3O93A

High resolution crystal structures of streptococcus pneumoniae nicotinamidase with trapped intermediates provide insights into catalytic mechanism and inhibition by aldehydes
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
190
structure length
189
Chain Sequence
MTKALISIDYTEDFVADSGKLTAGAPAQAISDAISKVTRLAFERGDYIFFTIDAHEENDCFHPESKLFPPHNLIGTSGRNLYGDLGIFYQEHGSDSRVFWMDKRHYSAFSGTDLDIRLRERRVSTVILTGVLTDIVLHTAIDAYNLGYDIEIVKPAVASIWPENHQFALGHFKNTLGAKLVDENLNELF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords nicotinamidase
publication title High-resolution crystal structures of Streptococcus pneumoniae nicotinamidase with trapped intermediates provide insights into the catalytic mechanism and inhibition by aldehydes .
pubmed doi rcsb
source organism Streptococcus pneumoniae
total genus 70
structure length 189
sequence length 190
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00857 Isochorismatase Isochorismatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.850 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Isochorismatase-like 3o93A00
2WT9A 1J2RA 1NBAA 3HB7A 3LQYA 3O90A 3PL1A 3KL2A 3TG2A 4L08A 3TXYA 2A67A 2H0RA 3O91A 1NF8A 2B34A 1ILWA 3UAOA 1YZVA 3MCWA 4WH0A 1IM5A 1YACA 1XN4A 3IRVA 3OQPA 4L07A 3HU5A 2FQ1A 3S2SA 3O92A 3OT4A 3V8EA 3R77A 4H17A 1NF9A 3EEFA 4WGFA 1X9GA 3R2JA 3TB4A 2WTAA 3O93A 3O94A
chains in the Genus database with same CATH superfamily
2V0CA 1PSZA 1MX1A 3HWRA 5C8YA 4Y6PA 3O2QB 1DIAA 1ZU5A 3OQMA 5FB3A 2VLIA 2F9LA 4MI9A 1ISGA 3FB4A 4KC0A 3C1UA 4L0QA 1ZJWA 4Z53A 1QAQA 1C3EA 3AR3A 3RE1A 4UW9A 3W8RA 1PF7E 1Y48E 2FEMA 5AFSA 5TQVA 4OV6B 2CLOB 4YJ3B 3EPHA 3EZYA 2PBLA 1TEHA 1R6AA 3B1ZA 3HL0A 2C4KA 4PZ0A 5CCDA 3VC1A 4ARUA 1T6XA 1FYFA 1U0OC 5EJMA 3OT4A 5JMPA 3USCS 5E1MA 5DTIA 4Z3DA 4OD0A 5HPYB 4MQUA 4LRWA 4PVCA 2I80A 4CQLB 1MIOA 1L7EA 3U80A 3PCXA 5GP1A 1XKTA 2IZ6A 1EQ2A 2GAOA 4OG2A 4IYJA 4QIHA 3UWOA 1I5OA 3A3YA 5DK4A 1XCGB 4F2WA 2B21A 2P41A 3BF7A 3GWZA 3DKPA 2HPZA 4P9NA 2AQIA 5JZVA 3P9IA 4XAQA 5BSHA 3U0BA 4O2BF 1RC1A 1JA0A 2RI1A 3V48A 2EYUA 1O4WA 2ACKA 2ZYVX 3OURA 2IHKA 1E2UA 1YKSA 2HYDA 4F9FA 1R0ZA 4DSTA 2W8BA 3IEUA 3ZDEA 2I8CA 1M2FA 2JIOA 1IWOA 5KYVA 3LOPA 1ONPA 3ZTWA 1GXSA 4G41A 4MJ3A 5FUWA 3X2FA 4IP0A 2EX0A 5FWAA 3AHGA 4Q93A 3EMBA 2Y3IA 1SURA 5A7HA 3ACDA 3OOSA 1QQ5A 1PK7A 1TM4E 4Q1FA 4PY2A 3C3CA 1P2FA 3EXHC 1N6OA 1ZNWA 1OLUB 4U9HS 4WN3A 1Z28A 2V8BA 2YWGA 3V7YA 3DSRA 1IATA 1Q1AA 4L4ZA 2G6TA 1Q95A 2H1RA 3V5NA 4WZAA 2BEWB 2HC9A 5DBFA 4D3YA 3ROQA 5B2ZA 3A4TA 3ONVA 2A7QA 2I4RA 3K2EA 4AJIA 4DIOA 4ENQA 3Q1KA 2WJ4A 4PNPA 4DM4A 1C3VA 3WJ2A 4V1CB 4AICA 1QG6A 4NWIA 2CB9A 3Q7IA 1MABA 2R00A 1H3EA 1B8OA 3DDCA 1WPQA 1LBTA 3K0KA 3QJYA 4EDHA 1YFLA 1TMOA 1AJEA 1VM6A 2I99A 2VHJA 2PUVA 3TH5A 1M1UA 3KAPA 2DWPA 3GEBA 1WD5A 2V6FA 4GEGA 1ISFA 1WB6A 2XTMA 1KYYA 4MCJA 4KODA 4BP3A 1XK7A 1Y5LA 3ESQA 5SV2A 1UBSB 4GKKB 4QAJA 3STUA 4EEXA 4DV1B 5EVJA 1ECGA 1VMEA 3WMRA 4IY1A 4KXNA 2ASVA 3Q7QA 1HR0B 1B8NA 2LE0A 2VYVA 4MQ5A 1RVDA 2QMEA 1KO4A 5FBWB 4WI1A 2PQ6A 3GAAA 3L7DA 3OZUA 5JD4A 4AMUA 3BF8A 2ET6A 2X3UA 1P6XA 2C84A 3L7YA 3QVVA 3WI7A 2UZ4A 3A9SA 3UTDA 4B6GA 4E5DA 1DIRA 4KI7A 1VXRA 3K9LA 4UFPA 6PFKA 2MSCB 3ND5A 5TVKA 4G5XA 1T9GR 2I2DA 3H11A 3OFVA 4GVXA 2E18A 3ZTTA 5K4HA 4O4JB 1SVMA 2NSYA 5JPDA 2C0PA 1KXZA 2GARA 2I7TA 2VDWA 4M9ZA 1GUDA 2O7VA 4IUDS 2F67A 3IQXA 4R84A 3KSUA 4YMSA 1A50B 1CJKC 1C7FA 1U2PA 3PR2B 1XQ1A 5G40A 5JSZB 3QG1A 4Z7NB 1E64A 5EL0A 4XGNA 2HQOA 2QLJA 1VL1A 1IEXA 3AOEC 4O4JF 2KLHA 2EDCA 1ADCA 4ZICA 3ILHA 1QWOA 3EUAA 3A7EA 3KTDA 1KQFA 2IK8A 2FKAA 4LDJA 3DEAA 3ANXA 1FDUA 2CL0X 4OA5A 4Q9KA 3V7FA 3WYGA 4JYCA 1UBRS 2ZTLA 3RBAA 1P75A 2HNKA 3MBOA 4YLEA 4R1PA 5EWJB 1MO4A 3H1PA 5CPBA 1A8SA 2Y71A 4PFQA 2VYFA 1R9JA 1M0SA 1X8XA 2IZZA 3HFRA 3JZMA 4DIKA 5JDIA 1O96A 5LZ5A 3AHDA 3H5NA 1BHO1 1YC2A 1MC4A 1V47A 5EQJB 3N8DA 4AURA 1KFEB 4CCSA 4WY8A 4LJLA 1OYYA 2Z5VA 4HDNA 1E1QA 4LJ9A 4UZEA 3QVWA 5C80A 1L5SA 1ODTC 2C9ZA 2C07A 1EI9A 2HIAA 2ZJ6A 2G9NA 4DIDA 1KO5A 4KPEC 4DYHA 5HF9A 3KXDA 4DA9A 1FDVA 4OY3A 2B92A 1VSTA 3HMKA 1PUIA 1AUVA 4Q3LA 3ZV4A 3R6GA 4QNNA 3TCNA 3TZKA 4DYVA 5HUJA 4EVQA 1KR2A 3D4NA 3S81A 3QXSA 1E59A 5DXAA 3UXMA 4MUEA 5KWSA 5D3MB 1GZHB 1W0KD 3TJMA 3IIEA 3CINA 1UODA 1D4OA 4Z0TA 2C88A 2RHLA 3FAKA 1I6KA 4K9DA 3WLQA 3QTLA 4V3BA 2EKBA 4BKPA 3CT6A 3C3MA 3GRUA 3H8WA 3A10A 5LMNB 2XWSA 3UOWA 1F2UB 1C7RA 1W2WB 1IB0A 2DT8A 5HHTA 4GRDA 1ZN8A 1KAOA 2B6NA 2ZYUX 3JQFC 2IEIA 2VPIA 5K0BA 3L84A 3N8GA 4B3CA 1QE0A 2QS9A 3E03A 5A05A 4CM6A 1LB1B 3GLGE 5C3UA 2J6CA 3LXXA 3AM4A 3E3MA 4TLMB 2IKSA 4UHBA 5FWXA 2V0GA 2C0CA 1ISHA 1R27A 4WT7A 4Y9UA 1KORA 3MELA 3TXXA 3PJFA 1BS9A 3RVRA 1FDRA 1TVKA 3IJEB 1G2IA 1G20E 2XYVA 3LP6A 3SLKA 3T7RA 3FRJA 1SBHA 4RFSB 2Q7XA 4KMMA 3GW8A 4BJ1A 1RWNA 3QHAA 4GWGA 4NU8X 1S2LA 2W42A 1IN6A 2FZCA 2R0QC 4U3JA 3LYUA 4N40A 1AZSC 3KO8A 4MDHA 5I5EA 4KBFA 3W04A 2QRZA 4J49A 3QA3E 4HAVA 4XW2A 4R3UC 1U7ZA 1TFRA 4B40A 5LZ2A 1O77A 3PRJA 4RA9B 4EQZA 5FHRA 1PLLA 2VDOB 2WQZA 3IAM6 4PF1A 3ER8A 2BJWA 4EB0A 3GZ4A 4HQKA 2W9XA 3ZCUA 4CDGA 5B58C 4W5QA 1P29A 2E0IA 5DU2A 1E9FA 4LFBB 2PZ8A 1RBZA 4C1NA 3KZNA 2IYLD 