2IEZA

Crystal structure of mouse rab27b bound to gdp in monoclinic space group
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
185
structure length
178
Chain Sequence
YDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYDSGKAFKVHLQLWDTAGLERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLIGNKADLPDQREVNERQARELAEKYGIPYFETSAATGQNVEKSVETLLDLIMKRMEKCVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Ras-related protein Rab-27B
publication title Structure of the small GTPase Rab27b shows an unexpected swapped dimer
pubmed doi rcsb
source organism Mus musculus
total genus 37
structure length 178
sequence length 185
chains with identical sequence B, H, I
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2006-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2iezA00
2ZTSA 3FKSA 5C18A 2FSHA 5BWMA 3GLHB 4UQOA 3T15A 5KNDA 2AWOA 1IJEA 2BJVA 4LCBA 1G4AE 1P9NA 2JATA 2ZEJA 4NMMA 1M7HA 5IK2A 4BUJA 1E2MA 1QRAA 3QEOA 4NH0A 2KBEA 4RD0A 1J90A 4HDCA 4R98A 3RS2A 1XZQA 2IS6A 2A5JA 3WBKA 1HT1E 1VHTA 1R0WA 4C0AC 1QDEA 3SYKA 4JLDA 4RFVA 2GHIA 3DZDA 4S2EA 5EZ6B 4U7DA 2ZRBA 4C0HA 1XEXA 2WIBA 4LPKA 2UZIR 4OQXA 1SXJD 1JPJA 5EE1A 3B9QA 4JL8A 2Q9BA 3EAQA 1OIXA 3DM9B 1A82A 1S1CA 5ANRB 2ONJA 2FV8A 3AUXA 1TU3A 3QXXA 1E0JA 1Z83A 3I92A 1YVDA 2OBMA 4B6FA 3RWOA 1SZPA 1MH1A 3DHWC 1DADA 4URUR 5E4FA 3RHFA 4LSGA 3V00A 2KBFA 4ZPXA 3S1AB 4BASA 5CB8A 4TMTA 2JEOA 5HZKA 3GJ8A 4TZ0A 3DO6A 4OHXA 2V6JA 1XNJA 2CCJA 4JLAA 4M21A 2ZS9A 1JAHA 1OT3A 4M2LA 1ZM3A 4C0LA 3D6TB 4LYJA 3SYLA 4D4JA 3ADCA 1II8B 3E5HA 4B48A 3AVOA 1G20E 1QG2A 3SFVA 4DLZA 4EPXA 3DL0A 2XZOA 3SJBA 2VYFA 2HYDA 1E2KA 2ZUDA 4AKGA 3E70C 2OLJA 4BRUA 1BMFA 2GXQA 4A8JA 1CTQA 1Z29A 1NBMD 1E9EA 1NN0A 2IF0A 3CM0A 2OFOA 2EFHB 4Q9IA 3RDPA 2V54A 2G77B 5HZHA 3FFAA 3RABA 3AVVA 1U0LA 4D2IA 4PHHA 4JBYA 4KV9A 1Q20A 2BMEA 4JKIA 1TAGA 2IS4A 1J8MF 2JIZD 1MABB 2ZRHA 3OEED 3N2EA 1XF9A 4NP6A 2A5FA 4EIWA 4Q21A 1IQPA 221PA 2NGRA 3KKNA 5JMTA 721PA 4C0BA 1VCIA 2JJ1A 3Q3JB 2OV2A 2ZI3A 2JLYA 4ZCIA 4O25A 3GFTA 1GL9B 4GMDA 3WHKA 3VKWA 2B8TA 3CX8A 4ITRC 1D2EA 1RRPA 4BZXA 4CYMA 5KUTA 1FW6A 1U9IA 3GLIA 1Z22A 2E9SA 4GP7A 4HLCA 4WXPA 2IS1A 3WXMA 5IDVA 2PJRA 1HUQA 1JPNA 1S2MA 2H57A 4JVLA 2C2HA 4LJ7A 4F93B 4TYYA 2AKYA 3NDPA 3OAAA 4JJZA 1DBSA 2ZRFA 3WNBA 3AP2A 1H8HA 1G18A 1Z0KA 3WHLA 3MSXA 2O8FB 4LBYA 3K0EA 4IEEA 4KCGA 4LJ6A 1E2QA 4RY2A 4EKDA 2HLDA 4W5WA 3T61A 1NL3A 5FFMA 2JDIA 4NU0A 4LBZA 5FI1B 1WF3A 3AH8A 1VG1A 1LFDB 4LX0A 3HYRA 4ACAA 5HKKD 2RCNA 2DBYA 3TQCA 2YNMA 3EPKA 2ZRIA 2RB4A 4A8JC 5E7JA 5JHHB 4NYIQ 1P75A 4Z1MA 5DGXA 1SXJA 4A92A 1T0HB 4YC7A 4CEIB 1EWRA 2IT1A 2D3WA 4PXAA 2GZAA 1W1WA 2EQBA 4TQAA 3TR0A 4YQFA 1LV7A 3UMSA 2A5YB 3I73A 1JAIA 4QBGB 1XMIA 1NG1A 2CLCX 2QENA 3CR7A 5JHGB 4PSAA 3K9HA 2J0UA 3BOSA 4DLYA 5BN5A 1EXMA 2BWJA 1QF9A 2IUSA 3OE7D 2RMKA 1KO8A 1OB2A 2O8DA 1IXSB 4KI0A 2F9LA 4D0LB 3BC1A 2CMKA 5DE3A 4XWKA 1WXQA 1XCGB 3GMTA 1FUKA 2G1JA 3ADBA 1W2GA 5JECA 4H1VA 1IY1A 4K8OA 3JVVA 1VG8A 1YZKA 4E22A 1AJEA 1U9IC 5A0FA 4DB4A 2WMNB 4PZYA 4EQ6B 4EUNA 3AVTA 2F1IA 1W0JD 4DLSA 2EWVA 5HE9A 521PA 3PQCA 2BEKA 3VKHA 1E9CA 1MO5A 2XNSA 3W6NA 2BBTA 4QGAA 2VHUA 5EE5B 1FP6A 1T0JB 2H7VA 4D4KA 3X1WA 1E2GA 4HAYA 4IVPA 1MT0A 1TNDA 3GJ3A 4YMTA 2W6JD 4L9WA 3QPVA 1CRQA 2IYXA 1EK0A 3IHWA 1VTKA 1I4LD 3ZD6A 4HZIA 4XIGS 1GUAA 5CDFE 4F4CA 3QXJA 4Q1AA 4CEJB 1KDRA 1SXJC 1G1MA 5EZ5A 2GDJA 3THOA 2F1RA 1Y3AA 8OHMA 3I5YA 5DLQC 1CJTC 2VP5A 3IGFA 4XJXA 2F6RA 3QF7A 5FTMA 5D3QA 5EXXA 1L8QA 3GLGE 2GVZC 3R7WB 2BJWA 4DSUA 4LV5B 2W0MA 4U00A 3VTKA 2QSZA 1X1SA 4GBMA 2ZYWX 3LY5A 4I1VA 4X8MA 4A0FA 1VPLA 3N5CA 4ZIRA 4MYUA 4ERNA 1W36B 4DWJA 1G7RA 5IT5A 3QENA 3B7GA 2QI9C 3K09A 4MQBA 3SBDA 1UKYA 3FWYA 4HAVA 1TF2A 2IYWA 4WZ6A 4B2IA 3GJ7A 2CXXA 2KI5A 1VDZA 2IHBA 3LBHA 2R6DA 1RJ9A 5DH9A 4A0GA 2VHJA 1F5NA 3QVVA 3KL4A 1UDWA 3VNVA 2GJKA 3EA5A 4A6PA 1Z0IA 2GAAA 2VPPA 2JLSA 2TMKA 1MO4A 4EPRA 3L0OA 2F3RA 4PANA 3GEIA 4TMXA 4PC1A 1QHSA 1DS6A 2YC4C 5J4YA 4EPWA 1GKUB 2DFKB 1R5NA 1G7SA 1YZUA 2ZVQX 1AM4D 2KWIA 1U90A 1S1MA 2UZ3A 1XD2A 3HU1A 1M7GA 2Q3MA 2ZQ5A 3ND8A 1XMSA 3QE0A 3UK6A 2MSDB 2P2LA 3TE6A 4C4PA 5KTYA 4DVGA 3UKDA 1W7AA 2NO0A 5L3RA 2ZJZA 2NG1A 4LC1A 2GESA 4CVNA 3WNCA 3QKTA 4TLBA 2OLKA 4GT1A 4I99A 1NKTA 2RKOA 3KJHA 1RFLA 2R6CA 2REBA 2XAUA 2QEQA 2ZRKA 3SZRA 1PJRA 4DCVA 2OXCA 4AD8A 2PCLA 4B6EA 4FIDA 3T35A 4MKIA 3BFVA 2CJWA 3T34A 3QF4B 4RD1A 5FOWA 4IOJA 4XWOA 1UADA 1HE8B 2GBLA 2I4IA 1U2RA 2CL0X 2WWIA 1NNEA 1E79A 3K09C 1XTJA 4UXIA 1Q1ZA 3ZQ6A 5EP1A 3ZZ0A 2HT6A 4B3BA 4E07A 2CNWD 1X1RA 2YJTD 2G1KA 1XU4A 1E9FA 3FHOA 2AWNA 4QBHA 3CH4B 1EGAA 1MRNA 1TUEA 2GILA 4B47A 1VIAA 1KI6B 4UNSA 4Q5IA 1YR6A 1E9BA 4ZI3A 1G8YA 4Q4JB 4XD7D 4OK5A 1HE1C 4XTCS 2FJUA 5KU1A 1KK2A 2V9PA 2QP9X 4LY6A 4IVQA 1AS3A 1UBEA 1XTQA 5CM8B 3UMRA 3G5UA 4K81B 2WSMA 5CM9C 3PG5A 5FTKA 5JFGA 4F4IA 2GVDC 5AWFC 3WYGA 3QQ5A 4DLVA 3VR4A 1NMZA 4TYPA 2GCPA 4UXHA 3TMKA 4FMCF 2EWWA 3THYA 4OKSA 1Z6GA 3UIEA 1MR3F 2Q9CA 1G8GA 4W7SA 4WVFA 5BQ5A 3HWSA 3GLHA 3RS7A 4EJSA 3EW9A 1M74A 2O8EA 5C4MA 1GITA 1S0UA 2ZREA 4C0SA 1N5LA 2R65A 4IOMA 4ASUA 4FMCB 4ARZB 1PLJA 2FZ4A 2PMDA 