2IEZA

Crystal structure of mouse rab27b bound to gdp in monoclinic space group
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
185
structure length
178
Chain Sequence
YDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYDSGKAFKVHLQLWDTAGLERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLIGNKADLPDQREVNERQARELAEKYGIPYFETSAATGQNVEKSVETLLDLIMKRMEKCVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras-related protein Rab-27B
publication title Structure of the small GTPase Rab27b shows an unexpected swapped dimer
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 37
structure length 178
sequence length 185
chains with identical sequence B, H, I
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2006-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2iezA00
2OV2A 1NVVR 3KXKA 1G21E 1E99A 1S3SA 1F6BA 1NMYA 2G1JA 3EZ9A 1E2HA 1YR6A 4RD0A 2ANCA 3QXCA 2CL7X 5E7IA 5GJBA 4PFSA 3H0KA 1ZVQA 3CRMA 1ZC4A 3HJNA 3IPXA 5FL3A 4FWTA 1TF5A 1W0JD 2G88A 4D2IA 5FTJA 2XSZD 2BC9A 4LHYA 5LB2A 4Q1BA 1C1YA 3FKSD 4A2PA 2BMDA 2R44A 2A5JA 1Z5ZA 4BECA 2IBMA 4EPXA 5JMTA 2VSFA 2OG2A 4LJ9A 1WRBA 1BMFA 2IYWA 2GJ9A 2JJ8A 3KJIA 3AVQA 4XSHA 5DGXA 1G3UA 1XCPA 3K9HA 2ZSFA 3PUZA 2BJVA 4IVQA 1ZBDA 2ZRCA 4KYUA 4LV5B 421PA 1XZPA 3TAHA 3GCGA 2QP4A 2WSSA 2ZQ5A 2OEPA 1ANKA 3QPUA 1A4RA 3LXRA 1PUIA 1ESNA 3FGNA 1ZRHA 4KODA 4P0TA 4OQXA 1OV4A 4HUTA 3SEAA 3VTKA 2GCOB 4K8OA 1E98A 4QBFA 4B71A 4G01B 4RFVA 3FDIA 2QGNA 1Z6TA 1FNMA 3TUZC 2DWPA 3F5FA 4A36A 1A5TA 3NBZC 3KXIA 2IA5A 3FOZA 3JZMA 3NKVA 1QVAA 1KO8A 3FMOB 4RZUA 3U3MA 5JJLA 5JRZA 5AWFC 2ZJZA 1G7SA 4A0FA 1CJTC 1BOFA 1VCOA 1R2QA 2A7QA 2OO7A 2P0EA 4GMDA 1EFRD 5AJWA 3A1WA 2IS4A 2C77A 3HPQA 4OI1A 2ZI3A 5IK2A 2W6IA 3LAWA 1T9HA 3P4YA 2F1RA 2V54A 2ZI7A 2XNDA 4JL8A 1W5SA 4NYJQ 4QGAA 4KSCA 4DDVA 521PA 4CEJA 1IJEA 2OILA 3QEJA 1UKVY 4W5JA 2P6UA 3EIEA 1QG2A 3V4FA 1P2VA 4JBYA 4DUGD 3D6TB 1A82A 1TEVA 3TK1A 1MR3F 1BMFD 1VMAA 3Q8XB 3ZH9B 4DB2A 5JEDA 1XD2B 1P4SA 2DYKA 4MKFA 4WIAA 1VCMA 2QM7A 1KMQA 3BGWA 3Q72A 1E1RA 1VYUA 4AKHA 1XD8A 1YRAA 4BFTA 4A82A 4D0NA 1JJ7A 1CRQA 3OEHA 4MYUA 2WSSD 3A36A 3PITA 5DHAA 2QPAA 2GETA 1SVWA 3NEYA 4LPKA 5H1YA 3RS4A 3CRQA 2IL1A 3EPKA 1CJKC 3UPUA 1GNRA 4OQMA 3AF2A 2XXAB 1NSTA 2XJ4A 2XXAA 2IYVA 4BLPA 5M04A 4EKDA 3RRYA 2CK3A 3RVBA 1MT0A 3WYGA 1AZSC 4ACAA 1AM4D 2HLDA 3FWYA 3QE0A 4PX9A 1N6OA 2RCNA 2WMOB 1Z06A 3CNNA 4KHZA 1Z28A 3THXA 1G8FA 2CCKA 2EWVA 2ZRMA 4GP7A 5CLQA 1PZNA 2FSIA 2B21A 3THWA 1J8MF 1F5NA 3MFYA 2V1XA 2W0MA 3BH7A 4LWZA 4O0MA 1LV7A 3CRRA 5K8IA 3F3YA 3NEJA 2GF9A 2VL7A 3BK7A 5EP4A 3LY5A 4B3CA 1A2BA 1IJFA 1S8FA 4M9ZA 4WVFA 1P9RA 1YZKA 4WZ6A 5IK2D 1OPXA 2JLRA 4IOLA 2XNDD 3M0EA 4W5HA 1F60A 2OCPA 1T0HB 4U5XA 1LNZA 3OIUA 2AFHE 4ZIRB 4TQAA 1MO6A 4YLGA 2OUKA 2JATA 3GFPA 3QQ5A 2D74A 2VHJA 3K09C 3U7GA 4ASUA 1E79D 5HCNA 5GVRA 2BEKA 1GKUB 2WV9A 3H4MA 3NC0C 4WZAE 2PJZA 3GJ5A 3WMGA 3CZPA 1M1YE 2ZS9A 4RFSB 1R8QA 4N3NA 2ERXA 3RWOA 4C3ZA 5FOVA 4BE7B 5G53C 5KYKA 4V03A 2WICA 1E3MA 3LX5A 1YQTA 4GZMA 2OLKA 1HT1E 2F3TA 3AQ4A 2V8OA 1E1RD 4UJ5A 3RANA 5AJXA 2G3YA 3OIYA 4BEBA 1ZINA 3BD9A 4LJAA 1OH8A 3CX7A 1SVOA 1Q1EA 4GZLA 1PLLA 3ASZA 3H84A 2C9CA 3O8DA 1G8YA 1D8TA 3AUYA 4KITB 4IW3B 4S35A 5FTKA 4C2TA 1E2IA 1WA5A 2ODNA 4JJKA 3RSLA 5GJWC 4FMCB 4C7OB 1CR4A 1R8SA 3B6EA 3WP0A 3G82C 2XTZA 4LK2A 4PHTA 4URWR 3TSOA 1E4YA 3DM9B 4RD6A 3JVVA 4C0KA 1XD9A 4F4JA 2GEDA 1OW3B 1AZTA 2GTPA 1XEWX 2XTMA 4LSGA 2O0KA 2NZJA 4ZI2A 2YYZA 1Q3HA 1R5OA 3K53A 4DBLC 1MABA 1Z47A 4DLUA 1T5LA 2CEAA 4GOJA 1FMLA 4IDOA 4BLTA 3O8CA 1NJFA 1I2MA 3PIRA 1KO4A 2IHBA 1TF2A 2C99A 3T1VA 3K0FB 3GLIB 3GLIA 2IYTA 2ORIA 2QT0A 1RJ9A 1J99A 2JIZA 2QTHA 2YINC 4MGZR 3MUFA 3Q5DA 4G0NA 1W36C 2MMGA 2REXB 1CS4C 5FI1B 1NG1A 2XB4A 2WOOA 3ND9A 3UANA 1XEXB 2PH1A 5SZIA 4KXFB 1D2MA 1AS3A 4TSFA 3THOA 2ZE8A 3QNUA 2VP0A 3PFIA 4OHXA 4QHYA 5KDLA 2F1HA 2GILA 1J90A 1OE0A 2XJ9A 3W5JA 3GEHA 4LZZA 5BYJA 3OE7D 1SXJC 1M2OB 3DKVA 4DLTA 1YRBA 1U0LA 1HQYE 3AUXA 1NJGA 1W46A 2LKDA 3EA5A 4W7SA 4LGMA 1PJRA 2R6CA 4XD7D 1DAHA 1N5LA 3HDTA 5FOXA 4IOKA 3VKWA 1KDOA 1X3SA 1N6LA 1VIAA 3BORA 3D7MA 5EE9A 3T1QA 2KBEA 3RDPA 1WBBA 2JA1A 5CK4A 4B34A 1WBDA 2DFNA 4ZPXA 1GL6A 2PEYA 3A4LA 3K70B 4BZQA 3SQXA 2QAGC 2W00A 2Z0MA 3X1ZA 3TGPA 2BMJA 1TQ2A 1C4OA 1G6HA 4JYCA 4ARZB 1KMHA 4TTQA 2VP6A 4B35A 3GPLA 2XB2A 1KI9A 3AP3A 3I4LA 4L8GA 3SDZA 1JEDA 3ONWA 1ZIOA 2IWRA 2BHRA 4ZCMA 2JLVA 1U81A 2NGRA 1OFIA 1IN7A 3AVUA 1I4DD 1V5WA 5FFMA 4F4CA 3GLGB 5G3ZA 3GLGA 1DVRA 5EE3A 5FR2A 4WXRA 5K8LA 1KK1A 1VCIA 3TSWA 2QBYB 1IN8A 3CONA 1E2FA 4Q02A 4CZ2A 2JIZD 4MKIA 4OQLA 2R8RA 3VR1A 2A9KA 2QUZA 2ZETA 3KUDA 4H9GA 1NNEA 3TVTA 2VYFA 1X8JA 3W3AA 1G291 4LDJA 3HYRA 4YC7A 3U7EB 1TQ6A 1J2JA 5EE1A 4YMUA 1NVXQ 1ETUA 4PTLA 3M1IA 4UNPA 5B57C 2YWEA 3MMPA 2B8WA 1DAMA 2GJSA 3LH5A 4M9QA 4BFSA 2VPPA 2ZJ8A 4IDPA 4JVLA 4RD1A 4KJZA 1R6BX 3CPEA 3MD0A 3OEED 4JIMA 1UDXA 1FX0B 2H8KA 4OYHA 3WHLA 4QG7A 3B1WA 1R5NA 4KFTA 2AHOA 4OL0A 1VG0B 2ZUDA 2BM0A 4EPVA 2ZUCA 3BS4A 5CM9C 1D2EA 5F9HA 3U2QA 1FOEB 4Q9JA 5EZ6B 4A92A 1G8GA 4A0RA 4TN1A 1JJVA 2ODWA 2QNRA 5FBQB 4PO8A 2GVZC 2QMOA 3VHXA 4TMZA 4LJYA 