2IGBA

Crystal structure of pyrr, the regulator of the pyrimidine biosynthetic operon in bacillus caldolyticus, ump-bound form
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
179
structure length
172
Chain Sequence
MQKAVVMDEQAIRRALTRIAHEIIERNKGIDGCVLVGIKTRGIYLARRLAERIEQIEGASVPVGELDITLYRDDHEPLVKGTNVPFPVTERNVILVDDVLFTGRTVRAAMDAVMDLGRPARIQLAVLVDRGHRELPIRADFVGKNVPTSRSELIVVELSEVDGIDQVSIHEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords PyrR bifunctional protein
publication title PyrR, the regulator of the pyrimidine biosynthetic operon in Bacillus caldolyticus
rcsb
source organism Bacillus caldolyticus
total genus 52
structure length 172
sequence length 179
chains with identical sequence B
ec nomenclature ec 2.4.2.9: Uracil phosphoribosyltransferase.
pdb deposition date 2006-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2igbA00
5K51A 1MZVA 4RHUA 1Y0BA 4RAOA 5BQOA 1A3CA 2DY0A 1DKUA 1G9TA 1ZN9A 2HCRA 3GGJA 1QB7A 3G6WA 4RABA 4ZFNA 1Z7GA 1DKRA 1DQPA 1ECCA 4QRIA 3ACCA 1W30A 3H83A 4RHTA 4X44A 2WNSA 1JLRA 4S2UA 1NULA 3DAHA 1J7JA 2PS1A 1OPRA 1G9SA 4QYIA 4RQBA 4RV4A 2YZKA 1OREA 3EFHA 1I14A 2IGBA 4Z1OA 1XTTA 1XTVA 4RANA 1L1QA 1ECBA 1HGXA 1FSGA 2E55A 2JKZA 1QK3A 1BD3A 1TC1A 5KAPA 4P3KA 1QB8A 2H08A 1STOA 3OHPA 1AO0A 1A97A 3DEZA 4FYMA 4P86A 2H06A 1DBRA 1G2QA 2P1ZA 1XZ8A 1VSTA 2VFAA 4WMLA 4OHCA 3LPNA 1P19A 1UFRA 1QK5A 1UPFA 5BQPA 3N2LA 1G2PA 1QCCA 1XZNA 2JBHA 4P83A 1U9YA 3O7MA 4M0UA 1V9SA 3ACBA 1IBSA 4RHXA 1P4AA 2AEEA 5KAMA 4IJQA 1VDMA 5HKLA 4M0KA 4X45A 4M0PA 1XTUA 1HMPA 1I5EA 4RAQA 3OZFA 4PFQA 1A95A 1ECGA 3QW4B 1A4XA 3HVUA 1ECJA 2PRYA 3M3HA 1P18A 1YFZA 1TC2A 4P81A 5ESWA 1QCDA 1I13A 1UPUA 3DMPA 2C4KA 3MBIA 5EUCA 5IAOA 1BD4A 5JV5A 4RADA 1ZN8A 4LZNA 1WD5A 2EHJA 4P80A 1VCHA 4LZOA 2FXVA 1O5OA 1GRVA 4KN6A 3ACDA 1A98A 2JKYA 3LRTA 5HIAA 4PAWA 1OROA 4P82A 4RACA 5ESXA 5BRNA 1I0IA 3S5JA 4RQAA 1NONA 4QYIB 1PZMA 4LZAA 1LH0A 1I0LA 4LYYA 2PRZA 1O57A 2XBUA 4P84A 4TWBA 2GEBA 1ECFA 4MB6A 1U9ZA 3GGCA 1QK4A 5E38A 3KB8A 1ZN7A 4RHYA 4F8EA 1D6NA 1BZYA 5IPFA 5JSQA 1L1RA 3GEPA 4JITA 4JLSA 2H07A 1GPH1 4WN3A 4LYGA 3MJDA 1P17A 1DQNA 5BSKA 1A96A 1CJBA 1JLSA 1R3UA 3NAGA 2JI4A 3OZGA
chains in the Genus database with same CATH superfamily
2QI9C 1I3CA 5EXSA 4KVAA 4LZWA 4U2EA 2I80A 1CV2A 2J0SA 3A9VA 3OIDA 1N7IA 2I67A 1E0DA 1W0JA 3DS8A 3BRQA 1W75A 5M7EA 1QRAA 4AKTA 1VP9A 1ESMA 1YD7A 5P8WA 3ZGOA 3V7UA 3SQMA 4W9NA 4G01B 4FMCF 3HBAA 4L9RA 3STUA 4HBZA 1PFQA 2G83A 2Q45A 3FLAA 3ZXUB 2I3DA 4JWKA 4X8MA 4D0GA 4PE5B 1I30A 3CCBA 1WPQA 3Q98A 3FSGA 1KE2A 4BO4A 4X94A 3ZGYA 3V4ZA 2X2FA 1ONSA 1TZCA 3DAPA 1ICIA 3JASA 4FHFA 3SK0A 4COKA 3GOHA 3ND6A 4RGQA 5DTRA 1D0VA 4O2BB 3COSA 2G9QA 3E8MA 1MXHA 3C3WA 5ALPA 4UM9B 3TO5A 1P0QA 3OO0A 4O0LA 4YLGA 5E2AA 2XMDA 4K9KA 1KERA 2ASVA 3LT0A 3TSZA 4REOA 1E1RD 1L2TA 2C3OA 1DWQA 1IAQA 3H16A 1E98A 5NLLA 2MJLA 4C6HA 5CVUA 3ZDAA 3LUJA 3PNOA 1S8NA 1QPBA 1Y9AA 4FX5A 4P3XA 2CLDX 2Q62A 3VC2A 5KQSA 4GBJA 3R0IA 1PNTA 3K94A 1H94A 4PZ9A 5DOVA 4JFRA 2OHHA 4MV0A 4XDYA 3I5UA 5EUMA 1ZNYA 1FW6A 3IXMA 3QBTA 1T3HA 1XYGA 2QU7A 1VB3A 3HP7A 4Z9YA 5HA5A 1XTIA 3R7WA 4RHEA 4FHDA 2OVFA 2A7XA 4HH4A 4PGGA 1Q0LA 4FSHA 1NJ1A 5HJ5A 2FUG1 4EB3A 2AN4A 1QCYA 2F3PA 1CRLA 1V1RA 4OXNA 2P67A 4DIOA 1Y3HA 3D6JA 4NG5A 2PUTA 4V38A 1FTGA 2VJDA 3GB9A 4DA8A 4GEGA 4BVHA 3IT0A 1D9ZA 5FUYA 1TVKB 3EW9A 3W78A 4E5UA 4RSGA 4D3YA 3UAVA 3B1YA 5DXFA 2WF8A 1KL7A 1S6YA 4CYMA 1JIKA 2W6JA 3I8XA 3KZKA 2AZTA 2V9ZA 3MHTA 2NV2B 3R8CA 2UZ1A 1KQPA 2O4UX 5H16A 1WKBA 1SCUA 1N75A 1OZ0A 5BN5B 4ZO9A 5KYVA 4EELA 1PUIA 5I7RA 1QNLA 3PXAA 5HFNA 1AKNA 4ZQIA 1MRNA 3IIEA 4TKMA 1CFZA 1EK5A 4G0WA 4N03A 4RZIA 4R6WA 4IWYA 1PGPA 3IAXA 3A28A 4I7EA 4C89A 3LK7A 1I1QB 3PUJA 1N1DA 2X3FA 3W5UA 2F4NA 3GRUA 4QBTA 4R1OA 1GZUA 1MAAA 4ZT3A 1EBBA 3OZAA 5DU2A 4RD4A 2PL1A 1E7RA 1QIFA 4ONEA 4HT3B 3MIZA 2PGIA 3LXXA 3OMXA 2XCRB 5JNRA 3DL0A 3EEYA 4EY8A 1S8OA 1PS8A 1VSBA 2GXQA 1QZXA 4JMLA 5EEHA 3TOVA 3TYXA 4HQNA 1F0YA 3HY4A 2PWAA 1QFXA 4ND2A 5DH9A 3PQ4A 2A9RA 3DBHA 1RTTA 3IKJA 3EOBI 4NOLA 4ZIRB 4QGHA 1KY4A 1K08A 2XBLA 5HQ3B 3OZ7A 3QF7A 3AWDA 1F0KA 3KZMA 5FWAA 2PAAA 1JG6A 5I7WA 2XMQA 1IJEA 4P7BA 2C8JA 4N6OA 1LFDB 1NI3A 1X7YB 3DMDA 4D8YA 3EVNA 3F3SA 1PEDA 4QXMA 3VO8A 5EIXA 2RG7A 4YYZA 1VLQA 1ZN9A 1AXEA 2GXUA 2HQ1A 1DKRA 3U49A 4ZT5A 3O82A 2O3UA 1XVUA 1U6KA 1USVA 2W8BB 1HE1C 1NGSA 3LP8A 5I5EA 1JHVA 5JISA 4NNJA 5DX8A 4ZVPA 3IHLA 4KB5A 4GOKA 1Z7YA 4ZT6A 1ZJJA 4CDGA 4ZYYA 4CMGA 5H1YA 1CIPA 4ECAA 2QQ0A 3SJCA 4BMXA 1QFJA 4QO8A 1B74A 1H2YA 1BH6A 1PFGA 3A9SA 3LOPA 3L4JA 1G8FA 1ETUA 4BQFA 4MUKA 3TQCA 1U3TA 3W8FA 5CDTA 3KSRA 1AGNA 1T5BA 3TTWA 2Q7OE 1KP9A 2WF7A 5TMPA 5K01A 1QAOA 4RVDA 2GAIA 5KIAA 4OGKA 1WHSA 1YJ5A 4GC5A 3F5MA 3SHWA 1Z36A 1LVGA 1G9XA 3BRWA 4I46A 4K0RA 4QT0A 1HR0B 3TPZA 5CNJA 4L5BA 1NBMA 1QYXA 2P78A 2Z6QA 5KYNA 1M1UA 3ZLVA 3HXTA 5L45A 4J2OA 3OESA 5E1OA 2QVXX 2XCLA 3CX3A 2GK3A 3HBNA 3QE3A 5EZSA 2QYTA 3G23A 3DEHA 4AD8A 5G0TA 5LNK6 1B8NA 4D43A 4EYQA 3UGJA 3SXUA 5FBZA 3E61A 4KQ6A 3Q0IA 2WLSA 3AIIA 4M0MA 4X66B 3FOFC 2EKZA 5IN5A 3ZWCA 2GBFA 2PX2A 5TVKA 2PMFA 2GVDC 3OD5A 1Z3IX 4IDNA 