A 1JJIA 3EZ6A 3KEQA 1U2RA 4L4RA 3L79A 4XB6B 3S2EA 1NBMA 3M6VA 3TLZA 1W52X 3L0SA 3AF5A 3E3AA 1COWA 5JS7A 4LBVA 4E12A 2ATIA 1B14A 2X42A 3N07A 1LCIA 3T3IA 4KVGA 3NT2A 1B3RA 1ZJ5A 2A0XA 5AVZA 3U7GA 1NDQA 3EE6A 5DXFA 3F49S 4MJLA 3AEQA 4PR0A 3IBCA 2VBGA 2Q6OA 2EBUA 3DTTA 4M8LA 5KS2A 2ZR8A 1B6GA 3Q7QA 5CAEA 2VAXA 2R62A 2OQVA 4DXHA 1LQTA 5K2MA 3I72A 4ITVA 3C4QA 3WTBA 3V3KA 1Z07A 3ACDA 2RSLA 2V98A 1R27A 3OBBA 4TXMA 3ZH9B 3VSCA 4N39A 3FCUB 1NF2A 5DSZA 5IDQA 2PV0A 2I6SA 3ZD8A 5GVSA 3S8YA 2B0JA 4D3ZA 1M6NA 2ZGVA 3GRVA 2ZRCA 5JJ5A 2R3SA 3WKEA 1JHDA 2B4QA 1D09A 2YVAA 2YR0A 3BS4A 3E9RA 2AB0A 3ONNA 4HEQA 4DV4B 1AS3A 1XYGA 1VCMA 3BD7A 4G8DA 4M99A 3H4VA 1KYYA 3FCOA 4N3CA 1IN4A 2OBMA 2RHBA 3GT4A 3M34A 2RGUA 4G0YA 4G4IA 4YAFA 1EUZA 1QVZA 2ZCUA 2FR0A 4URVR 3GVIA 3TTYA 3UH0A 4AZVA 1CNEA 5IT0A 5EJ7A 2DBZA 5A62A 1P2VA 4D9CA 4AZ3A 1YIAA 1CRPA 3NTOA 2CBXA 1YSCA 3QJ5A 1JAHA 4MVJA 4PZEA 2QX7A 4U2CA 3QYPA 2OK7A 3RANA 3VR4A 5KOJB 4MYDA 1HQCA 3D2LA 1H9AA 4H3SA 4MV1A 4DLZA 2FRDC 2UYQA 2ONZA 3ZCXA 2DPGA 3E27A 4WQMA 1NUSA 3PR2B 4BX0A 3ZS8A 2I3DA 1GU0A 1P39A 5CDGA 1M0TA 1SVIA 4MA4A 1F7VA 1XNJA 3STTA 4GC5A 2O8DB 2DU8A 3KUUA 3AUXA 3W0LB 1IN7A 1IQRA 3G7UA 3NX4A 5AI8A 4ZJYA 2EZ9A 4A23A 4CM4A 4PSKA 4Q9DA 4YLGA 3NBZC 2VDRB 1NFRA 1EYZA 4HAOA 3VFDA 1ZOPA 4GBED 1D2NA 3VUFA 4EJSB 5MDHA 4A6XA 4GP7A 1JWLA 2QN7A 1OMOA 2D4HA 4J2OA 5C37A 4B85A 1SC4A 2AD1A 2QTFA 4KO3S 1RTTA 3AI7A 4IMJB 4YQFA 2C9YA 5K6AC 1RJ9A 2FEKA 2QS9A 2MT9A 3PC2A 4DXAA 3SZGA 2G0NA 5B6JA 1ZX1A 1I9CA 4ZXPA 4DUGA 3D3JA 4JA0A 3A1VA 2YWJA 2YJ6A 2C5AA 2FXVA 4BLRA 3NP7A 5F33A 4MYUA 1X92A 4ZQFA 4MQ4A 4BO6A 1E0AA 1DC4A 1ZMOA 2EJBA 4EY6A 1Z5GA 4Q9LA 3QVVA 3TMKA 3QOWA 1IY9A 4QBGB 3KWFA 3CZQA 3PDHA 3L40A 5AT1A 5A3SA 5CH8A 4PNEA 1G6Q1 3K9LA 3QLUA 3WL3A 1VJ1A 2JRCA 4JHLA 3V2UA 5CDHA 4MGYR 1DJOA 1QH8B 1U7ZA 4LC9A 4LMBA 4X93A 5AJXA 3SHQA 1ZA2A 2ONCA 3I2KA 1U2PA 1XA3A 4G5QA 3PNLA 5COQA 1YI0A 3IMKA 4KE8A 1G5RA 4HNTA 2PXXA 3FYTA 3N2NA 1KH2A 2Z56A 4MVJF 4QGBA 1UKEA 5DSXA 1F3OA 4H77A 2ZUSA 1FU8A 1TEZA 3ZHOA 2W0MA 3I04A 3R5JA 1H6CA 1XWFA 4J7CA 4PTZA 4ZOLB 3UWSA 1QMGA 5BPFA 1EVYA 2VP5A 3H1GA 1UT8A 5LZ4A 3HSSA 5H4HA 1NOIA 3TO5A 1KEKA 1E2JA 2AG0A 1V39A 1E7YA 2P3LA 2Q6LA 3IHKA 3E9DA 1S1MA 3KOMA 4MEBA 1IVNA 1WABA 2QG6A 3N2IA 5KU7A 4FKBA 1G16A 2JJMA 4QYTA 4Y6RA 5MN5A 3O4RA 2N75A 1BX1A 3IAM1 4O63O 2FPOA 5J43A 3D4BA 3AFMA 4V3BA 5FUWA 1Q50A 4TZ0A 3INGA 1V41E 3SOPA 3DVLA 4XVCA 4UVHA 2IQ5A 4TXLA 4UBNA 1VLHA 2X0EA 2WPNA 1ZUHA 1SXQA 4PYOA 3MZ0A 4TTJA 4EL0A 3PA6A 5KC9A 3GA7A 4IVQA 2IH4A 3HN6A 2H1SA 2IZOA 3T3GA 4R1QA 4ZP1A 4V1CB 3MK31 2PWYA 1V9LA 2EBFX 1FIUA 1E1QA 3R6WA 5LP6A 1Q0SA 1UOQA 5JWRA 1ACJA 3RREA 5L3VA 3GJQA 2REXB 1YUMA 5IVKA 1B2RA 1KDZA 2PGIA 4B6OA 2JZOA 3IJPA 4NENA 3L6EA 3MWDA 1F4VA 1W1WA 3EWNA 4PLHA 3HTXA 2PKRA 1NF9A 3MGAA 3X2EA 5E4FA 2ZPUA 1CVRA 1THMA 4PPFA 1ADBA 4GQAA 5FFFA 4XFDA 4JELA 4X1YB 4TSRA 4KHZA 4NEQA 3N0RA 1NLFA 3EW7A 5CPBA 1YCHA 3I83A 1IL0A 3RYCB 1N6HA 3PD7A 5BRJA 4ER3A 5C1OA 2NP7A 2XNDA 3ZDEA 4PGHA 4H6PA 2I7TA 1U8FO 2VQDA 1OB2A 3ZHVA 2V7EA 3BERA 3K5HA 3VPGA 1L7QA 4W9NC 3KLNA 2WF8A 3TI9A 5LKAA 1IUPA 4CLDA 1NNUA 1HFJA 2DKFA 3C6KA 4BJHB 2YJ4A 2UUCB 1Q7RA 4JFAA 4BMPB 4RHEA 1A5AB 4KQXA 2GRUA 3DMTC 2LPMA 1PJAA 3SY8A 2L0XA 3LHFA 4OF4A 3OQMA 4AS1A 4KN8A 3JAWB 1JQLB 1L5NA 3ML1A 4F92B 2OA0A 2IBSA 1SOMA 4D4MA 3DFIA 1I24A 3IBYA 3R9XA 2ZSEA 4R2XA 1K92A 4IDAA 4PSVA 1GZ6A 2ZWOA 5HTOA 1PZEA 2HGZA 4YUXA 3LM8A 1C3JA 2FEOA 1N2GA 3KPWA 2E5FA 1Q5PA 2Q1SA 1PD0A 2NAFA 2ZPAA 2PV7A 3ASZA 3QMMA 4G5GA 4IIGA 4IIBA 3P2YA 1YXMA 4I5IA 1PQWA 2OHVA 5AK3A 3NAZA 3QKRB 4RO0A 3BM5A 3OD5A 4NOMA 1E1YA 2OFPA 4ZYXA 3T3NA 4UHBA 5TQ2B 3RTCA 4NJEB 4R1UA 1BEZA 4P4SB 4DMUB 2GLTA 1UMBA 3V00A 3GJ8A 2GSWA 2PBRA 4G0PA 4WCFB 5DLYA 1KIAA 4RD1A 4MW5A 3NV9A 4E5MA 3F0TA 4GLBA 2PRSA 4E88A 3CNBA 4A8HA 1E20A 3KEGA 3SXPA 2C4VA 2HCTA 4OUDA 5L7YA 1CUAA 3ISTA 1I32A 2ZSFA 3Q3JB 2IPNA 2XT0A 4N6GA 3LT1A 4OL9A 4P3PA 1HNWB 4C0QC 3H1BA 2QPAA 5EMHA 3TXYA 1D03A 1HDXA 1V11A 4L4UA 4CIDA 5IT5A 4B4DA 1DBIA 3SDZA 2JEYA 2ZSJA 3OG9A 1PX2A 5ICEA 1V8OA 3ESXA 2NZ8A 4QGGA 3KYDA 4URUR 2RMKA 5LUBA 2PMDA 4M0FA 2CSXA 5EINA 3I9JA 1K8YB 4KLRA 5FYQA 1JSCA 1JG6A 2OC4A 1VLJA 4IH1A 1E5DA 3HA2A 3HDVA 4C2UA 1FEZA 4NR0A 3PJDA 2N9UA 1AZLA 3FJ1A 3E1SA 1V1JA 3NJ4A 3R7DA 5IWAB 3AIKA 3G13A 2GUWA 4WY5A 1IM5A 2I1LA 1KVTA 4TTTS 2OG2A 4V24A 4JDPA 1BSVA 2V5UA 1HKUA 1UPCA 5KYUA 1DC6A 3ZCTA 4YMUA 3K6SA 2PH3A 1FVHA 3V1MA 4Y6LA 1MQ9A 4DV6B 4R6XA 2A0YA 5JY6A 4MB0A 2OLJA 1FSGA 1NNLA 2CMGA 