1Q1QA 4PAQA 3KQLA 3BH6A 3BC1A 1NN5A 5TXGA 1CR1A 2C96A 3MAAC 3PEUA 2IWHA 2OXRA 3DEFA 4KLNA 1WDTA 2CLSA 2YKGA 1QZXA 4LYFA 4Z54A 2X8AA 1NY5A 4JMPA 4A4DA 1KHTA 3R7WB 1LFDB 4WAUA 3NVAA 2O8BB 1U94A 1XXHA 1UKZA 5L3SB 4L9SA 2WM9B 2J7KA 4Q48A 3LNCA 1IAQA 3LBNA 2B6HA 1G20E 3FYHA 4KVAA 5L8VA 1P60A 1PVOA 3A4MA 3WYFA 1XZQA 4B33A 1I4TD 2VSOA 5KU1A 1XJQA 5FPYA 3G0HA 4Q4JB 4BFYA 2Q3FA 5CITA 4RVCA 3R8CA 2QN6A 4LRWA 2PCJA 2N42A 2WIAA 1OHHA 2Q21A 1JEEA 3R20A 1OFTA 2FU5C 4MRSA 1HV8A 3Q7PA 1LS6A 1O3YA 2ERYA 4R2HA 2YV5A 5KPJA 2OCBA 3PEYA 1TF7A 2A5DA 1XPOA 3IGFA 4ITRC 3K9GA 3PR1A 3RNLA 2DCUA 4HZIA 5FBVB 1OYWA 5CIWA 3JZAA 4JLNA 5HKKD 2X77A 3LVQE 4ZKEA 5FOSA 8OHMA 2J0SA 4URZR 3SN6A 2D7CA 5DN6D 4ZKDA 2GCPA 2Q3HA 2CLDX 1ZM4A 4LJ5A 4A9AA 3B2EA 3ETLA 3VX3A 4YXWA 1JECA 2IYZA 1Z07A 3LLMA 4I4LA 2IYXA 5KNCA 2HXSA 4ZDIA 4AYTA 1T8TA 1U0HC 1Z6XA 1HY3A 3RSOA 1AJEA 4X8LA 1KY2A 4C0BA 1G3IA 2FPMA 1HURA 1Z2AA 4QHSA 4MDEA 3AVWA 4Y0AA 4PAMA 4Q4AA 3K0CC 4L5BA 5SZJA 3NH9A 1S1MA 4NYJR 2OBLA 3HR7A 4L9WA 1E94E 3U3KA 4AG6A 2I1VB 3LBIA 2WKPA 5DH9A 2MSDB 2VHTA 1PLJA 3B1ZA 4KSBA 4A15A 1E0AA 4DDUA 3A37A 3FHOA 1QHGA 1EXMA 1VHTA 3NH6A 4M1WA 3WYAA 3IKJA 4RD2A 1Z0IA 3IBGA 4D6PA 1VYTA 3ZGXA 3GJ7A 4B47A 2I3BA 3L0OA 1Y3AA 3AEZA 3AM1A 1XCMA 2GXSA 1HTWA 1RRFA 3I8SA 1Z83A 4LHVA 1YJ5A 5TVKA 4D4JA 1SKYB 4AG5A 3FKQA 4TTRA 1NY6A 2JCSA 3NHAA 4DDWA 3KFXA 1AS0A 1OHHD 3SU8A 1G3MA 2XTNA 4HEJA 3QXSA 3R9WA 1SKQA 4QC2A 4EAQA 2ZJ2A 2CNWA 4UNSA 3GJ0A 4AIIA 2AKYA 3TSZA 4HAWA 1N0WA 1NBME 3TNFA 2FWRA 1I4LD 4PSKA 3EC2A 3SE0A 3ADCA 3N2EA 4NCIA 2XZLA 3L2OB 3IBYA 4DLVA 1FL9A 1U2RA 3ZZTA 1X8LA 1UPTA 1IY2A 1F2UA 1F2UB 3CM0A 2JJ2D 1UKEA 4BRWA 3ICQB 3AF3A 1EFHA 2DHRA 2HYDA 2OBNA 4ZV4A 2GKSA 3CIOA 2ZI5A 2KSQA 4LJ6A 1DG3A 2AN9A 3U5ZB 2CXXA 2QM8A 4P4SA 4YXWD 1US8A 1HH4A 4GFDA 4ZCLA 3KDSE 1XJ0A 4MUBA 5FPKA 3QKSA 2ZREA 4DLRA 1BYUA 1E2QA 2C98A 5H8WA 1MO4A 3NBFA 1ZU5A 3DHWC 5K8UA 2P3SA 1G9XA 2QTFA 2ZAOA 1R4AA 2BBSA 4QGHA 5E7JA 3P27A 2GHIA 2IXFA 2OT3B 1KSFX 1S4QA 4MRPA 5HTKA 5JHHB 2C5LA 4JLPA 2RGXA 3CUEF 1TUEA 4Q19A 3DOFA 4Q01A 3UG6A 3TLXA 2VF8A 4RD3A 4Q18A 3CWZA 2IYUA 1KKMA 1E0SA 5DI9A 1HE1C 1RIFA 3C7KA 4BASA 1KIMA 2QPTA 4Z51A 4A8JC 2ZRDA 3MWJA 5DI3B 2CVFA 1ONBA 5HE8A 1AN0A 1JAIA 4GPTA 1W7AA 3Q7QA 4B43A 3LDAA 2IYSA 3GQBA 3CF6R 1W0JA 2FE4A 4URYR 3UK6A 2CNWD 5FH9A 3TBKA 1KO7A 1ZC3A 1TL7C 3CW2A 1GVNB 1FP7A 1FQJA 1COWA 1SXJE 4C0JA 1JXMA 2QMUA 1W5TA 4AK9A 2OCYC 5BW8A 2DFLA 2RMKA 2PMKA 2QY9A 2O52A 4HLCA 4QL3A 5K8TA 5TDHA 3EA0A 3ZVLA 3K09A 3ADKA 1ZD1A 3V00A 2JGNA 2DB3A 3C14C 2VRWA 3FVQA 4E22A 4V0LA 1RZ3A 2WWGA 3KB2A 3U4QB 2QP9X 1OXUA 5F9FA 3GP8A 3SS8A 5KSYA 2BBTA 4I1SA 4NMMA 4II7A 4BFUA 1G8HA 4P4TA 3T15A 3RWMB 2ONJA 4Q4HB 1OFHA 1ZYUA 3K1JA 5A0FA 3BB3A 4F38A 5JRJA 3IPYA 4M1KA 3EPJA 1DOAA 3TQCA 5BXQC 3AP1A 3PG5A 2GZAA 4JSTA 3Q85A 2Q9AA 2OHFA 2VTKA 4N1AA 3SJBA 4P4UA 4NCHA 4EJSB 2ECKA 5FUXA 4G5SA 2FEOA 1S96A 2OFWA 4FMCF 1OH5A 1PLKA 1V43A 1QHHA 3SBDA 5KOYA 3TAUA 4PANA 2UZIR 5FUYA 1IN6A 1LF0A 2WWXA 2RAPA 2VP2A 5J4HA 1G17A 4YQFA 3LX8A 4OQNA 4CEHA 2K5UA 3O8RA 1FZQA 3SOPA 2LKCA 4EIWA 3P32A 1N6PA 3I1FA 2NO6A 2ANBA 4PHHA 3QXJA 4FXPA 4BQSA 2V7QD 1W2GA 4L4UA 4O25A 1EX7A 2ZI4A 2QA5A 3LW8A 1GNQA 4G5QA 1G1MA 4JS0A 2WKRA 3W8RA 4A6XA 4JBWA 5TARA 1II8A 2IUTA 4TL7A 3C41J 2PL3A 2IUUA 3RS5A 2O8FA 3U3JA 1XX6A 4K81B 4DUGA 4NYMQ 1FMJA 4F7WA 3A1UA 1FP6A 1CJVC 1COWD 1ZJ6A 2NOAA 4TLEA 4DCVA 4QHTA 5JI2E 3L8ZA 1VPLA 4DXAA 2Z83A 3OZXA 4E5UA 1VYVA 3EZ6A 2H7VA 4DLWA 2V4ZA 1KI8A 3BE4A 1E69A 5JWOA 1E2LA 2EFEB 3JVUA 4DVGA 3RRNA 2IEZA 2BWJA 4XTRA 3K9LA 3LLUA 4DT1A 3THYA 3THYB 2HV8A 5A5GA 2XX3A 2ZVPX 3A6PC 4EPWA 1GDDA 1NBMD 2CJWA 1CULC 2J3EA 1NL3A 1XRJA 3A4NA 3BXZA 1YZNA 3B85A 3IO5A 1KI1A 3EW9A 2F3RA 2RGNA 4PQFA 5JI3E 2NTYC 1Z22A 1CF4A 4Q9LA 1NLZA 2BBOA 2KJQA 4MRNA 4PSAA 4IOMA 2BCGY 5JWRA 2OAQ1 4UXIA 1GUAA 3I32A 5AJVB 5F98A 4Q66C 1WB9A 2YHSA 4C0SA 2VHQA 4M1TA 4J0QA 3SC3A 1HT2E 5JCZA 2OZEA 2GA8A 2QAGA 2R2AA 3A1VA 3CNOA 3K0AA 4LBVA 4G5OA 4PAOA 3FHCB 1Q1ZA 2G0TA 4S2EA 4JT4A 2CLCX 3ZS8A 4BLQA 4HLQB 5FBRB 3GLHA 3GLHB 4PQRA 4CEJB 1T8UA 2PMDA 3IILA 4MGKR 3DMDA 5C4MA 2QQEA 2J5XA 4Q9HA 2VP5A 3RAPR 1KI6A 4CRWB 2VP9A 1E79A 4RKEA 3KJEA 3ZDQA 2P67A 2BCJQ 3UMSA 4V0OA 5EP3A 2BM1A 4RZ3A 5LD2C 5CDFA 1G4UR 4DWJA 4LY6A 1W36D 4F91B 1ZUHA 2AWNA 3AF0A 1WXQA 1SGWA 3LD9A 4DEXA 3EPLA 4O3MA 4BLSA 4M9SA 3LA6A 3SHFA 1OYYA 4N0EA 3OFNA 3TW4A 4OK6A 5TB5A 1S1CA 5J4VA 2Z4SA 1UAAA 4QBHA 2FSFA 4I99A 121PA 1KOFA 1D2NA 4GI7A 3X1WA 1SXJD 2IYRA 4TLAA 1X8KA 4JVSB 5DE3A 1GIAA 1T5IA 1EX6A 5E3HA 2ZSEA 4FW9A 3VR4A 4DKXA 4ACBA 2ZANA 3ICEA 1AIPA 4XIGS 821PA 3THXB 2NZ8A 1FNNA 2GAOA 4WA7A 1GZSA 3J81k 3IHLA 3SZRA 3THWB 2FDCA 4UJ3A 3BFVA 2FX3A 4TMVA 3EC1A 1R0YA 2ZRIA 2WAXA 1GL7A 2J1LA 2MSEB 3VFDA 1RVDA 2XNSA 4NBSA 4FI3C 3D8BA 1F2TA 1YHNA 2KB0A 2V9PA 1TTTA 1XJCA 2C8VA 3GJ3A 3SQWA 1E2JA 1EFUA 5EE5B 1QG4A 4XTCS 2C03A 5EUMA 1VCNA 3SYLA 1P5ZB 1NMZA 4LJ8A 1N0VC 4IDQA 5CJ2A 1KSGA 221PA 2ATXA 2CDNA 4BFVA 1YVDA 2ZRJA 3SFVA 3TRFA 3UMFA 3B8HA 3CKLA 4EFNA 4O2LA 4Q1EA 1M7GA 3KXLA 3X2SA 2V55B 3TW8B 4W9MC 4TYWA 2CHGA 2FA9A 4GOKA 4XVQA 4DB4A 3S1AA 3M4YA 3S1AB 