1X94A

Crystal structure of a hypothetical protein
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
191
structure length
176
Chain Sequence
MYQDLIRSELTEAADVLQKFLSDDHNIAQIEAAAKLIADSFKQGGKVLSCGNGGSHCDAMHFAEELTGRYRENRPGYPGIAIDYVFSRYVEAVGAKGDVLFGLSTSGNSGNILKAIEAAKAKGMKTIALTGKDGGKMAGLADVEIRVPHFGYADRIQEVHIKIIHIIIQLIEKEMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative Phosphoheptose isomerase
publication title Crystal structures of two putative phosphoheptose isomerases.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Isomerase
total genus 66
structure length 176
sequence length 191
chains with identical sequence B
ec nomenclature ec 5.3.1.28: D-sedoheptulose 7-phosphate isomerase.
pdb deposition date 2004-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13580 SIS_2 SIS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10490 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glucose-6-phosphate isomerase like protein; domain 1 1x94A00
1B0ZA 1XNQB 3EUAA 1M3SA 4LF6B 1MOSA 3HBAA 4LZJA 5IWAB 4AQYB 2POCA 4DR5B 2O2DA 4NXNB 1VIMA 4DV1B 2ZM6B 4B3TB 4X62B 4U6NA 1HM5A 1X94A 2ZJ3A 4OX9B 2A3NA 2F4VB 3J7AC 3QKIA 4JI7B 3BJZA 2CXTA 1U0EA 4GKJB 3SHOA 5LMUB 4JI3B 4DV6B 4DR6B 1XMQB 3G68A 2I2WA 2HHHB 3FXAA 4LFBB 2UXCB 1N32B 2DF8A 5LMNB 1I94B 1XNRB 3JAMA 1G98A 2UXDB 2CVPA 1NRIA 1ZZGA 2ZJ4A 3IFSA 4B3MB 2DECA 4JI0B 1JXAA 3TBFA 4DR1B 2VQFB 3ODPA 1X9IA 4LFAB 4DUYB 5BY2A 2CXSA 3J80A 3I0ZA 2CXOA 2XHZA 1HNXB 4DV4B 1HNWB 2O2CA 2X3YA 4DV5B 3CVJA 5BR8B 3NBUA 1J5EB 4JI8B 1JEOA 1C7QA 1DQRA 1N34B 3FKJA 4LF4B 1FJGB 4JI6B 2V4MA 4S12A 3OTOB 1U0FA 3UJHA 1IBLB 2PUVA 2PGIA 2YVAA 4JI5B 1HR0B 1GZDA 2Q8NA 4JI4B 5FLXA 4X66B 4LF9B 1KOJA 1IBKB 4GKKB 1IRIA 2UXBB 1HNZB 4K0KB 4TOIA 3M5PA 3TRJA 2WU8A 1MOQA 1XMOB 4DR7B 2UUBB 2I22A 3FJ1A 1VI6A 5I01A 5A2QA 3Q7IA 4IVNA 4AMVA 2PUTA 4DR4B 4B3RB 1N8TA 3BCHA 4DV3B 3FF1A 4DR2B 4YY3B 2UUAB 2J6HA 2E5LB 1MORA 4EM6A 1NUHA 4JI1B 3ETNA 4LF8B 2CXRA 3J81A 2AMLA 2CXQA 1N33B 3T1HB 5IT9A 1IATA 3LJKA 3T1YB 1XTBA 4NXMB 1J5XA 3KNZA 1JLHA 3Q88A 1TZBA 3JX9A 4DUZB 4LF5B 4M0DA 1U0GA 1VIVA 2CXUA 2VF5X 4LF7B 4X64B 1HOXA 2CB0A 3HJBA 4YHHB 2UUCB 2VQEB 2UU9B 4DR3B 4JYAB 4DV2B 1WIWA 1GZVA 2E5FA 4S1WA 4KHPB 4LFCB 1X9HA 4B3SB 1C7RA 1TZCA 4DV0B 2CXPA 5LL6P 1JIQA 2CXNA 1IBMB 1T10A 1N36B 4JV5B 2PUWA 4X65B 4DV7B 3OOJA 1X92A 3C3JA 1TK9A 4JI2B 2VF4X 1Q50A 1VI5A 3PR3A 2XBLA
chains in the Genus database with same CATH superfamily
5JQGF 5CCXA 3RVMA 1GAJA 1KGDA 5FHRA 3VO2A 5MN5A 2PMBA 4LE2A 3KWMA 3EC1A 5EQDA 3I2GA 5L40A 1CE8B 4FHFA 3MXTA 4OB8A 3TGLA 2WD7B 3I30X 4HQOA 1UQUA 1FFXB 2B69A 4IIJA 3QFSA 1XZPA 3IQDB 1M9NA 2HKIA 4TRRA 1JDUA 2LCFA 1RAFA 1RCUA 1V7ZA 3SR4A 3AUXA 3KDSE 4BTVA 4CF3A 1O87A 3IMEA 3IQGX 3NHYA 4TS9A 2NU8A 4EG3A 5AUNB 2BCEA 4W1RA 3IMGA 1CQWA 3V8PA 2DULA 1NUTA 2FI1A 2G17A 3SKVA 3QWHA 1BFDA 3W2EA 4EEKA 4JBNA 5AXBA 2FQQA 1B73A 4IO1A 2WIGA 1JTFA 8GPBA 3EJ6A 2R8OA 1YJBA 2EGHA 4NDZA 3DFZA 3NH9A 3SK0A 3FETA 5I7OA 3C6BA 4UTRA 3WZLA 3CVJA 2FPMA 3PQ8A 4DWWA 4JS0A 3B70A 3CISA 5KDOA 3KCNA 4NZYA 1U04A 2QUKA 3OEED 4HRXA 3AVUA 2H1VA 1IIBA 1NRXA 2P35A 3A4NA 2V7TA 5KYNA 4L8GA 2XXBA 1OPRA 1RWVA 2BFEB 1HT2E 4LXYA 4DLAA 4XVCA 5TMPA 1J9EA 4TKLA 4WJKB 5ALNA 4ZEOA 1HDXA 1ZM7A 1XL1A 2FK8A 1T9ZA 4IILA 4M36A 1I4DD 3TZEA 4Y1EA 1SUCA 3ILYA 1C3VA 1A72A 4G09A 5FFFA 3S27A 2V59A 3U40A 4AM8A 4EYKA 1YZYA 3W77A 1M2VB 3MBKA 4LAFA 3U80A 1OAKA 5LIRA 4RKEA 5L3ZA 4LJKA 5AI9A 3ZCUA 4DB2A 3BWYA 4OHMA 1MAWA 1PGPA 3AKEA 5AXAA 1Y8QA 3DFFA 4X95A 2DKFA 1MENA 3ZCVA 2AC4A 3AVQA 5JMWA 1GRVA 1TU4A 4ITVA 4B8YA 2JLRA 3K0AB 2YWCA 3FDIA 5EJ4A 3NNDA 4LYJA 5AESA 4TRMA 3F3YA 2FN8A 1JVNA 2HUPA 1Q7BA 3KBOA 4F45A 1TECE 4F91B 4WCDA 3W3AD 3ML1A 4CHGA 2HADA 2VI5A 4YLGA 5B3KA 2XNKA 4MIEA 1L4UA 3PJFA 1RT9A 3RAFC 3X1KA 1UBKS 1LTHR 2UUCB 1GV0A 4P9NA 4W7IA 1DV2A 1EWYA 4J0QA 1IQUA 2PVSA 1FTQA 4FX5A 1U2PA 3PHCA 3Q87B 1V1MA 3OHMA 2C4VA 2VAMA 5E2BA 5J2UB 3KWJA 4DL9A 1QRAA 4K2HA 2XUGA 3TE7A 1XA4A 2CDRA 5DI9A 5GP1A 4H1VA 1LWNA 2Q3HA 3SQNA 3UANA 4P32A 1U8FO 5L95A 1PSZA 4AS3A 4CQLB 1JQ3A 3IQZA 1O96B 3WLRA 5CPBA 3KYJB 3UYLA 4YPOA 1P60A 2X41A 2NZJA 4CNBA 1IC6A 4EQZA 2PSHA 3DSRA 3G2IA 1WKBA 5EHQA 3STTA 4ETMA 1P4RA 4RUKA 3BK1A 3H5OA 3AKYA 5CK5A 1V7PC 1TGVA 2RGYA 2BMWA 4MS4B 5CAEA 1ZK1A 5EUCA 4WNIA 3PNMA 3DXFA 3O84A 2W6NA 3PYLA 1L1FA 3M9XA 1NZJA 1R6TA 2E37A 1POWA 1TA4A 2EATA 3I1YA 3OKAA 4UULA 1KK0A 4WXPA 2EFDB 1W85A 3D2LA 5ESXA 1P81A 2DBQA 3VTFA 1GTSA 2FPWA 3QXXA 3VZRA 2ZE7A 3TAHA 2VHZA 3UHFA 4NZOA 2A59A 2W2KA 2JPDA 3CEMA 3MRSA 3FWHA 3RAGA 3TCNA 2DCMA 3UXMA 1L5VA 4O0LA 4HF7A 2Q3LA 5CBPA 1UMKA 3BFVA 1SHZA 1UXHA 3NJRA 4UOQA 1EGQA 5DTRA 5L45A 4DSOA 4KWCA 2JGDB 2ZBVA 3TI9A 1Q92A 1P0CA 5AOAA 3UT0A 2JFUA 2BRUC 5ICGA 3C8DA 3VPGA 2COKA 4DUYB 2VCEA 1LKZA 2R6FA 5CYGA 5CDFE 2Z2ZA 3KOZA 3HBNA 4KAJA 2BBOA 2QYSA 3CXRA 5LA6B 3AEKB 5J2TB 3NBUA 4FMDB 4RTRA 3U7QA 3HUFA 1Z7YA 4BB6A 5ARBA 2EJTA 4JEUA 5TEWA 3O47A 2VYVD 5B4TA 3AFMA 5I7FA 5FTMA 2DBRA 1HNNA 3IXQA 3T5DA 4MYRA 5JYEA 3FYTA 4BO0A 1Z82A 1EK5A 3QPDA 2APJA 2YIJA 3N7AA 2EBHX 2HCJB 4CM8B 3QVXA 2W6CX 2P7HA 2WFLA 2AFIB 4POAA 2IS4A 4FKZA 