1X94A

Crystal structure of a hypothetical protein
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
191
structure length
176
Chain Sequence
MYQDLIRSELTEAADVLQKFLSDDHNIAQIEAAAKLIADSFKQGGKVLSCGNGGSHCDAMHFAEELTGRYRENRPGYPGIAIDYVFSRYVEAVGAKGDVLFGLSTSGNSGNILKAIEAAKAKGMKTIALTGKDGGKMAGLADVEIRVPHFGYADRIQEVHIKIIHIIIQLIEKEMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of two putative phosphoheptose isomerases.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Isomerase
molecule keywords putative Phosphoheptose isomerase
total genus 66
structure length 176
sequence length 191
chains with identical sequence B
ec nomenclature ec 5.3.1.28: D-sedoheptulose 7-phosphate isomerase.
pdb deposition date 2004-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13580 SIS_2 SIS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10490 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glucose-6-phosphate isomerase like protein; domain 1 1x94A00
3C3JA 3JX9A 3JAMA 4YHHB 1XNRB 4U6NA 1IBMB 1GZDA 2VF5X 2XBLA 2YVAA 2VQFB 1VIVA 4DV6B 4KHPB 1IRIA 3J80A 4JI2B 1NUHA 4LF9B 1JXAA 2A3NA 5IWAB 1IBKB 1X94A 4GKJB 4GKKB 4DR5B 2WU8A 3NBUA 1VI5A 3CVJA 2CXPA 4DV3B 4B3RB 4YY3B 4LFAB 5I01A 2Q8NA 4NXNB 4DV1B 2J6HA 4DV5B 2CXTA 3TBFA 2POCA 1HNXB 2UXBB 5BY2A 4JI4B 3IFSA 1JLHA 4DV4B 4X62B 2CXNA 3ODPA 4DR3B 2AMLA 4OX9B 2E5FA 1B0ZA 4B3TB 4LF7B 4K0KB 3J7AC 1JEOA 1XNQB 3Q88A 4JI7B 3J81A 4JI8B 4LF5B 4LZJA 3BJZA 1U0GA 5LMUB 1VIMA 4JI6B 3BCHA 4AQYB 4LF4B 3FKJA 5A2QA 3T1YB 3ETNA 1HNZB 1Q50A 2O2CA 4LFCB 1GZVA 2UUBB 4JI0B 4NXMB 4JI3B 1NRIA 4S1WA 1XMOB 5FLXA 1MOQA 1WIWA 2V4MA 1N32B 4JI1B 1MORA 1JIQA 4DR2B 4JI5B 4EM6A 4DV2B 4JV5B 2XHZA 2CXQA 2VQEB 4DUZB 4S12A 4AMVA 2PGIA 2HHHB 1TZBA 1N33B 2UXCB 4DR7B 2PUWA 1M3SA 2CXOA 2I22A 4X66B 3EUAA 1XMQB 2F4VB 1TK9A 4LF6B 1T10A 2PUVA 2E5LB 2PUTA 3LJKA 3I0ZA 2ZM6B 3KNZA 2CB0A 2I2WA 1FJGB 2CXRA 3FF1A 3UJHA 3Q7IA 1N34B 4LF8B 4DUYB 4X64B 1X92A 4DR6B 1HR0B 3OOJA 2UU9B 3FJ1A 1N36B 5LL6P 4LFBB 1KOJA 4B3SB 2CVPA 1C7RA 4DR4B 4X65B 1IATA 3PR3A 2UUCB 2UUAB 2O2DA 4M0DA 4B3MB 1XTBA 3HJBA 1J5XA 2DECA 3G68A 1C7QA 1HM5A 1DQRA 1U0FA 2ZJ3A 3QKIA 4TOIA 1X9IA 2CXUA 1J5EB 3M5PA 1I94B 3T1HB 3TRJA 5BR8B 4DR1B 3FXAA 2DF8A 1VI6A 2X3YA 1X9HA 1ZZGA 3SHOA 4DV0B 2UXDB 3OTOB 4JYAB 2ZJ4A 1G98A 5IT9A 3HBAA 1MOSA 1U0EA 1HOXA 1IBLB 1HNWB 2CXSA 1TZCA 1N8TA 4DV7B 5LMNB 2VF4X 4IVNA
chains in the Genus database with same CATH superfamily
1JEYB 5K05A 2G0TA 3CLRC 1N6OA 3EPLA 1DDGA 4IICA 3U40A 3L01A 1SUCA 5JAHA 4Q4JA 1ZNQO 3LWNA 3M4YA 3TZKA 4XPZA 4NBNA 5LU8A 3JZIA 4E13A 3HVIA 5JWRA 1G63A 4CR6A 9ATCA 1OFUX 3TWOA 5HF9A 5D3KA 2QTLA 3NMUF 1VHLA 2O1XA 1JWAB 3PJFA 2YKGA 3LLSA 2BEJA 1QHEA 4EI7A 5F9FA 5HSGA 2VPXA 5LB4A 4LE0A 3EMVA 1CB7A 2F4NA 3GBPA 2OZLB 1Q2XA 1QKIA 3M3HA 4H7PA 1HLPA 4KVAA 2UXBB 3UAGA 1YMUA 1UBOS 3DL4A 4RQAA 1OZAA 3DEIA 3UATA 3VUFA 4PLVA 4ZTZB 4AKGA 1UIMA 4BMSA 2XDQB 3WGQA 3SAJA 2PH1A 5EJ2A 1XR3A 2HJGA 2Q4EA 1D0IA 4PG8A 1ILEA 1GO2A 1M72A 1T5HX 5LQDA 1M6YA 2O8VA 1YR6A 4KOEC 4N5HX 3A4TA 4I5DA 1WZNA 4LRQA 1ECFA 5D6NA 5JMPA 1ODIA 2D54A 1H66A 1KMQA 1W44A 1SD1A 1BGXT 3E9DA 4X6UA 4B4OA 4BNFA 3CCCA 5TF0A 3SEFA 5J4LA 4AO6A 3LT2A 1VCOA 4JVOA 3AB7A 1F1BA 2QVZX 3N70A 5ADWA 4W9NA 3EVCA 1FFAA 2QTVB 4EB8A 3ZDRA 4EJMA 2PVSA 3BGSA 2OXTA 3REQB 2X4GA 1W76A 4KBYA 2WHEA 4AG6A 4YRCA 5GZ1A 3UPUA 1SXJE 2XHZA 3JPYA 5BN5A 2VQEB 2H65A 1A9RA 2WU3A 4I2NA 2GDZA 4NBKA 4Y2RA 5JC8A 3DEJA 1S2NA 3FHTA 1NZFA 4UEOA 4C22A 3PNKA 1QDEA 3KOWA 1XDUA 2WWGA 4HB0A 3GD7A 3STXA 4DQUA 1KSHA 2W22A 1NYLA 3HVRA 1T9AA 4LWZA 3PQ6A 2A4KA 1UBJS 4OP1A 5TPZA 4XUCA 3I9KA 1UEJA 3TAUA 2R6CA 5EJ6A 2OCPA 3KHTA 3PWKA 3MS2A 1PJ8A 2A8YA 3SCZA 1NQUA 4BWFB 3B6KA 2E1PA 5HPYB 3K0SA 3KOOA 1HKUA 2GJ8A 4IIGA 4F9FA 2Y27A 1Z74A 3AU8A 3AR3A 4QGAA 1Q21A 1M2FA 1LDMA 4M0EA 1I0ZA 4S2UA 2M9MA 3CRZA 3H9GA 2PHZA 3RS0A 1M2OA 2AXPA 1DE0A 1SK8A 3WTBA 4XQEA 5IMBA 4US1R 5G4LA 5BWLA 5FWXB 3OTGA 4MKIA 5HTKA 1UKAA 5HM8A 4W5QA 5JECA 1Q0QA 1A7AA 4TWZA 4UHHA 5BYJA 4IQ4A 5I3CA 5C53B 4S04A 4JUCA 1YVRA 1AKWA 1WKCA 3NVDA 4AZ3A 1J20A 3RC3A 4AY5A 4ZCRA 5L3SB 2P2YA 1TZJA 2UYGA 1HLGA 1OX5A 2ZUEA 3SLKA 1KJYA 4S35A 3ZXSA 2WINI 1QIIA 5C4IA 1WV0A 4MHTA 4X6XA 3RQIA 1J9GA 1ZK3A 2AJBA 2XE7A 3Q8LA 4L8VA 1T3ZA 1RPNA 1GGFA 3UW1A 5KYNA 1E9VA 3SR0A 3AR7A 4LBYA 1UPUA 4JJGA 2EFHB 4TMTA 4D57A 4ECEA 3HP7A 4UNRA 3TM4A 1DKQA 1M5TA 2JEYA 2ZJ7A 5JSQA 2Z5VA 3TZBA 4Q9JA 4G0PA 4F85A 2GGSA 5FPYA 3TYXA 2CFIA 3VU9A 3GJQA 3D6JA 3R4CA 5FI5A 5L3RA 1VLVA 4JGGA 1JECA 1F6WA 1LY1A 2QL5A 1OI2A 2VRCD 1YR3A 5TMBA 2NTNA 3RUFA 3RVDA 5KOIA 3JQQA 1DXOA 2PO7A 1NR7A 4DIOA 5TMDA 4PYJA 3TQRA 3PD1A 4DLNA 2BGWA 2HSWA 2ID4A 2MSNA 5TRTA 4C0LA 3HA3A 4J7AA 4Y9RA 3QE2A 4F7WA 2QBYA 3EVNA 4C2AA 2ZIXA 2DSTA 1Z0AA 3JAWA 4HS4A 1CS4C 3RWOA 1NBEA 3DONA 3AY7A 2XY4A 4M9CA 4PAMA 2Y1DA 2YCLA 1J56A 2GPWA 1Y9ZA 3ZU3A 3IQEA 3LYAA 1TFRA 1L7PA 2VAWA 3ZTYA 2G36A 4TV8F 3T12A 1A8IA 4N48A 2RHCA 1PF7E 5EJGA 1P45A 5CLLA 4N18A 1W4AA 1E6CA 1VLQA 3H6KA 4IF4A 1Y63A 3U3XA 2HPAA 2VRWA 1EVYA 2DTDA 4Y2JA 2WIJA 3ZTTA 4A16A 4EB0A 1N5IA 1P4RA 1TMOA 1XMPA 3FSGA 1TEZA 1VL2A 3FVWA 2DVMA 2GBFA 4YFYA 