5AMXA 1AGXA 1MB9A 1MT3A 3ACCA 3MCUA 2CXSA 4G5HA 3W8DA 4EUHA 5L4NA 4P34A 4M7OA 1RHRA 2FSIA 2XE8A 5JH7A 2H1CA 3SCZA 3A25A 2CMGA 2NSLA 4JQCA 2BM8A 3WZ2A 3FRIA 4B73A 3TK1A 1J1UA 3N7TA 4IW3B 2WAXA 3NAZA 1ID8A 1BH6A 2OP1A 2ZUVA 3E48A 5E4JA 3CYFA 5AH0A 2A8YA 2JIZD 2O1XA 5KJEA 3TR0A 4BNVA 1NR5A 1JMYA 3DE0X 3HP7A 4LI0A 2HF2A 4EQ6A 3ZHYA 4MQ4A 2VOEA 1T5SA 2MMCA 5C2JB 2F55A 1O6CA 3T38A 1KAGA 1Z7GA 1FFHA 1S2MA 3FUCA 1I51A 4GM4A 2CDCA 2XECA 5C37A 1WULS 3LO5A 4BB9A 5K8TA 4NS1A 1O95C 2GQ0A 3IALA 5HDBB 4DJFC 4DV4B 3LK7A 4ENPA 2B6HA 5EPEA 1C1YA 3QU2A 3LS2A 5ARDA 3ZD9A 1TF5A 3B9RA 4Q7MB 3O3CA 1JYEA 1KWKA 1NQOA 3I9OA 4FDUA 4B82A 4MRSA 1QS0A 2GJ4A 3COVA 3I9LA 1FSZA 2MIIA 2RIPA 4BBPA 4MEBA 2L69A 4PIVA 3GDWA 2REQB 3FBWA 5EE3A 2PX5A 1OF1A 4W9NC 1ZH4A 2A88A 1W88A 4DR1B 2VJMA 4BOYA 4UEQA 1E1YA 1KERA 2Z30A 3LXRA 1PBNA 3OPYA 4LNHA 4MKRA 3AHEA 4NCKA 1I2BA 1RADA 3JU3A 4PO1A 4BJ5A 5C4MA 5D5PA 3IUSA 4ZVQA 5DGDA 3OHPA 3TLKA 3L0DA 4M1OA 3VRHA 4L8WB 4CIXA 5A4MS 3I72A 2C2WA 4QUEA 2MWMA 2XRZA 1BS1A 1P45A 1U0SY 2GBLC 3O90A 1BA3A 3TTYA 3ISTA 4QX6A 4H7HA 4F9GA 5HKBA 4B4UA 2DR3A 2JK1A 2OGUA 3EPRA 4O0MA 1B14A 3LUFA 4DRYA 1NQAO 3NVAA 3OU2A 4Q9DA 4RIIA 2RAUA 3WO0A 4Z51A 3OQNA 4WK6A 5JE8A 4YRJA 1P3Y1 4LN1A 2FWIA 1LSUA 2QB5A 3ZQKA 3THXB 2AOTB 2Y9PB 4U7JA 1A5ZA 3EXHA 3AR5A 3NWBA 1O95D 1VCHA 3BRCA 2QAGB 2ZUCA 4L73A 3I01A 1RLJA 1WRBA 2WWYA 1RRMA 1P72A 1A9XB 3KTAB 4TKUB 3IURA 1B0AA 1M76A 2P62A 1UFKA 5JC1A 2MSDB 4PEVA 4URZR 1CS0B 1KYQA 3ZU5A 1DLIA 1PL6A 3E7XA 5AW9A 1PGQA 1WXEA 3AU8A 1OFUA 4QJ4A 3UJBA 1AMUA 3U4GA 5AI8A 4XYLA 2F8TA 3IQGX 1KDYA 4J2TA 1C14A 1K8QA 3GY0A 3WSTA 2Z6QA 4MTLA 4K3VA 2XNCA 1C9MA 1FYWA 1IBCA 5DBGA 4E22A 3NWOA 2CMFA 5BSWA 5J43A 2QUAA 1J42A 2X8BA 1KOJA 2CCKA 2GJ8A 1ADYA 3DCNA 2GLUA 2BT4A 2VYND 1GPDG 3ECCA 5D01A 2Q99A 3PX7A 1P7YA 2DUMA 2OHXA 2X5OA 1ZUIA 3FBTA 3J80A 1I3KA 5JECA 1KKLA 3FH0A 2CK3D 3NETA 3ZWBA 4X97A 3FBGA 2H7CA 1DARA 2WW8A 3TAUA 1W581 5KTYA 2FUEA 2QTRA 2KW5A 3H7AA 4CL3A 2Y8EA 3IJ5A 1ONOA 2H4HA 3E9NA 3WFJA 2ZSJA 4FDVA 4RK5A 1DQNA 3FHJA 1EK1A 4I8IA 1ZJJA 1KY5A 1M9NA 1QGOA 2F64A 2EX4A 3VYUB 1V5WA 2L19A 4U7DA 3ICEA 1BTOA 3JAMA 3DT9A 4D6PA 1E0DA 1EZ1A 3C4QA 4R4JA 2Q4DA 1ULBA 1KQOA 2PKEA 1FNMA 3KLNA 4K26A 4E6PA 1BKYA 2BLNA 2YV5A 4B79A 1W0KA 1WZIA 4Y2RA 1Q44A 3QVMA 2RIRA 1HYBA 1JQBA 1ZI8A 3HPRA 2FR8A 1UBFA 2JD2A 3VZQA 5FBQB 5IAJA 3UXYA 3GEHA 3FVWA 4JJ4A 3ESAA 4LCJA 5AVKA 2A9RA 3FMPB 2G88A 2IUFA 4KBYA 5DKFA 1E92A 5FNVB 4HDSA 4EYQA 3V4FA 4KPYA 3PDWA 4NAVA 4N48A 3AG5A 1VP9A 4YALA 3ETLA 4BS9A 1RZUA 4RLQA 3OLXA 5HDQA 5LBTA 3CG4A 1DBQA 4JC0A 3EQ6A 1PAUA 2BFEB 4XM0A 4UU0A 1RC0A 1CR1A 5H83A 1FNSA 1KH2A 2Y66A 4XE5A 3PE6A 2PX8A 1MOPA 2IIQA 3D2BA 4BGUA 1E2HA 1T0PA 3LT1A 1V6AA 3ZGLA 1DEXA 2EWVA 4Z5XA 4PC3A 2VTKA 5JZBA 4YPFA 2O8FA 1NVXQ 4HXGA 4MQFA 1KZ9A 2PFSA 4JFAA 3LP8A 2JGDB 3EDQA 1RXCA 3LW8A 2VNKA 1PFKA 1IEVA 1WF6A 2E4VA 3B2EA 2YVUA 3KEMA 3PDUA 4IYRA 2W4QA 5PGMA 3AUYA 3RF6A 2B2NA 4KGXA 3UKJA 4XWOA 3C1AA 4AROA 2R86A 5JZSA 2H9YA 3ZVNA 4WPGA 2EP5A 4GXNA 1L6RA 2F3RA 2FA9A 1P9LA 3V42A 3LRPA 1FPQA 4DIFA 4X7BA 3GA5A 4ND6A 1I5RA 3T1QA 2D1RA 5TB5A 1YI1A 5J4KA 4AS1A 1NY6A 3AFGA 3H75A 3GNLA 4YJ2B 4EA7A 3FHCB 2C61A 2PJZA 4KAXA 5ICMA 3DFMA 3NFYA 2O2CA 3RJ9A 1EJ6A 3KT6A 1DUSA 3IULA 4L9SA 1PL8A 1QQ7A 3LSYA 3L4EA 1JXOA 4RHTA 4RABA 3GO4A 5TQJA 4M0MA 3HDYA 1XQWA 2BEJA 1F0NA 3DLHA 2AJTA 4A0FA 2X6RA 3OOJA 1YZHA 1LPSA 1P6QA 4XFDA 3KUCA 1QH0A 3STHA 2C5GA 3JQFA 3OJWA 4AD8A 3U3ZA 3DFIA 1PJ3A 3T4PA 4E2XA 4GXRA 2CVPA 2D06A 5EPOA 1EAYA 1OIWA 3A9WA 4LJYA 4NEGA 4UEKA 3BTSA 2ZBRA 1EE1A 2JIZA 2LXNA 4HLUA 4QBGB 2PLNA 2DOKA 2ID7A 3IQZA 3T5AA 3NMUF 2QSZA 1NV9A 3FFTA 1DAGA 3AJAA 3IAAA 5AI5A 1I7QB 2ZIEA 1N1GA 4IV8A 4M1YA 4MWZA 3U1VA 4GOOD 2L42A 4Q9AA 4L78A 1G21B 4ER3A 4RPGA 2IIVA 5JHGB 3A4LA 3I04M 4J1TC 5ALLA 4QQKA 3TEJA 2QN9A 3I6IA 4YUWA 2LPMA 1BHJA 2I2WA 1BHQ1 1H9CA 2GRUA 5CXUA 2FW0A 4ES6A 4IPTA 2A5GA 3IP7A 3U1TA 4JI6B 2BMVA 2DHQA 2QRNA 3MBKA 1KYVA 4MW9A 5EHZA 1YE5A 3DVSX 2GZ1A 5LU9A 1RHQA 1V4BA 3PU6A 2CXQA 4PLWA 1VLLA 6Q21A 1GFIA 2H4FA 2IEBA 4JVMA 3FCCA 2I2XB 4RETA 1XKLA 1RS0A 1WBBA 1K6EA 1C8VB 2QN7A 4KIFA 1STOA 2OP0A 1SBIA 4DRXB 1T9AA 2Q6KA 3ZCSA 1BDBA 2IZ1A 2CKMA 2I03A 1SIBE 1MG0A 2VTVA 4HH1A 1JHMA 2IITA 3AI2A 3DAYA 3FFWA 3L06A 3KYCA 1UJ5A 4PNHA 5CCBA 4ZD6A 2XXAB 3IXQA 3W4JA 4K6GA 4XCQA 3ULKA 3C8ZA 2AWNA 4OK6A 1FDWA 1IMJA 4LY3A 2A59A 1C1XB 2XH8A 5LZ4A 2GJAA 2L17A 2Q29A 4QU5A 4OJYA 5HM6A 4IMRA 3ER6A 3PI6A 2DSTA 1ORIA 2QIOA 3R0ZA 2YY6A 4TWBA 4F91B 4D9JA 1ZM4A 4EH1A 5SY4A 3AWIA 1P7CA 5LP6B 1A9XA 5LMUB 2EU8A 1QH9A 4LRQA 1JS1X 2QDXA 1E3LA 2IEAA 1TT5B 1QK5A 2QD1A 3JYPA 1KNXA 3OCWA 1YZ3A 5L6LB 2C3UA 1H0KA 4A0SA 5KOJA 1EBBA 3WGKA 2P68A 5GGYA 5SYMA 1O95A 2H0QA 2DRIA 2BBTA 4IIBA 2I66A 4FC6A 4RIFA 4MB6A 5IXJA 4FC7A 1ULAA 3VXKA 1BRMA 1EE9A 2JA1A 3EIUA 3KV3O 5J59A 4RWEA 2JAUA 2HLDD 3RSGA 1EFTA 1ZJ5A 2BMEA 2UZ1B 1OFIA 4PV7A 2XZDA 2Q3MA 2DFVA 2WIDA 3KQVA 4BAUA 1VZ3A 4W6ZA 1T9HA 4JYZA 2VPWA 2FW9A 4AZ3A 4GPTA 1G63A 1HE2A 3D64A 1KK0A 3L6UA 2XE7A 4IJUA 4F7DA 1ODKA 2FP4B 4DNQA 2J4DA 4DMKA 1XYGA 5EKSA 5IZ4A 2IXTA 1ZK4A 1PSWA 5JFOA 1VE5A 2H7YA 1ZAKA 1T5LA 1ZKMA 4RK7A 3LYLA 1PV1A 