1AJEA 3PE3A 4R5HA 3D1JA 4BUCA 1B6GA 1GPDG 3GDGA 2NV0A 4W1SA 3ER9A 2ZYDA 1K88A 4AZ3A 1UBEA 2F8MA 4LBVA 4O4LF 4X54A 2KBFA 4ZALA 4DBVO 1GAXA 3P2JA 1QZTA 1X38A 4JENA 2MR6A 2WFAA 4RKFA 2VBCA 4QHTA 1QBGA 2LDXA 3PD7A 2DEUA 3RQSA 3LYAA 5FLYA 4CFYA 1T9CA 3PC2A 2XKAA 3QNMA 1PWHA 4HMQA 3WQBA 4CFSA 2IX3A 1H4SA 4CTNA 4P86A 3K9BA 3C7DB 3W7AA 4CDNA 2CLHB 5D3QA 3BXPA 3S1LA 2EDAA 4UAJA 1F2DA 1WDWB 2FDXA 4QIHA 4TL7A 5EWLB 3NHSA 2JG3A 3Q15C 3E6AA 4DT1B 1J09A 2IYLD 1XCLA 3AY3A 3JRNA 4MKZA 3VJKA 1FFEA 3JALA 2A0WA 3C7KA 3QM1A 1R4NB 3WTCA 2ZSHA 1PFUA 4FYHA 1Q16A 2LGJA 1RQ7A 2FUEA 1ZEJA 1I4EB 2CLFB 4N8EA 4I3FA 5REQB 4LTDA 4J1TA 4FBMA 4G8BA 4GOJA 3JWIA 5TPZD 1CUAA 4MVWA 3S5UA 4OHYA 2PMFA 1EFPA 5JD4A 2D1QA 2H1HA 5K03A 4FM9A 3DF9A 1QHHB 3ZE7A 1XQ6A 3NEPX 2GN6A 4NEQA 5J3JA 1DBVO 1VE1A 2YFYA 1G8JA 1CXZA 2ZT8A 4YQYA 1NVXQ 4HNUA 1GRNA 3DWIA 5EWMA 3L8HA 4QYSA 3Q8KA 4A23A 3NCTA 1P2GA 1D2RA 1Z68A 2OECA 4GI1A 1J21A 3IPRA 2ZI9A 2JLCA 3L0DA 4HK4A 4F9FA 5CTAA 4V0ME 4ZK2A 4UJ5A 2Z8ZA 2VDMB 3HMKA 3T3MB 3D6UA 1L5RA 2UV8A 3UJ3X 3VYTB 5CCEA 3P2IA 1MW9X 4D74A 4DDTA 5KYVA 4JJKA 1FS5A 3OJXA 4GZ6A 4X7MA 3JQGB 5JDIA 1T4BA 3U61B 3C6ZA 3O03A 4GC9A 3WLQA 1UADA 2LV8A 1L9XA 3UFBA 4DSTA 5BWNA 4OAQA 5THKA 5KOJB 1GLVA 1O97D 4RTPA 3C1UA 1XZNA 2HF8A 2HJHA 3G2LA 4ZYXA 3GVPA 3K0CA 1U81A 3HDJA 3OPYB 1IVYA 4FEEA 2PXCA 5FA5A 3IUBA 5AHXA 5K2MA 5JAZA 4Q1VA 5JU6A 1E6WA 2PIAA 3V4ZA 5FWYB 1IUOA 4HHEA 5BWBA 1G21B 2DETA 3ER8A 2BM1A 2GCOB 4WW0A 4R7GA 3JQ6A 2X5JO 1I2MA 1Z4JA 3GCZA 4LJRA 1T9AA 2B99A 1GD1O 1WNTA 4RFVA 3CTPA 4P8RA 2FDRA 4BKPA 4FFRA 1RYDA 1VG8A 5HR5A 3C4QA 4X7PA 4NFLA 4OGGA 4RQBA 4KAAA 4EFMA 1E6LA 3E48A 4L74A 3VPAA 4KH0A 2AEFA 3KQTA 4CIWA 1LRLA 4M7WA 2DSNA 2H29A 1Y8RB 3F3SA 2EU8A 3AL3A 3QFTA 4HPJB 2F3TA 1P1HA 2GTPA 2O0MA 1HDCA 2JFNA 3D0QA 3DCJA 4NBKA 1OBHA 5B3LA 3DYVA 5TXGA 5HRCA 2H1IA 1NHGA 3LL7A 3MNFA 4M55A 2VJPA 4N1AA 1VM6A 2Q6VA 5DP2A 2IDKA 4FZ5A 2C4KA 3RGWS 1YKFA 5AVQA 2DLCX 1E3DA 3GUYA 3K6JA 4QPJC 4WLUA 5LVAA 2R79A 3O74A 4B4OA 2RCNA 2OGSA 1P4HA 3AZOA 3QITA 2VTKA 4IUCS 2D0DA 4V1CB 1G9XA 3DWEX 4M98A 3R3JA 2X8AA 1E63A 1U8ZA 5IPFA 1JJAA 2RJNA 3KD2A 4V0MA 3VVLA 1RFGE 5K3DA 1UZMA 1E3IA 4BEBA 1YS6A 4YNBA 4FXPA 4E3WA 7REQA 4GPIB 4OIMA 2GLTA 3PPVA 1NBOA 3ADKA 3ACCA 4JCOA 5A9TA 3UNXA 4KBGA 1MH1A 2YOFA 3H9GA 3PR2B 2BUAA 5CVUA 1CHNA 1X7ZA 2W2MA 2Q5HA 2IPXA 3I04A 1DTWB 7MDHA 4AS2A 2A86A 3OIGA 4ZVQA 3EPKA 1C0KA 1CQIB 3WZMA 1ISPA 4JQYA 2HCBA 5FQNA 5JS2A 1L7XA 4F38A 1NG9A 1QLWA 1Y1RA 4WEQA 5A1JA 5BN5A 2QX7A 3AUUA 4Q3NA 1SCUA 4B4DA 3LPDA 4FC6A 5LKRA 3G0IA 2IBSA 5FB3A 3RYCB 5ADHA 1T0IA 1H8HA 1INLA 2OB1A 3DMDA 4QDOA 1IBSA 4MRSA 4FOTA 3GRZA 3H2BA 1F12A 3EZFA 4BHTA 2UYGA 4R0VA 4ER5A 4LY0A 1PZXA 4GQBA 2IP4A 3JQAA 4CMGA 5JXJA 4UUQA 3A2LA 5I8PA 1OYVA 3N2YA 2BEWA 5HFNA 3P9SA 1PQ4A 4DLVA 3W2GA 4OGWA 2J0EA 2O2JA 3EYWA 4G5YA 1MDBA 3DE4X 5JZOA 1EBUA 3CX7A 4UM5A 4XZ3A 3ZHOA 1QTIA 1VG9B 4JI3B 1U7PA 4TM7A 1VDMA 2Q62A 1H0RA 3COWA 4F9GA 3EOZA 3ORHA 421PA 2AX3A 1PG2A 1SXJC 2JGDA 4HAIA 4ARVA 3N8KA 1G8KA 1QGYA 4R69A 4DPMA 3Q40A 3RFTA 2A0KA 5A6SB 1F60A 5HQ3B 3HCNA 1Z8DA 4IYRA 4XVHA 1ELOA 1QDUA 1WTAA 4BLWA 3TVDA 4QTTB 2HZ7A 4B3MB 1BMTA 1PKEA 1SPXA 5CLHA 1XQWA 3MF4A 1ZEMA 4F9TA 1XHFA 5LBUA 1E1RD 3O9MA 4AWXA 4GICA 3NHBA 3D3KA 1E2JA 3E70C 3L8YA 1CUVA 1JF8A 2H54A 5LXTF 4NP6A 1XRSB 2QL5A 4G56A 4O4HB 2D7DA 1CJBA 1M5TA 3PA6A 4N41A 1T1IA 4LDNA 1JVSA 1P0FA 2C8JA 3OPYI 4IRMA 4CTKA 4HNVA 3GZ4A 3B6JA 5CVCA 1KQOA 1G2IA 2X5OA 2PH5A 4FE3A 1XXLA 5LIPA 1XTIA 4R8RA 1E5XA 1JTEA 1N0WA 3MWJA 4MCHA 4NLLA 3ZY5A 3UMBA 4QEZA 1SBIA 1VI6A 5LD2C 1KQ3A 4OHBA 3ICWA 3JS5A 2V9PA 1JS1X 3OOYA 1ILWA 1KMCA 1P1KA 4RHUA 3NP7A 2PX4A 3LBIA 2FOLA 1J70A 2IEIA 1RC0A 2ROQA 1ARZA 3N5CA 4KI7A 1HLPA 4PFQA 3TW8B 4B7UA 4QLBA 4Y9RA 2UYQA 4HD8A 3H19A 3ID6C 4QE3A 1A7AA 2FWIA 2CFCA 1IXZA 1UBRS 2A1IA 3PHJA 4RNCA 4WDQA 5JC1A 5GJBA 1A96A 5KYYA 4JEIA 2ZRNA 1KO8A 1J6UA 2H0AA 4NJMB 2FPKA 1R4NA 4XUEA 4OP2A 4AP6A 4L5AA 1S9DA 2VHJA 3CIOA 4QOJA 4L08A 2FEPA 1XLUA 3H9UA 5ER6A 3ETDA 1XC7A 4BO3A 5JMTA 4HLUC 1E1DA 4V1CI 3LGSA 4TTVA 5GJWC 3WMWA 5HF5A 2D7JA 4KN5A 4ZC1A 4IIXA 4QUKA 2AN3A 3HYRA 1YB7A 3DR5A 4KUEA 4GYYA 1CRZA 2EP5A 3VVCA 1G20B 1I2CA 3VJMA 3ZHRA 4IIBA 3DULA 1SZDA 3D1VA 1U4NA 3WS7A 3DEZA 2OO3A 4X3PA 1C2TA 2G9ZA 4O29A 4RJJA 5EP4A 2QD4A 4EL5A 4K1LA 4QO8A 1QIKA 1PU2A 3R3HA 4FI3C 4MEBA 2ZVQX 5E9JA 2YC4C 1H0SA 1JG1A 3QG1A 5FFNA 3V32A 3V48A 2WHPA 1NN5A 4TS1A 5KX5F 3FTNA 1NONA 1P2UA 1TM3E 2P62A 1T24A 1RYEA 2WM8A 3AGPA 3CO5A 4DMCA 5JRZA 3CMCO 3D2AA 4G1EB 1DZ3A 3EZLA 4WKGA 3SYKA 4FSHA 1NFQA 4GECA 5ICMA 1QRSA 3QGMA 5CLLA 5FKJA 4DG9A 2OCLA 2VYNA 1FRFS 4E32A 5BT8A 5ALEA 2Z6UA 2TRSB 3VC1A 4YRJA 3EZYA 1GA4A 3GEEA 1RM3A 2C5SA 5JBQA 3M8KA 4EBFA 3VKGA 1NDHA 4RIIA 1D9XA 1B6RA 3M5WA 5HFAA 1AKYA 1MHPA 2QL6A 2JA2A 2KE5A 1UOOA 721PA 5KSWB 4QZVA 3OTQA 1W25A 3JAMA 3NJ8A 4HQ6A 5IASA 1CDEA 5KOIA 1Y6JA 1VLLA 2EOAA 1HF3A 3EYAA 1K3TA 2K5UA 2Y4NA 4TQGA 1VP3A 3UG6A 5K2OA 2OGZA 3ZU4A 1M83A 2ZSKA 1JDVA 4KR9A 4DWVA 5FPYA 1DEAA 1FYEA 1TRHA 3QEMA 3EMVA 2V7XA 4NG5A 2QSYA 3H1BA 4NDAA 2V6BA 1VC2A 4NHOA 3VYSB 1A9OA 4EFLA 1R8QA 2L2QA 4GSYA 3LFTA 2HJSA 3TKYA 3WKDA 