3BRWA

Structure of the rap-rapgap complex
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
336
structure length
336
Chain Sequence
TTKVKLECNPTARIYRKHFLGKEHFNYYSLDTALGHLVFSLKYDVIGDQEHLRLLLRTKCRTYHDVIPISCLTEFPNVVQMAKLVCEDVNVDRFYPVLYPKASRLIVTFDEHVISNNFKFGVIYQKLGATSEEELFSTNEESPAFVEFLEFLGQKVKLQDFKGFRGGLDVTHGQTGTESVYCNFRNKEIMFHVSTKLPYTEGDAQQLQRKRHIGNDIVAVVFQDENTPFVPDMIASNFLHAYVVVQAEGGGPDGPLYKVSVTARDDVPFFGPPLPDPAVFRKGPEFQEFLLTKLINAEYACYKAEKFAKLEERTRAALLETLYEELHIHSQSMMGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rap1 GTPase-activating protein 1
publication title The Rap-RapGAP complex: GTP hydrolysis without catalytic glutamine and arginine residues
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gtp binding protein
total genus 78
structure length 336
sequence length 336
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02145 Rap_GAP Rap/ran-GAP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11210 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3brwA02
3BRWA 1SRQA
chains in the Genus database with same CATH superfamily
3RRXA 3S99A 1UBMS 4ID3A 3A2LA 5HZKA 5L3VA 2WSBA 3CNEA 4EJ2A 1GU7A 2VIIA 2QD3A 3L6EA 1POWA 4MVXA 4JYZA 3EDQA 3DHYA 5REQA 4PY2A 3LP6A 2NUAB 2ECPA 1DC5A 4BMXA 5B36A 4YCMA 5EXPA 4K6MA 2B61A 5DPMA 3THRA 2F4VB 3GROA 1WVGA 2JLCA 1YMQA 1BE6A 3OF2A 1E66A 3MGBA 2FEPA 2B8TA 2O3TA 5EZYA 2WIGA 5IHPA 3GP8A 3ZHTA 2ZPUA 4MGIR 2Y71A 4EZIA 5BR1A 3QU7A 3HR8A 1E9AA 5B6PA 2WU8A 1IN6A 3EOZA 2QIOA 2BN4A 2C5SA 4NH0A 4BJ3A 1JQBA 4MAMA 1X94A 2WIDA 4U7DA 2CVHA 3COYA 1GR0A 2GBPA 1ESCA 4O4HA 1H2HA 3WIDA 4CCSA 1X2BA 3MUEA 4LYFA 5IVDA 3OUUA 2GBIA 1JAHA 1VL5A 2PZEA 1YB5A 2JEYA 1J99A 1KETA 3EXG1 4ZRDA 3TI9A 4BZPA 2IU6A 2WJ6A 5C7LO 5KYKA 5TMPA 4P4GA 5LBIA 1WMEA 2ZJFA 1L4BA 4G1MB 2AOXA 1NVVR 2WM9B 3GJ4A 4PAMA 3AUSA 3HPRA 3OZWA 4JHLA 5SV2A 2PRIA 1FFAA 1MA3A 4IXWA 4WGFA 3TTVA 1SURA 4EG1A 1K97A 1JHDA 4Q7JB 4B85A 3E3LA 4ZCTA 2V45A 2QVLA 5GJWC 1KAHA 4RZUA 3KFXA 2AFHA 5T4FA 4PWZA 1TKAA 1CETA 1ZX1A 4FOLA 1PZEA 2QR5A 4TV8A 1DWOA 1BVUA 3CBQA 4CW7A 1JAIA 1EA5A 3N8IA 1AO0A 1W8IA 3AGPA 3HRIA 2CNOA 4NOKA 1M2WA 4MUXA 4K03A 2ZJAA 1TUIA 3OHPA 2QSUA 2O5CA 1GG2A 1DG1G 5ICGA 3Q7IA 5A9RA 3GFSA 1I32A 2XOKA 4HUQB 3UM9A 3V1UA 3KZXA 4JB3A 2A0UA 4B2LA 2CZQA 1VB3A 1QH8B 2IUFA 2XMZA 2Y3IA 4QARA 4XDGA 2HRQA 4CT4B 4HN2A 1BRTA 1HT2E 5IARA 1D1QA 4N7JA 3RU9A 1Y3HA 4RK0A 1NPTO 2IPLA 3HWX1 3RTCA 4WACA 1KMMA 2P9BA 3DTNA 2W70A 4ESOA 1PDWA 1GARA 3O4IA 1J56A 3SFZA 2FG6C 1IM2A 2YJ3A 2M32A 2H9IA 3G1TA 2XDWA 1W44A 1XWIA 3KZCA 2J3MA 4L9SA 3ZBUA 4S1NA 4AJ1A 1X13A 2CEKA 4MS1B 4CIBA 1TM4E 4FLFA 4K2AA 2H9YA 4C5CA 2GRAA 4NDAA 2ZAOA 1JMKC 1LF5A 3BJMA 3PUZA 4H4CA 5IAEA 3BULA 1G7TA 3A7DA 3SEZA 2GVZC 3G0OA 4DCPA 2XH8A 4LVNA 4AMUA 3MJHA 3MJSA 2ZUFA 1PW5A 4DFDA 1S9HA 1OB5A 2F1JA 2H7VA 1VI5A 1PGQA 2R11A 1KOLA 1FNSA 4AC9A 5A9SB 5JTTA 1GLNA 2PBFA 3L6OO 3QVSA 3DOHA 1QKJA 1SUCA 2HK8A 2R8RA 5KYTA 2YMPA 3I04A 4F9EA 1YQGA 5KWEA 1E8NA 3Q9UA 2BHTA 1QANA 3CNNA 1KMNA 1NBEA 1ZGBA 2I29A 2O48X 1THMA 2CZCA 2BKEA 2JFYA 3GWGA 1ISIA 1CNFA 1J8YF 1P0QA 2GNOA 2ORED 1XZPA 3KKQA 3R5SA 4IO1A 3L01A 4J2OA 1HZZA 4K40A 5ANRB 1UJ4A 4NMLA 3STVA 4QVIA 2QN3A 3BGDA 3D8RA 3HL0A 1EG7A 3LHFA 4ID9A 2Z5GA 4W99A 5A9TA 2HK7A 3IE0A 4K6CA 1TEHA 1K6MA 1E1DA 3A4NA 2FQXA 3GCWA 2JLWA 1RXEA 3HJAA 4INZA 1HQKA 1MIOA 4H08A 1MO4A 4YIHA 4EHIA 3KSBC 3ITDA 5E3IA 4A36A 1JQAA 4Z9YA 4G1UC 2JIBA 1MB0A 3CISA 1C8KA 2JI8A 1B73A 1YUMA 2BHRA 3V55A 1TMOA 1W5BA 5FOVA 3QG5A 3WLOA 2PQ6A 2C1XA 4UOEA 2YFHA 2VBGA 5JXWA 4CQMA 3AERA 3PUKA 1M2EA 2CLKB 5DK4A 1DWQA 2PX0A 5TEVA 2WM8A 5FWYB 3IUMA 5KOHB 5KHAA 4F45A 2PGNA 2AK3A 1X42A 2I5PO 1K6JA 3SQLA 5FI1B 4KVFA 4LVOA 1S3SA 2WW8A 5H5JA 3R20A 2ZVQX 3BQNB 1PKEA 2WG2A 3BPSA 3BTUA 2WQZA 4B6GA 2ZXUA 1O57A 2B92A 3HJCA 5JJIA 1FJHA 1JG1A 1OYVA 3JWJA 3QFCA 3A32A 1B6GA 4JGBA 4RJJA 1RTTA 1DINA 1D2MA 4YRPA 1VSBA 3R0XA 4Z86A 3C7CB 3TQRA 2YZ2A 3T99A 4AKTA 4QGBA 2A5JA 5L4NA 4U5QA 3UJCA 1C5KA 2WDZA 3GARA 4TV9A 5M29A 2WNHA 4U2CA 4QXAA 1JZQA 1CD5A 1GEEA 1CRZA 2HN9A 3E9QA 3IKVA 4KO3S 1ZH4A 3NTXA 1GDTA 4X60A 1N2XA 3E0XA 3A1TA 4KQXA 1FLAA 1X1AA 4AT1A 1AXGA 2ZBUA 4NU8X 4GI7A 3VVBA 1TA0A 1ZK3A 3QXCA 1IJKA 3J7TA 4YJ3B 1QQ6A 4EOGA 1C3LA 3BCHA 4HGZA 4LOJA 4WLOA 3UB4A 1XIVA 2IOFK 2W2VA 2XZDA 5I45A 3O8BA 1SZDA 2ZB3A 4CR8A 1PJLA 4WKGA 4J49A 2GTIA 4JC4A 2Q7DA 4E09A 2VBFA 1ISSA 3TSWA 1E4YA 2ZSIA 2ZWVA 2ZB2A 2R1VB 2LW7A 1KSHA 1WB5A 1A95A 2X9NA 3GEIA 1L0BA 4CMJA 2FE1A 1S0UA 5CX1A 3NIDB 4OP1A 4M8NE 1N2JA 1ZBDA 2WHEA 5JANA 3CRQA 3S1LA 3SS9X 4X3CA 1FDVA 4Z5XA 5C81A 5CXXA 4BCCA 2OGUA 4ZICA 3E3AA 4G25A 1B0AA 3KSUA 3RS9A 3U39A 2I4OA 4FGLA 4AN1A 1TYBE 2JLZA 4EUFA 3LRXA 1NMSA 2IPOA 1MEOA 2FSUA 3D31A 1J4AA 1Z75A 3F74A 1H2XA 4J0EA 2QJTA 2YJ4A 4KQ1A 1G21E 4GKBA 2HMUA 3WKDA 1XVUA 2IYFA 1ZIOA 5LJIA 1FDSA 1X7DA 2XPCA 4GVLA 1YS7A 4REMA 3W8NA 4NHEA 5A3JA 4CYMA 3VISA 1X6VA 3OD5A 2IEZA 1H4QA 4HYQA 1V4VA 4GSYA 4Q47A 4EA8A 3LQQA 3HUEA 2Z1NA 3AHEA 1Y0BA 1FXWF 3O4FA 3Q2OA 1Z4MA 1UJCA 1IHUA 4DB2A 2WJJA 5FH9A 3BMNA 4D0NA 3B53X 5JNUA 2PUTA 5JRJA 3Q7EA 4KR6A 3O03A 1L5FA 1TT7A 1V8BA 2O2EA 4F4IA 4BFXA 2VYNA 3I8XA 5F73A 