1X94A

Crystal structure of a hypothetical protein
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
191
structure length
176
Chain Sequence
MYQDLIRSELTEAADVLQKFLSDDHNIAQIEAAAKLIADSFKQGGKVLSCGNGGSHCDAMHFAEELTGRYRENRPGYPGIAIDYVFSRYVEAVGAKGDVLFGLSTSGNSGNILKAIEAAKAKGMKTIALTGKDGGKMAGLADVEIRVPHFGYADRIQEVHIKIIHIIIQLIEKEMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords putative Phosphoheptose isomerase
publication title Crystal structures of two putative phosphoheptose isomerases.
pubmed doi rcsb
source organism Vibrio cholerae
total genus 66
structure length 176
sequence length 191
chains with identical sequence B
ec nomenclature ec 5.3.1.28: D-sedoheptulose 7-phosphate isomerase.
pdb deposition date 2004-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13580 SIS_2 SIS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10490 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glucose-6-phosphate isomerase like protein; domain 1 1x94A00
1N33B 2UUBB 3JX9A 4AQYB 4DR7B 4JI0B 2HHHB 2CXUA 3HBAA 1G98A 1VI6A 1MORA 2UXCB 3UJHA 2I22A 4DV5B 2DECA 1N34B 3ETNA 2YVAA 5LL6P 4X64B 4DV1B 2PUTA 1TK9A 1X92A 4JI6B 4LZJA 2UUCB 1VIVA 4NXMB 4IVNA 3OTOB 4DR5B 1IBLB 2ZM6B 2CXOA 1GZDA 3NBUA 1C7QA 2E5LB 1DQRA 1JEOA 1JXAA 1J5EB 1VIMA 2XBLA 1HOXA 3C3JA 2F4VB 1T10A 3OOJA 4GKKB 1N8TA 4B3RB 1U0GA 3T1HB 2UU9B 1IRIA 3J7AC 4TOIA 1X94A 3BJZA 4B3MB 4DR2B 4LF6B 1HR0B 2VF5X 2I2WA 4DV6B 4LF4B 2UXBB 2J6HA 2CXTA 2CXSA 3M5PA 5BR8B 1VI5A 4JI1B 2CXPA 2CB0A 2ZJ3A 1WIWA 2CVPA 2UXDB 4JYAB 1U0FA 1NRIA 2UUAB 1M3SA 3Q7IA 1XMQB 4JV5B 3FKJA 4DR3B 4JI3B 2X3YA 4GKJB 5BY2A 4LFAB 2WU8A 4LF9B 1XTBA 2CXNA 2A3NA 2POCA 2VQFB 1MOSA 4DV3B 1FJGB 4DV0B 1X9IA 3Q88A 3LJKA 1GZVA 1B0ZA 4LF8B 1J5XA 4DV7B 4K0KB 1U0EA 1N36B 3EUAA 4DR6B 4S12A 4X65B 1JIQA 4B3SB 3TRJA 2DF8A 3ODPA 1XNRB 2O2DA 4JI8B 4NXNB 2O2CA 4OX9B 4DV4B 4DR4B 4JI2B 4YHHB 4YY3B 5IWAB 2XHZA 5LMUB 3BCHA 4EM6A 1XNQB 3FXAA 3FF1A 4M0DA 2V4MA 4LF7B 1C7RA 5LMNB 1ZZGA 2E5FA 3I0ZA 3IFSA 4LF5B 1HNWB 5A2QA 1I94B 4AMVA 4LFBB 3TBFA 4DR1B 1MOQA 1IBKB 1IBMB 4KHPB 2Q8NA 2VQEB 3PR3A 4X66B 3QKIA 4U6NA 4DV2B 4JI4B 5IT9A 4DUZB 3KNZA 4B3TB 2AMLA 2CXQA 5I01A 3SHOA 5FLXA 4JI5B 1NUHA 2VF4X 4X62B 3J81A 3HJBA 4JI7B 3CVJA 3T1YB 3G68A 2PUVA 1XMOB 1X9HA 3JAMA 2CXRA 1JLHA 1KOJA 1TZCA 4LFCB 2ZJ4A 3J80A 1HM5A 1N32B 1HNXB 3FJ1A 1TZBA 2PGIA 1HNZB 4S1WA 1IATA 1Q50A 2PUWA 4DUYB
chains in the Genus database with same CATH superfamily
2OCBA 1FIUA 2GVDC 5JXJA 3N2GB 1WVMA 3N8HA 1RBYA 1VRVA 4Q02A 3MCAA 3RJTA 4XW2A 3HKDB 3QG5A 1RNLA 2JBWA 3H1TA 5I4KA 3A3KA 3ABZA 2CD9A 4D79A 2P6PA 2GILA 4P4UA 3KEOA 1N1EA 3R1IA 5JHHB 4R3UC 1SUIA 3ZJVA 1ZZEA 1C3EA 4JNKA 4LG1A 3UFXA 4KZPA 4R1QA 1ZNXA 3JU3A 1I51A 4LI3X 3DE1X 4OK3A 3QPDA 4HDNB 4KKXB 4CF4A 4TMTA 2B5WA 5E7JA 5JCPA 1GPJA 3I2GA 2JAPA 4NMWA 2PPVA 2XNSA 3H8SA 4V0QA 1LU9A 1NULA 2ONYA 2BCGY 2VBCA 3HEAA 4PLZA 1GNQA 4ZVPA 4P80A 2RHWA 3TCKA 2AR9A 4KE9A 2HWUA 3VC7A 5JD5A 4IIYA 3UG6A 2C5GA 4OB7A 1PGPA 3H04A 1LS1A 2BDTA 2JK1A 2V7VA 1A1VA 5C3UA 4UNSA 2NACA 5AKZA 2BHRA 1KEEB 2PGDA 4WSOA 3RYIA 3WL7A 5I3ZA 3U4QB 4M8IA 4D9NA 5EFOA 5LXTA 3ODGA 4RL4A 5JCJA 1IBCA 2GCPA 1YB5A 2E7ZA 2Y76A 3D0QA 1FE8A 4G5OA 3IT1A 4YJ3B 3KDSE 4ZICA 2XVZA 1HI9A 2C95A 3GFFA 2LR0A 3L6UA 2FXVA 2O2YA 2DPLA 2O52A 1IJKA 2QTCA 4K9MA 3BCSA 1P7WA 2XH8A 4OA8A 2O23A 3M7IA 1GN9A 4IX1A 2YNMC 4JP5A 4M89A 4H7DA 1SGWA 2BFFA 3LBIA 3WICA 1XPOA 2V54A 3V7UA 3W4KA 4M36A 3GNTA 4PY2A 3F7TA 4DCSA 1Z26A 2QN7A 1TZMA 3ZHTA 3NVDA 2ZJBA 3PG5A 2B2CA 4G4GA 3FWYA 3OEHA 4OHRA 5FUYA 4F3CA 3FSEA 1WXFA 3K9CA 2HMSA 1YKGA 3DZ8A 3LJKA 4FSDA 1F4LA 2JJQA 4IJUA 4GZ6A 4JLOA 1JKIA 2XT9A 4UMFA 4ENVA 5BV8A 1GZ3A 1RI3A 2Q8QA 4D9EA 4PNEA 1CUBA 1M6VA 3A6KA 4IOJA 5HTKA 3QZUA 4EJ0A 3ANXA 2IHKA 4MWTA 2QRQA 1LLFA 1K27A 1M83A 4N3GA 4NZYA 2GKGA 3EX7C 1GGKA 1LB1B 2RGBA 1OILA 5EXTA 4XVUA 3LTNC 1WDKA 3AHIA 1Z18A 2P62A 1JL3A 4TWIA 5ES3A 1II8A 4CKXA 4F21A 5DNYB 2L0XA 1ZIYA 2RDMA 2I3AA 3LL7A 4BE4A 5IVHA 1D0IA 1ZM7A 2NQTA 2PSEA 3AJDA 3PQCA 4PO3X 2HGSA 3TIIA 1Z2DA 2HR1A 3UH1A 2CLMB 1VCHA 2DUWA 5FPKA 4FMCF 4TSRA 3BRWA 1W1IA 2PJDA 3IAUA 2B4TO 3OZDA 1MRZA 3TLAA 3VKVA 3OLVA 4ZT7A 2A5LA 2ZRNA 1OGIA 4LSZA 3C5CA 1SU7A 3TYXA 1Q2UA 1O5OA 3T34A 4AZVA 2A59A 3DVRX 3L04A 1IZ7A 2CNLA 2ZB4A 2ZAMA 5DTIA 1U0LA 1V7QA 2OXRA 4A8TA 4WECA 4EGAA 1NVGA 1XP5A 1DL5A 4JFAA 4BV8A 2D06A 3I1FA 3CNQS 3ZGNA 1YQXA 3UMMA 5LMCA 2FV8A 3TOXA 4ZKEA 2DCMA 3ZWKA 3GB9A 4FC7A 1FJXA 1L8LA 3FHOA 1IXZA 4AJHA 2G6TA 3S2EA 4MOWA 1NNEA 4HWTA 4LXYA 5IDVA 3RFXA 2G5PA 2BUCA 2QTVA 3K8OE 3W4JA 5LL6P 3MRVA 1IJBA 1T1IA 1SG9A 2J4CA 5KWIA 3B3FA 1T0HB 1U99A 2VHWA 5FA5A 1XRJA 4TUYB 3WRYA 1ISSA 3F47A 1J0AA 1N2CB 1HO3A 3GCWA 3IEXA 3QIVA 3OZVA 4JFRA 4RHCA 2NUTA 4RTSA 1F3OA 2EKZA 5NULA 2C00A 2I1VB 4IHQA 5L4NA 1QR2A 1VLVA 4HQRA 1LPOA 3ND7A 1VIDA 3BAFA 1V71A 3BX1A 3DHVA 4L8FA 3DOOA 3LUHA 1PJTA 3U1TA 4P35A 4F46A 1FRZA 2PLFA 5KNCD 2VP2A 4OJQA 4PLTA 1BDHA 1LBEA 4B7CA 3MWDB 3TG2A 1LK7A 2HNAA 3U7QA 2WAYA 4AJ2A 3DPSA 3RNOA 2AA3A 1MV5A 4FOPA 2JFQA 5HF6A 4QGSA 1CE8B 1E7RA 1XNHA 3FR8A 4DPLA 3NHWA 4EPVA 4HS9A 2UYHA 2I2WA 3OZRA 2NSJA 4UFPA 2ETVA 3H2BA 