2IEZA

Crystal structure of mouse rab27b bound to gdp in monoclinic space group
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
185
structure length
178
Chain Sequence
YDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYDSGKAFKVHLQLWDTAGLERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLIGNKADLPDQREVNERQARELAEKYGIPYFETSAATGQNVEKSVETLLDLIMKRMEKCVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras-related protein Rab-27B
publication title Structure of the small GTPase Rab27b shows an unexpected swapped dimer
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 37
structure length 178
sequence length 185
chains with identical sequence B, H, I
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2006-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2iezA00
3DHWC 1R5BA 3SFZA 3TR5A 3LQQA 2BEJA 1I4DD 3RS7A 3QOFA 3LLUA 2W2XA 3U3OA 5AR1A 1EX6A 1ZYUA 3QY0A 5HR5A 4HLQB 2WKPA 3B1ZA 4MUBA 2ZU0C 4TMVA 5FR1A 4C0JA 5H8WA 4BLSA 1E2GA 1LB1B 4URZR 1KMHB 2YKGA 1FP6A 4UJ5A 3THWA 5EXTA 2QE7A 3AP3A 2G88A 4IFBA 4TLCA 2IYTA 1E1RA 1KZGB 2NG1A 3EZ6A 2FFQA 3TK1A 3OFND 4D4KA 1NBMD 2G1KA 4OHVA 8OHMA 3U7HB 1XP8A 1YRAA 3RS2A 1NG1A 1Z28A 4TQUS 1P2VA 2QI9C 3OAAD 1CLUA 1RPZA 3E2IA 4US2R 4Z1MA 4MDFA 3RAPR 3TUJC 1ZP6A 3EPHA 4UKDA 2QMUA 2IYWA 1YQTA 3CNOA 3PUYA 4P0TA 4E03A 2Z0MA 3AKYA 1G20E 4Z8XA 4OQXA 3LLMA 5EP3A 2FDCA 2J46A 1YVDA 2JLQA 4JLPA 4D81A 1S3SA 1EFRA 3QEJA 4B6EA 4BLTA 1VHLA 1S9HA 4LHVA 4AYTA 4XVQA 2O8BA 3OEHA 1SXJA 3GJ8A 3K8YA 4F4CA 4URYR 4PPNA 1T3HA 1AZSC 5CDFE 1D5CA 3AF3A 4OK5A 2IS6A 2J9RA 3BXZA 3WYAA 4Q48A 1W2GA 1CJKC 1NBMA 2QTHA 2XX3A 2OBLA 4EKDA 3C7KA 3ZS9A 2FSHA 1FNMA 2B92A 3RRYA 1XJ0A 2IXEA 1UJ2A 4CEIB 3SJAA 2WM9B 2QM7A 2C98A 1DPFA 3SJBA 1O87A 3FYHA 4LHXA 2W6ID 1WE2A 1QHGA 2IL1A 5L3QB 5SZJA 4E5UA 4BASA 3WBKA 5HKKD 3CH5A 3IQXA 4JLKA 4BLRA 4DEYA 4WXRA 4CEJA 2H5EA 1EGAA 4MITA 1G3UA 4W5WA 5H1YA 1X3SA 4W5JA 2IEYA 2F7SA 4X8MA 4FN5A 4RZ2A 2J0SA 2L0XA 5FOTA 1LFDB 2I4IA 1IM2A 4JSYA 2GAOA 4EPVA 4QBFA 2QT0A 2ZR7A 3BFVA 1H8EA 4BFUA 5DSZA 3LW8A 2GZAA 2IYUA 3VX4A 4M53A 3HU1A 2XXAB 1W2HA 4C9BA 2QP4A 4KU4A 2WMOB 4LBVA 3L0OA 4FI3C 3R9IA 1V5WA 4IOLA 1RE0A 2OSBA 3CNNA 1N6OA 2LCFA 1G7TA 2C8VA 4L8GA 4XD7D 2F1HA 3CR8A 3KQNA 2F9MA 4W5HA 5F98A 1E4VA 1G7CA 1ZUIA 4JLMA 3HYTA 1XEXB 5IRCD 3NBYC 3SHWA 3K1JA 5BW8A 1JXMA 1DEKA 1K6MA 1S0UA 4UXHA 3CZQA 4B44A 3W6OA 3GLIE 1UDXA 2F43B 2DWPA 5D3MB 2HXYA 3HWSA 3AVOA 3BH0A 2IT1A 3Q5DA 4O25A 421PA 3AF0A 1OV4A 2ZREA 1N6RA 1M6NA 3O8DA 3Q5EA 1OFTA 1JBKA 2NPFA 1UAAA 3A1SA 1Q22A 4DLYA 2FFHA 3GEIA 1NMZA 4PO1A 3K70D 1U0JA 4FMDF 4DDWA 1E9RA 3LO5A 3PR1A 4B74A 4Q03A 2CDNA 2YVUA 2ZVQX 4GOXA 5CJ2A 2WVJA 4O3MA 1SXJC 2C2HA 1TQ6A 4NYJR 1R5OA 1E2HA 4QBGB 2ZRGA 4KBGA 3TLXA 2G77B 4OKSA 5UKDA 4G5SA 2ZRJA 3SR0A 3EC2A 4Q9JA 5LBIA 1W0KA 2WSMA 3BFXA 4C0AC 1Q44A 2EWVA 5EZ6B 1KI8A 3PUWA 3LFUA 1XRJA 1WQ1R 2DCUA 2DHRA 4U00A 1G9XA 2CJWB 2ZYVX 2IYYA 3B82A 5KDLA 3P20A 3PXGA 2IYSA 3K9LA 3SBDA 3EZ9A 2QTFA 4ACAA 2XSZA 4NE2A 1KO8A 1FP7A 3CRRA 4AC9A 3MLEA 2CVHA 2GILA 3HPRA 4G01B 2JEOA 1GFIA 1M8PA 2G83A 1VPLA 4P4SB 1YR8A 5LD2B 1R2QA 3BAFA 3WMFA 2E1RA 1XX6A 3I72A 5JWRA 4B47A 1ZIOA 3UG7A 2H1LA 1OXXK 1S4QA 2GCOB 2C95A 4IEEA 1OKKA 4BECA 1W47A 2CCGA 3J81k 2ZXUA 3TBKA 5CM8B 2OO7A 1NY5A 4TMKA 1NVUQ 2C9YA 1E6CA 4LYHA 4WIAA 5CJPA 3MFYA 4QC2A 4XVUA 1Z5ZA 2EQBA 3RSOA 2YZ2A 4DLSA 4D4MA 4FD2A 2N42A 1TTTA 3B5JA 1AS3A 2J0QA 3DPUA 5SZHB 1G21E 1NP6A 2F3TA 2QNRA 2ODNA 2BWJA 1SHZA 2O5VA 2I1VB 1TEXA 3EPLA 4EPWA 1OHHD 1D6JA 1WXQA 4BZXA 2H8KA 4HAVA 5AJZA 4A1FA 2XNDA 1E2MA 1YKSA 1Q1ZA 5FUVA 2CHGA 2QBYA 3CM0A 3UIEA 1B23P 2VHTA 2IXFA 3CZPA 4IXMA 3L8YA 5JSZB 1DADA 1ZAKA 1U2RA 3D7MA 1E9CA 2A5JA 1QG4A 1SVIA 3O47A 3OE7D 3PEVA 4URVR 2QPTA 1G5TA 5FUWA 3QG5A 3LDAA 3WNDA 4BQSA 1E32A 1A2BA 2ZRLA 2OCYC 3THYB 4HUQB 3RANA 4ON9A 1FPMA 1XXHE 2P5TB 3T5DA 3LAWA 3KKMA 1W44A 1TF2A 4FMCF 1NJFA 3U44B 2AX4A 4HAXA 4EPXA 2KBEA 4Z51A 3L0IB 5TY0A 4I99A 1SHKA 2QG6A 3C5CA 5DHFA 3GJ4A 5J47A 1UBFA 3RRMA 4A2WA 1VKJA 3R7WA 4QJ4A 1R6BX 4Q1EA 4BFTA 3GLHA 4A8JB 1YRBA 3FHOA 4NYMR 1GVNB 1W49A 2ZQ5A 4ZI3A 2GKSA 4C0SA 3I73A 4D6PA 4D0LB 1NY6A 5KPDA 5HTKA 4LPSA 2E87A 1DG3A 2YOFA 3B85A 2XITA 1HV8A 1G8HA 2KI5A 3RYTC 1H65A 2OCPA 2ZRAA 4GZMA 2GWHA 1X86B 2F1IA 4UNNA 1PZNA 2JA1A 4AK9A 3EPJA 4OQLA 4NDZA 1AQYA 1KMHA 1N6LA 3T34A 3TJZA 5C18A 1Z2AA 4D80A 2N1BA 4TYWA 1Z22A 1E9FA 2MSDB 4QGAA 2R62A 4PO9A 1F2TB 2C99A 3DVLA 4Q4JB 1T6NA 4G5QA 3KXIA 1T9HA 4ZKEA 2FOLA 3AUXA 3ADKA 2RHMA 4Q7JB 1NVVQ 5DLQC 2GJ9A 1W7AA 4O2LA 2FPMA 3RRNA 2ANBA 4A9AA 2ZM5A 1RRCA 1QVRA 2P65A 4LJ4A 5TXGA 1R0YA 5GJVC 3KQHA 3TKLA 4DKXA 4B3GA 1J2JA 4EIWA 1UADA 5FPTA 2WAYA 3AB3A 3JVVA 4GDFA 1N3BA 1SGWA 4HB0A 5KSYA 1CIPA 1VIAA 2ANCA 2B21A 2BC9A 2C9CA 3T15A 1KTVA 4LV5B 4MRNA 2QSZA 3M1IA 3PCRB 3UKDA 5JS8A 5JS7A 4LYAA 1G4UR 1E2LA 4ARZB 2P3SA 2WJYA 1G6HA 2Q3FA 1JR3E 3SN6A 1IJFA 4KJZA 1Y3AA 2R6CA 1WP9A 1KSJA 2Q3HA 4WZAE 1G3QA 2GTPA 2VBCA 3ZZTA 2B8TA 3EARA 2R6GA 2BKUA 4XWKA 3TE6A 1F2UB 4P4TA 1Z08A 1RVDA 1XTQA 3LV8A 4V0ME 3HYRA 4W7SA 2ORVA 2A5DA 3G0HA 1J8YF 2ZUCA 1LF5A 3GEHA 3BH6A 5CITA 2QL6A 