5GAJA 2YICA 3T7JA 4MQBA 4K9OA 3AF0A 3REGA 5DGDA 4KWCA 1J2RA 5I9BA 3EEBA 3OO1A 4NOKA 2BMFA 3GO4A 4LXHA 3ND7A 3WSWA 1CR1A 1Z5OA 3L06A 3V9AA 1Q0TA 1D04A 3TDMA 3PEYA 4JJIA 5I7HA 3VKGA 4FE7A 2HB6A 1NFQA 2LV8A 3VRHA 1I33A 5IJ0B 2DWUA 2ZSIA 2W2TA 4L7VA 3F6RA 1JG3A 2HPZA 1TZMA 3OZTA 3QLEA 5L3VA 1KYYA 1M6YA 1JA9A 5DGIA 2QUBA 4F4DA 2R62A 1IXRC 4YRJA 4F6RA 5BP7A 4UXIA 5K4AA 5AKZA 1YJBA 2NTEA 1N9KA 1QK4A 1WV1A 1KARA 3M5WA 4D0SA 4HFJA 1DL5A 1Z15A 3H2IA 4PGAA 3BTOA 1EFTA 1VKZA 1L4KA 2H9IA 4MUGA 1E64A 3DTTA 4Q4JB 4TZTA 4P5DA 3UT5B 5KEIA 2EAUA 2JAWA 1R8XA 1GPBA 4DSNA 3CT6A 5JD4A 1EQAA 1KKLA 4X6UA 4ACBA 2JCGA 3AFGA 3MBKA 4MV9A 3QKTA 3P52A 1F0PA 2J0UB 2QG4A 1AUPA 1MX9A 3GGOA 2PRIA 4BIMA 4C87A 2W11A 2VDQB 1LNZA 2UVPA 3O3NB 2PJDA 5LQRA 1XWWA 2VEDA 1NM5C 1GAJA 3ETCA 3ETLA 1DG3A 3E1GA 2AHOA 3PGMA 4G8CA 1R8SA 2H7XA 3IKLA 3ZNPA 1UPAA 2XNDA 5J2UF 1IUNA 4P3NA 4PONA 5KU7A 2Q6IA 2PEYA 3CJQA 4L28A 3GD7A 4F5EA 5CMLA 1ZKDA 2RH9B 3FUWA 3N0XA 5FHQA 4CEJB 3AF2A 1TKRA 3EZ2A 3NUZA 1KFBB 1YDFA 3NAMA 1LTKA 3R6GA 2WDZA 1EUCA 4DQDA 2LZ0A 2P91A 3K4HA 4RW0A 5DCYA 3USES 4HPXB 1TQ6A 1SB9A 1VL8A 2IP1A 3WYNA 2R8EA 5LZ7A 4ENUA 5JNSA 3OTOB 3GLHE 2OCXA 2I33A 3OEHD 4ZEVA 2V8BA 4HVTA 3JQBA 4LJYA 1N92A 3LTNC 1V6CA 2PGOA 3L7JA 3KYBA 1XIVA 4WOCA 5FUBA 2ZS9A 1ZESA 1LBEA 5T67A 2H57A 2OAQ1 3H1EA 3HACA 3RBZA 1T36A 3KEQA 3VSDA 4RIGA 1HA3A 1LKZA 2BFAA 1MQSA 4XPIA 2GOYA 2FMXA 3N74A 1IY9A 4RVCA 3ZZ0A 1QCCA 2B98A 3GJRA 3LQ4A 1KMNA 4U39A 4DV5B 2VHTA 2HZ7A 2Q3LA 3BXXA 2UUCB 2FJUA 3I4FA 1AE1A 3JYOA 5K4GA 1IWOA 4JT4A 2GWHA 1HFKA 3SDSA 5I8PA 1EE1A 2D8AA 1QRDA 3RREA 3ZQ6A 4FC6A 1Z37A 5G4LA 4F2HA 5JNWA 2PQ0A 4M1OA 5M04A 2CYCA 2C88A 2IEAA 4DB4A 1DAMA 3EARA 4TWJA 1MO6A 5DK4A 3W6UA 4J90A 2IHJA 5HKKA 4TXJA 4TUYB 3GEHA 4RADA 1S9DA 2QL5A 1DCKA 3QXGA 3GRVA 3WYFA 1PG5A 3ZCSA 5IXSA 1T4MA 1WVIA 4K88A 1NMEA 1A98A 4BC0A 1RYNA 3O9MA 4JMPA 1QHHB 2R96A 3VNRA 4BQIA 1NZDA 4ECEA 4XUEA 1WU8A 3O4JA 3ZJ4A 2QZZA 4G67A 5EJ2A 5BNIA 2W2XA 3GLIA 1FDVA 2AS0A 2YWCA 1N5MA 2C82A 5LJIA 3JVVA 3SGLA 3ZQKA 4D3ZA 1UBEA 1I7LA 3NV7A 3W3AH 1PVDA 1KQ3A 1GOTA 4CIBA 3W7VA 1V1MB 3AQIA 2LRHA 3GJYA 2JFXA 2ZZKA 3C7CB 4JIMA 1V9LA 4KLAA 3TB6A 4WTOA 1EQ2A 4GPAA 5DLEA 3T5DA 1K7FB 1QAMA 4NTZA 1Q3HA 3AEUA 1N2CE 3ETDA 2VHEA 2WM3A 2FZKA 4TSFA 1NU6A 4UUMA 4PQRA 2FPUA 5I9LA 2CMDA 4EJFA 4PTZA 4JUAA 2C7GA 4XVCA 2ADOA 5IT5A 2WTBA 3WAGA 2H54A 1TK2A 2NU7A 4JS0A 4EMSA 4UHEA 3BD9A 3NWPA 1RBMA 4WZBB 3V7YA 4DTCA 3Q6IA 1ZOOA 3IOBA 4S1NA 5IVPA 3KB1A 1AMNA 5KVAA 2Q6OA 1QFYA 3GRCA 4UNSA 2PVCA 2COUA 5THQA 4RD1A 1NKSA 3L92A 4QVKA 2F4VB 4JY7A 1TCUA 1A9QA 1Z0SA 2KWIA 4FJ0A 4A5OA 3BK7A 1I6LA 2ZSJA 4Y2GA 1HZZC 1KEVA 3T3DA 2YMMA 4AIIA 4H1WA 5HW0A 3WGTA 1R5OA 2QPOA 3IGFA 1HYBA 1G18A 1JYSA 1RP1A 1SZDA 2HY7A 3HBMA 4DUYB 4Q48A 3EXHB 2XTAA 4LG1A 1AZSC 2BFDA 5D6OA 4MVWA 3BE6A 3PQ8A 5LBTA 3MBOA 5KHOC 4LJ4A 2BI4A 2XUGA 1ZQ9A 1HGXA 3F1KA 1E96A 3KKLA 1UJ5A 4R8MA 5GIOE 5DBOA 1TUGA 4WKGA 2AEMA 4O2BF 3TL6A 2RHLA 4N0PA 2GBLC 2BHRA 1A97A 1KDOA 1MV8A 2VH2A 1IWPB 3GLFE 1Y6FA 4GPD1 2P5TB 2VTDA 1U2SA 3K2QA 2VKQA 2NYUA 2ZYIA 1SCAA 4A0SA 3SJBA 1XTJA 4BE9A 2B1JA 3LT2A 4ZGGA 3OKCA 5EGSA 4D42A 1YCHA 2VJLA 1NW9B 4FYIA 3TINA 1AQNA 4IOLA 2RHDA 2CJYA 4AWXA 1OFIA 5IWAB 2PU5A 1AY0A 3MTBA 2ZT8A 3LXRA 1SQSA 3IQIX 1DFGA 4DRXA 4JC5A 3KTAB 3LHKA 4CM8A 1Q17A 2JCXA 3W5DA 4U9HS 1U4SA 1JVSA 1VJDA 2ZSHA 3MSCA 2FDCA 5FX2A 4BPBA 2ZI9A 1FLNA 2OCYC 3ZEIA 3UA4A 5KPDA 2P40A 3C5CA 3WLMA 4B6OA 4RHCA 2IP2A 5LZ5A 4MKGA 1RXEA 3M1YA 5DNVA 4NXNB 5DHUA 5DSZA 1ZN8A 3ONFA 2IVZA 5FA5A 3LWNA 1WD5A 1Z88A 2OXIA 2A5LA 4MGEA 1RZUA 4MRMA 4E32A 1M1XB 3AYXB 4N12A 1I9GA 3QZUA 4DCGA 1YE3A 5BUCA 3QEKA 1H4QA 3E7FA 4L8GA 3RU7A 3TVTA 1E4YA 5FNVA 4C0QC 1XZKA 1CVLA 3DUFB 4XOUA 3A11A 3I61A 3TW0A 4YAUA 1U31A 4DAEA 1YL6A 1Z2OX 1YRLA 3V33A 3DO5A 3RNOA 3ZDQA 3SYLA 3K6RA 1VLLA 1JIJA 2WPDA 4LBZA 1O54A 4MJ7A 4EH1A 1V16A 5CCEA 4HUTA 2G36A 2WKPA 1S3IA 3MJVA 4JVSB 1AIPA 4MO9A 1RBQA 1OI4A 1W19A 1MQAA 3CGGA 4DR4B 2CWDA 3NBZC 4RL6A 3FW1A 5AVKA 2RCYA 1B0PA 2XDAA 4XVQA 2BUAA 4MDEA 4JLPA 4X7PA 5J4YA 2QV7A 1DQNA 3CXUA 2H1OA 1EWQA 3EZ6A 5J43A 3S3TA 1ZK0A 5AJVB 3LSTA 4DV0B 1M2VA 4G86A 4PC3A 1NP6A 1ENOA 3N5CA 4TPKA 3GLGE 3MC1A 2XVZA 3FKQA 5KWSA 1BMDA 1MZVA 2JAQA 4DDUA 5DN6A 4H7FA 5IF3A 3CX6A 3LY9A 4ESVA 3ED1A 1FP4B 5JBNA 2ZSFA 1EXMA 1UK8A 1UF9A 3ABIA 2QRKA 3K31A 4ZFNA 3VHQA 5CBPB 3MGCA 2JFYA 3F2IA 3PXBA 1GVNB 1XOIA 1Y1LA 3K1JA 3CLTC 3JYHA 3LPDA 4P6VF 3VJMA 4G41A 4CM5A 1JFTA 1M34B 2GQ0A 3OAAA 5EKSA 1J56A 4EUHA 3MPOA 4C43A 1Y63A 1QRTA 3M33A 1JB1A 2IZ7A 3HU3A 4BX0A 4TL9A 3B3GA 5KTKA 3P9PA 5K0TA 3HEMA 1OLUA 1R6VA 2Z09A 2YVKA 2J59A 3LKBA 4HWTA 3TN7A 4RZSA 2ZDQA 4KGVA 3ANTA 4EY4A 1KI7A 2QY9A 4GRDA 4N7BA 3ROPA 3C4VA 4K87A 1G5TA 3JAMA 5IYZB 3TZCA 3GJ3A 2PIAA 3TE7A 5B7NA 4PSDA 1VC2A 1XQXA 2DLCX 4KK4A 3QE4A 1EAYA 4ZYTA 2F90A 4OYYA 3AB3A 5G4KA 1XLUA 2VH1A 3BMNB 4IJMA 5BQPA 2BFCB 4GM0A 3FTEA 1E4EB 4LE0A 4RHXA 2P9TA 5EXDA 3L7YA 3TMAA 2XHZA 4MR8B 4BLUA 1XZCA 3HVUA 1GCIA 3DHVA 4Q21A 1P18A 4WXPA 4BZPA 3L7OA 5TT1A 3EGDB 5T4EA 3LA6A 1XPUA 1MO3A 2EVWX 4HN9A 1E0KA 1T43A 4RDIA 4TV9B 4X93A 5AVJA 4CFZA 4Q4JA 4E46A 3J81A 4EWLA 