3D8NA 2RB5A 1D2CA 3E9YA 1L9KA 2FF5A 4P3OA 5GAJA 4BO3A 2H1HA 1XQXA 3W5UA 1CQWA 2GFIA 2D0OB 2ESRA 1E5QA 3KNZA 4DNQA 3DVQX 3QELA 3N3BC 4IYJA 3UFBA 5M7EA 3PHGA 2H00A 5DHUA 4AMUA 2ZJ2A 1Q20A 1QANA 2CXPA 4BMSA 1WSWA 2KS6A 1FNDA 2BGUA 2Q1TA 3MCTA 2CJFA 1SZPA 2QA5A 2YWBA 1YJAA 4MVJH 5TNXA 3IKVA 3HN7A 3VR4H 1DWOA 2IYLD 3NBFA 3W5JA 5J1TB 5K8IA 3EF0A 4GXQA 3DLIA 2NO1A 5BSHA 2PMEA 2BR5A 2H59A 4ETIA 4ZWNA 4CF3A 1VJTA 3ONFA 4QEDA 1M7GA 4DM7A 5CB4A 4GGPA 5TC4A 3TKYA 3EVAA 4GQBA 5HTKA 2Z8YA 2FOXA 3UK2A 4C14A 4EYEA 4J4TA 2OL4A 2E6KA 1VLZA 2H0RA 4QPPA 1NTOA 4BVLA 2QMHA 2QG9A 4RD6A 3BL6A 4EQZA 1GPKA 1J97A 1AC5A 1ZH6A 1EMDA 3A28A 3OPXA 4JS0A 5KQPA 4LHYA 4HDQB 1UJ4A 1KO5A 1PO7A 1EFKA 3L6RA 2NQ2C 4G8BA 4QQNA 4I19A 1DWQA 4LYHA 4UTNA 2BFFA 3NW9A 4J0HA 2HO4A 4PLZA 3U0VA 3UJ6A 3AUUA 2UZ0A 2UZIR 1QP4A 1CYDA 2GHRA 5D00A 3MMZA 4EX7A 3IYLW 3V46A 4O25A 3LGSA 4YXFA 1NFFA 3JW8A 5DTMA 2WWRA 3RFXA 3AVQA 2C3MA 3NASA 3ODPA 3P9ZA 4DEYA 2C92A 3F96A 1F4LA 4WDRA 1CRZA 4BE4A 3UHAA 5B1DA 4J7UA 2L19A 1UBJS 1P2SA 1POXA 1OYVA 2FZGA 1K08A 3KBBA 4YPVA 2OXTA 2QV7A 4BMXA 5LDHA 1WPRA 2IELA 1YBVA 4EG4A 3W9YA 1XRQA 5AM0A 4WNAA 2XTMA 4B9AA 1XYYA 1Q15A 1Y3BE 5CJJA 5ELLA 4DCSA 1V45E 4GZMA 2IV2X 2OO5A 2C8JA 3E22A 4O5OA 4POOA 1JKJA 4MRAA 3CPEA 3I53A 2BRUA 4RSHA 5ALOA 3SJ7A 3QIAA 3IEXA 2C5GA 3QF4B 1U7PA 2RGWA 1T9GS 1PR6A 2JD1A 4JBGA 3S2UA 1CY8A 4MQUA 4U7WA 4IDGA 1MC8A 1RPNA 3KT0A 3EARA 4F8EA 5LQKA 2VNSA 3L8FA 2QX6A 2ADFA 2GAJA 3ENKA 2NV2B 4EKDA 5CB4F 2QM8A 1U5AA 1AKYA 1ORVA 3HI6A 2MSCB 2G9RA 3D2BA 2XDQA 1YBFA 1CUUA 4R7TA 2QTHA 4RHXA 2B98A 1OCEA 3EGDB 1KYXA 3DLTA 3RF7A 2FPKA 3ZKAA 4AVYA 2QT9A 3TLBA 4AZ0B 2Z5GA 4CEHB 2RCYA 3H5NA 5FNVF 4YV2A 2PBZA 3OJEA 4LSWA 4F93B 3MCAA 1RYDA 5C46F 1KWGA 3B8HA 4GZ6A 3G9UA 3AMVA 3HR4A 3I0NA 4FN4A 1D6MA 4A2CA 2JHPA 4K9LA 4L74A 3G8AA 1HOXA 2WUEA 4KUEA 4ENVA 1JA9A 1U04A 4S12A 4B7ZA 4HVLA 4E4YA 4CU2A 1XN4A 2V59A 3AR5A 3KQQA 1TT5B 2O48X 1HC7A 1SHZA 1C7JA 3HRIA 5ER9A 3E5RA 2ZAGA 3AP1A 2X5JO 3JQQA 2HMYB 1CETA 4DR3B 1CZKA 1M5TA 1RXSA 4X85A 3RRBA 4C03A 2BV3A 1HY3A 1XZPA 3OE1A 1C7QA 5AW5A 3V6MA 2E87A 1AHHA 3C7TA 4GOLD 1U1EA 2G40A 1LTKA 2KBEA 1IMJA 2QD5A 3X1MA 2RC5A 2QRKA 4QJ4A 4RNCA 3HJAA 1RC0A 3ILXA 1B8UA 2XUJA 3TCXB 3HWSA 2BFAA 2GDZA 4LJLA 5F21A 2NQTA 3DHYA 3EB9A 4KE6A 4DC1A 2V03A 4Q9HA 3V1LA 1A82A 2CMKA 4TLEA 1THZA 2ID8A 2P2CA 2PH1A 1XPRA 1JFRA 2CD9A 3D7MA 5ECDA 2E2WA 3GLFB 3LQQA 2PVPA 2ECQA 4CETA 3DW1X 4BL5A 1B3BA 1LS6A 5C2JB 3ZDDA 4ZYYA 4C7BA 3LZDA 4HCJA 2FUEA 4LY6A 3NGLA 1G5IA 2GAIA 3DOOA 3Q3GE 1XRPA 3GK3A 4XOUA 4LDPA 4TZ6A 2R1VB 1F12A 1KJZA 2X9VA 1NR1A 1R8YA 3BDVA 1JU3A 2AHOA 3BFPA 3ECCA 3I6IA 4HQOA 3VJMA 1Q6ZA 3JQ8B 3FNRA 4IIHA 4NSNA 4HD8A 5BRAA 2O0JA 2PKEA 4N54A 5DI9A 2XB9A 1T6XA 3NM4A 4G1VA 4MGKR 3WNVA 1JAZA 1NVBA 2BBSA 5IW8A 6CHYA 1S2GA 4K3VA 1PQ4A 2A4KA 5ICSA 1U3CA 3F67A 4ZO8A 3RVSA 1T6YA 4B34A 4OPMA 3DMFA 1S2OA 3WLMA 2A3NA 3WWDA 5IVHA 4C78A 2ZYTX 3O93A 2GWHA 5J63A 3MWGA 5L4LA 1DWPA 4JU8A 4Z1MD 4BWFB 4PN7A 5AI4A 4BN5A 1G6HA 1BGXT 2VS1A 4CR6A 3EFHA 1ST3A 1XF1A 1VMKA 1GGHA 4MWDA 3VAAA 3W9UA 1Z3CA 2W2MA 5K3FA 1V37A 4QC2A 3A9SA 1RRMA 4FE4A 1QQBA 2D54A 5A5FA 5HMMA 2Z1NA 3BMCB 3R5KA 3WYNA 3IPLA 1RLUA 1EG7A 3M6FA 4CFSA 4RORA 1FUEA 4R4JA 3K2BA 3O1IC 4CTJA 3JASB 5DTRA 4QQKA 3T1VA 1UDRA 2FFRA 2R1TB 2VUTA 4PICA 4S24A 2WA1A 3PXXA 4N47A 1JS1X 5FPTA 2QN8A 4IWYA 2IUSA 3JWGA 4FK8A 1CF4A 3FZQA 3ZXSA 2G6TA 1IXKA 5KEIA 3H86A 2KI5A 1ZFNA 4BFLA 4EPTA 3P0JA 4G0WA 3SHTA 1P73A 3NEPX 2ZYUX 5EJIA 3U6BA 2PGDA 2C07A 3RAPR 2Q1WA 5B53A 1B43A 3PS9A 4ECAA 1U2GC 1JBKA 1JI3A 2C31A 2QRVA 5K4AA 1SQ5A 3OJWA 1SAYA 4FQ8A 1NXQA 4PBRA 2D7CA 1YHYA 5C0OE 4HGZA 3JR3A 1ADCA 1XZ8A 5H80A 1BROA 4AKHA 1K27A 3FF4A 4PCUA 3HKEA 3I9V6 2EJUA 3CE9A 4LHXA 5AP9A 3I05A 4PLCA 4HPXB 3EPKA 5CPFA 5CD9A 3V8EA 4CKWB 5KX5A 3ZEIA 2BMFA 3ZWMA 2B8JA 4FKZA 4LZZA 1F0YA 3OCXA 3G0BA 5DX8A 9GPBA 1QC5A 4EG3A 2I33A 1RZVA 2KBFA 2X1VA 2C1ZA 4NFSA 5EIFA 2ZJ1A 3WWCA 4CMIA 1QDUA 1KMHA 4WI1A 4P32A 1KK1A 2R5FA 2WTXA 1Z36A 1K2VN 3HXPA 4A91A 1TGYA 2CXNA 3IHWA 1ZS9A 1SFRA 3U3OA 1BJTA 3JALB 2ANCA 2X15A 3ROEA 3OUTA 1GNSA 3QG1A 4D02A 2CMFA 5HKBA 3I9FA 4ZJPA 4QVGA 4C6TA 1Z75A 3KQPA 1W0KD 2H07A 4ZC8A 3N8IA 2WWVD 4BNMA 1VKOA 2V7VA 2VJMA 4HX5A 4HDRA 6LDHA 3LCUA 4D92A 4AC9A 2RKOA 4OBBA 1OPRA 1KY3A 1UBNA 5L3SB 4ZQGA 3KOOA 1Z0UA 3FOEC 2X3FA 2O8EB 1JHOA 3FROA 3HGQA 4Z9YA 1IXZA 1XHLA 1X7WA 1IB6A 4HPWA 4ZTZB 5JCOA 3UV7A 2BGRA 4PZ9A 2CT8A 3KJNA 4EI8A 1GOTA 3R0VA 2PIAA 3Q8XB 3PT9A 4KXWA 4J0DA 1YVEI 1R6DA 1ZUIA 