4TL9A 4OQMA 1G64A 1FFHA 3EZ9A 1E4YA 3LRPA 5FUXA 1S4QA 1XTKA 4TL8A 5G40A 2FPMA 4ESVA 1RYFA 2BCJQ 4B71A 1J8YF 3W90A 2GBLC 5BN4A 2D7DA 1KY2A 5AR1A 3GP8A 5ELXA 2FEOA 1DO0A 4KSCA 4UNRA 3OFNA 2NPFA 1CULC 2XB4A 4LGMA 3LVQE 1T91A 2PH1A 2ANCA 1E2FA 4JSTA 2IX3A 5HR5A 5CYPA 3UMFA 4G3XA 1KMHB 3U44A 3AKDA 3DOFA 3D8BA 4ON9A 2N42A 5F2EA 3EZFA 3P1JA 1U99A 1E0AA 4B74A 3SI7A 3RS5A 3C41J 1IN7A 1II8A 3RLFA 5TY0A 3IO5A 3U3RA 3BH0A 5DN6A 1IN8A 1FQJA 2C03A 3OESA 2CDNA 4QGFA 5CDFA 1DO2A 1E9SA 4C2TA 3B9PA 4V0ME 1SVIA 4BPBA 2QBYB 2PZGA 2FWRA 2H17A 1L4YA 4I81A 3VR6A 2BBWA 4RSGA 2J1LA 3LX8A 3MG9A 4EJSC 1CRPA 4FINA 3GLGA 4TYWA 1XEFA 5L3SA 3P27A 4NTZA 2EYQA 5EP2A 1E1QD 1ZYUA 1MRSA 2GXUA 2IYRA 1XPRA 3L8YA 2B21A 4YDHB 1SGWA 4O0MA 4FWIB 5FL7A 2Z83A 2WWWA 4TSFA 4FN5A 1NP6A 3WMGA 1JNYA 2QE7D 3O47A 1A7JA 4MRNA 4MRRA 4EAQA 1KJYA 3TIFA 4BFUA 1E2JA 3KKMA 4X8HA 4D25A 1CJUC 4QJ4A 1KO4A 4J0QA 3HPRA 1XCPA 2A2ZA 1VYVA 3EIHA 2IBMA 3TVDA 1KZ7B 1H8ED 2ZJOA 3PIRA 1XTIA 4LBWA 2OXRA 4BLRA 4PC2A 4PHGA 4P4UA 4QXAA 1GIAA 3KQHA 3I4LA 4DJTA 1W36D 1G5RA 3LBNA 4JL6A 3T12A 2FU5C 5DO9A 2ZI7A 3W5JA 4KVAA 4KFUA 1C1YA 5TARA 3CH5A 2HDNB 4JLPA 4WA7A 5DI3B 4PPGA 4GRAA 3X1ZA 2VRWA 1UKEA 1ZNWA 5E95A 1P61B 2XITA 3I8SA 1U8ZA 3AB3A 1NSTA 4LJ5A 1G8HA 2R6GA 3EIQA 1J7KA 4DC9A 1Z3IX 1NVVR 3GJ4A 5BYJA 2QG6A 2P6UA 1Q3HA 1C9KA 4GZLA 5BW8A 5L3QB 3U3KA 1E6CA 3NHBA 1TQDA 1YQTA 5K8UA 4TYQA 1YRBA 4HAWA 2J7PD 3A4LA 2ZSBA 4TQUS 1ZW6A 4JMPA 1G5TA 2WSSA 3THWA 1OFIA 4IKEA 5JS8A 3NEJA 4RZ3A 2B8WA 2KB0A 5KDLA 1FOEB 2FFHA 2L0XA 2NO6A 4DXAA 5HPYB 3U6BA 5SZHB 4US2R 3U7HB 1G6OA 1NI3A 2OBNA 2Q3FA 5AUQA 4A6XA 3TSWA 1IY2A 2BKUA 1OE0A 3L0IB 5FPSA 2NZ8A 3ONWA 2JLVA 1E2PA 4NDZA 3L0SA 4MGIR 4XVUA 3NVAA 4MH0R 3U5ZB 2ZJ8A 2ZPTX 2OO7A 2H16A 4DKXA 1JJVA 1ZD1A 3EARA 2VHCA 4XSGA 4G1UC 2FGJA 3W9YA 5AUNB 3CZPA 3LD9A 1FUUA 3LV8A 2RGNC 2XOKA 2H5EA 3IQXA 1AN0A 1D5CA 3EPHA 1P4SA 5G41A 3KXKA 4F7WA 5B30A 3T5DA 3GLIE 4C7OA 1BKDR 2ECKA 2ZJYA 3PEUA 1E1RD 4D6PA 1HA3A 2CL7X 2F3TA 3CLVA 4JLKA 4D4MA 3AVPA 1GNRA 2QAJA 2ZS7A 2O8CA 2BMJA 1F2UB 1GM5A 3KFXA 2NMVA 2ZVPX 3GFOA 4ZDKA 1XXHB 4XOIA 3SEAA 4BLQA 3K70C 3BD9A 2A7QA 1D8TA 3UG7A 4RD3A 5K8LA 4TMKA 4DBLC 5TVKA 4AYTA 3CRVA 3TJZA 5K8IA 1F60A 2ZE5A 5JCZA 3AVWA 4AKHA 1IY0A 2HJVA 4LHYA 3GJXC 1GP2A 1W48A 3IEVA 4PSVA 4HDQB 1F6BA 4FD2A 4JYBA 2VHTA 1OHHD 1TQ2A 1NIPA 4AC9A 1WP9A 5C4GB 1T3HA 4ZV4A 4ZKEA 3B60A 4QJ5A 4LJAA 4R2HA 1SXJE 3N2IA 3P4XA 1OXSC 5L3VA 1T8TA 2IXEA 3EC1A 3TGPA 1GILA 1W5SA 1M2OB 2XTZA 1GNQA 2BHRA 1HYQA 1OB5A 3AGQA 3CPHA 4LV8B 5AJWA 1DARA 4YXWD 2J45A 1SHKA 3MCAA 1QHHB 4B3DA 4TTQA 2O0KA 2J7KA 1E0SA 4TMVA 1VKJA 1VYUA 3Q72A 3TSOA 4D80A 3U2QA 2I3BA 4M1TA 3C15C 1ZC4A 4OI4A 5EXSA 3RSOA 3SQWA 4QBFA 2IK8A 1WBDA 5M04A 4IOLA 5EP4A 2XNDD 4YMSA 4URYR 3MMPA 2UVQA 2BEJA 3W6OA 3U61B 3DMDA 2O0JA 4JLJA 4KFSA 1P72A 1YZTA 4M22A 5FR1A 1ZUHA 4TT3A 1XX6A 2FPLA 4JLVA 1US8A 3ZIAD 1QHXA 2J59A 1WQ1R 4P31A 4WOPA 4MYTA 4P4SA 4V0MA 5F3WB 4YMUA 4BQSA 2CK3A 1UEJA 4BLOA 3R8CA 2IEZA 3H86A 3QEJA 2IYYA 2XJ9A 1OH5A 3KXLA 2F43B 2WKPA 2QM8A 2D06A 4LPSA 3KKPA 1N6RA 1ZUIA 2OESA 4HSEA 4HYYA 5CK4A 4ABYA 2FFBA 3BERA 3B85A 3SJAA 4OI1A 4W5HA 2IXGA 1JJ7A 3WMFA 3GLFE 1GL6A 3R9IA 3W8NA 3DMNA 3CNNA 1E2DA 1G41A 2MMGA 1DAEA 2DWQA 1XFAA 1W36C 3PJRA 3U60B 1MO3A 1CJKC 3TUZC 1XTRA 2JAQA 2GZHA 2YOHA 1OF1A 4GSYA 4A0RA 3I8XA 4PHFA 2QY9A 3C5HA 5G53C 3MJHA 4KFRA 2JJ2A 3I61A 5JS7A 2ZSEA 1IAQA 3OEHD 1AZSC 5D3MB 4C2UA 4TMZA 3FVQA 4IHQA 2ODEA 4DDTA 4LRWA 3TAHA 3LH5A 3K0FA 4PQFA 1K8RA 4RZXA 3W6PA 3VX4A 3IPYA 1G16A 5LBIA 3NXSA 2VIIA 4DIDA 1G3UA 1KGDA 4AIIA 3WYFA 1W0KA 5EE0A 1JALA 4U02A 4LYFA 3K0AA 4TN1A 2W6IA 2WMOB 5EQTA 1Z0JA 4NHOA 3KB2A 1ONBA 2NQ2C 2GK7A 1UM8A 2GA8A 4TTRA 1XD9A 3CW2A 3GJ6A 2V7QD 4LHZA 3CF6R 4PZZA 1NVUQ 5FI0B 1GRRA 1UPTA 3MWJA 3DKVA 4Q02A 1YR9A 2OAP1 2B7CA 3NDBB 4YLGA 5IF9A 3ASZA 5BXQC 4QGGA 3QPWA 4MITA 1R0XA 3WP0A 4P3YA 2QP4A 4CDGA 4TLDA 4X8OA 2DR3A 2ZETA 1D2NA 3QVUA 1N6IA 5FBQB 1QG4A 4RFSA 3VR1A 4ZO4A 1YZQA 1LNZA 2EVWX 2QGZA 1KI8A 2QSYA 3AF4A 2G6BA 2GEUA 2JGNA 4Q47A 2ZYTX 3MD0A 1E0KA 1T3SA 4NONA 1Z08A 2JASA 2ODWA 4DLXA 3ZH9B 5FL3A 5FTJA 2IEYA 1WRBA 1LY1A 3BH7A 1ZMXA 2WPDD 4PSKA 2HV8A 4RCYA 4MGKR 3ZVNA 4PO1A 4C0JA 2YWHA 2DCUA 2JLWA 5KPJA 4L9SA 3GJ0A 4LC0A 2XEXA 3C8UA 3LQQA 1TX4B 3PV0A 3GCGA 3RNLA 3ZQJA 1AZTA 3ZZTA 4N0EA 2YOFA 3AP1A 3OIYA 4BFVA 4HAZA 2BCGY 4WBSA 4NYMQ 3DKPA 4EPYA 3RANA 1ZC3A 2G88A 3RAPR 2XSZD 2XXAB 1M8PA 3THXB 2C9YA 2RGEA 3KTAA 1VCNA 2A5GA 4FW9A 3E1SA 1T4GA 4DB2A 3D31A 2PLRA 3AKEA 1UBGA 3BB4A 1Z5ZA 4H9GA 1E4VA 4CGZA 1B0UA 4XSHA 5J4HA 1G21E 1KYIA 1ESNA 3ICEA 1N5IA 2G0TA 4B3CA 3A1TA 1NG9A 3QJYA 1S96A 5H8WA 2ZE8A 4IJMA 5J4LA 4AKIA 4A2QA 4OK3A 3ZVMA 2EFGA 2ZROA 3U4QB 3HR8A 2OCAA 5FBLB 3LO5A 3FPAA 3VMFA 2AD5A 2ZSDA 4B3XA 1SKYB 2H1LA 1E2LA 2OCYC 1AQUA 1U8AA 4PC6A 3TW8B 4KSBA 4NKRA 1Q3TA 1OYYA 4FMBB 2C5LA 4DSOA 2GZDA 2QROA 4QHYA 3KJIA 4MA4A 5DHFA 4MYHA 3GLHE 5LB4A 2OCPA 2CCGA 5JWHA 5AJVB 2NTYC 4KFTA 4B33A 3SYNA 2QL6A 4IDPA 3MJRA 2GETA 4R7ZA 3SBEA 1G3QA 1Q1BA 1JBKA 1OLOA 4TL7A 4OHWA 4L16A 2ZXUA 1NVWQ 2ZRAA 4PPFA 2FMXA 1E2HA 4QOSA 4HDOB 4KYIB 2DY1A 4A2WA 1E9RA 