2CZCA 4DCMA 1MX5A 5IYZF 2NG1A 3FDZB 4LOLA 3G85A 3H4VA 3B60A 4TN5A 3TZKA 3PEEA 3T8YA 5E95A 2B0JA 1R4MB 2FKNA 1K06A 2XUOA 1XCGB 3VU3A 1WHSA 2FPUA 1K3FA 2QVLA 1L5YA 5K6AA 1XZEA 3VA7A 1W29A 1X42A 4IP0A 4ZJYA 1ZBQA 4RE6A 5DX1A 2E4WA 4NESA 1COWA 2FEWB 3WADA 1YOVB 3GAAA 3FYHA 3DUFB 3Q7RA 5EWJA 2OFXA 2Q8PA 4H0CA 1OX6A 1NASA 1PS0A 2B2CA 2D00A 4BP9A 1DCMA 2GYWA 3IP9A 3ZX4A 3A1NA 1FFWA 2A7XA 4RPIA 1IOZA 3ETNA 4IF4A 3I01M 4C4YA 2P5UA 1XPOA 2C9OA 2VVTA 3DZ8A 3KKMA 2EJVA 4F84A 1USVA 5BV1A 3CLUC 3T1HB 1OASA 3VTKA 4C76A 1JNXX 4K9QA 2QMOA 5M5BA 3F5QA 4MW9A 1KMQA 1TZBA 4WI1A 3FLBA 1LPAB 3BHIA 4U6SA 1ACMA 1SBYA 3GEDA 3DQZA 1XNGA 4WOJA 4M0DA 4Z2YA 1JG6A 2IHUA 1SXPA 4Q3BA 5HIMA 5ABPA 1J0BA 2NTJA 1BX0A 2C98A 2YDYA 2CT8A 4C21A 4WSOA 3SQXA 3VSEA 3PCTA 4Z54A 1CR2A 2O05A 3NHPA 2H57A 4DR3B 2O5VA 3KKEA 1Y34E 3GVHA 3KSUA 4NJOA 4ND1A 1IUPA 5IM5A 3WL5A 1XPUA 4MRMB 2DLDA 2GLUA 1KERA 1HDGO 1XA3A 2GBLC 2HLPA 2SKDA 3HEBA 2O3TA 4GM0A 4TT8A 3FTEA 5GM1A 1B2LA 1G7SA 1H0KA 2QPTA 3LZCA 4BO1A 1CVRA 1G60A 1N5LA 3AR7A 4XQCA 3WB9A 2VTDA 4BKQA 1YQUA 3IIMA 3WYBA 5ITWA 4MMYB 3L4JA 4OP3A 3ESAA 1QJCA 1M6EX 4KI0A 2Z2YA 3DBLA 4QUAA 4YO8A 3TX2A 3W4JA 4C0SA 3DBOB 4MV9A 4R1PA 3V1UA 1YRHA 2QSUA 3NTVA 3UWSA 2HU5A 3A9VA 4WV3A 1E9BA 2V1UA 1E7RA 1NQUA 1DP4A 1ZC3A 1J8QA 1N6RA 1QGOA 5AW6A 2YQ4A 3H6GA 1OWNA 3HN7A 4ZWNA 4UTVA 3LVBA 1VIDA 2F1OA 5H68A 4QXAA 5A5GA 2ZRHA 3RAEC 3L0OA 3L7KA 1TFRA 1CEEA 3AR8A 3JWJA 3QKWA 4L3OA 4YJGB 1QQ7A 1U9JA 2MIIA 5KC9A 1RWKA 3HZZA 4Y1GA 3RC9A 1NTRA 2OV3A 4JC4A 3X1MA 3OQOA 2PLAA 5A6SA 2IBMA 4DR6B 2W6QA 1U0NA 4PIPA 3WJ1A 3FM9A 4LSGA 4BO2A 2YOHA 3ITDA 4NK4A 2A92A 3I9NA 2X40A 4TLDA 1LW7A 2FSVC 3H04A 1J97A 1H94A 2D1TA 1NW6A 4JDPA 4QOGA 1QG0A 4QUGA 4BVAA 3P9IA 1FYVA 3QKTA 1A9SA 2R1UA 2YHAA 2Q2VA 2JHGA 2I9KA 3EEQA 3N8GA 1UC5B 5G1PA 1L4FA 1RWMA 1MQ8B 4JJGA 2B8JA 5EIBD 2MSCB 4JNKA 1UWLA 1LS6A 3FSGD 1O94D 3ZCSA 4U7DA 3HYNA 3PNPA 4FUTA 1GWNA 1W94A 1M0TA 2B2XA 4JBHA 2ZIFA 4UREA 5CH8A 5AIAA 5JZBA 5BRJA 1B3RA 1FLDA 2F00A 4D3FA 4XB1A 3AM1A 1JXQA 3AWDA 1RD4A 3HB7A 1JG7A 1KH1A 4WXYB 1P6UA 3FPJA 3GCWA 1C7EA 3H87A 3M82A 3DV0B 3GGSA 1L4MA 5E6UA 3HUUA 4M4SA 5ES3A 4COKA 2FPIB 2QNIA 1R3DA 3ZD6A 5LMCA 4LMPA 5EIAA 5DN9A 3QU5A 2JIZA 3ZLTA 2V5UA 4MRPA 1NBIA 4HAVA 3ZWKA 2AE1A 3ZE8A 2AEJA 4BO4A 4PQYA 1BEUB 3KETA 4DR2B 1XMJA 1XD8A 2QI9C 5AK6A 3EZGA 2KI5A 4ZJZA 1KFBB 2ISQA 4LJLA 2G36A 4LF8B 2KYRA 1QCZA 2WTNA 1W5FA 2NXWA 3OUTA 1BW9A 1EK1A 1GA1A 4FS3A 2OR3A 1Y4AE 1JWBB 1YJCA 3F6EX 2NUPB 4K9PA 4QULA 1NVVQ 5EA2A 1DO0A 2C9ZA 4I5GA 3CPHA 4TZKA 2EX4A 1JHRA 5AO9A 1NYTA 4B6JA 3A0RB 4Q66C 3ZTYA 2HCRA 2QROA 4F21A 2AI3A 2XQGA 3V34A 5JOQA 2R96A 1P3DA 3B5JA 2C4UA 3BIJA 4KVGA 4EJ6A 5JAHA 4NE2A 4MRNA 5ITVA 1L3CA 2X13A 5LOVA 4CL8A 4OSOA 4DLKA 5IZCC 4ZI7F 4N6OA 3EVBA 4NATA 3IVXA 2CHEA 2XTJA 4FU0A 5AVWA 2VHEA 2FNAA 3T41A 3JQFC 4K9RA 3JQBA 3OLYA 5ECGC 3V6LA 3RSFA 2KMLA 3AF2A 1H6AA 1MRSA 4QRDA 4C0AC 4OYRA 5I9LA 3BGSA 1FPMA 2B94A 4KWIA 4UU7A 1T9BA 5L7WA 2JLZA 4OB6A 5C31A 4PLHA 3IULA 3VR4A 4I4LA 3SR3A 1JR3E 4LNHA 1SHUX 4NULA 4Z7JA 2CVZA 1T2UA 4LF6B 1KJIA 3RW9A 1Z73A 4YJKA 3HCPA 1SWVA 5AJXA 2J87A 1SCDA 4RF4A 3EQ9A 5KOHB 4LC9A 4GF5A 2CEKA 3QWFA 1P7VA 4RXTA 4YJFB 4B3TB 2AHRA 1F20A 3OU2A 2WKRA 1TA9A 3FLEA 4QRHA 3LL4A 3ZWWA 2YVQA 3A4TA 5B57C 2YWDA 4M0MA 1HFJA 3AUKA 1SBQA 2VJNA 3PFKA 2FZVA 3AVPA 5BYBA 4ZZ3A 2OBLA 3OFKA 2FQWA 2D6FA 2FPPB 4BQQA 4M88A 5JXHA 3FVQA 1H4QA 1YHZA 3GH1A 2HDWA 1AB6A 1SKQA 2H6EA 3DC2A 4IFTA 2P7IA 3ZGYA 4KYIB 2I6QA 4OAOA 4R6XA 4HPWA 4WZAB 3UFXB 3WGJA 2DVMA 3VVMA 5IU6A 3P96A 2CV2A 1JHQA 3MVEA 4MP3A 2BZ0A 4FFPA 3TPFA 4XXHA 5HWSA 5KHOC 3C24A 3D8HA 3WSWA 4CM4A 2HO4A 1C7QA 1CF2O 1FQJA 3MRXA 1C30B 4OQLA 4UNQA 4JI6B 1GA6A 2VP6A 1XVVA 3QQPA 2RAUA 2C94A 1QRDA 1SEVA 2FKAA 4Q3CA 5DBGA 5DEIA 3CGGA 3KPUA 3OX1A 9GPBA 1PV1A 3R7NA 1HYGA 1LLQA 2JCYA 3A1TA 3NNNA 2E4AA 2QLNA 3L46A 1J07A 1CLEA 1L7EA 3FUCA 3G5TA 3KAPA 4B4WA 3DQPA 5ERGB 5LYYA 2QX4A 4LNUB 1J2JA 2QJWA 4C6TA 4YP7A 3MWEA 1IM8A 3IILA 1ZMOA 2JFPA 4GM1A 4WMLA 2ERXA 1LPPA 5GONA 4IH1A 4E6EA 4K3UA 4JP8A 1KYQA 4UCWA 2POQX 4I7EA 3KB1A 4JLUA 1CB0A 3OETA 4Z1MD 4E5VA 2VXYA 3KEGA 3BGDA 4YAEA 2WILA 5FT9A 3WYAA 4LBWA 4X97A 2SNIE 5JZMA 3O8QA 4LDAA 2GCEA 2ZYHA 2YV3A 1SXQA 3GMSA 3HXLA 2EZTA 1MX9A 4GXTA 5HPYB 2NZWA 3LX4A 1A2BA 4CG1A 1QH9A 4Y6PA 3NUQA 5C34B 4G4GA 4DS3A 2PNJA 1QFZA 1JU9A 4U5XA 2FW1A 5JNVA 1GT6A 2Q0HA 2PEYA 1R8JA 2Z43A 1DEXA 2CB0A 5IVKA 3K6KA 4JA0A 3AUTA 1HY3A 3I8OA 3P52A 1EXDA 5H83A 1G7CA 1RP1A 3ZWOA 2GA8A 4K0RA 4N0EA 1ADJA 2B25A 4KREA 2OAEA 1M0SA 5KSZA 3TG2A 1XVLA 4LG1A 4WA8A 1M1ZA 3N2NA 1IVSA 3LNTA 5CA1A 2GMWA 4DA4A 5KYUA 3P2OA 4R1MA 4ECAA 2D2FA 2V5AA 4HVCA 1AKWA 1OZHA 3QVUA 2F4NA 5AW9A 1IJKA 2DUWA 3MHTA 2FWJA 3VU0A 3BK7A 4F4FA 4CETA 2ZIGA 3RU9A 4HPXB 3SXUA 3WKBA 2XI4A 1QAOA 1GV1A 2Q5EA 2Q29A 4KQHA 4D5EA 1JEYA 1CWUA 3AO0B 4YJGA 1T9GR 2DB3A 4KIUA 2BBWA 3VPDA 2REXB 3DM9B 3H16A 1N3LA 3LOPA 1TQDA 1IOLA 2ACEA 1QRRA 4IFIA 2XUFA 1HKHA 2ZWVA 2GPAA 1Z6QA 1IFXA 1QX3A 3ONWA 4UXJA 2QHXA 4BRZA 4KVFA 3FYUC 2QAIA 3SHWA 1JGTA 1R88A 3B78A 3E9RA 3R2JA 4L8VA 4GZMA 3CLTD 4TLCA 5HOEA 3ZIUA 3Q0IA 5HRUA 1Q17A 2AI1A 3D4LA 3G89A 5KDDA 