2IEZA

Crystal structure of mouse rab27b bound to gdp in monoclinic space group
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
185
structure length
178
Chain Sequence
YDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYDSGKAFKVHLQLWDTAGLERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLIGNKADLPDQREVNERQARELAEKYGIPYFETSAATGQNVEKSVETLLDLIMKRMEKCVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the small GTPase Rab27b shows an unexpected swapped dimer
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
molecule keywords Ras-related protein Rab-27B
total genus 37
structure length 178
sequence length 185
chains with identical sequence B, H, I
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2006-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2iezA00
4Q9KA 3IIKA 5KPJA 4W5JA 3ZD6A 3LXRA 2VYFA 1WF3A 2XB4A 1ZD1A 2ERYA 2EFCB 4V0NA 2G0NA 3HPQA 3Q9LA 4FCWA 4ARZA 1YZTA 1RC8A 4NL4H 3TBKA 4LHWA 2G83A 2ZRLA 2ZR7A 4Y0AA 1LNZA 3A8TA 4YXWA 4PTLA 3K0AA 4F93B 2Q9AA 4QRHA 1QHHB 5FPHA 1YZQA 2CE2X 2F9LA 1E94E 1N5JA 4XD7A 3X1WA 4ZV4A 2IUUA 3L8ZA 1Z8FA 1S1MA 3DL0A 3DPUA 3M4YA 1E2NA 4MYHA 2PLFA 1MABB 4NDZA 3RWMB 4Q1FA 3Q8XB 5DLQC 1DAFA 1KIMA 1VIAA 4Q1BA 1KO7A 2IBMA 1LF5A 2G3YA 1KJZA 4DZZA 4UNQA 3BBPA 4BFXA 3PUWA 1R8QA 4ILEA 2QUZA 3NHAA 1F2UB 1XXHE 4XJXA 5AJZA 1OIVA 1Z0FA 3X1ZA 2OFXA 521PA 2B6HA 4FINA 2CJWB 4GMDA 4HB0A 4I1OA 3W9YA 1G3QA 3GLGE 5BWMA 1P7CA 4DDVA 2ZRMA 3SNHA 4MDEA 1H65A 3KKPA 4MDFA 4V02A 2D3WA 1MO6A 2BWJA 3B82A 5E7MA 3IO3A 4HSEA 2QL6A 1P2TA 1JQJC 1NG1A 2V3CC 2WMOB 2QNRA 4JL5A 1HT1E 2DWQA 2ZE7A 4IDNA 1KK3A 5FUVA 1DBSA 1CF4A 2F43A 4RCYA 5JZVA 1E1RA 4PC2A 3FMFA 4FCVA 2BMJA 2ORVA 2NZJA 1OHHA 4DDTA 3RC3A 4DB4A 1E1QA 1OH8A 2OCAA 1RRPA 2OESA 4LJ7A 1NLYA 4Q9LA 1GNRA 1Z6XA 4FI3C 4NYIQ 1LF0A 2Z5FA 3BE4A 2A5GA 1YZGA 2ZRCA 4Q1EA 3FKSA 821PA 2OUKA 3QPWA 2XXAA 3KZ1E 3QOFA 4B3XA 3QKRA 3OIWA 4M0LA 1OH6A 3LBHA 3TQFA 1COWD 4IKEA 1V5WA 2I1QA 2PZFA 2UZIR 2QENA 5JMTA 3K70B 1E0SA 1DAIA 1GG2A 4MGIR 1AN0A 3CKLA 5G3ZA 2ZU6A 4AKIA 2NMVA 2B8WA 3CB4A 3TH5A 3CZQA 4PSAA 1GAJA 4PQRA 1SKQA 4V0MA 4GI7A 4K46A 4TL7A 2C2HA 3ASYA 1EWRA 3NBYC 3DHWC 4JJZA 3AV0B 1EGAA 2RGGA 1E2LA 1II9A 2ORWA 4DLVA 2QROA 3CWZA 1JJVA 4I4LA 1E32A 2NO6A 2OO7A 2ZSBA 2ECKA 4GOJA 1NP6A 1N0WA 1S2MA 3DEFA 5EE9A 1HYQA 3KXKA 2GA8A 2B8TA 4OHVA 2FE4A 3LBIA 3T35A 1Z2AA 1KSFX 4DUGA 1KI7A 2GXQA 4C0JA 5L8VA 2JLZA 3U4QB 1KAGA 1G18A 1AKEA 2HCBA 1U8AA 4WVFA 1OLOA 4IXMA 1W0JD 1CKEA 2V7QA 3M1IA 4TN1A 3OEHD 4J0QA 4FMCF 3W5JA 2A5YB 4PC3A 4Q7LA 4HUQA 3EARA 4D2IA 2WAXA 4CW7A 4IEEA 1XXHB 2FG5A 5BW8A 3GLIA 4PANA 5JCPA 1DO0A 2RKOA 3O8DA 3GJ5A 5L3VA 4A0GA 5LPNA 1U2RA 2ANBA 4QHYA 3T34A 4ASUA 4U7DA 2CCKA 4X8OA 3GJ0A 2CBZA 4NP6A 2FA9A 2IYTA 3AVUA 2R6FA 4B74A 2QY9A 2MSDB 2ZJAA 3N70A 1S4QA 2J7PD 4RD0A 1OE0A 3AH8A 1XMVA 1H8ED 3ADDA 3D31A 3WP1B 1CLUA 5KNCA 1XZPA 3FWYA 4JL8A 3DKPA 3P27A 2CHGA 2W0SA 2JEOA 2QMHA 5CB6A 4AKGA 3LBNA 1Q22A 4JL6A 2IYSA 5IDVA 1P72A 3WXMA 1D2MA 4RSGA 4TL8A 3QKTA 2ZSDA 5CB8A 3A1WA 4LJ4A 4PPGA 5DO9A 5FR1A 3A6PC 4URXR 1MOZA 1E9AA 3LV8A 3DKVA 4PZYA 1KI9A 3P32A 4YLGA 2EQBA 4CT5A 1T91A 4LBZA 2V4ZA 2QTHA 3C15C 1ZM4A 5SZIA 3CPJB 3BJIC 1NLZA 4M22A 5F9HA 3H2YA 3ZYCA 4H9GA 4LBWA 4URYR 3AVTA 4MKFA 2REOA 4M1MA 4BGDA 3LRPA 1IOZA 1KK2A 2ODBA 1EFUA 5EE1A 2WIBA 2JDIA 1GWNA 3EZ9A 2BKEA 1NLFA 5GADl 1VCNA 3KL4A 3WBJA 2IYWA 1IN5A 1GRRA 1Q57A 4GZMA 1NRJB 4AIIA 1KO4A 1KI3A 1N6PA 1T5IA 1MV5A 1DELA 4F38A 4DC9A 4YMTA 4N0EA 2D7CA 1HY3A 1GNQA 1UDXA 4V0KA 3Q72A 3RS5A 5AJWA 5TDHA 5CIWA 1KOFA 3EA0A 1X1RA 4AYWA 1WDTA 5C4GB 3R8CA 1HQYE 1ZMXA 1F2TB 5B58C 3QEJA 5EXTA 4D4MA 4NONA 1T3LA 1BOFA 5FTKA 3EPJA 1QG4A 4US0R 5KPDA 3QXSA 5KDOA 1G8HA 3U60B 4DXAA 3L8YA 1C1YA 1TPZA 4LY6A 4TMWA 2GILA 1IXZA 3NXSA 2GXSA 4BLSA 1UF9A 4M1WA 1EFCA 1AS0A 2ZJBA 2OG2A 3U7FB 4GBMA 1TQ2A 3E70C 4DJTA 4LK2A 2MMCA 3NC1C 1E4YA 5F2EA 1KNXA 4C0HA 1EX6A 1XF9A 1CR4A 721PA 1KDTA 4OK3A 3TK1A 2AD5A 2CNWA 2OBLA 1AS2A 3VQTA 3GLIE 1W36D 3TVDA 1JEDA 3AKEA 3BGWA 1ANKA 3QXHA 4JLPA 2ZRHA 5KSPA 1A7JA 1GIAA 4MYCA 4QOSA 1E1RD 1J8YF 2NIPA 3AF0A 4NCIA 3GFPA 4BRWA 2YWFA 4PPQA 4CEHB 4DCTA 3RS4A 1ZM9A 1FPMA 1Q21A 1X8JA 3I92A 4GL2A 5KOYA 1NI3A 2QMOA 2HEIA 1ZM7A 2O8FB 1AIPA 2X77A 1N6RA 4TTPA 1QHGA 3RVBA 5KYKA 1ESMA 1G7CA 1J8MF 2WSSA 2NPFA 4DDWA 2ZE8A 2YVUA 1E0KA 2JLSA 4GOXA 2OM2A 4JZKA 4GPTA 4L15A 2IF0A 4YC7A 4XVUA 5E7JA 4NZYA 3N2EA 1DAHA 3R7WB 2C03A 2LKCA 5GJCA 1LTQA 2C96A 3OFNA 4PFSA 2OFWA 2OCYC 1TL7C 4W5HA 1CJVC 1G291 4P32A 1KMQA 1AA9A 1UEIA 2RGXA 4BLPA 5FOSA 2V1UA 3ADCA 4B73A 1T8TA 121PA 2YJTD 4N1AA 4RZXA 3TLXA 1LFDB 3NTUA 3C5HA 1JALA 4LC1A 4PR0A 2BCGY 3OEHA 3PUXA 4ZI3A 3KJEA 5JHHB 4JLOA 1QBKC 2OBNA 1XBTA 4HB4A 3VNUA 4B35A 4G1UC 5H1YA 4ZCMA 1BIFA 1E2DA 2GAAA 1XTJA 4Q4AA 2QN6A 4ABYA 4C30A 4BFYA 1D6JA 1PVOA 2CHQA 3IBYA 1MABA 1KHTA 3IIJA 4RY2A 4D26A 5JJIA 3EAQA 2CLDX 4LX0A 3ZVLA 2ZI3A 3ZVMA 3K70C 4JBWA 2ZRGA 3NEYA 1S1CA 3DZ8A 1A2BA 4KFTA 3IGFA 4KO8A 4Y0VA 5AUOB 4JLVA 4CEJB 5BN3A 2REXB 4OI2A 4D82A 5L3SB 5FUWA 4R2IA 1HEIA 4MRRA 5AUQA 2K5UA 3I5YA 3FPAA 2CEAA 4M4SA 3LW8A 3UWKA 1YR8A 1Z29A 2QM7A 4FXPA 