2IGBA

Crystal structure of pyrr, the regulator of the pyrimidine biosynthetic operon in bacillus caldolyticus, ump-bound form
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
179
structure length
172
Chain Sequence
MQKAVVMDEQAIRRALTRIAHEIIERNKGIDGCVLVGIKTRGIYLARRLAERIEQIEGASVPVGELDITLYRDDHEPLVKGTNVPFPVTERNVILVDDVLFTGRTVRAAMDAVMDLGRPARIQLAVLVDRGHRELPIRADFVGKNVPTSRSELIVVELSEVDGIDQVSIHEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PyrR bifunctional protein
publication title PyrR, the regulator of the pyrimidine biosynthetic operon in Bacillus caldolyticus
rcsb
source organism Bacillus caldolyticus
molecule tags Transferase
total genus 52
structure length 172
sequence length 179
chains with identical sequence B
ec nomenclature ec 2.4.2.9: Uracil phosphoribosyltransferase.
pdb deposition date 2006-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2igbA00
1STOA 1XTTA 3M3HA 1W30A 3G6WA 1OROA 1UFRA 1FSGA 5E38A 3OZFA 1DKUA 3MJDA 4P81A 1DKRA 2C4KA 1MZVA 4RHTA 1D6NA 1XZ8A 1TC1A 4P83A 1ECJA 1QB8A 1UPUA 3DMPA 3HVUA 3O7MA 4LZAA 4TWBA 1I0LA 5HKLA 5KAPA 1A95A 2JI4A 1I14A 1OPRA 2GEBA 4X44A 1XTUA 1Y0BA 2PS1A 1BD3A 1NONA 1A4XA 3GGCA 5JSQA 4FYMA 4RV4A 4M0UA 1A97A 1Z7GA 5ESWA 4JLSA 1TC2A 1QK5A 5IAOA 1ECCA 3OHPA 1VSTA 2JKYA 2HCRA 4LYGA 3GEPA 1V9SA 1XZNA 4JITA 4QYIA 4Z1OA 3DAHA 1G9TA 3GGJA 1ECBA 1QK3A 1YFZA 3LPNA 4RAQA 1AO0A 1DQNA 4P84A 2EHJA 1BZYA 4RACA 2H07A 2WNSA 4P82A 1O57A 3ACBA 4KN6A 2IGBA 3H83A 1I13A 1ZN9A 3EFHA 4RHUA 4WMLA 4ZFNA 5ESXA 1GRVA 5JV5A 1JLRA 4WN3A 1DBRA 3N2LA 2AEEA 1QB7A 3MBIA 4QYIB 4RANA 2PRZA 1P17A 1BD4A 4PAWA 1L1RA 1U9ZA 1G2PA 5IPFA 5BQOA 1J7JA 1QCCA 3ACDA 1A3CA 2JBHA 1P19A 1JLSA 1G2QA 1L1QA 4MB6A 1ZN7A 4RHXA 5KAMA 2VFAA 1HGXA 4LZNA 1GPH1 4LZOA 4RHYA 1OREA 3DEZA 1O5OA 1UPFA 2E55A 4P86A 2DY0A 2P1ZA 1ZN8A 4RQBA 4S2UA 4RABA 1HMPA 1QK4A 5HIAA 2H08A 1VDMA 1I0IA 3S5JA 1WD5A 4QRIA 5BSKA 1QCDA 3OZGA 1VCHA 1G9SA 3QW4B 1ECGA 4OHCA 1A98A 1LH0A 4IJQA 5BQPA 1A96A 5K51A 1I5EA 2H06A 4RADA 4P80A 2XBUA 4RQAA 1PZMA 4PFQA 4LYYA 4M0PA 4X45A 1U9YA 3NAGA 1P4AA 5BRNA 3LRTA 4RAOA 4F8EA 5EUCA 1P18A 1NULA 4P3KA 2PRYA 4M0KA 1XTVA 2FXVA 1ECFA 2JKZA 3ACCA 1R3UA 1CJBA 1IBSA 2YZKA 3KB8A 1DQPA
chains in the Genus database with same CATH superfamily
3LUPA 5CT4A 4L22A 3QVVA 2EL7A 2QLNA 4LJLA 4YI3A 2ZZMA 3TQHA 1LPPA 1OZGA 5EMLA 4NU0A 1ESZA 1DKRA 3SKYA 2MR5A 3QEMA 2IE0A 1JJIA 2V96A 1AMOA 3SVTA 1E7MA 1KAGA 4M8LA 5CDSA 1VE6A 3HBMA 1ZICA 3V4OA 1C7FA 5TR9A 4M9XA 3SQOA 3A6EA 3PITA 3QX7A 3CLVA 3G8DA 5FWNA 2ZS8A 3C7KA 2Q9UA 3A6PC 1IB0A 4FHGA 2FPKA 3LK7A 1G64A 4H31A 5TNXA 3RHFA 4OVKA 4AJOA 4E22A 5JNTA 5CJJA 1FYVA 4HV4A 1ORTA 4TLAA 3IUNA 2WD7A 3PFGA 2FN9A 3QVXA 2HRCA 3NHLA 2JGDB 4K88A 2JFVA 5ICFA 1FS6A 4X20B 4YRQA 1W25A 2ZK7A 5BSUA 1QTQA 3GRAA 1JDJA 2QSZA 4GMHA 3MZ0A 4HBZA 5L7TA 3U5TA 1WF6A 1Z5ZA 3BHMA 3BMQA 4TUYF 3QVLA 4UZEA 3JAWB 2G9NA 3KLPX 1NBOA 2P9ZA 3RKUA 3T4XA 2XZPA 1SC3A 2FAXA 3CNOA 4IIBA 1Q0SA 5EXPA 5I6DA 2QVLA 2X2FA 4HKTA 2OV1A 3LKDA 1QC5A 2QYSA 2Q5QA 1J2RA 5B30A 1KSGA 1ISPA 1P9NA 2JAOA 3IR5A 4GLOA 4ZJUA 1XU9A 1YI1A 2VQ6A 3FJOA 3OJXA 1YOBA 2FE4A 4PSVA 2H48A 2VA9A 4IHAA 5EP3A 2HO5A 3U1TA 5DN6D 4XTRA 2PFGA 3HUFA 4J76A 1KA9H 2HUNA 4BZQA 3A6JA 5AK5A 2J33A 3T9FA 5HNKA 4OH1A 2DCMA 1XF9A 4RMJA 1N6OA 4XX1A 5DX0A 1H9CA 2SNIE 3D8UA 1GG8A 13PKA 1BH6A 1GNQA 1PWYE 1S2MA 2YWHA 1GL9B 2ZT8A 2XT6A 3CG4A 3OZEA 5HF8A 3FOCA 4S1PA 1EE9A 3FD8A 4UBIA 2CHQA 4Y2GA 3R7WA 3SF8B 5CA1F 5HHTA 1A1VA 4HGOA 3CIFA 3QQ5A 5KTNA 2GXAA 1SHTX 1EFHA 3E7PA 3RSLA 4CV2A 1EWKA 1R74A 1Z4JA 2D4AA 2VUIB 4RCYA 3UH1A 4FQ5A 1ZOSA 4RABA 3L1IA 3WSTA 1VRWA 4Z6KA 1M2JA 1EFRA 1JHPA 1C3JA 5A9SB 3ML1A 5FIUA 1Q0UA 3C5HA 3PNLA 3EVGA 4WE3A 2MYUA 4DNFA 4RELA 3UK1A 3IBSA 1PR5A 1M83A 3K5IA 4I1OA 3PDUA 4JBGA 5FI1B 5EVCA 3NJRA 3W9YA 4D9BA 2XT0A 2CE2X 4FMDB 7GPBA 1QDEA 5AKKA 5GJCA 3N86A 2YV4A 1NAHA 4I1VA 3S2SA 5FWXA 3RRFA 1N2EA 4JYMA 1RRPA 3MPOA 4KMMA 3OFNA 3PTLA 3LH5A 1GFSA 1VB5A 1WMDA 2C00A 1SBTA 3K53A 3TFQA 5FOXA 2EYQA 3HZOA 3MAGA 5LNK1 1LB1B 3HYNA 3EBLA 1NI4A 1LS6A 3A32A 1MB0A 2VDJA 1RLTA 3DA8A 4M0KA 5HRUA 2JDID 1OX6A 4P4NA 2UUOA 1VHDA 2ZYRA 4G5QA 4LJKA 1WCIA 3NHJA 4Q6WA 1XXHE 3FXAA 2ILVA 1PFVA 1DJQA 3AOGA 4PPQA 3A0UA 3VGJA 3TR5A 1Y82A 2HHHB 1VLJA 2R6AA 1Y7HA 2RMKA 3CW2A 2D7DA 4GT1A 2NU8B 3OCUA 3OLWA 2F3PA 3DW3X 4BO6A 3STHA 1DG3A 1RWKA 1VL1A 4CV0A 1WABA 4FHDA 1UWKA 4RK1A 1NVXQ 5M3BA 5BV2P 3MJDA 5F4ZA 4C1BA 3ZG6A 4RXUA 1YVUA 1YZQA 2ODTX 2VOEA 2BRUC 1P7ZA 2OCIA 4LI0A 1JXQA 3AKCA 1L5OA 4YGXB 5AJTA 3ESXA 2UZ3A 4MW9A 3LDUA 4A26A 1Z7YA 2X8JB 2WPDD 3P2YA 4COKA 4CIYA 4IGEA 3F9RA 5EIEA 3R9XA 1M1YE 2AN9A 4DLTA 4C6RA 1QTRA 3F7NA 2G9QA 3VKGA 4QJ4A 2JFBA 4KAJA 4RZXA 1QP8A 4PZCA 1C1HA 2H51A 3NTUA 5LQMA 4D41A 4O1MA 3AM5A 3BE8A 1KK0A 1W4CA 1YSCA 2QR3A 1U8CB 2YJ6A 2A0KA 2NO6A 2ZYTX 3O8LA 1RWMA 1N0VC 1UMBB 2YASA 5G40A 2Z43A 3NBAA 4RPLA 3V00A 3MHTA 1NHWA 2XUPA 1CB0A 3H05A 2O59A 1NTOA 1C0KA 2HLHA 3JQAA 1M75A 3AYXB 4QEZA 5EWLA 3ABRB 2WUVA 4ZOLF 3WLHA 3FYCA 1COZA 3M1YA 3JQ8A 3QLUA 4AWXA 2B1QA 2BMJA 3LUBA 4YQYA 3IV6A 3R0XA 4LZLA 1W34A 4IICA 3UMSA 5AXCA 1SRRA 3TKYA 3EZ2A 