1MIOA 1QAOA 4PS0A 3D6VA 2ZWVA 3SIPA 1EFTA 1O5TA 1RQPA 3M6XA 1GZVA 1F51E 5AOAA 3OZBA 4CM7A 3JQ9A 2C57A 3RT1A 2FMKA 1Y63A 2IU6A 4ZAWA 2MOKA 1G0OA 2A1UA 2EF1A 4QNRA 5T8KA 5EQDA 3NBKA 4JXJA 1QB7A 1CEYA 4K8RB 1O9HA 2GHTA 1DO2A 1PG0A 1BU8A 1LBQA 3AONB 1RI4A 3NHSA 1IZ9A 5DRTA 3ZI7A 3MOSA 4YWHA 3RW9A 4CG0A 1G21A 2V58A 5CFOA 4DJEC 1DJLA 2GD6A 3GVHA 2N42A 1XVLA 5FJJA 5KYTA 1P75A 3HQ4O 1WB6A 1XJ0A 3BGSA 1YCDA 3M1YA 3W2TA 4OSOA 2AJTA 3TAUA 3VVMA 4URYR 2VEOA 4PS1A 2O5CA 4BAGA 1JSLA 2J9ZB 2QVYX 4RY8A 1E2NA 4MW0A 2WD9A 2Y1KA 2HMAA 4ZOAA 3U17A 5K9ZA 2EV9A 2G88A 5C8VA 4BTEA 3VPAA 1ZC4A 2HSJA 1IWOA 1OX4B 1TIKA 1UBTS 3IXQA 2FOLA 1V9CA 1HLFA 2XUKA 4X71A 3B1KA 1RAGA 3ORQA 3RC8A 2R1ZA 1HTWA 2YIJA 3GYGA 1GFSA 2ZBFA 2P27A 4LVCA 3EDRA 1K3FA 2VIIA 4K6FA 4RVNA 3P52A 3Q98A 5JMPA 1FRNA 3DYIA 3IT3A 3VKGA 3GBSA 2BEUA 1S2NA 2C7PA 3W8RA 2DR2A 2R60A 3JPYA 4X24A 1LNQA 3BJEA 3H3FA 4YV7A 1DEAA 3O3MB 3AEUA 3ZGVA 1CULC 3DZKA 4ODIA 8GPBA 5HNKA 1UBEA 4WLOA 5JRZA 5IFKA 1HXHA 3P9NA 3VR6H 1A4XA 2CHEA 1TZKA 1M8JA 2X6RA 2DQSA 2XRYA 3MQ2A 5I7RA 5B3JC 3OMWA 3D8HA 4JROA 3AF2A 4TRJA 3IEVA 5A0FA 2WFZA 2ZB7A 1XO1A 4EFKA 2FPGA 2H51A 3DDUA 3WWZA 3M70A 4IHKA 1ULHA 1YQDA 3Q8KA 4C20A 1QAQA 2B7LA 2BT4A 3LHDA 2BJWA 1HA3A 3BZUA 3NUZA 1HQKA 2AJBA 2OHOA 3P5SA 4C0KA 2VUHB 2XMBA 4CYMA 5JXHA 1MCZA 1Z8DA 1QX4A 1JMKC 3DLCA 4NG4A 4P7KA 3S3TA 4AMGA 5GTDA 1XMIA 1EUCA 2JEOA 4YMGA 5HA5A 3SICE 1VMDA 5ETJA 1XJWA 3QUBA 3H9EO 2EBWA 3LX8A 5FBQB 2QRJA 3EQ6A 3A2NA 4BP9A 2MYUA 5A4FS 2X9GA 5C7IO 1ZL2A 2V8BA 2PTHA 1OZFA 4DE5A 3BZBA 1NDHA 3EJWA 2HIAA 4D42A 4OXXA 2CK3A 4NNPA 3ZWCA 4RGVA 1TIBA 2AWNA 5HZGA 4WCDA 2WHEA 3RAGA 3AFNA 1CR6A 1ARZA 4JVLA 2NMVA 3WLPA 2C03A 3FSJX 3W7VA 1JILA 2VZEA 3F47A 1MO4A 3QMVA 2IYPA 3AZQA 5LYJA 2D4AA 4EZIA 2FSVC 3LQ2A 1UK6A 3OM0A 1M73E 4L3VA 4PYIA 4ESHA 4L8FA 3O0DA 3CH4B 4HJRA 5D5HA 1R8XA 2PO5A 3WAJA 4E2XA 1QWOA 2V1XA 3AG5A 2XCIA 3R0IA 2VWHA 4KXFB 4Q1DA 4Y9TA 3RSOA 4A03A 4BS9A 1TM7E 2B8EA 1EQAA 1RHKA 1RKBA 2R11A 4XIIA 5JSUA 1XCPA 4QTUB 1BYUA 4M0DA 2Y0BA 4UHCA 3FUVA 3IT1A 3VGPA 5DGXA 3WLAA 1O95D 3A7EA 1U6KA 3QHPA 4QTTB 2IOFK 4IHJA 2IHVA 3PWZA 3LUDA 3D7LA 2ZBPA 3KJEA 4L51A 2ZJ4A 3SEFA 3QH4A 1H0RA 3BULA 2VTVA 4CKCB 2QQGA 4KQ2A 2JKYA 5GOZA 3WKBA 5C4IA 3AHEA 4M0MA 4G9BA 1AZSC 1KJ8A 1YS1X 1A9XA 4ZCMA 3IT2A 2AJDA 4M36A 2JK1A 1SG9A 5KKNB 2W48A 1Z12A 2QU8A 2VSYA 4EB8A 1YIDA 3TFWA 2YHIA 4FYIA 2DSTA 5KSOA 2V7XA 4ND1A 2VNKA 3PFHA 4MDFA 1DUVG 4B8YA 4MARA 1KP3A 4BQSA 1XWWA 3CRW1 3UHOA 2OBBA 3TEJA 3ZX5A 1EVEA 1RAEA 4JLBA 4RIHA 3NVMB 2JFNA 2O1WA 1L4EA 2J7PA 4OHPA 4D57A 3TRHA 2PMBA 1ECLA 1A97A 4KN5A 1ZRHA 3A04A 1R5NA 2ZIZA 3ICPA 1OGIA 2AVNA 4IYRA 1GADO 1YI1A 2C2XA 3K9WA 4POAA 4G0UA 3KL4A 4RQBA 5ULLA 5C7YA 1Q11A 4AUKA 3IUJA 5BURA 1OZ0A 4AD8A 4AJHA 2OT3B 5C7LO 3ZX4A 4NVRA 4OHKA 5GONF 4MIOA 1TJYA 4MAAA 3WFIA 5JLJA 1V47A 1NUPA 1NVKA 3L0OA 1BE6A 4RY0A 5E9QA 5A4AA 4NCNA 1E8MA 5G3YA 4MW6A 3IQZA 4WUTA 3SKVA 2ZS8A 2QQ0A 1T5LA 4Y8VA 3RD5A 1MV8A 4MVJI 1ID8A 5AM1A 1PS8A 1MOQA 1X19A 1NG9A 5HIMA 3THSA 1JG3A 5D51S 1JR2A 5HF8A 1IJBA 3CZ5A 1X7XA 3CZ4A 3VR5D 3NWPA 4P86A 3NWEA 4IHJF 5F9HA 2PXCA 2XAUA 4CG1A 1CLEA 1K9VF 1MO6A 2AOTB 4GD3Q 3U16A 3DEAA 3HEAA 3DOHA 3LH5A 4RA9A 3M49A 4XDZA 1OHHA 5EOVA 4Q7QA 3SN6A 4L76A 3VZQA 4ONEA 3PDCA 3C8HA 3GG9A 2G9VA 3KQVA 4ZVVA 4BVJA 3H1PA 3E9MA 3MLBA 1NBME 4NBSA 4JLNA 5C1IA 2JJ2D 2JGIA 4HX2A 2FI1A 4I46A 2W6QA 3OOEA 1ZM2A 2C8VA 3HJGA 3ZQUA 4Z3OA 2B1QA 3AVWA 4YJDA 3AR9A 4RYLA 4D81A 2I6UA 3VYRB 3IUMA 3ZV4A 3W06A 4KW7A 2A5LA 3JD2A 4AAYA 4GPAA 4H08A 1ISIA 1I0IA 1N0IA 1G59A 3P19A 3ZU6A 4L4ZA 4OBXA 1KU0A 1I3LA 1I4DD 1JU9A 1CC1S 1CUWA 2AFHB 3HUTA 2FQXA 1SQ6A 5JVDB 4N01A 4MKHA 4AXBA 3OTGA 4OJMX 2JS7A 3MCWA 1N8NA 1YAJA 2LP4Y 1QTIA 3ND9A 4LGCA 1PSWA 2LW7A 2GCOB 3ACCA 1HDGO 3NWBA 5KJEA 2GCPA 4JI6B 5A9SB 1XZFA 1H8EA 2LE0A 4X1IB 2QL5A 1DDOA 4XKJA 1L6IA 3UPDA 5JAIA 3DV0B 3QX9A 3WQSB 4CM1A 1PNOA 4O2BF 5JIBA 3RJMA 1TB4A 2H7CA 1JXAA 3R5HA 4P4GA 3ND6A 1ISMA 2JDIA 2F1KA 1XC7A 1OU0A 5DI3B 4G37A 1EWYA 1YJ5A 3PFBA 3RF6A 3UHFA 3ZCVA 4BBZA 3ZI4A 5IP5A 2J30A 4MVJE 3NWOA 5F35A 4FSHA 2XDAA 4BNKA 4UULA 3DLAA 4R54A 3UFXA 4ZYVA 4GZLA 3M1IA 1X87A 3E35A 2QVGA 4PNPA 3DE0X 1CQXA 4LDRA 4ATNA 1OYOA 3BWMA 3L41A 4IVNA 1L3BA 4JNCA 1REQB 3A1FA 1FS6A 3WV5A 3VOSA 2VOEA 2BWJA 1C3LA 1XRLA 2ACEA 4Z9BA 1WCWA 1RHQA 1ZD9A 3KPVA 5AVQA 1PR1A 1M34E 1T3TA 1N5KA 5BSUA 3VZDA 2XZLA 1JQDA 2CB9A 3UJ7A 2IEIA 5FPSA 1SVSA 4YT8A 5ELMA 4HUQA 4IZ6A 4P5DA 4PNHA 5TQ0B 1A4IA 1PJQA 3COSA 4I5GA 4M1EA 5ECWA 1V5GA 