4BNLA 1XAHA 2QN9A 1ZUHA 1NDQA 4B3IA 5F9FA 3GU3A 5IULC 4TS1A 1VZ3A 2X86A 4PNEA 3G2LA 2HU2A 3D8RA 2NWQA 4I6JA 2EYQA 4HYTA 2JKYA 4FBGA 2WU8A 4MQFB 3L5KA 4E6PA 4JEUA 4XYMA 5G2OA 1SXIA 4KPEC 3D5EA 3ESYA 3K9HA 3MS7A 4M38A 4QEDA 4R54A 5E0OA 5AXCA 4P98A 3VI4B 3E4CA 4D9HA 5CA0B 3TEFA 1SZCA 4S1VA 1JE0A 3VDXA 4DIBA 2R6GA 2XT0A 2HWUA 3DTNA 3E9QA 1CQIB 1CB0A 1XQVA 3DCIA 3GEEA 1SXHA 4WXMA 3QLJA 2LCQA 4XWGA 3W3ZB 4A6EA 4WBNB 4HB4A 2IXTA 3F4BA 3G79A 4HN4B 4OLHA 1T4CB 3MMSA 4EENA 3JRXA 1ADBA 4CEJA 1ZBQA 1NMQA 3AJEA 3FTDA 4M21A 4AY4A 3KUUA 3NDBB 1KOGA 1LPNA 1JJIA 4ZV7A 2CLEB 5CDFE 1H8HA 3UMBA 1Z26A 3DVQX 4WZAE 3WJAA 4LPSA 4TWRA 5C5EA 3RIYA 3KAPA 1P6UA 2BCEA 1KRWA 3W1WA 2N3ZA 3U7EB 1U3FA 1WXDA 1CJBA 2ZJOA 1ULAA 1MDFA 3CRNA 3FHCB 3TLKA 3TG8A 4QOGA 3RJ9A 2G7MC 1IFXA 2GHQA 3GXOA 3OG9A 1AK9A 1NBEA 4K46A 2BJVA 1UEXC 4JLKA 2YHSA 1QONA 1G291 2TMYA 4JI1B 5JS2A 1I80A 5A05A 1LZLA 1E2UA 1DV2A 1OAOA 2OZPA 2PM8A 1B93A 1HL3A 2EW8A 3Q9SA 4FBLA 3N1UA 2DFPA 4J9VA 3CBGA 3ELUA 4FB4A 2O7SA 2CFRA 1Q1EA 3DHWC 2I4TA 1VYUA 5L7TA 2HUNA 4UHCA 2Z5GA 3TSCA 1JHZA 4RY8A 3KSUA 3PFFA 5CAEB 1K7SN 1ECCA 1E6CA 3IB6A 4DUGD 3TD2A 1XRNA 3KX2A 3OWHA 1CT9A 1KR5A 3ROFA 2R97A 4IXNA 4Y6GB 2B4YA 4GBMA 3QEBZ 2ORWA 4FONA 2WW8A 4V02A 4EW3A 1SHJA 1D8TA 2GT1A 1S2NA 2G0TA 2VA8A 4C4TA 5K0ZA 2QP4A 2JG3A 3HSSA 1X92A 1U8CB 2HJVA 2PKYX 3K05A 3HYRA 4L73A 4RS4A 4Z99A 4AROA 2O8FB 1AO3A 2H16A 4P1ZA 2CLHB 4MA5A 4TXHA 3SLRA 5CVCA 1ST3A 3H99A 4FHCA 2CFCA 2HCFA 4E5SA 3RJTA 3W2HA 4ZXFA 4AY5A 2UYCA 2VDPB 2RC5A 2GILA 2WUWE 2H5LA 1DIGA 2Z4RA 1QHHA 3EXG2 1XZ8A 1YBHA 4U9UA 2UAGA 5IARA 3NMUF 3OBBA 4X90A 4G07A 1NQXA 3K8OE 3M1LA 4QOSA 3TSOA 2I62A 2QTWB 1FMTA 3RRFA 5JOQA 3DD1A 1Z17A 3MGAA 4RTJA 3OUUA 2H2WA 4IXWA 2Y71A 5HBGA 3H05A 2M1XA 1S1MA 2X14A 3OJOA 2BRUC 3L05A 1KZ6A 1Q2UA 5FA8A 5KJEA 3UA3A 4EM6A 1KI6A 4MRPA 2Q50A 1XZJA 1OQAA 2VYVD 3NFYA 1ECJA 2PRYA 4FOLA 3G0CA 2P11A 1Q22A 4X71A 3KJNA 4WLVA 1NBHA 1AHPA 3C14C 4MAFA 3T4EA 4DZTA 3ANNA 3QX7A 2EBWA 5A62A 3AF5A 2M6SA 5HK8A 3LPLA 3UH0A 1BN6A 4G4GA 3KFVA 2Q9CA 5JAHA 3ZBPA 3G0IA 1PJSA 1RW4A 3EN0A 2RHRA 3GARA 3HKCB 3UENA 1IZYA 3FA2A 4DMKA 5DSXA 4O5OA 3R24A 4LTNA 4DREA 2VAXA 1NDUA 3N7TA 3OE5A 1E3IA 2PJUA 4J07A 2NQTA 1SD5A 1WQ4A 4TUYF 2ZP1A 4DR1B 3Q0TA 4F3TA 1UIRA 3UT6A 4ND7A 2XWBF 3RPEA 1USKA 3VU3A 5B6IA 3OLQA 1H2WA 1YKSA 1BA2A 4YQEA 4F8JA 2Z57A 1QTQA 1AUXA 3ENKA 2HIGA 4TMTA 1K4YA 4GI5A 4QYIB 2FFJA 1E2GA 2PD6A 1FK8A 2XWJI 3P4XA 3WMXA 4YCAA 2B5WA 9ABPA 4ETNA 3NBXX 2DUNA 2LW7A 1TMGE 4Q9NA 3BE4A 5TV2A 4EG8A 1UH5A 3BJZA 5BRAA 5DHSA 3TRHA 3G9ZA 4P5PA 4CKWA 1UEIA 1RVV1 1XVVA 5AVVA 4I9HA 3SX0A 3TIXB 9LDBA 2CLOB 3VHXA 3IXQA 2C0QA 1GG8A 3H2GA 1Q7EA 3EFOB 3WZLA 4K6HA 1PG2A 2B5VA 1GITA 1W4BA 3GAAA 4ZKDA 3E2MA 3JXEA 4EX6A 4IUCS 2FPLA 4O4JB 4JSTA 1IUOA 2NZJA 1SXJE 4DYHA 3EF1A 1SH7A 1ADCA 1HE4A 3CG0A 1H69A 5BQOA 3BIOA 4YAKA 3LCCA 2QTVB 3N5KA 3GQBB 3BJMA 2A78A 3H9EO 4NBVA 4BNNA 4E11A 1USUA 2V7VA 3L01A 4MKFA 1CJSA 5EE0A 1G98A 4U0KA 3ROKA 3I39X 3ZDEA 2GM5A 1GKLA 4KXXA 4MRVA 4PLTA 1W30A 5D3MB 5CX4A 5EJGA 5LA6A 1T91A 2XA9A 4S2UA 3WVNA 2CL6X 3KTAA 3FVRA 4ZAGA 4KTVE 3PNPA 2WSSD 1JEAA 1MT0A 4LY3A 4FKMA 1S2OA 4UVGA 3QOXA 1G6HA 2Y1DA 1YJQA 2OHFA 4XX0A 2A88A 3TW4A 1GEEA 1CDEA 3HUDA 3HWRA 4IDAA 2Q5JA 5JXGA 4MWOA 2X4DA 3I6BA 4EEZA 2FPGA 1E1LA 1FSGA 2IFTA 2QOEA 1GDHA 2Y8EA 4LOAA 5IEBA 2PJRA 2XJ4A 3KE9A 4DV6B 4P22A 2VK2A 5HFAA 2NU9B 4IIYA 5JCZA 1EX7A 2ZI4A 3GP3A 4D5GA 2WIDA 1KEEA 1N4DA 3RTEA 1UDBA 1QIDA 5AVXA 4ZRMA 5BWMA 2BKUA 3OHMA 3HM2A 3Q8WA 3IJPA 3U7QA 5CD9A 3MRXA 3SNKA 1WUIS 2YWGA 3K72B 3VKVA 2IY9A 1TQ4A 4PSUA 4PTLA 5LSAA 1FP7A 1A69A 1T9BA 3N28A 1IOLA 3DKPA 2ONJA 5LWQA 4DADA 4JT8A 2O7NA 3NGXA 1J24A 1JEDA 3N8DA 3P71T 4Z4IA 5BV7A 2IYPA 1HMPA 2IPXA 4GX1A 5IJWA 2FUEA 4MQEB 1L5NA 1YZLA 3CVWA 4UC0A 4QU8A 3ROXA 3F49S 1BWPA 1MHPA 1JSCA 1W96A 1QCDA 1SCJA 4JC8A 1DZ3A 1SU8A 5DULA 1QVRA 1SBIA 1H05A 3A3KA 3NUQA 1GNVA 1U63A 2NG1A 4Q7MB 3WMEA 2I6GA 3ICCA 3SY8A 3UIEA 3QTLA 4DR6B 3IDSA 3QF4B 4IG9A 3E53A 1DDGA 4UBOA 1KDYA 3KJIA 4NDAA 2JL1A 3AGPA 1Z39A 1VOTA 4CMJA 2QMZA 3TBFA 4YROA 5KMGB 4KI7A 3LF1A 3W6NA 5A4KA 2YJGA 1VBKA 5JJIA 4DV3B 1FY2A 1MW9X 1NAIA 3JYLA 4HH0A 4X8OA 1JRLA 4LEIA 1NTRA 2HBYA 4JEIA 3IPLA 4MUAA 1SQ5A 4MRSA 3UOGA 4DC0A 3SQXA 3ETGA 1IMJA 4RU1A 1M34A 1KMMA 4NFLA 2WF9A 4FFNA 4IWNA 2YV2A 5BN4A 2C59A 3O3CA 4UAUA 4RULA 1ZLXA 2FOLA 4MZXA 4CM3A 1KMQA 2QJWA 3WP0A 4IEIA 3A6GA 3AUTA 2HU7A 4Z8XA 2RDMA 4Y98A 1X7GA 4OQ4A 2IHKA 3H4TA 3RVKA 1ZN2A 2IYOA 1OWMA 4GBGA 5HDQA 3LBIA 1BE1A 1L7RA 2X0JA 5IYZA 1FNDA 3W9YA 4HZGA 4BEVA 1H4SA 2VJOA 4GYYA 4KQGA 2R8BA 4EFDA 2NUTB 4HDKA 3TZEA 2W2LA 1JFLA 2QK4A 5HKKD 2DY0A 5CP8A 1V4BA 4IXTA 2VJYA 3G5AA 3KSAC 2ZW9A 1HUQA 2MYPA 1FFXB 2Z95A 4H7IA 4LRSB 3PGJA 2VHQA 3ETNA 4EITA 1T6YA 3RIHA 5DT9A 1ZONA 1NI4B 2VUIB 3UOWA 2VDMB 3QG5A 3EZLA 4D1YA 2WHQA 4OQFA 4IDGA 1ISSA 1O5IA 1O0CA 4N41A 2HFJA 4XLLA 1PR5A 1KYWA 3SP1A 4PCLA 5CM9C 1VYHA 1XQ6A 3QIVA 3SEFA 1LB1B 3HYCA 4Q1DA 5AW8A 2QTNA 3LT5A 2OOSA 4RF2A 3DOCA 3BRSA 4HPJB 4AN1A 2IV3A 1H9BA 3D7RA 4KN8A 2EZ4A 4KZKA 2XUDA 3ZOZA 4CE6A 3UWOA 1EKXA 1PTKA 1SOAA 4PFJA 4QEKA 1ESCA 2OMKA 3WRYC 1O58A 