2D3WA 3F3YA 1YU9A 4I1SA 5EE9A 1OH8A 4QM6A 3CWZA 4JKYA 4RVCA 5HE8A 1XTKA 4IEIA 1ELOA 2PH1A 4WAUA 1GKYA 1W0JD 2ZSFA 1AA9A 1NMYA 3DOEA 3BIFA 2ZSEA 4MDEA 1FZQA 1S96A 4F93B 1OF1A 2CL0X 3QNUA 2GXQA 5F3WB 2ZSBA 2WV9A 4CVNA 5HZKA 4IOJA 5FI0B 5EE3A 3DEFA 3O8BA 1II0A 1MO6A 1C1YA 3B1WA 4FW9A 3X1ZA 5CB8A 1CJUC 1UM8A 2BIFA 4HUTA 3GPLA 2MSCB 3DO6A 2V7QA 3SE0A 3A6PC 4KITB 1E9DA 4BFZA 1P5ZB 5FTNA 5DE3A 4K46A 1KNQA 2WWHA 3U3JA 1P3JA 1KK2A 1TAGA 2YWGA 1XEXA 1HE8B 1XTJA 3T12A 4GL2A 1QF9A 2PZEA 4DBLC 1FFHA 5JHGB 1NF3A 1P2SA 4KFSA 3QKRB 1XTSA 3I62A 2PEZA 4LWZA 1XCGB 2B7CA 3IBGA 1G18A 3ZQJA 2ZPTX 4B34A 3A1UA 3LXRA 2IF2A 1S3GA 4M1TA 1P61B 1HYQA 2W00A 4LCBA 2ORWA 2I3BA 4I1VA 2F9LA 1KZ7B 5BN3A 4LJ7A 2PCJA 3HJNA 5BN4A 2VSXA 2OLKA 1NVXQ 3AVYA 2REXB 3AGPA 3UATA 3BH7A 2VLIA 1JEEA 2ZR9A 1IAQA 2BV3A 2YOGA 1CRPA 4PAOA 4DT1B 1MOZA 1DAKA 1OFIA 4YDSA 4YDHB 4EAQA 3ASYA 3H84A 2F3RA 5FOUA 2W6JA 3QKTA 4ZCLA 1LY1A 3ZVMA 5B30A 2W0SA 4DHEA 3TSZA 3QKUA 1IN4A 3LXXA 4O2RA 4DLVA 5DI3B 4TL8A 1ZBDA 4GP6A 1WDTA 2BBOA 2QAGA 4LDJA 4OQNA 4P32A 4MRSA 1K8RA 3C5HA 3QIAA 4QXAA 1E79A 3X1XA 4V0NA 4AIIA 4KV9A 4Q9LA 3CONA 3A1VA 3QG1A 1XTRA 3U6KA 3W5IA 2FZLA 2IUTA 3DOFA 3A4LA 5JJKA 4ZIRA 3QSYA 4LBWA 5FBVB 1A2KC 4NKRA 3ASZA 2GF9A 1E2NA 2JJ1A 4AY2A 2JLVA 1P62B 1NNEA 1OXUA 2GCOA 5KDDA 4GFDA 3U4QB 2WJJA 4GNKA 4N3NA 4A2PA 4HLDA 4PQFA 2IHYA 4DCUA 1S2MA 2JLRA 1AKEA 3E1SA 1OH5A 3DDCA 1KAOA 5P21A 1OIVA 5CK4A 5C46F 2G0TA 2FGJA 2VHJA 3OIWA 4YXWD 5KOYA 4EPRA 4A2QA 3K09A 3RHFA 1KSHA 3WBJA 4F91B 1N0VC 2BOVA 1U81A 4JMPA 2IYVA 1FX0B 3SQXA 1S8FA 4HZIA 1O3YA 4QM7A 3BGWA 1AGRA 3CUEF 4KODA 3ZLJA 4EFNA 1T5IA 4RD4A 2O8CB 1W4AA 1ZMXA 2EFGA 1GRQA 5EXPA 4BLOA 4ZKDA 1CXZA 2PL3A 4XOIA 1U0HC 4Q4HB 4JLAA 1OIXA 5JSZA 1II9A 3AF1A 1M7HA 3JZAA 3R20A 3QBTA 3NBFA 2IW3A 2PEYA 1XCPA 1EWRA 2VA8A 5GVSA 2H57A 2DFLA 2AFHE 4NYIQ 1DG1G 1ZD8A 3QKSB 5DYGA 1MT0A 2ONKA 1C9KA 2RGEA 3FE2A 4TYQA 3THYA 4HUQA 1QHYA 4HAZA 4LJYA 2V1XA 3AF2A 1LF0A 4FWIB 4PHFA 2OE2A 4EPYA 2B6HA 4E22A 2ZEJA 3PEYA 4LJ5A 4QNMA 2DY1A 1IY0A 4JYBA 2OLJA 4TYNA 3P4XA 2XAUA 3U44A 1JALA 3WYFA 4E09A 2R9VA 3TNFA 3VHXA 3NEYA 1X8KA 2QGNA 2QP9X 3AKCA 4EQ6A 4EJSA 1ODFA 2OXCA 3KJIA 4F38A 2IYZA 2HJGA 3HDTA 5FL7A 1VG8A 3HR7A 1U9IA 4RCYA 4A8JA 5EJEA 3PUZA 3GJ7A 3C8UA 3WY9A 4LI0A 3IPXA 2J3EA 3U6BA 1DAFA 1N6IA 4LRWA 3UWKA 5LD2C 1XMIA 1XMSA 2VQSA 5IF9A 2UZ3A 1T3SA 5KHOC 1WA5A 1DAHA 2DR3A 3B6EA 4RD1A 4PSAA 4G0NA 1RRGA 4WOPA 1R7RA 1U8YA 5K8TA 5J4LA 2CLCX 4B3XA 3TR0A 3CWQA 4DCTA 3TGPA 3R9XA 1SVLA 1M1YE 1KI2A 1P6XA 2H92A 3CRQA 3QJYA 4JBYA 4UNPA 4Z8YA 2F1RA 2ZS7A 3K09C 1MRNA 4ZDJA 4TLEA 1F2TA 2ZE5A 4Q4JA 1D2NA 1AM4D 2RGXA 4QRHA 1GNRA 4C0BA 4TL6A 4V03A 3Q85A 1JQJC 1SVSA 2EU8A 2IBMA 2ZUBA 3NH9A 2FNAA 4D0GA 1W4RA 4ZCIA 5B58C 3BBPA 2XOKD 3CPHA 3K53A 4DLUA 4KFTA 5DIFA 2FG5A 2BCJQ 3AQ4A 5BWMA 1OIWA 4PPQA 5DN6D 5G40A 4C2TA 3AM1A 2QUZA 3PV0A 1EFCA 4G5GA 3P32A 2AD5A 4AG5A 3DZ8A 1UBCA 1V43A 3AVVA 3U7EB 4ASUA 4ARZA 3IIMA 3GJ3A 4F4IA 1YZNA 4LGMA 4AD8A 5KO2A 2ZROA 4BFXA 4Y0AA 4C7OB 1KI3A 1D2MA 1Q20A 5FOVA 3EPKA 1JR3D 4TZ6A 1U0LA 1U8ZA 3K0SA 1SULA 2O8EA 2X1VA 2ZI5A 1XD8A 4R2IA 1QBKC 4PC3A 1E2EA 4Q01A 1DAIA 1MRSA 3K0FB 5LPNA 3L2OB 2ZYUX 1RW4A 2CL7X 1VYTA 2PT5A 2P2LA 2WPDD 1R5NA 2OILA 3GP8A 5LDDC 1M7BA 4DUGD 1NG9A 2QGZA 4JT2A 4A8JC 5C4MA 3LA6A 4MGYR 3RNLA 1YR9A 3KQLA 1OH6A 4LJ8A 3NH6A 4LV8B 3I8SA 2A2ZA 4BGDA 3QPWA 3AVXA 2ZVPX 4HZUB 4NCJA 4QG7A 3VHLB 1UBGA 5DHAA 2PMDA 2ZI3A 2KB0A 3GLFB 2CCKA 3KUDA 4ESVA 1FW6A 1P4SA 1VG9B 3IILA 4HSEA 2RH5A 1BYIA 3Q8XB 4FINA 1CJMA 3DMDA 5JLJA 1NN0A 4DLWA 2QU8A 3IUYA 1ZVQA 2BM1A 2HCBA 5AJVB 1JJVA 3HP1A 1UKVY 2KSQA 1WMSA 1X8JA 3D3QA 4L9WA 5FFMA 3RVBA 3RS3A 3TSOA 1L4UA 4TSFD 4A92A 2JLUA 5J4VA 3PJRA 4WVFA 4IDNA 3QXXA 4Q1DA 2X19A 4M9SA 4IOKA 1NLZA 3E70C 2D06A 1QHIA 2JASA 3QKRA 5SZKB 2AN9A 1U90A 5L3SA 4DRZA 1BMFD 5G3YA 1COWA 4BFWA 2JCSA 2CLSA 4MRRA 3WNBA 1JEDA 1CJTC 1SVKA 3THOA 4B43A 2EW1A 4KLNA 3SOPA 2CEAA 2BMEA 3MMPA 1VCNA 2OBMA 3ICEA 4K8OA 2A78A 3CR7A 2CNWD 2J5XA 2NPIA 3IDQA 1I4LD 3FKQA 4DWJA 3IIKA 1KI1A 2FX3A 2QZ4A 4UQOA 2ONJA 1CBUA 1OJLA 5JJLA 1GL9B 5D3QA 2VP5A 2OT3B 4TT3D 2GXAA 5BQ5A 2HYDA 3OIVA 4TQAA 1NSTA 2ATVA 2AKYA 1Z8FA 2XTZA 4OJQA 2JJ8A 4DCVA 3IPYA 3MGCA 3OFNA 3H86A 3RWOA 3B1YA 4KYUA 1XNJA 3ZZUA 4RD3A 4XWAA 2F1JA 3U7GA 3CLVA 1NKSA 4L15A 1P9RA 3OAAA 4TMZA 3L0PA 1FUKA 2NO6A 1JPNA 4JT4A 4KAXA 4IHQA 5E7JA 3L0SA 3TMKA 4A6PA 4Q02A 2CBZA 2FWRA 4NBSA 2J41A 4LC1A 2VEDA 1HEIA 3IO3A 3T1OA 1YZLA 3SHFA 4BPBA 1X6VA 5FTMA 5FOSA 1R10A 2VL7A 2HCJB 4M21A 2P5SA 2C78A 3VR3A 2OUKA 2BDTA 3ZH9B 3U4QA 2YC4C 3HR8A 2FSFA 2Y8EA 4JLOA 4EDHA 1T4GA 2CCJA 3S1AB 2GXSA 3DKPA 1KGDA 1DARA 4OYHA 1AIPA 4CW7A 1NIPA 1N25A 4LJ9A 4BRUA 4M0LA 3LBIA 1E0JA 3I92A 3LRPA 4OI4A 2WSSD 2V6JA 4KFRA 4QBIA 4CRWB 3O8RA 1KO5A 2VHCA 2AD1A 4J0QA 4MGKR 1OFUX 4RD0A 2GEVA 2W6IA 1RC8A 3ADBA 1E9SA 3FHTA 3WXMA 3X1DA 1GWNA 4Q66C 4JLVA 2ZRPA 1HH4A 5ANRB 2IS4A 4C3ZA 2O8CA 4LC0A 1ZM2A 5HKKA 3FGNA 3B13B 3MWKA 4AYWA 5IK2D 4RD6A 3VU9B 4Q4HA 3B78A 1T0JB 3CX6A 4MRPA 1R4AA 3KQUA 2R44A 3FVQA 1ZUHA 4AURA 4DVGA 4C30A 2PJRA 2GVZC 3QPUA 5AUPB 4OK6A 4IJMA 2QRZA 3QKSA 4URWR 