4V02A 4II7A 1N8SA 3RHFA 2Z1DA 4FIDA 1X0VA 4KRXA 1Z2OX 4YCMA 2G1JA 4UE3S 5JWOA 2FMKA 1IBLB 3M6XA 4R8VA 3FD8A 3T5PA 1S01A 2VYNA 1WCV1 1T2UA 1LJLA 1GN8A 1XZKA 1GGNA 3D8HA 4KFSA 2GBLA 2GO7A 5CDTA 1I13A 3E4CA 3IPRA 3G13A 4D74A 1HBJA 5IAKA 4OP1A 4WXEA 3RVOA 4E1BA 3HR4A 3GJ4A 4J7XA 4O2BA 2AHRA 2CK3A 2BGMA 2JCBA 2FWNA 5DASA 1OY1A 2FPOA 3G2LA 2C98A 4HJRA 1RWWA 3C39A 1OU4A 4YB8A 4EENA 1LBIA 4QM7A 4FFLA 1JBQA 2E87A 1SVNA 3CWZA 4A23A 3BJZA 2NUAA 2OCXA 4GH5A 4K28A 3RFVA 5KU1A 2GXUA 4L75A 5F33A 5HEKA 4CFYA 5I8WA 2JK0A 1HQCA 4J7CA 3ED1A 5BOSA 1GTMA 4BX8A 2WWHA 1MP0A 1NT4A 4NOKA 2ZYHA 2FEXA 4NBWA 1RRVA 1ZGJA 1SEVA 1ZGCA 4ZDWA 1T3LA 4XB1A 3EQZA 1QCDA 4US1R 3TQIA 2I91A 4BMNA 2B99A 3F2VA 3UOGA 3ZDAA 3BWMA 5B2FA 1ECBA 1KEUA 3NHFA 4RM3A 5HFNA 2Z3WA 5EFZA 1LWOA 3OZEA 1YB5A 3QI7A 4FNOA 2H2AA 2OZLA 4ISBA 5DHRA 2QAGC 2ZE6A 2GSWA 4H16A 4BAGA 4CIWA 2BEWA 5I6DA 2VF2A 4RC9A 3HM9A 5J63A 3F4BA 1NUQA 3NBMA 1YS9A 4HFNA 3TYXA 4QU9A 2WU3A 4WN9B 2B8EA 3FZGA 1AY0A 2P27A 3PT5A 5HQ3B 5I48A 2WU4A 3OLWA 4U5QA 1SUPA 2FDRA 1KVTA 1PJLA 3LUGA 3FSRA 5U4XA 1DC5A 5AM1A 1QB7A 5ICEA 1U3VA 5A6VA 1DBIA 4OATA 1MOSA 1GPAA 3BWBA 2ST1A 3FMVA 3EXEA 3PFNA 4I8XA 5DGTA 3UG7A 4C6TA 3CPEA 1OI3A 2IGBA 4WZBA 1A9ZA 3QXXA 5HQJA 3ZCVA 4ZWNA 3SQDA 5K3DA 3IO5A 4CKYA 3HZHA 3VU0A 4BE4A 3I6YA 2PUBA 4IMPA 2A9FA 2YYSA 3DV2A 5GOZA 3ZS9A 4FLFA 1SOVA 1K7YA 1PNQA 2CY0A 1WX1A 3MTGA 1PVDA 1I4DD 4BECA 3HKCA 3ZWVA 2DBQA 2FMIA 2ZSUA 2ZUDA 4OQFA 4U7HA 1DJQA 4ZQIA 3A3PA 4LDAA 1NVEA 3KALA 4GI2A 3UFXB 4JQOA 1HK7A 2JFGA 3MOSA 3PXDA 3R24A 3AVVA 3UMFA 4FYVA 3GUCA 1RYYA 3C6YA 3KVYA 3H0CA 1VPTA 1XKQA 3G59A 3VHXA 2G9QA 2WSSD 1GSIA 4IH4A 1XPOA 4Z6KA 2AOXA 3GGJA 3O8OB 1ZX1A 2ZITA 1UBLS 3DZKA 4C04A 2BSQA 3G9XA 4QYMA 1LBQA 3O1JC 1H9BA 1YTLA 2WMNB 2B1GA 2WSMA 2JBWA 3VKFA 4OJKA 3IPAA 1C3XA 2W6JD 4GM1A 4PAWA 4HKTA 4E15A 3N0VA 3PWZA 2NUPB 1DCKA 2NO4A 4O4JA 3DZCA 4S04A 4M89A 1U2QA 2WE8A 1M2NA 3DP7A 4NK4A 5FTLA 4X7PA 3I6QA 2CC2A 3CEPB 3REOA 1SQ0A 3HCEA 2QN2A 3BUSA 4RAOA 3ZVMA 1P1CA 1JIVA 1IHYA 1NL3A 4TYYA 1FRQA 1RMTA 3QX8A 2OC9A 4G4JA 1DRKA 2YRFA 4EITA 5JSZA 2HJGA 4LRUA 4MNTA 4JP8A 6REQB 2QRLA 2YYAA 1MF7A 1DKLA 1YL5A 3URKA 3D4PA 3KWMA 3TQHA 4MHSA 1XTPA 3PZRA 1YJAA 2BM9A 3W2EA 1Z15A 5AM5A 4MMZB 1EVZA 4ZAZA 2CL7X 3WWOA 3E5RA 3OU6A 5TC4A 2C1XA 4DIBA 2C95A 3H0EA 1WOYA 1U8CB 1XP8A 2HQSA 2ENWA 2ZATA 3DUWA 1CY8A 1JHXA 1VL0A 3JQBC 3L0ZA 1E2NA 5EFOA 3F8WA 5EWJA 4DV2B 2EF1A 2SCUB 3STVA 1KJJA 3K1TA 3KSAC 3B5IA 3RJ5A 4J6FA 4BO1A 2ZXEA 1QJCA 2HL6A 5B4VA 5DNVA 3PRYA 2QP9X 5HZMA 1Q6YA 3HRHA 1PZMA 1GRVA 2BGUA 3D31A 5KNDH 1CQJA 2JI8A 2HA4A 3MA0A 4BVGA 4ZIRB 4RJLA 3LSTA 5L3SA 1TD9A 3GLGA 1CERA 2JVIA 2XYRA 1VMIA 5ITSA 1ZD8A 4LX8A 4J2HA 3R3HA 1KYZA 1I2CA 4RE6A 4ZT6A 3JWHA 1XD8A 3W5AA 2PNJA 5D3MA 1PJTA 3REGA 4E3WA 1DCFA 2K7FA 4YO8A 2VF7A 1G20A 1SPBS 4OAPA 4XVCA 3LC7O 1E1RD 4AJJA 4BQFA 1PTJA 4J1TA 4WBNA 5KPJA 3JZAA 3U61B 1CZUA 3O4GA 2DUWA 4HEJA 3K5IA 3PUIA 1WZNA 3C5HA 3EFBA 4HRYA 3UH0A 1C81A 1D1QA 1IBSA 4GL2A 1A71A 4RBNA 3DF9A 4DRZA 4UOEA 4RNCA 4QOGA 2F8LA 2XDQB 3PVCA 3HEAA 2HLDA 2FQQA 4GOXA 2LNDA 5KC9A 1I9CA 1VA4A 3HB4X 2YIMA 4XGQA 1DEOA 3MEQA 4OHYA 3KAQA 2YIJA 2O6HA 4KIJA 2J7PD 4RAQA 4NCAA 3C8MA 3T8YA 4ECAA 4G9BA 3AL2A 3AUJB 1H6CA 4R2MA 3I45A 2IL1A 4ANFA 4NJOA 2QQFA 2R6FA 5FWYB 2OD9A 3X43A 4YUXA 2CLKB 1O8BA 3QYJA 1CF2O 4LKRA 2HI0A 3DP9A 3GT4A 4IQ8A 2VSFA 4PYLA 4F5DA 4UAVA 4QHYA 4FSDA 3QELA 2GWRA 3VOAA 2P3LA 2BF7A 1DKNA 4NG5A 2YASA 2WZCA 1MD9A 3ZK9A 3CX7A 1MJGA 3EGOA 5J9FA 1XRQA 2C42A 5L6MB 1SZDA 4TTRA 3WV4A 4FYPA 5ECDA 2HZ7A 5ETJA 2A0XA 3UJ7A 4RA9A 2MHCA 1T8TA 4UXHA 1CF4A 3AF6A 2QY6A 4D4LA 1G4AE 1BCRB 2VSOA 1EB8A 1J39A 2W37A 1GFWA 2X0JA 3ADPA 3DVAB 2E9SA 3DEZA 3FM9A 3L7AA 4LHVA 4Q82A 2J48A 4MIKA 4W63A 4I9FA 4MLZA 1DTWB 1KDVA 1I32A 1U31A 4AU1A 4BVBA 4CKEB 4AKHA 3NV7A 5CYPA 1FTQA 2N42A 4O3MA 1ODSA 4N0QA 1XUOA 2VQ3A 2X15A 4YN3A 1BEUB 1MVLA 3L18A 3PQFA 4GUAA 2D5LA 2QM3A 5JSUA 3IHLA 3H5RA 2CEKA 3BH0A 4IDAA 4X71A 3VPXA 3OETA 1MO3A 2ZJ5A 2I29A 4DEVA 6GPBA 4ZT4A 5JVDB 3MJRA 1FNCA 2WB2A 4JS0A 4RHEA 2VH2A 1FX1A 2IOHA 2ZP1A 5I47A 4PHTA 2IEDA 2OCYC 3LBNA 3IR5A 2HEIA 1RMQA 5P8WA 1KJNA 1R0BA 5DSTA 3ENVA 4P5DA 4C30A 1N6IA 4FYJA 3RC9A 2VSXA 1P1BA 5HWSA 4D9EA 2Z5GA 2C1EA 1EAMA 1W5FA 2G80A 3QWBA 3OFKA 4O1HA 4NOJA 5B37A 4YRZA 4ZAXA 1U0BB 4GX5A 4Q01A 3SM3A 3KDPA 2AA3A 1ACLA 2JAHA 1CW2B 1Y8QB 3WRYC 1YR3A 2Q5CA 1JFTA 2C3OA 1OPXA 4ND8B 4PSAA 2Y77A 5CJJA 3TIFA 1JJFA 2XEDA 1JIQA 1XTJA 1I2MA 4FBMA 2BHTA 4RF5A 1IBKB 2A78A 1LPBB 1OBCA 4Z0PA 3BG5A 2ZCVA 3RRYA 3GIDA 3W3AD 2WUGA 1NRXA 4TV8B 4JEHA 1WKCA 4B2IA 4BIMA 4C78A 2CZQA 1UJMA 3R75A 5A9SB 1QVWA 2H00A 4UHJA 3WDMA 2J0SA 4NTZA 3IEMA 3SHFA 3GEDA 3PFGA 1GADO 1U9CA 4FXPA 5EE0A 2GXSA 4NZOA 3U81A 4K46A 3HXLA 4FB5A 5H3CA 3FHTA 2PXAA 1T9CA 2GN4A 3TI7A 2NVWA 3ME5A 5ITVA 4Q3NA 4TV8F 1UH5A 2QRUA 1JVBA 2WSSA 2VRWA 3OHMA 3SKXA 4NENA 1PR5A 3NHKA 1E6MA 3H9GA 3SX4A 5TJ9A 4GNKA 1BXRA 4ZRNA 5JATA 4Q5IA 4L6AA 1TM5E 2GMWA 3MQ4A 4QJIA 4B4DA 4U2KA 1G8HA 3CKYA 2WUDA 3I8SA 1J00A 1CNEA 2VTDA 2W6JA 2WF7A 1JSXA 1M8GA 1NJFA 3EZ2A 1RKXA 4LX0A 2BW0A 4TKUA 4Y0AA 3WL3A 1VJ1A 2NO7A 1CS0A 3GVPA 3LX6A 3ZHTA 2H1SA 4XB6B 3AI1A 