4GF5A 4J4HA 5IG2A 4ABTA 1E69A 3F49S 4ZT5A 1LW6E 1YDWA 3VNAA 4D4IA 4DPLA 4NG4A 2I62A 3PSHA 3I9V1 5CPFA 5BNZA 1QV7A 4RCVA 3OUUA 1EKXA 4LWQA 1G98A 3TSOA 1GSIA 3KYDA 4XGQA 4YXWA 4CM8A 1NU8A 1IPHA 2WNIA 3AVWA 3B3FA 5CDHA 2CYBA 2IDMA 9ATCA 3GHHA 2QVCA 4KSBA 2VFAA 2QD2A 2R86A 3N8KA 3KEMA 4H77A 4BAGA 3O31A 3OF3A 5BOSA 4CEJB 1AQIA 4Z2AA 1P5JA 1M6VA 1K4MA 1U3GA 4MO9A 4N3BA 3SBXA 4WFIA 1KEEA 4UTOA 4YI5A 3WOVA 1ZAKA 5BYKA 3K1YA 4WJKB 4RTKA 2QM8A 2HF7A 1VIYA 3P9XA 1Z06A 2O8NA 3OUTA 2XVAA 1EFCA 1RBMA 1OVGA 2FMHA 5LDGA 3PHLA 3UKOA 4FXPA 4XVHA 3KOOA 4XB2A 2VTKA 2KLBA 2A1TS 3BBPA 3M6WA 3O91A 3T3GA 3KU4A 3G9ZA 4U63A 5B2EA 2PGOA 2QUZA 2GN2A 3OZTA 1GUYA 3O4GA 3N1UA 3W05A 1KGSA 2DFKB 1OXUA 5L3VA 1RZUA 1RKVA 5AVTA 3EOBI 4L16A 4TL9A 1C41A 1UJ5A 2QL5A 3G2PA 2UYQA 4ZAGA 2AMJA 3DUFA 4U8HA 2M1ZA 4JD5A 4YC7A 3CF4A 2FXVA 2WWTA 2P6MA 3AEUB 4HGPA 4CG0A 1PGNA 3GVHA 3R3YA 4JIGA 2A0YA 2P5SA 1MB3A 3Q3IA 4L0DA 3UFXA 5HRAA 5JNRA 2HGSA 2UZ1A 3KM0A 3DPUA 3M4NA 1RLMA 4U0JA 5AK3A 2ZSAA 4ZT4A 4B71A 2VP0A 2W6IA 1IXRC 2NACA 4XKJA 4BUCA 1EX7A 3GDGA 2D2EA 1SPXA 1VHJA 4B6GA 1W30A 4NYJR 3W04A 3ONWA 2Y1XA 4EMBA 5B1YA 3HA7A 2F3SA 1D07A 2BSXA 1NNSA 3ADOA 2HLDA 3L0SA 4JWTA 3VPDA 2GD6A 1XVLA 2GOYA 1E1DA 5IKEA 3COPA 4EAAA 4R1OA 1YQDA 4X7RA 4FIDA 4ZAYA 1X1AA 4DADA 1W8DA 1YA4A 3FDFA 3L8YA 3NHPA 3RC3A 3TD6A 3P96A 1SHZA 1WL8A 3DSRA 5ILOA 1CULC 3AMVA 4OM8A 4BCDA 1ZK1A 1AHIA 4TN5A 3K6RA 1N2JA 2GN1A 4U6NA 1NMSA 1PJ8A 1MC4A 3EXHA 3N2NA 1SCIA 4EWLA 4W9NC 5FTMA 1P45A 3TF5A 2I34A 3W9SA 4CV3A 2QN6A 1JQAA 2V6IA 2ZOSA 3L84A 4I7EA 4J4BA 4NHEA 3ZDFA 4YRCA 4CM4A 3UV6A 5CFQA 3GLFE 2G09A 1JIKA 2GK7A 5HPYB 1ZR4A 2PLAA 4GM1A 4LEIA 1ODLA 2LTAA 5DYNA 3IHKA 1PU2A 5HE9A 4DNPA 4EJMA 1DAFA 1K9VF 3FJ1A 3I52A 4YDHB 4D8WA 1OBCA 1T3SA 3ZKWA 2YV3A 1BVHA 4EUHA 2Q5OA 1LPNA 1NDHA 4JKYA 3UW3A 4JK3A 4OX9Y 1X77A 3P4YA 2JAHA 2YWFA 1Z34A 3PA8A 3EUWA 3KPUA 1JDVA 1BXGB 1TCBA 4FFMA 5C81A 1WMSA 3WGGA 5JY1A 4R6XA 2Q4TA 3GP5A 9GPBA 4GEKA 3B1KA 1I6WA 3RHZA 2H1WA 2PJUA 2HMYB 3AFHA 4P08A 5DYGA 4C7XA 5JALA 1AN0A 1NJSA 3MJTA 4MI1A 1D0IA 4AG3A 3SYLA 1UADA 2QROA 5IAAA 2GB4A 4YAJA 2FPGB 1P1KA 2JLQA 4O8ZA 1CV2A 2VF2A 2WQZA 2J30A 3WGJA 2EJBA 5ECYA 1F0KA 2BJVA 5JSUA 1KF0A 1NQXA 3W3AH 1XV5A 2QTTA 5E2IA 1LX6A 1X1QA 1JPNA 4DVGA 1I2AA 3G1TA 5KOJA 3LWDA 4EO4A 1AZLA 5JD6A 1CETA 4WNYA 2MMCA 3LNTA 1XN4A 3LD9A 1E0JA 1NOJA 1F8YA 3AETB 2NU6A 4TTAA 4UE6A 3RHSA 2O57A 1ZPDA 1WDLA 3WHLA 5BSKA 4WQMA 1X1DA 3V4PB 3WS7A 1BYUA 3WXMA 5BYAA 4RHEA 2WPNA 4M54A 5BQPA 3JAKB 2H52A 1RSZA 2OENG 1XX6A 4OGLA 2QR2A 5D3ZA 4YRDA 4OREX 2LKCA 3BRWD 4PPFA 5GZ3A 1GVHA 4Y2TA 3MF4A 1NXWA 3FLMA 3NFYA 2P3OA 1PZMA 3BAZA 5JJBA 5K45A 1DWOA 4CUKA 4JB8A 4BQNA 3RYCA 1JMVA 3QKWA 2K4MA 2YY5A 1EGMB 1PK9A 1PJRA 1Q77A 1QBGA 1TW2A 3RS0A 3V8VA 2F43B 2RGUA 4PFJA 3ZGYA 4BNTA 4RD0A 3VOAA 1QCYA 2AJTA 2IV2X 3RRYA 2WAXA 2OZKA 4PRYA 1GKIA 3HH8A 1TPYA 3VXKA 4XLTA 1QOQB 2G0AA 1XYGA 4EY7A 1ULHA 3W8DA 4JJKA 1STOA 3OM1A 4DRXA 1QFSA 1MT3A 3JALB 4W7HA 2FF7A 2AZXA 3K0HA 1BX0A 1NVAA 3K70B 3DDCA 3NH9A 1LNSA 5JMWA 4WZAA 1QU3A 4B5KA 1P7CA 2FPLA 4ERXA 1XCBA 4KYTA 5KYWB 2H0AA 1VGVA 5C8YA 3IEMA 4FFBA 2LWIA 1YAHA 2BT4A 2ECOA 3C3YA 3E03A 5CURA 5EWMA 4AZTA 4OXRA 4ZAZA 1JDSA 2CUKA 2XUDA 4L8WB 4NFHA 4Y2SA 1MNAA 4D44A 5E8JA 1UMDB 3G5AA 5FQOA 1AC5A 2HFJA 3VI3B 2XNDA 2VK2A 3L0IB 1MMFB 4P2GA 5KCZA 1EPUA 5BWBA 1VP3A 2OEPA 2WVHA 1E2UA 1PV2A 3OQPA 3LBYA 1TC2A 4HQ6A 2GBPA 3F7OA 3LVQE 3QITA 1T2UA 2Y1KA 3V80A 4G0ZA 3HNPA 3W6ZA 5JOQA 1ESEA 5BNWA 3ZYZA 4L6IA 1QGUB 5AXBA 4PSKA 2CKMA 4NJMB 4PLCA 1XRMA 2OD7A 5G0UA 4N6GA 1VKRA 3R1IA 2ZUBA 1QRAA 2OBFA 4YLEA 1TM7E 2ZULA 4EUSA 3R9IA 4ZDJA 1P2GA 2PUDA 1Y9AA 2H63A 2ZJYA 3SR3A 4RTOA 3E2PA 4YJ3B 3K0BA 1GRVA 3W4KA 2I7VA 1M34E 4P35A 3AVPA 4EB6B 1JQDA 4UHKA 3CNQS 3BTVA 2R7LA 2QLTA 4IV8A 1DQZA 4E2XA 5HXAA 4RH0A 5C0OE 4J3NA 5TQ0A 3LDHA 2GFHA 3WHKA 2P9EA 3L5OA 3UPDA 1ABFA 3AV3A 4EFKA 4HPXB 1JIIA 1ZCZA 4E4RA 2G1UA 4MLZA 3FNRA 1Q74A 2PZJA 3NHMA 1NY5A 2FV8A 2AOWA 2O0KA 3BMNB 3LVFO 3QBJA 4OMUA 3KSUA 1VE7A 2COUA 2JHPA 2PKQO 3HUTA 3KAQA 5BSTA 4UAVA 4YCMA 4RX1A 3VPFA 3NBKA 2ZIAA 1KI3A 3WLJA 3TRIA 1WUKS 3SYKA 5DBOA 4JSRA 4ALJA 3ZK9A 5BMVA 1Z47A 1A9RA 1GT91 1C8BA 2GPTA 3RVBA 4G9GA 4MW7A 2WTAA 1TB4A 5HR5A 4GP6A 2CXHA 5ILGA 5KO2A 1QANA 2EWWA 1E0DA 1KETA 1HO3A 3HP7A 4K8RB 5G0VA 5HEKA 1UK9A 3PHGA 4TRNA 2WU8A 2A35A 3QPAA 4QDJA 1QJ4A 3SMVA 5CFNA 1I5EA 5ERYA 3HR4A 4WT7A 3MGKA 3K2EA 2GTPA 1WHTB 1XU7A 2C4NA 3MNFA 3OBIA 3ONFA 4YP6A 2NPFA 1RBYA 2V54A 3I04M 4CM9D 4ZT2A 2AXNA 3OX3A 3HLYA 4RIGA 4BNVA 4ZTZB 1XPRA 1P1FA 2FETA 2YVUA 1ZK0A 4C2TA 4AL4A 1PEYA 2DHEA 3RTBA 2GASA 4KK3A 4DLLA 3LWZA 4RWEA 3QKRA 1HE4A 2IV3A 1KJWA 1XLUA 2VK1A 5LP6A 1TYCA 3GUCA 5FPHA 1M0TA 2B0JA 3IDSA 4L76A 2J4FA 4N54A 1UXHA 3GLHA 4XUDA 5BRJA 3AB8A 4OGKA 1V5IA 5IT0A 3SC3A 4N3NA 3UMVA 3EXAA 1KY2A 1YBAA 1YULA 2HUPA 4OU5A 1RABA 3IMGA 3IQEA 3ADPA 3P0EA 3PBKA 4FWIB 1S2GA 4K40A 2H2IA 4U7GA 4BLWA 5D87A 5DRYA 3P9SA 3R3VA 1EXDA 1JPJA 1Y3CE 5IVKA 4RUKA 2BMAA 2CL5A 3WLIA 2BV3A 2QTCA 4MUXA 3RRBA 1HWYA 5EXXA 4U00A 3WRVA 3TKLA 1Q7TA 5JAUA 3ETCA 1W44A 2JFYA 5J2TA 3TTYA 2YYZA 2DJ5A 2IIBA 2ZR0A 2H4HA 4RZQA 