4YPFA 1SOMA 1U2DC 3PIIA 1RP7A 2JGFA 4S1OA 1A7KA 2EFYA 1U7UA 3IQFA 2OB2A 1FRZA 3O4JA 4NENB 4V0KA 1U90A 3K5PA 1LZKA 1WF3A 4QDZA 1QGAA 1XV5A 2FFHA 1W29A 3QX3A 5KSWB 1JALA 3PU6A 4FNOA 1X8KA 3RG2A 4MDHA 3B12A 3BJIC 1QP4A 3MJVA 1E20A 4WNCA 1Z5VA 2D6FA 4CLXA 2DZDA 2ISQA 3K6JA 1O6CA 2WZDA 1AKVA 3T3OA 3EEQA 3PJEA 5FWAA 4NXMB 1AKRA 2G83A 1O96B 1LJLA 5EFZA 2F43A 3Q7RA 2AYZA 5JMOA 4DR5B 5JSZA 4B76A 3O1JC 1CF2O 1XVIA 1WUHS 2QVBA 1CE8A 2EG9A 3PDHA 4LZJA 4A0GA 4I50A 2B0JA 2X7XA 3D8NA 4LDPA 4E7OA 4RORA 5DH9A 5AW3A 4QXRA 3WRWA 4H7EA 1WDLA 2E1PA 3W77A 3WV5A 1U8TA 1ULUA 3QELB 4JFRA 3KEQA 4JXXA 4FWIB 5ULLA 1S4QA 3GEDA 1XJQA 2X0RA 3OCUA 4MO9A 3THYB 2ZBFA 4JQZA 3WSWA 3KKMA 1J0DA 1SKQA 3QWIA 5IP5A 4FK8A 3FVWA 4QEZA 3MMNA 3K35A 4MQUA 3ESYA 3H5IA 3DDSA 3V4SA 3FDIA 1ML4A 5DIFA 5E3JA 4DY6A 1F8GA 1RMYA 3L8FA 4TLMB 4XUDA 2BONA 3DV9A 3RHSA 2ZJ5A 1BN6A 1RZRA 2OV8A 1CSEE 3VR3A 1RBZA 1WG8A 4H9GA 4JVLA 3BTVA 5TJHA 1QR2A 1YS4A 3JD2A 2ZTLA 1D9XA 1U1FA 4ZAXA 1JFVA 4QDJA 3PL5A 3B3AA 4WBNF 3WLRA 4ZZ3A 3FPEA 1Y34E 1D1TA 2F64A 3I0MA 4XXHA 1EUZA 4JKOA 1N4AA 2EOAA 4IXDA 4J90A 4ZYYA 2JL1A 5F1OA 2JBAB 1NBIA 2JLAA 2Y92A 2XYPA 3RC1A 2PD3A 3K5IA 3D5TA 3LWZA 1XMSA 3PEWA 5FOTA 2EC5A 4D4GA 2XUPA 2H1SA 5IDVA 5JFOA 4FZRA 4KG7A 4L28A 3IALA 1OILA 1PFQA 1WCYA 3IXLA 3G6KA 3KV3O 1ZSYA 5HJ2A 4FS8A 1M5TA 5I5EA 3B85A 1L7XA 4P7BA 2A9VA 2A3RA 3DMPA 4NPCA 1DOZA 3VJRA 4U7HA 3KQVA 3W5VA 1P80A 3B9BA 3DT9A 2RBEA 2IZ0A 2YV2A 3I2HA 1OE0A 2BFFA 1O8BA 4P5PA 3WYNA 2CKMA 1WDMA 3D3WA 4XASA 3K1YA 5LZ8A 3R7SA 3V80A 5KSZA 1UINA 3VPBA 3O31A 4OKNA 3LP8A 1SVKA 4R84A 4NNPA 5AYVA 4AUNA 4OUKX 2FSSA 3BJRA 2VEDA 2SNIE 4FCTA 4EAAA 2XB4A 2PZLA 5CDFE 4ZHQB 3X1DA 1II0A 1QG2A 3BD7A 4OXNA 3QE9Y 1UPBA 4B5KA 1N2IA 1XZAA 1ZVQA 2V59A 5DYTA 1SHTX 3ORSA 1J2UA 4YP1A 2QY6A 3NZEA 2ZS8A 1C0PA 4DV4B 1NTRA 3OPYA 1CS4C 5DOVA 1GUYA 1HM5A 2AT1A 2Y1OA 1Q1GA 1S2DA 4MPTA 4UNPA 1Q21A 3DAPA 1EX7A 3RARA 2QV0A 1GGVA 1Z0UA 1GGHA 1NXTA 2CCKA 4YYEA 1AVTA 1DC3A 4EELA 1WTCA 5FUBA 4MW0A 3RABA 3WZ2A 4RANA 4B31A 4NLLA 4P5EA 2ZJ2A 2Z04A 2I2WA 3RDPA 3ON5A 4OJKA 1CB0A 1M9NA 1UMDA 2NV0A 2I2XB 2CL5A 2CD9A 3UJBA 4YCBA 2EYQA 3O6VA 2QRJA 3MUFA 1D04A 1QE5A 3BMXA 5IJ0B 1FJGB 1LWNA 1XALA 2Q6LA 1JG7A 4I3FA 2G28A 1EXNA 5J3JA 1ODTC 1T24A 4KLCA 3PRKE 2O3RA 3RIXA 5BSHA 1K88A 1OLOA 2UZIR 2HXGA 2X2EA 2CMGA 1K3FA 2WHRA 2YY7A 3CFYA 2GGSA 2J31A 1I2DA 3SIXA 4OKIA 2CXUA 4B3HA 1AN0A 1GU0A 1RI2A 3ONEA 3ERCA 2X7HA 1R8YA 1XUOA 3LYUA 1E2BA 4DLBA 4FN5A 3KR2A 1IOVA 4JI6B 3R7DA 2FFJA 1F3OA 5BUQA 1J21A 4F3KA 4CIDA 4L5CA 1LC0A 4PTLA 4BDSA 1UP7A 4QGHA 3GZNB 4C7VA 3PXDA 2I1LA 4M76B 5C8DA 5DTEA 9MHTA 1GZDA 4ZT6A 4QYSA 3TL6A 3CRNA 4JYAB 1E0SA 3A36A 2X5KO 1WVIA 3AW8A 4MEAA 4B3BA 4ZYVA 3T1TA 3K16A 3U7GA 1B6SA 4NFHA 1RXYA 2QTRA 4XR9A 5EP2A 4ZOBA 5B3AA 2DLDA 4MI3A 2OCAA 2OBBA 3MT0A 4TTPA 1L8QA 4ES6A 3T5MA 1FZTA 3ECAA 3JD3A 3PC3A 3IPYA 4Q34A 3L1HA 1KYQA 2Z3VA 4RMNA 3C6ZA 3JAMA 3HCCA 2QVCA 1KZHA 2ON6A 2PXAA 1KP2A 2AF4C 5CIYA 2O8CB 2IHJA 4YAWA 3VKHA 3OPXA 5DJ5A 2VXBA 2HO4A 1WIWA 4MMZB 4AECA 1QDLB 1E0KA 3CLUC 1Z5WA 1G20A 1OXSC 1J5EB 3TSYA 3TLZA 2I87A 2JIMA 2O0HA 1P7ZA 2WT4A 2VWHA 3CZPA 4HUJA 4ZZIA 4BC1A 5EUQB 1VKNA 4FQ7A 4XGQA 3WL3A 1ORVA 4AICA 4CKWB 3WTCA 2HCTA 3GWZA 4BPBA 1O6FA 3DC2A 1YL7A 4XLTA 1NLYA 2P2GA 4QOIA 3BERA 4BZXA 3I5XA 1K2WA 2YFQA 4O4IA 5K6AC 4BQQA 1KYIA 3SSMA 4PYJA 3KKZA 3S2IA 3U7JA 4EH1A 3O8OA 5I7VA 1JDSA 2RH9B 2VHYA 4EEZA 3FD8A 3GAAA 4KQWA 5FBVB 3WICA 4Y9TA 3RSQA 2JFWA 2X5JO 3ZCXA 2IBSA 1M74A 5DZSA 1SCIA 1BJKA 1KAOA 2IYTA 4HDAA 2DETA 4BO3A 3ZR4B 3SDSA 2V7VA 9LDTA 1HA3A 3CLRC 4OA5A 3SSOA 2VZLA 3OZ7A 4KZPA 2IUTA 4BVJA 1ZM7A 4TVBA 5C18A 1Q7BA 1M8GA 3T1HB 1ZK0A 5E7JA 1Y4DE 2RCNA 1MFPA 2AD1A 3RYHB 3LQFA 3LT4A 4RA6B 1A1VA 3IJEB 4X64B 3U0VA 2A4MA 4JELA 4X8LA 3GZTB 2TMYA 3N0VA 4IIEA 4LC0A 3WLKX 1IHPA 3DUFB 2ZWPA 4IOKA 2CDNA 1D2EA 5JPIA 4AJLA 4F71A 1Z63A 1PYOA 2VRCD 3ONWA 4L50A 4NOJA 4ONEA 4X94A 3SJBA 1ZN9A 3RVSA 2P4QA 1JV2B 5HGJA 4J07A 2X8WA 4LJ5A 5EQTA 4RE5A 3M34A 2UXCB 1TJYA 1Y1KE 3EB9A 5JPCA 4Y6LA 1RLJA 4DLZA 1ZHOA 1OF1A 3UOAB 1G8HA 2MINA 3EVTA 3TVTA 3RVPA 5F1YA 3V97A 3H17A 2YXDA 3DHNA 1NHWA 2XWJI 5B2EA 3B3QA 1LW7A 4EATA 1JT2A 2V6IA 4M0KA 4Z1OA 3U17A 3RYCB 3GP5A 2CWDA 3P5SA 4LFCB 3P32A 1V9SA 3ZWXA 1YTUA 1A9RA 5JNRA 2FWNA 2VXOA 5BPFA 4LZWA 1CR2A 5AI8A 3IBGA 4RU1A 3LD9A 3M33A 5DHPA 1O9HA 3N74A 5EKXA 2BKVA 3A1WA 5PGMA 1BQ3A 3I37X 4LK3A 3OHMA 2VJLA 4XB6B 3D6TB 5BOSA 1MTOA 2AGVA 5F2KA 1QGYA 1EYZA 1JS1X 5EIXA 3SZGA 1RJFA 5TNXA 4F91B 4MW5A 2NUPA 4Q9HA 1M73E 4QDKA 2IYYA 3DZKA 4RAOA 2FFAA 4IIBA 2A5LA 4O0LA 4DRXB 2O3UA 2VP2A 3D6HA 1GYRA 4LF7B 2HPVA 1L7MA 5TPZD 2AMFA 4PTYA 3MQ2A 2MDTA 2XMRA 5JAUA 3T1QA 5YASA 2HJ9A 3FXAA 4K9NA 1CDOA 3ADKA 4KN8A 5TVGA 1EVEA 1JKXA 2HQRA 3UGJA 1TAHA 2Z1DA 2AA3A 3K9WA 4WXMA 2COUA 1KBZA 1QHYA 1EVYA 2VRNA 2ZATA 4BU0A 4CLHA 3C87A 3MUNA 1VJRA 4QFBA 1ZH8A 3RYIA 1MRZA 1WLSA 1AC5A 4I1IA 4MVCA 4C7OA 1CEQA 1P62B 1WD5A 1Q20A 2IOHA 2EF1A 2IZ5A 1M7HA 2X13A 3OECA 2FP4B 4UM9D 2C20A 2JVJA 3LYAA 4JBWA 5EIEA 2X1VA 3KQUA 4XQCA 5ISMA 1ELOA 3EFEA 5JDIC 4ZP1A 4JI7B 1B76A 1VCMA 3BH7A 3LW8A 4L8FA 1XA0A 5EKDA 1PK9A 1ESMA 3DUWA 2JVIA 1FUEA 