1HZZC 4PYNA 3TB4A 4MUAA 2QQEA 2IYTA 1GV0A 1G7SA 5AVKA 2IP2A 3R7NA 1DT5A 3LLVA 3M4YA 3NOQA 4TSFA 1XLTC 5SZKB 4CKBA 4IXDA 1QV9A 2IPMA 3A4MA 3OSUA 4MVJP 4Z8YA 3IV7A 4K1LA 4UVEA 4E5VA 3KLNA 3KSRA 4RLQA 1Z3CA 2YV1A 4DMKA 1JQLB 2PA0A 2WTAA 3G7NA 1SQ5A 1GL7A 1FMTA 1H22A 2C5FA 2HGZA 1VSTA 3FRIA 1MC5A 1QXSA 2XLBA 4JYBA 2O2EA 2NXJA 4KWHA 3A06A 5HBGA 4ER5A 5I4IA 1YV9A 3GT7A 3RJMA 1U0EA 5KSWB 1QZZA 2CZQA 1CUUA 4KLRA 1P4SA 1T1SA 3F73A 2AOXA 4GP7A 4RWZA 2GZHA 3M6XA 5BVGA 3PE3A 4QSHA 1XNRB 4GC5A 1YZLA 2EEPA 3EEBA 3CONA 1KO5A 3JYOA 3N53A 4MPDA 3DB1A 4N8SA 4ND7A 3O1JC 3C5HA 3LBHA 2PX6A 5DW0A 2P4EA 3RIMA 2OCXA 1EZ4A 1R6BX 1PP4A 1XOIA 1GZHB 2MR5A 2QX9A 1KI4A 2DLNA 1S2DA 3PF8A 4FNOA 2IY9A 1KE2A 3IAS1 1TNDA 4N03A 3K8YA 5ER9A 3ESBA 4JJAA 3V4ZA 2GUGA 1Q5PA 1E89A 1G2PA 3ZEAA 1D2CA 1KFEB 5EHZA 5EE0A 3IKJA 5KNCA 3HJNA 3F8SA 2YXPX 2PX2A 1IXYA 5C1IA 1PX0A 1AZTA 5EZSA 2OZPA 2BH9A 3A2MA 3GLSA 3KLBA 3ZC3A 2OK7A 2WC1A 4BVKA 1H8HD 3KX2A 221PA 4QBHA 2WILA 3DBRB 3IPLA 4LYJA 5IU6A 1XTKA 1AKEA 1ZNQO 2NV0A 2XD9A 1E2KA 1FMCA 4M9CA 4U1RA 2HIMA 3A6JA 3CNEA 3L3BA 5H81A 1UZAA 3GYBA 5JTUA 1U02A 3FWNA 5ISMA 4E6EA 5JQWA 5IT0A 2F8MA 4F7DA 1FTNA 3VR6D 3KSZO 2J7PA 4N47A 3OD5A 4EB6B 4DQXA 2DFLA 3UMJA 5KSYA 4H3KB 2V5UA 4U6QA 1AHPA 1EWQA 2H1WA 1HDXA 4EA9A 2WMYA 5KKNB 3M3DA 4EW1A 1V47A 5ALLA 1E2IA 1CF4A 1PHPA 2ZITA 5HW0A 3OE4A 1Z5NA 2A57A 4IO1A 1U7UA 5AW2A 1U5BA 2O6LA 1P62B 3HCWA 1CDOA 5FBQB 2EWMA 1SU8A 1Q1GA 3AZPA 3EVCA 3CSSA 2Z2YA 4EJ2A 3ADBA 3A37A 1UADA 2ZUCA 4P0TA 3B5EA 2VH2A 4GC9A 1M66A 1HQKA 3I9LA 2BV3A 3M0EA 3Q3VA 3P5BA 4JZKA 2SCUA 3BB4A 5KTSA 1TGYA 2IYNA 3UHJA 3MN1A 3Q2OA 4MS3A 1N6HA 1Z08A 4GSLA 4NYMQ 4MUJA 3UEOA 4A8JA 7REQA 3E48A 3FFXA 1X6VA 2CN1A 1NMZA 5MGNA 2JLBA 3FR7A 4S2UA 4K86A 2XGSA 1X94A 4R71A 5KTKA 4WLFA 1RIIA 3MRSA 2B3TA 3MFQA 5F21A 1D1SA 3KELA 5TGTA 3O31A 3K09C 2VDNB 3TMAA 1SKUA 4X7RA 4HTFA 1G4AE 1QF7A 3T9DA 2XE8A 3G1UA 4NMMA 5K4HA 1GTVA 1RM4A 1VI5A 2WSSD 3DZKA 3NTRA 5EUBA 3OH8A 3SOPA 1H8HA 5LOVA 3QX9A 3T61A 4B71A 5I9IA 4MITA 2Q21A 1M75A 2FZCA 3D6TB 5IM4F 1M0WA 3GPBA 3QLEA 2HQOA 3R9KA 4UKDA 1PGNA 1KEKA 4L3WA 4PZUA 3ZPXA 5JNUA 4YRJA 4DA4A 1CIPA 1D3AA 4L75A 1KI3A 1PJZA 1Y9EA 2A1IA 2WTMA 1B2RA 3NAGA 4NCJA 1QU2A 2CL0X 1I5EA 1XWFA 3CQ9A 3TEMA 4N39A 5JW6A 4AZTA 1X8JA 1OVGA 3ZV4A 4B6QA 3A27A 2HK9A 4BGVA 1NN1A 1C9MA 1SUSA 4O5OA 4LNHA 3HU3A 5DSXA 1G8JA 2EFDB 6YASA 4HNQA 1NWCA 3RSLA 2F8LA 1ODFA 2V6MA 3GAFA 4X00A 1U8YA 3EA0A 1I4TD 2FSFA 2VXBA 1L5VA 3C7TA 1G21B 2HK8A 4YMVA 3UB3A 4QIHA 1RI1A 1SUCA 3FVVA 3G9UA 3KYBA 4PAMA 4F97A 1Z62A 1C3VA 2G67A 2W11A 1R8SA 3QVWA 2C2GA 3QF4B 3UNXA 5C9ZA 1U63A 4A27A 1K3UB 4L1KA 2PANA 3MINB 4UPDA 4GXRA 1QC5A 3OIGA 4HPWA 2D4HA 3KC2A 4JR1A 1W35A 1S7GA 1QZTA 3I3OA 2R1UA 5KJCA 4FFSA 1BWPA 4OF4A 1W6RA 1VPEA 2GX6A 3G3EA 3H3FA 4FFLA 4MKHA 4O4IB 3DXFA 4QGBA 4DDWA 1MVNA 5TJHA 4YUAA 1GTMA 4HH1A 3OMWA 3PGKA 1BEEA 4YWJA 3Q0TA 5KTNA 1Q7CA 1RQLA 2FPGA 3NPAA 4IYRA 3E81A 4CHTA 2PNFA 1PVOA 1CUXA 2ZRCA 1CLEA 2ZXEA 2FP3A 1PWHA 2XHEA 2BMVA 2J0SA 1G98A 4QQRA 5E6UB 3U81A 4RBNA 3N5CA 4Z7OB 1G63A 4U6SA 3GPLA 2Y4NA 1DJNA 5IASA 2OBYA 5TPWB 4X60A 1MW9X 2DC1A 4M1OA 4B87A 1QKKA 4U7TB 3SC6A 1EVYA 1RMYA 1PL8A 3Q4GA 3WBJA 2BTOA 2PKWA 2INGX 2IPXA 3PSAA 4GVPA 3FTDA 3EUWA 3GG2A 3L8DA 1VL0A 2FXIA 3LWDA 2AJTA 2P0YA 3H9BA 4PQYA 5D3MA 4H08A 5LJIA 5IM4A 3SBOA 4MS4A 2JA1A 3I8OA 1VLJA 3TQFA 3AC0A 3TG8A 2C3YA 1I1HA 1U81A 2VJMA 3N58A 4M8KA 4M49A 3CWQA 3RTDA 3WZ2A 2H06A 2F00A 4KYTA 3U16A 1QTIA 1HEUA 4YCBA 2YL2A 4UHDA 1GAEO 2HT6A 1IRIA 2Q6VA 2FYTA 1WL8A 3B9PA 3D5TA 3EXIA 2H5LA 3IPXA 4L78A 2R62A 3GJTA 1RRFA 4H1HA 3UXHA 1W34A 4DCOA 3CLVA 3PPIA 3F6CA 4LKRA 1JSXA 3K9HA 3UMYA 1JQEA 1P45A 2PZEA 4N3BA 1XRSB 2NQ8A 1KMNA 2N75A 1NLZA 4BFUA 3ROTA 1U6JA 1IHXA 3R23A 1D2RA 3ZBTA 3FVTA 3WIDA 4EX6A 3CW2A 2ODBA 1JAZA 4M0FA 2E21A 3G5MA 5ALZA 5AUQA 2VDWA 2Z2KA 2CSXA 1U9YA 3EPRA 5IC5A 5DM70 1VSUA 1PUIA 3A8TA 2QMHA 4X63A 3EBPA 4V1CI 1WZNA 2BM8A 2VYQA 1C0IA 2Z6VA 5DCUA 2XJ9A 3JQFC 2Q8PA 3Q88A 1K5PA 1L3CA 2GAJA 3DAYA 3M3PA 3MG9A 3TX2A 3QU2A 1NDHA 1FK8A 1WUYA 3QLVA 4B3BA 3IV9A 3EMVA 3LMKA 5SY6A 2GA8A 1VGQA 4LHZA 4AJPA 4JJ7A 4B4UA 4G8BA 1JDJA 2D1YA 4A2CA 2XRYA 3P2IA 3F6RA 2GRJA 3E3LA 5HIIA 1QRTA 2JANA 3FCOA 5TQ2A 1N6RA 4OQPA 1RM0A 2Q7DA 1KFCB 1X42A 2DETA 3HEMA 1IUPA 1U04A 3GEGA 3HYLA 2E2WA 1P72A 3PXXA 4QLAA 4DLPA 1DAOA 5IC6A 1LK0A 4KFCA 3OOWA 1ECPA 4K9PA 1SD5A 4ZRMA 3UAOA 2YKGA 3CZCA 1AKTA 2BEKA 1XRLA 3COYA 4RDXA 4KR2A 4M1SA 2VOEA 1KDPA 1NW5A 1WB6A 1IN4A 3VHXB 2FSGA 2UYGA 3AUJB 3OIUA 4NNJA 1NY5A 2PTHA 4F2DA 2C4MA 3G89A 3V97A 2XTAA 2WF8A 2GVZC 4TYMA 3OHSX 1ZLXA 3TLXA 2GAAA 3ZJ5A 3FMFA 1XEWY 3IPAA 2IXBA 4L5YA 4II3A 4C0SA 1I30A 4AECA 2H51A 2SKDA 3B13B 3FAZA 3KEGA 3T1YB 3BDAA 4D1YA 3C2QA 3HDQA 1FLNA 4QECA 2D0OB 1J09A 4EY6A 3SICE 4L15A 3SFVA 3CLKA 3LWNA 2WICA 1ZUNB 3KS9A 3LBAA 3OETA 1GQSA 1AHIA 1YR1A 4KB5A 4NJMA 2WDZA 3ZN2A 4QPZA 2PR2A 4EGSA 3N2KB 3WGNA 3T3HA 1CY7A 2IYQA 1NVBA 3GCZA 4PHHA 2EFGA 4QYIB 2Q5FA 4CM9D 5I9LA 4EKEA 3TKYA 3ZZUA 1B15A 1H69A 3OFKA 3W8RA 4LYHA 3B5IA 4QYSA 2YDYA 1BXZA 3TZLA 2F1HA 1IZ9A 4UZEA 4M4SA 2PUTA 5SV2A 3EZ9A 5T3UA 4WLOA 2PU7A 4F9GA 5AR1A 