1IC6A 1B0PA 1GUBA 2X0RA 2YVLA 5KKCA 3HA5A 3MAJA 5HGJA 2LXNA 1S3SA 2NU9B 4REQB 4UUOA 2QLMA 1L2TA 1JW9B 1VI6A 2W00A 4JBIA 5LD2C 3MTIA 1SHTX 2R44A 3GFFA 2GJSA 4ZYUA 1H5NA 3NH6A 3UUGA 3A9TA 2F00A 3LMKA 3ZK9A 4WN3A 3ZLUA 5BVHA 5CM2Z 3G88A 4OMCA 4QXMA 2YWGA 5JAZA 3H65A 3V8QA 3K94A 3KOYA 6AT1A 2XXAB 2YNMA 4N41A 3PQ6A 1E6WA 3B1VA 4MUMA 1JIIA 5F7JA 5HG0A 5HBGA 4QT4A 1SQSA 3NTLA 1AB5A 1XZQA 3OF2A 4G56A 4QO7A 1FF9A 1HEUA 1O7JA 2YOGA 1OY1A 3DMYA 3GLIA 2A33A 2K6GA 1FNMA 4OQYA 5EPEA 3SDSA 3RQIA 2QD1A 2ZYHA 1Q1ZA 1OWMA 3NBYC 1JDVA 3O83A 4NYIQ 2PUCA 2PJUA 3QY0A 1BJKA 1QKKA 2X0IA 2ZBGA 4WFIA 3KB1A 2P9EA 2YMLA 1JJFA 3RTEA 3QUCA 4L72A 3U19A 1KEEA 1YRBA 3QVJA 5AKYA 3BXPA 2C4NA 2CWDA 4WDQA 4LXTA 2YV5A 5LWHA 2WWIA 1X1EA 4KRFA 3QYFA 3AF0A 2HH9A 3PDUA 4HB2A 4H1HA 5C9ZA 1N2CA 3HSYA 4H1TA 5EE3A 1E1DA 3EASA 2NUTB 1L3IA 1ZN8A 4QDOA 1TJ3A 1E2HA 1PK8A 3M5PA 3IOCA 4H16A 3SLKA 2R8BA 3NC1C 3MJTA 4D7AA 2W2VA 2F9LA 3QUQA 1TIPA 1SKYE 3IX7A 4PBSA 1QVVA 3N6RA 3MMSA 1X86B 4CMEC 4Q1BA 3ZHSA 1IJKA 5A3JA 3K9CA 3ITKA 2P79A 2YW9A 2ZRAA 4S1OA 4TXNA 2XF2A 5AKHA 4ZVOA 1T25A 5J2UB 1YDMA 1YVRA 1VE9A 2CLHB 4XVHA 4PCVA 1PGNA 4RKRA 2FPIA 4JJEA 5F7OA 1ULBA 3F6PA 2D2XA 2XGMA 2RKWA 3DXYA 4OQXA 1M1XB 2JFBA 3TMAA 4EB3A 3LDHA 4FGLA 1B76A 4QRDA 1GPAA 4FEGA 2XBMA 2I03A 3R3YA 2AOUB 2HHAA 3PGMA 1EBFA 4ZRDA 4A92A 4BVGA 4DEVA 2OP0A 2BM1A 3M4YA 2IZ1A 4TGLA 1H3NA 3UH1A 1QHGA 3BL8A 2VZ9A 1EA7A 1IEWA 2BFWA 2G4CA 5DWDA 1W9HA 1Q1QA 3WAKA 4GH5A 2VDMB 1E0SA 1KQ3A 1A2BA 3C6MA 3L0IB 3OOSA 2E4AA 2XY4A 3LPDA 3PNSA 4Q4LA 5EUMA 5H68A 4EPXA 3SD7A 1LW6E 2WAOA 3R6LA 5TQJA 4UOEA 5TMBA 4ESVA 3WNDA 2PS0A 4YCCA 5BPHA 3ZZNA 2C94A 5AW9A 3E9QA 4N9QA 5IRCD 2G5PA 2FGJA 4Y2HA 2GBIA 3R09A 4K9DA 4TSFD 3GFPA 2OLEA 2FX3A 1WTAA 3WX0A 3COJA 1WETA 2M9MA 3IEUA 1JR6A 3HGMA 4W5RA 3V32A 1L7OA 2WYHA 1UM8A 1E94E 1TUEA 1YU6A 2IPLA 1NVMB 3BMQA 1NQXA 1GTJ1 3BZWA 4QXAA 1N2EA 2JIPA 3KLMX 5DP1A 4EOGA 1GLVA 5I51A 1NA5A 4K0KB 3SKXA 3HCEA 1EE9A 4TMFA 3ZE0B 5B3KA 4C6SA 5JSQA 3PT5A 3MJDA 3JSAA 4O2BB 3UATA 3FVWA 1F14A 2Q6KA 3MCUA 3QQPA 3PUIA 3PD1A 1T0PA 4MW7A 4NMLA 3F3MA 4ENQA 2AS0A 5AI5A 1KO7A 3BCRA 3OOWA 5AW8A 4X7PA 3QPBA 2GFQA 4IWNA 5HKAA 1TKCA 5GGYA 3AUFA 3FAZA 4LW8A 4YA6A 3PRJA 2C8LA 4Y6GB 2P62A 3QV2A 3RKSA 2WOJA 3L1JA 3IO3A 2C77A 1UEIA 2QN1A 4GF5A 5I8ZA 3VR3D 1XTRA 1GRRA 3GCXA 1WVMA 2FZLA 2JD0A 1ZONA 2HHCA 4M0CA 1N0UA 5I48A 4MGEA 5TV2A 1JA0A 5IAEA 4DF3A 1ETUA 4RV5A 1OFHA 3ON5A 3OTHA 2AG6A 2ZXFA 1JTEA 4UDNA 4ALJA 3CLTC 2Q3JA 3G2NA 4PAGA 1LZKA 1QONA 5BMVB 3WNBA 2PT5A 1BXGA 2GI4A 4MRPA 4BDTA 4PVDA 4QUGA 1R5BA 1EESA 4H6XA 2HTEA 3CVWA 1HYHA 4D9IA 4PQEA 1IB0A 4TL6A 2YX1A 4Z7NB 4GX0A 4B47A 2ZM5A 1H2HA 4IXWA 1NW5A 3FLMA 1OOEA 4JQZA 3EVCA 4JQCA 3LDGA 3LT2A 3ZWOA 3TLXA 2NVUB 5EJEA 1TAUA 2AT1A 4RZHA 1GPDG 1DADA 1FRVA 2BKEA 3RK1A 3RIXA 2VVTA 5H3HA 1T5SA 1VG1A 1B74A 4UEJA 3WL6A 4C21A 1T4CB 3GN2A 3DPIA 2Q1XA 3E70C 3RFVA 1SBHA 3M82A 2FFBA 3F73A 1N6LA 4QQRA 3R0ZA 3V4LA 1WR8A 2J0UA 2XMCA 3HYCA 3JYQA 1AN0A 3N8GA 3O8OA 2EF0A 3HG7A 4BO7A 4C2TA 4FYWA 1T1EA 4IX1A 3ZOKA 3M1LA 4HDSB 5TPZA 4B7XA 4C3VA 3TZEA 3GJ0A 4I6GA 1GA4A 2JGFA 4KB5A 3SAJA 5IKPA 1KY4A 3CUKA 1YZVA 2J4DA 4LJ5A 3FOAA 4OH7A 2NW6A 2ZETA 2Q0XA 3AXSA 5IUJC 2LNDA 1FRFS 2NACA 2P4QA 5A4KA 1YA4A 3LVQE 1CY6A 3F5DA 3UT5A 1PEDA 2ZAOA 3I1IA 2QI9C 3C8UA 3L4KA 1WXFA 4DA0A 2GAOA 2XYHA 1LD3A 1NNSA 1NVGA 1CW2B 2YCLA 2RE8A 3R7AA 1KVQA 3F7TA 4YXWA 1XTPA 3H18A 4EJSA 2JLXA 3SJCA 1H1DA 2BH9A 4RK7A 1TJPB 3FDFA 5EC8A 4GX1A 4HLUC 4HQLA 4CLHA 1WHTA 3I30X 5EHQA 1II9A 1PGOA 3Q5EA 1ZK1A 2OO7A 4N3NA 4I50F 5CURA 3TSZA 4AWAA 2FOIA 4ETNA 1GQ2A 2R25B 4M83A 1G19A 1BE8A 3DCYA 2GH1A 3ZCPA 1NLUA 3EHEA 2ZR7A 2ZJZA 2GEBA 2Z04A 2YMQA 1EFRD 4X1OA 3T4UA 4HDKA 1E2KA 1PR5A 2HCBA 4F11A 2W6ID 4KFUA 4PZPA 1YGPA 1A9PA 2VYVD 3OKFA 3O95A 3OOHA 4LMAA 4J0CA 4WH0A 1DTWB 2XUQA 1SQFA 1U6JA 1XNQB 5JO9A 1M5RA 1Z47A 4IUBS 2I62A 4KNYA 4KXMA 4OXKA 4WGGA 1ORDA 2OD2A 4PXYA 2W42A 1QH8A 5KQSA 4QG7A 3QEOA 3T7CA 1ECGA 2IHZA 3C39A 1FSZA 3I5AA 4J6FA 3SR0A 4I5DA 3MC1A 4IDDA 2IV3A 2X19A 4XYMA 4MUHA 2PZFA 3KL2A 2H57A 4ZOLA 1HI9A 5JNWA 4LRSB 5JTTA 3PGKA 4FIZA 2EWVA 3MRSA 4K8OA 1BQEA 1DAMA 1RYZA 2VDJA 3LUAA 1HT2E 3A2KA 1QGOA 3KVRA 3M83A 3QE3A 3U9SA 1QAMA 4KQKA 1EP1B 1GDHA 4OH1A 3K1YA 4R1LA 4B4OA 4I2VA 3L6UA 4OCZA 3OJLA 4XCXA 2GKOA 1XALA 4D3FA 1UQRA 1CTQA 3HGTA 3PNPA 5BV1A 5HUHA 2R7MA 3B9PA 3Q3EA 4DDUA 3ZVNA 4MGIR 4NTZA 1V5EA 1M6WA 4X63A 2H7YA 1ZGJA 1H2RS 4JEUA 1SOWA 3E05A 2AQ8A 3MJVA 2C4KA 4PE5B 3NWJA 4DDWA 4CGYA 1F8GA 1YB4A 