1XRNA 4F1WA 3MC1A 3UXHA 5IKMA 1VE9A 2H1VA 2YBDA 2O5RA 4FR5A 3IH5A 3CRVA 1T8TA 2IEYA 2DT8A 3SEQA 2EF1A 3E9QA 5IUKC 3NDIA 3A14A 5LSAA 5JZSA 2F48A 1O6FA 1YZNA 2JCYA 1Y1PA 5B53A 2XITA 5A6VA 3OFSA 4RPIA 2I78A 1NBIA 3C43A 3GBSA 5IVHA 3MB5A 1X0XA 2G36A 3KALA 3J81A 3E35A 4JB3A 1FU8A 3D7RA 1BWPA 3PHJA 2HRRA 5EJGA 1XQXA 3U7RA 1T8WA 1EUCB 4II2A 2G3YA 2FSHA 5JXHA 2EFYA 4U6QA 4M3NA 2O50A 1IBRA 3TCXB 3T4UA 2BSAA 2ATEA 1T0UA 3WK5A 1HDGO 1QGED 5AVKA 4LRYA 4PO3X 2GD2A 3ZDYB 3PRKE 2WPDA 4XM2A 4L74A 4FYVA 4EVSA 3DAPA 3HYRA 1CERA 2VP6A 4FHCA 3WP0A 5JR3A 2AKYA 4JEIA 2XZOA 1LF5A 1OIXA 2J3LA 4QATA 2WWVD 2PXAA 4I55A 4BVKA 2C7GA 1TPZA 1W0KA 2A33A 2YVKA 4FZJA 2IUUA 4CM5A 2HM7A 3ZVNA 3GZTB 4KXNA 4JGBA 4MYSA 1CY8A 4N7JA 4QWMA 3E48A 5JDIC 4BAUA 4KUGA 3CS3A 1NOKA 3RYHA 1EK0A 4XIYA 4O29A 1YD7A 4MJLA 2YN4A 4CLRA 4LI3X 4CF4A 5EXEA 1THMA 4B79A 1U11A 1RXSA 2QJTA 1M2OA 4FQ8A 5ALYA 3ANSA 3BTSA 3DYIA 3KEQA 1PZNA 3FBWA 2O06A 2Z57A 3RTAA 5BVHA 3DE3X 4CEHA 3VHXB 2J0UA 4I5EA 1ODTC 1QUFA 4X1OA 5DASA 4H0NA 4F8JA 1MO6A 4QTYA 4UXHA 1J0BA 2YH2A 2R48A 2FP4A 1Y63A 2Q28A 5DBIA 1EHIA 2WJ6A 1HLFA 1K8XB 1PGJA 4OF4A 1OWNA 3AUYA 3BF7A 3M83A 5AHRA 1DTSA 2YMQA 3NTRA 5EZQA 4DC1A 4MV1A 5KVCA 1N2GA 1SB8A 4C14A 1FTYA 5EZYB 2VAVA 5H02A 5JD5A 1US8B 4HNVA 1CNEA 2P3SA 2CBXA 3EC2A 1Q1GA 3B1FA 4K9LA 4A0HA 3W1VA 2R6JA 1SKUA 2AXEA 2JANA 5DP2A 5LFAA 3VOTA 1G6OA 3OE7D 5A04A 1ZWLA 2IODA 4L08A 1RJDA 5KQMA 3IUMA 4G0YA 3P9IA 3STVA 2JJ1D 1IHUA 2OV6A 2WFMA 1ZJ5A 4CLOB 2YZKA 4BV2A 4RLHA 4S3MA 1T4GA 2EP7A 2QVGA 4B31A 1J2EA 4KO8A 3JW8A 1J20A 3MRXA 1CW2B 1N9GA 4BVAA 4D4GA 2XCRB 4UXJA 1E98A 3UB2A 2VP4A 3QP9A 1M10A 1BRTA 4W8HA 5KMGA 4WBSA 3KJEA 2GS9A 1W88B 3ZDEA 4LF6B 2PGAA 3BIXA 1R0KA 2BF4A 4KYVA 4N5HX 4NESA 4BFUA 5K0ZA 4OHWA 4NYIQ 2HA0A 4UJ3A 5DXJA 4BZXA 1RPJA 1W96A 1PD1A 1BMQA 4YMTA 2VDMB 4AKSA 1Y4AE 1A95A 4B32A 3D6VA 1F8FA 3OOSA 4EA7A 2P1DA 1YRBA 2BD0A 4A8JC 2P0AA 3EVFA 3PXUA 2H7CA 4DA8A 5IABA 2AYYA 1BHQ1 1NONA 1GM5A 1D9ZA 3Q7IA 3DW1X 5TPWA 2NW6A 2IU3A 1U0SY 1TI7A 2BDEA 1PIWA 1CUFA 2ZSDA 3DL7A 3GPCA 3KQOA 2XYVA 5LM3A 1GQFA 1VL2A 4WCDA 1HLGA 4EY4A 3NBFA 1FVOA 4IH4A 4PTZA 5BPFA 1KP2A 1NNEA 1Z9BA 2RC5A 1SWVA 5AMXA 4R8VA 2HBZA 4R2MA 1EP3B 1WSDA 4TS3A 1X38A 2Q4BA 2RJNA 4G8DA 2NX2A 1U6IA 3E81A 4YQFA 1YS1X 2P7HA 1E9AA 3HKEB 4FEGA 4P82A 4GPAA 4M2LA 4YAOA 1RTKA 3F8TA 5FEMA 4UNNA 3WGKA 3QPWA 3IAAA 1A9SA 3AHEA 1TLFA 5TT0A 1Z4OA 4MV5A 2XYPA 2ZTSA 3B89A 3GRPA 4CM3A 4XWWA 2OMEA 3ABQB 4Q7LA 2QHXA 1PZFA 4M87A 4FLFA 3UT6A 2ETVA 2DHDA 2DRIA 3STUA 3VR5D 5BQ3A 2Z3VA 2PVSA 3IPYA 1GWNA 1WAMA 4FS3A 2F1JA 2NVUA 3JD1A 1YFLA 3AL0C 3Q0IA 2OYCA 1LPOA 1C0PA 3D54D 3EVCA 1QPBA 2OBNA 1P1JA 2W6MA 2RG1A 2VJMA 2BI4A 2Q3DA 3DEZA 4H4CA 3IVCA 4RFSB 2BN4A 3H2YA 2GSWA 4P86A 4KR9A 1Z7EA 4TQAA 4XYBA 2BZ1A 2Y66A 3MJSA 2HZBA 1SHLA 2RD2A 2IIVA 1C30A 4EOGA 1ZH8A 3W5IA 2BCEA 2J09A 4PZ0A 3IQGX 2NQTA 3GROA 3X2SA 1JH9A 1FFSA 4RMGA 5D00A 1MDBA 1SZCA 4WCFA 4J3JA 1RAEA 2I71A 2X2EA 2R8EA 4G0OA 3SEZA 1BOOA 1TNDA 4IDCA 4Q9AA 1D1SA 3CSDA 3W6OA 3VPHA 1G8MA 821PA 5I7AA 2WSSA 1BVYF 1Q21A 3JU3A 2WVGA 4X45A 3UB3A 3W4IA 3WKAA 4DLVA 4NMXB 1QH8B 2B5WA 2EW8A 3OJOA 4EG5A 3F3KA 4PXAA 1B8UA 5EUMA 5IJ0B 2EL9A 4WXRA 1F4LA 3ACCA 1SUBA 1NF9A 3MWLA 1EVEA 4GPZA 1AJEA 1AKWA 2YFQA 1U0RA 3UMFA 1N4AA 4Z4HA 1ONOA 3S81A 2WM3A 4YRTA 1U8UA 2OVBA 3VPGA 3HRHA 4N0EA 1GQRA 1DV1A 2V6FA 4BO9A 4ARZB 4IVNA 5E38A 4RENA 1N5RA 1OFIA 3K9LA 3P20A 3U3DA 4I3HA 1NUTA 4MVJA 3EIEA 4DF3A 1W6RA 2V6MA 5JCJD 2Q1WA 4CCYB 3IRUA 4Q01A 5HQ3A 2JH9A 1S6YA 5C1DA 1WCV1 2I4NA 4IIJA 1I3KA 5DX8A 1QH0A 1WXDA 3P19A 5J1SB 4PCAA 4MRAA 4OQPA 2BFDA 1OX4A 1PTJA 1U0EA 2D8AA 2SKDA 5T4EA 1LUAA 3MG9A 4RSMA 1QX3A 1RWWA 3PCXA 2NOAA 3PQCA 5CB4A 3TAHA 2Z95A 1OI2A 1OTXA 4MV8A 1W5FA 4N5IX 3DV0B 3ESDA 3SIPA 1QV6A 1Z88A 2FZ5A 4QT4A 2FPWA 8GPBA 1UPAA 2HX1A 2EFEB 3RSSA 5LMUB 1RWOA 2O8DB 1XRRA 4LRSB 1JPVA 3O95A 4FBGA 3ZZ0A 3O03A 4GKJB 1Q92A 1T29A 3CA8A 3KSZO 4Z86A 1GUDA 1KI7A 3O1IC 3OPNA 3QG5A 4PQRA 4WKNA 3KV1A 5KSYA 4OJQA 1DFHA 3CWZA 3R6LA 3VZDA 4XYEA 4YCLA 2X1LA 4RZ2A 1DQNA 1GZHB 2IP2A 1WR8A 3FNHA 1CDDA 2OAGA 1UOPA 3L8CA 4FEYA 4RVUA 4CDNA 4ARIA 2VCEA 1Z8FA 2FWJA 2FPPB 2HOQA 1UEJA 3D9QX 3EG9B 3OCJA 4L3OA 3KLNA 2E2WA 3C5VA 5EP1A 2SCUB 1XMOB 4UMVA 1ZCJA 4NLLA 3TQOA 4YCSA 1OR8A 1CUSA 2HMAA 1JLRA 3JV7A 1AKNA 1QRDA 2YIJA 3N2ZB 2ADMA 2IUSA 4NDAA 3ZQJA 4IEIA 3TQIA 4D8VA 1Z0JA 1EA7A 2HU5A 4G1BA 4MI3A 1RXWA 2H4XA 1EVKA 1TLLA 1UJMA 3LC7O 3KXLA 1YQEA 4PF1A 3D6FA 2NTYC 4QXMA 3H5RA 2GBFA 5K7SA 4M8NE 4JYAB 2VP9A 3JD4A 3U4QB 1YE5A 1BH2A 2XD9A 5DU2A 3KEOA 1Q22A 4X1IA 3NANA 3RAEC 3T9BA 4AVYA 2Q49A 2AFVA 1KVUA 1TU4A 1YE3A 1R9NA 2D0PB 2CXQA 5IN4A 1IWOA 3I5AA 3FBGA 4EG8A 2AOVA 5F3DA 1U1FA 2VJAA 1QMGA 1HMPA 4BC1A 4BMOB 3MWKA 1F1JA 1YVEI 1PGPA 2PN1A 5HBRA 1H2EA 1ZO8A 2ZBUA 4MKHA 4UTNA 3VBCA 5CNMA 1D3AA 1P4JA 2G72A 4B85A 5LIRA 2X1VA 4PHFA 4TTIA 5AI9A 3SS9X 1QF9A 3PX3A 2OE2A 3OJCA 2FMTA 1YZ3A 1EVJA 2WWWA 1TUBA 2OV3A 2ZR9A 4GR5A 1RBZA 4DCCA 3W7AA 2V5VA 5FJIA 3WMGA 3H5IA 4KACA 2GH1A 1CUEA 3MQ2A 4YFYA 1JSLA 4AIIA 1ESCA 4RAOA 4GLJA 1YA6A 4ZT6A 1Q7GA 1RRVA 4MQLA 2GK3A 2DSNA 2H8KA 4LXUA 4V0NA 3WISA 5BSFA 1KU6A 5KNCH 