3RJMA 1BFUA 1XCGB 2YASA 5AW2A 1GQYA 2NUAA 2E37A 3GUZA 5TEVA 4S05A 4I19A 1Z17A 3EXHB 4G09A 1L4HA 1XFAA 1E0AA 3G89A 5CXQA 5BVGA 2X15A 1U7ZA 3MINA 3N3AC 1VECA 4Z9XA 4CKXA 1HV8A 2IU0A 5IPFA 1XJ0A 1UINA 7AT1A 2DPMA 2GK3A 4GGMX 1LQTA 3CRW1 5B2FA 3Q3JB 2ZBPA 4M2LA 3G9UA 1A8UA 1R0LA 4HD8A 3ROXA 5B1EA 1J09A 4DA4A 5FUVA 3VU8A 2GD0A 3D8HA 4NYMR 4KVGA 3ROEA 4C08A 1JPUA 4J6FA 4BNJA 3KUCA 3GCXA 1AK1A 1P2BA 2DKOA 2V45A 3G0DA 2XW6A 1A2OA 1ONSA 2IP4A 4UW9A 2YVKA 5A2GA 1ZITA 3COWA 4WADA 2W8ZA 4D8XA 1KEPA 1PNRA 4S24A 3D3JA 4UREA 4U0KA 2GPNA 3PK0A 3AWIA 5CT4A 4LN1A 5ENZA 4AQDA 1WXDA 2YQZA 4KLCA 4Q9IA 3VDMA 4NU5A 3EW7A 5DP2A 3RBAA 1RC8A 3LKVA 5I8WA 2BFCA 1OH8A 1TM7E 1ISRA 1ZYUA 5L3QB 4MW7A 2BN4A 4LYHA 2WC1A 3T94A 5KEIA 4OXQA 4DR4B 4BVHA 4B71A 4WT7A 3QUSA 4M7OA 3SE7A 4GX5A 2AE1A 1JH8A 1FQWA 5I7HA 1A2BA 5F35A 2QVBA 2HF2A 1RI1A 3QVWA 1QP8A 2I8CA 3WZ2A 1N77A 5B7GA 2HOQA 4WECA 1WSDA 4IG4A 4OVKA 1A9TA 4ZXFA 5LUBA 3LW8A 2ZREA 4TYQA 1PU2A 4LJ6A 1I80A 4DCGA 2C7QA 3IT1A 8LDHA 1RMYA 4GKVA 4ZK6A 4F9EA 1OWLA 4E14A 2H51A 4PONA 2UXDB 4ZIRB 1W93A 2XVAA 7ADHA 3EZGA 1MQ8B 4CT5A 3MLAA 4KH1A 4OOFA 5CHEA 1QHXA 2W0SA 3QU4A 3S7ZA 3ABRB 4Q48A 3RYIA 4ALNA 4QBTA 1XQVA 5T8KA 1UBRS 4D3YA 1QRAA 1DCFA 1AXRA 1H23A 4W7IA 1WUYA 3QMMA 4KXQA 2I1LA 3LBFA 1J8FA 5J4KA 1XP8A 4IEEA 1YS6A 3SJUA 4ZCMA 1GNQA 4BP3A 3RFTA 2WPDD 3PG5A 3X1KA 3FSRA 4KG7A 1WOYA 1J0CA 3GFOA 2F6RA 2VP3A 4LTNA 4DMLA 1TAUA 2NO0A 4Y0VA 3DDHA 1MAUA 2D13A 3LUBA 3MM4A 1U6JA 3QY0A 3RRZA 3SYLA 4I6EA 4NF2A 4EGAA 5GJBA 3DOCA 3VHLB 3S2FA 3ME5A 5H16A 2QPOA 3DJFA 3GRVA 1UMBB 3SJZA 5CT6A 2EZ9A 3BE8A 3VH2A 3DDOA 5BOSA 5HUJA 2W93A 5FUQA 4EY6A 4LCJA 4QFDA 5SYNA 3NAMA 1ZUNB 2ABWA 3ADCA 1JPNA 1K8ZB 2FZWA 4B34A 2QM3A 4JP1A 4BRSA 1J8VA 2J9FA 3A9SA 3A6PC 2CMFA 1CQIA 3OLXA 4P3YA 2ZB3A 4ZGBA 1JG2A 1QS0A 2RHWA 4R8SA 2PX8A 5JLAA 5EXEA 2AN3A 4JI6B 3DVLA 5DOVA 3QVSA 3FROA 2K4MA 3HA7A 5LZ7A 1U7OA 4AXXA 4B40A 4M55A 3A0RB 3F4KA 1Q20A 2ZQZA 4IWNA 4I9UA 4DM4A 2QMYA 3ZVNA 1ZZEA 5KTRA 1WTAA 3FTCA 2QU7A 5EJ4A 4S1WA 4QPDA 1T4DA 5K6AC 4N9WA 5TJHA 1NXSA 2PZLA 3PL5A 3S55A 4NATA 3RVOA 5LP6C 2VXCA 3IAAA 3JQ7B 2YRXA 5TIIA 4H3KB 3JQRA 4AVYA 1LBQA 3OVMA 4DSUA 4QHTA 1ZGGA 4RHTA 4ZCIA 3QSGA 5B7NA 5JIBA 5K7SA 2NUTA 2XB2A 2Z4SA 2ATXA 4HR7A 2O5VA 1HYHA 2V7BA 5KKAA 3L43A 2O0LA 3EVDA 1DCKA 1YQUA 3FFBA 3VPSA 4ZTUB 3U26A 4UNIA 5FBWB 4C4PA 3I9LA 5LMCA 3CKKA 2VP2A 1SVKA 3ESXA 3KEQA 1VPLA 4KC0A 4L4SA 5FTWA 3EAFA 3HJTA 5E1OA 4FUTA 2VUIB 1J99A 2QTFA 2VDQB 3U09A 1PO7A 4GOLD 3UJHA 5IAJA 4DUGA 3B8EA 2PZEA 4QYWA 3I76A 4F3NA 1JHRA 4EHBA 3WMEA 4QO8A 3E05A 3HCFA 4PPFA 4K6CA 4PO3X 2ZSIA 4FB5A 2G04A 3Q12A 5EYPB 2IXTA 3VKGA 1MB4A 4KGZA 4ACAA 5HBGA 4KXMA 4B3HA 3IIEA 4TKVA 1NXVA 3IUJA 4L9SA 4UQOA 3DV9A 4J0GA 4W7HA 3IV7A 3AOEC 1P0IA 2J3MA 1EVJA 1LBSA 2VHUA 3OIUA 1JX6A 1D0SA 2Z3VA 4N12A 3S2ZA 5FHRA 4KNYA 4YYEA 1W6RA 1GTMA 1ECGA 4L3OA 3JWHA 3FFAA 4KFCA 2H2DA 2KSQA 2X2OA 4QYIB 1L5QA 3HYCA 3N3BC 1W88A 3E3MA 3STVA 4DNPA 1C30B 1BXRB 2Z43A 4JBWA 3UUEA 4HL6A 3L0OA 2A59A 3FKSA 2YDXA 3UJ3X 1BU5A 5EJ9A 1U3TA 4HAZA 2O7SA 4DFDA 2QUHA 3FZQA 3D4LA 2R62A 5I48A 4MQFA 1Z0ZA 1L5HB 1CTQA 2HK7A 3C5VA 4HUJA 3ZWCA 2KS6A 5HIMA 1YL7A 1T1GA 2ZB2A 3WRYA 5FULA 2IPXA 4ZPXA 1CDDA 2RBKA 2JD1A 3SJBA 4EHIA 1D7OA 3KQYA 2OZKA 1KJQA 1LS6A 5AI8A 4LDQA 1TVMA 4KQEA 2FR8C 2DR0A 2GZSA 3NEAA 4Q3BA 2GEFA 1KJ8A 4YEDA 1CY7A 2L0XA 2XTJA 3A9CA 5EE9A 3VZBA 4A3SA 2Y3IA 3NKVA 2YV1A 2FDCA 3TVDA 4TLDA 3AG6A 3HPQA 4HTFA 1O96A 1OHHA 2HLDD 1ZMRA 1U7WA 3GX1A 4ZVRA 1X14A 3UFBA 1QQAA 3CEJA 2IVZA 1F06A 4QUBA 1S8NA 3ER8A 5EVCA 1B2LA 1CUBA 2Q50A 3MVEA 3T06B 5IK2A 2X7JA 5JWHA 2JFWA 4LYYA 2I62A 1VHTA 1ZFNA 2CFCA 3K32A 1NG9A 2XUHA 3SJAA 1CY2A 3H17A 1XZIA 2QGFA 3M9LA 2UZ1A 2IU3A 3HN6A 4MVJI 4XWGA 3WYNA 5C7IO 4K8OA 4J7UA 4PYKA 5DI9A 1TFUA 1YUNA 1PZFA 1O94A 3NC4A 1NF2A 3DV0A 3EXIB 4I1OA 4HTAA 3GQBA 1KNQA 1N2BA 1GNLA 2YY7A 3O9VA 3O26A 1ZVVA 1NP7A 4KXUA 4O2AF 3U61B 4WFQA 1ZM3A 1KGSA 4LRTB 3SBDA 2WSSA 3T7DA 3FPBA 2J5KA 2X2EA 2RGWA 1VJTA 2NU6B 2QL7A 2Z56A 2XXAA 2JD0A 1T4MA 2OB2A 3BJIC 3ZGZA 3ICOA 3BRSA 3EQ2A 1KYYA 1A69A 3NHLA 5KVAA 1XVIA 2A6PA 5JDCC 1BMFD 1ML3A 2X0KA 1DWQA 4F3CA 2CNLA 3KZCA 3H6GA 4CBVA 4XB6B 1NWHA 5LQMA 2J0UB 4N01A 3ADOA 2XPCA 1Z5PA 2ZB4A 3MLBA 3KPVA 4LK3A 3I0MA 5IF3A 4NULA 3T3PB 4U7HA 5M29A 4JBYA 4P34A 1P44A 2D0PB 2FUG6 3QSYA 3W6OA 4F71A 3RGWS 4HNAA 4YVFA 1G8JA 4N03A 3E70C 2VCYA 2IY9A 4OL0A 4IXMA 4JYMA 2BBOA 4WWHA 2VJYA 4D6PA 1VI2A 1G59A 2Z1NA 4DRYA 4JJEA 4RZ2A 4GUDA 1BYIA 1G55A 1NW9B 3DGFC 2NU9A 2WG1A 3ET5A 4WY2A 1QTNA 2HU8A 4HFJA 5JSKA 5ITZA 4GI2A 1CKEA 1J42A 4DIBA 2CV2A 1YCFA 4JD5A 4FFNA 4U8GA 3E7PA 2AQHA 2X2PA 4TM7A 1FNDA 1ISPA 2MYPA 2CJPA 4JJ7A 4PCUA 2ZJ4A 1ZGBA 3WNCA 2HU2A 4BWGA 3RVPA 1YBAA 2CXSA 3LLMA 5ALVA 4LJLA 1TZCA 3PC6A 3W5IA 3BS4A 3C2QA 3QXJA 1YBVA 4D3XA 3T5AA 1E63A 1FEZA 1WXXA 1FP6A 2RI6A 3FNBA 3MCVA 3KZXA 4FXOA 4WLOA 2XRYA 4MJLA 1WLYA 5EUCA 3SQNA 2I33A 1UZUA 4EECA 2Q0SA 1IRIA 2IXGA 2ZRCA 4MQFB 4PSCA 4UU8A 5H68A 2NTYC 4PGMA 3L6UA 5A3RA 1DLIA 4RESA 5ER9A 1L7AA 3K09A 4MW1A 1FA9A 4OQYA 1WB6A 1Y8CA 1NUSA 4V02A 1E4VA 1E4EA 1M8FA 1PL8A 2JLSA 5JJLA 4BKRA 3HFGA 3C6YA 1TIPA 1UKBA 3P4UA 