3C8UA 1E96A 2FSHA 3QF7A 1OXTA 3QI2A 2YOGA 3OE7A 4GMXA 1JB1A 1SULA 2EFGA 1H65A 3C15C 4A2WA 2GESA 4JZKA 5HZKA 5DIFA 5F3WB 2C95A 1KDTA 1WE2A 3QXHA 3OFND 1E2MA 2DWOA 2HCBA 3WY9A 4BZXA 4XD7A 5JSZA 4OHVA 3ASYA 3VNVA 4R2IA 4FCTA 1ZW6A 1T3LA 1KJZA 4E07A 1E9FA 1R5BA 2G1KA 1ZAKA 2RGEA 3PUYA 3VR6A 4YDSA 4Z1MD 4Q4LA 2LCFA 3GD7A 1QHSA 3OAAA 2XEXA 4UXHA 3P26A 1NLYA 1XTRA 3B9PA 4C0LA 5IF9A 2ZS8A 4BRUA 1Q20A 2G83A 3B78A 4KO8A 1H8EA 3AB3A 3EX7C 1VECA 2YWHA 2CVHA 3BOSA 1HYQA 1Z0AA 4JJZA 3KQHA 2ZM5A 2UZ3A 5KTYA 3PV0A 4QJ4A 1MABB 2W83A 4LBWA 4DIEA 1OH6A 4NCKA 4NU0A 3PUVA 1OXXK 2JLYA 3KB1A 3K0CA 4B75A 3C16C 3RLFA 1VG8A 3SI7A 1RJ9B 5D3MA 5J47A 5LPNA 4Z8XA 3B1YA 4BZPA 1JR3E 1IQPA 1BS1A 4TMWA 2ZTSA 2ZI6A 3L8YA 4F4IA 3I72A 2VSXA 5LDDC 5H68A 5FTLA 5ELXA 3D31A 4PPFA 2BKEA 1YR7A 4TMKA 2ZROA 1NSFA 1OIWA 2E87A 1P6XA 2ZSAA 1E2DA 3U44A 3RRZA 2CHQA 1L4UA 3MJRA 5JCPA 1RC8A 4TLDA 5FBLB 1O87A 4O2RA 3OEEA 3TUIC 3DVLA 4XOIA 3LV8A 1E2KA 2WTUA 3HYTA 3NWJA 5F2EA 2GBLA 1X1SA 3VR5A 1W47A 4IOJA 4XWAA 2FOLA 4MDFA 5CIQA 1JXOA 1CTQA 1VG9B 2G6BA 1IM2A 2ZRPA 5FBWB 4HLUC 2A2ZA 4TQUS 4KFRA 1RYHA 2R65A 3H1TA 3VU9A 2B7CA 2NPIA 4JKYA 5JS7A 1U9IA 4IFEA 1MV5A 1JALA 1XTKA 2ZS7A 4AYXA 1KZGB 3BBPA 3OAAD 4D0LB 2HF8A 4LC0A 2X2EA 3SJAA 3QVVA 1KMHB 1L8QA 1TPZA 2BVNA 1N25A 1H8ED 2FEMA 3L82B 3GJ4A 3D3QA 3UG7A 2HEIA 4IXNA 3OHMA 4G5GA 2ZJ5A 3ZJYA 2KBFA 2ZJOA 1M34E 1XTIA 1MO3A 2RKOA 2YOHA 2VBCA 2AD1A 2RB4A 1CKEA 3IIMA 5FOUA 4QKQA 5L3QA 3BERA 4P32A 3CRVA 1B0UA 2OCAA 4AWXA 4MYCA 1E2NA 2QRZA 2BMFA 3QF4A 2EFCB 1N6HA 3GEEA 5B64A 4CT5A 4DEYA 1A2KC 4AYWA 3B7GA 2UKDA 1T4GA 2FV8A 4D4LA 3PXGA 4F93B 3WHKA 1ZIPA 2UVQA 4BUJA 2OAP1 2ZYWX 5HZHA 4ABYA 2D3WA 1FTSA 3GFOA 1OFUX 1RW4A 2IHYA 4GDFA 4V0ME 1KJYA 1U8YA 3QUSA 1P2TA 3REGA 2IX3A 1JQJC 1R10A 4PZZA 4A0HA 1OIVA 5E4FA 4DLSA 3G5UA 1XF9A 2EYUA 2WHXA 4A8JA 3T1TA 3IO3A 2NMVA 1GL9B 3U61B 3HP1A 2I4IA 3PUXA 4Q1FA 1ZM9A 4Q03A 3HU2A 5HKKA 1YZGA 1JR3A 2E9SA 4HB4A 2IS2A 3C4JA 4D82A 3TR5A 1HA3A 5DN6A 4JL5A 3ZQJA 1KY3A 3HWSA 4IVPA 2HYIC 3U3RA 1XMSA 4Q21A 4X8OA 3UKDA 1DAKA 1GITA 2FNAA 2ZRGA 2RGCA 1XFAA 1OXSC 4GNKA 1Q44A 1CJMA 4Q7KA 4ZO4A 4PHFA 2NG1A 1P9NA 4K46A 4N0DA 3F8TA 1JR6A 3QENA 4MA4A 5FPHA 1QDEA 1EG7A 1CJUC 4URVR 1XXHB 1YZQA 4BWYA 1Z0KA 3EZFA 1Z6AA 1U8ZA 1KI3A 1N5KA 5CLLA 2N46A 1LVGA 2CHVA 1CU1A 1F3OA 1R0XA 1TNDA 2WWWA 3DM5A 2D06A 2AFIE 4C0QC 3CPJB 3L0SA 4ZCIA 4OI4A 4NYMR 5DSZA 1YR9A 2VA8A 4BFZA 2H92A 2RH5A 1DAIA 4GP6A 3ZVMA 4PQYA 4B3GA 5JLJA 3BH0A 3QOFA 3W6NA 3MGCA 4AD8A 2ZE7A 3AVPA 3FFBA 3VAAA 1SKYE 4HZUA 5IDVA 1CR0A 1EFCA 4B32A 1XCGB 3AKEA 2HUPA 3QJYA 3ZZUA 5E95A 2HDNB 2Q3MA 3TR0A 1IOZA 4MGYR 3BB4A 1E2EA 2WZQA 1WP9A 4TYYA 2J87A 2WJJA 4I1OA 3IEVA 4IRUB 3SR0A 2EVWX 4PR0A 1VTKA 3L0IB 5BN5A 3GLFE 4MYHA 4URUR 4QJ3A 4BGDA 3H2YA 4PSVA 1W4CA 1DE0A 1JR3D 3MJHA 1FW6A 2ZJAA 1EFTA 3P20A 4MKHA 2JJ2A 3QBVA 1LTQA 4F92B 5JEEA 1N6IA 1GAJA 5FPSA 1NVUQ 2D7DA 1QHYA 2FGJA 1G6OA 2QZ4A 4V0MA 721PA 4LYHA 3SBEA 2HXYA 1MH1A 4TMTA 1GFIA 4HUQA 4HUQB 3CF2A 1DBSA 3VR2A 2NO7A 2DWQA 2WKQA 3KKNA 4LHWA 3KQNA 3GEIA 5EXXA 1RYFA 2VHCA 4CEIA 2KE5A 3HR8A 1Z2CA 2ZYUX 3I3SR 4DLXA 4Q4AB 3DDCA 1E32A 1J70A 4PPQA 4HI0E 5UKDA 4LOAA 1YR8A 4G5RA 1II0A 1IN4A 2Y8EA 1JPNA 3QPWA 2P5TB 4CF7A 1ESMA 3NBXX 4TL9A 2HJVA 1XBTA 5EE0A 4OJKA 4V02A 4NYIQ 2QEQA 4Q1DA 2WOJA 4LV8B 5EXTA 2G9NA 3B5JA 4LHZA 4BFWA 2EQBA 2D4HA 1UKYA 3RS2A 2GXAA 2QSYA 2AKAB 2CCGA 4Q5IA 3I62A 4IXMA 4JKIA 3LBHA 1DARA 3I73A 3TQFA 2TMKA 1S3GA 2GWHA 3ZS9A 3PEWA 3CR8A 1S9HA 2GJ8A 3Q5EA 3GJXC 3NDPA 1W48A 3CZQA 5B58C 2O8CA 5CM8B 4KBFA 1P75A 1KTVA 3T5DA 2O8EA 4DC9A 1E2GA 4PZYA 4I1UA 1NG9A 2H5EA 2SHKA 2XAUA 4IHQA 5KUTA 1E2PA 4B3DA 2GRJA 4TWZA 1P61B 2JJ1D 4FMDB 1VG1A 2G77B 3KJGA 2ZVQX 5TV2A 2B7BA 3AF4A 1T91A 4HAYA 1UF9A 5KSPA 1W44A 1G3QA 4NONA 3SNHA 5TY0A 2REOA 3EZ2A 1EK0A 1KI2A 1W4AA 3BJIC 5BWMA 1NKSA 2Q6TA 4HAZA 1Q0UA 4KFUA 3T5GA 4LJ7A 4P4SB 4DCSA 1US8B 3EZ7A 4DSNA 2WWIA 4MYTA 3WBJA 4ERNA 3QKSB 4ESHA 1D9ZA 3TMKA 4US1R 4WW0A 3I5XA 4KV9A 3B1XA 2MMCA 3LQRA 4KFSA 1EESA 4PO9A 2FN4A 1HE8B 3EXAA 1Y63A 4RJLA 4JT2A 4MUAA 2NO9A 3K0SA 4MGIR 3DPUA 3K70C 1N6NA 5HPYB 1QF9A 2WJYA 3AGPA 1J8YF 4PC6A 1IY0A 2IC5A 1LB1B 1FUUA 2IEYA 4PPGA 3AVYA 1KGDA 2QI9C 5JFGA 4JVNA 1ZM2A 2F9LA 1UDWA 2YWFA 1IXSB 3B9QA 4MH0R 4UNNA 2J7PA 4NP6A 1W49A 2CBZA 2WWYA 3EWAA 4BPBA 1ZNWA 3WBKA 3P4XA 1WCV1 4OI2A 4M22A 1CEEA 2V7QA 1JAHA 2QL6A 2ZRFA 3NDBB 4RSGA 1PV4A 2WAYA 4H1VA 5B2ZA 2VQSA 2HCJB 2W58A 2XOKD 4JL6A 2FFHA 3RS3A 5EJEA 3HPRA 1G5TA 2ZYTX 1P7CA 2PX3A 4HDOB 5C18A 2A5FA 2Q0HA 5EP1A 4ZDWA 3VKHA 1E9SA 1OB2A 2Z4RA 3RS0A 3U3OA 2J0UA 1Q22A 3B1VA 1Z08A 2Z43A 1XWIA 1TU3A 1Q57A 4JLAA 4KBGA 1E9EA 2ZYVX 4PXAA 4NL4H 2ZIAA 2IS1A 1IY1A 1NVWQ 5KPDA 2GJKA 2NO0A 1NBMA 2FGKA 5G41A 4AY2A 1CP2A 4LJ4A 5FUVA 2R6AA 1Z0DA 3T61A 3TIFA 5AUOB 4GOXA 3LWNA 4A0GA 3VKGA 3MLEA 4KLZA 4PC1A 1ODFA 2RHMA 3NIBA 1GTVA 2ZITA 3KTAA 1S9DA 1UBGA 2QU8A 4PZLA 2PCLA 3W90A 1N2CE 2ORWA 3LXXA 2VEDA 3CO5A 1G5RA 1SQ5A 1SVIA 1B23P 1QHHB 1DO0A 3BFKA 4TT3D 1DS6A 2CMKA 1KAOA 3CPHA 2ZR7A 4DIDA 3A1TA 2QRNA 4CEHB 2ZSBA 1DAGA 4EQ6A 4EQ6B 2J7PD 4C30A 4B44A 2W2XA 3HU1A 4D4KA 4HAVA 1Z3IX 