2JLSA 2WWYA 3W2FA 1RKBA 2A0WA 1R00A 1W4LA 3QKTA 3CSSA 4NR0A 3JWIA 3U16A 1QKJA 4NCIA 1FFCA 3FPEA 1XKTA 3INYA 4KQ2A 2IDZA 2IF0A 3QFRA 4A8HA 1YAJA 4TTRA 3ZHXA 1HDZA 2P0YA 4JMLA 4DUGD 5CDTA 2VF4X 1IM2A 1GT6A 1VBMA 4I66A 3KEFA 3RUDA 2Y76A 3SEAA 1H8HD 5EE0A 1E9FA 1II8A 4P3NA 3SDZA 2FZKA 5DW3A 3CONA 3IDZA 2WMYA 4WZBA 3ITEA 2H4WA 2OQRA 4FGLA 3SDSA 1J1UA 1Q1NA 3DBVO 1PO7A 3LRXA 1Q5PA 4MHSA 4Y0NA 1QYXA 1SXJA 3A58B 2JFUA 2MWMA 4TKUB 1R9JA 2W6NA 3LUCA 5TRTA 1A9ZA 2DF8A 2FG5A 3DZGA 4JI1B 4CM9A 1NPYA 3IVAA 4RY2A 3TOSA 3PXCX 3AVVA 5LOVA 5JAPA 2I03A 4HXGA 1REQB 4J94A 4V2IA 4LOIA 3VMMA 2IQIA 3RT7A 3GAAA 1GA6A 1HG0A 1QOPB 4GI7A 5D6NA 4JU8A 1KFJB 3UCFA 1H0RA 4DXHA 2EOAA 1UXJA 1CQJA 1O0BA 2GZ1A 5TS2A 1XWFA 1AVTA 4KE8A 2C5GA 1Q7CA 4JJ6A 2XXJA 3U5ZB 1V5EA 1QRSA 3BXZA 4TKVB 1ZUIA 4Y9DA 2ZUUA 2NUPB 4BRUA 4ID3A 4IZOA 3ENWA 2BCGY 4L9RA 5ALMA 1HSZA 3FUCA 3QG1A 4A7PA 4DCJA 4ZO6A 3MINB 4B6QA 5KDDA 1XPUA 1BJRE 1C7JA 2E9SA 4EY3A 1XZLA 2G40A 1YIDA 1V37A 3DBIA 5JPIA 4ARUA 4NOMA 2OHGA 2J6HA 4FCTA 3ELDA 4XWGA 2M6LA 4AO8A 1MQ8B 4D99A 3H5WA 4FFPA 4UNSA 3VDQA 1OW3B 2NT3A 3G8CA 2YS7A 1DEKA 1JZSA 1KZGB 2PZAA 2FB9A 3IJ5A 1G1MA 1EDZA 3EB9A 3F8WA 4L95C 2V3VA 3B20A 2C97A 2VBGA 4HXFB 4J16A 5FUVA 1CYEA 3MERA 2QRLA 3WBFA 2WMOB 4OXIA 1WW8A 3HJAA 4ECAA 3RVMA 3QIAA 4JI2B 2XGGA 3JZFA 4UCFA 5D1HA 6YASA 2BLLA 3TPFA 4NK4A 2GCNA 3OP1A 5EUBA 4JQYA 5F7JA 1TF5A 2H1SA 4CQMA 1F8UA 1TM2A 1K7XB 4CF6A 3LTEA 1NBWB 1SVUA 3WYCA 2Q7OE 2EW1A 4Y0VA 1UBGA 3LQ1A 4DWWA 3V6MA 4F9GA 5EXDA 1FC0A 4EM6A 4EITA 2PUAA 3GT7A 3FDZA 4W1SA 4CMHA 4EF4A 2LDXA 4IYJA 1ILEA 4ENSA 1G8HA 4KMOA 1NM5A 2R85A 3U7QB 1G9SA 3UV3A 1FYWA 4YHHB 2VYFA 3DD1A 1XNRB 2QRMA 3FVRA 4QDTA 4N12A 1NX9A 1TVMA 3HB4X 2G7ZA 4EIWA 1JQ5A 1NOIA 3V1TC 3KHUA 3VR3D 3DDZX 2FW6A 3LF2A 1NYQA 3BDVA 4TZKA 4D82A 1DZ3A 2HHCA 2RC6A 2ZFUA 2AEMA 4MV3A 1V2HE 4IJWA 5D1NA 4ESVA 1RRGA 3G1UA 3A1WA 3E7XA 5KOIA 1G21A 3GFVA 4AKEA 2HHAA 2UZ4A 3NYIA 3B51X 4ZCMA 4QSHA 1RWXA 3N87A 4IDNA 2Z5VA 4BQSA 1MABA 1UDBA 5A02A 3DPSA 3RSGA 3GGOA 2JJQA 3OX1A 2JFFA 3L7NA 2XCOA 1PL0A 2PNFA 3TZEA 2HYIC 3C6QA 4IUCS 1WZCA 2Q5IA 4XCXA 2QXUA 4Y1RA 2P7IA 4GIBA 3R7BA 4AO7A 3TE7A 4EF5A 1H1TA 4RZHA 1OFUX 4ERNA 1T34A 4G65A 2GA9A 1W73A 3AHFA 4UPVA 1E5QA 4NEGA 1ZM4A 4YAUA 3RVJA 3U19A 3BIOA 1BDJA 4D8XA 2E37A 1YRLA 3QH4A 5M34A 2UKDA 4LMPA 1BA2A 4MX8A 4J0IA 4JL8A 3K8ZA 2R1VB 2FR1A 4CZ2A 3CZ9A 4IUBS 2E87A 4X0EA 5GQSA 1GR1A 2VXYA 3AOEA 3HV0A 4HDNB 4TV9B 1ENYA 3V55A 3PIRA 3C48A 3QFCA 4YDRA 4DCTA 1HFJA 4EX6A 5C80A 5DDIP 3OE7A 4QPDA 5IAGA 2ZTVA 3L9XA 2P41A 3KTAA 3EC1A 4KIJA 4AY2A 5KVSA 2VJLA 1SJ9A 1RXCA 2A7QA 2JJ1A 2SHKA 1J4AA 3E2MA 2ODAA 1L4GA 4EI2A 3NBYC 1G9XA 2Y93A 1WULS 3AHHA 5E6RB 2FY8A 1SC4A 2A5DA 1IL0A 1JFFA 1W94A 2VKTA 4ES6A 4WRRA 1IM5A 1M54A 1KEZA 4JVLA 4IIFA 3K3PA 3SAJA 1EDBA 5FWDA 1CXZA 3ZKAA 2ZJ6A 1GGJA 5LP6C 2L17A 1VL5A 4U7JA 6PFKA 3CH4B 4CFYA 1F9EA 4Q9LA 4Y2XA 1LC0A 3FFBA 3S2EA 3UA4A 2AN4A 1DAGA 3L79A 1VHTA 2VHVA 4EFNA 4M46A 3LFTA 1YBMA 2XQFA 4UHCA 5D3KA 4F9TA 3EAFA 4WNCA 3LXXA 3U7EB 2Z5LA 3R0ZA 3D3QA 4EYOA 2I4TA 4I46A 3RUAA 4ENRA 1XDBA 4WBNF 4EMSA 2FYTA 5A1JA 3TW8B 5K4AA 2XBMA 2XGJA 1JU9A 1ZI9A 1Y9ZA 3CF0A 1JQLB 4X95A 1K1EA 4YRMA 2AN5A 5I01A 1CQZA 4F5DA 2A5LA 3ON5A 2A1UA 2A6PA 3ACDA 3C3JA 1RCFA 1MRNA 1IN4A 5BW6B 3RU7A 2VT2A 1ELOA 4AN0A 4X6LA 4EUNA 3Q85A 4QG3A 1MVOA 2IYOA 2VJQA 3G85A 1GQQA 3QIVA 2ON6A 4J7XA 2IRWA 1S7GA 3NIWA 3NJ4A 4FCCA 1PVDA 4KP7A 5T41A 3ODPA 2W2VA 1XQWA 1XPOA 1N77A 1DWPA 1W1UA 2Q9AA 2Y1GA 3PSAA 4W5JA 3VO9A 2PY6A 4XX0A 4BKPA 3CZPA 1QHFA 3AFMA 1OAAA 2ORYA 3KBOA 3VU0A 4ESOA 5HIAA 1DGQA 4QQKA 3ICCA 2YY7A 3KKNA 5DGHA 4C76A 4AS1A 2PGLA 2QRNA 5K9ZA 4PO1A 4R69A 2WJ3A 4JXJA 4RJJA 2JL1A 1SCDA 3C6BA 5HF9A 3OM8A 3RO7A 4AF7A 4YAIA 2HMUA 4OP3A 5ALXA 1NU6A 5JU6A 1N5KA 3OT5A 4E7OA 2I1LA 4BEWA 2F9FA 5K51A 1X6VA 3NRBA 5JQGB 1JEDA 2VS1A 4N8SA 3ZDRA 2FSUA 2JLVA 4L6AA 3JRWA 2P5UA 3VR5A 2C2BA 4LYYA 5EJAA 3QJ5A 4PW0A 2HMSA 4Z9YA 1ZNYA 2C5EA 5K0TA 3EQ9A 3L3BA 3KQQA 3MJCA 3CNBA 3IUYA 4XVRA 3HR7A 2DFVA 5IJXA 3UV7A 4RZIA 2ZRFA 1Q1ZA 1HV8A 5IK2D 4I8XA 2C5FA 3A1SA 1XRSB 3Q6NA 2KM1A 2NUTA 3P4XA 5BURA 4I9UA 1P6XA 3CN7A 3FUVA 1OWOA 1U5CA 4HVLA 2R1ZA 4OIMA 3ZH9B 5J4KA 3CVXA 2J3JA 4KFRA 2AG6A 1SCAA 3KUKA 1GGEA 3UFBA 4YMLA 1GLGA 2QEQA 3BGIA 2BKEA 3EX7C 3ZHRA 2IQ5A 2QSJA 4EW2A 2GTIA 2WI8A 3OZFA 2IFTA 5AVUA 4U5QA 4G81A 5AXAA 2B99A 3O92A 1AUOA 4PYRA 4O4IB 4BWFB 2YZ7A 1FJXA 3WDKA 2R4QA 2XBLA 4DJEC 1DX6A 1KI6A 5ESDA 1AB6A 4MWCA 1NW9B 2MU1A 4O4JF 1K2VN 4M76B 2P9YA 2Y1DA 4C87A 3M4ZA 3GG9A 4E5KA 2QRQA 1Q91A 2XMQA 1Y8RB 2XAUA 5B37A 4DKJA 5FUBA 3PG5A 2I99A 3D3WB 5K4GA 1RC8A 2W90A 1CF9A 1WKBA 3CLTD 4IEFB 3GG2A 2W2PA 2P6NA 2YICA 4F21A 1NXTA 3R3WA 4CLEA 5GJBA 3LSTA 1II9A 1L4LA 3CC8A 1A82A 4C6TB 1IBLB 3IIEA 1SCNE 4KR6A 4UHBA 4UU8A 5HKOA 1R3DA 1C3LA 3JZAA 4EPRA 3B53X 2FJ0A 2G83A 2O2DA 4Z0PA 2GBLA 5BORA 1MIOA 5E6SB 1ISFA 2EQBA 2QNRA 3P0HA 3KOYA 5AUPB 1DTWA 1HSOA 1KU0A 5LYJB 5KYVA 1GD1O 1GTZA 3BJRA 4IMRA 4QUEA 5ADVA 4WPGA 1QP0A 3OKCA 1NIPA 4AICA 1QYCA 3LM8A 2MIIA 1T4DA 3R09A 1JEJA 2JIMA 1W2GA 2WYUA 1KH3A 3D1JA 3IYLW 4HTFA 4LMRA 1UINA 5DI9A 5E4YA 3CUUA 4TYNA 5KJEA 