3BRWA

Structure of the rap-rapgap complex
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
336
structure length
336
Chain Sequence
TTKVKLECNPTARIYRKHFLGKEHFNYYSLDTALGHLVFSLKYDVIGDQEHLRLLLRTKCRTYHDVIPISCLTEFPNVVQMAKLVCEDVNVDRFYPVLYPKASRLIVTFDEHVISNNFKFGVIYQKLGATSEEELFSTNEESPAFVEFLEFLGQKVKLQDFKGFRGGLDVTHGQTGTESVYCNFRNKEIMFHVSTKLPYTEGDAQQLQRKRHIGNDIVAVVFQDENTPFVPDMIASNFLHAYVVVQAEGGGPDGPLYKVSVTARDDVPFFGPPLPDPAVFRKGPEFQEFLLTKLINAEYACYKAEKFAKLEERTRAALLETLYEELHIHSQSMMGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Rap-RapGAP complex: GTP hydrolysis without catalytic glutamine and arginine residues
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gtp binding protein
molecule keywords Rap1 GTPase-activating protein 1
total genus 78
structure length 336
sequence length 336
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02145 Rap_GAP Rap/ran-GAP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11210 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3brwA02
3BRWA 1SRQA
chains in the Genus database with same CATH superfamily
1HURA 3X2EA 1JQ3A 3BXXA 1YS4A 1DHTA 2HQ1A 1HT0A 3AZPA 3O8OA 4JBWA 1L5YA 4ZMRA 4K05A 3W1WA 1S8AA 5EZYA 2CXPA 3R3ZA 3VH1A 3K1ZA 3BMCB 1CD5A 1ESZA 4J16C 1PV2A 1VSVA 1MHPA 1RLJA 5JO9A 3VZCA 5FADA 4HS4A 1GPBA 2W2PA 4Y7CA 4N8SA 1RYDA 4OQYA 1Y4DE 3BHNA 4XYMA 4CT4B 3RC7A 3V4ZA 1EUDA 4CV0A 2QUAA 4KNYA 3P9ZA 5KDDA 3I42A 1U98A 2YV2A 3KLMX 2OMKA 3HBFA 2LDXA 4TUYF 4R1OA 5EP3A 2CLLB 1XWFA 2GHTA 2QUIA 2RH4A 4PNPA 5F76A 1C7IA 1SFRA 5J1TB 4MLDA 3UK2A 4OVKA 2GPYA 4QYSA 4Z0HO 5ALMA 3WGZA 1H2XA 1TCCA 3PL1A 3VISA 4ZCTA 2X0JA 5A5FA 2K7ZA 3A1DA 1A9YA 4P35A 1M1NA 5TXGA 1WMAA 2AI2A 2BF7A 2WTBA 3AFHA 2FFRA 4GZMA 4LA4A 3EZ9A 4XRRA 5EWJA 5K0JA 5EJ5A 1NMQA 2PQMA 3F5SA 3Q10A 4PTLA 3QVVA 2GZHA 4OJQA 1EFRA 1E3IA 3VC7A 1GP2A 4KGZA 4DCCA 3EEYA 2PUTA 3ABRB 4MUAA 1JWLA 3S0JA 2F6RA 3EOBI 2C4HA 4AURA 3QFRA 1QIEA 2J3QA 5GVRA 1SKBA 1GGKA 2B8TA 3FPLA 4N5MA 5KPJA 3IYLW 4TMYA 3VV3A 4X9XA 1YZVA 1KQGA 4DV5B 2ZJYA 1HDGO 1W2WB 4S0ZA 5DB4A 1KJIA 5EZSA 4AU1A 9ATCA 3P0FA 3GI1A 2VF4X 5CDHA 4CTOA 3FCOA 2QTBA 1O5OA 1VZ3A 3QF4B 4LXHA 3GRVA 4PPFA 2A0KA 3V7NA 1TM5E 3IGFA 1TKRA 3SQMA 1FE8A 2PWZA 1SCNE 5KKNB 4EHKA 2XE7A 4YMUA 1M34B 1QCYA 4P5EA 1K7YA 3GAFA 3CCBA 4G89A 3AEUB 4YP9A 5CHEA 2O2SA 2IWRA 4DBZA 3RS2A 4DDUA 1LJLA 2V7BA 1PZNA 2HHAA 2Z1DA 4N39A 5KS2A 1KO1A 2WKRA 4FZRA 3MT9A 5CDUA 2V7XA 2DP4E 1DX6A 3R24A 5FUVA 2Q4TA 1QZXA 4IDGA 3V3TA 2XTMA 6AT1A 1RJDA 5DBIA 3OUZA 4PHTA 1KHTA 1XU9A 2BJWA 3W04A 2VR1A 4CM4B 1AX9A 2FA9A 5HMMA 2R751 3BMNB 1A1SA 2AKAB 4V2UA 2GZ2A 4BTLA 1FNSA 3L7CA 5IYZB 2IS4A 1DV2A 1YONA 4JL8A 2PNFA 2VDWA 3VYRB 1TD1A 3RFCA 2I55A 3LT5A 3OBBA 1RLTA 3ZZ1A 3IKTA 4WNYA 1GPUA 6REQA 2GHQA 1VLZA 2VSNA 5C8YF 1H2RS 2RHOA 3G2KA 5DK4A 1E5VA 4KAXA 2PPVA 3EZ7A 5EWMA 1US8B 1FP4B 1KAOA 1V1RA 3LBNA 4PO8A 3N7TA 4JKIA 4YK7A 1TW3A 3GLFE 3BXZA 1FX0A 3SDSA 4TL9A 1CFZA 1M54A 1E8NA 4LPKA 1BSVA 2PM8A 3TOSA 5CJJA 5EXPA 3DKVA 3DE2X 2FP4A 2O0MA 5E2AA 3STVA 3CKYA 3UFXA 4BBPA 2ZYUX 3U31A 5HK9A 3OPXA 2VLIA 3OQNA 1IJBA 2G04A 3C24A 1XD2B 1HC7A 3RANA 4DCSA 3IP5A 4LFCB 2MWMA 5C1DA 2NIPA 1E9CA 5LQJA 3IMFA 4BVHA 2WVGA 4ARZB 4P4UA 4PFQA 2I62A 3RIXA 1WXFA 2PRZA 2QLJA 3ORRA 1L7RA 1T6XA 3E5RA 4HR7A 4X3PA 4DQ0A 3CV3A 4YRSA 2DHQA 2H85A 1CSEE 4ZAWA 2FPMA 3V97A 3UANA 1HG0A 4DIDA 3N2GB 5HDQA 2QQFA 4C7KA 5KSZA 5FWNA 1L4KA 5HM6A 5AJWA 1K75A 2QZSA 5HBRA 1VYUA 2J09A 4DGSA 3O0DA 5G0SA 3KFVA 3TZHA 3H2HA 1L7OA 5FOWA 3D7RA 4PBRA 4EBBA 4G4SO 4BFWA 4E4RA 4XVCA 3NDBB 4AJEA 1L5ZA 3SHFA 3HUEA 4PS0A 3P20A 1FIUA 2XIQA 1M2VA 1QGDA 1GFIA 1LS6A 2FSIA 2CB0A 3HN2A 5GPBA 4EYGA 3ZE6A 4D6PA 2ZRHA 1QKKA 4J2OA 5DLYA 2X2PA 1XZCA 1EVKA 2R60A 3TZCA 5KX5B 3WV4A 1RC1A 3NIFB 2QG6A 1HOTA 1E2UA 3TZLA 1GG2A 1QJ4A 3O3MB 5FOQA 1DAFA 4WI1A 4EUFA 2IEBA 2V3WA 2VT3A 1XTRA 2ETXA 1RLIA 2Q3FA 3GEEA 5KQGA 1CY0A 3GUCA 3M6LA 4KQIA 4YFVA 4X8MA 4CF3A 5DNVA 2G71A 1A8QA 3HVJA 1NI3A 1BWQA 2RHLA 4K26A 6PFKA 3U4QA 3TEMA 3SC3A 4KQHA 4JKYA 5IKEA 1XJ5A 1W75A 3P32A 1PT7A 4JUCA 3KPWA 2AFIB 1UXKA 1GQOA 1UM9B 3PXDA 1NBHA 2IHZA 2E4VA 2VT6A 1YJAA 5FI3A 1E2QA 2NOAA 3AU8A 3G1WA 4IRUB 2PGXA 4NBNA 3DZKA 1WQ3A 3GRUA 3GZNB 4QPJC 1XMOB 3LGXA 3PXUA 5JDIC 1E4OA 4HGQA 4DNPA 4OL0A 3LXXA 1A7KA 1G1MA 2PUGA 1AU9A 3O73A 1YNOA 2QX7A 1P4RA 3VHRA 3ZYCA 3JY6A 4C21A 2WJHA 2V7QD 1Y9JA 1ZXXA 1NLFA 3F7TA 1EFLA 2X77A 4ZEOA 2QT9A 3DV2A 2NO4A 4TSFA 2BGMA 2NAPA 4L0MA 4F9TA 5F1KA 1P0IA 3Q7RA 1F7UA 1E7SA 4M0KA 2WJAA 1YIOA 2ADFA 2O50A 4PWYA 4IIGA 2BFPA 4A9AA 2ZANA 3I92A 1BN6A 4X44A 4XM0A 1CHDA 2V7VA 4WL0A 1T5IA 4X66B 1KTIA 3S8EA 4D8UA 2C3YA 2C1EA 5JXIA 5CDGA 1JLRA 3UGQA 4NBUA 3LG2A 5JMOA 1Q83A 1YUMA 2OORA 4N12A 1HE8B 2VTDA 3BQMB 2O4UX 3EXEA 3I5AA 3PE4A 4R3WA 3EVEA 3VKVA 3WIVA 4OQQA 4ZI3A 3V00A 3NORA 1DX4A 1P4SA 1P1CA 3ZZTA 5JIBA 5L3ZA 5EXSA 3EEFA 4I08A 2I1VB 4O63O 4B3RB 2X8JB 3UENA 4YT2A 4E14A 3JVVA 3U3ZA 3GLIB 1YSCA 4NAUA 3HUTA 3I8OA 2QGZA 1JFRA 2ZS8A 1GLNA 3RRNA 5M2QA 1NW3A 4WGFA 2Y1DA 5A4KA 5BW8A 3QKSB 1W5EA 1NMSA 1PWHA 3ZE8A 3WWCA 5I7EA 1PJ4A 1P81A 2VH1A 3IIIA 5A6SB 1WP9A 4EYKA 5A0FA 1M8PA 4N0DA 1P7ZA 1LWNA 2J4FA 3COJA 