1JIUA 3H7AA 3GJYA 1O6CA 3ZKWB 2NU9B 3BGOS 1X1AA 4ZVLA 4CDGA 5HBRA 1YVDA 3P9CA 2H48A 3D59A 4EO7A 2BMWA 2HF2A 4TQUS 1D09A 3OE5A 3S2GA 3JRXA 3QX8A 3GEDA 1Z4OA 5JDIA 5C7LO 5FNVA 2C4TA 5FTWA 5IBPA 1Z5ZA 5L3ZA 3PBKA 1JTVA 4QELA 5ALJA 3BDVA 3PHGA 3OAAD 4JSRA 5JSKA 2OCAA 4FX5A 1T8SA 4J1QA 3WK6A 2VZEA 2GASA 4YA6A 2VN8A 4BLVA 1JDVA 7GPBA 3R3ZA 4L9WA 4RD0A 3AK4A 4TTPA 2ZIWB 3NKLA 3IX7A 2XCTB 4QX6A 4RHEA 1MF7A 2F4NA 5EMMA 3AETA 3HDGA 3CIFA 1F6WA 3OFJA 5CFZA 2JGLA 3TGLA 2NGRA 2QTGA 1V8ZA 3JQBA 4Q9DA 1XQ6A 3CRVA 3CLSC 3TBKA 2HPZA 5JRZA 1LEHA 2OMKA 4HWPA 3AG5A 1LDMA 5K8LA 1EBUA 3AEUA 5F4BA 2WU3A 1Z83A 1MQAA 3IIJA 5EA2A 5HNKA 3ZGLA 5MN5A 1W2WB 1DJPA 2HYIC 1G5HA 1BWSA 1JR3E 1T3GA 1YS7A 1TTTA 1RKUA 2GN6A 3CT4A 1C7EA 1UMCB 2D5IA 3K53A 3TSYA 4ZZIA 1FP6A 1QIEA 4RWEA 3AJ8A 4DMUB 3C8ZA 4B3SB 3JQAA 4PW0A 2F7SA 4KUGA 2WAAA 3MZ0A 5H9WA 5KU7A 1XF9A 4QQNA 2OG2A 1NGSA 4RSHA 2VZ8A 3W04A 1O4VA 2YV2A 1H5NA 1L5SA 4MK4A 4JOSA 4CV0A 4NDAA 1M34A 3F6PA 2P6RA 2I3ZA 1Z5VA 1MX1A 4CLEA 1RYDA 2B83A 1MRSA 4FWBA 4LX8A 1ZK4A 3H5LA 4AX4A 4ZYWA 2R8OA 3M6FA 4P4LA 3UJDA 3TLZA 2FVXA 4BBJA 3UATA 1E5QA 2R68A 3NHSA 5JANA 1A9ZA 1VLZA 4U7HA 3SZOA 4BNFA 2B5VA 2YIMA 4YRSA 3LBNA 3PTLA 1FDVA 4G1MB 2G40A 4U5XA 1T6NA 3IVCA 3KOMA 5BRNA 3A0UA 1UPFA 2P8SA 3B1WA 1VLQA 1X38A 2ZS9A 3GDWA 3CF6R 4H7KA 1ZS9A 3W5IA 4DABA 4TV9F 3G7SA 5I51A 1H4TA 2TYSB 4H0CA 4N5HX 2OXIA 3AHGA 3EIOA 4LMAA 1OB5A 3O1IC 1K8ZB 4GRDA 3SGLA 2XRFA 1XDGA 3L8FA 5DBFA 4C30A 2QNIA 4FFVA 1ZAYA 1TM7E 1Q1ZA 4KSCA 3TD2A 3UJ6A 2J9YB 5JSHA 4W5OA 1IVNA 2GERA 4EQ6B 3QSYA 4JBYA 1E6KA 2GM9A 2ZR9A 2D54A 3LG2A 5HFJA 3O8RA 4N48A 1AK9A 4A0RA 2A58A 4G0ZA 4CCYA 2B6NA 1WU8A 4I36A 5EMJA 4U2DA 1HE4A 4HPJB 3N05A 1LFAA 2FU5C 2PKQO 4QLBA 3IL2A 2RHMA 2J5KA 1VKOA 3N9IA 1SXJD 1ZSNA 4KN8A 3C1TA 1JDPA 2W5UA 1JQKA 1GGJA 2HY7A 2YXBA 4QNNA 4D02A 1K7XB 1FSZA 5LDHA 4H1TA 4FCTA 1QGUB 1T5SA 4Z3OA 3AZQA 2OFXA 3RYCA 1SPBS 4Z4IA 2AG5A 2PSJA 2ODWA 4CYMA 2DTXA 1H8EA 1XEWX 2XE6A 3IVGA 4XJXA 3SLRA 2DTDA 3DHEA 3GFQA 1PEYA 4M0KA 4RIHA 3PPXA 2NUAB 3ZHCA 4BFZA 4DADA 2QR2A 2YJ3A 4GI5A 1GXSB 2CFSA 4WZAA 4EFLA 5K0FA 1OBOA 2QSJA 1JXQA 3G0DA 3BF7A 3CINA 4RY9A 5ED4A 4B3JA 4EDFA 4G0VA 4DLKA 2Y0PA 3S1AA 1M6VB 4AJEA 2JGNA 2AFHE 3KE8A 3FYDA 3VUFA 4BCCA 1UP4A 1E1YA 5J43A 4BNNA 1FDOA 3FY4A 5DGTA 1QX4A 1WP9A 3IXLA 4PZ9A 1M5TA 3KFVA 1QQ5A 4RH1A 5K3CA 3IURA 1WBDA 4FGUA 3R3HA 2VCHA 4D0NA 1V5EA 2GHIA 2JFNA 5EP2A 4IDCA 3KVNA 2PSHA 1F1BA 3LUJA 4PVDA 4HKTA 4BLOA 1A82A 4P38A 2WHXA 2QMOA 4IHJF 4BASA 4DE5A 5K20A 1Z5UA 3AEKA 4AY5A 4IH9A 3L1VA 1GJRA 4KQ2A 3COPA 4M60A 5EJAA 5I3CA 2EFCB 2UUPA 4TV9A 2NPFA 2GZ3A 2JFVA 3FA2A 1JW9B 5KYTA 3T7JA 1OLXA 4MPPA 4EY7A 4AUNA 4GMHA 1TMYA 3GCXA 3IGFA 5FUXA 4EI7A 4K2HA 4A73A 2B21A 1V1JA 3KFXA 1CUHA 4EM6A 4DBLC 1SXJA 5JAMA 1K63A 4M1QA 4ITVA 3UUWA 3AV3A 3ZX5A 2JJ2A 5KTOA 1OCEA 2H1VA 2O57A 4DTCA 3ZDDA 5SY4A 5KQRA 4WDQA 2O8CA 3AL0C 3L7OA 3WSVA 1H65A 2QZJA 2VTEA 3ECSA 4GM4A 1C0EA 3WRXA 4BB9A 2QTVB 1OFIA 2OG1A 1Q19A 1VKHA 3IUQA 2O2SA 2A9KA 3NJRA 2WU1A 4L6CA 3BH7A 4DLNA 4QATA 4YRGA 5FADA 4TTRA 3TMYA 2BPOA 3HVUA 4W8GA 1I5OA 2OGWA 3MLAA 3IP9A 3KTFA 2HUPA 2VZ9A 3MFYA 3N39C 1ZONA 4P1ZA 4QU0A 4R8VA 4DIMA 1KXJA 4RQBA 4I4TB 4L5CA 4AF6A 3OZTA 1BVUA 3B1ZA 1AE1A 4OQFA 3GOHA 1NBMA 1CERA 4L8YA 4RHFA 3WGYA 1JT9A 2R6HA 2ZXUA 3L5KA 2QRNA 4MRVA 4F9TA 4LMBA 1IPFA 2I4IA 1W5TA 5KNBH 2NXEA 3EDYA 4EX7A 1P5RA 4TWZA 1LJLA 1NQAO 1VGVA 3N6VA 5K05A 1BS1A 2GKSA 2WM8A 3U7QB 1EKXA 3AJEA 1WTAA 2CFTA 3M9WA 1MW8X 3JARA 2HTFA 5ELMA 1E0DA 1T9DA 1XYYA 2H2FA 2J45A 3IOCA 4IVNA 4N82A 4QUHA 4XYMA 4AMYA 5KOHB 5EWJA 3WK4A 3GR6A 1RKQA 3KO8A 1GZDA 1I2CA 3BL8A 2W4IA 3QTTA 4TRJA 1PYDA 5JWHA 4IIJB 2YHUA 5TMBA 4C0BA 1AV6A 3HUDA 4O0LA 2XTJA 1M1YE 4URXR 1EVZA 1QIGA 4BTVA 1QFSA 2O1WA 1Y7IA 4GVXA 4OGLA 2Z5VA 5IH7A 2I0FA 1G3IA 5HVNA 2IPOA 4KXNA 1YDHA 4ZOBA 1Q1NA 4MIKA 1LSSA 4IHJA 3IDFA 1NMSA 2QD5A 3V4SA 3M5DA 4MQ4A 4HQ0A 4YBZA 1KFBB 4XGIA 5B3JC 4NZ9A 4J7XA 1R5JA 3F4KA 4IIEA 1PT9A 3U60B 1TQDA 5IDQA 1TRHA 3TRDA 4AKSA 4X6YA 3LE8A 4JS0A 4G5HA 4V0NA 4XB6B 2XUGA 4B48A 3QKRA 4YR9A 1NW8A 4BBPA 4C7MA 1QU3A 3GMDA 1UBSB 3R3SA 4BE9A 4XE5A 2H8GA 4A8HA 4YDHB 4BMVA 3S7TA 3LAWA 4KBGA 3TOVA 1X19A 3EFEA 4X61A 2V7UA 1S4QA 2CKDA 3M6AA 2RGCA 1W94A 3RVPA 5SZJA 4FWTA 1T2FA 2O2IA 1IB6A 3M81A 1C9YA 2V98A 3H5IA 3HNRA 3WO1A 2K87A 1COWA 4BNMA 4TKVA 4C0QC 1LPPA 5AICA 5JJLA 2EFYA 3T9AA 2O8BA 2XNJA 4JROA 4CM5A 2RK4A 3WGUA 1TUBA 5EYPA 2A9RA 3A3NA 1RMTA 1ZD3A 3DE2X 2GFHA 2OBNA 4LW8A 4JI8B 1OPRA 2B4QA 3DR5A 5BW8A 3DMGA 5D00A 3T1HB 2BFOA 5CA0F 2WD7A 4DV4B 2AX3A 1YVPA 4INJA 4ZODA 1N2SA 3LT0A 2X8BA 4BN5A 2HJGA 4IILA 4NG4A 4OH1A 2ZUFA 4KQFA 3VR1A 4TXJA 1P60A 2FZ5A 2J3DA 2W7TA 3GRFA 1G6HA 3BMCB 4E2XA 2QOEA 3Q8XB 4QOEA 4GDFA 4MWCA 4X3CA 1YK0A 2AUTA 3GYGA 1RPNA 1QM5A 4Z7JA 5BQXA 2JLWA 5HMMA 2HQ1A 5TS3A 1T9CA 2B9EA 4DY4A 4BNUA 1YRWA 5I7AA 5BSRA 1A50B 2JATA 4AZ0A 5HGXA 1Y6RA 1ULZA 3LWZA 4GDMA 1Z0SA 3RIYA 4YMTA 2C83A 3QRWA 1Z4QA 5ECGC 2GZ2A 1N0IA 3W9BA 3UYLA 3J81A 3HKEA 4CGZA 1KJNA 3L79A 1ILEA 2PYZA 3X1MA 1U5BB 5ARCA 4DNPA 5B1SA 3FOWA 5C46F 3LF1A 4PYLA 1E9DA 2PVCA 2WSMA 2QMUA 4GPAA 4JP3A 2PH7A 3N8GA 3EG9A 4K87A 5LBUA 