2XUAA 4Q4LA 3D2BA 4PRKA 3EPHA 2GWRA 3UG7A 3OTOB 4TX1A 5DBEX 2WSYB 3E7FA 3OKPA 5HIMA 1RQXA 3MWDB 3UTCA 1ZMBA 1TKBA 1MO3A 5CITA 3BILA 1FLAA 1UM9B 3WNQA 3TIXB 4YQZA 1U6JA 2FH5B 3O5AA 1T91A 5K2MA 4ZEOA 1ZI8A 4E5VA 4HEA1 4JGIA 5AVJA 2F8SA 4E5SA 4RD1A 2OXTA 4GXRA 2D0DA 2I4MA 4RHYA 1C1DA 4JBXA 1PJZA 1I3NA 2DH5A 5LLSA 3TOZA 4WWHA 1WPQA 5EJ2A 1QVZA 5JPCA 2NPIA 2I3AA 3DLAA 4KAXA 5CJPA 1CY6A 4I4TA 1G63A 5I8ZA 1HFEL 4GGPA 1X39A 4CE6A 1EZ4A 4J1SA 5ER6A 5I8WA 1PHPA 1W52X 3FF4A 4DZRA 3S8EA 2FPOA 1C4WA 4HNRA 4IRMA 2ZRNA 2YHIA 5DJ5A 4BEJA 1Z63A 4I5GA 1POXA 3DEYX 4CWAA 1WS6A 3A1UA 5C53B 3L7CA 3ENVA 4QRDA 3TOCA 1MJNA 2F9MA 3CJTA 4X62B 1X70A 4AY3A 3VUFA 2VP3A 1MAWA 1G6HA 2P78A 1KO8A 4XGRA 2DFPA 4MDEA 5LXTF 4FYYA 1TU3A 2J3MA 3H5TA 4RKYA 2FMUA 5AM5A 2UUPA 3B1YA 1FS5A 3CHYA 2J3IA 3O38A 1W4ZA 3KR2A 1A27A 4Y9UA 2FX3A 1CRLA 4BMZA 1E3EA 3EAGA 1BHJA 1QXSA 1DQPA 1W5BA 4FZRA 1I80A 3TLXA 4L73A 2FLWA 3T38A 1GA1A 1FRFS 3ZZNA 2P8SA 1O87A 2I7TA 1UFRA 2F7SA 2IELA 1VL0A 3BORA 3WICA 1NGSA 1FIUA 3ME5A 1OV4A 4O3FA 5ADWA 2AG8A 2BFBA 2FEMA 3NHBA 4QGFA 4TYMA 3RBZA 1QB8A 3O3NB 4N0MA 1MN6A 1E3JA 4ZAWA 1VKNA 1YU6A 3LPCA 1A9YA 3MWEB 4Q9DA 2W7TA 4KUHA 3N6RA 4D0RA 3KKQA 4RWZA 1LSUA 2OVFA 4WCFC 2XTNA 3TOVA 3QNMA 3V7UA 4LF8B 4CGYA 3AESA 4G36A 1RM4A 3RUPA 3S2YA 1QHYA 3B85A 4A03A 1TO2E 1YXMA 5A71A 4F1JA 1XEXB 4MWZA 2X4GA 4JUIA 3FRJA 4H1VA 5HS4A 4LWPA 4QBTA 4X71A 4CU2A 4EGCB 2AR9A 3ND9A 2OCGA 3B38A 5IMBA 5DNEA 4KVFA 1I9CA 2B3TA 1S7CA 5K20A 5BMOA 2HEGA 2BPOA 4XGNA 3UHPA 1UAAA 1YC2A 4YUXA 3PRJA 4BFTA 2ADOA 1KEUA 1GPKA 4JOBA 1GRQA 4JHLA 1EK2A 1V16A 4O2BB 4QUIA 3AEXA 3SBEA 4P0QB 3EUEA 4MW5A 3OAAD 3RB8A 2X77A 4V1CB 1EFDN 2VSNA 1E7RA 3TMKA 3TBFA 1SNYA 3PD1A 3K9CA 2CC2A 1I0ZA 1NKSA 2QE6A 3KQYA 4Q3LA 1PV4A 3DKKA 1EJ0A 1LBQA 1QB7A 3HLTA 1NFRA 1W49A 2VH2A 2XDQB 2WD9A 3NEJA 4QVKA 5LA6B 3ORHA 2Z04A 3B5JA 1QG2A 1RRKA 3JSAA 1M2GA 3U17A 2QRKA 4FCWA 1WEKA 4QJBA 4EG7A 3FOBA 1PTJC 1IMJA 2RGWA 3ZLVA 4B2IA 1IOLA 4NCJA 2XOEA 4CDMA 2F3RA 2REQA 2HLPA 2FPIA 3I8OA 1GQYA 3Q0EA 4WEQA 2VPZA 4FS8A 1K06A 5TGTA 4JMPA 3VR1A 1F51E 2EGHA 5JO0A 4LS3A 4EEXA 4XRRA 3M3PA 2H5EA 2BHTA 3M5DA 5FNVA 2BHNA 4FNOA 4ZEWA 1RE1A 3K31A 3ZWWA 5JCZA 5AVVA 3O26A 4MGZR 2J32A 1ZOOA 3CVJA 1BHO1 4ZU6X 3F46A 5I3CA 4PGGA 1KAEA 1NQUA 3TK1A 2JLRA 5C18A 1Z6TA 5DV9A 1P1HA 4YP5A 1Y6JA 3TLEA 1J23A 4EKNB 1MTZA 2BC9A 4MDFA 2WG1A 5K6AA 3QY0A 4FD3A 5TS3A 2ZUTA 4JBHA 2R5FA 4IZ6A 5EKTA 1D2AA 3JTMA 3NATA 4JEMA 2QENA 3N2GA 4R6WA 5T4BA 3WFZA 4ETIA 4YRBA 1LBHA 4C03A 5JW6A 2PIDA 3NBQA 5FTNA 3U44B 1TJNA 4I19A 1KYIA 1L5HA 2VWQA 4HAVA 4PYOA 4CI0B 3WBBA 5I7RA 1TJYA 1MX5A 4R84A 4L5AA 1QG0A 3T1QA 3IA2A 3DLHA 1KJNA 2EWMA 1TGYA 4GKBA 1XMVA 2RE8A 4PSAA 1SUPA 2O8VA 1X8LA 4DC9A 1A5BB 1U94A 1IHOA 2ZT5A 3EA4A 4HATA 3VVCA 2PH7A 1JLLB 3BTOA 5CYFA 3WX0A 4DG8A 1FZTA 1TL7C 1ULBA 2RAUA 1VJTA 2EXXA 4C7OB 2H92A 2ZIZA 3K4PA 3WI7A 1ETHA 2SECE 5KSPA 3UYKA 1D6NA 1JIVA 1NASA 3BXXA 1TC1A 1A7KA 1FRNA 1HLDA 4A2PA 4J2OA 1H6AA 1ONBA 3DGFC 2MINB 3L7MA 3U2QA 4O8CA 2PO5A 4UNQA 3V1LA 1IBCA 3D8TA 2C3UA 2VEOA 4QPPA 2WV9A 4TWAA 1GDDA 4TVOA 2Q27A 1UDWA 4DIUA 1SELA 3QUTA 3R77A 4DGQA 4DQLA 3L4KA 1NQWA 1M2WA 3L40A 4JC4A 2UXBB 1W5EA 2O6LA 4MKFA 4P9NA 5LU8A 3BRSA 3HKDB 3I1IA 4G0NA 3TSWA 2BJHA 2OM2A 3BIJA 1ZH6A 2DUMA 2ZSIA 1R4AA 1OZAA 3A1VA 3MOSA 2EDCA 4FZVA 4MIKA 3PNMA 3RIGA 2OAQ1 2LVBA 4HMPA 1AQNA 3EEOA 1XZNA 4FTWA 4MGIR 5B1IA 3UVEA 3HM9A 2AS0A 2OGWA 2BEUA 1KXJA 5EJ9A 2IP1A 3CCCA 3RABA 3MFYA 3O4HA 4CODB 3ZCVA 4E94A 4KR7A 3UAZA 3X43A 4JX8A 5BV0A 2OG1A 1N8TA 3GPLA 3AFIA 1MGPA 2YWBA 3FVTA 3KUUA 4N6OA 2YJGA 2ZTLA 2UYHA 2IS1A 4Q4AB 5M5BA 5IULC 3G9UA 4PYMA 2CEAA 3MYYA 3O1LA 5IDQA 3FYUA 4TMWA 4MHTA 4DOMA 3U62A 2IP4A 5KYUA 2C3PA 3H8WA 1SXJC 2HSWA 4B6PA 1GV1A 3D6UA 4WK6A 4KQEA 3TLZA 3T3HA 2AFHB 1GP2A 2MYNA 1J7JA 1X87A 2BGGA 1E3MA 2KMLA 4AN1A 1P0FA 4WKPA 1N92A 3FZGA 3M4YA 2O2GA 3H84A 4GD3Q 3BQ9A 1Q0HA 2Y8EA 2JKVA 3JPYA 1E3WB 1JB9A 3CUWA 4LVCA 3TTTA 5BWNA 3E05A 4AG6A 1N3LA 4TKZA 1L5MA 1M7HA 2HQOA 1LD3A 4F2PA 1YZVA 2WYVA 5KJCA 1X1CA 1QS0A 1M6NA 2WD8A 1R6BX 1WLYA 2PR7A 5JAOA 3RFTA 4CKCA 2X76A 1BN7A 1PJCA 3HL4A 2QDKA 1GZDA 4XSGA 4YCJA 1DU4A 2ORVA 3AZQA 4LJ8A 3UEOA 1T9CA 2QLJA 2OK8A 3M1LA 4MRMA 1A98A 5AKXA 5IYZF 3TX6A 3V8PA 4RJTA 2L0XA 2WSLA 1S3SA 4GBGA 2BBTA 2E4YA 5TC4A 3MOIA 1D09A 2HU2A 3KOWA 3NZEA 4YPOA 3IB6A 2NSYA 2P62A 2WILA 4JKIA 2QK4A 5IKPA 3LUDA 1L5WA 4ROSA 4WAUA 5FTWA 4D46A 2BEWB 2GYYA 4W5RA 1O03A 4GUAA 4ENTA 3I9NA 4L75A 5HK9A 5KNBD 2Z8XA 4D6YA 1XTVA 3KCQA 2AMFA 2V7PA 3AY7A 2EW2A 4J16C 1GJRA 2DWUA 3ZBPA 4RZUA 3ZDXB 4IHJB 1O5TA 3WO0A 5HCUA 4LHXA 2A88A 4OFBA 4TYQA 3F3SA 4I6EA 4BB0A 3KQKA 1ZU4A 1MW8X 4GX5A 4HK4A 4TUYB 2XTMA 3BCSA 4Q9IA 4IVPA 1RQGA 2PZ8A 3WR5A 1ABBA 2V6GA 4LMAA 4TXHA 1KMIY 1Z0AA 5E6UA 3WK4A 5F9HA 3R8CA 3RBVA 5B4VA 3BWCA 2KW5A 3JVVA 1W5TA 2BM1A 4HS4A 4NHOA 2PZEA 4W9MC 3I64A 1CSEE 1EHYA 4X85A 3DZCA 2JI4A 1DIAA 1K7CA 1D2NA 2EDAA 3EVTA 1NM5C 3GBVA 3M6MD 3N8GA 2WTEA 4DJDC 3EGDA 5JANA 2ZYGA 4Q4JB 3V4RA 3H11A 1BDBA 4C20A 3GVCA 2Q99A 1INLA 3DM9B 5ED4A 1MAAA 3MK31 4FOSA 2P9JA 4GOMD 1PKEA 1R4MB 4PEVA 4BVJA 1JZQA 1RWVA 1Q6ZA 2GZRA 4P1ZA 4EYSA 