1QP0A 1SU4A 3HN6A 2CXQA 1EGMB 4MGZR 4I1OA 2NZXA 1CJBA 3B20A 1I51A 1FDOA 1ADJA 1ZUD1 3G7NA 1E6EA 1SRQA 2QRLA 2VJPA 1N4DA 4MS1A 4QHSA 5EJ8A 2IEZA 2OYSA 4R40A 1EB8A 4Q9IA 1TMOA 2IYXA 1HNWB 4O1HA 2VZLA 3HJRA 2H63A 2O1SA 4IGKA 3THSA 1NYRA 1JMVA 4CUJA 4L1KA 4CKZA 5HIKA 1PBNA 2BAGA 1DIOB 1OLUA 2QI9C 3OQOA 1SUIA 1PLJA 3DT6A 3RYCA 3WLSA 3VV2A 5H59A 1A7JA 2WWTA 1ZI9A 3RHTA 4CDGA 1CDDA 2O8NA 2V6BA 1ATZA 5FNVA 3WYGA 5EKDA 3U1BA 3AFIA 5CA0A 3EAQA 3ZUGA 1PD1A 3GLHA 4YUZA 1Y4SA 3SOPA 4PG7A 1FXSA 3DE3X 5DX1A 5TQ2B 1L1FA 1U0BB 1HYHA 2NQTA 1QVZA 1ELOA 3FLAA 3K0AA 4EG3A 1WM1A 1A71A 2E4ZA 3QLUC 2FX5A 2ENUA 3DKIA 4Z53A 1LXCA 1ZESA 3BFVA 4P3KA 1VP9A 3MVEA 4URWR 5B55A 2HSEA 4MGIR 5KYXA 4KPUB 5ITVA 3D3WA 4F38A 1JIJA 3K1TA 2PGAA 3LLUA 2VWPA 4NX2A 1Q0ZA 1PEDA 2AMJA 3GQBB 5DTRA 4DR2B 3B6EA 2Z30A 4JLVA 5H0IA 3V8NA 4ZMSA 1O6ZA 2EW1A 3BULA 3BRQA 4MYSA 3JD0A 3OJFA 1X7ZB 3H1BA 3U4GA 5BWBA 2P75A 3AU9A 3U80A 1N2BA 2ATCA 2Q1UA 4Y2XA 3ZLTA 1M73E 1EVLA 2HU2A 3CNHA 2AOVA 2H2IA 4PEVA 1M5UA 3HJBA 1S89A 1SHKA 1YRYE 3OETA 1TM3E 3EPJA 2OO5A 3ROQA 2XYVA 4YLEA 3M6VA 4IH1A 1NRIA 3THRA 3OC6A 1GNLA 3TOZA 5GOTA 3O4JA 4HN9A 1AK2A 4S1NA 3DR5A 4LYFA 1XRNA 4NV0A 3RVSA 3K3PA 2ORED 2XCQA 2IQ5A 3ITNA 2PTGA 5DMHA 1QH0A 3X3HA 2GTPA 2RAUA 4FWIB 1OWPA 3CLUD 1BVYF 2PZJA 5CYPA 3NGXA 3OPYB 4YIHA 1KP9A 3ZN2A 3O21A 3LRPA 1YZFA 2A0YA 5ITZB 1ZGHA 2YYZA 1OWNA 3LUHA 4ICIA 4K3UA 5FLEX 1C0LA 1C9MA 1PQUA 1W4BA 5DYGA 3O1HB 2IKQA 4ZOBA 4MRVA 5I6DA 3P9YA 5JSFA 3PEWA 1E6WA 3MCTA 1NNSA 4RF4A 3OJLA 2HMSA 4JQZA 1I4OA 2YIDA 4XAQA 4Y0VA 3OE7D 3W8NA 1OZAA 4RZIA 2AG5A 2GYUA 4RTPA 2FLKA 2JFVA 1NONA 3B8EA 3B78A 1SXHA 1U8AA 3E3AA 3ORFA 5DOZA 4DA7A 3PUKA 3G9ZA 3HKDA 5JEEA 5GINE 2A5DA 2OD9A 3T3OA 4XGRA 2PLAA 2VK2A 3KKQA 3PKIA 1XDBA 5JMTA 3KSBC 3PHJA 3EHEA 4WK6A 3AUFA 1QS0B 2NLOA 3DMYA 4HDAA 4IKOA 1SUSA 3W7VA 3UKDA 5TIIA 5BQ3A 2VYCA 1PFGA 3RH0A 4J75A 4M9QA 1UOOA 1Y5RA 1O7JA 3ZE1B 2X8WA 5CB4B 1U3FA 2BZ0A 1W0JD 1YOBA 3OQPA 3GGDA 1LVHA 4C05A 4CEJB 3RE1A 4B7CA 3EPLA 3ER6A 3C7CB 3NT4A 4UTNA 1GYRA 3LYAA 4ZVMA 1OFVA 2QX9A 4GXRA 5FXMA 2P2SA 5JLJA 3NEAA 3F8WA 3TECE 2E55A 2VKQA 5HRUA 3KB6A 3VJKA 4LYEA 1ZSVA 3PD7A 4KK4A 1E9AA 3RYHB 1ZLYA 3TRHA 4KUGA 1PQPA 2VHEA 5IVDA 3RSQA 1MABB 1H0RA 1MOQA 3B6IA 2PQ6A 3FYUB 2XNKA 1BDHA 4KI7A 3NJRA 1XTSA 3K9GA 3OE4A 4KQ1A 2VNSA 1R0BA 2NZUG 2WICA 1R8YA 2ZT8A 3E1GA 3EBPA 4R0NA 4Y1RA 4YB8A 1Y4AE 2DPLA 3TJZA 3V4OA 1Z2EA 2QN8A 4TM8A 1SVOA 5I4IA 3USES 4IIJB 2QL9A 3DFIA 1P0QA 2AJCA 1Y8RB 4O2AF 4TQUS 2VXYA 4G4JA 3N58A 1QR2A 2XBLA 3BHMA 3DBRB 4L95C 4BQRA 3UMJA 1XSEA 2LVBA 4F9GA 5IFKA 1OHHA 2QV0A 3BRSA 1E3DA 2C97A 4GYJA 1OH7A 1HR0B 1C30A 1W5AA 3HYTA 5J63A 1FRQA 1BIFA 5JQGA 4IS3A 1QF9A 4P9NA 2HCJB 3NLLA 3RIMA 1D5CA 1FUYB 1SOVA 2ZETA 4TPKA 1V6SA 2HRBA 1UFRA 1PAUA 2V4ZA 3ZCTA 1GA4A 3VSAA 4TWIA 2P9YA 1NQWA 3DKKA 4EITA 1FPMA 4HDSB 2Z4RA 3PHLA 3QWAA 4EPRA 5FOXA 2ORVA 3RU3A 5K0CA 4FU0A 1OBVA 1J20A 1O2DA 4YRFA 2ZYVX 2HXYA 4GZLA 3QIAA 5CCEA 2W5UA 1FTWA 3IQEA 2HTEA 1X7YB 4ND1A 4IYJA 4PAOA 5JCOA 3RUAA 4AYXA 4YRNA 5KWVA 3R0QA 1XT6A 4O1IA 2AEFA 4MW6A 2R62A 2YOHA 3E9QA 4PO9A 1OFIA 2GRAA 1N33B 2IYZA 3EYWA 3IQXA 3QMPA 5B1IA 2IXDA 4K7JA 4CEHB 1QHSA 4A03A 1H2YA 2A33A 1EX9A 3SJZA 3RK0A 4RVSA 1DDIA 4TTIA 4WZAB 4D0RA 1PYOA 4F92B 3ILXA 3PNBA 3Q4GA 1YIAA 1OXVA 5J58A 5FKJA 3RSFA 1L3BA 2WPDA 4B6RA 3EH2A 4D80A 3G82C 5TLSA 1XMXA 4AN0A 5FBHA 1MXFA 1XALA 1JDSA 1CQZA 3AIKA 4XQGA 5IK2A 5SYAA 4BX9A 4X7PA 4GH5A 3IQDB 4MJ7A 1JA9A 1PKEA 4PC3A 3WGVA 1X2EA 5ED0A 1G6KA 4TUYA 1NMEA 2BM9A 3VPFA 5EIBD 4ODIA 2FEWB 1SQGA 4ZHSA 1NW8A 1XRRA 1EFVA 5TJ9A 4BO9A 1DQZA 4KXNA 3VPGA 3VU3A 3ZTWA 3ZWWA 2IX3A 1WBBA 2W6IA 4NHEA 3DULA 2CT8A 1V8ZA 5IUKC 2AQIA 4LX8A 3BXEA 5LQDA 4ZCSA 2HPHA 4DJJA 4MB0A 5JT1A 3EJWA 4Q4HA 1YIDA 1NSFA 4MVJP 5DM4A 4BO7A 4EEZA 1N2GA 5LYYA 2OBBA 3C7AA 2W90A 4HHEA 5AKIA 4B6GA 2ZVJA 4BMCA 4DRZA 2QF7A 1QIMA 3RU2A 3ZHCA 2HA3A 4A23A 3ZHTA 4GC9A 4H1HA 1J97A 1RE1A 4PYKA 3W2GA 4MR7A 2C3UA 1V8DA 5BNWA 4I4NA 5DW3A 5AVWA 2WWIA 3QMWA 3B1JA 4BV9A 4XWOA 4QLBA 4UASA 5DK6A 1QPBA 1QG6A 4QD3A 4M8NE 1ZSNA 4RH0A 3N74A 1LZKA 3DMDA 2HPZA 3G2MA 5B37A 5AW9A 1N32B 4YLYA 1LB1B 2QBYA 5COQA 3T4EA 1VG9B 1NIJA 3FKJA 1HWYA 2CHQA 3B6JA 4LDPA 3JWEA 4R1TA 5KVSA 2FQQA 2QE7D 3I01A 2H4ZA 2VH5R 4LYGA 1RZRD 3DVSX 1SOWA 4KO8A 3QLJA 4PX9A 1J99A 5G1NA 1MENA 1IDN1 1VIVA 1I4WA 2B69A 3C2QA 3EFBA 4U3JB 3TRJA 4KGVA 3QXJA 3NB0A 4EH1A 1WPRA 9LDBA 4BO5A 5B7PA 2PS9A 1V5FA 2ACVA 5EHQA 1DV1A 2L2QA 3T6KA 2QMOA 1NJSA 4N7BA 1MAAA 2EX4A 4PPQA 4J9VA 4W8GA 5EMJA 5J5VA 3SE7A 4BNYA 1PFQA 2LR0A 1G59A 2JJYA 5DSZA 1KO4A 2C84A 1MAHA 2EKLA 4FHZA 3ZUPA 1HFWA 4BPRA 4M9ZA 3DYVA 3ACDA 5L7YA 4M21A 3ZHXA 3VBEA 4Y6SA 2G4LA 4MS3B 4G97A 3TW4A 4CV1A 2XJ4A 2DQZA 1S8FA 3N8NA 4Q24A 4RIEA 3IULA 5HUJA 3D5EA 3DLIA 3A10A 1XP5A 2I1WA 4HDMA 2WV7A 1RI5A 3PQCA 3ICWA 1IVYA 4FONA 3GT4A 2ID8A 4KHZA 3RYFA 5ITSA 1VPDA 3GA0A 2AC4A 4XD7A 4ZAVA 1USWA 2WBLC 3K6RA 5EZQA 5FBWB 4AECA 3A6PC 4CEIB 1KPGA 4HYQA 3H9BA 1T9DA 3O6VA 1THMA 4BCCA 3ORQA 4FHGA 4PINA 2X9QA 1CUUA 4Z86A 4AO7A 1IZ8A 4BFSA 4MUFA 3ZHRA 3W6OA 2ZIEA 5JSKA 1GSIA 1CK4A 3MWEA 1ZISA 2LCIA 1J49A 3AOEA 3K1AB 3UTCA 2O5RA 3L1JA 