3IAFA 3I9FA 5I9IA 2BD0A 5CTAA 2H4ZA 1RSZA 3VYWA 3DOUA 1IN4A 1Q6ZA 2F48A 1JH8A 3W2IA 1SOMA 1Z0UA 2IHYA 4KVGA 4P53A 4EJSC 5K03A 4LZZA 3F5SA 3G2PA 1OTYA 3GBSA 4EATA 4UUPA 2ORWA 1KVRA 2BYTA 4WACA 4A26A 1BJTA 3KP1A 1SD2A 2CHQA 1E5TA 4Q3OA 1CJUC 2H4YA 3LWZA 3BERA 4RCYA 1KZHA 3EVBA 1GVNB 3BXXA 3D0RA 2BHSA 4PZAA 5P21A 3V1TC 4EUNA 3H1FA 2HU7A 2F3TA 2IV7A 4A2CA 1H4VB 1OV6A 2V7QD 3GGPA 3P19A 4YLGA 1IK6A 1YKGA 4BEVA 4F85A 1M1ZA 2QN6A 3AETA 4FOTA 3SG0A 2HQRA 2IU0A 1KEVA 1KARA 5JJCA 3U4QB 2JAQA 5C7LO 4E1AA 2PMDA 2IE8A 1WQ3A 5K4GA 1HE4A 3UMYA 1MX9A 2C57A 2II6A 3GFTA 3OQHA 1E3WB 1E94E 1WUYA 1GHTA 1OFVA 3LX4A 3GEMA 5BR8B 4NYJR 1KQNA 3WC4A 3ADDA 4K6FA 4HAYA 4RJ2A 1SGWA 2NM0A 4GX0A 1CZNA 5J1TB 3SFVA 4HZIA 3T5GA 1A5AB 5ALHA 1N6LA 4MRPA 5CJPA 1SVWA 3UKOA 4D9IA 1QUEA 5A4FS 4ND7A 4O8ZA 4P0PB 3VR2D 1YZTA 5DYNA 3RQSA 3OM1A 3G6WA 5FUBA 1WCIB 5A5DA 3EX7C 4D9BA 5DTJA 1U2DC 3GRYA 1LLDA 4MGHA 3D59A 1M0TA 2R25B 4YCDA 1E1RA 2Z0MA 3N70A 2R1TA 4IX1A 4TYNA 1FU8A 1DEHA 1U2GC 2DPXA 3V4LA 1MXFA 1P33A 1N78A 5GY7A 5AP9A 3OMWA 5L8VA 4G8CA 3RUCA 4LHZA 4D97A 1OU0A 3F4LA 3TMYA 2Q5HA 5I9BA 3JYHA 3P4YA 3A1FA 2FG6C 4D4KA 3G85A 3G2KA 1MO5A 2IYEA 4YRMA 3JQBA 5DI9A 2Q1UA 1DS6A 3CY6A 3NS7A 4UAUA 3LWNA 3UMCA 1U3GA 5I7VA 4GGMX 4HWRA 3VSCA 2JGDA 1A8HA 3P2EA 2Y6VA 1R0LA 1R0KA 2WJHA 4AB1A 2WDPA 1SU8A 4WWHA 3LX5A 1Y6QA 3ZX5A 4Z4IA 3Q1LA 4HYEA 3QEBZ 1HNZB 4M7RA 3OSZA 2R1UA 4DMUB 3RC8A 4NCIA 1L5MA 5EXXA 4FE7A 3TLGA 1JLRA 1L7NA 4FLMA 4YX9A 2G3YA 1WU8A 3KQMA 4LYYA 4MUJA 4YAIA 2RDMA 4JXZA 2VKTA 1VLQA 2HIGA 4B4WA 4B76A 2ID8A 3E1GA 2NQTA 2PIAA 3EIHA 3ZI7A 1A4XA 5B7NA 3CKKA 1W4AA 2WYHA 1ZMTA 3U0VA 1BWQA 5F12A 4CG1A 4KQ9A 4F71A 3T7DA 1WB4A 2CMDA 4C1BA 3EC2A 2UV8A 1PQYA 3EISA 6NULA 1MORA 4MINA 1JEDA 3AY0A 3CF0A 7REQB 2EWWA 5EE1A 5AK0A 1VCNA 4JWKA 2ZAOA 5HP4A 4QGBA 3N5CA 2ZBEA 4A16A 3PI7A 3JYNA 4C0KA 5TE9A 4XSGA 4QBFA 2I4NA 5IW8A 3GLSA 3SHQA 3A7DA 3PEYA 3PGA1 2RGDA 1BE0A 4ENUA 2HF9A 5FV7A 2XVZA 4MZDA 3QBDA 2Y2UA 2WWVD 2P78A 3CZ9A 2HRDA 2HJWA 5ALFA 2G5TA 1MAAA 2FW6A 4B8ZA 4DUZB 3AIMA 5AKEA 3TLBA 2WA1A 4AFNA 1XVTA 3HU1A 3BVPA 1PBTA 1OZGA 3KJZA 4DQUA 5BR1A 3I5YA 2OBYA 2P6NA 5FCDA 1SBTA 1NPDA 4K0KB 4A92A 5CH8A 3B7WA 3FUXA 4RH0A 3QG5A 3UY4A 1J99A 1K66A 3EFOA 3JR3A 1J2TA 1KC1A 3O7WA 5L9AA 3DXZA 2VF5X 4YT2A 4N7MA 4BLTA 2PGJA 3UWKA 3BRQA 1ZN7A 1QYXA 1XNHA 1CETA 3QE3A 4Z9XA 5IBQA 3LVFO 3W8FA 5AUPB 1RWXA 4EFKA 4JUBA 1GPKA 2OZEA 2O5EA 4F3RA 3BMNB 3MD9A 3GJ5A 3SSNA 2FQ1A 3OBBA 3GT7A 3I1IA 4KUGA 4OKNA 4C05A 5B53A 4J07A 5A5VA 2CVFA 2C2OA 3C24A 4H17A 2GD1O 5I9LA 3GUUA 1UANA 4JZYA 3FCXA 3W3AA 3TSCA 2D7DA 1SOAA 1NZJA 3DM9B 2FSPA 1C1XA 1AIPA 1EWYA 1CK4A 4AJKA 5LD2B 3WGMA 5IWAB 2P1DA 2BZ0A 2ERCA 2QY9A 1T1GA 3WGHA 3OTOB 4YRPA 3UYKA 1E9AA 3ZWKA 3DFUA 1SD5A 1M5UA 1WW3A 2ZSAA 3I5MA 3LC2O 4Y7DA 4W8HA 4D7AA 1QTRA 1VCOA 2FUNB 1TT5A 2PIDA 1RT9A 5BN5A 1HYGA 4GZMA 2IPNA 4P0TA 4PYNA 1H2AS 2ZR7A 2QLMA 2J59A 2QW8A 5A3VA 1A9OA 1G5QA 4DLVA 4GMKA 1UT6A 1XZDA 3UJ8A 4G1CA 2HBQA 1Q0QA 4N5NA 5CUQA 4B7XA 2XA2A 1CVRA 2NSHA 2A6PA 4JSTA 1WMAA 3GGSA 4W8OA 1VLZA 1X77A 3GEEA 4X8OA 3T9FA 1UJCA 5JARA 5K8CA 2Q41A 1E8MA 2FSVC 3EF3A 2HJVA 2E4XA 2X1MA 5CEJA 4E0BA 4OX9B 4R2WA 2J6IA 1DFHA 4HAIA 4V0KA 3PZBA 2OKCA 4G23A 4HC4A 5EGSA 3U3DA 4BNWA 5C18A 3AX6A 4D0GA 5HMLA 2FP4A 5D6OA 2BR5A 3H1BA 4MO9A 4NCXA 2PS1A 3OICA 4UPVA 3IT0A 2UUCB 2CHUA 2UUPA 1B43A 5F1PA 3HCBA 1J8YF 4MR7B 4LGMA 3K8YA 2UZ0A 4HNTA 1H5UA 1KYWA 2FRXA 421PA 4X8HA 2QVBA 5FXMA 4U4AA 3ROFA 1UOQA 2O2IA 2MINB 4XTCS 1ONNA 3KPVA 5KNCD 4TLDA 3VI4B 1L8XA 3BN3A 2XTAA 2V7QA 3AYZB 3AF3A 2YWBA 4HFJA 4R2LA 4WVLA 5FL3A 3STYA 4YJGB 2Q4RA 2C4NA 3OZSA 4GU5A 4MR8B 3VU9B 1UKEA 2FWRA 4IINA 4OLAA 4BC1A 3K2BA 4NECA 3RIYA 4CEJB 5AI0A 4QZVA 2QU7A 1M2VB 2EDAA 2C3YA 2VP3A 5D2CA 3D4OA 1XWWA 2BFAA 1IZYA 2B4YA 1LA2A 3O91A 1WXXA 3CUTA 3G7NA 2GSDA 5BWLA 3K9HA 2BFCB 2X4IA 2WQ6A 1Z47A 2JH8A 2J6HA 4G0XA 4I4NA 1MB3A 1L5QA 5E9QA 2GDZA 4WK4B 3SR3A 5T8KC 3ADKA 4GRAA 3SEZA 5G3YA 4EHKA 4M9QA 3VR2A 1EP1B 4A2WA 4EW2A 4PN3A 3ROMA 3PIRA 4CKZA 2XCUA 1YHNA 4EJSA 1AKTA 3WIEA 1IVSA 5E95A 4WOBA 2VNJA 3UXEA 4MUYA 3FNQA 2XKKA 4GZ6A 3KQHA 4XB2A 4GQBA 3C1TA 1D8TA 3ANSA 3GPCA 5DWQA 5EIWA 5BQ5A 1QGED 2XB6A 2O4UX 2N0SA 4QTZA 5DMXA 3SLGA 1X1EA 2GD6A 2XUZA 1NN0A 5WRFA 2R5FA 4UE6A 3TSOA 3I4FA 4N3BA 2OXFA 5ES4B 4FS3A 4WN9A 2C8VA 2HU5A 1LBSA 3DR3A 2O1SA 1Y3HA 1EFUA 4GMFA 4KL8S 4AWXA 3OC6A 2PL3A 4E2ZA 1OJ7A 3ZJUA 2GYYA 3IMEA 4QJBA 1A7JA 1TM1E 1EGAA 1RPJA 2X42A 3AZPA 1IXSB 4KLNA 4O5AA 3RT1A 3FNEA 1MG5A 1QDEA 4KQCA 1G8AA 3R77A 4F8YA 3G9QA 3TO5A 1KBQA 1Y1LA 2ILVA 4OXQA 4MS3A 2B37A 5K0GA 2CHFA 1HV8A 1S4QA 2QJFA 5EMNA 3IAM1 4IO1A 1ZIPA 2G63A 4RU1A 3ICPA 3UJNA 1B23P 2JFWA 1O89A 5CIQA 1FTNA 1MX5A 3KR2A 5HIJA 2PVPA 2WPNA 2X7JA 1EVKA 3DMRA 1AQJA 4IUYA 4PONA 2VUTA 3UCXA 1NBOA 2ZSIA 3KXLA 4L15A 2ESRA 1U2DA 2ATEA 4IWXA 3PFWO 4KW7A 4JUDX 3O8OA 3U19A 5EEGA 5IJ0A 5L95A 2FUG6 3LPLA 1CJSA 1U2GA 1DHRA 1VMKA 4LYFA 1FU4A 1ZSVA 1T4DA 4YONB 5JSYA 4Q02A 3UJ3X 3ZE2B 4Q1EA 4PLCA 3DV0B 3YASA 4JAVC 3CCFA 3W9UA 2HCTA 3E5NA 3K20A 3RYFB 5FO0A 2NUPA 1NNSA 4EAAA 1EFDN 4CQNA 3H84A 2O3JA 2Y0DA 2YJTD 4RMGA 1D1PA 1GYQA 1EIWA 1T9BA 5SY6A 1GL9B 2WKRA 