4V02A 3VNUA 3CPEA 1YZGA 3P4YA 3ZD6A 1Z0DA 3R8FA 2HYIC 2ZRKA 2J0UB 1GNQA 3G82C 5FI1B 4XD7A 4MYUA 1W4CA 1RJ9A 3CRW1 2W0MA 3K0AA 4B3FX 3EAQA 821PA 5FR2A 1ZC4A 3K9NA 4OHYA 3I1FA 3BS4A 5KNDA 1T0HB 2BBSA 1Z6XA 4NPHA 4V0KA 4TLDA 4B76A 3NHBA 3SFVA 1MO5A 2Q0HA 4M4SA 1KI9A 3I4LA 3B8HA 4YMSA 2VPPA 3QXCA 5FL3A 3GLIB 4B3BA 3KXKA 5FPKA 3QF4B 4PZZA 1XBTA 1JNYA 3GJ6A 3QE0A 1PUJA 1Z6AA 2CK3D 3PEWA 2LWIA 2JDID 1OYYA 3RDPA 4PQRA 1KYIA 2Q9CA 2F55A 2ZSDA 2AR7A 1E9BA 1YR7A 2VTKA 4WBSA 4WZBE 5H68A 5FH9A 2AK2A 3CF0A 1GL7A 1CKEA 2FMXA 2BBTA 5HZHA 3NKVA 5FPHA 1G64A 5EUMA 1E69A 3BB3A 1PLJA 2NZ8A 4US0R 2ZYTX 3BFKA 1B0UA 3NXSA 5HE9A 3OF5A 4GI7A 3AEZA 4D4LA 1NVWQ 1H8HD 1A82A 5FTJA 1XJQA 1G4AE 1FTNA 3QBVA 3SJCA 1GM5A 1T5LA 4CEHB 3M6AA 1KDTA 4FCTA 3GMTA 2GEDA 4AWXA 4LJAA 5DNYB 3W8RA 4Y0VA 3UMSA 5B57C 2WWYA 1E0KA 2GK7A 4Q1CA 3T06B 4MKGA 3ZGXA 3L82B 1R0XA 1R8SA 1GOTA 2CK3A 3GLGE 1IXSB 2EFCB 1CJVC 1QRAA 4GZLA 4IXNA 2PBRA 4IW3B 3KFXA 3B1XA 3I32A 1Z0FA 1RYHA 1FQKA 2ERXA 4BRWA 5KSZA 2V3CC 3VKWA 5E3HA 4TMXA 1QG2A 2QQ0A 3REGA 2O8DB 4LBZA 4JVNA 1OE0A 1PJRA 1US8B 2KE5A 5JEDA 2CHQA 3DL0A 3G5UA 1UKYA 4A36A 1KJYA 3LY5A 4DLRA 1U98A 3EZFA 5H70A 3BOSA 3NWJA 3LD9A 1N5JA 1VCMA 4MQBA 4PSVA 2J0VA 3IEVA 4QHYA 1G3RA 1Q3HA 4I81A 2A30A 1OSNA 2OXRA 2GF0A 4TLBA 1ZJ6A 4DCNA 3TUZC 3T61A 1AKYA 1KY2A 5JZVA 4OI0A 1FQJA 1SVWA 2GJKA 2Z4RA 1GKIA 3BJIC 4D82A 1OHHA 4LBYA 1E2DA 2VYFA 3KTAA 3VKGA 4LZZA 3CNLA 4RKEA 3KB1A 4ESHA 5KYKA 3SJZA 1VYVA 3K70C 2V1UA 2R6DA 1Q12A 1OXVA 3I5XA 4WZ6A 4HZUA 4BLPA 2ZJAA 1FUUA 4HAYA 4HDQB 4U5XA 3OE7A 2H18A 5JWHA 1IJEA 1AS2A 1VG1A 1XU4A 1ZD1A 3GLFA 5FPSA 3TQCA 2ZR0A 3A1WA 3ZZ0A 3PG5A 4MH0R 5EXSA 3I3SR 1G17A 2ODEA 2QT1A 2REOA 2RGNA 2X77A 4PAQA 1P72A 1IN7A 4RFSB 2ZJ2A 4RZ3A 1XXHB 5DH9A 3EIQA 3Q7QA 1D9ZA 3F0TA 2FE4A 3WHKA 2XZLA 2FN4A 5KNBA 5JJIA 5JWOA 2ZETA 3CO5A 2IK8A 5AJWA 1K5GA 3O8CA 5CYPA 1CU1A 2RGCA 3SU8A 3GCGA 1CP2A 1E4YA 2WJIA 3PUVA 2D2FA 4JVMA 1TNDA 1EK0A 5GVRA 3CX8A 2ZI6A 1E2FA 2NOAA 1ZINA 2FZ4A 5J40A 3UANA 4LK2A 4HAWA 2ZANA 5AJXA 4UXJA 4URXR 1IN6A 1W36B 1KAGA 1YZTA 1NLYA 5CB6A 3EX7C 2VSOA 4P4UA 3TAHA 1WB9A 1RRPA 1ZM3A 4NONA 2W2TA 5JECA 2ZI7A 3LH5A 2OG2A 3Q7PA 4M1KA 4M1MA 3P27A 4YMVA 2A7QA 4Q4AB 4TMWA 1XTIA 4N1AA 4FMBB 5TVKA 1AJEA 4OL0A 4QKQA 5TMPA 5L3RA 2YINC 2BKEA 4JL8A 5F9FA 5SZIA 2IYLD 5DGXA 2VP4A 2YWEA 4ITRC 3GJ5A 2R6AA 2NGRA 1D8TA 1JI0A 4C4PA 2HJVA 4RSGA 3W9YA 1GRRA 1KSGA 1L8QA 4CEIA 3CW2A 2PZFA 1DTSA 1Z0KA 5GJBA 1ANKA 4JSTA 1FOEB 1KDRA 4CGZA 5KUTA 1R0WA 3R9WA 5L3QA 1Q0UA 4M9XA 5EP2A 5FBRB 4KVAA 1G3IA 1MR3F 1DOAA 1ZNYA 3CH4B 1YJ5A 4QHSA 1AK2A 1DBSA 2BEKA 4G1UC 4ZV4A 2VIIA 2ZI9A 4YMTA 5TARA 1M34E 1ESNA 1CR1A 1LS1A 3KFVA 4DSUA 1XD2B 5JEEA 1BKDR 4XSGA 2JATA 5LB4A 3AVQA 4B2LA 4BZPA 4DDTA 3DZDA 4PFSA 2QA5A 1X1SA 2GZHA 4IFEA 5IDVA 2A3RA 3W8NA 2HXSA 3UPUA 1KKLA 1LS6A 3S1AA 2AL7A 5AJYA 2XXAA 2HF9A 5M04A 1FNNA 2RGNC 1ESMA 5CDFA 2RGBA 4JLBA 4DSTA 2O8FB 2ZRIA 2VF7A 2WAXA 3KKNA 4WXPA 1ZNZA 4XWOA 2NTYC 2IYXA 4DZZA 4UNSA 1F60A 1SXJE 1Z6TA 4DSOA 1FL9A 2R8RA 1TADA 1CR4A 2F43A 3N2IA 5D3MA 4C0HA 4N0DA 4TYYA 2FSGA 1W0JA 3WRYC 3FKSD 1ZM4A 2PT7A 3THWB 5J4YA 1EFHA 2OZEA 1XB2A 2WICA 5FOXA 2VHUA 1Z0IA 2BMDA 1NBME 2R6FA 2JIZD 2P6RA 1OT3A 2IEZA 1CULC 2W83A 3QI2A 1YZUA 2GK6A 1MV5A 4EFLA 3DM5A 3NVAA 5E7IA 2XB2A 5FUYA 2JJ2D 3NEJA 2J87A 1M7GA 2Z5FA 3D6TB 3A37A 3PFIA 3X2SA 2MMCA 2O0JA 4AKHA 1UEJA 4X8LA 3E5HA 4RCZA 4EFMA 2WWWA 4XSHA 5LB2A 3B60A 3DMNA 2LKCA 4QGHA 2ECKA 1E98A 2FV8A 3RS5A 4F92B 1NN1A 1IY2A 3AKEA 3Q9LA 1G8YA 4H1VA 4YC7A 1NRJB 1G3MA 3TQFA 2YOHA 2NZJA 2CJWA 3QEOA 4JBXA 4A4DA 4Q21A 1QHSA 2QRNA 3JZMA 1T3LA 1XZPA 4HB4A 5CYOA 3QF4A 2CLDX 3QXSA 2QPAA 2HV8A 1Q1EA 2CE7A 3GJ0A 4KXFB 4NHOA 4P4SA 4DCSA 2REBA 2IXGA 1XEWX 4YQFA 1DAEA 1GG2A 2G1JA 3B9PA 1E1QD 4M1OA 2GHIA 3QVUA 3JVUA 1YZQA 4MKFA 1DE0A 3TRFA 1UPTA 1OW3B 3W5JA 3UMRA 3C14C 2TMKA 3PEUA 4NCIA 3ND9A 5JI2E 5JFGA 3BB1A 1F48A 2OFXA 1W5TA 4NCKA 1IN5A 2XJ9A 2QORA 1UDWA 1TQDA 3EWAA 4BFVA 1ZUNB 4LOAA 3BRWD 1KOFA 3A4NA 2D4HA 1HY3A 3LX5A 2Q9BA 2BMFA 2VRWA 4KSBA 1GZSA 3Q3JB 1G6OA 4I4LA 4GMDA 4PC2A 3QVVA 2DFNA 2ZIAA 1EFTA 1U94A 3CKLA 1HURA 1HQCA 1II8B 3I61A 4OK3A 2RMKA 2PJZA 2O8DA 1US8A 1GDDA 2J1LA 1KDOA 2ZUDA 3KJEA 3ONWA 1MABB 3H4MA 4G5OA 4LHYA 5EP4A 3U61B 1OLOA 3KB2A 2FGKA 5EQTA 4YXWA 1CR0A 1E2PA 3ZDQA 1KI6B 1ZCAA 1Z29A 4G5RA 4ZCMA 4EUNA 1CEEA 2KBFA 4N0EA 5BYJA 5F9HA 3IO5A 2FU5C 4XJXA 2Q21A 1J90A 1NMXA 3KKOA 3OEED 3H1TA 1FMLA 1F5NA 1LTQA 4QFMA 2GCNA 2QAJA 2XZPA 3L43A 3KL4A 5JBQA 3EW9A 1SKYE 2J7PD 2O0KA 3IEUA 3UXMA 5ELXA 1W36D 1J8MF 5FBWB 3DM9B 5G41A 1VCIA 3C41J 5GJWC 1E96A 1P73A 3SS8A 1YHNA 2XTNA 2C77A 4JIMA 2WIAA 1NVVR 4NYJQ 2YHSA 1ZU4A 4Q18A 4ACBA 1Z3IX 2IA5A 2IF0A 4PHGA 3SYLA 2A5GA 3EA0A 3THXB 1SVMA 2IYQA 3WMEA 1A1VA 1JXOA 4XH9B 4Q9IA 3FFBA 1W46A 1KIMA 2QMEA 3W3ZB 4RFSA 1XXHA 3LNCA 2IUUA 5G3ZA 1N6PA 1KO7A 1ONBA 2WJHA 4MKHA 2HLDD 4ILEA 3VQTA 3ZIAD 3SYNA 4HDOB 1CTQA 1GIAA 4DC9A 4LHZA 4RY2A 2WWIA 4GSYA 3K0CA 1UEIA 1OXTA 3AUYA 4HAUA 4JL6A 3VFDA 3WP0A 3REFA 4HLUA 1XPOA 1XMJA 2WKQA 3QF7A 2H7VA 2IYRA 4IRUB 1ZM9A 2ODBA 3CBQA 1GRNA 1SKYB 4PHHA 4DLXA 1NN3A 3MCAA 1GUAA 1XD9A 