3KKMA 5CJPA 3K0EA 4FN5A 3MWLA 2PZFA 3QPVA 4HLDA 3Q9LA 2ZR9A 2JAQA 3CF0A 2JLUA 5LBIA 5JS8A 2F1JA 1SVSA 3QXXA 5KSZA 4R98A 4CGZA 6Q21A 2Q9BA 1OSNA 3QG1A 3ZVNA 1KZ7B 1AK2A 1Z6GA 4M2LA 4CT4B 1II8B 4GL2A 3QKRA 4B6FA 2O8FB 1GRRA 4LV6A 4C0AC 3WMFA 2ZXUA 3QIAA 4JLOA 1W36B 3FFAA 1G7TA 4MITA 1G41A 4B73A 1GP2A 4UQOA 1AQYA 4LC1A 5BYKA 3N5CA 1GKYA 2MSCB 4MRRA 5C2JB 1P9WA 1NRJB 4QRHA 5BN3A 3IEUA 1K5GA 1YZLA 2GNOA 4KI0A 3WP1B 3B82A 4DSOA 3C5HA 2D2EA 1E6CA 3CB4A 3MRSA 4PC7A 3MWKA 3UXMA 1SVLA 4DT1B 4NH0A 1DO2A 2OSBA 3VNUA 3A1SA 4POAA 1G64A 2CJWB 4TLBA 2YNMA 1M8PA 2E1RA 1NI3A 1SXJA 1SXJB 2OLJA 2RGDA 4GSYA 4LBZA 5AUQA 3RC8A 1E4VA 4GBMA 4LYAA 4US0R 2C78A 5ANRB 1S2MA 3UATA 3TH5A 4C4PA 2BV3A 1MRNA 3A8TA 3LO5A 5SZKB 1RRPA 1QHNA 2DPXA 4OK5A 4HLUA 1SHZA 3ECCA 2Z5FA 2CL0X 4QXAA 5BQ5A 4TZ0A 4YMWA 3KKPA 2VP4A 1WQ1R 3I8XA 1G5PA 2JEOA 3NHBA 1AQUA 2O8DA 2O8DB 3ZQ6A 4C9BA 4D4MA 1ZP6A 3P1JA 2GCOA 2GEUA 1XNJA 2QAGB 3K0AB 2QPOA 4B6EA 5DHFA 2BIFA 1QHIA 2REBA 2ONKA 1AGRA 5LB4A 3PCRB 2OBMA 1NF3A 3KQKA 2ZJBA 1L7VC 4Q47A 2GVDC 2RGBA 3AV0B 3QG5A 2QTVB 4DCTA 1H8HA 3KL4A 4R71A 1VIYA 1ELOA 1KI6B 1HQCA 1Z0FA 1G19A 2FZLA 4UNQA 4V0KA 4YMSA 2AK3A 1MKYA 1M74A 4E03A 2GXQA 1ZD8A 4IEEA 2R6DA 3IDQA 3ND8A 1U90A 1P2SA 3X1YA 2FH5B 2IK8A 4FCWA 4NE2A 1E9AA 1RKBA 1U99A 1KI7A 2HF9A 3PEVA 2ODBA 5GADl 2C04A 5FR1A 2KWIA 4QJ5A 4H1UA 3SJZA 5G40A 1ZNZA 2AL7A 3B60A 2VH5R 2B92A 4RKFA 4M9XA 4DCUA 1QRAA 1VKJA 1KNXA 2ORVA 4TYNA 1KYIA 1W4BA 2D62A 1YE8A 3CX6A 2FFAA 3CX8A 4PO1A 2JLXA 1CRPA 4Z1MA 2ZE6A 5FUWA 2FMXA 3LRPA 4R7ZA 4YDHB 1L4YA 1K5DA 1UFQA 1XD2A 3M6AA 5FI0B 5GVSA 4OJQA 2DY1A 2H18A 2OFOA 5P21A 1RPZA 3MSXA 5DLQC 3CBQA 1LF5A 2EWWA 1NMXA 2F7SA 1D9XA 3SJCA 3TJZA 2EW1A 4FINA 1F48A 1M7BA 1OF1A 1UJ2A 1FPMA 4IDNA 5CB6A 3A58B 4QGGA 2GDJA 5SZHB 4X8HA 1N6RA 1D5CA 1X1RA 3AVTA 2ZRLA 1F2TB 1EGAA 5CYPA 4B3XA 1NIPA 3GLIE 1ZNXA 2QG6A 2YZ2A 2QMHA 2WJGA 2ZRBA 3CH4B 4EPYA 5G3YA 3CH5A 4RCZA 1DAFA 4IKEA 1XDBA 4TYPA 2VHUA 4D0GA 3FB4A 3UWKA 4TL6A 2IF0A 5EZ5A 4PC3A 1H8HD 4ZI3A 4AI6A 2OE2A 4GRAA 4HAXA 2YVUA 2X1VA 2F55A 1FUKA 1II9A 2BKUA 4QFMA 1FTNA 3UMRA 4DLYA 1T3HA 2NO1A 2JDIA 2W6JA 3WRYC 5CYOA 2W0SA 2W6ID 2F1IA 3AVOA 1BH2A 3NG1A 3OF5A 4NHOA 4DJTA 3V4RA 3FE2A 2AR7A 1TQ4A 4B2LA 4PPNA 2WJVA 5FTNA 1XTQA 2J45A 3T1OA 3WNCA 4ZIRA 1J7KA 4B76A 1K8RA 4CIDA 1ZM3A 2P2LA 1QBKC 1TADA 4QGFA 4G3XA 1P2UA 3VQTA 1XEWY 5JSZB 1U0JA 4NYIR 4DRZA 5EUQB 3SYNA 1KI4A 2FZ4A 4RFSA 3RHFA 1AS2A 2N1BA 1XB2A 2RGAA 1VHLA 3DO6A 1T0JB 4QBGB 1GRQA 1UEIA 4NZYA 5JBQA 1XPUA 4M1MA 3ZD7A 3KX2A 3IUYA 3RABA 4FMBB 3TVDA 4C2UA 1ZD9A 1OIXA 4IDHA 1GG2A 4UXJA 1M7HA 3FTQA 3OEHD 3X1DA 2VIIA 5J5CA 4KCGA 1BKDR 2FF7A 4EJSC 2RGGA 3NXSA 4CDGA 5CK5A 3CNLA 1G7CA 4V0NA 2KI5A 2PLFA 4PC2A 2GXUA 2WBLC 2WPDA 3GLGE 1EWQA 4RY2A 2A78A 1CIPA 2CK3D 2Q9CA 3IQXA 4WXPA 3W34A 4DCNA 2ATVA 4FCVA 3U7HB 2ODEA 4C7OA 1ZCAA 4EPRA 1E0JA 4NDZA 4JYBA 2HLDD 1ZMXA 2FFQA 5JJKA 5D3MB 4FWIB 3N2IA 3IIKA 2J9RA 4M4SA 4X8MA 1KDRA 4OHWA 3W3ZB 4XWOA 4BFXA 1AA9A 5IHPA 1R0ZA 2AXPA 1RRGA 4MKGA 1P73A 1A7JA 1SHKA 4HATA 4JBXA 2I1QA 1Z29A 3N70A 4D80A 1XU4A 3GJ6A 1GM5A 5DYIA 2WIBA 3FMFA 1KNQA 3NC1C 3NTUA 3FMIA 1IHUA 5EXPA 3U44B 2QGZA 3OIVA 3K0FA 2JDID 2W6JD 4Q00A 3WXMA 1G3RA 1W1WA 3BFXA 3I92A 3W8NA 1OXVA 4EPTA 2IW3A 2WWHA 4IJMA 3R9IA 3IIJA 5TMPA 5KNBA 1NIJA 1GOTA 621PA 4BLRA 3AF1A 1PUJA 4Y0VA 4OK3A 4Q1CA 2QP3A 3IHWA 3Q3JB 4ASUD 4FMDF 1YZTA 5AJZA 1NP6A 1XEXA 4ZDKA 5FPTA 5EP2A 4DZZA 4KU4A 3KKOA 2EFHB 3VU9B 4B2PA 3EIHA 2J59A 2RHDA 1NVVQ 4YONB 4DHEA 3HU3A 1Q12A 2IYLD 4TTPA 2XITA 4JLDA 2RGNC 1MOZA 2WWFA 2ZI9A 3EASA 3U6KA 1XXHE 2ZU0C 3R9XA 4XH9B 4DSTA 1YZUA 4OKSA 2YJTD 3QSYA 3E70C 3SHWA 3DOEA 2ZE5A 2WPDD 3QEOA 2DR3A 4NKRA 1Q21A 1KSJA 1N5JA 2HJGA 3O8BA 1BIFA 2FSGA 2OXCA 5L3QB 2R9VA 4HB0A 3DZ8A 3X1XA 2JLQA 3EIQA 2QENA 3QF4B 2W2VA 2GAAA 2NPFA 4JLVA 5AJYA 1QHXA 3CR7A 4NPHA 3AKDA 4ARZA 5FL7A 3K8YA 3WRXC 4OHZA 3AP2A 4L16A 4LUCA 4BLOA 1XMJA 2BMEA 3KFVA 4Z8YA 5IT5A 2V3CC 3KZ1E 4KYIB 3VMFA 4HDQB 1GRNA 4JLMA 1IONA 4B3BA 4QBIA 3V9PA 4M21A 1E1QA 3WNBA 1EWRA 2O5VA 4A8JB 4EDHA 5KNDA 1ZCBA 1P3JA 2QBYA 2V1UA 2DBYA 1HUQA 4HB3A 1Z8FA 2ZPTX 1NKTA 1G7RA 5A4JA 5KDDA 4ON9A 1G8PA 2J0VA 3RS7A 3E1SA 3C5CA 1JI0A 5JHGB 4WBSA 1TU4A 1DG1G 4DSUA 5JECA 2R6GA 5D3QA 1UM8A 1ZUNB 4EFMA 3WMEA 4KVGA 2OFXA 4P33A 4U7DA 1Q1BA 4TSFD 1UBFA 5KDOA 1GSIA 3DZDA 5E7MA 4QM7A 1FX0A 3E2IA 3EG5A 3W6PA 4QM6A 4UNRA 2V6IA 5HR5A 4Q9IA 1P72A 4IEIA 2PBRA 1LW7A 4TLCA 3LVRE 4LI0A 2IXGA 4OQFA 4WOPA 4M1OA 4P31A 2BJWA 3KJHA 4AKEA 2ZR0A 1KJWA 2V6JA 2ZRAA 4DLZA 2EU8A 3R8FA 2VF7A 5JZVA 2CCJA 1YKSA 1TMKA 4HYYA 3BB1A 1AKYA 3BIFA 1MRSA 5FOWA 2R62A 1N5IA 2LWIA 2H1LA 5FTMA 4JVMA 2A5YB 1OT3A 5AUPB 3K70D 2EFDB 3SFZA 1DADA 2GCNA 5C1BA 2IXEA 1JBKA 3FPAA 5L3VA 3R7WA 5IRCD 5KSOA 1FQKA 5FL7D 3FMPB 2O8BA 1TQDA 3BAFA 2PZGA 4M1YA 4AKIA 4HZUB 4LPSA 5L3SA 3BWDD 4XJXA 2AX4A 3RYTC 4QOSA 5J40A 1YU9A 4Q7JB 4XVRA 3AKYA 4JLBA 1DPFA 2A3RA 4RZXA 2C9YA 2J46A 1FFHA 2VLIA 3QY0A 1KK2A 1W0KA 3B13B 4D26A 1E1QD 3AGQA 2FG5A 3GJ8A 3MWYW 2EYQA 3VHLB 4M0LA 4M1SA 4Q4JA 2JJ1A 1XPRA 1GKIA 2Z6VA 3VX4A 3EWSA 4RZ2A 4HDCA 4RCYA 1TUIA 1DEKA 1QVRA 4Q7MB 3OIWA 