3ENZA 1YJAA 4G56A 1ZN2A 3UJDA 5JLJA 5LD2C 1KBZA 4GMXA 3SZUA 2HR1A 4PCVA 4KHPB 1WEHA 4FN5A 2V4MA 1L4KA 1FFDA 4ZCRA 2OD2A 1A8PA 1W9MA 1UBFA 1WLSA 1ONNA 3FPJA 2HJRA 4JJIA 2WKRA 1QQ6A 2XNHA 4J8PA 1U3WA 5TJHA 5FTJA 1GTMA 3ZV4A 2ATVA 1A4IA 1G3MA 4X3OA 4JI5B 3MT8A 3FOWA 5DW0A 1K9SA 2VHWA 4YQEA 1UMCA 2XB8A 2W4QA 3QVUA 4DZZA 3KXKA 4O4LF 2H07A 4KQJA 3GEGA 3K2BA 4P22A 5DLEA 1Q0ZA 5CB8A 5DULA 3VR4D 4MULA 4KV9A 4OSPA 3M6FA 4IDGA 3WWCA 1G8YA 3EIUA 1P7PA 3IOMA 3SX2A 2PR2A 4BIIA 2PH3A 4RIEA 3L7OA 4ROTA 5AOCA 3A7DA 1DIGA 3D81A 3LZDA 1U81A 1PLKA 2NV6A 3WWEA 2QTMA 4JI3B 1UKVY 4EKEA 5GADl 2QW1A 3OQOA 1N5IA 3IV7A 5K8UA 1U4NA 1KOJA 2C20A 4YRSA 1LA2A 2VWPA 5H0IA 1ILWA 3LPMA 5FR2A 4BGVA 1S2LA 2P9GA 4HXYA 5KZMB 3R8XA 4Z7QB 4HYYA 1YTUA 2F55A 3BSYA 5CA0B 1DAIA 3H4VA 2E55A 3OWOA 3QVJA 1IY8A 2TYSB 3ZU2A 4G0MA 1U1GA 3VBEA 5J4VA 1OC4A 1XZFA 4FSXA 3SS7X 4YJ2F 5DH9A 2B8EA 3S5JA 2QM3A 1H4VB 2JAUA 4WNAA 2CB0A 1GCUA 3OEED 4QRIA 4COOA 1BJTA 3HKCA 3MHPA 3KJFA 2W2TA 5EGNA 4AULA 2DQSA 2P2CA 3A6FA 3Q3CA 5E0OA 3M4XA 4E5YA 4MA0A 4PLTA 1I51A 1EGVB 1KPGA 4PX5A 4TMFA 1G3IA 5EHNA 2FK7A 3B12A 3THYA 2IS6A 2FR8A 2WP8J 4L6CA 2ZYAA 4AECA 1ZHHA 3C3PA 4EFDA 1A7UA 1Y8QA 4MEAA 1AZSC 4E5PA 2FEKA 4X8MA 4LY3A 4QQRA 3VM6A 1E5XA 3PI7A 1VBKA 3QBTA 4H0FA 3S44A 3WB2A 5K1ZA 5IU6A 4MCAA 2W6QA 1HKHA 1XVAA 1H5NA 1V5WA 4TKLA 1J8DA 1V9CA 1ZA1A 2B36A 1RLUA 3CJQA 3ICOA 2YWEA 2H1IA 1JQ3A 1H65A 3CLRD 5MF6A 3DP7A 3W7VA 1ADFA 4ZYTA 5B64A 1ZD2P 3GH1A 2VAWA 4IG4A 1HDOA 3JARA 2IS4A 5FYDA 2WWXA 3AL3A 2P9BA 1LDNA 1ZVQA 2H2WA 5I4CA 4KJXA 2VQFB 3WL7A 1EFKA 1X9IA 3E70C 1FTWA 1SWWA 2WHQA 3B3AA 3F8SA 3HI4A 1SU6A 2ZRPA 3M6AA 5CH3A 3Q8MA 3H2GA 4M21A 2HSGA 5AJXA 3T0IA 3PQ5A 1UXIA 4CU5A 2C4WA 3WNBA 3U6KA 2FOLA 4FKMA 1Q6YA 3DDSA 1WU7A 2XXAB 2AUMA 4D3FA 5MN4A 4IG9A 3DEFA 3VZRA 3RD5A 1H2ZA 1E99A 1PG2A 1NT4A 1TAHA 2AEFA 2UV8A 4ZCTA 2NZ8A 4CQJA 1R0SA 4DCUA 3BGWA 2B2NA 3O9ZA 4NS4A 1EM8B 1KVSA 1MC8A 4FFLA 4FIZA 4GYKA 4L50A 1S8NA 1G66A 1KPHA 3AG5A 4MV9A 2NZXA 4PQGA 4IOMA 5HQTA 4LJ4A 2P9HA 3AU9A 3NLLA 4MR8A 3SKXA 3HTXA 2BFNA 2EQAA 3G2IA 4R54A 1LTHR 2DHCA 3SSNA 1NIJA 1EWYA 4C0QC 3I6BA 1ECBA 3PNOA 1SZDA 4JROA 4ND2A 3TH5A 3NV7A 4TLBA 1F2UA 3BGVA 1ORIA 2INGX 3M6LA 2UVPA 4BU0A 1G38A 3QEOA 1FU7A 2HH9A 5TQJA 3AJDA 3JQEA 1S02A 2FUNB 3M0EA 3QMVA 1FTSA 5BXYA 4RTPA 3CY6A 3O8NA 2OECA 1NBHA 1T0BA 4Q47A 3A6LA 4GZ3A 3V9PA 4HWRA 4I50B 5CR9A 3T5AA 1B14A 2CMGA 5E9WA 3M1IA 3RV4A 4U2KA 1RJFA 1S96A 1DAPA 1K6XA 1U2DA 3A9VA 3SFTA 1T1JA 2RHBA 5KWEA 1QRTA 3T4EA 4WIAA 3WL6A 4GU5A 3H5OA 1ZMTA 1F0YA 1C0LA 3WDLA 3WK7A 2PWYA 2WU3A 4BATA 3AF6A 1KI1A 5LNK6 1XN1A 4IAOA 1OWLA 4NENB 4TLDA 2NUAB 4B0PA 2Y6VA 1OREA 2YFKA 2A78A 2Z8YM 3D3KA 5AW2A 4MS3B 3ZWVA 4M89A 4NCNA 3NXSA 5E1OA 3IX7A 2G9VA 2VDPB 3CRRA 4OI2A 3EVEA 3ES9A 4XPIB 2H08A 5DM70 5CHYA 3OAAA 1H66A 4I4NA 4XSVA 4BX9A 5JISA 1KRWA 3AI7A 4NAVA 3Q8LA 2GBLC 2WIDA 1CQWA 4K6FA 4AZ0A 3NRJA 1QQ5A 4BKRA 4EHAA 4Z1MD 1PQUA 2CT8A 1K3FA 3QSGA 3UMCA 3SIWA 1CZNA 2LGJA 3L8FA 3WRXA 1V48A 3MWJA 4KLAA 4X3PA 3W34A 4KX3A 1UDAA 3UPUA 1GKLA 5AJYA 4D0LB 3DLPX 2AT1A 3C3KA 3OOHA 3ZXYA 4QD3A 5FBZA 5CVVA 4MRPA 3GMDA 5C4GB 2I8LA 1RQ2A 4OQ4A 3PB3A 4EG0A 5TDHA 5LUAA 1RHQA 3NRCA 2Q41A 2JFHA 3WSWA 3HKBB 5EEGA 4GNKA 5IC4A 1J97A 3DJYA 3WE7A 5CUQA 2NMVA 4G97A 2XSZA 4CMBA 1YZUA 5L3QA 5HQJA 3CZMA 1JJAA 1J33A 1SVNA 3CE9A 3PRHA 4RPKA 4BNNA 2J48A 4CIDA 3BFKA 4KRFA 2B82A 2NZ2A 4OH7A 1E3TA 2A92A 4G5OA 2OFOA 4QU5A 1DKUA 2QUIA 4HNTA 5LLTA 5A3JA 3NKVA 3GBPA 1OILA 2E5FA 2Q5CA 2VHEA 3H8VA 1UPCA 1D04A 3ORQA 4IY1A 4KWTA 1PGOA 4UC0A 1FS4A 3ASZA 3MEQA 4D4MA 4DR4B 1BJKA 4IHQA 1BIFA 3PJDA 1KMHB 3SQDA 1NUPA 1J7KA 2FQXA 3C3WA 5CNKA 4BJ3A 5K0JA 2P6PA 3LIPA 1QP7A 1T5SA 3IQZA 3OFJA 3MJVA 4P5PA 2QNIA 1BU8A 3LI2A 4LX0A 5JSQA 1YONA 1I4OA 4A2QA 4BCBA 1RRCA 2XDAA 3IP8A 3I09A 2HKIA 3M1AA 4HG2A 2QV0A 4JUCA 1X74A 2GNOA 3H5AA 3UT5B 2GD1O 4BX0A 4F9EA 1ZL0A 3AR5A 2CMFA 2QPTA 3U9LA 1F8XA 1LQ2A 2RBKA 1I4TD 4NABA 4AW9A 1XJWA 2D5AA 5E7IA 2X9LA 2QZJA 5L6MB 1YMQA 4ACBA 1BEUB 2NO7A 3BXFA 3I3SR 4YK7A 4HN9A 2VF7A 3PXGA 5KJ6A 1GRRA 2J46A 1P81A 3LCVB 2YWGA 1H05A 1UMBA 1AKTA 1CDOA 1D2HA 1P0CA 2E85A 3CR3C 1BZYA 2BUAA 3EUFA 1JFSA 3QX3A 3NTLA 2O7SA 2JIZD 1YR2A 4DB4A 2Z4SA 4XD7D 2JFNA 2O14A 2A9PA 3DZBA 1MDFA 1Z2DA 4JP1A 5M2QA 3K6KA 3KC2A 5ESXA 3ECCA 2HQ1A 2FFAA 1HKUA 2X14A 5FV4A 4RTNA 3D7SA 2WLTA 4E2YA 1KFBB 1TF7A 2AXPA 1XXHB 2JZOA 5DVZA 2PZFA 1PS9A 1MG0A 1U9ZA 4MKZA 2M6RA 5F12A 2V3WA 4MVXA 1L7RA 4KPUB 1NQAO 2OXFA 1TE2A 1Q7BA 2Z2KA 3A3YA 3GFQA 2UZIR 3GLHE 2XRFA 3PWKA 4EUKA 4GQBA 5HGXA 3LBHA 1L1QA 2WVAA 3OMLA 4IIXA 4LHWA 1NN5A 4YMUA 3AF1A 3DYVA 4TMVA 5GVRA 3C87A 1TKAA 3PGJA 3HABA 3T7SA 4WJLA 5KINB 3AUFA 2O3UA 2C2MA 5JFTA 2CE7A 2V7TA 3FPFA 3RARA 4PC2A 2JBAA 1YBFA 3PV0A 3CM0A 4BMYA 3FF1A 4CV1A 4HJXA 3DBHB 1L5VA 4X64B 3Q8KA 1IH8A 5A62A 4DR5B 2X22A 1M1YB 2GJKA 3EFOA 2H1RA 1NJGA 2LR0A 5LMNB 3QW4B 4DJTA 3QM1A 5JNWA 4YJHA 1G7SA 4TT3A 4WK2B 4RMIA 3NQ41 5LQKA 1JSXA 2YMMA 5REQA 3UAGA 1V5GA 4V0OA 3OEWA 3TLMA 2PKQP 5ALNA 1RTTA 1JJ7A 1DELA 3A6KA 1N33B 4DV4B 4DT1B 3H9CA 1Y7PA 4ZVVA 3FAZA 5LYYA 3MXTA 3ZOKA 4S1OA 5CA1A 1BW9A 3VFDA 4MO2A 1DJOA 1SQ0A 