1N2BA 4P4SA 2AB0A 2F7SA 4KXLA 3TQOA 5IW8A 4BV3A 3FJYA 5HX7A 2B7BA 1EVZA 1XDGA 2O5EA 3WSTA 1RRKA 3ZWVA 4MWEA 4LIPD 2DHDA 5FRDA 2WUEA 1UJNA 1EYZA 1ZK3A 3SHVA 3Q5GA 4S1TA 1NE7A 3R3WA 2XGSA 1THZA 2BGTA 3GBSA 2GKGA 2R44A 3IQGX 1T4CA 2CNWA 3C3XA 3I73A 1OA0A 4QATA 1IK4A 5K0BA 3N6RA 2PN1A 1H3NA 2DQSA 2FZEA 3G2HA 4J16C 5EXTA 5BO5A 3NYIA 5LU8A 5AM4A 2X15A 3SYRA 4GPBA 1UXOA 1EE2A 1MZPA 1NQAO 1VA5A 3NTOA 3A9TA 4L16A 1RCUA 1XZBA 1H2EA 4NYMR 4Y9TA 3WHIA 2J67A 4EATA 5J4LA 1T0UA 2QZJA 4L2IB 1JE1A 4PG8A 3GFQA 4AUEA 4TV9F 3FNIA 3JD1A 5AOCA 4F96A 3PDWA 1NWHA 4RKYA 4UZEA 3HLKA 3P9RA 3CG4A 4Z9AA 2ZCUA 1YI0A 1YV9A 4YRDA 2ZRNA 3ORFA 5KX5A 1Y80A 3WK9A 1IULA 2OZEA 3KQWA 1HDXA 1TF5A 2EG9A 2NT4A 4FLFA 1AQJA 1X13A 1LLUA 2AQHA 2A86A 3OE7D 4IX1A 1SVLA 3OQNA 4F93B 1EZZA 1P2FA 5CUQA 5CA0F 4OFZA 3MAJA 2Y0BA 1K89A 2FN9A 3GDGA 4H3HB 4UZFA 1WQ1R 4YO7A 4BHTA 4DILA 4RKRA 4DOMA 5JQWA 2NTYC 2JGRA 1L8OA 1QBKC 3TQFA 4WBNF 1FDWA 1Q6YA 3P1JA 3V1TC 5FBQB 1YTUA 4IOJA 4X62B 5KYUA 5FUXA 3CU5A 2B4KA 2I8LA 4AZ3B 1C9DB 5IKMA 3HUEA 1KBZA 2FVYA 3G8BA 5A2GA 1HK7A 3CVYA 4BTVA 2O8FA 4BB0A 4V3CA 3RFCA 3MWFA 5B58T 2B7LA 4WA8A 4IDHA 3I53A 4LS3A 4JENA 4AG5A 2XMZA 3AOGA 1NI5A 2AMVA 4J0JA 4P34A 5TEVA 1IQPA 2QTBA 1U94A 5EQJB 3ILSA 3AM5A 2C29D 1WMAA 2Q5EA 3TOCA 3VR6A 5BRJA 5K2OA 1W25A 1E58A 1PFKA 2D0DA 4ZQEA 2Y99A 2W4QA 3SZRA 2V7BA 1OC2A 3F97A 3F98A 3OZIA 4MPTA 5DB4A 3WZMA 3K6SA 1JSLA 4WY5A 3U61B 3PC8A 3RTAA 3DDCA 3Q8XB 2EFEB 5FJIA 5JC8A 1GPJA 4UBNA 1JA1A 4GOND 1WA5A 4LDJA 2GNAA 4UNNA 5ADHA 2F3RA 2CWWA 3DOUA 3QVOA 3U39A 4J3NA 3A2MA 1E2NA 1LBIA 1L5FA 5FB3A 3O8DA 2LE0A 4WNAB 2DOKA 2FPMA 2G1JA 1V5FA 5JE8A 2WF6A 4HQOA 1U8XX 1CZHA 1GSAA 1M0WA 5TSDA 3K0EA 3D7LA 1LDMA 1ECBA 2ZS8A 1Q50A 4JJAA 1MCZA 2PRJA 1E92A 1PL0A 1ZVQA 2CK3D 4LA4A 4U7JA 2IYQA 5CW1A 1MORA 3O91A 1FEZA 2VF8A 4X7MA 5FI0B 1QRRA 2ZRPA 3WLAA 1DS6A 3BRCA 3K0HA 1OT3A 4JELA 1XZIA 1EUDB 1QB8A 2ZE5A 4TYMA 1WL8A 3TIVA 4QHSA 3OIVA 1JDZA 2H31A 2R5FA 1E6WA 4L0MA 1EG2A 4MS3B 3T9DA 1YKGA 3U40A 4C6RA 3SZOA 2DULA 2XNHA 4MPPA 4Q3NA 3TSAA 3FYUA 4PGHA 1GTVA 4UD6A 1RI1A 2AWNA 4L8LA 5D7BA 4I1IA 4OREX 4Q3EA 5KTSA 4A36A 1JG1A 1L5GB 4F5ZA 3E84A 5EOVA 5FTKA 1HSZA 2ZYAA 3ND9A 3P5BA 3ZY2A 1HLPA 1LSJA 3RYTC 3QBJA 4GZ5A 3H11B 1L7AA 4R4JA 1P9NA 3UAGA 5DN6D 2H8GA 4JJ4A 4RTKA 5CJPA 1AS3A 2HMYB 3DZIA 4PPYA 4YCSA 1B0UA 1QP4A 4NFSA 5DW3A 4Q16A 4DMGA 3UWPA 1P5ZB 1TM2A 2DECA 3X1ZA 4FIDA 4GBED 3PSAA 3QE9Y 1TLFA 3GFGA 4YRTA 2MSWA 3QLTA 4GP7A 4ISBA 1W5BA 4FDTA 5T6BA 4ALJA 4B80A 4HNUA 1ORDA 4P5EA 2J31A 4PWYA 4O4JA 4PR0A 2Q9BA 3KU1A 3W8DA 1U9IC 2WEKA 5JBIA 1U7TA 1XZFA 4OGFA 1Q19A 1FA9A 2ACKA 3W79A 2BDTA 2QTVA 3HN7A 5TGZA 4OMCA 1PDOA 3WO0A 5CM8B 2F3UA 3LX8A 3P9ZA 4WFQA 4WOPA 4YDHB 1Z0IA 1OH7A 4TZ6A 4JQYA 4G24A 1QH0A 2IKSA 4GKJB 1WZEA 4Z86A 3N7UA 1VIMA 4C4RA 4DSAA 3HABA 3JAWB 1H4TA 1KVQA 4ZVRA 2PSHA 1B1AA 1OASA 3W4KA 2JIBA 1PDVA 1OLOA 1XROA 4LOHA 1JA0A 1Z8FA 2Z8YM 3JCZA 3MJSA 5CLGA 5FAXA 3ZDBA 1NPYA 4RFSA 2Z98A 1LPOA 5AXAA 4IDPA 5KYTA 4AKIA 4W99A 2W4IA 3PTLA 4FN5A 2RKWA 1K5HA 1AKVA 1LF0A 1Y6QA 1L1RA 1AZLA 3M3DA 4EI7A 3QLUC 1G7TA 4HTFB 1F20A 4H6PA 5DIFA 2AX4A 1NWCA 1LV8A 4Q3BA 1JJVA 2QN1A 1ESDA 1RQNA 4LCBA 1QYVA 5BYBA 2UXDB 2Q27A 1QFSA 3LQYA 4LUCA 2ZAOA 4AU1A 1AGRA 1N6HA 1ZGAA 2ATIA 2JI7A 1A4RA 2EDCA 2O8NA 1QG0A 5HE9A 1PJLA 3PX3A 2GDJA 3RS8A 4HFMA 3IBFA 3ZS9A 5K6TA 3OPXA 4O4JF 1VI6A 3IURA 2MYUA 1NURA 3PLAE 3X43A 2JJ2A 1KORA 2Z9DA 2XYGA 2FSSA 2OL4A 1VXRA 2CFTA 1R1DA 1HQYE 1X7XA 4H6WA 2EOAA 2QMUA 4OO3A 3VTKA 1SU6A 3G0BA 5KOHA 2ZBRA 4PLCA 1V9CA 4NC9A 3DAHA 3QU5A 1CY6A 1QHEA 2VJCA 4RVUA 4TWAA 3UH1A 4C7OA 2H2FA 4KVFA 4LYAA 3BREA 1CE8A 2YZKA 3FRIA 3HB9A 4JSRA 1BGXT 3BKWA 3LFHA 3LL7A 3G2IA 3DL2A 3L18A 4O29A 4PW0A 2SKEA 4HLCA 3ZCVA 2RCNA 4CL3A 2NUPB 5ED4A 2PWPA 1TA4A 3JARB 3UG6A 1FVOA 2F9MA 2PXXA 2V7GA 3V2UA 4N76A 3CWQA 3MS4A 4QEZA 4QOEA 3D8NA 1KS2A 5CBKA 4JLNA 2IU3A 3D3NA 1O03A 4PYKA 3DC7A 4ZOAA 5HYVA 4D26A 2JBAB 3PVZA 1TQHA 1AU9A 4QUAA 3GFOA 4ZVSA 1C4WA 1LW7A 4Q7JB 3VPBA 3ZQJA 1U1FA 1UMDB 1W93A 1X0XA 3GN1A 4QRHA 3WGNA 4ARBA 4YXWA 3ONDA 2ZBQA 4INZA 3W1VA 3R0XA 1G8AA 5CA1B 1UPCA 1TKAA 1A9XB 2R4QA 4UBKA 5LZ8A 4ZTUB 1P6QA 3G88A 2O5VA 1P4AA 3RBAA 3WZ2A 1A76A 2I2AA 2NQ8A 2HRCA 3NCTA 3QEMA 2HQBA 3KU4A 4BQSA 2WWGA 4Y0NA 1LRKA 3KUCA 1JDTA 3LOUA 3AG6A 3CTPA 1W0KA 3L0BA 2WYUA 3TZBA 5LR6A 4IHJF 3C8DA 2ZJ2A 5A4MS 4G8DA 1GNRA 4P7GA 4L8WB 1F5NA 4RPHA 3T4XA 4DV4B 2HIAA 4EO7A 3VJLA 5JALA 2H9AA 2JJ1A 2X9VA 5F51A 2WJ3A 1ZHFA 2Y1LA 4MB0A 4XDZA 3WL8A 3C1UA 3ET4A 1WAMA 3CEJA 3A6DA 4FCWA 4KMOA 4PBRA 2F9LA 5GZ6A 4XGQA 3ZHRA 3T3GA 4EG4A 1IOVA 2O8BA 1EFRD 2GN0A 1TKBA 4DHWA 4CBVA 2NUTA 4FJ2A 2B25A 3MGKA 5AXDA 2QD2A 2WD8A 4CFSA 3H9CA 1OI3A 2YJZA 1NXOA 1I10A 3C3YA 4FFRA 2ICAA 2JFPA 2BFEA 5ICFA 5CLLA 4ER0A 1B4DA 3RANA 5A4JA 2DPXA 5AM1A 1JU9A 1T5LA 1WM1A 4QQRA 4MS1A 3TB4A 1QHXA 4JIGA 1KZ1A 3K1TA 1A7KA 2WJYA 4EY7A 1RLIA 2CXPA 5B1EA 5DFAA 1TM3E 4QT4A 3W9SA 2XDQA 1V2GA 4U7FA 1QH1B 4FGZA 4ZAWA 1K8QA 4E0BA 4L75A 2DPYA 3DFMA 3T7TA 1SD2A 4BQEA 1IG0A 3BK1A 1JEYB 2VAVA 1YH3A 1Z2EA 1T25A 4L57A 3DHNA 2V4UA 4G6ZA 1J99A 8AT1A 4Z7QB 3SJZA 2ZAMA 1XK7A 4Q9LA 1O0BA 