3TLZA 2VSXA 3I72A 1RMTA 3GLHE 2M6SA 5BN3A 3QELB 4BMXA 1GGVA 2PVPA 4EHHA 1P0QA 2DWOA 4RANA 2CXSA 5EJ8A 4LYGA 4DBZA 1ZH4A 2AJCA 4OHVA 2IU3A 3WBBA 2PL1A 4B5LA 3NBKA 3ASVA 1NVTA 4KN6A 1HT1E 2BKLA 3JYLA 2FGKA 2Q2NA 4R1UA 5LM3A 1J20A 4NU0A 1TGYA 4PHGA 4V0LA 2FRDA 3X2SA 3RIXA 4U7GA 3PGJA 2QTNA 3H7IA 3KG2A 4JZKA 4W82A 2VPXA 3UT5B 4C88A 1VGQA 2V4MA 4KPUA 4EVRA 1T3GA 4AMUA 4GLLA 1QQBA 4DYVA 1VXOA 4JUFA 2G4VA 1OI4A 2FPIA 3CCFA 3GV0A 4FYVA 2YZMA 3SBEA 2X0FA 2Y8EA 3H2YA 3ICPA 3R7DA 2B4QA 1GPUA 2EX1A 4GOOD 4I50A 3QBVA 5BMVB 4GP7A 4DR7B 1I2BA 3ZNNA 2ZI3A 2XCUA 1PR3A 3WYDA 3GAFA 2Q3DA 3UN1A 2CC2A 3GDHA 1BU8A 3R5FA 1N3IA 4Q3AA 1E79D 4ZQHA 5I3CA 1K8RA 3AMVA 2J85A 3IUQA 4L75A 1OYYA 4ZOLA 3SSNA 5I9IA 1AXEA 3HM9A 4MJXA 3DW3X 1SIOA 1A9PA 1K66A 1VA4A 1CJSA 3PA8A 4EM6A 5G0VA 5FUMA 2HSEA 1P7YA 2AG5A 2PR7A 5IJZA 4KB5A 3Q2KA 1IEVA 1ESDA 1P6XA 1ZI6A 2HRBA 2C88A 2WSBA 3OTHA 1E2IA 5MGBA 4UU8A 1UP6A 3DDWA 1A9YA 2IHBA 1WM1A 4RELA 4ZCLA 2IVZA 2UZ4A 3FFTA 1Z8NA 2Y1OA 3BE8A 1RKVA 2WWGA 2XMRA 2P75A 4XWOA 1RRGA 2PL9A 3VO9A 4UXIA 1PT7A 3C8UA 3UC9A 1M75A 2JGNA 3CLHA 3ESCA 3EVZA 4XVRA 4IUYA 4TMYA 4U2FA 4HNGA 2GHIA 3U5TA 4CM1A 3IEUA 2PO7A 1F14A 3FNEA 5IJ9B 2P9BA 3EXIA 1CYDA 1MDFA 4ME6A 2ILVA 1O95C 2XQFA 1QS0B 5K0TA 3BE4A 1WW8A 1WZIA 4G0NA 1GSAA 3TTWA 1Z2NX 4LKRA 3T9DA 1JBKA 2CXPA 4KQ2A 4OMCA 1DSSG 1VCIA 4LC1A 2QN7A 2BT4A 4L3WA 4RVGA 3U2QA 2P5TB 3JYHA 4NYMQ 3IJPA 1R10A 5JDCA 3NORA 3F67A 4LGMA 2WAAA 4LZPA 4H7FA 4BIMA 3Q0TA 4CUKA 3MS2A 4HNAA 4IDGA 3KT6A 4C4SA 3C5VA 3S29A 4BASA 3USCS 1U3UA 3DB2A 4HVAA 4OREX 2P0AA 5I9NA 1AKTA 2WQ6A 3ROPA 4I4CA 4G6ZA 2GZSA 3KTAA 1JEAA 1NBME 1S0UA 1T9HA 3F0TA 2Q9AA 1BA3A 4Y0VA 2P78A 2QYOA 3OOSA 2J3LA 4HDRA 3RYHA 4Z1OA 1TO1E 1P4GA 4DRXB 4QYIA 3ICVA 4V38A 2A7QA 3FTFA 3CH6A 1CZNA 3IA2A 4LHYA 6GPBA 3EMDA 2OY0A 2WWVD 3HY3A 3I6MA 3UFXA 3H1GA 3KKLA 1KIAA 3PENA 5ULLA 3STYA 3VZCA 3GFQA 1BGWA 2IDZA 3K8OE 3QF7A 1UBCA 4U8GA 3LCJA 2XITA 5CXSA 1IB0A 3Q9UA 5F51A 4B6RA 4EW2A 1WF6A 4ARZA 1D5WA 1YMUA 4WACA 3AEQA 3O8DA 5DDIP 3T7SA 4ADSG 5DN6D 2O1WA 1ORRA 1KZHA 1TJYA 2EFGA 3W6PA 4J0EA 4NF2A 1R27A 3KJZA 2FSHA 4EHAA 3RFXA 2P9GA 2QE7D 1ZC4A 1SU4A 3KL2A 1A5SB 2B4KA 3HB9A 4NBVA 3ENZA 3LQ1A 2F6RA 3NTLA 1XKQA 5EIWA 3RUHA 3T7IA 1EUYA 2C82A 2HV8A 2XYPA 3NWOA 1LW6E 3Q41A 4FIDA 4I19A 4PXYA 1N6HA 2FUCA 3FMPB 1Z5GA 2FSIA 1V96A 3EARA 2O2ZA 4N18A 4QPZA 3RU2A 3O8LA 4AB1A 1OV4A 3L8CA 1RZ3A 4LNUA 2ZYSA 2R00C 3PUZA 4G1FA 3HV0A 4CXMA 2PUBA 3GUUA 1NZFA 3K7EA 2B9EA 2W48A 2WYVA 5IBRA 2B5WA 2CCGA 2QTGA 1RZUA 5G4KA 4R3UC 3RG2A 2HWUA 4PTZA 4YMUA 4I1SA 5DTQA 5KTYA 4JJ4A 3UO8B 3MS7A 3TTVA 3BE5A 1A2QA 3H11A 1XZMA 3BWMA 1MGPA 1MZVA 3L06A 3AW9A 4NIMA 4E1AA 3Q3VA 2VDRB 3H5AA 1KNQA 1SC3A 2YV4A 1KDVA 5LQJA 2O5CA 2H2DA 4XGQA 1FP1D 1L5SA 2CL0X 3MUFA 3PU6A 2FR0A 3T35A 1KKMA 3GNTA 5CVDA 1WUTA 3HYSA 2C04A 3ZI0A 1E92A 1T5TA 4HT3B 2O2XA 4QICA 1DO2A 4ZFNA 1YHYA 3E2MA 3NATA 4JYPA 4NNOA 1BMFA 1JXMA 1V4VA 2ZK7A 1DPGA 2LD4A 1HT3A 4G8CA 4ACBA 4F7WA 4DXDA 4JN6B 3TLAA 5FR1A 4F6CA 4F8EA 1AOXA 2HK7A 1DJOA 3GVCA 1J23A 2H4YA 1DINA 1M2WA 4FE4A 4KWEA 4O0MA 4RZ3A 4YHHB 1BH2A 1KR2A 2VSNA 2OZEA 4PS1A 4BV3A 4WN9B 5AW1A 1OGIA 3HC7A 3VISA 1NGSA 3CVYA 4A7PA 5B7GA 5H80A 1Z06A 1QR6A 3C15C 3DGFC 4KAFA 2XOEA 3GC6A 5JROA 2H65A 4S04A 4FZJA 2IHZA 2X8WA 1VHQA 5KINB 1OU0A 1ZRMA 1L1QA 1HGXA 2BIFA 3ELBA 3L77A 3U1TA 3JRWA 5DM2A 4MKFA 2QG6A 4U2EA 1RWWA 3LE8A 1Q7CA 1Z6TA 3B3FA 1ZGBA 4ZT6A 4O5AA 2NQ2C 1I4WA 3AQIA 3WL7A 3WGYA 2ODNA 4AQYB 4OA5A 5D85A 4BO6A 1CY6A 1SOWA 2DWUA 3IJEB 3JPYA 3MSXA 1AU9A 1UWCA 4BEJA 7REQB 1SXJB 2A1TS 2FMKA 2JIMA 2QT0A 1U1IA 3AOEA 4MR8A 2RGEA 4PGAA 1DB3A 3QUCA 1PWXA 1T6XA 1W49A 1F06A 2WBLC 2RFLA 3KKZA 3OZDA 3WO1A 3X1YA 4BAUA 1ZGHA 2ZYAA 3OZUA 1EWQA 3ZDRA 4EWLA 4HQKA 2Q7OE 1AF4A 5EGSA 4WVFA 2BCJQ 5EZ5A 4MWZA 1VE3A 3H5NA 2QLLA 4INJA 1QHGA 2XECA 4C7KA 4DE5A 5CB6A 3BXHA 3C8MA 4WJLA 7GPBA 4YUVA 1XHLA 3QELA 4HB4A 3UEOA 3OZSA 3MLBA 4Q9JA 4MWGA 4QA9A 1EM8B 1E61A 1K9SA 2Z8YM 2R4UA 3EVTA 4TV9F 1JBEA 3PYMA 4RE5A 4LHXA 2ZDQA 3KYCA 2NT4A 4ZZIA 1ZK4A 1N7IA 2LDBA 4MPJA 3OOHA 4YI5A 4XIFA 3ZHVA 1WCYA 1Y9ZA 3KK0A 4TVSA 1YQWA 2AOTB 1HNWB 2QBYB 2BPOA 1DQZA 4M9ZA 3M49A 2RIPA 4ZT4A 3EULA 4GMGA 3BBLA 1OAOC 5HKKA 2C2YA 2JDID 2FZWA 1JDTA 4K6HA 5JVDB 5LD2B 1M6VB 2BMEA 1VG1A 5BN4B 3VR3D 3L8EA 1PLKA 1X1SA 5IVDA 1BVHA 4LEIA 4DIOA 1TM1E 2WYOA 1FRVA 3KXKA 2Q07A 5HE8A 3ZZTA 1WV1A 4N7JA 3GUZA 4DLRA 1GZ3A 2JLYA 2WWWA 3U7RA 2R8XA 4YV1A 2C2XA 1EZ1A 1UZNA 3PXBA 4MPTA 4J16C 5JMOA 1PD1A 4QTZA 3WNVA 4E12A 1U3CA 3VKHA 3IEVA 1W76A 2N42A 4Q9DA 2SICE 2FPLA 3H05A 3QE0A 3QKUA 4BC1A 3Q85A 3STWA 3SOPA 1WKVA 2UUAB 3G8YA 4RMJA 3T34A 2C2WA 2Z6QA 1GUZA 3KZMA 3OFVA 2ZCJA 3BIWA 1X1DA 4U9HS 2WKPA 5JALA 3QPAA 2D2VA 4LJ8A 3TD6A 5BSMA 5MGNA 1Y3BE 1ZH6A 4C4TA 4JYBA 4CQNA 4HSEA 3WGTA 4EA8A 5JAIA 2MSNA 4JVSB 2K7FA 1FS6A 4TV8F 4C7XA 3M33A 2HPZA 5K3FB 5LZ9A 3WLNA 4LF5B 3IE0A 2JGIA 3WNCA 1XJCA 2BP7A 3KQVA 5IH7A 4JP2A 2RGUA 4ZOAA 1IM5A 3R8XA 5IJ9A 1UEJA 3MCTA 1M1YB 2P4UA 3O2JA 1VLHA 3M6LA 5K0LA 3PXAA 2R5WA 2WMDA 3WB1A 3JQ8A 3EXFB 1U80A 1LC0A 3CRZA 4HBZA 4KLZA 4M49A 1ZMRA 4Q9IA 4BAGA 5CX1A 4DVGA 1NJ8A 1CUEA 1CNFA 1UMDB 2NGRA 4UHFA 