2O2XA 3VDNB 4BNWA 3EGEA 3IPRA 4X91A 3T12A 4O63O 1HZJA 1KE1A 4KK4A 2HMVA 4TM8A 5LR6A 3OSUA 5JNUA 4GRDA 4R9RA 4B3GA 4CT4B 3HCFA 3RJ5A 4IEEA 4KODA 4Q1BA 1C3OA 3N07A 3M3HA 4KXWA 3NTOA 4DPMA 3KQNA 3HB1A 4FD2A 4HOYA 4N5LA 3TJRA 2GUWA 3UXYA 2CXSA 3LO5A 3Q7QA 3OVMA 4GVLA 5NULA 5KHOC 5E4FA 1WXGA 3SZGA 4UU7A 2IOQA 3ICQB 4EPWA 2WTUA 1S89A 4LWOA 2VUTA 5K3CA 5TF4A 1TRHA 3KKEA 7REQA 2HCFA 1I0LA 3DMHA 1THZA 1D2EA 1Z6YA 3AJEA 2GI4A 3WHPA 5C2JB 4DNXA 1QIFA 4S04A 1Z18A 3B9RA 4D7AA 3ZV5A 2VQEB 1OCEA 3BMXA 5FUYA 2E89A 1SK8A 4F0JA 5K6AC 3DTVD 2Y9PB 3IDFA 4JUBA 5D5PA 3TR6A 5KC9A 1P72A 1K7FB 5A6SB 3RIHA 3VOBA 3OZXA 1MGOA 1RKXA 3AKZA 2DLDA 4JWKA 2ZITA 1JPUA 1UJ6A 4AS2A 4DIKA 3OQNA 4TMKA 3L8ZA 3NM6B 3ID6C 4EHKA 3W5AA 4YROA 1SBZA 1W85A 1AXRA 2OC9A 4BNKA 1PK8A 1TF2A 1PVVA 2Z2YA 3PQ6A 2G1PA 4CKYA 2V7BA 4KXUA 4MEJA 4DJFC 8ATCA 1J5EB 1FXUA 2DWOA 4INZA 4US0R 1N75A 4L72A 1MX9A 5H4HA 2D54A 3T7IA 2QMOA 1R4ZA 3HZHA 3E27A 3VYVA 3LT4A 4YRPA 1IHDA 1OAOA 1YQWA 1PJQA 2P77A 2R8BA 1U8XX 4K9KA 1QR2A 3AR2A 3WKEA 2PK3A 1I10A 4ZFNA 4A1FA 1W29A 1UL1X 5TEWA 1S3IA 3K0AA 4OA8A 3V46A 2QAGB 1K6MA 2BI8A 3BCHA 2ZKIA 3HPRA 2GHQA 1P61B 2JGFA 2QPAA 3KE9A 1GYPA 4B4OA 4DV2B 3A0RB 3U40A 3DHEA 3A6GA 1U8EA 3S2IA 1J8YF 3ZOZA 1G2IA 2WA2A 2PT5A 2R4UA 5BN1A 3RAPR 3BWXA 3C74A 5JS7A 4MQ4A 5CP8A 1XCPA 2A4KA 2VPTA 3EDQA 3Q11A 3G9XA 3RASA 1ETUA 4OHYA 4LDNA 3FMFA 4ZOLA 1D7OA 4LNHA 1ARZA 4Q4HB 2RGNA 3MS2A 2D2XA 5TQVA 3T35A 4AF6A 3BKWA 1Q0PA 3EE6A 4MQFB 3A05A 1Y4ZA 2PPVA 1X14A 3HWSA 4UD6A 1Y4UA 3RUIA 4KQXA 2KS6A 2AHRA 4JEHA 1Y42X 3HMKA 1E1QD 2J9FB 3LHKA 5IWCA 4BWYA 3CZAA 4MJXA 2W2KB 3AYZB 5AIAA 5BN4B 1PT6A 4BQFA 3WMEA 4GVXA 5COBA 5K6RA 1CUHA 3PPYA 3HB5X 4YUZA 1QO0D 4R81A 3B6IA 3U3XA 2JHFA 2H06A 4A10A 3F1LA 4ARSA 5A7FA 3EGXA 1B8VA 1L5FA 2RJOA 3AETA 4BXOB 1PKXA 2O2EA 3BDAA 4DR3B 1E2EA 1AXGA 4GMDA 4JHXA 3RWBA 2XMGA 4TSFD 4DARA 3SWWA 3M81A 4MS4B 2O8CB 3FYUC 4MPDA 5FFFA 5LWHA 5JG7A 3KAPA 5DI3B 1KMNA 3LX8A 1FY2A 1ZD9A 2XVZA 3VU3A 2YKGA 3GPIA 2K5UA 4ZK6A 5HJEA 4LJRA 1PLJA 3RU2A 4LE0A 4ARBA 1SPBS 1PQYA 4KIFA 3ZIAD 2ZLBA 3UJ6A 3TTWA 5A3QA 4QVIA 4H9GA 3H3JA 1ZHOA 3O8OB 1DUVG 4CL0A 1A5SB 3SZOA 1KO5A 3N39C 2Z83A 3NEAA 4KXQA 1VPTA 2PX3A 2HV8A 2Q5EA 4TXMA 1F4VA 3NTXA 2QMHA 2VNIA 4YRFA 5JZ9A 1P0PA 5KYGA 1Q12A 3A04A 1ZOIA 3RC2A 3GRYA 5FLYA 4E32A 4JKOA 5LQRA 4CMGA 3O75A 5A2GA 4IH9A 3D4NA 3PQDA 2X5OA 4NJOA 4ZAFA 1RQNA 4NV3A 4MWBA 1N1MA 3H2IA 4W1RA 4UTXA 4MEBA 3GI1A 1J42A 2HA4A 4OXNA 4Q3EA 3D4LA 2PKCA 3WV4A 4DM4A 2ZJ7A 2PT6A 3PF9A 4LTMA 4QLBA 3PKIA 4KYUA 1OU0A 2PWPA 4HMOA 4JLNA 1SCJA 3M3DA 3SIXA 3WK8A 1JVSA 5J2UA 4C5CA 4DJJA 4X1KA 5AM1A 5ITSA 3HXMA 2YNMA 4D97A 3THXB 3NOOA 1F3OA 4UVDA 5LJLA 5EQJB 1R4NA 3BA6A 1QFMA 3F9CA 3L01A 1ZRSA 1XTKA 2C59A 1BWSA 4JITA 2GPJA 3GX1A 2BI7A 5JATA 3OO1A 3RAJA 2ZIVB 3LS2A 4L7VA 4P4GA 3IQIX 1CWUA 1Q44A 2O8BB 1R8JA 3IP3A 3EGOA 4DIBA 1Y3DE 1QYWA 1XAHA 1JNXX 1N2CB 1ZIDA 4NDNE 2IA5A 3A3OA 3I0NA 1GRCA 3QZUA 5CH8A 5BSMA 4BL5A 5JZVA 3V7WA 2Z4RA 4QJ5A 4RDIA 5FBQB 2R1TB 3PVSA 4DANA 1U7DA 4R8MA 1NQOA 1IN1A 4GX1A 3D0QA 1ZQ1A 1JIXA 2D5IA 1X7YB 4U8GA 1BVRA 1KORA 1WHSA 3SG0A 3L49A 5EKSA 1F4PA 2I3BA 4GBJA 4Q4DA 1FFXB 3RS3A 1OJLA 3ZGLA 4DQUA 4HB3A 2IE8A 1JTEA 4IP0A 2QYHA 3R8FA 2C8JA 3I2FA 1TVKA 1PJTA 4H35A 4NARA 2RSLA 3NVKI 1JHMA 1O94D 3UNXA 2A57A 5EIFA 1A76A 1YR6A 1TZ2A 2UZ0A 2ODEA 2RHCA 2NZWA 4ML3A 4QPJC 5JAIA 2PD4A 2NYUA 4LIPD 5CHEA 4MVJE 2CKDA 3EDRA 3O2SB 1XMSA 3HCPA 4OK5A 3IKTA 5EL0A 5K3FB 5E2BA 2ZYIA 1C8KA 3VC2A 4ED9A 4RIFA 2W2MA 2RCYA 3EY9A 5CIQA 2JAQA 2J5RA 2ZXEA 2JZCA 2WYHA 4TYYA 1K6IA 1KI4A 1J0DA 3N7UA 2H7VA 3VZCA 1WSBA 1M2EA 1SCKA 2CD7A 2IHUA 4X9XA 4YPFA 2I6GA 4AJHA 4QHTA 1JR6A 1V1MA 4NBTA 2PLFA 2KBFA 4K9RA 2DE0X 1X7WA 3MS4A 2YOGA 5AHXA 1GAEO 3QLTA 3O4IA 3PXDA 3RU9A 3LFUA 4E2ZA 2ZI7A 3E1KA 3QOWA 5JO9A 3WLAA 4BBZA 3C3MA 1X1SA 2XRMA 1XE3A 4RORA 3RS9A 5B6PA 1IBSA 4S24A 3BERA 3O3MB 1XNGA 2QRVA 5JNVA 2I4OA 2QRPA 2RI6A 3KL2A 4MAFA 2IEGA 3UWPA 1XVUA 1Y5LA 3SHOA 3M5WA 3TTUA 3HJGA 3MD0A 2WEKA 4AD8A 4E46A 1DAEA 5LB4A 1HR0B 1NL3A 4AJPA 3HWX1 4ILKA 4QKQA 1R6UA 3AUKA 1BCRB 1XB2A 4M1TA 2H1HA 1B00A 4L9SA 3ESRA 2IXGA 3VU8A 5I3ZA 1U4OA 2PX4A 4GZ5A 4I4LA 5AKIA 4I9NA 1U04A 3AEKA 4UDYX 2AB0A 4MROA 4YECA 3E5HA 3QWHA 1SUSA 2XQJA 3X3HA 3SSMA 1CY1A 3EBPA 3P9QA 2AK2A 2PL3A 2HU8A 1T5LA 3LHSA 2CNBA 2I2FA 2FRVA 4GSKA 3IIKA 3F5SA 4CR7A 3WIUA 4KIGA 4B3MB 2FR8C 2GBIA 3B36A 3E23A 4QOSA 3FCSB 3OJFA 4BUZA 5T64A 2IITA 3MSXA 3TW6A 2JKYA 3NIDB 1CHDA 1I4LD 2ROQA 5JJ5A 2XKJE 4CYMA 4R68A 2VZ8A 3X0DA 1K89A 1D8TA 5KKAA 4BNYA 2XGMA 3RK1A 3LXUX 4ND8B 1WUHS 2IYVA 3WLMA 4B8WA 4ZMSA 5EESA 1AS2A 1M8JA 1OI3A 2XTJA 2Y4OA 5BP7A 1OFVA 1SKMA 1CS0B 2XE4A 1XVTA 4CNQA 4CTMA 5KYNA 1N3IA 3EQ2A 4CTKA 3R4VA 2O0MA 1QF7A 3ZS8A 1AT1A 1XMQB 1N5JA 2X2PA 3V9AA 1XTQA 4XD2A 5F21A 1RHUA 4DMKA 1CQIB 4W6ZA 3WNVA 3D8BA 4C3OB 4A0RA 4B75A 1PS8A 3ZX4A 3GP3A 3ZJTA 1QVVA 3ZV7A 2PYDA 3IEPA 1TDJA 1NBME 4L02A 1YOVA 2FMXA 3DFZA 4JP2A 4RY8A 4BUJA 1QQAA 2HI0A 4LZOA 4OM7A 4PE5B 3AGPA 4WN9A 5GGXA 5TMPA 3W3AA 2O7VA 5AVZA 2AW3A 2R2GA 1ZUNA 2M2IA 3REQA 2JIZA 1TEXA 2BHLA 2O5EA 1RM3A 4XD7A 3THWB 4D1YA 1SXJE 2B94A 1EX6A 2W6JD 