2GCNA 1NN1A 2OE2A 5DISB 4N0DA 4HUQB 3VU9A 4BLPA 2XGJA 1GZSA 2GCOB 4DT1A 3WP1B 3ADDA 4F91B 4KLNA 4C30A 1K5DA 1W5TA 1TL7C 1KTVA 1NBMA 5DYIA 3RRZA 2OT3B 5TB5A 2DB3A 4AY2A 1G3MA 4Q01A 5FBVB 1PUJA 2QAGB 5HCIA 2VA8A 1NN5A 3L2OB 2P6NA 4NCNA 2O8BB 2KJQA 3W3AA 4JLMA 1ETUA 3C7KA 3FYHA 3M4YA 2JIZA 3QSYA 1E2EA 3OEEA 3P32A 3VFDA 1R8QA 2IWRA 4QM7A 1DTSA 1PV4A 3U3OA 3FDIA 2VF7A 4L15A 2FFAA 4QL3A 3HU3A 1FX0B 4Q1BA 5AK0A 2YWFA 1A4RA 3GEHA 5E7IA 1XEWY 1TEVA 2CHGA 3GLFA 3EG5A 4QHSA 2G9NA 1KJWA 1G19A 3G82C 4IVRA 1OH8A 1G4UR 3BS4A 5CLQA 4PAMA 1OSNA 1XWIA 2LKDA 1A2BA 2B6HA 4HATA 1OXVA 2BOVA 2XTMA 5CIWA 3EWSA 4Q9JA 1F2TA 3QOFA 3EX7C 4PQRA 2MSCB 4NYJR 4OQNA 4BFYA 1NLYA 4DCUA 3WMEA 1QHGA 1ZIPA 3GJ5A 4MRSA 4RVCA 4PC3A 3RRYA 2R6FA 3WRYC 1J2JA 5P21A 5GADl 3LW7A 1DAKA 1KO1A 1RIFA 4PX9A 1EG7A 4Q4AB 1GWNA 5SZKB 5EUMA 4KBFA 3D7MA 4OK6A 4PO8A 2HYIC 3PFIA 3KKOA 1BOFA 4Z8XA 5HKKA 1NLFA 4RD6A 4BLTA 1N5KA 3BJIC 1ZJ6A 2C95A 3HR7A 4KJZA 4HLQB 5EE9A 1A2KC 3UATA 2JLXA 1RRCA 4NYIR 5CJPA 1P9WA 2IUTA 2W0SA 2FFQA 3RSLA 4PR0A 4ZCLA 3CRQA 4Q7KA 1D2MA 2FE4A 1F2UA 3PEYA 3CKLA 1E98A 2FZLA 1XXHA 3CZQA 3AF2A 4Q4HB 2DFTA 3K1JA 3DZ8A 3BE4A 3R20A 1JB1A 1WMSA 5TV2A 2PCJA 3NHAA 3ZDQA 5LD2C 2WWHA 2RGBA 3OE7A 3RRMA 1M1YE 1II9A 3BORA 3QXCA 2ERYA 4M1MA 1CS4C 4HZUB 4YMVA 2GJ9A 1KO5A 2F7SA 4JSYA 4MGYR 4RCZA 4CRWB 5F9HA 2QT1A 2NIPA 4M1YA 4DZZA 4EFNA 1Z6TA 3AEZA 4FMDF 2HCBA 3C4JA 2AN9A 2ZI5A 1ZIOA 5J47A 5CLLA 1ZRHA 4DUGD 3EZ2A 4C9BA 1W0JA 5FOXA 1CIPA 1PUIA 1FQKA 1OIWA 1TF5A 1HY3A 5TXGA 2Q0HA 4FMDB 3X1DA 3L8ZA 1R10A 4Q00A 1HQCA 3SS8A 4OQFA 4UNPA 1BS1A 5FUVA 3QIAA 4UXJA 3TLXA 4CF7A 1XPOA 2DWOA 4URXR 1JR3D 3PVSA 1UF9A 2FOLA 2W6JA 2ZJAA 4M1SA 2ORIA 1Q21A 1KSFX 4LI0A 1QBKC 5FOTA 3R8FA 1SVLA 1VIYA 3QKSB 1Q44A 2WZQA 3E2IA 1KNXA 3TSZA 4A2PA 5JSZA 4CEHA 4L8GA 1UBFA 4MKHA 1N6HA 4US1R 1MKYA 1YZLA 2GAOA 1J70A 1ZM7A 1KAGA 4B35A 4Q03A 4MKGA 1NSFA 1RYHA 4OQLA 1ZINA 4QJ3A 2F43A 1Z07A 1G8PA 2VBCA 4KLZA 5JZVA 1E32A 1NF3A 3T1OA 4Q66C 2IXFA 5KHOC 1ZVQA 4FWTA 3VR3A 2FSFA 1E3MA 1Q57A 3BAFA 2HEIA 5H68A 3P20A 4JLOA 3Q8XB 4LYAA 5JJLA 2KE5A 2CHQA 2Q9AA 1XEXB 3H1TA 4D0NA 1G9XA 2WJGA 3B1XA 1NN3A 3CRMA 5DHAA 1GL7A 4NPHA 3NH6A 4GNKA 3WRXC 1OXXK 3VQTA 2W00A 2YV5A 2BIFA 2DHRA 2RH5A 5D3MA 5HE8A 2PT7A 1DG3A 2RGCA 5KO2A 2OHFA 2C96A 2GRJA 2YWGA 5JRJA 2JJ8A 3A1SA 4POAA 1P6XA 4TLAA 1YE8A 1OYWA 2WWGA 1N0WA 2E87A 3A8TA 4N1AA 5IHPA 4E03A 4V0NA 4YONB 1G6HA 1CF4A 3AF1A 4B43A 5FPTA 1EFRD 1DE0A 4PC7A 3AUYA 4U5XA 3QBTA 4LJYA 1P73A 1KO7A 3OHMA 2CEAA 2Y8EA 4A8JB 5GVSA 1E9DA 3HU2A 5LPNA 4PPQA 3LLUA 4KYUA 3VR2A 2JLUA 4A36A 2C99A 4FCTA 1CJVC 3WNDA 3F3YA 3S1AA 3KQLA 1B23P 3QKRB 1FNMA 5UKDA 3I1FA 4CZ2A 1L7VC 3PUVA 1JQLB 4IDNA 4P4TA 3KUCA 1DEKA 3FFBA 2D7CA 4P0TA 4Y0VA 3BRWD 5C46F 1YJ5A 2H92A 4LOAA 3FMIA 2P65A 3H0KA 621PA 2OAQ1 821PA 4ACBA 4BRWA 1KSGA 2GF9A 3ZGXA 4NE2A 4LBVA 4DEYA 4G5GA 4OJQA 3UPUA 2XZLA 2YVUA 4A9AA 3ECCA 2CNWA 1VG9B 2QMEA 3AF3A 1TPZA 4M9SA 5FUWA 1X3SA 2BMDA 2BVNA 1KDTA 1OJLA 1MABA 4Q9KA 1Q1EA 3O8RA 2GEVA 4QM6A 3A1WA 1BH2A 3B1WA 2I1VB 3U3MA 4XD7A 3ASYA 5JWRA 4RD2A 3PEVA 4GDFA 1S8FA 2HXYA 4KVGA 1BYIA 4JVSB 1RKBA 3PUWA 4BFZA 4LYHA 4LHVA 1TEXA 2IYQA 4EFLA 3WBJA 3THXA 1U8YA 4IDOA 2VSOA 4O3MA 2GWHA 4R71A 3CBQA 1AA9A 2QORA 5FBRB 4Z8YA 2Z6VA 4GL2A 2PEYA 3VX3A 1E69A 1KI7A 1A1VA 4AYXA 2X1VA 3FMFA 3D3QA 1U94A 2Q21A 5GVRA 1N6OA 1KOFA 1Z63A 4KITB 5B64A 1NRJB 2RGNA 1IN5A 2ZR9A 4TQ9A 4D0GA 2O8FA 3PEWA 1W4CA 2J0UB 3IDQA 3OIUA 1G7TA 2JCSA 1P3JA 3H4MA 2ZRLA 3LFUA 3QXHA 4K46A 4M1WA 4NBSA 3ZS9A 4E09A 1Q22A 4D4LA 4QGHA 4EPVA 3NWJA 1GAJA 2O8DB 3RS3A 4XVQA 1OXTA 3QUSA 4LV6A 3CO5A 4RKEA 1AS0A 4BLSA 2BMFA 3DOEA 2VSFA 1R2QA 4I4LA 4CEIA 3PITA 2ZSAA 3CRW1 3GQBA 3NBFA 2PMKA 2XZPA 4URZR 4MRVA 1JXMA 3K9LA 4XTRA 1FNNA 4IW3B 3R9WA 3L43A 3IHLA 4DEXA 3A36A 2RGGA 2QUZA 2V4ZA 2XX3A 4Q9HA 4R9UC 1N25A 3U7GA 3KDSE 4GI7A 1ZUNB 4MYCA 3TW4A 2HXSA 3EXAA 4LHWA 3A58B 4ZDWA 3TH5A 4TZ6A 3CX6A 4IOKA 3PCRB 4RKFA 5J5CA 2IA5A 4YDSA 2BKEA 2ZJBA 2ZAMA 1Z06A 3JVUA 4IXNA 4Q1EA 3QPUA 2FDCA 2J41A 2BM0A 2VEDA 3AF0A 4EQ6A 1WDTA 2ZRCA 4X8LA 5FPYA 2QQEA 5FOUA 4DCSA 2ZRMA 3TUJC 1L2TA 3O8BA 1E1QA 2FN4A 2A78A 3L82B 4TLCA 4M9QA 1I2DA 2V8OA 3A4MA 4V0LA 1IXZA 4ZIRB 2ZI6A 2CCKA 4G0NA 2Q6TA 2KSQA 2UKDA 2QE7A 3K0CC 4XVRA 1DELA 3RC8A 3K9GA 2QU8A 4CEJA 1C4OA 3IUYA 1NVXQ 2HUPA 1DAFA 3FKSD 1OV4A 1OW3B 1ZD9A 3V4RA 1RJ9B 1Z8FA 4TL6A 4WZBE 1CP2A 2QPAA 1IM2A 2ZRJA 4Q7JB 3BK7A 4HI0E 4MUAA 3OF5A 2YYZA 1XTSA 1Q12A 2IYSA 3R7WA 4NCHA 1H8EA 1OPXA 1NY6A 1TUIA 2R44A 1KMQA 1II0A 3JZAA 4PAQA 4JLNA 3V9PA 5JBQA 4OI0A 1E99A 4KAXA 2ZU0C 4B3FX 4OHZA 1Z0FA 4IEIA 1TU4A 2AFIE 2WTUA 2X19A 1OH6A 2RHDA 1XD2B 1FL9A 1HURA 2WWFA 5KDOA 5HTKA 2J0VA 4UJ5A 3WY9A 2ATXA 2A5DA 2R62A 3CPJB 2VL7A 1ZU5A 2X2FA 5G3ZA 2VP9A 2QRZA 4UNNA 4XWAA 1Z6XA 3CNLA 3B2EA 3EPJA 3RC3A 4PO9A 3ND9A 1V5WA 4GOJA 2B7BA 4Q7MB 1CR1A 3F8TA 1A5TA 2Z0MA 5DI9A 2O0HA 2W2VA 1YRAA 1RPZA 2QMUA 1AQYA 2ONKA 1OKKD 2J7PA 3SDZA 1XPUA 1NBME 2CJWB 3LDAA 1CR2A 1GSIA 1HV8A 1LB1B 4HLUA 5KPDA 3BFXA 1P7CA 1KNQA 2ZE6A 1DG1G 1SULA 2DWPA 1BMFD 4HZUA 2P5SA 5CYOA 2LCFA 2VSXA 3ZZUA 1O87A 2ERXA 4KO8A 2C04A 2ZSFA 2PEZA 