1WDLA 1KJJA 2HPVA 2QZ9A 1W87A 2WSIA 3HR7A 4I6EA 5L3QA 3CGWA 4LNUA 4WK0B 4DUYB 3RT9A 5K03A 1OXBB 3BFKA 1TT5B 1MMFB 3SX0A 4A6EA 3HYSA 4MZDA 3GV0A 3LDHA 2C3PA 4A8JB 2AFRA 2EW1A 4ENPA 2FWRA 4Q03A 3RHZA 4C5BA 3EZ7A 3IEVA 3FGNA 1ZPDA 1JZTA 3B36A 2DQZA 2OZLA 1VL8A 3VPBA 1YAHA 5HQ3A 3UBTA 1Y7HA 4PNZA 2I4OA 3E9ZA 3N76A 4Z4HA 4Q4JA 1UWVA 4ENUA 5JT1A 4HTFB 3CNOA 1EX7A 2UZAA 4Q3LA 3WBFA 1M6EX 3TNFA 3Q9SA 1ZVJA 3EF0A 3QA3E 5FJJA 2G1JA 2ZTLA 3GC6A 3PX7A 1L7BA 1VE5A 1XZMA 4ZDKA 4TRMA 5GM2A 10MHA 2W6JA 5AOAA 3OA0A 5ICSA 4JB3A 3KUUA 1P6QA 1JG2A 1OTYA 1YU6A 2AMVA 4JL6A 4R69A 3OTIA 3IHLA 4Y2YA 5EIAA 2WF5A 4YRIA 1AO3A 3K3PA 1QH1B 1O6BA 4GM1A 1M8FA 4X5OA 5EFZA 3C8UA 1QG2A 3CR7A 1KWKA 3UMFA 2R6FA 5AP9A 5IUJC 3G8YA 2PH1A 1K9VF 5CA0A 3LBYA 3AVWA 3QTLA 3KTDA 3RLIA 2AF4C 4DOMA 4UE6A 2R44A 3G9ZA 3WKCA 1OH5A 1YR2A 4DG8A 5HCIA 3EGXB 3M5PA 4KAXA 4Z3KA 1GAXA 4YQZA 4UOEA 5A2GA 2XRZA 4TTVA 4QKQA 1VP3A 2CFOA 2IBTA 4UVHA 5EKTA 4ARIA 3NW9A 1LV7A 1KK2A 2I1LA 1CK4A 2BONA 1O95D 2GBCA 2P4HX 1AQNA 3WGKA 1DO2A 4KXQA 2A86A 1Z47A 5IDYA 3TXAA 4MPJA 5HA5A 3TRHA 4QJIA 4DIEA 1H94A 1XZCA 3EXG2 4E1BA 1GPYA 1Z7WA 1LNZA 1V3QE 3D7KA 3EWSA 1E1NA 1D1QA 3MS4A 1DIHA 1C2YA 3U3DA 5EINA 4YMHA 1QC5B 1MO5A 2MSWA 2V1XA 2G1UA 4ZVSA 5KJ6A 5BNWA 2KYRA 4HWOA 4NENB 2O2DA 1X9GA 4X91A 3ABRB 1DRJA 3AUSA 4DSNA 2KM1A 5BN3A 1U7DA 2RK6A 3BFXA 2VTVA 4FQ7A 3PTAA 3IPRA 1PT7A 2A94A 3NBZC 4WN9B 4FFDA 1HC7A 1ZI6A 2LBPA 3EARA 4H7PA 3RYFA 1XZNA 2AD5A 5A0FA 2VC2B 3JPWA 1AF7A 8AT1A 8ABPA 1P4GA 1QO9A 2Z56A 4LZPA 3ZCTA 3H6GA 3AH8A 3IIIA 2HA5A 3EMDA 5EMHA 2OM2A 3SIPA 4WOPA 2ZYGA 5TEVA 1SA0B 3QQ5A 4ZT4A 3WZMA 4E5PA 4P3YA 4F72A 2I62A 2JKVA 4PWYA 3RG8A 3WMXA 5JATA 3RW9A 2FN7A 1Z4PX 1M2VB 2V5VA 2VHVA 1EWYA 2IXGA 1MB9A 1I3CA 1SD1A 3A1UA 3TZCA 4BE7B 4PN7A 1MG5A 2CDBA 4OU4A 5C5EA 6LDHA 2YN4A 3RSHA 4F5WA 3PD1A 3GGGA 5CCBA 2J59A 3GPCA 3ZIAD 2R8XA 4XUCA 3U4HA 4OHMA 1VHJA 4RCZA 5IZCC 4BWGA 2CYBA 3SVLA 3WYFA 2N46A 3HCPA 5AK3A 3Q41A 2A78A 2R751 4MS4B 4PIPA 3LXUX 4HH4A 2JFYA 1NF2A 3G5LA 4W9NC 3HPRA 2WD8A 3R0JA 2HWXA 2VJMB 4XVHA 4IIXA 1M1XB 3DVAB 3HKCA 5JISA 3U6BA 3PJRA 3W79A 2PMKA 4KW7A 4Q4CA 1KZYC 1UBLS 5BW4A 3ZGXA 4UQLA 3DO8A 3O3CA 4FZRA 2E6UX 2Q1SA 4FXOA 5HRUA 5HKKA 2QN8A 3EAGA 1DZIA 4QGFA 5GOTA 3CUWA 1CXZA 4OXYA 3HCCA 3MQ4A 3O03A 1ZOOA 2QVLA 4GMKA 5AKHA 3GZ4A 4R9VA 3MYRA 4UTRA 1BKSB 5BNIA 3THSA 1KEZA 4ALKA 1NR5A 4BNDB 1R9NA 3MS2A 1MNAA 2KX7A 1Q1QA 4ZAWA 4MGIR 1T2EA 2C8JA 3NNSA 3SSOA 2OXEA 1F12A 5EZ5A 1A2KC 1XEAA 2RHDA 4MICA 3SDBA 4Z4FA 2HMYB 1JR4A 3QH4A 4J07A 3B5JA 3CPSA 4KMOA 1C9NA 1E3EA 4E03A 4QNRA 3CPEA 4P7KA 5CDUA 1NSYA 3EH1A 3DO5A 4GHWA 3FZEA 1LVUA 2J67A 4GMGA 2RHBA 4QL3A 3I58A 4TOIA 5JAZA 1LJ8A 4EKYA 3ZG6A 1F2UA 3EVNA 4NL4H 2GD1O 4JQSA 4ZI2A 1X1QA 5ULLA 2PZMA 5FBWB 2R84A 1T5DX 3DMRA 3BZWA 4RKFA 1QHIA 1YIDA 5B2FA 1G17A 5TQ2B 4JI1B 1AGXA 1XZGA 5E2AA 1RXSA 1SN7A 3ZIAA 2XKJE 2X5KO 3SI7A 1GYRA 4D5GA 1IL0A 3ROGA 3AINA 1RM3A 4FBMA 1QTNA 4AM8A 2ES4A 4DKJA 1BMFD 1ORTA 3AR6A 3JYPA 2OC9A 2FWNA 1U3UA 2YWJA 2IPNA 2Q5LA 4NX2A 1E6EA 5EPEA 1XXHE 4N0PA 2OCKA 3NTVA 3RVMA 1FJ2A 2B7LA 2ZIUB 4AS1A 3GZNB 4FI3F 1T3SA 1XZPA 3LO8A 4JC0A 4QTUB 4QOFA 1UBTS 1XBTA 2FJ0A 3EIUA 3JR3A 1Z75A 4AD8A 1ADCA 3NHYA 1SG0A 4DRXA 4EARA 1GZ4A 2IS6A 3RI3A 3VR4H 1RTTA 2RGDA 4FXPA 4S1OA 1ENYA 2P9CA 3C3DA 3GAAA 3HSKA 1C81A 1DAGA 2PX0A 2R87A 2RAFA 3HA7A 1N9KA 4IDGA 3U1VA 2R5WA 5HQJA 3EDMA 1FXSA 1L5YA 1AF4A 4NJMB 2IEYA 1X7YA 4Q4AB 1HYGA 5A7GA 2WHPA 5T6MA 4IUBS 4YP6A 3HE3A 5TS2A 3CVOA 1Z4NA 4EG3A 3ICQB 4W9RA 2JARA 2QPOA 1H66A 4RM2A 1KARA 2C3MA 1EUYA 1SWWA 4WRRA 3PLAE 2O8FA 3L40A 5H16A 5CT6A 4Y2VA 1ZIPA 1G16A 4CM4A 2GK7A 2FZKA 2C7OA 5KOJA 1LBQA 3IELA 4E09A 1TEHA 3FFWA 3AUAA 5DASA 1DSSG 4WL0A 4OSPA 4DQ0A 5JROA 2P68A 3THWA 3R9IA 4PPQA 4Y6SA 5T67A 1O03A 3C7CB 3RIGA 3OP1A 4BZZA 1YT5A 3LYUA 4MZXA 1IXSB 2BBSA 3M1IA 2OCIA 4HUQA 2OBFA 2HCFA 5FNVB 2MSLA 1GWNA 1RWKA 1BMFA 1HH4A 2OUKA 3O8QB 1M72A 1RW4A 1A8UA 2P5UA 2H07A 1NJ2A 4FGKA 3ROXA 3VRHA 4BLPA 1QQTA 3UQYS 1DRWA 1PKEA 3MBIA 4E2FA 1XMVA 2X4GA 1JEQA 1G64A 1L4FA 4P98A 4HAIA 2WJJA 1ONBA 4RH3A 2WI8A 3KJFA 1TLTA 3L2OB 5EE3A 2QSZA 1WM1A 3UUFA 3IPCA 4FB4A 3KEFA 1ZG3A 3IKMB 1SBZA 2FPKA 2P4UA 1N6OA 2XWJI 3AETB 1NURA 2YS6A 4Q4HB 1G8PA 4KDFA 3LF2A 3SYNA 1KDOA 2B8JA 2ORVA 5KAMA 2PK3A 3WLOA 2IITA 3TQSA 1FYXA 2VA9A 3FNEA 4C4RA 4O08A 3IMEA 3DFZA 3HRKA 4ALIA 1CWUA 4M0MA 1PX2A 3MOGA 2WF7A 1T5HX 2Z4SA 1OI3A 3HJUA 4GL4A 2VQDA 4B3RB 4CU5A 1POXA 2G70A 4LRUA 1RMQA 4Y2UA 3RREA 3AVVA 1G9SA 3KSMA 2W43A 4MGEA 4A91A 5AQ1A 1OU0A 3O21A 5AOBA 3EZ6A 2NXWA 4JUAA 3P9RA 2J0VA 5EZYB 1CCWA 1LK5A 1WY5A 3U7FB 4IG4A 1YL7A 3RK4A 3IAXA 4UPEA 1LTKA 4MHTA 1BHSA 3FPLA 3RH0A 1DG3A 1N7JA 1PFUA 2FW0A 4NU8X 3OLXA 4M0EA 4RTMA 1YVRA 2EZ8A 4V38A 1M5UA 2IYXA 1XTIA 4XX0A 2ONJA 5IULC 4C76A 2XQGA 2WTBA 2YXNA 5AW0A 3T9FA 2IHBA 5EQDA 4RCYA 4LOAA 3LGSA 1O94A 3HLKA 4Y1EA 3U31A 3K9NA 1U2GC 2PYIA 4IXWA 2Y71A 1MVOA 4HAUA 4G1BA 7MDHA 2OSVA 4LNAA 3GBVA 2MT9A 3BKXA 3K0FA 3A1NA 4K3VA 5JE8A 4FINA 1ZGZA 2ECOA 2ZW9A 3G02A 4LRSB 1D07A 3FOAA 3VH1A 1V3UA 1KBOA 2AW3A 3GLHE 2G1KA 3G8CA 2P6NA 4ZALA 1Q2XA 1L3BA 1QFYA 3QFFA 4UXIA 1R7RA 4D8UA 4MB6A 