5BXQC 4B47A 1J7KA 1ZM2A 2FFQA 2R44A 4FMDB 3RS0A 3RHFA 1A5TA 2V55B 1YRAA 5E3HA 2QEQA 3VHXA 4KBGA 1KK1A 2OT3B 5FUYA 4CEJA 4NYMQ 5LD2B 3AF4A 2XOKD 3QE0A 4LYFA 4WZBE 1GKUB 3X1YA 4EPWA 5GVSA 1Q1BA 2ZSFA 1YZLA 1M6NA 4D0NA 2XAUA 4P4UA 3CH4B 4X8MA 1XDBA 2IX3A 3GJ4A 5FBVB 5B30A 1S96A 5TB5A 1TTTA 2JJ8A 4BZXA 2J46A 2ZRDA 3IPYA 3PENA 2R8RA 4IOKA 5D3QA 4NTZA 1BO6A 4PO8A 4JKIA 4A0RA 1Z63A 3QXXA 3BOSA 3X2SA 1R7RA 1D2NA 1ODFA 1XP8A 4TZ0A 5EQTA 2QSZA 3CLVA 2QP3A 2F3TA 2EFEB 4BRUA 3FYHA 4A8JC 1H8EA 1OYWA 2BBTA 2LWIA 3I32A 3E2IA 4OHWA 2GNOA 1NF3A 5JECA 3AVXA 4IRUB 2FPMA 2ZAOA 4GT1A 1RIFA 1S3SA 3QVVA 4B3CA 3VTKA 2ZS8A 2WOOA 2DWOA 2GVDC 3BH6A 1WE2A 3NBZC 4D4LA 3GLFE 2GZAA 4G01B 4NHOA 2ZS7A 4FCTA 1RYFA 3PG5A 4JVSB 2C77A 4M9SA 3TRFA 2IEYA 4JBXA 1U0HC 4IVRA 3RRYA 4B71A 4LYJA 4XWKA 1NG9A 4KYUA 2JLXA 2G1JA 2ZROA 4C7OA 3BORA 2LKDA 5DHAA 1G41A 4OI1A 1VIYA 4LOAA 1QHYA 3NDPA 3TUZC 2GEDA 2ZJOA 3L43A 4Q00A 4DT1B 3NH6A 1J2JA 2EWWA 3AVPA 5AR1A 3TNFA 2O8BA 1OSNA 3U3MA 4QNMA 2D06A 2CNWD 4FWTA 3GEEA 2J45A 1E2QA 4EFMA 3VAAA 2ZJ2A 3LWNA 1Z3IX 4C0SA 3GFTA 3B60A 1IJEA 3ZIAD 221PA 2WPDD 1G8YA 3B13B 3DOEA 2IT1A 2RGEA 1UBGA 1TEXA 4M1SA 3OAAA 2ONJA 3TQCA 4B3GA 1Q1ZA 2YC4C 3IHWA 3KTAB 2P2LA 1T6NA 4EUNA 3CBQA 2AK2A 1H8HD 2JIZD 4PQFA 4AK9A 4FIDA 1VHLA 1WQ1R 4DSNA 2IS2A 1SXJE 5HKKA 2EWVA 1SGWA 2C8VA 3QF7A 3ZZUA 2XITA 5FL3A 1HT2E 2XNSA 1FMLA 1FQJA 1X3SA 2IXFA 3ND8A 2FH5B 2BEJA 3OIVA 3OIUA 3UIEA 5HTKA 4F92B 1E98A 2A5DA 3AVQA 4TL9A 4BLRA 2O8CB 3EASA 4QGFA 4GRAA 3GJ7A 2ORIA 2X1VA 2NO1A 1P6XA 2GF0A 2FFAA 2ZJZA 2J7PA 2WWFA 4TMXA 1BYUA 4FMBB 4FMCB 4D4KA 4QBHA 2QZ4A 4B3DA 3QF4B 5JSZA 3LVRE 4JS0A 1VCOA 3ZQ6A 4D25A 1OYYA 1M7BA 2L0XA 4IDHA 3ZJYA 2Q6TA 5K8IA 5F3WB 4GDFA 2V54A 4CRWB 4V0OA 2ZRJA 2XJ4A 1ZAKA 1JR3E 1Z5ZA 3EX7C 4YMSA 1OXUA 3GEHA 3THOA 3V00A 1XTIA 3AVVA 1Q0UA 4JVNA 2GHIA 2QG6A 1ZNWA 4PHGA 5DIFA 4G5QA 3EA5A 4OQFA 1M8PA 4G3XA 4JLBA 4KAXA 3TUIC 5DI3B 1UBFA 2H5EA 3PEUA 1W5TA 2GCOA 2J87A 2OXRA 3UG7A 4GZLA 2JA1A 3CRVA 2F3RA 3PUVA 2YC2C 1M7HA 1J99A 1N5KA 3GJ3A 4XVRA 5DYIA 5C46F 4ZCLA 1TUEA 5SZKB 4TMVA 4ERNA 3LX8A 5K8UA 4Z8XA 4KJZA 4TT3A 1DPFA 4M9XA 1F48A 3PFIA 1W7AA 4IHQA 5C1BA 2OAP1 1QF9A 2VF8A 4PAMA 3B5JA 2IUSA 4ZI2A 1VTKA 5E4FA 4A6PA 5BYJA 1ZUIA 4DDUA 4A2QA 2R2AA 3THWB 4OHZA 2JLWA 5FOUA 1W36C 5KSZA 2GJ9A 4ACAA 3SQXA 3VU9A 2HV8A 1N0VC 4E03A 2BKUA 3U7GA 4YONB 3ETLA 3AF1A 3PIRA 5KHOC 2RB4A 5E7IA 1U9IC 4PPFA 3ZLJA 1ZP6A 2QE7D 1VHTA 2WV9A 3KUDA 1KO8A 1OW3B 3W8NA 1R0WA 4UNPA 1F5NA 2OXCA 3HYRA 4IDPA 3OESA 5M04A 1KTVA 1FNNA 4JYBA 4DLZA 1DAGA 3SBEA 1EESA 4JJKA 3C16C 1EXMA 1TADA 1ZW6A 2H57A 3SHFA 4DRZA 4W9MC 2UVQA 4GNKA 3T15A 1FFHA 4WIAA 3ZDQA 1FP6A 2EU8A 3DMNA 5JI3E 4M1YA 3QUSA 4QFMA 2ZANA 3WP0A 2PL3A 2JAQA 4NU0A 4R9UC 2GWHA 4E22A 4IFBA 4TZ6A 1NBME 4XWOA 3UMSA 3CNNA 4BECA 2ASEA 4TYQA 4C2TA 1TAGA 2A5JA 3BH0A 1KKLA 4S2EA 4EPVA 2BHRA 3AP1A 4TQ9A 2XNDA 1KZGB 1HURA 1IXRC 3HU1A 3G5UA 2PEZA 3LFUA 3KQKA 3I5XA 1E69A 3RS7A 1N6IA 4DCUA 2B21A 2QTFA 5G3YA 4EKDA 4HEJA 3CR8A 1N6KA 3QKRB 1UADA 2NO9A 2PZEA 4JLAA 1W0KD 4XTRA 2AXPA 2P6UA 3FDIA 2FZLA 4A8JA 4QJ4A 4DIEA 5JFGA 2H17A 1G7RA 1XCMA 2ZEJA 3LD9A 1E4VA 2G6BA 3PJRA 2KI5A 1GM5A 3CX6A 3F0TA 1WRBA 4O25A 1Z6TA 4ZDJA 5JJKA 1GNPA 4HAVA 4L5BA 3CF0A 1NL3A 3F8TA 3C41J 3W3AA 2JIZA 2R62A 1R6BX 4WW0A 1UKEA 5JWOA 3QKSA 4OJQA 4RFSB 1FMJA 1MKYA 2A7QA 2GXUA 4MQBA 2AXNA 3I73A 1RKBA 1SXJA 3HDTA 1ZBDA 4R98A 4RVCA 2FU5C 1NVUQ 4EFLA 4DLXA 3N5CA 3L0PA 3NWJA 2QI9C 4HI0E 2OILA 2BIFA 3IQXA 1NVVQ 4MRVA 4B3FX 4TMZA 2CJWA 4B2IA 2J41A 1YU9A 1G8FA 2JLRA 1XB2A 2VIIA 1NBMA 5LBIA 5JJLA 1IN6A 3GLHB 2YOHA 5A5GA 3LQRA 4NCJA 2ZJ5A 3O8BA 2BDTA 3QXJA 4JLJA 3THXA 2R6GA 4A2PA 1BYIA 1R2QA 2IS1A 1CR0A 2O8FA 1OJLA 1DARA 2X2FA 1II8B 2AWNA 4E09A 1U99A 5HZKA 3A4MA 2ZJYA 2FWRA 3MWJA 4Q01A 3SJBA 1Z0AA 4B3BA 1G9XA 1E9RA 4XSHA 5AWFC 2DPXA 3VMFA 4QXAA 4CDGA 1D9XA 3L0SA 3SS8A 3CRMA 3K0AB 2J0QA 3BB1A 2XZLA 2QSYA 1OXVA 3S1AB 5EUMA 5EP3A 1H8HA 3TGPA 4PQYA 1TUIA 2AKAB 3MAAC 5CJ2A 1XZQA 1O3YA 3EG5A 4XOIA 2VSFA 3ONWA 1YVDA 3BFVA 3SDZA 2ZVQX 3IQWA 1O87A 4URVR 1FW6A 4A82A 4NH0A 1G5TA 1W2GA 1JEEA 1W48A 4UNNA 4Z8YA 1P73A 5SZJA 4RD4A 3CX8A 3ZGXA 3EIEA 2PH1A 3P20A 1JAIA 1K5GA 3U6BA 3P1JA 3NVAA 4KHZA 1XTRA 1E6CA 4ESVA 1HE8B 2YNMA 5JCZA 4M53A 3SE0A 3MWYW 3DM9B 3W5IA 1KY2A 2A30A 3R20A 3K0CA 5EXPA 2PMDA 2QGNA 4P4SB 1F3OA 1M74A 1UJ2A 4L9WA 4LWZA 1QHXA 1U0LA 1IJFA 4HDOB 4XH9B 3THXB 3L2OB 4ON9A 3BS4A 3WMEA 3KKOA 4RCZA 3GFOA 2JLYA 4RD2A 4BFTA 1IBRA 4LJ8A 4D0GA 2JLQA 4BLOA 4PZLA 1VYTA 2QTVB 1E2MA 2HDNB 2OE2A 3UK6A 2A2ZA 3DO6A 3UKDA 2WOJA 4WA7A 3VX3A 2J1LA 2D7DA 5FR2A 1ZINA 1KJWA 3Q5EA 4EJSC 2QPOA 1EFRD 4NCKA 4H1VA 4I1SA 3C14C 4RD6A 5D3MB 2NPIA 1IN8A 2WJIA 4LCBA 4TL6A 1IN7A 4UJ5A 1G5PA 2VRWA 3DZDA 5L3RA 4DLRA 2HF8A 1R10A 4TLCA 2D62A 1SVMA 1W1WA 5ANRB 4UNRA 4YXWD 2C98A 1KK0A 3FHCB 3G82C 4CF7A 1VG9B 2OLJA 4HDCA 1K6MA 1XMIA 2R6AA 2WZQA 2KE5A 3IDQA 4UXIA 3AP2A 1IY2A 1E9CA 1E2EA 1LS6A 2H92A 1MR3F 4P3YA 3PQCA 3KQNA 1ZD8A 5JWRA 4FWIB 4I1UA 2FSGA 4WXPA 4LZZA 1W5SA 4ZCIA 1UFQA 3FFAA 4G5RA 1VECA 1L4UA 1E9SA 1XU4A 4PHHA 3WMFA 3AGPA 4AD8A 3GPLA 4JLDA 2CK3D 5KNDA 