1MDFA 3PXBA 2BEVB 3GBSA 3KZMA 3SHTA 2I8AA 3ZTTA 1O94D 3D4NA 4KNWA 2W83A 3C97A 2YH2A 1M34E 4FX2A 3IL2A 4FUTA 2JK1A 2MYUA 1XCGB 3HB4X 1PR0A 3LY7A 3DMTC 3QEJA 5EN4A 2PLFA 4MQFA 4ZT3A 2A9FA 4G07A 1K75A 2CLHB 3BKWA 5TGZA 4B8ZA 1MVOA 5BNFA 1T0BA 3AHJA 4A8JC 1V26A 8AT1A 4IICA 2R00C 2OR3A 4G0MA 4ROTA 5LXTB 2FEXA 3IEPA 1AZTA 1GUFA 2CXTA 4CN8A 1BD3A 2VZ0A 3VKWA 4QG3A 3JWHA 3ZI0A 1Q17A 8GPBA 2H85A 3TPZA 1TXGA 3GCXA 2H4JA 3FOBA 4Z4CA 3CRRA 3QUTA 4HVLA 1GL6A 1UR5A 2QY9A 1X7GA 2ACVA 3TCXB 3QTBA 3WWDA 1HKHA 2BGRA 3IUQA 2QRZA 1ZITA 1VE3A 4CGZA 5EEGA 5LVAA 2R6GA 1VOTA 1F48A 3U7QA 3OFKA 2GH1A 3EEIA 2FJUA 1BA3A 1E92A 2H5JA 3PGJA 4Q12A 4WXYB 5DM60 1P4RA 4AMZA 2CXRA 4I4TF 1U0OC 1DFIA 2YIDA 4ZI5A 1JVSA 3M3PA 3G0IA 3P0HA 5ICEA 1CCWA 4C0HA 4Y2PA 2JLYA 3EGDA 4I0WB 2B1RA 3R7WA 4OQDA 5BVGA 5AOAA 4DUGD 2ZBRA 3PSHA 3SE0A 1O9GA 5GTDA 1U2GA 1KEEA 1DB3A 1PCXA 1IVYA 3BCUA 3OF5A 3IPXA 1WW3A 5FB3A 4ZARA 2R6FA 1Y6ZA 3M6FA 2OT3B 3RS3A 3AOEC 4KMOA 3PIDA 3VNQA 2QLBA 3H4TA 4LY3A 1GFSA 3LKVA 1P0PA 1G38A 3EC1A 4CIAA 1P5RA 3KT6A 4I5EA 1YJ5A 1UZNA 4AKGA 3QEOA 4EFMA 3UJ7A 1EUCB 2BI8A 2R25B 4P80A 3F67A 5E9JA 1XZDA 4BV9A 3UPDA 3R8FA 3DE2X 4MW7A 4MPDA 3KZNA 1UC5B 4GWGA 1HEYA 2NXNA 1T5TA 1YIDA 3CB2A 3R7AA 3KB6A 4O4LB 1RU3A 4Q3KA 4UFPA 1WETA 3P0EA 2GRUA 4XLZA 4OBXA 4PLFA 3TJRA 5B4UA 4HNAA 2C7PA 1JHAA 4R51A 1T5IA 5SZIA 4BY9E 2QJFA 1W4AA 2JGKA 3A1EA 1J06A 1R9NA 2EJTA 3FHLA 2I3GA 3PCXA 1EK6A 1T6ZA 1AU9A 4BU1A 1CR1A 3RVNA 1VGRA 1EP3B 4CCYB 1X7XB 3ABRB 4ZK2A 4V0NA 1YHYA 4A16A 5CEFA 2HU2A 1RHJA 2AKYA 2QTHA 2HWWA 2P4EA 3HG7A 4HFJA 1HV8A 2P35A 2YIJA 3PVCA 1UC9A 3GK3A 4GBGA 2CCGA 4JBHA 3VNAA 3WGTA 1XYGA 2YTZA 4OJMX 4R9SA 3K09C 5FYDA 3EVEA 4ILEA 4N0QA 5LUBA 3W5HA 3QVGA 4OHCA 1RWMA 3M9XA 3VI4B 3ISVA 4YH1A 2OLJA 1M2JA 2ZS9A 5FA8A 2HBQA 3TEMA 2NXEA 3BG5A 1FCJA 5FAXA 5GAJA 4UTVA 4K5QA 1B2RA 1GCAA 2C03A 1A8QA 1GAEO 1RM3A 1KY3A 1LPPA 3OT1B 5GM2A 5C8YB 1EDEA 1LSSA 9GPBA 4QRIA 4N3CA 1D1PA 1C9MA 4LHWA 5JJ5A 4KYVA 4HCJA 3C6MA 3RS4A 2D0IA 3U0BA 1DFHA 4YV1A 3P2OA 2HEIA 4HPWA 4OGWA 3OZAA 1EUDB 1YQ9A 2CL7X 1YZGA 4N5HX 1GT91 4XQ0A 4ENQA 5FD8A 1KYYA 3D7MA 3K70B 1O5OA 1NF9A 1QGUA 2VA9A 3KV1A 4DCNA 4X6LA 5ILGA 1XQYA 2O7QA 2BEUA 3QU4A 4P4SA 3TEFA 3VYRB 4B9EA 1U9IA 2X9GA 2ZRMA 3A70A 5BQXA 4U2BA 2QUZA 1CR0A 1DKUA 1OAOC 5ER9A 2J5RA 3DE6X 2WOJA 4DZTA 3OLWA 4QTYA 4KXLA 4EECA 1OFVA 2FRDC 4H1TA 4LV8B 3IP5A 4ZKDA 1BZYA 3B2QA 1Y42X 1TQ6A 2PLAA 2O4UX 2VDLB 3EXEA 4C6SA 1N2CB 1FFEA 5IUNC 3BDIA 1N57A 4L74A 1PGPA 2HBYA 2QW0X 5GM1A 4CM9A 2VP0A 5EJMA 5BMVF 4UCWA 2F8TA 4EKGA 4MQ4A 4B3FX 5FPQA 1TEZA 2B2XA 1BW9B 1M0SA 4RV4A 4XAQA 4Z7NB 3TLCA 4IEEA 5KTNA 3SIWA 4C7JA 4GR4A 3BOSA 1RRVA 4PYOA 2XBMA 2WZQA 3KOYA 2IXGA 3R7BA 3L4EA 4BVFA 4OJQA 4X20B 1R9MA 3A3NA 2YZ7A 3ZWQA 1EVIA 1HXHA 3OU6A 5ALZA 4CG2A 3U56A 3R0IA 3USCS 1VP3A 2J0QA 3PNLA 2V7TA 4X45A 3U4GA 5DNWA 2P9CA 2O3JA 2OZLB 3OX2A 4E5UA 1KC3A 1XU9A 4M0UA 1FMLA 1T2EA 2IHBA 4MVJI 4KV9A 4WVLA 1GUZA 3PC2A 1N75A 3D7RA 3UT5B 2XUHA 4EW6A 2NTNA 4F4HA 2ZSFA 1QF7A 3BGIA 3NYRA 4P32A 5CK4A 4IR7A 3DBLA 4UVHA 4YRCA 3LP5A 1BG6A 4Q4HB 1J8MF 3GELA 5EHGA 2KYRA 5BT8A 2A1UB 2MSCB 3U09A 1U7PA 2Q29A 4EX7A 3S2UA 2W2OA 2WWRA 4XIIA 4TYMA 4Q24A 2J9GA 3GRAA 1TF2A 2VHZA 4NMWA 2AHRA 3MBOA 1U3CA 1K6IA 1MC8A 2JBHA 2XUKA 1IN4A 3L1VA 3PUWA 4ZAGA 1DELA 2QN8A 4JJ8A 3TR0A 1B7GO 3ZE7A 5I7FA 4QHYA 5EHQA 3URMA 1UM9A 4NRDA 4NAVA 3CH6A 4G0PA 3IA7A 1FU7A 5D3MB 1LWOA 1FS6A 1SBIA 2WINI 3PA8A 4UXHA 4BO4A 1VSQA 4II7A 4RPLA 2Y4OA 2ZSHA 4MA5A 3IAXA 5LL6P 2BMFA 4ZAFA 1TAUA 4P4LA 1E98A 3B1KA 5L45A 3THXB 1PWXA 1ZA1A 3FG9A 1DBWA 3S2YA 2D0PB 2MYPA 1JJAA 1O5IA 4G8DA 4TYPA 3L4SO 4S3MA 1GKYA 2B7CA 4YCNA 1SWWA 4NCJA 2GLUA 1ZQ1A 2XMQA 3IB3A 4UHJA 4YUAA 2EW8A 2V3CC 2JHPA 1WZ2A 1AXRA 4D96A 3DMTA 3JASB 1SVSA 3S0JA 1T8RA 1CJKC 2VRCA 3NHJA 5IBRA 4D9BA 5WRFA 3IUPA 1N33B 2VOJA 1Z35A 3L0ZA 1EEHA 2BSAA 5D8DA 4BFYA 2GSDA 3ND5A 4F21A 1C30B 3H97A 4AJHA 3H9JA 3RNOA 5BOVA 2X3FA 4HQRA 4ZTUB 1XTRA 1J09A 2NO0A 5DBHX 2I99A 3FN4A 3TRKA 4FGUA 3WKBA 5ADHA 1P0CA 4GO1A 1IXRC 4FQ5A 3T7JA 1XI2A 1A9XB 3M6LA 1QCZA 4WI1A 5G4KA 9ATCA 1BWQA 2R96A 1RKXA 2QUHA 3C5VA 2FR8A 2Q5QA 4LN1A 3DR5A 5BR4A 1VMIA 3G9XA 3VR6H 4PZYA 4MYTA 2ONJA 1Q7RA 3MA0A 3X1KA 2RHRA 3F0TA 3I9KA 3RCBA 3ZGOA 4C4AA 4F7WA 1L3BA 3MG9A 2FEWB 4ZC1A 3TEJA 4ND3A 1Q84A 2IQIA 2QRMA 4GXTA 3GLQA 1PJAA 5T7BA 2BR3A 2IEDA 1BDHA 4H3VA 4CF5A 4RTPA 2QD2A 1P7CA 4J7CA 1XX6A 3GMIA 3BD9A 4NMMA 4RDHA 3RYFA 2BM9A 2HBRA 3KQYA 4MGHA 3UAWA 2A0YA 3R7NA 2M98A 3CVXA 2GPAA 2GPTA 4WXEA 1W0JD 2I7TA 3ZD6A 1ULBA 1TCCA 3GJ3A 1KAEA 4NJOA 4S1VA 2YOHA 1Q2UA 5TPZA 1KIFA 4B5LA 2IYZA 4RD1A 3QM1A 4FHDA 2VYCA 2L18A 1R7RA 1E1KA 3VMMA 3SSNA 3UWOA 1SUEA 3HLKA 5DN6A 5EZQA 3EULA 1R4AA 2VFAA 2BH2A 3PITA 5DNYB 4MB2A 3ICOA 3CT4A 3OBIA 5DCUA 1FYXA 4P7GA 4AG5A 8ATCA 4YNBA 4KUEA 1G2IA 2DG2A 2DTEA 1X1RA 4FX5A 5EINA 3O1IC 4BX2A 1TVMA 4UZSA 2I6GA 3CLTD 3HVKA 1N5IA 3M9LA 5CVDA 1SB9A 2D5CA 3ZE6A 1WR8A 4JJIA 4RIHA 3VX4A 1U0EA 1LVHA 1GZVA 1JEDA 1L1RA 1RCFA 4NFSA 5KOJB 1GV0A 4M1QA 3UXHA 5C1BA 1WB6A 13PKA 2QM7A 3MK31 3SHVA 4F3TA 2ZCJA 4C07A 1HL7A 1LBIA 2MJLA 5C3UA 2IHVA 1I94B 2QMOA 3SIRA 2Q9AA 4H7KA 1PR1A 5DGXA 