2FPGA 3E4DA 1XZCA 2SICE 3CXUA 4MEJA 3P7MA 4ER5A 2YUTA 3A26A 1CJMA 5FD8A 3I2KA 3FZNA 3OPYI 5E1DA 4H7JA 3G0OA 4ATNA 1ID1A 4FT4A 6ADHA 3A1VA 3CW9A 5F5XA 3KL4A 4X60A 1ZD1A 2P2DA 3OPXA 1SHUX 3BD8A 5JCPA 2IZ5A 3H5VA 4X6XA 4OH7A 4UCQA 1U7WA 3PB3A 1R0RE 5C7IO 3UJAA 1A9YA 2DWUA 2CUZA 2QQ5A 1XEWY 4DPLA 1XCJA 3AVXA 4M1WA 1PCXA 2I6QA 3JTEA 1GQRA 2OXEA 1SBNE 4NU5A 4J0EA 5E6UA 2PL1A 1RAFA 5EMMA 2AH5A 3OLQA 3NNDA 4W9RA 3VVMA 2SCUA 2AFIE 3ZXIA 1E0KA 3LUHA 3QVSA 3SSOA 5DNCA 3LKBA 1D9ZA 3TFWA 3UB3A 2BHNA 5THXA 1CX9B 2QTCA 1BDMA 2B4KA 3E2PA 2YBEA 4OK3A 2JLZA 2VBFA 5I7WA 4IEFB 3HB9A 2WM2A 2BUAA 1W85B 4FGUA 2W7TA 1U5AA 1CRPA 4AJEA 2RONA 3HSKA 3JD2A 4CETA 3U4CA 3K70D 1W30A 4K8OA 3H2ZA 2I0FA 4RKYA 1XF9A 1GGMA 1WMFA 3A0RB 2NAFA 3EEIA 3NDPA 3IPYA 3CIFA 4JLWA 4C4PA 3Q0TA 5LA6B 2VK1A 1NUPA 2HAEA 1GNVA 4GZ5A 3BJIC 1OIXA 2UKDA 2VLBA 2ZBFA 3B6MA 2HMVA 3V1NA 3T7JA 2VJCA 3THWB 5EJFA 2FOLA 2H9IA 2EFGA 2JJ1D 2R7KA 3BRSA 1V96A 1GNSA 3OG9A 1HF3A 2ANBA 4CR6A 1WXWA 1ODIA 2QG4A 4WQMA 4C0HA 2XDQA 5LA6F 2IPOA 3GUVA 4TV9B 4XPIA 2O0MA 4MDYA 2BUCA 1WXFA 2NTVA 2Y4OA 1JHZA 1JAHA 4X6LA 1DC3A 1P0FA 1THTA 1Q74A 3QOFA 1EGVB 2YHUA 1FP1D 4DB2A 1Y63A 4LTDA 3JQDA 4DA6A 2GJ9A 4DTIA 1SOWA 4G84A 2P7HA 4RY2A 4CMAA 3AVYA 1OV4A 4UD6A 4E21A 2N47A 2CL6X 3QTTA 2ZI5A 4TV9F 3UO8B 2B61A 3TW8A 2DGDA 2YIDA 3ZU2A 4EZBA 4FHDA 2RC5A 1BA2A 4TLBA 3NDBB 2ANCA 3HLYA 2E4AA 2ZFUA 2CBXA 2H4WA 5CDFE 3BH6A 5E6SB 1XQVA 4A8JB 2RGWA 2VPXA 1JNYA 4KFRA 5ERGB 3IP3A 5BVGA 5TPWA 1N6HA 4D25A 2QRHA 4RVDA 4XUGB 5AIBA 5KNCA 3K8ZA 4KQ2A 5CB4B 1XL0A 3GP3A 1XK6A 4J0CA 3AQIA 2OV4A 4YRFA 5DT9A 5FPYA 5EPUA 5GONB 1YFZA 3V00A 3D6TB 1H85A 4KWCA 2GLXA 2BBSA 4E5YA 1N4DA 2C29D 5K6TA 1BGWA 4U8GA 2I6XA 2OBBA 1T13A 2WHPB 2XMRA 1RCTE 3H3JA 3JAKB 1DTWA 1XPRA 2FYTA 2X8JB 4CKEA 4X44A 4F46A 2VJAA 5CB4F 4ALLA 4XX0B 3B1JA 1SCQA 3RODA 3IA7A 2D5AA 3FMOB 1UMCB 2XRYA 1G8MA 2B8WA 3G2QA 3DAPA 3MT7A 5AO9A 4G5RA 4S1TA 3SHWA 3UV7A 4KP7A 1J90A 4NZ9A 1I0IA 4UXIA 3TQOA 3SD7A 4EKDA 5DIFA 3A05A 1JNXX 1XWFA 4MPDA 5BUZA 5BN1A 2GF2A 1H94A 4NP6A 4AZWA 5LMZA 5EY5B 1TCCA 4J7AA 3DD1A 4RS4A 4RY0A 3ST7A 4FHGA 1J25A 2YFQA 3ZLUA 3RVNA 3ZLVA 4BPBA 5D5HA 4BO0A 2AG6A 3VR1A 4HY3A 2NZXA 2YXEA 3INRA 1ZAYA 1GZ7A 1T15A 2BJVA 3ETEA 3KKPA 1ZA1A 2W6CX 3K1AB 3LMKA 1NY5A 1V26A 1X7ZB 1ZHHA 3EQ8A 3QFSA 4IZHA 1JSCA 3TUJC 4D43A 4L7QA 2W0MA 3GN1A 2JDID 4I4IA 5JJKA 3GVHA 3P9SA 2ZQ5A 5K3FB 1QIFA 1XLWA 1DJMA 4XPZA 4HB4A 5JFGA 4IBOA 1GTL1 3HUTA 2OZVA 1L1QA 4DR6B 4BYGA 5CFOA 1GR0A 4ND8A 5K5EA 3QVGB 621PA 3QVKA 1PDOA 3DJYA 3TLYA 5HXAA 1E98A 4TTAA 2CVOA 2DUUA 5LKAA 1FUKA 5L3RA 1HE5A 1ECPA 3TTTA 3MTIA 1FP2A 4KMRA 5U1PA 1C9KA 2BTQB 3IUBA 2B35A 3OUZA 5AKJA 4FNGA 5T4EA 3O1LA 3BFVA 4BY9E 4TV8A 1BSVA 3TTWA 3DVQX 3OCZA 3GDHA 3QMVA 3AVTA 4AO6A 4I99A 5T8KA 4M0DA 2FK7A 2KX7A 1CEXA 3K6KA 1D6NA 1E9SA 3NNSA 1GNLA 4C7KA 4H3HB 1DBVO 3O9ZA 2BAGA 1U0GA 4W8GA 2VCHA 1ZSYA 2DHRA 2NG1A 4KGVA 3GD7A 2ASEA 5KTKA 3VPAA 1JJIA 3TRDA 3GLHB 4CW7A 5MN6A 5IKXA 4EGFA 4ARSA 1OWMA 1TAHA 2P9GA 3BXZA 3KOMA 3OZXA 1KO8A 2B9VA 5K0NA 1LY1A 3DKVA 1Q12A 4OKIA 3L93A 2Q5QA 1PDVA 4PZEA 1TLLA 3HKDA 4PPYA 3SMVA 5HZKA 4EAQA 2SECE 4TS4A 2AN5A 2WVAA 2YINC 3Q6MA 4RD1A 1CJBA 4U9UA 3IQDB 3P0FA 1JLLA 1ZDMA 1NSYA 4CKBB 2AS0A 2GVZC 2Z1NA 1ICEA 1KU0A 2WKWA 2WP8J 2TS1A 3B85A 3SYMA 4WXHA 2HWXA 3KBBA 1JKFA 3IR6A 4QGHA 2HMSA 2J0QA 1RPZA 1VG0B 3EY4A 3D7SA 1RQLA 2PXXA 1U0TA 2COUA 3TXAA 1NMZA 4R8MA 3BIWA 6LDHA 3IB3A 4OQQA 1U28C 1UXGA 4ZYWA 4PQGA 2BDTA 2HQBA 2QZPA 3RD5A 5CLJA 4J4HA 2EF0A 3D6AA 3PFBA 2HMAA 1OJLA 1GG9A 3QPVA 4BNJA 1TPYA 4E33A 3SZLA 3ICVA 2A0FA 3HE3A 3W5HA 4BQRA 1O5IA 2Z8YM 2WJJA 4EA6A 3DUFA 3DTYA 4M8LA 1JFFB 4JYPA 3SM9A 1E3WA 5LYJB 1UQTA 2ZBUA 1QIEA 3II6X 4M9SA 4R83A 3T9BA 3JYOA 3RV4A 4TKMA 1IJKA 4AWBA 1PWYE 1KI7A 2O59A 2OYRA 1YHZA 3E70C 1GU0A 3N75A 2ATXA 2Q62A 2GNAA 1GQFA 4BQIA 1V8BA 4ZDJA 3KJIA 1OA1A 1NE2A 3DMYA 2Q0QA 1P2UA 2VHVA 3C85A 3R44A 4OIMA 5CM8B 1HLPA 1OZAA 3WWPA 5LYJF 3M83A 4X95A 5JSKA 3WXBA 5KWEA 5LQMA 5B1SA 1SXJB 2NADA 4ZAYA 2OORC 3F3SA 5FWNA 3SF8B 1LK0A 1NXPA 1AQNA 2E4YA 3GC6A 1YK0A 2XE6A 1HNWB 3MB8A 4LK2A 1P2GA 1WUHS 2AVDA 1E7MA 2Y1GA 3FYHA 4FYWA 5HOQA 3CUUA 4L5BA 2JJ1A 4AJ2A 1TZ2A 3UUGA 5KOHB 3G1UA 1WL8A 1QTQA 1P9OA 1Y8AA 4QD3A 1LZLA 1Z18A 1ORDA 3PHLA 5HUQA 2RE8A 3N0WA 5CXXA 1QQBA 1K9VF 1NZDA 3PHIA 4Z9FA 3PK0A 2WKPA 3MERA 4GT1A 3AERB 1YASA 1P5ZB 2PRZA 4DADA 4PQEA 1BKSB 1LRJA 2X58A 1GKUB 5KYNA 4U2DA 3CVXA 1SKAA 3BIXA 3ETJA 5F1YA 3IQWA 4C06A 4GKJB 1DJOA 1RQ7A 1UBNA 1YRBA 1ADGA 1ZWKA 2JPDA 3WTCA 4PSDA 1I30A 2AW3A 4BN5A 1JDJA 1QFMA 4IIVA 3LVBA 5EESA 1E2EA 3N6RA 1V1RB 3NVMB 4IH9A 2ZI9A 1QV6A 2JFFA 4A36A 2Q4TA 2OILA 3CV3A 3ASZA 2F7SA 3EZXA 4KMSA 1PDWA 1UMDA 2YWCA 1ZKDA 4LF6B 5IC6A 2H5LA 3G8BA 3EEQA 4QBIA 3U7RA 1W19A 2BRUC 2D1SA 5K99A 3BK1A 4H3KB 4ALNA 4BB6A 1FFXB 1Q1EA 3JQAD 1GR1A 2Y4NA 1E3SA 1SELA 3CWQA 1O9HA 1O58A 2ZVJA 3KSMA 4HZUA 3O8QA 4MYTA 3SXJA 5LLDA 1NTRA 4RMNA 1U1FA 2Y0PA 5I8ZA 3WHKA 3PE3A 4AMGA 2IS1A 1EK6A 3SYKA 1TEXA 2NVOA 4PHGA 1J8VA 3NIGB 3JWJA 3RABA 3R9KA 2X7XA 2GFQA 4D96A 3IAUA 3JATB 4M2LA 5A3JA 1CDOA 5D3QA 1E1LA 3EOZA 4MV4A 1V9CA 5CIYA 1S2OA 2XBLA 4PPGA 1L8QA 4EYGA 5EWMA 1WHSB 