1H4QA 1ISIA 1FZTA 1EUZA 2PIDA 3JWPA 2C83A 4HC4A 4TV8F 3ABSB 4ZIRA 5BURA 1NBEA 2DZDA 4QRHA 3T1HB 2NZYA 1XEXA 2AV6A 1RWOA 2WWWA 4Q9LA 3HJHA 2F3TA 4ZI5A 1X94A 5EZ6B 3DEYX 1QV9A 4O08A 3WHPA 2O8CB 1VDMA 4B3SB 4MDEA 3GLRA 2FSHA 4Q19A 5JBNA 1E62A 5AW3A 4U8GA 4UMEA 4P4SA 4LWOA 2WLSA 3G89A 5IJXA 4OGWA 3BD8A 3QUBA 2HYDA 3R74A 2ZYDA 3O4FA 1G9TA 1WXQA 4J29A 3SC2A 4MGKR 3U4HA 5JS8A 2HHLA 2I6UA 4FP9A 3E9RA 1Y81A 4TTAA 1U9YA 2ZBQA 1RRCA 1QHIA 1SVKA 1R0YA 5F1OA 2G6TA 4JEIA 4QBTA 3GEDA 2QE7A 5CCDA 2WYOA 2F8TA 2VJMA 3K30A 1GVHA 4JQCA 4EHIA 3DWIA 5TQ0B 3LF2A 2EJWA 4KN6A 5CFQA 1UK6A 2RHWA 4KQWA 1KR5A 3BSWA 4MV6A 3STUA 3UHAA 5JFOA 1IHXA 2QRHA 3MS7A 4M0CA 4MULA 5KYTA 4YFYA 4V0ME 5DV9A 3BX1A 3ZWPA 1XRPA 1B8OA 1OLSA 2B4KA 3QA3E 3NHZA 1I01A 4OLFA 4R1LA 1G8YA 4PIVA 3ENQA 1RP1A 3O03A 4K6OA 3DMFA 3AFNA 1R00A 3OKPA 1GCOA 4HLQB 2I2DA 2SECE 4HVAA 5AK3A 4ZQBA 2VYND 3K8ZA 4BB5A 5EJEA 2G63A 3IQZA 3LYHA 4CMJA 1CZOA 3IPYA 2C0CA 3HI4A 3M6XA 3CUTA 3A4MA 1A3CA 1ZRSA 3RQSA 1GN9A 1FJ2A 3T5PA 1EK0A 3FF4A 3G02A 2EZ4A 3HDTA 3ODGA 4LY6A 4QWWA 4D9EA 2ZUVA 4ZI7A 4DLYA 4D8TA 1OOEA 1ZK3A 2H9AA 1JHPA 4U2EA 1VRCA 4G84A 4S04A 4DVGA 2AD1A 3A11A 1UMBA 4BYGA 2QM3A 1B8UA 4OBBA 2D5CA 3ZXYA 3UQYS 5C80A 4LJ9A 2M32A 1AF7A 1Q14A 4RPKA 3NBUA 5AHRA 3HMQA 2Z09A 4KDRA 4UQPA 2W4IA 2WWFA 5DX0A 1RXCA 2WTMA 8ABPA 1LK7A 3H2GA 3ZKWB 1DB3A 4O1MA 4WZAE 3OM8A 1U2PA 1SIUA 2EFHB 5LLTA 3PX7A 2PRYA 1YA8A 1ZLXA 4XR9A 1GCGA 3NBQA 4RY0A 4E31A 5CBKA 7ABPA 3HB7A 2F00A 5AXAA 4B32A 1HQCA 3EN0A 3GPBA 3L4KA 1IIBA 2HLPA 3VYSB 1QOZA 1K8RA 2HT6A 2PH7A 1FQWA 1IN4A 4X8HA 2NAFA 2FSUA 4QA9A 4AMVA 5JO0A 5ALJA 2ISSD 2VF7A 3GEMA 4LXQA 2R2AA 1DFHA 2TMGA 2GO1A 1YCGA 2QSZA 4K46A 2G06A 5CX1B 3QPDA 5J4KA 4N5HX 4F1KA 5AVJA 3WQBA 3UWPA 3DDCA 3H86A 4HLUA 1OROA 2DB3A 2ZE5A 3JQBC 1DC6A 1ZCBA 4L75A 1M7HA 3K53A 5JE8A 4RSRA 2F64A 3Q5DA 5D8DA 5FBQB 4C88A 1R7RA 1KJ9A 1ZM4A 3C87A 2XXJA 1OLXB 3KEMA 4A91A 4UNIA 3PNOA 4KIGA 1ORIA 7REQA 4JASB 1CZHA 2QK4A 3ITKA 1A1VA 2R86A 1H05A 4XPZA 3OLVA 2O6LA 1DBIA 1CR0A 1Y3HA 4RD6A 2H2GA 2P41A 1Z4QA 2IKSA 2GZDA 4DSNA 2YS7A 4B5KA 4B7AA 4NCKA 1KK1A 1Y34E 1ZGZA 2VYVA 3O38A 4QFDA 2HRCA 2W11A 4FUQA 3I58A 4JN6B 1SD5A 5ALVA 1FBTA 2C99A 3V2HA 4C4OA 5IC6A 5UKDA 3AV0B 3FPGA 3QKIA 4JEHA 3RIYA 4HX9A 4KJXA 4DYVA 4BJ5A 3E9YA 4D8YA 2HJSA 3I61A 3E22B 3E6AA 5CT4A 4AW9A 2J9RA 2CFIA 1R15A 1GYQA 3SLKA 1WB4A 1EVEA 2ACWA 2QVYX 3Q0EA 2W83A 2YQ5A 2XA1A 2BL4A 5K3EA 2GZ1A 5LL6P 1EJ0A 4DLNA 4JS0A 2IHKA 3T94A 1VP3A 4MI3A 1MJFA 2G9RA 5SICE 1P5HA 1E5QA 2J5RA 4UHEA 3IP7A 4QECA 1EA7A 2HMUA 3QE2A 4ZODA 4C30A 2XUFA 4WD3A 1Q84A 1ZIDA 3CLRC 3PC8C 1E6LA 9LDTA 3TAUA 1J39A 1BXGA 5AUOB 3P2IA 1SC3A 1AHPA 1RWWA 2CJPA 1VL0A 4IVPA 4IKEA 4M87A 2BMWA 3UFXB 3S1AA 3AM1A 2YDXA 4ND4A 3FVVA 5IKXA 2P7HA 3FOAA 2CBXA 5A3JA 3MWYW 4DB2A 3WGGA 5A1TA 1TVCA 1JYEA 4O5OA 4FIDA 3CVOA 4EKIA 3DV0A 4B74A 3PGXA 1X1BA 1TMGE 3M9WA 2EEZA 1IMOA 2I8AA 2V74B 3O8LA 5CGZA 3UHFA 4CFYA 3FPHA 1NF9A 1WMSA 1HA3A 4Q05A 5AI5A 2WFMA 3IJRA 1NUAA 1PQ4A 1I7DA 4QGGA 2RMKA 1G20E 5HQTA 4YACA 4K6FA 3HK2A 4J3FA 2I03A 2HMYB 2W6JD 5JDCC 3EXG1 2G36A 4QUBA 1EGAA 1DTWA 4XX0B 1XZJA 3F6BX 3FX2A 4HAUA 2BGRA 2GD6A 4I9FA 5EJ2A 2UUCB 1U2QA 3NCHA 1TYCA 3H6KA 4XWYA 1KC1A 2WHQA 4JZKA 3VQTA 4MUKA 3DBHB 2PKQO 1KYIA 2OK7A 3BWXA 3LX4A 4F12A 2Z5GA 2NTEA 2UYOA 2R7NA 2QJTA 3LUFA 3OPVA 4LCJA 4O4IF 4B80A 5CFPA 4O25A 1SULA 4H7JA 1SBHA 2H0AA 1U3GA 4PCAA 4BQNA 1IQRA 4WKPA 5DM60 1Z0IA 2Q5IA 3DMTA 2ZJAA 1QE3A 3EASA 3I6BA 3QPWA 4QUKA 3OZTA 1A9XB 3HYSA 4GOMD 1FW6A 3L8DA 4CQNA 3ZCQA 2EQAA 1YHNA 4DUPA 2ZRGA 1VG0B 3FGNA 1WEKA 2ENWA 4BAZA 1T8TA 2X76A 3PXXA 4UNPA 3G13A 5H9VA 3SHOA 3STHA 3BJMA 1VLMA 3QU5A 1DO8A 2O7SA 1WNFA 5CK4A 3WB2A 2RC5A 2VDWB 4FS8A 5EKUA 4LVCA 2O59A 2PL3A 4F60A 3QX9A 3NALA 1Z3IX 5CFMA 3FR7A 3KV3O 1C7RA 2FN4A 4NV1A 2HCTA 3A32A 2R47A 1HKUA 3OU6A 4NECA 3TE7A 1JEAA 1SVUA 2ECPA 2DLCX 1US8A 1EVJA 1Y1TA 1MVOA 1J56A 1A77A 1JBQA 4KZKA 1Z6QA 3UJ9A 3DAOA 2Q1XA 5KDOA 1XF9A 2IZ6A 6ADHA 1W35A 3PVZA 1SM4A 4CL8A 1H4SA 4BGVA 4A0RA 4NBTA 5J59A 1HE2A 5T8KC 5DNEA 1MO3A 2WIKA 2O2DA 1AA9A 2CVHA 1A95A 3E8XA 2R8BA 1U8YA 2OAEA 4I55A 5HTKA 4C2TA 3P4UA 2AJTA 1XD2A 1T4BA 1VL8A 3ESXA 3RAPR 1VDZA 2V6IA 3AZQA 4FGLA 2P1ZA 3RAEC 2VK4A 3HL0A 4QEZA 4WLVA 3C6QA 5FAKA 2BFFA 3QKRB 2QW0X 1AV7A 4RDIA 4B09A 2XXAA 1JJBA 2F1RA 1KAMA 3X1DA 5LMZA 4J8PA 4HH0A 2O3QA 2D6FA 2GXSA 3SXUB 4PX5A 2RGEA 3D8RA 4DM3A 1JNXX 1KI2A 2H29A 4MP3A 1LPSA 2IHYA 1GTZA 1T2VA 2FPGA 2QYTA 3REFA 3TSYA 3UJ7A 3WGYA 5DN6D 2O0HA 5I4CA 5A0TA 1SCDA 1UT5A 2I7CA 1M2VB 1RM5A 3O9ZA 4PZZA 1W2HA 5KTSA 4PE5B 5GIOE 3K9FC 2I65A 4Q3LA 4GOND 5KWJA 3U4IA 4MV7A 4PPNA 1CIVA 4JFAA 4XVRA 4UTVA 1DG1G 1C1YA 1Y9ZA 1H1DA 2R1TB 1NM5A 1P45A 4GFDA 3A4IA 2RSLA 4OU5A 4TLAA 4AJLA 5LOVA 1NBIA 4GUDA 3BCHA 4QQKA 4CTNA 3OP4A 2DBQA 1V71A 1MBZA 2FKNA 2R84A 1TM1E 4KWHA 5CH5A 1N2HA 4RESA 5T3YA 1KI8A 5DT2A 3WDLA 5A4IS 3KOMA 4KR6A 3FAZA 1A5AB 1VJ1A 5CR9A 1J5XA 4ENVA 2XE6A 4G5RA 1HG1A 3AQIA 2I7VA 1LBSA 1JVBA 1BHJA 1NJFA 2FPUA 3H8SA 3R0ZA 1DP4A 1ISFA 3SR4A 3SZMA 1E3WB 3CH6A 4CR8A 1RW4A 5JAMA 1W4AA 4JHXA 4CMEC 3FOFC 1GVNB 3H17A 1XOIA 4DZZA 1RWBA 5JNLA 2FPWA 2ZJ8A 1BKSB 1G38A 3CT4A 