2PVPA 3LUPA 4KU4A 2ZRJA 4ZOLB 3IAHA 4JJZA 2ZU0C 5FPPA 2M6LA 4UMVA 3NDJA 2R8YA 3DV0A 1O94A 1H2ZA 1VL0A 2FPOA 2XBUA 2YFYA 3N2KA 1E62A 1RAGA 2GVNA 4WZAB 3ZJ4A 4R71A 3Q8MA 1LX7A 4MEJA 1E2FA 2BZSA 2Q21A 2JFZA 4FINA 1TZBA 3A4VA 1GTVA 4GI3A 5TGTA 1GN8A 4KR3A 1K8XB 1XKXA 3N0XA 2Z2IA 2OORC 4ZANA 4BXOA 3L1KA 5BRNA 4B71A 4DDKA 4L0QA 4I2VA 1J7KA 4TM7A 4HC4A 5B4VA 1NL3A 4GKJB 2NO7A 2WM3A 1TM2A 2ZQ5A 3BWCA 1W36C 4FHFA 1V47A 1Q1QA 2P6OA 1G17A 1QH0A 2RKBA 2JASA 3VTKA 4B47A 1E9EA 1QSGA 1W87A 1IK4A 1JNYA 2JRLA 3AVPA 3EOAI 4MLPA 5KYYB 3I1FA 3WL4A 1SXJD 2GHTA 3R6LA 2PX3A 1P45A 3KDPA 4H77A 4L57A 4U8HA 2HU5A 4CLDA 5HX7A 4YJ2A 2Q2OA 4IUCS 1K9SA 1KFBB 1X8LA 2FHSA 1L5RA 2QUKA 3PTZA 2Y8EA 3K9QO 1WSAA 3WBJA 2NPFA 1GA4A 1WY7A 2D7JA 3MB5A 4DIMA 1I4WA 1XTUA 2OC9A 2NUAA 3KU1A 1WDWB 2VK1A 4HYYA 3BMCB 1IDN1 4ER7A 4QLOA 2Z5FA 4S35A 5EGSA 5D5HA 4UNSA 4IIVA 1RRPA 4PSVA 2FY8A 5AW9A 5DLQC 1JAZA 1KAQA 2QLNA 1QV7A 4LDAA 4DUGA 2VPXA 2BMVA 3UPTA 2QTFA 4GHWA 2VEOA 2KE5A 4K3VA 3TQIA 1NXOA 1EXMA 2FRDA 1Z82A 5J5AA 3T7CA 2QUIA 3CKLA 4CG0A 3C8DA 4WXPA 1CUAA 1KF0A 5GOZA 5F5XA 4AS3A 1RIIA 3R40A 2H2GA 4YRNA 1N5LA 2XW6A 1F0PA 5IG2A 1KNQA 2FPIB 3Q7PA 3CMMA 3EQ9A 3PRHA 1RBQA 3G82C 5D00A 4KGVA 4EA6A 5KJFA 3K0SA 2O4CA 2C54A 3RWBA 1Z88A 1AIPA 1PAUA 3LVQE 5TE9A 1YR8A 5C52B 1J2RA 2VWPA 3H1TA 5B7QA 2G5TA 5DCWA 4GBED 3QOFA 1XZKA 5TF4A 2AFHE 4JLUA 3MJDA 4I2NA 5LOVB 1EGVB 5TQ0A 1SQ0A 1BX0A 4FE4A 2BEWA 3H1EA 4INAA 1TIPA 4MJXA 4X00A 3SQDA 5IDQA 3G6WA 2Z6VA 1GA1A 2A1TR 1L4HA 1LI5A 2ZYAA 3C1TA 3JZMA 4OM8A 4W9RA 5TPWA 5DLDA 4E5DA 3W5CA 1K06A 3W90A 2C2MA 4D2IA 5JTUA 1EWYA 2C04A 1LRKA 4DCTA 4NCKA 2WV7A 1CQJA 1H0SA 3TTTA 1RM4A 3OCYA 2VCEA 3EF1A 3H8VA 4MXDA 2FLWA 4Q9AA 4YRJA 1ZLYA 3L40A 1RC1A 2QZ9A 2Q07A 3AHDA 3F9RA 3NT5A 4JR2A 1MORA 1ZD9A 2C07A 1TYAE 4JYPA 7ABPA 1DJNA 5AW6A 4KCGA 3VZBA 3ELWA 1X1SA 2ZQZA 3N58A 3OKCA 4L0CA 1LSOA 5AM2A 1U6IA 4QXQA 1SXGA 2P8SA 1TD1A 4PZZA 3H5WA 3OFNA 2FX2A 3ANYB 3OM9A 1A4XA 4R01A 3AVTA 2PSFA 3IJPA 4OFXA 1ZXBA 1PG5A 2JFUA 5K0CA 4KQHA 2X3YA 4QBKA 4BECA 1Q0HA 1FTWA 2W4QA 4YT8A 2C8JA 4KQKA 2ECFA 2C97A 2HZ7A 4CV0A 2X14A 1N6LA 1IY8A 3ELUA 4DIFA 5EMKA 1ONSA 3GDGA 3NR2A 4MUFA 3PX2A 3MERA 4OFZA 4B17A 4E11A 4ENUA 2P41A 1EJ2A 2IXBA 3BIWA 3W6ZA 2GT1A 3T41A 3VPAA 4BIIA 4HDRB 3LOUA 3F3YA 3SLGA 4QZVA 3NHSA 4WRRA 3BXZA 4MVJG 2PZGA 3C6QA 3B5EA 3PQDA 1FFWA 4YCDA 1HBJA 2YXBA 3WLEA 3IVAA 1IEWA 3UMYA 4TYWA 4EITA 2WAXA 1JIUA 3NUZA 4GUAA 4FFMA 2H9AA 3E6AA 1OH8A 3S28A 1AKYA 1O0SA 3JXEA 1GNTA 3WRYC 1GVNB 2M1XA 1KIMA 4V1CA 2GD1O 2Z2XA 5JYDA 1QP8A 2GF9A 1MXFA 1GRCA 2DR2A 2VJMB 5A4JA 5G3YA 3WK4A 4D8YA 4F2WA 3K73O 5B58T 1PK7A 3DZIA 1LK5A 3FWKA 3H4MA 4FSHA 4X5OA 5ESWA 4CU2A 5B37A 4RJLA 2ZSKA 4LRUA 3I45A 1ZXXA 1ZH2A 1DBRA 4YMUA 1YE3A 2RCYA 1Y1SA 2I1VB 1LZLA 3GX1A 1HDIA 2A9JA 1SY7A 2OV6A 3OJ0A 2ZRGA 1KSGA 2X5NA 1WMBA 4JB2A 1WTAA 1W581 5AI5A 1MC5A 4BKUA 2QJRA 3NRBA 4OHMA 1T2VA 4HGRA 4CQLA 1LCIA 3LQYA 2DFPA 3MTBA 4HTAA 4QHSA 5C5DA 5K05A 4Q1FA 1YRQA 4QYIB 4R2LA 1QF9A 3VDMA 2CE2X 2WTXA 3IULA 3Q7SA 3D0QA 4BS9A 4JLBA 4OO3A 4RDCA 5H9VA 3AFIA 1T9GS 1Z2OX 2X4DA 3JU3A 4M22A 1HF3A 2H57A 1PX0A 2PL9A 2EL9A 1AB6A 1R4ZA 2W58A 3JX9A 3MBKA 4N6NA 4BX9A 4D4MA 3M4ZA 1MX9A 2JFFA 3HHPA 1DAGA 1JDVA 1TAQA 2GPYA 3AUJB 4HS9A 4WKBA 4QNRA 3TB6A 4EP1A 3RUFA 2E89A 3R3JA 1VG9B 4K0RA 4ZEVA 2C0QA 3LUAA 2HDNB 2OPHA 4J1SA 4N01A 4DTIA 4XJSA 2Q2NA 1ZCAA 2AHOA 3NJ8A 1K8QA 3EF3A 1TK2A 5G3ZA 4GMXA 3THWB 4J7XA 2ZUDA 1E59A 3EY4A 1ZUD1 3N2LA 4BNIA 1CZLA 1XE3A 4PFQA 5EZSA 3RAPR 4G26A 1ZISA 4MIOA 1DRKA 1SVWA 3G9ZA 3O5AA 4NE2A 1P44A 4GKVA 3OOWA 3OJXA 2UVPB 5ALTA 5C3MA 1PFGA 2HC9A 2R8XA 4P98A 4G24A 3UG7A 2A5GA 3D59A 3R2JA 4EPTA 4CV3A 1J0BA 4ZIRB 1SD2A 2H1RA 3RC3A 1F6BA 2P0YA 5FHQA 1A9TA 1BXRB 3PHJA 2G71A 2H4XA 3NPMA 3X2FA 4DJ5X 1UFKA 2FJ0A 3KB8A 2QQEA 5KDOA 1NC3A 4YBRA 1ZU5A 1UFOA 4FEGA 3EXFB 4IO0A 1F0YA 3REOA 3EIXA 1Z29A 1JXOA 4M9RA 5JADA 1SD1A 2HXYA 1SQSA 3RTEA 3KIPA 5FUVA 5EYPB 2EKBA 4PBRA 1QF6A 3QEAZ 1XVTA 3TLEA 5HMMA 5DMHA 2AC7A 2PRJA 3JYQA 4Z4FA 2O8FB 1PNOA 2XQIA 4NHOA 3DFFA 2HWYA 4O1MA 1DRVA 5B1SA 2IP4A 1IEQA 3HJUA 1ZVMA 2GK7A 5CA0B 4X85A 2IUSA 4ODIA 3RIGA 2NYUA 2JHGA 3TTXA 5ARBA 1RJ9A 3WGQA 1Q7CA 1WMAA 4GRDA 2MSNA 4C7MA 5JS7A 3B89A 2HJHA 3PNPA 2IQ5A 3DOCA 3QYPA 1X1BA 4QQKA 2I4TA 3ESDA 3S7TA 4I8DA 1U7TA 1Z22A 3A9RA 2D2IA 3PWKA 4AWBA 2XKAA 2NNLD 1SEPA 3ZWDA 2F9FA 1ZW1A 2DR3A 2CB9A 2YDXA 1RYNA 3WNBA 3PD7A 2XRZA 2VSQA 2X77A 2Q5OA 3CUTA 4S1WA 5KHOC 3HYTA 2FWRA 4UEJA 5DI3A 3HCBA 4F4CA 2OFFA 1KH3A 2YV1A 4B81A 3GG9A 3AVXA 4FIDA 5KYWA 3G02A 4FMCF 3WP1B 3E9ZA 1A0OA 1NYLA 3HYSA 3KQOA 1Z9BA 2VL7A 2PL1A 1XZFA 4E6PA 1R50A 2GUGA 4AF6A 5LQKA 3I1JA 3SZ3A 1TTPB 4QHTA 4FWTA 2DFNA 1X2EA 1T25A 3MYYA 5EIAA 3LECA 2ZITA 5T4HA 3UK1A 4GZ3A 4FQ8A 2CLDX 5K01A 2Z6AA 3USES 1NHGA 1UBKS 3PXXA 2AQKA 3SHQA 4ENPA 3WHIA 3GLGE 1T2UA 4MRNA 1Q11A 1H94A 2FX3A 3LT5A 1W35A 4NZZA 3RVLA 4TMWA 2ZSAA 1NKSA 1NJ1A 5T4BA 5B55A 2XKBA 5BP7A 4HEQA 1DKLA 2DUJA 4C08A 1VLQA 1GN9A 3CX7A 1OGYA 3QPWA 4HFNA 1CUXA 1WSWA 5F33A 3OUZA 2A84A 5IEBA 1P0IA 1UXHA 4WT7A 1GCOA 3E9CA 3WO1A 1WMDA 2J6CA 2R751 5JQGA 3NTQA 4Z9FA 4CUKA 1OMOA 1DIAA 3I4FA 5TX7A 4JLVA 4URVR 