2HMTA 4NARA 3IXLA 3ZJTA 2VNAA 3WMXA 3QPWA 2O8NA 3C3DA 1I4LD 1VE1A 2P11A 2QSJA 3IHWA 1BQ3A 3M34A 1EKXA 4FFPA 4EG0A 5LOVA 2XMZA 4L8GA 3H6GA 4ARIA 2NUTB 1N8TA 3G2NA 1EWKA 4TN1A 5AW3A 2XUOA 2HFJA 1L7DA 2HA3A 3ONWA 2IHNA 5FPSA 1D5WA 2ZRQA 1U81A 2C8LA 4KUHA 4OMDA 1TO6A 2PS0A 3B5EA 3L92A 1DGQA 3PGMA 3BMOB 3AV0B 4JLDA 4LISA 4C14A 4IZ6A 4P98A 2ZWIA 2JDIA 2QG6A 3RC7A 5LU8A 1TJPB 1BVHA 3QXJA 1YGYA 3PC6A 2P67A 3CMCO 5LBIA 3RG2A 4M1MA 4C29A 3VKHA 4K7JA 4AF6A 2NZ8A 2A1UB 4UMEA 1GAQA 1C9DB 3IR7A 4MV0A 2P69A 4JP2A 4QVGA 1DRVA 4XQGA 3AKYA 1UC9A 3T7EA 4Q48A 3ZHRA 1DDIA 3P0RA 4D92A 2YN2A 2P40A 4B4KA 5FA8A 4I08A 4BZZA 2C99A 2JCGA 2X2FA 2IZ0A 2QTVA 3QYPA 2EAUA 4MGIR 5EUQB 1XHFA 4ZVUA 1D6MA 2CWWA 1J56A 3ECAA 3EDRA 3BTVA 4UULA 2PWBA 2C4VA 4P92A 4WFQA 4KZPA 1UKBA 5DHUA 2VT2A 4C5CA 4BIIA 1TAQA 3K15A 1ZR4A 4DDKA 2Q5JA 2ID4A 3HA2A 3M6UA 4M8NE 3DG9A 1CJVC 3RNOA 1NWCA 1H8ED 3UMJA 2Q2VA 1WUIS 4MUKA 3ZGYA 4CTOA 3R9XB 3AFHA 1HTBA 1BMDA 1HYQA 3IPCA 4AKIA 3VJKA 1YS2X 3ZHSA 4EHDA 1G4UR 5C5CA 5KNLA 4UTZA 2V45A 2PH7A 3EXIA 1WAMA 2GHIA 4KJZA 1PQUA 2GEFA 1P1FA 2P9TA 3INTA 3NCHA 1UL1X 2GF0A 3RWOA 4CKWB 3M0EA 5JBIA 1H2XA 2FSUA 4Q34A 4PR0A 1Z5PA 2P2SA 1E9CA 2ODWA 1NF9A 3GMDA 3O8RA 4HDKA 1QIGA 3MJCA 5EYPA 2IBTA 5CDUA 2ZYWX 1CUZA 1XRJA 2N46A 5EINA 2DULA 2Q49A 2JEYA 1Z88A 2H51A 2QF7A 3TEFA 1G9SA 1CY0A 1N2CB 1ZICA 1MTZA 4NYIQ 4TMZA 4JGGA 5CLFA 4LZOA 5DTMA 4IUBS 1B00A 2ODBA 3L49A 1CE8A 1AHNA 5LP6F 3IE2A 1WV1A 4MQLA 4MR7A 3B8HA 2Z09A 1EXVA 4PBSA 3MAJA 4Q00A 4FHFA 5CVDA 3PFIA 2E48A 4OJTA 5HKLA 4BCDA 2HMUA 3C4JA 1AKVA 4YJGA 5FBZA 4BJHB 3RT9A 1N2EA 1UJ4A 4XVUA 5FA6A 2QVGA 1Q2UA 2HRRA 2YCBA 3OF2A 4H1HA 4J1QA 5HTKA 3WLOA 2Z5FA 1XTKA 4GS5A 5G4KB 3CS3A 3LKDA 4BE9A 3CX4A 4DNXA 5AKZA 4D9NA 1RKUA 2UUOA 2WF8A 1RI2A 3TMAA 1ZNQO 4B33A 2E5WA 3HM2A 3E15A 1XEAA 3MWLA 1G64A 4GMGA 3LT2A 1JXMA 5IDWA 1HSZA 2BFCA 2QJOA 2OGTA 4RIHA 4YAEA 2QMHA 1T5OA 3EVAA 4ZVTA 1P0CA 2GZ3A 3GLUA 2WWGA 4N3NA 2CSUA 3SEFA 5JSQA 3KR9A 1XA0A 3FPJA 2ZAMA 4K9PA 4AN1A 1EDZA 1RWMA 4YRAA 2BFDB 2PZJA 3FNFA 1PW5A 3GVCA 4GWLA 5D86A 1R50A 2ZRJA 1Y8CA 3OPMA 4PNEA 3CRVA 3CH4B 3DKKA 3ZYCA 3M82A 3UEOA 4O4IB 3NYRA 3E27A 3OTGA 2YR0A 4RTKA 1XZIA 2BGKA 4B32A 3RTGA 2W2QA 4MYSA 2OV2A 2PG3A 1U28A 4M4SA 3O0DA 3TZHA 2XB4A 4HAXA 4RE5A 3VUFA 4O4IF 3OE5A 1AN9A 2ZKIA 3C3EA 4I55B 1LNSA 4YGXB 3HPQA 3HXPA 1PFYA 2NZJA 4NI5A 4ZKEA 3CWCA 4XFKA 1M8JA 4GX1A 2JFOA 2EP8A 1FVOA 3AKDA 1EXNA 1PG5A 2D5BA 4K9QA 4ROSA 3DZFA 3M6LA 4OLFA 3VISA 1IIRA 1GIAA 3VC2A 2ZZKA 1JL3A 2WHXA 3GVIA 2JZCA 4HN2A 1EQAA 3AB3A 3D7RA 2H65A 1FLAA 3PD7A 3GEIA 4GHWA 4HAOA 2YY7A 2GAIA 1D9XA 3FOCA 3MRXA 4U2EA 2R6AA 3PXCX 1KSGA 4HVLA 1N1MA 1UDXA 2J45A 3TSZA 3LUBA 2IEZA 4LUCA 1GNQA 4A2QA 2R7LA 3IUMA 4LBYA 1E69A 3EVDA 2HDWA 1MOQA 4KPGA 1XHLA 4PLYA 4X45A 1GT6A 4ICIA 1CUCA 3H1GA 3HADA 5IAGA 1Z7WA 3JQAA 1ACMA 1XR3A 5ELLA 2BMFA 1IHUA 1HTWA 2H1WA 2I76A 2O2XA 2WD7A 2OORA 3L8CA 3IE1A 4HBZA 1KEKA 1VCIA 4FN4A 1EUCB 3HLTA 4I3FA 2OSBA 2AX3A 2LD4A 2PRKA 2A1TS 4PYOA 1H0SA 3DNMA 5FL7D 4BAZA 4DUPA 5CEEA 4QOHA 4LSGA 3RYFA 4LOHA 2BVNA 4JXKA 3VTFA 1FUUA 3E7FA 2VIIA 2YOGA 1LDBA 3E3LA 1OT3A 4ERXA 2NACA 4IR7A 5BRAA 2ZPUA 3G82C 3I9MA 2AFIA 4B17A 4RTSA 3P2KA 4WLVA 3VJMA 3FGNA 5AXDA 3OUTA 1W5SA 2OB2A 5A7FA 4FK8A 4OHCA 3B1WA 1ISSA 2POCA 1CJTC 4EFMA 4Q12A 4ZDIA 4J0JA 2C82A 3IHTA 5BT8A 2AFHB 1SXJC 3CC8A 3GK3A 1KIAA 4I4TF 2JHAA 1EZ4A 1LUAA 4JQYA 5LB2A 2EW2A 3V97A 2RHHA 2ODPA 2WTBA 3HABA 4QO8A 3BFXA 1VG1A 3RU2A 3U7GA 5FUYA 2WWXA 3OZGA 4YAWA 3W5VA 1VPEA 3REQB 4EHIA 4WKOA 5IDQA 1XZ8A 1E3IA 5G41A 3QE9Y 1JF8A 1M6WA 1TJ5A 4HQNA 5AW4A 1XMIA 4XCXA 2JFZA 2DQ4A 5JV5A 1N0VC 1KDZA 1R64A 4WJKB 3PIIA 4XVRA 4D57A 4LSZA 3HSSA 1YKFA 1U9ZA 4JB2A 4GBMA 4Y2PA 4CM4B 3EG9B 2IH2A 2HQ1A 5UKDA 3ZZ1A 4ITVA 1P5JA 4ZI7B 1MNAA 3H4TA 3A27A 5JLAA 3GI1A 3VUEA 1Y5RA 4YJFB 4BU0A 4YMHA 3RYCB 1V3QE 1RQRA 3CLUC 1E4EA 1H2RS 3QU9A 1GEEA 4MKZA 5JWHA 3TFQA 1K7XB 4KO2S 4BMDA 2GZRA 3K53A 3DE1X 1OYWA 2IU6A 3PDIA 3A6LA 3MIZA 1IK4A 1JECA 5DX8A 5K0ZA 3QUQA 3BS4A 3E0XA 3FX2A 3PPYA 2C0QA 3PRHA 4RWZA 1H4SA 2BMJA 2A0WA 1E8NA 1R9GA 3OJCA 3P5SA 3TM5A 4E4YA 1NQUA 3OPVA 4L6CA 1GPYA 2QX6A 3LL7A 4PZUA 3NO4A 1H8EA 3H65A 5BSUA 1JDUA 5F7JA 5LA6A 5F98A 1Z07A 1E5XA 1A2BA 1BMQA 2OM6A 3E1KA 1GFZA 3EIOA 5CT9A 3T41A 5K0FA 1KEZA 4KFCA 2JJQA 5ALTA 2YXDA 5IULC 1ANKA 3EGWA 5HILA 5CDFA 4M6WA 3V8QA 3ZV7A 2VQEB 1K8ZB 1UM9A 2PS9A 5F78A 3DD5A 3TKYA 2V8OA 4CKXA 1B6SA 2CUKA 2VQSA 1PE0A 2SHKA 2G5CA 4G0QA 2ZU0C 4TV9A 2DWCA 4ZVNA 4TWRA 4IDPA 1RXVA 2FE4A 3VKWA 4KXMA 1KI3A 1EFHA 4G86A 4L4SA 2WIBA 3PPXA 3SP1A 1Z7EA 4OHUA 1LC3A 1FYVA 2G9ZA 2H7VA 1ST3A 1N2OA 2LDBA 5AJZA 5ECWA 5AVUA 2SKEA 2G82A 2NSJA 5TVGA 5KCZA 5CDGA 5AESA 2GVNA 4TROA 1P3DA 4OHBA 4WY2A 5E4YA 2J32A 3T35A 3D3WA 3JARA 2WV7A 3I9V6 4R05A 4GZLA 1ZYUA 1TKBA 3RWMB 5IBCA 3WLPA 3R7NA 1R3DA 2NXEA 3TL2A 3KG2A 1QG4A 4NEQA 1WZUA 3ODGA 2Q3HA 4ZYUA 3G23A 4EB8A 5B6PA 5KOIA 1JHRA 1NVMB 3GAMA 3MN1A 4RGBA 3B12A 2R7AA 4JIGA 3WMFA 4QARA 1V7PC 2HD4A 3KVRA 2ZKLA 1SBQA 4B48A 1C9YA 4RACA 5MN5A 1SD1A 1A9TA 2DFKB 4WDQA 5EWLB 4YDHB 3HRKA 1IHDA 1VJRA 2OCIA 4ZC8A 2O8BB 1QB8A 2WHPA 1JVSA 1REQB 2P9CA 3G49A 4LJSA 4XWWA 1TU4A 3H19A 