3L8HA 4BMSA 2E55A 3D8UA 5LLTA 4MEJA 1G0OA 3L8MA 3K0SA 3G9TA 3ORQA 3QWFA 1R9JA 3I0ZA 4DLAA 1L8AA 2ASEA 3B52X 1R0SA 1F17A 1NN0A 4YP7A 2QRVB 4AK9A 4NQZA 5GVSA 3NG1A 5AO9A 1Y5MA 4D9IA 1Y9ZA 4RD4A 1MIOB 1JG7A 2WDPA 2ZS8A 5KQPA 5K0LA 1K7YA 2FZLA 2XQVA 4U6NA 2V5AA 2XRMA 4V0RA 4UREA 3DCNA 4PXSA 2K6GA 5LUAA 2WF6A 2DFVA 3F4BA 5A6SB 2AZ4A 4EL0A 3P0JA 5K6AA 5KHOC 5AHKA 2OO5C 1FFAA 4MW4A 1YFJA 1VPLA 3WOHA 3WNQA 3WHLA 3RC9A 3NDPA 3LUCA 1Y3DE 1RHRA 1HK7A 1KK0A 5EMNA 1QQBA 5FWXA 3RE1A 1BDBA 2OO3A 5DBGA 1J2YA 1QHXA 4L7VA 4HTAA 4X24A 5JARA 4O02B 4UM7A 1CEXA 1TF5A 4ILEA 3IEUA 5DHFA 2QM3A 4KRYA 1XDWA 3RYCB 3OJCA 3RS4A 1Z8HA 4B6EA 2ZYRA 2RI6A 4XA8A 4E15A 1FFGA 3WLFA 3DLHA 3T7TA 4NBRA 2Y2UA 2XBMA 2J9ZB 4Y1RB 4NS4A 4MO9A 1FRVA 3KWLA 4MPRA 5DHRA 1E6MA 3SBXA 4GOXA 1L7XA 4HT3B 2AL7A 3NHRA 4ZVTA 1FFHA 3SHVA 1S2LA 1P4AA 1E3WB 3FI9A 3TM5A 1JQAA 4P36A 1E60A 4L3VA 3JZFA 1QR6A 5AM5A 4KMRA 5U9CA 4CIWA 2OYSA 2REQA 5KNBA 2E4XA 2YV5A 4EBFA 1Z82A 2YCBA 1QLHA 1UXHA 3PFHA 4KTTE 2CLHB 1SC4A 3K8QA 4MGHA 5AJHA 3U4CA 4DMLA 5F7JA 3BORA 5A4DA 2CXHA 1FTSA 1UT6A 3I64A 3A6EA 1Y3AA 4EUEA 2YJ5A 3KZOA 1J5EB 1DCKA 2KBEA 2NZYA 4LN1A 3AZOA 3AUKA 3GLVA 4R2IA 5EVCA 3TZ6A 2L2QA 1H85A 2ZJAA 3BEDA 1OWPA 4LCEA 4A8JC 2W2OA 2B98A 3AY3A 1H0SA 5HM6A 3TBHA 3PRJA 3ZZ1A 1A7KA 4TL6A 3W6NA 3AKCA 1V9SA 4ZYTA 4W7HA 1YJ8A 3HJTA 5LKAA 5KNLA 4BFSA 3KZVA 1XDDA 3I6ZA 3OIWA 3QXSA 2I6SA 3L4KA 2WNHA 1NAIA 2YMLA 3PQFA 1ZMTA 3DJFA 3OQMA 4MWBA 1QS0B 1U9JA 2P6MA 5JCOA 1OLXB 4QOSA 2QWXA 2O54A 3IHKA 5DGDA 5LYJA 3HZZA 3GQBB 3RVLA 2DWCA 1YULA 3GH3A 4MW0A 1W73A 4IJKA 4CKCB 1SXJB 1KWGA 3C6MA 4M22A 5C4MA 2CGEA 3R8XA 5KHAA 3TI9A 1CUFA 1ORRA 2XMCA 3T35A 4DLYA 4DDUA 2BP7A 4NBNA 5CURA 4PIMA 3WWCA 2Z4RA 4I1IA 5FA6A 5L53A 3D7NA 3IV6A 4BL5A 1L5HA 1QQ7A 1R12A 5FT9A 1MN6A 2FKNA 2J5QA 4PZAA 3WGVA 2X0NA 4MRSA 5C8YB 2VSXA 5AKLA 1YE3A 1CIVA 1R0XA 1W9HA 2HOQA 3PDWA 1LXCA 4NCHA 4X1IB 3UUEA 2HEGA 2OMEA 2PFSA 5KTTA 1R00A 1US8A 5KWSA 2GESA 4URYR 4B3CA 1AK2A 2VK1A 13PKA 3C7KA 4NJEA 1G6OA 2MYTA 4GP9A 3HM9A 3FG9A 5I9SA 2G76A 2QJWA 1HT1E 4RS3A 3ZH2A 2H52A 4ARUA 2HRZA 2NZ2A 3IRUA 2HJWA 2YVUA 2KJQA 3O4RA 1GM5A 4OQDA 3OHPA 3KG2A 3JATA 3HNOA 3TKLA 1XFAA 4G9BA 3TTVA 1R0YA 1LZKA 2MJLA 1OI7A 1IHPA 1DDIA 1LC3A 2RB4A 5AKKA 4E2YA 1RYZA 1E6CA 2WF9A 3C97A 1Z0KA 1JWLA 3S2UA 1A7AA 4CDNA 3M82A 2FFHA 4M46A 1KDTA 2IYRA 2W58A 2P41A 1E2JA 1KR5A 3NHJA 3TOSA 4FW8A 3V2UA 2QK4A 1NHGA 2VKTA 3DJYA 3INYA 3BD8A 3WJ1A 1T2UA 1UFOA 1YZVA 3SXUB 1BIFA 1OYWA 3CG0A 2EKPA 5K0NA 1HNZB 3BWBA 4K9NA 2NXNA 1E5VA 2ZBDA 3H5RA 2H08A 2V9ZA 3I2FA 3QU4A 2LXNA 3PL5A 1MENA 4Z1MA 5TMEA 1JEYA 1Q0TA 3EB9A 4X45A 4YXFA 2EKBA 3FDZB 1II9A 4I4TF 4RW0A 3TVYA 3Q7SA 4P6VF 4RPJA 4EABA 1D4AA 2I1QA 2JFPA 5AJXA 2RE8A 4II7A 3MJSA 3M1LA 2AX4A 3QVGA 4GOOD 5AVTA 2JFOA 2KLBA 4UQPA 4ZZ0A 2GR9A 3G2QA 5TQ0B 3O92A 3ZLUA 1SUWA 1W4RA 2ZM6B 3L6OO 3NBUA 4NYJQ 1Q7BA 2GPTA 4F5ZA 1I7PA 1PW7A 4MV1A 5DWVA 5JEEA 5F3WB 3ERCA 3A1EA 3P26A 3BREA 3QVJA 2XUHA 1DJMA 2O3UA 2AF3C 4R7ZA 4ASUD 4RK0A 1GL6A 2RHCA 3LLSA 1YTLA 3B9BA 4DSAA 4XGKA 1ULHA 4HDAA 2O9JA 3LS2A 2CDNA 4WZBA 5DNAA 1UJ6A 4Y0VA 4F45A 5KX5F 4Q7MB 3J7AC 4J2OA 3L6DA 3M83A 3QV1A 2XVMA 5EXPA 1ENOA 1WE2A 3NBQA 1PJRA 1RKBA 2V6GA 2EF1A 1VJ0A 3WFJA 5DGCA 1DUVG 1UOOA 1A27A 1W30A 1MC8A 3EZLA 4PTLA 4YASA 5CLFA 4G5XA 4U2KA 2J6HA 4ZZ3A 1G4HA 1ZH4A 4LSMA 4DGQA 3QWBA 5IH3A 2H5JA 3DAHA 4YYEA 3RHTA 3UK1A 4JLMA 4MQ6A 1U0FA 4TYWA 1E6WA 5FWDA 4RPLA 4XD2A 4RV4A 5CX1B 1W0JD 3DB2A 4ARVA 4MRNA 4DUGD 4YCCA 4G85A 3FNIA 3I1YA 2HLDD 3OQHA 3IT0A 3PFCA 5BY2A 2Y1FA 5A5FA 1FJGB 3EVTA 4LVUA 3AFMA 1SXPA 1GSIA 1PR0A 1CHNA 2I80A 2IA5A 3ZXXA 1TKAA 3T41A 3S0JA 1QORA 1BW9A 1XDZA 4U8GA 2X8AA 1GYQA 1E62A 4MR8A 1MG0A 4ZCMA 3C45A 2P9ZA 3FKSD 1INLA 3Q6NA 3K32A 4AZ0B 2YJNA 3OBBA 4B45A 4ZGWA 3JZDA 3DQPA 4F6RA 4JH0A 3RK1A 3DW3X 3QWAA 4YAGA 1D03A 2RKOA 1A8QA 1O1YA 4HGQA 1LKZA 3RKUA 5C52B 4EUFA 3O5AA 4N3CA 1N1DA 3MSCA 1QDLB 3GGSA 1AGPA 2H57A 1UJ2A 2JLCA 2ZSUA 3L8YA 1CQIA 4L4SA 3SE0A 3SR3A 2C1EA 4L28A 4RD3A 2C84A 2VJCA 4G4JA 3LT2A 3SHQA 2O0LA 4CDRA 4G0UA 3FUTA 2F64A 3DAOA 3MTJA 3R9XA 3QF7A 1YCDA 2I67A 3GRUA 1WJGA 1SUEA 1M67A 4FHCA 1BHQ1 3T0FA 1ELOA 1K8RA 1ZIOA 3RVJA 4YV7A 4B3TB 3HL0A 2GQ0A 5T8KC 3DMYA 2VNSA 2H1FA 3H3XA 2OZLB 4G97A 4D8WA 1P9OA 2PVPA 3NVKI 3MAGA 1QF6A 3M9LA 2FRXA 1PYOA 2FW7A 4IWXA 4P0QB 3K35A 4FYYA 3TNYA 4EG6A 4DQUA 3UJ8A 1GR0A 4OJNA 1P5JA 2HNKA 4DLRA 1S02A 4A0GA 3G88A 2AN9A 3MTQA 3FPCA 4DUGA 2HBQA 4C7BA 5K8UA 4YMUA 3WGIA 121PA 2Q3FA 3WFIA 4EBBA 5JPCA 2G06A 2PD3A 1T9AA 5BWCA 4F4CA 1U98A 4P5PA 1GG8A 1F0NA 1JDNA 1KMMA 1TJ5A 1EINA 4B3XA 1UZMA 4D9FA 1U2DC 3EY9A 1KO7A 2I7CA 4EECA 5C4IA 4UJ3A 4UDYX 5AVJA 2Q7OE 4CN8A 3VKHA 3LI2A 3OTOB 4FFOA 2PRYA 2RHHA 3DTVA 5AM2A 4IHAA 3ETHA 1XZKA 2VJOA 3WS7A 5ARBA 1PR1A 3GJQA 2N1BA 2NO7A 2PD6A 4QOIA 4BNIA 2AUNA 3QW2A 1AMUA 2IUTA 2QTHA 5ENVA 1EU1A 5J2TB 1UMBB 3ZDYB 4PG8A 2HJHA 4HGOA 3KSAC 2OPHA 1D2HA 4LHXA 1A71A 4AF8A 1XJCA 3AESA 1EFUA 3D4IA 5KYUA 3VR4D 5PNTA 3I23A 1E1LA 3VI3B 4XDYA 4MVJI 4TV8F 3PQ5A 3KQSA 4IVRA 4DIUA 1CF9A 4K6FA 5C1PA 3D5QA 1KQPA 5M7EA 2QX7A 1YL5A 3NORA 3T6KA 1EA7A 4X8HA 3U4GA 4COOA 2H5IA 2A1TS 2OD2A 