3ITNA 3SKYA 4IDHA 1PVOA 1YONA 3H2HA 2D7DA 1G5PA 1DUSA 4V3BA 5D3MA 3VYTB 4YRMA 3WJ7A 3EY9A 1JLHA 5KWSA 1UXGA 1U1IA 4IUDS 1Z0KA 5DT2A 5FXMA 5FWDA 2J1LA 3GUYA 4HMOA 3LVFO 4C07A 5TGZA 2ZVPX 3LGSA 4TQAA 3FOAA 3I3SR 2Y0EA 3GLRA 4R2JA 4RULA 4Z4EA 3AVYA 1E2FA 1Y6JA 1LJUA 1M6EX 2GXUA 3FLMA 3KR9A 3GLQA 4I5EA 2YHIA 4PGAA 1T6NA 3L0BA 1MP0A 3OM0A 4RH3A 1P1IA 3IE1A 2XVZA 5BXQC 3LWBA 2IXFA 4PYIA 3LI2A 1DADA 4DJFC 3VXKA 1M7GA 2X13A 3R6LA 4MW6A 1GUFA 2Y4NA 5AVQA 2B9EA 1O94C 1IPFA 3DKIA 4LSMA 1SZPA 1VSTA 3ZV6A 4M0UA 3PEWA 5DCWA 5DTQA 2ZTHA 4CV0A 2BSXA 4QGBA 3BMXA 2A9RA 1YOVB 2E85A 3RHZA 1BS9A 4HJXA 3DOHA 2FDRA 4KEAA 4HGZA 3VAAA 4CG3A 2XXAB 3WLLA 4KPYA 1YMVA 3LY8A 1J00A 1Q7GA 2Q9BA 5EQTA 5F5LA 3RK4A 1G7CA 2J3KA 4L50A 4BTLA 2A35A 2OGTA 3QLTA 4RE5A 4MRAA 4Y67A 4CMEA 3KZNA 1EWVA 1LWNA 4B9AA 2O0MA 1L4UA 4KNVA 4N5LA 2OGSA 3S28A 2P2ZA 3R5FA 4EHKA 1GGJA 2XE6A 1ORDA 2YS6A 5TPZD 5ESDA 4CU5A 4P4NA 4MS4B 1ZC3A 1QB7A 2PTHA 3DEFA 4GRAA 1G5QA 3KT3A 2BJHA 1XRLA 2CJXA 5FTMA 3FZGA 1LDYA 1KDTA 1SXHA 4IH9A 2R5FA 3VJLA 4DYDA 5JJCA 1UAAA 5ICEA 1G9XA 4L7VA 4AKTA 3NGMA 4G26A 3F1LA 1XJ5A 1OUMA 1KP3A 4GPAA 3DDSA 4M76B 3DM9B 4GE3A 4JNCA 4QPNA 2WD8A 3W5SA 3UUGA 3FW1A 3BMOB 5GONF 2AUTA 2GEBA 3HDGA 4HUQA 1M1YA 2QRQA 5BV7A 1FYVA 1ZH6A 1Z9BA 1ZM9A 2ZLBA 3I42A 4FW8A 5FTJA 3SJCA 5HYVA 1U9IC 3GJTA 3GVPA 3L0CA 4C30A 1RYFA 3PUKA 3ZK7A 3H13A 4ZZIA 1KI6A 1QP4A 2JG3A 3OPYB 3UXMA 1JAIA 1OXKB 1IBLB 1J0DA 1UDXA 4TT3D 5LYJB 1KO7A 4MUXA 2YWBA 3NFRA 3UT5A 5FPPA 1XA0A 3C0KA 4EGQA 4F06A 4UM9B 5JSZA 5LQCA 2LWIA 3ZE8A 1XDBA 2QSZA 1MB2A 4L57A 1P2TA 1GL9B 3AEUA 1YNSA 2ZYUX 5BXYA 1J06A 4JJ4A 1HDRA 3FNEA 2FEPA 1CRPA 2IYQA 4WFKA 2HL6A 1PFQA 2G0NA 1BX3A 1ORVA 1Y9EA 4MVJA 3THSA 3OUTA 4CKEA 2AJ8A 1PYOA 3FDXA 4GM0A 4Q03A 2HA5A 4AUEA 2BDTA 1E32A 1AKYA 1DUVG 1KYXA 1L4NA 4J3NA 1S9DA 3ZNQA 1FP4A 3K9WA 4AZTA 1SB8A 5EKSA 4XUDA 3DUFA 3Q9UA 4KOAA 1J22A 1D9ZA 4BL5A 3Q72A 4F5EA 4PVDA 1GPH1 1G64A 2JAUA 5BWNA 1JRLA 1AD2A 4U2CA 3EDMA 2ZDHA 4HG2A 2PBLA 1RRMA 5EIEA 1Z2OX 4C6SA 1M8JA 5I6DA 1D04A 4F8JA 1EFAA 3H7AA 4PLYA 2NQ2C 3ADBA 2UKDA 2PS9A 3BHMA 4N5MA 2H11A 4HAIA 3HZHA 4CLRA 2EFYA 2JJ1D 3OJCA 3C3MA 2GETA 5D84A 4ZYZA 4ZT2A 5T7BA 1DJNA 3AEQB 1WDLA 2C77A 5B3AA 1O0SA 1X1QA 2GAJA 4G0OA 4GLBA 4Y3UA 4PGFA 1TQ4A 1T5LA 3A2MA 3A1VA 1SVMA 4LSGA 1UUFA 1R0KA 4EG1A 1UQTA 4PYRA 7GPBA 4PZCA 1ZISA 3PNSA 3ZHOA 4QOHA 4N0EA 5K0TA 1E1RA 1N5LA 2WZBA 1G5IA 3GUUA 3CFYA 1E3SA 2IIPA 1E3TA 1W5EA 4FCCA 1C3OB 2WI8A 3IVRA 3LQ4A 4GPBA 3AHJA 2MYNA 4KO1S 1GJRA 4PSUA 1ZJJA 1Y42X 2G28A 1XRPA 4NHEA 2ZJBA 1QPBA 4H1VA 3TW0A 4ZV4A 3LD9A 5DNDA 3TLEA 2WJVA 3VV2A 3WIUA 1BXZA 1TMYA 4YR7A 4HNUA 1XUOA 3QGMA 4PBTA 1C9YA 5JNTA 1BOOA 4JC0A 1RM5A 2CZCA 2FPIA 3I5AA 3PNLA 3GB9A 3ERCA 2QV7A 3H97A 1GEEA 3C41J 4TQ9A 4TWBA 1EGMB 4M89A 1JMVA 1FFBA 2ZB7A 4HRVA 5BVGB 2K7ZA 3IIIA 3Q3GE 4FB4A 3T3EA 3PC4A 4O2AB 4M99A 1SK9A 1SFRA 1M2KA 3IMGA 4RVSA 3HZZA 4IQ0A 1U8CB 1DQYA 4A6DA 3FRHA 1ACLA 3IVCA 1DIHA 4UQPA 2PEYA 4EKDA 1VL5A 2QNRA 1HURA 1KRHA 2MINA 3K1YA 5E6UA 1IC6A 2QN9A 2AC2A 2Y6UA 2BFDB 1TUEA 2C1XA 3EGCA 4LRSB 4YCDA 1BHSA 2UUOA 4CQLA 1T0IA 1A77A 1GUZA 3II6X 4H2DA 4J0JA 5E1DA 2J0EA 2JVJA 2H1LA 2GUGA 3KKMA 4MPJA 4ZGGA 5A4KA 4J29A 4QVIA 2DFNA 4KQ1A 1EM8A 5AFSA 2YXLA 1BEZA 2OQIA 2HZ7A 3HVHA 4F38A 1JE0A 1PYDA 4HNSA 3KQQA 1X3SA 2ZFUA 4IDFA 4JENA 1W47A 4RF2A 3TIGA 5HWSA 3DD5A 3NIBA 4WN9A 1GQQA 3MJTA 1NU8A 2ENUA 5FUXA 2VF5X 3NETA 4HDKA 5F3DA 1TB4A 4F45A 3UYKA 1ZI8A 2FQYA 1NRWA 1H2BA 3C1UA 1FUUA 4BDSA 3VU9B 4AN1A 6REQB 2VDOB 1CY4A 5CCXA 4DABA 3NLLA 4G5SA 4R3UC 4W5JA 1GGVA 5CT9A 4AJIA 4CKZA 3E2IA 4HPJB 4GKJB 5CCBA 1MAWA 1ZLYA 1AA9A 5KOYA 3S2IA 4ZP1A 3TECE 2AXEA 5ED4A 1C3EA 2FFHA 1G7RA 3TCXB 3T9CA 1PZHA 1RRVA 4O1HA 3PDIB 1LK0A 1MV8A 2J3QA 2XHEA 3I4FA 4F5DA 3VSCA 2WB2A 4DCUA 2FKAA 2DHDA 3A9VA 3H1FA 3NRJA 2QG6A 5B1YA 1G21B 1M34A 4D4MA 3WYGA 4AYTA 5EJ8A 5E2BA 4BBAA 4KMMA 4BQRA 4YLGA 4A0GA 2GPTA 1UWCA 3AEYA 2KPOA 2DPXA 4BFLA 3K71B 4TSKA 3WWEA 1N7HA 2G0AA 2QJTA 3AEQA 3LXUX 1O94D 1POXA 2O48X 3FPFA 1G3UA 2C29D 3PFKA 3QPCA 4RKWA 5TT1A 2ID8A 3TOVA 3HYSA 3V1LA 3DMTC 3HBFA 3OM8A 2Q3JA 4ZGWA 1DTEA 1IOLA 1NRIA 1GQFA 4WY8A 4MP6A 2HCBA 3D6MA 2G1UA 1E58A 4A1OA 2FI1A 3OHSX 3ROTA 3U3MA 1GPMA 2IQIA 2FXVA 2YMQA 4K9PA 4O4IF 1MW9X 5EIFA 1QHHA 2WAXA 4J0DA 3ZHBA 3VNUA 2CXQA 4L78A 1K7YA 1AKTA 2NACA 3ZE2B 3PDJA 2RHRA 2R68A 5FX2A 4DRZA 2FY8A 4DMUB 2C7RA 1YD7A 4X1YA 5KJFA 2KE5A 2QJOA 4BTEA 4P38A 4Q9LA 2W6JD 5KYXB 1QF6A 3UF0A 1TJPB 3JQ9A 2ZJFA 3FMPB 3NPMA 5AW0A 1VP9A 3R44A 3LY9A 4CLXA 3GWGA 1T26A 2D3TA 2DT8A 1T1IA 2GWRA 1CUVA 1H9CA 3PYXA 3GO4A 1WS6A 4Z1MA 1B6TA 4E0BA 1RI3A 4OHZA 4AD8A 1C9NA 2AR9A 2IZ0A 3C6MA 4ISCA 3C8MA 4YRAA 3IIMA 2D1FA 1B14A 3FMVA 2F59A 3ZY3A 3LS2A 1M75A 1JFFB 2RE8A 1MXHA 1U0NA 3ZOZA 1FBTA 4B45A 3VTFA 3ZHZA 2YNMC 1VTKA 2R44A 3GV0A 1EFVB 3GJ5A 2C4VA 4H0CA 2EGHA 2JKYA 3AERA 4DVJA 2PJRA 4LXHA 1CQZA 5ALIA 5IARA 2YHUA 4HADA 1X70A 2LZ0A 1SUIA 1YB1A 5E9JA 1E7RA 4NCXA 5A3VA 3NVAA 3PXAA 3C3AA 1WDKA 3BRWD 3TGPA 2ERYA 1EXDA 1T9ZA 3HE3A 2JA2A 4P7KA 4Q1EA 1D2GA 5EC8A 4Q4HB 1GNVA 5EMNA 1YOBA 2QUJA 3MMPA 4YRJA 2E4UA 1WDTA 3QELB 3IUSA 5KVCA 2RFLA 4UZSA 2HIMA 