5CXQA 4NEQA 2QUZA 3F6YA 3F7MA 4AP5A 3DL7A 4R8SA 1E3JA 2G72A 3ONVA 3BF8A 4IL5A 3JZFA 2PSEA 3F4KA 4M0FA 4A1OA 1GU7A 3RIEA 3G2OA 5CDUA 1N4AA 2BEWB 3VO9A 1RQRA 2C7BA 3DV2A 4UU1A 3I0NA 4BQRA 1NR1A 5SY9A 2XAAA 2OCKA 4BN4A 2C9BA 5IDVA 3PK0A 2Y4OA 2J07A 2R85A 1SVIA 2BDEA 3ID6C 3PC6A 1VYTA 4NV0A 5CB8A 3SQOA 3Q3IA 4RJJA 3ROQA 3HEAA 4C0WA 2CLIB 1WXIA 4UPVA 5HP4A 3GPBA 2IH2A 4WKCA 2AR7A 2JRLA 1X8XA 5FO0A 3L8MA 4ND6A 4V03A 2CV2A 3CPSA 4BC1A 1IJKA 3ZY4A 4A8JA 4YRKA 4WT7A 1ZJ4A 5KNDA 5F98A 3F0TA 1EX6A 1IOZA 4MINA 1TC1A 1CQPA 2VRNA 1D2NA 2WFAA 5FHRA 3JRWA 1X42A 1VHQA 3NS7A 7REQA 1WCXA 3CLSC 4JBWA 5AT1A 2NZ2A 4GL2A 1RLUA 5B37A 2Z6AA 1GQOA 1TIBA 3R0QA 4RWEA 4ZOBA 5ENVA 4WKOA 2OGSA 1M5UA 4WMLA 4DKXA 4ZHQB 1DJMA 2JARA 5D5QA 5L3ZA 1CQJB 4EPTA 2O52A 4ENQA 3N8GA 3R7DA 1XNRB 1DHTA 4GEKA 1DO2A 3ZKAA 3AU8A 1VGVA 1QANA 4L1KA 4QAQA 2PV0A 4PX2A 4UE3S 1TQ2A 4M1TA 1BN7A 4XJSA 3ST7A 3U7RA 2IBSA 3K2EA 3NWJA 4G2TA 4ZT2A 3WQHA 2BKXA 3C48A 1I2BA 3PNBA 4MWDA 3MQ2A 4N0QA 4P38A 4IH4A 4NU0A 1Z56C 5A5VA 1Z22A 4ZWNA 1LV7A 1RPJA 2GFHA 1WPRA 1EFUA 2QD5A 3IAS6 2H11A 3GDOA 4P81A 1IY8A 4F7DA 3IAUA 3HA5A 3WV5A 2BI7A 4G0OA 1UM9A 3D7MA 3IULA 4MV4A 4YQZA 3INRA 1NKVA 2NU6A 2JLRA 4N82A 2A0WA 3R76A 5CA1A 5KQRA 4RH1A 2ZULA 3DBLB 1NUSA 2ZATA 3D3KA 4AN4A 3GG9A 4F2WA 1ACLA 2CXSA 5AI9A 3U4GA 1EEXB 2EP5A 4DABA 4F04A 5BV1A 4BWFB 3FMOB 4LGCA 2XODA 1IN5A 1YACA 2YYSA 5AKLA 5BT9A 1C8VB 3PJRA 5AMXA 3WA7A 4LWQA 4NDZA 2CMFA 2CDNA 2VWQA 2ZYGA 1U8TA 4QGSA 2BKVA 5TQ0A 4UTNA 1XGKA 4BNZA 2CV0A 2VOJA 3RV4A 5KJ6A 1V8FA 1DWPA 3NOOA 5GJCA 3AOEC 1DAHA 1O9HA 1TAGA 2MIIA 3I2FA 4DA4A 1J2TA 1WKCA 4F7WA 3ABZA 4D9NA 1PE0A 4CKXA 1R74A 4DRZA 2PX4A 3RS5A 2XMGA 2IOQA 3FF4A 1SWWA 1HL7A 3GPDG 3ROEA 2GAJA 2CCGA 4WDRA 2FG5A 1PWZA 4A16A 3AR7A 4C3UA 1W4ZA 3CXRA 3UANA 1P17A 4KAFA 5KVCA 1YF3A 4Z1MD 2Q7XA 2UZ0A 2YOFA 3H1PA 5CFLA 1KH2A 5AKYA 4IR7A 1EUDA 5LQJA 4GHWA 3HJTA 4TRJA 1ISGA 3GIWA 1YULA 3O2QB 1IY2A 1ORWA 4AAYA 3P9YA 4CHTA 4WSOA 4FHEA 4BQQA 2FMIA 3EMVA 2W2QA 4TV8A 3F90A 4KBFA 4BMYA 2VH5R 4B4UA 4RTNA 2ZGVA 1TM5E 4ZAYA 1GNQA 4XB1A 2C77A 1D4OA 2AJDA 2O50A 2OCPA 3OQHA 4L8YA 2HV9A 4E30A 1R16A 2ZIAA 2HCBA 3M6WA 2FF5A 2EW1A 3MYRA 3VR2D 4NJMA 5HF8A 2C83A 4JBGA 3L0YA 5D84A 1L1FA 2JGFA 1YHYA 3LGXA 3EHEA 5FT9A 3SMVA 4B81A 5CFRA 1GA4A 2BTEA 1G55A 1ZRNA 2HLHA 4HD8A 3RR2A 1PV2A 3ESQA 3PNQA 1VG1A 2VATA 1JJBA 3P2IA 3PPVA 1B14A 4DQ0A 4EL5A 1JT9A 3O0DA 4Q7QA 4DV7B 5F77A 3DR5A 4H59A 4JQCA 4MMZB 2OGUA 3EJWA 4BKUA 2XITA 2Z5LA 3GT7A 2BFOA 1E9CA 2W0MA 3IEIA 2G40A 3K9WA 2OV8A 3DOJA 2DQKA 1COWA 1E62A 4BRZA 4GR4A 1NYQA 3EUWA 3ILXA 3PDJA 4LJ7A 4ZARA 3U9TA 2YYZA 4DCVA 4P9NA 3OFSA 3WLHA 4RK7A 2A9KA 4MEBA 2VZ0A 3EOAI 1R3DA 3IRUA 5GPBA 3TTTA 1MJGA 5TMDA 4LHZA 1UFQA 4IDFA 1WDMA 1GGFA 4HDNB 4UJ3A 1XZNA 5AESA 2OCDA 3DM9B 4AZWA 1R9JA 5GONB 3RGWS 3V80A 4JBNA 1MO2A 2CL7X 3DTVA 3JAWA 3DHEA 3P7MA 3I52A 4KVGA 4LXQA 5G02A 2ZIZA 4B31A 3GPLA 2M2IA 2WAOA 3NZEA 1W48A 3EIUA 4L4XA 4M0KA 5CHYA 1XTZA 1I5EA 1TF2A 4QDOA 3ZYZA 1IRXA 3AU9A 4BO2A 5KYXA 1Q84A 2QXTA 4G25A 3FI9A 3R9XB 4ZZ3A 2H48A 9GPBA 4UASA 2Y0DA 3DE6X 2AF4C 3VVMA 2WSYB 1EVJA 1T0PA 4I08A 3WXBA 2CLKB 3CPJB 3PZBA 4J0IA 4RORA 4DM7A 1RABA 1FFWA 4WZZA 1O95A 2NP7A 1E3TA 1DG9A 4DIFA 3BHMA 4P58A 2FWAA 1T13A 2WBLC 1HFJA 1W581 2FPOA 3I83A 3K1YA 1SO8A 3AFOA 3RKSA 4Q1VA 5LQUA 2IOHA 1LD3A 1T10A 1MRSA 1JLHA 4LSMA 4L0DA 1A9PA 4Y9SA 1P29A 5ESXA 1IXYA 2VJPA 5EYPB 3N2ZB 2C9DA 2BF7A 3FRJA 2C98A 3OQ6A 5LDHA 1JPVA 3Q88A 1CEEA 2GD0A 2V7XA 1I0LA 2FRDA 3NNNA 4GE3A 3K09A 4N3GA 1YDMA 4HDSA 3WGJA 4HXGA 2AMFA 3OPYB 4HMQA 4L4RA 3A2LA 1F9AA 3BHJA 1SIUA 4RD2A 1M2EA 4TQUS 4ZRDA 4DM3A 3JQBC 2EBUA 4YAFA 3RHSA 2ZREA 4OM8A 5BWCA 1IBCA 1UKEA 5AVRA 5DE3A 4MCJA 4PICA 1I9CA 3RCBA 4BJ5A 4DCCA 5K05A 5J59A 2E4ZA 4GGOA 1VGQA 4M9QA 2D2FA 3MJDA 2VOEA 1K7XB 2DBRA 4HDQB 4KWTA 2PUBA 2CNWD 3ADDA 2GAFA 1PJBA 2ERXA 3I6MA 4HNAA 4Y67A 3QEJA 3RT9A 4CLEA 4M49A 1BU8A 1W4CA 4YRMA 5JATA 1FBNA 2XNSA 3WMRA 1MP0A 2VTKA 3TUZC 4L3WA 1Y0BA 2BGIA 2JBAA 4JXXA 2YZGA 5C80A 2JEYA 4RK5A 2WT4A 3TNJA 4XM2A 1SVWA 1K7CA 2CFOA 1L3BA 4YPFA 3ZE0B 3B1KA 4LHVA 3TRIA 1VBNA 2I4MA 1BJKA 3UJ9A 1ZZEA 3WNDA 5BMVB 4A15A 1YVPA 4NHEA 4DA6A 3COWA 4KE9A 5BOSB 2YZMA 4K6MA 1AJEA 3BZUA 3DCYA 2PS3A 3ELBA 3F7NA 4QYSA 5DBEX 3V7WA 3ZWPA 2W6QA 4BNGA 4CUZA 1O96B 1YQUA 3DV0A 4YACA 3WGIA 1ZINA 3UAXA 1N6NA 1EGMB 3KQQA 5IG2A 1DCMA 1E60A 3P8ZA 4C4YA 4CL2A 1O7JA 2PCJA 3V1MA 2ZUSA 1LK7A 1FNBA 4MW5A 2ERYA 4Q15A 3GCWA 3BMOB 1S7GA 1BD3A 3EHDA 4J6FA 4RCVA 5DZSA 1XVTA 4HK4A 5JG7A 1EJ0A 2J9FB 1HLDA 2CJXA 3CNEA 1Y8QB 1PR0A 4LZZA 1KJYA 1X9IA 4D8XA 4BRSA 3HC7A 2R8RA 1UDAA 3HUTA 4BMCA 2X13A 1TYBE 3KFLA 3OPMA 4ZOEA 2FWIA 4YRAA 2POQX 1DSSG 4QYWA 3DOEA 3TLCA 1J5EB 1G5PA 3C5WP 4RSRA 2OCLA 2ZVJA 4G84A 4KACA 1PZXA 4UOZA 4YUZA 2OMEA 3V6LA 4UD2A 3VR6D 3H5AA 1TTQB 3PUHA 2EARA 4I3GA 2NOAA 2RGBA 3WP1B 4CKCA 1YIOA 4EG6A 1WVMA 2P4SA 3GDWA 1X7ZB 3SZLA 5JAPA 3QKSB 5JAQA 1XA0A 3TNYA 3VV3A 3WNCA 2NSJA 2O5CA 2PKQP 1TAUA 1GCAA 2HU5A 1TO2E 2OOKA 2KJQA 1JHQA 5LBIA 2XRZA 4UATA 5KDLA 1KOJA 1N2XA 3HYTA 1RSZA 1M10A 3OJFA 4GWKA 3RUEA 3TR6A 4ABYA 5JAOA 5IUNC 4H4DA 1W85B 2QJRA 4ZO7A 3AR3A 