3V4RA 3R8FA 4KV9A 2O8CA 1FTSA 3QQ5A 2JASA 1XMSA 5J47A 3QY0A 1KSJA 4OQNA 5EUQB 1GKYA 1WA5A 4HLQB 3CX7A 4URZR 1W36B 2ATVA 2GK7A 3Q7PA 1ZC3A 3B1ZA 5EZ6B 5FI1B 1NMZA 1G3UA 2OCPA 3BXZA 4CZ2A 2AWOA 1T8UA 3U44B 4PSVA 2AN9A 3NG1A 4NE2A 4W5WA 1T5LA 3IHLA 4EFNA 3U44A 2J0UB 1WBBA 2F9MA 4Q4LA 1Z2CA 3NC0C 1WB9A 1E2GA 2BJWA 3OAAD 4LDJA 1X8LA 4MRSA 1JJ7A 3CWQA 3EIQA 2IYZA 3KKNA 4I99A 2P67A 3TR0A 4YMVA 4ZDIA 3I61A 5CM9C 3HYTA 3CW2A 5JWHA 1G21E 2VBCA 4DSOA 4TSFD 4EQ6B 2KBFA 4Q1AA 1R0ZA 1DAMA 2RAPA 4F7WA 1VG0B 1E99A 4QBIA 1VG1A 2CE7A 2ZUDA 1G1MA 4DHEA 3BFKA 2MSCB 4OQMA 4M1TA 3RRMA 3KJIA 1T9HA 1S0UA 3K53A 3OHMA 2IYYA 1S3GA 4RKEA 4Z1MD 2DWPA 3K9NA 4M1KA 1KO5A 1SVIA 3KB2A 3FHTA 1HTWA 2QA5A 2ZU0C 3KXLA 5DN6D 3PEWA 3A1UA 1HA3A 4K81B 3GEIA 4C0KA 2YKGA 3CRW1 3L0IB 3VU9B 3EPLA 1CS4C 3AGQA 3ICEA 2G77B 2BJVA 2W6JD 1E2PA 5IK2D 1FQKA 1QZXA 2A78A 2XGJA 3SJAA 1ZM3A 1YQTA 1J90A 2QP4A 1PV4A 3MGCA 4XWAA 2PX3A 2FDCA 3AF3A 1G7TA 2C9CA 2XSZA 1NBMD 2KSQA 4CEIB 3NHBA 4AYTA 3SYLA 1PLJA 2YHSA 5CITA 2XXAB 4OI0A 3EZFA 3EC1A 1FUUA 1QDEA 1W2HA 3A1TA 5FBLB 1XWIA 2ODNA 2NO7A 4HB3A 4A2WA 1CJTC 3NIBA 3ZD7A 2WKQA 2WBLC 1MO4A 5J4HA 1T3SA 2FX3A 2V9PA 3AB3A 3VR2A 1TF5A 2ZVPX 4ACBA 2C99A 4BFZA 5IT5A 1KMHA 3ZZTA 4DLYA 1AJEA 2ZRPA 1IAQA 4FD2A 3IKJA 4LPSA 5EP1A 2RHMA 4GOKA 2F1JA 3T5DA 4LBYA 4DLSA 1RW4A 4QGHA 3BD9A 1IY0A 1NMXA 3MSXA 5JHGB 1PUJA 3QEOA 3QI2A 4DB2A 4LHXA 1DAKA 2GK6A 4RZ2A 2G9NA 2CLCX 1SKYB 3U6KA 3VHLB 1N2CE 5FPYA 3KB1A 2PCLA 5J4KA 1C4OA 5AUPB 2EFDB 1ZNYA 3REGA 2OFOA 1ETUA 1F2UA 3GJXC 2ZSEA 1CU1A 3NDBB 2IYUA 1P2UA 1WP9A 5KTYA 4DWJA 2YINC 4MRNA 2O8DA 2CVFA 4TQUS 1G8PA 1GL6A 1MRSA 4CGZA 1L7VC 3WRXC 1RRFA 4GP6A 4XVQA 1AKYA 2Q21A 2IYLD 1YE8A 3TJZA 5DYGA 3U2QA 4Q02A 3VR1A 1ZUHA 1V43A 3C7KA 4Q48A 5KNBA 4HLUA 4S35A 3J81k 2NG1A 2ONKA 5CYOA 4A4DA 621PA 3F3YA 4KVAA 5L3QB 3SQWA 3UG6A 1X8KA 2FZ4A 3K0FA 3PCRB 4M1OA 4KXFB 4TYWA 5KDLA 2RGCA 2W2VA 2C9OA 2IHBA 2E87A 2J59A 1W4CA 1XTKA 2JJ2A 4DCVA 3OEED 1M7GA 2DY1A 1M34E 3ZS9A 2ANCA 3RC8A 3ADKA 2WWHA 3GLHA 5A0FA 1FUKA 3CF2A 3QBVA 2AFHE 4LGMA 3QG5A 2D2EA 1RJ9A 2UKDA 1NIPA 3GD7A 1E9DA 1Q20A 2VA8A 3BIFA 1E2KA 3KKQA 4OYHA 3W90A 3HR8A 1JAHA 4NYMR 2F55A 1ZVQA 4R7ZA 3M6AA 4QGAA 3TE6A 2VSOA 4U00A 2OAQ1 4WXRA 3SJCA 6Q21A 4OQXA 3D8BA 1JXMA 2V6JA 1US8B 1XRJA 3U3KA 2W6ID 1N25A 1PJRA 3AKCA 2IYVA 4MA4A 3W34A 4JLKA 1IY1A 4C0QC 1CJKC 3HPRA 1ZRHA 4PSKA 4BUJA 3U7HB 2BEKA 2J0VA 2ZI5A 2ZS9A 2ZSAA 3EZ7A 5TARA 1KI6B 4PAOA 5ELXA 3T06B 2QGZA 4JVLA 3JVVA 4YMUA 1VKJA 2QPAA 1LY1A 5KUTA 2YYZA 4YDHB 3CNLA 4R2HA 4TLDA 4P4SA 1BH2A 5TY0A 4G5OA 4F4CA 1SXJD 1LVGA 2GBLA 4QNRA 1NKSA 2I3BA 1N6HA 2VP6A 2ZIAA 5FBRB 3T61A 3FMIA 2O52A 1KDRA 1QHSA 1R5BA 1QHNA 1ONBA 4OJKA 4ZKDA 4QGGA 1OHHD 1XD9A 2XTMA 4JYCA 1SQ5A 1XPUA 4Q21A 3VX4A 4ZKEA 2HLDA 1E79A 2QMEA 1M2OB 1TEVA 3W3ZB 1Q1QA 2BV3A 2OSBA 1TQ4A 1OXTA 2WSSD 3KTAA 5IF9A 3FKSD 3KJHA 2WICA 3LLMA 2GJKA 1CIPA 1Q44A 2AX4A 3AUXA 5TV2A 2ZE6A 2F1HA 2P0EA 2QMUA 2IL1A 4TMKA 2CK3A 4UKDA 4PO9A 1HUQA 4NYIR 2ZRBA 3K1JA 4TWZA 3B1VA 1DG1G 3RYTC 1Q12A 4KLNA 1YR6A 1GL9B 2YZ2A 3M0EA 3RRZA 3QPVA 2REBA 2FSIA 2Q3HA 3WNCA 4K8OA 1LS1A 4JVMA 1BMFD 4QG7A 4B43A 2X8AA 4BQSA 3SHWA 2RH5A 2WM9B 5EXXA 1XFAA 4JIMA 1G19A 1N5LA 4D80A 3VR4A 1Y3AA 4MITA 1JBKA 4O0MA 2C95A 2GDJA 4AKHA 3VR3A 2ZXUA 3R9WA 2J0UA 2QT0A 4DBLC 1G20E 5DH9A 2XJ9A 3PUZA 1IM2A 4Q9IA 2IWHA 3DDCA 3KKMA 1P60A 1PUIA 3H84A 3U3OA 1NN1A 4Q7MB 2DFNA 3LNCA 3U7EB 4E5UA 5J40A 2IYQA 2G0TA 3GQBA 3JZMA 2ODWA 3PVSA 2X2EA 5DI9A 4IVQA 1R0XA 3GLFB 4TTRA 1EWQA 4DEYA 1VYUA 4BFSA 4O2LA 1P3JA 4A6XA 5GJBA 2OZEA 5EE0A 1K8RA 2CL0X 3MJHA 4IOLA 4B48A 1RYHA 2GAOA 5DN6A 5FFMA 2PX0A 2I1VB 1CJUC 1E3MA 5FPKA 4UJ3A 1N6OA 2YWEA 4QM7A 2MMGA 3VR6A 1AGRA 4TLAA 3RDPA 2XZOA 3GJ6A 5J4LA 4POAA 1OPXA 5DHFA 1HE1C 3SYNA 5CM8B 3H4MA 1JPNA 3IPXA 1EFTA 2HCJB 4PAQA 3TSWA 4CYMA 2O0JA 2DFKB 3OE7A 1IQPA 1GITA 1SKYE 4A8JB 3UXMA 2OBMA 1II0A 3HU3A 2QT1A 2ZPTX 5CJPA 2ZAMA 4TYPA 1NKTA 1N6NA 1P61B 2LCFA 2NGRA 1DO2A 2IK8A 5JI2E 3PXGA 2XOKA 3EZ6A 4GMXA 2RCNA 2PLRA 1G3IA 4ESHA 2FV8A 2VO1A 4AURA 1NY5A 1GSIA 5EE5B 1NVWQ 1VCMA 4C9BA 4EQ6A 4HDQB 4Z51A 3SZRA 4PHFA 2O5VA 1OXSC 2J5XA 1UM8A 1TU4A 3V4FA 4DKXA 1SVWA 2FEOA 2DFTA 2JJ2D 3ASZA 3ZH9B 4BFWA 1OFHA 5JSZB 4Q19A 3WYFA 1W46A 1FNMA 3IUYA 1AZTA 4V0LA 1L8QA 2FEMA 4PZZA 1I4DD 1NMYA 1R5OA 5FOXA 2KBEA 4PO1A 1YZUA 3ICQB 2C04A 2PEYA 4MKIA 4KITB 1EFRA 2BVNA 4B44A 4HAWA 1ZU4A 5FI0B 2ZYWX 4GP7A 2QU8A 1Z22A 2VF7A 3CF6R 1GFIA 3TAHA 3UANA 2P5SA 4LJYA 2HXYA 4B33A 4BFVA 4II7A 2BM1A 3RSOA 3T1TA 4QJ5A 1HQCA 4US2R 2NTYC 3I62A 1F60A 3NBXX 2G88A 5KU1A 3LA6A 4QHSA 1F6BA 4PX9A 2Q3FA 3DM5A 2CL7X 1DG3A 3EWAA 4JT2A 1RE0A 4DIDA 3EZ2A 1SVKA 5B64A 1HH4A 3CH5A 2JLUA 5J4VA 4NYJR 4A92A 4TSFA 2O0HA 1R5NA 3SFZA 2BMDA 3U3JA 3EXAA 4OK6A 1GDDA 2ERXA 1Q3TA 1A4RA 3S1AA 3SR0A 3IEUA 2IEZA 2OLKA 2AHOA 1DVRA 3QPUA 3BFXA 2BCJQ 3QKUA 1P9WA 2GCNA 1KI1A 1SVLA 3I3SR 1T4GA 1X6VA 1XX6A 2J7KA 5AK0A 5JRJA 3MFYA 1PZNA 3GLHE 5HCIA 4RFVA 3R7WA 1Z08A 1II8A 2VP5A 2VHTA 2O0KA 2VLIA 2FFHA 4QBFA 2NZ8A 1KKMA 2WPDA 2WHXA 3OF5A 1G7SA 2OV2A 1W0JA 3WHKA 1N0UA 1U9IA 2V6IA 4JLMA 1E9EA 4DLUA 1D2EA 3B8HA 3QBTA 