4BZQA 2MSEB 1P60A 4DJTA 3MJHA 1RFLA 2XEXA 2GVDC 3UK6A 1KDPA 3FMIA 4KVGA 4LJ6A 2QMOA 2OAP1 4L9SA 2HT1A 5KTYA 1OH7A 4JJZA 3GLHE 1OYWA 3KQKA 4CZ2A 4TZ0A 2VSFA 721PA 4R9UC 2QBYB 5EP1A 2GBLA 5JMTA 3ZVNA 1R8QA 1F2UA 4A82A 3RLFA 1XEWY 5J4KA 2XJ4A 4US1R 1NKTA 4YONB 1EXMA 5FTLA 4QGFA 1PUIA 4M22A 4D25A 3NC0C 4BLQA 1JECA 1OFHA 3BD9A 3WMGA 4JJKA 5KPJA 2XOKA 2GEUA 5EE1A 3OHMA 2WOJA 4YMWA 5DN6A 1IXRC 1NI3A 1U8AA 2ZRNA 2LKDA 2QE7D 3W6NA 2N46A 3UG6A 4LYJA 1E1RD 3IQWA 3ZS8A 1XD2A 4NZYA 4PSKA 5JRJA 1S1CA 1G5PA 4NH0A 4TMTA 4TTPA 2CE2X 1E9EA 1TX4B 4QJ3A 1SQ5A 1TF7A 2E9SA 4FMCB 3VKHA 2FPLA 3PQCA 1JR3A 3HPQA 4Q1FA 3R7WB 3K0EA 1AGPA 2AK3A 4NU0A 4TLAA 5E4FA 4BFSA 4BFYA 2RB4A 4Z1MD 4C0QC 2O8FA 1L4YA 4JLDA 2PLRA 3AVUA 1PLLA 1TQ2A 3CF6R 1WF3A 3IBYA 5F2EA 2W58A 2IX3A 2AWNA 3TUIC 4TTQA 2WPDA 4V0MA 2YWFA 3FFAA 5CIWA 3AVTA 1EFRD 3AVWA 4DUGA 2PZGA 3F5FA 3K0CC 3OEHD 2AFIE 2EYUA 1CS4C 1SXJD 1T8TA 2OESA 2IUSA 3SQWA 4BWYA 4NYMQ 3GFTA 5BN5A 3EASA 3WNCA 4HLUC 3V00A 1W36C 3TW4A 1DS6A 2IC5A 1N6NA 1WCV1 2FFBA 3OZXA 2OCBA 4D0NA 4M1WA 4QHTA 3X1WA 4HB2A 2ASEA 1Q3TA 1ZC3A 2BJWA 1G16A 3MD0A 4AG6A 4UNRA 2X8AA 2V8OA 1Z06A 3V9PA 4DT1A 3BERA 4KO8A 1VHTA 3LVRE 4QJ5A 4XTRA 1EWQA 1I4TD 2ORIA 4DLTA 2GBLC 1UKEA 3IHLA 2DFKB 4TSFA 5DI3A 2H17A 2J45A 3FMOB 1ZNXA 1BMFA 1E3MA 3D31A 4OQMA 4D26A 1H8ED 4FXPA 1XPUA 2BBWA 3LW7A 4CYMA 4TL9A 1OPXA 4TL7A 1K5DA 1Z07A 4NL4H 1SKQA 1M74A 4B32A 1DAGA 2FH5B 4GT1A 4XVRA 4A0RA 1GITA 1HTWA 2CNWA 2YNMA 3TVDA 4HATA 4L16A 3RS0A 2FEMA 3GJXC 2ZS8A 4IDPA 2D7DA 4DLZA 2JAQA 4TT3A 2ZSAA 4CT5A 4B71A 3FWYA 1IY1A 2IWRA 1RRFA 1W5SA 5A0FA 3VR6A 2YJTD 4D2IA 3M0EA 4DXAA 2OBNA 5EE0A 4KI0A 3T1QA 2ZYWX 3QENA 1HE1C 3NHAA 1E2IA 2GXUA 4R7ZA 4A0HA 1XWIA 2NIPA 2XGJA 1P7CA 1FX0A 1KK0A 2GNOA 3LQRA 4C2UA 4M1YA 2EFHB 3B9QA 2J59A 3KX2A 1N5LA 4DDVA 3AV0B 4MYCA 4NYIR 2XNSA 1BYUA 1R0ZA 2RCNA 5AUOB 4MUAA 3TSWA 5JHHB 1QZXA 4ZO4A 3UMFA 1N6KA 3SBEA 2RAPA 5EXXA 3T1TA 5G53C 1Z83A 2A9KA 2NQ2C 3VR5A 1W0KD 1CRQA 5CLQA 3FOZA 3KJHA 1FTSA 5IT5A 1TUIA 1II8A 2Z6VA 3MSXA 4GRAA 2G0NA 2RGDA 4MA4A 1S9DA 4Q7LA 1ZIPA 4IVRA 1MABA 3EZ7A 2G3YA 2QROA 3M4YA 4Q7MB 4K81B 2XSZD 1N0UA 3N5CA 4G3XA 2WSSA 4HB3A 4LSGA 1G8GA 1JAIA 1KI6A 2D2EA 1A7JA 4KLZA 2ZAMA 2ZRFA 2FSIA 2ZRCA 2ZS9A 4F7WA 3OESA 4LPKA 3BE4A 3W6PA 1UKZA 3KZ1E 2ZITA 1N0WA 1HT1E 4IVQA 1OKKD 4KYIB 5IK2A 2WBLC 4M1SA 4PTLA 2EWWA 3LX8A 1P9NA 2JLXA 1G8PA 4QGGA 2OM2A 3LVQE 3PENA 4JLNA 3MAAC 1L7VC 4DSNA 5CIQA 2V9PA 1G291 1W48A 4CT4B 3GFPA 3U3MA 2QAGB 1X1RA 3SI7A 5J4HA 4AKGA 3MWYW 4PC7A 1CR2A 4PANA 2BJVA 2MMGA 5KDOA 2OV2A 4W9MC 3THXA 2FFAA 1PLKA 4XIGS 5AWFC 4R98A 1GILA 3B7GA 1KMQA 2EFDB 2XNDD 4QNRA 5JCPA 1Z6GA 1DAMA 2GAAA 1Z6YA 3ICQB 1KJZA 4HLCA 4HI0E 5CM9C 3VTKA 2ZE7A 4ZIRB 3ZYCA 2Q6TA 4IDQA 2QTVB 1KK3A 5FUXA 3DKVA 4QL3A 4DIEA 3C4JA 2PX0A 5FTKA 3W90A 3OIUA 5A5GA 6Q21A 2GJAA 2HF8A 1WRBA 2YC2C 2WWGA 4D4JA 1E0SA 1ZNWA 2JDIA 2FJUA 2IWHA 3AGQA 4RZUA 1LVGA 4AI6A 1VMAA 5TB5A 4IKEA 3TAUA 4FCWA 1U99A 1KSFX 4PQYA 2EYQA 2RGGA 1UBEA 4H9GA 4JYCA 4U02A 4II7A 3A36A 4YMUA 1IBRA 1ZU5A 2V55B 4GMXA 3EWSA 4MRVA 3P1JA 4B33A 4C7OA 1XEFA 3EC1A 2R2AA 3SC3A 3NG1A 5E7MA 1D9XA 1H8HA 4Q4LA 1Z63A 1TL7C 2HT6A 3K0FA 3C15C 4B73A 4OI2A 1JAHA 3B2EA 4RFVA 4A0GA 3GQBA 3QQ5A 1W1WA 2K5UA 4HEJA 4PC6A 3RWMB 2RKOA 2Q3MA 4S35A 4TYPA 4OJKA 4F4JA 1TQ4A 1VDZA 1BS1A 1MO4A 1NLFA 1P2TA 1F6BA 2ZE8A 3AP1A 3EIHA 1YZKA 4QOSA 3GLGB 3LWNA 4MGIR 2DPXA 3FMPB 3IIJA 3A8TA 2HUPA 4P33A 4RKFA 4PO8A 3ADCA 1NIJA 1N6HA 1XPRA 4TWZA 3EIEA 4O0MA 3BC1A 1IONA 3EG5A 4EQ6B 1E0AA 2WZQA 3PUXA 4IOMA 2QSYA 4EJSB 4ABYA 2O0HA 2DWOA 3HU3A 3CRVA 4WA7A 1VG0B 2Z4SA 5J5CA 4URUR 1G8FA 1X8LA 1FMJA 3MRSA 5JRZA 3NDBB 2A5FA 1GKUB 3Q72A 4R2HA 5HCNA 2V4ZA 3WRXC 1Z47A 3UWOA 2DYKA 3ZVLA 2C5LA 2VP9A 2BVNA 3VAAA 4E07A 3NBZC 4ERNA 4RZXA 1IN8A 3RSLA 2JGNA 2V6IA 2EFEB 4BE7B 2IS2A 3CF2A 2BHRA 2QQEA 1T91A 2XTMA 3EA5A 4RJLA 3SYKA 1NJGA 5KSOA 3ZVRA 1A5TA 2ZRMA 2AWOA 4P3YA 3ND8A 3U60B 2PCLA 2ZE6A 1UF9A 3RRZA 4Q1AA 4KSCA 2AKAB 1E2KA 2ZRBA 2WJGA 3A4MA 2G6BA 3FTQA 3ETLA 5DO9A 3AKDA 4OQFA 2QEQA 2QN6A 1QHHB 2WJVA 5K8LA 1AN0A 4JBWA 1TPZA 5KSPA 2FA9A 2WWXA 2DBYA 1MH1A 3FMFA 3V4RA 1QHXA 2PLFA 1IQPA 3CPJB 4JVSB 3CIOA 4B2PA 3AH8A 3U3KA 1ZM7A 5FBLB 1ZW6A 1KI4A 3TIFA 2ZJZA 4Z54A 2B8WA 3A58B 4IDHA 1HT2E 5KNCA 1GSIA 1XFAA 3T5GA 1GAJA 5KU1A 3B1VA 3KKQA 2YYZA 1LW7A 1BO6A 1XCMA 3RS4A 4EPTA 4DEXA 3K9GA 4NTZA 2V7QD 2VO1A 121PA 2O8EB 1IHUA 4ZPXA 5GJCA 1TU4A 3LBHA 1XMVA 1ZD9A 2WKRA 4PHTA 3SZRA 1JJ7A 2GESA 2I1QA 2C03A 1MKYA 1JPJA 3ECCA 2WWFA 1KO1A 2ZAOA 2FEOA 4NMMA 1E94E 1XF9A 4OHXA 2ZJ5A 3HU2A 2ZTSA 1KJWA 4BEJA 2NO1A 4AKIA 4Q1BA 1N5KA 1G19A 1E99A 4PPGA 2ZJOA 3ZD7A 3AF4A 3FHCB 4B48A 2AHOA 3L8ZA 5DI9A 1GL6A 4Q5IA 4UJ3A 4PZLA 4Q9KA 2NMVA 2Q9AA 1TF5A 3QXHA 3MJRA 4CIDA 221PA 3PVSA 2OHFA 2OEPA 4KCGA 4X8OA 5DYIA 1G1MA 2OFWA 2UKDA 3W3AA 2GRJA 2QM8A 2VP2A 3VU9A 1OXSC 1E2JA 4XTCS 4FIDA 5FOWA 4FWTA 5A4JA 2P0EA 4LYFA 1WBDA 2W6JD 1A4RA 1QHNA 1LNZA 1RZ3A 2D74A 1GNPA 3NTUA 4MYTA 1JR6A 1MO3A 3CX7A 3I5YA 3D8BA 2KWIA 2ERYA 1AQUA 4JL5A 3RC3A 4C0KA 1L2TA 2QPOA 2R65A 5L3SB 1EFUA 4U7DA 4RD2A 2J0UA 4KFUA 2VP6A 2SHKA 1SZPA 3KXLA 1E79D 