2JHPA 3E03A 3MZ0A 3HDVA 3RUDA 3QVJA 2C59A 3HO1A 4KREA 1QO9A 1OBOA 4JOCA 1AO0A 4IHKA 2W48A 1W36B 5HF8A 5CJ2A 2H8GA 2PU5A 3EDCA 4FUTA 2Z6AA 2CC2A 3RT7A 2X5KO 3HP7A 4C0XA 5L51A 4L6IA 4PN3A 5JHGB 3WA7A 4JY7A 2P9HA 1PJZA 1PEKE 1ZRMA 3QEBZ 1J8VA 5D51S 1B8NA 2C04A 1K6EA 1XD9A 2I29A 4GOXA 2OHFA 3OPYI 4XLTA 1KA9H 1RS0A 2BWJA 2CL0X 3O82A 3ORHA 1RHUA 4ADSG 3MN1A 2CEKA 1CQXA 2OILA 4KSCA 3WP1B 1SXIA 3B5JA 4F96A 1JSZA 1ADCA 4FZVA 1M6YA 4O2AB 1JIXA 2OVFA 3C6XA 3DFKA 1YS1X 1Z6AA 3EXEB 5KBYA 1JAYA 5EKTA 2WJIA 1JQKA 4WAUA 1Q0HA 2RI1A 5FJJA 5K3SA 5B4VA 1J0DA 2IZ0A 4WE3A 3EZ6A 3RK1A 4WXYB 1C7FA 2X8JA 3EA4A 3U7RA 3H5NA 3FDFA 2HFJA 3ZWBA 2X8AA 3VDQA 2VPYA 1DFGA 2H1IA 1J1IA 1G291 3CX7A 4XB2A 1K5GA 4CDNA 1Z6YA 1Q74A 4RA6A 3MLBA 2ZS7A 1C8BA 1P74A 3OJWA 4UTPA 2H1VA 5EYPA 421PA 4GM4A 1YCFA 4JXKA 2I4NA 3E4DA 2OV1A 3EY4A 2Q9BA 3PJRA 4CQJA 3RASA 1OZ0A 5C7OO 1O94C 3KL2A 1DKUA 5ELLA 1LBIA 1U6IA 4TQ9A 4RPIA 1AKYA 1LJ8A 3W5HA 2EZ9A 4HNRA 4B17A 3RWOA 4QJ3A 5LOVF 1P0CA 1HEIA 3N0VA 1U8CB 1JMYA 1FDRA 4PX3A 1ZINA 4I5IA 3LC1O 4EY6A 5MFPA 1W36C 2OWDA 4UHCA 3FUCA 2QM8A 4LOHA 4OFBA 1WY7A 2J9YB 3SM3A 3LUJA 3A0RB 2PY6A 1P4HA 5F1PA 2JFBA 1PHRA 2E0IA 3ECSA 4CKCB 5CA0B 2C0QA 2IC5A 4X91A 3K71B 4I2VA 1G8JA 3F8TA 4GEKA 4Z9BA 4DA9A 5TQ2A 1U1FA 2XWSA 2HNAA 5CRIA 1KDTA 4DIEA 1RMYA 2NTYC 3R7SA 3SDZA 5JAPA 1N2CA 5AKGA 4YECA 1PR2A 1KSGA 4DA0A 2XQFA 3VI3B 3A14A 4R8RA 4JI4B 3OCUA 3R40A 1YRWA 3NQ41 1XE3A 4KLCA 3LZ6A 4TMFA 2F55A 1SVWA 3FNHA 4QGBA 4RTRA 2G1KA 1DO2A 2MSDB 1M1ZA 3CSDA 3KLOA 3OIGA 1DBSA 1RAHA 1KE2A 4B3DA 2P1RA 2Q2VA 4FKBA 5M3BA 3S8YA 3LRXA 4HWSA 5HM8A 1L1EA 3GELA 1OYWA 3HKEB 3NNNA 2C2ZA 3FVWA 4V39A 3GPLA 3R75A 5BSWA 1D2EA 1YR2A 1Z88A 5JPCA 4IH9A 2YHIB 5EHXA 4ZHQB 3TNLA 5C7LO 3IB6A 1E89A 4F6RA 3HXTA 1GGNA 2B83A 1I10A 1X7ZA 5TDHA 6Q21A 1WU8A 1V9LA 1H66A 2V03A 3PTZA 2IYOA 3E5MA 4GE0A 3I2IA 3TOCA 4QBIA 1R0XA 1EPUA 2I6XA 2PUAA 3T8YA 5EERA 2XB8A 2QY6A 3CM0A 1YTUA 3KR0A 5F12A 4EGAA 5L6LB 2WB4A 1P4JA 5A4FS 5KSPA 3CX8A 3HJUA 4R2XA 3ZVLA 1C1XB 2D2VA 2Z43A 2ZIXB 3LBFA 4WKGA 3ZKAA 4NZOA 4F3CA 1TMYA 1IXYA 4J1NA 4UE2A 4MK4A 1Y48E 4IR7A 4KAAA 4GF5A 5IMSA 4W5JA 4E2FA 2Q4RA 4LTDA 4RE5A 4BTVA 1P1HA 1ISSA 3A1SA 1ZQ1A 2VDKB 4BFZA 3KOOA 4MQBA 5E9QA 4HWRA 4BLUA 4EI7A 4YMTA 2O8VA 1K2WA 4RUKA 1K92A 2Y1XA 5EMKA 4YUYA 4CLEA 4CNQA 5ICFA 2IOFK 4Z9AA 1ZUIA 3UG7A 3GRYA 2P6NA 3ILHA 3ZHVA 2CE2X 2YJGA 5K3CA 1Z12A 2FK7A 4NC9A 1LPAB 3CWZA 3ZC3A 1E1RA 3QLVC 2C20A 2WTXA 3V8BA 1WCIB 2BHTA 5IBQA 1Y4ZA 3CF6R 1N8TA 2AKEA 1ESNA 1B1CA 1GL7A 1YR3A 3FGZA 3GP8A 2ZROA 3BB4A 3FPJA 1FSZA 4IZIA 3T4XA 2GPAA 3WRXA 4CMCA 5J4HA 2YJTD 1W581 1SU7A 5FV4A 4UTZA 2PD3A 4OUDA 2JGLA 4EY8A 1E8MA 2AXPA 4RXUA 3OX3A 3FRHA 3GFQA 1U4SA 5BWCA 5GMOA 2W2KA 2Y1CA 4F7DA 4WOJA 1HRDA 3KOWA 3LBHA 5BYJA 4E5YA 1BQ4A 1P5JA 1Y9DA 3V7WA 4DHWA 1PQWA 4Q4LA 2MDTA 2QEQA 1M5RA 1HDXA 3T7DA 4WLOA 5IDWA 1Y8ZA 4HJXA 5JJKA 1BX3A 1RRVA 3IR7A 2B4YA 3R3VA 3KB2A 1XMPA 1IK6A 1O58A 1XYGA 2JFQA 4BUCA 4BNVA 3D1LA 3GFBA 3MTEA 2V3CC 1HX7A 3M3HA 4NK4A 2G72A 1D0IA 5DTJA 2F8LA 2UXDB 3FYUA 4FE4A 3IFSA 5BRNA 1MN6A 4LBWA 4B7UA 4TYNA 3AEZA 3ICEA 3HQ4O 4G5OA 1TM7E 1N7GA 2CHEA 4UMVA 2AJBA 4C43A 2LPMA 4NKRA 2Q4DA 4HDQB 4IL5A 3HV0A 5FH9A 3OTWA 3AETB 4MRMA 1ORRA 1G3UA 1D6NA 3B70A 3A1CA 5DRYA 3G1TA 2B8WA 2AUMA 5LYJB 1VPTA 1KBOA 3AB3A 4I50F 3SVZA 3RKSA 2BGLA 1NMXA 1E3TA 4L22A 3MRSA 3O3CA 1A2OA 1GTVA 2KI5A 4XQCA 3JQGA 1KJQA 1UXJA 2IITA 1TTHA 2HU8A 2GPBA 3H5TA 1CJTC 3QHPA 4MTLA 1SXPA 3N39C 2TYSB 1K06A 3I9JA 2Z4TA 1ZWLA 3OM9A 3OCXA 1W52X 4MA0A 2AI3A 2IIPA 4YHHB 1TJPB 5A9SA 4AUKA 3TLZA 4C0JA 1A9RA 1UZAA 1Y8QB 3BL6A 1ISGA 1IXKA 4KQJA 1AGRA 4WESA 1F2TB 4BY9E 2OZLB 4KACA 2VP0A 4EABA 2C5HA 1CWUA 1E9DA 2DYKA 2H1FA 4YRPA 4ABYA 5BWLA 5KSWB 3HY6A 2ZYTX 4MAFA 4MUNA 1TKBA 1MB3A 4KQEA 4YR9A 3K8OE 5IT9A 4L0CA 4QREA 1KY4A 1JBEA 5J43A 4IDNA 3WI7A 5KTKA 1QQBA 3NU1A 1QK5A 1G6HA 1CR1A 2DH5A 2NT3A 2I67A 2GVDC 1V5EA 3M5PA 4OHUA 4AQYB 3THXA 3F6RA 3IPXA 2F3RA 1OAOC 4IWNA 5I5EA 1KMHA 1CW2B 4BMNA 3ZDAA 3NRBA 4QPPA 4G0NA 5HZHA 1JSXA 4UM9D 1TQDA 3PKZA 1JL3A 4CU5A 1JSLA 1IPHA 3R0VA 4B9AA 1KZ7B 2ZKLA 1ODSA 1SBCA 3AVPA 3KELA 4MH0R 4JJZA 4AO6A 2FTKE 1N7IA 1LWOA 1XELA 2O2HA 3KKKA 5C8YA 4JB0A 3R6WA 1CFJA 1ZMXA 2C0PA 3AUUA 3GIDA 4F06A 4DFDA 1WW2A 4H4EA 3JYOA 3N28A 4FNAA 5FO1A 2QIPA 2Y6VA 1Y6QA 4PLFA 1JPNA 4WRRA 1KS9A 4YRKA 4MLZA 4HDCA 4QYWA 1IULA 3KEQA 4QXAA 4U2CA 2F48A 3LDUA 5BXYA 4Q1EA 1F8XA 2PCJA 1NR1A 2FPLA 2QRMA 1T9GS 4HGOA 1NI4A 4X7MA 1WSAA 5IM4A 3A6HA 1H0HA 3NDJA 1TZ2A 1ZN9A 2HIMA 1RKXA 4NZNA 2AI1A 4UNSA 5L8VA 3O4VA 1PS0A 4TV9A 2I7XA 2CYBA 1FA9A 1ULUA 2MU1A 2PPLA 1BRTA 1I9CA 1W0CA 1V3TA 4NG5A 4RZXA 3A4LA 5AK0A 1V47A 1NX6A 2EWVA 1FDUA 2FEMA 4JIMA 4H3KB 5B4TA 3BSSA 1JU9A 3HI6A 3HYNA 1BWSA 2QTFA 4MR7B 4GUAA 1XAJA 4XIIA 3TWOA 1NTRA 4C6TA 2O2XA 5ALUA 4W9NA 5IZ4A 1MIOB 2ZFUA 3ZV3A 4BQFA 2JAUA 1T8YA 2OCLA 2Z95A 3N53A 4L74A 1QIDA 2V1UA 4GDFA 1WD5A 1HYBA 1BYUA 2CFRA 4JXXA 1YZLA 4UPDA 2XADA 1DAKA 3LCJA 3K9LA 3DE4X 2F1IA 2EHDA 2ZSBA 4MRSA 4YEDA 1D7AA 2VUUA 1P1KA 1FCJA 4L28A 4OHVA 1AQNA 4KQFA 4RU1A 5JSHA 1TK2A 3BB3A 4G1EB 3W9SA 1AMNA 3W5CA 3F6YA 1SJ9A 3PQ7A 5D7BA 5TMDA 1AQUA 3CVVA 