2D2FA 1G18A 2QORA 3PENA 3E5HA 1CR2A 4JLKA 4OHYA 1VDZA 2F6RA 3T35A 2GZHA 2JLSA 3DL0A 4Q7LA 3TKLA 4XWKA 4CVNA 2C2HA 1KDPA 2R6FA 3EAQA 5GJVC 4FD2A 2YWGA 4CEIB 4B2IA 2ZU6A 4JLJA 1DELA 1TAGA 1XTJA 3LW7A 5HCIA 1TX4B 1IXRC 4IVRA 3ADBA 4OI0A 5AUNB 4ILEA 1OKKA 5DNYB 1OH7A 3TUJC 4AC9A 1OB5A 2IYQA 4P3YA 3QKUA 4XSGA 5AK0A 5EQTA 3PJRA 1JPJA 5C4GB 1SVKA 4BEJA 2X2FA 3H86A 2HT6A 3T34A 1X6VA 1LS1A 3RRMA 2VO1A 5J4LA 2FFBA 1ZU4A 1W4RA 2L0XA 1K6MA 2OM2A 5J4YA 2H16A 2OESA 1XTSA 2IT1A 5KHOC 1NN0A 1HEIA 4LBYA 2CE7A 1ZNYA 4I1VA 2ZSDA 1DAEA 4HAUA 4AKGA 4A1FA 2IS6A 2W2TA 5BN4A 1IXZA 3LFUA 5B30A 3SYKA 1KO1A 3QBTA 1GNPA 3VR3A 3FHTA 4PHGA 1CLUA 5DYGA 2XOKA 2P65A 2F9MA 4E09A 4L15A 5H70A 2O8CB 1W0KD 3L0PA 3AVXA 2CL6X 4OBEA 2QE7A 1IBRA 2O8EB 3GMTA 4IFBA 2IF2A 4B3FX 5FOTA 4RD4A 3UIEA 3GFTA 2QROA 3ZYCA 2QQ0A 4US2R 2GK7A 1CXZA 3L43A 4TYQA 1E9CA 3AH8A 3DKPA 4Q9KA 1XMVA 1UBCA 1KK0A 3PQCA 1U8AA 2AK2A 4QNMA 1RE0A 4U02A 5LD2B 3TE6A 1E9DA 2GBLC 2A30A 1U98A 4JSYA 5C46F 1AGPA 3OESA 4GT1A 1MO5A 2O0JA 1W2HA 2J0QA 3BRWD 2ZUBA 4A2QA 1E0KA 2GK6A 1E9RA 2WSMA 3K9NA 1GILA 2ZRKA 1Z6YA 3KQUA 3GLFA 3GLFB 4B74A 2GZDA 3CRW1 1N0UA 5KO2A 5GJCA 1NLFA 3DMNA 2ZRHA 2PT5A 5L3RA 1U9IC 3W9YA 2XZOA 2CE2X 2F43B 2F43A 2NQ2C 3UWOA 1OKKD 1RRCA 1NN3A 3W6OA 4AURA 4TZ6A 2AXNA 2JLWA 1KAGA 4R9UC 1GWNA 2ZRNA 4FIDA 4TQ9A 3U7FB 4TT3A 3U6BA 1XP8A 2PJRA 1G4AE 3NBYC 1WF3A 3QVUA 4W5WA 3T06B 4CYMA 3T12A 2GF0A 2WJHA 4LHXA 3WNDA 1S0UA 3ZVRA 4D81A 3ADDA 4Q1AA 2ZJYA 3ZD6A 2H57A 5HE9A 1C9KA 4TMXA 1BYIA 2H17A 4LX0A 5CB8A 3ZLJA 2BBWA 2DFTA 4XVUA 2WJIA 3EPHA 3REFA 1G16A 1IN5A 4NCNA 3RC3A 3ZIAA 2PLRA 3I61A 1OLOA 4HSEA 2P5SA 1DTSA 2ASEA 1L2TA 3I5YA 1Q3TA 2QE7D 4URXR 5JJIA 2B8TA 2YC2C 4I81A 2PX0A 4A6PA 4G1UC 2J0UB 4NCJA 1UEJA 3CWQA 1AKEA 5DI3A 4LYJA 2X19A 5DO9A 5EXSA 3KKQA 2AD5A 1NN1A 4UKDA 4EFLA 2QAJA 4KAXA 2IYYA 1XMIA 1LY1A 3KUCA 3W5IA 1UBEA 4C0HA 2JLZA 1UADA 3F0TA 2ZAMA 2BOVA 2WVJA 2XSZA 1Z63A 2P6NA 2BEJA 3FKSA 4EUNA 1XEFA 4MQBA 2DFKB 1D6JA 1I2DA 2QT1A 2GJAA 2PEZA 5JWHA 4B48A 4D25A 4NTZA 1P62B 4LCBA 5J4KA 1M6NA 2C9OA 2WMNB 2ZEJA 3AKCA 3KTAB 2IUSA 2NIPA 3ZZ0A 1T6NA 3QKTA 3EARA 2J41A 1KO5A 3U60B 4M8NE 1A1VA 1WMSA 3AVVA 1JQLB 1SZPA 3U4QA 1RFLA 2XGJA 2PZEA 3PUWA 4YMTA 3O47A 2O0HA 4CW7A 2GEVA 1SVMA 1TEXA 4M53A 2A5GA 2XZPA 1JNYA 1T3SA 4QNRA 2FJUA 5DISB 2AWOA 1ZM7A 5AR1A 3LQQA 1ZUIA 2QSZA 4Q4HA 3PVSA 2YC4C 3CLVA 1KK3A 2JASA 4U00A 2FPLA 1Z0JA 1N3BA 2YOFA 3IQWA 1N6KA 1R0WA 4EJSA 4MRVA 4TL8A 1BO6A 1OJLA 3GLHE 4HB2A 2P6RA 1KSHA 4ESVA 1E9BA 2HT1A 1R7RA 3MG9A 2FPKA 2G0NA 4ZDJA 3ZIAD 2BDTA 1KKLA 3QKRB 1EFRA 1X86B 5CDFE 2QMEA 4YMVA 4WZBE 1CBUA 4DDTA 3MCAA 2PT7A
chains in the Genus database with same CATH superfamily
2OV2A 1G21E 4FSDA 1LXCA 1S3SA 1F6BA 1NMYA 2YRWA 3JWEA 3WLEA 2NP7A 2G1JA 5C52B 1AXEA 1SBCA 1E2HA 3JQPA 5IXYA 4G4IA 4XJSA 4FNGA 2XCQA 2MINA 2MINB 2ROQA 2HK9A 4Q12A 3Q0EA 1V1RB 2HHCA 1L4BA 3E7XA 4PFSA 1ZC4A 5FL3A 1Y3FE 4OLHA 3EF1A 1N2EA 5FTJA 2BC9A 3GVCA 4LWPA 2WU4A 2XYQA 3DHEA 3DR5A 4RNDB 2IZ6A 2R44A 1GTMA 2A4KA 2DFDA 4N18A 3TLYA 1U9JA 4EPXA 2IXAA 2VSFA 4Y2HA 3DBLA 3PC8A 2MDTA 4H1TA 4ES6A 2OGUA 2PRYA 3CH7A 2VK4A 2GO1A 3KJIA 5JLAA 3GD5A 1EWYA 1Y1TA 3AVQA 1VBKA 1Y9DA 5AVWA 1J1IA 1UJBA 5DGXA 1XCPA 3K9HA 5E3JA 1W4ZA 3Q9UA 3DAPA 4EB3A 5CVDA 3L92A 1HL7A 4RK6A 1SK9A 1RFGE 2FSSA 2OO3A 3OLXA 3R3YA 3LU1A 2I66A 5F4ZA 2O1XA 4NBKA 1FZTA 3DKRA 3MLAA 3JVDA 1LLDA 2M6SA 1ANKA 1QLJA 3H04A 4ZCTA 2A14A 4RX1A 5BWLA 5JZBA 3OX2A 1ESNA 3UV3A 1UZUA 4F3TA 1XZFA 1B0AA 4IGEA 4IFIA 4HUTA 2C31A 4HNRA 1L8AA 5F5LA 2GCOB 1E98A 1YB1A 2HA2A 4QBFA 3B5IA 5DOVA 2VZ8A 3QITA 3U4IA 4HG2A 3PZRA 2DWPA 2PUDA 5EJFA 4B7UA 5EJIA 3R3ZA 4ZALA 1RCUA 2EW2A 3INTA 3ZLBA 1GQSA 1QQ5A 2XYRA 3JZMA 4MVJD 4C3VA 3FUTA 3FOZA 4UBNA 3U3MA 2EAUA 4F5EA 5BNIA 4CQLA 3OI7A 3M3PA 5KYTA 1BOFA 1VCOA 1R2QA 3UJ9A 4ZN6A 4IJVA 4S1OA 3UB2A 1EFRD 4FQ5A 5AJWA 2VSNA 2NU9B 1YMUA 2X15A 3A1WA 2X2PA 1GPMA 3GLVA 3HPQA 4JVOA 5BV0A 5IK2A 1QK3A 3UJAA 4U6QA 2W6IA 3LAWA 2E82A 3BYZA 4WXMA 2V54A 4I6GA 4I1RA 5IX8A 3IKVA 4EFNA 3ZPXA 2J9ZB 2D0PB 2VKQA 2OXEA 4JL8A 1W5SA 3BD8A 4LZLA 4B81A 4KSCA 1QIGA 1J09A 3ZU5A 4XYBA 4HH0A 1NI5A 3JYOA 3TSCA 1KHHA 4MHOA 1Q15A 4UASA 1IYZA 1B0ZA 2FWIA 2FW6A 4FONA 4JT8A 2P6UA 3D43A 5L6LB 1KAHA 3V4FA 4CBVA 4BNDA 2O3UA 1HRKA 4QUIA 3D6TB 4EVIA 3LXUX 5BSEA 3AIMA 3PUJA 4D4HA 1G21A 1VMAA 4L4XA 2JFUA 3GBSA 3CUVA 1T24A 4S0XA 2DYKA 3M70A 3P9RA 4V2UA 4Y2XA 1KMQA 2G82A 2R1VB 2R1VA 4XAQA 3LHDA 5IAGA 4AKHA 3ZHQA 3UAOA 4BFTA 3PNVA 2I2DA 4DYVA 2H4HA 1K4YA 3KPYA 4MYUA 1SBHA 3BA1A 2D1YA 3UT5A 3JPWA 2D5BA 1SVWA 3CEPB 1L7DA 3R9KA 2O9JA 1J8QA 1JAXA 3CRQA 4BX2A 2IL1A 3EPKA 1CJKC 2W4MA 4YJHA 2C9BA 2WJPA 4K8RB 4NARA 2XJ4A 3HN2A 5M04A 4EKDA 3E35A 1XUOA 3M1LA 5FYDA 4DW8A 2FSPA 3S28A 1RJFA 1TJ5A 3DJYA 3IUNA 3PXCX 1XEAA 4ZO7A 1AM4D 1R12A 1WAMA 1Y1RA 2HLDA 1N6OA 3KAPA 5EIFA 3AF6A 3PVCA 4WINA 4ENUA 1Z28A 3THXA 1E7RA 3SKXA 1G8FA 5CLQA 3HP7A 3LYAA 2J08A 4NDNE 3ITKA 2FMTA 3TEMA 3ZTYA 3E1KA 5E1DA 4O0MA 3UJHA 1KP3A 4C3OB 3O1HB 1BXGB 2RJNA 3F3YA 2AJDA 4G89A 2K7ZA 3CLRC 4IUYA 1JA0A 1E92A 5EP4A 3HZRA 5C81A 1VL1A 1CYDA 1UWLA 1NXWA 2N9UA 1C30B 5HIKA 