2Z83A 5L3VA 2QMHA 2ZI4A 3PITA 4HYYA 3T35A 2GA8A 1D2EA 5JCZA 4UNQA 2XZOA 3MG9A 4GBMA 2DFTA 2CVFA 4I1OA 4Q7KA 2D62A 4GP7A 4WW0A 3WHLA 2KJQA 2NO0A 2X2EA 1BH2A 2WHXA 2GJ8A 2FPKA 5B2ZA 3KDSE 1XZQA 4BEBA 1AS0A 2O8BB 1P9WA 1EX7A 1SXJB 2JJ1D 2XB4A 3IKJA 4B3DA 4B6FA 2JLYA 3FKSA 3GLIA 3MUFA 1TMKA 3VMFA 3BK7A 3QPVA 5B64A 1T8UA 2JIZA 2GZDA 2A5YB 3EZ2A 4P31A 1VTKA 3SNHA 2B7BA 2VH5R 2ZU6A 2Z43A 2H16A 4B3CA 4PXAA 1RKBA 621PA 5BYKA 1M2OB 2JJ2A 4PR0A 4LY6A 1F3OA 3WP1B 3N70A 4M9QA 3BB4A 3AP2A 1OB2A 4ZDWA 1C4OA 1QDEA 1TU3A 1JQLB 4JZKA 5AK0A 2BM0A 4PAMA 4PC1A 2IHBA 4NP6A 4DIDA 4QBHA 2BCGY 1KO4A 4DB4A 2DB3A 2ODWA 1J7KA 1YE8A 3NC1C 4CEJB 1E9AA 1VECA 4V0OA 3EXAA 5K8UA 1P75A 2AXNA 4CEHA 2VF8A 3FB4A 5DISB 1DELA 3GFOA 1NSFA 1VIYA 2EVWX 2X2FA 4MYHA 5EZ5A 1J70A 1DO0A 1WBBA 1Q1QA 4YLGA 2F6RA 5CLLA 4AKEA 5GADl 4ZI2A 1YR6A 4IDOA 4POAA 1N5IA 1TUEA 2ZJBA 1RIFA 1AZTA 3MWLA 4LX0A 1LV7A 4LV6A 3U7FB 2C96A 2WTUA 3VR2A 1E1QA 2GJSA 2NO9A 2IS1A 1RYFA 3H2YA 1OB5A 3W34A 3VNVA 5C1BA 5FBQB 2CL6X 2JLWA 4A0FA 3CRMA 1I2DA 3I8XA 1KKMA 2JLSA 3TW8B 3WYGA 5FL7D 3BORA 3IGFA 2DWQA 4OHZA 1EESA 2OCAA 1TEVA 3ZJYA 2CXXA 2RGAA 3H0KA 4NCHA 3LBNA 1XJCA 3CB4A 5AUNB 2BMJA 4PZYA 3PIRA 2VHQA 2OAQ1 5EUQB 4TTRA 3T1VA 3ADDA 2W2VA 4M8NE 4FMDB 2ATXA 4OI1A 4V0LA 3U5ZB 1KY3A 2GDJA 4UXIA 3GD7A 2C04A 4JLJA 2P6NA 3U3RA 4B2IA 1BIFA 1G7RA 1RJ9B 3K0AB 3GLGA 5CK5A 4I1UA 4GPTA 4X8HA 1GTVA 5AUQA 4A15A 3RABA 4LHWA 3VR4A 1Q21A 2QAGC 1I2MA 4Q9HA 4A6XA 1IXZA 3NDPA 4PPFA 1CF4A 2V54A 4JVLA 5K8IA 1HUQA 3OIYA 2QENA 3R8CA 1Z0JA 3MWJA 4JS0A 3KKPA 2WOOA 4L4UA 5L8VA 1SVOA 2NO7A 1J99A 2J7KA 2QY9A 1ETUA 1KK1A 4ZDIA 3K70B 1S1MA 1Q1BA 2YWHA 4L5BA 1KI7A 5EE5B 3FDIA 1DO2A 4JKIA 4CF7A 5JI3E 3AVPA 2C9OA 3OEEA 2PMKA 5HPYB 1G5RA 1GP2A 4KBFA 1VYUA 4MKIA 4M2LA 2P6UA 3BWDD 4NCNA 4ASUD 3TVTA 1HA3A 3VR1A 1N2CE 4DDUA 2WIBA 3U2QA 1G41A 4CDGA 2J7PA 1NL3A 4TQ9A 3SEAA 3N2EA 1KHTA 5HCIA 4B75A 4GOKA 5C4GB 1PV4A 1QVAA 3KUCA 2ZRDA 2CMKA 3VX3A 3GEEA 5BXQC 5TDHA 1W4BA 4AYXA 4Q4AA 1G7SA 1DVRA 2G9NA 3NIBA 2PX3A 2ZRHA 4Q19A 1JB1A 2CHVA 1QHHA 4S2EA 1HQYE 1ZRHA 5FPYA 2OFOA 3QUSA 1E2QA 2ZJYA 1VCOA 3FPAA 2YV5A 3QXJA 4TN1A 5IHPA 2ZJ8A 2P67A 2RHDA 3TH5A 3NBXX 1BOFA 4Q00A 2WMNB 4ZDKA 2QP3A 2JLZA 1NN5A 2AXPA 2D7CA 4OBEA 3X1YA 4C0LA 4M9ZA 2GETA 2HLDA 3ZIAA 3GLFE 2O52A 3F8TA 3V4FA 2UVQA 4B35A 1PVOA 521PA 3C16C 1Q57A 2HDNB 1ZCBA 4GOJA 4LUCA 3RC8A 2UZIR 4Q47A 3IHWA 3KJGA 1Y63A 3ZQ6A 1IOZA 4H1UA 4KHZA 4IVPA 4HDCA 4DB2A 5TV2A 5E95A 1KNXA 4PX9A 1UFQA 2HEIA 3K9HA 3SDZA 1XDBA 4BUJA 5C2JB 2GCPA 2FF7A 4FCVA 3P26A 4EJSC 1P2UA 4OHWA 3KTAB 4R71A 2VP0A 1COWD 1U9IC 1Z0AA 4MGZR 3GLHB 1EG7A 3A1TA 1Z2CA
chains in the Genus database with same CATH superfamily
4CODB 2SKCA 3AX6A 4P86A 3SFZA 1UBLS 2X1HA 3LQQA 4PFJA 4U7HA 2YDXA 4BNDA 3PFNA 4G8CA 4PS1A 3MIZA 3QOFA 3PKJA 2PL5A 2BMAA 1X9HA 1P0IA 2ZB4A 3QY0A 1YJ8A 2ECFA 2QJOA 3TD2A 2C7QA 3GDGA 4EL5A 2YWCA 3BREA 1HM5A 3ZNOA 3PSHA 1J2TA 1FS4A 3LPMA 4N18A 4C0JA 4YCSA 5H8WA 1SQFA 3M9XA 4BLSA 2XE8A 2A67A 4OIMA 5ELMA 4BB5A 4CNQA 4NNJA 4UJ5A 2YKGA 5EXTA 3DOIA 1I1NA 2H4WA 3KP1A 4HQ0A 4K9DA 2NG1A 3EGDA 1B73A 1CB0A 5YASA 1NBMD 2NUTB 1Y4UA 3U7HB 4DV6B 1SK8A 1NG1A 1CY4A 3HCDA 3Q3GE 3OEYA 4W7HA 4O4HA 2QI9C 4J0DA 2UYHA 3D9QX 1JBQA 3D1VA 3NKFA 3DZFA 4LFBB 3HJCA 4J0JA 1RPZA 2AZMA 2OYCA 1OI4A 2H29A 5FPPA 1HQDA 1LWNA 1Q83A 1IB6A 4GR5A 2Y99A 4IEFB 5CUQA 1GNLA 2ZT8A 3TUJC 4BIMA 1NW3A 4FDMA 4IGKA 4LNUA 4QPCA 4UM8B 5ALGA 3SCZA 4E03A 3PKZA 4HDKA 5G4LA 3T7CA 4OQXA 5TPWA 1P7WA 1WVMA 5EP3A 1X1CA 3ZWQA 1E7SA 3HN2A 2JLQA 5JD3A 1S9HA 4RKWA 4XVQA 4MR8A 5A4FS 2W98A 3OD5A 4R8VA 1GQQA 4F4CA 4N0QA 4URYR 4PPNA 4JC5A 4CIVA 4C29A 1AZSC 4Z99A 1XQ9A 1NP7A 2ZYAA 4X20B 1UBHS 3Q9SA 4WOKA 3R7DA 5C0OE 2JIPA 3WYAA 4Q48A 3S0JA 3R7AA 2QTHA 1J0XO 2OBLA 4AVYA 2QE6A 3C3PA 1SUPA 3IS3A 2ZQZA 3E7XA 1PV1A 3H04A 3G3EA 4ZQIA 1OFGA 1I5OA 2XV1A 2IXEA 3PTZA 5GOZA 1AKUA 1NXXA 4U2BA 3EH1A 1DPFA 1O87A 3HJAA 3DV2A 1M8FA 3M3DA 2BGNA 1MNQA 4KIUA 4FKBA 4E5UA 1PFYA 5CBPB 3KEFA 3WBKA 5IT9A 5MN6A 3CH5A 1L7OA 2ZBDA 3FG9A 4R4JA 1EFDN 3T3DA 1RHQA 2C84A 1EGAA 4W5WA 1G3UA 2HA3A 4DEYA 3E03A 1VA5A 3JAMA 4UD6A 4Q6BA 3QFCA 2W8ZA 2IEYA 1HPLA 5AD1A 3ZDDA 3JQ6A 3ADOA 3QHPA 4FNOA 4X8MA 4NC9A 3I0ZA 1O9GA 2L0XA 2PY6A 5EWMA 5FOTA 3KEQA 3WG9A 5CLJA 1GJRA 1MTOA 1ZUNA 4KR7A 2GAOA 2YQ4A 4QBFA 4EPVA 3KSAC 2ZR7A 3LCCA 3BFVA 1YQUA 4P93A 1V4BA 2QZSA 3B6KA 4P92A 4BO2A 3LW8A 3EMDA 4HNAB 2IYUA 3KYJB 1KYXA 4BC1A 1PJSA 2XXAB 4C9BA 1JDVA 3C1TA 4L4RA 3I2GA 1I10A 2HPHA 3FLBA 4FI3C 1V5WA 3R9IA 2OSBA 3ADPA 3CNNA 1N6OA 4HPWA 4YRAA 4YAFA 5F98A 3KQNA 1FCJA 1G7CA 1ZUIA 3HYTA 2C92A 2WUGA 3LHIA 3GUVA 1R6XA 3KOUA 2OD2A 1JXMA 3TQRA 2CXQA 2F2TA 2G9ZA 4S3MA 5I7HA 3CZQA 3BE6A 3DDWA 3VU3A 4B44A 5T6MA 2AA3A 2F43B 4UW9A 5D3MB 3HWSA 2P2GA 4DQUA 3BH0A 4V24A 2IT1A 2R11A 3UAXA 2VH2A 3AF0A 2D0PB 3MGAA 1E61A 1GGFA 1KQPA 3Q5EA 1NXVA 1JBKA 1OFTA 3D7KA 2PU5A 3MHTA 4TV8F 4DLYA 2FFHA 3JWPA 3K70D 4FYWA 3ORRA 1WDLA 1JDNA 4B7ZA 4DDWA 1KIAA 3W2EA 4REQB 1MQ8B 5BN4B 2FPGA 2QLLA 5B3JA 1K7YA 3OVMA 1SUFA 3JV7A 4F3CA 2JI8A 3T1YB 4GOXA 3NNNA 3RYIB 4DSZA 2WVJA 4Q15A 3PA8A 4XPIA 4BFLA 3U7RA 1TQ6A 