2VDWB 3IP3A 3IPAA 5ES3A 4F4CA 5AHRA 1O0CA 1V35A 1IY2A 1T5IA 4X20B 1VB3A 1D8TA 1XZHA 2O2ZA 3PSAA 2OFFA 5BV8A 4KU4A 1DX6A 3RUHA 4UBIA 3FNHA 1ONOA 2IITA 3LVBA 3SQMA 4NP6A 1H2AS 5EL0A 1XCMA 2K2WA 3M4XA 3QITA 2M6LA 1RYBA 1KI1A 2PKQP 4J16C 4QXAA 1EDBA 4ZT4A 4KBFA 1MZVA 1RHQA 4C6HA 6PFKA 3GEHA 1G3IA 2IYEA 2YJ4A 4QUDA 4F2HA 5IJ9A 5THKA 3L0DA 1W5FA 2J7PD 4FDMA 2DFKB 3GNSA 3Q9SA 4LX0A 1ECLA 3RHFA 3BMNA 1JAZA 1H94A 3F8TA 1USIA 3QEOA 4YRBA 4D42A 3H9UA 4FYWA 4RMGA 2JGRA 4Q7JB 4PE5B 2IUYA 3GY0A 1DLJA 5CP8A 2ZJ8A 3AVTA 4O25A 3IOBA 1Y82A 4GXTA 2FDXA 3UAZA 4QOEA 3BJZA 4TYPA 3SF8A 4EAAA 4ZICA 5ALOA 2I6XA 4BQFA 1BX0A 2FMXA 1Q0PA 2P41A 1KRWA 3PE3A 1T4GA 3O8QA 3ZZ0A 1Y4ZA 2B4RO 3DQPA 4A2CA 4IKEA 4R2LA 1N7IA 4EYKA 3K6SB 4LI3X 1T8TA 1BN7A 1DI0A 4RY2A 4HWRA 5BQOA 3FUTA 3AJDA 5TB5A 1MJHA 1BVRA 5HIKA 4TV9A 1T5DX 1NUTA 2OOSA 2WM9B 3GFPA 1PK8A 1VZ3A 4KQ6A 5DSZA 2WIKA 3TI9A 1NN3A 4BNUA 5T4HA 4ZOBA 3P9CA 3UJDA 4R2MA 1N33B 4LMRA 5FR2A 4RWEA 2D2XA 4DKJA 4N7JA 3DOIA 3DXFA 3GDFA 3PGVA 3R77A 4YQZA 1LBHA 4M4SA 2Z1MA 3Q8MA 5EGSA 1XYVA 1S7CA 5I4CA 1UM8A 1ZJ6A 2EGGA 2RGBA 3TGLA 4DVGA 2CV1A 3IRUA 4FZRA 3IPLA 1N2HA 3U3DA 4H7JA 4P22A 2BEVA 5G4KA 2QP9X 1EE1A 1VKNA 6ABPA 4JEUA 4Z5XA 1ACJA 3HNRA 3EZ2A 2HK8A 3SEAA 2EFGA 3N1UA 3SHFA 3TSZA 1RJEA 5JPIA 2Q8QA 3EXG1 1SCAA 2EIXA 1Y6RA 3OLVA 1S2LA 1Q7CA 2AB0A 1EP9A 1X80B 1MOPA 1ABFA 3LMKA 4JOQA 1R0YA 1G6OA 2NU6A 3N0WA 3B7PA 3TX2A 1TRKA 3FMIA 1EK0A 1VLJA 2QP4A 1JQKA 2DAPA 4X1IA 5KOJB 5LM3A 4TROA 1XYYA 2NG1A 1NVFA 1VHWA 2QUZA 4R8KA 2QP3A 5KHAA 3OLWA 3AM1A 4ZVLA 1G8PA 4TV9F 1YR9A 5KYYA 4TKZA 4JFRA 1IWPB 3IVGA 2O20A 5B3JA 4ND4A 2O2XA 1E7YA 2YWGA 4JYCA 4BX8A 3EDRA 2X3YA 2Q0XA 2W6JA 2XDWA 4XR9A 4Z9AA 3BB3A 3U56A 2J3HA 2WOOA 5CAEB 1AQ6A 2GFIA 3AYXB 3ICCA 3IEPA 2YINC 4N0DA 1D0VA 4EHDA 3MOGA 1FQOA 2QXYA 3JXEA 4DV5B 2GN4A 2HBZA 2PZFA 3DNMA 3G7UA 4NH0A 2E4AA 3TVTA 4HEA1 5IU6A 2UZ4A 1MUUA 3AI1A 2X58A 1EUDB 1Z6ZA 4PY2A 5B64A 2O3RA 4NARA 1DZIA 2G09A 3GJ4A 4G1EB 5IZCA 1YR8A 4FYPA 1BGWA 3AEKB 3IYLW 4IP0A 4X20A 3WQBA 3G59A 2FQWA 3CW8X 3R9XB 4MIYA 1DO0A 4XOIA 1ZMOA 1NNLA 2R5WA 2F64A 1AUOA 1DU4A 4Y9UA 2ZP1A 4BVJA 2I3AA 2ZDGA 2B82A 3P2YA 4FMPA 3FAKA 1KR2A 2B78A 1HDIA 3EPHA 3G8CA 2ZYIA 5IKMA 4G5QA 4G1CA 5DBOA 1R88A 4JLPA 4FFOA 1X1BA 1UBSB 4OHMA 1P8AA 3V55A 3QWAA 4RIHA 5BQFA 3EGDB 3JZFA 3T35A 3GT0A 3JYQA 3B1YA 5AVJA 5P21A 1H2XA 4TMWA 2YWJA 1OXBB 1Z2AA 3HEBA 2QAJA 2C2BA 3SHVA 2O8EA 5IX8A 4UEQA 5AVRA 1E3DA 3VDNB 5AKGA 3DHEA 2J3LA 2PFGA 1KTVA 2NZYA 2VUSA 2FPMA 4NZYA 1GZ3A 3L7KA 3V80A 4W8OA 2C4NA 5EP2A 3N86A 5EESA 4A2WA 3NYWA 4MUJA 2F9FA 4AKEA 2VPPA 4EVIA 5U1PA 1QV7A 3N8KA 1JZTA 1HTTA 1U6IA 1AIPA 4MDHA 4R8RA 4D3ZA 3MIIA 5BW4A 1O95D 5I7FA 1UBEA 4EKEA 5F73A 1RYHA 2WDZA 2ET6A 4HQRA 4XDHA 3RC2A 4JI3B 4DMCA 5K3EA 4X71A 1K4YA 1X8JA 1NN1A 4AT1A 3WYDA 2IHJA 1RRCA 3OKCA 2NVBA 5B3KA 3RC8A 1IL0A 4A23A 1QE5A 2W37A 3K9HA 1VBMA 3CBGA 1TM5E 5CLGA 3PJGA 1RBZA 4MS1A 4D6XA 1Z6QA 3USCS 4C9BA 1O9BA 1F5NA 1P5RA 1JDBB 3GJ7A 2TMYA 2F3QA 2YHIB 4O5AA 3JWIA 4MYRA 5B12A 3JS5A 1LRKA 4EFKA 5IFLA 5GIOE 1MABB 1W5BA 1PT7A 1WXGA 4L5IA 3TXYA 3EISA 5C2JB 1B2RA 1HE2A 3NUGA 1PJRA 3PFIA 1MJGM 2QZ4A 3Q7IA 1E2GA 4XYMA 3ZWVA 4CETA 1DV1A 4QAQA 1NG1A 2HDOA 2JRLA 3I5XA 1M1UA 3K8QA 4B2IA 4LJRA 4MYDA 1L2TA 1P33A 2WWIA 4QJ5A 4D8VA 5AKXA 3S2EA 2Z2ZA 4AY3A 4JL6A 3MSCA 1YOVA 3AIOA 2YTZA 1H8HA 2AFIE 5L6LB 3EHDA 1U04A 4BCDA 1KARA 1GTVA 3QKSB 2P90A 3QOYA 5CYOA 3V1TC 1EINA 1E6LA 2QNIA 3DTVD 1O77A 3CNOA 2WYHA 3OOSA 4GQBA 3C85A 4OLFA 5P8WA 1B43A 3WYCA 1EB8A 5LDGA 3KVOA 5B1SA 3EC7A 2Y1CA 4URFA 4X9XA 3LF1A 4OHYA 4C6TA 4NSNA 5IUJC 4GMHA 1R4MB 4HZUB 4Z4FA 3C3KA 3HCBA 4M0PA 2BGTA 5AM1A 1HYBA 2GERA 1ST2A 2GN1A 5TF4A 5JZVA 2VH5R 4KQCA 1JT9A 2IYPA 1HQYE 1KPGA 3CLSC 3JVIA 1ZH8A 4K6OA 1GL7A 4XEUA 1Y8AA 5ALZA 2I3BA 1RT9A 1NP3A 1FYDA 1YRYE 1WM1A 1MF7A 2DJ5A 4G0XA 1SAYA 3EFOB 4DDWA 4HQ6A 1FL9A 1UJ2A 9GPBA 2FN9A 4RZHA 4M7WA 4AI6A 3FPJA 3TEFA 1NF9A 3E0QA 3EC1A 3PXEA 4C3VA 1S01A 4JKOA 2PSEA 4ESHA 2JGMA 3FPEA 1A5AB 2YVQA 4FYYA 2XRZA 4PLHA 2VK8A 3UKDA 1PT5A 1L8XA 2OXFA 5CM8B 2Z5GA 4QYMA 3ENZA 3ZEAA 4B3FX 3R7BA 1AGYA 5EJFA 4CG1A 1BVYF 2ZRQA 2ZSBA 3K9LA 1CJSA 1ORTA 4PSAA 4HH3C 3O8RA 3RRXA 5JOQA 3EVGA 3HDVA 1V0JA 2NZWA 1T6BY 2VP5A 4OF4A 2EARA 4GI3A 4MK4A 4G1MB 5CB0A 3ODPA 1XRNA 2ZZKA 1N6HA 4FFRA 4UD2A 4UMEA 2HRBA 2JFUA 1KY3A 3HO6A 2QNBA 3LRXA 4I1RA 1NULA 4R31A 1RAAA 1SHJA 1E7WA 4HV4A 1F3OA 2EJCA 3ESRA 3JPWA 2B3DA 3V34A 4AF8A 1KH3A 2B25A 5JS8A 2QENA 5EXXA 4MRVA 1ODJA 4WIAA 3MYRA 2BAGA 1NVWQ 3IPYA 1ND5A 5I3ZA 1KQGA 4PIVA 1UXIA 2BEKA 3HSYA 1Z0DA 3DUFB 4IJ5A 4A26A 1SB9A 1IXSB 4GVLA 3AKYA 1TCCA 4RS4A 4PV7A 3EWAA 3HL0A 3CR8A 1YRHA 3PRKE 3SR4A 3NUQA 3F9CA 3KOMA 5LLDA 4UUQA 1TA4A 1U1DA 2BEWB 1MORA 2JDID 2QZZA 3OF2A 4QATA 1IEVA 4RCVA 4JI5B 4JV5B 1WW3A 1E5XA 4I4NA 3RKUA 4PX2A 3GGDA 5KNCA 2DFDA 2XR1A 4UC0A 5A5FA 5BNTA 2XUQA 5HJ5A 3PXBA 4DR7B 4B6PA 4MR9A 1T3GA 1XLUA 2A88A 5CEFA 1XAGA 3T7RA 5T57A 2JJQA 3RSOA 1F2UA 3PPIA 3TLGB 1LSUA 4N6OA 2B7BA 3AUSA 2R8ZA 2PU5A 4B79A 3KLBA 3SD7A 4NDAA 1H0HA 1LJLA 2BHRA 5JS2A 4DZZA 5AMXA 4V1CA 2X77A 5ALRA 2OKCA 3T1NA 3DDUA 4DT1B 3S99A 4GLJA 5DCUA 5FLKA 4BUZA 