1O77A 5D3QA 3FNHA 5AW6A 1SUAA 1EX9A 1T6ZA 4YRPA 4FBGA 3T9BA 4E4YA 4XFDA 1JSCA 1B41A 1YONA 3AVPA 3D8SA 3EZYA 2WJVA 4HJRA 3B89A 4WCFA 5E0OA 3STUA 3VPGA 5K09A 1JVNA 5B2ZA 2AG8A 4NSNA 5BN3B 2OGUA 1WZIA 4PBTA 4DC1A 3TDMA 1SY7A 2HXGA 1OYVA 1MQSA 2BRUC 2O5RA 5AHOA 3CRZA 1MD9A 5H68A 4QGAA 1BD4A 3BWCA 1SCIA 1DBPA 5DN6D 1B6TA 1TB4A 1FFXA 1UPAA 4KQ9A 5KSPA 2GRAA 4KG7A 1IOLA 5ALGA 4DV0B 3ICOA 4JWKA 1O96B 5KYYB 2C4NA 3BBPA 4FQ8A 3E15A 4C6TB 1K92A 5CBPA 1UK7A 1VA5A 2ECQA 2FX3A 3BE6A 4IJ6A 4KBYA 3EUAA 2CZCA 1TLFA 1G7CA 4S12A 4UAVA 1SHUX 3OTGA 2A0UA 1KI6A 3T7EA 2QM0A 1R4ZA 2H7CA 2O5CA 4GXNA 4QYWA 2JCXA 4DPMA 2AV6A 2JBHA 2DOKA 3DBHB 1JNYA 4MKXA 1HYBA 2EP8A 2JK0A 2P9HA 2FR1A 2PXXA 4H27A 4I19A 2OAP1 2YMQA 3P8ZA 4JEIA 3TPFA 3MELA 4YDRA 3TZKA 1XSEA 3V3KA 1K5HA 2E49A 3TPZA 5D86A 5GZ1A 4KXWA 1L5NA 2EP5A 2PJRA 3NDRA 2OUIA 1ZZGA 1GKLA 1TZKA 2IHUA 3BXOA 3KR1A 4L4UA 4LEIA 1QGZA 1QO0A 2OK8A 4LVCA 1YZQA 4MUHA 3WQHA 1X86B 3K4QA 1QTQA 3X2SA 3ZW7A 3ANMA 3HKCB 2AZTA 2X1HA 3R75A 3Q98A 2XCUA 4NESA 4I81A 4GAEA 5DIFA 3VR4A 1I3NA 4AMGA 4ID9A 4AURA 5HS4A 5TIIA 2NG1A 2QIPA 1RYMA 1Z38A 2VDKB 1RZRA 3RS7A 5IT9A 2WWGA 4PZ0A 2A9QA 3HA5A 2DUNA 2UAGA 1UK6A 1DQPA 1IOZA 3A4LA 2MSEB 3GLUA 3M1YA 4IGKA 4Y6OA 4Y7CA 3MTDA 3OF2A 3L1UA 3PEVA 1EGAA 1EI9A 1QJ4A 1YXMA 2B1QA 3G68A 3GDOA 1L9KA 4OYLA 5AK5A 4EYKA 4GKVA 2A5FA 2Q3EA 3JASA 2WKQA 2FPMA 2JZCA 4RF4A 1XTTA 4ECEA 1ISIA 2VPIA 1RHQA 1J0EA 1G20E 4JXZA 1ZH6A 1UC9A 3FAKA 2GPNA 3L0PA 4LECA 4O4HF 3T8YA 5JJ5A 4AQ7A 4DR2B 1UMKA 3KXKA 3CW9A 4IZ6A 2FQYA 3DLAA 4WOCA 2J3JA 3O8CA 4F12A 4K8OA 2RH8A 1X0VA 2JDID 3D81A 1JS1X 1TUEA 3A58B 1JEAA 3J7TA 4G84A 3LUDA 5GZ3A 5ECWA 1O87A 2XUQA 3KUKA 4UM9D 3MSXA 3FJYA 4YAKA 2K2WA 1AXRA 2DQKA 3EK2A 4YRQA 2XQJA 5L45A 3ZDBA 4EAAA 1T0UA 4MRMA 3UIEA 1QH8A 2BKVA 4GBGA 1JFLA 2XYPA 1AO0A 3UMVA 4XUEA 1QVVA 3LP5A 4M2LA 4OPMA 2FSHA 3DG9A 2D2EA 3HCDA 2ZRJA 2HIGA 3HUTA 3DUFA 4MWOA 4FGZA 3DKRA 3LYAA 4LJYA 3Q3IA 1IJEA 3O4FA 4WCDA 2ZANA 5TARA 4F85A 3AP2A 1N2IA 4PXAA 4Z7QB 4URFA 1AUXA 1KI7A 1W2HA 4B17A 4II2A 1HRKA 4Z51A 4BNYA 4I50B 1VBMA 2C9OA 2ZAOA 4QBFA 5AMXA 3ZWMA 4WKOA 3QXGA 1EK0A 1PR5A 2BKLA 4B4WA 1V8BA 4KE7A 1AKWA 3F96A 2CLOB 4DRXB 2VTBB 1U2EA 1YDEA 4K6HA 1R4MA 5J3JA 1EEHA 3I04M 4JBLA 5F78A 3GLIB 4FR2A 4YQYA 1YFZA 3DZJA 1GPMA 1GUAA 5G0WA 5HE8A 2GTIA 4H18A 3E3AA 1W29A 4EG5A 3R6GA 2VQFB 3OU2A 3KTAB 1MDFA 1Z3IX 1PUXA 1TF2A 2LE0A 2XD4A 4DCUA 1I33A 1TMKA 2NTVA 2QGZA 3L1IA 2CLFB 3L93A 1Z73A 3P2KA 2C97A 3NIFB 4P58A 4Q18A 5FBRB 3VNRA 2BTQB 4CLOA 5JV5A 2C9MA 5U4XA 4CF7A 2WOOA 3KEQA 2I6UA 3ACCA 4KQHA 3EMKA 2D8MA 2O14A 2GO7A 1DOZA 3BULA 4DZRA 4ZT5A 2C7RA 4QFCA 2WA1A 1F20A 3IQFA 1RQPA 3KJIA 4Q19A 1E96A 2HW8A 2FG6C 1HTBA 2FUG1 2GHQA 2ZRPA 4CQJA 4FDLA 4X71A 2XE7A 4BVAA 1SXJC 4TS4A 4UHJA 4DDVA 1B6RA 2GDZA 3MXTA 1IH8A 1C7RA 1WLSA 4UU0A 4B2PA 4HYYA 2F43A 1NI3A 4URUR 3V2GA 2EXXA 1UMDA 1UAAA 1FUYB 3KYJB 4XDHA 1KYIA 1FFCA 2BFNA 2VATA 4AYXA 4U7FA 4IKEA 1XD2A 3U9SA 4XUDA 2GN2A 2X2OA 1C1DB 2Z5GA 4M8SA 4B6GA 1PTKA 1TA0A 4FCCA 4US1R 5I01A 1TM4E 5JSYA 3WRXC 4EOGA 3RARA 3QUTA 1P4JA 3IDAA 4NABA 4TYQA 1TO6A 4Y9TA 2I7DA 2IHVA 5LYYA 1NRJB 3NLLA 3JAMA 1CQZA 2I8CA 4QO7A 2L19A 1QHEA 2WUWE 1NONA 4CEIB 1U9IA 1GUYA 1K75A 4M7PA 3L07A 2DFKB 2YR0A 2GZ1A 2GPAA 3AFOA 1Q50A 3IJEB 4LRXA 3IERA 2FMIA 3PF9A 4MWGA 2Y1EA 4OQQA 4WDRA 5JQGF 1DDGA 1HKUA 2LNDA 2XGJA 3TUJC 5AKGA 4DIFA 3LDGA 2RHRA 3UK0A 5NLLA 3D0RA 4KI0A 4Y9SA 2EW2A 3O2QB 5GJCA 3Q9UA 4IGFA 4MLZA 1P74A 5K3OA 2FVYA 1C7JA 1NMQA 3CKYA 1ONOA 2WWXA 4HDKB 3FTCA 5PGMA 1RKVA 3P9SA 2ZSAA 1FZTA 3A11A 3WMGA 1SG6A 1DOHA 2D0DA 2OQ2A 3SK0A 1CZUA 3UZUA 4RYLA 4DGSA 1V7ZA 1ECCA 2DFTA 2NAPA 4PINA 1EXMA 2JGRA 2FTKE 2XB6A 1VB3A 1LNQA 3D3WA 4ZEWA 1KEWA 4RZXA 2AFHB 3FCUB 3VSAA 1IHDA 4WY8A 1CUGA 1Q15A 5LZ5A 2HPAA 4I99A 3V4OA 4E1AA 2WJ6A 3NBYC 1ZR2A 3HDVA 1V25A 3UAGA 3AFGA 3P0RA 4IMJB 1S2IA 4P54A 3VHRA 4MKZA 4DS3A 1XNGA 2QUKA 4P31A 4C03A 2CV0A 4FJ1A 1I2MA 2PMDA 2QAJA 2ZIXB 2JI4A 3SY8A 5LBIA 5ALTA 4CETA 3FKQA 4KLZA 2ACKA 2FRDC 4JP8A 2OKCA 4K3UA 2BDEA 4KKVA 5HS6A 3SR0A 4I1OA 1K86A 3IKLA 3I6QA 3W1EA 3T5PA 1DIRA 2UV8A 3S7ZA 1A4XA 3B3GA 3FMOB 4PM4A 4NCAA 4J91A 2OB2A 4PRYA 3W8DA 5CVVA 5JNVA 1KMHA 4XUGB 2PXAA 2E9SA 1W46A 1MB3A 1WHTB 3HJGA 2PZGA 3ESXA 3KSBC 3MHPA 5KKAA 4QPDA 3DLCA 4QOHA 2PT6A 1QIDA 4J4BA 1J07A 1VHQA 1JXOA 2YWHA 5D6NA 3L8GA 1FZQA 5DE3A 2JHFA 1EIZA 2G9VA 3ZDQA 1WETA 2P91A 3CLHA 1SVNA 3PWSA 1SO8A 2E4YA 4GWLA 4KPUA 3E7PA 2AJLI 4HXFB 4K0KB 2Y8EA 4FZ5A 4NNPA 5CXSA 3C3MA 1T2NA 1GPWB 2YVLA 2QTWB 1NSFA 2H2WA 2C8LA 5CPBA 4LV8B 1U3WA 5EY5B 4O4JB 1AA6A 1AJEA 3THYA 1TCBA 2WVJA 7MHTA 4JX9A 3T7KA 2Q41A 1SHZA 1MC1A 2DAPA 3RU3A 4QQ8A 2WWHA 4DJ5X 4YT4A 3TNLA 3HO6A 3QXJA 1L5RA 3JD3A 5K4GA 2WIBA 2YXEA 5A2QA 1UBKS 3I1JA 4RKEA 3O4IA 5ELXA 4ESOA 2VDPB 1EVEA 2H1SA 2G77B 1T2DA 4J16C 4G5FA 4X90A 3FPJA 1J97A 1OZHA 2FFRA 4MVJM 4NC9A 4PX9A 1X0XA 4TLDA 4DT1B 1JQ3A 1U6KA 3WZLA 1ATZA 2Z3WA 1GLNA 3N1UA 1LDYA 1YJXA 3LY7A 4QG3A 5JH7A 2NU6A 5ITVA 3C4JA 3T7AA 1E2UA 1EAMA 4B3DA 2PUDA 3TLEA 3UC9A 5ALQA 4D4MA 1LUAA 3R6WA 1TZCA 4PLVA 2NTNA 4OYHA 3NU1A 5CVEA 3I2YX 5AJUA 1LBTA 5L51A 1N5OX 1JDUA 2WTNA 1REQB 3JWPA 5D5HA 