3LBYA 1BROA 4DY6A 3J81A 4NICA 4FLEA 3DW1X 4JLMA 4GRIA 3DMGA 4FMPA 4TMZA 1NXPA 4Y2JA 2V7TA 1B76A 1PX0A 2G9UA 1HFJA 3FYTA 4OXKA 2FJUA 1NAIA 4I3FA 4N41A 5JYBA 5IUJC 1Z26A 3UK7A 4RMJA 3A2LA 2QZ9A 4OF4A 4EF4A 2V54A 1BE0A 1F48A 4CMEA 2J8ZA 4R1NA 2ZBVA 5FHRA 1VJRA 3MEQA 4B6JA 1RD4A 4C6SA 3BZBA 3P9IA 4WSOA 3RS0A 1B2LA 4PV7A 1U1DA 1VBKA 1UT8A 4YMWA 4M0DA 4N18A 4LZWA 1GPDG 2P0AA 3PDJA 2BJHA 4YAJA 4POAA 4EARA 4X1IB 4L4RA 2YJNA 4WDRA 4YRMA 4KFRA 2I3BA 3O5AA 4H2DA 4L0DA 3LBIA 4RV5A 4UC0A 4AY2A 4YCDA 4GPD1 1L7PA 3GK3A 2XDAA 3ESRA 3OJXA 3KSMA 2E9SA 4JLSA 3H7IA 3HJTA 1WTAA 3SYMA 2PUVA 1OWOA 3EXFA 3GA7A 1MOZA 3CONA 1AUVA 2OGSA 1KI7A 4F1JA 4D3ZA 4DBVO 4QNMA 4D6YA 4F5ZA 1Y7PA 1H8EA 2CWDA 3DM5A 1SMKA 3IAFA 3TEFA 1TD9A 2QLMA 1PR0A 3KAQA 2CWWA 4GPAA 4Z7OB 1NWHA 4YDRA 1I94B 3LT2A 4JR1A 3V7YA 1TQ2A 3UWOA 1YKFA 3NR2A 4D25A 2BCJQ 2BOVA 4HB2A 5BN5A 5BQ5A 1W48A 3AJEA 4V0RA 3WAJA 3OH8A 1QU2A 1K2VN 4ZANA 1RAEA 2O8CA 1A5SB 1VL1A 3LJKA 3FNEA 1U63A 1BC5A 1N9ZA 1PGNA 3C15C 1CVRA 3PD0A 5DNCA 4CL2A 3K0FA 1ZP6A 3HVIA 2B9VA 4UHKA 2V7UA 3JAKB 1XA0A 1E92A 3C74A 2WWYA 2P67A 3G0BA 2GBFA 5TC4A 1RRKA 5DYWA 3TNJA 1N5MA 3S55A 1HUQA 1CLUA 3LA6A 1DX9A 3SBEA 3C39A 4IIFA 1S2DA 3UJHA 5IVKA 2PJUA 3WWPA 1LDNA 2YXPX 5BW4A 3RSHA 2BSQA 3LSYA 1U80A 2Q1YA 1WUHS 2VTKA 3OFND 4ZVVA 3UUWA 3WLEA 1KVQA 4WECA 4KRXA 3ZJ5A 3P9XA 2PUEA 3NVDA 1K3FA 1EQ2A 1LQ2A 4US0R 4YH1A 3WQQA 4JH0A 1U31A 3MJDA 1RWVA 4YJFA 5D5HA 3P0HA 1GRVA 3ABOB 5ICEA 3UKJA 5KKCA 4M9SA 4H0NA 4I8IA 2IQIA 3ME5A 3CKKA 1E3EA 1HM5A 2PXCA 3AK4A 3FNRA 3RRFA 1GGMA 2HIAA 3N2EA 1LTQA 5K20A 4LRYA 1FUKA 3UMCA 1LW6E 2MTBA 3GMIA 2GZRA 3HKBB 1GPMA 4IIYA 3V80A 2VNAA 5AH0A 5HR5A 3ZH2A 2B78A 3BGWA 2OQ2A 1M66A 1PVVA 4OPMA 3D64A 3WS7A 1KO8A 1ZFNA 1CQPA 5ALZA 4KIJA 3S2YA 4F56A 2J0SA 1LPMA 1PGOA 4FNGA 5FULA 3QUTA 3WL7A 1Z6XA 2YNMA 1FB5A 4FGJA 3W0LB 1GZVA 1TC1A 2X4GA 1JG4A 1KJYA 3IXQA 3JALA 3KYCA 4QHTA 4A6DA 4AULA 4LE2A 3AEQA 1I3OA 3PGVA 5K8CA 1E98A 1DI0A 1KBZA 2O4CA 3EXIB 4Q9DA 4HWKA 3A7DA 3RHFA 2JIQA 2WF6A 1O8BA 2DQKA 2VUHB 3RYIB 2W2MA 5L9AA 4RVNA 4F4DA 2HHHB 1EX7A 2VRCA 4I36A 4RM2A 4YO7A 3ZY5A 4B4OA 3DSRA 1RACA 3ZQ4A 4F9EA 1ACMA 1F0KA 1JJ7A 3N0TA 4AUMA 3CRZA 2XCIA 1LPBB 1CUIA 2NTNA 2WAXA 4P93A 2WB2A 1USIA 1RM4A 3LIIA 1ZA1A 2CEAA 5B1HA 1BXZA 1KPHA 4HY3A 4JYBA 4D5GA 1KIMA 5C3MA 3ADBA 3PTAA 4DUZB 2YL2A 3DHNA 3AR2A 3DF9A 1CV2A 3I1FA 3L0ZA 3OAAD 1EK2A 3ZGYA 8ADHA 5KYWB 1UOQA 5DGCA 2G8NA 1ZD5A 2YIMA 3C4QA 2GASA 2GF9A 5GJCA 4QPNA 1CJMA 1L5KA 2PSJA 2UV8A 1YCHA 4PN7A 4WOPA 1FUUA 4I7EA 2O0JA 3DZCA 1UC9A 4FFMA 2I4IA 2P9BA 1OT3A 1ZJYA 4FCTA 1BCSB 4B6QA 5IT4A 4RADA 1ZM9A 5AVXA 5JASA 4LZLA 3CEMA 4BRWA 1VLHA 2HKIA 3G2HA 2ZIGA 4WX2B 2AZDA 3O75A 4UDNA 1MHTA 1Y98A 4CLOB 2PX4A 4GNRA 5JHHB 5EIEA 1DT3A 4OK6A 4BX2A 1U0SY 2W00A 3CR3C 3U44B 1IUPA 4Y1GA 5IFLA 2CMGA 2E87A 1SU6A 2KE5A 2XSZD 3COVA 4FCCA 1YRQA 2D7JA 1G5FA 2MIIA 2PL5A 3KB8A 2JGAA 3TH5A 2CVZA 1JTVA 5DZSA 4PYRA 3QJGA 1LX6A 3WK4A 1LFDB 1RHRA 3KKOA 4JSRA 5IVIA 4RULA 3OO1A 1FLNA 1FS5A 3PX3A 2ZCJA 3CO0S 5IAOA 4YAUA 3PU6A 1RYYA 4YP6A 3UOAB 3SN6A 1H6AA 3OMWA 1WMEA 4RM3A 2X42A 3TD9A 5SY6A 1MTOA 4P3YA 3OI7A 4MJ3A 4KR0A 3RABA 1G41A 3RCBA 3R3UA 3FUWA 3V33A 4J0HA 2X40A 1VGQA 3IUQA 3ONNA 4GEGA 4HRAA 4W82A 3WHKA 3YASA 4DLXA 1N75A 4ID3A 5IANA 1AVTA 5AJTA 3KUUA 3JQBA 3HWX1 4EPVA 4OHZA 1ZOOA 3GRZA 4JXJA 1R5BA 3VPXA 3BHIA 3AC0A 1N1GA 1NBOA 1Z4PX 2AHOA 2W2NA 3C14C 2J9FA 3FZNA 3LLVA 2QTWB 4UREA 4ZPXA 3TM4A 4L3OA 2G5GX 1R6XA 4JVMA 4W1SA 5DLDA 5IZCC 1TAQA 1KVRA 2EC5A 1G21E 2NO6A 4B3JA 3ZCRA 1YFKA 1E7YA 2WTAA 4XH9B 3HNRA 3WNDA 5G02A 5C2JB 1UJ6A 3DF7A 1QZ3A 1Q1EA 4OKNA 4S24A 4H7KA 2XF8A 4LYAA 2A84A 3DTTA 3QZUA 2P3LA 1RZVA 1YUBA 3AJRA 1DHRA 3H11A 4I5DA 1Q0TA 4B4KA 2ZTVA 4M8SA 2AUNA 1Q20A 1VIYA 4LPSA 5F7JA 3WGQA 4LGMA 1XBTA 1D8AA 3WNCA 1H2EA 4N5IX 2FPIB 4IDPA 4MKXA 2ZXUA 3PQ5A 2OC9A 2PJRA 2B1RA 2YC2C 1EINA 1ZH8A 5E4JA 1YI8A 1QHXA 2YBEA 3GUYA 3GUZA 3ZJVA 3RRZA 4YRAA 2P6UA 1QBKC 1T25A 3NJ4A 4TQAA 2OM2A 5HE9A 2GDJA 1Q15A 2CZGA 2ZR9A 3DDNA 2DXIA 3R0IA 1JYFA 2DR2A 3VUEA 4EHJA 4J43A 3WLAA 2YIVX 3C3PA 3ZHSA 5AM0A 1MQAA 1R8QA 2QMUA 3LWBA 1QV7A 4Y2SA 4JLPA 4Y6PA 3RJ5A 2GRUA 1P17A 2P9ZA 4TT3A 3UC5A 5LIRA 2X8BA 2PO5A 3IOBA 1ECBA 4U39A 4AZSA 4BJHB 1M33A 2UYYA 1AHNA 4PYLA 2HM7A 4IUCS 3DVQX 5E0OA 1CUVA 3T0IA 3QPUA 3MXTA 5A0VA 3WWYA 1DMSA 2UAGA 3AUSA 1T4DA 4QDTA 4C1NA 1CS4C 4EFDA 1QQ6A 1RC8A 2W71A 3G2PA 4MIEA 2OCXA 1YZHA 3K96A 1ADYA 3M5CA 2Q1TA 5CGQB 1MV8A 5A3RA 1QJCA 1QH8A 1T8PA 3CLKA 1TNDA 1G5PA 3SQXA 4HQ6A 1RVDA 2AC7A 1B2RA 2ID4A 3DZHA 4B8YA 1DCFA 4QUEA 2DQ4A 4IFEA 4PXAA 3VKFA 1PL0A 3GFOA 1CJUC 1CTQA 3AR4A 4HG2A 3AHIA 1U5AA 2QVLA 5BYKA 4L9AA 4OG2A 4XX1A 2E1RA 4JLNA 4RIHA 2HLDA 1KFBB 1SCUA 1HT2E 3KEFA 5T5QA 2EEPA 2CNBA 4XGQA 2Q5CA 1UJCA 2F4NA 2EVWX 2HX1A 4HZIA 4J0IA 3FWNA 3SR0A 1KFKB 1REQA 4Q4DA 1C50A 1NMYA 3VPCA 4DNFA 3ZX4A 4CV2A 2YZ7A 3ZZUA 1V6AA 4TKMA 1PU2A 2WRZA 1WZNA 4RD3A 1MU0A 3GG9A 3V8QA 3WK6A 4L4ZA 2GEVA 1EXMA 1C0KA 1SK8A 2BFFB 3QKRA 1IK4A 2TMKA 1N25A 1FUEA 4LDQA 4RFSA 4WDQA 2ZSAA 1I0LA 1Q6ZA 4OQFA 2VHTA 1ECPA 2AWNA 4M0PA 5F77A 2E4WA 5L95A 5U9CA 4IWXA 1X92A 3DTVA 1L7VC 4ER5A 3H5LA 3TLGB 2PYZA 