4ZI5A 4LCEA 4BLSA 2JJ2A 4WX2B 4A5SA 2PRJA 1D2EA 4P93A 4D9JA 3K0SA 1SXHA 2X7XA 1J0EA 2UVPB 3DFUA 4Z0PA 4EF4A 1CW2B 1R6XA 1QIJA 1PEDA 5C4GB 1RS0A 4A2CA 3PFHA 4Q93A 2CYCA 1Q50A 5D2CA 2X42A 1GAQA 3N2GB 1XE3A 2ZYRA 1MB4A 4WZBB 1VSVA 5D00A 1YV9A 1PT9A 5IDYA 2FHSA 3AETA 3WIUA 1N5JA 2QXUA 2R8YA 3SE7A 4B48A 1WRBA 2Z5FA 2CWWA 2D3WA 1Q0LA 2VZLA 4PTLA 1ABEA 3R76A 4DF3A 5SY6A 4L50A 1ABFA 4BZXA 3CT4A 1T5DX 3OX2A 3KQNA 5DYIA 3ROQA 2TMYA 5JH7B 3ZNPA 4HDNB 1RVV1 3FBWA 4ECEA 2ZTMA 4JLWA 2GK4A 4BC0A 2OL4A 1B8VA 2Y99A 3NT4A 3FXAA 2VQSA 3OZIA 1WUKS 2I80A 3COZA 1V6CA 3GHYA 2Z4TA 3ZDQA 3DBHB 1NJSA 4X5OA 2YYSA 4AF8A 2IDMA 3NKLA 3ZK8A 4D2IA 3ROXA 1C7IA 1C29B 1PJ8A 1EA5A 3DVAB 3BSSA 2FN4A 3J80A 1S8OA 2WYWA 5G0TA 1CVLA 3CXUA 4XVUA 3N2ZB 1DDGA 1AS3A 1BNCA 3D7NA 2FN3A 2RDMA 2ATEA 1S1MA 1IQ0A 5KNCH 1ODJA 3A9UA 5CFZA 2GEJA 5TNXA 1WZEA 1V11B 1GEGA 3N58A 3HZOA 3DT8A 3DZCA 3N76A 5GM2A 2OA0A 3T38A 1SC9A 3T3IA 3ZBUA 5TQ0B 2I87A 3DLAA 3EEYA 2FR8C 3F5MA 1T0UA 4UTNA 3WL4A 2JFGA 4C06A 3BXOA 4MAAA 4DBLC 1OTXA 1YKSA 4ZHQA 2HX1A 3OQ6A 3IVGA 5FI5A 3AF4A 2FLKA 2W6JD 5ALRA 1ZVJA 2QAGB 3ANYB 3OEWA 3ZGZA 2C2OA 4CIBA 3G17A 4MGKR 5JNUA 4MI1A 5DYYA 1NF2A 4ER3A 3MT8A 4FINA 4LGYA 1CR6A 3M5CA 4ID3A 4RL6A 1AGXA 1QH0A 3D4BA 1XQYA 3LX5A 1FE8A 3P9XA 1T6NA 4ZI3A 5L4NA 5AHKA 3ET4A 3RREA 2B82A 3KKPA 4Q6BA 2AA3A 3T1YB 3HYTA 4JQSA 1F1JA 1RM4A 3I3SR 3CW2A 3HG7A 4FDVA 4ROSA 1R0YA 5DK4A 2W2NA 3T94A 1ZZEA 4G89A 3THWB 4RD0A 3ETEA 4N03A 3SVZA 4RCYA 1R3UA 4BNVA 1XNJA 4HJRA 2XCOA 1YBHA 1XRJA 2AN4A 3LW8A 3NC1C 1JPNA 2AXQA 2WPDA 3AUSA 1QBKC 1J8DA 5FNVB 5LP6C 4XPIA 2CNNA 2AV6A 2VOEA 1W0KA 4XX1A 4DLWA 5CVJA 3SHQA 4F96A 1WD7A 1R5OA 5IHPA 2P65A 1M2NA 1FOEB 2B61A 2JD2A 4UUOA 3Q1LA 1KDYA 2HBYA 3L7JA 4MYTA 4PIMA 13PKA 2AFHE 3BCUA 2WWTA 2RONA 1J99A 1U7OA 3GRRA 4D0GA 4FB5A 1C3LA 2YN0A 1QU3A 4LYYA 4C07A 1QO7A 1ZLYA 4ICIA 2WMYA 3OZTA 4CM9D 3NOXA 4QWWA 1MVNA 3GRCA 2C2MA 1M7HA 2DFLA 3QBTA 3EUAA 1RYHA 1PV2A 1NNLA 4QARA 3A6LA 1R15A 2FV8A 4BX0A 4DQUA 2J9GA 3L1KA 1GGHA 2CKDA 4D4GA 2C1EA 2PT6A 4C0LA 3UJDA 3M1AA 1FLNA 1O9BA 4WLVA 2RHCA 4EDFA 4NZNA 4YYEA 5L3RA 1W1WA 2G0NA 2YWXA 2W4IA 3EVAA 3OOEA 2OCAA 5C1OA 3W5AA 2CNWD 2Q5QA 4UXHA 1OZGA 2DWCA 4WLNA 1NQWA 1RQRA 1TUIA 2XVZA 2HHHB 1SCAA 2XDAA 3A04A 1XJ5A 3CF4A 2CHVA 4Y2XA 5ALZA 3LDGA 3V2IA 4A1FA 3OQIA 4AF6A 1I30A 4FHGA 4PQFA 1ZZGA 3ETGA 3V4VB 2DBVO 1ZAYA 5HJ5A 1QF7A 1GQFA 1QONA 2WF8A 3O7WA 5BW4A 4RTLA 4P3NA 3I2YX 4EPYA 4EJ2A 3K31A 4I55A 5BY2A 4WXRA 1T1SA 1A4UA 1ZIPA 2BMVA 4YWHA 3LLUA 3EDQA 3WNZA 4F4JA 5IAJA 4G5GA 3WKAA 4UAVA 1U6JA 1H42A 2P9FA 4G0MA 4DA8A 1OZAA 3FZNA 3A9CA 3C7AA 3TINA 3S8MA 4BECA 5ITZB 2E49A 1X6VA 3VPSA 5HM6A 1D09A 3QMMA 2RG1A 3GB9A 3QOXA 5GGXA 3WY9A 1VPTA 1XDGA 1HR0B 2Q1TA 1VDZA 2H7YA 1UINA 1CR0A 3ZZUA 3FR7A 3P4UA 4QYTA 3JYOA 2CE7A 4ED9A 3VYRB 4JYZA 2AFHA 2NV6A 3DM5A 1WF3A 1JFTA 3O83A 1G8PA 1UKYA 5EMKA 3GW8A 4R2MA 5FEMA 3VDQA 1PUXA 1Q19A 4AX4A 3PDUA 3IQIX 1TZKA 1V8FA 4YCAA 3GGCA 2PJZA 3BF7A 1JFFB 2ZJ6A 4G0YA 4PWYA 3JQEA 4YC7A 3CVXA 3ICOA 4LK3A 5B12A 2O3UA 1Y1QA 4UOEA 1ZISA 5K3FA 3F4KA 2YWRA 4JXJA 3W5UA 3BIFA 1KO1A 1TMYA 3B3JA 4B34A 1HRDA 5HNKA 1N0IA 2RB4A 3C5WP 4EZEA 4PZDA 1M1YA 1V41E 4CE6A 3ODGA 5IAEA 1CZOA 4YRCA 3C3YA 4IJUA 3ZXYA 2BTOA 3B3QA 1N2XA 1XIVA 2ASVA 2Y1LA 3IAS6 4N0QA 4QBTA 4TUYA 1FTNA 1DIGA 1CZLA 4O33A 4O1HA 3STHA 3A0UA 3VC2A 3RSZA 5LDDC 3T0GA 1N77A 3H8VA 2YMQA 1O0SA 5IM4A 4PFSA 2N0SA 2Z9BA 1PP4A 1VKZA 2YUIA 1BXGB 1T4GA 2JGAA 3DWGA 3NX4A 5EE0A 3QPWA 1L7MA 3FUXA 4ESEA 2ZUUA 1REQB 1A5TA 3O8NA 1NNSA 4YH1A 4KDFA 2ZSAA 1WZ2A 4D4MA 2XA1A 1BD4A 4G3XA 5C1IA 2X8BA 1ZGJA 1AZSC 3BTUA 3DJYA 2I1QA 2TSYB 3ESXA 4HWKA 4ML3A 4MMXB 4OV6B 3MIIA 5EESA 4W6QA 3VTZA 2IEYA 1V5IA 4B6FA 1W2GA 3TUZC 2SECE 5IWAB 3CNLA 1UJ6A 3CPEA 3L04A 4HEA6 4QLOA 1DAEA 1WDTA 4RSRA 5FOSA 3RSCA 2AYXA 1BEZA 3IIIA 1NF3A 5IG2A 4X62B 4RSGA 5A0FA 2RARA 1M6YA 3PLAE 2PX6A 1HRKA 1TKCA 4BP3A 5ALSA 1U65A 3K8QA 5I5EA 1NVUQ 3QE3A 2OAQ1 2I62A 1SOMA 5T4HA 4ATNA 4EDHA 2QP9X 1AC5A 3SC6A 1DC4A 1P4SA 3M6WA 1RXSA 5I4IA 4ZTUB 4F2GA 1RWXA 1BD3A 2R6DA 1R8SA 3G9QA 4J76A 1IZ7A 4RK7A 3WC4A 3GEBA 4YONB 1AQJA 4BYGA 1JAZA 3DVAA 3HJNA 4M22A 2E4UA 2GK7A 2GZ2A 1IN7A 3FPKA 3DMGA 3GUHA 3KUUA 4YO7A 2BFBB 4IDPA 4N47A 5AVSA 4OD0A 3B6IA 4NV1A 4Q00A 2CE2X 1NX6A 3UATA 3PT9A 3PUYA 2QTBA 5D01A 3W8FA 1LSSA 1EEXB 3ZQUA 3GA5A 3QVOA 5M3BA 1F7VA 1TC1A 4EG0A 2Q6KA 3BH0A 2GBPA 5IC6A 5T5QA 3WO0A 5C1DA 4XQ9A 1QIEA 1Y1TA 3QKRB 4EOGA 3B6ZA 4BQFA 6Q21A 2DLNA 2HU8A 1R0RE 3DKVA 3L0ZA 3MMXA 3BJMA 3Q3JB 3RHSA 3T6KA 2QRMA 4G1BA 1Z4MA 2ZB8A 1P5RA 4KODA 3ZY4A 5BXYA 4NU6A 4RPCA 1KEEA 2CDCA 2EFHB 2WIJA 4MWTA 4YQEA 4DIDA 2VLIA 1U9YA 5FLXA 2VZ9A 1B8NA 3QLUA 3HFGA 2XTNA 3PVZA 5EY5B 2QAGA 3E05A 1CRLA 4K0KB 3NIDB 2QQEA 3OLQA 1RAGA 3BD9A 4PR3A 1SXJD 4YMIA 1L7PA 5FIUA 4L0DA 4Z8YA 5JSYA 1IY2A 2VK8A 4IVNA 1S8AA 1OBVA 3E23A 3V4OA 4LPKA 3ZG6A 1G55A 2ZIXB 2G1PA 4HUTA 2CMGA 2C3OA 4G4JA 2QL7A 2PJRA 1K6IA 1UBSB 2OVFA 1LNQA 3KJIA 2BFMA 4Q3LA 2DKNA 2OESA 3E3MA 4JLOA 4GOXA 4C7MA 3CX8A 4N0PA 5NLLA 1P39A 1ZSNA 1R6DA 1PJCA 2OUKA 2WT8A 3R3SA 4UDOA 5FNVA 4ZVMA 2TS1A 3AV0B 2JGRA 2BSAA 1U8YA 2MINB 1E0KA 1U11A 3RUEA 2CXUA 