5JNVA 3QF7A 2GXAA 1Q1NA 3IS3A 3ZWYA 2WJGA 2CBGA 3F7OA 5A3SA 2RH4A 4WK4B 4E22A 3SI7A 1T29A 2QYSA 5IVDA 4AMBA 4X61A 3ZDFA 4RKQA 1HH4A 2FSUA 1A27A 1F0YA 2R6AA 5EIOA 1CZNA 2JIZA 3QQPA 3LUPA 1SD5A 2QLJA 5KYWA 4KR3A 1ZRNA 3MPUA 4UFOA 4AKSA 2XGMA 4DSOA 1EDDA 5SYMA 4LZLA 3B38A 2LP4Y 1E79A 2FF7A 2QX8A 3IAS1 3KR0A 4HDNA 4TYMA 3WR5A 2ZYGA 3O38A 2EFJA 1DJOA 1JA1A 3OY2A 2YFHA 4FYKA 3QWBA 3IBFA 1EFRA 2JIMA 3Q5EA 2OCAA 2WBLC 4ISBA 3PNBA 1N0UA 3E9YA 4Q4LA 2M32A 1RYDA 3EMKA 1KVQA 1J07A 4JWTA 5ICMA 5B1DA 2NQTA 4I6GA 4A10A 3MBKA 3L5OA 3JX9A 1A72A 5GV7A 2I2DA 4L28A 1GGNA 1YZLA 2XBLA 2EDCA 2FH5B 3I52A 3O4IA 4JJAA 4Q37A 5AKZA 3FMOB 3ZDAA 2HA3A 1V2GA 3OZVA 3TO5A 2FUG1 3CUTA 1NNEA 3Q4GA 5KNCD 1FLVA 3G7NA 4OQ4A 3ZR4B 3HFRA 5ALDA 1FDRA 3O8BA 1GL3A 5BN4B 4G5HA 4JX8A 2X22A 3ZGLA 1QFMA 7MDHA 2BFDA 2Q2OA 3BWYA 4W5OA 2I2FA 3QUCA 4RMIA 4MPTA 2TYSB 3AWDA 1WP4A 1OMOA 4KYIB 2OHHA 1BH2A 1XTKA 3SHQA 2NSJA 2RG1A 4IIDA 1PLKA 3P20A 3TBHA 1QK4A 2AK3A 3BXOA 3GLFA 2O8CB 3G8YA 3ESDA 3TOZA 4KP7A 3ZS9A 2WT9A 4OD0A 2G83A 2QN7A 3FGZA 3CZRA 2O57A 5C32A 3SWWA 1HZZA 3MBIA 1SC6A 3KJIA 4KCGA 4DV4B 2YYYA 2PBZA 3HYTA 1L3IA 3JZAA 4KV7A 4M37A 1K66A 5TPWA 4RJTA 3WADA 1LNZA 3OD1A 2Y68A 4QA9A 2VDPB 1WU8A 3OO0A 2PJDA 1Y5LA 2IT1A 3D5EA 4FCTA 4U1RA 3KU4A 5G3ZA 2A14A 4HBGA 2A5LA 1CEEA 5AJHA 3THYA 2VLBA 2ZRGA 1L4YA 2VS1A 3DVQX 3GJXC 1EXMA 3NHUA 1TECE 2VTEA 4O4LA 3A28A 721PA 3Q1KA 3WG9A 3O74A 2BGIA 3HA2A 4F60A 3L40A 2XEXA 3D7MA 3PDIA 2GF2A 2QMOA 1O6FA 3Q3IA 3MW8A 3BD8A 4AG5A 2JAPA 3VKVA 2RJNA 3O4RA 1QIDA 5FBZA 1I5OA 1F3LA 3OZGA 1KJ9A 2VK4A 2ECFA 3F47A 1JMYA 4RD2A 4YLYA 1L7NA 2ODBA 4P80A 4RMNA 2TSYB 5CDGA 3N5CA 1XK6A 4PCVA 3HZOA 5HMMA 1PRYA 1JEJA 1PT9A 3NG1A 4FFBA 3BSYA 4I4TA 4JC4A 4MQ5A 1TK9A 3REOA 3DFZA 1WV1A 3NHRA 2V7GA 4TXNA 1C5KA 3RHSA 2AC4A 1QGOA 2WDPA 2VF2A 1F0PA 1E2IA 3M2PA 4I9HA 2O7QA 1FJGB 4RWZA 1THGA 2G5TA 1FTGA 1AS0A 2CGEA 1H6AA 2ZTVA 1ISFA 5I7OA 2QV0A 1HL7A 3CCBA 4AS1A 3G0CA 3HKDB 3K0FB 2Q3EA 2RC6A 4RGBA 3ZGYA 2BF7A 4U2GA 5AVOA 2J6BA 4LJSA 2G6BA 1GSIA 2UYOA 4NCKA 1YS1X 3QE3A 4RK0A 1FSZA 5HKLA 5BSMA 1QYIA 3CZQA 4HDRA 1AY0A 2C3OA 3Q87B 5A9SB 4C7OA 2Q5QA 3JQ9C 1XHFA 4OAOA 1ZG3A 2PVCA 4KX3A 1ZHHA 5KQPA 4BQPA 4R54A 5FB3A 3A7EA 5J5VA 3TZCA 1DARA 3ISTA 2ZJ0A 2NO4A 1KFEB 1X9GA 2PLWA 3RSFA 4TL7A 4BNHA 4D9HA 4HAXA 2R8OA 5I8ZA 3R7SA 3ZG6A 5BSHA 4MUHA 1BU8A 1AM4D 1RWKA 3JQBA 1YCDA 5AJYA 4U6SA 5ADUS 1BEEA 2HFJA 5K09A 2FTKE 4F93B 2V0GA 2VWGA 2XQVA 3RS5A 1GAEO 3EYWA 4P4UA 2FE4A 1U0EA 4KHZA 1QWSA 2F1OA 4BQEA 1NSTA 5G2OA 3HRKA 3QFHA 4UE2A 2JCVA 1CNEA 5AOBA 1IUKA 3R7NA 4ZVOA 1QTQA 4RVCA 1W85B 2R2AA 2V5AA 2WYOA 4HDCA 3VMFA 1UDWA 2BMWA 3GPLA 1JDPA 3PHCA 4G4JA 3TTTA 4A8JA 1Y6GA 4X93A 3GUCA 4N6GA 2J46A 2YR0A 4YGYA 2J9RA 3DQZA 1AA6A 3EEQA 4JL5A 2A2ZA 4JYBA 1RABA 3D4BA 1XQWA 4O5OA 1W94A 4XD2A 1Q0RA 4EY8A 1Z4JA 4KKVA 4HGOA 1XZLA 2QN3A 4CN9A 1V1JA 4EPTA 1P2UA 2QRUA 3KVYA 4TLMB 4ZT5A 4HVLA 4RTNA 3OJWA 4MITA 3LCVB 3QOWA 2W2KB 2NXCA 2PGJA 1SEVA 3PEFA 4R1UA 3HWSA 1L5MA 1KAQA 2WFAA 2WU8A 3LX6A 1EWQA 3EF0A 1LNSA 5K8JB 3AVVA 4N5DA 4WW0A 4A27A 3OZEA 1U2GC 3AVWA 4Q3KA 1TEHA 5LJLA 2B6HA 5KYGA 3KHSA 2ONJA 5IK2D 1NTRA 1JHAA 1JPJA 1OH6A 1DIOB 5CB8A 3ASUA 1FFSA 3BRQA 3DZBA 4H7KA 4X45A 5K8UA 5TMPA 4X41A 1HTWA 3AUAA 1BW9B 4UKDA 1OPXA 2WF7A 3DT8A 3V1MA 2YDYA 4E1BA 3J7AC 4AFNA 3SFVA 3L1HA 3I9OA 3ICPA 3R1IA 5EPEA 2JHCA 4PZYA 4QT0A 5CCDA 1J21A 4FWBA 2A1UB 3SNHA 4H7EA 4UM8B 4BYMA 4BASA 4EP1A 1V16A 1AHHA 1GGKA 1IBCA 1M1ZA 1DZ3A 1L5RA 1KPIA 1SU4A 2KI5A 3LQ2A 1U0OC 2MSCB 4R51A 4C7MA 1S3SA 1KFBB 4AU1A 3CB2A 4CMIB 4RUKA 4K8RB 3UUFA 2XXBA 3KRTA 2RHBA 5IH7A 1IH8A 4G4SP 1IM2A 3GA0A 4K40A 5JY6A 2WJPA 5JMTA 1ESEA 4N5IX 1JHXA 4JIGA 1OA1A 4O8CA 3UPDA 1ZJ4A 3F2IA 4I9NA 2BFEB 3JQ6A 3SIRA 4KWIA 2IZOA 4HS9A 5CX4A 1GT6A 4LHSA 1NV9A 4TYWA 5ICCA 4AZ0A 2Q5JA 3W9YA 3O8QB 2JK0A 5M3BA 3CWZA 1H9AA 2HXYA 2NYUA 2QQFA 4ZI2A 5JPCA 2YNMD 3HKEB 3HU3A 4XZ3A 4QOIA 3EXFB 5HRCA 3O03A 1REQB 3Q8KA 1ISIA 3JQEA 2EIHA 1EDOA 3EXHC 2XECA 3QV1A 1Y48E 3A70A 3ANSA 4JJZA 5DWVA 4BMXA 3LL4A 1KO8A 3UJ7A 4MP3A 4TSRA 2Q21A 1Y4SA 5B58C 4BVGA 4QASA 1POWA 5EZYF 1BC5A 4U7FA 5EE0A 1UFKA 2XRFA 2ZIXB 3I9NA 5KIAA 4TS1A 4D74A 2CYBA 1E99A 1A9YA 1QOZA 2H2HA 2HCFA 2XMQA 3CLTC 3MELA 3NS7A 3R76A 3QX8A 3GROA 3IQHX 3T4UA 5K3AA 4U63A 4XM1A 1J0BA 5LLTA 2RARA 1ODCA 2ZE5A 3HKBB 1JF8A 4YJGA 3WNBA 5I7SA 4QXQA 5KYUA 3GT3A 2G8NA 5TQ0B 4B6GA 2P79A 2B6NA 2F3PA 3JQAB 1TF2A 1FS5A 2CHGA 1ZIYA 2GNPA 1RJ9B 4HDQB 4YRKA 1G38A 3NDBB 4RHEA 5I4IA 1PR1A 2EWWA 2YWFA 4KDCA 5KAMA 4IRXA 2HT6A 2PJZA 1FU7A 4W9MC 2F8SA 5A0FA 3BK1A 5IT4A 1Z63A 1L5SA 3RSLA 2VPQA 2JRCA 4CHTA 1IWOA 3RB8A 3HSSA 4YAJA 5JZMA 3D1VA 4K9KA 5IYZA 4D45A 1JHQA 1GZDA 4NMHA 2YVAA 4KXYA 4CIBA 2QUBA 1CZRA 1CJCA 1Z36A 2F17A 3DVAA 3WYFA 4YIKA 5K3FA 1D2EA 4YUZA 5MDHA 1UBTS 1OIWA 4CU2A 5BSFA 3WHKA 4NVRA 4L07A 4D5EA 1VOTA 1KYTA 3BWXA 3OQJA 2Q4OA 3U3RA 2NSLA 3ND8A 3CE9A 4OBEA 1KETA 1P73A 4OUKX 5ALWA 4H0FA 3DDWA 4I8IA 3E5HA 4BKMA 3FOFC 1OXTA 3OO1A 1ABEA 1G4UR 3K6JA 3RYIB 1L4GA 3A3YA 1GYRA 1YASA 1HORA 2PWZA 2X8LA 5I4KA 4ABYA 1ODTC 3N75A 1EU1A 4PZUA 1IJBA 4OX9B 2IPNA 4OH7A 3OT1B 3EFHA 3GG9A 4BVLA 4BIMA 3ZHYA 2R87A 