5F3RA 1SHKA 4PQRA 4NZ9A 4Z9FA 4XPIB 2FP4B 3W77A 2OVBA 1JJBA 4JBXA 4QQFA 3OHPA 3HJBA 4V1CA 3JD3A 1E2LA 3TXXA 1KHTA 2LDXA 4OJKA 2H7XA 5CU7A 5IM4F 1AKNA 5EG5A 5B2ZA 8ATCA 1NJ2A 3CKKA 4JX8A 2NZWA 4KSYA 4YAUA 2DFLA 3E81A 4GMGA 4RIIA 2JFHA 1C8VB 4OB8A 1H6BA 3CUTA 3WGVA 3PC7A 4MOWA 1SVLA 3OQPA 4QODA 2C0QA 5EUCA 4EUEA 2YZGA 1UC4B 4N3GA 4HMOA 3VHXB 1BGWA 3C7KA 1W0JD 3CF6R 4CU5A 3K70D 1A9TA 2H17A 3H5VA 1DHTA 5F4ZA 3FPBA 3IO5A 4JI0B 3MRTA 2QUJA 4J2HA 1V7PC 4N5DA 3KUCA 1X1CA 2O0HA 2PAAA 4X6XA 2Q3BA 4XASA 1F48A 4UMEA 2AQKA 4YB8A 3U7EB 4ZI7B 2E4XA 3DDOA 1QH1B 1VE1A 3CUUA 1VJRA 1R8JA 2OD7A 4FVTA 5FTMA 2YZ7A 1A98A 4X3PA 4EH1A 2HA3A 2RGEA 1XTTA 1FS5A 5J23A 3EIUA 3O38A 1TJ4A 4FDVA 3U49A 5AKGA 3OPNA 3AC0A 5LXTB 4XRRA 4L2IA 1GV0A 2I4IA 3D6JA 4IGFA 2OAQ1 4W9RA 4Y0VA 5FUQA 1O1YA 1SA0B 1UJ5A 3OX3A 1YDFA 4U5QA 5SZHB 4H6WA 4TS1A 1ZKMA 3EAFA 5TJ9A 1MJHA 4CTNA 3OQVA 2GJ8A 3D6FA 4IQ8A 5CCXA 5KCZA 4LVNA 1S7GA 4H4CA 3OKPA 3IP1A 5KREA 2G04A 2Q5FA 4RTJA 4J7AA 4BYGA 1QFYA 2VFAA 5TEWA 5JEEA 5NULA 3FOZA 2BUAA 2RBKA 3AJ9A 3O7MA 5A5EA 4HB4A 4EI9A 2JH8A 3URMA 4R0NA 2AE2A 2JLYA 1OIVA 1D0SA 1H0SA 1MP0A 1RQ7A 2FCAA 2PU5A 3FPEA 1GNVA 2BHSA 4YP9A 3GRPA 5TQ2A 3V7WA 5K0GA 2HBQA 4UHEA 3K7EA 2ZDQA 4NJEA 4P4SA 3NRJA 1KH3A 4OFZA 1IE3A 3QU7A 1DBVO 1XRMA 2GPSA 1J6UA 3HY3A 4IHAA 2HDHA 4BDSA 1URPA 1E3LA 1THTA 4JD5A 1CWUA 1U9IA 2QYOA 4MCHA 4W1QA 4WCFA 3LHIA 4ZO9A 5JAOA 4KR6A 3QMWA 2I67A 3TM4A 1DC5A 2FMUA 4UU8A 4MAMA 3L8ZA 5JJIA 1TCVA 1CZOA 3O8LA 2XUAA 4DDMA 3HYLA 5B7NA 3FPAA 1CZRA 2C20A 3TQCA 2XEXA 3SMQA 4DG8A 3JRWA 1WMAA 4A0RA 3DONA 5JADA 2I8AA 4I36A 4YR7A 1XZCA 2ZBUA 5T67A 1YJBA 2I76A 2IDMA 1G63A 3VSDA 1JHRA 2V3VA 2X2OA 2H6EA 1Q0RA 4ETWA 2BPOA 4KGXA 1N8SA 3BGVA 3MF4A 4S2EA 2W2TA 4CRWB 3G7NA 2HL6A 5ALVA 5JCZA 2HRZA 2OCGA 3LIIA 4HC4A 1RKUA 5AXDA 4LXQA 1Z83A 1QZXA 4A8JC 1GL7A 2P75A 2RGBA 1J00A 3AZPA 3VPSA 1ZCFA 2QROA 1Q84A 3D6TB 3AW8A 3MPOA 4UJ3A 5DEOA 3IXLA 3W4KA 1C3OB 2IS1A 4OATA 2WF5A 1CS0B 2W8ZA 1VCHA 5F51A 3F6BX 3QVOA 1WZ2A 4FUTA 2WUFA 1FUKA 4JKYA 2YYSA 5FJIA 3P97A 4KXNA 4YRBA 3EF3A 4JOQA 4BU0A 1VB3A 3ZYZA 2WT9A 1JKFA 2Y1DA 3ETGA 2ZI7A 3REOA 4JU9A 1F0NA 2DKNA 4B1FA 3UMYA 4BO4A 3F6YA 1TZMA 2W2LD 4KODA 1ZC3A 3FKJA 2G9QA 1IPEA 2YL2A 1NOJA 3U3DA 4DJJA 2G5TA 5BSGA 4XW2A 3WS7A 3AVYA 3PE6A 2IZZA 2G06A 2RI6A 3C15C 3LE8A 1GGKA 3PJRA 1XPOA 4HFMA 1C80A 1Q22A 2H7VA 3WQRA 1VPVA 2D0PB 1RRKA 3STVA 1I51A 2APJA 2HSWA 4ALNA 3AFHA 4KSCA 1OTXA 4UQLA 1U3WA 3CNNA 4WLFA 4BJ6A 3L4EA 2D6FA 1Z13A 4LE1A 1U9ZA 5I47A 4MHTA 1YS9A 4HLQB 4NOJA 3PXCX 1LBTA 1GUYA 2G5GX 3JVIA 4UVDA 1J0AA 4LDAA 1JZSA 5CM8B 3QEJA 2RHDA 1YE5A 2CC2A 3N2GA 1RXCA 4Z1MA 4LJSA 1P0MA 3EBLA 2D5IA 4LX8A 3C1AA 5F2KA 2PUVA 4BX9A 2F9FA 4BZPA 3H5LA 4BASA 3NVKI 2I65A 3IKJA 3JWEA 4HADA 5DYNA 3R9IA 4JI5B 3RQSA 2JLAA 5ESDA 4N7BA 3V55A 4LYAA 2ZZMA 1SGWA 1QHEA 2F43B 1HZZA 4V0KA 3OETA 1LFAA 4EGFA 3QI2A 2P6MA 3BA1A 1VYVA 2HYDA 3H84A 3DLPX 1P8JA 4CTOA 2H1RA 2PFSA 4R2HA 2O59A 1KJIA 3AX6A 1X7ZB 4AJLA 4EB6B 4J0FA 4LQDA 2FG7C 3LKBA 4E5KA 3H04A 3WWYA 3T9AA 4YNBA 2CHGA 2OZEA 3GPIA 4J3JA 1BKYA 1PR3A 2WKWA 1M9NA 3AUTA 3SXUB 3V33A 3ERCA 1MC4A 3H6KA 3PWSA 2O3RA 1LA2A 2FFHA 3K3PA 2R6ZA 3TR5A 3OA0A 1ZJZA 2JFPA 3GJRA 4KO4S 5FLKA 1J8YF 1X2EA 1F8FA 1OBOA 4YHBA 3QFHA 1AO3A 3CUSA 3U37A 5FOQA 4TV9F 1G21E 3IB6A 3R3JA 4R84A 3D7KA 4EECA 2XYRA 5TMPA 4GE3A 4LX0A 1B1AA 3CO0S 3PCTA 1MMFB 1LPNA 5AI9A 4JITA 4JYBA 4ZO6A 2INGX 3PFIA 3ESDA 3DTVB 1XQ1A 4FWBA 1YZUA 5CEJA 3VZCA 1KAHA 1KFCB 4ANFA 2RKBA 1QCYA 5BSEA 3FMVA 1K75A 1J8MF 1OTYA 1YR9A 5ADUS 2GJAA 1RJFA 2IYRA 3GJZA 2YVUA 3P9YA 4M0LA 5LN1A 3E5MA 4CI9A 1VG0B 2ZTSA 3NG1A 1YBHA 4IINA 3PFFA 3GRYA 3PU6A 5KNBA 2R79A 3A25A 1R18A 3EGDA 4FFDA 4LECA 5LQJA 1Z6YA 2R8RA 3P4UA 5LMUB 2XAAA 5KTSA 1GFWA 3WB9A 3DP9A 1W2HA 3DPSA 3ELBA 1YS7A 4E5NA 5BP7A 1SUWA 2Y2VA 2BMAA 1YZNA 3G8CA 4NZPA 5HZHA 5JBNA 4W9MC 4MULA 2WD7A 5LL6P 1RKVA 1W0KA 1W88A 4Y1GA 3T9EA 4DBVO 3Q7SA 1XD2A 2C58A 3LXXA 3OT5A 4N49A 4RK1A 2CVFA 4M9RA 4C06A 2WIGA 1YR8A 1T5DX 1UPAA 3QLVC 4HAUA 4FHDA 4ZGBA 1CIPA 2XUGA 2VP4A 4M76B 1UC5B 3WL4A 3QVGA 4CN8A 1R10A 2JAWA 4M0EA 4EG7A 1TT5A 2IIPA 5LDGA 3H87A 5D3ZA 2SCUB 5BUQA 4LGMA 3O91A 1E58A 3I1FA 4KQFA 4OP1A 4G89A 3R4CA 4N0DA 3WIVA 3L7JA 5A4DA 3A4MA 5I9IA 3MWEA 1U2TA 1TZ2A 4W5TA 3EXHC 2JIBA 1CG6A 4J0EA 4HS4A 4BNIA 1AE1A 5DNAA 5AUPB 3VPHA 2G72A 4JOSA 2AZMA 4ROTA 3TQQA 4IS2A 4CMAA 3QUTA 3KVYA 4GI1A 2FNAA 4FZVA 1DC7A 2SECE 5ALNA 5BRNA 4EVSA 4DT1A 3AO0B 2FMTA 4JOBA 2R2GA 3FVTA 4EAQA 3ZWYA 4J49A 1QU3A 2M2IA 