1T6NA 4JT4A 2NO9A 1Z28A 3NKVA 2V6IA 5SZIA 5E7MA 3TKLA 4D82A 5EJEA 1U0HC 3KQKA 5KSPA 4Q4LA 4TWZA 1TTTA 3P4YA 1XJ0A 5LDDC 1KI2A 1GOTA 1UAAA 3LQRA 3W3ZB 1KK1A 1G5PA 3PENA 4JS0A 3QF4A 1P2TA 2OG2A 1P62B 1SVOA 1W4AA 4V03A 5TDHA 2GJSA 2JJ1D 1KI3A 3ZYCA 2WM9B 3SN6A 3CB4A 4HB3A 4US0R 2XTNA 2QP3A 1WB9A 1R8SA 3NC0C 5FTLA 4GPTA 4HUTA 2PT5A 3FGNA 1E1RA 5AUPB 3B1YA 3SHFA 2G0NA 2P6RA 1DOAA 4F4JA 1ZP6A 3QKSA 2AD1A 3THYB 2PJZA 3K8YA 1KI6A 3JZMA 2O52A 3RVBA 4NL4H 1EFCA 2BBOA 2QMHA 2H18A 3TNFA 4HAXA 4QHTA 3AVUA 4JBXA 1LW7A 2J46A 4Q4JA 4EJSB 2O8EB 1UFQA 3M1IA 4DLUA 4BWYA 4A15A 1UDXA 3OAAD 1VHLA 2IYTA 1I4TD 3KX2A 1JEDA 1UKVY 4AURA 1H8HD 3BXZA 4OL0A 3MWYW 3VNUA 1OHHA 1U0JA 1F48A 2HLDD 2QN6A 1H65A 5GJWC 2JDID 4BFWA 3U6KA 4GMXA 4II7A 4YMWA 4HLUC 5GJBA 3DEFA 4NZYA 3LA6A 2WKRA 3SNHA 2AL7A 3NBYC 4PZLA 3NEYA 4Z54A 1VG0B 4Z1MD 4YXWA 2GK6A 1XXHE 4DLWA 5CK5A 1R5BA 1BYUA 2BM1A 2CL6X 4BFSA 1ZCBA 3LX5A 3IEUA 2D4HA 2VHQA 1AS2A 2J87A 1PVOA 3SR0A 1T3LA 1W2HA 4ARZA 1GG2A 3FOZA 3OIVA 4JT2A 2CE7A 3BWDD 2DFLA 1XD8A 4H1UA 5EE3A 5FR2A 3VAAA 3U44B 4JZKA 2XNDA 2FA9A 3HDTA 3ZJYA 1P5ZB 2ZIAA 2HF9A 3ZVRA 1OKKA 1AKYA 4F38A 3A4NA 1RC8A 1WBBA 1W4BA 3VHXA 3ZIAA 3BFKA 1AK2A 4QG7A 5FTNA 1WE2A 3AP3A 4MDEA 2RGAA 4O2RA 2Z4RA 1RZ3A 1Z47A 1W44A 3EWAA 1D9ZA 3FE2A 3ZLJA 1JXOA 2PX0A 2PLFA 3Q85A 1F3OA 1X8JA 1P9RA 2IYUA 3MUFA 1GNPA 2IYLD 4UJ3A 4TTPA 1JI0A 2C9CA 3LWNA 4CT4B 4IRUB 1G7CA 1KMHA 3GFPA 5JRZA 4M4SA 3K0SA 3QKRA 4WAUA 5JEDA 2Z43A 1GRNA 2GXSA 3GLGB 3NC1C 2X2EA 1P60A 2V1UA 1CLUA 2OCBA 2YZ2A 4QFMA 4MKFA 4B73A 4S35A 2YC2C 1IN6A 3G0HA 3BGWA 4KODA 3B1VA 4M8NE 3VKGA 1LF5A 2NO1A 1S9HA 3U3JA 1UKZA 3QG5A 2W2TA 3TUIC 4PQYA 2AXPA 2QBYA 5F9FA 2V1XA 1I4DD 3OEHA 3IQWA 3SJZA 4GP6A 4BFTA 2FG5A 4Q18A 2E1RA 2NO7A 4JVMA 3B6EA 4NYJQ 4FI3C 1E9AA 1IHUA 4GOKA 4FCVA 1MV5A 5A4JA 4OJKA 5FOVA 1XDBA 5GJCA 3NBXX 2AFHE 3LBIA 4WW0A 4C0QC 3KJEA 1COWD 4R2IA 1DVRA 4G5OA 1S3SA 4I1UA 2DPXA 2MSEB 4N3NA 1LVGA 2BC9A 3IPXA 3X2SA 2V7QA 2GXAA 3IBGA 4GZMA 2QTFA 4M9ZA 4OI2A 1YZNA 4Q1DA 3W8RA 3AQ4A 1JECA 2CVFA 1CJMA 4DSNA 2GF0A 1FTNA 3DDCA 3NTUA 3K70B 2W58A 1L4UA 2PZEA 3K9NA 1QHIA 2P3SA 3SE0A 1XEWX 2WWXA 2OEPA 5FPHA 5H70A 1ZCAA 2EFCB 5CB6A 1E2NA 4ESHA 1XJCA 5B58C 3CONA 4NCIA 1ZNZA 4NCKA 1X8LA 2FSGA 5DI3A 4LJ4A 2OSBA 2PL3A 2JA1A 4B32A 5FH9A 4ZDJA 4KU4A 1O3YA 4EDHA 3THWB 5JCPA 5JJKA 2K5UA 4JBWA 1EWQA 4I1SA 1VCMA 2WPDA 2YHSA 3MFYA 1YZGA 3HJNA 1ZM2A 1U98A 1M7BA 1TADA 2R8RA 3FMPB 2WBLC 4RJLA 1I2MA 3AM1A 4ZDIA 5L3QA 1SVMA 1TQ4A 3EC2A 4DLTA 1Z0DA 3HP1A 4NYMR 1V43A 3LVRE 1OIVA 2D2FA 3NIBA 4HB2A 1ZNXA 3FKQA 2Z5FA 2VF8A 2CVHA 1HQYE 2XSZA 5C2JB 4UNQA 5FBWB 4CIDA 1JR3E 1N2CE 4QBIA 3RS0A 2BV3A 2F9MA 1NLZA 3ETLA 3BB3A 1E79D 1G17A 5JI2E 4BZPA 2ORWA 2H8KA 2WVJA 3A37A 3TQFA 4Q1FA 3WYAA 1UBCA 1VCOA 4A1FA 4C7OB 2ZANA 1RE0A 2WJJA 3EA0A 1GFIA 2EYUA 2O8CB 1NY5A 3QY0A 1NMYA 2CLDX 3DPUA 3I72A 4BGDA 3ZVLA 2WHXA 3CF2A 2R2AA 5GJVC 3TVTA 2J0QA 1W49A 1SHZA 4OHYA 3X1YA 1EFUA 1T5LA 1Q0UA 1KKMA 1YR8A 1XBTA 2F55A 2ZRDA 2A30A 3EIEA 4HB4A 2WJIA 3J81k 2ZR0A 2BDTA 1IXRC 1FMLA 1COWA 1CEEA 1G8FA 3A1VA 4AI6A 4AKEA 2J9RA 4LHXA 2ATVA 3IO3A 3LLMA 2IWHA 3TAUA 3REGA 3UG6A 2RGDA 4LDJA 2ZITA 2FEMA 3KXIA 5EXPA 3IIMA 3NG1A 4QNMA 1ZBDA 4DDUA 2NPIA 3SU8A 2YOGA 1FPMA 1MO6A 2ZI4A 1UEIA 2C8VA 4M9XA 3QNUA 4B2LA 1XP8A 5KYKA 2IC5A 1Z6AA 1Y63A 1DAMA 4O2LA 4ASUD 2JLZA 2ZYUX 1X6VA 2ZR7A 3B1ZA 1CU1A 4GFDA 4AYWA 2IF2A 2AX4A 1SKYE 1P2VA 1N6PA 2QM7A 3UWKA 1HT2E 2WOJA 4TMWA 2CE2X 3MAAC 4OYHA 1XJQA 2OZEA 4JYCA 1R0YA 3B82A 1W4RA 1AIPA 1OFHA 1US8B 3MWKA 3OFND 1GDDA 1QHHA 1SVWA 1S3GA 2LKCA 1GVNB 2J3EA 3AV0B 3QXSA 4P4SB 4PFSA 1OFUX 4Q19A 1N0VC 4HEJA 1KDPA 1IN4A 4M1OA 4JJKA 3CF0A 4DDVA 4IDHA 4LK2A 1E94E 5JEEA 5L8VA 3MGCA 3T06B 3PUZA 1T8UA 1S9DA 5CJ2A 1Q1QA 2YINC 2C9OA 1G3RA 3CPEA 1TF7A 2OFWA 1P2SA 3BB1A 4TLEA 4WZAE 5KOYA 5IRCD 4Q1CA 1ODFA 2Q3HA 4DRZA 2G83A 4PPNA 1ZM4A 5DN6D 5L3SB 1YKSA 3T1TA 2WIAA 4V0KA 2A9KA 2IYVA 1R7RA 2P0EA 1DPFA 2C98A 1D6JA 2FGKA 1BIFA 3SQXA 3W5IA 2R6AA 1MOZA 2F1JA 4C0KA 5G3YA 5C1BA 2W83A 3TR5A 1YHNA 4G01B 1Z2AA 4A82A 5F98A 2PX3A 2GTPA 2QA5A 1QVRA 3ZS8A 3K0FB 1HH4A 3V4FA 4E5UA 1EX6A 2OFXA 3FTQA 1JR6A 4XH9B 1D9XA 1KI1A 4KHZA 1PLKA 1E2IA 2ZRPA 1R4AA 2VTKA 1FMJA 1VMAA 2IS2A 5FL7D 1KJZA 4TSFD 5E3HA 4PHTA 2D74A 5EP3A 3HPQA 3K0AB 1K5GA 1R6BX 1T5IA 3AKCA 3L0PA 3LAWA 2R9VA 3GD7A 3QI2A 1K6MA 2WICA 5CIQA 2AXNA 4HB0A 1EX7A 1HEIA 1TMKA 2GJAA 5B2ZA 1GTVA 3BIFA 5KSYA 2FF7A 3PUYA 1JQJC 5JI3E 3UWOA 3U7EB 2LWIA 3AGPA 4A0HA 1SVKA 4JIMA 1NJGA 3EASA 3AVYA 4BZQA 5K8TA 3M6AA 5FUYA 2C77A 4TYNA 1CR4A 3I5XA 4QKQA 2QTVB 1J99A 4RFSB 1VYTA 2FH5B 1AGPA 3IBYA 2Z4SA 3VHLB 1OFTA 4B76A 2WAYA 1SKQA 2VP2A 1RVDA 1BO6A 3IKJA 1GKIA 3M0EA 4PAOA 1X86B 1NJFA 4BFXA 1RRFA 2ZRGA 2QPTA 1PLLA 4DUGA 1NVVQ 5AUOB 3K70D 5JLJA 5J40A 4W5JA 5J4KA 2ZYVX 3VR5A 2D2EA 3Q7PA 4DSTA 3C5CA 2MMCA 3GPLA 5AJXA 2QMOA 4DHEA 3SOPA 1KSJA 4DLRA 2BBSA 1JR3A 5BN3A 3H84A 2WSSD 1N5JA 3KQUA 1ZAKA 5A5GA 3KTAB 2WAXA 2QZ4A 3LXRA 3KKQA 2GEDA 4KBGA 4BE7B 5FPKA 1QHYA 4G5QA 4B75A 3GLIB 3LW8A 2DYKA 4CT5A 2DFNA 1KIMA 1P2UA 3K53A 3KJGA 1JEEA 2RAPA 3CX7A 3U7FB 3I3SR 5JJIA 3RRNA 1QZXA 4BEBA 