3OUZA 5FQNA 3S44A 5C5DA 1JR2A 4IMJB 2VTEA 4FYYA 4Z0PA 1OPXA 2JLRA 4WZZA 4IEFB 1YIDA 5AHOA 9ABPA 2BP7B 2BP7A 3TCNA 2OCPA 1B16A 1SELA 1T0HB 3AW9A 1OBHA 1IHYA 2E0IA 1MO6A 2OUKA 3UK7A 2JATA 4L5CA 3WGTA 1WPXA 3I76A 5MF6A 4DREA 3PC2A 4I4TA 4FE7A 3DE5X 3TEFA 1E79D 1HT3A 2XV1A 1RI1A 2FTKE 1HFEL 2DUJA 3UXYA 3H4MA 3IAS6 4J4BA 4GEKA 1ST3A 4PZ0A 3GJ5A 1ENYA 3RUAA 5AI4A 5JAPA 1BMDA 2QJFA 4HOYA 4I5EA 3HJCA 4N3NA 1QM5A 1QRSA 4NFYA 2OOKA 2JG3A 2HWUA 5G53C 5BUSA 1YL5A 4V03A 3UMVA 1R0LA 3EJ6A 3F9RA 3I28A 2GNAA 3VSDA 1C29B 4Z4IA 4GZMA 4KOEC 2OLKA 1UODA 3AQ4A 3H19A 3Q2IA 1E1RD 4TS3A 4AN0A 5A3RA 2G3YA 4CG3A 5JANA 1ZINA 2VS1A 3ESRA 1SVOA 3IE2A 2FPGB 1Q1EA 3MN1A 4GZLA 1U7XA 4IDCA 3SX0A 2AVNA 2PSEA 3DPSA 1JKIA 3UMJA 1ZUD1 1P9LA 1K97A 1WBJB 4IW3B 4RHYA 4S35A 4TROA 1V1MB 1V1MA 4LZAA 4DR4B 1Y7LA 5KHLB 2G1AA 2ODNA 2ZWIA 3HCBA 2ZVJA 3NP7A 3PE6A 4V24A 3ZV4A 3N8HA 4FMCB 2W2LD 2B25A 2F1KA 1HF3A 2PL5A 3GGJA 4CV2A 4DLPA 4Q34A 4Q7QA 3AG5A 1UMBA 1MJGM 2ARKA 3G8CA 4G8BA 1UZAA 3JVVA 4C0KA 1SBQA 2GEDA 1Z7BA 2YFKA 3R76A 4LSGA 3FG9A 4ZOQI 3R5KA 3BGDA 5JS1A 2ZYDA 2R5FA 1U2GC 1E20A 3UJ7A 3DZGA 3DV0B 3DV0A 3IEKA 3MTQA 4F3RA 3DLCA 1YB2A 3AJDA 1FMLA 2NZYA 5ILOA 3AYXB 1AMOA 3DEIA 4YMIA 1CDOA 1SZCA 3RHZA 3WK5A 2P91A 1SOMA 1TF2A 3G2LA 3SSMA 3K0FB 2VTVA 2K87A 2XKBA 1SKUA 5KJEA 4C88A 4UM5A 5A04A 3GLIB 3GLIA 2AJ8A 2CFTA 2SNIE 5EMKA 4EGQA 1CY1A 4MLDA 1ZGJA 3Q5DA 3C1UA 3GYBA 2MMGA 2QV0A 3GFSA 3I4CA 5FI1B 1WXIA 3C8DA 2QM3A 1F7VA 4P38A 1FLDA 3G59A 1QDLB 5I4KA 4LVCA 4YAOA 4ZT2A 2Q62A 2P2ZA 4G0PA 1MNAA 4XCXA 5ENVA 4RTOA 5SZIA 5B1YA 1SMKA 3MCWA 3MS7A 4KXFB 1D2MA 1EAYA 3OTIA 2ZE8A 1F1JA 3S81A 3QNUA 2WM2A 4TS1A 1SBYA 3UTDA 3COVA 4ZREA 2HA0A 4GLOA 1K68A 1G5HA 1H2RS 1J90A 2CLEB 2GFQA 4KPEC 4BE4A 5AD1A 2LDBA 3GEHA 2AW3A 3G2PA 5BYJA 4EMBA 1T6ZA 3QK7A 5DNUA 2VCEA 1SZJG 3DKVA 4DLTA 1GYRA 2F9FA 3IA7A 1NF9A 2DOKA 5AVJA 5HZMA 3UMYA 2A9FA 2PGLA 4W7SA 3EA5A 4EHBA 5AW7A 4LKOA 2XBUA 1Y5NA 1PJRA 4DV0B 2QRMA 3J81A 1VPTA 3WC4A 2AOXA 3GVHA 4O2BB 1H9CA 3HSSA 3MELA 1ZXLA 3SIWA 3K6SB 1RHJA 1TDJA 3I4FA 3VKWA 4U7WA 3VOAA 1EDOA 5ED4A 4REQA 5A5DA 2ZB2A 2KBEA 3DP9A 1NVKA 1H23A 1JSCA 2WNIA 2JA1A 2IDMA 5K0NA 1WL8A 2CNOA 3SEZA 2DP4E 3K6KA 4B34A 2DFNA 1GCUA 1EHCA 4ZPXA 1AXGA 3FPGA 1JG1A 4WK4B 2GT1A 1N57A 3M6VA 3STHA 5EWMB 5EWMA 4QDTA 1PSWA 1ND5A 4HH3C 4PYLA 1CNEA 1UM9A 2W00A 3F1LA 1TQ2A 1C4OA 1G6HA 3PKZA 2Y67A 4JYCA 4TTQA 2VP6A 2XB2A 4E5SA 3I4LA 3HYSA 3ZXYA 3SDZA 3TLBA 4JR1A 3AIIA 4YNBA 1CEYA 1X13A 3IX7A 2YFQA 2GYYA 3BJMA 4YCJA 2XTJA 2BHRA 2OB2A 3GRZA 3JALB 1LVUA 1TGVA 4C87A 4EY4A 3RIGA 5CDGA 3V6LA 5FFMA 2C3YA 4W1QA 1T5DX 4MUIA 5FR2A 1DBVO 1KK1A 3R1IA 3EXG1 3ZWBA 4HAOA 1MCZA 4M6WB 2WNHA 1E2FA 2Q6IA 4JGBA 1K89A 1I32A 3CX3A 3BTOA 4UPDA 3V4ZA 4BV3A 4CZ2A 4EAAA 3GGCA 4OQLA 5JAMA 5DV9A 1P19A 4J2TA 2JHPA 3A10A 3CTPA 4H9GA 3NHFA 3COSA 3CZ5A 3ZHYA 1NNEA 2AG8A 3W3AA 2G5GX 3HYRA 4GR9A 4AKSA 1TPYA 3D5EA 4UUOA 3LG2A 5ESXA 3MYRA 3S55A 1NP7A 5B57C 3NYRA 1YZYA 2VNJA 4OQQA 1DJLA 2OV4A 4M9QA 2VPPA 1PZHA 3R6WA 4RMIA 2OCIA 1UQUA 3JQBC 4NH4A 4IWXA 3WL7A 4CV1A 5J43A 3GUUA 3DZFA 3ND7A 4CKYA 4JIMA 3S68A 1VKRA 3AHIA 3WHLA 4Y30A 3OCCA 4M7OA 2P9TA 2Z09A 1EWVA 4PO3X 4Y2QA 1YJBA 3QWBA 2AHOA 3P2YA 4KFTA 1VG0B 2V7BA 3NYIA 2PRKA 3QV2A 3O84A 4COOA 1NBEA 2ZUDA 2BM0A 4DIOA 4EFKA 5LP6F 3MJFA 5K8VA 4CF5A 1F5SA 3U2QA 1XE3A 2X2OA 3VPGA 1XU7A 1XVLA 2FFRA 2I3AA 4A92A 4KRXA 3PQ5A 1ZRNA 1CZRA 2UDPA 4OMCA 5IN5A 1ZRSA 4MVXA 3DV2A 3ACDA 5JNVA 1DC5A 4YT5A 5SYNA 1NUUA 3BH6A 3BC1A 1DQSA 1NN5A 3H8VA 3JZFA 4RZHA 4N12A 5TXGA 3R7FA 4J16A 1O0CA 4FHZA 2OXRA 3KWJA 1QZXA 3C3JA 2X8AA 3AL3A 3R75A 3FB1A 3PTAA 3DCNA 4WAUA 3L7KA 5EIHA 1XXHA 4OD0A 5B7PA 3T7DA 3DL7A 3EEYA 2X6QA 4GE0A 5KTMA 1MW9X 4H2DA 4E21A 4L9SA 3NDJA 2H85A 2OZLA 2OZLB 3EOZA 2XQKA 3ID6C 3VTFA 1YXMA 1IAQA 1O94D 1UPUA 2QTTA 4OFBA 1M34B 2B6HA 1G20E 3FYHA 3AO0B 4MV5A 4QOHA 2IH2A 1PVOA 2YH2A 2J9FB 4MJLA 4I8DA 4ESOA 2EF0A 2PBZA 2Y1WA 4R1MA 4IJWA 3UMMA 3QWFA 1X87A 4ARBA 5A3SA 4Z0HO 1KZ1A 1U7ZA 1XJQA 1X7YB 2DM6A 2KLHA 3OCXA 3O9VA 4O08A 4QTXA 1QTIA 5FPYA 2B36A 2ES4A 1ZSYA 1SB9A 2JBAA 4FIZA 4RSRA 3Q3HA 5BVHA 5A62A 3G0HA 1L3BA 3I9OA 5TLSA 4MMXB 3HBLA 3R8CA 4K2HA 2QN6A 3VKVA 2DC1A 5JSFA 4H7EA 4HH4A 3L4EA 5DPMA 6ABPA 2N42A 3BMOB 3BMOA 3T38A 3V1NA 1F1BA 3JWPA 1LC3A 1OFTA 1LPAB 5SY9A 3WX0A 1HV8A 4YALA 1PRYA 2IZ5A 3KTFA 1MAHA 1VKHA 4G0UA 2IFTA 1P4JA 4R2HA 5JROA 3PEYA 1TF7A 3K8QA 5ES4B 3ANSA 4KQEA 4I4CA 2DPLA 3I1IA 3IT0A 2DCUA 4EO4A 1Z5OA 2IEBA 5FBVB 4B4VA 2X77A 1WZUA 3LKBA 4M1ZA 3LP5A 5FOSA 5D5HA 2QIOA 2GAIA 2D7CA 1MENA 5KZMB 3AETB 2PO7A 2CLDX 4IDDA 1EE1A 4GG1A 1ZM4A 5HK9A 1JB9A 3RU9A 1I3MA 4LJ5A 3ETLA 3ZIUA 3DO8A 2XY4A 2IYZA 4AB1A 1WUKS 5K6TA 2IYXA 3HACA 5KNCA 2YIJA 2E49A 3PPYA 1ZQ9A 4AYTA 3RSOA 2LZ0A 1CEQA 2LE0A 4BB0A 4X6XA 4EKIA 1M72A 1T8SA 2P3LA 2CFIA 1HURA 4QHSA 2P2NA 1PR6A 3CE9A 1UJNA 5JNTA 2ENUA 4MUNA 4W5QA 2OBLA 1JFSA 2IZ1A 2GB4A 2QTAA 2QRQA 3LBIA 4CMJA 3EVCA 3FCAA 2BFCB 1CY7A 1PLJA 2H1RA 3H99A 5ADVA 4HDMB 3BMCA 1C7ZA 2Z8XA 1EIZA 4G8JA 3FHOA 1I30A 3UJCA 1EXMA 3P52A 5IBCA 1VHTA 4M1WA 1M8KA 3C6KA 1QC5A 1B1CA 1QC5B 4N40A 3BL5A 4DLLA 3ZDAA 4P92A 4RD2A 