5GV8A 4JEIA 1LSJA 2O7NA 2Z1MA 2NZXA 1FFAA 4TKMA 1Y1SA 4IH9A 3RSCA 3RNLA 4D1YA 4B4UA 1KSJA 2I9KA 5KSWB 1U5CA 4KAXA 5IMBA 1WP4A 3G5UA 2I2AA 4FYHA 4UARA 1RHUA 2AI2A 3H75A 3P9CA 4S1TA 5FLYA 1JDJA 3HJHA 1QWSA 4BVBA 3OLZA 4I3GA 2PLWA 3JQ8A 5AKZA 5K0SA 3RU2A 5EJ5A 1MGPA 1DSSG 1T9ZA 4AKSA 5K4HA 3AF6A 3TW6A 3BIJA 1S8OA 2J9YB 5COAA 1Q7CA 5K3EA 1PFYA 2XYGA 1PDWA 5ERXA 1G291 2R6JA 1L7NA 3EZNA 1G4UR 3R1IA 1M2NA 4G4SP 4M1MA 1DZIA 3KZMA 4AJ1A 2JG3A 4G65A 4K28A 2AXEA 2QLNA 1Y89A 3AERB 1ZJJA 4MUJA 5GOTA 4HI0E 4C43A 2IX3A 2BI7A 3C3PA 2HQ1A 1M2HA 2PA0A 3FBWA 3ZG6A 3ZLBA 1PD1A 1VSBA 4DA8A 4O5AA 3L9XA 3ROTA 5EHZA 4FC7A 3V5NA 1XZHA 3G3EA 3MYYA 2C5FA 1OASA 1XOIA 1Q0HA 1V3UA 4O0MA 5BW4A 5F1PA 3QNMA 4V0OA 4HZGA 5I7OA 2Y1WA 2HNAA 4Q3AA 5JBQA 4U7JA 1XDUA 2Z30A 1NC1A 1VPTA 1YCFA 4KTVE 3FCSB 4D0RA 5K3CA 1SXHA 4MLCA 1QGAA 4DLLA 4AM8A 5JOQA 3JASA 3JQ7B 3OPVA 3U7IA 1H94A 1KYZA 5FUBA 2R1TA 1UT6A 5EXPA 3JD1A 4N12A 3JVUA 3F2VA 2X3UA 1W1IA 3RABA 1G7TA 3K0FA 3NALA 4KR0A 4PCAA 2PZMA 1Z0AA 4EHJA 5C35A 5DZSA 5HR5A 3SOZA 3ELDA 1M2EA 2XKBA 2LCIA 4DXDA 2A5YB 5IAKA 2J6CA 5I9SA 2H5JA 1DG3A 2W90A 3R3HA 4WKNA 3SQMA 3TGWA 1N9ZA 4R1OA 3QPDA 1PKEA 4BQRA 1M6EX 4MEJA 1GN9A 2VQ3A 3N05A 4MUBA 4RSRA 4B7AA 1Y9DA 2E18A 2VWQA 3QOFA 4HH0A 5JAPA 4Q7KA 4XLLA 3UNXA 3W6ZA 3KAPA 3WR5A 2C3OA 3N3AC 3R8FA 3ZDZB 1D4ZA 1RZRD 3I4CA 3K0KA 3WV4A 2P9JA 1ZD2P 2A9JA 2G83A 1SBYA 2CLKB 4IDNA 3TZLA 1F0PA 3KZXA 1S01A 2P9YA 3RU9A 2L82A 2WD8A 1P2UA 1TYEB 5AQEA 2VATA 2CLIB 4P7GA 3UXYA 2VP3A 4CKWA 3DTVD 4BKQA 2QTWB 3BXFA 3Q85A 4WX2B 1IHDA 2FFQA 3WLKX 4FFVA 3RAJA 4QASA 3AKEA 4RULA 1R3DA 3VPDA 1ONNA 4PLPA 4AS3A 1CRLA 1DKOA 4X94A 4OKSA 3T5BA 2IV7A 2P3SA 4LF9B 3I5YA 1JT9A 1OTHA 1V26A 4HXYA 5D01A 5DCLA 3FN4A 5E1BA 1Q92A 5FWYA 4REOA 1DG9A 5AVJA 1KJWA 2FK8A 1EX6A 4HNAB 3P0HA 4YR9A 1R1DA 1XTBA 1K98A 5CLFA 4WNYA 1EFUA 4E94A 2ZYVX 5CXXA 1N1MA 3OY2A 3OZUA 4ZRNA 1WHSB 2R7NA 3G2IA 3LLUA 4FGJA 2XQFA 4J7XA 3KQYA 3OD1A 1ZUNB 3NHJA 3CYFA 1JPJA 2B37A 5HFJA 1VE3A 1G38A 1PS0A 1W73A 3DLBA 1FP4B 2VQSA 4QNNA 2O8EA 1EXVA 4CF5A 1S2IA 5EIAA 4HATA 1NI3A 2OPBA 2CNDA 3GCDA 1HZJA 1MF7A 1TQ8A 4ZCTA 2EGHA 4EJ6A 1C9KA 4D25A 3VU1A 1Z63A 1SCDA 1T15A 2W4MA 1IWBB 1UODA 3A9VA 4DQVA 1FDTA 3OJOA 3HCAA 4NDNE 2JJ1D 3GU3A 4CLRB 4CM9D 4Z2AA 1QE3A 3ST7A 2AC2A 1QKIA 1HT3A 2BCEA 2VRCA 3FR8A 4WCVA 1ODJA 2ENWA 2EZ8A 4YDHB 2WKSA 1XWIA 1R2QA 1G2IA 1MJNA 1Y1QA 1N2JA 1D9ZA 1X80A 1SU4A 4B5LA 3PF9A 3BWDD 1U2DC 1LBEA 1TEXA 1NBIA 2A9QA 2QPLA 3F8TA 4TL9A 3RC9A 1E96A 3ROXA 2DF8A 4LS3A 5TF0A 3K16A 2WZBA 4RJTA 1X70A 4RNDB 1GFZA 2C5SA 2FRDA 3H9JA 1FVOA 3PJGA 5HS4A 1SXJC 3D4IA 3FW1A 1E61A 4EF6A 2J46A 1E9FA 1SPXA 2K2QB 1Z4MA 2MINB 4N4AA 2BHLA 3RYHB 2VQFB 3NEJA 3W3AA 1QO0A 1GVHA 4DPLA 5DRYA 3OZVA 4I3FA 4FW8A 4O4JF 1NN3A 1GTMA 5LLDA 1AK1A 2IBMA 5ALPA 4XVQA 1NLMA 2WU3A 5J59A 4FMCF 3X43A 5AW1A 1ZAYA 1WF3A 4MH0R 1P6XA 2W93A 5JWHA 3VYSB 4BFYA 1OX4A 1DXQA 2LKCA 2ZUFA 1OI3A 1ZHFA 1I4OA 1XEAA 2UDPA 3H0CA 3W78A 5JFGA 4BZXA 3M4NA 1QTNA 4G09A 1KRHA 2DPHA 3ZE1B 1T9AA 2HPHA 4R1MA 3B1FA 1I6WA 4NH0A 3MJRA 1ZXXA 4BIMA 5K6AA 1RYHA 3U4IA 1Z0SA 2PL5A 2OHIA 4K2HA 4A0SA 4AJOA 3KR2A 2D1SA 4KQEA 3DHVA 3RWBA 3BK1A 4EEXA 2OQ2A 1MENA 4B2IA 4Y1FA 2BKVA 2Z9BA 2JI6A 4JLUA 1Y7HA 1RADA 1Z29A 4R3WA 4Z9XA 2WMNB 3I28A 2ZFUA 1L7DA 1XAJA 4KYUA 5JV5A 2IE8A 4L0QA 5KNBH 1PGQA 2V7BA 1SH7A 2FF7A 1V16B 1O5IA 2JAXA 5LZ7A 3T4XA 3ZN2A 7AT1A 1UC9A 5PNTA 3OZEA 3NTQA 4N6NA 1Z6PA 2IHBA 4PPGA 1Q3KA 4Y2SA 5CRIA 4FOSA 3W6PA 4AYWA 1K8ZB 1SHJA 2JIZD 1NLZA 4YN3A 1P4SA 3RBZA 1ZINA 3S2YA 3WDLA 2B4TO 5C80A 5IASA 3HEBA 3EIQA 5DM0A 4HAIA 3OZDA 4DBLC 1AMNA 3ROPA 4XFJA 1KU6A 5A0TA 3JQEA 3AM3A 1T5IA 1TAGA 3EVEA 4B3HA 2PWZA 3GRFA 4L8VA 2B36A 3KZOA 1GV1A 3KCNA 2AZXA 3GPLA 5ALKA 2QENA 5A6VA 1VE7A 1W5EA 1Y8RB 3S6JA 3UGJA 1G5HA 2O8FB 5LOVF 3NYQA 4EYOA 1JIUA 3H2KA 4LISA 3E1GA 1ONPA 5ALFA 1JDUA 2VP2A 3MMXA 4QRIA 1DO8A 1LVUA 3V8NA 3VVLA 4EP1A 5KDDA 4LF8B 1O94C 5HPYB 4S04A 1I5OA 1NN1A 2GZDA 3GLIE 3B6KA 4RY2A 3LV8A 1N1DA 1PYGA 4D82A 3HBFA 3EZ7A 1EB9A 3K9QO 1UMCB 4CQMA 1VSVA 5JDCA 1GD1O 2JGLA 1H69A 4FHGA 4YRPA 3U3ZA 2FPSA 4D45A 3AR8A 3L7BA 1C0KA 1JL3A 1HKHA 3BWEA 3U4DA 3SKYA 2W2QA 2KJQA 1DBWA 1OPXA 1HX7A 4FZ3A 4WESA 3ZGYA 1B41A 1Z5PA 2QIPA 1Y6QA 3EVTA 4PFSA 4INZA 3ICEA 1B4DA 1ZXBA 3M4ZA 2WJ4A 1RHJA 3M7IA 2GPBA 4PV7A 1G17A 4Y9UA 1CUFA 3TPCA 2AEFA 1HSZA 2H2FA 1N6RA 2Q49A 4M9ZA 4KXYA 1NBAA 2VTEA 1N2CE 3IR5A 2OGTA 1HYGA 4P4TA 2FVXA 2ODWA 1V3TA 4EHDA 5T4FA 1E0DA 1GTSA 1TVKA 5CX1B 5BSRA 4WFJA 1HNXB 3D6AA 3LC0A 3CLVA 