2QX9A 3K1TA 3ZUGA 1JDNA 2CNKA 2H7CA 2PXXA 1GDTA 3WMGA 2AVDA 1U0GA 3VKFA 1E3MA 3BHJA 2QEQA 3AM5A 4GFDA 2WUEA 2FSGA 3MN1A 1SVLA 2J7PA 1BKYA 1KP2A 2WKQA 3VKUA 1SOUA 4NJMB 2RGEA 4C87A 4N7RA 3HCRA 3H2BA 4R9SA 5E3IA 4A91A 1K7CA 5HZGA 1NUPA 2PQ6A 4X95A 3IRVA 1TIKA 4ZRNA 5E7QA 4MA4A 4AJPA 1IN8A 1UWVA 3A1FA 3GELA 3JAKB 2YS7A 1CFJA 4BNYA 4J9VA 4Q05A 1JT2A 4EB3A 2P2NA 4FI3C 1OY1A 3DTVB 3A37A 3W1WA 2YWDA 3X0DA 3KQUA 3WIOA 5LP6F 3RUCA 4KYVA 1B8VA 2BJVA 4QULA 4H17A 5G02A 3WLMA 3LA8A 1AHPA 3V8RA 4B73A 3OURA 2OV3A 3JQFC 1YCGA 4TTRA 5KDDA 5MFPA 1UJNA 2I2WA 1F9EA 1V5FA 4HB3A 3ZI0A 3RTBA 4CM3A 1CR6A 1F8XA 2QTTA 4WJKB 1DNPA 3AV3A 5DYTA 1HY3A 2C4TA 3ZI4A 3NDJA 4UPDA 3UICA 1WMSA 1I3CA 1GQ2A 1JQ5A 1TU4A 1FXSA 2C59A 1HGXA 3HB1A 3B52X 2G9QA 2VPIA 1SURA 1NTOA 2QA5A 2FUEA 1V7PC 1PR5A 4BWYA 5AJVB 2QORA 4X85A 3BSWA 1E6MA 3O3MB 2XV1A 5FBVB 1R27A 4ETNA 3E9NA 3GQVA 1EK5A 2PR2A 1U7TA 4R7GA 4OJKA 2CXUA 1JXOA 1K06A 3EMDA 3IKLA 3RFVA 1KKLA 1COWD 5C8YB 1VRVA 2PLRA 3K72B 4MRMA 4JBGA 4Q1FA 3HKBA 3L46A 1PFUA 1RCUA 4YJGB 1ZD4A 1BE1A 5BNWA 4MAAA 4ZAZA 2NXEA 3UHFA 3VR4H 3PD7A 4QU5A 2VTBB 4URWR 5LB2A 4G1BA 4FIDA 1E62A 1JYSA 1MIHA 3OMLA 1ILWA 1CNMA 1HL3A 2JASA 1U31A 3SIWA 3SLGA 3VYVA 2D1TA 3GLTA 3LY5A 3IHLA 4G85A 3DL2A 3LOPA 4IIXA 5ARDA 4IW3B 4EITA 5HF8A 3ETDA 2WSBA 1QPGA 4KWCA 3ROFA 2E82A 3BBLA 1Z4LA 4F6RB 1NE2A 4DDVA 1TGVA 2BM0A 4KXNA 2NUTB 1XEFA 1YVDA 2DLNA 4I0WB 1OFUA 3CF0A 4ZWNA 2XNDD 3G82C 3EGXB 4RLQA 4DPLA 2W90A 3NYQA 1GAWA 1SQGA 4P3NA 3R3WA 3R5KA 5K3FB 3TKYA 4C6TB 4EL0A 4NMMA 3FNQA 3I2GA 4MCAA 3UZUA 4NR0A 4UDNA 2BI4A 1V41E 2Y1KA 3INTA 3QA9A 1H2ZA 1ADYA 3KLPX 1N9GA 3P52A 1U8TA 2YN2A 2QRLA 1I1OA 1HG1A 2PA0A 2ZIAA 3HGQA 3EQ6A 3FBGA 2BFAA 5FWNA 2V9ZA 1KI9A 1NMXA 4YCBA 5TT0A 3QPAA 2GJ4A 3AESB 1M6NA 5TE9A 3VC3A 2OHVA 1YI0A 4V03A 3UK2A 3BOSA 3W9SA 4E4TA 5K0GA 4Y1FA 3EAGA 4NE7A 4JI8B 1W19A 2CNDA 2ZG6A 3R6WA 1NVVR 7REQB 1L7OA 2W42A 3EE6A 2ZETA 3DZIA 3K0AA 3UM9A 3CPJB 5BNFA 3V6LA 1DRWA 3TM5A 2ILVA 4YAGA 1OX4B 1TDJA 3A6FA 3LP5A 4EO4A 3ZYCA 4FMCF 1XLVA 3TLJA 1PX0A 4M54A 3MQFA 1L3BA 3I6QA 2JJ2A 1U5CA 1H8ED 1R8XA 4YRSA 3PQ8A 2R25B 4CIYA 4WESB 4C01A 1QONA 2XYGA 2LD4A 2OO5C 1E1NA 4BO8A 3CNBA 1Q0LA 5B3JC 3VH4A 1OX6A 4I3GA 4Z86A 3TFOA 5EZ6B 2HYIC 3ZDCA 5ETJA 3V4ZA 2F4VB 4X60A 3CVVA 3ENWA 1ENZA 4Q5IA 3TTWA 3FPKA 4BEBA 1RHJA 1W29A 4FS8A 3RRYA 1E2MA 4IHQA 3AIMA 3HLTA 3I1JA 1DIAA 1S2IA 3L7IA 3OIYA 4CM7A 3PTLA 1T5TA 2FZ5A 2I4MA 4Q00A 4W7SA 3U4DA 3N6RA 3EXIA 1Y34E 2AQKA 4MVJE 5K5EA 3PQEA 3I53A 3WA7A 3NNDA 1GAQA 4N0PA 3S2UA 4OYYA 1KERA 1M34E 1NLUA 1YBHA 1LWOA 2ZCVA 3OZWA 4QQNA 3ZE1B 3ZEIA 4ASUA 5I5EA 1PV1A 4LA4A 3DCIA 1JTVA 4GGOA 4EOGA 1VJRA 2ZRFA 2Z2KA 4A0FA 3F1KA 1FVFA 3HJRA 3LW7A 2H08A 3H7IA 3L8GA 3W2TA 4UU7A 1Z6PA 2YIDA 4UMDA 3VR6D 3CVYA 4BYGA 2FE1A 3IOYA 2HM7A 4FHCA 3L06A 2A9KA 2AG8A 1VMAA 4FZ5A 2FSSA 3L1JA 3R6TA 4WZAE 5D6OA 3TTYA 2DFVA 4RDXA 5K0JA 5JZBA 1U8YA 1YE3A 3W5UA 2V7TA 3P2EA 1YJXA 1NI4B 4I14A 1TJNA 3B9PA 1YE5A 3DHWC 4HH1A 3UKOA 2C9CA 4LQCA 4XX1A 1J4AA 4AS3A 1EFRD 3DF7A 2FOLA 3RJZA 1IVSA 1R0CA 3DP7A 1U2DC 3GEMA 3F74A 3M5WA 4LG1A 4LY6A 2XKAA 2FR8A 4C7JA 4D41A 5HJ7A 1IBMB 5FKJA 3C6XA 1O3YA 1OASA 2IWHA 2RBEA 4L5JA 2OENG 2J3IA 2VHXA 2XNHA 1V9CA 1VSUA 2HSGA 2RJOA 5DYGA 1XZ8A 2BE7A 3FX2A 5GGXA 1FFEA 2XYRA 4RNDB 3W78A 4EVRA 3E9MA 3BIJA 2IS6A 4PXYA 4IGFA 4QUGA 1IPEA 5K8LA 2PD3A 4YAIA 4MKRA 3CH7A 2O19A 1ZH2A 3EXEA 3RK1A 3TLMA 3F90A 4R4JA 4KIJA 121PA 3CVJA 5LD2C 3WV5A 2ADFA 3EGOA 1P17A 5NULA 3GZ4A 4D4JA 4DDTA 1FJXA 3I5YA 1JEYA 2ZBVA 1ZNYA 2M98A 3KD2A 4KGVA 3U4AA 1WW8A 1CXZA 1JKMA 1WPXA 1S2OA 4X91A 3TXAA 3RSSA 3WGNA 3ZW7A 2AMLA 3VO9A 1YRQA 3CLKA 1K9VF 1M7HA 1NR5A 3T99A 3ZLTA 2P4SA 5ECYA 1OLUB 3DE2X 3MOIA 4DDUA 2Q6OA 2VNKA 1OXUA 1PL6A 3WXMA 3E3NA 2JARA 3H2GA 2CDRA 1G16A 3ZXUB 2JLWA 1R10A 1OILA 2VQ3A 2VXYA 7REQA 2YN4A 3EMBA 1DJPA 1WUIS 5C80A 4NZZA 1LLDA 3R5TA 2FEAA 3VPAA 621PA 5J5CA 4OBWA 3QI7A 2I1QA 2NAPA 5JH7F 4W9NC 3MMZA 3GL9A 1EP3B 2NIPA 1HG0A 3UMRA 4HZIA 4MVJG 5AKEA 1FXUA 1ONNA 1L5YA 3KOZA 3O8LA 2OCKA 1GZ6A 3B82A 4KI7A 4LGCA 2E4WA 4NFSA 5CVDA 3WRXC 1ZOLA 1LLFA 2PX4A 3EA4A 1SVOA 3DMNA 4NBSA 4BLRA 5F98A 2CJWA 2WF8A 3NTVA 5ULLA 1KOFA 2C97A 2YXEA 1LPBB 4RYLA 3M0EA 4OB6A 1PFVA 5AP9A 3UK7A 1T15A 1WU7A 4JWKA 4X24A 3W9UA 1E9CA 4ZOAA 1OXMA 3WSVA 4O8ZA 3G13A 4DN6A 3G5AA 2Q4DA 3DAYA 2C8KA 5JATA 4CTNA 2QE6A 2G7ZA 1SIOA 3X1XA 1OBHA 4LDZA 5EP1A 4D9GA 2D00A 3QK7A 2NO7A 3CNQS 4PX9A 1KIMA 1OT3A 5DNAA 4Z4IA 4KXLA 5LWQA 1MHTA 1PWEA 1V1MA 1HUQA 3KEFA 1NYRA 4XXHA 4R3NA 2VK2A 4URHA 1U8EA 3SYMA 3ZWOA 4IX1A 1G6Q1 2C1EA 3D43A 4B8WA 2A1IA 3BBPA 3MPOA 1EKXA 1VFPA 3H2KA 2GYYA 2VH2A 4CM5A 3H3JA 3ACDA 2P2LA 2QTAA 1U2RA 3T0IA 4LEIA 2QUAA 3IP6A 2JJYA 5H83A 4RJJA 3CURA 3JWEA 2J9YB 1N2CB 1YZTA 4ZVSA 4INOA 2FAXA 1N2IA 1XDZA 1QZZA 2BKLA 2C2YA 1BFKA 1P1JA 5E1BA 3I04M 3K9QO 4YJFA 3T5DA 1I14A 1Z8HA 4DA0A 2COKA 5KB3A 5EKDA 3IDAA 2J0UA 3ZKAA 2YV2A 3B6MA 2I2AA 4MS4A 4IO1A 2ILTA 3E1KA 1WB4A 5KX5B 1ISSA 1XDWA 5BQXA 4DLVA 1GSOA 1GTG1 4MI9A 3KXPA 1FW8A 1FFHA 2XMZA 5E4JA 4B31A 1GD1O 4H7IA 4XPIB 1JA0A 4WCFC 4DV6B 1Y7PA 2R6GA 4RGYA 2ZIEA 1RXCA 2ID7A 4QUHA 4H7FA 1NXWA 4Q3AA 4CT0A 