3ZWQA 1MV5A 1TLTA 4O0LA 1CTQA 3ASVA 1G8SA 1WSAA 1B8UA 1O9BA 1OAOC 4MMYB 5DN6D 5HKAA 1DINA 1BMFA 2WJAA 3P20A 2J9FB 2C4MA 3CZ5A 4D44A 3P0HA 4EEKA 1P8JA 3NHRA 2WI8A 2X2OA 3N58A 4RK6A 5TMBA 1LDNA 2J6BA 4NQZA 3HJCA 3V2UA 4F9EA 5BN4B 1U0FA 3ZKWA 1MAWA 1YRHA 4TMYA 3O2NA 3I04A 4FGSA 4P3YA 3QV2A 3RSHA 5E2AA 1DUVG 5BQ3A 3HBLA 1M2WA 3BMCA 4MKHA 2WAYA 2CFTA 3A70A 3E5HA 4RDIA 4BGDA 3L0SA 3OE4A 4NV3A 4UQOA 5EIAA 1C29B 2FPWA 2VBCA 3K1AA 2HSWA 3NHYA 1X7ZA 1WLYA 3N0TA 3K31A 4GE0A 1GPMA 3B3QA 3NHBA 4YCLA 4EMBA 4RDCA 1RAHA 4KNWA 4FINA 1ZIOA 1HT0A 2CDRA 3DZ8A 5K3FA 5LP6C 1KJZA 2C2GA 1U4OA 2W6OA 1RXUA 4N7JA 4YUYA 4H6PA 5BSKA 1C30B 4PS0A 2BMAA 3CCBA 4GPD1 4XM1A 4W7HA 3GLFB 4CMKA 1SRRA 2OZPA 2HH9A 3EUWA 4EFLA 3FGOA 1LPMA 1SQFA 2UXBB 2H92A 1LX7A 4HB3A 4FEYA 1W25A 1IQRA 1SZPA 2YN4A 5CFRA 3LM8A 2GPTA 1S8NA 5EP1A 1BDIA 2BDUA 1E5VA 3VGJA 1KMQA 5C4IA 1N7GA 1R4MA 4NULA 2YMLA 3FOEC 4IMIB 4ZOLF 4E88A 1TJ4A 3M70A 4DLSA 4WLNA 4IHAA 4LYAA 1H3NA 4IIGA 3SXUB 3X1YA 4JUCA 2HWUA 2OY0A 3B78A 1A5TA 3ASYA 3RSZA 4Y9DA 3GLFE 2WFZA 3R3XA 3WP0A 1KY4A 1SQSA 3TZQA 2ROQA 3Q9SA 1U1DA 1KE1A 3S2UA 3OECA 1QFSA 2FLVA 3FWPA 1KK1A 4IM7A 3PQEA 3EPPA 4LZWA 4PFKA 4AC9A 5B3JC 2QXTA 1J0XO 4JMPA 5FL7A 1U4NA 4GYKA 3TBFA 5EIXA 1QHGA 4W5NA 1RZRD 2G25A 3FNBA 4I81A 1L3BA 3D81A 2FFHA 3FTDA 2C03A 2DYKA 2W2LD 3NHUA 4J03A 7ABPA 3V4RA 3H4IA 2HIMA 1N32B 3DMFA 2YDXA 4PQRA 4F2DA 1YR6A 2VDRB 3MRSA 3B52X 2X86A 1JI0A 3AGPA 3H5IA 4G0MA 1P9NA 5IX8A 1G16A 1Z3CA 3KZ1E 4JU8A 3R7AA 4IDBA 4CKBA 4XQ9A 1XXHB 4NDAA 5CK5A 1TC2A 5CVCA 1T8YA 3VNRA 5KVCA 1KYIA 5HE8A 4H18A 1Z4MA 1SHZA 1GQYA 3KQWA 4PXSA 1XRPA 4KGDA 4P4GA 2WQ7A 2CJPA 5CK4A 7YASA 3DAFA 1CUBA 1EVLA 1NMEA 1IUNA 2RJNA 4BJ3A 2IH5A 2FFAA 4B5LA 4KPFC 4KDEA 1XC7A 4G56A 3ELBA 3A9UA 1FPMA 1T8PA 1WVMA 5F64A 3E23A 3L0OA 3Q0EA 4E5UA 2D5CA 2XNKA 4WCDA 2G67A 4XR4A 4M49A 1CY2A 2PD4A 3CLRC 4C0XA 821PA 1ZXLA 2XADA 3CX8A 1DOZA 1M75A 3TDKA 4CWAA 3HUDA 1M2OB 2R44A 1ZM7A 4EF4A 1XXHE 3S6JA 2EJBA 4Y1RB 3HJNA 3GRAA 5KSOA 4ZOAA 4EKGA 5K0EA 2IXEA 3IKLA 1RI3A 4PG5A 3EGCA 5ALOA 4GD3Q 5G02A 1M2GA 1UDCA 2RI0A 4EPVA 2WFLB 3EA5A 1L5WA 5EHXA 2VWPA 3N05A 1IONA 2GPAA 3AHCA 4P31A 1CG6A 1DQRA 4RHCA 5K0CA 3QFRA 3SVLA 4D26A 3OMLA 4DR7B 4DMHA 3DTTA 3BHNA 2GERA 4B6SA 1P44A 4PC1A 5HNKA 1T0BA 1J4AA 3E22B 4YCCA 4BO3A 3F1LA 4R16A 4F6RB 1ABEA 1V45E 1FXSA 1IN1A 4KAAA 4HDMA 2XMDA 4QPJC 1FNDA 1NUTA 1TYBE 1N9GB 2C4UA 1XMPA 1LKZA 1D7AA 1XHEA 1CZRA 3GPIA 3O8DA 4K6HA 4LBZA 4JJAA 1JQEA 2FE1A 3UA4A 2VTBB 1LDEA 1GZ4A 3F98A 3N2GA 3WNCA 2JFXA 1N4AA 3JCZA 5E9JA 4OBEA 4EKYA 1PR2A 4DC1A 4TLAA 1EFVB 3SS8A 1JQ5A 1RMYA 3D54D 3QVTA 1IQ0A 4JQZA 2HO4A 3CLRD 3SS7X 3AERA 3OFND 2QBYB 1W46A 3U49A 3K8QA 4DV3B 3ZE9A 1XPUA 3CUKA 2GH1A 2GT1A 4MW5A 1ZW6A 3TN7A 3VZBA 4UD2A 4AYTA 2RBKA 1K2WA 1BN7A 4KLAA 1MX3A 5TY0A 1TTQB 3EE6A 4CE6A 3A2MA 3ADCA 1E0JA 4ZJUA 4CQMD 1G7SA 5IDXA 3VSBA 1GWNA 5KUTA 1V2HE 1X3SA 2JAXA 3CVJA 1JE0A 1X15A 1K9SA 3M81A 4BMVA 1CP3A 1CUUA 1P5HA 1XV5A 4Y8VA 4DCNA 2AKAB 1L7VC 1F3OA 3I9KA 4OXYA 3PVZA 4O2AB 3GLIB 2DBRA 3DTVD 4Q03A 4ENVA 1NC3A 2OO7A 1NXXA 3WGVA 2O3QA 4H7IA 2HPVA 1Q0LA 1I7SB 1Y3BE 1DWUA 2HBZA 4RGQA 4RYDA 4MVJF 3HR8A 4LNUB 2BCEA 1XZMA 3BBLA 5HJ7A 4D56A 4TSRA 2QTZA 4ENSA 3RFFA 5ALQA 5KWVA 2R68A 2XT9A 2C78A 1OILA 2J0EA 1DTSA 1G66A 4ILEA 4OJQA 4BO8A 2JKVA 5IJ9A 1NIJA 2OT3B 4CG2A 5REQA 4P86A 5DN6A 2GR9A 4CMIA 2ECOA 1VJGA 4MWDA 4MVJE 3KZCA 5LQRA 2JVKA 2PTGA 1VRVA 4HK4A 3GLIE 1P6UA 2HHAA 1FCJA 4DG9A 4BC0A 1M0EA 3FE2A 2Y67A 3PQ3A 5E6RB 3VDRA 4AMZA 5IMSA 1G2QA 4LOLA 4M3NA 1KMCA 3KB2A 5H59A 5JJLA 4OI4A 1ORHA 2E7ZA 3V6LA 5KBYA 3TZLA 3A4NA 5HBRA 1VIVA 4AO8A 4WMLA 1YMQA 1LXCA 1C3OA 4L3OA 1FFEA 1SIUA 2GETA 3KYDB 1DG3A 1ZCZA 3JQGA 3QY0A 2HO5A 2C4HA 3PHJA 4U6QA 1THZA 2ODTX 2ZDQA 4H1UA 3D6VA 4CDRA 3O84A 1MRNA 1IY8A 3E61A 3KELA 4HWKA 2IP1A 1X1RA 2M2IA 3PHCA 1GPBA 3OWHA 3TTXA 5BNWA 5JASA 2WSBA 4MDFA 1UEXC 4OREX 2A1UA 1XDWA 2FH5B 1P80A 1BN6A 3B2QA 1CDZA 4PFJA 3OE1A 4KLRA 2IYYA 1PNVA 2XRFA 1S02A 4LMAA 3FB1A 2X1VA 4LMBA 5DSXA 2OWEA 4MPTA 3I01M 5BNTA 4TL6A 3U7EB 5DGHA 1N7JA 4B1FA 2VO1A 4FFMA 4IVPA 4PU0A 1GSAA 4KO8A 2Q6OA 3KVOA 1TZCA 4HEA6 2OLKA 4B87A 4KRYA 3IDQA 1OAOA 3AP2A 2XV1A 5HIIA 4R81A 2ECKA 4YXWD 1ZCBA 4U8HA 4FFRA 4EM6A 5E3IA 1QZXA 2PZGA 2FUG1 1L7OA 2CJWA 1QORA 2WAMA 2GN9A 2XX3A 4Q1VA 1NM5C 4AKEA 1RFGE 3LT4A 4UBIA 5JPIA 5L40A 3X1KA 1NRJB 2HWWA 2RGEA 4FZ5A 3NP7A 2NU6A 4M9CA 5A0VA 2YZMA 5CVTA 5KAPA 1UDBA 3OIUA 3SE0A 3R9XA 4XCVA 2IUEA 2V3WA 3MJHA 1XJCA 3AXTA 3DC7A 4P82A 3W77A 4AO7A 2AE1A 3CLTC 4D82A 2P9HA 3A9TA 3HJTA 3O75A 4M7PA 4ONEA 4QL3A 4QXOA 5KNBH 3W9BA 1ODCA 2W4IA 4DNOA 1RZRA 1D6JA 2O2ZA 2QP4A 2P6OA 1LVUA 5FPHA 5AM3A 1DBWA 2W2LA 4CI9A 4QPPA 4HLCA 4U63A 5LP6A 4CCYB 3O94A 3G2IA 3OLCX 3P2YA 1SQ6A 1XE3A 3V32A 2OOKA 1SCUB 5KYYB 3H87A 3RRBA 5CD9A 2WTEA 1TIKA 3ESXA 2BCJQ 4GDFA 3TLJA 4HPWA 4Y2YA 3FLAA 5AHXA 1Z4OA 5KJFA 1WUTA 3WGGA 1BQ4A 1U7DA 4QBHA 1XP5A 1EBUA 1Z82A 4FMBB 4FW9A 4N5LA 5CBPA 2UU9B 4COOA 1E9VA 1MIHA 1XZQA 3HU5A 4QYIA 5BW6B 3C6KA 3H42B 1RAEA 2B2CA 1HRKA 1R18A 1F60A 1KAMA 2YWXA 2EIHA 3NV9A 4GMDA 5IZCA 1N0IA 2Y0BA 3P9QA 5AXBA 2PT6A 4MSUA 3A14A 1NVTA 4ZGGA 1RJWA 5AVXA 3WK9A 4F96A 