1OH7A 4HB2A 1OXXK 3QXCA 1ZIOA 4KODA 4H1UA 3TW4A 4PHTA 3KXIA 4HZUA 4JLNA 4FW9A 5IK2A 3B1XA 5IRCD 4US1R 2PT7A 3QIAA 4EJSB 5JEDA 2F7SA 3SBDA 3UMRA 4C3ZA 1XJ0A 3E5HA 3PUYA 3K09A 3IBGA 4A0HA 5H70A 1E79D 1K5DA 2P65A 2VTKA 2PCJA 3EW9A 2HUPA 5HZHA 3OIYA 2WJYA 2GXAA 2BMEA 2YOFA 4JT4A 1TF2A 3NH9A 4OK5A 3OFND 1YKSA 4FMDF 4C2UA 2GJAA 3JZAA 4KBFA 1P2SA 1YZNA 1YZKA 4DCNA 4E07A 1XJCA 3V9PA 1DADA 1E9BA 2W2TA 3RRNA 3WMGA 4BLQA 2IW3A 3EPKA 5HE8A 4V03A 1KJYA 3ZVNA 3K0FB 3LY5A 3P4XA 1SVSA 4XSGA 3W8RA 1U8ZA 1T3HA 4AWXA 1G3MA 2GESA 2H8KA 2ZRAA 3K9HA 2PT5A 4X8HA 3B9PA 4X8LA 5G41A 1ZJ6A 4F91B 2AD1A 1QHHA 2IYRA 2NQ2C 3FHOA 4LJ6A 2FJUA 1JQLB 2R65A 5BN5A 4TLBA 2O8DB 3GLGB 2PZGA 2ZI7A 2IS6A 4BEBA 1Z6GA 4AG5A 3CM0A 1OFIA 1U81A 1L4YA 3T1QA 1SULA 1HV8A 2YWHA 3CIOA 1KI8A 3TSZA 5G40A 1I2DA 2CCGA 4TT3D 2RGNC 1SZPA 4B34A 1R0YA 2EYQA 4B6FA 1SXJB 3MWKA 1CEEA 1VYVA 2QRZA 4M9QA 1D9ZA 4Q4JB 4AG6A 2YV5A 2NO0A 3QENA 4LC0A 2EYUA 3MMPA 4Q4AB 2SHKA 3EIHA 3BH7A 3DMDA 1KDPA 2XZPA 2CCJA 3FGNA 1ZU5A 4D6PA 1KDOA 2Q9CA 4F4JA 4Q66C 1E2HA 4Q4HA 2PJRA 1FZQA 4O3MA 2ZI9A 2G1KA 4B2PA 2P3SA 4B6EA 2QAGB 2ZR0A 5G53C 1CP2A 4EDHA 1JR6A 3FMPB 2VEDA 1NVXQ 2OCBA 3PEVA 4DLWA 4HATA 2WWYA 4TYYA 5FUXA 3BC1A 1G6HA 4HAYA 5FOWA 2CMKA 3D6TB 1G16A 4R71A 4L8GA 4WOPA 3WY9A 4KSBA 2BC9A 1IONA 1UKYA 4IJMA 3D7MA 4LV6A 2D2FA 3ADBA 1AQYA 1U8YA 1FL9A 1ZCAA 4WZ6A 1ZNZA 1E96A 3C8UA 3U3RA 4MH0R 1AK2A 2C9YA 3W6OA 3WRYC 4LYHA 3AUYA 2QP9X 4Z54A 2JJ1D 1WXQA 3MWLA 1E2JA 1RVDA 5HR5A 4XIGS 4P0TA 1Z0DA 2W6IA 4TMTA 4BZPA 1JI0A 2YWGA 4G5SA 3FVQA 3H86A 3GP8A 3F5FA 3GLIB 2JATA 4KFRA 4PPNA 4C0AC 3L0OA 3FB4A 3KX2A 3QVUA 4LRWA 4XD7D 5JLJA 4EPYA 1RPZA 5C4MA 3ZVRA 1CR1A 2KB0A 4OQLA 1UDWA 5CLLA 1RRGA 2ATXA 3CPEA 1MH1A 3IIMA 4NBSA 3VKHA 4M8NE 4KU4A 5FTJA 1KAOA 4Q9JA 1E2FA 2QBYA 3QG1A 3A36A 4HLCA 1IN4A 5KDDA 2J3EA 1US8A 3I1FA 3Q3JB 4TLEA 2FFBA 1Y63A 3ZIAA 2FGKA 1YR7A 2XTZA 4RD3A 3BWDD 1UKVY 2AK3A 1YJ5A 3VKWA 2GF9A 1G3RA 3LDAA 1UPTA 1AZSC 1GRNA 1JNYA 2QQEA 1CRPA 1RJ9B 1RZ3A 1QG2A 2HLDD 1RRCA 3LH5A 1OFTA 5SZHB 2XB2A 3U5ZB 5FOTA 3TMKA 8OHMA 3T12A 1XEXA 1Z28A 3W6PA 3MD0A 5DE3A 2C5LA 4LHVA 5AUNB 3X1XA 2RGNA 3TW8B 1KY3A 4D81A 1NY6A 2BBWA 1AGPA 4MUAA 4GFDA 2VHUA 2CL6X 1NIJA 1Z6AA 2HYIC 5EJEA 2FSHA 1KZ7B 4LHZA 2W00A 4OHXA 2VP4A 5HCNA 2WWGA 1ZCBA 3C5CA 2ZYUX 3GMTA 4UQOA 3VNVA 2W83A 3K8YA 4JKYA 1DTSA 2FMXA 1GOTA 2IYXA 4DLTA 3VFDA 4P4TA 4V0ME 5LDDC 5HPYB 4NYJQ 1B0UA 5A4JA 3ZS8A 1BKDR 2BM0A 1R8SA 2QORA 1ZC4A 3B9QA 1G4AE 5HKKD 2WJJA 3AM1A 1OH5A 3A1SA 2GJ8A 5HE9A 2DCUA 2GCOB 2F43B 2J9RA 2FPKA 2P5TB 4MYTA 4IOMA 2X19A 1W4AA 1GKIA 4MRPA 5EP2A 3OEEA 2HXSA 3FKQA 3TSOA 3HR7A 4ZIRA 2BMFA 1G8GA 2DR3A 4OL0A 3TUJC 3I4LA 2EVWX 2XEXA 4HYYA 4B2LA 1TMKA 1DS6A 1UKZA 2IXGA 2B92A 4EJSA 5AJVB 3B2EA 1E1QD 1OB5A 2ZYTX 5H8WA 3K09C 4PC1A 1OIWA 4BZQA 5FL7D 5TVKA 5K8TA 5JS8A 2YOGA 1OFUX 1PLKA 1WCV1 2IHYA 2GVZC 4YQFA 1XD2A 1SVOA 4NMMA 1JR3A 3QF4A 3T5GA 4MKHA 4NKRA 3REFA 4P33A 4PC6A 5TXGA 4LSGA 2ZUBA 3LLUA 4DVGA 4D0LB 2Z4RA 5DISB 3MG9A 5CLQA 3A1VA 1W47A 1KGDA 2V7QD 2VP2A 3RS2A 1T0HB 3OE7D 3B1YA 3SOPA 2FN4A 1XTQA 3THYA 1AS3A 1NN0A 4CEHA 4OHYA 1ZD9A 4HAXA 4QBGB 3H1TA 5KSYA 1L2TA 2F1RA 1OKKD 4ZDWA 1KI4A 2H16A 2ZTSA 3MUFA 4Q7JB 5JBQA 1VCIA 4DEXA 4JMPA 4ARZB 3L82B 3RLFA 2NOAA 2A3RA 4URWR 3KJGA 2VP0A 1UAAA 1Z0IA 4MUBA 2VHJA 2QE7A 1VMAA 2MSEB 2Z4SA 3EWSA 2PBRA 2QAGC 4QM6A 2H7VA 2V8OA 4JSYA 4HUQB 2XTNA 5CIQA 2HF9A 1TQDA 2O8EB 4U02A 1G5RA 4IVPA 5GVRA 4EPTA 1Z6YA 2E1RA 2OEPA 3RS3A 5C18A 3JVUA 4GSYA 5CDFA 3CRRA 1CULC 4IXNA 3GCGA 3SC3A 4AY2A 3AF2A 4NCNA 5C2JB 2JLVA 4HZIA 2AL7A 4M2LA 4BEJA 4A9AA 4UXHA 5FOVA 1OB2A 2DB3A 2RGAA 2A5FA 4U5XA 3QJYA 4B76A 1DE0A 1XCGB 3EC2A 4QKQA 2VQSA 2QBYB 2CHVA 1E9FA 1KMHB 1B23P 2ZM5A 2QAJA 1E2IA 4HLDA 4DT1A 4QL3A 1KSHA 1S9HA 3PV0A 3NBFA 1T0JB 2RHDA 2IC5A 2BBSA 2WTUA 1DAEA 1GZSA 3K9GA 1QVRA 2WAYA 3LAWA 1X1SA 1FTNA 1BMFA 1SHZA 4PC7A 4A15A 5JRZA 1CXZA 1QVAA 3B6EA 1OKKA 1QRAA 2VSXA 3K0CC 5L3SA 2ZJ8A 3BRWD 3RNLA 2ZR9A 3HJNA 4DSTA 3I72A 3CPHA 4OI4A 2A9KA 3UWOA 4KI0A 2JDID 1LW7A 2FGJA 3THYB 1EFHA 3KDSE 3TKLA 2OHFA 2QRNA 1SXJC 3H0KA 3DOFA 2ZETA 1A1VA 3FFBA 4MGKR 4PXAA 5DGXA 3RSLA 2HYDA 2WIAA 1JECA 1OT3A 4F4IA 3EPHA 1MT0A 3TAUA 1E0AA 5CYPA 2W58A 3CZPA 3HU2A 1Z47A 3T1VA 2E9SA 4LJAA 3W6NA 4NPHA 1X86B 1KI6A 2EFHB 4B32A 5FTNA 3UATA 1ZYUA 1TQ6A 4W7SA 4EIWA 3A4NA 2GKSA 2ZI6A 2WWIA 2CVHA 1I4LD 4A0FA 4L4UA 1CR2A 1KNQA 1G4UR 4RZ3A 5F98A 2ZREA 4AI6A 1ZIPA 1VPLA 1IXSB 2AR7A 1Z06A 3HWSA 4LYAA 4RZUA 4URUR 1N3BA 3CONA 1NN5A 1Q3HA 1WMSA 2AKYA 3VKGA 4YMWA 2ZI4A 2P6RA 3TVTA 1TF7A 3NKVA 5J5CA 3CRQA 1WBDA 1TNDA 2ZQ5A 3Q7QA 2WWXA 3AQ4A 3LVQE 4QJ3A 3PEYA 1ZUNB 1I2MA 4IW3B 1KO1A 4N0DA 1MO5A 1P9RA 3AP3A 4LV8B 4CIDA 4BWYA 2GEVA 4B75A 1GRQA 5IHPA 3GLGA 1P75A 2VL7A 4ITRC 4G5GA 1E0JA 1YHNA 3LXXA 3KQLA 4JBYA 3G0HA 2IA5A 2WJVA 4TYNA 1XXHA 3NEJA 1P4SA 1XPOA 1COWA 3WHLA 1JPJA 1N5IA 2AFIE 3B85A 4LBVA 2JCSA 4HUTA 3MRSA 4C0BA 3HP1A 2GJSA 3RABA 5E95A 1J70A 4A36A 3LQQA 1C9KA 4HAUA 5L3QA 3KFXA 1IHUA 1Z0KA 3MJRA 2ZUCA 4YDSA 3R9XA 1FX0B 2IF2A 4HAZA 4KSCA 4Z1MA 3AEZA 2ZRIA 1U98A 1VG8A 3U4QA 4L16A 2EFGA 3D3QA 5CDFE 1LB1B 5UKDA 5LD2C 