4LZPA 3ONEA 3W5BA 3Q5DA 1W49A 1AHNA 2LP4Y 1UJ6A 1Y82A 3V4OA 4FCTA 3WYDA 2BMEA 1G5FA 2HIMA 5DOZA 5HF5A 1NIJA 4MMXB 4C07A 2CY0A 2QRVB 2W9XA 1AVTA 4QOFA 2BEWA 3AUXA 4B83A 2GTIA 5JWOA 4C4ZA 3D5TA 3NTUA 4OBEA 3BWEA 4IFIA 4WI1A 2ZYRA 2C3PA 1O6ZA 1DXQA 1U0FA 2V6IA 2AOVA 2ZRIA 3MTDA 2GCNA 2WYVA 2ZSEA 3RHZA 4CTKA 4HL6A 3GGDA 4F38A 4G0NA 4R9VA 4EPRA 1AN9A 3LPCA 1DIRA 3IIMA 4F4HA 5KZMB 5EWMA 2Q7DA 3PC2A 1PJ4A 2N47A 4OXKA 5KB3A 3QW2A 5ECYA 1CUGA 3R7BA 4B85A 5JCOC 1RQPA 4FM9A 2WZDA 2HMSA 1GZDA 1V2HE 4FVTA 4RC9A 4Y9UA 2VC2B 1K5PA 1EIWA 2VSYA 5JCPA 5BQ3A 1KRXA 2ZBUA 2OP0A 5ALTA 1V7QA 2WVHA 3GT4A 4IS2A 2J30A 3M5CA 4OUDB 4WN9A 1Q21A 1C9MA 2WIKA 1O9BA 2AQIA 3IBTA 4CLOB 4DDWA 4ZHQA 8ADHA 4X54A 5AP9A 4CDNA 2DKNA 2PGJA 1CQJA 2I0FA 4QTXA 5CT4A 4YH1A 1CULC 5EMHA 1MJGM 3AERB 3TI7A 1X94A 3GP8A 1VJCA 2Z9BA 1WPXA 3BH6A 2H5JA 4RSMA 4P08A 4ZMBA 1LUAA 1NUAA 2VRBA 1XEWY 5BVHB 1Z4LA 1GSOA 1Q7CA 1TM7E 3LQRA 3VBEA 1NUPA 4YHHB 4KHPB 2CNLA 4Q1AA 4MLPA 3C3AA 1ZC4A 4XIJA 1XTRA 2OXTA 4V0LA 3NIFB 4FPXA 5EWJB 3FJOA 3O1JC 4MNTA 1S1CA 3H2BA 2ZSBA 3D0RA 4Q66C 4ZC1A 4RJTA 4CQLA 4BKQA 3URKA 2JKZA 4D9MA 4YPOA 4YDRA 3SPXA 4BFLA 2C9ZA 1XVAA 4JX8A 3ZWBA 3BL6A 1BHJA 5AUNB 1TM1E 1IQRA 4J0CA 1MTOA 1MBZA 1CUHA 4XLTA 5BW6B 5IABA 1OBHA 3AP3A 4HEHA 3AVQA 3REOA 1L5VA 1ZAKA 2H85A 4CM1A 1X8KA 1NIPA 4WNCA 3ZHYA 1TTPB 2MSCB 5KNBA 2GPYA 2O1EA 4ZHQF 2VP5A 5KQLA 3HFRA 3V5NA 3D31A 3B6ZA 4MLCA 3WBBA 4G0ZA 4JLOA 1L3CA 3KQNA 3WGYA 2OAP1 1E9BA 2Y9MB 3NHSA 3MWDA 1XZGA 2ALJA 4HVCA 5JS6A 4J7UA 3F74A 4CR7A 1PHPA 2WYOA 4NCNA 1PJ8A 1J07A 1PKEA 1VPDA 3IMCA 4IY1A 3C3CA 5AOAA 4D41A 5JZVA 2F48A 5KYGA 4BV8A 2F1KA 2FWJA 2AXNA 1G0OA 1U04A 1KJQA 2J9RA 1L5OA 1NMZA 3NT4A 4M8LA 2PL9A 1RC0A 1VPVA 3QITA 5AM5A 4Q9JA 1DIHA 1FNNA 1ZNZA 3JQQA 5HZKA 4B0PA 1JEQB 1TYEB 4EZEA 3AK4A 3RRYA 4BUJA 3ES9A 3DEAA 5EUQB 4PYOA 1UXHA 4TYWA 1Y89A 3LUKA 2NZWA 4CMEC 4BLWA 3K9FC 5LC1A 2QLTA 3FCYA 1Q95A 3LKZA 4PRYA 3UWMA 4D9IA 2ZIFA 1UBKS 4E2ZA 5DHFA 1CJKC 3AUAA 4OVKA 3RTBA 3EZNA 1UPBA 1R66A 1UKBA 2AFHA 3PXUA 1G60A 1TLLA 3E9ZA 2D3WA 3NFRA 1DJPA 3OVMA 4TTQA 4CTMA 1V6AA 4TLDA 4B7AA 3GJTA 4QTYA 1AQUA 2II6A 4BLQA 3FYDA 1W36D 3ZX5A 1V37A 3NHAA 1VECA 1KI9A 4XYBA 3EF0A 3S68A 3SZ3A 3ZV6A 3BBPA 2AFIA 4FWTA 4R9UC 1VPWA 1U8UA 1TRKA 3DMGA 4PBSA 2H6EA 3HG7A 4Y8VA 4Z5XA 1M2WA 3ZU4A 1G3QA 3E5NA 1E63A 1FU7A 2GUWA 2WIGA 4MI3A 3UO8B 3DPUA 4DGSA 3L6EA 4GVPA 4FFBB 4K1LA 4EHAA 3GP5A 2HV8A 4GP6A 5AK3A 5T4BA 1HT1E 1BRMA 2AFRA 2X4IA 4ZT7A 1DBIA 1GAQA 2V6BA 4JH0A 1LJUA 4I4CA 1SCKA 4MYSA 1XPOA 2OYRA 5ARDA 3Q2OA 1WD7A 4X41A 1NC3A 1YBAA 3JV7A 1BWQA 1QC5B 1T1GA 2AW5A 3ACCA 3T52A 2BLNA 3HRKA 1GTMA 3AETB 2FPRA 2BFBB 1CHDA 5T3YA 3SM9A 3UZUA 2C7PA 1MFPA 1P7CA 3OCWA 2BH2A 1NYTA 2I4IA 1UBHS 3LHIA 4BN5A 4FTWA 3L6BA 2J4CA 3RG2A 4EF6A 1R4NA 2NX2A 4KWEA 1GZ6A 4YR9A 4QDJA 4HEA6 5HQTA 1KAQA 2GSWA 3MTAA 3WWPA 1SNYA 1P91A 6ADHA 2PR2A 2X2OA 1OI2A 4NZZA 5F5LA 2P30A 2HSEA 1CR0A 1JAIA 5REQB 2ZKIA 4M9ZA 4TMXA 5JLAA 1XTSA 3RF7A 3UKOA 3ZZ1A 1YNSA 2A9QA 5HKAA 2L18A 4DE5A 3S5UA 1F1JA 1BRTA 1Y4DE 2DU8A 4L72A 2H08A 2IHYA 1GZHB 3JQ7B 4XIFA 2OQVA 5A3RA 4Z53A 2VT2A 3VAAA 4R1SA 3VR1A 3GEBA 4JI8B 4EB6A 1C0KA 1MD9A 2ET6A 2GRUA 1W5SA 4EPVA 1YB6A 2AJBA 3BXGA 3IVXA 4BLOA 1YFKA 2H1VA 4GOJA 2R1ZA 5IS2A 2XI4A 1X8LA 3D2LA 1PKXA 3WHLA 1PSDA 4F9FA 1VSVA 1MGPA 4MDFA 2DBZA 5AVQA 2FK8A 2GEUA 4DLUA 4J6EA 3ZWAA 4UBJA 2XXJA 1VMIA 5GONF 1A72A 1M2HA 4D79A 4LFCB 5EHIA 3M3HA 2L19A 3OTIA 1NJ8A 1OAOC 4OYHA 2ONKA 5KC9A 5FBWB 3TTSA 3UXHA 2JHGA 4UTVA 2YL2A 4M9SA 4QXRA 1PT5A 1J49A 3PXDA 4KBGA 3B1VA 1MIOB 1EP3B 3EMKA 3H1GA 4LMPA 4NENB 4E2YA 4AXBA 2HO5A 1K6XA 4AP6A 2IUSA 3D7NA 4ATNA 3UOAB 2WJJA 4ND5A 1YBVA 2R65A 4IHAA 4M1ZA 4M1EA 4PQEA 3HUFA 5IJAA 4LV6A 1NT4A 1OKKA 1S7CA 4D80A 1OV4A 5CG2A 1OROA 2ZSKA 3C39A 1GZVA 1R15A 2XNKA 3GDHA 3HDTA 4MA0A 7MDHA 1JVNA 3FDXA 1RJWA 3ASYA 1IK6A 5DYYA 2KQUA 8ABPA 1CP2A 2G9VA 2OCBA 1YOVB 5LLDA 1IHOA 4LNAA 1PNRA 4RJLA 3MYYA 4LF9B 1ZUIA 4E5KA 3EPHA 1JIIA 4WNYA 3CBQA 5BOSA 1G3MA 4H9GA 1Z2CA 3CUEF 4W7IA 5IK2A 1MENA 1XDUA 4KUHA 3NTVA 2JEZA 3U1BA 3M6MD 5TX7A 2W6ZA 3YASA 4W8OA 4H1VA 4CVNA 5FH9A 1MAVA 1RXYA 4GO1A 4DCNA 4ZV4A 1O6GA 2FPWA 3AEXA 4NBUA 1V25A 2O8DB 2R8YA 3FTQA 4W5TA 4D4IA 4PZYA 3C24A 4X00A 2ABWA 2XF2A 1R64A 3SJ7A 5DNWA 1YIDA 3KHSA 4P7FA 4JI3B 1FNSA 3UB2A 5HPYB 2JI4A 3I72A 5M3BA 5CGZA 2HYDA 1YQDA 4K5QA 4DW8A 1N78A 3CWZA 3QVWA 1P3JA 4YCJA 4B8WA 3G5LA 1GGMA 2V97A 3M6VA 4DBZA 3QKIA 2D2VA 1Q1GA 3JX9A 1SPXA 3E3NA 2O1SA 3T9BA 3MT0A 1D1SA 2AE1A 4E12A 5FUMA 4WVFA 5DM1A 2B83A 4QBHA 2FZWA 3CR8A 4PZDA 1X3LA 4DJTA 3EH1A 1OZFA 1E3SA 1YZVA 1SKAA 3AR5A 2CSXA 2AN5A 5K4HA 1IHYA 4GW3A 5K0FA 5FPQA 5BMVF 3ORYA 1XT6A 1JDBC 3R7LA 3RVOA 1EFLA 2D2IA 2HRQA 1DBWA 2OGTA 2WWWA 3QVVA 4NOMA 4QPCA 4EKEA 1N8KA 3QH4A 4WFJA 1OLSB 1M1YE 4BP9A 4ZCRA 2E5FA 4YLEA 2PFGA 2Z2IA 4N48A 1KEWA 1NLYA 2Q0SA 2ZRFA 3EYWA 2OT3B 3LIPA 1ONNA 3K0CA 3NH6A 4L9AA 2B0JA 2Y2UA 3CEMA 3P0JA 5ECWA 4JUBA 3KXLA 4B5KA 1CY4A 4H7PA 2FF7A 3NBYC 3GRRA 1B2LA 3P96A 3R20A 4OFBA 4ZZIA 5HUQA 4CLDA 5ADUS 4M7OA 1AQLA 1UXJA 1D4AA 3AR6A 4ZI7B 3L8GA 1RC1A 4DJDC 3PNMA 1E3EA 5H7XA 5B7PA 2WE8A 1T1JA 2DT5A 