2QVYX 2FJ0A 1ZXBA 3BXOA 1PR0A 2D8MA 1JHYA 1QOQB 3FJYA 1P4GA 3FYSA 3I9JA 2ODNA 1J0EA 3ZXYA 4YEDA 1AKUA 1PZXA 3EW9A 3FHLA 3DBRA 3M4ZA 1KETA 3CLTD 2PGDA 1N3LA 2QZ4A 4MW7A 2BHRA 3NM6B 2K7ZA 2BELA 2P5YA 3P0JA 4LPSA 5B3JA 5T67A 2ODAA 8GPBA 1WY7A 1H1LB 2XXBA 3T1HB 4MH0R 5FBVB 4FKZA 1SIWA 1KE2A 2WKQA 3I92A 4YRSA 3Q8KA 4ZCPA 3UJHA 5KMGB 1N9ZA 4HGZA 3WLTA 1EM8A 2OCGA 2XWQA 1GLVA 1S1CA 3JQ8A 1TO2E 3OWXA 4B8YA 4CMEC 2FDCA 3KOXA 3DKRA 1K68A 2H1FA 3GLRA 1IE3A 1SVUA 2FZLA 3Q98A 3ZVRA 4R8SA 2PJRA 3NHMA 1CUGA 1K8XB 4JY7A 3DGFC 4L0DA 4BGVA 3LU1A 1ZITA 1ZM9A 3TSYA 4B3TB 1FMFA 4Z9AA 4O4IA 2B69A 1UUFA 3JS5A 4UTVA 1JSLA 4GC9A 1SA0A 3A32A 1FRVA 3HN6A 3IOYA 1JYFA 1PZFA 4X62B 1V6CA 1SVKA 2YOHA 3G2HA 4XTRA 1KVUA 3JQ9C 3WAKA 2PKCA 4I55A 4Q9JA 3ZCRA 2RBGA 3D1LA 3AH8A 3AFOA 4JBGA 3OFNA 3UMRA 4A1FA 4BVFA 3ZTYA 1F0PA 4YTEA 1L5LA 2OR3A 3ZNOA 1T8WA 1CRWG 4UJ3A 3WLRA 3CRQA 1AV6A 2D3TA 5H3LA 1U63A 4N3CA 2Z04A 3DLCA 1BVRA 3QWFA 4CQMA 1B0PA 3ZBQA 2EEZA 1U90A 4N7RA 1DC7A 1NFFA 2NYRA 3VPFA 3Q8WA 3DPUA 4IJVA 2I55A 3PJGA 4L4XA 4NQRA 3PA6A 1FDOA 3NKLA 4ZJPA 4AAYA 1ZZEA 4R9SA 1CUFA 1VOTA 3DTVA 1YDFA 6ABPA 3CH6A 4ZK2A 5EJ7A 5CYOA 3W8EA 4KR9A 2O3UA 1KS9A 3MGAA 3UJCA 3W0LB 2J33A 4MRRA 4XUDA 4DZZA 5AUNB 4LE2A 4KWHA 1Q84A 3J7TA 4F21A 2O0JA 3OH8A 3ORSA 4KYIB 4S1WA 2AG5A 2X40A 1WQ4A 4P32A 3WOVA 1FSFA 4OGWA 2JD1A 1GCOA 3L82B 3LGXA 3M33A 1RI5A 4TKVB 4C03A 4KPUB 4GAEA 1CLUA 2R8XA 4WRRA 3KU4A 4I4TA 1ZD4A 4QOJA 4X00A 4HGQA 2QRGA 4IQFA 2CFSA 1FFDA 2QX4A 4KO1S 2HM7A 2M6SA 2QTTA 3UN1A 3DBLA 1EXWA 4QEDA 3W1WA 3ZGOA 1M5RA 5LDDC 2GEUA 2NU9B 3HSYA 2CDAA 4ENRA 2ZDGA 1NNEA 1TAUA 3AC0A 4K05A 2ZRHA 1TYDE 3RS4A 2VJOA 4EJ2A 2I6TA 4FMDF 3S44A 5JBQA 2WG1A 4FUQA 3NGLA 5CX1B 3BZWA 4FYYA 3PSHA 4DDWA 5T7BA 4Q4AA 1GV0A 3WHIA 5DTQA 1SQGA 2WHRA 1GQ2A 3OOYA 4F60A 1Q17A 3PC8C 1QRUA 3QKSA 1WMBA 3QPAA 3LPAA 4EKIA 3WFIA 3T52A 5JYEA 2RGUA 3WNZA 1E9EA 2ZQZA 1QV9A 3B3GA 3FGZA 2X19A 4IKPA 2O2GA 2RHJA 3QEMB 4TTSA 3PT9A 3AB8A 1YS7A 5DX1A 5DM2A 5LNK6 2I6SA 1VIAA 3UT5B 2JGLA 1M10A 4YS6A 1EDEA 1PIWA 1XTZA 3O83A 1M1YB 3JSAA 4YJFA 3RYCA 3TD9A 4JASB 4KK4A 3DOFA 3QVXA 2JI7A 4MRNA 1SRQA 1JFVA 1L7QA 1WM1A 4W1QA 1XNJA 2G70A 2IW1A 4MWEA 4I4CA 4OXIA 4AF7A 1ORTA 4YXWA 4KXUA 4REQB 4URVR 5FPKA 1WXQA 1II0A 4URWR 3R0XA 1P5RA 4X9XA 5B1EA 4EO9A 1OOEA 1ZGHA 3R6WA 1M34E 4IMJB 4WL0A 4L3WA 1LBEA 3SAJA 5A0TA 3PBKA 3H18A 1WDMA 2I7CA 3PD1A 3NR2A 4AULA 1G0OA 1S7CA 1RLOA 3L8ZA 4D3DA 4TM7A 1YQ9A 1M1YE 1EVIA 2YHSA 2EG5A 2AHOA 3AMVA 3RVDA 3TNYA 2BFWA 2JNWA 1E6EA 4DM7A 3F3MA 4DJTA 1JIIA 1XQ9A 4ZVMA 4FJ0A 4OUDA 3AUSA 1R4AA 5AW2A 1KEWA 3M5PA 4KQ6A 3LBYA 5CLGA 3UG6A 2C2KA 2XIJA 2ZUUA 4G63A 5BN3B 4FIZA 2YJ3A 1FLNA 4FGJA 3S1AB 2XQJA 4FNAA 1ZH2A 2NTNA 1DB3A 3RFTA 4TL8A 2QQGA 2WP0A 3QX7A 4QOIA 3Q4GA 2CXRA 4RPJA 3WL8A 4G0WA 2V6MA 4FQ7A 3ZY4A 2OMKA 2ZZMA 1E2DA 1SUIA 1CR2A 3OKPA 4EHFA 2D2EA 3CVOA 1NYRA 2D3WA 4RSHA 2IEYA 1M33A 2ZROA 1NVBA 1SWWA 5JS8A 2B3TA 2WINI 3WKCA 3V3KA 1VA5A 2P9YA 1X14A 1YJQA 2NXCA 2OBLA 4MVJD 1NF2A 1KZYC 1XMXA 5BRNA 5AKGA 2CJYA 5MFPA 1JPUA 2VNIA 1FTWA 2VFAA 2ZT5A 3AESA 1OPRA 2HU8A 3FYUC 4JLAA 1MKYA 3FPAA 4TX1A 3BWCA 4WKBA 1YT5A 4F9TA 3U9TA 1NM5A 3A2NA 1DMSA 5AICA 3KLMX 1SG6A 1JXAA 2VEOA 3BD9A 1AGRA 4J16C 1G5HA 4NJMB 1RYBA 3GCXA 1Q7CA 3HNPA 4UUAA 5EWLA 5FOVA 3KB6A 2CNKA 5IH3A 4JOCA 1RW4A 1S3SA 5SYAA 4ER7A 2O2SA 1OI2A 1DSSG 3R0VA 3HJAA 4ILKA 4PM4A 4RH1A 3S4YA 3WKBA 1EA7A 1NATA 5JMOA 2P79A 2WT4A 3O5AA 5JCOC 1ETUA 3GUYA 4Q7EA 2B4RO 3QBVA 4C3OB 4IFTA 2F3PA 5BWNA 3M4NA 2CYCA 4QUGA 2UYCA 1FSPA 4ZYXA 5ALEA 1W1WA 1FYEA 1Y81A 2TMDA 1XZAA 3ZU6A 2JIDA 2ZBVA 1V2GA 3UWSA 2WILA 4PBTA 3ZZNA 2QUIA 1WTCA 1ZH6A 1IAVA 2EJCA 2I4MA 1BX1A 3LBFA 3WNQA 4W4TA 3UMVA 4EPXA 2WF5A 2BEVA 1POWA 1E3JA 1QFJA 2HOQA 5BN4A 4YAKA 1O94C 5AW7A 1A9QA 1FJ2A 4GBGA 4FQ5A 1X7YA 2V54A 1JTVA 4U5XA 3AZOA 2QROA 1WMEA 4H59A 2WUEA 3BORA 1L4GA 4RKQA 4UDNA 5JISA 2V97A 5ILGA 1W36C 1XVVA 2WR8A 3VNSA 1RPTA 1BXGB 5TPZA 2OCBA 3AHJA 1LTQA 2O8DA 3NH9A 3KR1A 4FGLA 3RRMA 3QKIA 3FWYA 3EWAA 3HCWA 1NAIA 1J7JA 3OTIA 4RDXA 1V9SA 1C30A 1QVZA 3BB1A 4Q7JB 5A0FA 1W75A 3D8SA 4QXAA 4EPYA 3GLFA 7AT1A 1NFQA 5TF4A 2XZTA 1T3HA 2MYTA 3VGPA 4BWYA 4PC6A 4MUXA 4ZOLA 4UHKA 3UANA 4FP9A 4DQ0A 3LDFA 1IY9A 2V5UA 4HRAA 5IM5A 2ZS8A 1DQSA 1EP3B 3NRBA 2JFUA 1PVVA 4FFBB 4LV8B 5AVYA 1ZINA 1XDBA 3IXMA 4JJ7A 2CV0A 3HS3A 4DCMA 3QU4A 4FFSA 2D1YA 3Q41A 4NOMA 1S89A 4IRMA 4YO7A 2WT8A 3B9QA 1OD6A 1KQ3A 1E1CA 4MLCA 4D02A 1BXKA 3RUIA 4AY3A 4CMEA 3WGJA 3LZCA 4RKFA 2BZ1A 3WK7A 4LF7B 2IS6A 1CU1A 3O4VA 1O94D 1N5LA 3DMGA 4CEHB 4HTFB 1U7OA 5FORA 5I8PA 2NTJA 5ENDA 4PO9A 1V9LA 2JFNA 2WAAA 1TJYA 4JR2A 5JMTA 1IXRC 3CSUA 3N2KB 1GYPA 5G0SA 5JHHB 1W36D 2DJ5A 3MWKA 1NASA 3Q40A 4N9QA 2VJPA 4DXDA 4CMHA 5DISB 1WNFA 5FT9A 4UTRA 1IM8A 1QG0A 1BKDR 3DXFA 3N2NA 1TC1A 1C4XA 1N57A 3PEVA 2OQRA 4JLKA 2FN9A 3WGZA 1S3FA 4JL6A 4UQPA 2IC5A 3F74A 5LZ9A 1HDYA 4PS1A 1X1SA 4PFSA 3IUPA 1EWRA 1F4PA 3F47A 4TWAA 1XXHA 4R54A 4BXOA 4Q1DA 3Q11A 4QUDA 4EW3A 2H0AA 1IM2A 3PUWA 1VSVA 4GOMD 1DC6A 4E70A 2Q2QA 3EBOA 4V0ME 4FD2A 2MJLA 4JLVA 4BGEA 4EB3A 5DNDA 4I6JA 2JZOA 2Q3BA 3AEYA 1JEYB 4JR1A 1ZW1A 4V0LA 5E8RA 3VU3A 4ER0A 1AM4D 5JXGA 4G65A 3I1FA