5EJEA 4HQLA 5TC4A 2UUBB 3HTXA 1L7EA 2COUA 1ST3A 1VCIA 3ILYA 2VAWA 5FLEX 3LNCA 5AH0A 3NH6A 5HRCA 3K6KA 1OFUX 3OO0A 2I71A 1H3EA 4LY3A 3M2TA 1P2UA 3MCUA 5L4LA 5FPHA 3FUXA 3AKZA 1M6YA 2JF0A 5LIRA 4DR5B 2JGIA 2Q99A 3LPDA 2NQ2C 1EG7A 6ADHA 3FHTA 1DAFA 3BGIA 4FLMA 2Z9CA 1PK7A 2XPCA 4HZUB 5LOVF 2JIZD 1DQRA 1G1AA 2D2FA 4AWXA 1A9YA 1P0CA 3H5NA 2DMRA 3AHDA 1NR1A 3PFBA 3GLFE 4H7JA 1AKRA 1UKVY 3P19A 5DRTA 3NYIA 4BXOB 2XKBA 3IBCA 2ZUUA 4RY8A 1JIXA 3UOGA 4BNLA 3LHKA 4AU1A 5ILQA 3T5MA 1DPFA 3ASYA 3U3ZA 4BBZA 1RWQA 2CDRA 4L7QA 4R1UA 4WEOA 4ZOLA 3R5XA 1C9EA 2VPQA 1MIHA 1LQUA 1NSTA 2FR8C 2QX6A 3GROA 4P5DA 1ZAKA 2GKOA 3U4MA 3E2MA 3VOBA 2PZ8A 2XY4A 5FPPA 2PV0A 1YKSA 4IPTA 3RJ9A 3E2PA 3MBOA 5A4KA 4IVQA 3FBTA 2PBZA 1QUFA 3T06B 2W0MA 1YDWA 1TIBA 1US8B 2O1XA 4X20A 2WB2A 2JFZA 4W1PA 4QDKA 3G1WA 3COSA 2ECFA 5L3RA 2FLKA 3FTNA 2H0RA 3FWPA 3IE2A 3IUYA 3OWOA 1H2WA 4HCJA 4YAEA 4DSUA 5FKJA 3R8CA 4K6GA 2VYND 3O3MB 4ON9A 3H2KA 2X22A 3N2IA 3WGLA 4CIXA 3H6KA 1PSWA 1G1MA 5D84A 4E51A 2ZE8A 3KJGA 5FR2A 2QU7A 4JJEA 4K81B 1SKQA 1CJUC 4IEIA 1J25A 4Q48A 4YK7A 4F1WA 2R6CA 1MEEA 1CNMA 4LVNA 4FYMA 3O9MA 3T5BA 4DV7B 1FLDA 5C0OE 3W5CA 1SB8A 1ZK0A 1YMUA 1LTHR 2BCEA 3OM1A 4GE3A 1GNPA 4J4TA 1KHHA 2C2XA 1X15A 3M6VA 1GRQA 1NJ6A 1OV6A 1TAHA 1ULUA 2SBTA 3UB4A 1DAIA 3FCYA 3DNPA 3ZWOA 5IFLA 1KXZA 3CM0A 4MYUA 4DR4B 1A4RA 5IWAB 2VK2A 3QXXA 5LCXA 2DSNA 3NWJA 2M6SA 3KXDA 4Q3BA 5C37A 3VFDA 2CUNA 3HG7A 3D5EA 1AK1A 4J29A 4Z0TA 5ETJA 3DE3X 3LL4A 4D3SA 2W2MA 2ZRDA 5BNFA 2IH2A 3AM1A 1U8AA 1P2TA 4HZIA 1UOQA 3BIWA 1NZDA 1Q0QA 4A6DA 4KYVA 3KQPA 5JXGA 1V1MA 2Y6UA 3TEFA 4M8LA 1O3YA 2ST1A 2O5VA 1P4RA 1BFKA 1T8UA 3HBMA 4UAJA 4DLLA 3SNKA 1KRXA 1R9MA 5JZMA 2VO1A 1KORA 5FLXA 1TIKA 5L8VA 4O2LA 2QLNA 3CCFA 3H4IA 2CE7A 4S04A 3GY0A 5FPTA 2B2XA 3R3VA 1X7HA 3DZIA 3M6MD 5D87A 1ZICA 4ZCIA 3P0EA 5DOZA 4DMMA 3BQ9A 3AHEA 4J0JA 4DMRA 2OV8A 2JGFA 3VU9A 1Y82A 2JGMA 3EW9A 1YBVA 5F73A 4N0MA 3D2LA 1RQXA 2GEFA 4B4KA 5JUWA 1Y42X 3DP7A 3R2JA 4FFPA 2BVNA 4YJKA 3U1BA 1G3RA 1TTPB 2H4WA 1XO1A 1O95C 3QKSA 5DP1A 1R0ZA 2ZJZA 1DEKA 4J4HA 4M1ZA 4WZBB 1I6LA 4P4TA 4EJSA 1UDBA 3SDZA 2AVNA 3Q8LA 4OG2A 5KQSA 2WABA 3Q6MA 1Z0UA 2V0GA 2EGGA 4ENSA 4O2AB 4TLCA 2FQ1A 3HCAA 2ZATA 3C1UA 4FYKA 4NG5A 1CJMA 1E98A 4NP6A 2VWGA 3KKKA 3V1MA 2F3TA 2QRPA 2VP4A 2WVGA 4H77A 4J0CA 1IBLB 1FSSA 3MGBA 4BQPA 1THTA 1MABA 4WOBA 1FP7A 4LOJA 5E9QA 2NVUA 1A5TA 5CVUA 5LU8A 4BC0A 2C3UA 1RC0A 1KNXA 1TKCA 2R1TB 1QB8A 1WO8A 1XQ1A 1N9ZA 1XU9A 2DRIA 2WM3A 4MPTA 1F2TB 3PDIB 3RD5A 2AFIE 3MAAC 4RFSA 5DBHX 3UWSA 5ALIA 3ONVA 3PQDA 4UBMA 1TA9A 1Q21A 3K0AB 3C3EA 3FPEA 3O1HB 3DOFA 4X1YA 4CQMA 4PN3A 5KNDA 3HJRA 3PNVA 1IN8A 4PXYA 4MEAA 4MR8B 4ZV9A 3SZGA 2C96A 4H4CA 2CDCA 4LGMA 3I2IA 4MQFB 1A7UA 4TKUA 3NHPA 3DAPA 2HFJA 5EMLA 5JLAA 2HLHA 2XUOA 5T57A 1E5XA 1NYLA 1TJ4A 4Q24A 2LCFA 1D4FA 2Z95A 2C07A 3OWHA 1ISPA 1VGRA 1VLHA 1Z2EA 2GM3A 4QUDA 4BKPA 2QDKA 3ECAA 3MUFA 4NFLA 3Q7IA 4PZEA 3WLLA 1JFFB 3R7AA 2LDBA 3O94A 3V4RA 1CQIB 4G26A 1T9GR 3BOSA 5A9RA 3VGPA 1KAHA 4WK4B 5HZGA 2Y68A 4PO9A 2A7XA 3PXGA 2RD2A 5F1OA 2IHNA 4GO1A 5A02A 1J0BA 3AF1A 3DOCA 3OT5A 3PHIA 4TTJA 4YAIA 1ZK1A 3H2SA 1DI0A 1QZ3A 2FPPA 3ABQB 3CUSA 4CQLA 2Q4DA 3GN1A 1EM6A 4BV2A 3ZBQA 3ZE0B 1BMDA 1M9NA 2G36A 2GEUA 4AROA 3RVNA 3AVXA 5FHRA 3ND5A 4H7IA 4F2WA 1KYQA 1QPZA 3C14C 1C0KA 1ZM2A 2VI5A 3SOZA 1NVMB 4F9EA 3GIDA 2HL6A 3URKA 4HNRA 4BRWA 1NYRA 1VBFA 2AQHA 2ISCA 3NWEA 1ZD4A 3PQ8A 4DLWA 4LBZA 5C8XA 3AONB 3HBNA 2QQ5A 4S1PA 2BFWA 5DYNA 5EQJB 5FO1A 1W4LA 1YZGA 2QZPA 5CPFA 2WJWA 5KIAA 1KTIA 2FPIA 2H2HA 5KHLB 5JPDA 1QRAA 1JHVA 2B20A 2VNHA 2VYVA 4UFNA 4WERA 1V4NA 4DILA 4XM0A 2C7QA 1TXGA 3TJMA 5FTLA 1KPIA 4M37A 3FSRA 4OP1A 5HOQA 3GUZA 3JVDA 1L6IA 3SHOA 5JR3A 1A8PA 2O06A 4JI5B 1E9SA 4FCWA 1QV7A 2XMRA 2JJYA 5JTTA 2Z2IA 4W8HA 1CR4A 2IUSA 1H2FA 2QROA 1OZGA 1WV1A 3ZNPA 3ZTYA 3UGJA 2WTEA 3GEHA 3ECCA 1CRPA 3L7YA 4WFIA 1B1CA 1IY9A 1UFKA 2IIBA 2J7KA 4M88A 3VNSA 1LPBB 5BN5A 4AKGA 1Z07A 1W49A 4JNCA 4MUYA 4X1KA 1B23P 1CVRA 2O8DA 2COEA 3MXOA 3OC6A 2QEQA 3AESB 5JLJA 2RONA 1VIYA 3HY4A 2X0RA 2X6TA 2ILVA 3LDUA 3DFKA 3CFYA 3PUIA 4BP9A 1OI4A 4KEAA 3E53A 2JLZA 1B2LA 1ZKMA 3B9QA 5T4HA 4LJ9A 4Q47A 1P5FA 2OEPA 3ZVNA 1AC5A 4L9AA 3ZV7A 1FDSA 1UP7A 1LWOA 2JVKA 4PZZA 3B9RA 3CUUA 3SM3A 3V8RA 3VH3A 4NXMB 4U7WA 3UXEA 2VT2A 3ZVMA 5DEOA 3CLRD 1AQIA 3STXA 1WKBA 2A8YA 3DQZA 3DO6A 4CMEA 4EVQA 2QL9A 3GMTA 5BQ3A 2Z6QA 4GFDA 5E6RA 2OHVA 4XEHA 3SYRA 3GJ8A 3R6LA 1VJCA 9ABPA 2O0MA 2DBRA 3ZDEA 4D0LB 1L4LA 3BSFA 2BFCB 4BMDA 4V0LA 4CMIA 3R9WA 4MVYA 5E3HA 7ABPA 3QNWA 2J33A 2NSLA 1H2YA 2WIDA 4YO8A 1UQTA 1VPVA 3OF5A 3PRHA 1K7EB 1DCFA 3U4AA 2GYVA 4DNXA 3RT1A 5BYKA 4EAQA 4Q82A 3MWKA 3MRTA 1QE0A 2XGOA 1G2OA 4ZRNA 3Q15C 1AN0A 4DF3A 1EGHA 1B6GA 5J2UA 5FWYA 2BY4A 4BV3A 3K0EA 4FSHA 3OPYI 5KMGB 5F98A 1NV9A 2RGNA 3QVXA 1S96A 5LB2A 1GZSA 1V11A 1MX5A 1XXHB 1KI6B 2Q3CA 5E1BA 4DEXA 4KK3A 1MAVA 4FUQA 2AWNA 3ZWQA 4D6PA 5CB4F 1KZ6A 3W9UA 1EDZA 1ORWA 2NYAA 3EXHA 1RT9A 5LQSA 3A1TA 3OMXA 4V1CA 2G83A 4R68A 2M9MA 4C1NA 3W77A 2G72A 4O25A 3V9AA 5JJIA 3RFVA 2W9XA 4G1FA 3KKNA 4ZARA 3FLMA 3G23A 3E0XA 1JEDA 3FDJA 1SVOA 1HBJA 2YRWA 1YR6A 3O9VA 3PE4A 2WJIA 4HATA 