4RJLA 5GJWC 1NJGA 2IXEA 1G17A 1M1YE 2Z83A 4EAQA 4Q1DA 4KLZA 3KUCA 1XJQA 1BS1A 1NNEA 2O8EA 3AKYA 3P26A 2ZYVX 5F9FA 4UNSA 3ND9A 4BASA 2Z6VA 2Q3MA 4LJ9A 5KSOA 4MYUA 4KCGA 4O2RA 1UEJA 2WWWA 3BERA 2H18A 1CJMA 1GL7A 3T1OA 3CR7A 4KFUA 3K70D 4LI0A 5H68A 4LUCA 5FTMA 4ASUD 4QHTA 4MKGA 3KQUA 3R9IA 1W4BA 2GZHA 2KWIA 1Q1EA 2TMKA 1QHIA 2O8BB 4EPRA 4JSTA 2VHCA 4CT4B 1UBEA 5FL7A 3TR5A 3PITA 1GTVA 4AKEA 3A58B 4NCHA 4WZAE 2ODEA 4Q9HA 4BE7B 1PLLA 2R6DA 3K9LA 1LV7A 2F6RA 3A37A 4TQAA 5BQ5A 2EW1A 3K0SA 2BOVA 2JJ1A 1W0KA 2W2XA 3P4YA 1DOAA 2IS4A 1SHKA 1XD2B 3LO5A 2D4HA 4QC2A 3IILA 4CVNA 1U94A 4BPBA 3B1WA 4C0LA 3FOZA 3K0EA 1XCPA 1JB1A 2GBLC 2N46A 2VH5R 4RD1A 1XNJA 1A82A 3E1SA 3SEAA 1DEKA 3SYKA 2RMKA 4Q7KA 1N6LA 2WJHA 3LX5A 5K8LA 2Y8EA 3AVOA 3QSYA 3O8CA 2CLSA 3QKSB 4RFSA 5AJYA 5LB4A 2DBYA 1U90A 3O8RA 2DHRA 4AYXA 4Q5IA 3AVWA 1A2KC 2Q0HA 2QAGA 4G0NA 1CBUA 2VHQA 3FMOB 4DSUA 3MCAA 2WJGA 3SI7A 4L9SA 1FOEB 2GEUA 3CUEF 4Q4HB 1AM4D 2HJGA 1KSGA 1Z0JA 2C78A 4IDQA 5LB2A 2XNDD 2WKRA 3ZQJA 3DVLA 3UPUA 1ELOA 2FF7A 3FTQA 4OBEA 4I81A 2ZRFA 4MGZR 4IOJA 3X1DA 2IUTA 3KQHA 2FSFA 2JGNA 3O47A 1EX7A 4WAUA 2ZITA 2DFLA 1FX0A 1F2TA 4LPKA 5EZ5A 3BB3A 1KI2A 1S8FA 4KFSA 1EG7A 2WVJA 1NVVR 4ZDKA 1OIXA 1RFLA 3OZXA 2RGBA 5FBQB 2GCPA 1D8TA 1KYIA 1MO3A 5BYKA 5FH9A 4HLUC 4A1FA 1NSFA 2FOLA 1I4TD 3BAFA 2QQ0A 3PR1A 1XEXB 4UXJA 3C4JA 3WYAA 3WNDA 1OF1A 3BB4A 3CO5A 1NJFA 1P2VA 2CDNA 1Z83A 3B78A 3RANA 5DNYB 1GVNB 4ZPXA 4C4PA 1JXOA 4TTQA 2RGDA 4Q03A 5FPTA 3RAPR 1P5ZB 3RWOA 1UBCA 2R6CA 3SFVA 2B7BA 1ESNA 1EK0A 2FPLA 3FE2A 2I4IA 1XD8A 5EE3A 2BBOA 4LHYA 2WSMA 1FP7A 3MLEA 2B7CA 3ZZ0A 1S9DA 4LJ5A 4DCSA 2ZRNA 1XEWY 4I1VA 5B57C 1TX4B 2CXXA 4WBSA 1Z07A 2N42A 2XSZD 3SN6A 2PMKA 4D4JA 2P6NA 5P21A 2F1IA 2WKPA 3AVYA 421PA 2VP9A 3ECCA 5TMPA 5FPSA 4C7OB 4IDOA 2DYKA 1MRNA 5CK4A 2GRJA 1CTQA 1R4AA 2W0MA 2V1XA 3CNOA 2ZE5A 5D3MA 5DSZA 5FTLA 3THWA 4IFEA 4DUGD 4CEIA 5KO2A 3UMFA 1XPRA 4HZUB 4N3NA 5B2ZA 3GLFA 2ZRKA 2UZ3A 1W44A 2HJVA 3AKDA 4Q18A 4KYIB 2IWRA 4Q1CA 1XMJA 1P9NA 1VDZA 2QPTA 3WNBA 2D74A 4Q47A 1G64A 1TU3A 4MGYR 2HT1A 1AQUA 1CRQA 2XX3A 5FBWB 2N1BA 1W4RA 4OKSA 5EXSA 4BLTA 4KVGA 2Z43A 3Q85A 1XEFA 2W6JA 4BFUA 5CK5A 3N2IA 5EP4A 1NSTA 5J4YA 4M21A 3WYGA 1G6OA 1JR3D 2KJQA 2GTPA 5DI3A 2GZDA 3I8XA 3IO5A 3Q5DA 1YRBA 2H1LA 2VPPA 2GETA 2Q9BA 3BK7A 1U0JA 2Z0MA 3VR5A 2WMNB 1XEWX 3A4LA 1OV4A 2HT6A 1GILA 3B7GA 3KFVA 3QNUA 1YR9A 4M9ZA 1GP2A 4IEIA 4XTCS 4Q4JA 5AJXA 3SU8A 3TIFA 3I8SA 1D5CA 1GUAA 4AC9A 2PJZA 2J0SA 5GJVC 1XTSA 1ZNXA 4LV5B 1P62B 4EPXA 3LW7A 3SJZA 4FN5A 2QM8A 4RKFA 5JS7A 3U61B 3IEVA 5BN4A 2R9VA 4P31A 2FNAA 3WBKA 3GJ8A 4ZIRB 5JEEA 1W49A 4ZO4A 1NN3A
chains in the Genus database with same CATH superfamily
3QA3E 3IIKA 3N53A 4JELA 4JP2A 2CEKA 1RLJA 4O02B 1QV6A 4BO9A 4DAEA 3WXBA 1N0IA 4MZXA 2DFDA 1H3EA 4P7JA 1X92A 1ZD1A 5D1HA 3LQFA 2CNLA 3DP7A 4BU1A 3DNFA 3Q9LA 4MIEA 4O29A 2D7JA 2ZR7A 2ODQA 3A8TA 2CF5A 1COZA 2AG6A 3ANTA 2EIHA 2FEAA 5EFOA 2W6OA 1YZQA 3OJLA 3QJGA 1E94E 2NVOA 5LYJA 2HPAA 3X1WA 2VZ8A 5CMLA 1HE3A 3L4BC 1N2EA 1FDOA 3L8ZA 2XE8A 1UH5A 5HJ2A 5KINB 2R1ZA 3HB1A 1QIJA 3HY6A 5SYAA 4MYHA 2YWJA 1MABB 3RWMB 1PIWA 3Q8XB 1DIBA 1Z5GA 2X3YA 2G0AA 1KIMA 4EB6A 2V5VA 1K89A 1SG6A 1Q1GA 1POXA 3PRJA 3KQWA 1LF5A 2H52A 3LC1O 4LXYA 2G3YA 4K9NA 5JAHA 5CAEB 3DZIA 2RHTA 1YGPA 4TS4A 3RRFA 1IZ7A 3LCJA 3QUCA 4E4RA 1NPYA 3R5JA 4XVCA 2QUZA 3NHAA 1F2UB 1XXHE 2X0IA 3L1IA 4LCJA 4OAQA 5K3SA 3DTNA 2IY7A 3RFCA 2G17A 1EFVB 4U6NA 521PA 4GMDA 4I1OA 4UARA 2IELA 4YVFA 5TNXA 3ZU4A 4DDVA 2C83A 1L5YA 3GPDG 3RJ9A 4MDEA 1JTFA 4J0HA 4B7UA 5AVRA 3L7DA 4EWLA 4RA9B 2QL6A 1P2TA 1NG1A 2ZYAA 1E64A 2V3CC 5C8XA 1O4WA 4AZTA 1U2EA 3JQ8B 1KQ3A 3Q8MA 2QNRA 4JL5A 4XGIA 1NHGA 4J9VA 4LCEA 1KK3A 5FUVA 1DBSA 3TMYA 1QV9A 5HOEA 2YXPX 3BXPA 3R3ZA 5LVAA 1T2AA 2BMJA 4DDTA 4YV7A 2HJSA 3UT0A 4C01A 4AUNA 4LJ7A 2OESA 3H99A 5HVNA 1WKVA 3URKA 1LF0A 3D4OA 1UPXA 2ROQA 2CVPA 3PX3A 4M1QA 821PA 2OUKA 2BFAA 2VAWA 4N76A 2XXAA 2I2WA 4ZMBA 1SUWA 2Z9DA 3QOFA 1U5AA 3EODA 3OIWA 1D07A 2W43A 3AUAA 3BXOA 1M1NB 3TTWA 1OH6A 1COWD 2IZ7A 1EAYA 2ERCA 3F3SA 3HN2A 2I1QA 2R7KA 2UZ0A 3FHJA 4OLFA 4Z86A 5LFAA 1Y6GA 1IVYA 4WKOA 4BNHA 5JMTA 3K70B 4CWAA 4DG5A 3UYLA 5FWYA 4MIKA 4BX2A 3QKWA 3TW8A 3QWHA 3NWOA 2IU4A 4MGIR 1JFFA 5CNIA 1YCFA 5TMEA 3NM4A 3CB4A 2HNKA 3CLKA 4U5QA 3TH5A 4PQRA 1SKQA 2AB0A 1SBHA 4GI7A 4RVOA 5DASA 3O1HB 3UHJA 4TPKA 3ESQA 2IITA 3FOZA 1FZTA 1YZVA 3R6TA 1EWRA 3OQIB 3BL8A 1T5TA 3A05A 5K0NA 3AV0B 3CN9A 4Y6SA 2VAPA 3GFVA 3ZTTA 4IILA 1ZOPA 4DLVA 5IVHA 2CXPA 2JARA 1E1NA 3NTOA 1RWNA 1JJVA 1CHDA 3E48A 2FWNA 2OO7A 1E66A 3K32A 4GOJA 3ZE6A 1NP6A 4HDNA 4MVJI 5JCOA 2UYHA 1HYQA 1LSOA 4JCOA 4PBSA 4OHVA 4OQPA 1NULA 5AW8A 3T35A 4D9CA 3SYTA 5I4CA 3DMFA 2JLZA 2VFAA 1KAGA 2ZXFA 2WVAA 3A7DA 4X90A 5IVKA 4BYGA 4XM2A 2B3TA 1N2HA 2HCBA 4QDKA 4HQ6A 4WVFA 1OLOA 2BEUB 2ZZKA 3OEHD 1DJOA 1Q84A 2EJBA 2YV4A 4FMCF 2A5YB 4MV8A 3V1MA 4L6IA 4XLZA 4B7ZA 3H04A 3AEYA 3E8SA 3ZCPA 1LPOA 3HN7A 1EINA 1Y7TA 4JA2A 6GPBA 1GYPA 2XDQA 3GT3A 4FEAA 3QA9A 4MRMA 4MUMA 4MSUA 3SJUA 2E5LB 4ED9A 4E2ZA 1UXJA 1AQIA 4PANA 2YYYA 2I0FA 3N8KA 4Q24A 1SZDA 4UM9B 5L3VA 4Y9SA 4A0GA 3AHHA 2O2CA 