3DHYA 3KJNA 3QP9A 3LHDA 1M2FA 3E9DA 4CI9A 5BWLA 1XPRA 4LRTB 5TJHA 1UP4A 4RK1A 3WK7A 1O54A 2OQRA 4DLUA 4U39A 3W5IA 3QPCA 1U2ZA 3R24A 4R54A 3UBMA 4B8WA 5JWRA 1KKUA 2RBEA 3NTQA 2QVXX 2FW8A 2GXQA 4HN9A 1IQRA 3BWEA 3ACBA 3CUUA 3LRXA 5ENDA 2AJBA 1AMNA 1RLJA 2BFNA 2JAOA 5DCWA 3PC4A 1UPXA 5IK2A 2IHNA 1Y3DE 3OSZA 4CR8A 3HVRA 2QLMA 3FYCA 1KDZA 2QUZA 1EGVB 1CYEA 2W5UA 1S2IA 2I29A 1NULA 3AY6A 1VYHA 4YJ2F 1UOQA 1TCVA 2YIVX 3ZD8A 1HA3A 2PUWA 3NRJA 1DMSA 2GVNA 3TSAA 2ZG6A 3O95A 5G0WA 4XR9A 3UGQA 5EEHA 2QTMA 3D8BA 1QMGA 2CLIB 5DTMA 1HE3A 5FBQB 1I4LD 4HYQA 1UBNA 4R9VA 4LN1A 4XGKA 5IN4A 4L07A 1MF7A 1Y1LA 2V8OA 4FFVA 4G01B 1GDTA 4OYLA 3SM9A 5D8DA 3RADC 1II9A 1FPQA 3FYUB 2OPHA 1UJBA 2A1UA 2N3ZA 1KRXA 4NR0A 3LM8A 1XALA 2C2KA 2DOKA 2CLKB 3DOEA 4GPAA 1SQGA 2WYUA 4WBNA 4LOHA 2O19A 2V74B 4ZDWA 3VPFA 4BO7A 4J03A 1KF0A 1MLDA 2E5WA 2REOA 1RPAA 4MUHA 2ZJ2A 5HK8A 4BP1A 5BSHA 2CV0A 1ORTA 1YK0A 4RM3A 2XE8A 3KP1A 2BMDA 4ENPA 2VQ3A 2CLOB 2YOGA 3RV4A 3DG9A 3FRIA 1ULZA 3SU8A 4C1BA 1PZMA 1QOQB 2WJWA 3PGA1 4WOPA 3PC3A 5B3JA 3SFZA 4CCWA 3RRZA 3KV3O 1JHPA 4MV5A 1NYQA 2OHXA 3H2ZA 1PZEA 2ZUFA 3CR8A 3Q8XB 4AJJA 4YJDA 2XODA 3FY4A 3HCDA 3PHHA 4AZVA 3MWGA 4HRYA 3GHHA 5DLPA 4R31A 2JK1A 3ZC3A 2ZZMA 2VF8A 4EY3A 2CHFA 1GLNA 4WESA 5G02A 1MOZA 1ZD1A 2XT6A 3LO8A 3O4VA 1EXVA 4NC9A 4RETA 1TJPB 4QPCA 2BF4A 5LZ7A 5L4SA 2XRZA 2PGXA 1CUJA 3IMFA 2VKQA 4MMZB 5CCDA 5C81A 4BNIA 3V00A 2KS6A 1DX9A 4KR3A 4MV7A 5EQJB 1U8UA 3L7AA 3NAMA 3STUA 4DNFA 4E5PA 1PL0A 4X66B 1B00A 2XGMA 4E1BA 2DBZA 2ZSBA 4RVUA 5CFRA 1FYXA 1XZHA 2I2CA 3U4CA 1RXVA 2YZKA 3UVEA 1F2UB 3TRJA 2PA3A 2R86A 1GN8A 3QFFA 3TB6A 3EH2A 4W5QA 2UZ1A 2Q2WA 5A9SB 3JYPA 2ADFA 1X13A 2BFCA 3EC2A 3Q7QA 1J39A 3T5TA 4KAXA 5ALQA 2J0SA 3THRA 1BTOA 2WTUA 3NONA 2VSOA 2ZTVA 3LW7A 1MRZA 1VLZA 3HQ4O 4U1RA 2WWFA 1ICEA 3DHVA 4FFBA 4UHJA 2E5LB 4BU0A 3H2IA 2KPOA 1X2EA 3MQ2A 3QZUA 5JQGA 4BMCA 2J5BA 5E0OA 2GZAA 2RHDA 3PC7A 1I33A 3KXLA 3V1TC 3L2OB 1RXCA 3MTDA 4KO2S 2I91A 1QIFA 2GI4A 2ZIEA 4Z53A 3W6UA 5LP1A 4KTTE 3GJ8A 1GU0A 1DXHA 1OUMA 4W5WA 2P79A 3EY9A 1W73A 2TMGA 1ZDMA 1F9EA 1JDBB 2EWVA 3OG9A 4KMRA 4IR7A 3HYLA 4ZU3A 3HHEA 3FWNA 3V4SA 4H27A 2IHYA 2R62A 3L7OA 2O54A 5E3HA 4F86A 5ADWA 1U2RA 3UENA 1NF9A 1CULC 1VOTA 2Q6IA 5TSDA 4H35A 4OJTA 1XVAA 5EUQB 3VZDA 1XEXA 3ZOKA 1BXGA 4ZAFA 1L8QA 3I9V1 1U7ZA 2Y2UA 3BRQA 5EVCA 3PNLA 3PNQA 3ZDXB 1AGYA 2FCRA 2VYCA 4TMVA 1PBTA 4B17A 1RC1A 2ZUSA 4S3MA 2O7QA 1NXOA 1W48A 4YVFA 5LL6P 2CXNA 2E48A 3DEYX 4YA6A 2E1PA 2J3MA 1I5RA 2AKYA 3GPCA 3OPQA 4C4ZA 1TM7E 4CLEA 1TUBB 3O8BA 4AUMA 2J30A 4MIYA 7AT1A 4YUWA 5DNAA 4S1VA 3DPSA 2IPNA 3PR3A 2I65A 2XWJI 4GMFA 1ADGA 4Z4GA 1NW5A 3COVA 1XZGA 3V1MA 1B4DA 2ZRLA 2RG7A 2F9FA 1TVKA 3KV1A 2YVKA 4IIHA 4YTEA 3HRHA 1T34A 2IYQA 4D6YA 5MHTA 1ULTA 1YDHA 4KXNA 4KGZA 5HX7A 1EUDA 1EG2A 2JLUA 2GNOA 1XJQA 3HKDA 3W05A 4Y0AA 3WLOA 4DREA 5C37A 3IAHA 3QBJA 2F7SA 2V7GA 4BPBA 1G21E 3AB3A 2DQ4A 2VH2A 1OE0A 5JSKA 2R6JA 3I6BA 3VMFA 1HE5A 2QMZA 2BFBA 1IHPA 4GEGA 1RWQA 3RARA 3QF4B 3Q5DA 4R4JA 3WDSA 5LMNB 1TVCA 4BGVA 4C0HA 4A26A 1R5JA 1YZKA 1Q1ZA 2F62A 2GFQA 2BH9A 3OJFA 1OVMA 3AHEA 3D7MA 1BXKA 3BZBA 3A6GA 1IULA 1DOAA 1NIPA 1YNSA 3H4IA 3KYDB 3VHQA 3X0DA 4EYSA 4JI0B 4E88A 4GX2A 4MVJH 1IEQA 1KMIY 3PV0A 3QKRA 3B1XA 4DADA 2AOXA 3PIIA 3P9NA 1GUFA 1OV6A 4J4TA 3TTYA 4DIKA 5HSGA 4N5IX 2EFJA 1O7JA 4RS3A 4PZYA 2AJDA 1ULAA 2MSLA 3EBLA 5ISMA 1AMOA 1X14A 3LQQA 3UOAB 5JNTA 4GVXA 2I6GA 2GEUA 3DLPX 4KQIA 4MDHA 4CKCA 4HV4A 5FOTA 3GBSA 4LZZA 5D3MA 3REGA 1WMEA 1JDSA 4PX3A 4ETIA 4I9HA 2GAIA 3SSMA 1G6HA 1YL5A 1J1IA 3JY6A 1JMVA 2FDCA 3OT1B 3LX6A 3TW4A 1XRNA 2CK3A 3I32A 3QVGB 1Y6RA 4NABA 4TLLB 1V6SA 3TR5A 4M38A 8LDHA 5JLJA 1GKIA 4MS1B 4NH0A 2VDLB 1WLSA 2ZYUX 4Q7EA 3DKIA 4RD1A 3W8DA 5AJVB 3RVDA 3DMYA 2FXVA 1N0UA 4ZVRA 4CMAA 4PRYA 3I39X 1DKNA 2XGJA 1FYFA 4JFAA 4E2XA 4E5UA 1N9GA 5EFZA 1W1IA 1Z6XA 1I14A 1Q1AA 3K2IA 3OH8A 2HOQA 4NOMA 1Q1QA 5DBEX 5SZJA 2VT6A 4A16A 2GN1A 4O63O 3R9IA 4MW2A 1C7ZA 4L5JA 1EH5A 2KM1A 1N0HA 4AY5A 3U62A 4QREA 1N4AA 5FLKA 1IY9A 1MX1A 2DUMA 1IZ9A 4B2LA 1PS8A 5BWCA 5K3OA 3KFLA 4CEIB 3NHLA 4XCVA 2GJ8A 4AWAA 2DP4E 1QPGA 1WMSA 4E5NA 4NE7A 4Q3DA 1R50A 2WG1A 1UMBA 2FWAA 3BRCA 3K16A 3MUNA 1VKJA 3DLHA 3DD5A 4JB0A 2H1SA 3U3JA 1OC4A 1Y8ZA 1U63A 4P4SA 1XN4A 3GPLA 5C7IO 2E0IA 3R9WA 3RRMA 1FW8A 3C97A 3K9NA 4HRVA 1MB3A 5BRAA 2GBIA 3H5LA 2Q41A 4HTFA 4MKIA 1JLRA 5BUCA 1NC3A 4E33A 5DOZA 4JL6A 1RKXA 1XG5A 1ZINA 3MOSA 3V55A 1EMDA 3OEYA 5CA0F 4FEAA 1AKQA 1ZN2A 4Q9NA 4M8IA 4Q4JB 4YHBA 4LSWA 4BVHA 3ZE6A 4LHSA 1WPQA 3ROFA 3BS4A 1KQNA 1F8FA 3GD7A 2A0UA 1RKBA 2WJZB 3VPBA 1L7DA 1T5OA 3DNPA 4M1WA 1MW8X 1Z26A 4KQ9A 2DUJA 1RRCA 2G83A 4RO0A 3OTWA 1EX9A 4FQ7A 4GRAA 3QJGA 4ZKDA 5JJLA 1Z35A 3PLRA 3RRNA 3LWZA 4PSCA 1I3LA 2XB4A 3BJIC 4O25A 4E70A 4Q21A 3WSTA 1GPH1 1QG2A 2ZIWB 3W2HA 4Z9XA 1U2GC 3HDQA 3KR1A 2WAYA 3LHSA 4N4AA 1SHJA 4RAQA 2CVOA 1DUVG 1FP2A 3DNMA 2B1GA 3K0EA 4KE7A 4O4LA 4Q3KA 5TPWA 3ZU3A 2HTEA 4QNNA 2ZJ4A 3ZNOA 3LUGA 4DW8A 1UZLA 1KJ8A 2PSSA 3ZXSA 4JJAA 4QBFA 4BPRA 4RTJA 3ZEAA 2F3UA 3K0FA 2I7DA 3CZCA 4ZTBA 5DNCA 3K0HA 5CD1A 1U99A 2BEUB 4CU2A 4F3YA 2C5BA 3R7AA 1EG7A 3HNRA 4PYKA 3G5LA 1S9HA 2GETA 3GL9A 1AE1A 