4A2WA 4NARA 4RK1A 2QTGA 4YI5A 3PQ2A 2CZCA 3PFCA 3DO6A 1AZTA 3EIQA 4RYDA 2Y1GA 3EXIA 1V5IA 2H7VA 5A0TA 1JHOA 3QPWA 1PJCA 1X19A 3FG9A 1BJTA 5AKKA 5FOVA 5JARA 1RZRD 4ZCIA 1XU7A 3QU4A 4JKYA 1QIMA 1J8VA 3ZE8A 3W8RA 3B1JA 4DXHA 4E70A 4FC7A 3MJHA 4G0QA 4DANA 5J23A 1LPBB 1C1YA 4J49A 3BCRA 3ME5A 2XXAA 1JSRA 2IGTA 4MVJH 4YJ2B 4NK4A 5E1MA 3R7AA 4G0MA 3TMYA 4GPZA 4IHQA 1M2JA 1MOQA 3WNZA 2P69A 1BROA 3HZHA 1GILA 2VPPA 4RK4A 3VHRA 4NDNE 1G8SA 5I51A 4PLPA 4LSZA 3O75A 4OUDA 2H00A 5CJ2A 1M3SA 2D13A 4F60A 4CZ2A 5JU6A 2QT9A 4OQMA 3LRPA 1YA4A 3K7EA 1MNAA 3KYDB 4WESB 4YIKA 5EJAA 4BX9A 4JLWA 3S5JA 1GPNA 3UYKA 2CUKA 1Q7GA 4KDRA 1SUAA 4INOA 4P31A 3STVA 2PUDA 2XBUA 4P32A 2AGVA 3AI7A 3MHPA 3NEAA 4IIDA 4BNXA 1L7VC 3A1CA 3T34A 1ZD5A 4NE7A 5BVHA 1WB6A 1OGYA 2A7QA 3CH7A 5EJ7A 2CDCA 2ZT5A 1ZN7A 3KR2A 1HFWA 5KNCA 1ZJ5A 2QX7A 2CEAA 1A5BB 2CD7A 2FEWB 2ZBVA 4OU5A 1HLGA 3F6EX 4ARIA 3T54A 2HKIA 3EIFA 2RGAA 3V8NA 2G8NA 2FW1A 4PX3A 4KITB 1HYGA 3S1AA 4BZZA 3WLJA 5AW5A 1FU8A 2JK1A 3H5WA 1AV7A 3PXEA 4UEWA 3QFCA 5ALEA 1GQFA 1QOZA 1I2MA 4W5WA 1U28A 2V1UA 3K53A 3FVQA 3NP9A 1XDBA 2WG0A 4DPMA 1ZUNA 1R4AA 2HLDA 2MMGA 4N8SA 1J0CA 5FTLA 4TN5A 3LCVB 4XVHA 4AS3A 2Z83A 2F6RA 5TQJA 5LNK1 2R7NA 2X8BA 4ZK6A 3MF4A 3DW1X 4IQFA 5CYFA 2BGNA 3TW6A 2HCRA 2MWMA 5K7SA 5U1PA 1DQSA 4RMIA 1X86B 1QWSA 4KPGA 1UKVY 4MUIA 1LPPA 1UOOA 4GSLA 3VJKA 2X58A 4GKBA 4V0KA 5EJ8A 2IIBA 3KSMA 3R41A 4GKVA 1W59A 4EO4A 1IJFA 4II3A 3KUDA 3D3QA 1OX4B 4FDAA 3RQSA 3VKFA 1RBZA 2IEGA 3IHTA 3CVOA 3PHBE 3JALB 1Y4ZA 3DLCA 1I3KA 1JKJB 5CRIA 4R1PA 3KC2A 4Y30A 4ARZB 4JJEA 3RYCB 3C1AA 3I04M 4CMIB 3KKEA 3NM6B 5E4JA 3KJZA 2KPOA 4TMVA 1RR6A 1GSIA 2CXTA 4LC0A 5H68A 4XWTA 3ZZTA 1CUUA 1Y5RA 3NHFA 3TQTA 4BMZA 3F5FA 4U1RA 5J4VA 4V1CB 2ZI6A 2FMHA 2ANCA 5AD1A 5JJBA 4J1SA 4OH1A 3W2GA 5FWYB 1QIGA 4JLJA 1FJ2A 1ADGA 1G2QA 1VFNA 4AP9A 4BNJA 5FPSA 1GPMA 4PVDA 2Q8PA 4NE2A 2JHPA 1RC8A 1QHIA 2P4EA 1PSWA 2L82A 3QWFA 5ALDA 1BYIA 1P1JA 1XQWA 3MUOA 4GL4A 1J25A 3IP3A 2WTMA 5FEUA 2Q2VA 3QNWA 4MYDA 3VI3B 2O2GA 1WJGA 4BNKA 2ZWOA 4IXMA 1VCNA 3ESBA 4HDMB 4N5IX 1YU9A 3DZJA 4LJAA 3TLZA 1T1IA 1F9EA 3M3PA 4TLAA 1SU4A 1C30B 2QJFA 1NRWA 2VZLA 2UYGA 5THXA 2GN1A 5G0WA 2D5BA 2Q28A 2IPOA 4PTYA 5JCJA 5C8YB 5CT9A 1UK6A 2FEOA 2FP4A 5EUCA 3RFXA 4K0KB 4D9KA 3V8QA 3KKMA 3IUMA 4NH4A 3FNQA 5ADVA 2WJHA 1ISPA 1H4VB 4HGNA 2R47A 1CZKA 4OHRA 4WQMA 4YUVA 5KTOA 2QG6A 4F9EA 2VSNA 4NBTA 2QGNA 1MF7A 2HF9A 2HX1A 4M86A 1BTOA 5GOZA 4MB2A 3IE1A 3V1NA 2VKTA 3DCJA 3VPXA 2QJOA 3AY7A 1Q0UA 4ZDIA 4LYHA 4LDNA 4CQMD 4IKOA 5KINB 3ZK7A 1P62B 1E6KA 2XUAA 3G49A 1NVEA 4R83A 3WLPA 4CPDA 2BZ0A 4XWKA 5AW6A 3IIJA 3HDJA 4X20B 4B45A 5A9SB 1VI2A 4DDKA 4TTJA 1K6JA 1T0JB 2JAOA 4R16A 1QC5A 4LYJA 3LC2O 2B1QA 3DZHA 3LW8A 3RVNA 1FYVA 2FY8A 2ZYDA 2W70A 5DO9A 5LL6P 2BGUA 3JWJA 1SUPA 1B2RA 1FYWA 4QHTA 4QVIA 2O3RA 2YJ4A 4OI4A 5LPNA 5DN9A 4X6YA 5ITVA 2DKOA 2X0NA 4RTQA 3HXQA 1OHHD 1MH1A 2YRFA 1HDRA 3I5YA 4OHYA 3DPIA 3B53X 1O97D 2YV4A 5BWLA 1OXUA 4I1VA 3ZHZA 1OW3B 5IXYA 1DMRA 1SOWA 3MSXA 4XWAA 1VHJA 4MUYA 2G25A 5HF9A 2J5QA 1J70A 3JQ7A 2C3MA 1ZHOA 1Q7BA 4LKRA 1AS0A 2QNBA 5BN1A 1S2IA 5HILA 1N6RA 3TKLA 4MDYA 3GROA 3W05A 5IN4A 3UXEA 2CXOA 5G1PA 4DQLA 1VGRA 3I05A 4MV3A 4BMOB 3L43A 4HNHA 2OHGA 4AF6A 1XRJA 1DO8A 1EUQA 2GN9A 5K09A 3UNXA 7ABPA 1K97A 2H1HA 5ILOA 2YXLA 4ZZ2A 4HWOA 3Q4GA 1VJ5A 4EO9A 4H35A 3B3QA 3UFXA 1L5KA 3IS3A 1SUDA 2C78A 5F78A 4ON9A 4QPZA 4DDHA 1BWSA 2GK4A 3ZE9A 3H2HA 5JCXA 1Z63A 1QQBA 1XTVA 1W2GA 3SF8A 1JJFA 1G8GA 1JAXA 3AEQA 4KI0A 1AKMA 2ILVA 2J48A 2RIPA 1K9VF 1KI3A 2IEYA 2OXRA 1EJ2A 1R4ZA 3JWGA 1GO2A 4R84A 3ZHCA 1BIFA 3BSSA 1PGNA 2IX9A 4Y1RB 2VWGA 4DVGA 2A8YA 2EC5A 1MGOA 1M1NB 2HGZA 2IS2A 1T1SA 3RAPR 3VR4H 1NATA 2FYTA 3BF7A 3ODPA 4RBNA 2R60A 3DE5X 3OTHA 1QQ5A 2ZE6A 5LP6A 1KXJA 5E6RB 3GLHB 5E2BA 4AJ2A 1XXHA 3I2HA 4W63A 3WJ2A 1KETA 4UFPA 2OORC 5CFQA 1SN7A 1WF3A 3ZHBA 4BNIA 2UV8A 3LQFA 1GQRA 5KNDH 3RE1A 1ZI9A 2G0NA 3KPJA 4FW9A 4P33A 4TTTS 5ITWA 2QU8A 1ODFA 2X4LA 2PT5A 2AOTA 2IXFA 1E5VA 1RXVA 3VX4A 4RVSA 4B1FA 1K6EA 2OBNA 2J45A 4XDGA 5J40A 2ZWAA 3Q1LA 2AKYA 5GJWC 2GFIA 4UHDA 5FTNA 1NXVA 4IM7A 3FGOA 3NR2A 4IYRA 1TIKA 1X1BA 1CNMA 4UU0A 1JZSA 4ZEWA 3RJZA 2O8DA 2NO9A 4JBXA 2ORYA 2RHHA 1X1EA 2MSNA 3HUUA 4OHMA 4QG3A 3W9BA 1P9RA 6Q21A 2BSQA 3G8DA 3S2FA 3PC8C 1WHTB 4EEXA 2CVPA 1KSGA 2FVXA 3U3KA 2HU8A 3AINA 3ZIDA 2YQ4A 3CCCA 2O0KA 5EJ5A 3AEZA 3KEOA 2DXIA 5J1SB 1UFKA 1MMFB 2XYHA 2WABA 2ZJ1A 1R0LA 3GMDA 4D9JA 4E13A 4LQDA 2I1VB 4Q1EA 3OCUA 1X38A 2X1MA 4R8VA 2IE0A 3UMSA 4BFVA 2WYIA 5BNFA 1T3GA 2R8XA 5AHOA 2IZ0A 3QYPA 2X7XA 4AJKA 1QRSA 3R2JA 2XW6A 3STWA 3CEPB 3CKYA 4G63A 1IBMB 3FHTA 2RHMA 3S2GA 3KQSA 2X9LA 5JS7A 3MWGA 4BMSA 3E23A 1OU4A 1N5IA 3OPYI 3FY4A 3FPKA 4IQ0A 1OXKB 2VSOA 3ECAA 2BPOA 5B57C 2LVBA 1FBTA 1GD1O 2VP4A 2J4DA 3SYMA 4HRAA 3FYUC 1NX9A 2WJPA 4QE3A 5FKJA 1AV6A 2W4MA 5ADWA 3L7DA 5JY6A 5A2QA 5EIEA 4DNFA 5I7UA 2GD1O 3VO2A 4BX2A 1A88A 3FAKA 2P2LA 3QPCA 3AB7A 2BM1A 1N2CB 2HEIA 3PPYA 3OIGA 1SHLA 2B3DA 4MVJF 4RHFA 5LYJB 5KU1A 5EHZA 2A0KA 1NBOA 1D2GA 5LLSA 3AHHA 2BFFA 2ZVPX 3I62A 2VYNA 4P4TA 3CEAA 4LXIA 1SCNE 1K2VN 4FUQA 1T5TA 4QUGA 4XARA 4AS2A 2HA6A 2RBKA 2HWYA 