2P41A 2NSJA 3D8UA 4BDTA 5JH7F 2JK1A 5K3DA 3GJ7A 1AC5A 3AWIA 5F35A 1CUSA 2I3BA 2CV0A 4F96A 4DY6A 3IXMA 2YXNA 1Y3AA 3L0OA 2CVPA 4AZSA 1CQWA 3I8SA 5CRIA 3JARA 2WUDA 4D4JA 4OJTA 1JG2A 1Q7EA 1SKYB 4XDYA 1YGYA 3IDAA 1W2WB 4OHOA 4PPYA 4AG5A 4DDWA 3W4IA 3KFXA 3GRAA 5KVQA 2R8XA 1GPBA 2GUWA 3SU8A 5CB0A 5LBTA 1T4BA 1AKMA 1NLMA 1DAOA 1AA6A 4LFCB 4JNCA 4CCWA 2AKYA 4EHLA 4HAWA 3CCBA 2GERA 1KVSA 4PSKA 1I4LD 1MF7A 2PMEA 3TNFA 3WLAA 4MNTA 3LK7A 1X1QA 3ADCA 3N2EA 2XZLA 1CY0A 1RKVA 2O3JA 2NQ8A 4C4OA 1SUDA 1HDXA 1FL9A 4DLVA 1W88B 1JLRA 2DTEA 3O4VA 4DBVO 2VI5A 5IP5A 1UPTA 2IYAA 1USKA 1N3LA 3KZOA 2GLTA 4MIEA 2Z98A 4UHBA 3U09A 1BHQ1 4BRWA 3ICQB 3QVSA 4JBNA 1EFHA 2HYDA 2A0YA 3K2EA 2ZI5A 2KSQA 4LJ6A 1O08A 3I04A 3WZ2A 1YIOA 1SN7A 3X3HA 1IULA 2QM8A 4YXWD 3WKCA 4GFDA 2TRSB 4MUBA 2W6PA 1RKXA 5AJUA 2CXNA 5J63A 5FPKA 4DLRA 1E2QA 3CIFA 1XWWA 3IVGA 3BZWA 1R37A 1U80A 4PLFA 5DCUA 3U9TA 5H8WA 3UBMA 2Q5HA 3QELB 3AR7A 3ZBUA 2P3SA 3G0IA 5BMVF 4JEMA 3PHIA 3RHSA 3QPBA 4R2KA 3AKZA 3D0RA 3HE3A 2BBSA 3A1DA 4QGHA 4EJ0A 2H2HA 1O5OA 3LM8A 2YDYA 1WW2A 1E5TA 2GHIA 3IP8A 1KSFX 1R16A 5HTKA 4AAYA 4E31A 5JHHB 3FHJA 3CUEF 1BD4A 4AF7A 2QYTA 2UYYA 4BNJA 4MI9A 4RJTA 4F06A 4WA8A 2JGFA 2R6JA 2VF8A 4C04A 2XUIA 1DC8A 2DT5A 2Y05A 5HDQA 5HIIA 5KREA 5CG1A 1DWUA 1ZG3A 1JYSA 4RD3A 4Q18A 2I7XA 1RWWA 3CWZA 2IYUA 2QLJA 4CNQA 1N4DA 4MW6A 4R7TA 4JYMA 1RIFA 2X1MA 3H5NA 3C7KA 2D2IA 3HNRA 2WHQA 4YJDA 4QLOA 3T5CA 4A8JC 3MWJA 2ZPUA 4M46A 2CVFA 2ZKLA 5GM1A 1ONBA 1D07A 3HV2A 1AN0A 1JAIA 1WHTB 4U0KA 4GPTA 4BX9A 4NCBA 3AT1A 1ZX1A 1KRHA 1RP7A 2OZPA 3EQZA 3OJ0A 3Q7QA 4FFBB 3LDAA 2JAUA 4MVJI 5ALOA 3GQBA 3CF6R 3FYUC 4RJ2A 2ZATA 3I9FA 4C21A 3H3XA 1V25A 4M49A 4RH1A 3FR8A 5FH9A 1W9HA 3TBKA 4CM7A 1KYVA 1ZC3A 5LZ5A 1YTUA 2VAWA 3CW2A 1E1DA 1FP7A 1YI8A 2W7TA 3DF9A 3P9SA 4C0JA 4DYHA 2QMUA 2MSWA 3R7AA 3MQ4A 3N86A 1DIAA 4AK9A 4HUJA 5BW8A 1N0IA 1ZIXA 4CL8A 2QDXA 1UZLA 5K6AA 2YMMA 1SCUB 1SCUA 2VCYA 4WK6A 1Q16A 3OCWA 1WMFA 4FWBA 4ENVA 2YCLA 4RVOA 4FGUA 3PLRA 2HTFA 3FVQA 1R0KA 1MD9A 5F9FA 4F85A 1RM0A 1OXUA 1YK1A 2OXTA 3SS8A 3Q41A 5TR9A 4K40A 2BBTA 3MGKA 4I1SA 4FYMA 4JJ4A 1TGYA 4HTAA 5CB4A 3NPMA 4NBVA 3MJVA 4N6GA 5JO0A 2LP4Y 3ZV5A 4KXQA 1U2DA 1YWGO 3WGGA 4TV8B 4B6QA 1D0IA 3BB3A 1OI2A 4WT7A 2ZJ6A 5JRJA 3QE3A 2BSXA 3FYSA 3QM1A 3TQCA 5C9ZA 3N8KA 2LCIA 3H1EA 2PRZA 3HCNA 2D00A 1TYDE 2OHFA 4N1AA 3T7RA 4FEGA 3HGMA 4P4UA 2ECKA 3U17A 5FUXA 2VNAA 4G5SA 4J1QA 3P0JA 4MVJA 1V43A 4TKUB 3SBDA 3ONDA 2NX2A 1YA6A 5G4LA 4ISBA 3TS1A 2DLDA 1G17A 3IR5A 1X7ZA 1ECCA 1SEVA 3DDNA 3FSGD 1PJCA 1VL2A 4R01A 1Y7TA 3BEOA 4EIWA 1VL5A 1P91A 3I1FA 1P2DA 5D8DA 3VZQA 4YR9A 5K3EA 1QONA 2WF9A 2YTZA 2ANBA 2VRCD 3FI0A 2C07A 2G9QA 3S2SA 1RWPA 3U4AA 5FAKA 1I3OA 3FOFC 1PD0A 3UJDA 4BNGA 5EZQA 3QXJA 4ER5A 3DTTA 1U2GA 4GRIA 4FXPA 4BQSA 1QP0A 2DSTA 2YS7A 3O8OA 4H3VA 4L4UA 4Y18A 4EX7A 2ZI4A 3LW8A 1A9YA 2NACA 2RI0A 2G63A 4G5QA 3GRVA 2A86A 4LZOA 4EGJA 4TXJA 3TZCA 4TL7A 2LTAA 3C41J 2PL3A 2PU5A 3ZDCA 2O8FA 4C5CA 1D6MA 3A2NA 3LUCA 1XX6A 2ACKA 2FQXA 4KPUB 4F7WA 1HT0A 5TGZA 1EZ1A 1CJVC 1R0CA 1COWD 2AN1A 2EFYA 2H2DA 2VBIA 4O4IF 1XVTA 3HB7A 4FSHA 4I1IA 4QHTA 2OFFA 2ZZKA 4B3JA 2F17A 2Z83A 4G1MB 2FMUA 5IAJA 3K9QO 5DTEA 1L8LA 2R7NA 4CLRB 1XTVA 4OMUA 2OCXA 1UWKA 2BI4A 1NATA 3AM5A 4ARUA 1PR4A 3RRNA 2IEZA 4IPTA 2BWJA 2BUCA 5EXDA 4D7AA 3K9LA 2PUEA 3LLUA 1BMTA 4DT1A 5HVNA 3THYA 3THYB 2J4FA 4GW3A 3QUBA 1ZD3A 1NBMD 2QJRA 1WPQA 1DUSA 3QEAZ 3NJ8A 1NL3A 1J0DA 2W71A 5F2KA 1ZHHA 1KOJA 3EW9A 3P0EA 1T36B 3I52A 4I55A 4I55B 3T3IA 2NTYC 3P8ZA 4X92A 2QIPA 4XFDA 5IPFA 4MRNA 1COZA 3CUYA 4CN9A 3RV4A 2GSWA 4WLEA 1T2UA 1Z18A 1CX9B 1EPUA 1R6XA 2OAQ1 2VKTA 4Y2SA 1U6JA 3U31A 5K3OA 4PR3A 4X54A 3I32A 2AOWA 2FHPA 2JI7A 1P0PA 1PCXA 1MX1A 4FK8A 4WLVA 1R8JA 3B48A 3KIPA 1DCTA 2BGWA 3GUVA 4M1TA 4J0QA 3IDFA 4XX0A 1K1EA 4XX0B 3AMVA 1B76A 4PLWA 5JCZA 3IKLA 5JFTA 4QULA 5KINB 4RA6B 4ER0A 2X7JA 3A1VA 3SHWA 4TSRA 1AZWA 4OLJA 1YI1A 4AJHA 1PQWA 4DJAA 1U3GA 5EESA 3OZWA 3ZS8A 3DAHA 2XT6A 2QR5A 2V58A 5IFLA 4CEJB 1OI7A 1T8UA 1TI7A 5ALMA 5TX7A 4CU2A 1DBWA 4MGKR 5C4MA 1IMJA 3W6UA 2GHRA 3NDRA 4MZDA 2F8TA 1E79A 1THMA 2PYZA 4O1IA 4QO8A 2BCJQ 1AHHA 3UMSA 1KYWA 4V0OA 2BM1A 2G72A 3G2QA 1P17A 4J7XA 2YZNA 5LD2C 1BCSA 4WZBA 3H6KA 3EMKA 3GWGA 4KP7A 4EL5A 4C6SA 4EX6A 4YDQA 3U1VA 5IEJA 4F91B 3N8NA 1PVVA 4GGOA 3P9QA 3ZDBA 3NAQA 5BSRA 2H9AA 4RXMA 3SX2A 2YBEA 2GPJA 3HKEA 3HKEB 5G4KA 1QQ6A 1A2QA 3K05A 4G07A 4F5DA 3EPLA 4ZTZB 1XZAA 1BEZA 3QJGA 3LA6A 4N8DA 5ETJA 4PBTA 4PRYA 3HDJA 1OYYA 3L7AA 3FCSB 4N0EA 3WGMA 4BY9E 1NW5A 4OK6A 4OP2A 3OZUA 5TB5A 4XM1A 1IUPA 2Z4SA 4KEAA 4JB2A 3NX4A 3SVLA 1C3OB 3ESYA 3LYUA 1U8EA 5K0LA 1KOFA 2YNMD 1D2NA 4FS8A 3AUSA 3CMMA 4OF4A 3PGXA 4TV9F 4Y1FA 5B37A 3FDZB 2IYRA 1P4RA 1RQGA 2ZTHA 3OA2A 1X1TA 5DE3A 4MMYB 3OEWA 5MGNA 5E3HA 2W2LA 2H1HA 1PFKA 1U1FA 4DKXA 5AHKA 3ZDFA 1AIPA 3N28A 1YNSA 2OCLA 1N2JA 2IXBA 1PUXA 4N6OA 4J6FA 2GAOA 2KS6A 4CTNA 4XA8A 3BL8A 3SZRA 5CPBA 3THWB 3LT5A 2PZKA 3QGMA 3U4DA 3FOBA 3BFVA 3N5KA 4J3JA 5FBKA 1LLCA 3B70A 4HV4A 1R0YA 4J0IA 3WIOA 2NM0A 2WAXA 2J1LA 1DV2A 2HM7A 1K92A 1OZ0A 4KR3A 2KB0A 2FPPA 2A9RA 2FPPB 3U0BA 4UTVA 1VJ0A 1XJCA 1K98A 