3NDRA 4GYKA 2RH8A 3R3YA 4C22A 1MQSA 1U2RA 2ANBA 1SVUA 1W5AA 3FGPA 4PN3A 1EXNA 4QHYA 2VH1A 3T34A 5BR7A 2N75A 2BP7B 2WC1A 1YB4A 4YCDA 3H2GA 2A3NA 1W5BA 1K1EA 5GONA 2CBZA 3BF8A 4K6OA 3V2IA 1KPHA 3C70A 3AVUA 1MPTA 4Z6KA 3GPIA 1Q0HA 2IX9A 4B74A 3ONEA 4RD0A 2BAGA 1WMBA 2BFCB 2Q4RA 3BKXA 1CRPA 1OE0A 4LYEA 1GEEA 3V55A 1CLUA 2VJMA 1R6DA 5KQRA 1N8KA 4JOQA 2CHGA 2W0SA 2VXOA 3CLSD 3JRWA 4GUAA 5EIXA 3LBNA 1U28A 4QYIB 2IYSA 5EZYF 4HVTA 4GL4A 2XCSB 3SOZA 1D2MA 3WXMA 3DQPA 3MELA 4G63A 4V3CA 3LC2O 3IQDB 3RTAA 3SZOA 1Y3IA 4D9KA 1MW8X 3RKUA 3HWRA 2QDKA 3OQ6A 4JEHA 3A1WA 1GV1A 3L0CA 5CBKA 2SECE 3S2FA 2VBFA 4QVIA 2IXTA 2EQBA 3HLTA 3VUEA 1T91A 2VEOA 3DWIA 5F12A 3HDHA 4M8KA 1V37A 5JNLA 1VRCA 2V4ZA 2WRZA 3C15C 2J3KA 5DU2A 4WFQA 3BJIC 5F9HA 4M22A 4W6ZA 1N5OX 3H2YA 4NPAA 3ZYCA 4RDXA 4AULA 1OI7A 4URYR 3ZHVA 1SJ9A 1TJNA 3ZZ1A 4L9RA 1BS2A 2QRVA 3H4VA 4I5IA 3BGVA 1XVAA 1EFUA 5EE1A 3GQBB 1SK8A 3ER6A 1FU7A 3KJQA 3AFOA 3O90A 1OTXA 1ZZGA 3CKYA 3NTQA 1GWNA 3KOYA 4IH9A 1C9NA 1B0PA 3V7YA 1YC5A 4BX9A 4KIUA 1X80B 2DULA 1J22A 2WG1A 3IPAA 4DLNA 3QLEA 3WBJA 4LFBB 1LWNA 3CG4A 3KE9A 5BW6B 1H0RA 4W6QA 5A6VA 4RELA 1KO4A 1X1EA 1EWTA 1UKBA 4X1KB 4DC9A 4EEXA 1UDXA 2DAPA 4JUIA 4V0KA 2XPCA 3LGXA 4YGYA 3KR0A 4R8KA 5AJWA 5TDHA 3AONB 1NONA 3VU0A 1KOFA 1VDMA 1X1RA 4L4YA 3P2EA 4H0CA 1P8AA 3W78A 2C4UA 3U9SA 3R8CA 4A5OA 1HQYE 1I0ZA 1UJBA 4N9WA 3BJRA 5EXTA 3IKMB 2AEEA 3KLBA 4I5EA 4YMGA 1ZHOA 1GDHA 2B5WA 5FTKA 2Q7XA 3I8OA 4IXDA 1ZR4A 1A9YA 3E1GA 3MTQA 3UK7A 4J7XA 4DXAA 1LSSA 1M1ZA 1MG5A 3FG9A 3NJ4A 2FP4B 4LY6A 5HOQA 3DLBA 1DKOA 4UE2A 5K3AA 2POCA 4DV1B 2WE7A 1ZKMA 1O7JA 2YZ7A 4M1WA 1O94D 3G23A 2J4DA 4MCAA 4B2YA 5KMGB 4IDDA 1V4VA 2EJCA 3LG2A 2W90A 3I2YX 3EYWA 4LWOA 1ZIXA 3GOQA 4GBMA 3DCNA 2FK8A 3G59A 5K0FA 2FZGA 2AG5A 3D7RA 3KT6A 1CUBA 2GARA 1NVGA 1E4YA 2MMCA 2SNIE 3NC1C 1EQ2A 4PQGA 4BGVA 1KNXA 2COKA 1FC0A 4U2GA 3QE3A 2J5KA 3TNYA 2V3WA 3TK1A 1H05A 4NBLA 3EVZA 2VDWA 1BC5A 3OBIA 1N92A 3DDHA 4GXNA 3D3EA 3OCJA 2WHYA 3B5EA 3H1PA 1WUYA 2NQ8A 4YBRA 1N78A 4C0WA 1JU9A 3RU3A 3L8DA 4JLPA 4TRJA 5JARA 2AI1A 1C3JA 4MYCA 1IIBA 1M2VA 2NIPA 3AF0A 3OZUA 4NCIA 1NF9A 4PPQA 4F71A 3DZFA 1ZM9A 4LE0A 2PK3A 5A3SA 3RS4A 1A5BB 2Q3DA 3QWFA 4NICA 4KDRA 4MX8A 4V38A 5EWMB 5KCMA 1ZKDA 5HF6A 2PYZA 4UM8B 2DTDA 3GYBA 4TTPA 5KYKA 1CUIA 1LDYA 1QHGA 2P3OA 5D3ZA 1D1TA 3BMQB 3ICPA 2Z5VA 4R2LA 3CIFA 4DDWA 3RU7A 1N32B 3VDQA 1H22A 2CJYA 3S28A 3V1TC 2JLSA 4BJ1A 4YT4A 3P9QA 3M6UA 2A0UA 2X1HA 1NFRA 2OM2A 2XCLA 3PYXA 1Q15A 2E4ZA 3DFIA 2GTHA 3VGJA 1X1CA 3CRZA 4MWZA 3PYMA 2ZJ7A 4XVUA 1HNWB 3N2EA 1QRDA 4PY2A 5JSFA 5KWSA 1A97A 1SKUA 4Q1DA 2ZTUA 1LTQA 2DP4E 3PGKA 3TLYA 1TL7C 3CFYA 5LN1A 1AOXA 4P32A 3PXDA 1N2IA 3BXFA 1L9XA 2ZVDA 1PNVA 3I2HA 3K6SA 4D56A 2QYTA 1J42A 2IH5A 3M6WA 4I7EA 1Y9AA 4CM9D 2H59A 2YJTD 1SB9A 3D6VA 4N1AA 4RZXA 1R4ZA 4WN9B 3D8UA 4QUJA 5CPBA 3ABQB 3EVFA 1A95A 3EXIA 1T2EA 1CUDA 3OEHA 3TS1A 4U63A 1KMCA 5TGZA 3SXPA 2P6OA 1RCFA 2WQZA 2MHCA 3IR5A 2AEMA 5EA2A 4EMBA 2I03A 1GVHA 3KPVA 3P9RA 4MB6A 4DBLE 4DM7A 1OU0A 1XBTA 4ZICA 4HAOA 2EDCA 3WOVA 4M8IA 1DOHA 1XL1A 3JQ7A 3HH8A 2AYZA 5CJJA 3VNUA 2VDUE 1IEVA 4OH1A 3R40A 5L6MB 7GPBA 2HGZA 2BEWA 3IQEA 1XTJA 1R3UA 1SKBA 3CVOA 1LJUA 4GM4A 2D13A 3OPNA 4Q4AA 4TS1A 4ABYA 1PVOA 2BKVA 2CHQA 3AR8A 1OX4A 2G9VA 4RY2A 4D26A 3EAQA 2RIPA 4LX0A 3ZVMA 2ZI3A 3K70C 3HWWA 2IPAB 2ZRGA 1HT0A 1S1CA 3DZ8A 1A2BA 4Y0VA 4TUYF 2NTVA 4JLVA 1KBQA 3ULKA 2GN4A 5JROA 2BFOA 3COYA 3E0XA 4LRYA 5BN3A 5ULLA 2VQ6A 4OI2A 5L3SB 2B2NA 3L7MA 3UMVA 4XCVA 3DDUA 4R2IA 4J4BA 5FUWA 1ORTA 1DLJA 2R86A 3B8EA 2VOEA 4MRRA 5AUQA 2K5UA 3HHPA 2JGAA 2Q50A 1VRVA 2D1QA 3LW8A 1J5EB 2DPHA 3VJKA 2Z56A 5BXQC 1RI3A 1A2QA 1U0SY 2X4GA 4ZOAA 2ZIVB 4GF5A 2R44A 4YUYA 5LIPA 3TGLA 1G38A 1ZVVA 1A5TA 2FZEA 4Y6QA 4FGKA 2RHBA 2H9IA 2J32A 2V55B 3B89A 3E35A 1YRAA 1U6JA 3BILA 4AROA 4DZRA 1OTHA 2OT3B 5FUYA 5TS2A 3TXAA 3KPWA 4CEJA 3PFFA 4KQEA 1PGJA 4WK0B 3TLKA 1J2RA 1JIUA 4H4CA 4BEWA 4YFYA 3X1YA 3PWTA 4GYWA 4TTAA 4WBNA 1XVIA 4CCYA 3LKBA 4XE5A 3QFTA 4P83A 1M6NA 1QYWA 3D1VA 4EX7A 3M70A 4P0QB 4MVJE 4OJMX 1TI7A 3IJPA 2DHQA 3G13A 2FUG6 3C8MA 4L0QA 2CHEA 3I5AA 4I55B 3SZMA 1R3DA 5TB5A 4H18A 2JJ8A 2ZRDA 1FFWA 3PENA 1U7TA 2CFCA 2R8RA 4IOKA 1TYAE 1Y5NA 1GL3A 5DX1A 3JAMA 3DF9A 4JKIA 4XPIA 4A0RA 1KAEA 1P5FA 4UFPA 2PG3A 1SU7A 3MINA 4Q3NA 3K96A 3X2SA 1JDSA 1OLUA 5EQTA 1EMDA 2QP3A 3GV0A 2I67A 5TPZD 2UVPB 2F3TA 2YRXA 4B6SA 4ZKDA 1LD3A 1C80A 1FSGA 3RIYA 1H8EA 1EI9A 2KLBA 5F64A 1XDWA 2JFHA 2V59A 3E2IA 3I32A 3QX7A 4HMOA 4OHWA 3R7BA 4F5DA 2YQZA 2ZAOA 4MARA 3AIIA 4X20A 3L8FA 4GT1A 1L7NA 1RIFA 3QVVA 4DUPA 3OIFA 3V8MA 2QX8A 3BH6A 1WE2A 3NBZC 2G67A 4P53A 2HA5A 4OP3A 5E6RA 4Y2HA 1YTLA 1K8ZB 3CXUA 2UDPA 3D6JA 2X5NA 3WICA 2YN2A 1JJAA 2VHVA 3PG5A 4N8EA 2OORA 2PD4A 4OSPA 2C77A 1RMQA 1JKMA 2CXHA 5A3JA 2IEYA 1YBMA 4IVRA 4JBXA 1NG9A 1LPAB 2Y66A 3KELA 4EG1A 5BV0A 5JASA 2G1JA 4TKLA 3ED1A 1U0EA 4NJEB 3UHFA 3QSGA 3OCUA 3DBLA 1VIVA 1HZZA 2Z2ZA 1XA3A 4WKBA 3MGBA 1P74A 4XUEA 4OI1A 1NV9A 1VIYA 5EHQA 4MVJA 4CKXA 1TTPB 2GEDA 2X8BA 4CJXA 3ZU6A 3JQBA 1OSNA 4PLZA 4CMAA 2G8NA 2X5JO 1B8NA 2JI6A 3LP8A 4J03A 2WP0A 3DTVB 4I46A 4EK9A 1SZCA 3Q2IA 