1W4ZA 2QN3A 2ZRGA 2XDAA 3IX7A 3AFNA 4L5CA 5DTMA 3ECSA 1FLDA 4OU5A 2FWMX 5UKDA 4GBGA 1JV2B 4G5SA 2BMWA 3BIWA 3NHRA 3SR0A 4OXXA 2R1ZA 5E1DA 4C89A 2Y9PB 3BFXA 1D0IA 4CLOB 1Q44A 4CPDA 4RVSA 5EZ6B 2R86A 1JMKC 2I99A 2PLAA 1I6LA 4UFPA 4AQ7A 4I4CA 3Q0TA 3OQIA 3A32A 2AFHA 3KJFA 3BD7A 1ZRNA 3HE3A 3K9LA 2A1TS 3LDUA 2H0AA 2G70A 1SIOA 1ZN7A 1AQLA 3W5IA 2OV8A 3G0CA 5CIYA 1ESEA 3M8KA 4CKWB 3AXTA 4FEAA 4RIFA 5I5EA 4ZHSA 3CRRA 3SHQA 2GILA 2FP4A 2GR9A 3V4VB 3OPVA 1GFIA 1M8PA 2O0MA 1GGEA 5K3DA 2CXSA 3WRXA 4D44A 4NF2A 5LD2B 2HFJA 1R2QA 1Y82A 1FW8A 4CKCB 5JWRA 1MB9A 1XX6A 3V2IA 4OBWA 1ZIOA 1OASA 5A3QA 2P90A 1OVGA 1OXXK 4RC9A 4IRXA 1T1IA 1OKKA 2Y93A 2O3RA 1QG0A 2IEDA 2FPWA 2RG1A 1H1LA 2WUDA 1NY5A 2VJMB 1KR2A 1EKXA 4TMKA 2C9YA 5CJPA 1MJFA 4XVUA 1E92A 6CHYA 1YC2A 3RSOA 4LVUA 1P7ZA 3PWKA 3TTYA 4DLSA 4B83A 3PDUA 2UAGA 1CQWA 4FD2A 3A6GA 4D4MA 3VO9A 2SICE 4ROTA 4K9LA 3DPUA 4AB1A 2QR5A 2AQIA 4KX5A 5JUWA 3P94A 2O5VA 3ZI4A 1Y6JA 4D4GA 1KKUA 4MUYA 3RQSA 4EPWA 1OHHD 4RTJA 3G5TA 1BD4A 3OZCA 4L95C 5GGXA 4BZXA 5KQMA 2XNDA 1E2MA 3VOTA 4CKYA 4EQZA 5FUVA 3AINA 3MUNA 3CM0A 2R7LA 2GPNA 3CKKA 3PFKA 3WDKA 3L8YA 1MTZA 1QXSA 4F5DA 5JSZB 5ADHA 1ECGA 2FW9A 1XLWA 3VH2A 4A0HA 1RXCA 2A5JA 1FS6A 3O47A 3PFCA 3UMBA 5B3JC 1G5TA 3WDMA 2UU9B 4QYMA 3LDAA 3NHFA 4L8LA 5E6SB 2ZRLA 3NFRA 3THYB 1M2VA 4FLFA 4Q0MA 3H5TA 2QX8A 5DXJA 3GX1A 1FPMA 4IIYA 2FEKA 3WGQA 3NM4A 3FCCA 2P5TB 5KTRA 1M1XB 2J9ZB 3Q5GA 4C3UA 4II3A 4X41A 2FRVA 1CS0A 4BMXA 4MS4B 1NJFA 3EISA 5FB3A 3MOSA 3QITA 3NXKA 4G0XA 2IGTA 5KNBD 1NQTA 4Z51A 1SHKA 3C5CA 2IUYA 3H75A 4LRSB 5DHFA 2IZ5A 1U1EA 3P9SA 3R7NA 3IXLA 5J47A 2I3ZA 4A2WA 3BKWA 3N86A 3TG8A 2JIOA 4ER3A 3E53A 3G2JA 3R7WA 1R6BX 5HJEA 1IHYA 1P18A 1R4MB 3GLHA 3ANYB 3UJCA 4A8JB 5GZ1A 3OJWA 2QQGA 5E1MA 1Z5VA 1DJNA 2DKOA 3VJKA 4BMVA 10MHA 4QAQA 4ROSA 4D0LB 4D99A 4MVJA 1NY6A 2GN4A 3UGKA 2J5BA 2PL9A 5HTKA 4GGPA 1EBFA 2VPTA 1DG3A 1ZG3A 4MDHA 3B85A 2GBPA 3OJOA 4GS5A 2GD0A 3DLIA 1QH1A 3C7TA 4M0MA 3RPEA 1FP1D 1RYDA 2I7DA 2IU3A 1J1ZA 3FD8A 3Q6IA 3V4SA 4LDNA 2F1IA 2BFBA 2JA1A 5AM1A 1JTFA 1ICEA 2A7XA 3UOGA 4NDZA 4AK9A 3HCFA 4C22A 1N6LA 4L85A 4X60A 5JDIA 3RIEA 4D80A 2N1BA 4GUAA 1T0BA 2JW5A 4DJEC 1GKLA 2R2GA 1AUVA 3G1TA 2QLMA 3EG9B 3DVLA 4Q4JB 1LJ8A 1ZSVA 2WD8A 1AHHA 3M82A 3W9SA 1P9LA 5ENDA 3OP1A 2BE9A 1T2FA 2DPLA 1P1FA 2RHMA 3MBOA 4MROA 4YUVA 3M6WA 4JLSA 2FPMA 4IH4A 4LNAA 4MUXA 4HKTA 1C8BA 2ZM5A 1QVRA 4I5GA 5BMOA 1R0YA 2QN2A 5ECYA 2C0CA 1GXSA 3GP3A 1AF7A 3BVPA 4CR6A 5BV8A 1N3BA 5KSYA 1KAQA 3ZWAA 1CIPA 1DQYA 3T15A 2ANCA 2C9CA 4R01A 1FRFS 2QN8A 2A58A 1MJGM 3M1IA 4WMLA 5K0EA 2G06A 3UKDA 3HNPA 1XR3A 2EV9A 5KTKA 4LYAA 4KIJA 3OLQA 4ARZB 2Q1YA 3M4NA 3SN6A 4QDKA 2GX6A 3NNSA 4KGZA 2I3DA 1Y8RB 5G2OA 2LPMA 1BVHA 1NMSA 3AERB 1I5RA 3OJXA 2Y1EA 4DMHA 1G3QA 2HU7A 2FSSA 2J3HA 1ZH0A 3EARA 3NB0A 2YS7A 2BKUA 4B6GA 4XWKA 4X1KA 1F2UB 3TE6A 4ALLA 4ZJUA 3WNZA 3P9IA 4MUGA 1RVDA 2PKYX 4MRAA 1BRMA 5DCYA 3HYRA 1I30A 4DFDA 3ROXA 2FR8A 1KZ1A 4N5LA 1DXOA 2DC1A 3GVCA 1RM5A 4ZODA 4IS3A 3A3KA 3GEHA 2JCGA 3BH6A 1INLA 1U04A 5CITA 1HE5A 4Z4IA 1DX4A 1WCIB 2D3WA 2DSTA 1LC3A 1YU9A 1E7QA 1GPLA 3F3YA 4I1SA 4MVJG 2XHZA 4WKNA 4JKYA 1F0KA 5ALFA 1QNLA 1OH8A 3UT6A 2PH1A 1GKYA 3MUEA 4BJ6A 3DOEA 2GZMA 2P9EA 4AWAA 3EOBI 4HH3C 3RCBA 5K09A 2B36A 3ABIA 1DWUA 3VYUB 3ZV3A 4BNNA 4EVRA 2HADA 1N75A 2JZCA 2ZWOA 5LZ8A 2M9MA 3UJNA 3GHYA 5F3WB 1PW5A 4TV9B 5EIFA 1GV1A 2K2WA 1W59A 5CEEA 1TFUA 3OX3A 4CF3A 4IH1A 4TUYA 3WTCA 2I80A 5HQ3B 3X1ZA 2VTBA 1D4AA 3LNTA 2BIFA 3WLMA 3VNAA 3GPLA 5J1TB 3DO6A 1TM7E 1ULAA 1Y6ZA 2WZDA 1UPBA 2H3HA 4UHEA 2YZKA 5JDIC 2FVYA 3LTEA 4FYMA 3WK7A 3AZOA 4N3GA 5DE3A 4EMUA 2LGJA 1T6YA 5FT9A 2VH1A 1P3JA 2XQIA 2AEFA 2F67A 1QV6A 2WM8A 5ALJA 2B8EA 4CL3A 4S05A 5HKKD 2P5UA 5IAJA 2B2NA 4KSYA 3K1AB 1E1CA 4CLHA 3ED1A 3GGCA 4KXMA 3BN3A 5BYBA 4A8HA 1ZD5A 1QJ4A 3QKRB 3I62A 1DZ3A 5AW6A 4NS4A 5B7NA 1N5RA 1XCGB 2B7CA 4IP0A 3GBSA 1O77A 2ZPTX 3MN1A 4YR9A 1FEZA 3QU2A 3VRHA 1NJ1A 1R6VA 3C6KA 4J1TA 2YVAA 5CAEB 3AK4A 1KETA 1APBA 5IVKA 1K3FA 1GLVA 4I1VA 4YHHB 4RSHA 3I0NA 4QDOA 2BR4A 1Y7LA 3LDFA 4RULA 2RE8A 2JA2A 4ODIA 1M5TA 4CM6A 1U02A 4EGSA 1X8XA 2D0OB 2VLIA 2A1TR 1U0EA 1UM9B 2YOGA 3NANA 4E5MA 4DT1B 1QO0D 2NQTA 3ESBA 3QMWA 2PGAA 5HMLA 2JI7A 1L5VA 4EAQA 4ALMA 3R8XA 3U62A 1E20A 1PD0A 2F3RA 3ETGA 3PC2A 4PYRA 5FOUA 4ZFNA 2W6JA 4RDIA 1LY1A 1VKRA 5B30A 1Z6QA 2W0SA 4MR9B 3QKUA 4Q39A 4KKXB 1B0ZA 4JP1A 1XQXA 1WY5A 3D2AA 5HSGA 4XLTA 1NFFA 1WDTA 2BBOA 2FR8C 4G23A 4JUFA 3JAKB 1QGED 4LDJA 4PCVA 3RAGA 1THZA 1JLLA 2PTHA 4YCJA 5ISMA 3C5HA 1C4KA 3KQYA 3ES9A 4IJ5A 4AIIA 3DAFA 3L8MA 3QG1A 4F96A 1XTRA 1OI2A 3IV7A 4DC1A 3DOFA 4GKVA 1BOOA 4IWNA 4ZIRA 1O6CA 3QSYA 5E7QA 1A2KC 3N6VA 3ZDCA 1FFEA 2JVJA 2GF9A 4ZC8A 1HLFA 2DQZA 1TJNA 2PS9A 4M49A 2EERA 4H1TA 1L5HB 1U7XA 2A1IA 3FNQA 2XTAA 2WJJA 4GNKA 4ZQHA 5EOVA 4A2PA 4HLDA 4PQFA 2YL2A 1S2MA 3IV9A 4R3NA 5FKJA 1I0IA 1NU8A 3IAFA 3SEZA 1OH5A 1EUDA 4LSMA 4NY1A 1KAOA 4OHFA 4RH3A 1OZGA 2GPWA 4ZVUA 1OIVA 5CK4A 5AI6A 5LMCA 2FPXA 2G0TA 2VHJA 3CKYA 3LK6A 4OBBA 4YXWD 4EPRA 4A2QA 3K09A 1OZFA 3LE8A 1N0VC 2BOVA 1L7DA 4J7AA 4NHEA 4EW2A 1U6KA 5IDXA 2DG2A 4BO7A 2EKPA 1WOMA 4PZ9A 