4QRHA 5E38A 1J49A 5J5VA 4X66B 2CHUA 2C4HA 2G1KA 3I4FA 2D06A 2X8LA 3COZA 1AS2A 3LK7A 5FPHA 4G9EA 2AK2A 5LB4A 1JHAA 5ILQA 1O0CA 1NKVA 3L92A 1E2DA 4FYXA 3SCZA 3FWPA 4AJ2A 4DR6B 1EEXB 4HQRA 4NE2A 3A9UA 4W9NA 3MMNA 2PJRA 2HMUA 3ZIDA 4GGOA 4JC4A 5KJCA 3EBOA 1E32A 4OP3A 3KQTA 4AI6A 4C2BA 4AK9A 1BCRB 2R85A 2C2HA 1NW4A 3SBDA 1CR2A 3DMTA 4ENTA 4QYWA 4LKOA 1U0NA 3RS0A 2GUGA 1T4MA 1JRLA 1NI4B 3BJMA 4QIHA 2ZROA 2GQ0A 3C6BA 3AM4A 1SJ9A 2CYCA 4CFYA 1XI2A 3BSFA 4FFBA 4L6CA 1T36B 1YVPA 1D6SA 4UNPA 1P17A 3HS3A 2O19A 1AGPA 4JL8A 2EC5A 1H5UA 3ABSB 3P4YA 2BFNA 4HVTA 4F4UA 2AR7A 3AI1A 4EGAA 2NZYA 3B5EA 2G1UA 3P0EA 3L7OA 4MS1B 4WE3A 2Q07A 2YS7A 4GI5A 5C8ZA 2P0YA 1WUHS 2D7DA 1KF0A 1NHWA 2IP4A 3P7MA 5H02A 4A6PA 3CO5A 4RD2A 5DPMA 4EG5A 3R40A 3FYHA 1LVHA 1OXBB 1UKBA 4XIJA 3GRAA 3UK0A 5FBHA 3M5WA 2QN6A 2I6XA 1DAEA 2DT5A 1EWKA 1DP4A 3EXFB 3GGCA 3TTVA 1DXYA 6GPBA 4D26A 4AY2A 1N2XA 4CI0B 1IM2A 2AOTA 1G8YA 5DCUA 4Q34A 2CE7A 4HAYA 4HGRA 5TT0A 4A16A 2GEUA 3NGMA 4UMFA 2R6AA 4EA7A 5CBPA 1VB5A 3KD3A 4DCJA 4Z86A 1ELOA 3RYIB 4FB4A 5ELXA 2BCJQ 3H6HA 1Y1KE 4YI5A 1KI2A 4HWGA 4EF4A 3OE4A 1DKNA 1ZMTA 2GZSA 4FWTA 4I7EA 3IEPA 3UMVA 3CEJA 1JALA 3X3HA 4O3MA 3QXXA 5J5AA 3UGQA 4D3YA 5I4IA 1ZL0A 4ED9A 5B7GA 5CYGA 1G1AA 1G4AE 4A8JB 4B46A 4DCVA 3EGEA 4DSZA 4HXEB 1IATA 2J0VA 2JPDA 3GZJA 4NHOA 2BYTA 1RQNA 4HGQA 4I66A 5EIWA 3FKSD 5AOBA 4YT2A 1SQGA 5K45A 3T1HB 2FWJA 4H17A 5JVDA 3GPDG 1SK8A 4UZFA 3A4YA 1KFKB 4MPDA 4U6QA 2Z2KA 4JI8B 3GLTA 4X60A 3Q8WA 1OIWA 5FEMA 1KE2A 5HE8A 1BX3A 3OMLA 3DMGA 1RHMA 2C2GA 4LCJA 3BGIA 3UMFA 5A9SA 4RV4A 3RADC 1RJGA 4RDHA 4RK4A 4X1IA 1KFBB 4FHFA 4IY1A 4WEQA 3DOCA 2BDUA 2ZSKA 3D3NA 3DV0A 4K2AA 4QT0A 1K88A 2A7QA 2OCIA 4NXNB 3F9RA 2RHJA 1WA5A 4COOA 4EYSA 2R00C 2FV8A 2VAVA 5EE0A 4JWKA 1A77A 2WJ6A 4DFDA 1P7YA 1ZPDA 1VFPA 3ICOA 5A02A 2SKEA 5DI3A 1G41A 2X4GA 3B6JA 1ZK4A 1FBNA 3MS7A 4JOCA 2YUIA 1NKTA 4MWTA 3ZW8A 2WIJA 4NRDA 4I55B 1G8SA 2OAGA 3RRJA 5AM5A 5FWAA 3TLAA 1GAEO 3VNRA 1UZMA 4Q4DA 2EFEB 5LJIA 4TSFA 4GRIA 1R37A 1RM3A 1ABFA 1RFLA 2BSAA 2VI5A 3GMIA 1ZZEA 2MYTA 1DRKA 2EBHX 4PRYA 3W5HA 1YZYA 4NYMQ 3A36A 1REQA 2X7JA 1P7PA 3PQ4A 2WTEA 2Q8NA 3TRIA 3U3XA 3W3AH 1UIMA 4RAOA 1CZHA 1Z4QA 3D81A 1XCMA 4JC8A 5INTA 2Y9MB 4WZBB 5DFAA 2HDOA 1OSNA 1WY7A 3MILA 2J9FB 2LDBA 4IQ0A 1C0EA 5K0CA 1I36A 2AN3A 1N4DA 3GGOA 4AJ9A 4PHGA 3WP0A 1KAOA 4BEWA 3HH8A 3U9LA 3ZY4A 5KUTA 2X8JB 3DWFA 1EK2A 1XTQA 1H4QA 4F60A 3QVSA 4R9VA 2JJQA 1WZUA 1CB0A 3IFSA 3NFYA 1ZD3A 2GTHA 5TQ0A 4K5QA 1J2EA 2AD5A 5ES3A 1S4QA 2NXEA 5D87A 3X0DA 5TGDA 4DYDA 2G7ZA 3PXAA 3EMBA 2J4CA 2NU9A 1NMZA 3VR3A 5H70A 1GY8A 1OX5A 1MAAA 3RT9A 4QYXA 5BOVA 5BW5A 1D4AA 3QFSA 4W6QA 4W1RA 3DGEC 4W5JA 1Q16A 4YJFA 1GNQA 2ZRLA 3UKJA 3VISA 5G1PA 2D0IA 1JLSA 1ODCA 3SNKA 3T1QA 1ULSA 1RQ2A 2ZUBA 1ZH4A 3K4PA 4KL8S 3T6KA 1KORA 4L16A 4CHTA 1YMVA 1IEXA 1N7HA 3MQFA 4DMCA 3L18A 2XXAA 2F3PA 4U39A 1L7AA 1JXOA 2JH9A 5BVGB 1EDOA 1E2GA 1L5YA 1UBFA 3C8DA 3IAM6 3K9GA 4DWWA 4GS5A 4EX6A 1H2BA 1WBJB 4F91B 3U4QB 5CX4A 1DE0A 3VR2A 4I9UA 3WIUA 5FKJA 1VG8A 1GLNA 2AMFA 4GI7A 4KRGA 5JI2E 3DXZA 2P90A 4IF4A 4KFSA 3E3NA 1C4KA 3C6XA 5HBRA 1XMQB 3CZ9A 5HP4A 1JR3A 2D5AA 2KLBA 2OBYA 3IVGA 3L93A 4PIMA 2NSDA 1NVVR 1WW3A 1CJSA 3CX3A 3U6KA 3Q2OA 1A72A 1FX0B 3KALA 2DBVO 2ZJFA 3TTWA 4PX9A 1V95A 1SNYA 3N8NA 2WB2A 3CONA 1U0LA 1X0XA 1T8UA 2NYVA 3D54D 5EESA 4X41A 3TVYA 3L8HA 3LQ1A 5DT9A 4X7MA 2W11A 1TM2A 4BY9E 5KTTA 4PINA 2QVBA 2RD2A 2TRSB 3SI7A 5BOSB 2XGJA 2C2BA 2CW5A 3D9QX 4RA6B 3FSRA 1VBNA 4NABA 2NUTA 4EMUA 4EGSA 1OGYA 3ILHA 4Q9AA 2W2OA 1EJ2A 5AJVB 2J3QA 2WRZA 1G42A 1UK9A 4ZPJA 1G8KA 2RGYA 3I1YA 1JUDA 4XYEA 2GKSA 2DY1A 2ST1A 2HWWA 2UYOA 3A3YA 3THXA 1JMVA 1NF3A 3KD2A 1GEGA 1X7GA 4U7TB 3A3NA 3VKFA 2R6FA 4Q7JB 4AKGA 1M2VB 1F20A 3A6KA 1NVFA 2XLBA 1A2OA 3EXHB 4AUEA 5EJ9A 2WJVA 5AFSA 5J2UA 4LOJA 4M89A 3KJQA 1PDVA 1UOOA 5EN4A 1VHLA 3EC7A 3HDJA 1IK4A 5FA8A 1J9EA 5T64A 3BF7A 2WAMA 1ABEA 2VYVA 2ILTA 2ZI3A 4MP6A 3T52A 2HZ7A 4D9GA 3P0FA 1S8FA 2KMLA 4Q03A 3VO8A 3THOA 1Q77A 1VIDA 3KT8A 1W1UA 2YXBA 3OM9A 4K46A 1U0GA 4WW0A 2QX4A 2AOUA 3HJNA 3KU4A 2ZJ3A 3A32A 4K03A 3IP9A 3MN1A 4F5EA 5HOQA 3U4MA 3MINB 1T26A 1C41A 3KKOA 4RBNA 4B0PA 4JT8A 4IGAA 3D6MA 2KQUA 2N3ZA 3V1UA 3AW9A 1T35A 2W6JA 2X5NA 3L5OA 4CIBA 1ZSVA 1ZIOA 3DH0A 3UC5A 2O2JA 2QYTA 4Y0AA 2NSHA 2ZLBA 3ZXIA 5BYKA 3PC8C 2C2MA 1BDIA 3A26A 1YI8A 1OXXK 2H9IA 3VU3A 5KDOA 2GN9A 4LQCA 3CN7A 4Z6KA 4FCTA 2FN4A 5B58C 4ZEVA 4AYXA 3EOAI 1H05A 4WFKA 3GJXC 4HDNB 5A0VA 1WMBA 1EHIA 4PY2A 4MMYB 3C8ZA 2D5CA 4CW7A 1ZIPA 