3ICVA 1ZU4A 1X70A 2C82A 2PZFA 3QQ5A 4BX3A 1FDWA 5A71A 4D44A 4JS0A 2ZUTA 4DIKA 1HDRA 1HWYA 4IQ4A 3RD5A 1ONOA 4PR0A 4ZJUA 4NF2A 2CKDA 1RYBA 1TM7E 1UF9A 3OIYA 5EMJA 5EY5B 1W88B 1MT3A 1ZJ5A 4PCUA 5BWMA 4R2WA 3A6PC 1I3OA 2QUJA 4EUEA 1APBA 2GCGA 3U61B 1E3WA 3OEYA 2V74B 4WOBA 1AMOA 3MM4A 1ZONA 6GPBA 1SD5A 3AKEA 2P4UA 2QZSA 3GHYA 2XNKA 1PDOA 4HWSA 5JATA 3WV4A 3OCVA 4M9XA 4U6QA 5J5VA 5LXTF 1XXHE 1L9KA 4OF4A 1Y6GA 2HSWA 1IB6A 3AR8A 3K1TA 3NDRA 5AMXA 1O97D 4ARZA 4YAGA 3ZJVA 5JEDA 2DTXA 3B38A 4JP5A 5FUYA 5JNLA 3HBLA 1Z4JA 1P1FA 1M8PA 1T9GR 2B4KA 3DLTA 4HZIA 5DGHA 4YR9A 1O03A 2EWVA 1VG8A 3K72B 4FEAA 4JFAA 4WLFA 3UTDA 3ODGA 3HMKA 2QRNA 4NK4A 3OPMA 1Y3DE 4NS1A 1KDVA 4C22A 1VCHA 4JP8A 4N8EA 4UVIA 4Y7CA 2X19A 2Q4RA 3VI3B 1Z4LA 4WNIA 1E7MA 1SXJA 3QJYA 3BSFA 1Z0ZA 3CLVA 3AEYA 5TJ9A 3RUEA 1G21B 2APJA 5HYVA 3WIVA 3NW9A 4IUDS 5JJCA 4O2BA 2AJBA 3EEBA 4HSGA 3ZWWA 5J40A 3KNZA 3SM9A 5ECGC 3C3YA 4EFNA 2P79A 2G0AA 2ZAGA 2YHAA 4LBWA 2BM0A 5LP1A 4M9ZA 4QUBA 3CX6A 5LM3A 1IK6A 1QKIA 1Y6RA 3TLMA 4F92B 2MCFA 2V6MA 2RD2A 2DJ5A 4CXMA 1P4AA 2DHEA 3FA2A 5SY9A 4K9KA 3PWSA 5FF9A 1T3ZA 2CMKA 2QJOA 3OZFA 1E99A 3TRFA 1OWNA 3GT4A 1G60A 4MIYA 1RE1A 3K9CA 4OHXA 5AKGA 5A6SB 5LC1A 1SG0A 5K5EA 2I6QA 3SWWA 1P60A 2WPDD 3D8SA 3T9AA 2J6HA 2VH5R 2E6UX 2ZRKA 4BOYA 4LRSB 4JJEA 2PBLA 2DBQA 4R68A 4RVHA 3FPGA 3MOSA 5H80A 4I6GA 4BVKA 3GIWA 1UKZA 1VJCA 2OCKA 2ZJ7A 1R8JA 2A9RA 3YASA 4LNHA 5JRZA 4CMHA 4DREA 2VPIA 1AV7A 4OJNA 4C0JA 1B8OA 1UOQA 4GF5A 2ZKIA 4NPHA 2ID4A 4UMEA 1V41E 3WE7A 4F96A 1T9DA 2NSYA 1J8FA 3MN1A 4LG1A 3OI7A 4O8ZA 1UK7A 1K4KA 4H0FA 2E4AA 1XCPA 2LUOA 3D81A 1IRXA 1R6DA 2C2BA 4E5KA 1RACA 3QSYA 4JI2B 5E38A 4LF5B 2E2WA 4F5EA 3RRBA 3SC6A 4KMMA 4HUTA 4CM3A 2G3YA 1T9ZA 1JTEA 3SC2B 4GZMA 4HSEA 4R2XA 4GOND 1Y7PA 1G19A 1Z0SA 2DBZA 3IVCA 4O63O 3MXTA 4CTOA 1D4FA 2ZT8A 3EMVA 2H1OA 2JCVA 4WMLA 5KNCH 3B3JA 1NC1A 2GAOA 1BDIA 1ZK1A 2WD7A 3U3RA 2GBGA 1II8B 5DU2A 1LEHA 1FQWA 3VH3A 5KJ1A 1PLJA 1ZM4A 3E7PA 4G85A 3EXHB 1XL1A 4HKTA 5ALFA 3UB2A 3KYDA 4JI1B 5HW0A 1P2SA 3AUKA 3LSYA 4FJ2A 4G97A 2EVWX 2BKXA 3KR1A 1NVDA 3NOOA 5ER6A 3WFJA 2PA3A 3OWXA 3RJZA 4YIKA 4ZV9A 4CM8A 1NKVA 1PSWA 1PQ4A 4M88A 5C8YF 1SUSA 3VHQA 5J43A 4GM1A 3EZXA 1H3NA 3WL8A 2G04A 3GIDA 3TD9A 3ROGA 1FFDA 1JBKA 1J49A 1ZPDA 2GZDA 3E7WA 4M36A 5HDBB 1EGQA 1FP2A 3LPAA 4R8SA 2CYBA 3VPGA 5CYFA 1C81A 1WPXA 4ATNA 4BBPA 1TKBA 3G8CA 3AY0A 1P1BA 1P3DA 5F77A 2WIBA 2HJVA 2ZKLA 4G5RA 5AK0A 5LB2A 5C8ZA 2JAHA 1Y89A 5DN9A 2UKDA 4CTNA 1A5BB 3F2IA 1ZXLA 3LC7O 2WWFA 2JIZD 3QBVA 1GHTA 2CLSA 4GPZA 2RB5A 2YASA 3T4XA 4H3HB 2FDXA 1KO8A 1BGWA 5J9FA 1JHUA 2C88A 3RRNA 2Q6OA 3JS5A 4IIHA 1Y5LA 4PTZA 4RXMA 2IV7A 1UBCA 4I08A 3FF4A 2O8VA 3L79A 1DT3A 1D8TA 1L8AA 2GF2A 2NXCA 2VK2A 2WABA 2V6GA 3AINA 3QKRA 4DL9A 1L4FA 1P2FA 5EZYF 4OV6B 1PR4A 1R6TA 1XG5A 2H31A 1YUBA 4WEOA 3EUEA 4JLPA 4HJRA 3ZHVA 4ENRA 1WZNA 5E0KB 1GTRA 3G2MA 2B25A 3BC1A 4YAJA 1A4RA 1PV2A 1WXHA 4QBGB 5SZHB 3VR4D 1W9MA 5EWMA 1XELA 2C9CA 3W05A 5EJEA 4G4JA 4IQ0A 5BQPA 1KHHA 5DNCA 4EVIA 3T7RA 3WGUA 1KQGA 4ZV7A 3QLEA 3N5CA 2XECA 3KHSA 4DDTA 5G53C 2PS0A 1YK0A 1H1LA 1IHYA 3OF3A 1S2GA 4ZQFA 3WG9A 2DOKA 4DE5A 4L3VA 3FFBA 3TPCA 3OJFA 3TMKA 1GNVA 2DSTA 1YZHA 2I3DA 2FUCA 2O2DA 3B7WA 3E1SA 4F04A 1WB9A 1RP1A 1V25A 2X5XA 2PUDA 5IK2A 3AHIA 3H2ZA 1U7ZA 3VPHA 3I9V1 3NHAA 4Q15A 2CUTA 4B2IA 2IV2X 2VOEA 3SG0A 5AQEA 3HLTA 1TVCA 2HQOA 4RNCA 1ZL0A 2GM3A 3ZCPA 4ZGWA 1FEZA 2C4VA 4CU5A 2QROA 1FTQA 2AG6A 2GDJA 3LCVB 3TUIC 3UAGA 2H4WA 4ZU6X 3FBGA 3TVYA 2EJCA 1GU1A 2HH9A 3FIUA 4JUAA 4PWYA 4MRMA 3REGA 2FOIA 4C0KA 5EZ5A 2JS7A 4NEQA 2AW5A 4J1TC 5IJ9A 4K9LA 1WZIA 2R44A 2W11A 1M2VA 3FPJA 3ZKWA 1BVRA 2AG1A 3EWAA 3FYCA 4ZQEA 5I3ZA 2IJGX 1G5RA 2GR9A 2VF8A 4YT2A 4FMBB 3BS4A 3IQWA 1RWOA 1JF8A 2IVFA 1GITA 1GPYA 4HDCA 1JR3D 1OX4B 1ADGA 2D8MA 2G9ZA 5GGYA 4RHFA 3SJ7A 3ITKA 3AEKA 3T3GA 2GJ4A 2E48A 4EHHA 3DEYX 2RAPA 2ODEA 2IPXA 2B36A 3DTVD 1F17A 1TMKA 3KB2A 4EMUA 1LLCA 4MV0A 2J59A 5JXJA 2NG1A 4B6PA 2LBPA 2GZ3A 1VCNA 2Y0PA 2W2LD 2PM8A 3FVRA 3HZHA 3KKEA 4RZQA 5TQ2A 5JNSA 2Z2JA 1NJ8A 1TD9A 3F46A 3L93A 3EFOB 4UD6A 3G23A 4NDNE 4EENA 3DL2A 1Q14A 5CLLA 4M37A 1JHVA 3KOUA 1EK0A 2FZLA 1NATA 4OB8A 1JRLA 1OTHA 1XJWA 1XVVA 3LX6A 3V8RA 4L9AA 1GRVA 1LV7A 3LUJA 3HYLA 3M70A 2J5BA 3T0GA 3ZV6A 4KL8S 4D0RA 4QUIA 4C0QC 2IYUA 2MMGA 1OFHA 1Z06A 4ALKA 3TLXA 4OK6A 4YCAA 1HYBA 4AWXA 1NUPA 2Y68A 4YPVA 2HF2A 5LZ4A 1T13A 1Z83A 2D2VA 1VLVA 1NJ5A 3N07A 2GESA 3NNNA 3QJGA 4C88A 1PGOA 4C9BA 1X1QA 4IILA 2FW6A 4Y9SA 4UJ5A 1U3DA 2WAYA 2VJCA 1RXIA 4Z54A 4DANA 2UZ4A 3HDHA 2ZRLA 1XL0A 1MZVA 2FPGB 3KS9A 4L5AA 1B43A 4EHAA 1IJBA 1PUJA 1NN0A 2YZMA 3LM8A 3EPKA 1ZM2A 4NJMA 4EJSB 2J8ZA 1V96A 5LP6B 2IYOA 4FEYA 1F4PA 3ZOZA 1DLJA 2GOYA 3LNTA 4M1ZA 1RHUA 3KQWA 4TM8A 5DNEA 2BMAA 3DTYA 4TUYF 1YZLA 7REQA 4LF8B 3I01M 4UC0A 4AU1A 1GEGA 3TQCA 2GFQA 4LE2A 2JATA 3LHDA 1VBNA 3BK2A 5EHNA 1JQLB 1T1RA 2IITA 1QZZA 3QYAA 4NV1A 3NONA 1VL8A 4BPRA 4ZO9A 4C7KA 1SHJA 1T6BY 2Q9CA 1AE1A 2YHSA 4HDOB 1E7WA 1TRKA 2G07A 2QW8A 3KUDA 1JVBA 3MTQA 2X6TA 2FMXA 4RA9A 3S55A 1E4VA 2IELA 2IZ7A 2RHJA 4JOQA 3NTVA 1XMXA 3FSGD 2HA5A 2CZGA 2X0EA 3TRDA 3WDMA 4BQPA 1L3CA 1E9VA 1M6YA 4MVYA 4ARUA 