1JGTA 2OQVA 1I13A 1NBMA 2A3NA 3QV2A 4AMYA 4RDHA 3LL7A 1LLUA 2HBQA 4YBZA 2EHDA 2I2CA 3C3EA 3I04A 3E7WA 4YDRA 1Z0UA 3B1VA 2SCUA 4QJ4A 1LTQA 4XDGA 2G40A 5A7HA 2AD5A 2Z5LA 2OBBA 4OM8A 4PM4A 3X3HA 2P9BA 2A58A 2VPTA 2RHGB 1FF9A 4U7JA 2F9LA 3PUJA 1AKNA 3FGPA 3MCZA 5I5GA 4ICIA 4Y9DA 5I7RA 3FUXA 2H18A 3R3SA 3D7NA 2XI4A 3GU3A 3NAZA 4BC1A 4LF7B 3MTDA 4AAYA 1WQ1R 1NN0A 1YZQA 5FI0B 2HSJA 3IQWA 3LBHA 1ADGA 1BIFA 2ACKA 2Q2QA 4FOPA 4E07A 3C8HA 1OLUA 4OLHA 4ZI7A 1O58A 3RC7A 3C6BA 4EG8A 5TV2A 3EDCA 5AOVA 3THYB 1ULUA 5LQAA 4IIBA 1JTFA 5CEEA 4AJOA 1SBNE 3MMSA 4TXHA 3E0XA 2A7QA 5CH3A 3MUNA 1JVSA 2G5GX 2DMRA 1U8ZA 2Z2JA 4N3AA 3T95A 2I7VA 4LRUA 2D2VA 1RRFA 2P5SA 3IQDB 2C31A 1MO5A 2QLNA 4J0QA 2KLHA 2VTVA 2O2IA 1B7GO 1N1DA 2AC7A 3DDNA 4PRYA 4AJ4A 5K8TA 1XMVA 4Q02A 3TOSA 1TW3A 2R86A 3TZ6A 3DYVA 3U37A 1J7JA 5FUYA 2D5CA 3W3AD 1KA9H 2G17A 4K9NA 4QLAA 3C8DA 4YRQA 2NV6A 2ZJ6A 4PQYA 2Q41A 1BX1A 1JQ3A 1Y9AA 3D8BA 4Q1DA 2LDBA 5FQOA 1I3NA 2Q99A 2EX4A 3JQCA 4KH0A 4BNLA 3L7LA 3EWIA 3JQAD 2QTHA 3CV3A 1TM4E 4K9MA 1YACA 3RROA 4NIMA 1C9JA 2UVDA 3I01A 3OUZA 3I4LA 2NYVA 3CPHA 5FTKA 4HLCA 3ROPA 5JV5A 1TVCA 3FPAA 1LFAA 2QW0X 2W2LD 4H4EA 1MG0A 4EGFA 3HYNA 4ASUD 2YIMA 1XEXB 3RWBA 2NV0A 4GIBA 4BIIA 3L0SA 3P9SA 1OYVA 5IULC 3H4MA 1W73A 2OL4A 5F4ZA 3DDCA 2WIGA 4LJYA 3MCTA 3H5VA 4X3PA 4MULA 5FUBA 4F2GA 1S8FA 3H3FA 1O08A 3U9TA 1DO2A 1OC2A 1H3NA 2O2DA 3EVTA 2XVXA 4LBZA 4XLZA 2JH3A 4EI8A 3H11B 4RKEA 2QGNA 4PYNA 3VJMA 4DY6A 5DSXA 3ROMA 4TWRA 4C7XA 3H0CA 4C5CA 2FZCA 3RD5A 4XCXA 4TL6A 4GR5A 1ENYA 1KJNA 1O5OA 1JR6A 2JA1A 2WR8A 5IHXA 1IIRA 3CUWA 2EAUA 3BZWA 2FEKA 2IYOA 3I9JA 3KCNA 3MUEA 5I4BA 1KOGA 2C2HA 1ZN7A 3PS9A 3JZMA 1LI7A 3OIDA 1TL7C 2J9GA 4K6GA 2X86A 5K4GA 1LCIA 2H4JA 4B4DA 4Q19A 4EUFA 1JQAA 4F72A 1NQAO 4Y6GB 4R1QA 4XQCA 3OIVA 4RV5A 2NZ2A 3EYAA 3AI2A 4UM7A 4BS9A 4EUSA 4BEVA 1XDDA 3EEBA 1U0TA 3LC2O 4JY7A 1GUYA 1RCFA 3LHIA 2DETA 5IAKA 4JX9A 3NWBA 4DMMA 4Z54A 1SIUA 3CE6A 2OPHA 2QAGA 3IEUA 4Q9HA 3L8MA 1YHNA 3ZD8A 5L8VA 3OF3A 4BNMA 2PX2A 2CK3A 3K20A 1PWZA 2AUMA 4Y1EA 3EA5A 3ZW9A 3U7HB 3HADA 1PFWA 3AZPA 2IOFA 4JC8A 4B3RB 1LW6E 4WKNA 3TEJA 1PAUA 3QEKA 4X62B 4I08A 5AM5A 3G79A 4UE3S 2IIBA 2V7PA 4Y7CA 1E9RA 1U0RA 2G9UA 3E7DA 5F76A 4WY5A 3I6YA 1A8PA 1ZPDA 3VZQA 3Q88A 5F33A 2JDIA 2K5UA 3UCFA 2XUZA 5KSOA 4OFBA 1IXKA 2ZWVA 4NBWA 2BMFA 3IAHA 3ZE7A 3KKOA 1X7GA 2GSDA 1Q0ZA 4NG4A 2G9ZA 2CF6A 1KU6A 3H65A 2R2GA 2FRDC 3B7GA 3COPA 5GZ3A 2XF2A 3ON5A 4RFSB 4UUPA 3RYHA 5JI3E 1GPJA 3INRA 3LECA 1C2TA 1F14A 2C2KA 3RS7A 2Y2UA 5ECGC 2YZNA 2XMSA 4FPXA 2GUWA 1CY1A 2VHVA 3A27A 3M5CA 1ZUNA 4JLKA 5HR5A 5C9ZA 1CVLA 3BULA 4L8FA 5FJJA 1ZICA 2OWEA 2FSVC 4UUAA 5K99A 2WD7B 4KGXA 3T9BA 1N6IA 2I91A 4BNDB 4HEJA 5DBFA 4PVCA 4IIJF 3V3TA 4M1SA 2KQUA 4I4LA 2IXBA 1X3LA 3CKLA 3FGOA 2G9RA 3HCAA 1H1LA 3BA6A 4YJ2B 2GLUA 4GLOA 5LU9A 1JDBC 1KXJA 3MC1A 5GONB 5LQRA 4WE3A 3DMHA 4U02A 1QF7A 3OTHA 3WQHA 4RELA 3GAFA 3W2FA 3OC6A 2L42A 2NPFA 3H9JA 1KTIA 3FF1A 1NFFA 2Q6LA 1PK9A 5TQVA 3WV4A 1T9KA 4MUIA 1CERA 1WHSA 3HB9A 1ZR2A 2ACWA 5CK5A 1UJ6A 3GN2A 5DLQC 1P7WA 4AIRA 1NR1A 4FE4A 5CA0A 3B1XA 2PNFA 3L0YA 3UENA 5EWMA 3F6EX 4E11A 1YA6A 1Q1EA 4ZO9A 2QRPA 1CT9A 2W0MA 3EG9B 2JZCA 2NPIA 4QXOA 5C0OE 1XJWA 5H80A 4DIEA 5CW1A 5DM1A 1JJ7A 3HUDA 4ZKEA 5IZCC 2I4IA 1C7QA 2UZ1B 4EF4A 4YPFA 3KLOA 2EEZA 4UCWA 5ESXA 3ZGOA 6GPBA 2IX9A 4PCLA 5J4YA 1VBFA 1YV9A 2BR5A 2ICAA 4XDZA 2OUKA 3ZDDA 3AVUA 3KX2A 2ZZMA 2X5JO 5JADA 3VX4A 1F7VA 3S2GA 5AW4A 1XXLA 1G42A 4FVTA 3ABSB 4GBGA 1CUHA 4TX1A 1S4MA 3AQIA 4FS3A 2ZIFA 3JWJA 1K1EA 4Q4CA 5IN4A 2JLBA 4DYVA 3T5BA 5BW5A 2P3QA 2JIRA 2ECKA 3UTDA 4OH1A 1DKLA 5DNUA 2H00A 4PWZA 1CEXA 5A1JA 4DWJA 1EWYA 4RZ3A 2AZ4A 4UDOA 2XQKA 4YJ3A 3D5QA 2O8NA 2JL1A 2XE4A 4D92A 1SQ6A 2QVCA 2P69A 1HNNA 1PN3A 2YOHA 5LBTA 4BN4A 5LNK6 3TRFA 1EUCA 2WM8A 4BMVA 2FLKA 4L8WB 3HP1A 1BXRA 1C30A 1VXRA 4JA2A 4NCJA 2J09A 4FE7A 1CHNA 1QTRA 5IC4A 3GLGA 2G88A 4NXNB 4IFIA 2X9LA 1D5WA 1XTZA 3PE4A 4ILKA 1P6XA 3THRA 4F46A 1Y3IA 2DX7A 2JLYA 2EERA 3E48A 4J1TC 1MC1A 3O83A 4LHXA 3RFCA 4KDFA 2ZSHA 1QM5A 4IINA 5A9RA 1CCWA 2C5FA 4X1KB 1QRDA 4CM4A 4ZQEA 2KHZA 3MRXA 5B6JA 3QKRA 3CSSA 3BSSA 3AMVA 2HQOA 1WMAA 4PANA 4P7GA 1JTEA 2VAXA 3SYRA 5EZYA 5CFOA 1MKYA 4UDYX 1XCJA 1SM4A 3Q10A 5AM4A 3RYCA 1Y1PA 2O3TA 3AO0B 4R1NA 3ED5A 4O4HB 5ERXA 3RSGA 5FUMA 1C9KA 1Z88A 1JBQA 1OH5A 5HQ3B 3HY4A 3FPSA 2PS0A 3LUFA 5ALHA 3R20A 1XB2A 1B6GA 3B9QA 3EXAA 1RE0A 1GTZA 3R6GA 4GXNA 4J9UE 1NQ5A 3KYDA 4C2BA 1YDEA 3AFIA 4DCOA 1ZHFA 1EFUA 3GBVA 1CEQA 4MGYR 4RZXA 2M6SA 5LDDC 5A0TA 3JATA 4ZVNA 3Q11A 4LECA 1C4KA 1E3WB 1KQ3A 2VATA 1GR1A 2JIDA 2Y71A 3MT9A 3NB0A 1TYAE 4UASA 3T5TA 4D0NA 5J47A 3L1VA 3ZCQA 5KPDA 5E38A 1MPXA 1IVYA 2Z9DA 3B12A 4GMDA 1M6VB 4XRGA 1V3QE 1XALA 2JFFA 1Q91A 1KU0A 1YB6A 3KKPA 3PJEA 4LI0A 1XTTA 4X44A 5JHGB 1M6WA 1T35A 1XTSA 1FQKA 1E5QA 2AL7A 4FMDF 1U1CA 4FHDA 5EE5B 3PC8C 2BVNA 3BKXA 3RS2A 1E8MA 4P5DA 4ZREA 4Y6RA 4DC1A 1E3LA 3ICVA 3QP9A 1E89A 4MYSA 3W7AA 5AVSA 1WXWA 5FR1A 3E81A 1PWYE 3NWEA 3ZWQA 5JO0A 2DLCX 3ZZNA 3LA6A 3UOWA 1P6UA 2NYAA 1KY5A 3CJQA 1KFCB 3DHNA 2QROA 1PJ3A 4YHBA 4L8GA 1XHEA 1AN9A 1MX9A 4DLYA 1XE3A 4MCIA 2ZXEA 1W30A 4XX0B 3RIMA 3W5DA 