4QGHA 1NULA 3Q1KA 4GPIB 1CUYA 2CJXA 4NATA 2YBEA 4LSZA 4YAOA 4L8GA 4ESEA 3T7JA 4JGBA 4HHEA 2IWRA 7MDHA 2J87A 3GFRA 2ZS7A 3I5XA 2PRKA 1KP9A 3IV6A 1T24A 2Y3IA 4DMRA 2VJAA 3CEMA 3Q6NA 1HMYA 1P2FA 5E9JA 3D4LA 3RVMA 4MGZR 1H2XA 4O2AF 3HB9A 4IIUA 3V8PA 3OFND 3DBLB 3ODGA 1DMSA 2GO1A 1I1QB 3LO8A 4J91A 3FBGA 5JU6A 2PWBA 2ONKA 5EKDA 2Q5LA 4I9GA 3WGGA 3S1AB 1XDBA 3NP9A 4IVPA 3VZRA 4DIMA 1RKXA 2HWYA 4PR3A 4XD7D 2NT3A 5AW7A 5JZ9A 4FDTA 1HRKA 1MEJA 2L18A 5F9MA 3K9BA 1KSHA 4EY5A 4MYHA 2YTZA 1U2GA 1W46A 4IRUB 4LNUB 2OG1A 1M1NA 3NPAA 1CVIA 2CJWA 3M89A 5ECGC 1VXRA 4HZUB 3T4PA 4LXIA 2DWOA 5BMVA 3UOGA 2JB9A 3CNLA 1MB4A 1R0WA 3FJOA 4JUDX 2ZOSA 3AF3A 1L7PA 1FQJA 1TVEA 4KDFA 4QX6A 3IR7A 3UJ8A 2V9PA 2VAMA 4O4LA 2NYUA 1Q0ZA 3ADPA 1MBZA 3B78A 4JJ8A 1ZK3A 3FMFA 4Q02A 3IS3A 1G8AA 3CLRC 4HMQA 4PAOA 5JMOA 1SU6A 4DR4B 4KVZA 2NVUA 3LDAA 3K1AA 4HGYA 4Q5IA 3RVBA 1THGA 2O06A 4BNXA 5JAUA 1FX1A 4X8HA 2I1VB 1SCUB 4DCUA 1W96A 5CFNA 4LJAA 3NJRA 3UWKA 2VRWA 1T4CA 4C5CA 2OFXA 3I01A 4QU9A 2O3SA 1T6BY 5EIXA 3C85A 2HIHA 4TS4A 3H8SA 3MJCA 4BN4A 4DMFA 2AJCA 2CFRA 2DG2A 3UKDA 2DTDA 4LEIA 3KOWA 3N75A 5D3KA 1CFZA 4BNTA 4HDSA 3RSFA 4N0PA 2VJYA 3ZJ5A 2XXBA 4LYJA 3EY4A 4UAUA 3KETA 1UBUS 1FXSA 2AQIA 4U7HA 1A8IA 3MUEA 1Z38A 3B6EA 3OQBA 3AEYA 3DFUA 3TSYA 3SSNA 1FFCA 2EDAA 2ZREA 2BE9A 2OXIA 3OO1A 1GA6A 4FNMA 4KN9S 3RVNA 4BFXA 4WAUA 1N34B 5HX7A 3UB3A 2X0FA 1IM8A 4YALA 4HQNA 1IRIA 3HCCA 1IIRA 2XVAA 4PAWA 1PRYA 4QFBA 4IJQA 3TTTA 5K3AA 5KHLB 1HSOA 3KSAC 3QK7A 4AP6A 4QYMA 4EEZA 5C52B 3BPSA 4LE0A 3RPEA 2IEZA 2B4AA 4M88A 1U90A 2IDKA 2VNAA 4TX1A 2JA1A 2Q4EA 2ZTMA 4OIMA 3CRVA 4PZLA 3W5IA 1UAYA 3K09C 4OHRA 1TFUA 1UL1X 2VA9A 2ZRMA 1QM5A 3HUFA 3FX2A 4NFLA 4XIYA 1NP7A 5H16A 2KLHA 4YCSA 3IEMA 1QYIA 3RO7A 1VE5A 1MG5A 1M33A 5LBTA 4HNRA 5AK4A 1P5JA 2DR0A 3DDZX 3ZVRA 2JAQA 2CJPA 3TI7A 3K70B 2HHLA 2LCFA 3PHBE 4CZ2A 1E5TA 2ZKLA 3COWA 3VZSA 1G9TA 1DTWA 2PZBA 2QSZA 4QYSA 3UO8B 3FZNA 4MVJG 3ZE2B 3ZHCA 4HEJA 3MHTA 1TI7A 2JRLA 4TS9A 4KKVA 3JYHA 1ZA1A 1TEHA 4M1ZA 2WABA 4FYMA 3TQFA 4YPOA 4HKTA 3CWZA 1AF4A 4WXHA 4Z3DA 1H42A 3L1IA 1UWLA 4G1MB 4DIDA 3VX4A 3DE2X 1Y8QA 4B6EA 1FZTA 1T43A 3OZTA 5TDHA 1VXOA 1H2YA 1OKKD 2OHFA 3I9MA 3G2JA 1RXEA 2Y9PB 3KQWA 1T2DA 2QVZX 3FTPA 4RABA 2YICA 3B1XA 1B8PA 1FDSA 2NVBA 4I4IA 3ZE7A 3OE5A 5JPCA 4L27A 3IIMA 1P4GA 2COEA 2QIOA 4ZALA 3UW3A 5D7BA 3IUSA 4F9FA 2VSXA 1FCJA 5DOZA 1CU1A 4GOMD 5C8YF 3KP1A 2HRRA 3H2IA 1XTKA 5T4HA 3BUSA 3CW2A 5KNCH 2VH2A 2W98A 2F8SA 3IKTA 1USKA 4UW9A 2I7VA 3DL2A 1FNCA 1E1NA 4U9IS 1BX0A 5IN5A 1Z5VA 4XE5A 5I4BA 1MZPA 4EO7A 4YMVA 5ITZA 2F4VB 2B5VA 1VKHA 3QVKA 3LJKA 4J3NA 5IU6A 2G17A 3D8RA 1ZI6A 2FP4A 4XPIA 3ANNA 1U2EA 3FPJA 3IPCA 4C07A 1G2PA 3T5CA 4CLOB 5AVSA 1LI4A 2OBFA 3BVPA 3KQUA 3F4KA 3OF3A 5EXEA 1UDCA 2WM3A 4G0QA 3CF4G 5B3JA 2QRNA 2A1TR 5DHFA 1XQYA 2YBDA 3K0SA 1J56A 2CCGA 2H08A 3WWEA 4OB6A 3B52X 4MR8B 3KHKA 2QP9X 3FLAA 4QBHA 1F8YA 3DJYA 1CIVA 2GHIA 1ZWLA 3KSMA 1VSTA 5FYDA 5EL0A 4A9AA 2C82A 4GT1A 5G02A 2GF9A 4KXXA 3DZFA 4I9NA 2O1SA 4PG5A 4QXOA 4G0NA 4HWTA 3KYCB 3KOXA 1AHIA 3QW2A 4KV7A 4B80A 4UUPA 2WNSA 4Y6QA 4KVFA 1EUDB 4O8CA 3WB1A 1VIVA 4U4AA 4QOGA 3CX4A 2GD2A 3PA8A 3H16A 4AMVA 4HWOA 4E08A 2HF8A 1KZGB 1ZD5A 4NE7A 3FM9A 4XI9A 3GAAA 3KFLA 2D5LA 3TK1A 1JN0A 4BNUA 4I5FA 1O58A 3DZ8A 1P0FA 3SYKA 1DB3A 2XNHA 2FMHA 3V48A 3DKVA 3W8EA 4DG9A 1JH8A 3LF1A 1K6XA 2G9UA 3GHHA 4IEFB 4M1QA 1U0OC 4FE3A 1D2GA 2NTYC 1RR6A 2O57A 2WTNA 4NL4H 3GQVA 3JQFC 1ML4A 1CUDA 3N0VA 5CHEA 2J5KA 5LXTA 2GEJA 2QN9A 4ZO4A 5DCWA 2Z83A 4FYJA 1GGNA 3RTDA 1HTBA 3C2QA 3RVPA 4G8CA 2FSVA 3BH0A 1SA0A 4J1TC 5UKDA 2P77A 4BLVA 1Z6AA 2HNBA 4UU7A 3PKJA 4Y2TA 2PL9A 2EXXA 2AR0A 2N1MA 1V3VA 3DE6X 2NUBA 4M4SA 4MAFA 3E0QA 1BCSB 1TD1A 2IYOA 2Q9BA 5FO1A 4G81A 3T5TA 2BFDB 3TTSA 4LQ4A 3RC2A 5KDLA 1CDEA 4FFLA 3ZWXA 4E1BA 4F1KA 1U7HA 4Q3OA 4R8KA 2I2DA 3OM8A 3B6IA 1PV2A 1WM1A 2Q6IA 2V0GA 4KH0A 2N47A 1C1DB 2ARKA 2XB8A 1TD9A 3KQMA 5CLQA 3UHJA 2O9JA 5LQSA 3IE0A 5LWQA 1J1UA 1ZVJA 3HZZA 2D2EA 3P27A 2KB0A 3GAMA 3N5CA 3LKDA 3WMXA 1DCMA 4TMTA 4GG1A 3LAWA 3K72B 3OZSA 3U31A 2PSJA 1K5PA 4ES6A 1OYWA 2HHJA 2I7DA 3QU4A 3R7FA 4YCNA 3OCZA 1INLA 2J41A 5K20A 3ID6C 5CFZA 2DETA 4MV4A 3ZZ0A 3ILYA 4DC0A 3X44A 2GM4A 3MT9A 4WZ6A 1G64A 1SXIA 4XARA 4IIEA 3O4VA 4NNJA 3AHJA 1MOSA 4AF8A 3TSOA 2ZE5A 2OSBA 5K09A 1T9BA 3ETHA 3X1YA 1BA3A 5GJCA 3QXJA 3DOUA 4UMDA 1WAMA 2CLCX 4RANA 4U6NA 3Q11A 1TA9A 2J3HA 2YY7A 4WD3A 1DQNA 2WDPA 5AHKA 2FJPA 2HU2A 2ZVPX 2PCJA 3QA9A 4LRYA 5ARDA 4Y0NA 1ONOA 2G82A 3GGGA 3N2KA 4UE6A 4D3DA