3CNBA 5B64A 3EDRA 4P4LA 4WZ6A 4AZTA 1XKLA 4B8WA 4MQUA 5DXJA 2R6HA 1U3WA 2X58A 1RAIA 4RK6A 5I8WA 1MQSA 3LMKA 4UVHA 3LAWA 3L93A 5KUTA 1QPGA 1IN1A 2QN1A 2QJWA 1UBMS 3M9XA 3WWOA 5CG2A 2HIGA 2ZVDA 1MRSA 4GR9A 3VPDA 1ORTA 3S2EA 4EHHA 4UU1A 4M1YA 2Z3WA 1QE0A 5IF9A 1VSUA 4G26A 4LBYA 1KSHA 1G18A 2EZTA 2FWBA 1K6XA 1TA4A 1Y3IA 5FJIA 2GSWA 2NVBA 3QK7A 2AFRA 4JT9A 5EQJB 1EVYA 3AB8A 1H69A 2AVNA 2FCAA 1EKXA 1URPA 4JDPA 1Z5VA 2GXQA 5DGIA 4BCBA 5GAJA 1JR6A 3OQ1A 2A9FA 3C0KA 1BA2A 4L5BA 1RAFA 2D1YA 3M6AA 4MR9A 3EQ6A 4TKZA 1IIRA 5CNIA 3FAKA 4MYRA 2YWXA 3FE2A 1H2ZA 3DOHA 5DEIA 3TTTA 1NQ5A 5FEMA 1U8FO 2ATVA 2H1SA 3HL4A 3R8XA 1FQKA 4C08A 4OQ4A 1UXHA 3STXA 3W9YA 1KI3A 3GWGA 3T3MB 1TAUA 4URHA 4MKFA 1YK1A 5GV8A 5CLJA 3N5KA 2JEOA 1SBTA 3ENKA 4WNCA 1MX5A 1EFAA 1TRKA 3WP0A 3MJFA 3C85A 2W6OA 4DIKA 2C31A 1BFDA 2WM8A 3AY0A 3D2CA 3WMWA 1HLDA 4Y6GB 4IXDA 5EEHA 2R2GA 2VQFB 2H51A 5DHSA 1RI4A 2QTMA 4LZZA 4HTFB 2AOWA 1DBVO 4W9NC 4JL6A 1K3TA 4QOSA 4YN3A 3TNDA 1R0SA 2CMDA 3ZHBA 4Z49A 3IMEA 1RRPA 1T5BA 2B5OA 3LPCA 4B6OA 3P2EA 4BDSA 4DF3A 1GWNA 3E2PA 1N0VC 3JQRA 1UR5A 3LVFO 2RI6A 4PC7A 4WCVA 2VP2A 2P2LA 2G28A 2WSSD 4XGIA 3W5IA 4YMGA 2J9GA 1COWD 4NJEB 1JGTA 3G68A 4DRXB 4GLFA 1WO8A 5GONB 4BLOA 2XRMA 2BFCB 3FB4A 3HVKA 4IJVA 4X60A 4DQLA 1ZEJA 4OHCA 4YV0A 3EC1A 3CF4G 3HH8A 3QJ5A 5DHUA 2OFPA 1S0UA 3G2NA 1OVMA 3LGAA 6NULA 2R8ZA 2FMHA 4DSUA 1KQNA 4JBNA 1OI4A 4WWHA 4HOYA 1J0CA 4B75A 1MP0A 4RA6B 5AM5A 1L7NA 4L57A 2FUG1 4JNKA 3H13A 5C53B 2BGWA 3LKDA 1QHNA 3AKYA 4IILA 4A1OA 4D3XA 5JI2E 3G1UA 3INTA 3HPQA 1TT7A 4KDCA 1GQ2A 4GQBA 4KE9A 2Z1NA 4ZCLA 5GV7A 3I5YA 1FS6A 4DRYA 2C2YA 4U7HA 4P81A 4F2HA 1HT3A 2CD7A 3CLHA 2C4KA 3K09C 3URMA 1OXMA 3BAFA 5CT8A 2O8DB 2YS6A 2YXLA 4NIMA 2YC4C 1I36A 1WOYA 2GN2A 4G63A 2ZS9A 5JYEA 2WG0A 5FOSA 2P8SA 2OFWA 1ZK4A 3PYLA 2BHRA 2E5WA 4QXPA 4RGYA 5B7GA 5KC9A 1BA3A 3G79A 3R5SA 4QOGA 3OQMA 1ZEMA 4FBGA 4MYTA 3HJAA 4TTPA 5D1NA 3VYUB 3ZCPA 5FTWA 4RFVA 3PRKE 1MLDA 2C29D 3PFCA 4MVWA 3MUEA 3QH4A 3KZCA 1MEOA 4EY7A 2YBDA 1XCGB 4UUPA 1R6UA 4CKEB 4EVSA 1G63A 1M1UA 2Q8QA 4WW0A 2JEZA 3EEQA 4JR2A 3FYHA 5FL7D 5JWHA 1IM5A 1NNLA 1MAVA 4PFSA 1I14A 3G0DA 3A06A 2C4TA 1H1TA 4ME6A 3LS2A 2JGEA 1VYHA 3HA7A 1B6RA 2MSCB 1JR3D 1F8YA 1YS7A 4CYMA 3ZHZA 2Q07A 1RDFA 3CNLA 1YL7A 3COPA 1D8TA 2J3DA 1NVMB 1Z74A 3NC4A 1M72A 4JDUA 5KNCA 1NBME 3TMKA 4Z54A 2QAGA 4FFWA 3JATB 4QDZA 2B99A 1DMRA 2H4JA 2DKNA 4RORA 4WPGA 5EPOA 3ZJ4A 2AMLA 2KPOA 1JECA 4NZPA 2JIRA 5IW8A 4HNGA 4O4JF 1V41E 4Q4JA 1QHHA 3TRDA 5CXQA 3EW7A 4L3WA 1CBUA 2VN8A 3HR4A 3T3IA 1L4GA 1TTTA 1USUA 3NMUF 4G1UC 4WV3A 1O6GA 4PW0A 1VJGA 1L5SA 5EP4A 4RF3A 1C1XA 2ZWPA 4C5AA 3D4NA 4GO1A 2ARKA 1SBQA 2ZI4A 1FXWA 1KKMA 4ZU3A 3QP9A 2BFAA 4G5QA 2UVPA 4REQA 1X8KA 4GP9A 2CJXA 4YJ2B 4D98A 2JLSA 4Q3EA 3SEQA 5KOJA 5FT9A 1E1LA 4E5UA 5DHQA 1VG1A 1YV9A 3A25A 1E9VA 2BI8A 2JLZA 1VKZA 2GK4A 2NO5A 3RC3A 3CUSA 5JVDB 1QCZA 2FRDA 1YJ8A 2ZJ1A 3RVPA 3MJHA 2JK1A 4H3VA 3TTWA 3IT0A 3HBJA 4CLHA 4BMXA 5KYUA 4YWJA 1U0HC 2NZVG 3C6KA 1SHTX 5K4GA 3IQWA 4HFNA 1GDHA 4C3ZA 2IOYA 3ELUA 4HFJA 3V4VB 1XTVA 5LD2C 2NU8B 2MSKA 4WCFA 3OTOB 1G64A 2Y99A 4N82A 1R4ZA 3EC2A 3KHKA 4RXMA 3FTEA 1E32A 2XEDA 1U0TA 2QRKA 4NOLA 4RQUA 5CB0A 1Z7GA 2Q5FA 2V3VA 4MI6A 3JWIA 3AERA 3O0TA 1IEWA 4M99A 3IL2A 5BMVB 3IAXA 6ABPA 4FT4A 1G5RA 3OA2A 3U3DA 2ZU6A 2HRRA 4EG8A 3G0GA 3V2GA 1DQPA 3T9FA 4JLKA 2GM9A 3AF5A 1MTZA 1I2DA 4PS1A 1ULAA 4ZOLF 3VOAA 2B94A 1U9CA 2ZE8A 3DCJA 2ZSUA 3M4YA 1FJXA 3OY7A 3R09A 3W2EA 4KWCA 4CF7A 5IMBA 3RG8A 1CZUA 3SFTA 4HDRA 3DVRX 1LRLA 3QKTA 1AC5A 3MCVA 1L8QA 5FWAA 3WLFA 1M2GA 1JEOA 3ZU4A 1J9ZA 2ZB3A 1H9CA 1D09A 1ZOLA 2IELA 2N47A 1L4FA 4HWTA 4O4LA 4DTIA 3NNSA 4F3RA 1R3UA 1YDGA 3EULA 3C3BA 1V4NA 2YFYA 4JVLA 4K9QA 5KAPA 5JD3A 3B85A 3UCFA 5F9HA 4EG5A 5IG2A 5ELXA 4A36A 2JLWA 1B0AA 3EFOB 4H59A 3V8RA 3RBAA 1LLCA 3S2SA 3S1AB 5JTTA 2VJNA 1Z5WA 2Z98A 4G8CA 3U4DA 3KHUA 1K8ZB 2XUHA 4DA4A 3T52A 3THWB 2L42A 1WXEA 3F3MA 1DXHA 1NKSA 1OZFA 3A9WA 5DU2A 2EJUA 2JIZD 3WIUA 4ZJYA 1KTVA 4RQTA 3TW8B 1USGA 1IBLB 3JYHA 3TL3A 3UMVA 5JEDA 3ECCA 3S3TA 1UM8A 2E82A 3DEFA 3F97A 1HXHA 4OHKA 1G8SA 1TF7A 3FLBA 2Z5LA 4JBHA 2OYCA 4AXBA 3OE5A 4MPJA 3OIYA 1FQOA 3GVPA 1NE2A 3NEJA 1P2GA 2GTIA 4FYMA 3BXHA 5CB4F 1ZM2A 1F2TA 1YQDA 2ZCUA 4U9IS 2QRVA 1G3QA 4LNHA 1E6KA 1UK8A 2H1WA 3RVKA 2Y68A 3I2JA 4IV5A 4A0HA 3JWGA 1J8YF 4BKQA 3H19A 4MDYA 1G7SA 4KQ6A 1E3SA 2RI0A 4NPAA 5ALGA 1LRJA 4AAYA 1K63A 1OIWA 4PXSA 1ZYUA 1G5HA 3TZKA 4QYXA 3THXB 1QYDA 1GT6A 4GICA 5C4MA 2YXEA 4J0DA 3ZQUA 2M2IA 1KMHB 3UXEA 4A8JC 3QU9A 4HKTA 5HCUA 1PIWA 1QAMA 2IXAA 4JCCA 4R9UC 5DGTA 5MHTA 5CIWA 3F5QA 1YB6A 5JNTA 3HVRA 4KVGA 1IHOA 3KZKA 4MVCA 2WSMA 2WJVA 1S1CA 2PA0A 2PKXA 1VLJA 4Q6WA 1UKCA 3P9CA 2I78A 4NLLA 4W5OA 2I76A 1QIIA 5L6MB 1X1EA 3RFFA 2Q99A 2VAXA 4QOHA 2P0YA 3PLNA 3TL2A 3SR3A 3AF6A 4RJIA 4CG1A 4NJMA 4FQ5A 4PLZA 4QQRA 5C8YB 5ADWA 4K9NA 4FFLA 4RL4A 4LHSA 1KO5A 3IBCA 3PXAA 1K6JA 1ONOA 3C4VA 4Q15A 3TVDA 4URZR 1I4EB 1P19A 3KYDB 4B3GA 4ESOA 1Z6GA 2KB0A 4MB6A 2CNKA 2XDYA 2JF0A 4ZVTA 3TGLA 4Z51A 5I5GA 4O2RA 2OBYA 5FPQA 3KWFA 2YN2A 3BIFA 1TU3A 1SN7A 3PF9A 4UUOA 3QEMB 1FSFA 4RVOA 2DHEA 2X6QA 3I4FA 5FTNA 5T41A 1CS0B 3OKAA 