3ADKA 4RZ2A 4G5SA 3PUXA 3MWLA 2D62A 1DAGA 4QNRA 2AK3A 4G5RA 2QPOA 3BBPA 3O8CA 1DAHA 4V0OA 2XXAA 4B2PA 2ASEA 4AG6A 1CXZA 1TQ6A 2J5XA 2QRNA 3LXXA 3KQNA 2WJHA 2QTHA 3R9XA 2XOKD 3REFA 5B57C 1RRGA 5KNBA 3FHCB 1QHNA 3CRRA 2AKAB 3KB1A 1SXJB 2N1BA 2IW3A 2WWYA 2V3CC 4JVNA 1U81A 1SQ5A 2GKSA 2XB2A 4JLBA 1PZNA 2QGNA 1YR7A 1XMVA 5KNCA 3SC3A 5DSZA 3FMOB 4B44A 2J0SA 4M0LA 1GKYA 2ZJ5A 3C16C 4UKDA 4I1OA 1QVAA 3F5FA 4OHVA 2C78A 4JKYA 1KAOA 4LWZA 3U4QA 3PXGA 4D26A 2FSIA 4LZZA 3ZD7A 2OM2A 1ELOA 3K0CA 2EU8A 5SZJA 3IILA 3KZ1E 4D81A 2IL1A 4L5BA 2PBRA 2GNOA 4BEJA 3AVQA 1M34E 2SHKA 1NKSA 4QC2A 5EXTA 3CIOA 3B78A 3VU9B 1EFRA 1LF0A 1W46A 4DT1B 1KK0A 5KSOA 4AK9A 4EPTA 4CW7A 2ORVA 3TBKA 4RZUA 3Q7QA 3QKUA 4QRHA 3TK1A 6Q21A 5EUQB 4ZCMA 3CNOA 2CLSA 4BECA 3EPLA 2WJYA 2WOOA 3HYTA 2REOA 2XJ4A 2X77A 4M53A 3I62A 3Q5EA 421PA 1N6KA 3Q9LA 2FX3A 2IYZA 1OH7A 3P26A 3A6PC 2F1HA 4HUQA 5HCNA 2VP0A 2GCOA 4LJ8A 5LD2B 3UANA 4RD4A 2N46A 3NBZC 2VP6A 3CWQA 3GLFB 1ANKA 3SFZA 1IONA 2G3YA 2ZE7A 4TT3D 2QAGA 2YWEA 3QG1A 4URWR 2ZUCA 4ILEA 4MGZR 3IIKA 4HLDA 2O8BA 3EZ6A 4HAUA 1F2TB 1N3BA 5CITA 2CK3D 1FTSA 1IBRA 4DCNA 1EFHA 2GJ8A 2FNAA 3SHWA 2O5VA 4IFEA 3RWMB 3BH6A 1HTWA 3CR8A 1KY3A 1IOZA 1G291 2OUKA 5DNYB 4MRPA 1FP7A 3N70A 1KKLA 2JLRA 1FX0A 1XRJA 5LB2A 1CBUA 1R5OA 3DM5A 1XCMA 4IXMA 2VP4A 1IJFA 2A3RA 3Q5DA 2ODNA 1N0UA 4Q7LA 3FHTA 2B92A 3T1QA 1RW4A 2REXB 4IFBA 4AWXA 3I32A 4WIAA 2EFEB 2CBZA 4DIEA 2P67A 5IK2D 3H2YA 4OBEA 1XB2A 3LNCA 4B3GA 2OBLA 2JJ2D 4M1KA 2NOAA 2HF8A 1OXUA 3EZ7A 2VO1A 2IHYA 1AGRA 4PTLA 3SJCA 1KZGB 4Q4AA 4B34A 1ZD8A 2I1QA 2JLQA 3B5JA 3MRSA 1FZQA 2HJGA 4MDFA 4Z51A 3GEEA 1GRQA 4W9MC 1KI9A 3F0TA 3OZXA 1EESA 2AK2A 1W0KD 4P32A 1ZU4A 2AR7A 1CR0A 4L4UA 5DYGA 1ESMA 3UXMA 2X8AA 2ZRNA 3OIWA 2W6ID 2ZS8A 3T1VA 3X1XA 1KDOA 3A1UA 2QAGC 3O8DA 2ZUBA 5KDDA 1YU9A 4JL5A 4MUBA 1XMJA 3FB4A 3PR1A 2HT1A 1LS1A 5TMPA 3RS4A 2ZI9A 2QQ0A 4V02A 4EFMA 1DAIA 2EFDB 4Q4HA 2AHOA 2YKGA 1AKEA 3IIJA 2WJVA 1EFTA 2FPKA 4FXPA 2CHVA 1N6LA 1ZM9A 3MLEA 2HCJB 3NH9A 5AJZA 3TRFA 3QBVA 3AKYA 1N6NA 4Q9LA 1NIJA 4C3ZA 1CKEA 1Z0AA 5AJYA 2IUUA 3B8HA 2QNRA 2VLIA 4ZI2A 4Y0AA 2ZM5A 1WCV1 1ZNYA 3C14C 4NCJA 5H1YA 2VQSA 1G3IA 1W47A 4GOXA 3RYTC 3CWZA 5J4VA 5DIFA 2V55B 4LJ9A 4WXRA 2P5TB 1WA5A 5JWOA 1KSHA 2OILA 5JSZB 2NZJA 5KSZA 4CEHB 1T9HA 1Z6YA 2PZFA 2RGXA 3ICQB 4P33A 3DVLA 3AVXA 3B13B 1LS6A 2ANBA 3KFVA 2VH5R 4Q48A 3CUEF 1R0ZA 1NMXA 1UJ2A 2ZJ2A 2WV9A 3KUDA 4KXFB 3W34A 4A4DA 2EW1A 121PA 4LUCA 1X8KA 4DCTA 1XZPA 1Z2CA 4URVR 4IDQA 4ZKDA 2RHMA 1SVSA 2WKQA 5FOSA 2ZU6A 4DDWA 2ZAOA 1KI4A 2ODBA 2W2XA 1E96A 1M6NA 1VECA 5BYKA 4FCWA 1KK3A 4AG5A 1KHTA 1LTQA 3T5GA 2QT0A 4F92B
chains in the Genus database with same CATH superfamily
2ZSUA 2AQ8A 5BWMA 1CYEA 3GJTA 4MXDA 2PU5A 3ESZA 5G2OA 3ZH2A 4BUJA 1PFGA 1P9NA 2ZBPA 3BDIA 2FP3A 2R85A 4RF2A 5AH0A 5JC8A 2IS6A 3DLCA 1CQZA 3B6KA 4WEOA 4C5CA 2A5JA 2WT8A 1VHTA 1Y9EA 3I9OA 4UREA 3WBKA 4ZHQB 2W8BB 2D54A 3DC2A 4QWWA 1ESEA 3QE4A 4XARA 1E5DA 5LJIA 4JLDA 4QQNA 2OORA 2QUAA 5K3EA 2Y0PA 2PSEA 2CXHA 4L8YA 4NE7A 4P22A 3QX8A 3T4EA 1JPJA 3B9QA 1P0FA 1YS1X 1Z2OX 2HTFA 3NM5A 1SUSA 1A82A 5ANRB 4G0ZA 2PS9A 2FV8A 3AUXA 4ND4A 3QXXA 4X97A 3I3OA 2ONJA 3TQTA 5E1MA 2R60A 2OBMA 3SYTA 2VDKB 4C6RA 1A9OA 5IBRA 1SZPA 1N8KA 2Y2UA 1DQZA 2X2OA 4D3XA 1FSFA 1H85A 4OHFA 2Q5FA 3QLTA 4ZPXA 2QSJA 4IIVA 5CB8A 1JLSA 4RGYA 4IYJA 3EGXB 1RHQA 2JEOA 4FK8A 4OHXA 2PKQP 2V6JA 3HVUA 3KELA 1NYLA 3ETEA 3JR7A 4AUKA 1O6CA 1JAHA 3C6QA 3AEYA 4ZI7A 1ZM3A 3D9QX 2C54A 2WM2A 3D6TB 2A0FA 1WVMA 3NBKA 4FZRA 3E5HA 4D4JA 1OXBB 5FUBA 1G20E 1X2EA 2ASVA 3LUJA 1YQGA 3UAOA 3NLLA 1NXQA 2VYFA 3OEWA 1Z5WA 2PUTA 3ZWKA 5HXAA 1QHFA 1E3JA 2P9CA 2ZUDA 3E70C 4X3PA 2HUNA 1XA0A 2AEMA 2PFKA 4U2BA 5F12A 1BMFA 4TPKA 4CGYA 4BO5A 1NBMD 1E9EA 4GKVA 4ID3A 2OFOA 4S24A 2V54A 4DMLA 3ORRA 4RLSA 5BQ3A 3IULA 3RABA 5AW3A 1QQ7A 4D3FA 1QO7A 1Z7EA 1TZCA 2DTXA 2EJVA 1Q20A 3MTJA 4FQ8A 4JKIA 4TXMA 1ZD2P 2J3QA 4L4SA 5AP9A 1J8MF 1AF7A 3GAFA 5ITVA 2A1UA 3O4VA 3LPDA 4QRDA 2OFFA 3MZ0A 1R0BA 2A5FA 1KYYA 4BRZA 1JEJA 2GN6A 4IUBS 3WDMA 2QJFA 4EIWA 2HU2A 2NGRA 3GRFA 1NXOA 2Y0BA 4K9OA 4REQA 3RV3A 2I6TA 1Z6ZA 1EJ0A 3VI4B 4K6KA 2G36A 2OV2A 1JIXA 1LLDA 3H83A 3ZY4A 1NHWA 1R6UA 1FSSA 2CLFB 2ZI3A 1Q0LA 4UD2A 5BQOA 4JVOA 2JLYA 3HTXA 4QPNA 1EE2A 1RAIA 5AM4A 1GL9B 1USIA 1H6AA 3ACDA 4GMDA 4CM6A 3U1BA 4GIBA 4OM7A 1UXJA 3U5TA 1QX3A 1HO3A 2PRYA 4ITRC 3O4GA 1HSOA 3JSXA 1CQXA 5BO5A 5KUTA 4KUEA 5DBEX 5WRFA 4L50A 4ARSA 3AIMA 1U9IA 1GRCA 3ECAA 1X1BA 1Z22A 2E9SA 2I22A 3GCXA 3HCDA 3LLCA 4GP7A 4PXSA 3VZBA 1PZMA 1Y3DE 3A2NA 4FFLA 1OBCA 1WHSA 4LJLA 4Y2PA 4KLRA 3ZHYA 4DREA 4F2HA 1Y5MA 1JPNA 1S2MA 2HQ1A 2XPCA 3O8QB 5LQSA 4DM3A 2EL7A 3R7AA 5BXYA 6NULA 3HY4A 5LYJB 3PE6A 3OAAA 5G0TA 3UVEA 5HFJA 1Z0KA 2ZYGA 1ZD4A 2O8FB 4LBYA 1K6IA 4PYLA 4EKDA 4JLSA 2HLDA 3W2TA 3HKDA 2VWPA 3ROTA 5JQGA 1N2SA 1OFGA 4LBZA 4GUDA 1WF3A 1U3CA 1ID1A 4LX0A 4ACAA 3HYRA 5HKKD 4LECA 4XWYA 3TQCA 3TZCA 1KJQA 1XA3A 2YNMA 3H8WA 2ZRIA 4Q6BA 4HS9A 5ALFA 4C1NA 4E1VA 3TI9A 3KPJA 5JHHB 1NBAA 4NYIQ 5FADA 2OCKA 1T0HB 3OCCA 2ZBDA 4K9NA 3WLKX 3QOXA 3KKEA 2D3WA 2N47A 4PXAA 5LC1A 1PGJA 2BT4A 1TM4E 3TR0A 1CRZA 