1J5EB 3E5RA 2HHJA 2ODPA 3MTIA 1EP1B 3OT4A 3QPWA 4MRPA 1TMGE 2V97A 5DTMA 2EHJA 3VTZA 5A1TA 2A0WA 4OSPA 2DE0X 1PZNA 5HKKD 1U9ZA 3A6DA 2M1ZA 4TWIA 4WVLA 5HJ2A 4C4ZA 5K0FA 3E8SA 3H4IA 1KPHA 2ISSD 4FNAA 4O02B 4ZVMA 1F60A 1B74A 4BO1A 3BUSA 1EX1A 2HGSA 5ALJA 3OT5A 3AW9A 2P9HA 1A71A 3EPRA 4L16A 3CY6A 3MLEA 3N7UA 4JB3A 4YI5A 2OHIA 4CDNA 2P4QA 4CG2A 2RG7A 3FTEA 3JTEA 1PD0A 3JQFA 1YK1A 4PTYA 2HK6A 4G0VA 4C3UA 3M1LA 1SBIA 3KBBA 1YZUA 4PYLA 4RTSA 1V3VA 3SGLA 1C41A 5AM2A 1L8AA 1EFVA 1Z13A 3A4VA 4LXTA 1QBKC 1GKUB 4ND5A 4P33A 3FWKA 1P2DA 3BH7A 2O14A 3O4JA 1U28A 3K94A 4TTPA 5CJ2A 3DD1A 5ALEA 4IPTA 4L9AA 4B74A 2E5WA 3G85A 2BM1A 4D6YA 2CXPA 2YV3A 4DV3B 2BKVA 3G5LA 3LPMA 4EG5A 4UNPA 1OGYA 2N1MA 5KNDD 3L8ZA 2YZGA 3IE0A 1W59A 4J0CA 5HKAA 1K98A 4CFSA 1D4OA 1SC3A 3B7WA 1BHO1 2BFMA 2OSVA 3EQ8A 4FJ2A 2HDHA 2EU8A 1DEAA 4ESEA 3ICWA 3ELUA 5CFPA 2GA8A 4FYJA 4K9QA 3ACBA 3I83A 3OCJA 4OHXA 4ZT7A 4U0JA 1W4RA 2XZTA 4KVFA 2JHFA 3SEZA 2V5VA 1PEAA 3GFTA 4M9QA 1RD4A 2A92A 4CV3A 2NZVG 4F86A 2DRIA 3ZH9B 2BI7A 1VJ5A 4J3FA 3GAZA 1M8KA 5F1OA 4DWVA 1Q50A 1RZUA 1BS2A 4QWWA 2FWNA 4L76A 4MUGA 1FDUA 1JPVA 4KBGA 3IUBA 3KXDA 1R4AA 3OZXA 1SQSA 2ENWA 4E5PA 3MXTA 2YJNA 3ABOB 2HTFA 2EKZA 1WIWA 4QRIA 3CRNA 4L72A 1R6AA 1N32B 5CTAA 2WSSD 4ZEXA 2G8LA 1XQ6A 4UM5A 1BHQ1 5I9MA 2F3SA 5JSYA 1S8OA 3DC7A 2OBXA 3EOBI 1TJ5A 1TZBA 3U3ZA 4BE4A 1UP4A 1UCFA 3FCOA 1F7UA 3DA8A 3Q6IA 3GUHA 3BWVA 1T2CA 4IVPA 4E33A 3AEKA 2VJKA 3WHPA 4YMWA 4YPVA 1YH3A 2LPMA 3KNZA 1LPSA 2CW5A 4F11A 1SHTX 2N75A 3P32A 4WMLA 3W04A 3CF2A 1IAQA 2GKSA 1PG5A 2HN9A 3G9ZA 2NZJA 4UUMA 2OPBA 1TKCA 5E7JA 1TPYA 4M7PA 5DHFA 3HXMA 4TQUS 4DR6B 3QVOA 2WA2A 4HXEB 4DMFA 2V55B 4TWJA 5FTLA 2W6QA 1ZM2A 4ARZB 3H5WA 3RUPA 2ALJA 1E9BA 5IW8A 1G0NA 4TTSA 4G3XA 3WK4A 1L5NA 2RKBA 3DWIA 1Z4QA 2V0NA 3LGAA 5DTIA 3TW8B 1GRQA 3WMRA 3VVCA 4PS0A 4GMFA 4MRSA 4UEJA 4UZEA 3O90A 3RW9A 1WX1A 3N58A 3SC2A 5JQGB 2OSBA 2IHYA 2HPHA 3CG4A 3AINA 4OP2A 4YBRA 2GM9A 5AIBA 3GJ6A 2XCIA 5INTA 5JDCA 1QG6A 3QUAA 2EZ8A 1V11B 3AF3A 2Y67A 4DQDA 4X0EA 4ENRA 4Z1MD 4OQNA 1U8AA 5CGQB 4ALLA 1SH7A 1G5FA 1NUUA 1T3SA 3M2TA 3QXCA 2QUIA 3NIWA 1X7WA 2YRFA 3PUYA 4K7JA 2CXXA 3I2IA 5JXHA 2AFVA 1PGNA 1A5ZA 1L8LA 1ZNZA 1R9MA 2AMFA 3PQFA 2H2IA 3WB2A 3ZX4A 1BXGA 4XVHA 1FC0A 3X44A 1YA4A 1ZHOA 5KQGA 4FLEA 5DM4A 1XZEA 3GMDA 4GYWA 5FORA 4BATA 2R8XA 3W77A 1RTTA 3BGIA 3T7TA 3RSZA 3ZV3A 1Y5MA 5F2KA 3D6VA 3ZWWA 2CMKA 3K15A 4FGSA 2IOQA 2ZRMA 2GRUA 2RJ3A 2SKDA 4P81A 3UMFA 1IBKB 4PQEA 1GZ7A 2UZ0A 2ZYRA 4TM8A 3EXEB 1OAOA 2C8VA 1SR8A 5EEHA 2GNOA 4I1SA 3W8EA 3FDFA 2WTNA 1SU7A 1K2WA 1WCYA 1R4MA 4HZUA 4LRYA 4XGRA 3WLHA 5H4GA 1RPZA 1PGOA 3ZWKA 4TSFD 5YASA 5G40A 4OX9Y 1FYFA 5JISA 1T34A 2BKUA 3FDJA 3H04A 3AXTA 4B3CA 5HZHA 2IUSA 3BMCA 2P9ZA 1C1XA 2X1HA 4HXGA 3RC1A 4AIIA 1EUYA 4L3WA 4V0KA 2EV9A 1TAHA 1ECBA 1PBTA 2CF5A 3BD9A 3BWCA 4RLHA 3P5SA 3N39C 5ELXA 3BE6A 4AP5A 3IQZA 4EG0A 4Y9SA 5AI5A 4PGHA 1PR0A 3UAXA 5J4VA 2NMVA 3GJ0A 3ZCVA 2V58A 3EIUA 2GEDA 5AM3A 1XQ1A 1I4DD 2A0XA 1JZSA 1OBFO 5BV0A 1EZZA 4WZAA 1CSEE 1EVKA 3M3PA 5AW5A 1ML4A 1OFTA 2VCEA 2Y1XA 1NBME 1ZU4A 4H4DA 2YN0A 1CVRA 4F2WA 1JFSA 1T3TA 3UOGA 5AW8A 1KQPA 3EZ6A 4KUEA 2JFPA 1YJCA 3WWPA 2HBYA 1H85A 1XLTC 1JLSA 1K86A 2CNOA 1VKZA 3AR2A 4K88A 5KTMA 3W4IA 3OU7A 2CBZA 4NX2A 1FVXA 1Q84A 2RONA 1VE6A 1SXJA 5A6SB 4DCCA 1GFZA 2I65A 1GKKA 2Q1SA 5LOVA 1G8GA 3RAGA 4CMBA 4N8SA 4NY1A 4JLMA 1A9XB 2X42A 1AE1A 1FCJA 3D5TA 3GLHA 4P7FA 2GTIA 2NADA 1RVV1 4ZI7B 4B3GA 4XB2A 3R0IA 5FV7A 1V9LA 4EB6A 1W96A 2Q4RA 3AUTA 3AT1A 1CJTC 2GRAA 4XJVA 3WLRA 4Z49A 1WF6A 5KWJA 2WJAA 1ST3A 3NBZC 4HNGA 5HNKA 1JXMA 3K0HA 1L7QA 3CG0A 1AN0A 3EAQA 4D4GA 1B15A 1OXVA 1P5FA 4HWPA 4MWSA 4MVYA 4BNNA 2V3CC 3VI3B 2BEWA 2QYTA 3TZLA 2OTCA 5BPFA 3B5EA 1XPUA 1DFHA 3DFIA 3ZWXA 4Y1RA 2AN4A 2R00C 3N8NA 3TL3A 1TC1A 2XNKA 3WKEA 3BAFA 3FKSD 3BN3A 1P7ZA 2QRZA 2ZBGA 1GQOA 1K6XA 3IBSA 4GGPA 4EFLA 3S1AB 1H5UA 5H0IA 1SVWA 2O7RA 1SCDA 2G4VA 5T64A 4JJKA 1AHNA 1T3HA 3QG1A 3EA0A 4QBFA 2OP0A 2HLPA 4S2EA 2DKNA 3HYLA 1NVVQ 3Q2IA 1PR6A 4XARA 1DKUA 1XZDA 2ZE7A 2VJMB 4YQFA 4A2QA 2I6UA 3VR4A 4BDTA 1ZI6A 4B75A 4QG3A 5IT9A 4RIFA 4WBSA 4PFJA 3FCEA 1UBHS 2AFHA 4X8HA 1RXVA 2B35A 4WHMA 3C39A 3VHRA 1HQKA 2DWOA 2XUFA 4BFWA 5LMNB 4NDZA 4TTVA 4KL8S 1K6JA 1OKKA 2J4CA 4LDAA 5DK4A 1P5JA 4O4JB 3K9NA 5GM2A 2Z4TA 4XWTA 4CEHB 3HXKA 3P2JA 1VIVA 5BSUA 4YUYA 2C1ZA 2F3TA 5DXAA 1MB3A 2H7XA 1FVHA 5J1TB 1H2HA 2WNIA 3GCGA 1UF9A 3T38A 5IT5A 2BM8A 1FZQA 2N0SA 3NM5A 4KQXA 1GV1A 2Q7OE 4CQLB 4ENWA 2JK1A 2I3GA 2X0NA 3IXQA 4KMOA 2CYAA 2ZQ5A 1VG0B 3E4DA 1P2GA 1RM4A 3G2KA 3IP1A 2B4YA 4JITA 1VI5A 1Z16A 3SBEA 2HJSA 4ES6A 4L2IA 5E7MA 3SVZA 4Z0TA 1HE8B 2PANA 4JI2B 1VPTA 2ZSFA 3QVVA 4H0NA 4PF1A 4AICA 4JC5A 1QCZA 3P9QA 1JFFA 1X2BA 2WPNA 1GG2A 2XRMA 3KZKA 1MTZA 2GO7A 1RXYA 4HF7A 1CUWA 3PICA 4RVUA 2B7LA 4UOEA 5CEJA 2GZ3A 1U3VA 2I7CA 4DQXA 1MH9A 1W9HA 1NRJB 4MV8A 2XTMA 4FZ3A 3HFJA 1V7QA 4JLBA 1D07A 1ZNXA 5CBPA 4P0QB 2YZ7A 1E3IA 1B23P 2QAGB 2VBCA 1D2HA 2P65A 1VIDA 2ZYVX 3V7UA 3HKCA 2ANBA 1IIBA 4ENSA 5T4EA 2DHRA 1P9NA 3ICQB 2D4HA 2MR6A 2YZKA 3HVJA 3OJ0A 4Z0PA 4DCNA 3EPPA 1TT5B 2Y0PA 4JJFA 3OQVA 1Y33E 1FS6A 3Q2OA 3S44A 4GPEA 1LSSA 1NLZA