4RD1A 1MAUA 3SBOA 2O5EA 2H9IA 5EHNA 4GS5A 1EESA 1VE5A 2HTFA 4HBGA 4QBGB 1KIAA 2DPHA 4HMPA 1E61A 3DA8A 3H65A 1KJZA 2WF7A 4B43A 2RFLA 4M37A 3WL5A 1O94A 4DIUA 1B42A 3W1VA 1FOEB 5FWDA 3M0EA 1ZJJA 2LBPA 2FNAA 4JL5A 3ZXUB 4MP8A 4OM7A 5AJZA 1UZMA 4ZTUB 5AQEA 1UBLS 2QLNA 2F2TA 4WJKB 5ALFA 4BVJA 2MCFA 5BUSA 4AF8A 1P2VA 1PNTA 2BONA 2IYVA 2WMDA 2ZR0A 3H5AA 4M86A 5K03A 1KYWA 3DLBA 5JMPA 4Q4AB 1WR8A 5DHFA 4UDXX 1WSBA 1U3UA 2NU6A 5I7SA 3R7NA 1SKYB 3BDVA 1M10A 2RHDA 3GT3A 4G5SA 5GTDA 1Z06A 1IZ7A 2PT9A 2WU1A 2CJWB 4FFPA 2RHCA 3EUAA 1FX0B 1K08A 4J16A 3GA5A 3F2VA 3GD5A 1T0IA 1ZNQO 3TI9A 1GGEA 1NUQA 2HJGA 2L17A 3H2IA 3I1JA 2IK8A 3DONA 3I1IA 4FR2A 3SC4A 4DBLE 1USVA 4KYTA 1T4CA 5AHKA 3K5PA 4GLBA 1EUCB 2YMMA 2A9OA 3DHWC 3HEBA 4GVXA 3DH0A 1E3LA 4YALA 3I6YA 4IP0A 4N8DA 4OU4A 2VUSA 1GR1A 1UPAA 1YAHA 4JI0B 3UEOA 2W22A 5ALKA 4A2PA 3U9SA 5JNUA 4B6PA 1MT0A 3P96A 4D44A 3SYLA 2OZVA 1NRJB 2EU8A 3I9V6 3IJEB 4IZ6A 1LU9A 4LMAA 1N1DA 4NEHB 4R2JA 5HCNA 1D2MA 2B8JA 3AP2A 1D1PA 3TMYA 2ZI9A 4LNAA 1DWQA 4K88A 4C6RA 4JYAB 4L8LA 1N0IA 3PX2A 4PPYA 3OZXA 4C7BA 5B53A 5BWMA 5F3DA 1E6UA 5LQUA 1MX1A 1ZUNA 4L15A 5ETJA 4QG3A 3QOFA 4J3JA 3MGAA 1EGVB 2WNHA 2O8FB 4DMMA 2AD5A 1IRXA 3DQQA 2ICAA 3L1HA 3QSGA 5FV7A 5CDFA 4GHWA 5BSHA 2R1UA 1G0NA 2IYAA 4RK0A 2FMFA 3HLYA 4PY2A 4MGEA 3WZ2A 2QSJA 1SBYA 2P2NA 2ZVQX 2V96A 4OQEA 4EGJA 4CUKA 2CYAA 4U5QA 1XXHB 3WNZA 1UBJS 2DECA 3AG5A 3F78A 5A5EA 4QOJA 2XD4A 1OR8A 4EJ6A 3RRJA 5KYYB 2BC9A 4Z0PA 4AF6A 3KZOA 1WCXA 3CLTC 3WK5A 4EG4A 4DNOA 4HXGA 1QH1A 4G23A 1A27A 3IC5A 4AL4A 2FVXA 2LCQA 1F38A 3M4XA 1JPUA 2VI5A 1CZNA 4QU9A 1EFKA 2ET6A 2E2WA 3V9PA 1A7AA 1DJOA 4TWRA 1QWSA 2JEYA 4R05A 4E0BA 3H99A 3PPXA 2CMHA 2Q3EA 3B9QA 1GSOA 3DLHA 4RZSA 1SY7A 4S1TA 3AH8A 1P9LA 1MPTA 2O14A 3ROGA 4D9HA 3CZ5A 3IIMA 3TFQA 1U0GA 4G07A 2XTJA 1UEIA 4EL0A 4LGCA 1CHNA 4BMZA 4A0QA 2XZDA 4ZOQI 4IIBA 5JWOA 1G7CA 2QU8A 3NI2A 1QIGA 3KU1A 4MP6A 4QYTA 3ITEA 3JQEA 3HJGA 5DGDA 5EY5B 4KO3S 1DJMA 3WHIA 2FV8A 3FIJA 4LF6B 1V9CA 2C8JA 5KAMA 5BPHA 2GN1A 1IY1A 4DLSA 5AQ1A 3Q11A 4ZQEA 3QNUA 1XZFA 3HS3A 1K5HA 1XFAA 4K28A 4KB5A 4MW2A 5P8WA 4F8YA 4Z4IA 3W5VA 3AUYA 4FR0A 2NTJA 4YJFB 3AKZA 1NG9A 2KYRA 2UZ3A 4Q9AA 3FSGD 4WLUA 3GXOA 3TNFA 4U2GA 2GEDA 3PQEA 1RWKA 2RGYA 3N6XA 3PUWA 4NCHA 5I9IA 3LRTA 1X1AA 3P2OA 1EX1A 1T0PA 3QU2A 1HH4A 3L05A 3V48A 2AR0A 2OHHA 3HXKA 1K4YA 4YRDA 2ZIAA 3S1LA 4AJJA 3OLWA 3LCVB 5HIMA 4TT3D 4JGGA 3N5CA 4NYIR 5TS2A 4MWOA 5F2OA 2AOUA 3BTVA 2XTAA 1JIIA 1V16B 3VTAA 3SSNA 3L6BA 4KQXA 4TT8A 1JTEA 4XYEA 5TVKA 2G5CA 3ZS8A 4ANFA 4D9JA 1AZLA 4E33A 4URFA 4EGFA 2RAPA 3KNZA 4UVEA 2EBHX 4IVRA 2B7LA 2YQ4A 1J0AA 1RCFA 4DT1B 2ZEJA 4Z3OA 3DWFA 4O02B 1DEXA 2CF5A 1KMIY 2GD0A 5EPEA 3DAYA 1ST3A 1Y1SA 3NTVA 1I0ZA 2D62A 3NAMA 4HYYA 4L8VA 4LI3X 4NEGA 5DW0A 3FVTA 4PBSA 1E1CB 1PYDA 3K70B 2PRJA 3PHBE 1WZEA 1HYGA 2LIVA 2OHJA 2I2BA 3BZUA 3OICA 5H82A 5TVGA 4M9UA 3BORA 4XXHA 2X7HA 1GOTA 2QVCA 2BKLA 2C88A 3GRRA 2Z2JA 3TIVA 3MMNA 5FBKA 2CDRA 2D1RA 2LW7A 1XDWA 4IDAA 1V8BA 1NTOA 2R8EA 1XIVA 1PNRA 2I3GA 3QMMA 3RW9A 3SVLA 5KB3A 3I83A 3U7QB 1DPFA 2G25A 2QG4A 2F43A 4MVJA 4CMIA 3K92A 4LHVA 4PYIA 4C5BA 5K0SA 4D0GA 2PKQP 1V2HE 3H05A 3BFJA 3AXTA 3D7SA 2Y67A 4N6GA 4KN9S 4M2LA 1XZGA 2QNRA 3D8HA 4BFVA 3K0AB 4X63A 5BW6B 3ZOZA 4LGYA 1FDIA 1AMOA 4AMYA 4GLOA 1Q2UA 1IAQA 1T2UA 5L3VA 1JZQA 3IVMA 3K1JA 1KI6A 2JGDB 1YA6A 1VJ0A 1XJQA 4P2GA 4XSGA 2YMPA 3F98A 5TPWA 2DJIA 1WF6A 1YS2X 2N1MA 2NSHA 4J07A 1BCSA 1DIHA 2P9EA 2WSBA 3G59A 3L6UA 5HDBB 3WLPA 5I7WA 1UMCA 3B8HA 4TXHA 3HNOA 3LLMA 5HKOA 3I9V1 2ZM5A 5K2MA 1K68A 5C8DA 3FKQA 1H93A 2PG3A 5A7GA 5LZ5A 3D2BA 3OT1A 1AKWA 4U00A 3ZI4A 4DANA 3TCXB 2O52A 3W9UA 3G8YA 5JOQA 5JQGF 1O0BA 3GD7A 4GI3A 1KYYA 3A1FA 5CT5A 1GG8A 2Q3DA 4NP6A 1USKA 1APBA 3TQFA 2ZDHA 3NM6B 1GPAA 1VI6A 2XYGA 4NYIQ 1NFFA 4OB7A 1Q1QA 1CY1A 1MNAA 1T5OA 3DEKA 3MTIA 5LNK6 4WXHA 3G6WA 4OREX 1VPVA 1CUHA 3L0YA 5I51A 2ZXEA 4QDXA 3LH5A 2D0OB 1WCWA 3UA3A 2A1TS 3UICA 4RHYA 2B20A 1CX9B 2A92A 1K4KA 1WXWA 2WEKA 4I5FA 1BGWA 3S44A 2CLFB 3S29A 4C03A 2OUIA 2A9QA 4MUIA 3RVBA 4EFNA 3L92A 1C3XA 1P29A 1UK9A 3FTDA 3DYIA 4G65A 2QP4A 1EFPB 1YZYA 4FYVA 2AN3A 1JA0A 1LC0A 3BTUA 1EJBA 3E3NA 4US1R 3WYEA 3ZI0A 4D45A 1KVTA 3L0OA 1F0NA 3D5TA 4Q4CA 5LQNA 1KYQA 2BV3A 1JKMA 2ZRNA 3HP1A 4XWGA 3V4PB 4BQPA 1FMFA 4G0XA 1ZICA 4A1FA 1D4FA 3W1EA 2V5UA 2FQXA 2K2WA 2HK8A 1SZPA 4YCJA 5KNLA 1RBMA 3ZGNA 2XCRB 3SY8A 2WPDD 1YE8A 5K8LA 2JZCA 2JVJA 2ZJBA 2IE0A 4AKGA 4DQVA 1ST2A 2OSBA 3H04A 3MQ2A 3LUKA 2E4XA 3OU2A 4O5AA 2BTQA 4YASA 4RD4A 1SGWA 3JWJA 4FOLA 3AUTA 3RJMA 5GZ3A 4HBZA 4PG8A 4RNDB 3AYZB 5JNVA 5THXA 3L07A 1QO0D 5CPFA 4YHBA 3GHYA 1AKQA 1JHYA 4CQMB 2VHUA 3C3XA 1H4TA 5JTUA 3HCOA 3VHLB 4F2PA 1DC3A 4MPDA 1E5XA 1KZ4A 1DQSA 1DU4A 1KNXA 5CUQA 2BKVA 1PK9A 4JIGA 4LCBA 3K35A 5AI6A 5AJXA 2X9LA 4ZAFA 1N2SA 3DE6X 2YJ6A 3DD1A 1H8HA 2IPLA 4PLVA 3LHFA 1XU7A 2X0DA 4QICA 3WJ1A 2PZGA 4RW0A 2F17A 1QP7A 2XRFA 4MEAA 4BX8A 4EMTA 2HL6A 1GZSA 2XMSA 1W85B 3C6ZA 2H8KA 4NAVA 4RD0A 4V0SA 2JI4A 5GQSA 4D9BA 2QIOA 3AKCA 4MAMA 1Z0KA 4BNUA 5BNTA 2CUNA 3CWQA 1VYVA 4BMVA 1DE0A 1P77A 5JR3A 3QTLA 1DAOA 3ODPA 3DGFC 1YVPA 4RE6A 1EFDN 1OYOA 1GTMA 4KTTE 1UBCA 4M22A 1RMTA 