3EODA 1YE3A 2PQ0A 3FNRA 1P4AA 3EVAA 3LF1A 4IIHA 4LXGA 4P08A 4R69A 1S8OA 4TTVA 5DDIP 5EIFA 1P44A 2QENA 3H9QA 4YFYA 4BJHB 1ABBA 1X74A 4JNCA 4EZBA 5F1OA 2I2BA 1EXMA 3KJXA 4QICA 2BWJA 4OA5A 3SJ7A 1F2DA 3IT3A 1KO8A 1OB2A 3PA8A 3E53A 1RACA 1ISHA 1X0XA 2CMKA 3IJEB 1GPDG 1FRNA 1T0UA 3COPA 4J3JA 3GMTA 2HHCA 1ITZA 3ADBA 1W2GA 2AOVA 4YRNA 5BYBA 4H1VA 1IY1A 4K8OA 4QYTA 5K3AA 4DIUA 5CXXA 3H9BA 1M75A 4CU5A 1ODJA 1ORHA 5EVCA 4E22A 2EGHA 1SY7A 5BR4A 4MCJA 3QU5A 3BXEA 4OP3A 3TAXA 1SCUB 1SQ6A 1W0JD 4YB8A 4NVRA 3STYA 4AJ1A 1T1RA 4UUMA 4RGQA 521PA 4X6UA 2TS1A 3NNNA 4JCOA 3CV3A 1A0OA 1MO5A 1MV8A 2O7QA 1F8GA 3K4PA 2XNSA 5DJ5A 4MI3A 3W6NA 1WU7A 1YDEA 5BY2A 2H7VA 4BJ3A 2EKQA 2PD6A 4F3KA 3DGEC 3E27A 3GGOA 1NE2A 1MT0A 4TRMA 1TNDA 1DBQA 2AEEA 3NORA 5ALZA 1PUXA 3B6JA 2FAXA 3QPVA 2NU9B 2IOFK 2BFNA 3KOZA 4RTQA 1I4LD 1VJDA 2ADFA 3QK7A 4PSUA 3ZD6A 1LI4A 1Z2NX 3G6WA 3TRKA 3WVNA 5CDFE 4HDKB 3ET4A 2BH2A 3QXJA 4Q1AA 5E2IA 3WQQA 2QD2A 3PQ2A 4F8JA 1YS6A 3RU7A 4ECEA 1T4BA 3QYAA 3RADC 3WGZA 3I5YA 2YVLA 1DCMA 2DSNA 3KQYA 4CU2A 4W8GA 5U1PA 1T3GA 1O6BA 4WFQA 4RIIA 3BMCB 5D3QA 4A4DA 3QEBZ 1XYGA 4DLLA 2BJWA 3AUJB 4I1YA 1KAEA 2W0MA 4DJ5X 4A0FA 4GBMA 4CL0A 3LY5A 1UC5B 3N5CA 3L8GA 4WJZA 4BX9A 1CUSA 2NVBA 4ITUA 4MYUA 4R1MA 2PIAA 3QFTA 2HQOA 5D6NA 1LVHA 2W6ZA 3WR5A 1JJBA 3OM9A 3AJDA 4DWOA 1G7RA 1IVYA 2QI9C 4G25A 4RA6B 4HAVA 1TF2A 2B4YA 3E3MA 4PW0A 4LVOA 1HFEL 4WZ6A 3ZV7A 4B0PA 5JNRA 2DEUA 1H66A 2IHBA 1VHJA 3NNSA 2R6DA 2ZRQA 1CDZA 4R31A 3HI4A 4F12A 4ZANA 1VIVA 3R5XA 2VHJA 1F5NA 4RVUA 3QVVA 1DQSA 4JP8A 5DV9A 5T41A 1P81A 2FP4B 2C4WA 4KKVA 2XKAA 1PWYE 3EA5A 3RGWS 3ZU4A 3CF4G 5H3HA 4BMXA 1LDMA 2YZNA 2JLSA 3FMVA 2YTZA 3HYSA 3ZDFA 3C87A 3I28A 3MCTA 1KBQA 3R2JA 5CFQA 3PB3A 4TMXA 1DGQA 4R40A 3RVSA 4O4LF 1DS6A 1ML4A 5J4YA 2XMDA 4EECA 2DFKB 1R5NA 2RAVA 1YZUA 4WY5A 1A5AB 3I58A 1JZTA 2NNLD 3H2BA 1XD2A 2I3GA 3HU1A 3PNMA 3QXGA 4I46A 1FSZA 1PQYA 1GUZA 2NV2B 3ND8A 3L93A 3QE0A 2FWIA 1WZCA 2P2LA 2X9GA 4KQEA 1SUIA 1YMVA 5AW7A 2R4UA 2XCRB 4MQ6A 1FS4A 2JEZA 2JIDA 2NO0A 4HX5A 1UKBA 4RLFA 3EBPA 4LGYA 1Z5PA 3DTTA 3U37A 2NG1A 3R3WA 4A6EA 3K8OE 1NRXA 1U2PA 2BGRA 2Z95A 1M1NA 3QKTA 1FVOA 5FV4A 2D2VA 4TLBA 2NUBA 2YY7A 5TEVA 2ONYA 4WY2A 4NJOA 2REBA 2J4DA 2J09A 1DV2A 1EHYA 1PJRA 3L79A 2FOXA 3OCVA 1LZKA 1LGYA 1T1IA 2JBAB 1DAPA 2H0RA 5DBOA 3U7JA 3D6NB 1NUUA 3T35A 4CKCB 5C7LO 5HK9A 2RHHA 2Q1SA 3CGGA 4P7FA 4HGQA 1U0GA 4IOJA 1WY5A 2CNKA 5EPOA 3I1YA 1UADA 5FNVA 2O4UX 1O6FA 3JARA 3DEKA 5IFKA 2ZDGA 1XTJA 3MBIA 3M33A 4HQNA 1K8QA 5EP1A 2FVYA 3EC7A 1NYRA 2JI4A 4K8RB 4FB5A 4FR5A 5AHKA 5JD3A 5JY6A 3COWA 1XPJA 1YAJA 2HREA 4L6IA 1XU4A 2P2DA 1U2DA 2MYTA 3CU5A 2EGGA 4W4TA 2I91A 1YKGA 2AWNA 5THXA 3FYTA 2Q3JA 2DBQA 3CH4B 1N9GB 5AXAA 1QRSA 1GGNA 2GILA 2VPQA 3HWX1 1P1CA 5KTMA 2ZYRA 4JI5B 4EYKA 4K05A 3WIVA 1YR6A 2AFRA 1YMQA 3KL2A 3MJCA 4O3FA 3ZY3A 1E9BA 4EMTA 1VZ3A 1PEYA 4IIEA 4Q4JB 3OOHA 1HE1C 1NR1A 2IYEA 2C57A 2R1TA 3EXIB 4LY6A 2P8SA 3IA7A 2YCBA 3CA8A 3L0BA 3DLHA 4YUVA 2F8SA 1WUIS 2FN9A 5REQA 3RNOA 3AFNA 3WYGA 4Q3AA 3L1VA 1I3NA 3EK2A 1NMZA 4X1KB 2GCPA 5CA0A 1EDDA 3TJMA 1U2TA 4WHMA 3N2YA 3DEZA 4Z49A 4MQFA 5CFZA 3FM9A 4MWCA 3W5DA 1JG6A 1TYBE 1HE4A 1USWA 2Q9CA 3UJ8A 1ULTA 3N2NA 3B48A 2JD2A 4NAHA 4WVFA 3RS7A 1L7RA 2YIDA 3TX2A 4BO1A 3AMVA 4R05A 4GQAA 2ZREA 3DAYA 3NYIA 5DT9A 5FOQA 5KNDH 4MINA 1Z5OA 3ETHA 4PGHA 2W4IA 3HKBA 4MEAA 4WBXC 1FFHA 4FZ3A 5C34B 3HY6A 3OSZA 2IHJA 1SELA 3E7WA 3HJRA 3LRPA 3RARA 1ZK2A 2HMUA 3NHKA 2C8JA 3ZLBA 3LWZA 5G40A 1KZ1A 3FGOA 1J0DA 1P2DA 3A1FA 2FZEA 2GBLC 4JI1B 3O84A 3OTIA 2RGUA 1KY2A 4R3NA 5ELXA 2FEOA 2Y66A 1DEXA 1ZIYA 3QBEA 5TQJA 3VHXB 3CZ9A 5A2QA 1VL6A 1VKOA 3OFNA 3SHOA 2RH4A 3WK5A 1KQFA 1CULC 3ES9A 1DB3A 3LS2A 1M0WA 3LVQE 1U0EA 1UFOA 1V1JA 2OV3A 3G1WA 5K05A 4EA9A 4FIZA 1M1XB 1V35A 5ALEA 3QE9Y 2H0AA 1WAMA 5D5PA 3UEOA 1E2FA 3ZWVA 5LVAA 3E3NA 3A6HA 1OY1A 5SV2A 5IS2A 3UMFA 1LSSA 1ZN7A 3JQCA 1KMHB 2X41A 4ZVKA 3EGXA 3IP7A 2N42A 3ITEA 4FYMA 1M6EX 1X1TA 3P1JA 1G8KA 1U99A 3WB9A 3M5WA 1E0AA 2HA3A 1TT5A 5DM60 1V9LA 1N5OX 5C1OA 1KAHA 3C41J 3ITNA 4U3JB 4O2AB 4KN6A 2W11A 3EA4A 3IO5A 4MWSA 5HRCA 1FXWA 3RREA 4AWBA 2HWXA 2C03A 2PANA 3BXGA 1VFNA 2B5VA 3KZKA 1KXJA 4MI1A 2CDNA 3TCXB 5ICMA 5FPPA 1Y9DA 3FNEA 2D5IA 2FLWA 3H17A 1M2GA 1CVLA 2H17A 1QLHA 4TVBA 4ENVA 1E1NA 2VBIA 3JALB 2ISCA 3EUFA 3EVBA 4EB8A 2E6UX 4FINA 4TYWA 1XEFA 1C0IA 1IULA 3Q12A 1V41E 1KAQA 4NTZA 4PLYA 5CUQA 1ZYUA 3BG5A 1EVZA 4KQIA 1H4VB 5JQGF 2H8GA 4KMRA 1GQRA 1K6JA 3KZCA 1OQAA 4O0MA 1KOGA 1XVAA 2WWWA 4TSFA 4X1YB 2CNOA 3ELWA 3WMGA 3UUWA 3O47A 3IPAA 4M0MA 4MRRA 4EAQA 1KJYA 5KQRA 3RUPA 3WYCA 4BFUA 1E2JA 1I3OA 2IW1A 1X39A 4F6RB 1UXIA 2FXVA 5HW0A 2NSJA 1HXHA 4D25A 2WYHA 4NENB 3Q87B 5GQSA 3HSKA 3ZD8A 4UULA 1ZOSA 1EA7A 1KO4A 3E9YA 4FOTA 1J8FA 2XE6A 3SEFA 3TLEA 4BBZA 5KKNB 2IHNA 1XCPA 4L9RA 1GV0A 3HN7A 3FUVA 4OSOA 1VJ0A 3TVDA 1KZ7B 1H8ED 2W2OA 2GRUA 2OXRA 2P40A 3GWGA 5FWYB 1W88A 4HMPA 4PHGA 1P4RA 4B3HA 5AVZA 1W1IA 3C4QA 5SYAA 3I6MA 3K94A 1IZ0A 2PLWA 3KQHA 2VDWA 1W36D 1XAHA 1KVUA 2UUOA 3OZ7A 4JL6A 1PHPA 5H5JA 1THGA 1XRMA 1YL7A 2ZI7A 4KFUA 4ETWA 2MYPA 4XIIA 2ZBVA 2HDNB 2RHTA 1JKJA 1FRZA 2EZ8A 1NDHA 