1HYHA 1U2RA 4F72A 5J58A 5IBCA 1NVWQ 3A26A 1R0XA 1JMVA 2DFKB 2JDID 1F14A 3GRPA 3LCUA 4OMCA 1FVXA 2GCEA 4PEVA 4WUVA 4YMVA 4LJRA 3MMXA 1G0OA 5KYUA 3U60B 3D7NA 1AD2A 1CHDA 1EHCA 2GXQA 3DD1A 4N3BA 4UM7A 2C4UA 4B82A 3BA6A 1CX9B 2P0AA 2QD5A 4CIYA 1KR2A 1OSNA 4Y9UA 4UDOA 4ZO6A 3RF7A 4EABA 3RNLA 1MTZA 2HPAA 1M1XB 3DAFA 3GY0A 4PANA 2JANA 1UAAA 5CBKA 3RG8A 1HT1E 1LLUA 2B3DA 1UQUA 2LTAA 3OOHA 4MH0R 4KE7A 4C0BA 4CF7A 3DCYA 4ZEXA 1PIWA 3FX2A 3C16C 3T3EA 1DG9A 2J0VA 2IK8A 3KLNA 2QXTA 1QAQA 5FWXA 3ILYA 1N9KA 2Y1LA 2GZAA 3SZRA 1NG9A 2H1IA 1KYTA 3VO8A 1UC8A 1E8DA 1EWRA 1T4MA 2WU0A 2Q5LA 1T0HB 5THQA 3VVMA 3PYXA 2XD4A 2JFGA 2W2KA 5CVEA 3VGJA 4GE3A 1UADA 1J33A 5DHAA 2E4XA 3M5WA 4G6ZA 3GFGA 2WIFA 4ZT7A 5DM2A 1O95C 1ZOPA 4D9EA 1QFZA 2VDKB 4JUBA 2GPNA 3NTUA 1TPYA 1SCNE 3W34A 3ZZTA 1T26A 1C4XA 1Y9AA 4O59O 3QVWA 2UYOA 1WZCA 1UODA 1OXKB 2OAEA 3PT9A 2JAPA 1E1RD 5GQSA 4CRWB 3OE7A 3V9AA 4ZJZA 1C8VB 3H6GA 4D0SA 3SXPA 1HGXA 2JH9A 1M1YA 3ECCA 1USIA 1YC5A 2P69A 3H5AA 4PS1A 2Z6QA 1C4WA 3CEAA 4RY8A 4N4AA 3GT0A 3JAWB 1HI9A 3UAVA 3L5OA 3PWTA 4NCIA 1AHIA 1MV8A 1G8AA 5D1NA 3REQB 4YO8A 1HG0A 3WYBA 3MS2A 2QIPA 5HA5A 4KN6A 3DPUA 3AMVA 1KQ3A 3LBFA 4MKZA 2Q99A 4WFQA 2AQIA 3VHXA 3OIFA 5DFAA 5KTRA 2NAPA 4XA8A 4WGGA 5JNVA 2ZB8A 1L6RA 1WCIA 2UYYA 3C8UA 1XMOB 4OHWA 1DV2A 2CLLB 3IRVA 2Q3BA 1PZMA 2A33A 2NTYC 3DV2A 2G36A 4JEMA 4UFOA 1D0IA 1QS0B 1RFLA 4W7SA 5FCDA 3S2SA 3TBKA 4AB1A 5C4MA 1I6KA 1CQPA 1F8FA 3BZUA 3LQKA 2Y66A 3PCRB 1ULHA 2O07A 4MVJD 5ECYA 1XZHA 5G40A 3VA7A 2P9HA 4G01B 3ZK7A 1XTPA 1RWNA 3CVVA 3HFJA 5CCBA 3U19A 1M34B 2YWXA 5CJ2A 5I8ZA 1MJNA 1U4SA 4X0EA 3UWKA 1RAHA 3HB5X 5FTNA 1NIPA 2ZT7A 3EXAA 3L9XA 3E9DA 3FYUB 2WWTA 1A27A 2ZIXA 4M1OA 5IVIA 3IVXA 4RGBA 4U39A 3OT4A 5HIIA 3T61A 3T7AA 4CTJA 4P7JA 3CNLA 1W9HA 4ETIA 4XX0B 5JIBA 2WPDA 2ZJZA 4OYLA 3LTNC 2YOFA 3E7XA 4E5VA 1DDIA 3L6BA 5FFMA 1TF5A 3GVIA 5EE0A 1PS0A 1LY1A 4HGYA 2ZRIA 3RV3A 2DVMA 5B58C 1A8UA 2OAQ1 1V43A 5D87A 4QPNA 3PGLA 1Z25A 1EHYA 1XYVA 2OCIA 1NBWB 5JZ9A 4JV5B 1M76A 1PR3A 4NG5A 4F3RA 3G0GA 1WVMA 1XROA 2H92A 1Z2CA 2QTVA 1ST3A 3TW0A 3QUSA 3LL7A 1CUYA 1NOJA 4JUDX 2BSXA 4EZBA 3NC1C 2BMWA 5BW8A 5JUWA 1Z5ZA 2FU5C 5B7GA 3KPVA 1A50B 2UDPA 4KGXA 1NP3A 2PJZA 1V3UA 3T3MB 5BYAA 4PGGA 5CT8A 2WA2A 5AKXA 3TKYA 4IDNA 1A9PA 1GPKA 2RHCA 2P9JA 3CJQA 4QBHA 4DMMA 3D6VA 1YZFA 1V5WA 1PWHA 3AVUA 3VNVA 1BRMA 3MQFA 3K2QA 2YS7A 5DHSA 4HN9A 3BSSA 1J2YA 1BGXT 3B3FA 4NBWA 5EJGA 5TB5A 1TO1E 5K8CA 3QVLA 2RGBA 1I6LA 2NZVG 2FPPB 3L0BA 3DB2A 4IIJA 4UOQA 2W37A 5CUQA 5JCJA 4OLBA 3GLHA 1Y8QB 2FVXA 4NYIQ 1ZR2A 3KZKA 4M21A 3TXXA 2IL1A 4S2UA 3OQPA 3VGPA 2OXCA 1FA9A 4LNUA 3WZMA 3FNRA 4HPXB 4DMRA 1XZMA 4JB0A 3SR0A 1X7ZA 2R9VA 1ZI8A 4MWDA 4IIDA 2BPOA 4P93A 4IDEA 5K09A 4YRKA 1Z7EA 2FE4A 4AZ3A 1FVFA 2JIZA 1L4UA 4J8PA 1NGSA 4TRNA 2I80A 1VPTA 1ZH6A 5JS1A 2DY1A 1I36A 1C1XA 1X8JA 1OXMA 1WX1A 2IF0A 4LCBA 3RSGA 5EQDA 1Z56C 3EG5A 3CF0A 4F85A 5B5SA 4PYMA 2FF7A 1YDHA 2GZSA 3JAKB 1E2HA 1LD3A 1CVRA 1H66A 2NU7A 3OM0A 3WJ7A 2RKOA 1XMJA 5HKKD 2PUAA 2I2CA 2GN1A 4YP0A 4E2XA 1XZ8A 2J32A 3DHWC 2WSYB 1Q95A 1XLTC 2RHMA 3VR4A 4TLAA 2VF7A 5JYEA 1TRHA 2QM8A 3WTBA 2OD9A 3WGVA 3K70D 3VAZA 3NEPX 1VHJA 1UWKA 1NVMB 1U2SA 3DL4A 3F3SA 2H0RA 4J1NA 2Y1KA 5FR2A 4EQ6B 2HFJA 1DIOB 3WQRA 5IAKA 1Q15A 3CW2A 1E1MA 1WL8A 4YC7A 1AA6A 3TBFA 1MJFA 1IATA 2REXB 3QEMA 5FX2A 2I67A 2YINC 4XGNA 4BO9A 1BDBA 1QX3A 2HK6A 3AP3A 3BKXA 3UK6A 2H4YA 4GYWA 1XNHA 2YHIB 4JLJA 3CEJA 3W1WA 3E27A 4OQNA 3DLBA 1EFKA 3DZCA 5GZ6A 4FNAA 2H1FA 3IP8A 3KJZA 5B1DA 5TT0A 3WB2A 4NOMA 3KEFA 3OICA 2Y67A 2O6LA 1LTKA 3I4CA 4C4SA 5AM3A 1FFBA 4Q21A 1GFWA 3QWAA 4YV0A 3CKMA 3I5UA 4JWTA 3PB3A 5A5DA 5KTTA 5H4HA 1QOPB 1TUEA 3W2TA 3PKZA 1A4IA 1XRJA 2VTDA 3KFLA 4HQLA 3U62A 5H0IA 4XI9A 4KO2S 1VIVA 3DAGA 3M6MD 3NTLA 3L0IB 3BH0A 2F00A 4ZREA 5IH3A 3SBDA 3SJUA 3SYTA 1YVDA 5GADl 3JTEA 5EQFA 5KTMA 3BZBA 3TUZC 1R4NA 3SZMA 3EDRA 3ZWKA 3HKEB 4DQ0A 4AY2A 5BN5A 1DTWA 1BOOA 2AOUA 1EQUA 5LYJA 4KITB 3QQPA 4ECAA 3IIKA 4I4IA 1QIIA 4HNRA 1KRWA 4NBNA 4TQ9A 4GI2A 3PHHA 1I51A 3D4LA 3DTVA 4LBVA 1QQ7A 3DMYA 2GEFA 3A2MA 1VHDA 1FLVA 2RGNC 4D5GA 4HDMB 1VCIA 2W2LA 2H7XA 4EPYA 4DN6A 3WWEA 5FNVA 3T06B 5AXBA 1C0KA 1MOPA 4DPMA 1GKKA 1T8TA 1I0LA 1BO6A 5AO9A 5T8KC 4IIXA 3DQZA 3EFHA 4DLSA 1YS9A 4JSTA 4D79A 3DOUA 3G85A 4YBZA 1N78A 4X1KA 3SX0A 4MITA 1UM8A 2JAUA 2GTHA 2R6ZA 1V39A 3TX6A 5LD2B 1Q3HA 4NQZA 4DY4A 3UMVA 3A8TA 1JECA 4M7OA 4DCSA 1I7DA 4GIBA 1S3GA 2GM9A 3QVTA 4MWSA 5IC6A 9LDBA 4AJNA 2QWXA 2BBWA 1BDJA 2C3UA 2IE8A 1YL5A 4K26A 4CKBA 3R0JA 3HKBB 3WGHA 2C59A 2OOKA 2PGDA 3BEDA 3GVXA 3B1ZA 3MCVA 4NS4A 4HAYA 5EZ6B 4F3NA 1HLDA 1OZFA 3P9XA 1QWSA 4MV6A 2AZ4A 4AVYA 2BFPA 4Q3LA 2VP3A 3ISJA 1E6CA 4LISA 4W1PA 1P73A 3FGZA 1NF8A 3B5IA 4LX0A 4AURA 3BB1A 3IIJA 4D6PA 4DXHA 4YRLA 1NVAA 1OW3B 4UEWA 5ALYA 2MSDB 3ZCUA 3DWFA 3NIFB 1KI3A 4QOSA 4TVOA 6YASA 1EHIA 3A9WA 4UHHA 4ZQBA 3NHBA 5FEMA 3W8FA 2W6IA 1TTQB 4CMGA 5HUQA 4DV2B 1LVGA 1G7CA 1A2QA 1P31A 2X9LA 2ZWOA 4MQLA 4QDOA 5A03A 4J4HA 4QUJA 2C9DA 1XD9A 3CUUA 1Z4OA 2C98A 2ZJ1A 1MA0A 2QLTA 1ZM9A 3AJEA 1L7OA 1ODFA 1Y7IA 3U4DA 5JFTA 1NBAA 2GQ0A 1XRMA 2Z43A 3SP1A 2JLUA 7MHTA 2QTTA 3C74A 5C32A 3KQNA 1MG0A 