2GRJA 4ZYZA 2IZ5A 2C3MA 3GFRA 3GZJA 3T5BA 1GTG1 2NWQA 1IHYA 1HDYA 2OXFA 2DWQA 1XD8A 1H23A 2FMXA 1V7ZA 1T9CA 3AHDA 3KTOA 4M38A 1R9GA 4MVJE 2BP7A 3FRJA 1D5WA 1V4VA 4ZCIA 5FUMA 5JPIA 2CF6A 5JQGB 4H4CA 3QBVA 4JEMA 1UH5A 2I0FA 1F2VA 1TLTA 3BL5A 4DWJA 2C7QA 4YT8A 2GESA 3NZEA 1A4RA 5C31A 1ETHA 1LV8A 1N5LA 4L2IB 4ZA2A 5F3RA 2JA2A 3U6BA 4Z3DA 3MOGA 4ES6A 1MD9A 2IPMA 3OCJA 1GTSA 4JZYA 2OR3A 1NSTA 1OY1A 2JAOA 1PR6A 1N7JA 2PR2A 2SKDA 3IQGX 5GGYA 1T3LA 2B3DA 3AEKB 4Q3NA 5JWRA 1CIPA 1JS1X 4DLVA 1L5QA 4OY3A 5EJIA 1E2IA 2YZMA 3SJAA 3F6EX 4K9RA 4GKVA 4R9RA 5CLLA 4R84A 2PUBA 2XMBA 5T64A 4CEHA 3SG0A 1JLMA 4K2AA 1NUHA 1XTIA 5EJGA 3RAGA 4P83A 3LT0A 4DREA 4JLWA 3SFVA 2IPOA 1KP2A 2NN3C 2P6PA 4LQ4A 3WKEA 2QA5A 5LJIA 1E69A 1IG3A 1JR2A 5GZ1A 3DLTA 3R3XA 2PBRA 4RLHA 2CSXA 3KM0A 2KHZA 4HO1X 4BGIA 1B8PA 3HCFA 4M46A 4N0PA 1E5LA 2DT8A 4P32A 1IN8A 1VBFA 3A36A 4ZQIA 1QOQB 1WW8A 1AQJA 4TQGA 3ICVA 1O6CA 1P2FA 3IO5A 1BHQ1 1EB9A 5IU6A 4KR9A 1P2BA 2IYRA 1NFRA 1AV6A 2OFXA 2SKEA 2FZKA 1YULA 1GDTA 3A9RA 3UMBA 4UCWA 2XWBF 3EMBA 4WBNA 4YLGA 3HXLA 3QHAA 1FNDA 2GZMA 4NYJQ 2A9RA 3ZNQA 3MK31 4DC1A 4IIDA 4WASA 3EF0A 4JJFA 1L5FA 4MUHA 5ICSA 2QL5A 4HSGA 5C1IA 4Q00A 3ASYA 4NCXA 1Q0SA 1H2WA 4KYVA 3HU2A 3D7KA 3TLAA 5CCBA 1CY4A 3GUUA 3JWHA 1VB5A 2IXBA 1ONNA 4QE3A 2GUWA 3P9RA 3HXMA 4G0QA 1O0CA 1NXQA 2WP8J 1K7CA 2A1TR 3A6LA 1EFUA 2GBLA 1XKTA 2NUPB 1JFSA 5DX8A 3AUAA 2FHPA 3WFJA 1B1AA 1FNMA 3C3YA 4BFUA 5EXTA 4EHAA 3RJTA 3I2FA 1ODCA 2OD7A 1V95A 3E9NA 3HKCB 2WIJA 2GILA 3FJ1A 3T1VA 2GNOA 2ZDGA 1MJHA 2XPCA 2LZ0A 2R44A 3A4VA 3B9PA 2I8LA 3E4CA 5G4KA 1UPUA 4M1TA 1FDSA 2HSDA 4LWZA 2B2NA 4H1TA 1JQAA 1QYVA 4W7IA 3UUFA 4JT4A 2RGNC 3C43A 2TMYA 4TVSA 3P5SA 3R7LA 5ED4A 5EIXA 2RK4A 3I6QA 3RAFC 3KU4A 5JADA 3ANSA 5GP1A 1HKHA 1W5BA 3IVGA 3DDHA 3RV3A 5LDDC 2GK6A 1G7RA 4RYDA 4EB0A 2XHZA 2AZ4A 5F2KA 1QAQA 2GQ0A 2XVMA 5AW4A 1I1HA 1TYEB 2ZYWX 2IBSA 3SPXA 3OUUA 3MINB 1ZD9A 2G0NA 2FGKA 4HDNB 4TLBA 3GJQA 1WETA 4M0EA 4I9NA 2YY7A 2C58A 3PIIA 3TIIA 5LFAA 3DDOA 4V24A 2ZBRA 3FPEA 4TKVB 2OLKA 2RD2A 1Q17A 1J09A 2HAEA 2I4LA 2JCGA 4Q7EA 1W6UA 3ZU2A 4X0EA 4PANA 3U5TA 4GLJA 1EX6A 1QLJA 2ZJ4A 3PF8A 3MWGA 1UXIA 1JHXA 3TQCA 2X86A 4E46A 3N8HA 4JVNA 4E30A 3E9EA 3T1QA 2O8BB 1C9EA 3KR1A 4HB3A 3DZGA 3RYFB 3MFQA 1U9IC 3H2KA 2QD1A 5AKYA 3OSZA 4X61A 2ZJOA 5I4BA 1JXAA 4LVOA 2W93A 4PO1A 3FDZB 2V9PA 2FSVA 3PPVA 3NV9A 4Z0NA 1EVIA 4YAOA 5LDHA 1YF3A 2ZCVA 4UQOA 3PWSA 4D74A 3C1UA 3MC1A 2Q7OE 3MAAC 4XKJA 3T95A 5DVZA 3KXIA 3ZWXA 3K1AA 2Q6VA 3AI3A 4RPJA 4RKEA 2X4IA 3M6WA 3E58A 1OSNA 4KBGA 1IQ0A 2PUDA 5REQA 2OWEA 1T2AA 2N0SA 5FDFA 1DCKA 2Z8YA 3BK7A 2VUIB 1K9VF 1VLVA 4UBOA 5AKKA 2W2TA 2WHYA 1PT8A 4GSLA 2IBMA 3UAGA 3RB8A 3D43A 3DBLA 3P0IA 4L16A 1QP4A 1RPAA 1Y1QA 5D5QA 1EVQA 4GGOA 2AJ8A 2XT0A 1XTPA 3IKJA 2DR3A 3ADOA 5AW0A 3FLMA 5BNFA 1GAJA 1D9XA 1B4DA 4YGYA 2W43A 3EEIA 1C29B 2QAGB 3HSKA 1JIQA 2FOIA 3JZAA 1RIIA 4IUYA 1XCBA 3NKVA 5I7AA 2BBOA 4ETMA 3FHTA 1J0EA 1NIPA 5LU9A 2ZJ7A 4KR2A 4YP5A 4HN4B 4XVUA 1G2OA 1T5DX 2C7BA 2I6TA 4JFRA 5B6JA 5K0LA 4Z5XA 3HGMA 3DHEA 1XLWA 3HE3A 1XAIA 3O8DA 1UT6A 3DFFA 1YZNA 2ID9A 3GCXA 1W73A 2P4SA 1N8NA 1RNLA 3TD2A 3VHXA 4R8KA 1UQRA 4AO8A 1I3MA 5DXFA 4TTQA 4OD0A 1NJ5A 1Z08A 3OAAA 2PANA 3UCEA 1QX3A 2FEPA 1L5GB 5G53C 2GEBA 1CY2A 2XMZA 2RH5A 1OLSB 4OHFA 1TAGA 3K7EA 1LSUA 4TX1A 4ENWA 5LYJF 1ZH0A 2PSDA 1UDWA 1IU9A 2H7VA 4UBNA 1C9KA 2X19A 1YR6A 4QU8A 4HPXB 4EHBA 3QVGB 3SKXA 3N05A 4LDNA 3X1MA 4C29A 1FFCA 2G1JA 1GU0A 5U4XA 2Z9CA 2XOXA 2AYZA 4IQGA 1TUIA 3T7JA 1WVMA 3ND9A 1CDEA 1V35A 4YP1A 1N3BA 4TXJA 4DVJA 5AVZA 5IJ9B 1HTWA 5JFTA 5LLDA 5JVDA 3THYA 4YGXB 3ZXSA 3HU5A 2QB5A 2Y9PB 4OKIA 3MELA 4JI7B 3N6RA 1LTHR 3JQ8A 4XM1A 4UMFA 2XDQB 5JU6A 1T5HX 5KYUB 4XWKA 4ZRDA 4CXMA 1QRTA 4ZKEA 1WU7A 1XVAA 1RBZA 5ENDA 4CF6A 4UE3S 3EWIA 3LVBA 1MVNA 1X1SA 3P2YA 4FDUA 4N76A 2YXDA 4BKOA 1B73A 1PS9A 3LY9A 5ILGA 2NUAA 1PVOA 3A1VA 1G4UR 1QVAA 2H52A 4KRYA 4MI9A 2WYVA 4P58A 4W63A 1N2CE 5DIFA 2VJAA 5F4ZA 5L53A 4CLRB 5FEUA 1X38A 5ALPA 3PRJA 4YRZA 1TOAA 3E3LA 2RKWA 2R5NA 3PB3A 4EEXA 2AK3A 4EF6A 3OZWA 2GBGA 1F12A 2L69A 5FUQA 5CXUA 3B1ZA 3D9QX 4RMNA 5J4VA 4QARA 2ZPUA 3RPEA 2QZZA 2ZRAA 3HXOA 1IPFA 2EV9A 2XOKD 5DI3B 3KT3A 2DUNA 2R7MA 3SEAA 1N5DA 3ZD6A 1JT2A 4LRSB 3S7TA 3LIPA 2G40A 3O8QA 4JQYA 3NTOA 5EXDA 1U5BB 1A9SA 4CLXA 5JUWA 1UK7A 2G9QA 4KSYA 4A2QA 4U7FA 4V03A 2A3NA 1E1DA 2OGUA 2OV6A 4P4GA 3RSZA 3GYGA 2NXEA 3E9MA 3OQVA 4O4LB 1IHPA 2Y66A 4G8DA 2Z1MA 3QY0A 3SBDA 4D4HA 2QSUA 2EWMA 1AO3A 4GBED 1R6AA 5AJYA 4RFLA 1JFLA 4GMKA 4KXXA 1ILWA 4MI1A 4A8JB 3HFSA 5AVQA 1T9HA 2CD9A 3H6GA 4IDCA 2OLEA 4QBKA 2B34A 1UL1X 4GWGA 2GLUA 2PAAA 4YCSA 4D46A 1XWIA 3AR6A 3EIXA 3IR5A 3NUGA 2BTOA 1F4LA 4HNQA 1JQLB 2QRQA 3P52A 4ER3A 4JVOA 3Q72A 5I9TA 4DUGD 1DXOA 2I7DA 2AGVA 3EMKA 1J4AA 3CLTD 4WN3A 3OQJA 5KTNA 1BOFA 1UBUS 2XUJA 3GT0A 3RS3A 4PZDA 4Q1FA 2C4NA 1MGPA 1P4GA 1CDOA 1YDFA 2GCOA 2VG8A 3BE8A 4B71A 5JPDA 3ZCUA 1JJFA 2VJDA 5CM9C 5FPSA 3T34A 3C5WP 3E9DA 3V7FA 5IKMA 2QRVB 4X6LA 3WK7A 3TTXA 4FMBB 4S1OA 3K2IA 1CRZA 3ORSA 5HBGA 4L6AA 1JHUA 2CL7X 3DAGA 1X7DA 1DC8A 1DKPA 2AR9A 3AJDA 3GJSA 3D4BA 2CNOA 4G1BA 1GNQA 3G9TA 4TLEA 6LDHA 4JGIA 2YRFA 1XRQA