2Q2NA 4PPGA 3ZU6A 5IM4A 1IZ9A 1NXWA 2DZDA 2H31A 1CUHA 2VRWA 4C21A 5E95A 1P61B 2XITA 2Z8YM 4DQUA 2OD2A 2RJOA 4W5OA 1NSTA 1AT1A 3EIQA 1NPTO 2FW8A 1J7KA 2P2CA 4WUVA 4XYGA 4KNVA 1RWMA 1CE8A 2VAPA 1U8CB 1PJTA 2GSDA 1CG6A 1YC2A 4OREX 4XA8A 1RBZA 4B6RA 4YMLA 2HLNA 5L3QB 1E4OA 1E6CA 2FMIA 3AEQA 1TQDA 3SWWA 4TYQA 1YRBA 4ALJA 2JCBA 4TQUS 3FCXA 4IWXA 1G5TA 2WSSA 5ISMA 3KYIB 3THWA 1OFIA 4IKEA 1YBFA 4AROA 1DKLA 4RIGA 3LZDA 3PGKA 1QIKA 1T3ZA 4RZ3A 3O3MB 3VPAA 1ZWLA 4PCVA 3IE1A 2H4HA 1P7WA 5BMOA 4UHFA 1WCWA 3U6BA 3FFTA 2OBNA 4J4TA 5AUQA 4A6XA 1FMFA 2WSYB 2YJNA 3TSWA 3PJGA 4D9GA 4DR4B 5FULA 1IY2A 4JK3A 5FPSA 3ONWA 2AFVA 1GQYA 3Q7SA 1UZAA 3CTMA 1GQOA 3LKVA 4NDZA 1PTJC 3G9ZA 2WLSA 2OBBA 3N39C 2NO4A 2H16A 5IEBA 3X44A 4G09A 4M9RA 4NABA 4ZV7A 4BO8A 1J22A 1KC1A 2Y77A 3CTPA 4JBNA 3CZPA 1EP3B 3LV8A 3OLXA 1U0OC 1WDWB 1WNTA 3PPWA 5JRDS 3IQXA 4XLTA 4YWJA 2OA0A 1Q2XA 5GZ1A 1P4SA 5B30A 2A9FA 2DHEA 3K2QA 3KR0A 2ECKA 3ZE6A 1XHFA 3PEUA 4LXHA 3HCCA 2PHZA 1YDHA 2CL7X 2F3TA 2I4NA 3ADOA 1W4LA 1GNRA 2QAJA 3ENNA 2Z30A 4K9SA 3OTHA 3OJEA 4D4MA 2BMJA 1F2UB 3ENQA 1W52X 3KFXA 3DKRA 2XMSA 1XXHB 2IE0A 3VO2A 3SEAA 3AB7A 5GM2A 1Q1AA 2H65A 3UG7A 4BS9A 4RD3A 2PH7A 5K8LA 3ANXA 4TMKA 4AYTA 2ZE5A 1EGVB 4UUAA 4LHYA 5ADVA 4R1PA 3IEVA 1I94B 4CN9A 3CSUA 1F6BA 2XDAA 1K75A 2W93A 3R5SA 5A5VA 5FLXA 4XR4A 1I33A 1OHHD 4AC9A 1KJNA 2Y1CA 2D1RA 2O1EA 3M5DA 4ZV4A 2WKSA 5TS3A 5FEMA 3B60A 2DT5A 1Q7CA 3BSSA 3G9QA 3N2IA 5BNTA 3ENVA 2RH9B 1MNAA 2WA2A 2NXEA 4R1SA 1HYQA 1R15A 4N5DA 5AJWA 2XWBF 1DARA 3FYUB 3HWWA 2CHEA 4NR0A 4PX5A 4ND8B 2P9HA 3L9WA 4TTQA 4B84A 3P5SA 2EFJA 3AIOA 2YWRA 3ENZA 5LXTB 2J7KA 1E0SA 3TJRA 1ZUWA 4D80A 1XQVA 2J85A 3H2JA 1NUHA 4DV1B 5EXSA 3INGA 1E61A 3VHQA 4J2OA 3SQWA 5FNVF 1C9NA 4IOLA 4NZNA 5EP4A 3VPCA 2O5EA 4FHCA 2XNDD 3GZNA 3MMPA 4L57A 3AI3A 3N0VA 2O0JA 1U3GA 4MWZA 4M22A 3LKBA 1ZUHA 5FR1A 2PXHA 4WKOA 1GU0A 4XYLA 2J5BA 3CNEA 1KJ9A 3E2PA 4LE1A 4P7JA 2AZMA 4NOMA 4V38A 4MYTA 5FPQA 4I3HA 5A03A 1CY8A 5KS2A 5F3WB 2I4RA 3A3OA 4L0QA 4KI7A 1TTQB 3KIPA 1EIZA 1AK1A 2ZUEA 5LLSA 1FUYB 1KFCB 1OH5A 1XDUA 4BMCA 2GN2A 2WKPA 1GYPA 1V26A 6GPBA 4HSEA 4HYYA 5I7AA 4ABYA 3DHVA 1G5FA 1E7QA 4KIGA 3AHGA 3ZDEA 1JIQA 1QYIA 3ABRB 2IHKA 5CB4B 3B85A 3KEQA 3RUDA 4W5HA 2IXGA 4BPRA 2RB5A 3GLFE 1UDBA 3M6VA 4G0VA 3DUFB 4JODA 5T5QA 1GPUA 3R9IA 1U5CA 1KZ9A 1G41A 4DYDA 4JUBA 1PTKA 1DAEA 4WFIA 3ZHRA 2QMYA 2YWDA 2DWQA 4F9GA 2XBUA 5K0LA 2A67A 4H16A 5CA0F 4GOND 3U60B 1XTRA 4D02A 4GWKA 5BVHB 4FGKA 1OF1A 4RGBA 4A0RA 4DQXA 1T9GR 3JWEA 2QY9A 2QX7A 4UZFA 4CQLB 2QV0A 1O54A 1SCKA 4QUBA 3DL4A 1ML3A 3OEHD 3R0IA 1GADO 2X1HA 3KE8A 1M8KA 3X2EA 3O8NA 1UWVA 2CUNA 2VT6A 2DGDA 3OT1A 4RADA 4ZODA 4DDTA 4LRWA 4A5OA 1CQJB 3QX9A 4N47A 4H4EA 1A8QA 4WKNA 2IOFA 4PZAA 2VF5X 1IBSA 4HO1X 3JU3A 4M87A 5DW0A 4JUIA 3GJQA 4C2AA 3F2VA 5KC8A 3HB4X 1G3UA 1KGDA 3JVEA 5LOVA 4GI2A 5C8YB 2QJOA 3WYFA 1O94D 1U7OA 3K16A 1BMDA 5EE0A 2GK4A 1YB1A 4NG5A 4PO3X 4LWQA 1BE1A 4FGUA 2ZR8A 3EXIA 3PE3A 4UMDA 2W6IA 4XYBA 3RTEA 4ZGGA 1TA9A 2Q2WA 1KEVA 5AESA 4FFSA 1JEYA 1UM8A 4IDEA 3UJHA 4R0MA 1FVXA 2VZ9A 4U4AA 3H5NA 4TRNA 4DPMA 4ZOLB 4BQIA 1Q11A 2V7QD 2WA1A 1ETHA 4PZZA 1H6DA 2EDAA 5JG7A 4RK6A 5K7SA 4PEVA 1A27A 5FI0B 4Q02A 3VR4H 3DKVA 4EA8A 2G8LA 1FF9A 2OAP1 4QD3A 3FNHA 2VJNA 2VOJA 3GIDA 4OIMA 1IQUA 1JA1A 1XNHA 5EJ2A 5JH7B 4QATA 3DBHB 1DKRA 4MITA 1R0XA 4MV4A 2YVKA 1C4KA 1RWWA 3CEHA 3S7ZA 4CDGA 4TLDA 3A9CA 4X8OA 1PSWA 5FFNA 2ZETA 4ZEOA 1MC5A 1U4OA 2QD3A 1AVTA 3MT8A 1SOAA 1Z8NA 1AV7A 2QTVA 3I2FA 3PKZA 3UHOA 3VR1A 3LYHA 2QSYA 3LA8A 4G84A 1QWSA 3TTUA 5C4IA 4EL0A 1ZG3A 1FXWF 2JGNA 3OJOA 4OYYA 4RO0A 1MENA 1T3SA 2AG5A 1Z08A 3OQBA 4OB8A 1QCDA 4LYDA 1TKBA 4M37A 1IL0A 4D9CA 5CPFA 2PWZA 1ZGGA 5A3JA 5NULA 3CZ4A 4ZT2A 4QYSA 3GVIA 2UXBB 1KFKB 1ESCA 5MFPA 2HV8A 2DHCA 2D8AA 3PXAA 4RMGA 3OD1A 4PO1A 5HM6A 2ECOA 3DUWA 3U09A 3ZVNA 1O57A 4G1EB 3GJ0A 2Q5QA 2WK1A 3LQQA 3GCGA 3KD2A 4Q3BA 4ZZ2A 3ZQJA 1OFVA 4XPZA 2EKLA 3VI3B 2YOFA 3HCBA 3NHFA 1ZPDA 2BCGY 1HYBA 2QW0X 3A6JA 3KCNA 4K6GA 3ROZA 1QVZA 2QUJA 2QTBA 4AN4A 1QO0D 1R6DA 2P27A 4A10A 3RANA 4FDVA 1NJ2A 2FX5A 4Q15A 1O5TA 3EGVA 3RT9A 4F4FA 5BSGA 5KC9A 7GPBA 2PPLA 1CUVA 1NU8A 2OCDA 3I01A 4YUYA 3TF5A 1M8PA 1Z56C 3AF5A 4FLMA 3HVHA 2RGEA 4HHEA 4PFJA 5EWMB 1RPJA 2YVAA 5FHRA 2WFZA 3D5TA 3KVNA 3ADPA 2IH4A 1DIBA 3SY8A 2RE8A 1ZONA 2XYGA 1MP0A 1Q19A 2WG2A 3D31A 3FGZA 4PTZA 1GGKA 2ODPA 1U63A 4ZZIA 3QMPA 2R8EA 2JIOA 5H7XA 2DPYA 2CZQA 2NXNA 3NIWA 4XSHA 5EIAA 4B45A 1FFXB 3VZSA 4WPGA 2I4OA 1N75A 2G0TA 1WEKA 3A1TA 4INPA 4PINA 3EVDA 3CGWA 4ML3A 3BK1A 1NW6A 4Q3NA 1L5VA 3IBCA 1SJ9A 1P5RA 2WNHA 4N6OA 1HFJA 5H8WA 2ZE8A 5J4LA 2I6XA 3L1KA 1QE0A 3F5MA 3MGKA 3JALA 3UXHA 2X4GA 3ZVMA 1NI4B 4IDGA 1H4SA 3K32A 3P0FA 3Q6IA 3CB2A 3NW9A 4I4CA 2CYAA 1OD6A 3LHDA 2VHZA 2JHAA 4MWOA 2VJBA 3ME5A 3LO5A 1LNSA 1HEYA 2E2WA 4N8DA 3UHAA 2JGFA 3V7WA 3VMFA 2AD5A 1A95A 5AKZA 1SKYB 3WZ2A 2H1LA 1E2LA 2MYUA 3INYA 1U8AA 4PC6A 3TW8B 1AV6A 4MPJA 4X1YA 4B80A 4C4OA 1CS0B 4I5EA 1JJIA 1TC1A 2FUG1 2ZB8A 2XB6A 3EGOA 3OTQA 3HUEA 1TC2A 1WUTA 3P97A 2CCGA 2ZDQA 4JN6B 4YO8A 5FXMA 1Y6JA 2NTYC 5JWHA 4AS1A 2XUHA 4G07A 3MUEA 4KFTA 1DIOB 3OZRA 4JQYA 