3BYZA 4N3CA 3PGXA 1IZ8A 2NO6A 3W5AA 4DA7A 4GPEA 3L0IB 5EGNA 1ULUA 3D8SA 3PKIA 3LIIA 4PSAA 1QDLB 1W1WA 1M2GA 2YIDA 2YZ7A 4CIWA 3NATA 5I7SA 4FCCA 4IQ4A 4IPTA 2HA7A 3ASUA 2N75A 2F43A 4CDMA 5LWHA 1GN8A 3CISA 3L3BA 2RHCA 2BH9A 3EWSA 3NETA 4MUEA 4R7ZA 2OSBA 5TNXA 4AMUA 2GDZA 2MSEB 4YRQA 3WB9A 2Q4BA 1S2MA 1CS4C 3Q72A 3SC2B 1HT3A 4F46A 1MB0A 4YRIA 1NG9A 1GDDA 2XJ9A 3WQSB 3DXZA 1PV1A 3CUKA 6PFKA 1U8AA 4HGOA 4CEIA 3NAZA 3AJ8A 5MDHA 2XTMA 3EFBA 3I9MA 2OYSA 2XT6A 4WD3A 1ZCJA 3BQNB 3PDIB 4OFXA 5BSUA 4CGZA 2CVFA 4X91A 3WKAA 4AJOA 3DEKA 4NQZA 1RJ9B 3P4YA 2FSFA 3FOZA 4DWWA 1DEAA 3HO8A 3RC1A 3GLFB 5C1PA 1NYLA 3JTMA 4MWBA 4UM7A 3HO1A 1SIBE 1AOXA 4JR2A 4UDYX 1EK1A 3FLMA 1HZJA 1X70A 2BBOA 1YCDA 2J6CA 3A1FA 3AI2A 4ZI7F 4IFBA 5DKFA 3QKRB 5F9MA 4ZA2A 3C41J 3R23A 4C5CA 4XVRA 3RT7A 2BWJA 2AD1A 2IUFA 4GI7A 4RDCA 4XEHA 3RTDA 2A3NA 4F1WA 3EIEA 5FTWA 4NNOA 1BDBA 2IT1A 3JWHA 3A7EA 1E2DA 3F7OA 3IEXA 4RD6A 4ZVQA 2E4UA 4AMZA 4CTOA 4YUYA 3A2KA 3FM9A 3AZQA 4PX5A 4N7JA 4YAGA 2EYUA 2Q41A 3PDHA 2NXNA 4NJEB 4Q9HA 3ACDA 3UUFA 3UMYA 1FP1D 1Y1TA 3A36A 4YJ2F 3SHQA 4B2YA 5KKNB 3EISA 1KZHA 2BBTA 2AEJA 3JPWA 4O08A 3A4LA 4UBLA 1VHTA 3HJRA 4JLAA 2ATVA 4IWXA 1O08A 3T12A 4A6XA 4CKEB 1U0HC 4AX8A 1PF7E 4GX5A 3ZCXA 1DDIA 4AICA 2P9YA 3GRKA 2PRZA 4MR7B 4ME6A 1YCGA 2J3DA 1Q0PA 5ALUA 3GWZA 4RZHA 4Z2YA 1CTQA 4YA6A 4NG4A 1NQTA 3BA1A 2CDRA 5E1BA 5C1OA 4Q0MA 1OX4A 3X0DA 4AECA 3SJAA 4WFIA 4OKSA 3TW8B 4D8UA 1SGWA 1JKJA 1W47A 3DMTA 2ZETA 3TLGB 4DLSA 1WCV1 2VJMA 1DI0A 3WGZA 1E6EA 3KQOA 4JLUA 5AOVA 4BRUA 5KJ1A 1C0PA 4AKHA 4GOOD 4OMUA 3UMCA 2F8TA 1IDN1 3G8AA 4M1KA 4ZVVA 1KE1A 5FUQA 3DNFA 1DAOA 1J9EA 3NEJA 3S1SA 1E61A 3GC6A 2JJMA 3NEYA 4V1CA 4AZ0A 3SVLA 2QMYA 1N0UA 1NVKA 2DH6A 3N3BC 5FEMA 4LWOA 4FNMA 4NMLA 5MFPA 4DPLA 2BEKA 3HKDA 4JEMA 2Q6KA 2FKNA 3A37A 2A1UB 2ZBGA 3WLOA 5AHWA 3GLGB 2Q1TA 3HK2A 1OXXK 3QNMA 4EL0A 2AC4A 2XGJA 4D92A 3L79A 2VDUE 3CUTA 3DYIA 4MDHA 3VC1A 4DT1A 1KO4A 4HDMA 1T3TA 1XYYA 3IE2A 3MTIA 2P2NA 2IEZA 1D1TA 3EULA 1XQYA 3HN6A 4GLBA 3BN3A 1FX1A 1QJCA 4IIUA 5G1NA 1U0NA 4QPDA 1EWVA 4K9PA 2PTHA 2ID9A 1TI7A 1W5AA 2PQ2A 1SC6A 1YJAA 4CKCB 1OTHA 2Y1FA 3L0ZA 3L6CA 4P4NA 4AB1A 1GGNA 3IEKA 3T3IA 4BFXA 4EAAA 3U6KA 3R8FA 4M3NA 2C9MA 2G76A 2VF2A 3IH5A 4I2VA 3SAJA 1KAHA 3RM3A 3TECE 3FTPA 3T35A 3NO4A 5DGXA 4AWBA 5GADl 1XB2A 4MGYR 4MHTA 3IQZA 3SE7A 1S5PA 2JASA 4J1NA 3TEMA 2AN1A 1BCSB 3C8HA 4YJ3A 4CN9A 3NASA 2LDBA 4P86A 5LQDA 1W88A 3KALA 4RLFA 1GR0A 4UQPA 1F4LA 4HQKA 3FCCA 2BEUA 3K6KA 3LT1A 1TTTA 5FWXB 3DBRA 2IZZA 4KIJA 4OHUA 1L4LA 2XOKA 3DULA 2IE8A 1J09A 4BBAA 4AJ4A 2FDRA 2OFWA 3NDRA 3VV2A 1Z4KA 2X6RA 1JI0A 1CJUC 1V9SA 4XYLA 4R1LA 2FPPB 1I36A 5K8LA 2X3YA 1XZDA 1R37A 4LXYA 5FULA 1ZL0A 2NSHA 3OLVA 3THRA 1K27A 1EX9A 3H1AA 4REQB 4XCXA 3VO1A 5M29A 4KBYA 4ARAA 2NUBA 3NIWA 1E1MA 1W4RA 3JQAD 1DLJA 4B2PA 4X1KB 3OOWA 1NLUA 3EE6A 1ZH4A 1I2ZA 4QU0A 1YA8A 3IT2A 1HKHA 3M9LA 4KJXA 2C58A 1ZMTA 2ZPAA 5HVNA 2RMKA 2EHJA 1GARA 5C8YF 3K1AA 2D1TA 5T41A 2DFVA 1H0RA 1ZGHA 4RGBA 3R4VA 4CG2A 2K5UA 1JDVA 1U7PA 2RFLA 4IV0A 4M55A 2H18A 2IU0A 3GJ0A 1B6TA 4WWHA 2XZOA 3VYSB 3ABQB 2E87A 3K15A 1JMVA 4CUJA 1J5PA 1KPGA 1WO8A 4G65A 3NORA 1E9FA 1ZNQO 1Q1QA 4HX2A 3LQQA 3OQIB 2JB9A 3FTCA 4RQAA 5ALIA 3V6MA 1UZAA 5DMXA 3LLMA 3ZQUA 4A8JC 5IDQA 4MIKA 3SQLA 3WA6A 3GA7A 4BATA 3QJ5A 1QYDA 2C2BA 3OIWA 4MV6A 3RSHA 2W00A 4U8HA 2HC9A 1RCFA 3QVUA 5EJIA 5IDYA 2IWRA 3QRWA 3GZNB 9LDTA 2UXBB 1N2OA 2PPVA 2W58A 3EDRA 1KPHA 4DUPA 4JJ8A 3G1WA 4Y2QA 5BN3A 1S96A 2CBXA 2H4XA 2I5PO 3FBTA 3I0MA 4RPLA 3H6KA 5TT0A 3DJYA 1O4VA 3FD8A 1QXSA 2E89A 4BWYA 3LDGA 2PBFA 2NO0A 4BV2A 2ZIUB 1JHDA 3BERA 1DO0A 4WZAB 1TPYA 1ZH0A 2WT8A 4QOHA 2A6PA 2B8TA 2RHOA 1WTAA 3SOPA 1MB2A 5CXUA 2PUEA 4ZV9A 3PRJA 4IMJB 3VZQA 2GJ8A 2FOXA 4S0ZA 4UW9A 3GLHA 3TOXA 1ODTC 1CW2B 2I2CA 4L08A 2H52A 3IMKA 5FXMA 1DQPA 1RKVA 5EZ5A 3WIBA 4CQMB 2Q9AA 4OQQA 4DG9A 3T9EA 2WNSA 1VMKA 5JW6A 1JECA 2D3TA 4XR9A 3T5CA 1CUXA 4TMWA 3CM0A 5AKEA 1U7OA 3N75A 1P0CA 3NKVA 3WGHA 3THWA 3KDSE 4FEYA 3EXAA 4CIYA 5K6RA 3NUGA 4KQKA 1QIJA 3VNSA 5H8WA 1R6XA 4Q4AA 3V1LA 3NI2A 2RI6A 4JOSA 2VSXA 5K8CA 1Z6AA 2IYUA 2P2ZA 3X1DA 1CC1S 2Q4RA 2UVDA 2IELA 2XUFA 4GQBA 4KFCA 4AJNA 1JR2A 4BLSA 3PQ6A 1YWGO 5HMMA 3T7CA 3BFVA 3T7SA 3HSYA 1Z4JA 3GUVA 3OM0A 3DLPX 4II2A 5IT9A 5J5VA 3R1IA 2WTNA 1J33A 2ZI3A 3TZKA 4OV6B 4IJVA 1CLEA 1TGYA 4KQCA 1KIMA 4ZP1A 2FQWA 4A5SA 1BHO1 3LZDA 2FW0A 2YQ5A 4OXIA 3VBCA 4C6TB 2AXPA 1YS1X 1C1XB 5EWLB 3RD5A 3SR0A 3RYIA 2AG0A 1Z6QA 3N0VA 3UG7A 2DQZA 1FS6A 1TPZA 3DLIA 1BGWA 3II6X 4JFAA 3S4YA 1L7NA 5HJEA 4EG1A 3KZ1E 1GUFA 3DDZX 3E48A 4HUQB 2QHXA 4TYNA 2A1TR 3E5HA 5KYYA 5HKLA 2VHJA 2CLFB 2IY8A 3SICE 2PGXA 2RHGB 1ZSNA 1Y8AA 4ESHA 1JEJA 1ENYA 3IOYA 1VIAA 1C2TA 1QYCA 1RYZA 3NANA 1L4YA 1NRIA 1JAHA 2ATXA 2PR7A 4MUXA 2FXIA 5K99A 3TD6A 2QRUA 3CF2A 1KFEB 2R9VA 3S40A 4HS4A 3DEIA 1Q12A 3FF1A 3SCZA 3TRKA 3QENA 1FDIA 4BZQA 3ZJUA 1Z6ZA 4QPPA 5KDOA 1FQJA 2PX8A 4V24A 4B7UA 1R88A 2YYYA 2OQRA 2YHIA 5BSWA 1N2CA 1H5UA 2HMTA 3GYGA 4YN3A 1OSNA 1Z0FA 2HHAA 2KLHA 4EY6A 1CEXA 4GGPA 1NVWQ 1PLJA 3TG2A 1KPIA 5JJ5A 4OQZA 1DC6A 2HLNA 2AZDA 3D2BA 5L3RA 4E5DA 4ER3A 3FETA 3L8HA 5M34A 2Q2WA 4MQL