1PT7A 3OQHA 4BBPA 2BAGA 4HK4A 4XQ0A 3ZLJA 2WTXA 3IIEA 2Z57A 1FMCA 5EXPA 1GRQA 2GS9A 5BNZA 2XUIA 4Y2YA 4J1TC 1CRLA 2B3TA 1U0HC 3OCJA 3IT1A 3ZJTA 3ZH2A 1ECBA 4RQTA 1ZI8A 1RI1A 2WHQA 2IW3A 2RHTA 3IUJA 4PG5A 2O54A 4D74A 3E8SA 3P0RA 4C4TA 5BP7A 4NYIQ 4O5AA 4BNTA 1WUJS 3CVVA 2A4MA 1SVNA 1Y1TA 1ZJJA 1C9KA 1CX9B 4TYQA 4HUQA 1QHYA 2B9EA 4LJYA 1FVXA 4G5XA 3MWDB 4I2VA 4P2BA 1QPZA 4DLNA 3CUYA 1CJCA 4GOND 2ZEJA 1YIOA 1P0QA 2DY1A 1IY0A 4IIVA 3VAZA 4JYBA 3UPDA 3RK1A 1A4UA 3P4XA 1VJRA 1CEYA 5IVDA 2OENG 2BM8A 3I8OA 5F52A 1VMEA 1P1KA 2R9VA 3H2HA 3VHXA 1GZVA 4EQ6A 1D2RA 3DVAB 5TT1A 3NHJA 5IH7A 4UBNA 1MXFA 3V4LA 3F71A 3K2EA 4ZWNA 4I4TB 3HDTA 2LR0A 2WJWA 3AY0A 3AWIA 1ZL2A 3GWGA 1MX1A 3LWBA 4RCYA 4DS3A 3WWPA 3FNIA 3LUFA 4OP3A 2HRCA 3KC2A 3WY9A 3RM3A 4YJFB 4KUEA 4BMOB 3IPXA 1M8KA 2H06A 4IDDA 3U6BA 4L8WB 4QUJA 3F1LA 3VSEA 4EYOA 2Q4DA 1N9GA 2Q5OA 3PPIA 2DPYA 4C5AA 5IF9A 3V5NA 1BN6A 3BMOA 2VXOA 4BTEA 2YBEA 2G4LA 5BMVB 1A71A 4OMDA 3U39A 2IOFK 2A59A 4PSAA 2R4UA 2EEPA 5TRTA 1BMQA 2QKYA 4MV3A 5K8TA 5J4LA 3TCNA 3VAYA 1XROA 4KXWA 4B3XA 1H9BA 4II2A 4EUFA 3HO6A 4FZVA 4S1WA 5ESDA 4CQMB 3KLBA 2R1VA 3UAGA 3N2LA 1D6NA 4JBYA 4GPD1 1BHO1 3E9RA 3K09C 3P0FA 1HE4A 1MPXA 1F2TA 4TLEA 1L4FA 5J2UA 2O2JA 2W9XA 4ZI7B 1D2NA 3CLSD 4MPRA 4KO4S 2QPLA 2RGXA 5F73A 1BDJA 3KQSA 4L5AA 4EG4A 3Q85A 1O9BA 5C31A 4UPEA 4N0MA 4IG9A 2JGDA 4D0GA 2BZGA 2FEAA 1VI6A 3BZWA 4K6KA 4ZCIA 2BFMA 3K53A 1C3XA 2BCJQ 3DSRA 1OIWA 2PAFA 2VPWA 4EW1A 4RS4A 3UMMA 3NQ41 2X0EA 2QUZA 5F7OA 1XMOB 1QBGA 2W2QA 2FZCA 4MDYA 4G5GA 4QWWA 1F6WA 4ZVOA 4O33A 1XELA 3STVA 1V43A 2ZB2A 3FNRA 2YZ7A 2C8LA 3FOFC 1XCBA 3F9CA 1DKQA 4FGLA 4AD8A 1QS0A 5IEBA 4CMBA 3E9NA 3OC6A 1L7PA 1TXGA 5EJ8A 1IK4A 1D2MA 1E6UA 1Q20A 2Y0BA 1JR3D 3UAYA 4PG8A 3B6JA 1U0LA 4YAOA 3F73A 2O8EA 1XAJA 2X1VA 4EHKA 4PC3A 3V34A 5K7SA 1DAIA 2Y1OA 1NBOA 2QD1A 4LN1A 1TJYA 1I7DA 3LP6A 1TO6A 3ICCA 3FMVA 3BA1A 1VYTA 3GIWA 1MAUA 2P2LA 4B9AA 2OILA 2FLKA 3GP8A 2BGWA 1UDCA 1E5LA 5LDDC 1CRWG 1M7BA 2RHOA 1SNYA 2H48A 1XZIA 3HS3A 3M34A 5C4MA 1Q0QA 3BCSA 3RNLA 1NJ6A 3NH6A 4LV8B 3I8SA 5IN5A 5TJ9A 1W29A 2C2ZA 2DQSA 1VYHA 3QPWA 2ZVPX 4HMPA 3T0IA 4DMCA 3VHLB 1H2HA 3R76A 5LZ4A 4CWAA 4BU0A 1QPGA 1YI1A 4A16A 2ZI3A 4KLAA 3KUDA 4XIIA 2CFRA 2WTEA 2OYSA 3O9MA 1YK0A 4J3JA 4X1YB 4ESVA 1RS0A 5HGXA 1FW6A 2PV0A 1TUGA 3Q8XB 3TSCA 4G89A 4EUEA 5CLHA 4GC5A 3ZTTA 1C2YA 3QQPA 3I58A 1T5SA 4AKTA 4FFPA 3T9DA 2JI4A 2WDPA 3F96A 2HCBA 3QX9A 2VDMB 2O3QA 4PBRA 4RF2A 2HA5A 4WINA 5AJVB 3RBZA 4F12A 2VXCA 5GV7A 5AI0A 2C4HA 2PU7A 4UEOA 1WPXA 1Y42X 1JEJA 2EKLA 4KWHA 4DDHA 5ARCA 1KOGA 1L4UA 2Q49A 3B3FA 3DC7A 4WK2B 2W2NA 3HDQA 1BWRA 4WVFA 3H2BA 3RT1A 4Q1DA 2X19A 4M9SA 1WMAA 3CU5A 4DIUA 3E70C 5SZKB 4EEKA 5IDQA 1TM3E 1RQGA 4RY8A 5L3SA 2PUVA 5G3YA 4N01A 1DRJA 3ZTWA 2EKDA 3E9DA 4R05A 4HDMA 4HN2A 2BFWA 6YASA 1FSPA 5EKUA 1ZWLA 4XGQA 2YXPX 3HMQA 3ZHBA 3S6JA 4EP1A 2CEAA 3ACCA 5ALLA 2NXNA 1SK9A 3D4BA 1Q0LA 4YJ2F 2Q4BA 1MPTA 1QTIA 4EA8A 3WYCA 3URMA 2OCDA 1JHYA 4DWJA 3NS7A 1VE5A 4EY4A 4K1LA 3PGLA 2QZ4A 4UQOA 2HCFA 3B9RA 1OJLA 1ZBQA 3VR3D 4MA5A 5JJLA 3IEIA 3HXPA 2XUGA 3IOYA 1M6EX 4GXTA 4UDNA 2VP5A 3TXYA 1M5RA 4L22A 1ICIA 1ILWA 2YYYA 3DGEC 1PDVA 2Z58A 3NIDB 3R6LA 4TQAA 4X71A 1NSTA 3EIXA 4IV8A 1VB3A 2ZVDA 3QOXA 1Z8FA 2XTZA 2QRLA 2EZ8A 3I9V1 3BSYA 3DVSX 3RU2A 2UZ1B 3I42A 3H86A 1UP7A 2M6SA 1DUIA 5HIJA 3A6EA 4RD3A 2O3TA 2XA9A 5ALMA 1QQAA 4KNYA 4X1IA 1NKSA 1M2OA 4BNWA 4RY9A 3L0PA 3U3ZA 1RQRA 1RADA 1DIOB 2I8AA 2WRZA 4W9RA 3T3MB 1DSSG 3L0CA 1NBWB 1BU5A 5FA6A 1JHMA 2NO6A 2D1QA 3AUUA 1JPNA 3O8LA 1VL8A 4IZ6A 3KQWA 4JT4A 1UL1X 3NBMA 1WUIS 4CM4A 3KSBC 4H17A 4YRSA 3EFHA 3LYHA 1QP7A 2YN0A 3PXUA 5E9AA 4L78A 2FWRA 2XRYA 3A0UA 3KRTA 4LE1A 4Z0HO 1NU6A 3WA7A 3IO3A 4WBNA 4HXFB 3VTAA 3VR5D 4AMZA 5J2TF 3WYBA 1HNWB 5JZOA 2IOHA 5FOSA 5F3RA 1R10A 2HCJB 2N9UA 3KL2A 4P3KA 4KH1A 5L6MB 4JJ8A 5DZSA 3GH1A 4G4JA 3ZNQA 5BQFA 2ZSUA 3U4QA 1RKUA 1TCUA 3R4CA 2WF7A 3R7SA 3ZI7A 1T4GA 1JWAB 3G2LA 4MK4A 1KGDA 5A04A 4D9IA 1IZZA 1DCFA 2DH6A 2CJXA 5LZ7A 1Z36A 5CH3A 2JAXA 4JDPA 4RVHA 1U8EA 1E0JA 5FNZA 3LRPA 2D0IA 2WUEA 4BLUA 2XD9A 3OCYA 1GCGA 4J90A 5C34B 1W8DA 3PLNA 4D8VA 2P77A 3MHPA 1S5PA 4BEWA 3W5AA 3GI1A 3VR6H 4MGKR 1O96B 5CLIA 4L0CA 2PNJA 1QLHA 3ADBA 1E9SA 5FWXA 3X1DA 3HDGA 2X8JB 1GWNA 3TX6A 4B8ZA 2Q6IA 2O8CA 3SVZA 1AKRA 2VT7A 3PT9A 3QSGA 4DILA 5KKCA 4MV7A 1V3TA 2E5LB 4HNHA 4M7WA 3W2FA 1NQUA 2FN9A 2ZSKA 4KDEA 2V8BA 1R4AA 3HZOA 4MW2A 1I1OA 4G63A 5CVDA 1QRRA 5FJJA 3D7LA 3OF2A 2R44A 1DKPA 3PVZA 3UXEA 5C8XA 1Y9EA 5BWLA 3W2IA 4OK6A 5THKA 3UFXB 5JTUA 2A0UA 3QKSA 4URWR 2B30A 1EP3B 4XA8A 5LFAA 2WJAA 3FOAA 1EDEA 3LC7O 4YAKA 1Z0DA 2HYIC 2ZRKA 2J0UB 1C3EA 4BCBA 2HNKA 1QO9A 4QUGA 5FI1B 3EZGA 4MYUA 3B6MA 3GLRA 3CRW1 2W0MA 4UDOA 4B3FX 1RZUA 821PA 3K9QO 5FR2A 3UMJA 5A71A 3K9NA 4OHYA 2OZLA 3I1FA 2WSLA 2WUWE 4GM4A 5K0BA 4B7XA 3GAAA 2GB4A 4DYHA 3HRHA 2VK4A 3DT8A 5AVTA 3AZQA 1W93A 4O08A 5GINE 3SFVA 1MO5A 3H99A 2L17A 3MB5A 4M4SA 4JI1B 2OA0A 4C4XA 4EMSA 1LBHA 5A4DA 4FSXA 2VPZA 3GLIB 4UE6A 2UVPB 2XA1A 3KXKA 3N8NA 3F7OA 4LTMA 5KNDH 2ES4A 1XBTA 2CT8A 5AKZA 1JNYA 1VRCA 1Z6AA 2CK3D 2ADMA 3WGOA 5LQAA 3V7FA 1OYYA 2P3QA 1A0OA 