1UFVA 2X0JA 1HFKA 2VJOA 3MLEA 4KN8A 3ESQA 1V0JA 4YIKA 3V7YA 2VN8A 2XRMA 5TMDA 1TADA 1P2FA 2O4CA 2EFYA 5CXXA 5DBIA 2IUYA 1GZ4A 3TIIA 1E6UA 2RI6A 1LZKA 5FFMA 1DC5A 2XNDD 1MV5A 4FDTA 1V5GA 3AR4A 1C3XA 2OCBA 3AY0A 3KOYA 3LC0A 3N5KA 3PFIA 1H4VB 3L01A 4JROA 4YRDA 4ZVSA 5TR9A 3R7SA 4D1YA 3K70B 2QMHA 5T6BA 4ZAVA 1WPRA 4KU4A 2W70A 4OXYA 4CIYA 1K9VF 2EZ4A 3F6BX 1I0LA 1MP0A 4D0RA 5FX2A 2G5CA 4EA9A 3PTAA 2FEMA 4FMCB 3HL4A 4HAOA 4U63A 3ZV3A 3PJRA 1XKXA 2VEOA 3TRDA 2JA1A 2VDJA 2CLCX 2MMGA 3DOIA 1Q3KA 4FJ2A 4NQRA 3RAPR 2WJ3A 2PG3A 2RE8A 2XYRA 3CNHA 5FTKA 1NIJA 2GS9A 1ZH8A 3GUCA 3IDAA 3PQDA 4MWDA 3C3KA 4UUPA 5EE5B 1XRMA 3SIXA 4Q19A 3WV4A 4C0XA 2X5KO 5IP5A 4BS9A 4GI2A 1TCCA 1N7JA 2G80A 1G20E 3DNFA 4QOSA 1GKKA 1U8XX 4BUJA 3DBRB 3T12A 3A2NA 4XX0A 3TRIA 4AJKA 5A4AA 1M67A 1DRWA 3IT2A 1SVSA 2GM4A 3TOSA 5H8WA 2IK8A 2VRCA 1Q1GA 1V5FA 9LDTA 2G72A 1SD5A 3IP1A 3PFBA 1DAOA 1KXZA 2J33A 3B6EA 2JJ8A 4O1IA 2IYPA 3UKDA 1N6PA 4E3ZA 3HFJA 4KGDA 2IY9A 4ZAXA 2C5AA 1D8AA 1T8WA 3UXEA 3EE6A 3HNPA 4ZO8A 3GLGE 2AMVA 3RC2A 4MZDA 1JX6A 4NOLA 2C8KA 5I48A 4CEJB 4FLFA 2BI7A 2F3QA 4XGRA 1VZ2A 3UQZA 1LS1A 4LE0A 5E4JA 1G5QA 3WMRA 1XEWY 3QWIA 1VIYA 2OLEA 4K86A 4EHNA 1H6CA 3LT5A 3GJSA 4IZHA 5T4FA 2CLEB 3M6UA 2O8EA 1MQSA 2X1VA 1CUZA 1T3SA 3BAFA 1SG0A 3O3OB 1OFIA 3RK1A 5BOVA 4DNXA 1SU7A 3MM4A 1EK0A 4U3JB 2OEPA 1NBHA 3BXZA 5G40A 3CKMA 3H3FA 3ZOZA 5KWIA 1JH8A 1GCAA 3QF4A 3D8UA 5SZHB 4CEHA 1NFRA 1CUUA 1ZN9A 2OYSA 3H1TA 3OM9A 4LRUA 2NSHA 4QXMA 4B33A 1XTZA 4NCBA 3CEHA 4PC7A 2I2WA 1Q0HA 4Q3EA 2VNKA 3KYDA 2QUIA 4RLQA 3TL3A 4IL5A 3IE1A 1FDIA 1VMEA 2RHHA 4OVKA 3CN7A 3SIRA 1RHJA 4A9AA 2HEGA 3FGPA 2CVPA 1LVGA 4JUBA 1BA2A 1POXA 3GOHA 1EE1A 4B73A 1CUYA 4GLJA 1S6YA 4M37A 4IDHA 3KQHA 3I01A 4QXQA 4TN1A 4W7SA 6CHYA 3HXMA 1EDBA 1GXSB 3W6NA 2EW2A 1LI4A 1Q7TA 4A6DA 3Q3GE 3LQYA 3WK8A 4R2JA 5CB0A 3K2BA 3PFCA 4N5HX 3C5EA 3PXEA 1WWKA 2IIBA 2IXDA 4R7TA 3S2SA 1GRCA 2HXGA 2I6FA 5DH9A 2RGRA 1S3GA 5A05A 3CWQA 2BGJA 3PHGA 1DJMA 2GZMA 2HQSA 4IHJB 1T5BA 3IUYA 1IBLB 4TQ9A 1TQ6A 1TEZA 3OPVA 2IYEA 2HT1A 4MQ4A 4M8KA 4QDKA 1EK2A 3EWIA 2M32A 5E1DA 5DB4A 3WHPA 5KWJA 1WXQA 3R7WB 3ZLBA 4EIWA 3AQ4A 2N1MA 3FUTA 2WT4A 3T7RA 1ZWLA 4DIFA 5KJFA 1V8PA 1SQ6A 5JBNA 4MYHA 1F7UA 2M1ZA 2PZLA 4M99A 2XB9A 2H4WA 2WYIA 2I1VB 5A3SA 3TBHA 3VBCA 5K3EA 3WGQA 2WI8A 1RTTA 4NEHB 4QDJA 2X77A 4R0NA 1YZFA 4FT4A 3JVUA 3OHPA 4HGPA 2B7BA 3TL2A 3PGLA 3ZE2B 3NDPA 3PPXA 1U02A 3D8SA 4QFBA 5LP6B 2VWGA 2Y1XA 3MCAA 4LQ4A 1W4LA 2CXQA 3KQKA 1DBIA 5TDHA 4XVQA 4PU0A 1GQSA 4X93A 2XH8A 3G9XA 4KG7A 1HG1A 1S7GA 4ALLA 3OC0A 2HB6A 5K20A 3OJ0A 2QRJA 1VPLA 3AKDA 1KA9H 2VAPA 4BX3A 5AVUA 2X1HA 3LUBA 3VNSA 1F5SA 1UDXA 2XJ9A 4A8JC 3Q4GA 4O6VA 3M1YA 4MUIA 4PAQA 4W5NA 1Z6ZA 3FJOA 2RD2A 3EWSA 2J7PA 5CYOA 3DDHA 3R3XA 4G41A 3U4QA 4MLZA 1XYYA 1BXZA 4M83A 4G0XA 3F4BA 3IOMA 2ZETA 4EG8A 3JYNA 3X1JA 4DV0B 4RGQA 4FMBB 4D8VA 5JCPA 3U49A 5EL0A 3U3KA 1AQNA 1CZRA 1I5OA 3MAJA 1QGUA 1EFRD 2Z2IA 3HU2A 3OIVA 3FMGA 1O6CA 1E9CA 1ULBA 3Q3HA 5KIAA 5LXTA 1KI7A 1JLMA 2JAHA 3AEUA 3EZ2A 1BN7A 3H18A 4QYXA 1PO7A 4JYMA 4Z49A 5CMLA 1ZXBA 2OM2A 3A3OA 3HCAA 1LV8A 2PX8A 4U0JA 3A11A 1UK6A 2Y3IA 3JU3A 3OFNA 5FTNA 4V0NA 1PF7E 3Q2IA 1KZ9A 3LOUA 4EGQA 2R11A 4LHVA 1FNMA 1YS9A 5FYQA 2ZE5A 3G59A 1J2RA 3QIVA 5GAJA 1VKHA 1XXHA 5A7HA 3JZFA 1VKNA 4W9NC 1DTSA 5G0SA 1O95D 4ZAWA 4F3RA 5AD1A 1Y1PA 5DASA 4EPXA 4J91A 5IMSA 1BE6A 3HVKA 1A88A 1E7QA 1YE5A 3K4QA 1NAHA 3TLBA 3FI0A 1K6EA 3O38A 1ZD9A 4R2LA 4R2WA 2NZUG 5JSZB 1KMHA 2D0OB 2IF2A 3L5OA 3VNAA 1J1UA 4EECA 1L7VC 4P4LA 1BXRA 1R5BA 2BFDB 2DFDA 3FFAA 4Y2RA 5J40A 1MO6A 5T3YA 4ER6A 4Z0TA 4D4KA 1RLOA 4R2XA 2QMQA 3VDRA 1JH9A 2CXOA 3NV7A 3RSLA 5CITA 2JHPA 1ZMBA 2PJDA 2VDKB 1EJ0A 5IVPA 2HMTA 3OF2A 4OY3A 4DNOA 4YP1A 2X5XA 4CT0A 4X1KA 1C4WA 2E6KA 1MBZA 1QKJA 4WNCA 4IMJB 3RNLA 1IM2A 3OI7A 4RZQA 3RUAA 1YZVA 2W2LD 4JBLA 2JI8A 3Q3EA 2G6TA 3DEAA 4GEKA 5AJZA 3K05A 4QUHA 4YDSA 2ISCA 2OWEA 2PRSA 3MS4A 3AF0A 2GPJA 4X60A 3ZU5A 1J0CA 1D0VA 4KXUA 4Y6GB 1GUDA 4MXDA 1A9QA 3BWDD 4DJJA 4F3KA 1YD7A 4FGKA 2OV6A 2XNJA 5E6SA 4QGSA 5JNSA 1D4AA 4D45A 2E85A 4HGOA 4K6FA 2YNMC 4OHCA 1ATZA 1EGAA 4BVBA 4I8XA 3DAFA 3ES9A 2W2TA 3L43A 3LQKA 1NUHA 3SQMA 1PEAA 4DCJA 3GP3A 3AR9A 4YJ3F 3AUYA 1UXKA 3UWDA 1S5PA 2GO7A 1DUIA 1ECPA 1T8YA 2UVQA 2ZUDA 3DMNA 2FP4A 2MYUA 1ONSA 3ADOA 3DA8A 3NIFB 2EF0A 3P97A 4Y6QA 4B3CA 4EKDA 5C9ZA 1VPDA 1PR2A 2OO5A 3KWFA 1BCSB 2IE8A 3SFTA 4EQ6A 1TMGE 1VIVA 4UM8B 1E99A 2DFNA 3M3HA 4DM3A 1ZU4A 4GOMD 1TRKA 4Q1BA 2VDWB 4CCAA 2KX7A 3D4OA 4UVDA 1KJJA 2RHOA 4JSYA 2QR3A 2KLBA 1NY6A 2ZBGA 1KH3A 2DE0X 4EFKA 1GTJ1 1I6LA 3NV9A 4O4IB 2BY4A 5C7YA 3EPJA 4DV2B 1X1CA 2L17A 4GWGA 1RM5A 2BOVA 2Q0QA 3D7KA 2IYZA 1T0HB 4KCGA 3FB1A 1QH1A 1UFOA 3HA3A 4ZRDA 2ZI7A 1CUGA 1P72A 5AKIA 5EJFA 5ICEA 5BRNA 2WM3A 1W88A 2HBRA 4EPTA 1QYCA 3KXDA 4Z8XA 4G8DA 1KY4A 2Q2OA 3GNLA 4JZYA 1YR7A 2G71A 4BQPA 2I4IA 2Y93A 5ES4B 3L7IA 3A1CA 2G25A 2JASA 2OCYC 2PGNA 3G1UA 3GLSA 5D1HA 2RHLA 2PQMA 2PZJA 1YFZA 5IYZA 2Z09A 4LJ5A 2DT5A 5EJ2A 4DGSA 3TH5A 3SBXA 2BLLA 3IOEA 3QMVA 2R2GA 3E5RA 3DVQX 1RE0A 1NF8A 1L0BA 3DLTA 3E8MA 4KO8A 4AURA 4ZCMA 2FX5A 2Q5CA 3JAWB 3WKEA 3KB2A 4FCCA 2YWFA 1X7GA 1N0VC 4MGZR 