1R74A 4ZVVA 3MJRA 4LZPA 1HTTA 3JQGB 1OLOA 3HEMA 2DJIA 3BQ9A 1XP5A 3A7EA 4FCCA 4UTVA 2B82A 2ZXUA 2DAPA 2ZRAA 2G9UA 3A06A 2FMXA 4XB6B 4HG2A 2QV7A 2DY1A 3WI7A 5K8JB 4LXIA 5LFAA 2R5WA 3UJ7A 1EFDN 1NJ1A 2JPDA 2YUIA 4GLOA 4HEA6 1RMQA 4DT1A 2P4QA 2PYDA 4CF4A 2VDQB 1EA5A 3PU6A 5E38A 1QZ3A 2CJYA 2H4YA 4EAAA 1Y8ZA 3BZUA 4FC6A 2DY0A 1G3MA 3H8SA 4JR1A 5E2AA 5TB5A 5IWAB 2MT9A 4GM1A 1CDDA 5B36A 2QN7A 1ZW1A 3UZUA 1C9MA 1SC9A 2P3OA 3HHEA 5JYEA 1TRKA 1UM9B 2UZ1B 4JLMA 4L8VA 4HL6A 3T9DA 2C61A 1UBJS 4CKEB 2JIZA 3WWZA 4G5XA 3OEEA 3RM3A 1ORDA 3T7CA 4BOYA 1U7PA 3GI1A 3LP5A 4KN8A 1GAEO 3EFBA 4FR0A 3FDIA 2XYRA 1Y4UA 3U3DA 4L02A 5KVQA 1RJGA 1P3DA 4O1MA 2O2SA 1A4RA 5E7IA 2CHGA 2VCEA 1EZ4A 3KTDA 2V97A 4QHSA 3C3JA 1RI2A 4IVRA 4P83A 1L5ZA 1G4UR 2B5OA 2VNIA 5A4KA 2D1TA 1XWIA 1A2BA 1LCIA 1KJ8A 2FZKA 3IAXA 3IOMA 5CIWA 2YL2A 3SGLA 3DW3X 3EWSA 5ECDA 1IBCA 4XI9A 1TM2A 4FE3A 5IC6A 3BIJA 3KU4A 3ODPA 3DDZX 1NLYA 3RRJA 4B3RB 1P4JA 3ZGOA 4QA9A 3FJOA 1FDWA 3ESAA 3I8OA 3OF3A 4BHTA 1BU8A 2XQIA 3T5BA 2VHWA 4N3BA 5BUQA 1RYEA 1DAKA 1RIFA 4JJFA 2X1LA 3FZGA 1FFEA 3CWCA 2OC4A 1U4SA 1GWNA 4KNWA 5SZKB 4DMGA 4KBFA 1B15A 1GA1A 3L01A 5DFAA 4RS4A 5D5QA 1RXEA 1LQ2A 3O1HB 4PSDA 3U1TA 3Q3IA 4BLTA 4CDRA 4C5BA 4HLQB 4QXQA 5EE9A 4YRJA 3TQQA 3UATA 3EJWA 3I9V1 4NYIR 4BDTA 2JLXA 1PK8A 2HEGA 2W0SA 5HQ3B 4C2BA 5CVVA 5AI4A 5GINE 4ZCLA 2IPAB 3T9FA 1DRVA 2JFXA 4RYDA 2C59A 3SDSA 1VC2A 2RAUA 4F46A 1F2UA 2C3OA 1A50B 2GKGA 4UE2A 4NMLA 1Y80A 2B1JA 3TINA 3U4DA 1XXHA 3JZIA 2OOKA 2XNKA 2Y1KA 1JDPA 3DPSA 1MU0A 3DOCA 3N05A 5LA6B 3WO0A 1O97C 2W2KA 4HDSB 3R20A 3NHPA 1JB1A 1ZIXA 2EP7A 3B5IA 4J90A 4OFBA 3DDHA 4XZ3A 2RGBA 3BE8A 3HA7A 4CETA 3HB1A 5JDIA 1UZNA 2OWEA 3OD5A 1L7XA 1KBZA 2ERYA 3S2IA 1JDJA 2Y05A 2Z1NA 3F7NA 1H2EA 1JPVA 3DAHA 4JDPA 4K6CA 1EE1A 1VP3A 4MQEA 4PRYA 4TWAA 4UBKA 3WGYA 4CRWB 1V5FA 3K6SB 3LYLA 4W8HA 1S5PA 3MHTA 2YZGA 4D9FA 4QYIB 1QUFA 3AEZA 3MW8A 4OQYA 4UM9B 3NV9A 4HJRA 4UTXA 2FMUA 2AN9A 2K7ZA 1ADCA 1M6VA 2YJ6A 2OYRA 4MA5A 1U3DA 3EZXA 3HR4A 1EMDA 5CLLA 3TZHA 5CU7A 4D1YA 3BT7A 1E1DA 1CUZA 4MJ7A 5EKTA 5FOXA 5EHZA 1NP7A 4FHDA 2JI7A 4EVIA 3VYUB 4CE6A 5A5EA 1HORA 1SC3A 2AR9A 1AUXA 4X20B 3SS8A 2OVBA 5DNUA 4S04A 4MVJE 5IYZB 2V3WA 2VDJA 2P0AA 3GHYA 1P2GA 1WXGA 2DWOA 3RIEA 4URXR 5CCBA 1TUBB 2IVFA 3BEDA 4G41A 4UCQA 1M2FA 1Q21A 5FOTA 4MWEA 5D01A 3R8FA 3C5VA 1G2OA 4DG8A 1VIYA 2QYTA 1CP3A 3VV2A 3QKSB 4I9HA 1XZHA 3TSZA 4A2PA 4CEHA 4AY6A 5CIYA 4X1IA 4GE0A 1CD5A 2CDBA 2XCLA 4I55B 1MTOA 4US1R 1YZLA 1QF6A 2GAOA 2GR9A 1J70A 3W78A 2OK8A 4MX8A 1X1CA 4H7DA 1ARZA 3WSTA 6YASA 5LOVF 5K4HA 3ZHBA 4E7OA 1ZINA 3UHJA 4QJ3A 1EINA 4QQRA 4EZEA 3OH8A 2F17A 4KLZA 4HNSA 1V6SA 3OZFA 1G2PA 1RYYA 5EIOA 1NI5A 4Q66C 3BIWA 4GF5A 1AB6A 3T1OA 4CTMA 3VR3A 3ULKA 5KHOC 4RDIA 3U4MA 2P8JA 4QGSA 4W5RA 4DANA 4KWHA 1NX6A 2KE5A 2CNLA 4GOMD 1XEXB 4LWPA 2GBPA 3FOEC 4W9NC 1Z17A 2ZIXB 3B1XA 3A1DA 5EGSA 1NN3A 4NBRA 1TAHA 3NH6A 2YW9A 2VJCA 1I32A 1YTLA 1X1DA 1K7SN 2QHXA 4MRAA 4ZI7F 2GPSA 4QLBA 3P19A 1L5QA 1YB7A 2VT3A 1QU2A 5K9ZA 4F04A 5EZQA 2NZUG 2OHFA 5F23A 3VVCA 5JRJA 5KVAA 3T0FA 1SCIA 4UM7A 1P6XA 4NC9A 1TE2A 1TYZA 4TLAA 1C1DA 2BH9A 2OBFA 2WWGA 3Q3HA 4LDZA 4ZTZB 3A8TA 3D59A 4OLFA 5IHPA 5C5IA 1RWVA 1JA9A 1I14A 4JXKA 5IAOA 2NSLA 4AF8A 2WU8A 3E22A 1XU9A 4FM9A 2ZCJA 5FP0A 4DV5B 4Q6WA 1A2QA 4PC7A 3S99A 2GEJA 3HV2A 4C87A 5JSHA 4V3BA 4MUFA 1P73A 3FPHA 4JI8B 1V7PC 1E7WA 4C0XA 1O2DA 4PPQA 5HX7A 1ADBA 1BCSB 3HCFA 1PEAA 1AQNA 2NZYA 3Q9UA 4FCTA 1JEOA 4KYTA 3S1AA 3IB3A 3JYPA 3IAHA 4I36A 1RIIA 3QKRB 4JP1A 4LWOA 5UKDA 3I1FA 1QANA 1L7VC 2JB9A 1TOAA 3PUVA 2GERA 1VJRA 1YUNA 4O4HB 4P4TA 5AK5A 5T3UA 7ABPA 2D7CA 1XTTA 3KJQA 3KEFA 5DXAA 5B37A 3ZDAA 1OBOA 1RYMA 3KXPA 3DP9A 5C46F 2RHCA 3WLIA 4LOAA 5DXFA 621PA 2OAQ1 3AG5A 4D44A 3R75A 1ST3A 1WJGA 1DC5A 1ATIA 1HDRA 3TOVA 1XDSA 2B2XA 4I6JA 4NE2A 4V2UA 4DEYA 2A0XA 2GO1A 4OJQA 2XZLA 4MW9A 3OZWA 2XECA 5I4BA 4BQRA 4D9JA 4EF4A 3F7MA 3DXXA 4ZK6A 4WE3A 3JQBC 3U7QB 3O94A 3T1TA 4A6PA 1MABA 4KH0A 3D4PA 4HSGA 5ALKA 5JOQA 4QM6A 4QX6A 2WD7B 3A2LA 3H8JA 5ESRA 2Q50A 4MV1A 2BP7B 4P54A 1EHIA 3UXEA 1GO2A 1TIKA 1TYCA 4GS5A 4MQUA 4F85A 5LZ7A 5JU6A 3PXCX 3E48A 2PM8A 3FOCA 1BYIA 4C3VA 4DDUA 4GXRA 3T9BA 3FRHA 4KGDA 5BSMA 5DX1A 5TEWA 3WXBA 3ORSA 4LYHA 3CO0S 1HOXA 4YPFA 1U7ZA 1TEXA 5DBIA 1OROA 3D0OA 3WBJA 2JKZA 1QU3A 5JCOA 1H6BA 1U8YA 5HIAA 4ZGBA 4Z7JA 1TKAA 4IDFA 2B37A 3CBQA 5FBRB 4FBLA 4GL2A 5F3DA 1ZOOA 3KFLA 1PT8A 1E69A 4EY4A 5A5FA 5AOCA 3TZLA 1JHQA 2YYYA 3V8VA 2GN0A 4E13A 3EQ9A 1ZVVA 1Z13A 5CAEB 3TGWA 2JGLA 1X7YA 1OFUA 4DFDA 1ISGA 2J4FA 2VCYA 3IOBA 3PFKA 2QI9F 4O4IF 5B64A 2CB9A 2I9PA 4FW8A 4RIFA 2WPNA 3DC7A 3BSWA 4R2KA 4K86A 4D0GA 2B4QA 2PSHA 3PX2A 1T8YA 5BN5B 3I2GA 1GU7A 3BZWA 3DEYX 1G7TA 1N2BA 3LFUA 4M1WA 3ZS9A 4HYEA 4AJ2A 4EW1A 3ANMA 5ECWA 4OAOA 1SEPA 4GI1A 2QSUA 2H6EA 3LPLA 4M83A 2O8DB 3FH0A 3PC7A 4L27A 1YJBA 3C7AA 3CO5A 1AS0A 3FUCA 3N3AC 1IRIA 4Y6OA 5BNIA 1ECFA 1R2QA 3UQZA 1RZVA 2R1ZA 1B42A 3HH8A 1X7HA 2M9MA 2CLHB 3FR7A 4GMGA 1OBFO 4MCHA 2PMKA 1JLRA 1UWLA 3E5NA 3M4NA 1L5OA 1Z8HA 1ZH2A 2JAHA 4NZPA 1SIUA 1Y3CE 2DQ4A 3GNLA 3JATB 3K9LA 1FTGA 2QXYA 3J7AC 3L43A 4J0KA 1JFFB 4FQ5A