1SU6A 1XF9A 1FPQA 1CUEA 3C6XA 3LRPA 1VI2A 2OY0A 3MWEB 3NP9A 4PC3A 2QQ5A 2A5FA 3FSGA 4QE3A 4A5SA 2Z08A 1YB2A 2RH8A 1QORA 3I58A 4D9FA 4YRTA 4V0QA 2NN3C 4K9RA 5K8VA 2JDIA 4HAOA 3EPPA 1OT3A 1CZRA 4F1WA 2VAXA 1D2CA 2NVWA 3RYTC 2FFQA 3TECE 3A1VA 1LI4A 1U0TA 3Q3VA 4J03A 3UVEA 4H59A 1VXOA 3A4LA 4EO4A 4F6CA 1TO2E 2FGKA 5C5EA 1R8SA 3TNDA 3PTAA 3ZHQA 2VHWA 2VTEA 5BV2P 1Z4QA 5KU1A 1H0KA 4JBYA 10MHA 1COWD 4DQKA 5E4FA 1SZJG 3GHHA 3JQ7B 4OTZA 1QIMA 1IFXA 3R6GA 4OBEA 3DBHA 4FYVA 4A8HA 3G0HA 2FF5A 4ZMBA 1Y9DA 1Q0PA 1SO8A 4RE6A 3QYFA 4HOYA 1AHPA 2PWYA 1CQIB 2VPPA 1II9A 4QQ8A 4DA0A 4EA9A 3K71B 1TU3A 2P40A 2VCYA 3T7KA 2JD0A 4E22A 1ZDMA 3IPRA 2QG6A 3HA3A 4RCZA 1B3BA 4YCJA 1FQJA 1MJGM 4RTLA 4XYLA 1E2IA 1RYMA 2C4HA 2G72A 1CDDA 2W2MA 3OZEA 4TLLB 5BN4B 1ANKA 1NM5C 4HAZA 2H7CA 1JZSA 2P11A 2OYSA 2OL4A 3B9QA 4TTRA 1V1RA 2VDRB 4LTMA 5EJ9A 1OI7A 2IHZA 2P2CA 3QVUA 1KRHA 2A8YA 1KERA 1YJBA 3IC5A 1E5DA 2O2YA 2VHEA 2DKFA 3H75A 3Q9NA 4JNCA 3TCKA 3TQTA 3QHPA 1VJTA 2J0UA 2Q8PA 3HEBA 3K7EA 4XVQA 5GVSA 1WZUA 2CHVA 2C83A 2Q5FA 3ILXA 3TIGA 3AJAA 1L7NA 3BWDD 2P77A 1J0CA 4FFSA 3U9LA 3OHSX 2V9CA 2OO5C 4L5YA 2O3SA 1KJQA 1ECLA 4CDRA 1WXEA 2E9SA 2WJYA 3ZV5A 1Q77A 3ADOA 3MPUA 3MWFA 5FLYA 2A6PA 3VAAA 5D85A 1UKYA 1IZ7A 1IC6A 2D2FA 2SHKA 4GLFA 4HMQA 1G5FA 4RLSA 4IIUA 4FOPA 1UKEA 2AEEA 3LCMA 1E2DA 4RKEA 4ARAA 2ODPA 3UANA 4C14A 1NRWA 5DTQA 2AMYA 2IHKA 2R6R1 3ZBPA 2WKPA 4B1FA 3DO5A 1QB7A 1G8GA 3I3OA 2J3KA 5JARA 1GO2A 1P5HA 1O4WA 3GZ4A 2O8NA 5IDYA 3UATA 4BGUA 4C04A 1JPUA 1Z0JA 4Z1MD 4COOA 1GRRA 4MVJA 3B6ZA 4NCHA 5J23A 1R3DA 3LVBA 4AO6A 3KXIA 1FNBA 1UDAA 1L5KA 4N76A 4L6CA 5AICA 1XPOA 1JKJA 1L5MA 2FN9A 3FCCA 4KSBA 1U7HA 3JQBC 4PYIA 5KQMA 2O14A 2IEGA 1T9CA 5I8WA 4TKUB 1IOWA 2IDKA 3IESA 3HB1A 4AO8A 2E4ZA 2ISCA 2IRWA 3A1SA 4OYRA 4OP3A 4OI1A 3QUCA 3KDAA 1RHQA 4IDOA 2O3QA 4AW9A 4WHMA 4CV1A 5KPJA 3S81A 4U02A 3R09A 4R9VA 2RK6A 2OHVA 4WZBE 5T67A 2W6PA 2XNCA 3MOGA 2Z95A 1P2DA 3CS3A 3SF8A 1AS0A 2B6HA 1GZ6A 1JQJC 2WY2D 5MN5A 1HNWB 1FRVA 5K0SA 1DPGA 1RAIA 4KSCA 3GPIA 4YLYA 3LPCA 1E32A 3OCJA 4JCOA 521PA 5REQB 2OV1A 1T6NA 3D7LA 4JITA 1HE2A 1Z68A 2OXFA 4IGFA 1Z47A 1WXQA 2G4LA 2XUIA 4ISCA 1BWPA 4LJ7A 3TM5A 3KSMA 3KT8A 4WDRA 3D3KA 1LSJA 5DV9A 2GBCA 1W76A 5HE9A 4PLYA 5TMBA 3TOCA 4DLNA 5IASA 4GLOA 3TZCA 4O08A 1MAVA 1N0WA 4IVQA 4A23A 5M5BA 4JBXA 2FEOA 1YR3A 3EVGA 2XCLA 1KPGA 4F84A 4YWHA 1DJPA 4R4JA 2WF8A 5FPHA 1ESEA 1EWTA 3UJHA 4O4HB 1U1DA 3GNQA 4J3NA 3SKYA 1NAHA 3D6NB 3H5OA 5F76A 2Q62A 5I7HA 2A58A 1MT0A 4NH4A 2QZZA 3WMXA 1U28C 3DMHA 4KP7A 4F4DA 5KYVA 2L42A 4DNQA 1Z7BA 1FMFA 1E2PA 2ZR7A 2J0EA 3PNOA 1W6RA 4XYMA 4FFVA 4MWEA 4DLLA 4XWWA 2VUIB 3IYLW 2IOFA 3OU2A 5AIBA 2WT9A 5M2QA 3C39A 3RASA 1N2BA 3ILHA 2ZZKA 1Z0DA 3Q2KA 4H7HA 4MS4B 5BWBA 1GZ5A 2AFHB 4HYEA 4IEIA 3K9FC 4R41A 2NTJA 4TV8B 1PKXA 3K53A 3ZOKA 1L4GA 1WQ3A 2HMVA 3HABA 4N5MA 2D1RA 4RZ3A 5HFAA 1ZGGA 3I53A 2VLIA 4IS2A 3K9HA 3AEQA 2SKCA 3IDAA 2ZIEA 4FJ0A 1JDBB 4KYTA 4BLUA 3BICA 3FPAA 3ESRA 5L3SA 1BQ4A 1G41A 5FTKA 3T5TA 1URPA 2OAP1 4IHJF 4NCNA 4DA7A 1BDMA 2BBOA 1NVEA 1EWVA 2WTEA 4YRQA 1XEAA 2PKEA 4MS3B 1IUOA 4P33A 1NQVA 1IH8A 3AKYA 3QPDA 4HEHA 3ZLTA 3QUBA 2D7DA 1Z3CA 1V11A 2AUNA 1CP3A 4DWVA 3CGWA 1IY2A 4R6WA 4BAGA 2D5LA 2DTDA 1OV6A 1XAHA 1CR6A 1EWKA 2NM0A 3E0QA 4FR0A 5AKZA 5FR1A 3O73A 1NXXA 3NDIA 4TKVB 1KNXA 4LZAA 4DMKA 2OESA 3R41A 4B3MB 1JI0A 3ENNA 4ESHA 2ADMA 2LWIA 3KLOA 5T3YA 5JDIA 1UIRA 2B99A 1AKTA 4BE7B 4OQQA 1IMOA 2ZUEA 4PHCA 4EB0A 5CGQB 2WU1A 3V7NA 2V4MA 1I5OA 3R5KA 3QJ5A 2HGZA 3T95A 4BTLA 1C7ZA 3C4VA 1NQTA 4K9SA 3FGPA 4WE3A 4QUDA 3H42B 1KOJA 4MP8A 4UHCA 2NXJA 1EFAA 2AFRA 2E7ZA 4OI0A 3FUXA 1X0VA 2V65A 2WIJA 5KTYA 3COJA 3K30A 1M75A 1IZ8A 5DLPA 1E2QA 3LMKA 3FPKA 1I7PA 4W9NA 4DS3A 2QXUA 2NW6A 2R2AA 1GGKA 1NNI1 3PNQA 1WE2A 3BAFA 3HDGA 4NIMA 1A8PA 1CJBA 1XDWA 2ONYA 2XNHA 3R5FA 4K8RB 5IFLA 2PX4A 5IT0A 4RTOA 1QIFA 1XQ1A 3JW8A 2XCOA 2XYRA 1VECA 3LZDA 3M5CA 3ZYZA 3DLAA 4G8CA 4IWNA 4WV3A 4MKHA 2Z4TA 2E5WA 3AHCA 1CNMA 1UMBA 2PZAA 3FHOA 3JQAA 1WPQA 4UBLA 5EKUA 4F5YA 1MIOB 1E64A 2I6FA 2J7PA 2LIPA 3H16A 1M2OB 1RXWA 2WA1A 4N6GA 3WBFA 4JX9A 5B57C 5ALIA 3P45A 4E1AA 2G17A 4TLDA 3F8WA 4QOEA 3WLTA 1C29B 2ORIA 2SICE 4CQMB 4C89A 3AERB 5FDFA 3NNDA 4RD2A 3ZBTA 4UQLA 1A7UA 3QVKA 1P1IA 2ANCA 4YUVA 4YAKA 3U4QA 4IVRA 3L0CA 4X1YA 5JWOA 3EGVA 4DIOA 3HLYA 4U6NA 3ENKA 1H2EA 3RVRA 2CCJA 1IHXA 4FWBA 3SE7A 5HOEA 1GCIA 5A1JA 1PT5A 4OLAA 1NM5A 2WWHA 2XVMA 3INTA 4HNQA 1HETA 4RLQA 1BXGB 2ZB7A 3QLUA 5F9MA 3Q3CA 1XTZA 1C9EA 3EYWA 3P0JA 1ORHA 2YXEA 1VFPA 3O75A 1CQWA 3TW4A 3QOXA 4HLNA 4EFKA 5B1YA 3EHEA 1DIGA 4TV9B 1WSBA 3FCAA 3I34X 3PQ3A 3MB8A 5HIMA 1HDZA 3H9CA 3RU2A 3I32A 1Z37A 4GMFA 1A88A 5ENZA 1NBMA 1Z2AA 1Z6TA 2HLDD 3DEHA 1GR1A 1HTTA 3A3KA 1MNQA 4EGAA 2E82A 2Z4RA 2OPBA 5FPSA 5M34A 3EIUA 3DCJA 3B1FA 3NC4A 2VXCA 4WA7A 2CT8A 4M8IA 1XBTA 4IWXA 2WVAA 3BK7A 1REQA 4N0DA 1LK0A 4PHTA 3TFQA 4DSOA 4DNOA 3TLAA 3OVMA 4ZVVA 4E70A 1G6HA 4EI8A 1SBZA 4GM4A 2A88A 3F78A 3DXFA 2XUJA 4MRSA 4ZU1X 4J3FA 3EZ9A 4LHVA 1QQ5A 2FK8A 2FPRA 3BREA 4RAQA 1PLLA 5CX1B 4MZDA 2CWWA 2JGMA 2VO1A 4CEIA 4XPIA 3H9EO 3T1VA 3L06A 2QL5A 1WF6A 3AI3A 3AF5A 4BHTA 4D1YA 2AQ8A 3R24A 4RC9A 3RKUA 