2YV1A 2YFYA 3ETEA 4PTLA 5AW5A 4OMCA 1UQUA 3I01A 4WGFA 3ZW7A 4HUTA 1DOZA 2JAPA 3DMDA 2VHTA 2Z2IA 3FDJA 1JFTA 4E21A 1R2QA 3TZQA 4XI9A 1JXMA 1XXLA 3B2NA 4HB4A 2ZATA 4KSCA 2EU8A 5ALLA 1DKPA 3SYNA 2JLYA 1M2VB 3A7EA 4EGQA 3K6SB 2D1FA 3W2GA 2JD0A 2DWCA 2EKQA 1XD2A 3T5BA 3QE3A 4TXLA 1YTLA 1ZW1A 3OQ1A 2FSIA 1BTOA 4B2LA 1U2DC 1LVUA 2QL7A 3I6YA 2I6UA 2PQ6A 3AUJB 3EZGA 3ND7A 3Q3VA 1QOZA 1MR3F 3WJ1A 3DE5X 2QS9A 1V43A 3CRW1 1W8IA 5JARA 1T9KA 3ZNOA 4N76A 4OL9A 1DFIA 3G2OA 4EMTA 1OZFA 2GRJA 1XUOA 2V97A 3G68A 4E5MA 1QIEA 3HO8A 4GOXA 2HXSA 2WNHA 2NADA 3R5XA 3EQ6A 5FH9A 3WQHA 3DLBA 4M37A 4GKKB 4G4SO 3DXZA 4QLAA 4W4TA 3KDAA 4FLMA 4MUIA 1YS2X 4HDKB 4UVEA 3VAZA 1A7AA 2ZE6A 4RD2A 3UK2A 3K05A 5BWCA 1OASA 3OA0A 3V8NA 3UICA 3TQQA 4RF3A 2X19A 1QIMA 3E15A 3RROA 3Q8XB 4NY1A 4ZCIA 2VHJA 4FPXA 3WRXC 1TMOA 4MSUA 4NOLA 1Z68A 1NUQA 3G6KA 2R44A 2X8BA 4HI0E 3A3KA 2KX7A 3H65A 4KGVA 4X3CA 5DBGA 3TLJA 4D3ZA 3PUXA 4E70A 3T1HB 3J81k 2XH8A 2XR1A 3GYBA 3KLOA 4GC9A 4QOJA 1UBNA 2NV2B 2BYTA 5A1TA 1CY0A 3RVOA 4TWIA 4NU6A 3UJBA 1X2EA 4CHGA 4UM5A 4E51A 4INJA 4LQ4A 3U81A 4K3UA 1OBOA 5K5EA 4Q03A 2V7WA 3TQSA 2GEKA 1XF1A 4GM0A 5ALUA 2CSXA 5KWIA 1SOUA 5D8DA 5EN4A 2BISA 3DKRA 1R0RE 4F2WA 1M67A 3AH8A 2HCTA 4MQ5A 1RYMA 2QSUA 5MDHA 3I4LA 1CZKA 1QDUA 2AZMA 4KPGA 5H3CA 4BQRA 1BDHA 2ZJ3A 4UM8B 4HRVA 3UK0A 1LWNA 2F1RA 2X1HA 3DTVA 3NEPX 5JFGA 5EZ6B 2EFHB 1W1WA 4MVJF 4DDKA 2R79A 4W9RA 1JLMA 3WMWA 5A5EA 5E7QA 3JYHA 2I4LA 5GONB 2NVWA 1L1EA 1G20E 1R5OA 2WK1A 1WQ3A 4MUYA 3CNHA 3S3TA 3V1UA 3EDOA 2RB4A 5BW4A 4M0DA 5G1PA 5KNCD 1L7PA 1B42A 1T1IA 2W22A 3DF9A 4HGNA 5HMLA 4OKIA 1AHPA 1ZNQO 4H7JA 1OXSC 1U8ZA 5JSZA 1KZYC 3E3NA 2V9CA 3GJRA 3JY6A 2BKLA 2C83A 2Q2NA 3L77A 5F7ZA 4Y2RA 3SC2A 2QSYA 5B1DA 2QUAA 5ELXA 3IIJA 1G8FA 3CT6A 3MBKA 1C9DB 1TFUA 4F6LA 1IN7A 1EWTA 2NSJA 2WZBA 5DHPA 1JHXA 5DYTA 1Z5PA 2UYYA 5F51A 5HKKA 1AKQA 3OG9A 4H3SA 3T61A 4KU4A 3SX4A 1XTBA 5LUBA 1KSHA 4ZO8A 4RY9A 3E0QA 4RY0A 2MT9A 3H04A 2GHRA 2HMWA 1N3BA 2X0KA 3CEAA 1H2BA 2P2LA 1GILA 1HYEA 2HC9A 1FX0A 2XVMA 2Z56A 3FE2A 3FPKA 3CCFA 3LRTA 4BNXA 2J0VA 1ODIA 4IW3B 4LJAA 4MQEA 3FN4A 5EYPA 2GARA 2M98A 4OV6B 2HY7A 4O2LA 1NI3A 4CG3A 3PPIA 2ZB4A 1E6KA 4EG1A 4OK3A 3FKSD 3OQJA 3M6XA 4AG5A 3EZLA 3FNGA 3P2KA 3BFPA 3BHIA 2OK7A 4RVHA 4MGHA 3SZRA 3VO8A 5HWSA 2UUAB 2ZYUX 5IMSA 4JI7B 2RKOA 3OTWA 1P73A 3R0QA 2HK7A 1FB5A 5CVUA 4QQ8A 5IF3A 4LYFA 5BN5A 4IWYA 2NU7A 4GI2A 2ACEA 4L57A 1CEEA 1CFJA 1KS2A 4HUQB 4L9AA 3IOBA 4UMEA 2PBLA 5E7MA 3ZHVA 2WP0A 4CF5A 1QO0A 2VDUE 1G5PA 4IJMA 4JA0A 4PPNA 1Q1EA 2JZNA 1U2SA 2RJ3A 3WYEA 3VRHA 2OP1A 3EGIA 4Q6BA 2C61A 5C35A 1SQGA 3JQRA 4OJYA 4GO1A 1W4AA 5C1IA 1JDPA 3L43A 1ACLA 4B3IA 1OV6A 2KE5A 3CO0S 1SOVA 2QRGA 1BQEA 5DEOA 3UUGA 1KZ9A 1ZGHA 3HCOA 4CCYA 4P0PB 4UBMA 3MT9A 3U3ZA 4ZI7B 1EQ2A 3AF2A 3TO5A 4JC5A 4ER0A 3UOAB 1LI7A 1ZSVA 4NFYA 4Q0MA 1WBBA 3RSZA 5K0FA 1FK8A 1NQTA 4HDMA 5JSYA 2A9KA 3B9QA 1ZH4A 2GZMA 3BH0A 3EIWA 5F77A 5IJ9A 5LQJA 1XEWX 3L6OO 4B7CA 4YFVA 2Z1NA 2RHHA 5HTKA 3OLXA 2WWGA 2F6RA 4A36A 4UDNA 4UHDA 5K3SA 4MINA 2RH5A 4C4AA 2ZT6A 1O5IA 1GSOA 2B8JA 4NX2A 1E3IA 4ZICA 3NR2A 2NLOA 1KBOA 3WXBA 5GOZA 2C42A 2OLKA 4TV8B 3V2GA 3HK2A 4Q4CA 4Q05A 3BC1A 1D6SA 4QIHA 1QAOA 3UWKA 1RQRA 4C0XA 1ULTA 1WSAA 4NBUA 5HZKA 3RK0A 4RVGA 4WW0A 2P2SA 5C51B 2O8EB 3RTCA 1QIHA 4CTOA 4XUEA 4OQFA 5LCXA 3S99A 1E2FA 3HXKA 3JX9A 3W9BA 2WJWA 4LPSA 2ORIA 2PX6A 3HUEA 4BO2A 5LXTA 4DDHA 4AJJA 4HFRA 4ALIA 3BH7A 3KPVA 3DVQX 2GJSA 1SBHA 4IFIA 1IJKA 3ZE1B 1NT2A 3OT1B 1B15A 2PANA 1IHYA 3GUZA 1KJYA 1HDCA 1L4MA 2I1QA 2IPNA 1EBUA 2WTXA 3CRMA 3HG7A 3MWYW 2JW5A 1RBQA 4IJKA 1BE8A 1L4BA 3LXMA 1CUIA 4MAMA 3NGLA 4WOBA 1ZG3A 4YA6A 5ENZA 1FLDA 3KIPA 5CVJA 1YFJA 3IPXA 1C9KA 2IX3A 3NVDA 4YASA 1VG9B 3RSCA 3UAVA 4S35A 1Z4NA 3GLFA 3PQ7A 2GQ0A 1JVBA 4AC9A 1P91A 4BIMA 4TXJA 3OX4A 5DN9A 1AF7A 1KZ1A 4E08A 1PJLA 2CL6X 4YB8A 3NONA 1JSRA 3ELBA 2BCJQ 3HNRA 1Y7IA 4IX1A 1POWA 5DFAA 2P9CA 3WBJA 4HAYA 1U3FA 4RE5A 1TUIA 3PLRA 1E2GA 2OBBA 1R0ZA 3AFNA 1OAOC 5BQFA 1C0EA 1JA9A 3K92A 4QOFA 3RC7A 1SA0A 1OLUA 2C29D 4WY5A 2PXCA 4O4HF 1VGQA 4YWJA 1N2IA 1ZWKA 4F8EA 1OLXB 1JKXA 1VXRA 2EZUA 1H5UA 2I80A 3VHQA 2RHTA 1OLSA 1A1SA 1HM5A 3QA3E 4XJTA 3VSAA 3W8EA 4B46A 5KWJA 1GSHA 1VQ1A 4IDBA 5AOVA 1SHUX 2WJGA 3CCBA 1LK5A 3MS7A 4N6NA 3S2GA 2H2DA 4RTLA 3FA2A 5G41A 2WY2D 3X1WA 2J5BA 3ICVA 3QHAA 3N8HA 1NW5A 1EVYA 1EXMA 2WHPA 2BP7B 2RGNC 1Y5IA 1HDIA 3CPHA 5JYDA 4NE2A 16PKA 1EFPB 3OIYA 4X8HA 4I1YA 3ZV6A 4QWWA 1HUQA 5HFNA 2AOUA 4P83A 4D45A 4UFOA 5K4HA 4WECA 4AB1A 1JDUA 2Z9BA 3WLFA 4KDEA 3OMXA 1DAMA 2QMYA 3X1YA 2KPOA 1E6EA 3RAFC 4A0GA 2J3KA 3DS8A 5IBPA 5JEDA 3RGWS 3T5DA 4Z99A 4EA8A 3U09A 3MLEA 4FYMA 5DYIA 1ODCA 2MOKA 2I2AA 4BO1A 4WACA 3R9KA 4DWVA 3ETLA 3MUFA 1OHHD 2A3NA 3PEUA 2GCOB 2YWRA 3QNUA 4E0BA 1UQRA 4S1TA 4CKBA 4LYGA 3PU6A 1TTHA 1ZD1A 2B35A 4JLUA 3DNFA 5DTRA 1AUQA 2AFIE 2NSLA 1VB3A 2PUWA 1T3TA 2LCFA 1NSFA 2ZT7A 3NWBA 3QTTA 1JBKA 4H7EA 3T7TA 3TAUA 2VZ9A 2Z3ZA 5DYWA 2J0QA 1RKUA 3RTEA 5F1PA 4D3DA 4P8RA 5JRZA 1JEYB 3P9NA 2EBWA 2YTZA 4WY2A 4DLBA 1O57A 2IXDA 4NJEA 3JZMA 3ACBA 3KQSA 3HGTA 4ENQA 1XAJA 2XMBA 5F73A 3VSDA 3PGKA 2O6HA 4DLSA 2IKQA 2NVOA 3NC0C 4O2AB