1G291 1QOQB 1J24A 2HZBA 3QSGA 4Y2GA 3WJAA 1V4BA 2GFQA 4BJ3A 4KXUA 4PZDA 4Q16A 2PKEA 2CNBA 1QMGA 2C29D 2RAPA 3TRJA 1EVIA 1K4MA 1EUCA 2V59A 2OHJA 2QRKA 3WIVA 4OMCA 3DMFA 3NT2A 3PRKE 3SLKA 4V0ME 1SELA 4UEJA 7ADHA 3LPAA 3MBKA 1DPGA 3WGHA 2OP1A 5JY6A 3D4NA 1I94B 2Z5LA 3RUIA 2P11A 1UPUA 4WVFA 2VFAA 3EFOA 4IKOA 1UPBA 3PR3A 1DBVO 4R2LA 1H2RS 3HRIA 1Y1TA 3ADOA 2D2IA 3F6SA 5B53A 1R18A 2LW7A 5K6TA 1DKLA 2GCOB 1GP2A 1HTTA 1JMYA 3DWFA 5K6AC 4DLTA 4BNTA 2OHIA 4QEZA 1R37A 4KO3S 5F12A 1TE2A 1YMQA 2HMUA 4MX8A 3R0VA 1UL1X 1XR3A 4Q9NA 3NETA 2ANCA 4BC1A 4L02A 3GXOA 1KDRA 4OI4A 4K5QA 4QBGB 4XPIA 1W75A 1JGTA 1G59A 1PQPA 5J1SB 3KOOA 2ZRLA 1ONNA 1YAJA 2V7TA 3OZCA 3WGQA 3RABA 1NW7A 3F9IA 4CKWA 4NAUA 3MJRA 3DWIA 1QIFA 5FULA 5LUBA 4LJLA 4QRDA 2Q5EA 4K9RA 2FPLA 2OV3A 2CC2A 1R5NA 1YI0A 1OV4A 3HKBB 1K8YB 4PFKA 4XD7A 5EIWA 5CD9A 3OOHA 3H83A 2X7HA 4C5CA 1KI9A 3BAZA 3K9GA 4UEWA 4FS8A 4CEHB 4WA7A 3SVZA 1K08A 2C04A 2JIOA 2OM6A 2ZBFA 3ENWA 4QICA 2QP4A 1KRHA 5H7XA 2EFEB 2W8BB 4BNVA 5L95A 2YUIA 3LQYA 4KVAA 3OCYA 5G3ZA 3O95A 1D4ZA 1PO7A 2J31A 1R4MB 3FYUB 4O2BF 3TMKA 4ZQBA 1R6DA 5JADA 4LRQA 2VSFA 5GIPE 3E1KA 3KAQA 5D3ZA 3TQQA 1UFVA 1U5AA 4J3FA 4DMGA 1KEPA 4U7GA 2GZRA 1G8MA 3R3XA 3W3ZB 3EXG1 4GWGA 1ZD1A 4O0MA 3QOFA 4OYYA 3ZYCA 2W6NA 3HO1A 3A25A 3SQMA 4A36A 4OAOA 1WF6A 1KIMA 1ODJA 1EFVB 4JJKA 4RVOA 1L2TA 1BDJA 1OYYA 5JZBA 2KW5A 2BYTA 1CUAA 2XV1A 4CLOB 3QYJA 4MB2A 2AR7A 4C87A 1TFUA 4P5EA 4DV6B 1NVWQ 4A0QA 1COZA 1ESCA 1Q16A 2PL1A 5BSGA 621PA 3C8DA 3I2JA 1T4BA 3A6DA 2CB0A 4WY2A 3EC1A 4UM9B 1ZA1A 3MCWA 4QHTA 4B2YA 3FTFA 4JBHA 5DB4A 3L4BA 4OMDA 4ZIRB 2HT1A 1GU1A 1IZ8A 2ZR8A 4IDNA 5BSHA 1J0XO 3FX2A 5F1YA 4Q37A 3U40A 2HSDA 2Y9MB 3ENZA 3GOQA 3JYLA 4UE3S 5CTAA 2VF8A 1DQSA 1MNQA 1KOGA 1XV5A 2VDRB 1J22A 4JLBA 1X87A 3B85A 3U48A 3ZY3A 1IYZA 1U94A 1GKUB 4E32A 3K1AB 3SMQA 1ZJYA 2WNIA 1CS0B 1NPDA 4Z7NB 3IQHX 3E3MA 1OBVA 3VPFA 4LJ8A 1P1IA 1Q7EA 3R24A 1N6LA 3S5UA 4LYFA 4C07A 3BSWA 4NTZA 5G4KA 5KWJA 1XPJA 3ONDA 1E7QA 1OHHA 2R66A 3O75A 4B84A 1JHXA 4DG9A 1VHWA 2R6GA 4WLNA 2XI4A 3FWHA 4U4AA 3ZHSA 2NU7B 1OE0A 4FFBA 5J4YA 2ZR0A 1QGOA 1QFXA 3EXEB 4NU6A 3HPQA 1PI3A 2GGSA 3ORHA 3NR2A 4FJ2A 4RH0A 4V3BA 4WQMA 1NBIA 5LFAA 4RTOA 2VJLA 2VPYA 2PIAA 1RBMA 1G8GA 2PSSA 1FNCA 3WX0A 1ZD5A 2GBLA 3NTOA 2RCNA 3RU2A 2RJ3A 2QUIA 5I7VA 3RRJA 3PP8A 3K0BA 2OO7A 1IM8A 5SZHB 4O2BA 1CY4A 2ZJ5A 4OSOA 4R1TA 3HB7A 3A1WA 2LRHA 2Z2XA 1K06A 1BKDR 1KYWA 1W2GA 4P53A 1TZBA 2XZLA 5EUQB 1PJ8A 3HR4A 1IATA 3A6FA 3D3WB 1DIGA 3BXHA 1M6WA 3C98A 1RCTE 1UDXA 1S3GA 2IBSA 2GN0A 1UKCA 3ACDA 2JD1A 2ZAYA 1OFTA 2D74A 3KJNA 2X86A 3KQVA 1H93A 1HLDA 3H13A 1QG0A 2VHTA 1N2CE 3GT0A 1OA1A 1DZ3A 4HWKA 5E1MA 2ZOSA 4BP1A 4A0FA 2GRUA 2XUZA 1HE2A 2YXDA 5IUNC 5AKYA 1AOXA 3FMVA 3HWX1 1WCV1 3DD1A 1JR3A 3RAEC 3MMZA 4IKPA 3IAFA 1CQJA 3DDOA 4YO7A 1IY0A 3HYRA 2IJGX 1WP4A 2Q3LA 3ZZTA 4ZXPA 4C7OA 2JD0A 3B48A 3F4LA 3FGZA 4KFTA 2CNDA 2BFBA 1FFEA 2KI5A 2XBLA 4RSRA 1ZISA 5BW5A 5IJ0A 1L5MA 2AHOA 4CKEA 4BX0A 4CTKA 4HXGA 4CPDA 1MB0A 4R16A 1DRUA 4J0QA 3OZAA 4R3NA 3T7SA 2RHOA 3E8MA 4U8HA 5EZQA 2A9OA 4MTLA 1UPTA 2EJUA 2NYVA 4W7SA 4FHEA 2J6IA 2D00A 1KE1A 3OA2A 3AOEA 3IVXA 5FLYA 3I01M 4E3ZA 3Q0IA 1N7GA 3QHQA 4NCNA 5SICE 3N3BC 2NN3C 3LECA 3RFUA 4F4HA 1XELA 1OWLA 2DG2A 1C50A 2W71A 3Q7TA 4GLOA 2ZJ3A 4CFSA 1RWNA 2HK6A 4OJMX 2HIAA 2DU8A 2TMKA 1IONA 3H11B 2AEFA 2XA9A 1CUYA 3B6IA 1XJWA 3DZGA 5AW5A 3ZI7A 5AW3A 1R5BA 2Y1GA 3VV2A 2CNOA 4U5QA 1KJWA 2Q4EA 2XNCA 3KZCA 3AVYA 2VR1A 1A5SB 4XQCA 2CBGA 4YXWA 1X9IA 2GD6A 3GGOA 4BRZA 3IBFA 2IXFA 5CXUA 3U9TA 1P7YA 3FOEC 2WLSA 4LHVA 5E2IA 2J5RA 2W4QA 3TDKA 4BMYA 2CV2A 5JH7B 3QW4B 1IDOA 3WWYA 3VAZA 1SMKA 5BN4A 3GLGA 3VC2A 4R3WA 4CJXA 3OX1A 4HB4A 3MJTA 2FZGA 4QPNA 2AZDA 4D80A 1DS6A 2BEVA 2Q9UA 1YQQA 2QAGB 2BHSA 4CR8A 5F23A 1O8CA 2E5FA 3FPFA 4PSCA 5BPHA 4ZEOA 3I2HA 3REQA 2LTAA 5F9FA 1C7FA 2OHOA 1UIRA 1R0BA 2H9AA 5BNZA 1FVHA 4IOKA 2FE4A 3QEBZ 4F4UA 4GF5A 1L4NA 4E46A 1RHJA 2H17A 4Z9AA 3VVBA 4EA6A 4QT4A 3F2IA 2Y0CA 2DPGA 1R15A 1J1IA 4UOZA 1PF7E 3OX3A 1FL9A 1Q77A 1MU0A 3CSUA 3WL8A 4GNRA 2AK2A 2NO0A 4PLGA 5LC1A 3U62A 1XL0A 3NO4A 4LY0A 4OUDB 1FUKA 1LRKA 3K5IA 1CTQA 4MI1A 3O2SB 3U44A 3TQRA 3SF0A 4GRIA 1DMSA 1O5IA 1AKYA 2XT6A 4MS1B 5JC8A 1GA4A 4QU5A 5B2EA 3S2FA 1Z36A 2XCQA 4RZQA 1GGFA 2WT8A 1K6JA 4ZOLB 2ZJFA 3H1BA 3NNDA 1TU0A 1L4HA 1VG0B 3T0IA 4PF1A 2AZXA 4JGIA 1N3BA 2PZAA 3SHWA 4F6LA 1XTUA 3IUEA 4DYHA 1ZU4A 1PZEA 1NBHA 1P2BA 2R6AA 2J3EA 3CJRA 2A5YB 4R9UC 2HXYA 5D01A 1ZUWA 2AJ8A 2ID8A 4BMOB 2ZJ6A 3PFWO 4HDSA 4ZYZA 1E1QD 3PWZA 3RRNA 1LPSA 4PPFA 3E9EA 4JC8A 1T3ZA 2VNKA 4TSKA 4O4LA 2CVZA 2QMZA 2D0PB 4AUKA 5KVAA 4AY6A 1XX6A 5J47A 1SBHA 2VAMA 2A30A 2NPIA 3H84A 3IXMA 1A5BB 4Q3DA 2WYVA 3WFZA 1X1RA 2C5LA 3GNQA 4OATA 4YACA 2IYSA 1KJ8A 2JCVA 4R5MA 1NBOA 4GECA 3NEPX 3OFNA 4DA0A 1U80A 3JZMA 1GPUA 4ZTUB 3TGPA 4B82A 5KDOA 1L1QA 1T6YA 2HA3A 2XTMA 2X13A 2RC6A 5ALNA 3W7AA 2DHDA 4IYJA 2IZ6A 3ZW8A 5H9VA 3UBMA 4JV5B 1DQYA 2W93A 2Z2JA 4EPRA 5C1OA 4P32A 4WFQA 3BN3A 5CT8A 1E9AA 2BKAA 3GH1A 1RWBA 5A9SA 2YX1A 3R3UA 4GMFA 3G9QA 3DL0A 3LXMA 3IUNA 3KQMA 2V3CC 2KS6A 3MA0A 2GBIA 1Z7YA 1U7PA 1V16A 2E4AA 4OL9A 2Y27A 3L4EA 4A9AA 3NUQA 3IKTA