1HOTA 3JATA 2JFXA 1ZCZA 1CB7A 3FCYA 4C7BA 4DT1A 5JAMA 4DJEC 4XWAA 2X0NA 3KOOA 3JQBA 3DNFA 4G2NA 5GONB 1OZHA 1OPRA 2R86A 2Y0DA 4PPNA 4IHKA 5M7EA 4EX6A 1YRHA 1FYWA 1M6VB 2DECA 5G02A 1B0UA 5F78A 3V7UA 3KYCB 5A4FS 4X44A 5F2EA 4MLDA 3D6JA 3GMSA 1YZNA 2I62A 5HRUA 2PQMA 5AKEA 3GLIA 1JR6A 3VX3A 3HYCA 1SU7A 2V6FA 4EHFA 4OGKA 1BJTA 2VZ8A 3OTWA 4MUJA 5HNKA 3SCZA 2I66A 4OX9B 3ZQJA 2R3SA 3PDJA 4W1RA 1FDTA 4LDJA 3WQQA 1COWA 3R3YA 4MMYB 4POOA 1CUFA 3LQ4A 1IBLB 2PMCA 3FOCA 1DEXA 1EFCA 2TMDA 3CR8A 3JQRA 4PLTA 2Q3EA 3GLRA 5H8WA 4FPXA 1C3OA 5ALSA 3CIFA 5TV2A 4X97A 3P9PA 4BNHA 2CSUA 1CDEA 1KQOA 1NMQA 4MQMA 2XUQA 1I5RA 2F7SA 1G3UA 1A9SA 4I55B 4JLSA 4QVKA 4C5BA 4P31A 4R16A 3DEZA 3D3EA 5K0TA 3L18A 2V7BA 4N3NA 4KGDA 4M1KA 1DXYA 2P3LA 5P8WA 3ZY6A 1AN9A 1G3RA 5A0FA 4P86A 4S1PA 3PHBE 5B3JA 3T3PB 1LDMA 2FWPA 3GLGB 2Y0BA 5LB4A 3ML1A 3TZKA 4A5OA 1GNSA 3CINA 2EWMA 5D7NA 2E0IA 2DKNA 4X7BA 4ACBA 4Q9LA 4NEGA 3V00A 5CITA 5JYBA 3JZAA 1P1RA 1U28A 2HRBA 2QLLA 5CW1A 2VDOB 1MVNA 2I4RA 4RSMA 4W5WA 2NZUG 4BO1A 5EJ8A 1U81A 3KB1A 2FPMA 1EP9A 4FW9A 2E85A 5KVSA 2I91A 1PSZA 1HK7A 5JNWA 3GFRA 1Q1BA 3E22A 2K87A 4MULA 2O5RA 2JAOA 1KYXA 2WZBA 4J16C 2W5UA 5HILA 3ZEIA 4W5OA 5EERA 3STUA 2IT1A 1T0IA 4PGHA 1UDCA 1Y9ZA 4HWOA 4IMPA 1NURA 1Z0FA 1QHEA 1H2FA 4L9WA 1GTJ1 3P0RA 1SA0A 4PQRA 4PO3X 1SG6A 3CZCA 2HRZA 2QX9A 1A9OA 4I9GA 4IINA 4A1FA 4G36A 1GZUA 1WCV1 1WDTA 3NS7A 4LRQA 2AE1A 3IA2A 3MWYW 2QI9F 1VMKA 2QAJA 5BXQC 4R05A 1RKVA 1KO5A 1T1SA 1AKUA 1J2TA 1XXHB 3R44A 3CX4A 3QITA 4YXWA 4YP5A 1K6EA 2PYZA 4M9QA 2NGRA 3HXPA 4RKFA 3EQ6A 3FPHA 1PDVA 1NVVQ 3AHGA 2Q4EA 4YJ2F 4CEHA 3W79A 4D3ZA 1BCRA 2IIBA 1N8TA 4ZWNA 2FSVA 4MYUA 3WLLA 3L8HA 1M8FA 4B7XA 1PD0A 3VYUB 3UGKA 1CUIA 2V7PA 2ODAA 4CUJA 3QYJA 3UUWA 2HV8A 1PNTA 1WP4A 4R54A 3TK1A 4WBXC 2PZJA 3OLQA 5EJ7A 3IAAA 3PNKA 4G81A 5F64A 1C41A 4UPDA 2AB0A 1OIXA 1PL7A 3HMQA 2A14A 5LLSA 4R1SA 4EB3A 4P1ZA 1Z4IA 1GGJA 1H2BA 1QE3A 3DEAA 3PPWA 4YJDA 1VC2A 2QLJA 1NZJA 1WZEA 2SCUA 3LH5A 1R4MB 2WJZB 5IJAA 3ZS9A 3C1OA 1DG3A 2XTNA 3LUDA 1F2TA 2LKDA 5EIWA 3GXBA 1C0IA 4BKMA 3NDBB 1BFKA 2IY7A 2I22A 1GIAA 1GNQA 2YZKA 4Y1EA 1ID8A 1H2YA 2DULA 3TLKA 2P2SA 2X3UA 5JZVA 1VHQA 4FGWA 4P36A 3TQHA 1R8QA 3IAM1 3W2HA 4JI8B 4K9MA 3JWEA 2O59A 4F7DA 2JEOA 2HY7A 2MWMA 3WJ2A 2G70A 3PDCA 2C94A 2GNPA 5I3CA 2B7LA 3ZGNA 4XVUA 1UAYA 4P38A 4H6XA 3RBVA 2RJOA 5T6MA 3GA0A 5BNTA 5LA6B 3VKGA 5K2MA 4GMKA 1UBUS 2TSYB 4GX2A 4Q6WA 1KE2A 4LJKA 1HMPA 3L7YA 4LZPA 5DE3A 5BWOA 3QV1A 4S04A 4BO8A 3AU8A 4EB6A 1J00A 3PD1A 2CV2A 2P8JA 4OFWA 2YL2A 5KDDA 2FRVA 1JLLB 1DOAA 2CUNA 3CJTA 5A7FA 2J9FA 4CKCB 2IEAA 1YDFA 1Z4NA 4RQAA 3CVYA 4RCVA 1BQEA 5CNKA 1KO7A 1PJBA 2OC4A 4UU0A 5FP0A 5I9LA 1QOQB 2EL7A 1MJHA 1DLIA 4K9QA 5HEKA 1NUTA 3RS5A 3WXBA 3R3VA 4FFBB 5CDHA 1KRXA 4EUKA 3RUDA 3G0DA 3W4KA 3VR2D 4XIJA 3ZC3A 4P92A 1I7NA 1EXVA 4REQA 3V33A 1PFVA 1YL6A 2WSMA 4XFJA 3B48A 4WSOA 4E33A 1G66A 1L8LA 3DG9A 1E6WA 1DQYA 3RM3A 2I4NA 2ZJ8A 3HKCA 3LCJA 3M6VA 2Y27A 3ZU2A 3ZGZA 1MUUA 2YZGA 3GCDA 3BT7A 1FTGA 1OXBB 1XQXA 1GSOA 3IB6A 2XWPA 2IGTA 1Y9EA 4D41A 2Q5EA 2XRFA 1FU4A 1VLHA 1JYFA 1U3VA 4YJKA 1Q83A 1Y5MA 3OFSA 3A6FA 5H3CA 4B09A 3EHDA 2WRZA 5JASA 1FSFA 3AESB 5IX8A 5LQMA 3GL9A 1QC5A 5L53A 2C7RA 3RS8A 3C15C 2K2WA 5CLQA 5SY6A 1SUPA 2CDAA 3JRNA 5KKAA 4KUGA 3ZPXA 3ASVA 2QZJA 1UT8A 3QNUA 4DXAA 1KI9A 2J9YB 4CUZA 1DEOA 1TVKA 2A5YB 2CHGA 5COBA 4ALJA 2W48A 3ENZA 3QLJA 1IZ0A 3AJ9A 1SM4A 2IZOA 2QD1A 3USZA 4EFDA 3RFTA 4LQLA 1QR6A 1GYQA 4ITVA 1EVZA 2B4YA 3FMFA 1K08A 5J1SB 2R7AA 3DR3A 2ZRPA 3UCXA 1UL1X 3I05A 1UKBA 1UJ2A 2IYAA 3V1YA 3DLPX 4J0IA 4KXMA 3T9EA 2EKZA 4A7PA 3LZ6A 4FC7A 1OJ7A 5ARDA 3NB0A 3CU5A 4G0QA 5J1TB 1HE8B 5TVKA 1U0JA 2BGTA 2WYOA 4GW3A 3LT1A 4JUIA 5ALNA 3C4QA 4NV3A 2Y76A 1H1TA 3NANA 1A4UA 2GBLA 1KEUA 1KVSA 4KIGA 3NXKA 2JA2A 1JJVA 3U31A 1N2OA 3OX1A 1H4SA 3RS7A 3V7YA 4P0TA 2AVNA 1VKHA 3QP9A 2F62A 3UJ3X 3H1PA 3KC2A 3PZRA 4KQEA 3AUXA 5AUOB 1EXDA 5FTMA 3AF4A 1VI6A 2QX8A 4MJ3A 2ZIGA 2ZR9A 3DF9A 3I6ZA 3ND8A 1EMDA 2Y9MB 3RGGA 5D7BA 1I10A 2VHXA 2VNKA 1CR4A 3AEUA 3H11A 3TZQA 2VAWA 4X3PA 3FCSB 1LBSA 4H7FA 3PK0A 5G1NA 5IJXA 4V24A 2V6JA 2IIQA 3NWJA 1ZIXA 3HY3A 4HWGA 1ICEA 2XCQA 1JDUA 3KFVA 2P2NA 1PEKE 5CM9C 3PEYA 2XGGA 3AFHA 4I4TA 5ALDA 2QQ0A 1RAFA 4I8XA 1C1DA 1G63A 3O95A 1WXWA 3GGJA 1HX7A 3BD6A 4XOIA 5DNVA 2G77B 2MINB 2GMWA 1W4CA 1S02A 4I3HA 2ZUVA 3Q8WA 2Q4DA 4L5JA 4HZUA 4C1NA 4E2YA 1IOLA 1ZG3A 2ERCA 3Q11A 3K2EA 2PHZA 1G42A 3QKSB 3CKYA 4TZ0A 1G4HA 4QD3A 4U2EA 1W7AA 2RGDA 4HH3C 3WNZA 4NOLA 4CM4A 4CNBA 4LUCA 3EPJA 1RZVA 1XNRB 2P4SA 1QRDA 3IJRA 1XT6A 3QF4A 4R5MA 4I66A 5J2UB 4XCQA 4ALMA 5FBHA 2JI7A 3A31A 2BCJQ 5JPDA 1N8SA 1ZGHA 2AZMA 3TCNA 1Q44A 2I3BA 2INGX 2PUJA 3HADA 3QW2A 2WWVD 4MUMA 1NVTA 2HLDA 4RZXA 2XIQA 3PUIA 4BVLA 2ZIVB 5LKRA 2VJDA 4FS3A 4ZPXA 2OO3A 1XZIA 1U3GA 3RIYA 3H87A 3WRXA 3KPUA 3Q72A 5HE8A 3V4VB 5K0ZA 3SVTA 2W98A 1CZOA 1PUXA 4XQGA 5K4GA 1MVLA 2WWWA 3RS0A 4O2AA 2BMDA 3JZIA 1QPBA 1C1HA 1QV6A 1SVOA 2QMYA 2ZI6A 3M2PA 5LP6C 1VPWA 4K8OA 2WQ6A 1NLFA 1NMZA 2GCNA 1FZQA 1YQEA 4Y67A 1MAUA 5DX8A 1N5DA 4BMOB 5BNIA 1Z07A 2P9YA 4XSVA 1J23A 1H42A 2EBHX 3PQCA 3ZXYA 1KU0A 4FOTA 1VJ5A 1KDTA 2C3MA 3EJWA 3X1XA