2BN4A 2NTVA 2VTKA 3DAHA 4H0FA 2H4JA 3Q7SA 1PD1A 1XJWA 5FH9A 5JO0A 1Q7RA 4QBTA 3ZE0B 3KZKA 2B4YA 3CF0A 2JANA 4E5NA 1CKEA 4AO7A 5FPHA 5HZHA 3QYAA 4UTNA 5EUMA 2UUBB 3STHA 2NZ8A 1UODA 2HJHA 2N1MA 4ENRA 2BW0A 3AFIA 3PFGA 2O07A 4K3VA 4LFAB 5CLFA 4HDSA 2PKCA 2PUBA 1QAMA 2GLUA 4FS8A 4BDSA 3HZRA 1A82A 3H18A 5FTJA 1XJQA 3TSAA 1NE2A 1R1DA 1KEPA 2UYGA 4YJGA 1PT6A 1T5LA 2PJUA 3OURA 4FFBB 4NBNA 5CA1B 2WF6A 4FYJA 2B0CA 1JEYB 2YJ3A 3W8RA 5DNYB 1RAFA 3UMSA 2WWYA 4RE6A 2GK7A 2B1IA 4KI7A 1UUFA 3KKKA 3N2ZB 3ZGXA 1WDMA 3BQNB 3L82B 1R0XA 2H8GA 3T99A 3GLGE 4WUTA 3T8YA 4ISBA 3LKVA 4IXNA 2PBRA 1BHQ1 4FBGA 1PTJA 3KFXA 3B1XA 3ZHTA 1A69A 1X7YB 3I32A 2AW5A 2GLXA 4DE5A 2ERXA 1XO1A 3F97A 2APJA 2GBCA 3H4TA 5E3HA 4F5ZA 4XCQA 2QQ0A 3GJQA 4OMUA 4PBTA 2O8DB 4LBZA 4HVLA 3A4IA 4JVNA 1OE0A 1US8B 5D7BA 4HS9A 2CHQA 2IEBA 2BF4A 2NV0A 5JU6A 4A36A 2B4RO 2PGLA 2JGIA 2V98A 1BX3A 3EZFA 4LI3X 4YECA 5H70A 1GT91 1IJBA 2VSYA 2CBXA 2YV3A 3NC4A 4FEGA 2EDAA 2QLBA 3R24A 4ID9A 2P6PA 4QU8A 1G3RA 4IJUA 1Q3HA 1QG6A 3CLRD 3JQFA 4KXNA 4NJMB 2XUFA 2GF0A 1AXGA 3BSWA 4DM7A 3TUZC 1QM5A 3AL0C 1SVWA 4ND5A 2IPOA 1GKIA 3BJIC 1G21B 1M1ZA 1OHHA 4JROA 4LBYA 4RWEA 4D82A 1E2DA 3VKGA 2IDZA 4LZZA 1DXQA 2B2CA 2D4AA 1MVNA 4KGVA 1KEEB 1L4BA 2EBUA 3NATA 4PSDA 3QLVA 1L5YA 1R50A 3NALA 3K70C 2R6DA 4GGOA 4DV0B 5CDSA 1S3FA 4HZUA 5FWDA 1FUUA 1P4AA 4HDQB 4AMUA 4DIBA 3DV0B 3P2IA 2H18A 5JWHA 4N7JA 1YVEI 1XU4A 3GLFA 3VC1A 2F3PA 4ED9A 3WLHA 4OXKA 5FPSA 1HTBA 1MB2A 1KJQA 1LJUA 1V35A 2CDRA 3N2NA 2H54A 2EWMA 2QUAA 3ISTA 5I9NA 2WYVA 4GPIB 1PGOA 2J33A 2YXDA 3ZZ0A 1L5ZA 1R9NA 3IMFA 4HQ6A 3I3SR 1FTQA 2REOA 1I6WA 3G7NA 3DCNA 3VUFA 1P72A 1IN7A 1AKTA 2ZJ2A 3WIBA 1FRQA 5EPUA 2FF5A 1YVRA 3EIQA 1V3VA 3O4VA 2XZLA 4D9GA 5KNBA 4G5FA 3KOZA 5AJWA 1K5GA 3F3KA 1LDYA 4C20A 4G0PA 3CT4A 4MCIA 5K0CA 3UN1A 1KFEB 2P6MA 4WJKB 1MB0A 4MWZA 2WJIA 3IOMA 3N7AA 1TNDA 1EK0A 2X4GA 3MZ0A 2IJGX 2X2PA 1B3RA 4C03A 2NOAA 1E1NA 5EHNA 2E4XA 1W36B 1IN6A 2J3QA 1YZTA 2O2DA 5IHXA 2R97A 1DRUA 3QTLA 1PTJC 2O6HA 3CH7A 4WCFA 5CDUA 3ZU5A 1VRWA 4DGSA 3LH5A 4Y2VA 2OG2A 5JECA 3OT4A 5EIBD 5HIKA 3DZHA 3NLLA 1ECCA 2A7QA 1NVAA 4NICA 4Q4AB 3GEPA 1W5EA 4ZZ0A 5BQ3A 4CFSA 1Z4PX 3EDCA 1BEUB 3EAGA 3BMNB 1CRZA 3VJRA 4FR5A 4I50A 4JYPA 3TZBA 2D8MA 3HM2A 2RCYA 1PR9A 3BYZA 1EE2A 3TIVA 3BHMA 2IYLD 1ES9A 1Q6ZA 1U2EA 3DD5A 2JLBA 3I3OA 3E82A 2GCGA 1WLSA 1IZ8A 3TINA 4G84A 1KMCA 1JI0A 1S8AA 3JQFC 2FK8A 2HJVA 5CDTA 1A76A 1JVSA 2X15A 3EZXA 5DCLA 4BX2A 2DERA 1R8JA 1KVRA 2VWGA 1Z0KA 2XYVA 1V7CA 5EAIA 3SVTA 1FOEB 4GVLA 4RSMA 3U1VA 3HLKA 4CGZA 5KUTA 5L3QA 2WJ6A 2EXXA 3QLVC 4HADA 1G3IA 1X9IA 5LR6A 5BRNA 5REQA 3G0GA 1AK2A 2B6NA 4O8CA 4G1UC 4YRBA 4YMTA 4QXRA 5TARA 1K8YB 3NWEA 2FX2A 3KQQA 4XSGA 2CUNA 2JATA 2C2XA 4WTOA 4R1TA 4B2LA 4CT0A 5CB4B 4WN3A 4BZPA 3TAXA 2JH8A 4DDTA 2IH2A 2GMWA 1SUWA 2QA5A 1WTAA 4PFSA 1X1SA 2R25B 5IDVA 4TMFA 2C2YA 1JHAA 2P35A 3AUAA 3BWMA 2D5LA 4QU9A 1K8ZB 2O19A 3JQ8A 2AL7A 2DP4E 5B3LA 2VNAA 2Y9MB 3QZUA 3ZDXB 3NGXA 3HFSA 3WK5A 4JUDX 3MJ4A 3FROA 4BNDB 1TYBE 4P3XA 1ZNZA 2QSJA 3EAFA 5D5HA 4QVKA 2PUEA 2H7CA 4DCGA 2C7RA 4DSOA 2BZ0A 1A8IA 2FN7A 1A5ZA 5HWSA 2JLAA 3AY3A 3OQPA 3PGMA 4JN6B 4N0DA 4NBKA 3KYCA 3OWOA 4C0HA 1I5EA 3A3OA 5DWQA 1V25A 1WUHS 2G71A 1WMBA 1R0LA 3RIGA 4AMYA 4YAEA 4LYEA 5BNIA 3I04A 1ZM4A 2PA3A 2PT7A 4HC4A 4BMCA 1UP6A 5EMJA 4LZJA 2OZEA 1XB2A 1JDSA 4MVJM 2NADA 5FOXA 1Z0IA 4DWOA 1KP3A 1F5SA 3MTQA 2C9DA 4PV7A 4WCFC 3H1AA 1ND6A 1HX7A 5DB4A 1CULC 4XWTA 2GK6A 1MV5A 2ARKA 1M6VB 2XF2A 3DM5A 3PPYA 4LXUA 4Z4CA 1E6KA 1EM6A 2CXPA 4CMKA 4IIUA 5FUYA 2D1SA 1CQZA 2W2OA 1M7GA 2Z5FA 3NEJA 3SBOA 4CKEA 1GQYA 1PJTA 1FFSA 3A37A 2X9LA 4ZXPA 1K9SA 4AKHA 1UEJA 4EFMA 3E5HA 1KBOA 4OX9Y 3O95A 1VLJA 4S1PA 3B60A 1SC4A 5KKAA 3DMNA 4QGHA 1DXYA 5E2BA 4HDKB 1NN1A 2HM7A 1IY2A 4OGFA 3AR4A 4YJKA 2FYTA 4H1VA 2X6TA 1NRJB 3MF4A 1XYYA 1M54A 1PS0A 4BVHA 4QEKA 1YBMA 1RRMA 4JBXA 4MR8B 3ZK9A 2CFCA 3A1EA 1TD1A 2PWAA 2R66A 3FLMA 3OM9A 1DUVG 5LP1A 2VT2A 1ND5A 1QE0A 2EBFX 2HK7A 1FQOA 1QQTA 2REQA 2NM0A 3MRXA 1OA1A 1NNEA 4Q37A 2RKWA 2HLNA 1L7BA 4UCXA 4I6GA 2OG1A 5CYOA 1DTWB 3QF4A 2CLDX 4Q82A 4XEUA 3UGJA 2WF5A 2QPAA 4BB6A 5K9ZA 2J30A 2HV8A 1MFZA 2CE7A 3GJ0A 4JR2A 1KOLA 4RW0A 4ER0A 2IXGA 4KPEC 3PQ8A 1XHLA 3GAFA 4M1OA 4GP9A 4YAUA 3CINA 2GHIA 4L2IA 1QO0A 3GFGA 1KS2A 1W52X 3VDQA 1RYYA 1EVZA 2WFLA 1L0BA 3BF8A 4DYVA 3TRFA 4WHMA 1WUYA 3DMHA 4BX0A 1ZN2A 3BD6A 1J20A 1BC5A 2C3PA 3GUUA 2TMKA 4L5JA 4ZVTA 2H11A 1OD6A 3P9KA 2YASA 3F2IA 4GD3Q 3OKPA 1QGZA 4BNMA 4PSCA 4W6ZA 2VAMA 4YRJA 1F48A 3C85A 3GN2A 5AKIA 1IN5A 3EIUA 2QORA 4G36A 5EWMB 3CZRA 1A7KA 1ZUNB 2HK9A 3EYWA 3A4NA 4OXNA 1QRDA 2Q9BA 4BZWA 4FYXA 1BFKA 3LZ6A 2JC3A 4KSBA 1EBBA 3PHCA 2I6SA 3E18A 1GZSA 3Q3JB 1G6OA 3CBGA 4GMDA 3QVVA 4I0WB 2POQX 4GOOD 3GV0A 1EFTA 2GSWA 2AUTA 1Q1NA 4JLUA 1NMQA 2XZDA 1OC4A 3UUWA 2HX1A 3F5QA 1TA9A 2PJZA 4WQMA 2FHSA 1CY8A 1EAMA 3BXHA 3BCUA 5HBGA 1M2EA 1QOZA 1VPTA 4DXHA 1YA8A 2O50A 1YRYE 2NTJA 3KJEA 4X9XA 1NXSA 1AK1A 1DAOA 3P97A 5JFTA 2ZAGA 5EP4A 1YIDA 3DEJA 3R3HA 3U61B 3KB2A 4NXNB 3E2MA 4J76A 4YXWA 5B3AA 4DJ5X 3H3JA 5A6SA 3Q3CA 5ILOA 4DA8A 4Z0NA 1Z29A 4NIMA 1O8CA 2JH3A 2KBFA 5F9HA 5GM2A