3SQWA 3ZIDA 1EFUA 2Z57A 4GS5A 5CLJA 1P1BA 1AY0A 4B46A 3SBXA 3G0DA 5EUMA 3SYLA 2GGSA 1P5ZB 5DT2A 2CHEA 4G65A 5FORA 5C1IA 2ZIWB 5TGDA 6ADHA 5J5AA 1N0VC 4IDQA 4RA9A 4WFIA 5CJ2A 2EGGA 1JDBC 3T9FA 1U4OA 221PA 2JFHA 4R7GA 4BFVA 1QO7A 2A0FA 3SFVA 1CW2B 3CKLA 5JY1A 2Z3WA 3I58A 1X1BA 2JAWA 1M7GA 4IJ5A 2Q8QA 4MGEA 3EVBA 1UL1X 5E3IA 2QQFA 4MULA 4ZV7A 1KMIY 4GOKA 4W6ZA 2ZCJA 2IOFK 3G2KA 4RGQA 4XVQA 1VM6A 2X14A 4DB4A 3N8GA 1U9YA 5CLHA 1E96A 3WL8A 5TS2A 2JBHA 3QI2A 3ZGVA 4RLFA 1P8AA 4GMXA 1SULA 1WSDA 3ULKA 3L7MA 4GI3A 4UVEA 1H65A 2C1EA 5TSDA 4WPGA 5EHNA 4MJ7A 5CA1A 5DIFA 5HZKA 1ECFA 1B6SA 4BHTA 3OFND 2IZZA 2HCBA 4BZXA 4PZUA 2BH2A 4JP5A 1Z88A 2RG1A 2WILA 3L4JA 3WLSA 1K8YB 3ASYA 1MO2A 4BCDA 3G2HA 2YJNA 1V9LA 3OE5A 2IIVA 4JY7A 1T3LA 2R8PA 5JCOA 2RIRA 1KJZA 2LDXA 1Z0SA 1NHWA 1T6BY 3LPAA 3N0RA 5HQ3A 5HWSA 1K7FB 1RYEA 4YDSA 2H3EA 3NBAA 3GD7A 4Q4CA 2IE8A 5FOQA 1ISFA 1TO6A 3WGVA 3RI3A 2FJ0A 1YUMA 3P26A 3K1AB 1NLYA 3B3GA 1OXKB 2VK8A 5JAIA 1E1YA 2JB9A 2ZS8A 2G83A 3B78A 3WFZA 3W6ZA 4NNJA 3OU2A 1H8EA 2WIJA 2XQGA 4U9IS 3EX7C 1VECA 2CVHA 3BOSA 3INGA 4GI5A 2HAEA 2WTMA 2IPMA 4FFNA 2B2CA 1Z0AA 4FGWA 5I7VA 4JJZA 4Q3NA 2UZ3A 1TC1A 4QJ4A 3R0JA 4F9FA 2CB0A 1CUFA 4DIEA 5CDUA 2VQDA 2PUTA 4NU0A 1OXXK 3PWSA 3KB1A 4X85A 1DC4A 4Q37A 2O5EA 2LW7A 3P5SA 2HNAA 4BIIA 4OUDB 3C7AA 3DOUA 4CMKA 3HR4A 1N3YA 4GVLA 3T3PB 3WB2A 2INGX 3P71T 3B1YA 4BZPA 1JR3E 4C5AA 4FJ2A 3BAZA 3TB6A 2R1TB 2ZTSA 1ITZA 3MB8A 2EKDA 4NE7A 1IK6A 2XIQA 1GTJ1 1BRTA 1RQPA 2RAFA 5CBPA 1ISSA 5KQGA 3HZOA 1K2WA 4IF4A 3SHQA 1Q0HA 3QKIA 4JC4A 3WHIA 3N39C 4Z3KA 4CODB 2I2XB 1OLUB 3GHHA 4RCVA 1IZ8A 4X66B 3NRBA 3U44A 4V38A 2CHQA 2CNNA 3GP5A 5JCPA 4PG8A 1F7UA 1CHDA 2ATEA 4KR9A 3TUIC 4XOIA 4WQMA 1AH2A 3BTVA 4O3FA 4NZ9A 4C6TA 2COEA 2H4JA 1FXSA 1X1SA 4KQWA 4I9UA 1ULAA 4Y6QA 4GICA 3T1NA 1J0CA 4MB6A 4ZI7F 2FOLA 4CKEA 1YCDA 1A1SA 1CZHA 2FLWA 1JG7A 1VG9B 1CD5A 2XODA 5K51A 2OQIA 4JWTA 3RBAA 3S6JA 4RK7A 2RHLA 3K2QA 3PF9A 4IXWA 4TQUS 5L4NA 2DXIA 4FGZA 1PZFA 4ID3A 5F33A 2R65A 2PX6A 3VU9A 2NPIA 2OQ2A 2P4EA 9LDBA 3VYTB 4MI3A 4GKKB 2D6FA 2FK8A 3E9NA 3OAAD 3DXXA 3IIIA 3OZCA 2H51A 4LC0A 1UMCA 2WTXA 2EGUA 2B99A 3OMXA 3G6KA 2AE1A 2FEMA 4BO7A 1WU7A 3D3QA 3IHTA 1B3RA 4QYIB 5B6JA 1R74A 4IXNA 4G5GA 1QGOA 2AFVA 3FYDA 3ZJYA 4HX5A 2YOHA 2RKOA 2D5CA 3O8LA 1A50B 3WE7A 2DH6A 1P81A 4HGQA 3C2QA 2XCLA 4QKQA 5L3QA 3ORRA 1U2ZA 4OQEA 4DZTA 1B0UA 1B2RA 1DXQA 2P9GA 3KOWA 3O2SB 3MGAA 1E2NA 2QRZA 3FUWA 2BMFA 4YVFA 1MJFA 3NPAA 4GWLA 5ER6A 3W7VA 3BULA 1DXOA 3GNQA 2QX4A 5C0OE 1A2KC 1JIXA 2UKDA 3NV7A 3OM9A 4I8IA 3J7TA 2GLXA 4IUDS 5FWXA 3PXGA 4FGJA 3Q7TA 2UVQA 3KSDO 2ZYWX 3GARA 5E9QA 4BEVA 2D3WA 1DZ3A 4L6CA 1RW4A 4TWBA 4X6YA 4PNEA 1RPAA 3FTNA 2JI6A 2H52A 4GPD1 1U3UA 3UEOA 4A6EA 3F7MA 4EZEA 3G1TA 1P2TA 3QUSA 3REGA 4F2DA 2IX3A 3W90A 3DSRA 3IMEA 5DCLA 5KC8A 4DLSA 3G5UA 1XF9A 2EYUA 2BFEB 2WHXA 3ZX4A 4A8JA 3T1TA 5L9AA 3ZNPA 1F4PA 1H2WA 3IV6A 3LDHA 3M9XA 1NPYA 3EGIA 3PHJA 4Q03A 4KQXA 1JHMA 4NC9A 3ZWYA 4CL0A 4DN6A 1RXEA 1JR3A 1ORTA 3MQFA 2E9SA 4GZ6A 3ZD8A 4AJJA 4HB4A 1I51A 2D0DA 3UCXA 3C4JA 3T5MA 1WHSA 4D82A 1OLSA 1HA3A 1LDEA 1M8FA 1ZGZA 2HA4A 4JC5A 1B2LA 3GNLA 3V8NA 4LOKA 1KY3A 1U1GA 3I9V6 1ZUNA 3KHSA 4PWYA 3WQSB 2O06A 4S1VA 3F90A 2C9DA 2PQ2A 3NM5A 4YRQA 3U3RA 2WQ7A 3DUWA 4WOKA 1J0BA 2FMKA 2IYPA 1OXSC 1Q44A 1CJMA 3D8RA 3HEMA 4Q7KA 3VHXB 1CUGA 5F7JA 5FAXA 4QGBA 4K46A 2C4VA 3F8TA 4PRLA 2WVGA 1U11A 3DLTA 4FDTA 1RI3A 1L1FA 3UXHA 2FEXA 1E5QA 1NVTA 3C24A 3SLRA 3KSBC 1CJUC 3AFIA 3LK6A 3WVNA 4L8LA 4BMNA 4AY5A 4BWYA 4EY8A 3EPRA 3QWHA 4U9HS 2O2DA 3EZFA 1CT9A 1U8ZA 4ZOAA 4UPVA 4L7QA 2NLOA 1E7WA 2WY2D 3NVMB 3OZGA 1PEKE 1F3OA 1N8NA 2H5JA 2IELA 2P78A 2D06A 1PT8A 3FSRA 3PU6A 1CRLA 3IAUA 3L0SA 4GM1A 2IPAB 4MO9A 1K4KA 1YR9A 1E61A 2Q6KA 1SUPA 1CJCA 1ZL2A 2VA8A 3EF3A 1WXFA 2QN9A 1BG6A 1FJ2A 1DAIA 1GEEA 4U2KA 4EEKA 4PQYA 5BQXA 2VTBB 2VTBA 1PHRA 3QOFA 1NXVA 2ZE7A 2B1QA 4GE3A 1HDCA 2Q0QA 3AVPA 4PLYA 1FDTA 1DC7A 2XADA 4GPEA 1K63A 3KLOA 3V3KA 3LUKA 1I33A 1XCGB 3PQ7A 4KR0A 3X1KA 3OQ6A 2QRPA 1GQFA 1HDZA 3LUDA 1RLIA 2HDNB 2HNKA 3TR0A 4PYJA 4GMGA 3BB4A 3H5TA 3T52A 3I9JA 1YVEI 2JGRA 5LL6P 4BBJA 4XVCA 4X62B 3WNZA 5DU2A 1LPOA 3CVWA 2XUZA 4Z7QB 1J07A 1FVFA 3ZU3A 2CXSA 4MYHA 3QUAA 1UC4B 3TTTA 1NT2A 2JLBA 5JADA 1VFNA 1FW6A 2CBGA 3JY6A 5D85A 2G0AA 2I62A 4MKHA 3U4HA 1DIGA 1LTQA 1ZK2A 3B7WA 4LIPD 4YRJA 3UZUA 5LU8A 5I7AA 3BL6A 5K0FA 2D7DA 2QZ4A 3SZMA 4YR7A 3T7JA 3P2IA 4BZZA 4YV7A 3A3KA 3CTMA 2R7KA 3SLGA 4WOBA 1U0NA 2HXYA 5ADWA 4N6NA 4FHDA 3P2KA 3KKNA 3ZHBA 3MVEA 4JBLA 3D2LA 1YSCA 1RYFA 3OE4A 3PC7A 1HDRA 2CD9A 3QH4A 4FE4A 2ZWMA 2Y99A 2YJGA 1YVPA 1BDIA 2C42A 2XF8A 1H94A 5DNDA 3DDCA 4DLXA 3M9LA 4PPQA 3HKDA 4EA6A 1YR8A 2JEZA 1WCIA 2Y8EA 1IN4A 4HCJA 5FHRA 1JPNA 3QPWA 2FJPA 2P5TB 5JSUA 1T4DA 2C4UA 2JFVA 2FVXA 1W87A 2X5JO 4UFNA 1CF2O 1WUTA 2W98A 4OJKA 3TCKA 4FFLA 2YW2A 3SG0A 1KERA 2NTVA 2P9EA 2QUIA 2XOEA 4KK4A 3TBHA 2YMQA 3HRIA 4YREA 1FDWA 1TRKA 2J09A 2QGFA 2WOJA 4BQNA 4DUPA 5ULLA 1E6MA 3IOCA 3KLBA 2NXEA 4QDOA 3W77A 4L07A 1P0IA 1ZDMA 2FZGA 3LHFA 4UMFA 5FTWA 3RS2A 1YE3A 1ZKMA 1V5IA 4DC0A 4Q5IA 1G0NA 1IATA 1ADFA 1HKUA 4IXMA 5TRTA 3V4LA 3I62A