2J45A 1E2QA 1CB7A 2O7NA 3VAAA 3BMCA 4M55A 2QTWB 4QXMA 2ZRQA 2FW6A 3AFHA 3PT9A 1FNCA 1X15A 5IC5A 4C0SA 1JVSA 1YBVA 3U4CA 4TYNA 2GN2A 5F33A 3I01A 3WJ1A 2WPDD 2RGYA 2RGEA 4OTZA 5ECWA 2G71A 3OAAA 2O3SA 1TM1E 1Q1ZA 4RVNA 3IHWA 4ZRMA 2ONJA 4E0BA 1U4OA 1DTWA 1T6NA 3FPEA 5E9WA 3V1UA 1QYCA 5K0BA 3OWHA 3UAVA 3JATB 4PQFA 4DARA 3SSMA 5BQ3A 5AKHA 4KR0A 1VHLA 5SY9A 4DSNA 2F64A 1DU4A 1GZUA 5L40A 3VXKA 1O6BA 4UUNA 1DV1A 4EH1A 4EGFA 5A4MS 2BKAA 1FQJA 2IXFA 4P7KA 1KOLA 4EKNB 2YNMC 3OIVA 1DFHA 3OIUA 2V6BA 4G97A 4XJTA 4CE6A 2A5DA 2O07A 3ZE0B 1GGKA 1REQA 3DOCA 1IY8A 4YJFA 4QGFA 1H4QA 2H4JA 4O6VA 5G0WA 3ZGNA 2GM3A 2O1EA 3GARA 3OZDA 1K7SN 2PRSA 3NU1A 1BYUA 2P41A 1MG0A 2HPHA 2QZ4A 4B3DA 1PJ8A 2IOFA 4FUTA 3ORHA 3QEMB 3LVRE 4NMXB 4I9UA 4D25A 1T0BA 3GVHA 3IA2A 2L0XA 5K8IA 2Q6TA 4UHJA 1IBSA 5F3WB 1K8XB 1CQIA 1SU6A 1ADJA 2GO1A 2Z5GA 2GK3A 3A9TA 3CE6A 4EKYA 3AIKA 1LNSA 2ZRJA 1Z9BA 1ZAKA 2XUAA 3KVVA 4YWJA 1L5ZA 4X3PA 2NU8A 1DBWA 5HM6A 2F4VB 1XTIA 3OFVA 3MRXA 5H80A 2NU8B 1CDDA 3VGPA 4JVNA 1ZNWA 2J09A 3OOYA 4L50A 3IV7A 1ODSA 2VPIA 1E3DA 2O4UX 3NNSA 4OQFA 2NSLA 1M8PA 4EF5A 1IRIA 2GVNA 3ON5A 4XUCA 4L7VA 1HPLA 1PTJC 4WGFA 2J87A 2P1RA 3FNBA 4UBOA 2O8CB 1U02A 1U28C 3W2EA 1UT6A 3KKKA 3CRVA 3V8QA 4CIBA 3L01A 4NJEA 3AHCA 1KH2A 1DRWA 2G4LA 3DWEX 1XYGA 2P27A 2NPOA 3BSWA 3VSCA 2VDRB 2P3QA 3OZFA 1TUEA 5C46F 3HKDB 4GE3A 4XLTA 1QIGA 2J5QA 3N58A 3LX8A 1IHDA 3PFWO 4RZIA 1X38A 2ENUA 4KJZA 4Z8XA 4ERNA 1SD5A 3N8GA 2XT6A 1F48A 5HZGA 1XF1A 3PFIA 3FJ1A 5IN5A 3P45A 1VKOA 4JZYA 3IALA 2JFGA 2IUSA 5KTPA 1VTKA 5AW9A 4A6PA 5BYJA 4JSRA 5BUCA 2YS6A 5T6BA 4P5EA 1MX1A 2R2AA 4RXUA 5U1PA 1DBVO 2HSZA 1UOQA 1AN9A 2P9QA 2VK2A 4ZQCB 5GINE 5JBIA 4N54A 2B4RO 1Y82A 2GJ9A 3W5BA 2FPIB 4ACAA 4IMJB 4LDRA 4ZZIA 3SQXA 4RUKA 3ONFA 1N0VC 3LKZA 4PONA 1Y37A 4D9GA 2I71A 2NSJA 3AF1A 1NLUA 3HB5X 3PIRA 4GX1A 3U7QB 2X8LA 2FG7C 3LT4A 2AOVA 1J24A 4PPFA 5KREA 2XT0A 3ZLJA 1RT9A 3M6MD 2JZOA 1Z15A 3E7DA 1CQZA 3F49S 3VNBA 1JDZA 1N1MA 1R0WA 4Q4DA 3W8NA 3FX2A 1F5NA 1ZRMA 1JYEA 1WOMA 3JVEA 1BCRA 4IDPA 4ZYUA 3PJFA 3UQYS 4TV9A 2DTXA 3L7KA 5KKAA 1ZCFA 3O03A 1ABFA 1F0KA 1EXMA 3BRWA 4R8RA 1ZW6A 2H57A 2VQ3A 4U8GA 1MU0A 2XMRA 1ZOLA 3T15A 5L4SA 1YK0A 2J4CA 3ML1A 5DGXA 4MJLA 3N6VA 3WGHA 1FP6A 3DMNA 3D7SA 5BSMA 5JI3E 3I4CA 4I9HA 4J0CA 4M1YA 3QUSA 5LOVA 3NWEA 4QNNA 2ZANA 5H9VA 3WP0A 2BH2A 3UOWA 3U9TA 4JC8A 2RCYA 2OKGA 3ICCA 3NIGB 4IFBA 1KETA 1NBME 4I3GA 4L0MA 4TZ6A 4EVQA 2ASEA 5GV8A 3EQ7A 5HDBB 5IDQA 5ICGA 2A5JA 3E7XA 3C8DA 3TJRA 2B8JA 1G5QA 2B99A 4S2EA 1A9SA 5KNBD 2GZ2A 2W6CX 1GTJ1 2BHRA 3AP1A 3GGJA 5IYZB 3SHOA 1NUUA 3EBOA 1IXYA 1KZGB 4Z4CA 4EHIA 1NVEA 1RYEA 3G5UA 2PEZA 4NESA 3I5XA 2RHRA 3RS7A 1EUZA 1N6IA 1DC7A 1Z75A 1DFIA 2FPPA 4FFMA 4LIPD 4YDQA 5KNLA 5B4VA 2GRUA 1LRLA 3KOWA 4HEJA 1N6KA 4KL8S 2AJ8A 2PZEA 4AY5A 4M89A 1WV1A 1SUSA 4GQIA 4XTRA 3ZN2A 2O0LA 2VNHA 4HC4A 4BVJA 2GPSA 3FDIA 2FZLA 4DIEA 1RQ2A 1JVNA 3C4VA 1WMFA 1PX2A 2YBEA 3LD9A 3ZDBA 3UAZA 3JZDA 4LFAB 3H1GA 1GPBA 3KLMX 4ENPA 2DKOA 3C1TA 4DMLA 2D0OB 3H2IA 8GPBA 4MS1A 4HAVA 1X9IA 2TMDA 3CF0A 4FGUA 3F8TA 1QK3A 2M98A 3C41J 5CW1A 4FZ3A 5TS3A 3OWXA 2X0DA 3DEIA 4P92A 1HRDA 1NT4A 2YZGA 3NORA 4WW0A 5JWOA 5I9IA 5EJFA 1FMJA 3QI7A 1MKYA 2A7QA 4JODA 1JDVA 2DH5A 4ARUA 6ABPA 4CCYB 2XADA 3B53X 1SXJA 3HDTA 4YIKA 4RVCA 3UN1A 4HH0A 2FPPB 4DLXA 2VUIB 3IE2A 3PHLA 4ZQBA 3L0PA 3DE2X 3ZHBA 3AV3A 4DTIA 1T2UA 2BIFA 2OILA 3IQXA 5FQOA 5PNTA 1JQ3A 4J0EA 3QWAA 1K92A 1JHQA 2XZTA 3OZWA 4YFVA 4GG1A 4B3FX 4P3PA 2XWPA 4EEKA 1MB4A 2GOYA 2VIIA 5ESRA 1XN4A 5IH7A 3ASVA 3H5WA 1PGPA 4GR5A 4HH3C 4J7AA 4XM1A 2EX4A 1Z5PA 4KGZA 4U7TB 3ZK8A 3ZV5A 1NX9A 1F12A 3OY2A 2XGGA 4ETNA 2AMYA 4M9CA 1GJRA 2TMGA 5AVKA 1Q2XA 3THXA 4CMIB 2HWKA 1DP4A 4IUCS 3JYNA 4A2PA 4JENA 1LK7A 1D8AA 1RI1A 1UUFA 1HNNA 3QFSA 2L19A 1ODCA 5HZKA 1HFJA 1WQ3A 1GHTA 1XLTA 4OMDA 3G5TA 3ZWQA 1SKMA 3F1KA 1Z0AA 1JSXA 4G2NA 1KKUA 1C1XA 2RI1A 4XSHA 2F3UA 4Y18A 1PT5A 4XX0A 1DIGA 2I80A 4JI8B 1SA0B 5JXWA 1D9XA 2DY0A 1U9JA 3CRMA 3K0AB 2HY7A 4MCIA 1G5IA 2VQEB 1IZYA 1MX9A 1ZGHA 2JFUA 4ENRA 5C53B 3ENWA 2BEVA 3LHDA 5EP3A 1SCDA 1N5MA 4BGEA 2WFLB 1VMIA 1QQ7A 3SVTA 1TUIA 3MIZA 3QE4A 3EG5A 4OYLA 5T4HA 2LCIA 2HA0A 2E49A 1O87A 3EW7A 3IQWA 4PYQA 2V7EA 4QICA 4F3NA 3DUFB 4YT5A 3ZBQA 4CU2A 4GP9A 4PLVA 4YEDA 1PBTA 4CGYA 1JEEA 3IQZA 4C06A 5I9NA 1F0PA 2C2GA 3C1OA 5T8KC 4C7OA 2NADA 3C3BA 2HMTA 1WSWA 5SZJA 4ZI7F 3P20A 1K5GA 1GXSB 3P1JA 3NVAA 1T4CA 4HFJA 4P81A 2YY6A 3UUEA 2BSQA 3OM8A 1JLHA 1RR6A 3I6QA 5IDYA 4ESVA 2QN8A 2GAFA 2V03A 5IEBA 3SE0A 1GN8A 3VTAA 3NRBA 1Z2EA 1Q0QA 2A30A 1V1RB 1FU4A 2DPGA 3HVHA 2PZMA 1ZD2P 3MJVA 2QX4A 4WFIA 3SLRA 5DP1A 2NO4A 4P4SB 4TWRA 1VJDA 1H9CA 1UJ2A 3HYLA 4LWZA 1XHEA 5CB4B 1HQKA 4L2IB 3OWOA 4LVCA 3ZWYA 5K3DA 1W1UA 5ALLA 1UBSB 2W2OA 1WEKA 5HRUA 1AD2A 3FUUA 1IUPA 3KKOA 2ZATA 4RD2A 4B8ZA 3AYXB 4BFTA 3N05A 4EYOA 2PGXA 4BLOA 2IHVA 2IQIA 1U2ZA 1MFZA 4UHEA 5CCBA 2FCAA 3D4NA 5H0IA 1PL8A 3JYPA 5K8VA 2WOJA 3WLQA 3SXJA 4DJDC 2RDMA 4R4JA 3SPXA 2F8SA 3CMCO 5JYDA 1Q5PA 3L7AA 4L4ZA 5FWNA 2D7DA 1ZINA 4X7MA 3IDOA 4F4FA 5FT9A 3BE6A 3IP5A 1U8XX 5ALYA 4EJSC 4NCKA 1T9GS 1ZA2A 1RM5A 2RONA 4P7FA 2IOYA 3C14C 2G7MC 