3BA1A 1KEZA 1A8UA 3IQXA 4M21A 4Z3DA 2VT2A 4JASB 3A31A 2ONCA 3EQ7A 3RROA 5HRAA 1VCHA 4PAWA 1XBTA 2OMKA 1T3HA 4MUNA 2J31A 5KZMB 3WLLA 1W4RA 2ZUWA 2BZSA 5DTIA 5F77A 3SYMA 5EKTA 5A4FS 2HDOA 3RUIA 4MW1A 3VU9A 1FX1A 2GRAA 3IVRA 4G0OA 4X3OA 1YSCA 2HFJA 2PUDA 1UPCA 5DWQA 2V6MA 1HNXB 4IGIA 2JFHA 5EJ5A 1M72A 3CNNA 5K3CA 1PD0A 5H3HA 1R9MA 4TXMA 1B3BA 5BMOA 1NR7A 4D3XA 1NMQA 1JECA 5EEGA 3B51X 2N75A 3BSWA 4KJXA 4WCFC 4LF4B 2GCPA 2XMPA 4S12A 1MB9A 1WBJB 5DHQA 3TCKA 3TIVA 1EI9A 4CQMD 3QPVA 2H07A 1AO0A 2H52A 1IOVA 3EFOA 1PLJA 1RPNA 1Z5ZA 3G02A 4B82A 2X4DA 2C3YA 3BRWA 2QVBA 2EIHA 2JCBA 3CSSA 4BFCA 5IAOA 3IDOA 4KK4A 5L9AA 2GEFA 4WOKA 3WAGA 1FLVA 2DFPA 4G1MB 4B6OA 2ZWOA 2W8BB 1ULHA 1XVTA 2IHKA 3BGWA 3E03A 1SBTA 3G5AA 2NADA 1F6DA 5A5DA 4JVOA 4Q03A 5DNWA 4DCVA 1NX9A 5DEOA 5E9QA 1O57A 2SCUB 1NT4A 3DV2A 5JNRA 2CVHA 3U0VA 4MUGA 3WK5A 4DMMA 1G6Q1 4OJYA 3IT1A 4RF5A 3UXYA 3E4CA 4FFDA 3GJ3A 5EHGA 4QM6A 5DCLA 5DGTA 4ZDJA 1O58A 2JZCA 4OL0A 1SCIA 2KBEA 2QK4A 3CB4A 1CEXA 1ZP6A 2GXUA 2B1JA 5ALGA 4EAQA 1WY7A 4TZ0A 3D6TB 3LJKA 2GKSA 4HAZA 3AV3A 2HSGA 1LK5A 2R751 1E6CA 1U31A 2F3SA 3F8WA 1Y3HA 3I61A 1D04A 2NUAB 2B0CA 2VF2A 1J0AA 4MCAA 3SXJA 4BNWA 1T1JA 4FE7A 2I4RA 2QIOA 1PW7A 1SHLA 2L69A 1QSGA 3DMPA 1SY7A 2Q0SA 4V24A 1FCJA 3TQTA 5B7NA 3LQ2A 1IJFA 2DJ5A 4HXGA 5CHEA 4WK4B 4YJ3B 5EIHA 3P4XA 1IJEA 2OD2A 1K5HA 4YRSA 3RUCA 4DMUB 3KQSA 3QV2A 1N2IA 1D2MA 2BI4A 4TL6A 2WF6A 4Y7DA 1SAYA 2GD6A 1E5TA 3VKWA 1T10A 3CEJA 4M89A 1NFFA 4R68A 2FF5A 1R0CA 2Y67A 1BEEA 2YJNA 2ZTUA 4UNRA 1MQ9A 1WXIA 3KT0A 3UAOA 3QE9Y 5FV7A 4KR7A 1TTHA 2B1QA 1I8TA 1TUGA 1PL6A 2HWWA 1YJQA 4K88A 3BRSA 1YBAA 1OA0A 3P2YA 2ZIUB 1Q83A 4BWFB 2P5YA 1VQ1A 3L9XA 1EXNA 1HZZA 1IY8A 5HXAA 4ZYYA 3TBKA 2LBPA 1SOUA 4ZCSA 1AH2A 2DT8A 3ROMA 2XQJA 2HRRA 5HCNA 2B4TO 3O2NA 1XF1A 2X14A 3A9WA 1EVIA 5DIZA 5TMBA 2EKZA 2IZZA 4A8TA 4AUEA 4OOFA 2XXAA 4AY2A 4C0BA 3SX2A 1GG9A 1MO5A 4UW9A 4FSXA 4N82A 1DWQA 2Q5OA 4XLLA 4INOA 5J4HA 2LKDA 4KV9A 4MR7B 4LFBB 4D9EA 2P11A 1K0FA 1W47A 4MP6A 4TX1A 1QP7A 4PE5B 2O8BA 1TA0A 4ZP1A 3R5XA 1UBGA 3DXYA 2IZ1A 1VJ5A 4MR9A 5DULA 1AGNA 4OXIA 4DOMA 1XZ8A 1Y1SA 2XHEA 3ODPA 1GZ6A 2BGIA 1XZAA 3JZAA 3MJDA 3PQ5A 3RUDA 5AI5A 1RNLA 4GNKA 4IDBA 4PEVA 2D4AA 1GZ7A 3GGOA 4WCVA 2DZDA 4NZPA 2L42A 1RXEA 5F1YA 5COAA 1ZJYA 2EDCA 1UDRA 1LPMA 5FBHA 5I7VA 1XDBA 2K87A 2V7WA 4YAWA 5AVZA 2PBLA 2PQ2A 4BVEA 3UZUA 4MW6A 2QTVA 4HNRA 2YXNA 4MW0A 4PRZA 4R9NA 5IWCA 3N0WA 1W0CA 5IKMA 1F1BA 4I08A 2AD1A 2G77B 5JRDS 4KLCA 1SA0B 4ZI7A 1LPBB 1HDZA 2VPQA 1CLUA 1JFRA 2ORYA 4TTRA 2QSJA 1YQEA 3I1JA 3CV3A 2I22A 3H7AA 2PT5A 2UAGA 2JIPA 4O2AB 4YT4A 1I7QB 3N0XA 4LXXA 3TMAA 4CN8A 3NDBB 2J3DA 1L7AA 3SG0A 1A9ZA 1TMOA 2WUDA 1P4AA 2WFMA 4EW1A 3SZRA 2PDAA 2OD7A 1X7HA 3PNVA 1YJXA 2RMKA 2XMDA 3UJBA 2D0PB 3E3LA 4DPKA 4MW5A 4LRWA 5T7BA 3MTGA 4FR0A 4AZ0B 4CKBB 4L6CA 4X85A 4WINA 3BWXA 3E2PA 4Q9AA 5JBIA 4GNRA 2J59A 3OVMA 2XADA 4IIUA 2VDWA 4RMHA 1QFSA 2XMBA 1E2UA 3UAYA 1NXWA 4GAEA 1QVRA 4NJEB 4X61A 1WXXA 5I4KA 3TXAA 2O8FB 2PKRA 1FXWA 1RJDA 2UUOA 3ZNQA 1JR6A 1YI1A 1SBZA 3KX2A 2HY7A 4UUMA 1T0BA 1NXSA 3ZI7A 4ALKA 2GD0A 3R9XB 3A6ZA 3TUJC 5F3RA 3V8QA 1JQ5A 1KOFA 1GTL1 3HFRA 3L4BA 4TYQA 3TJMA 2BLNA 4MINA 4B1FA 5HOQA 3JSAA 1EGHA 5JHGB 3PUHA 4S24A 2YS6A 3UMVA 3ZW7A 2WSSD 3LH5A 1EVLA 4TLAA 5E4TA 3OIDA 4E5KA 3S2EA 4D8UA 2JGKA 1ZOPA 1N8KA 1ZUIA 4WFIA 4JX9A 2XVAA 3FNRA 2XRFA 3GN2A 2Q5LA 3KTFA 4J2TA 2GF2A 4QUDA 5ALOA 3X3HA 4H9GA 4PPGA 4BJ6A 4BZQA 4C1NA 2Q6LA 4US0R 3DF7A 1LTKA 4B76A 2C2ZA 2J1LA 4L7QA 3NFYA 2AK3A 2KB0A 4MCJA 1Z8HA 2C2HA 1Y33E 1NV9A 5EUMA 4ITRC 3OIFA 5GOZA 3HXPA 3T3HA 2OYCA 5K6TA 5G4LA 3ZKAA 4FNMA 2AVNA 2PWAA 3GGJA 5K01A 4N3AA 3VZQA 4FYKA 3W90A 3VH1A 1T6YA 2UYCA 4JKIA 1OX4B 3DLIA 3ZDBA 3U31A 4C0JA 3VSDA 1HLGA 2EQBA 2QB5A 4JI7B 3RFVA 3CH7A 3N2IA 1WMAA 4IKEA 5ESRA 4I4NA 1L4EA 2LTAA 2EJWA 3U3MA 4QASA 2B4RO 3ZDFA 3QSGA 1SKAA 4IQFA 1XCJA 2XY4A 5BN1A 3EZXA 3E35A 3VO8A 3QG5A 3WGGA 3L8MA 4BEVA 4PX2A 1PGQA 2BMAA 1Z4PX 1UP7A 4EUNA 1B14A 2L0XA 3HO6A 4B83A 4RVDA 4QFCA 2LW7A 1R6UA 1FSGA 2PSEA 3PCRB 4EKGA 1C9KA 1K5DA 2PGLA 1PT6A 2WUGA 3HB5X 1H8ED 3TQOA 3UV3A 2P9JA 4HWOA 2WA1A 2H1FA 2N9UA 3KQMA 2OYRA 2DCUA 1PUJA 1RJ9B 1T3TA 2QJOA 4GO1A 3NHJA 4A5OA 4BE9A 5F78A 1SC4A 2HR1A 3CA8A 1L8XA 3T3EA 1QAQA 4BMZA 3A3NA 1G66A 4W5HA 2MSEB 2YY7A 1SQSA 1BHJA 5FL7D 2R84A 4NAVA 1YVEI 4BFWA 5KAPA 2J6IA 2PMDA 3QWBA 3E7DA 2IYXA 2EJCA 4JFRA 4CZ2A 1EUCB 4HX2A 3GG2A 2I6SA 4TWBA 3BHJA 4TLBA 2Q1SA 3O1JC 3TLKA 5JPDA 3FJYA 3IESA 4IIEA 5DI3A 3QYFA 1FNNA 1WCIA 3W4IA 5JSQA 3I1IA 4MHOA 4BKUA 1DBWA 3E3NA 1R2QA 2JIQA 3R09A 3G2QA 2FVYA 1XNHA 4DUPA 2FJ0A 4B0PA 3DV9A 3RPEA 4BQEA 2ZUEA 4JGBA 3SQWA 3RTDA 4DV3B 3KQPA 1EINA 2Q4BA 3GUVA 4YEDA 3C48A 1FFDA 3W1WA 3QEJA 4BDTA 4BVFA 2B7CA 5LB2A 3TWOA 2PUGA 3I6ZA 3R41A 5AUPB 1P5HA 3JATA 4EPWA 3VHRA 1EFKA 2QRZA 4J43A 3E61A 4ENRA 3OFSA 1G59A 1ONBA 2IA5A 5KJEA 3ROGA 3VHLB 3ZWAA 2FPRA 1PR9A 2R6AA 3VUEA 4QJBA 3TR6A 2WU4A 2PZAA 2WUVA 4AG3A 4US2R 3HBFA 2IHJA 4YDRA 3MCUA 2J9RA 4J1TC 2I8LA 5M7EA 1ZM3A 3SIPA 3BC1A 1VLMA 1DMRA 3DOJA 4AO6A 4KOEC 3T95A 1NE2A 3DCIA 4KMMA 3VR0A 3L0PA 4K40A 1TW3A 2OZLA 3NUGA 1V2HE 1OX5A 2XUQA 3MINA 3LUPA 5U