3FM9A 4LCBA 3WGLA 3L4EA 1FDWA 4QQ8A 4C4OA 5JMWA 4UJ5A 4ZOEA 1K4YA 4WN3A 4L8VA 3T3NA 3C3DA 1RTKA 3K4QA 5JADA 2VRWA 2C4VA 4TLCA 3PKIA 4ZV9A 3LHIA 1QQ5A 2QVYX 3R23A 5ANRB 4FDAA 4YXWD 5K0EA 3LCVB 1NW4A 2HHCA 3FHCB 2YXBA 1NRIA 1NVFA 4RWEA 1VG9B 4K40A 4CF7A 1XMIA 2AJTA 2WZQA 2ZR8A 4KR9A 3LPAA 4LQ4A 3HRHA 2BR4A 3KIPA 1E2EA 5KNCH 1LS6A 3KPJA 4K9LA 1QX4A 3PQCA 1ZD8A 4AY6A 3NEPX 1ZMOA 4I1UA 1VL5A 3VOSA 1MOQA 2VJMB 4M1ZA 5EERA 3C5EA 1W5SA 1XMPA 2JRCA 3FFAA 4G5RA 1L4UA 2YV3A 3R8FA 5ESDA 3AGPA 4KR2A 1H1DA 4IPTA 4JLDA 4G24A 3WJ2A 4BL5A 1REQB 4F4UA 5ALZA 5JSHA 2XAAA 5KNDA 4YYZA 5G4KB 3HY4A 4Y1EA 4ENSA 5BNWA 4DMMA 3QY0A 3QP9A 4OQNA 1KEZA 4CFZA 1WULS 2Z3WA 3ABZA 3D1JA 1JHYA 3ISVA 4COKA 3GEMA 3B1ZA 3G8AA 2VT6A 2OCPA 3BXZA 4G56A 5EAIA 1T8UA 3JATA 2V6MA 1YWGO 4JJ8A 4NE2A 4YJ3A 5BN5B 4M0MA 2F9MA 1DTWB 2QKYA 5IT4A 5D3KA 1UWKA 3E9NA 2WSBA 4B6JA 4BRZA 4C21A 3I2IA 3MWEA 1JZSA 4LDJA 1JJ7A 2QJRA 3EIQA 3U4IA 4RKRA 4BCBA 2P67A 4Y1FA 5CVUA 3TR0A 4YMVA 2Q6IA 5KC9A 3VR3D 2Y9MB 5JWHA 4ALNA 2Q6VA 2QRVB 4ITUA 4KKXB 3VPBA 4DSOA 1AHPA 4LRQA 1UOOA 2HLNA 4YRFA 4HBZA 1R0ZA 5IT0A 3TCNA 3OFJA 4J76A 4ZAFA 3HSSA 4KIJA 2R00A 2W6NA 3QEBZ 4H6XA 2PKEA 4L4RA 4AIRA 2VTBA 1VG1A 4XIFA 3NGLA 2NU6B 3WFIA 1E59A 1AUPA 4QSHA 4A91A 4FYMA 1A2OA 1Y7PA 3PFCA 4EHKA 4CI9A 1S0UA 1JAYA 1WU8A 4AY4A 1GSOA 1AXEA 2HREA 5GZ3A 2NVBA 2QXYA 3N59A 4C2AA 3L1UA 1AKVA 1FP4A 1ZMTA 3K9NA 2JJYA 3KB2A 1NU6A 4NECA 5D2CA 1B8OA 1QLJA 3FRJA 5D87A 2GJ4A 3NCTA 4K2HA 3KLNA 2YKGA 1NI4A 2WFMA 1GYRA 3AM4A 4QGBA 1ZWLA 2JL1A 4ZAGA 3VU9B 4GI3A 2DUWA 1CG6A 5IK2D 1N8NA 3W2IA 3VKVA 4QOEA 1B0AA 1OJ7A 1QZXA 2A78A 1JKIA 1ZM3A 1CDOA 3EMVA 1YQTA 3IDSA 4S0XA 1FLDA 2PAFA 3KZCA 5HTOA 4XWAA 3ZY4A 1A8PA 1U0OC 4DSZA 1E58A 5ALVA 1SPXA 5DK6A 1TFRA 1RXYA 1KR5A 1WXXA 1Z8NA 2E18A 2J3JA 2RJOA 3FF4A 2BGWA 1Z7GA 1MAWA 2CHUA 3NHBA 3QRWA 4AYTA 1IK4A 5DBFA 1UQUA 2V9CA 3HL4A 3SYLA 5CITA 2XXAB 1U7OA 3EC1A 2XUZA 5K0SA 4HGZA 1NNI1 3ZY2A 1QTNA 1W2HA 3EZNA 4EMUA 3CXRA 4A2WA 4WLEA 1YDHA 3NIBA 4LF7B 1JXQA 2WKQA 1Z5WA 3ZHTA 5J4HA 4R31A 1T3SA 1KP3A 3KB6A 3D3WA 3VR2A 2NQTA 1CUSA 4HRYA 4HXGA 4N8DA 2JGDA 5KYXB 1YTUA 3WB2A 3RREA 5JAMA 3HVKA 1C41A 1BH6A 5J43A 3ZZTA 4R1PA 3GNQA 1F4LA 2CDBA 3O2NA 4FD2A 4LPSA 3UV7A 4DABA 5JANA 1KVQA 1RM4A 3ETDA 1MC5A 2RHMA 4QFBA 2CFIA 3T5DA 5CA1B 1RW4A 4QGHA 5G2OA 5B6PA 1SELA 2OGZA 4C6SA 3GJSA 5E6RB 3YASA 4DWWA 5BP7A 3QEOA 4BNTA 2V5AA 3GBSA 4RZ2A 3TFWA 3SHVA 1CZNA 4TM7A 1C7FA 4ENQA 3SJ7A 1N2CE 3OIGA 2WD9A 1WW3A 3B20A 1WXEA 5CXQA 3A3YA 1ZNYA 3R5SA 4KVZA 5DNWA 1F2UA 5DHPA 3DBRB 4UQPA 5I7UA 2NVUB 4ZEVA 4Z4QA 2CVFA 2OB2A 3VR5D 1IVSA 1SCNE 5I7FA 2FN9A 3RG2A 1DZ3A 4XVQA 1C7RA 4KC0A 4XR9A 3SNKA 5HFAA 4QODA 2FMKA 4Z4HA 1XMOB 3U2QA 1WHTB 3L5KA 2XWQA 9ABPA 1ZUHA 4EOGA 4Q48A 5JDIC 4HLUA 3SX2A 1KU0A 2ONKA 3L84A 3TQOA 3F3YA 2Z3ZA 3E82A 1RKXA 3KZKA 4YTEA 1I5OA 4ND7A 2WWVD 3UG6A 3I9LA 1CYDA 4DIFA 4KXFB 1YUBA 4TYWA 4WLOA 2YYSA 3ILXA 3URMA 5C5IA 4WECA 5CFZA 2W2VA 3QM1A 3WA6A 4UAUA 3ZX4A 2J59A 2A84A 3GUZA 5FP0A 1XTKA 5LBUA 4BU0A 2DY1A 2ANCA 3P0EA 1V1MB 3L8MA 2QHXA 4DJFC 4E1BA 3RC8A 3DEAA 1UK6A 1ACLA 3E18A 4O1HA 3GLHA 1CS0A 1FUKA 2YVAA 4BQOA 4KO2S 4OIMA 1DAPA 4LGMA 1PKXA 2D2EA 3GGGA 3NM5A 3HA5A 4KE7A 1FE8A 3IUJA 1TM7E 4OYHA 2VA8A 3KPYA 4KDFA 3EC7A 3W90A 3M1YA 4KUGA 5AVOA 4EELA 3NVDA 2OZLA 3C8HA 4RHXA 3DZGA 5IDWA 3FFXA 4DFDA 1J9GA 3Q10A 3A9UA 4EHAA 4LRTB 3WLJA 4JR1A 3TE6A 4LJKA 3SJCA 5J1TB 2VJAA 1MEJA 6Q21A 3U60B 4NU5A 1ZJWA 3HCWA 2V6JA 1US8B 4ER6A 4QLOA 2JK0A 1OREA 4LMPA 1EFPA 1QLWA 5AW3A 5JNUA 1P4HA 2IYVA 3VVLA 4BAGA 5C52B 2XNJA 3QHAA 1YMQA 4N82A 2B4QA 1ZRHA 1XV5A 3F98A 5CB6A 3OP1A 4Q39A 4UDOA 1A9RA 1A8SA 2J0VA 2QK4A 3D6NB 2H5IA 2ZS9A 3ZD9A 2B36A 1KI6B 2OOSA 3PZBA 3I6MA 2LE0A 1EHYA 1B6SA 1NYLA 3KSUA 5KQMA 3KEOA 5CVDA 1QU2A 1CY7A 4JVLA 3U16A 1MA0A 1PFKA 3ASUA 3HCEA 1VKJA 3IAFA 1RC0A 4L9AA 2QPAA 4YMUA 3GRUA 5EPOA 1SBQA 4QYXA 5DGCA 3W77A 1BH2A 1M2NA 4G5OA 1SXJD 3PCTA 2GBLA 2RKBA 3LIPA 4QQNA 2VYVA 2I3BA 1E6UA 3VH2A 4NK4A 4N0PA 5CT5A 4AKTA 4L3OA 3T61A 4OX9Y 1ZJYA 4GIBA 3FMIA 4TV8B 1C7EA 2O52A 2AG0A 4PINA 1FLNA 2V9ZA 4AO8A 3W5DA 4RKYA 1EQAA 1YOBA 2J3DA 3AHEA 3CWCA 2B1GA 3DEYX 3G9XA 1XD9A 3QQPA 4OJKA 4RFLA 2YWXA 1XPUA 1BA3A 4ZKEA 3WDMA 4DCGA 2QVZX 5DKFA 3LPMA 1E79A 4M98A 3ZHXA 1TEVA 2ZSUA 3EWNA 2AUTA 4DQDA 4ZYXA 2X9GA 2P5YA 2IYFA 4GM0A 4QPDA 2WSSD 3ORQA 4MGEA 1C3XA 1CIPA 1Q44A 2AX4A 3EUAA 1KFEB 4EO4A 5EMLA 2QMUA 5T7BA 1ZXXA 3CUUA 3IP3A 4PO9A 2GFQA 5KKCA 2A9FA 4C4XA 3FOFC 2JANA 1H4TA 3SVZA 1W0CA 2I91A 3QPCA 4TWZA 1P81A 4KQFA 4TWJA 2IFTA 4X6YA 3RYTC 5CEFA 3C6MA 4JDPA 2QG9A 5SYMA 4AX4A 1HYEA 1G4HA 5DMXA 1IMJA 2ZZNA 1PJ4A 3Q8KA 4NBVA 1P2DA 4NI5A 3WNCA 1JLRA 1XZCA 2FUEA 2H00A 1XRQA 4FGLA 2AUMA 3NGMA 3SHWA 3N3BC 4BQSA 4YNBA 2H2AA 5TGDA 3DCIA 1XFAA 4EGQA 1I13A 4BVEA 5JDCA 3AQIA 2K6GA 1N3YA 3DEKA 4LDAA 3CUVA 2AHRA 4P54A 2IPMA 1IIRA 1JDUA 4MWSA 1ZH8A 3JWJA 3DXFA 2J0UA 1RWBA 3BSYA 3PL5A 4Y9DA 1DKRA 1K6EA 2QD4A 3EOBI 5DH9A 4Q9IA 4RPCA 4YB8A 1XRMA 1B93A 4CLXA 3O31A 2PE5A 3F97A 1ZN9A 1PUIA 2X4IA 3H84A 4UU7A 3ISJA 3HCAA 3NUQA 4JFRA 1WO8A 1YJXA 8LDHA 2BUAA 3WYDA 4F3CA 2BMWA 4DSAA 3WKBA 3GQBA 4W5